3MUFA

Shikimate kinase from helicobacter pylori in complex with shikimate-3-phosphate and adp
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
160
structure length
160
Chain Sequence
QHLVLIGFMGSGKSSLAQELGLALKLEVLDTDMIISERVGLSVREIFEELGEDNFRMFEKNLIDELKTLKTPHVISTGGGIVMHENLKGLGTTFYLKMDFETLIKRLNQKEREKRPLLNNLTQAKELFEKRQALYEKNASFIIDARGGLNNSLKQVLQFI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Helicobacter pylori shikimate kinase reveal a selective inhibitor-induced-fit mechanism
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Transferase
molecule keywords Shikimate kinase
total genus 55
structure length 160
sequence length 160
ec nomenclature ec 2.7.1.71: Shikimate kinase.
pdb deposition date 2010-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01202 SKI Shikimate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3mufA00
1I4TD 1E94E 1Z06A 4BEBA 2FPMA 2XJ9A 3K9GA 4L9SA 3VHLB 4G01B 3OIUA 4HZUA 3FPAA 2K5UA 1F48A 3Q7PA 4DT1A 2IUTA 1R5BA 3AF4A 4IEIA 5P21A 3KJHA 4TLAA 1ZM2A 3C15C 3L2OB 2P6NA 5LDDC 2XSZD 3OF5A 4RZ2A 1IXSB 1EX7A 3LBNA 4IOMA 4Z8YA 1S4QA 3TH5A 3UIEA 1EFRD 1YR6A 4LY6A 5E4FA 4ERNA 4JLJA 3N70A 5B2ZA 1SVWA 3ASZA 4RZ3A 1WF3A 1U90A 2O5VA 2BV3A 2KWIA 2ZJZA 4FWTA 2IT1A 2FV8A 1XF9A 2BJVA 4A2WA 4Z54A 1VPLA 4TWZA 3U7FB 1XX6A 2N42A 3ZVMA 3PR1A 4JLOA 2GBLC 5EE3A 1NSTA 2I1VB 4QM6A 2WWWA 4KCGA 4URUR 2HXSA 4B3CA 1Z6GA 2ZS8A 5JJKA 1Q1EA 2ZI9A 4FI3C 3QBVA 4XTCS 4O25A 5HR5A 5JSZA 2N1BA 1E0SA 3X1YA 3I8SA 2ZUCA 3KXLA 2NMVA 3AVXA 3AV0B 2C2HA 3FKQA 3D6TB 3QPUA 4DEYA 4DUGA 2GVZC 1T3LA 1W2HA 2XB4A 4OK3A 1N6HA 4JLDA 4Y0AA 2H18A 1OV4A 3K1JA 4IHQA 1N25A 2ZE8A 1YVDA 1IXZA 4IVPA 3KKMA 5H70A 1XXHB 5LB2A 5FTKA 1C9KA 1GTVA 4P31A 4GDFA 2WOJA 4XJXA 4HB2A 4KFUA 2IF0A 1AQUA 1W44A 3QXHA 3MWJA 2QPAA 2E87A 3CWZA 1A82A 2O8CA 3NDPA 1DAGA 3T1VA 3EIQA 3AVYA 1UDXA 1TMKA 2QRZA 1T3SA 1G3MA 4IFEA 2NO9A 2JJ1D 1UKYA 3BXZA 1QHXA 1QHSA 2PBRA 1XMIA 1VYTA 3DEFA 4LHWA 3EPLA 1RRGA 3O8DA 5FUXA 1DG1G 1S9HA 2ANCA 2DBYA 3MAAC 5C4GB 1G8GA 3M1IA 4EIWA 4DDTA 4C0HA 2ZI7A 4AC9A 2RAPA 1S3GA 1XP8A 3A36A 3IQWA 4PC7A 1JPNA 1XTKA 3EAQA 1M7BA 2J0UA 4Q1EA 3LWNA 4IDQA 2O8BA 1U8AA 1GRRA 4L5BA 2X8AA 2EFEB 2C8VA 3RS7A 1A1VA 2B92A 1E2DA 5EZ6B 2Z6VA 1Q21A 2GESA 1W0JA 2D62A 1E2GA 4L8GA 2MMGA 3PEYA 4F93B 2QAGB 3GLHE 3O47A 2X2FA 4MKIA 4Q00A 1CJVC 2CNWA 3FKSA 3MSXA 4A9AA 4DC9A 5EJEA 3E5HA 5AJWA 2VH5R 4B3BA 2VHUA 5F2EA 4G5OA 4PX9A 3LAWA 2F1IA 2WJGA 1ZINA 4Q7MB 4PSAA 2H16A 1KZGB 4FMDF 3VMFA 5IK2D 1Q12A 5FPSA 4P32A 5HTKA 4DLVA 4TLCA 4HYYA 5HPYB 3FMPB 4ASUD 5DI3B 4PHFA 2G3YA 3LFUA 1UKZA 1GDDA 1R0ZA 4NL4H 2JLXA 1SKQA 4NDZA 5FFMA 4AG6A 2AX4A 4B33A 1N3BA 2Q9AA 4MKGA 4RFVA 5CLQA 3WMEA 5JJIA 3LD9A 1H8EA 3TR5A 3B85A 3V4RA 4BFVA 2JLSA 3IUYA 3SJZA 4QBGB 2QAGA 4RKEA 5GVSA 3GLIE 1P9RA 1U0JA 2CE7A 1E96A 2GK6A 3LH5A 1HQYE 1WQ1R 4IKEA 2JIZD 4D4MA 3U3KA 3VX4A 2ZXUA 2IF2A 3HU1A 4JSYA 3N2EA 4ZI2A 1S2MA 3VHXA 4PPGA 4BFWA 1AQYA 2C03A 3CRMA 5JECA 3NTUA 1ZP6A 4B74A 3FE2A 2ATVA 2VPPA 4F7WA 3EPKA 4CYMA 3BD9A 1JR6A 3OIWA 4LPKA 4OQNA 1NI3A 1UBCA 1KI2A 5TDHA 3HWSA 2BMDA 3THYB 3I62A 3P20A 1KSGA 3GMTA 1IXRC 2IS6A 2BM1A 4BGDA 3F3YA 4MRNA 1VTKA 3CPJB 1D2MA 1OXVA 3D7MA 4E09A 3BWDD 3PEUA 4Q03A 4UXJA 4Q4JA 3M0EA 2QTHA 1KMHA 4PQYA 3UWOA 3U44A 5HCNA 1OH8A 4E07A 2QMUA 1WP9A 1XTIA 4R2HA 4XD7D 2ZIAA 3OZXA 4KLNA 4YXWD 2HF9A 5JI2E 3RSLA 5GADl 1PLJA 4GP6A 5D3QA 3BFKA 3A8TA 2I3BA 2ERXA 2Y8EA 1SVKA 1J70A 4J0QA 4EQ6B 5AWFC 2QORA 3B60A 3HU2A 3RDPA 2QROA 4OKSA 1F6BA 1J2JA 4HAXA 1G6HA 1EESA 2IUSA 1D2NA 1GUAA 3AB3A 3CIOA 1VYVA 4K46A 2WMNB 4AK9A 5BN4A 3K70D 5JJLA 2IYSA 3ADKA 1X1RA 4S35A 5DO9A 5KPDA 5CB6A 3OEHA 2XEXA 1XEWX 3THOA 4OHYA 2O8FB 1W47A 4DCVA 3MRSA 2V8OA 1GNRA 4R7ZA 1ZM3A 4M9ZA 2WAXA 4EPYA 2GXSA 2LKDA 1UEJA 4A6PA 4AI6A 3K70C 5IRCD 3WMGA 4MRPA 2NO6A 3QKRA 2GXQA 4Q21A 3QQ5A 4TQ9A 1S1CA 1P2SA 4PZYA 5K8IA 2AD1A 4QL3A 4JVLA 4TZ0A 4C0JA 4EJSA 1V5WA 5FTNA 3IILA 3FMOB 3LV8A 1ESMA 2VQSA 5DHFA 3THYA 2YC4C 3C14C 1RPZA 2HDNB 2HYIC 3GJ3A 1NN5A 4U5XA 1R8QA 2FGJA 1JXMA 3QVVA 2A78A 1Z6AA 5FOVA 1OPXA 5HKKD 2B7CA 2QSYA 3NBXX 4CVNA 2R2AA 3KB1A 4GRAA 2IX3A 4Q5IA 1TEVA 2OE2A 3ZZTA 3TNFA 5L3QB 1HH4A 1ONBA 3SDZA 2YWGA 1R0YA 4POAA 2BKEA 2PMKA 1KDPA 1NBME 2JA1A 3I3SR 4KSCA 1J99A 4LSGA 2WJYA 4ACAA 1ZIOA 4BZXA 1NMXA 2ZJBA 2NIPA 3THWA 1OJLA 1ZCBA 4N1AA 3ZZ0A 2R6AA 4M1MA 4R71A 3L0SA 4NCJA 1NY5A 2PZEA 4XIGS 1SKYE 3WNBA 1G7RA 4DB2A 5EXSA 5FOUA 3SNHA 4K8OA 2OCAA 3GEHA 4TQAA 2CCGA 1G21E 5GVRA 2JEOA 3LVRE 3KTAA 1FQKA 3QKSB 4DHEA 3QY0A 1Z2CA 1MO3A 1W4BA 1KAOA 3QXCA 3PUWA 2GJSA 3TUIC 1MRSA 2JJ2D 3OEED 2A5JA 2AK2A 3I1FA 4JYCA 4W9MC 2R6GA 4LCBA 4IFBA 1CXZA 4RSGA 3T12A 1XPRA 5BN3A 1MH1A 3EZ6A 4NU0A 2KE5A 2CLCX 3ZQ6A 1QG2A 4L9WA 4JZKA 3V4FA 1ZD8A 1Q1QA 2X2EA 2YC2C 2OLKA 4H1UA 1OKKD 1OHHD 3TAHA 4PO8A 1GG2A 4TMKA 3IIKA 1XB2A 1XMJA 2C99A 5KO2A 1EG7A 3OHMA 2VP5A 4TMWA 4HZIA 2WJJA 1I2DA 3P26A 3EX7C 3UWKA 3ZH9B 2BJWA 2X19A 3A4NA 3EIHA 5FI1B 2FFBA 2MSCB 4IEEA 3A1SA 5KPJA 4PC3A 2F7SA 1DO0A 1G3UA 5LBIA 2AFHE 2OEPA 1NN0A 2W2VA 3U6BA 3K0CA 1PUJA 2QGNA 2V1UA 1TUEA 4OQXA 1ELOA 5DI9A 2GAAA 1FMLA 1LV7A 1G3IA 1X1SA 3GPLA 