3MUFA

Shikimate kinase from helicobacter pylori in complex with shikimate-3-phosphate and adp
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
160
structure length
160
Chain Sequence
QHLVLIGFMGSGKSSLAQELGLALKLEVLDTDMIISERVGLSVREIFEELGEDNFRMFEKNLIDELKTLKTPHVISTGGGIVMHENLKGLGTTFYLKMDFETLIKRLNQKEREKRPLLNNLTQAKELFEKRQALYEKNASFIIDARGGLNNSLKQVLQFI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Shikimate kinase
publication title Structures of Helicobacter pylori shikimate kinase reveal a selective inhibitor-induced-fit mechanism
pubmed doi rcsb
source organism Helicobacter pylori
total genus 55
structure length 160
sequence length 160
ec nomenclature ec 2.7.1.71: Shikimate kinase.
pdb deposition date 2010-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01202 SKI Shikimate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3mufA00
5AUQA 2WJVA 1YR9A 5H68A 2UKDA 4G5SA 4B48A 1YU9A 4I1SA 3NHBA 2G1KA 1FZQA 1YZLA 5AR1A 5JBQA 1NN3A 4CT4B 2OHFA 4NYMQ 5HR5A 5JZVA 3TMKA 5KNDA 2WIBA 5TV2A 3RSOA 3NBXX 1ZC4A 1YVDA 3OEED 1KK2A 1CJUC 3AKDA 5D3MB 3UK6A 4UXJA 3KKQA 3IO5A 3ADKA 1PUIA 1UKVY 1JAIA 1YE8A 2N1BA 3F8TA 1S0UA 3QF7A 4L5BA 1P72A 1W7AA 4LDJA 2DWPA 3WBKA 3AUXA 1LFDB 3AF1A 2YC4C 2OLKA 2QU8A 1KJWA 1NN5A 2PMKA 1ZD9A 4TTQA 4TYNA 4X8OA 1OIWA 4NKRA 3PUVA 2W00A 4QBFA 2ZRAA 1D8TA 2KSQA 2H18A 2FSGA 2AN9A 2O52A 4RD1A 2F3RA 1FL9A 2Q3FA 4RCYA 1N6PA 4B73A 2RGEA 1E1QA 1L4UA 1G6OA 1OXXK 2J46A 3GJ0A 2YJTD 2GF9A 1R8QA 2JJ8A 1KO4A 4L16A 4M1KA 1RRPA 1JALA 4M1MA 3U7GA 1NIJA 3K09C 2LWIA 2KBEA 1E79A 5A0FA 5B30A 1A82A 2B8TA 1FMJA 2ZJAA 1FNMA 2CHGA 2VRWA 3PUZA 3HYRA 1EWQA 2HEIA 4AYXA 3CWQA 4B76A 4KBFA 2CDNA 2GEDA 4LBZA 4UNPA 1I4LD 2VHTA 2YWGA 4G01B 4IKEA 2FX3A 2YHSA 3A4MA 1ONBA 1CJTC 2V7QD 2OUKA 2J0QA 2W6JA 4U7DA 1SKYE 2HJVA 1QHIA 4DLSA 2ZJOA 3QXJA 4LHXA 4BQSA 4NCNA 4JLKA 1EWRA 1HYQA 2AWOA 3V9PA 2IEZA 3OIYA 4ARZB 4MYUA 1U9IC 4WXPA 2JLVA 2YC2C 3C5CA 5JFGA 1DO2A 3AVPA 3DOFA 3HP1A 2PZGA 4BZXA 3GJ4A 2F9MA 4AG5A 3MWYW 1S3GA 4BRUA 1KK3A 5FPSA 4URVR 3CR8A 4XSHA 1E0KA 1QVRA 3TBKA 2P67A 4RFSA 2ZSDA 4L8GA 3GJ6A 4Q7JB 2FNAA 1CRQA 1HH4A 5FL3A 1CU1A 1EK0A 3VFDA 3B1XA 2OZEA 3BIFA 5FUWA 4OHZA 3W34A 1W46A 3OE7D 5FI1B 1CJMA 1FQJA 5SZIA 1GWNA 1GNRA 2JLZA 2R9VA 3MD0A 4Q1CA 4BEBA 4JYCA 4FINA 1MABB 3LA6A 4GL2A 3CX8A 1AA9A 3K70B 4L4UA 2EVWX 4TMXA 4D0NA 4GRAA 1G21E 1ZIPA 2ZQ5A 1X1RA 5A5GA 5LB4A 5EXSA 4RKFA 2ZJ8A 2GXAA 2FH5B 3QOFA 4ZKEA 1D9ZA 5IRCD 2E87A 2D62A 2GETA 2W2VA 2CK3A 3AP1A 1EFRA 4TN1A 4TL8A 5J47A 4NYIQ 4RSGA 1Z07A 4PC3A 2LCFA 2QMUA 4JVLA 4R7ZA 5E3HA 3RRZA 1T9HA 3VU9B 3KKNA 4F7WA 2XZLA 1QBKC 1Z6TA 2OCAA 1OFUX 3D31A 5JJKA 5GVSA 2GTPA 2ZUDA 4JZKA 2CLSA 2G77B 3IBYA 1KK1A 2OBNA 3QBVA 2VTKA 2BBWA 1W44A 4IDQA 2IHBA 1IN8A 2REOA 4D4KA 1WCV1 1Z8FA 4EUNA 5KPJA 2QN6A 2FFHA 3WMFA 3BH0A 4P3YA 3RRMA 2PX3A 4KYIB 4V02A 2W58A 3KZ1E 2IYLD 1G4AE 3EAQA 1HA3A 4DLTA 4CEIA 1NL3A 2XJ9A 2ZI4A 3B2EA 1EFCA 2YZ2A 4Z1MA 1NKSA 4QNRA 4JL6A 4AIIA 4TSFD 5A4JA 3EZFA 3FE2A 5KDLA 4B35A 4ZKDA 2ZYVX 1KZGB 2V1UA 4AD8A 3OHMA 3QKSB 3QQ5A 5E7JA 4IDOA 2HJGA 4C7OB 1EX7A 2IYUA 3PG5A 4DLVA 3LO5A 1BMFA 1DAEA 2J7PD 5FR1A 3SS8A 3TLXA 3QBTA 4GI7A 1T3LA 3AUYA 3NIBA 4Q19A 3BOSA 4FMDF 4MKIA 5JCPA 4QM7A 2QP3A 4TL9A 3TSOA 3HWSA 5KSOA 2RH5A 4HAYA 3EXAA 4QGAA 2X77A 3IEVA 1HT1E 2CMKA 1XEWY 1T5IA 3BB3A 3QJYA 1N5IA 4YQFA 3GLGA 621PA 1OFTA 2O8BB 4M22A 1QG4A 4KXFB 4B32A 1GIAA 2P65A 1CIPA 5EP4A 1M7HA 1X8JA 3MCAA 3EWAA 3CRRA 2IF2A 2YINC 4NP6A 1ZM9A 5KPDA 3RDPA 1YRBA 3K70C 1GDDA 5GJBA 2R2AA 2OT3B 3TKLA 4PZYA 3ZS8A 1YR7A 2XTZA 1DE0A 3PITA 1DBSA 1TUEA 1AQYA 1Q12A 1FQKA 3QSYA 2HLDD 4ZDKA 3NDPA 4DXAA 1FMLA 2IS4A 4V0ME 4US2R 4KFTA 2VHJA 1B23P 4QJ4A 5FUVA 3T1OA 3OAAA 2FPLA 3ZVNA 5CM8B 2OXRA 1U2RA 2H16A 1W0KD 3CW2A 2QMHA 1Y3AA 2JLYA 5HCNA 2ZJBA 1WRBA 1VYUA 4RZXA 2C5LA 4A82A 1W4RA 1US8A 1E2IA 2Z83A 1CR2A 3T15A 1KNQA 1AQUA 2WWIA 4CRWB 4D4LA 2CCJA 3KL4A 1EFTA 4FWIB 1U0HC 2R62A 4JL5A 3DKPA 4CEHB 5HE8A 1D2EA 2VF8A 1QHYA 4PPGA 4RCZA 4G5QA 1EG7A 5AK0A 1NP6A 1MO3A 5UKDA 4ZCMA 2PCLA 2F1IA 4DDVA 2JGNA 4I81A 221PA 4QBHA 1SXJC 2F43B 3PXGA 3NC1C 3KJIA 1P9NA 3I5XA 2H17A 4LWZA 1OPXA 1GILA 2EYUA 1VCNA 3R8CA 2GJKA 4US0R 1XJQA 3GLHE 4HUQB 4UKDA 1X8KA 1XTIA 4CT5A 2DR3A 2NO7A 4OHVA 4EJSB 3X1DA 4P0TA 5SZHB 1ZNXA 4PO8A 1XPOA 4R98A 3IPXA 1I2MA 2BIFA 1WMSA 1RZ3A 4KJZA 3ND8A 4AI6A 3FMOB 5JLJA 3EW9A 1J90A 1P4SA 1F60A 1U94A 1L2TA 5CIQA 5KYKA 2YOFA 4QRHA 4ERNA 2NTYC 1XEFA 3I92A 5LPNA 2QE7A 4DCNA 4JMPA 2UVQA 1DAHA 4FN5A 4GP7A 1WP9A 5GJWC 2VSFA 5TMPA 3L0PA 4RZ2A 2XB4A 2ANBA 3A1WA 5DH9A 2DCUA 2R65A 3IKJA 1E96A 2GAAA 3F3YA 3MWLA 3RC3A 4M9QA 1T8UA 1Q1EA 4ZCIA 3QXCA 3THOA 1ZC3A 1IOZA 4JJKA 3DMNA 2HCJB 3RYTC 3KJGA 3SFVA 5IK2D 4NCKA 1ZRHA 4PR0A 4BFYA 2REXB 4DDTA 5AJVB 1ZU5A 2IS6A 3AB3A 1CRPA 4DDWA 4Q9HA 2VF7A 1QG2A 4FXPA 2HT1A 1XTSA 1TMKA 1WBBA 3AVWA 2WSSD 3AVQA 3IILA 4BE7B 1U99A 5CITA 4XOIA 2FEOA 5FBWB 1KO8A 4BLRA 4N0DA 1R0ZA 5JI3E 2BWJA 1SXJA 4M1YA 4LOAA 3U7HB 4YXWA 2RB4A 1JR3D 5C4GB 4B44A 1A1VA 2KJQA 1G5RA 2RGNC 1KNXA 1T0HB 2QM7A 3FGNA 4UJ3A 1E2JA 1XZPA 3ND9A 1BO6A 1G8PA 3LNCA 5FPYA 4ACBA 1TEXA 1XFAA 1W2HA 1XMSA 