3MUFA

Shikimate kinase from helicobacter pylori in complex with shikimate-3-phosphate and adp
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
160
structure length
160
Chain Sequence
QHLVLIGFMGSGKSSLAQELGLALKLEVLDTDMIISERVGLSVREIFEELGEDNFRMFEKNLIDELKTLKTPHVISTGGGIVMHENLKGLGTTFYLKMDFETLIKRLNQKEREKRPLLNNLTQAKELFEKRQALYEKNASFIIDARGGLNNSLKQVLQFI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Shikimate kinase
publication title Structures of Helicobacter pylori shikimate kinase reveal a selective inhibitor-induced-fit mechanism
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Transferase
total genus 55
structure length 160
sequence length 160
ec nomenclature ec 2.7.1.71: Shikimate kinase.
pdb deposition date 2010-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01202 SKI Shikimate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3mufA00
4JBXA 3IEVA 3H84A 3CWQA 1NRJB 1J2JA 5AUPB 1TADA 5L3VA 1BIFA 2IA5A 2REOA 2GF0A 2GAOA 4W5HA 4TMZA 4V03A 1TU4A 3K0AB 4R9UC 4PZYA 1E2GA 4KAXA 4LV8B 1OF1A 3NH9A 4D6PA 4UQOA 1G5PA 2ZVPX 1A1VA 2QMHA 1U9IA 4LV6A 4UJ5A 4PANA 4X8LA 3GPLA 4AKHA 2ORVA 2PCJA 3RDPA 4JYBA 3OAAD 1GNQA 1GZSA 2HT6A 1FZQA 2YOGA 1R6BX 3QG5A 2ZE5A 2ZYTX 4G5RA 3I5YA 3B1VA 1JR3D 4PQYA 1DAKA 1W0JD 1II8A 2F3RA 4QBIA 1E0SA 2WJIA 4A0HA 4HZUB 4M1OA 4PPQA 4K8OA 2ZE6A 3RSLA 1FX0A 5KHOC 3CRVA 1EFHA 3LX8A 1IN4A 5E4FA 1E9CA 4ACBA 2ZRDA 3OIYA 4HB4A 2NPIA 5AJZA 3Q8XB 2ZAOA 1ZM9A 2ZI5A 1AKEA 1SXJA 2F9LA 3K0CA 2EFEB 2ZRHA 1N5IA 4R2HA 1J99A 3GJXC 1KNXA 1Z2CA 5FPTA 2BWJA 2BBTA 2RKOA 1CR0A 3VHXA 1J70A 4BGDA 1IY0A 1B0UA 4IVPA 3V4FA 4MH0R 3U5ZB 1R5BA 4AKIA 4MKGA 3TJZA 5BQ5A 3AF2A 3IIKA 4G5OA 1P62B 4CEJA 1ZNXA 2QQEA 3QKRA 1U0JA 4II7A 5DHFA 4DCTA 3P20A 2QTFA 3TQCA 1S3GA 2VSOA 2REBA 3TR5A 2IS1A 1D9XA 1IJEA 1L4UA 2EWVA 3EWSA 2YWEA 1ZVQA 5B58C 5G3YA 5FPHA 4NONA 4EIWA 4JS0A 1GILA 1QDEA 4F38A 2YOFA 5TMPA 3LRPA 5IDVA 4DT1A 2HCBA 1JEDA 5KNBA 1E9FA 2VF7A 3CPEA 3L0PA 2B6HA 4BRWA 1TQDA 4BPBA 1CP2A 3CLVA 3U7GA 1J90A 1GDDA 3DZ8A 2CMKA 1KY2A 3RRYA 2GEVA 2GCOA 1OH7A 2ZJZA 3X1DA 4MDEA 2C95A 5ELXA 4LSGA 1JPNA 1U8ZA 1N5LA 4YDHB 3DZDA 3V9PA 4IDNA 3VTKA 5J40A 1T3HA 1XPRA 4I1VA 4KXFB 5CM8B 2X19A 5E7IA 5KPJA 1DVRA 4Z54A 2L0XA 2QT1A 2BIFA 5HCNA 3LBNA 5C18A 5EXXA 2ONJA 4B35A 1AN0A 4B32A 1XJ0A 4H1VA 5K8TA 1AQYA 2R6GA 4MGZR 3RS3A 3UWKA 5CJ2A 1UEJA 1V43A 3LA6A 1RRCA 2IK8A 4RSGA 4DLWA 3RWMB 4KCGA 3FMPB 3TRFA 4GMDA 4M1MA 1XMIA 1QHSA 3HP1A 5CM9C 2F43A 3GLHE 5J4YA 3DL0A 3DHWC 2RGXA 2IHYA 1P61B 2Q3FA 4B3BA 3RC8A 3K70D 5H68A 2WHXA 3CRRA 4GL2A 5KSOA 1W44A 3PJRA 2ZPTX 2FSHA 5CB6A 1Z29A 3OE7A 1TTTA 4GFDA 3WBJA 3EARA 1P60A 3SR0A 1E1QA 3WP1B 1FUUA 1W49A 3BIFA 4FMBB 4Q47A 1DEKA 2IC5A 1KGDA 3GQBA 3NBZC 1TUEA 3QNUA 4GNKA 3LV8A 4IOKA 4ZCLA 1BKDR 2IUUA 1G8PA 2GNOA 2HUPA 3GLHB 2OCAA 2DB3A 3W8RA 2R6AA 3RS2A 2HJVA 3FDIA 3VR2A 1HT1E 4GP7A 2ECKA 3B5JA 1X3SA 5LB4A 4NCJA 2ZRPA 1GIAA 1R7RA 2WSSA 3EA5A 4V0OA 3R7WA 4M1KA 4DC9A 1W5SA 4LUCA 2C9CA 1E9RA 2WJVA 4HLQB 3TIFA 2XXAB 2HLDA 5KO2A 1SXJD 2PH1A 4UXIA 2W83A 2RB4A 5FUVA 1G5TA 1SXJC 4PFSA 1XD8A 4GP6A 2D4HA 2I4IA 2EVWX 3RS0A 2OO7A 1J8MF 5B57C 3QG1A 2NO7A 3LXRA 3BB4A 1TF7A 2CNWD 2HF9A 3RSOA 2G1JA 3TK1A 2JCSA 3I61A 2VP6A 4ZDJA 1XD9A 1IY1A 3ECCA 4QL3A 2VRWA 5IF9A 1W36D 1IAQA 2REXB 3SI7A 3WP0A 4B33A 3EG5A 4D0GA 1CF4A 1ZM7A 1OLOA 3VU9B 1A2BA 2ZM5A 1G9XA 1WP9A 4TMWA 1IOZA 2IYSA 4FIDA 5AWFC 2R6DA 4A15A 2EWWA 4B47A 1RYHA 3HYRA 2ZQ5A 1W1WA 4S2EA 1L2TA 3SQXA 4F7WA 1JBKA 4Q4JB 4JLMA 3QIAA 1XD2A 1TF5A 2GJKA 1OPXA 5TV2A 3N70A 3ICEA 3SOPA 4Q01A 3B78A 1M8PA 5LD2B 2QRZA 3R20A 5JMTA 1E2JA 1VG9B 1KSFX 2R6FA 1R10A 4OQFA 4W5JA 5KNDA 3GLFA 5AJVB 1T3SA 1KDRA 1SZPA 2XTZA 4RFSB 2ZE8A 3AEZA 4V02A 5GJWC 4TYPA 3C8UA 5TDHA 4TZ0A 1MRNA 3CBQA 2B7CA 4M1WA 4KU4A 3BXZA 3GJ5A 1BOFA 1KZ7B 1NKTA 1LY1A 4UJ3A 5FPYA 4IVRA 2O8DB 3MGCA 1P6XA 2JLSA 4B6EA 4B34A 3JZAA 4TL6A 3T34A 4Q03A 3A1UA 3K0FA 1OIVA 4Q4HA 1B23P 3SJCA 1E2LA 4GZMA 3K9HA 3ASYA 2J0VA 3IO3A 3QPVA 3OE7D 3TGPA 1E1QD 4BWYA 1S0UA 5FUYA 5J5CA 5KUTA 1EX6A 2NZJA 4D2IA 2XZOA 2AN9A 3U3MA 3RRMA 3UMRA 3I3SR 1PV4A 2WWGA 2Q3MA 4GBMA 2V1UA 1GNPA 3A4MA 3RAPR 2K5UA 1M6NA 1VG1A 1IM2A 3PQCA 2Q9AA 5FTKA 4IW3B 1I2DA 1VTKA 3LD9A 3FPAA 5CIQA 4KI0A 3IQXA 4N0EA 2GCPA 2DWPA 1NI3A 2R6CA 1U99A 4YXWA 3DDCA 2EFCB 1XTQA 3BFXA 2ZREA 1UBCA 5EXPA 1FL9A 3FE2A 3W6NA 5J47A 3QPUA 4OHZA 1SKYE 2W2VA 1G41A 1XJQA 3BK7A 4D26A 4PPFA 2W6JA 8OHMA 4HSEA 4TQAA 1ANKA 2F6RA 3W5IA 2H16A 3D7MA 5KPDA 1F2UB 1OIWA 2AWNA 4NKRA 2J7PD 1KK2A 4ABYA 2J7KA 1JXMA 2FFHA 3QVVA 2YJTD 3JZMA 2AL7A 4FMCF 1M1YE 4DCSA 3L8ZA 2YKGA 1COWA 5H8WA 2A5JA 1N0VC 4D0LB 2A7QA 4LPSA 3GJ8A 3DMDA 2D2EA 2QG6A 2BOVA 1SKYB 2G3YA 4ESHA 3AV0B 2ZRCA 2OV2A 4MKFA 5EE3A 3C7KA 2QGZA 3MMPA 4RY2A 2DHRA 3SYKA 2GJ9A 2J5XA 2D74A 3B60A 2AK3A 1FQJA 3TSZA 3K09A 2A9KA 2JJ8A 3NHAA 4A82A 1K6MA 1MH1A 1W5TA 1VHTA 1A2KC 4BLSA 1S2MA 4L4UA 1SVKA 1F6BA 1U8AA 4BFVA 3MWYW 2P3SA 1RE0A 2BHRA 2FZ4A 3KXLA 4E22A 1NIPA 2F1JA 3AGQA 2ZJAA 3SBDA 3F0TA 2WKPA 2ODBA 1F2TB 4ILEA 1P2VA 5AJYA 3AVVA 3TLXA 5CDFE 2G88A 1NVUQ 2FV8A 4FCWA 4H1UA 4XJXA 3UMSA 4KLZA 4ZV4A 5IK2A 4JLPA 4X8MA 2MMGA 