1U99A 2MSEB 2C04A 3LO5A 2A5YB 4DLSA 2GCOB 1KNQA 1KY3A 2J87A 1YR7A 2CCKA 4UQOA 2B6HA 4IRUB 1JBKA 3RRMA 3UKDA 4GZMA 1E1RA 3VR1A 1Z29A 3F8TA 4G5RA 4KBFA 1OH6A 1XD2A 1ZC3A 3LY5A 3H86A 3MJHA 4WW0A 4JL5A 5BYKA 3U44B 4O2RA 2ZR0A 4OJKA 1X86B 2ZRNA 5BN5A 1BO6A 1XCGB 3ONWA 2OCPA 2GCPA 1R0XA 4LC1A 3WP0A 1JR3D 3CB4A 5L3VA 1CIPA 1NBMD 1GFIA 4DSUA 3PV0A 3VKHA 1VKJA 4ASUA 3BE4A 3FWYA 2NQ2C 3CWQA 4G5SA 3ICQB 5FI0B 2ZE5A 5FBLB 4QFMA 1LB1B 2ATXA 2RGAA 3QF4A 3DDCA 1G7TA 4HLDA 3J81k 3NEJA 2QA5A 4O0MA 5M04A 4QHYA 1QVAA 2QEQA 3ZZUA 2R44A 1Z47A 4LJYA 1NJFA 2WKPA 1YKSA 3CX7A 4GOXA 3KXKA 1T5IA 1P2UA 1E79D 1UBFA 4TL8A 4D0GA 3K0SA 2WICA 1EWRA 1FUUA 4PQRA 3U4QB 2EFCB 3EZFA 1E9CA 4OJQA 4DVGA 1UPTA 4URVR 3ADDA 1OXSC 1ODFA 1X8JA 1Z0FA 2CBZA 2ZREA 4JVSB 1JEDA 1Z6YA 4JBWA 3G5UA 3OESA 4I1VA 5TARA 1WBBA 3HYRA 3L0IB 2BMJA 4I99A 4Q1CA 4MGKR 2B21A 2YOHA 3VR4A 3UG6A 4GL2A 1ANKA 4HUQA 4JLMA 4DCSA 2HLDD 2AL7A 1KZ7B 4MDFA 4GSYA 2XTMA 2C9CA 1YE8A 3HP1A 4A8JA 3UANA 2IYRA 3A4MA 1M34E 2GCOA 1U81A 1SGWA 3S1AA 3KQLA 2AN9A 3EG5A 5TXGA 2OFOA 2CJWB 4B71A 4OBEA 3BFVA 3NVAA 3B1VA 4KYIB 2J0SA 3QIAA 4AKIA 2I4IA 2F43A 4MRSA 4M8NE 5FTLA 2XSZA 3ND8A 1K6MA 1H65A 4C9BA 1DS6A 4MYTA 3WMFA 1EFRA 1E2JA 1QHIA 2V54A 4P3YA 5KYKA 3CRW1 2RKOA 1AA9A 2VF7A 3ZIAD 2ZITA 1Z0DA 3R20A 1G17A 2GILA 1IQPA 3A1WA 4LWZA 1NBMA 3CNLA 1TNDA 4XWKA 1NIJA 3GJ8A 3PVSA 5F9FA 4FCWA 1S96A 4HDOB 5LB4A 3EPJA 1DO2A 3ZD6A 1D9XA 3T5GA 2H5EA 1D6JA 3OFNA 2W6JD 2HJVA 2Q6TA 2C98A 1OB5A 4PC1A 2VRWA 1KNXA 4XSGA 2RGNC 2QMOA 4GMXA 4D4LA 2QQ0A 1G16A 4GOJA 5E7MA 4CEHA 1MABA 4RD6A 4TQUS 1RRPA 3CKLA 5FPYA 2XXAB 4F4JA 1CRPA 5D3MB 3CLVA 4TL9A 2ZU6A 4DUGD 5DN6D 2PX3A 1E79A 3RSOA 3Q9LA 2R62A 1OIXA 3L82B 1T4GA 4LHXA 1HYQA 1Y63A 2IEYA 4PZZA 4QNRA 4IW3B 4UNQA 4QGFA 1BMFD 4LV8B 4O3MA 1TF7A 4A6XA 4PO9A 1BS1A 2ZRJA 3CZPA 4JLAA 1E2PA 1Z6TA 4N0EA 4W7SA 2FJUA 2RH5A 4Z1MD 3RHFA 1XMSA 5CIQA 3H2YA 4LJ5A 3B1YA 4A15A 4DLUA 4LBZA 3NWJA 3UK6A 3NH6A 1QHNA 4NYIQ 2IWRA 2XTNA 2IWHA 4IOLA 1ZYUA 2Z4SA 3QNUA 1GVNB 2A9KA 1LTQA 4O2LA 3WRXC 4ZDJA 2WWXA 2WV9A 3L8ZA 1RKBA 1T91A 3K8YA 4Q18A 3UMSA 5FBQB 1Z5ZA 4NKRA 3FMFA 4TT3D 4ARZA 1ZM4A 5JWHA 4AYWA 1FOEB 1QZXA 4RFSA 2KI5A 1W0KA 1N6OA 2FZLA 2QUZA 2WSSA 1S8FA 4ZDIA 1WE2A 4D26A 4LJ9A 2VP9A 3TE6A 4LJ6A 4YMSA 1Q0UA 4QM7A 2GA8A 1NVVQ 3GLHA 2KBEA 1I4LD 2ZRAA 1FFHA 1E9AA 2Q3MA 4A0HA 4CF7A 5EXXA 3WYAA 5B30A 5BWMA 2WTUA 3RC8A 2PT7A 5CK4A 1EK0A 2W6ID 4AWXA 3K0AB 5EUQB 4OHWA 1LY1A 3BBPA 1GL6A 1G7SA 1G3QA 3NBYC 1KJZA 2W00A 2CE2X 2CNWD 2WIBA 5H68A 3ZVRA 1Z0AA 4JYBA 2P6UA 2H17A 3BH6A 5JRJA 2F43B 2ZSFA 1QRAA 5CYPA 4HAYA 421PA 1WXQA 2PJZA 1KDRA 1KI6A 1MRNA 4CRWB 4B3DA 4B3XA 1KO8A 1G9XA 2CVHA 4Q19A 5B57C 2QE7A 4G5QA 2R6DA 2WKRA 2A5GA 1W36C 2OLJA 3G0HA 4OHZA 4C0AC 3HDTA 3ETLA 1NRJB 1IN6A 1N6LA 4MRRA 4OI1A 3U7EB 1A2KC 2VSXA 4RZUA 4QJ3A 1XXHA 2REXB 4FCVA 1KAGA 3NBZC 3DOEA 3BH0A 3GFTA 3I61A 1KMQA 3GD7A 3VR5A 1KMHB 2KB0A 4PHTA 2VA8A 1P73A 1E2LA 4PAMA 3KKPA 5UKDA 1NNEA 3ZLJA 2JATA 1WB9A 2R9VA 3MG9A 4PSVA 1NY6A 2QRNA 2CL6X 2MSDB 2WPDA 1UM8A 1OH5A 1OW3B 3BERA 5ELXA 4CEIB 3ICEA 3QPWA 1T3HA 1SHKA 3AVOA 3QF4B 1EFCA 3W90A 1DEKA 3B7GA 2QP4A 1ZC4A 2IUUA 3EXAA 5HE8A 2J9RA 4YMVA 1OT3A 3I72A 1SZPA 4DLYA 3SZRA 2QGZA 4X8MA 621PA 4KAXA 3EZ9A 2V6IA 2QL6A 1VIYA 2HT1A 2D74A 4TMXA 1NG9A 4LV5B 3GJ0A 1FNMA 3MUFA 4JS0A 4FXPA 5FL3A 4G3XA 3QXSA 5AK0A 1E0KA 1CJUC 4Q4LA 3BOSA 3U3JA 3SHWA 221PA 3KX2A 4AKEA 1F60A 4BLOA 1SXJA 2CLDX 2EWVA 3E1SA 4JSTA 2C77A 5FUYA 3T5DA 4KFTA 2G0NA 5KHOC 2XGJA 5E7IA 3MJRA 4LBWA 2LCFA 4Q7JB 2ZYTX 2BVNA 3DO6A 5LD2B 4D2IA 4Z8XA 4Q4HB 4B43A 3CH4B 4XVQA 2D2FA 4LDJA 2O8DB 1P60A 2QM8A 4PHGA 5C46F 4YQFA 4A0FA 1M7HA 3B6EA 5AJVB 1XCMA 2QMEA 2EFGA 4Q01A 4M1SA 3GLIA 3BB1A 2CHVA 2Q0HA 3L0PA 1FW6A 1YZTA 4JLBA 2ZI5A 1TU4A 4KU4A 2GHIA 2IYYA 2ZE6A 4BRUA 4FMDB 4JKIA 3AGQA 5EQTA 2NG1A 5SZIA 2AR7A 2OT3B 3SJCA 3KKNA 3OE7A 5GJVC 3CUEF 1N6NA 2VP0A 4PXAA 2ZRFA 5DNYB 2Z5FA 3PJRA 1TF2A 3IQXA 3DKVA 1H8HA 2ZJOA 1Y3AA 2CK3D 3JZAA 3JZMA 4ZO4A 4Q4HA 3D3QA 3IHLA 1D2EA 3LW7A 4JMPA 1CRQA 3CX6A 1VCMA 1VIAA 4II7A 4EJSC 1ZU4A 4PTLA 5DHAA 4BFSA 3HPRA 3PFIA 5A5GA 1E2HA 1KGDA 3TW8B 1MT0A 5AJZA 3C5HA 1D8TA 1OH7A 3UPUA 3H0KA 3EA5A 2QTFA 1TADA 1LF5A 3AVPA 3HPQA 4TYQA 3FVQA 4QBIA 2DFTA 2C5LA 2GK7A 4TL6A 2AK3A 5AJYA 2L0XA 4EPWA 4GI7A 2G1JA 1B23P 2WKQA 3ZS9A 1P5ZB 2P0EA 4HI0E 3WBJA 4EFLA 5CDFA 4LBYA 3QEOA 2O8EB 3BJIC 3AVTA 2AD5A 1DG3A 1SVMA 2EYUA 3E70C 4QKQA 4MKHA 4CT4B 1P7CA 3IEUA 4OQLA 2GEUA 2IXEA 2O8DA 2BC9A 2VYFA 1LVGA 1VECA 4WBSA 3IIMA 4IVQA 3TUZC 1Z83A 1OB2A 2YVUA 2NO7A 3Q7QA 5J4YA 3TVTA 2WWFA 2XXAA 4F4IA 2GXAA 1BYUA 2ZTSA 1VCIA 2B8TA 2OXRA 3GFOA 1E2MA 2WWYA 4V0MA 5G40A 3K09A 1MKYA 5DE3A 4BZQA 2OXCA 2B7BA 3LBIA 1NL3A 1O3YA 2GJAA 3CRVA 3QPVA 1BMFA 3WBKA 3AVQA 4KFSA 2XNDD 4HAUA 1G19A 1WA5A 2ODWA 5FR2A 1OKKA 2BKUA 3W6OA 1P6XA 1U2RA 2A5DA 2XX3A 4XTRA 1HE8B 1HT2E 1OXTA 3DVLA 2GETA 2OAP1 4R9UC 1AS2A 3MWLA 4W5WA 1U9IC 2R65A 5FR1A 1EX6A 2DCUA 3O8BA 1JQJC 4Y0VA 1AGRA 2FSIA 2ZUBA 2H7VA 2V7QA 1LS6A 2SHKA 3X1ZA 3TUJC 2QT1A 3A1TA 1IOZA 3QKUA 3SFZA 1ZD1A 5CM9C 5FUWA 2CCJA 3SR0A 4LBVA 5KUTA 5AJXA 4A8JB 4HAWA 3WNDA 4A36A 4Q9LA 