2QBYB 1F3OA 1UKZA 1V43A 3FHOA 1V5WA 3QUSA 2WKPA 1AS0A 1QZXA 1ODFA 2FFBA 1Z6XA 3IIJA 4QJ3A 4S35A 3OEHD 1NI3A 2I1VB 3CKLA 1R4AA 1S96A 4QGHA 4F38A 4BGDA 1NVXQ 4D81A 3CRW1 1OW3B 3QG1A 1NVWQ 4M1TA 3CH5A 1ZUNB 4WVFA 3MMPA 4DZZA 4EJSC 2C9CA 4DCUA 5EP3A 1LVGA 4U02A 4UXIA 1IXZA 2XTMA 3FKQA 3Q7PA 2BVNA 5B57C 2QGZA 2QTHA 2BC9A 4GZLA 1OKKD 2F1RA 2CL6X 2J0UA 5BW8A 1Z63A 2ZU0C 2AFHE 2V6JA 1S4QA 1E3MA 2RGXA 3VKHA 5EE9A 4UNQA 5KDDA 3IO3A 4TYPA 3WY9A 2B92A 3ZJYA 4FCTA 4IOJA 1NY5A 3I73A 2ZEJA 4MGYR 3B78A 4DSOA 4UNSA 4GT1A 4LC0A 2R6CA 4IHQA 1JEEA 5CK5A 1ZM7A 4HB3A 3TW4A 3UMFA 1MV5A 1U8ZA 4DIEA 1RFLA 1FW6A 521PA 2ONKA 4MDFA 2HF9A 2JLWA 3T1TA 5FBLB 3NEJA 2FWRA 3GFTA 4PPNA 5E7IA 1PUJA 1VG1A 2CHVA 4FMCB 4V0LA 4AC9A 1G17A 4LHWA 2O8CA 2W2XA 1WDTA 1NBMD 3AVOA 4BWYA 1UADA 1WQ1R 1JJVA 5AJYA 4A9AA 1ZNZA 1K5DA 2ZJZA 4B71A 4M2LA 3EPLA 1JXMA 2GCOB 1CKEA 3VKGA 1OFHA 5JSZA 1DPFA 3K0FB 1RYFA 3DMDA 1YRAA 3SEAA 2L0XA 2DFTA 4OI4A 3ZQ6A 2JDID 1WE2A 1XMVA 4LYJA 3U3KA 4B75A 1FFHA 2VP6A 1KSJA 1U90A 2GJ9A 4BLPA 2NPIA 1QDEA 2BM0A 2ZRFA 3U3RA 4YMSA 2GJAA 1E2PA 1KHTA 4DEYA 5FOTA 2GCPA 1JECA 1PLKA 4HB2A 2OXCA 4US1R 4BLOA 5FPKA 2AKYA 1CR0A 1XTQA 1XPRA 2O8DA 1IJFA 1ZM4A 5KNBA 1XCPA 4HUTA 1YZUA 4J0QA 1PZNA 3SN6A 4LRWA 1Z5ZA 3A1UA 4A0RA 3U61B 1JPJA 4B47A 2ZRKA 4QJ5A 1TTTA 1SVWA 4XJXA 4QOSA 1IONA 2C9YA 1LS1A 3GJ3A 2QI9C 3B7GA 2XEXA 3CF6R 3KX2A 5DSZA 3RS4A 1G8HA 3ZD6A 2IYSA 4FW9A 1LW7A 4P33A 3WNBA 2RCNA 4GZMA 3VQTA 1UJ2A 1IN7A 4LBYA 4LHYA 3EZ6A 4RKEA 2H1LA 1MOZA 3IQXA 2IXEA 1Z0FA 3X1YA 2PZFA 2VP9A 3L2OB 3AKCA 2NQ2C 2IYWA 3S1AB 3SJAA 2FE4A 1GKUB 1Z3IX 1Z06A 3KJEA 2F6RA 1AS2A 4MRSA 1E6CA 4GP6A 1OB5A 4EAQA 1RRCA 4NCJA 3T1VA 1IJEA 1RRGA 2IWRA 1HE8B 1JR3E 3LW7A 3KKOA 4Q66C 4B43A 4CYMA 3K9NA 2W6ID 1KDOA 1N6LA 3ASYA 1M7BA 1JAHA 3PIRA 2ZJ2A 3UWKA 4UNRA 1T8TA 2GILA 3TK1A 1T4GA 2REBA 3GCGA 1Z2AA 3LVRE 3OESA 3MJRA 2A2ZA 4DUGD 3NTUA 4HDQB 4BZPA 3LWNA 2FMXA 1VHTA 1I4TD 2R6FA 4NMMA 3GFOA 4TMKA 3SR0A 4O3MA 3EZ2A 4D0GA 2G0NA 2NO6A 1X1SA 2IA5A 4F91B 5JS8A 2ZE6A 1IM2A 2HDNB 1BKDR 3KKMA 4JBWA 4CF7A 3W5JA 1TF5A 4BPBA 3FTQA 4AYTA 1Z6GA 4LY6A 3BWDD 5CLLA 1E2EA 4A92A 4EFLA 2AXNA 5DI9A 2FZLA 3PCRB 3E5HA 1W0JA 3P27A 4EPVA 3BS4A 2O8FB 2GJSA 5JWHA 1JEDA 2FGJA 5J4YA 5L3QB 4DKXA 5FUYA 4V03A 3PVSA 1GKIA 2JLXA 4V0NA 2CVHA 4LHZA 3WMEA 2WPDA 5GVRA 4C9BA 1JB1A 1ETUA 2V6IA 2ECKA 1TEVA 1XCMA 1Z2CA 2A3RA 3KTAA 4LBVA 5B64A 3GLIA 2IS2A 3BFKA 2V1XA 3BK7A 3SJBA 1GG2A 1J8MF 2KB0A 4HSEA 5JI2E 4JSYA 4GPTA 3B8HA 2G9NA 4JLAA 4YMWA 4JT2A 5G53C 1F5NA 3TR0A 3CZQA 2UZIR 3CBQA 2CXXA 3NXSA 4EPWA 3BAFA 3VMFA 1IN6A 4MGIR 2JJ2D 4Q03A 5AUPB 1NLZA 1K5GA 2ZJ5A 3GLFA 4MRNA 4N0EA 3TRFA 2ZAMA 2NG1A 3N70A 1CLUA 2Q3MA 4Q00A 3UG7A 3T5DA 4Q47A 4HLUA 2VSOA 1KMQA 2XOKA 1P9WA 1RYHA 2ODBA 1NBME 2WKQA 4DSNA 5EXPA 1KI7A 4XIGS 3RRNA 4DRZA 4BFSA 5AJZA 4G1UC 3M1IA 2ZIAA 3EC1A 3UG6A 2GXUA 2GHIA 4HZUB 2EFDB 3B6EA 2XSZA 1TQ6A 2GZDA 3T06B 3PQCA 2IBMA 3CNOA 5CLQA 3MG9A 5C1BA 4CGZA 1NLFA 3LAWA 4URYR 2IS1A 2QQ0A 3D3QA 3CF0A 4JSTA 3P4YA 2OSBA 3ZIAA 2FV8A 1NMXA 4AG6A 4BRWA 3T12A 4X8HA 3IBGA 4OKSA 2ZE8A 3MFYA 1GL9B 2IHYA 3HR8A 4CEJA 2P6RA 2EWWA 3ETLA 5CB6A 3WBJA 5EP1A 1T0JB 1ZD8A 2Z6VA 1KI6B 4POAA 3TQCA 2A9KA 2CBZA 2ZPTX 5KSYA 1MH1A 2NPFA 4IOKA 1G7RA 1UPTA 4A1FA 3P20A 1P62B 2ZUBA 1GSIA 3EC2A 3TR5A 1H8HA 2EU8A 5DN6A 1AN0A 1P75A 2GK7A 4JVMA 4C2UA 1W36B 3FMFA 4DLZA 4DB2A 4JLNA 2P2LA 4I1VA 3PEWA 3OFNA 4JKYA 4QFMA 3CLVA 5E4FA 2A7QA 4F4IA 2YWHA 1G19A 2IYZA 4KVAA 4YDHB 3G5UA 3AV0B 5C46F 3GP8A 2WIAA 1M1YE 4OHXA 4WA7A 2R8RA 2HF8A 3L0SA 2ZR9A 3PUWA 3U44B 3AF2A 1G5TA 1D9XA 5FTKA 3RSLA 5KOYA 1P2SA 1G7SA 5E7MA 4OI0A 2J41A 2PJZA 4PQRA 4W5JA 1HUQA 2BEJA 4U5XA 5C2JB 2QSYA 2YWFA 4OI2A 1RRFA 1TF2A 2AX4A 4HB4A 3TQFA 4DHEA 2H5EA 3V4FA 1DOAA 2GKSA 4BFUA 1XRJA 4YMUA 1G18A 5AWFC 4KV9A 2GBLA 3I32A 2IYQA 2NO1A 2ZANA 3B1ZA 4GMXA 4LGMA 1NSTA 4TZ0A 2BBOA 3NC0C 4EPYA 4OK5A 4WBSA 3R9IA 4XD7A 3LQQA 3EARA 5H1YA 1XZQA 2BOVA 2VIIA 4ABYA 1BYUA 4DLRA 5EUQB 2C77A 4Q4AB 1HQCA 1W4BA 1US8B 5EZ6B 5G3YA 1KY2A 4IXMA 1NN0A 1YR6A 2CE7A 1OIXA 1XXHB 5TVKA 2CNWD 2ZI9A 3HPRA 1OHHA 3P4XA 4K46A 3LQRA 3TAUA 4NL4H 5HCIA 4IEIA 2GWHA 2VHUA 1KI1A 3WP0A 4AK9A 3ZS9A 1R10A 3BD9A 3VR6A 1PV4A 1OFIA 3BORA 1GNQA 3T34A 3PEUA 3IUYA 4EFNA 3CWZA 1FTNA 3ZH9B 2ZI7A 4C0KA 2ZETA 5FFMA 2GCNA 4JS0A 4D2IA 2ORWA 3MUFA 4MRRA 4TQUS 3I62A 1AK2A 1Z0KA 4AURA 2CCGA 2W0SA 4HAVA 1R5OA 3LV8A 3EASA 3K70D 1G3MA 2NZ8A 3FMPB 2HYDA 1H8EA 1KO1A 1G1MA 3KB1A 4Q1AA 2DWOA 2FFQA 2JIZD 1O3YA 1W36C 1BYIA 4IXNA 3QF4A 3FVQA 3IDQA 5FL7D 3EPJA 3EPHA 3QKRA 2ZM5A 2AK3A 4AKHA 1AKEA 2ZI3A 5CDFE 3AGPA 4RZ3A 1N6IA 3TJZA 2NOAA 1E2HA 3BC1A 4BFZA 3FFBA 2JLSA 2CHQA 5L3SB 3A6PC 1MKYA 3NG1A 4KFRA 2FGKA 4ZIRA 1Z22A 3K0CA 1II8B 2KWIA 5DYGA 3GQBA 3GJ7A 1TUIA 4IOLA 3VR5A 1OH8A 2B8WA 1MR3F 1N0UA 4A8JA 2WWFA 4RY2A 1IY0A 1OB2A 1JR6A 3PJRA 1UBGA 3C16C 2O8EA 3HR7A 1QHSA 1Z0JA 3B82A 1D5CA 1VIYA 1PLLA 1XF9A 4E09A 2CL7X 4KLZA 3EWSA 4YLGA 2I1QA 4M1SA 1GRQA 3W6OA 8OHMA 1SXJD 3EG5A 1FUUA 1AZSC 3MRSA 2GF0A 2C9OA 5FBRB 4W5WA 2PEYA 3Q5EA 3K0AB 3H86A 4WZAE 3KKPA 1IN4A 1COWA 3T61A 1VYTA 3THXB 1NRJB 5ANRB 1SXJB 2Q0HA 5E95A 3SC3A 