1SHKA 2E87A 1KI4A 3U7EB 4WOPA 4KYIB 5KDDA 1QVAA 2H57A 5JBQA 2QUZA 4ZDWA 1NLYA 1PJRA 3LW8A 4TWZA 3CR8A 3FHTA 1DTSA 2XGJA 4B3CA 4MYTA 1BYIA 3O8CA 3L82B 4P33A 1PUJA 2XNDD 1OFHA 4I1OA 1E1RA 5FBLB 4BFYA 5JRJA 4A2WA 2C03A 2V6IA 2BM0A 4A6XA 4LHYA 2FNAA 5DHAA 1SULA 2DBYA 3WMGA 1ZP6A 4J0QA 3WHKA 2IYXA 3B1XA 1XX6A 5F2EA 1UBFA 1QRAA 1HT2E 1V5WA 3IILA 1G21E 2CHGA 2ZUBA 3KTAA 3T1VA 4QHYA 1Z6XA 2P65A 1OYWA 4V0KA 3EW9A 5JHGB 4Q9HA 3R8CA 1EGAA 2V54A 5DI3A 3QUSA 4EAQA 1US8A 2ZRGA 2OHFA 3RANA 2VF8A 2FH5B 4FD2A 5HTKA 2FOLA 3LO5A 1ZCAA 4YLGA 4AC9A 4KBGA 1ZUHA 1XMVA 1R5OA 1YRBA 3QXSA 1UADA 1TAGA 3REFA 1Q3TA 1Z83A 1LS1A 3K53A 2OCPA 5FL3A 2WVJA 4JJZA 2PMKA 1G3UA 4RD3A 5GVRA 2BMJA 4YXWD 2B8WA 2VHCA 1L4YA 4GOKA 1GP2A 4DIDA 1JAHA 1PLJA 2QORA 4U00A 1IXRC 1Z5ZA 1EFCA 3B2EA 3I62A 1RIFA 2GF9A 3QPWA 4PHTA 3SJZA 4MUAA 1NN0A 3IQWA 2ZSAA 5SZJA 2QEQA 1FNNA 1YR8A 3RVBA 3E2IA 4TTPA 4M4SA 2QQ0A 4NP6A 3AUYA 3KDSE 3KB2A 1IJFA 2WMOB 3WNBA 4C3ZA 2BEKA 5HR5A 4JLVA 2FSIA 1Z63A 4LJAA 3T61A 4Q4LA 1WRBA 2ANCA 4UNSA 4Q9JA 5E7MA 3QI2A 2BMFA 5FI1B 4OKSA 1W4AA 3EZ7A 1MV5A 2OCYC 3CF0A 2JLWA 2CLCX 4Q9IA 2IXEA 3T5DA 1G291 5FR1A 2C98A 2W6ID 1E0AA 3U6KA 4BECA 2YVUA 1U0LA 1UFQA 4P3YA 2QM8A 4CW7A 4LBZA 4PSVA 3QF7A 3GLIB 3OZXA 1X8JA 4RD2A 1UJ2A 3GEIA 3B1WA 1S4QA 1P73A 2RGNA 221PA 3K09C 2A30A 2OXRA 1JQLB 4PSAA 3BERA 2VA8A 3FKQA 3S1AA 4Q1EA 1IXSB 4R98A 1ELOA 2HDNB 3BB1A 2QAJA 2UZ3A 3JVVA 3K1JA 3E70C 1CEEA 1NIJA 1E98A 2P0EA 3BWDD 4U02A 5CK5A 2BEJA 4PAQA 1EWRA 4PX9A 4V0NA 5EZ6B 5BXQC 5IK2D 3CIOA 2IUTA 5AUQA 3E1SA 4JSYA 1YR6A 1Z0DA 2WAXA 4OL0A 3X1XA 3GFTA 4MDFA 1F3OA 4F4JA 1G7CA 2W00A 3MG9A 2PLRA 2G83A 121PA 3BB3A 1Q21A 2RGAA 1FNMA 1A7JA 1E1RD 1GG2A 3BH0A 4NPHA 5FTLA 2GTPA 2X77A 2O8EB 4HB2A 4BLRA 1G8YA 2O8BA 2CJWB 4CVNA 1YZTA 4B3GA 4WZAE 521PA 1T4GA 2KE5A 2VSFA 1UKEA 4AIIA 4JKIA 1NJFA 2QTHA 4XWOA 4L9WA 4MRNA 4XWKA 1Y63A 3AF3A 3X1WA 4RZ2A 2J46A 4BQSA 2JLQA 2AWOA 2Q3HA 3FKSD 2GWHA 2MMCA 4EPRA 1OT3A 1KO7A 2DWQA 3KJHA 3QXXA 3WBKA 3WNDA 4URXR 2GXUA 4Q1CA 3LDAA 3KKMA 4MRSA 3VX3A 3AVTA 1OFUX 2OCBA 4LJ7A 2DCUA 3CX6A 4HAWA 3VR1A 1JECA 4KLNA 1Q20A 1JPJA 3I5XA 2B92A 3EZ9A 4PC6A 4ZIRA 3AP2A 3U44B 3LXXA 3OIUA 5FBRB 3VX4A 2IXGA 4DSTA 4DKXA 4OBEA 3TUIC 4PO1A 1AA9A 2OM2A 2PX3A 2NIPA 5F98A 1KIMA 2B21A 4MUBA 1OFIA 5E7JA 1FP6A 2DR3A 4E07A 3BD9A 5CJPA 1KY3A 4QC2A 1LV7A 4GPTA 2XTMA 1NN1A 3CNOA 3KFVA 4OHVA 4OK3A 3TH5A 2F7SA 1X6VA 3QEJA 3QKUA 4LGMA 4Y0AA 1NBMD 1PLLA 4Q19A 4M22A 4DSUA 3THYB 1K8RA 3AKDA 2O8FA 2BKUA 5JJIA 2OLKA 2ZJYA 1KKMA 1S8FA 4KHZA 1D2NA 3U3RA 4IVQA 2DFKB 1XXHA 2GXQA 3CWZA 3HU2A 2P5TB 1W47A 2QNRA 3THXA 4OI1A 2VSXA 3EZ6A 4C0LA 2DFNA 1UKZA 1KDTA 2GK6A 2ZYUX 2OXCA 3T5GA 1FMLA 1JJVA 5IHPA 3UG7A 2OFOA 5EZ5A 1AM4D 2DFTA 1JJ7A 2EW1A 1GRRA 4RD1A 2HYDA 2R8RA 3OIVA 4IKEA 3FFAA 2NTYC 3W5JA 3KUDA 2OBLA 4V0MA 1XTIA 1XEWX 2KBFA 2H7VA 4MITA 1AZTA 4LPKA 4PR0A 2QU8A 1FW6A 2JDIA 1CU1A 2J0UA 3VR6A 2RGNC 1GWNA 4RKEA 3Q3JB 3B7GA 1RJ9B 4DLUA 4A6PA 5L3QA 4US0R 2V6JA 1Q22A 2ZR0A 1G20E 1E9BA 2QY9A 2XAUA 3AKCA 3NKVA 1ZM2A 2OAP1 2R62A 3K8YA 4JLBA 2WWWA 4QFMA 1KSGA 3H2YA 4P4SA 4ZO4A 4C30A 1G3RA 1N6PA 3K9NA 2EQBA 2P6RA 3A1WA 4M0LA 3UANA 3CPHA 1EX7A 2JAQA 2CXXA 2ZROA 3THWB 4IFEA 4LHXA 4PHHA 1E6CA 1SVIA 2ZU0C 4AWXA 1QF9A 1FFHA 3IHLA 4PC7A 2GRJA 3WHLA 3WYAA 2QENA 5EE5B 4HUTA 1XZQA 2FGKA 3FMIA 3UMFA 1CKEA 3SS8A 2AD1A 4PHGA 1WE2A 2IEZA 3K9GA 3QJYA 1CJMA 4D80A 2HYIC 3HPQA 1XPUA 3TAHA 4TSFA 3MWLA 2QI9C 4BZXA 1JEEA 1E2EA 4QJ3A 2HJGA 4GOJA 4A2QA 1IN8A 2ATVA 3BBPA 4JL8A 4LDJA 4TLCA 1XCMA 2PJZA 4E03A 2RHMA 3QXJA 1OIXA 3DEFA 1HURA 2ZJ5A 4JBWA 4IOMA 1L7VC 5C4GB 3E5HA 1E2MA 1P5ZB 1XEXB 1VIAA 1WBBA 4JVLA 3ADBA 2JLXA 1NL3A 1NMZA 2ERYA 4M8NE 2R65A 4LZZA 1XP8A 1U90A 1GL7A 3VKGA 3NTUA 3IPXA 2QAGB 1XMSA 1KI8A 3U2QA 1VHLA 3LX5A 2CNWA 5DYGA 1G16A 4C2UA 4IDPA 4G5GA 4UXJA 4BFTA 1KAOA 5FOWA 3SBEA 1M74A 1XTJA 4DLVA 1TU3A 4JLOA 1M7BA 3RRNA 1Z3IX 2VIIA 1E2HA 1NKSA 1KK3A 1ZD8A 2ZSFA 3H1TA 3KJEA 3LY5A 4HZIA 4XTRA 4BLOA 1DELA 4O25A 4BFUA 2EFHB 2XOKD 1Q57A 2G77B 1NSTA 4FWTA 2XITA 2ZUDA 4HUQB 4GDFA 1GITA 5KTYA 1DO0A 2Q9CA 1EG7A 1YZGA 2G0NA 1P7CA 2VL7A 4TN1A 4S35A 5J4HA 1DBSA 4LJ9A 1KI7A 5EE9A 1D9ZA 2XZPA 1A4RA 1NMXA 4FWIB 2BBWA 4CEHA 1Q1ZA 2CL0X 2NO9A 4C9BA 1MO6A 1YRAA 4O3MA 4RD0A 3CF2A 2ZI7A 4PC2A 2KI5A 4PAOA 3BGWA 1KMHB 4IXNA 1HH4A 4ITRC 4LYFA 4PSKA 1T0JB 4C2TA 2OG2A 3TE6A 1VECA 4NYJQ 2FMXA 2PZFA 5SZHB 3QKSB 2ANBA 1NY5A 2LCFA 4UXHA 5FBQB 2C77A 2WZQA 5BW8A 5C46F 2JLUA 1VCNA 1G7RA 3QEOA 2FSGA 2ODEA 4ZPXA 3LQRA 4LOAA 5FOVA 4XVUA 4UNNA 2JDID 1P2TA 3BE4A 3AM1A 4PQFA 2JLZA 3FOZA 1RC8A 3FGNA 2Z83A 2E9SA 4NHOA 1KNQA 1XFAA 1XF9A 4F92B 4MYHA 1ZD1A 4ARZA 3GLGA 4GI7A 2GHIA 1BMFD 3D31A 1ZMXA 5FH9A 5M04A 2TMKA 4TYNA 2FEMA 4MGIR 1KO4A 3QF4B 3B1ZA 3VR5A 3FHOA 4Q1FA 3DM5A 2ZI6A 3NDBB 3U4QB 4LY6A 4GZLA 2F1HA 3K70C 2VP2A 3U7FB 4JKYA 3DMNA 1OV4A 1CRQA 4KJZA 1RVDA 1ZNWA 4HAVA 1U9IC 2QPAA 5DO9A 2QMOA 1TQ4A 4JJKA 2EFGA 2LKCA 2QT0A 1YZNA 2ASEA 1KI1A 2X2FA 3CRQA 2D62A 4MYCA 1ZINA 2BBSA 5EP2A 4TSFD 4WXRA 2J3EA 1YR7A 4LX0A 3HR7A 2GCNA 2QBYB 3B9QA 1MO4A 4F4IA 2H17A 2IEYA 4JT4A 3QKTA 4QOSA 4H9GA 4QGFA 1Q1QA 3KXIA 4IEIA 