4CIDA 3SU8A 3C41J 2WSSD 4JBXA 1R7RA 3ADCA 2EW1A 2IYLD 2FSHA 4P33A 3KQNA 2YV5A 1E1QA 5LPNA 1NP6A 3DMDA 3SOPA 3KB2A 3C5CA 2WWIA 3EASA 4NYMQ 1E9SA 4BE7B 2F3TA 3NC1C 3TR0A 1FNNA 4B32A 3GCGA 4DT1B 5HE9A 1XPOA 1ESNA 1NVXQ 2GF9A 4WOPA 4HLQB 3K53A 2QBYA 1FZQA 4ZCMA 2V1XA 1ZMXA 3SQWA 2RGNA 5CK5A 1XDBA 1CR4A 4B6EA 2JDIA 3TIFA 1VYUA 3AGPA 3PXGA 2ZROA 3AKDA 2ECKA 4LHZA 1E0AA 5DGXA 4PC2A 2X1VA 2IYVA 4KHZA 1K8RA 4QHSA 2CHGA 2OV2A 2PLRA 2VP2A 4Q4JB 1KSJA 1OIVA 1N6PA 3T1QA 4PO1A 4D81A 5ANRB 1AN0A 1M7GA 3C16C 2F9LA 4M9SA 4BRWA 2E1RA 3RVBA 1XEXB 2CHQA 2QU8A 3DM5A 1LS1A 2OCYC 4P4UA 1N6KA 5BYJA 5BXQC 4JJKA 4UXHA 1JJVA 3GLFA 2DR3A 1L4UA 3FFAA 3IPYA 4R98A 4QGGA 1G20E 4MH0R 1FPMA 1COWA 1NLYA 2J59A 1OE0A 1CULC 1PLLA 4GFDA 2IYWA 1IBRA 4A8JC 3M4YA 5D3MA 4BFZA 1QHGA 3AF3A 5FOTA 3VKGA 1S1MA 3KJEA 4G1UC 1XEWY 1J90A 4OQFA 4C0KA 4PAQA 1Z2AA 4GT1A 5GJWC 1U8ZA 2JJ2A 3OEEA 5EE5B 3LDAA 3GLHB 3N5CA 4B3FX 4M0LA 3KXIA 5A4JA 1N5IA 1GL7A 2W0SA 3NHAA 2FA9A 4LX0A 2HEIA 2R6CA 2OHFA 4EPRA 5HKKA 4GPTA 2ZJ5A 3I73A 4GOKA 1OHHA 2BIFA 1JPJA 2YNMA 3PUZA 3BB4A 4U7DA 4Q7KA 3QENA 4I1SA 3TQFA 4F91B 2ZRKA 1MABB 4BPBA 4BECA 2ORVA 3RS5A 2GRJA 1VDZA 4HATA 4EUNA 3UMFA 2NPIA 4E5UA 2WBLC 2EU8A 2HT6A 5E95A 3MMPA 4HDCA 3Q3JB 2YJTD 4ZIRA 3Q85A 4B76A 1SVIA 3TGPA 3AP2A 4PQFA 5DYIA 2VHTA 3TVDA 1R0WA 4XOIA 1R2QA 1UKVY 4EKDA 3G82C 1ZNXA 5J40A 4I81A 1GSIA 4IVRA 4TL7A 2WVJA 3P4YA 4DRZA 1JNYA 1X3SA 3T06B 1XEFA 2GKSA 3U6KA 2QPTA 1P2VA 3IGFA 4HAVA 4GNKA 2RMKA 4XVUA 1Z22A 3SBEA 1KSFX 4ZI3A 4US0R 4C0LA 1CU1A 2FMXA 3QJYA 3AP1A 5HZKA 5L3QA 5FBRB 1ZM7A 2ZEJA 4KFRA 2ZRIA 4YMWA 5B64A 1WRBA 2QT0A 2ZU0C 4DEXA 2PX0A 5C2JB 1HT1E 5AUQA 4XD7A 4IDPA 4C0QC 4EPVA 2IYUA 3KTAB 1R8SA 1QBKC 4QJ5A 5DYGA 1G8HA 1XZPA 4B6FA 3L0OA 4FMCF 4M4SA 3BH7A 1KK0A 3DL0A 4QNMA 1JQLB 1CTQA 1E9BA 2XAUA 3IEVA 2IYXA 2NGRA 2VIIA 3B1XA 1WBDA 1ETUA 2AXPA 4WZ6A 3CR7A 3RRNA 5B58C 2DB3A 3TRFA 2Q3FA 1GL9B 2NPFA 2HCJB 1XTSA 2NZ8A 2XB2A 2YKGA 3H84A 2Z83A 3IO3A 3TKLA 4WVFA 3W8NA 1HTWA 4PPQA 4D0LB 2YINC 1XTRA 4Q7LA 1W0KD 5TY0A 3GJ4A 1T6NA 3PQCA 1IY0A 1YZLA 4MA4A 1ZNWA 5DIFA 3ZDQA 5FBVB 4WZBE 3AVWA 2NO1A 4RY2A 3ZD7A 3Q8XB 2VO1A 1GKIA 2EWWA 2FZ4A 4V0ME 3RRYA 4C2UA 2GZHA 1GP2A 1E0JA 3VR6A 1G41A 4WXPA 1HUQA 2FNAA 5L3RA 3RANA 3V00A 3T1TA 3RS4A 3NC0C 3TQCA 1SXJC 1GNQA 4QGHA 2JLYA 3EWAA 3AM1A 1N0VC 5L8VA 3TW4A 1XMVA 4BWYA 4CW7A 3VAAA 3LQRA 1L4YA 1GRNA 2ZSEA 4XWOA 2A30A 4UKDA 2IL1A 2H8KA 2RHDA 4HLUC 2R6FA 4HB4A 2XZPA 1CJMA 2XOKA 2G0TA 4LYFA 1WMSA 3D31A 2R8RA 3CR8A 3LX5A 1W4RA 2JASA 2ZAMA 1TAGA 4ILEA 1VCNA 1KOFA 3ZIAA 1XJQA 3H4MA 2F1HA 4W5HA 4P0TA 3TLXA 1ZNZA 3GFPA 5JCPA 2BMEA 3KJIA 1T9HA 3PEVA 1US8B 3V9PA 2YYZA 3JVVA 3W3ZB 1TQDA 4ZDKA 1XD8A 1P72A 2YWFA 2W6JA 3SJAA 4FWIB 2WJVA 4DBLC 5IF9A 4AY2A 1XCPA 1X8KA 4RJLA 5C1BA 4MGIR 5KDDA 1Q1BA 4LHVA 5JEEA 4WIAA 3LBHA 1NLFA 1RFLA 3RABA 4A82A 4KI0A 3R9XA 4PPFA 5LD2C 1TPZA 4US1R 2J0VA 5FL7D 2H1LA 1QF9A 4P4SA 3THXB 4GBMA 2XZLA 4AKHA 1E32A 2UKDA 4TLBA 4MYUA 5IDVA 3WP1B 4Z51A 2KSQA 4M9QA 2ZI4A 4RFSB 1CS4C 5G3YA 2REBA 3EC1A 2DFNA 3EA0A 5JLJA 2ZRMA 1RVDA 1II8B 2FEMA 4ABYA 3BAFA 1BYIA 1XTJA 1N5KA 1XWIA 2JIZA 1A7JA 1F5NA 3U3OA 4A0RA 4XH9B 2YWHA 1NKSA 2IS4A 1AJEA 2I1QA 2GEVA 2RGBA 3I4LA 4MYCA 4ZIRB 4L16A 2YOGA 8OHMA 1F2UA 2BWJA 3AKCA 3KFVA 2RCNA 4EAQA 5KSZA 3MD0A 4X8OA 2F3RA 2G6BA 2EQBA 1XTQA 2IYTA 1YHNA 4ITRC 3U3MA 3KQKA 1GIAA 4P4SB 1Z0KA 3LX8A 4UNSA 1OXXK 1CR0A 3GEEA 2OFXA 4RD4A 2QENA 5EE0A 2VL7A 4KV9A 1E6CA 1RYHA 1JEEA 4MYHA 2BEKA 2QN6A 3WNCA 2GZAA 4M53A 2XTZA 5F98A 1XFAA 1HA3A 1DAHA 1VG0B 4C3ZA 3H1TA 4Q9IA 1DARA 2J1LA 3CW2A 1L2TA 4PPNA 1Z63A 1LF0A 1II8A 2LKCA 3OE7D 4NCKA 2JLVA 3TSOA 1US8A 1I4DD 1XPUA 2BCGY 1ZAKA 3K9NA 1NKTA 2OO7A 2WSMA 4C4PA 4E03A 3FGNA 4GP7A 1H8HD 4HAZA 4JVNA 3PITA 1YR8A 2GNOA 3D8BA 3CH5A 3LXXA 1AIPA 1MV5A 1U94A 2GJ9A 2ZE7A 2D7CA 1T5LA 1UF9A 2WHXA 4RD1A 2IXFA 3PENA 3R9IA 2JLQA 3OEHD 5A0FA 4BLRA 2WWGA 4M2LA 4URWR 5CDFE 2C96A 2JGNA 3BGWA 4PHHA 4LYAA 4M21A 2ZRGA 2OBMA 3C4JA 4M1WA 2DFLA 3U3RA 4C7OB 4H9GA 2A7QA 3TSZA 5FTMA 4OYHA 1ZM9A 3F5FA 2FG5A 2ZVPX 5GJBA 1E9FA 2D4HA 2Z0MA 4A1FA 4KITB 1ZU5A 2C9YA 2H92A 4KXFB 1SULA 821PA 3AH8A 3W6NA 1WCV1 4DSTA 1NLZA 1U0HC 1K5DA 2E9SA 3W6PA 2HLDA 4BLTA 3FTQA 4KLZA 3VFDA 2OAQ1 1ZUIA 4XSHA 2AWOA 1GILA 1UEIA 3OAAA 4IDHA 4MKFA 4TTPA 2JJ1A 1N5LA 2ZQ5A 1W5SA 3KUDA 3CNOA 1U98A 4Q47A 1DELA 4V03A 2W2TA 3AUXA 5FPKA 1E1RD 4RD0A 2EFDB 2GEDA 3OIVA 1CR1A 2ZRLA 4B48A 2ZANA 1FTSA 1DTSA 3RNLA 1SKYB 2OFWA 1U9IA 5HCIA 5K8LA 2KBFA 5BW8A 3Q5DA 1E9DA 1P3JA 1UADA 4ON9A 2JCSA 4EPXA 2XNDA 1SXJD 2J46A 3NKVA 2UZIR 3VX3A 4AIIA 1D5CA 3U7HB 4QBHA 2DWOA 3T61A 4B75A 1ZCAA 2VBCA 1G4UR 2ERYA 2RGDA 3PUXA 4YMUA 1CBUA 4ZCLA 3QEJA 1G6OA 4E22A 3IDQA 4OL0A 2P67A 3LW8A 1Q57A 1EFHA 1II9A 2XITA 1WDTA 1E2KA 2PJRA 2CLSA 4IDOA 2UZ3A 1RW4A 2G77B 1DAFA 4RCYA 1CKEA 4TMVA 1U8YA 1K5GA 2WJHA 4IOJA 4A2PA 1IN8A 1YU9A 3SFVA 2JLWA 4GMDA 3BC1A 1F2TB 5IK2A 1N6RA 3F0TA 3DHWC 4EFMA 4URXR 1E9EA 4FIDA 2FFHA 4OI2A 2GVDC 3E2IA 2QI9C 1AM4D 1OIWA 2BBTA 2HJGA 3RWMB 4LJ4A 3GJ6A 4IOKA 2IHYA 3FHCB 4LOAA 4MITA 2OESA 4OK5A 4TYWA 2XZOA 4HSEA 1KI7A 1A2BA 1GITA 1DVRA 1UBEA 2WZQA 3T34A 1NMYA 