1AM4D 1FP7A 4B2IA 4PPFA 4DVGA 3ADDA 4IDNA 3W3AA 4LSGA 1T6NA 5M04A 1YQTA 3EA0A 3FB4A 3I4LA 1J8YF 3SBDA 2QP4A 4QHSA 2BBTA 1OH7A 4OI1A 2OEPA 1XPUA 2BDTA 1GL7A 2J0VA 4DSUA 4QHTA 4CDGA 3A37A 5DNYB 3IEUA 1E2MA 3JZMA 3O8DA 4A2PA 1QRAA 4BUJA 1Q20A 3ZD7A 2DHRA 5AJWA 2LKCA 2XXAA 3QI2A 4URXR 3K0SA 3K1JA 5JEEA 4NU0A 2QA5A 1JJ7A 1TQDA 1KI3A 3FKSD 4ZO4A 4TYYA 1ANKA 1OF1A 2J59A 4TYQA 2JJ1D 1W48A 1M2OB 4B3XA 1FX0A 3T1QA 1KI8A 1Z6YA 4KVGA 5HKKA 1TNDA 3DPUA 3CO5A 4NYJQ 2F1HA 4C0HA 2J7KA 3QVUA 2B7CA 3NBZC 3R7WB 4OHYA 1N3BA 2QT1A 1FUKA 1CR1A 1VTKA 1II0A 4OQLA 3SE0A 5DI3A 4KSCA 1RJ9B 5F3WB 1UDXA 1OH6A 3KUDA 1RE0A 2GVDC 2RMKA 1XXHE 4WXRA 2YOGA 1KTVA 3PEYA 4IVPA 4M4SA 5TXGA 3TE6A 3O8RA 3A1TA 2C99A 4LC1A 5EE1A 3T35A 2CEAA 3ICEA 1JQLB 5BN5A 3U60B 2C98A 2XNDD 3K9LA 2BKEA 3X1WA 4P4SB 1T3SA 2IF0A 4URUR 4Q18A 5EZ5A 2IYRA 3OEEA 3REGA 821PA 4DCSA 5GADl 5K8IA 2I3BA 3KUCA 2DYKA 3KXIA 4IVQA 2JLUA 1U98A 3GD7A 2IUUA 3BFVA 4DB4A 2VP4A 1KDPA 3DL0A 4Q4LA 2ZVQX 4DCTA 2VHQA 5GJVC 3QPVA 4ZI3A 3HPQA 3AQ4A 4H1UA 1E1RD 5FOWA 5CYPA 1P2VA 2Q21A 2QGNA 1TQ2A 4C0SA 1YHNA 3BE4A 3VNUA 4ZCLA 2O0HA 1QHHB 3B1YA 2DFNA 3TUJC 3AP2A 2ZYTX 3H0KA 3THYA 2J0SA 1MO4A 4LJ5A 4NPHA 1UBEA 3Q72A 4KODA 4OK6A 1XMJA 2W2TA 2P5TB 1VECA 3QEJA 4B3BA 4G5RA 1LF5A 3DKVA 2Z43A 3H1TA 2HUPA 2MMGA 3QKUA 2ZSAA 2WWYA 1S1CA 4Q5IA 2O8DB 1KI4A 3A4LA 4GNKA 1P3JA 4MKGA 2EFHB 3GJXC 4KITB 1CF4A 5EJEA 4KI0A 3W6NA 3QNUA 2Q6TA 2EFCB 1T91A 1F2TB 4ILEA 4ARZA 3ZLJA 2V7QA 1FP6A 1H65A 4GBMA 4NONA 3LY5A 4V0MA 3A1VA 3QXHA 1E9SA 2OCBA 4Q7LA 2D7CA 3L0OA 4NCIA 1U0JA 2FPKA 4JLBA 1XJCA 4LJ9A 4PXAA 5JECA 1E94E 4PO9A 1OSNA 2A5JA 3DEFA 4S2EA 4H1VA 2QRNA 2XB2A 1Z0AA 2HYIC 4B3CA 1K8RA 1SXJE 1NIPA 3IHLA 4XVUA 1AGPA 2XAUA 1KJYA 4G3XA 4KYUA 3NKVA 5C4MA 2WWGA 3QXSA 4RD3A 2NIPA 5SZJA 3ZQJA 2FSIA 1KGDA 4EDHA 2CLDX 1X6VA 4E22A 2BMDA 1MABA 1KO7A 3M6AA 3CZPA 3W5IA 3BH6A 3OE7A 1HY3A 3Q9LA 2W83A 4DBLC 4OJKA 2GEUA 4DWJA 3VR1A 4KCGA 2BMEA 1WBDA 1M8PA 2ZRHA 4HDOB 2MSEB 3GLHA 5HZHA 2ZI6A 2QRZA 4FI3C 4W7SA 4DLYA 3SHFA 1AS3A 3I1FA 4OBEA 3B1WA 2O5VA 2PH1A 1E4YA 1XD9A 1KO5A 5G3ZA 3N5CA 1D6JA 1DG3A 4BLQA 4DLXA 1KOFA 2C03A 4IEEA 1XEXA 421PA 4PSAA 2AFIE 2WVJA 5TB5A 3EIEA 2RHMA 2ZS7A 5JMTA 2GZAA 3U6KA 2ZREA 4LJ6A 1DO0A 2QL6A 3EPKA 1A7JA 5K8LA 2YKGA 2DBYA 2WJYA 4RD6A 2Z4RA 1YR8A 5CIWA 1KK0A 1KZ7B 3R9XA 1XD2B 4A4DA 4LPSA 3V4RA 3X1XA 3AM1A 4K81B 2ZRGA 2VL7A 5CJPA 4RD0A 3KQKA 1W4AA 5DISB 1E0AA 3QKSA 2WAXA 2RGBA 4KBGA 4RZUA 3TVTA 1XWIA 1DAFA 2AD1A 5BQ5A 3KJHA 3W3ZB 4C7OA 1KI9A 1N6HA 1VHLA 1N5JA 2VH5R 1P73A 3LFUA 3FHCB 2AWNA 3KTAB 5IDVA 3VR4A 1W2GA 3GLIB 4TSFA 1YJ5A 1GITA 3SNHA 2PLFA 4IDHA 2QTFA 5L3RA 1QHXA 1MO5A 1VMAA 3JVVA 3AF4A 2OFOA 2RKOA 3WYGA 1PVOA 3KXKA 2WJIA 4TT3D 3VKWA 4EFMA 2J7PA 2UZ3A 1AGRA 1Z28A 1M34E 4WW0A 4UQOA 1VG0B 1YZGA 2GXQA 4MA4A 5FTLA 4OK3A 4XTRA 2J87A 5J4KA 3UPUA 2O8BA 1OV4A 3AVYA 1G41A 3R8FA 4D0LB 5J4VA 4WAUA 3U2QA 1RC8A 2FSHA 3L82B 1HE1C 2GEVA 5DYIA 3NHAA 3GEIA 1QHGA 2BBSA 4B2LA 1CULC 2X2FA 3WXMA 3M4YA 1SVSA 3U7EB 2QQEA 2FEMA 2IK8A 1MO6A 2PZEA 2X19A 4MKFA 4PAQA 4NBSA 1C9KA 1JNYA 3EA5A 4NYMR 3GEHA 2QPOA 3QG5A 2HV8A 3ICQB 1JPNA 2PCJA 3TUIC 4BECA 5FOVA 3LXRA 4JLOA 2V8OA 2ZR0A 3H84A 4ON9A 5H70A 4LCBA 3SYKA 4M8NE 2VP5A 4BZQA 4ASUD 2EW1A 4Q4HB 4HLQB 2GA8A 4K8OA 4OHWA 4C0AC 4IFEA 2PT7A 3I72A 3RANA 2OAQ1 3GEEA 3DM9B 4Y0VA 1ZCAA 3Q5DA 4LHVA 4M21A 2H92A 4AWXA 2BJWA 2C2HA 3QPUA 4HAXA 4PHTA 2CJWA 1N5KA 2NO0A 4ZDWA 3CH4B 2HLDA 2XITA 3RABA 1GOTA 4NDZA 1SGWA 3VHLB 2D7DA 3IIKA 2D2FA 1VYVA 1GFIA 2WTUA 2IUSA 2EFEB 5KSPA 1XU4A 2GK6A 1HT2E 2V54A 1N6KA 3UKDA 2XZOA 2JLRA 1W0KA 1HURA 3BRWD 2ZSEA 2XJ4A 3Q3JB 5BXQC 3CPHA 1XTRA 1Q44A 4WZ6A 3DOEA 1KY3A 1NJFA 2FJUA 5DHFA 1GKYA 2DFKB 1XBTA 2CLCX 1T5LA 2EQBA 2F43A 1II9A 1AIPA 1DAIA 3W8NA 2QG6A 1R0WA 2QORA 4C30A 1P6XA 5TDHA 4XWKA 1E2DA 1E1QD 2OBMA 4V0OA 4Q9KA 3CUEF 5J40A 3M0EA 3W9YA 4NE2A 4BLTA 5ELXA 4HUQA 2VO1A 4Z8XA 4XWAA 2PX0A 1LV7A 2DY1A 3LVQE 2E1RA 1Y63A 2ZJYA 3E1SA 5EXTA 1EFUA 1E79D 1P2UA 1OYWA 1ZAKA 4HZIA 3HJNA 4TLCA 2GNOA 1IXRC 1CR4A 2KE5A 2OCPA 1CS4C 1VCMA 3BB4A 1P9RA 1EXMA 3CIOA 1XNJA 4HYYA 3RS0A 2W0MA 1AJEA 3BERA 4LJ8A 4L9WA 2BM1A 2IYXA 2Z0MA 1JQJC 2ZRLA 4GMDA 2P6NA 3LD9A 4LBWA 3TSWA 4F92B 2W6JD 4HLUC 4A0GA 2QY9A 3W8RA 4JBYA 4OQXA 1GTVA 3RVBA 1J2JA 1TPZA 1OHHD 2H8KA 5CK4A 3ZYCA 5G40A 1LNZA 4Q48A 1OE0A 2RHDA 4JL8A 3DZ8A 1CTQA 4GSYA 2JCSA 5FBQB 4EQ6A 1KYIA 4ITRC 1E98A 3AP3A 2OBLA 4A36A 1W47A 4C4PA 1RKBA 3LX8A 4PHGA 3GMTA 4M9XA 1UFQA 1ZNWA 2N42A 3HU2A 5B2ZA 5J4HA 1KAGA 3ZDQA 3H2YA 3LW8A 1ELOA 4Q1FA 5FUXA 3H4MA 5K8UA 4DLUA 5HZKA 3Q85A 721PA 2OFWA 2ODEA 4IJMA 2BCJQ 3O8BA 4NYIR 4R9UC 5IK2A 1RIFA 4ZI2A 4TLBA 2D3WA 3ZZUA 2IWHA 2WM9B 4G5GA 4XWOA 4HB0A 2QZ4A 4RFSB 5EE3A 5FBVB 2ZSBA 2VQSA 2WSSA 4HATA 4W9MC 4PPQA 4FD2A 3LBHA 4W5HA 2ZRNA 1VDZA 1BS1A 2OLJA 2ZRJA 5FPHA 1E9DA 4PC6A 1SULA 5F9FA 1Q0UA 4FCVA 1KSFX 5JCZA 1CJKC 2X2EA 3QF4B 1R5BA 2CK3D 1EFRD 4JVNA 1JR3A 3QKRB 1TX4B 4Q9LA 2R6AA 2ZU6A 4Q01A 4P4UA 3NBYC 1EESA 4O2LA 3U3OA 3VHXA 1GVNB 2BEKA 6Q21A 1G5PA 4Z51A 1E9AA 1XDBA 2V4ZA 1IBRA 4M1WA 2ZTSA 4M1OA 4TLAA 3RAPR 3MWKA 4R2HA 5EUMA 1NSFA 4B3DA 1G7CA 2OO7A 3DVLA 3K0EA 