4CEIB 2YOHA 3IPYA 3K0CC 2Q0HA 1KI2A 5D3MA 1JALA 2JEOA 3O47A 1IQPA 4Q1DA 2C5LA 1N6RA 1ZYUA 3FB4A 5EXSA 5G3ZA 4XD7A 4C4PA 2GETA 2X1VA 2J7PA 3AKYA 3KQNA 5KOYA 1NLZA 2BCGY 4C0JA 2WICA 2O8CB 3NEJA 2OT3B 3LBHA 3Q9LA 1GKUB 4TYWA 1QHHB 3CZPA 3DOEA 3PR1A 2BMEA 1XDBA 4EPXA 1W36C 3WRXC 1AQUA 1YZLA 1FMJA 3VKWA 1KJYA 2Z4SA 5FOTA 4IOLA 3ZVRA 3J81k 4URUR 5H70A 1KO8A 1YJ5A 2ZTSA 1C4OA 3MRSA 4I99A 2GAAA 2R44A 3HPRA 4MA4A 4URZR 3SYNA 1ETUA 4Q5IA 3ZVNA 2FWRA 2AR7A 5L3SA 2SHKA 1UEIA 3K0SA 3W90A 2J87A 1S9DA 4M9SA 4TTRA 1ZAKA 1G5RA 2ZYWX 1MKYA 2CCJA 4UNPA 3VAAA 1PLKA 4Q7LA 1FUKA 5JFGA 2FG5A 3EASA 2QGNA 2JASA 5JWHA 1YHNA 1Y3AA 2W2XA 1CJTC 4FCVA 4K46A 4D82A 1DAMA 2B7BA 3TKLA 2FFQA 3NIBA 4CT5A 2OFWA 2C78A 1II8B 4Z1MA 4BFSA 1VCMA 4KBFA 4GOXA 1LNZA 1G7TA 3UK6A 3CX8A 1NJGA 2HXYA 5EE0A 2GZHA 1FX0B 1MO3A 2IYTA 4C7OA 4ASUA 3I92A 3WYGA 4PQRA 2ZIAA 3QXCA 3ZDQA 3SJBA 4HAZA 1NP6A 2OUKA 3CB4A 1XTKA 2GZDA 4QGGA 3SHWA 5BYKA 1ZNYA 3VQTA 5LDDC 1Q12A 1W2GA 4JLAA 1SXJB 2WIBA 2I1QA 1KTVA 2XNDA 4FN5A 1N5JA 4ZCIA 2D3WA 1DAFA 2AX4A 3FHCB 1N6NA 1KKLA 2FE4A 1G1MA 3LNCA 4QRHA 4Q4AA 5B64A 1W0KD 3AKEA 1R2QA 4EKDA 4PC3A 3LLUA 2W2TA 1CULC 1E2NA 3RWOA 2OE2A 4C0KA 2ZETA 4YMVA 5JS8A 1WQ1R 1I4TD 1ZIPA 4DEYA 4W9MC 4DZZA 3BH7A 2O0JA 1NVXQ 2IF2A 3MWKA 3QKRB 5SZIA 5FBWB 5HKKA 3VKHA 3HDTA 1X8KA 2IW3A 1SGWA 1UPTA 2CEAA 2HCJB 2AFHE 1KSJA 3MWJA 4PPNA 4B76A 4A8JA 2VTKA 2QP4A 3C14C 1ZU4A 1Q1BA 3O8BA 2WOJA 4DT1B 1GVNB 2XEXA 3PG5A 3ZIAA 2C99A 5K8IA 2FPMA 2RH5A 1NY6A 5ANRB 1DO2A 1FOEB 3VFDA 1ONBA 3IIMA 5JZVA 1D5CA 5LPNA 2V8OA 3A1TA 5BN5A 3JVUA 3SC3A 3FWYA 1LTQA 2GCOB 2QL6A 1TL7C 4DLZA 4EPYA 2CLSA 1NNEA 2WJGA 1KYIA 1OKKA 4G5SA 4HDOB 4YMUA 1OFTA 3P32A 4TMXA 4DLXA 3ZD6A 4KFSA 1WA5A 2C2HA 4NYIQ 4C0HA 2BBOA 4PO9A 3ASZA 1T5IA 3AUXA 4XD7D 1SHZA 3I4LA 3BS4A 3UG6A 1Z06A 2P6UA 2ZSDA 4BFXA 3L43A 5JWOA 5FI0B 3GJ0A 2MSDB 1OHHD 2V7QA 4CIDA 3EPJA 5F9FA 1JNYA 4ZDKA 5GJBA 3FMOB 1OH6A 5TVKA 4I4LA 2GJSA 2ZRMA 3GJ6A 4PZZA 2QE7A 3CRW1 1RW4A 1WMSA 3EIQA 4NH0A 5A0FA 3RLFA 4URVR 5K8LA 3DKVA 2NOAA 3EPKA 3O8DA 5SZKB 2V9PA 3TW8B 4Q66C 1JR6A 2O8EA 1OYYA 4AD8A 2ZSBA 2W6IA 1EFTA 4FMCB 3W8NA 4B75A 3IGFA 2F43B 3RS7A 5BWMA 3BAFA 1YU9A 1AIPA 1W48A 2VP5A 1A5TA 4PC1A 2LKDA 4WVFA 1LF5A 4M2LA 4XVRA 3FYHA 1XJCA 3NXSA 4LBVA 2GK7A 4QKQA 4TT3A 5L8VA 2OZEA 4HB3A 3IUYA 4EPWA 2OSBA 4HYYA 2I3BA 5G40A 2ZXUA 5HZKA 4B6FA 5CIWA 4LBYA 3SHFA 1R5NA 2XNSA 1YKSA 3L0OA 4B48A 1S1CA 4Z1MD 1ZRHA 2OEPA 2Y8EA 2PCLA 1MABA 5JJLA 4HAXA 1W7AA 1G8GA 1KDOA 2HF8A 1GAJA 2GKSA 4ASUD 4BFZA 3SU8A 4EPVA 3A58B 1EWQA 1CR1A 1KI6A 1IONA 4KVGA 3R7WB 2Z43A 4KITB 821PA 3EAQA 4JBYA 4HLUA 3D3QA 2IS2A 4JMPA 2WWFA 3GJ4A 3AVQA 3QQ5A 4B3FX 2FFAA 5JSZA 2FFBA 2QTVB 2ZI4A 3V4RA 4P4UA 2PEYA 4QBFA 3ZS8A 2ZS7A 2CK3D 3C4JA 4D0NA 5DNYB 2PX0A 4ZI3A 3A36A 2JJ2A 3X1ZA 5AJWA 4W5WA 2WIAA 1N6OA 5FL7D 5CK4A 1P2SA 1GM5A 4WBSA 1QHGA 2ORIA 1CIPA 4A36A 3M0EA 2EFDB 3NEYA 4CT4B 2GEDA 5HKKD 1ZUIA 4K81B 1WXQA 1ZC3A 3IKJA 4NL4H 3FKSA 3NWJA 1NVVQ 4FMDF 4HATA 2LWIA 2ONKA 3PUYA 1NG9A 1DG1G 4A8JC 2CCKA 2AK2A 2V55B 4C0SA 1ZIOA 4Z8XA 4TMKA 4XSGA 1ZUNB 5CYPA 3D6TB 5EJEA 3ZIAD 3GJ3A 5JRZA 4L9SA 4LHWA 2CHVA 5JI3E 2AXNA 4OI0A 3MCAA 5TARA 4EQ6A 1G3MA 3GP8A 1OSNA 4PPGA 5AK0A 1XD2B 2FF7A 3A1SA 4UNRA 1Z2AA 2D7CA 1WCV1 2HEIA 1W4CA 2QRNA 4LBWA 421PA 3EPLA 4DBLC 4L5BA 1XBTA 2X8AA 3U3OA 3WY9A 1OKKD 4ERNA 2J45A 2N46A 2FPLA 2RGGA 2UKDA 5DIFA 1NBMA 4BFWA 1AZSC 1NSFA 1Z0IA 1T5LA 1MOZA 3GLFB 4KFRA 2UVQA 3K0AA 3RS5A 3GLIE 2Q6TA 1E9AA 2V7QD 1SKQA 1Z6AA 4DLYA 4A92A 1Z08A 4JVMA 2WTUA 1XB2A 1E0JA 1XNJA 4Q02A 1R4AA 4B2PA 4DJTA 3FMFA 2QE7D 4IJMA 1TMKA 3PUWA 1X8LA 5KSPA 4HZUA 1OH8A 4D4MA 3Q5EA 1E2QA 2NO0A 5JEDA 2F1RA 3H86A 2PLFA 5JECA 1DARA 1KJZA 3K0FB 4Q4HB 3NBYC 4BASA 1T3LA 5JS7A 2BDTA 2B8TA 1U81A 2BJVA 4RVCA 4TMTA 4HI0E 5FTJA 1Z6YA 4QHSA 3AQ4A 4TT3D 1UDXA 5EP3A 3LH5A 3T15A 1NVWQ 2GZAA 4NBSA 3A8TA 3QBTA 4NDZA 5BYJA 3AVPA 4OJQA 3TW4A 3TBKA 3TUZC 2VEDA 4Q21A 3ZZ0A 3KQKA 1QG4A 4L16A 2JLVA 1UF9A 2JLRA 2YHSA 2FDCA 1Q44A 4LV5B 4IEEA 1X1SA 3EA0A 3PUXA 4TL8A 4YDSA 3U61B 4WW0A 1Z0KA 4WIAA 4PZLA 1P9RA 1NN3A 4AG6A 2IS6A 5JHHB 1F48A 4QXAA 1HTWA 4B3DA 2IYYA 4DXAA 4D4JA 1SQ5A 4LJYA 5HPYB 3K9LA 4TYYA 2F1IA 1Z22A 4YQFA 4P0TA 3HJNA 3MUFA 5J4LA 1OH5A 5C4MA 4A0FA 1G18A 1N5KA 4AKEA 1TX4B 3HWSA 1TPZA 2ZR7A 2JJ2D 4Q1BA 2E1RA 3SNHA 5KYKA 3THOA 2BKEA 1VYTA 5KSZA 4Z51A 1VDZA 3F5FA 2VLIA 1W46A 1BYUA 1XEWY 2NG1A 3NH6A 4MQBA 4TLEA 3GMTA 2HV8A 1VMAA 4EJSC 2VHQA 3VNUA 4BUJA 3AF4A 4LJ5A 1XCPA 3SYLA 3SFZA 1GRNA 2D06A 1I4DD 3EC2A 2YWFA 1HQYE 2GA8A 4AYWA 2KJQA 4HAUA 1AS3A 1X1RA 4KV9A 3TSOA 2FPKA 2OESA 2OBMA 3QE0A 4L15A 3W3ZB 2WKRA 2HXSA 4AKGA 4N0DA 1OXSC 3NC1C 3GFPA 4E5UA 3LLMA 4AY2A 1BH2A 4DIEA 1UAAA 2ZI9A 4KODA 5DISB 3NBXX 4MGYR 2R2AA 2JATA 2RHDA 1HE8B 4Y0VA 3TQFA 2IHBA 3B6EA 2YNMA 2WV9A 4JLKA 1PUIA 3ZQ6A 4LYJA 1E9DA 3LBIA 2XOKA 3U3KA 4LC1A 4DEXA 4OHWA 3I73A 3PEUA 3DOFA 4ESVA 2YINC 2VHTA 4NYMQ 5JI2E 4HDQB 2G1KA 3P4YA 6Q21A 4JL5A 1WDTA 5EE1A 5DI9A 4CRWB 4HB0A 5F3WB 1OJLA 1DADA 3ZD7A 3CH4B 5TY0A 1VPLA 1M7GA 4NYJR 1ZNZA 1K5DA 3QY0A 2H1LA 5EQTA 2VPPA 1AS0A 1GFIA 2XSZD 3OFNA 3KB1A 4FCTA 4G5QA 1SVLA 4X8OA 4DSOA 