4HLUA 5DISB 3IIJA 4OK6A 5EXTA 4CEJA 2J0QA 1DBSA 2ZS9A 4D4KA 5IT5A 2FX3A 1AS3A 1W4AA 2O0JA 1U0LA 2CVFA 2P5TB 4Q1DA 3SYKA 1T0HB 2B8WA 3PG5A 1DADA 2GJ8A 4DDWA 4Q66C 2WM9B 2Z4RA 5JWOA 1PUIA 3QKSA 1DAKA 3HYTA 3R7WA 2P6RA 5J4HA 521PA 4JKYA 2ZYVX 1G64A 1LNZA 1PV4A 1XRJA 2FF7A 3WHKA 5EUMA 3SN6A 2WIAA 1C4OA 2FPLA 3LXRA 3RAPR 2BCJQ 2LWIA 5KSOA 2Q21A 1RJ9A 4QHTA 4H1VA 1P9NA 4GZLA 1IY1A 5AUOB 1EFTA 1M8PA 2WOOA 1KKMA 2ZUDA 3RWOA 3VU9A 4YDSA 4BFTA 1VCOA 3K0CC 2G9NA 4M1TA 3UG7A 3BRWD 1M1YE 3SEAA 1PZNA 1E2FA 2FGKA 5J5CA 3C8UA 4YXWA 2FDCA 3GLGA 3LLMA 1OSNA 3AEZA 2CK3A 2OSBA 3R7WB 5CIWA 5L3SB 1VG1A 4D80A 4HLCA 5JHHB 1GNPA 1T8UA 3A58B 5TMPA 1W49A 1HQCA 3EWSA 1CR2A 2ZETA 4V0NA 1R5OA 3AF0A 5DN6A 4I4LA 5SZJA 4QJ4A 2X77A 1NF3A 1IONA 5DSZA 2ZVQX 3DZ8A 3QXJA 2V4ZA 4B3GA 1KO5A 1SVLA 3KQUA 3X1XA 1KDOA 3KDSE 3GLIB 4NYMR 1E4VA 3LLUA 1FUKA 2ANBA 4NBSA 3RS2A 2BM0A 3KL4A 2PCJA 2REOA 2N46A 1O87A 3AKYA 2Q9BA 3IHWA 2TMKA 2AXNA 2V55B 4YLGA 4C0BA 2BDTA 3QG1A 4L4UA 1VMAA 2GXUA 1G1MA 3SQXA 3QOFA 3AKEA 5CJ2A 1KHTA 3RLFA 2O8FA 2PMDA 3O8CA 1KK2A 4JLKA 2J7PA 2V6JA 2PEYA 2ZI6A 3BS4A 2IK8A 5IHPA 2HXYA 3KKOA 4OI0A 4HB3A 2GZDA 1NJGA 1PJRA 4KODA 4NYJQ 4M1YA 4TT3A 4HUTA 4TYYA 3VKWA 4OHXA 1KI8A 2VHJA 5J4VA 5K8TA 2YOFA 1HURA 3CF6R 4PZLA 4WAUA 3A6PC 2J45A 4LK2A 1Q44A 1YZGA 1Z8FA 3NHBA 1KJYA 4Q4AB 1Z0JA 3N2IA 1SHZA 2OILA 2P65A 2IHBA 2CL7X 3B8HA 3QBTA 1JI0A 4OHVA 4D25A 2BBWA 2ONJA 4CT5A 1JALA 4V0KA 1N5JA 4DZZA 2FOLA 1CEEA 3KKQA 1OYWA 3A4LA 3FDIA 4QBFA 4B2PA 1NN1A 2JDID 1P61B 3L8YA 4ZCIA 4B44A 2AFIE 3CRRA 2IC5A 4MRVA 1L7VC 1CP2A 2JLUA 1JECA 4BLQA 1E2IA 4UNNA 5TB5A 2PCLA 3ECCA 4RVCA 4UJ5A 1Z28A 3SJBA 3PEWA 5SZHB 1W7AA 5FOXA 1UDWA 1KSHA 2QNRA 3WHLA 3LQQA 3ZYCA 1E4YA 2QQEA 2ZR7A 3OFND 1W1WA 2OG2A 3NBFA 3DPUA 4Q1AA 2XJ4A 1KI4A 2C9OA 1E9RA 4C7OA 1YZUA 2NZJA 4V0OA 4ZDWA 4LYHA 3SC3A 2QZ4A 5JMTA 4LGMA 1VG8A 1YZKA 1BIFA 2O8EA 4HZUB 5KNDA 1MO6A 3ZGXA 5G3ZA 2EVWX 5GJCA 2IS1A 2P2LA 3HJNA 1XZQA 3SE0A 3SHFA 1TX4B 4BFUA 4G5GA 3SS8A 1S3SA 1OYYA 4ESVA 3EZ7A 5EE1A 5SZKB 5FPHA 4P4TA 1CJKC 2ODBA 4Q48A 4DIEA 4EPTA 3NDBB 1YRBA 4Q9HA 2PL3A 3PCRB 2PLFA 1KK3A 2J7KA 1W36D 2D06A 2RHMA 2FWRA 4Z1MA 2ZSDA 3SI7A 3T15A 2DYKA 2GAOA 4NH0A 4G0NA 3QKTA 1GRQA 4Q9JA 1AK2A 4WA7A 2ZJ8A 2VF8A 1GM5A 1Z3IX 2JLRA 4TMTA 5EXPA 2J41A 1UKEA 5AUPB 4NCNA 4R2IA 4RD2A 4NONA 3B1ZA 4QGAA 5H8WA 1UAAA 4AYTA 4JVMA 4NYJR 2AKAB 3U2QA 1G5TA 1FMJA 4B47A 1W4CA 1ZNYA 2GBLA 4OQMA 1FP6A 3BORA 4NHOA 4QC2A 3B82A 1RE0A 1XXHE 2CXXA 1KYIA 4DLWA 3U7GA 4XVRA 3AVVA 1RZ3A 1JR3E 3HR7A 4F92B 1XJCA 2DHRA 5C18A 3MWKA 2FPKA 2VEDA 3EW9A 4BUJA 2G1KA 2BBOA 1EXMA 1E3MA 2FU5C 4NCHA 5J47A 2FN4A 3THXA 1ZW6A 2ODEA 2F9MA 4S2EA 2ZPTX 2AKYA 3B1WA 4DSNA 2ZSAA 5CITA 1TQ4A 4KVGA 3QSYA 1OFTA 1ZUNB 4NYIR 1TUIA 2GDJA 4AD8A 4B2LA 3BK7A 4EDHA 1ZIPA 1AKYA 1ZD9A 1MOZA 2W0MA 5FH9A 3L43A 4UXIA 1F2UB 4FMCB 5JS8A 1IY2A 2MMCA 2XNSA 2IEZA 3KUCA 2A3RA 5JBQA 1BH2A 1G7CA 2GCNA 3TMKA 3MWYW 3I8XA 3VNVA 4C30A 2GTPA 2JJ8A 3GLFE 1NMZA 1XNJA 1DAEA 1VG9B 2VP6A 3MCAA 3VU9B 4DCUA 3LRPA 2V3CC 1N6IA 4DDUA 2O8BB 2CDNA 5K8UA 3WY9A 2BEJA 3TSWA 1W5TA 1NVVR 4CDGA 1E99A 4XWAA 4DKXA 1QG4A 3U4QA 2HV8A 3JVUA 2GWHA 3EC2A 4N3NA 4ZKDA 2ASEA 1AS0A 3QG5A 1QDEA 1IHUA 3EPHA 1R10A 3UATA 1JAIA 2VSOA 4AKGA 3R8CA 4F4CA 2JAQA 1DAMA 5JEDA 5JFGA 1Z07A 2WAYA 3I32A 4RCZA 3FHTA 1FL9A 1C1YA 3FOZA 3R8FA 3CPHA 5KSPA 3GLFB 1G8YA 3K0FB 2ZRPA 1AKEA 3CRQA 2BMFA 1P2TA 5E7JA 2ORWA 1Q22A 2ONKA 1RIFA 2G88A 4IDNA 3S1AB 1P75A 1Q1ZA 1LFDB 5TVKA 1QHHB 1XD9A 1CF4A 2VP4A 4TYPA 3GLGE 5H1YA 1G4AE 4DDVA 4HUQB 2PEZA 3K9LA 3P4XA 1Q20A 1A5TA 3VQTA 1Q3TA 3QE0A 1KO7A 1IAQA 1G5RA 4TLDA 3B9PA 1ZRHA 2BHRA 3VTKA 4URZR 3W5IA 1J7KA 4WXRA 1G18A 3LNCA 3C7KA 3M6AA 4IXMA 3B5JA 4ACBA 2ZRHA 2ODNA 5EP3A 2RGCA 1B0UA 1JB1A 3LA6A 4D0NA 5JSZB 3K70B 1G8FA 3K9HA 1XD2B 3K0AA 2VTKA 1T0JB 5DLQC 3ZS8A 3AVUA 3B78A 1JJ7A 2W58A 1JAHA 4HEJA 4I1OA 2FSGA 2OM2A 2YWEA 4UNPA 1MO5A 4LRWA 2BOVA 2ZJ2A 4KJZA 4MGYR 3P1JA 3NEYA 4B34A 1VHTA 1JXOA 4LZZA 2F55A 3DKPA 3RS0A 2ZI3A 2ZYWX 1NSFA 2J3EA 5F3WB 4TMZA 5JRZA 5J4KA 3UXMA 3WYGA 3IKJA 1R5NA 1W0JD 1RRCA 5DH9A 2FSFA 1GAJA 4MGZR 2RGEA 5HZHA 3X2SA 4DLRA 1ZUHA 5JCZA 5E3HA 3FKSD 3DZDA 2PZGA 1KKLA 4FW9A 1BKDR 2WMOB 4JL6A 4M1OA 5CLLA 4YC7A 3T1OA 3TBKA 4X8HA 1KI1A 1AZTA 4Q4AA 2F1RA 5EE9A 5KDLA 3MGCA 4B2IA 3TAUA 1E2QA 3VR2A 2JLZA 1NVWQ 1HEIA 1N2CE 2CEAA 2DWPA 1V43A 1YZNA 4DLXA 3SYNA 5G41A 1GKYA 5FL7A 2GJKA 4KYUA 3DOFA 2O0HA 1E1QD 5JWRA 1W2GA 4NCIA 2FE4A 4U00A 1Z0IA 3GQBA 4BZPA 2QAGC 2DWQA 3W8RA 2W2XA 4RD3A 5KNBA 3W34A 1GKUB 3WYFA 2ZS7A 4DSOA 1FP7A 4DXAA 4BLPA 1HV8A 3HR8A 1CLUA 1UBGA 1I2MA 5CB8A 1FX0B 4JLVA 4BEJA 721PA 2C78A 2CMKA 3ZJYA 1KTVA 4CEHB 2H57A 3W5JA 1TEXA 1ZJ6A 4QRHA 5AR1A 2J0UB 3WRYC 3PUVA 4IJMA 3B2EA 3LVQE 3CX8A 3FB4A 4QG7A 2NTYC 3UMRA 4D82A 1TQ6A 2VHCA 3NG1A 4PANA 4LJ8A 4M22A 3DM9B 4NMMA 4A2QA 3B13B 3QUSA 1R4AA 2ZAOA 1E69A 4QXAA 4X8LA 2P5SA 1XBTA 1M74A 1XU4A 5CJPA 1LW7A 3K09C 3RYTC 2YZ2A 3U61B 1OFUX 2F1JA 3REGA 4DCNA 4DWJA 3GJ5A 4KBGA 4JBYA 4LC0A 3I5YA 2O8CB 1SVOA 3TK1A 4ZPXA 4M1KA 1G5PA 1YR9A 3I5XA 1KY2A 5FTJA 5F9HA 2PZFA 3CNNA 2OBNA 3AP3A 3IBYA 1VHLA 1GWNA 2IYQA 4AYXA 