4A8JB 3Q7QA 2VPPA 3OEHA 3PV0A 5AJXA 3SFZA 2AL7A 1G8GA 1R6BX 121PA 3ZZTA 3ZVLA 3P26A 1X86B 4F93B 1S2MA 1SHZA 4U00A 3U4QA 3C41J 1E0SA 1COWD 4Z1MD 2RGDA 1UBCA 4O25A 1XJ0A 1YZQA 3G82C 5KSZA 3X1ZA 1XMIA 2GBLC 1KMHA 2EFGA 2QEQA 1XB2A 4I99A 2QAGA 4CEIB 1DTSA 2WWHA 1OKKA 2YNMA 3SOPA 1WB9A 1HQYE 3QXXA 4HDCA 4TTPA 4MYCA 1BMFD 3D8BA 4N3NA 2ZRBA 2ZITA 2PEZA 4FMCF 4CIDA 1GRRA 2H57A 4JT4A 1LF0A 2VA8A 3HDTA 1W36D 4Q1BA 3AF3A 1G3IA 3B5JA 2V3CC 1U81A 5EE5B 5H8WA 3CRVA 3REFA 3KQHA 5EP2A 4QC2A 1X3SA 2XXAB 1ZM3A 1N0VC 2QMEA 1N0WA 1P5ZB 3HU1A 5DIFA 4ESHA 3U3JA 4DIDA 2V9PA 3UATA 5HPYB 3K53A 5IF9A 1T3HA 3K0FA 4H9GA 3MWJA 1NVVR 1O87A 1N25A 4JLMA 1SQ5A 4Q21A 1ZJ6A 1VCIA 3VTKA 1FX0B 3GFPA 2BMFA 4PTLA 2ATXA 5LB2A 1NBMA 2IEYA 1OYYA 3MSXA 3WMGA 3SI7A 4D6PA 2CVFA 3GLGB 4MUAA 5TY0A 3FHTA 4QHYA 2SHKA 3G0HA 3A58B 2WWWA 3WHLA 3GPLA 3BFXA 2IC5A 1Z6AA 3C14C 2KBFA 1GZSA 1FPMA 2JDIA 2PL3A 3BBPA 1AKYA 3THWA 3KXLA 5DI3B 1VG9B 3IGFA 1GAJA 3B1VA 4D80A 1G3QA 2VBCA 3EIQA 4TL7A 1E2NA 1C1YA 1TL7C 2ASEA 4QGFA 1HEIA 3SU8A 4HLDA 1PLJA 3I61A 5EQTA 2X1VA 3OAAD 1HTWA 4DT1A 5JHHB 1ZNYA 3K9GA 4EIWA 3ZGXA 4PHFA 3PUYA 4FWTA 3I8XA 4I1UA 3K0CC 4OYHA 3QE0A 1J70A 4JLJA 1VIAA 4C3ZA 4A8JC 4JJZA 1UAAA 2P5SA 2QUZA 1OXSC 3PUXA 2JLQA 5IT5A 3U3MA 4QGGA 4JIMA 3ONWA 4JLPA 2P3SA 3B85A 3WYAA 3DHWC 1NY6A 2A5GA 3Q8XB 4RD4A 2G88A 3S1AA 1ZBDA 2LKDA 3LX5A 3QEOA 4TMWA 4DJTA 2JATA 4RJLA 2XGJA 3TNFA 4BFXA 4GOKA 2XTNA 1G6HA 4TLDA 1U8AA 1NJGA 2NO9A 4TQ9A 1KAOA 5FH9A 1XCGB 4LZZA 1S9HA 3THYB 4HAUA 3NDBB 1DG1G 3WRXC 2GDJA 2R6GA 1WF3A 2WV9A 4YDSA 5JHGB 3DM5A 3JVUA 1R8SA 5P21A 2F3TA 4AYWA 2OESA 2VP0A 2W6IA 5JEDA 3QENA 4OQNA 2C04A 2K5UA 3R20A 4NTZA 2C78A 3UMRA 3X2SA 4C0QC 5FPTA 3N2EA 2QE7D 4A2WA 2C96A 4DC9A 2G0TA 4LV6A 4DUGA 4MKHA 2D74A 4ZPXA 2ZYUX 4CVNA 3U5ZB 4MUBA 3B9QA 4TYWA 2I4IA 3NBFA 5G41A 2HXSA 3PFIA 1Q1BA 3KFXA 2J1LA 3CNLA 3HU3A 4PO1A 1G9XA 4IFBA 5FTNA 3WRYC 1NNEA 2O8FA 5L3QA 1F2UA 4LYFA 4PC2A 4XH9B 3CM0A 4URWR 1ZUHA 1R7RA 4I1OA 1E0JA 4L15A 5J4LA 3CRMA 3T5GA 3OIWA 4X8MA 4B33A 4UXHA 3CPJB 3PENA 1E2FA 1KI2A 4JKIA 1J99A 5GJCA 5BN4A 4IVRA 4FMBB 4TMVA 1TU3A 4LJ4A 3ZVRA 2IT1A 2XNSA 1BH2A 2ZE7A 2GVZC 1BIFA 3J81k 3UXMA 3N2IA 4YXWD 5FOUA 3LLUA 3KQLA 1UEIA 3NH6A 2FFAA 2GESA 2OFXA 3GLHB 1GRNA 4NH0A 4MRVA 4D4JA 3K09A 4Q9IA 3VNVA 4PAMA 4A0FA 2GRJA 4B34A 5K8TA 4A15A 1SZPA 2B6HA 4N1AA 1U0LA 5KO2A 5JS7A 4M53A 3AVTA 1NMYA 1XEXB 3GLGE 2JJ2A 4EPTA 1D2MA 5KTYA 1GP2A 3BXZA 2QAJA 4NHOA 3C4JA 2EWVA 1YKSA 1Z83A 4DEXA 1N5LA 5CDFA 4HZUA 1IHUA 4F4CA 3SBEA 3TVDA 4OQFA 4R2IA 2Z4SA 3QPWA 4ZDIA 1MRNA 2DFLA 1E32A 1N6OA 2AK2A 4NCHA 1U9IA 2DB3A 2YWEA 4Z54A 1TADA 1W49A 2ERXA 4TMZA 4G5OA 4PANA 4GOXA 2NMVA 4Q4JA 4JLVA 1E2GA 2WHXA 3LDAA 5IHPA 2F7SA 2RAPA 4Q1DA 2ORVA 2WOOA 1LY1A 3B9PA 3WYFA 4EPXA 3SYNA 1LB1B 4PQYA 1FOEB 1G3UA 1YZNA 1KI6A 2CCKA 2FF7A 2ZROA 5B58C 3MLEA 2P0EA 1MT0A 1W1WA 1ZUIA 4EPRA 1CBUA 4RD2A 2N46A 3CB4A 1CP2A 1E2QA 4ZDJA 2Q9CA 3C7KA 5F2EA 1NLYA 3C5HA 4X8LA 2J0UB 3UMSA 1YZTA 4RFVA 4KFSA 2WSMA 3OIVA 3B60A 1W4CA 2D06A 5JJLA 3DDCA 2A5DA 4JVSB 4LJ7A 5D3MA 4C0BA 4M9ZA 3TAHA 1GNPA 3SDZA 4PSKA 4QBGB 3VX3A 1Z47A 4P31A 3RWOA 3FFAA 1OXTA 5L8VA 4AKIA 4I4LA 2RGAA 5BN3A 5KDOA 2J45A 5HE9A 5FR2A 2G6BA 4KAXA 3AVVA 4GFDA 2OM2A 3U44A 1P7CA 2D4HA 3A1SA 1OT3A 3RS7A 3IIMA 3UIEA 1RW4A 2HXYA 2IYVA 1A2KC 3FWYA 1Z08A 2B21A 4KO8A 4D4MA 4PFSA 2O8CB 5JRZA 2BKUA 2G3YA 4QG7A 4UNNA 1ESNA 2BJVA 1JI0A 3V00A 5JSZB 3SZRA 1NVVQ 2VSXA 1XTJA 1E2KA 3QVVA 2QP9X 4PQFA 3U6BA 5KHOC 2A30A 1P61B 2CJWB 3WHKA 4KFUA 1UDWA 2YOHA 4MITA 2H7VA 4QM6A 3CPEA 4DCVA 2MSCB 4Q4AA 2ZVPX 3UANA 3CF2A 1GM5A 4LJAA 2ZAOA 2VHCA 3CX6A 2GAOA 3NH9A 2AR7A 3VR3A 1IXSB 1R0YA 1XXHA 1ESMA 4BFVA 4MGZR 3RS5A 4F4JA 4QNMA 3WNCA 2A78A 5KUTA 2QM8A 1E9RA 1C4OA 2WJHA 1DAMA 2HT6A 1EGAA 1SVIA 4PHHA 2G83A 2V55B 5DE3A 1F48A 2CNWA 2BCGY 3FDIA 4AKEA 1Q57A 2QPTA 3OIUA 4XSGA 1E9EA 2QMOA 1S9DA 1ZP6A 4C0LA 5KU1A 4ESVA 1X8LA 3RS3A 3NEYA 2IW3A 1DS6A 3I5YA 1E99A 3GJ5A 2ZUCA 4IDPA 2P6UA 2BMJA 3VR2A 1QVAA 2ZS8A 2ZRDA 1SKQA 2YYZA 1KKLA 4QXAA 1SVKA 4Q9JA 3TH5A 2FU5C 2NZJA 2OCYC 3LH5A 5AUNB 4YMVA 3CONA 4TMTA 2ZRIA 3BB1A 4IW3B 2FDCA 2ZYWX 1G8FA 2JIZA 3UWOA 3TIFA 1KDRA 4YC7A 2CE2X 5LDDC 1CEEA 5FL7A 5L3SA 1Q3TA 4LYHA 4A6PA 1RVDA 1II8A 3K8YA 1G4UR 2J9RA 4HAZA 1TAGA 1VPLA 3AGQA 4HEJA 1W5TA 3QIAA 3VU9A 3WP1B 4EQ6B 2MSDB 4LV8B 5EE0A 4EKDA 2ZI5A 1NG9A 2DWQA 4LX0A 4DSTA 2KI5A 4UJ5A 1TF7A 1SHKA 1XTKA 4OQMA 5AUOB 2WWXA 1L4YA 2QT0A 3AVUA 4QBIA 3TW8B 1E9FA 1W0JD 2OILA 4OL0A 4LPKA 4B3FX 1MRSA 4IOMA 3FPAA 1XD8A 4KLNA 2ZRMA 4TQAA 2YV5A 3ZZ0A 4A2QA 1TU4A 3CX7A 4JLDA 3LLMA 1UF9A 4Q7KA 3K0AA 2WPDD 2WBLC 3W6PA 5FTMA 2ZXUA 3THXA 2BV3A 2GZHA 3CR7A 1OXVA 1G20E 4B74A 1KKMA 4AY2A 4LK2A 4D82A 1UEJA 3A8TA 2PLRA 1E4VA 2F9LA 2OE2A 4TL6A 2WICA 1IAQA 3D7MA 4B6EA 3AKEA 1E69A 3LBNA 1N2CE 1A2BA 1QHNA 1ZINA 1WA5A 2WOJA 4D25A 4AKGA 4WOPA 4MYTA 4Z8YA 2ONJA 1IN5A 1M6NA 4Q1EA 4GDFA 3E2IA 1D2NA 1CJVC 3VX4A 4A6XA 1KDTA 5JRJA 3B13B 1OJLA 2Q3HA 1P2TA 2XOKD 5CB8A 1LS6A 3LXXA 1VG8A 1F6BA 2ZRCA 3O8CA 3MGCA 1JXOA 1S8FA 3GLFB 1R2QA 2FOLA 2Q9AA 5JJIA 1N6NA 1G7TA 3FKSA 2B7BA 4OJQA 2OAP1 4FIDA 4II7A 3R7WA 2XSZD 