3QBVA 5L3RA 2ZEJA 1E94E 1GSIA 2H8KA 1VG8A 4FXPA 3AVWA 1NF3A 4DCNA 1RRPA 2C04A 2BMDA 4C0QC 4CDGA 1YQTA 4N1AA 2ZE7A 4TTQA 3R8FA 2WWIA 3CRMA 3GLHA 4M9XA 1H8EA 4TQ9A 1WBDA 4TMVA 4NE2A 3NVAA 3P27A 1LB1B 2VH5R 3W6OA 2J59A 2XZLA 3Q85A 4QGHA 1GKIA 3B82A 4ZKEA 4EFMA 5FOXA 1CR2A 4F4CA 4EJSB 2XXAA 3KTAB 1AKYA 4YMSA 1TEXA 3BJIC 5JLJA 4JZKA 4XVQA 3F8TA 2RGDA 4YC7A 3QENA 3PCRB 1E9EA 5DE3A 1TQ6A 5DI3B 1US8B 1BMFA 2QA5A 5HCIA 4M1SA 4G01B 4TL9A 3U3JA 2BJWA 1I4LD 2BVNA 2ZU6A 3SZRA 2VO1A 3VNVA 3BRWD 4AG5A 1LFDB 2AKAB 1Z6GA 1XTSA 4KVAA 4O2LA 2WSMA 4OQNA 1GL9B 1DOAA 3VU9A 2NMVA 2D7DA 3EXAA 2MSCB 1E9SA 2IUSA 1NMYA 5GJVC 5EP4A 1FQKA 2KSQA 4LRWA 3PFIA 1ODFA 5FUWA 4P4TA 4Q4JA 4E09A 3WMFA 2QM7A 3OEEA 3OESA 1UBEA 1W4RA 3U6BA 2PT5A 3GCGA 2GVZC 1C9KA 2WKQA 2X2EA 2NPFA 2J41A 4B74A 3TVTA 2Z4RA 3RABA 1D6JA 4DLRA 3T1OA 1CJKC 2V1XA 1L8QA 2VP9A 4L8GA 2OILA 4O0MA 4OQMA 1ZBDA 1D8TA 4OK6A 3T12A 1S3SA 1GKYA 3RNLA 1KHTA 5B30A 3TR0A 5A4JA 1IN5A 3AP3A 4DVGA 2NO1A 3T35A 4RFSA 4M9ZA 4F93B 2F9MA 2YYZA 3CX7A 3SJAA 1OXUA 4NCHA 4BLQA 5KSYA 4IXMA 2WBLC 1UM8A 2O5VA 3OEHA 3SDZA 1CR4A 1E96A 3WMEA 1HQCA 1AK2A 5FBVB 2ZRNA 5DLQC 1LS6A 4AK9A 1G4UR 5D3QA 1J8YF 4FI3C 1UKVY 3ZYCA 2O8DA 2DFLA 1AS2A 1EXMA 2NZ8A 1R8QA 3S1AB 1OB5A 1JR3E 1P9NA 5IT5A 4JYCA 3KKOA 2ZI3A 2IYQA 5E3HA 2XTNA 2WJYA 2NQ2C 2RGCA 4M9QA 2O0KA 3AGPA 1KK1A 3C41J 1QHXA 4NZYA 1Q0UA 1A82A 4LHVA 3OFND 5UKDA 4TL7A 5K8UA 4TLBA 3A37A 2JIZD 4UKDA 4US2R 4JVNA 3PUVA 3F3YA 4Q9KA 4LWZA 4KFUA 4M21A 2ATXA 2JJ1D 1T8TA 2A3RA 5GJCA 2ZYVX 2VQSA 4DDVA 4D25A 4P32A 2A2ZA 4B2IA 1LF0A 2AFIE 3DPUA 2CBZA 4BLPA 1SVMA 1H8ED 4R71A 2YWHA 1RPZA 4DB2A 4CZ2A 3EIEA 2O8BB 1QVRA 1QZXA 2GDJA 1GRQA 2BM1A 3AB3A 1E3MA 1VKJA 5KDLA 3NBFA 2KB0A 2G0TA 2WM9B 4GMXA 2ZUCA 1I2MA 4G3XA 4LI0A 4DLTA 5HE8A 3ZQJA 4ON9A 3KJIA 1CLUA 2GJAA 4MRRA 1TNDA 1P75A 2CL6X 1VYUA 1F2UA 4OJKA 4Q48A 2PMDA 1G3QA 2OAQ1 3IEUA 1W0KA 2O52A 3AF1A 3LW7A 2V3CC 1XXHE 3VR3A 4ZIRB 2Q21A 2FJUA 3SQWA 1KI9A 1XU4A 1QG2A 2A5YB 1CS4C 4C0BA 3PXGA 3L0IB 1TF2A 3P26A 3U60B 1RYFA 2NO6A 3A4NA 1QHIA 5G53C 3PEWA 2C9OA 4DWJA 4WAUA 4QNMA 2AXPA 1YVDA 2ZR9A 4R2IA 4CF7A 2IT1A 4IDHA 3TNFA 5P21A 2CVFA 4RKFA 4ZI2A 4QHTA 4V0ME 4NCKA 2O8FB 2P6NA 3Q7PA 3KQLA 2VP4A 4LHZA 4IHQA 3OEED 1R0ZA 1HUQA 4I1SA 1GL6A 3CR7A 1XXHB 3ETLA 4V0LA 2GXAA 4JVSB 1E69A 4OK5A 1FTNA 2GVDC 5FFMA 3THXB 3CZQA 3QVUA 1N25A 4O2RA 4RJLA 5EUQB 3UWOA 4TZ6A 1HEIA 4NYIR 1U8YA 1VCIA 1DPFA 1G7SA 2FZLA 4LJ6A 3BFKA 1N0UA 5CITA 3TMKA 5KNCA 2WMNB 4OI4A 3X1YA 4G0NA 5LD2C 4DRZA 1F2TA 1G19A 1NG1A 2WWHA 3AVXA 4QM6A 3R9WA 3V00A 1E79A 3W9YA 5F9HA 1JAIA 4DDUA 4JLNA 1YZUA 4IFBA 1Z28A 2RGEA 1XCGB 5E95A 2VBCA 2WAYA 3OEHD 1N6KA 3SEAA 5FTNA 1OHHA 3Q7QA 3L8YA 4DLSA 1IY2A 1N0WA 2XB2A 2IXFA 4OQLA 2J0UB 2EYUA 3N2IA 2G9NA 1XZPA 3N5CA 3PUZA 4B71A 3KJGA 5L3QB 4TQUS 4DCUA 5FTMA 2EYQA 4P4SB 1WF3A 3K0EA 1FP7A 1ESNA 4LCBA 1E0KA 1T8UA 3L0SA 4LC0A 5CDFA 3WYFA 1KK0A 3ZZUA 1G8FA 3REGA 3K70B 5H1YA 4RCZA 3IO5A 4OHYA 4QGAA 1SVSA 4EPTA 4AURA 2FA9A 1E4YA 2Z0MA 3I72A 1JI0A 2IWHA 3VR4A 4YMTA 1DG3A 1G6HA 2MSEB 4PO8A 5FR2A 1LW7A 2JGNA 3OHMA 1SXJE 4EUNA 3PITA 1KI3A 2A5GA 1T6NA 2PZEA 5KDOA 1QHNA 3BH6A 3RYTC 3P4XA 3QSYA 4YMWA 3CW2A 1K5GA 1KO5A 3FTQA 1C1YA 3EZ2A 4IDQA 1OXVA 1N6LA 3PEVA 1P9WA 4LJ8A 2ZS8A 4LYAA 1Z0AA 2AHOA 1DAGA 3LFUA 4RZ3A 1LVGA 1O3YA 4Q7MB 2IYVA 2C96A 3KFXA 3CM0A 4DHEA 2IL1A 3B13B 5C2JB 4A4DA 4MKIA 2VP0A 3KKQA 5JCZA 4Z8YA 2ZRFA 3IHWA 3M6AA 1UDWA 1FPMA 3H0KA 2FSFA 1F5NA 1GNRA 4EJSA 3AVUA 4DB4A 4DSNA 3VMFA 1TUIA 4KYUA 1SVWA 1OB2A 2CK3A 3RS4A 4XIGS 1T9HA 1OXTA 2AKYA 3IBYA 4FINA 4OYHA 1NVVR 1W2HA 3P1JA 4URWR 2XJ9A 5G41A 2D2FA 3RC3A 1CJUC 1HY3A 5FL7A 3C15C 4CEJB 2H18A 3KQHA 3PVSA 1E2DA 2XJ4A 2IYUA 3NDPA 1W36B 4IDOA 4JLJA 2FU5C 3T1TA 1DAEA 2ODNA 3QXHA 1T91A 2CLDX 2QROA 1G64A 3KXKA 5EXTA 1RRFA 1TEVA 5JCPA 4B43A 3AVOA 5FOSA 3ZZTA 2J9RA 5DN6A 1S9HA 3TAUA 1M7HA 4HLDA 1ZM3A 2GBLA 3GLIA 3TUJC 2WPDA 2P5SA 4BE7B 3H4MA 4ZCMA 3CUEF 3MLEA 3GFOA 1Z47A 4B44A 1OE0A 2ZJ2A 3KZ1E 5CLLA 5DH9A 4CEHB 2QZ4A 3NG1A 4FW9A 5KU1A 3ZVLA 3ADKA 3GLGE 2FEOA 3ND9A 3OF5A 1II0A 2I1VB 1IXZA 1UKYA 1XEFA 4ZKDA 5AUOB 1JB1A 3O8RA 3KUCA 5FUXA 3B85A 2ZITA 3SE0A 2IBMA 2Q9BA 3ND8A 1VCOA 1E79D 4Q00A 4WZBE 1G17A 4MYUA 4OHXA 2ERXA 2J0SA 4ZDIA 5FPKA 2EU8A 2WSSD 3PV0A 1NLFA 2A78A 1M2OB 3M1IA 5TB5A 2HLDD 3AF0A 3ZS9A 2W58A 2BC9A 1R0YA 2PBRA 3KKNA 4HLCA 4ARZB 2A5DA 3GLGB 4BZPA 2C8VA 1ZJ6A 2RAPA 3QOFA 2VHUA 2VYFA 2O0HA 2OFXA 2CJWA 3D8BA 3L2OB 4XOIA 4C0AC 3UATA 2QMEA 2ORWA 3AVYA 4B2LA 4AYTA 4JSTA 1XTRA 3I8XA 5DGXA 2QSZA 3IDQA 2RGBA 2VHJA 5BN3A 3W6PA 4X8HA 2NGRA 1YZQA 3TSWA 2ZAMA 2GJ8A 4W7SA 1DE0A 2ZJOA 3MFYA 2AD5A 1X86B 2XB4A 2GEUA 3FFBA 1U0HC 1P3JA 2FX3A 3HYTA 721PA 3LQQA 3KQUA 1JXOA 2YC4C 3GD7A 1VG0B 3U44A 1HE1C 1R0XA 2PL3A 1NN5A 1P72A 4GSYA 5JJKA 2ZSEA 1RRGA 1XMJA 4D4KA 4KSBA 3UXMA 3ZGXA 1OW3B 4PHFA 2ODWA 4BZQA 4CYMA 2P67A 2HT1A 4IRUB 4MGKR 4U5XA 5LB2A 2PT7A 1PZNA 3EWAA 3NHBA 4WZ6A 4EFNA 4R7ZA 4XWAA 2BCJQ 3THYA 1IN7A 1EFRA 2H92A 5D3MB 1XWIA 2CHQA 4QBHA 4NTZA 4HDCA 4P31A 4JLDA 2OLJA 4Q18A 1P4SA 3PIRA 1D2EA 2YWGA 4I81A 1OXXK 2N1BA 4U7DA 1H65A 5A5GA 1E32A 2CDNA 5FOUA 5JWRA 2GILA 1AGPA 