4BQSA 4C2TA 2W83A 4TSFA 3P27A 4CGZA 2QP9X 2ZR9A 4FD2A 2ZRCA 1X8LA 2RGXA 3THWB 1JR3A 4ZV4A 4V02A 3U5ZB 3IPXA 1DPFA 3ZVNA 1EGAA 2EFHB 1J8YF 2V7QD 1HE1C 4TZ6A 3BB3A 2HF8A 2WPDD 1NG1A 1AGPA 3B9QA 1F2TA 2QP3A 1RRFA 1IJFA 2IXGA 1T8TA 1Q3HA 3FHOA 3NIBA 2PH1A 4JLNA 5J4LA 3RS3A 5EP1A 2Q3HA 4HDQB 1SVSA 2VHQA 2QM7A 4JT4A 4LJ7A 2QMHA 3W9YA 1TU3A 3I92A 4US2R 5KNCA 3CF2A 4Q1FA 4YMTA 1W48A 4MUAA 4Q02A 3AF2A 4RKFA 2A2ZA 2HUPA 1TL7C 4QOSA 5FOSA 2V9PA 4BLSA 3MLEA 3EZ2A 3GP8A 2VSFA 2IA5A 3A1VA 4CEIA 1OFIA 2ZRDA 3W3AA 1ZVQA 1G3RA 4DIDA 5KOYA 2GF0A 1X6VA 3KFXA 5JI3E 1NN3A 2J5XA 4AURA 1TTTA 4C0SA 3OAAD 3K0FA 2G83A 4UNRA 3Q5EA 2Q9CA 2Z43A 4TN1A 5KSYA 2FFAA 4BASA 5JZVA 3CO5A 2HYDA 2DFKB 1ZBDA 1GZSA 4JJZA 3CZQA 1YRAA 5JS7A 2XOKD 3KZ1E 2RB4A 1EFUA 4MDEA 1N0UA 2QE7D 1EWQA 3QXXA 3O8RA 2OZEA 3NXSA 2QBYB 4EQ6A 3CONA 3QI2A 5FOWA 4TSFD 2PT5A 5AUNB 3FFBA 2VLIA 1PLKA 4TTQA 3RC3A 4JL8A 1KO1A 2IBMA 4FCTA 4FINA 4LJAA 2UVQA 5TV2A 5KTYA 3AUYA 3NH9A 2ZM5A 2P3SA 1UJ2A 4DB4A 1YQTA 1FTNA 2QTVB 1II0A 3ZQJA 3IO5A 5FPTA 4WZAE 4PFSA 1KJWA 5CM8B 1Z6XA 1OFHA 5L3SA 4Q9KA 4ARZB 3SBDA 1SQ5A 4TYNA 3FMIA 2EYQA 4JIMA 3P32A 5BQ5A 1IJEA 1R6BX 1KI9A 2IW3A 2ZJYA 4HB0A 4NE2A 2QY9A 1D9ZA 2HCBA 3PUYA 3QVUA 4B73A 1IN7A 3VR3A 2ZJAA 1YZQA 4LI0A 1TQ2A 3GEIA 3EARA 1KO4A 4PR0A 3ASYA 4FMBB 1N0WA 4U02A 4CZ2A 1FQJA 4LHYA 4BFYA 5EZ5A 2OBLA 2NO0A 2C95A 1RJ9B 4W5JA 3AQ4A 1TF5A 1H8ED 4Q1BA 5KU1A 4JLPA 1KI6B 4AG5A 1Z08A 2ORIA 3GLGB 2RGGA 5KDOA 1GOTA 1KK1A 1F3OA 1M2OB 4YONB 2IYZA 2O0KA 2D3WA 3IBGA 1P9WA 3AF1A 1RYFA 3RRZA 1IM2A 2ZSBA 3DMNA 3WXMA 4URYR 3TJZA 4F38A 1CJTC 4ZKEA 1L8QA 6Q21A 1QHYA 1P62B 4I1UA 4KVAA 2FEOA 4DLZA 1UFQA 4KO8A 3HU3A 4DJTA 4PSKA 1S9DA 1MR3F 1YJ5A 4YDHB 1RC8A 4LPSA 3EIEA 3SYLA 4PC6A 4OI4A 121PA 3REFA 3GJ7A 2KJQA 5JHGB 4N0DA 1FX0A 4EFNA 2CJWA 1NVUQ 2ZYUX 4MQBA 2W6IA 4NPHA 2YHSA 1DAIA 3CBQA 3K0EA 1DOAA 1G8PA 3ND9A 5EP2A 3T35A 1XJ0A 2CL0X 4K81B 1COWD 2IS2A 3KJGA 3X1DA 3KQHA 1DE0A 3OIYA 1OXUA 4A4DA 5C4MA 2FH5B 1XEXA 1E2NA 3CF0A 2QG6A 4RZXA 1OLOA 1E98A 3R9WA 2DY1A 2A5FA 4DCTA 1QVRA 4IXNA 4PAOA 4TTRA 5DI3A 2AWNA 4UJ3A 1HY3A 4B35A 1KI3A 4A92A 2OUKA 2O52A 4M9XA 1G291 2AHOA 1M6NA 3MFYA 3QF7A 5FUVA 3ADBA 1KDTA 1SXJB 1BOFA 1J8MF 4FN5A 4NZYA 4L15A 2D7DA 1IN5A 3CPEA 4D4JA 1KIMA 3BFXA 4LUCA 2OCBA 2BBSA 4LYJA 4V0LA 1IN4A 1OF1A 3VNUA 5EP4A 1S0UA 3A1UA 4CEJB 2QSZA 3BIFA 4JT2A 2WWHA 4LV6A 4KSBA 2QAJA 3GJXC 3CM0A 3X1WA 1P4SA 4D6PA 2J7PD 1MO4A 4MUBA 1PVOA 1NIPA 3FYHA 4BFXA 4TLEA 2WJIA 3U60B 4A0GA 1W46A 1A4RA 3PIRA 1E2EA 5G53C 1W36B 1QHHA 4EJSB 2D2EA 1AZSC 2DPXA 2ZRBA 2FFQA 3A37A 3QKRB 5FBWB 1SXJE 4ESHA 2NOAA 4NTZA 3Q72A 3ZVLA 4NP6A 2QPOA 4DLTA 5CYOA 2F6RA
chains in the Genus database with same CATH superfamily
2ZVDA 5TGZA 5IABA 4PV7A 4HJXA 2Q27A 2UDPA 3Q1LA 2HRCA 3VHLB 4AW9A 1VFPA 3OIUA 4MUIA 3L4JA 3Q7PA 3KVNA 4N7JA 3IS3A 4GI2A 2I03A 3H0EA 2QE6A 4IEIA 4TLAA 5P21A 2P6NA 3RTGA 2WEKA 5CDUA 1IXSB 1ZZEA 3UIEA 2DUJA 4B6OA 3LHFA 3N7TA 3M3HA 3CZAA 1SVWA 4X1OA 5AVWA 2PXXA 4YJGB 2I78A 4F04A 4RZ3A 1WF3A 4NMLA 4NATA 3CPSA 2YFQA 2BV3A 3L1KA 3GUUA 2IT1A 1CY4A 2BJVA 2WU1A 3QY9A 4WCDA 1VPLA 2CLFB 3H2KA 2N42A 2VNJA 3PR1A 4JLOA 3ROEA 5EE3A 3C5WP 4URUR 2HXSA 4KLAA 1VLZA 3NJ8A 4UPVA 1VHJA 1W88A 1GZ4A 3WOVA 4CKBA 3ZDDA 1NQXA 4KE8A 2FCAA 3P19A 2N1BA 1B1AA 1MC8A 5FBZA 3I8SA 5IAEA 3WL4A 4DLAA 2NMVA 2OD7A 3K4QA 5B12A 1BA3A 2FQWA 3DV9A 4DUGA 3NDIA 1T3LA 1QYXA 5A71A 1N6HA 4JLDA 5IYZF 3V7WA 2H18A 3KPUA 1J09A 1K86A 4Y1RB 1ADFA 1TJ4A 2X9VA 2C4MA 4NDNE 4J6EA 1YUNA 3HE3A 5KTTA 4X7PA 1U04A 2C5AA 4PAGA 1Y6ZA 5FTKA 3PRYA 4G8BA 1C9KA 3MTDA 1LLFA 4F5DA 4XJXA 1OAAA 4C76A 4CIXA 5I51A 4DZRA 1Z4QA 1W44A 3QXHA 3A9UA 3L01A 5F5LA 4Z0PA 2QPAA 2IH2A 2PGAA 3DGFC 4BVKA 1WZ2A 1GYQA 1FSZA 2J3JA 2K6GA 3IBCA 3O82A 4XPIA 2OC4A 2QRZA 3C6BA 4MW7A 4PYQA 1T3SA 2BEVB 2I4MA 3BULA 4IFEA 4WX2B 3VSCA 2Y2UA 5KTSA 1I9CA 1E1CA 2I2DA 3FVWA 2PBRA 2BRUC 3HYCA 1FFBA 4WESB 3EPLA 1E3WA 1FBTA 4PN3A 4IMRA 2EGUA 3DUFA 3GGSA 4E30A 5LXTA 4L78A 1HTBA 1QHEA 2EW2A 2ZIEA 4XUEA 4F56A 2R60A 1OBVA 3B6JA 5BMVF 3A06A 4RKRA 3RW9A 3K5HA 4NS1A 3H87A 3UK2A 1DINA 3I42A 3TGLA 1FMFA 2E5FA 2P8JA 2PVPA 1CVIA 2J0UA 2V7GA 2X5NA 3KS9A 1YKGA 4O4IB 4Q1EA 4NEGA 4ZREA 1OPRA 1LLQA 4FU0A 1GRRA 2P2ZA 1AGNA 2X8AA 3VKVA 4EX7A 3RS7A 5IT9A 1E2DA 3E3MA 3HSYA 4ICIA 2GESA 4A1OA 1V95A 1M0SA 2OK8A 4I3FA 2GN9A 1YK0A 2D62A 4M7OA 4X71A 4BNZA 3DBRA 5DLDA 3IEMA 3PEYA 3BZBA 2PUDA 4FGLA 1NPYA 1C30B 2AYYA 3CX4A 3AJ9A 1UDBA 3OECA 5DNDA 1FPQA 1RPNA 3VI4B 3VOAA 3WMXA 1LKZA 1Y5IA 1UBTS 3E5HA 1VBKA 1B8OA 4QODA 4AXXA 4B3BA 4EEXA 4GG1A 1IMJA 2VHUA 3F5SA 4G5OA 3ZWAA 2F1IA 2WJGA 2JVKA 4K28A 4PSAA 1O9GA 4RGBA 4ZVPA 2BMWA 1EZ4A 4FMDF 3YASA 4PLPA 4MS4B 2VDRB 4CQLB 1MHTA 3ZJVA 2BFAA 3ED1A 4CM3A 1MOPA 1ULHA 2VNHA 2WHRA 3IUNA 3LBFA 4HYYA 4RYLA 4C1NA 3AEQA 5HPYB 2WIDA 4JZYA 5F4BA 4NL4H 5HEKA 3AUTA 5CEJA 3IVMA 4XR4A 2WA2A 1SKQA 1KARA 4P3KA 4F9EA 5HWSA 5C53B 2AX4A 2GBPA 2Q9AA 3HUEA 3OTOB 2VYVA 2W22A 3KJFA 5C34B 3TR5A 3UC5A 2GZMA 1D03A 1YB6A 1I36A 2A92A 2Q62A 3MJVA 3OQ1A 4B5LA 2FOXA 4ZVRA 6ABPA 1NW9B 3Q3CA 1I94B 1LW6E 4H18A 4QBGB 3KAJA 3GLIE 4DG9A 4XPIB 1AK1A 2CE7A 2AMFA 4LXYA 