2JJ1A 4KU4A 2AD5A 3U4QB 1RJ9A 2CL0X 4R71A 4DDUA 3DZDA 3ZIAD 3BJIC 2FA9A 2QENA 3VAAA 1KMHB 1NN1A 1GL6A 3HYTA 3AEZA 1S1MA 2QAGB 1W5SA 5LBIA 1M7GA 4XVRA 4JBXA 3SJCA 3SQXA 4P4TA 4BLSA 1SVMA 3JZAA 4XVQA 1E9CA 1P60A 4P4SA 1L8QA 2FG5A 3SYLA 4A0HA 2JEOA 1OIVA 2IYYA 2IUTA 4YMTA 1DVRA 2DPXA 2XX3A 4PSVA 4CEJB 4PAOA 1H8HD 5DN6D 2OG2A 1NKTA 2NGRA 2ATVA 4V0KA 5L3VA 3LRPA 2C95A 2ZS9A 1OXUA 2XNDA 1VCOA 2XZPA 4RVCA 1DEKA 3CNNA 2AKAB 3OFND 5D3QA 4MRPA 2RGNA 2R44A 1EX6A 1OH5A 4NZYA 4LI0A 2VLIA 4B6FA 3RS2A 1L7VC 4CZ2A 1Z0DA 2JA1A 2Z5FA 4O2RA 2X8AA 1KIMA 1UKYA 3F5FA 3FOZA 3CRQA 4P32A 5JWOA 1ZMXA 2YVUA 4LYAA 1QHHA 4CEHA 1ZD1A 1G16A 2A5YB 2PBRA 5FOSA 1TQ4A 3OF5A 3RRYA 1IQPA 4GOJA 2WMOB 3ASZA 3LBIA 3AH8A 1E1RA 4BFWA 4TTRA 1U8YA 1G8YA 3C8UA 2ODNA 5TARA 2MMCA 4PZLA 4WZBE 3THWB 5J5CA 2VEDA 1NF3A 1G64A 2QPAA 4M0LA 3IQWA 3P32A 2QROA 1G291 1OLOA 1Q1ZA 1FTSA 3KQNA 4HLCA 4EJSA 2E9SA 5LD2B 5CYOA 4YONB 1ZIOA 4MH0R 1F2TA 1S3SA 3SHWA 2PT5A 3L43A 3L8YA 1LTQA 3EZ7A 3BGWA 1K6MA 1IY2A 1VKJA 2WMNB 3AKYA 4TWZA 3RWMB 4XD7D 2FN4A 4Q02A 4URZR 4QL3A 4DT1B 2RGGA 4Q7MB 1Q1QA 2ERYA 2FPMA 3OZXA 5HTKA 3U7FB 4PX9A 1XX6A 3L0IB 4KHZA 3ADCA 2Q9BA 3ADBA 5DGXA 2IXFA 1ZCBA 4DLWA 5JWRA 1FNNA 1WXQA 2WKRA 3EZ9A 4C0JA 4MDEA 1J7KA 4FCWA 3EIHA 1NG1A 2D2EA 4M9SA 5FOXA 1G3RA 5SZKB 5DLQC 3O47A 1E2LA 1E9BA 3R9WA 1KSGA 3RHFA 2WJGA 2EYQA 2F55A 2J5XA 3FMIA 4C2TA 3PEVA 1M74A 2GJ8A 3WNDA 2ZRPA 2RGCA 4HAWA 2WAYA 1QF9A 2C8VA 1ZVQA 2QAGC 3GLIE 1ZU4A 4B2PA 4E5UA 1AZTA 1PJRA 4E03A 5DHAA 1XP8A 1KSHA 3NWJA 3PR1A 3KQUA 2A5FA 1DAGA 4BFTA 3A36A 1H8ED 1JBKA 2VYFA 2GXSA 2O0JA 1DADA 2JAQA 2R6DA 3D6TB 3F0TA 3SJZA 2O0KA 3GLFE 4MGKR 4CW7A 5BWMA 3IHWA 5DO9A 1I4DD 5BYKA 3TSZA 3AVXA 5EXXA 1UKEA 1ZM2A 5F9HA 4XTCS 1Q21A 3L8ZA 3ECCA 2QBYA 2IXGA 2HCBA 1A4RA 2ORIA 2QNRA 4G0NA 4LJYA 2F1JA 1DELA 1F2UB 1XD2A 3KFVA 1B0UA 1BOFA 1I2DA 1UM8A 2QSZA 4ZV4A 2AXPA 4MQBA 2TMKA 1SKYB 4HI0E 4ZIRB 1Z0IA 3BH7A 4D26A 2WZQA 1RPZA 2IYTA 4TZ6A 4E07A 2ZSFA 4BASA 5LD2C 2O8EB 3KB2A 2ANCA 3K9HA 1ZW6A 3QKTA 3RC8A 2BHRA 5FI0B 2IX3A 3EX7C 1XEWX 1DARA 1R5NA 4LV5B 1N6RA 2ODWA 1SVOA 1A5TA 4MYHA 5KNCA 1SVLA 2J3EA 4KSBA 3ZVMA 2IL1A 3MJHA 2OV2A 2ZR7A 4NYJR 2AHOA 1NVUQ 3AF0A 1ZYUA 4TT3A 2Y8EA 3I8SA 3GJ8A 1KJZA 2FSFA 3TGPA 3KDSE 4TLEA 3QY0A 1Z29A 2WJJA 2PMDA 2ZE5A 2QTVB 5FTJA 1IY1A 2PJRA 5CJ2A 4WIAA 5CM9C 3RNLA 4LUCA 1Q22A 5HKKD 4PZZA 1DAKA 4ACAA 4IRUB 2G1JA 1EFHA 2GCOA 1GUAA 2FZ4A 3I3SR 3P1JA 1CXZA 3DO6A 4Q4HA 4JYBA 3W90A 3C15C 4Q4JB 4L9SA 1NMZA 5C18A 3IPYA 1HV8A 1R0XA 3A4NA 1YZKA 3MAAC 3NVAA 4FMDB 3TUZC 3SQWA 2JASA 3RLFA 4BEJA 3E70C 2VP2A 5BYJA 4ASUA 1Q3HA 1UBFA 4O0MA 3FYHA 4PC1A 5F98A 4B3GA 4QKQA 4Y0AA 4PC7A
chains in the Genus database with same CATH superfamily
3AINA 1EFKA 1Z4MA 2WJVA 4HFMA 4B0PA 2CWWA 1SKBA 3DL4A 2G1KA 3F78A 1AH2A 1H2XA 1FZQA 4KQEA 4PZ9A 5EPUA 4AMYA 5TGZA 3WWYA 2VNKA 4LZLA 2D0PB 5FLEX 5GV7A 3PDUA 3RAJA 3A06A 4ZZ1A 4GGMX 4OGLA 2WIBA 5LZ9A 4ZREA 3NBXX 3RSOA 1ENPA 3M5DA 3SY8A 1KK2A 1CJUC 3UK6A 1A8UA 5LMZA 1I1HA 3IO5A 3ADKA 1UKVY 2CNNA 3KKQA 3U6BA 1N92A 3EOBI 4GPD1 3MWDB 4LDJA 1ILEA 2DWPA 2VPYA 3LPMA 3O8OA 5IKXA 2YC4C 3EEOA 3WHPA 2LP4Y 2Q29A 2NU7B 3U80A 1OFVA 3WGGA 3AK4A 4KXYA 3EVTA 1SPXA 2QR3A 4I0WB 5AKHA 3RUDA 3T99A 5K0JA 1OIWA 1WW8A 4ADSG 3OMWA 5IM4F 2W00A 3AFNA 3Q1LA 4QBFA 3DKRA 1MAVA 1NE7A 3PI7A 1GQRA 3IKTA 1U7HA 2AN9A 2C54A 1IOLA 2F3RA 2O52A 4HEQA 2Q5JA 4Q15A 4RCYA 2Q3FA 2ZSJA 4TT8A 1O96B 2ADFA 2ZIGA 1QE0A 1TI7A 1G6OA 1E63A 1FFBA 2F59A 2R7LA 1A5BB 1OXXK 2J46A 4PBSA 2OP0A 1KARA 3F3SA 1WD5A 1ZOIA 4P54A 5A04A 1H4SA 4L16A 4BHTA 1N7IA 5INTA 5LYJF 4EYOA 1XRSB 4L27A 3I58A 4NOKA 1QFXA 2YXDA 1W9HA 1Z82A 2KBEA 3DMRA 5B30A 1FMJA 3QELA 2GEJA 3NIWA 4P83A 1RZVA 1E4OA 2GAIA 4ZV9A 2RHOA 3BQ9A 1O5IA 3HYRA 3PUZA 4XIYA 4YRIA 3FDJA 2F8SA 3EGWA 2GEDA 3M6MD 2KLHA 2YWGA 4WN3A 3N0XA 1PZMA 3MB5A 2J0QA 2W6JA 3OJLA 3D64A 1T2EA 4V1CI 3QVSA 1LJUA 2X2OA 5A3SA 4GOOD 4F8JA 3EZNA 2ZJOA 5KKAA 5CNJA 2XUJA 3BMXA 3IT0A 3QXJA 5SYAA 1EU1A 4NCNA 2AWOA 3LC7O 3K5WA 1KDVA 2IEZA 3IUBA 4ZEMA 2VNAA 3EY4A 3L1HA 3VNAA 2AMVA 2ZDQA 1DO2A 1YA4A 3DOFA 2W6QA 3GJ4A 5E1MA 3C3XA 4AG5A 1BFDA 2H1OA 5AKJA 1YK1A 3ENVA 4RETA 4XSHA 4AO7A 1BGVA 4YT4A 2NSDA 2AMYA 1XA4A 4Q1VA 3SXPA 3TBKA 4RFSA 1EFPA 4JJ7A 1XRNA 2ZSDA 4CBVA 3AYZB 1AD2A 3TZCA 1MEEA 1X1AA 5FL3A 4BQPA 2FETA 1CT9A 4TV9F 2OZEA 1RAFA 4AZVA 3E9MA 2WD9A 3LCJA 4D8UA 3NALA 1P8AA 3N8HA 3DVQX 4QSHA 5FUWA 1W46A 2Q4EA 2VT2A 3JQRA 2VRBA 1P2BA 1ADYA 1CJMA 4ZTUB 2W8BB 5I7AA 5SZIA 4MR8A 3JZIA 4HDMA 3U3ZA 2G4VA 5AHKA 4XJVA 3G0IA 4DM7A 3MD0A 4DWVA 2Y2UA 4Q1CA 4BEBA 4LC9A 3U4DA 1CRWG 1LDEA 3QUAA 1XVIA 2XECA 4TMXA 4D0NA 2RJNA 1ZIPA 3IPAA 3FGZA 3SC6A 2YVKA 4RF3A 4RKFA 2CUZA 2ZJ8A 5EMJA 5IAEA 2GXAA 4E2WA 3WG9A 4KXUA 4ZYVA 5IRCD 1ZGHA 2R85A 2CK3A 4TN1A 4TL8A 4Z0HO 5J47A 1F8FA 2BTOA 2PZKA 3OCYA 4NYIQ 4D9IA 4X65B 1Y4DE 3H1BA 2V5VA 3PD7A 1MB4A 4I4CA 1T9HA 1KU0A 3OOWA 4BN5A 3VU9B 2PX6A 4ZMSA 1P0FA 2JFYA 1OR8A 2G9RA 2OCAA 2VHZA 2PGXA 3MJVA 5HFNA 5GVSA 4J9UE 3KQTA 2WW8A 3QFSA 2OBNA 2GA9A 4ANFA 5I3ZA 4MQLA 3LX6A 2BBWA 3Q6IA 1I3MA 1EVEA 2ONYA 3UQZA 4KXNA 2REOA 3RV4A 1WCV1 3P2JA 3MGBA 1HT0A 2I6GA 3KJZA 