4JIMA 4N3NA 1U98A 1H8HA 4AYXA 1D2MA 4IOJA 4Q7KA 1Q3HA 1GTVA 4G1UC 4RZXA 1KO1A 4CGZA 1F60A 3WNCA 1BS1A 3W3AA 5DN6D 1W4BA 1S1MA 1SVOA 3KL4A 3GLFE 4MRPA 4BRUA 3EX7C 2WPDD 4TLAA 3ICQB 2GBLC 3BFVA 4FMDB 4BEBA 1XRJA 5AUNB 2F55A 5L3SB 2ZRBA 3GJ7A 4QNRA 3LVQE 5AR1A 4DDWA 1RJ9A 2ZANA 1BO6A 3ZJYA 4NYMR 3KKPA 3DO6A 2A5FA 4JL6A 1R8SA 1KDPA 2CCGA 4GT1A 3G5UA 2IYWA 1DS6A 2ZS9A 3IBGA 5FPSA 1U94A 2IX3A 1Z6TA 4RD4A 621PA 4QG7A 1ZD9A 2CE7A 3UIEA 2JLYA 2FGJA 2ZJ8A 5HZHA 3ADCA 1EK0A 1Q1EA 5C1BA 3DVLA 4B73A 1G3IA 2YZ2A 4EFLA 4HEJA 3THWA 2QP3A 1GUAA 4C7OB 2RMKA 5IRCD 1DAIA 2N42A 3HU3A 2WOOA 1Z8FA 5CB8A 3WRYC 2XSZA 3AH8A 4LYHA 3T1QA 3C5CA 1T0HB 3I8SA 3SFVA 2WJJA 2IWRA 2W6JD 1MRSA 2GXSA 3B9PA 4DCVA 3N2EA 3CPJB 3B8HA 4Q9LA 1XPOA 2C9YA 2IS4A 2DYKA 2J1LA 3CNNA 4PAMA 2QPOA 3HU1A 3MD0A 2QN6A 4DUGA 2CE2X 4Q4AB 3CF6R 1N6HA 4POAA 4PXAA 2QP9X 5HE9A 1N3BA 5TXGA 5DYIA 4A1FA 1AJEA 4TYQA 4XTCS 1COWD 1KMQA 1VYVA 2PZGA 3B1YA 2YV5A 3WXMA 1JQJC 3ADDA 2QMUA 1XEXA 2QPTA 4QJ5A 3BORA 4M1TA 2DY1A 4RFVA 4A8JB 2ZRKA 2P2LA 1II9A 2QAGA 1FTSA 1KOFA 2ZRIA 4A9AA 2W0SA 1MT0A 2CL7X 1CTQA 1RZ3A 1HV8A 1KJWA 2W0MA 1EESA 1G6OA 3EC1A 4PTLA 4Q7JB 1MR3F 4RCYA 4TLDA 5CYOA 4BEJA 1CRPA 2H5EA 3X2SA 3U7HB 1N6IA 3CO5A 4EDHA 1G8HA 5B2ZA 4MRVA 4RD6A 4AI6A 3Q5DA 1PVOA 4US1R 4URYR 3R9XA 4WXPA 2KWIA 3TVDA 3BOSA 4HLUC 2WJHA 2PEZA 4HUQA 4HAYA 1EFRD 3CONA 3IIJA 5DSZA 1WB9A 1KZGB 4XSHA 1RFLA 1Z07A 4OQXA 4A2PA 1Z0FA 4LJ4A 4I1UA 1S96A 4A0RA 2WWXA 1HYQA 4RZUA 2V4ZA 3GEHA 2UZIR 3PEYA 4QM7A 2XX3A 2IYRA 2J0QA 3A6PC 3MSXA 4KSCA 1EFUA 1MO5A 3OAAA 3DM9B 1KMHA 4KFTA 3SN6A 1IHUA 4OI2A 4NCNA 1H8HD 1VIYA 2YC2C 3QKSA 1HA3A 2FN4A 1JR3A 1Z0JA 3M4YA 1W0JA 1E2FA 2IYLD 2ZVQX 3T06B 4QJ4A 1G4AE 4ACAA 1ZC4A 2F3TA 5EP1A 5GADl 4Q1AA 1IBRA 4NU0A 3EIHA 2R9VA 1IN6A 4F91B 5LBIA 3G82C 1R0WA 4KO8A 2KBEA 5GVSA 3MJRA 4M1YA 5AJXA 3PENA 1ZCBA 3CH5A 1QHYA 1CJVC 2Z5FA 3MAAC 1ZW6A 1YE8A 1M34E 3A4LA 3QF4A 1YZKA 3BC1A 4D81A 3UKDA 1U2RA 1GOTA 3FVQA 3MJHA 1KAGA 3U4QA 3RRZA 1MABB 3AP1A 5JEEA 2RCNA 1J7KA 2WWYA 3ZLJA 3KX2A 1E2KA 1KI6B 4JT2A 1P2UA 2ZRLA 4DDTA 1DAHA 2JIZA 3C16C 4BLTA 4QBGB 4M53A 2Z6VA 3I1FA 3W34A 4LK2A 2QSYA 1E99A 2JJ1A 5JSZB 3UPUA 1CXZA 1RKBA 5CLQA 3A1VA 4B3XA 4NMMA 2IF0A 2OBNA 3RHFA 4DUGD 1QBKC 1O87A 3ONWA 2GESA 1E2IA 1CBUA 2QBYA 3OIWA 2CVHA 1ZM4A 4YONB 2ZJBA 3ZVMA 4MKHA 4D4LA 3C5HA 3CNLA 3LAWA 1YR9A 2JA1A 4A0GA 2BV3A 4CEIA 2PJRA 4GRAA 1N2CE 1KSHA 5J4VA 1TQ2A 1ESMA 4NCIA 3LWNA 1NBME 2DPXA 3R9IA 3ZH9B 2QAGC 1UBGA 3VHLB 3DKPA 3EZFA 2G6BA 4XH9B 2O8CA 3I32A 4WA7A 3G0HA 1E2PA 2IYZA 1QHHA 5J4KA 1ZU5A 3NC0C 1E4VA 2ZRAA 3CKLA 3GEEA 4EQ6B 5BN4A 1AGRA 5EUMA 4UNQA 2ZRJA 3EPHA 3Q72A 3HR8A 3LVRE 2DWOA
chains in the Genus database with same CATH superfamily
5DIZA 3DFMA 13PKA 3H4TA 3AESA 4YJGB 3QH4A 5JAUA 1E4EB 4YAGA 1E4OA 2YFYA 5HYVA 4U3JB 5A3JA 3DWEX 1TADA 4EFDA 3LZ6A 1MX5A 4M36A 4OGFA 4MDYA 1EFVA 3BREA 3BXPA 3K0AB 4R9UC 4BFLA 1E2GA 1URPA 1VE3A 1OF1A 4D6PA 4E32A 2W42A 2ZVPX 2JI6A 4LV6A 1MIOA 1AG9A 4H7DA 1BGXT 3RDPA 2G5TA 2H65A 2PSEA 2QJOA 2XAAA 4Q3NA 1TGYA 5AHOA 1K0FA 5REQA 2XE4A 1R6BX 1YL7A 3GGOA 2XNKA 2V7GA 1DXOA 3IVAA 2RH8A 3QG5A 4FHDA 4PRKA 5I9LA 1JR3D 1C3EA 3DDNA 2PUVA 3KSZO 3IUBA 3PFCA 4H4EA 4MXDA 2OZKA 4DBZA 2WJIA 3QU2A 4A0HA 4HZUB 1AGNA 1GCOA 1MDBA 1NHGA 2BFDB 3FF1A 2JEZA 3GT0A 4K8OA 4M1OA 1TDJA 2QNBA 4DMKA 5BP7A 2JKYA 4HH4A 4BX8A 3VNRA 3TFQA 3CRVA 4ZCLA 1L6RA 1EFHA 4C7XA 4I08A 3LQ1A 1Y3FE 5AFSA 3NORA 5E4FA 2XCLA 2C59A 3AC0A 3KPVA 2XE6A 3V7NA 3Q9NA 3TZKA 3IHKA 3FYDA 2PVSA 5AJZA 4B87A 2ZAOA 1JX6A 2C8KA 3FNGA 4GU5A 2OO5C 3FWPA 1A95A 1WIWA 1L1EA 2EFEB 1M6VA 2FPGB 1QJ4A 3PXBA 1J99A 3AHDA 4I50B 4OAPA 1JVBA 4BXOB 5FPTA 4GKVA 2JI4A 3VA7A 3G8CA 2A67A 2RKOA 4BQPA 4C03A 2WHQA 3I9V1 2E49A 1X15A 2R8ZA 4MV4A 4Q3DA 3RADC 1B0UA 3V4FA 3SHTA 1WP4A 2AMJA 4DYHA 1F5SA 2HOQA 3DZCA 4C01A 2WDZA 2JFYA 4DCPA 2QQEA 2E4XA 2H4JA 1U0JA 2SKCA 3I1JA 4OXQA 5DHFA 5THQA 4DCTA 2QTFA 3G2MA 1IUKA 2W9XA 3G8DA 3JQGB 4G81A 4NQZA 3TQCA 2REBA 1DC6A 1L4UA 2EWVA 3E22B 4HDNB 4P98A 2RHHA 1HOTA 2BM9A 5FPHA 3KUKA 4GLLA 1GR1A 1GILA 1IDN1 5TMPA 3LRPA 3PEEA 4FM9A 3GP3A 2O1WA 2Q41A 2O9JA 2PWBA 5CB0A 3JQ8B 4R6XA 3DLTA 4AICA 1D1TA 3CLVA 3KJNA 2HPAA 2EZ9A 5DJ5A 1J90A 1GDDA 2ZJ3A 3DZ8A 2CMKA 3OBBA 3WKDA 5BNTA 4KIWA 4AS2A 3X1DA 1OH7A 4MDEA 4EVRA 5ELXA 1JPNA 5H5JA 1G8SA 3Q88A 1U8ZA 1VFPA 9LDBA 1DJPA 2PKWA 1FBNA 4YDHB 1T4MA 3B1FA 2E4ZA 1KEZA 1MVOA 1NJ5A 2XNHA 4IDNA 4WRRA 1AXRA 1SBZA 5J40A 3VTKA 3GZNB 1AMOA 1EFDN 2FYTA 1H2HA 4ZANA 1UXHA 2X19A 4GYKA 3D4NA 1DVRA 1SWVA 1UAGA 1WXXA 2HY7A 1MD9A 2BIFA 2J5RA 2QT1A 3L0CA 1ABFA 5DYNA 4R51A 5IBQA 5C18A 5HQ3B 2ONJA 1VBMA 4B35A 5CA1A 4H1VA 2FQ1A 2R79A 3NFRA 1YA6A 1Y8AA 4EHFA 1V1RB 5D6NA 3WTCA 4MGZR 1UMCA 5K8TA 1GT6A 1O96B 1UEJA 1KEUA 2VPXA 4CL8A 1H93A 2EKDA 2HO5A 4HXEB 5JC1A 1LGYA 4PZCA 2C9DA 3RWMB 4OHKA 3F2VA 2EERA 3LL7A 3TRFA 1PU2A 4M37A 4GMDA 4CN9A 1Z34A 4K9QA 1LCIA 2Z2YA 2ETVA 4PXYA 4N8EA 3L8CA 2PJDA 3HP1A 1MB0A 3NONA 4WHMA 3RT7A 5J4YA 4TRRA 4CM4B 1P61B 2V7XA 2EWMA 2ZT8A 3LQ4A 4B3BA 1KMIY 3FSRA 2YVAA 1KBQA 2TECE 3RC8A 1NJ8A 2PN1A 2PYZA 2WHXA 3CRRA 3SVTA 1EP1B 2FSHA 3FVWA 4E70A 2NUPA 4GO1A 