2EG9A 3ML1A 3STHA 2B99A 2JIZD 1XZ8A 3DT9A 3UT0A 4IV0A 2ZXUA 3FGZA 3HU1A 4ZAZA 5E6UA 4X1YA 4DJJA 5EYPA 4G8DA 3H1BA 5AW0A 4PPGA 2J6IA 3FHJA 2ZJ3A 3M2TA 4GQIA 4HKTA 5LLSA 4RWZA 4YPVA 1XNRB 1FUYB 5IUJC 1ESZA 2ATVA 2VPPA 1ZIDA 4HD8A 4F4DA 4Y2XA 4GGPA 5B36A 2QDKA 1LI5A 1H5QA 3OIWA 4IKPA 1KI2A 1EHIA 1ENPA 3I04M 4L3VA 1OT5A 4GU5A 4YAFA 2A9OA 1JHVA 2BM1A 4TKLA 4BGDA 1JIXA 3NNSA 5CVUA 4D4GA 5IULC 1YQEA 2J85A 5HFNA 3MHPA 2AG8A 2I3AA 3BE6A 3I2JA 1OXVA 1PHPA 3D7MA 1V4BA 3PEUA 1QNFA 1UWVA 3DHEA 4KL8S 3ZXUB 2WIFA 4AJ4A 2QTHA 1ADCA 2C2MA 2I22A 2PLNA 2GN4A 4G1MB 1Z18A 2H0QA 2HM7A 1SWWA 4XGKA 1DFIA 1RSZA 4LTDA 2CXHA 3AEYA 1X2BA 4R2HA 5G1OA 4EI2A 5KKCA 5D1NA 3CLTD 3QZUA 2XYPA 1RRVA 3VYWA 4D4HA 4KLNA 3K73O 4HJRA 4LYGA 5GADl 1PLJA 2FQQA 5C7IO 2C4HA 5DHSA 4EZIA 1KYVA 2WUGA 5JLJA 5FLEX 1EJBA 1XROA 1VA5A 3WK6A 3LWBA 1Q83A 3FAKA 3MXOA 5HZMA 2CD9A 3SSMA 1WPGA 4W1PA 1C5KA 1MB4A 1PNTA 5AWFC 3RDPA 5MN6A 1UP7A 1EVLA 3DZGA 1J2JA 1YJXA 1L5QA 4HAXA 5CFNA 1D2NA 2IE8A 3ZI4A 3CIOA 1QC5B 3RAFC 4NEHB 5BN4A 3ZIDA 1WXXA 2XCTB 4DM3A 3B6KA 3K70D 3ADKA 3QW2A 4IEFB 3NIDB 4S35A 4CHGA 5CB6A 2XEXA 2JG3A 3R74A 1W47A 2BEUA 1NW6A 4DCVA 4HBZA 2V8OA 4O2AB 1UFOA 1VSUA 5LOVA 4H59A 4KPGA 1RHUA 3FLAA 4Z0HO 3DAHA 3EEBA 4K86A 4NNJA 5IKMA 4R8MA 3GIWA 3CUTA 4PPYA 3K70C 4W63A 1JIKA 5AP9A 1WZEA 1QRTA 3WMGA 3X2FA 2NO6A 1RDFA 1OVGA 4WFQA 3QQ5A 5EJFA 3DDOA 5GAJA 4L8WB 1USIA 2AD1A 3LPDA 4OPMA 1EG2A 3E7DA 5EGSA 6ADHA 4TZ0A 4K1LA 2W93A 3COYA 1V5WA 1FU7A 5FTNA 5KYNA 1R88A 3N59A 1I2ZA 1CDZA 5BPFA 3FMOB 1K7SN 1RYMA 3H5IA 2VQSA 5DHFA 2Y1WA 3WK4A 2YC4C 4PWZA 5JNSA 1RPZA 4V3CA 2GBFA 2IU3A 3DZIA 4PLYA 4D1YA 3A9CA 3HFJA 1NBEA 1HEUA 1P8JA 1Z6AA 1OPXA 2B7CA 3HB0A 2QSYA 3V1UA 2GD0A 2Z5LA 1M1XB 4QYMA 1V48A 5DM4A 5L3QB 4MVJD 1ONBA 3O4JA 1B1CA 3Q0IA 4I9UA 4POAA 4KXLA 3ME5A 4WPGA 2PMKA 1UXJA 3A0UA 2LCQA 5KIAA 2P41A 2ISSD 4KSCA 2Y68A 2FCRA 5BMVA 5DLEA 4ACAA 1NMXA 3DWIA 4EY7A 2GPNA 4F3YA 1QIKA 3ZZ0A 5K0NA 4M1MA 5JOQA 3L0SA 1UJNA 1XP5A 2PZEA 3IP6A 5D51S 2BY4A 2G9QA 4KX5A 4Y6SA 3B3QA 4DB2A 2D4AA 3P0RA 3S27A 1NVGA 3SVLA 1K75A 5EXSA 1JVNA 3I2IA 1GGEA 5FOUA 3VR6H 2WFLA 3TZLA 1XZFA 4K8OA 4TQAA 1ETHA 4W5OA 1NXWA 5LZ8A 2YUIA 3FYUC 3N0TA 3H8VA 1WS6A 3SICE 3KTAA 1JSRA 5BSVA 3SZLA 3Q41A 3QY0A 1Z2CA 1A8QA 5I4IA 1W4BA 1VM6A 3FTCA 2ZWPA 3QPCA 5A4DA 2JGRA 2DBZA 3RVJA 3V7FA 4AMZA 5LM3A 3UMCA 1QGOA 3I1FA 3OZFA 4JYCA 4OHFA 4YMIA 4BGEA 1TLTA 2QN1A 5F52A 4KHPB 3LKZA 1ZI6A 4RSGA 3T12A 3W1VA 4CQMB 1QE3A 1NZJA 5LQNA 1P3DA 3EZYA 1Z39A 2H2HA 2WM3A 3JQAB 3V4FA 1ZGJA 3B6IA 3TNJA 5THXA 1GTZA 1RQXA 4CG2A 1RQRA 4IR7A 5JCXA 4PCLA 3JVEA 3THSA 4AJPA 3P2KA 1XL0A 1M73E 3OLQA 1XMOB 1DC5A 4PO8A 4U2BA 5F77A 4ECEA 3IIKA 3E22B 1XMJA 3W7AA 3VPFA 3H11A 3OHMA 3FWZA 4FFNA 4TS9A 1HQDA 3PCXA 3PP8A 5C8VA 1KYTA 3EX7C 5JXIA 2BJWA 4GPZA 2JKYA 2Q2OA 2CNDA 1WUKS 1Y6JA 2FFBA 2MSCB 2VJKA 3Q87B 3DMYA 1MTOA 5LP6C 3GJYA 5TQ2B 3SM3A 1G2PA 1NN0A 2W2VA 3LHKA 1UJ4A 1PUJA 4LKRA 1CY7A 1TUEA 4BVHA 4ATNA 1IEWA 4YK7A 5CPBA 2EJBA 5HYVA 5KOIA 4WOJA 4DQDA 4KK4A 1G3IA 1QNLA 1X1SA 3E9DA 3M6MD 4KO1S 4L0MA 2GQ0A 4D43A 2MSEB 3GPLA 2XMBA 2GR9A 4WY5A 2NU8B 1U7ZA 1DRVA 1RXSA 1XRSB 5F1PA 4CR8A 2BHNA 5GONF 2K87A 1TM7E 3SS7X 1JFLA 1RWPA 1JDZA 2IPNA 4RLQA 4U0KA 3CVXA 1VB5A 4H77A 1PR2A 3F8TA 4Y2SA 2GN6A 2FK7A 2WG0A 1HDXA 4K5QA 4MWBA 1JSCA 4R1SA 1ODCA 5ALTA 4E2YA 1N78A 3OT1B 3FZYA 3VOSA 1ZC3A 5DGHA 5M5BA 2RAFA 3MJHA 3L6EA 4JL5A 4WW0A 5BYKA 1I0LA 2HU5A 4PYIA 2LXNA 2ZJ6A 2H2FA 2ZB7A 1JG6A 3K94A 4GHWA 1XCGB 5DNAA 5BN5A 1NNI1 3K9CA 4NJEA 3GWGA 1P5FA 1V6CA 4XM0A 4D9MA 2YJ6A 3B9BA 3FWHA 4LC1A 1KDVA 5KQSA 3GH1A 3PXDA 1XYVA 4R1TA 1CIPA 1NBMD 2A57A 2BH9A 1X3LA 3JVDA 3DEHA 3FWYA 3OPVA 4L5IA 1PQYA 1M2NA 4FE4A 1Z75A 2QIPA 5FI0B 2WLTA 2VTEA 3DE2X 3IEIA 4OJTA 4PRYA 3ZY4A 4GNRA 3ZCTA 2RGAA 3A1EA 2L17A 5EMNA 3T9AA 3TQSA 4E4YA 1FYXA 2QA5A 3NEJA 3MGKA 5C1OA 5M04A 3N1UA 4B0OA 1QZUA 2MCFA 3TX2A 4D41A 1JKJB 4U7TB 4S1TA 4N8EA 3F9RA 3KKKA 4HNRA 1N75A 3J7TA 1VJGA 2XT6A 3SYMA 1FEZA 4EHBA 3ROZA 1EWRA 3K9BA 4DYVA 5CFZA 1FUUA 1HYHA 4C88A 5IJ9A 3U4QB 4PBSA 4U4AA 1UPTA 1ZSYA 4DDHA 4NHEA 1C8KA 1OXSC 1NWCA 1X8JA 2JIQA 2CBZA 4B6JA 2BFNA 2ZREA 4MR7B 3E4CA 3MJCA 1XLTC 4NJMA 3DL2A 3HYRA 5CR9A 4ZJYA 2BMJA 2E4WA 5KYUB 2AMVA 1SC9A 1P9OA 1ANKA 3FOEC 2HA2A 4K9PA 1RWKA 4WY8A 2R6HA 5JMPA 3JQRA 1XCBA 2AL7A 3S2IA 4MDFA 1TIKA 3TPZA 2XTMA 3DXZA 1D09A 1X0XA 2IHTA 1H5NA 2XV1A 3M33A 3OD5A 1Z5VA 1Q92A 4HO1X 4RGYA 2QR5A 3UANA 1X7DA 4JU8A 4BUZA 1RWNA 5AKIA 4R1OA 2P11A 4HXFB 4J7AA 3NGXA 5FNZA 2UUBB 4UBMA 4G2NA 1A88A 4ISCA 4HRXA 2YHBA 3I9NA 4RO0A 2AN9A 4YCMA 3EG5A 5TXGA 4J76A 4NOMA 5CH3A 4MR9A 3HG7A 2AZXA 1IK4A 2G72A 2J0SA 2I4IA 1HC7A 2UUOA 1LSUA 5CDYA 1MJ5A 1YB2A 2G67A 3CNBA 3RSGA 5FTLA 5J2UB 4YJ2A 1H65A 4XQEA 4D92A 1C50A 4RHXA 5CCXA 4NARA 1Y33E 2FPRA 1A2OA 1E2JA 1QHIA 2V54A 2V4MA 2V74B 1ZJ5A 4PXYA 5FIUA 1T43A 5A3JA 3CRW1 2OA0A 4YROA 3ZIAD 4RK6A 1AB5A 1Z0DA 4UCQA 3KLNA 1Z36A 3SD7A 3QE9Y 3R20A 1JQDA 2Y99A 3ZWXA 2LTAA 3BHMA 4LWZA 4XQGA 4E5SA 3CNLA 3NFYA 4O2BF 5CVJA 1QFJA 1OTYA 3GJ8A 5F9FA 1C41A 1S96A 2WD7A 3DTYA 2R6JA 3N0WA 5FKJA 5HF5A 5LB4A 1D9XA 2R7AA 4TXNA 1FFGA 1HGXA 2UYQA 3W5VA 2C98A 