1N1DA 4EUNA 2FFHA 1AXRA 1RP7A 3RHTA 3WMFA 4QJIA 1WAMA 4MYRA 4P3YA 4QPDA 2Y66A 2HJHA 1ISHA 4L95C 1BWQA 3IC5A 4DQ0A 1N3LA 1I8TA 4RGQA 4WFQA 4B31A 5IBCA 1TVKB 4C20A 1NL3A 2XJ9A 4GI1A 1AUQA 4E2ZA 2B2NA 5JJBA 3K15A 5KYWA 4B79A 4NABA 2HIHA 2CW5A 2FQ1A 4JL6A 4L85A 5KVAA 1KMIY 5IUKC 3EZFA 3ILSA 1C1HA 4B35A 1K4YA 2UYQA 3NGLA 1KFBB 1Q92A 4DGQA 4N9WA 1E1CB 4EYKA 2BGIA 2ZUSA 3QQ5A 1YCGA 4U00A 2VWHA 3CNBA 5EC8A 3CS3A 2FMTA 2IYUA 4BE4A 5FFNA 3V97A 1Z0SA 5HIIA 2FDXA 3RVOA 2J7PD 4MHOA 3PGJA 4K28A 4QYTA 3QBTA 3CT4A 5I9NA 1T3LA 2XCQA 3T0GA 3QWHA 4FP9A 3PWSA 5HKAA 2K2WA 4I7EA 3AJ8A 2FPIA 4FMDF 2O3SA 1GEEA 2BFCA 4XX0A 5AVKA 4QM7A 2QP3A 5EIHA 1UZLA 4N5LA 4TVKA 3HWSA 2RH5A 5BPHA 1ZVJA 3G8DA 1SNYA 3IPLA 1FQWA 1KPHA 4CLDA 3ZXSA 3ETNA 2OAGA 3AY6A 4JELA 5E1DA 1N5IA 3HXTA 621PA 3I6YA 1QG4A 2TSYB 3OI7A 2ET6A 3LWDA 5F78A 3L79A 3MCUA 2P65A 4ABTA 3BMNA 3JQGA 1M7HA 1X8JA 1ZMTA 3F6PA 3PQ3A 4N82A 3EWAA 4PW0A 5CTAA 1L8AA 1U1IA 2I8CA 4KQWA 3TFOA 4G4SP 4Y1RB 3KRTA 3ZDAA 2YINC 2J5RA 4NP6A 1WHSB 1U7TA 3GZNB 3I4FA 4S1OA 2CDBA 4FYPA 5J43A 4ZHQB 2R2AA 4JHXA 3RYFB 3H2JA 4DJDC 3E4DA 3WRVA 1MC1A 4YRGA 1RDFA 4A36A 2Q5CA 1X7XB 2XB6A 1TUEA 1AQYA 4K26A 3WV4A 1YS2X 1F2DA 3CZAA 1RRMA 2NPOA 4EB8A 2HLDD 4ZVPA 2VRNA 2EKQA 1U2DA 3NDPA 5DYNA 2HQSA 4US2R 1VKOA 3DDNA 4MQEB 1A2OA 3QVOA 1SBNE 4P5EA 4FE3A 4Z2AA 1MJGA 3IURA 3NCTA 4QJ4A 6LDHA 4FHGA 1R6VA 3BJEA 1U2RA 3NQ41 3DFMA 2AE2A 2WA2A 4YJ3F 3CW2A 2QMHA 4LWPA 1UFKA 5DVZA 4P3NA 5T4HA 2C07A 1N2BA 3ROTA 4B3MB 2PUBA 1HLFA 1W4RA 4UVGA 3WL6A 2G36A 1ZK0A 3I6QA 3DEIA 4LDZA 2BONA 3CQ9A 4FSXA 2ZYIA 5K4AA 5U1PA 4WMLA 1B43A 1MQAA 2R62A 3G7NA 3QP9A 2EJTA 5HE8A 1D2EA 1FXSA 1WD7A 3L49A 3LPLA 4F1WA 4G5QA 1UWKA 3IKVA 3CXRA 2JGNA 4I81A 3VZQA 4I6GA 2F43B 3JWGA 2NU8A 2A0KA 2B99A 2BY4A 2XMBA 2BTQA 3RFCA 4AF8A 3I5XA 3O8NA 2ABWA 2R5FA 4FFBA 4LWZA 4OAPA 4BQRA 1GILA 1SB9A 2EYUA 1D5WA 1VCNA 2XOXA 3IQDB 5SYMA 3QX8A 1P44A 4Y9DA 4US0R 2VQ3A 5HKOA 1XJQA 2GO7A 3GLHE 3ZE0B 3G8YA 1OTXA 3TFWA 1L7EA 3MAGA 3BPSA 2NO7A 3W8FA 3SEZA 3Q3IA 2Q62A 1P4AA 3X1DA 2H1RA 2BM9A 3EWIA 3EEFA 2PUHA 3KUKA 3WGTA 4UQLA 2E6UX 2GCIA 3IPXA 1XPOA 1V8OA 1I2BA 1I2MA 2QRUA 4CLOB 2ON6A 2BIFA 1PRYA 2MSWA 2YDXA 1F06A 1NXWA 2EATA 1UP6A 1DU4A 4ZOEA 3ST7A 3ZQKA 4BJ1A 4DEVA 1UXGA 2IPLA 3FMOB 3I83A 3MBIA 3P0HA 3EW9A 4PG5A 1WZCA 3NFRA 1DAPA 1BHSA 5KYKA 4QRHA 5H9VA 4ERNA 2A35A 5DBIA 3SHVA 2E5WA 4JMPA 3DE6X 4GP7A 1CR6A 4EB6B 2P6MA 4CKWA 2VSFA 3H0EA 3BF7A 3L0PA 4O59O 2XB4A 4RZ2A 5TMPA 5C34B 2ANBA 5DH9A 2GN6A 3VV2A 4K9LA 1A9OA 1U5BB 1W94A 2P5UA 3F3YA 3MWLA 2XMDA 1E6WA 1CZKA 4HQNA 4BKOA 2E85A 4CL3A 3FAKA 3HM2A 4ARCA 2GERA 1B2LA 3FX2A 2DEUA 3PSHA 4JJKA 1T8YA 2HCJB 1VLZA 3P52A 3RYTC 2XYVA 4JH0A 4EHBA 4BFYA 3AW9A 4NULA 2IS6A 1S8OA 3AB3A 1CRPA 4Q9HA 4JR0A 3WL7A 3AR2A 2CJFA 5BT9A 4BNJA 1NPTO 2WSSD 1OLXB 1QIHA 1PHRA 2HMUA 2JI6A 2VEOA 2QJOA 3IILA 4PRYA 4CF4A 3I1YA 4XOIA 4UHJA 2Y1DA 1NXQA 3ROPA 5BOSB 4N18A 1ID1A 1P6UA 1R0ZA 2LXNA 1R74A 2J32A 2W4IA 3BEOA 4GWLA 4CMBA 1KVTA 1W0CA 3OM1A 4YXWA 3UJAA 1RQLA 1DHTA 2IU6A 3U5TA 1WS6A 2BTEA 1RXSA 1JG7A 2GD6A 2QQ5A 2KJQA 3WQBA 1IM5A 3IDAA 2EBHX 1KNXA 1T0HB 2QM7A 3JARA 3N8IA 3OJWA 3PLRA 4ZARA 5C8YA 5JC1A 1ZOSA 1JI3A 1GPBA 1XZPA 1U8EA 2VAPA 4BV2A 1NQUA 2VSNA 3RU2A 1M0EA 1J8DA 2I3AA 4BXOB 2QBYB 1XAJA 1PCXA 3RHZA 5A9SB 2J6BA 4LNAA 1V35A 2FFBA 1VE1A 2SKDA 3PHGA 3ESAA 4KX5A 4RA6B 4AS1A 1Z6XA 3PPWA 1K0FA 3WJ1A 4QFCA 5ENDA 2DBVO 3CKLA 1EP9A 4DIMA 2BFBB 5G4KB 4F38A 1NVXQ 4CETA 3CRW1 3OJEA 3TEMA 1HZJA 4Z4CA 4PX5A 3GN2A 4WV3A 1FDSA 4M1TA 1P33A 2OORA 2CV1A 4CM7A 1GTG1 1KC1A 3C3KA 5IW8A 3P45A 3H04A 1YUMA 2C9CA 1LVGA 2VBFA 3R3VA 4UXIA 3ISVA 2XTMA 4E4YA 2HGSA 1OVMA 4EO7A 5L53A 3PBKA 2OXEA 4L8LA 3MOIA 4HEA1 5DDIP 2OKGA 4C03A 5BW8A 3AM3A 5JT1A 1O5OA 1E5DA 4YUZA 1I7QB 1MO2A 1XKTA 2WUWE 2V6JA 3WGQA 3VM6A 3ZHYA 1R0KA 2CLKB 1YZHA 3I9KA 3WY9A 3ONFA 5BNWA 2B92A 1PL8A 4CCWA 4FCTA 2WF6A 1P7PA 4ZCQA 3W04A 1MJFA 2ZEJA 1IQRA 1JSCA 2Q6KA 3IMCA 1S2LA 3RK0A 4N49A 3FLAA 4WK0B 4DSOA 2P1ZA 5B4TA 1IH8A 3E48A 4IHQA 4LC0A 4INZA 2HK9A 4C7BA 3EQ6A 1VHDA 3V1NA 2WEKA 2GNPA 1VKNA 2AI2A 4FGZA 1MV5A 2NUAB 3TNLA 2Q2WA 4AKTA 3L5KA 3N9IA 3R0IA 1FW6A 521PA 4BNWA 1E3EA 4B6RA 3JSXA 4MDFA 1GPAA 2HF9A 3E3AA 3MS4A 3ZDEA 3SQNA 4J0KA 2IJGX 3CZRA 3ICWA 4Z3KA 3MZ0A 5JQGA 1VG1A 2NU9A 2ZIXB 3W9UA 5HDQA 3QSGA 5CA1B 2KHZA 4KE7A 4C6TA 3AVOA 3KAJA 1FJGB 1ONOA 1S01A 3B36A 5I48A 4A9AA 1FVFA 5THKA 1DAOA 4M2LA 3MUEA 3N6XA 3KDAA 4K9DA 2IU0A 1OFHA 1DDIA 1DPFA 5AXBA 3X1JA 3QEBZ 5FOQA 3GA5A 3SEAA 3HCEA 5A2QA 1R9NA 2WF5A 3CRNA 3F7TA 4QWMA 3SM9A 5I5EA 1WE2A 1XMVA 3DP7A 3FYUB 3F7NA 4CDRA 4B75A 2VP6A 4N3AA 3AFIA 1KOJA 3OZCA 2DPYA 2Y6VA 4IUBS 4P8RA 2GI4A 1EHIA 3JY6A 1NW5A 4YRSA 5GIPE 3U3RA 4DIUA 1R6AA 4EB0A 1YONA 2I2XB 3NYRA 3QX3A 3DFUA 1JPVA 2MIIA 4A1OA 1ORDA 1E2PA 2PTHA 4I6EA 3PHLA 4G24A 4BLOA 4UAVA 3G8BA 3SDSA 1XPRA 2D5LA 3PXCX 2F4NA 3LT2A 4QUIA 1UBKS 2JGMA 1XCPA 1H93A 1QTQA 2OTCA 1LBSA 4PX2A 1YZUA 5JNVA 4LRWA 5I7HA 1SQFA 3A1UA 5EINA 2JGAA 4XUGB 4P9NA 1A50B 2OMKA 4QJ5A 1Y5RA 3AQIA 3FNQA 1LZKA 1PJ4A 3N2LA 1SVWA 2AX3A 4IRMA 3OQBA 4MKXA 4QOSA 4ISCA 4RY0A 1J22A 2JAUA 3IQGX 3PWTA 3CF6R 3J80A 4GXNA 