2C54A 3UV7A 2Z2KA 4DMLA 1B14A 3WP1B 1Y6GA 3BIFA 3LX4A 1DEKA 4UUAA 2AQKA 1J0CA 4XR4A 4U1RA 1KVRA 3CX4A 4OAQA 4N48A 1GG8A 2JGDA 4ZOQI 3UHOA 3U0BA 1FDSA 1VRWA 2O6LA 3AHJA 3N2YA 4GNKA 2Q4BA 4QQKA 3MIIA 2VQ6A 2IUUA 2OCAA 2WZCA 4ZO7A 3RS2A 4E31A 3FDIA 4GP7A 2JCXA 5DTEA 3ZNNA 3NRBA 2HKIA 3B5JA 4NCJA 3Q8WA 4DC9A 2NUTA 2V5VA 1CIVA 4V0OA 4QQNA 1LWOA 2C9CA 1E9RA 2XI4A 3BIWA 4HLQB 4G1EB 4LUCA 4YBRA 3S1SA 1CQPA 1VJGA 1RWNA 2OAGA 4UXIA 1B4DA 3MYYA 3UAWA 1SUSA 4D6YA 4PFSA 1XD8A 4GP6A 5HOEA 2I4IA 1QGED 3RS0A 5LZ4A 2H31A 3L6UA 4MVJI 1J8MF 4AFNA 4KK4A 4YUYA 4HYQA 2O05A 3E15A 3BB4A 2J67A 4YI3A 1U1CA 3TK1A 2G1JA 1T6ZA 1B1CA 1JHVA 5AICA 3G2LA 1XVVA 5LDGA 4C89A 4OTZA 3W4JA 3EMKA 5KKCA 2VRWA 2CLKB 3OFKA 2QLFA 2YTZA 4PZPA 4R41A 3ROQA 3BMOB 2AE2A 2ZYRA 1RZUA 2GAFA 3ANMA 3D8UA 2E85A 4L07A 5B4VA 1CF4A 4FYYA 3VU9B 4D8WA 4P8RA 2OCDA 3N2ZB 4YJ3A 1E5XA 1G9XA 1PGQA 2AUMA 1IOZA 3JV7A 3JX9A 4R54A 4KVFA 4YRFA 5AWFC 4KQXA 3ZV4A 3WL7A 1FYXA 2YJGA 2X5KO 1B8VA 2ZQ5A 5JADA 1W1WA 5KNBD 3RC9A 3CS3A 4N5LA 2G9RA 2HRRA 3DVQX 3UV6A 1LRJA 4TTAA 1B43A 3X1MA 2FG6C 4WMLA 1C3VA 2IHNA 1XD2A 3H5TA 3ZHZA 5I5GA 3DA8A 1XZNA 5FA6A 2R66A 1VKZA 2HWKA 2O2JA 2ZWIA 4KYTA 3SOPA 1CD5A 4NABA 1VJ5A 2HRCA 1L5SA 1HE3A 1B1AA 1ZL0A 2CXHA 1W85B 4AG3A 5LD2B 3RODA 4EG6A 2Z5VA 1GPUA 3H1GA 4MI1A 3RQIA 3DVAB 3TL3A 1I0IA 2R6FA 1GA4A 1JN0A 2CUNA 3GLFA 2PQMA 2CYCA 2XTZA 3OU7A 1EG2A 5I7FA 4IGEA 4A6EA 3C8UA 4XGKA 2OB1A 2QX6A 5K3BA 1F8XA 2H1VA 4MWCA 3REQB 3SGLA 4ZRNA 3D6VA 4E88A 3CBQA 2R8BA 3F71A 4M1WA 1ODIA 2BFFA 2X4DA 2HIAA 3BXZA 3C3EA 4KU4A 2M6KA 3VTFA 1KZ7B 2AZXA 4FKZA 1PT8A 3M3DA 5LXTA 1LY1A 1RQLA 2Y68A 4IVRA 4DSZA 3LT1A 4E4RA 1VP3A 2O8DB 1PWHA 1RE1A 2BFEB 3D8NA 5ELMA 4BOYA 1C1XB 2JLSA 5JNLA 1UBLS 1I7DA 4KUHA 4B6EA 2XMCA 2X0NA 3AFHA 3EIUA 2H7XA 3OQIB 4L3VA 1K6IA 3A1UA 4Q03A 3T34A 3Q1LA 5DX8A 3SJCA 1E64A 1TCBA 3QPAA 4GZMA 2W2KA 1LDNA 1LLQA 1GGHA 3ASYA 4CKEA 3Q3VA 4J1TA 4MPTA 3IO3A 2AZ4A 1AO3A 2P3OA 1EKXA 5DASA 1U0RA 1HDYA 2J5BA 1S0UA 4WKBA 5J5CA 3ITNA 4FFWA 5EXEA 5KUTA 2XKKA 5IM4A 4NBNA 5SY4A 1JU3A 1PV4A 5BW5A 1R12A 1W25A 1QGOA 2WWGA 5DRTA 1K0UA 1YBVA 1W59A 1NYRA 4D8VA 2V1UA 2PYDA 2K5UA 3WIBA 1PCXA 3GGDA 3GIWA 2IS2A 2QXYA 2G82A 1P1IA 4D8XA 5IN4A 5D8DA 1P80A 2Q4OA 2AN1A 2PGJA 3KKEA 3NM5A 4N54A 2Q9AA 1NQXA 1RPNA 1VQ1A 2QF7A 1WETA 1KEEB 4IZ6A 2QXUA 4DMCA 1I33A 4DYDA 5IT9A 5A4MS 3L6RA 3GJYA 4JH0A 3LWBA 3WGQA 3KWLA 3IQXA 3PJEA 4K26A 4AY3A 3N8NA 1D0SA 5JDCC 2R6CA 3ICPA 5K3SA 1M66A 1NPYA 1U99A 4RUKA 1IZ0A 1YCFA 3DDCA 1XTQA 3MMSA 2ZREA 4HH0A 2IVZA 2ZB3A 1FL9A 5HK8A 3SZ3A 3T5CA 2G1UA 3T95A 5J47A 3VC3A 2W2LD 3EQ9A 1EVJA 1XJQA 2EHJA 2PGLA 1A9TA 4DILA 2W6JA 3ABOB 1SBHA 8OHMA 1PL0A 5JARA 1DFHA 1NUPA 3W5IA 1QP8A 2H16A 1RSZA 3IAAA 4ZTZB 5BNFA 2WU3A 5KPDA 1F2UB 2AWNA 2J7PD 4OV6B 4ABYA 2IU4A 3I53A 2FFHA 4J90A 3AR3A 5J9FA 1C30A 2IP4A 1YIOA 2AL7A 4FMCF 1M1YE 2R11A 4X61A 1COWA 1N0VC 4M55A 5BSFA 4LPSA 2BAGA 3UK1A 3PNSA 1J20A 4GPZA 4KKXB 4FBGA 4MR7B 2D2EA 2QG6A 2BOVA 3KKKA 4G67A 1LBTA 3UHAA 2XGSA 3DXXA 1QO0D 3ZK7A 2RH4A 1ZR2A 1CNFA 2ZRCA 3MBOA 4EYGA 1PGOA 4RPJA 4MP8A 3ZWBA 4DSAA 1GADO 3KSAC 4U8HA 2I78A 2D2XA 3C7KA 1WZ2A 1BHSA 4YFVA 6AT1A 3M6VA 4RY2A 1U2DA 3G23A 1YK0A 1DX6A 1NW9B 2RFLA 2GJ9A 2J5XA 5BO5A 2D74A 2IZ0A 2X8WA 3B60A 3LY7A 3ZXIA 3TSZA 5JZOA 1IUPA 1HRDA 3P45A 4YAUA 4UUOA 2DUNA 3KKZA 2O2DA 1YHYA 4NMXB 1W5TA 1WOYA 1A2KC 4F96A 4Z4EA 1SVKA 2FB9A 4ALLA 2SECE 3JYOA 1PFGA 3MWYW 4OOEA 2P3SA 2W8BB 2FZ4A 3JPWA 4R1QA 5IUKC 4EG4A 2F1JA 3C6ZA 4KWEA 2DQSA 4RULA 2WKPA 4XSVA 4W5RA 2ZT6A 4W8OA 2J32A 2OXFA 4U9UA 5AJYA 3AVVA 2BPOA 1X7ZA 3FI9A 3TLXA 3ZWCA 2G88A 1ZRMA 2C31A 3BYZA 4H1UA 3L1IA 4MUMA 4KLZA 4QUDA 1N2JA 1L4KA 1JFVA 4XJXA 5IK2A 4GYWA 1T8YA 2ZUTA 1NVGA 4HAOA 2V9CA 4WOPA 1C1DB 4IDEA 1V1JA 1H2RS 3OIGA 3LW8A 3OX3A 4MWSA 3W6UA 1FTGA 1SBIA 2PL9A 3PC7A 3UK7A 3GEDA 4B3CA 2XH8A 4MYTA 3L82B 1FVHA 4P33A 4ECAA 1V3UA 2BUBA 4V1CB 1E3TA 1E1RA 4BMDA 3F6RA 3VU8A 3E9NA 2PQ0A 3WGGA 4LHYA 2D8MA 4J0QA 1H3FA 3A70A 3WHKA 2R0QC 4ZT5A 3FRIA 5TR9A 1H9BA 2O8VA 5A5EA 3SC6A 1G21E 1OA0A 2DCMA 2ZJ4A 1OYWA 1MUUA 4E08A 4TROA 3ND6A 1Q95A 2PNJA 3R8CA 5C8ZA 4OQEA 2XCSB 2OZPA 2ZRGA 1BX0A 2VJMB 2WT4A 2FSUA 1KMMA 4GQBA 5BVHA 1N32B 4FD2A 3H9BA 4R1OA 1Z5NA 2DMRA 3CV3A 3LO5A 4YLGA 5JS6A 2X0EA 2OORC 1R5OA 4L50A 4MDHA 3REFA 1TAGA 4KXQA 4NJOA 1Z83A 5EJMA 1FP4A 3RUFA 1LS1A 2YIVX 5EMMA 4JAVC 4AY6A 1GQ2A 3FUWA 4P2GA 3B7WA 4FE7A 1G21B 2ADMA 1L4YA 1O95C 1GP2A 3A2LA 3HDYA 4UU0A 1JWAB 1JAHA 2C07A 3KV1A 2GZSA 4U00A 4I1PA 4PZ0A 5FWXB 3H11A 2R97A 2GF9A 3JYQA 3QPWA 4AIRA 4PHTA 2IEBA 3MB8A 1PGPA 1NN0A 1X0XA 4XLZA 1TA9A 2HA4A 4WKPA 1WW3A 5KJFA 2ZSAA 2QEQA 1FNNA 3GVXA 3I2GA 1CQXA 3E2IA 3OU2A 3RVBA 4TTPA 4CU5A 2HWYA 2XE7A 4ZU3A 5FCDA 5FOQA 1IQUA 1XTPA 1TFUA 5BN4B 3TKAA 2VH1A 2DUJA 2ZCUA 4IJQA 3ZXUB 2VDQB 3AUYA 2PZMA 1FSZA 3KDSE 3AJAA 3NQ41 2BEKA 1IIBA 3KPYA 3W7VA 2HA0A 3DMTA 2Y66A 2F1OA 4Q39A 2XDQA 3ENVA 3QI2A 1MFZA 4C4YA 4OKSA 1WSBA 1T3ZA 5D85A 1LDMA 2OCYC 1JAXA 2N0SA 2VZLA 4RJ2A 3RTAA 1SUDA 2JLWA 4H08A 3UUFA 1P0QA 2QTAA 4DLAA 5AJTA 5FR1A 4B7UA 5HILA 2YVUA 3PI7A 1UFQA 4AXXA 4E1VA 1BN6A 4LBZA 1STOA 3HNOA 1SOUA 3OZXA 3IOEA 1QYIA 