3OBBA 1OB5A 2JCBA 2VRWA 3NHRA 2OO5A 1M6HA 2RGNC 2QMOA 3QLUA 1DB3A 1LCIA 2VKQA 4KQXA 4RDIA 1E1CB 3N2ZB 4TQUS 3F7OA 3S2FA 1CRPA 3GRUA 5D3MB 3CLVA 4TL9A 1V41E 1AK9A 3LTNC 1LPOA 5DN6D 1P4HA 4KE9A 2V97A 3N0VA 4WASA 3RSOA 4PZZA 3L82B 3R23A 5DK6A 1JU9A 2VHWA 1EU1A 3UHPA 4YMGA 4H7JA 5U9CA 4RMNA 3NUQA 2F64A 4A6XA 4TXLA 1GXSB 1GZ6A 4PG5A 3PE4A 4J0DA 4BRZA 2D13A 1CNFA 3CUSA 4MUMA 2IVZA 1E2PA 3UFBA 3FF4A 4KR7A 3G5AA 2WVHA 3CUYA 1GPAA 5BYAA 3OQMA 1TAUA 3BREA 1XMSA 1Y1PA 1VI5A 3Q12A 5CIQA 2QD3A 2CUTA 3NCHA 3F97A 4P6VF 4YPFA 3NH6A 1QHNA 4IOLA 4NBLA 4WCFB 5TPWB 1ZICA 1LPBB 2Z4SA 4EITA 3TFQA 4Z86A 1NVMB 4O1IA 3SEFA 3ZCXA 1RLJA 5KB3A 2WV9A 3JY6A 1NBWB 1RKBA 3L8ZA 3NLLA 1T91A 5TQ2A 3OQIB 1NRWA 1NF9A 4TT3D 1EFPA 3KYDA 4Q0MA 4EA7A 1AKRA 4KDCA 4ND8A 1UAGA 5AM5A 3R7NA 1WSAA 4RFSA 4ZCRA 2JBAB 4EY5A 4WRRA 3MSCA 4CXMA 2QUZA 2W2PA 1S8FA 4LOJA 4ZDIA 1P18A 3O9MA 4D26A 5BR1A 4PY2A 4B3IA 2VP9A 2WFLB 3JZFA 3MGAA 4ZU6X 2DCMA 4KJXA 1I4LD 2MOKA 4OCZA 4P7JA 1E5XA 2PMEA 3F2IA 2HWKA 2CHEA 5BWMA 4WL0A 3WGIA 2WTUA 1Q16A 3RC8A 3QWHA 3A11A 2CDRA 2XQVA 5CK4A 5JDCC 5HDBB 4YEDA 3ZX4A 4J2TA 5L7WA 5EUQB 4CLRB 4Z4FA 1HDZA 4IGIA 3M9LA 4GLBA 1N2CA 1FU4A 5EMLA 5HX7A 1WUJS 3UB3A 4H0CA 4IMPA 2CE2X 2CFSA 4AKSA 1TM4E 4CKBB 4E1BA 2WIBA 1BDJA 4X6UA 3ZVRA 1OAOC 3ESDA 2P6UA 1RCTE 4JHLA 3DMTA 2E5WA 2ZSFA 2DWCA 2DHEA 4PLTA 2VJLA 3GNLA 1WXQA 1KI6A 4GPEA 3PE3A 4B3XA 1H22A 4YP1A 4EG5A 1BDIA 1G9XA 4N7MA 1ORWA 3BCUA 3VYTB 2EW8A 4G5QA 1U0GA 2WKRA 4AJOA 1OFVA 1ZI8A 2OLJA 4C0AC 3I09A 1NRJB 2YY6A 3WJ7A 3N2GB 4N8SA 4GKJB 4MRRA 3C5EA 4XYMA 5ED4A 4XGIA 4HQOA 1XXHA 3EVAA 2C8JA 3HJRA 2PBLA 1XRMA 2YYSA 3RT1A 2C1XA 3D02A 1KAGA 1OYOA 4DUPA 4YT4A 3BH0A 4N3BA 2YZ7A 2X3UA 2AOTA 2O57A 2KB0A 1E5VA 3FFTA 3LVFO 4ZEOA 3U13A 5EJMA 5LP6A 1NNEA 1QX4A 4GD3Q 2WTAA 3DXYA 4RVNA 3STVA 4AN4A 3F6CA 4L4SA 4GPD1 3I01A 4R0MA 2WPDA 1UM8A 4RQAA 3MWDA 2O2IA 1EM8B 1TAHA 1OH5A 5LMCA 1TYZA 3IXQA 1IEVA 5BVHA 3IR7A 4W8OA 1UBSB 5LKRA 3ICEA 3QPWA 5AT1A 1P39A 1AH2A 3D3WA 5DNCA 1IK6A 3QM1A 3ZGOA 3TZHA 3W90A 2DQSA 1YDMA 4BIMA 3AHEA 1Z6QA 5AM2A 2DOKA 2EC5A 4G4SP 4JAVC 1RXWA 1W4ZA 1OT3A 2P27A 5LZ5A 2XMPA 1UBOS 1T5OA 3I72A 3KV3O 1SZPA 4LMPA 3HRHA 1ZDMA 2WYUA 4OMCA 4X8MA 3SZRA 3DHNA 4E21A 1VXOA 3EZ9A 1ST3A 1SQSA 3F8SA 3UYLA 4WN3A 4S1VA 2DHDA 2M6KA 4M1QA 2O6LA 3KT0A 4RK1A 1BCSB 3GJZA 3O91A 4FXPA 4BO5A 2SCUB 3VPCA 1E0KA 3W3AD 4QBKA 1U1FA 3OM9A 1PBTA 3NWPA 3VJLA 4GM4A 4PLHA 4B79A 2QTMA 1EGHA 3RQSA 1F60A 4F3KA 2CLDX 3TFWA 2EWVA 5FUYA 4CG0A 2C77A 3T5DA 2XCRB 1DTEA 4HYEA 5LMUB 4KFTA 2G0NA 1LRKA 2PUWA 3BWEA 4LDNA 5E7IA 4EHLA 2QD1A 2VP3A 5GTDA 2LCFA 4NXNB 1Q2XA 2VN8A 1FQOA 4Q4HB 3WLTA 2R6ZA 5HFAA 4WKGA 3ZV4A 5K0BA 4XVQA 3I6QA 2BFFB 4LDJA 1P60A 2J09A 4PHGA 4YI3A 2H54A 1M7HA 2JLBA 4KUEA 2NVUA 4MAAA 1Z4MA 1XCMA 3BQNB 5AJVB 1YNSA 4Q01A 4M1SA 2C29D 5DNUA 5E1DA 1AMUA 1ICEA 5B3AA 2O3TA 1RPTA 1KU0A 4EZEA 2PJDA 4N6NA 4WADA 2Q0XA 2RI1A 3QOWA 4R5MA 1TU4A 1L6RA 4CETA 3WMWA 2IYYA 2ZE6A 4RQBA 4BXOA 4Q3AA 2QI9F 2VJQA 1ZWLA 2NG1A 2VAXA 1NAHA 1DKOA 2VZEA 3EH1A 4HDNB 3ZWQA 4D9CA 2OT3B 2VTDA 4ZHQF 5CDSA 5LQMA 4KGVA 3KVYA 4HDSA 2VDQB 5GJVC 1LBHA 2HIHA 3UKJA 4BRSA 1QGZA 1N6NA 4PXAA 1YVPA 1YBVA 3CRZA 1ULAA 5DNYB 2ID9A 1SXQA 4YWHA 1SMKA 2ZG6A 3KXPA 3VV3A 3CRNA 1NJSA 3KUUA 4II2A 4XX1A 1WHSB 5CW1A 1UM9A 5B3KA 3D3QA 4YNBA 2JGLA 1JJFA 4U7WA 4KOEC 1XDSA 4JMPA 3ZWNA 1T9KA 2BFBB 4JLWA 3NV7A 3L0YA 3A1CA 2ACWA 5DHAA 2ZYRA 3HPRA 3PDIA 3PFIA 2GD2A 1E2HA 2DTDA 1HT0A 3OU7A 1KGDA 3P9QA 4ZRMA 5BR8B 3IIIA 2I8CA 3UPUA 4RXTA 3EA5A 5BO5A 5FX2A 3CLRC 2QTFA 4BXOB 1LF5A 4F72A 4TYQA 5LFAA 4FXOA 4L8LA 1USKA 3C45A 3PWZA 1F1BA 3C70A 4GMKA 3ZLJA 2LBPA 3GXOA 3G2JA 4WTOA 1GRCA 4GI7A 1B23P 4EI8A 2BZSA 2JFXA 4LVNA 3UV3A 3CJTA 4ISBA 3WK5A 3CH7A 4LBYA 3SC2A 2O8EB 2VPIA 3BJIC 1Z82A 4PYLA 1RQPA 1TZBA 2AD5A 1YZYA 4JDUA 4MHSA 3DOUA 3UGTA 1H6AA 3E4DA 5LWQA 2IXEA 2FPIB 4MRAA 5KTPA 2VYFA 4FFSA 3WRYA 4NZ9A 3MUOA 4J1QA 5LQJA 2O1SA 3A10A 3QBJA 1AHHA 3AYXB 2NV6A 2PIAA 3KXDA 1WXGA 1Z83A 4CIWA 4LWPA 3S2YA 3AHFA 5J4YA 2WWFA 2PUTA 2BEWA 2PG3A 3K0HA 5JIBA 4NAUA 2FSUA 1K8ZB 2MYTA 4WBNA 3GFOA 1ISGA 4IFIA 4XXHA 4PSUA 4LCEA 1C7JA 2OHVA 1VJ5A 1DRJA 4OF4A 4V0MA 4GXTA 4AICA 4C87A 4G2TA 1IB6A 1L5GB 1HOXA 2H7XA 1NVKA 2D0OB 4RF4A 1P0CA 1Z35A 3CRVA 1Y7HA 1XQXA 2QOEA 3WBKA 3AVQA 3CZMA 2VZ8A 2P4QA 2PL9A 5FR2A 3T41A 3W6OA 3PXEA 1U2RA 4IO0A 4RS3A 3CH6A 5TF0A 4OP1A 1T9ZA 1HT2E 4F3RA 4TVSA 3B48A 3GD5A 4Y6GB 4F96A 2WSIA 1U9IC 2OWEA 4G09A 4XB2A 5FR1A 1EX6A 3G8CA 1LK0A 4D99A 4Y0VA 5HRAA 5ITWA 3G3EA 5LUAA 2DTEA 2H7VA 3B1KA 4RY8A 1KBZA 2P9QA 2ZIWB 1LLDA 4A5OA 4M7WA 3WSWA 2QT1A 2BGNA 5CM9C 2HSZA 4X7MA 4M7RA 4LBVA 1C3VA 3T3OA 3OY7A 1CUZA 2QLLA 3EFEA 4UBKA 4Q9LA 5DNEA 1NT2A 3VBCA 4JP1A 2UU9B 2WSSD 1SCAA 4BVJA 5CCEA 1P1BA 4LS3A 3ADCA 2X8LA 3OUUA 4J7CA 3TMAA 1WXEA 4C22A 3DMDA 1REQA 3KB2A 1LRLA 1A69A 1Z8DA 1CUYA 2X4GA 3C5CA 3EDYA 3L4EA 3QVGB 4NFHA 5AKEA 4INAA 4BE7B 4AMUA 2NQTA 5GZ1A 3DAPA 1SBQA 3V5NA 3GCGA 16PKA 4XJTA 3GHYA 9ATCA 4B6RA 1ESNA 1A5ZA 3PNMA 1RWOA 3EGVA 2DQZA 4HLQB 5AO9A 3K53A 1JZSA 5BSHA 3GA5A 4RVFA 3EB9A 3GAFA 2QBYA 1ZMXA 4YUVA 2RGNA 1UANA 5E6RB 1JA1A 3IESA 3HKDB 3LT1A 