2Q2VA 3FCUB 4PYOA 5LNK1 2IYSA 1RTKA 3WLEA 1XVVA 3B6MA 3PICA 5HZGA 4D97A 5KC8A 3MELA 2RCNA 3SYRA 1ISSA 4HWOA 5I8PA 4J0JA 2XNCA 3TAXA 3BA1A 3TLEA 3C1OA 4EA6A 1RXCA 1WY7A 4CQMA 2IXEA 2IH4A 1C0EA 9LDTA 1KJJA 1QAOA 1BU5A 4NI5A 2CSXA 3O4IA 1Y6ZA 2JPDA 1QK5A 3JCZA 3L2OB 5GGYA 4DAEA 3AKCA 1QOQB 3G1UA 1FLVA 2Z2ZA 2DFDA 2IUEA 4XFDA 2IYWA 3TIVA 3CYFA 3KJEA 2F6RA 4FNGA 1E6CA 3IUMA 1S8AA 3F6BX 4GP6A 2VDWB 1AHPA 2JFWA 1RRCA 4NCJA 3T1VA 3OQIB 4OJTA 3CMCO 4TRJA 1RRGA 4EG1A 4KDEA 3AY0A 2FWNA 3KHTA 4UOEA 3VJKA 3WQHA 1PJ8A 4MQ6A 5DP1A 4L8YA 1Y8RA 3CF4A 1JYFA 5TSDA 1X38A 4U9HS 5JBIA 2CJYA 1E4EA 2P78A 3HKEB 1PO7A 2XGOA 5ILQA 2YCLA 4C4YA 2QG4A 4QOFA 2IZ5A 2REBA 3EXIB 1KERA 3DB2A 1Z2AA 2A2ZA 1ORIA 2ROQA 1ACMA 2AN1A 3JQEA 4QQRA 4RFLA 2FMXA 3NAZA 3OO0A 5KTSA 2R6FA 1DEXA 1QTRA 3DTVB 4AZ0A 2E4ZA 2BMAA 1PEDA 2EOAA 2G0NA 1UK6A 1NAHA 2V45A 3IT1A 1X94A 1X1SA 4M1ZA 3RVNA 1AO0A 3UMYA 2ZE6A 3UJCA 1IM2A 1N5RA 1N1EA 1NVAA 3KKMA 4Y9UA 1UMCA 3FTQA 3N0WA 3U4GA 2UXCB 1UBHS 3BWDD 2HW8A 1FNBA 3HUFA 2CL5A 1JJIA 3QLUA 3RK1A 3PCRB 2XR1A 1XGKA 4E6EA 4IKPA 4RZIA 4I3HA 4RABA 4RY8A 4DKXA 2M1XA 5HYVA 4AP9A 4BNZA 4RIFA 2O9JA 2XQIA 3NP9A 1U3GA 1PSDA 2CVHA 3C7AA 3GPDG 3HHEA 2OZKA 3HVJA 3MPOA 4D3XA 5LQRA 3GZJA 3OT1A 5AKGA 1ETUA 1QGYA 5AJHA 2ECKA 1TEVA 8ATCA 1Z2CA 2I2WA 3I04A 2IS2A 1I7LA 1MD9A 3BFKA 3SJBA 5JFTA 4K6KA 1GG5A 2PS0A 4D9KA 5C7LO 4UD6A 2BM8A 1G5IA 2OHIA 3E8MA 3RGGA 2GYWA 2WQZA 5FNVA 4FDMA 4DMRA 3NXSA 4RLHA 3GP3A 4TM8A 5B3JA 2X14A 1UWCA 2QZSA 3S7TA 2XBLA 1USVA 2E3JA 4GR4A 4IS2A 4Q03A 5EWJA 4AMBA 3TD9A 3BBLA 1TMOA 3CSUA 3UG7A 3ASVA 2PGDA 4HBZA 1ODKA 1D0IA 3EHEA 4HLUA 4Q47A 4RZQA 1EP3B 3ZIDA 3PR3A 1TIKA 4DS3A 2K7ZA 1NRXA 1QYCA 4BDSA 3O3OB 1ZITA 4KUEA 1JFLA 1L5SA 2G9UA 2V74B 3AB7A 3GA0A 1GLVA 1A96A 1GSAA 3ZR4B 5IJWA 4NE9A 4DRZA 1CUIA 4Z7QB 4MVWA 5B6PA 2WKSA 1YK0A 1R4ZA 3COYA 1L9XA 4IL5A 1QK3A 3M1IA 5AJZA 5BNFA 1XMQB 1CC1S 1GPYA 2JVIA 2IE8A 4BYGA 4B7AA 4HZUB 5A4FS 5BW5A 2HIMA 4FN4A 3O1HB 5FWXB 2XSZA 3Q40A 1QTIA 2SECE 4JJIA 4PGFA 1NRIA 1TKRA 1RBMA 3S44A 3WA6A 5CLQA 3L0BA 3MG9A 1NMEA 2LW7A 4CNQA 2C7GA 1NLFA 1PL7A 2J9XB 4N03A 4URYR 3IVAA 2E49A 1YVPA 1VLQA 2PLNA 4CN8A 3D3QA 5EOVA 3LK6A 3AHIA 1TJ5A 4JSTA 5EFZA 2C20A 2I8AA 4RHCA 1NMXA 1QH1A 5IYZB 1GZ3A 3R5FA 4GL4A 4X8HA 5IC6A 2ZE8A 5I3CA 4YAFA 3QH4A 1HNNA 4RDIA 2CFTA 3SZOA 1JPUA 1M5TA 2H1HA 4J6FA 4XYGA 3RC1A 1HG1A 4YMLA 3MT7A 3SIWA 3WBJA 1PNOA 1XNQB 1D4OA 1KI6B 1R9JA 4POAA 1DZIA 2CBZA 3D3WA 3IDFA 5KSYA 3G49A 3H1AA 2SKCA 3NJRA 4IOKA 4QPCA 5TPWA 3U81A 1A7KA 1F3LA 1ZD4A 2B5WA 5TRTA 5I5GA 2AOWA 1GTJ1 1AN0A 1BU8A 5BORA 4JVMA 2VAVA 3VGJA 5CB4F 4INPA 3OZEA 3WGYA 4H3VA 3GJSA 4ZVMA 4R7TA 2EDAA 1Q7CA 3EQZA 1SY7A 1Y98A 1A95A 2XAAA 1L7NA 4PLFA 4QFMA 2BEVB 2GPTA 2QTGA 1V45E 4FLMA 3T3NA 4KXQA 2H29A 4UPVA 5E4FA 3WNVA 1NQOA 1QVZA 4QDZA 4BS9A 2FUG1 2OK7A 2P3OA 1EYZA 1WSDA 1ZX1A 2FEPA 2JIOA 3M70A 2IYZA 5GONF 2AJBA 5BRAA 3TRDA 3LOUA 2ATCA 2GASA 1FYEA 3UW3A 4S3MA 3GP8A 1SPBS 4OHXA 1HORA 2J6CA 5REQB 5TF4A 4GX1A 2HF8A 3BA6A 3PUWA 3AF2A 3AU9A 4F9FA 3JAKA 1WU7A 1C7ZA 3PC8A 4P4NA 3S29A 3WGIA 3RSLA 4IGAA 1EFVA 3BTUA 5JZBA 5K4HA 2PG3A 5KOYA 5E7MA 5CT8A 1VBMA 4W5JA 3IXMA 2I2AA 4J7AA 4RADA 4IBOA 1Z6PA 2YWFA 4OI2A 1RRFA 4FR5A 4HWRA 2IV7A 3TQFA 4WL0A 2G5CA 3HNRA 1XRJA 5BSVA 1PFVA 4QBKA 4TUYF 1XNHA 4YMUA 1S2GA 4KV9A 3AEUB 3I32A 1QCDA 4DBVO 5B3KA 3U0BA 4GMXA 2IOYA 4DA7A 1NSTA 4TZ0A 1OGJA 1QV7A 3A2LA 4EPYA 2FW8A 3N0VA 4NV3A 1YDFA 1YQEA 2GARA 2PX5A 3JQ9A 2QTMA 1Z16A 1WDLA 4G2TA 2G9QA 4HEA6 4NFLA 4P38A 3EGDA 1EVKA 4ZU1X 3E3NA 2BOVA 4KE6A 2VIIA 3IOYA 1BYUA 4DLRA 1NURA 4DJFC 4W99A 5G3YA 2WWRA 1US8B 2G08A 1YXMA 4IXMA 5TVKA 1OIXA 1XXHB 2LPMA 4RENA 4HQ6A 5IVKA 3DUWA 1PT9A 4G86A 4E21A 5ESWA 3L6RA 5JNSA 1QC5A 5B1HA 1CSEE 4EMUA 4RVNA 2VWPA 5F12A 1SURA 2XRZA 4IEIA 4L8VA 4H4EA 1NYLA 3CA8A 3WP0A 5J4KA 3T3HA 4AK9A 3T7KA 5IVIA 1E18A 4V1CB 3VR6A 3A9VA 5FJIA 4HX5A 1EWTA 2O54A 5BT8A 1M6HA 1A9RA 1ONSA 1V5IA 3PC4A 5DHRA 5JPCA 2WIGA 4KX3A 1Z45A 4PPYA 4MLDA 1KPGA 2O8VA 3E03A 2N3ZA 1D1SA 1LWNA 1BAPA 3DE4X 3DLIA 4JS0A 4L4YA 1HYGA 4J3FA 5FKJA 4D2IA 3QE3A 1ZCJA 4LRXA 3I62A 2IOFA 1LD3A 1FU7A 4AURA 4G56A 4HAVA 1R5OA 2ZB4A 3WIEA 3P0FA 4YIHA 3EASA 1U0GA 1O0CA 1G3MA 3FMPB 3HWX1 4KRGA 3SE7A 1H8EA 4L5JA 5I7UA 1EAYA 3D6VA 1SUSA 3KB1A 5FWYA 4EZIA 1UQTA 2DWOA 4Z49A 4BBAA 5ICEA 2X58A 1BDBA 4M8KA 4YPFA 2UVPA 2C4TA 2ZYAA 3HFSA 3QFTA 5DF1A 3FVQA 2EERA 3ZX4A 3DLCA 4IUYA 2C9DA 3QE4A 3QKRA 2ZM5A 4Z53A 2TYSB 3MCWA 1AKEA 4KMSA 4U2GA 3U4HA 4AKHA 1UWLA 2X9LA 3KETA 1XTPA 2YX1A 3WWZA 4IF4A 4O4IB 2WQ6A 2PVCA 4BFZA 1FC0A 3OU7A 4ZCSA 5FLXA 3D3JA 5BSEA 1X77A 3HKBB 2JLSA 3UJ9A 5BSMA 4XI9A 2B1RA 4CMJA 3NG1A 3QW4B 4EEXA 1SEVA 4QICA 3PFGA 4ZIRA 1PR6A 2NXCA 4KPFC 1JLLB 3RVDA 1DJNA 4QGBA 3WLMA 1Y4ZA 1TUIA 4IOLA 2PV7A 4MW9A 2RIRA 3PDJA 2OGTA 1LBQA 1RMQA 2PS9A 2WWFA 1T6ZA 1HTBA 4YQZA 1SZJG 2Q07A 4CTJA 1BFUA 1MB0A 3JQ7A 5LR6A 3PJRA 1RM3A 3HR7A 3SHOA 1D5CA 2YBEA 5J59A 1VIYA 2QM0A 1V16A 1XF9A 4LQLA 4NAVA 4S0XA 1PD0A 5LNK6 4I1IA 4JJ8A 1YDEA 2CL7X 4L5CA 4TTSA 3K7EA 2I1QA 4M1SA 3W6OA 3BFJA 2WU4A 3BICA 3SOZA 2EGGA 4JBGA 2Q27A 2ZUWA 3D4LA 1X3LA 1AZSC 1U2DC 2GF0A 2Z2JA 