3CISA 3E5MA 3GEIA 3B1WA 1S4QA 1YQQA 3ANTA 3JSXA 1P7VA 3T94A 3Q8KA 2RGNA 3TSCA 2P90A 1CVIA 1T0IA 4JP2A 3K09C 3OHPA 3L1HA 2OXRA 1JQLB 5EZYB 3AI2A 1C0IA 2VA8A 2WJAA 3KU1A 4OA8A 4QDUA 3I39X 1C9YA 1N5OX 2I6XA 2QRVA 4IIUA 4P4GA 2HDNB 4R98A 1OLUB 3BF7A 3KOUA 1GTRA 1V3QE 3PDCA 4H3HB 1I3CA 4K9NA 4ARUA 3E70C 2R3SA 3RU3A 1EJ0A 2X7HA 3QELB 4X1OA 1RWOA 5CU7A 1F4PA 5DBHX 3IUQA 1NIJA 2P1RA 3BWDD 2RARA 1DC8A 1EWRA 1JYFA 4PX9A 3AW8A 4IPTA 4O4LB 4KGXA 2P2SA 3HKBA 3LK6A 1TO2E 3MERA 4JSYA 2E4AA 4FYJA 4PLPA 1C50A 5NULA 1J21A 3AOEA 3CKYA 1F3OA 1WZIA 4PLWA 4LDNA 4DV3B 2O3QA 2PLRA 3A1NA 3WS7A 121PA 1XPJA 1MTOA 2FUG6 4JCCA 5LP6F 1M2JA 2OBBA 2BHTA 4RDHA 2TS1A 3A2MA 4FFBA 1FNMA 3I6ZA 4RIEA 1TAUA 1S5PA 3MRTA 3RTGA 3WYCA 1D6NA 2CUTA 4LYEA 4NBTA 1G8YA 2PBZA 2HU8A 4RFLA 4CVNA 2Q5FA 3I6QA 4Z7OB 3U4CA 4H7FA 3LHSA 1JDBB 2GAIA 3AYZB 4XYLA 2LRHA 1UKEA 1VRCA 4WNIA 1E7QA 3KP1A 3F6PA 1NJFA 4MRNA 3HBFA 1DCFA 2C92A 4RZ2A 3W8FA 3OLQA 2H06A 1H6DA 4BQSA 1BG6A 4K9OA 5K6AC 1TTHA 2A35A 2AWOA 4N7RA 1ABBA 4GQIA 2AZTA 2GWHA 3HJFA 1YJXA 3MELA 3KJHA 2NU7A 3JVDA 4HBZA 4WPGA 3SKYA 3VYRB 1GPDG 3ZEIA 5CFNA 5C3UA 1CK4A 1O0SA 3E5RA 3LP5A 4WN9B 5AKKA 3H2KA 3VX3A 3AVTA 1NGSA 1THTA 2NTJA 2Y71A 3HDQA 3LPNA 1JECA 5BSTA 4EGAA 1DJQA 1X1TA 5DNWA 4E5DA 2P9TA 3LUCA 4Z6KA 1NUHA 3G0OA 4M7RA 4TM8A 5BYAA 3OIUA 5I4IA 4XGNA 2IXGA 3NB0A 4DKXA 1F1JA 1WUKS 4CWAA 5DBGA 3SK0A 1LPBB 2A9VA 4JUAA 3UM9A 2B21A 4K3UA 3PD0A 1L7RA 2FSVC 4E07A 2DR3A 1HYBA 4H1WA 3BD9A 1NMSA 4ZOLF 3EUWA 5CA0F 3OPNA 1OI7A 4GPTA 1NN1A 3KFVA 1UOOA 3DBRB 5L4NA 4XYBA 3TH5A 2F7SA 3LPMA 4RZSA 4W5QA 3H99A 3QEJA 3SEFA 3BKWA 5DB4A 2V0CA 5BSMA 4A5SA 1PLLA 4Q19A 5BRAA 2BKUA 2ZJYA 4R8SA 2ZM5A 2W5UA 2XIJA 2YH2A 1DIGA 1EE1A 1TD9A 3QHPA 4HKTA 4ND3A 4D3SA 1J2YA 1NVAA 3EXHA 3THXA 1JSCA 4P7KA 4S1PA 1RM3A 2VSXA 3EZ6A 3SMVA 3A1EA 2BEVB 4QOEA 1PFWA 1QCCA 1Y1PA 2CDAA 1BXGB 1ZIDA 2DFNA 3FLBA 5F5NA 3ZCQA 4XXHA 5JFTA 2EJCA 4J07A 1JJVA 4C78A 5EZ5A 1AM4D 2DFTA 2HRQA 1KZ4A 2E18A 2EW1A 2Q3LA 4DRYA 4YO8A 3C4QA 3EY4A 2HYDA 3HKEB 2PD3A 1NT2A 4G9GA 5HS4A 5ALFA 4H6PA 3UMCA 3ZBQA 1XTIA 4I55F 2CB9A 2BFOA 3V4ZA 4E15A 4UQLA 1XEWX 4RV4A 4M83A 3FNQA 4F4FA 3OY7A 3VSEA 1CY7A 1ZMTA 3AL2A 3TPFA 1IFXA 1KS9A 1Q0QA 4EG7A 3KT0A 2C3UA 2I3GA 4R1TA 3B6JA 3SSOA 5HW0A 1V1MA 4U2BA 2VKTA 5IZCC 3G17A 4A6PA 5L3QA 4RK6A 3FNEA 2HV9A 1NBAA 2H3EA 3S70A 4BRZA 1XHFA 3DOCA 4FQ7A 4J1SA 4ZVUA 1IE3A 3K8YA 4JLBA 2WWWA 3A28A 5KYYA 5ICEA 5BSHA 3O7MA 2ZIZA 1ONPA 3OWOA 4N8DA 5E0KB 1J2TA 2EQBA 4DMHA 3A1WA 3DFIA 4S1NA 1DB3A 3QWBA 4FDUA 2ZB8A 3DBHA 3I76A 3P0IA 2WNIA 3I64A 4YJFB 5LZ7A 2JAQA 1G60A 2ZROA 3EG9B 1HLGA 4PHHA 1OWNA 4JASB 4WY5A 2VRBA 3WAGA 4RA6A 1JQBA 3WHLA 3KSRA 3SBOA 2RI6A 3Q40A 3HDHA 1XZQA 1CKEA 3ZWOA 2XNCA 1NPTO 2BCEA 3ME5A 4EMBA 3CUVA 4PQGA 1KA9H 3TAHA 2B35A 4N0MA 5B4TA 4Y6PA 1PDOA 1A1SA 3IVCA 2X9VA 4S2UA 4MQEB 4MK4A 1W581 2ATVA 3FTNA 2V7EA 1TYCA 3M6MD 4LDJA 4RELA 5IVHA 4H15A 1XCMA 3EPPA 5ENVA 1A9SA 2RHMA 4TUYF 5A2GA 3QXJA 3GNQA 2ZJ5A 3IB6A 1JG4A 3E5HA 5C81A 1L5RA 4N65A 5CDHA 1DEHA 1XEXB 1VIAA 3E3OA 1WBBA 3LSTA 3ADBA 4OIMA 5CCXA 3HVIA 1FDUA 1DI0A 3M33A 1NMZA 1E7MA 2ERYA 2Z98A 2J3IA 4M8NE 1I7LA 4LZZA 5DYTA 3IRUA 3RFVA 4UVHA 3EULA 1TJ3A 1NV8A 4QREA 3IPXA 5KMGB 4FEAA 2QAGB 2HT1A 2IY9A 3GH1A 2BGIA 1XN4A 4UMDA 3LX5A 3C8ZA 4WXYB 4XW2A 5EYPB 1KDZA 4B5KA 1FUEA 3RVLA 1Q19A 1WWKA 4GKAA 4JB8A 3SBEA 4BKPA 4B3MB 4XR9A 2VTVA 1M7BA 2PU5A 1Z3IX 2WVHA 1E2HA 1U3TA 1KK3A 3H1TA 3IP7A 3LY5A 3EGIA 3SFTA 3U7IA 3WRXA 4BMPB 3ON5A 3IAHA 2R1VA 2XGGA 3GMDA 1LPMA 1PTKA 2EFHB 3IE0A 2DQZA 3W79A 5TIIA 2Q1WA 2X8JB 3DDUA 5T57A 3KT6A 4LMRA 2YHAA 4ZVQA 2V3VA 4INZA 4TXLA 4GX5A 1M6HA 4LJ9A 4CMHA 2M6RA 4TVSA 3D4PA 2EEPA 3IT0A 4NVRA 2EBHX 4HK4A 1NMXA 3R74A 4FWIB 3PPIA 4RKQA 1HNXB 3SIRA 4RD0A 4PC2A 2ZI7A 4RGYA 4E4YA 2UVPA 3QEMA 5A9TA 1NNLA 2CDRA 5H81A 1GZ4A 1HH4A 2X5JO 3T3PB 5TT0A 2OG2A 2HQ1A 3AERA 3P9YA 1C7RA 3CLUC 2FMXA 3KE8A 5JMOA 2C77A 2WZQA 2JLUA 3DAOA 1C3OA 1BS9A 3D7SA 1G7RA 3AO0B 4N0PA 1R6DA 4GI1A 4OHCA 4ZPXA 3DEIA 3LQRA 5K6AA 4HDKB 2CZCA 4F2GA 4UM7A 4MWBA 4D42A 3DVRX 4AF8A 2QLLA 4L5CA 4JOSA 2GCGA 1HL7A 1GPLA 1H6CA 2JDID 2XMGA 3GDWA 1DJMA 5B1YA 1M33A 3RROA 4NQRA 3AM1A 4D9EA 2ODAA 2YV2A 3FGNA 2Z83A 4KLRA 4NHOA 1KNQA 2Q3DA 1V47A 2HU5A 3M6WA 1CC1S 4G1BA 4G1MB 3ZHOA 3QUCA 4PLHA 1YR1A 4WY8A 4RHTA 3GLGA 1PR2A 5FA8A 5EG5A 1A8PA 1BMFD 5FH9A 2EG5A 4TYNA 2FEMA 3AONB 1O97D 1KO4A 1BFUA 1NM5C 3E8SA 3N2NA 3KS9A 2XF2A 5DP2A 2G04A 2H52A 2AFIB 2VSNA 3B1ZA 3UJNA 5CP8A 2NP6A 3FHOA 3BIXA 4Q1FA 3NDBB 5I6DA 2F1KA 3U4QB 4CU2A 3LKDA 1W35A 2F1HA 1H2WA 2I2AA 4BU0A 2GYUA 1OXMA 1T5DX 4HAVA 1YB2A 3TMYA 1X8XA 5DO9A 5JALA 2GHTA 3K71B 4JJKA 5BY2A 3MC1A 2SNIE 1ZOLA 1D0VA 3N3BC 1YZNA 2ASEA 2X2FA 2JGKA 4CKCB 3PHGA 1VP9A 2RSLA 3LE8A 4HX9A 1TMYA 3O4RA 1ZINA 2H2GA 2BBSA 2C61A 2B8NA 3OOYA 4NBKA 4TSFD 3HTXA 5J2TA 1K06A 4ID9A 2J3EA 1YR7A 2DHQA 2WU1A 4KEAA 1A88A 1JG1A 1XVTA 2P62A 1RP7A 2DQKA 4LX0A 3Q0IA 3RSQA 3RTDA 3SS7X 4E2YA 5HHTA 3NT5A 5TT1A 1YFLA 3BMCA 4G09A 1QYDA 1RI4A 1RZVA 2JA2A 4JT4A 3DZGA 4G0PA 3AEQB 5CG1A 1NASA 4F45A 1Q1QA 1ENOA 2VDKB 5FADA 3UK6A 5K0LA 1AKWA 3IPYA 2CFIA 3M89A 4D3DA 2AXQA 2C2ZA 3K0HA 