1FDSA 2QLNA 2WFAA 2ILTA 3AQIA 4K7JA 1Q1GA 4RLFA 4UE6A 4B4UA 3G9ZA 5FQNA 5LZ7A 4OLAA 4FFLA 2ECKA 2FRDC 4LHZA 3GRRA 5DGXA 2CHFA 3SSAA 5JD3A 3G85A 5KMGB 1Z62A 5AK6A 2PLRA 2VP2A 4OQPA 5BSGA 1G20A 2AJBA 5IN5A 4DBZA 3IEKA 3UGKA 1JMVA 3JAWB 3MERA 4RK5A 3ZZNA 3AKZA 4CKCB 3WGLA 5ANRB 4D81A 2VJCA 1F14A 1M7GA 1WV0A 4KXUA 1QPBA 2VQDA 1CQJB 1UR5A 3ZBUA 1JWBB 4FFRA 5EEHA 4UTVA 2QU8A 4ZEMA 3ONDA 3DF7A 2OCYC 5IPFA 4KQJA 1SR8A 5D87A 4WK4B 3V4PB 1G6Q1 1RWMA 3Q7TA 4KXVA 3KU1A 2I2CA 3VAYA 2RHTA 4FYIA 4AO7A 3D1JA 3OU2A 5I7EA 1IHYA 2MSWA 3PWSA 4GFDA 3T3MB 2IYWA 1F5SA 1OAOA 2FETA 5D3MA 3C3WA 2Y1OA 1S1MA 4G1UC 4MYDA 1XEWY 2EX0A 5BWLA 1ZW1A 4OQ4A 5GJWC 3IL2A 1U8ZA 3OEEA 2V3VA 3T3IA 5EE5B 3RV4A 2A86A 1ZA1A 2QUJA 3AJRA 3BMOA 4M0LA 5BNWA 2C57A 2IVFA 1R0CA 2XVYA 3KQOA 4PQEA 4GC5A 2W0SA 3NHAA 1A9PA 2WRZA 2OMKA 2R96A 3BXGA 4X97A 4LX0A 2A0XA 2NX2A 5C7LO 5CT6A 1TYBE 3UAWA 2AJLI 3IEXA 4G0XA 3UWSA 3QVKA 3OLWA 4B83A 1DOHA 2OHOA 3LKVA 4EYSA 4CIVA 1QV9A 5KYTA 1XAJA 4CN8A 4AKIA 2BIFA 1JPJA 4FDUA 2WWRA 3BIOA 1O94D 2JBHA 4MV9A 2YYAA 5ALMA 2AQ8A 4BPBA 5IYZB 1EP1B 2EQAA 2ORVA 3E2PA 4PE5B 5EWMA 5B2FA 4FX5A 4ECAA 2XECA 1HX7A 2W6NA 2IH4A 3EBPA 4FZJA 2HT6A 5JPDA 3E48A 3UHFA 3Q85A 1SVIA 1VJCA 1YB1A 4X62B 3AP2A 3CE9A 3QLUC 4JASB 4TV9B 2Z2YA 1IBKB 2R1ZA 3E2MA 1NYTA 4XOIA 4YCBA 1CETA 2HMAA 3SVTA 3R7DA 1SKUA 1IQ0A 4NG5A 3TNLA 4Y2UA 3UMVA 4C4RA 1XN1A 4TL7A 2H63A 3P4YA 4RBNA 3HS3A 4DRZA 3AINA 3T1HB 1XEFA 2QPTA 1PJ8A 4MS1A 2NLOA 1NUTA 1W87A 1CY0A 4HAVA 1X1CA 4INOA 3OPYI 2RMKA 1ZIYA 1Z22A 3WWPA 1KSFX 1J2EA 4XAQA 3NBAA 3WJAA 1B0AA 3QJYA 1SVNA 7YASA 2A4MA 1ZM7A 4CM8B 5KJCA 1PFKA 3H1EA 2BTEA 2C92A 2ZRIA 3KPJA 5IBQA 5F4ZA 1SG6A 1WRBA 2F8MA 2QT0A 2RCYA 2ZAYA 2ZU0C 3A9WA 3TTSA 7ADHA 1HT1E 4S1NA 3SDBA 2FY8A 4XD7A 2FDRA 2XCOA 2GS9A 4AWAA 3DWFA 4PIPA 1N5RA 4BAUA 4QJ5A 3O3NB 1SZJG 5BQFA 3PL5A 1E77A 5F3DA 5JJBA 2AJCA 4C7JA 3L0OA 1GTJ1 1W5BA 1IWPB 1FZTA 4DSZA 4DWWA 4YUXA 1X77A 3ECAA 1CFJA 3I52A 5EIFA 2P77A 3GGDA 1A5SB 2IYXA 2YBEA 3PFFA 4PBRA 4QDTA 5I9SA 5C8DA 1ETUA 4AN1A 3E35A 4P3XA 3RVSA 2V9ZA 5IASA 4NCBA 4MQ6A 1GL9B 1QVZA 4LYDA 5I9MA 2XB2A 3I05A 4IIHA 2PUCA 2GD6A 3IO3A 1Q7RA 5B1IA 2AFVA 4PPQA 3ROTA 4NZMA 1RXIA 4Q7LA 1QB8A 3NYQA 3PC8A 2G28A 4GWLA 3NP7A 5TY0A 1E6UA 1BXGA 1EVKA 1H3NA 1Q1NA 5CB4A 3UJ6A 2NV2B 3EWNA 4YP7A 4BBZA 3ER8A 1J22A 4XA8A 3E15A 1OA0A 3HCPA 4WZBE 4Y6RA 3RTCA 1JFFB 1Q19A 4NZOA 3V7YA 2DKNA 2R4TA 3AI3A 2AQHA 2RIPA 2W6ZA 3I6IA 4LDZA 4U2KA 2Q3EA 5IEBA 3VDRA 5AW4A 5IVPA 1H4QA 2L19A 1X1DA 1YVUA 2CLIB 1U3DA 3KUXA 4HYQA 1EUCA 4IYJA 3V2UA 3I9OA 5A02A 2YUTA 1MIOB 3HZOA 3LU1A 1G41A 2FW1A 1P44A 2XNJA 2W2KB 4DRXB 1CWUA 4HGZA 4CLOB 1GYPA 2VWQA 5ENDA 2QTWB 4BL5A 2WG1A 5EAIA 4BBJA 3V8EA 2ZK7A 2R97A 3EWAA 3CSSA 3AM1A 4EI7A 1P31A 4CMAA 3LK7A 3VAAA 4CW7A 4F21A 3AFNA 3IVCA 4JNKA 2HRBA 4UKDA 5MGNA 1UT5A 3D6FA 2IL1A 2PSHA 3HBFA 4L22A 2XZPA 4HDKA 1CJMA 4LYFA 2G0TA 4B81A 3MUNA 2ET6A 3GL9A 3X43A 3AXSA 1KY5A 1CY6A 2ETVA 5AICA 2IP1A 3HCRA 3P9SA 2VSYA 4GICA 1GCGA 4RVOA 5ELLA 1W4RA 2ZATA 5CMLA 1TW3A 3CUKA 2AW3A 2BD0A 3L3BA 1VCNA 2QTNA 1ODJA 2VUTA 5DW3A 1MIHA 4X6YA 4UAGA 1C8LA 1E7WA 2J3IA 3H4MA 2F1HA 4NOLA 4W5HA 2ODTX 4C6HA 3CLUC 4Q39A 4NZZA 2TS1A 4B6QA 3QVMA 4ALNA 5K3SA 4X90A 5L4SA 3CVUA 3V9PA 3REOA 1G98A 3D7RA 4ONEA 1TQDA 4RNCA 4EB6B 2PZAA 1P72A 4RTMA 3SJAA 2QZ9A 2WTXA 3ZYZA 1GTRA 2VK4A 3TQHA 3VH1A 1TI7A 4FWIB 4HAIA 3U1BA 4AY2A 4TRNA 3BWYA 4Y6PA 1PE0A 2IYAA 3K1TA 1EZ1A 1XCPA 4UHKA 4R8SA 3EFHA 1LUAA 1QYCA 4YP9A 1ABBA 1I30A 4LHVA 3SQLA 5JEEA 1TFRA 5IXYA 1RFLA 4A82A 2N3ZA 4KI0A 4XD2A 4EL5A 1U3TA 2LW7A 4RQUA 4B7CA 2WJPA 2H1LA 2Z3ZA 4J16A 1I32A 3KBBA 1DLIA 5JFGA 2XZLA 4GBMA 5I7SA 4YUZA 4AKHA 4LRXA 2F4VB 2GJ4A 1UOPA 1K9SA 2VRCA 4FFVA 4RGQA 4ZVKA 4YBRA 5GGYA 3TZBA 3WP1B 3FPKA 1WAMA 5AOVA 1RZUA 1L0BA 1VP9A 5ARDA 1G60A 4HVLA 3NPAA 3U80A 2ZZNA 2GASA 3ZG6A 1NI4A 5AW5A 1WDMA 1IHOA 2FEMA 1JAYA 3LUGA 4GBJA 3FAZA 4KH0A 3FNQA 5F3RA 4ABYA 1XWIA 1WZNA 1A7JA 1SC6A 3MZ0A 4A0RA 5E4JA 4F3NA 1M67A 3II6X 3CURA 1ECJA 1K08A 4QDXA 8OHMA 1AB6A 1YVRA 2I80A 1LDYA 4INPA 4H6XA 4X8OA 2EQBA 1XTQA 1ZGCA 2X9NA 3BL5A 3O3MB 3ORRA 1ESDA 4D9GA 3AU9A 3FYUA 4P2GA 2IPAB 1C0LA 1J8QA 3HUTA 1X1EA 4UAVA 3KT8A 2E5LB 4P4SB 1F4PA 3C3KA 3EXG2 4WGGA 4HEQA 3OHPA 2OQ2A 2OOSA 3W2TA 1GCUA 5B4TA 4FE3A 1T8SA 2QN6A 4KQHA 2GZAA 3MYYA 3FRIA 4M53A 4QARA 2GRAA 4J7UA 2W6QA 4E6EA 3BMNA 4FYHA 1DBPA 2XTZA 2Y1LA 3ZNQA 3BZWA 5T41A 3JRXA 1HA3A 1JTVA 2BAGA 3QVOA 5FP0A 1VG0B 1HKUA 1X92A 3K2EA 3U09A 2Q3BA 4BYGA 1L2TA 1NZFA 2Y77A 3H4TA 1Z63A 2KMLA 2LKCA 3EZGA 4HGQA 4IILA 4L7QA 1ZGZA 2KHZA 3ACDA 3TIIA 1KPHA 4BMXA 3D0KA 4G9BA 1US8A 2WAAA 1IDOA 1XPUA 4WLVA 4CF5A 5FFNA 1WLYA 2WSMA 1BN6A 4I50B 4EVSA 4YQZA 4GP7A 3B3JA 5F1KA 4K0KB 4HAZA 3KJZA 3E8XA 2GNOA 5A4KA 2QPLA 5COQA 4LFBB 1PSDA 3UJ8A 1AIPA 5C7YA 1EVEA 3OTHA 3M4JA 3WGZA 3E84A 3ZUGA 3TECE 2D7CA 3I45A 9LDBA 1ZUWA 2JZCA 5EJ4A 4J2HA 2IXFA 4OAOA 3NYIA 5CGQB 5D6NA 5BVHB 4GUDA 3GP3A 5C4IA 2B37A 2WWGA 5KVAA 1P77A 4URWR 1ISRA 5ER9A 2Y92A 3GROA 5ES4B 5BW4A 4ZD6A 3EIWA 2NU7A 2P30A 4ZZ0A 4ER5A 1CHNA 3OTQA 4M21A 5L9AA 3RFXA 2ZRGA 4OHBA 5IBCA 3VR5H 2OBMA 4E1VA 3KOXA 4GMGA 2FI1A 3T3PB