3MRSA 4LZPA 1NPDA 3QU2A 4P1ZA 2KLBA 1WNTA 4O2BB 4F5WA 3MJ4A 4RPHA 4NJEB 1KE2A 3UN1A 3V7NA 3MUNA 1EE9A 1L5OA 3KKPA 1COWA 3AWDA 3E82A 1VYTA 1ISPA 3T61A 5ANRB 1SXJB 3ADDA 2R7KA 3O4HA 4PWYA 1B3RA 3IP9A 4QOJA 2O20A 3MWEB 4EOGA 3F5DA 4EI7A 5M04A 1C3JA 2ZT5A 3EA0A 3NYWA 1GNVA 4DMKA 2QP4A 4QHSA 3I39X 4H7EA 3KVVA 1U28A 3OLQA 4RH0A 4B0OA 2YRFA 2OEPA 2V7VA 3GGPA 5LUAA 1G2OA 1G21A 3VO8A 4DC0A 4EAAA 3ROMA 3RUFA 1Y5MA 4AMUA 4BX9A 4HNTA 3RTGA 1Y1LA 4CDGA 2DOKA 4AX4A 1U2EA 4AF6A 4B5LA 1QRAA 3PE4A 3ZD7A 1NYRA 1FRNA 2XXAA 4AN0A 3V7FA 2WM8A 1HLDA 4L3VA 4X6UA 3I64A 1X39A 1IZ0A 1EZZA 3M34A 1KI3A 1O8CA 3OFKA 3DLHA 2J59A 5GPBA 4IR7A 2ZUUA 1RYYA 3DHEA 3E27A 4IXDA 5DLEA 1DT5A 4IIJA 4KVGA 1F6WA 4RV9A 5BV2P 4CFYA 3OFSA 1PD1A 2IIBA 2Q41A 3ABRB 2JI9A 2KMLA 1XZCA 1ZRSA 2MCFA 4C0HA 5BMVB 2F1HA 3QVUA 5BQXA 2AFIB 1ZMRA 2XUQA 4HJXA 3TRJA 4GKAA 3JD3A 5A6VA 3CUSA 2VUSA 4KO4S 4J75A 5TE9A 1G8SA 1II0A 2LUOA 4MO2A 3X44A 1DRWA 3OQNA 3WICA 4G8CA 1XZ8A 2AEJA 5DI3A 5FADA 4BJHB 4BVFA 2BZ1A 1TD1A 3JASA 1R16A 4WBNB 1LJ8A 1KP9A 2C1XA 3KUDA 4L9RA 3HL0A 3F7OA 2GVDC 1RCTE 1SN7A 2RMKA 1HYBA 1ND5A 2ZW9A 1XAGA 4WHMA 3V2UA 3L40A 4R1SA 5CLIA 1KTVA 1E5XA 4PYRA 1TCCA 1WQ4A 2CD9A 3TE6A 3MWDA 5EKSA 3UFXB 3PVZA 5ALQA 2H7XA 1SKMA 3ICEA 1C9EA 3RKUA 1Q50A 2BUBA 2BKEA 3X1WA 4P4SB 5BUZA 3P94A 4ZQIA 2CMGA 3BWYA 2H0RA 3GXOA 3NM4A 3DD5A 3P0JA 2V96A 1CUGA 1M2FA 4Y3UA 1Y1QA 3O91A 5AKEA 4ZRDA 2TS1A 1QK4A 5K8IA 4TYMA 1F7UA 4YJ2F 1W4LA 2WYUA 3KZXA 2DYKA 1PG0A 1DJLA 3HA7A 2I6UA 3GD7A 3HEMA 4KQJA 4B3SB 1MFPA 2BEUB 2J08A 1OVGA 1OTYA 1YH3A 4C08A 2VP4A 3DL0A 4Q4LA 1JX6A 4I1RA 2G7MC 4JI0B 2VF5X 4I9NA 5GJVC 4ZI3A 2PUAA 4E0BA 3LBFA 1E1RD 4EKEA 5T7BA 4LWQA 4X63A 2QGNA 1TQ2A 1RXYA 4B6OA 3QYJA 2O0HA 1W5BA 3F47A 5EMKA 4G0XA 3ZWVA 1H1DA 2DPMA 2PMFA 3W6UA 5HS4A 3AP2A 4JJAA 3SS7X 3T9EA 3H0KA 1HDOA 4RPCA 5PNTA 1W5FA 2J0SA 1BRMA 3WL8A 4X1YB 4KODA 4OK6A 4K6GA 3KYDB 1XMJA 3EK2A 3OHSX 3FR7A 2VAWA 4IICA 2UUAB 4C43A 4BNNA 5IXSA 1QGUA 4G5RA 1LF5A 5J63A 1DLIA 1L6IA 1NT2A 2HUPA 1VRCA 2VH1A 2ZSAA 2O8DB 1DCFA 1H1LB 3L7AA 3E05A 5JSYA 1D07A 1TYAE 3GLTA 1HBJA 1UT5A 3UTCA 4G1CA 4DTCA 2Q6TA 4KFCA 3SEFA 1F2TB 1PZXA 1GZ4A 3EBLA 2ZKIA 3KSRA 4ILEA 4KWIA 4NONA 5IJXA 1XHLA 3M1YA 3LY5A 4V0MA 2IHNA 1XOIA 1IUKA 3A1VA 1QH9A 4D9EA 2FTKE 2H08A 5LDGA 4IQ4A 1MA3A 1TLLA 3SC4A 2OCBA 3CWCA 3VOBA 3L0OA 1NBEA 2B4YA 5GZ6A 1SU7A 1U0JA 1E1LA 2L17A 4JLBA 3IV6A 3WWEA 2C2ZA 3UAOA 1AKVA 4JI6B 1U3VA 3T3GA 2XPCA 3A9WA 1QX4A 2JCYA 2OORC 3NHUA 4Z86A 4OKIA 4AZ3A 1Q2UA 4FHCA 1LSOA 3P2YA 3IE2A 4H1VA 1BD4A 1VLHA 2QRNA 4FHDA 5DX0A 2O07A 3ILYA 4L50A 4RGYA 4MB2A 4XLLA 2V7EA 1K8RA 3QY9A 1ESCA 3IH5A 1NIPA 1XA0A 4WECA 2W8BA 1RHKA 3DJYA 4NCAA 3EFOB 4KYUA 5KTTA 4GD3Q 3WK4A 2AYZA 1PWEA 3QXSA 5SZJA 4XR4A 4R1MA 3O38A 5JPDA 4Y7CA 2P6OA 3UFBA 4E22A 2ZBFA 1IM8A 3K1AA 2QDKA 2FUG6 1AKQA 2ZIVB 3SSAA 1UBNA 5D00A 1GZVA 1F0YA 3ESCA 3OJXA 4UDXX 3KQWA 3FDZB 1HY3A 4Z4GA 3I76A 3U49A 1DL5A 3TOZA 4DWJA 2F3PA 5T67A 2GKGA 2BMEA 4CTOA 3VYSB 4KSYA 4ZA2A 1CJCA 1BXGB 1E62A 5E0OA 4D8WA 4OGFA 5K20A 3I2HA 1S6YA 2O5VA 2ECQA 3I9OA 1XD9A 4TSRA 3N5CA 1HDXA 3HB5X 2R6JA 3BDAA 1EUZA 1ZFNA 2QYTA 4EI2A 3ZXYA 4LZAA 1EJ2A 4KQMA 3ODGA 1ZI6A 5CG2A 1WMAA 2WVJA 4K05A 5TB5A 3NM5A 2RHMA 2ZS7A 5BP7A 3NHLA 2LV8A 2YW9A 2ZREA 4A5SA 5JMTA 3U6KA 2QL6A 3V34A 1SO8A 3O7MA 4IM7A 3TM5A 2A58A 4MP6A 3CEHA 2W93A 4Y6LA 5K8LA 5D6OA 3G0OA 4RD6A 5JAUA 4ZAFA 1XZBA 1ZGGA 5CCEA 2RHBA 1IWOA 5K0TA 5AD1A 4Y1FA 5DZSA 4LPSA 3V4RA 3AM1A 1RBQA 2EJUA 4IZIA 4R1LA 2ZRGA 4EGAA 5CGQB 1UJCA 3KQKA 2IY7A 4QUEA 4K87A 4Y2GA 1F8XA 1V5FA 2RGBA 3RR2A 2AD1A 3ROKA 1XDUA 3TRHA 1N5JA 1L7XA 2VH5R 1O08A 3VR4A 4RJ2A 1W2GA 5THQA 4TSFA 2H9IA 2UYGA 4EUEA 5KEIA 1T15A 2QTFA 3TL6A 2PLAA 2J67A 3RJTA 4DILA 5GGXA 2JS7A 3MINA 1QHXA 5FPQA 4JWKA 3JVVA 1E3LA 3AF4A 3D1LA 4MI1A 4ND3A 4DF3A 2RKOA 3CTPA 5LXTB 3NGMA 1M6VB 4ZXPA 2O1SA 5HGJA 3KALA 4EFMA 3I30X 4OGWA 4X6LA 3PC6A 4GYKA 3R3HA 4B81A 2YJ6A 1Z28A 3P2OA 2PS1A 1IY9A 4WW0A 5EMLA 2GXQA 2MDTA 3S2FA 3TKAA 4G9BA 1H2FA 3M9WA 4KGXA 5CCBA 5J4VA 1YQ9A 4WAUA 1FY2A 1MH9A 1N8NA 1T2NA 2FSHA 1RC8A 5L9AA 1J8VA 3U7QB 2XBUA 1CULC 2X2FA 4NARA 1IWPB 3U7EB 3WXMA 4BN4A 1NNSA 1PL6A 1Y6GA 5FV4A 1KRXA 4Y1RA 1E3QA 1MO6A 2PZEA 2X19A 3LL4A 4CU5A 4NBSA 1JHYA 3WQQA 3EA5A 1H9AA 1C9DB 2QPOA 1O0SA 2LNDA 3NMUF 2HV8A 4CG0A 3RYFA 2WFZA 2ZB3A 1L5GB 1NVDA 2V8OA 4I4TF 1Q3KA 1G6Q1 3V8NA 4LCBA 4YJKA 4M8NE 4P7BA 5F9MA 4I5IA 1XUOA 4ASUD 4JQSA 1GZUA 1GLNA 2EW1A 4Q4HB 2CBGA 4YHBA 1SQ0A 2A0XA 1EX9A 3FKJA 3OF3A 3T6KA 4FIZA 4CM5A 2OAQ1 3BHMA 3GEEA 3MTBA 3SDBA 3AERB 3GGGA 5JAOA 1GT91 1OT5A 1TYZA 1B8PA 1UXJA 2HMAA 2NV6A 1HOTA 3G2NA 3Q5DA 4LHVA 3VR4H 5KVVA 3QPUA 4HAXA 4PHTA 2CJWA 2A8YA 5A0VA 3DEYX 1FCJA 4FX5A 3UMCA 3K8QA 1USIA 3WK6A 4R54A 3VHLB 4QDJA 3CX4A 4HCJA 3YASA 1VDMA 1VYVA 2A0UA 3G0GA 1ISGA 3I28A 4IHJF 2IUSA 4Q9DA 1Z7WA 3PFWO 3KLBA 9ATCA 2HRDA 4D9GA 2X8BA 4F85A 4YY3B 2XZOA 1W0KA 1F8GA 2A3NA 4Y2XA 1UBJS 1U7OA 3UICA 5AIBA 2FJ0A 1YE3A 1PGOA 3OZDA 1LLFA 4MGEA 3QLUC 5DM0A 4WZ6A 3FNEA 1KY3A 4UE6A 2C4WA 5F21A 4OAOA 2CLCX 1T5LA 4JYMA 2EQBA 2F43A 3QBDA 4M1EA 2C3OA 3W8NA 1SCNE 1PBNA 1DNPA 4ITVA 1WG8A 2QN3A 3LECA 3OZFA