4UUNA 2Q0HA 3RBZA 4IH9A 1JALA 2C5SA 4BAZA 1YOVB 3ZI0A 2HO4A 5BN1A 5I8PA 2M6LA 5LQJA 3MWDA 4YJ2A 1MPXA 1P1FA 2DSNA 2P2CA 4HQFA 3C6MA 5EXSA 3NT4A 1AHHA 1Y4AE 3UXEA 3ZOZA 5JD6A 1Y8QA 3GUZA 1R6UA 4HAIA 5KQLA 2ZK7A 2WD9A 2B6NA 4C0JA 2X7XA 3E3NA 3HB1A 3ZV3A 4DBVO 3N0VA 1GKUB 1ZKDA 2BR3A 2ZYHA 5C9ZA 3STUA 3DOEA 4AM8A 1SY7A 3AR4A 4EPXA 4JI5B 4AP5A 2NU9A 3HHEA 3WOVA 3PQDA 4QEDA 4URUR 1J1UA 4FLEA 1A9RA 5H70A 1C4OA 3AESB 3ZCRA 4DWWA 4IRXA 1RYNA 3IMKA 4RV5A 1R74A 2GAAA 2PLAA 3RRBA 4JB0A 3QPBA 4FVTA 4URZR 4IH1A 1EFVB 1NXQA 3IOYA 4IYRA 3RS8A 5L3SA 3K0SA 1IM8A 2MHCA 5IARA 1TZMA 1YTLA 3MJCA 4O3FA 1TE2A 3HA2A 4Y1GA 3OZFA 1MKYA 5FFFA 4KR7A 2OUIA 3JVEA 1E20A 1MIOB 3FOEC 3ETHA 2FG5A 3TTSA 1M2NA 2QGNA 3SX0A 4HX2A 1KS2A 2W2XA 1CJTC 1IB6A 5ECDA 1ZISA 5REQB 4K46A 3RAFC 3CVVA 1I14A 4O33A 1P5FA 1YRWA 1Z4IA 2C78A 3AF5A 2A0WA 2ZYAA 1QS0A 1KP2A 3IT3A 1UQUA 4OQPA 3GDGA 4RHXA 4KBFA 4BFSA 2XWBF 1Y7HA 3UWSA 4D8UA 1G7TA 2JPDA 3IBCA 3R41A 4FX5A 4G0ZA 3OE4A 1AKTA 4Y6GB 2HXYA 2PMEA 5EE0A 1UBNA 3EXG2 3FMVA 1BEUB 2GZHA 4LY0A 5SY9A 4C7OA 2BLLA 4PYRA 4ASUA 5AKHA 1UJ6A 3UH1A 1OX6A 3EJ6A 2OCGA 2XVMA 3QXCA 4OJYA 3ZDQA 3SJBA 2FPOA 1UK8A 1NVMB 1XTKA 3C3MA 2GZDA 3DOIA 4KGVA 2CMDA 5KC8A 3VQTA 1E8MA 1Q12A 3S2UA 2CBXA 1M6VB 2JEYA 3UJ9A 1GNSA 2B4TO 1Q7GA 4GE3A 2IHZA 3L6OO 3TIXB 4I5FA 5DGCA 4AROA 1N5JA 1LLFA 2D3WA 1DAFA 4MPDA 4YALA 5B64A 4J9VA 5CB4F 1T13A 4F06A 1O94A 3IDOA 3JZDA 1QX3A 3AKEA 5KS2A 3VR3D 2OHHA 1YD7A 1WMFA 1ULAA 3I52A 5HFNA 4YMVA 4XDHA 3HZOA 1LPAB 2H63A 3LBFA 2XUKA 2A57A 3M5CA 3BH7A 4MUEA 4N9QA 4U2GA 5DHTA 5SZIA 3T3MB 1LPOA 3VKHA 1EQ2A 5B6IA 4MUFA 3H3JA 2IW3A 3FGOA 1UPTA 3KBBA 2HCJB 1KVTA 2WPNA 3MWJA 3VPAA 4GICA 1ULUA 3UFBA 1QH0A 5EIWA 3G8BA 5ALVA 5K0NA 2C1XA 1ZU4A 1D3AA 3MEQA 4HEA6 5EFOA 3O8BA 2G7MC 1FNBA 5ELLA 1M8GA 3VO9A 2C99A 3NIWA 4JJ6A 2KX7A 5HQTA 5ETJA 5SY6A 1B2LA 2GPYA 3UHPA 1K9SA 3H8VA 4XIYA 3RW9A 1RPTA 4D41A 1PW7A 1YNOA 5JZVA 2G71A 4WBNA 1TM1E 2V8OA 3A1TA 5BN5A 1QH9A 3PL5A 1KU0A 1NVDA 3FWYA 3OX2A 2QS9A 4GI3A 3W8EA 3OTIA 3NJ8A 1TL7C 4J0EA 2JCVA 1EWYA 2HADA 3IKLA 2CLSA 4RXUA 4BNIA 4DLZA 3DE6X 3IURA 4HDOB 2OKGA 3VV3A 3L8FA 3RK1A 4YMUA 4KR2A 2NWQA 4WA8A 2C2HA 2PL1A 1XRQA 4C0HA 4HF7A 4PO9A 5ALIA 4F46A 1A4IA 4KWHA 3WWCA 4EECA 3DFKA 3U80A 3STHA 5BW4A 3BS4A 1PG0A 2BUCA 2ZSDA 4BFXA 4DA7A 5JWOA 3LQ2A 3BWBA 1ABEA 4FQ8A 1GJRA 5FI0B 1ZEJA 1OHHD 2MSDB 1X7XA 3B3QA 2PKYX 1BQEA 4P84A 1E61A 5CA1B 2R47A 4QTXA 3H13A 5KQSA 5IEJA 5TLSA 1B8UA 1UMCB 3CLTD 3H5LA 2JHCA 2GJSA 4PEVA 3EIQA 3RLFA 5AM2A 4GLOA 1Y9JA 2QKYA 2POQX 2BRUA 3JD2A 1C8KA 4KMMA 4L4ZA 1DQNA 1YS4A 3OA2A 3GAMA 4DNQA 2PKQP 4FU0A 5THKA 3CUUA 3CB2A 4M0PA 1EFTA 1GDHA 4JQSA 4KWCA 2CJPA 3F1LA 3BAFA 5JAPA 1HG1A 4L3OA 1U2QA 4G9EA 4KDRA 1XLUA 5JXIA 5TC4A 4FZ5A 4QOGA 1XJCA 3NXSA 4AQDA 3FPLA 4QKQA 1V8OA 2GPNA 3IUYA 2NUPB 3LYUA 2ZXUA 1JV2B 4RENA 4B6FA 2XRYA 3KOWA 3PWSA 5F4BA 3URKA 1O58A 4LY9A 1JEYA 4DR6B 1X1QA 2O50A 1A7KA 4FNGA 2IHTA 2JGDB 1ZH6A 5DHPA 1S1CA 2AEJA 1KAMA 3X2FA 3EC7A 5AM4A 5JSYA 4MW2A 1MABA 2CV1A 4EITA 4MI6A 4CKBA 3UW1A 4MR9A 3W5UA 2HPHA 3VKUA 1JKFA 4W5NA 3DC2A 3DWFA 3RG8A 3SM3A 4BKUA 3A58B 5F12A 4XRGA 2I2FA 4FSXA 3K72B 2NUTB 4QUHA 1EXNA 1K5PA 2Z43A 4KITB 1HF3A 2R8EA 3PFNA 4X1IA 5AKEA 2QVGA 4C05A 1M6YA 1OGYA 3AJDA 1P1BA 3D3QA 4IMJB 1OAAA 1GZ5A 4A27A 4BATA 2Y6VA 4Q34A 1QQ5A 2ZI4A 3V4RA 2VDVE 5ALGA 1XU7A 1G5FA 1ZK4A 2ZS7A 3TR6A 1NFQA 3OPVA 2JGRA 3PDWA 1RMQA 3WQHA 1I6KA 5I7SA 2BJHA 2PX0A 3OX4A 3T0IA 5HKBA 4MW6A 4ZI3A 4P5PA 1QRRA 2JK1A 1IWBB 2NZYA 3AXTA 1BQ4A 3B53X 5LC1A 4AX4A 5AJWA 4W5WA 3JWHA 1OWOA 2WIAA 1SC6A 3ZQUA 1V25A 1F6WA 3FSGA 2PUGA 1OY1A 1QHGA 1Z6QA 2N9UA 2ORIA 1SQSA 3E35A 3ER9A 4JITA 5HKKD 3NHRA 1XZFA 1SXHA 1EEXB 4LFAB 3IKJA 4NL4H 4BX9A 3FKSA 4AO7A 1KEKA 1SZCA 4MEBA 1C5KA 2ONKA 2J9XB 4EGJA 2PRZA 1NG9A 1DG1G 4X91A 2CCKA 4YJ3B 5ABPA 2AK2A 3C3WA 3P0RA 4C0SA 4EHIA 3QFTA 1Y1TA 5CYPA 5GV8A 3D6TB 3TOSA 5E6SA 3GJ3A 4GBGA 3MIZA 4PNZA 3NNDA 3VXKA 2EL9A 2HK6A 3LUGA 3B6ZA 4TPKA 4F2PA 2R4TA 5TSDA 4EA8A 2GPSA 3ZD8A 1XCLA 1JXAA 3NTQA 4IDFA 3L6DA 1G3MA 1CY4A 1FF9A 3HUDA 2A9PA 1XD2B 3QXGA 3ODPA 1BZYA 2D7CA 3QRWA 1W6RA 2HEIA 1A69A 4L02A 5FI3A 4L2IA 421PA 4CTMA 1N2CA 4ZZ1A 1EX9A 2WM3A 4F97A 1S6YA 5IJ0A 1JW9B 1JLSA 1YV9A 3CG0A 1OLSA 4DM3A 1WULS 2V65A 4UEJA 1PQYA 3N8IA 1RLTA 1WU7A 3LTEA 2DERA 4MEJA 1W5AA 1BCSA 2HPVA 3HFSA 3GLFB 1ZGHA 1WS6A 1DKQA 1SHUX 1E9AA 3H9JA 2CVPA 2V7QD 2B2XA 2D5IA 3H87A 1Z6AA 2Y93A 4FOPA 4JI1B 3OE1A 4DLYA 4G26A 4E14A 5F7JA 1E0JA 3E58A 2BFFB 1XNJA 3VUFA 4I8XA 2E5FA 2O07A 3NHZA 1KMCA 4RJTA 3KVVA 1Q7CA 3NBUA 4UOZA 4O8ZA 1PP4A 5LXTB 4IJMA 1BXZA 3H0EA 1MQSA 1O8CA 2I71A 2W7TA 3Q5EA 3FPCA 2JFXA 1Z36A 1VXOA 1UPAA 2FFRA 2F1RA 3LK7A 3Q9SA 4IS2A 4J75A 4XUGB 5JECA 2ON6A 4AXBA 2CNOA 1Z5OA 2FZWA 4U9IS 3NBYC 4GMFA 1XZGA 2J5KA 1YFKA 1Z4PX 3QSGA 5U4XA 4CKEB 2WB2A 4HI0E 2D13A 1Z6YA 4UBMA 3AQ4A 4OLHA 3IQIX 3O90A 5PGMA 3IV6A 4QYWA 4FS8A 3CJRA 3LH5A 3ZWVA 1NVWQ 1JDTA 3AZQA 3K1AA 1ETHA 4WCVA 2CVQA 4H3SA 4JB3A 2EAUA 3A8TA 3DZBA 3QBTA 4DCCA 2G1AA 1O2DA 3AVPA 4G0OA 4N49A 4DMMA 2BGWA 3Q3IA 4IXTA 4Q21A 4W1QA 3TBHA 2F62A 1ZK0A 1QG4A 4L16A 2C4WA 2ZYSA 4R2JA 4ZYVA 4J8PA 2CL5A