2ISQA

Crystal structure of o-acetylserine sulfhydrylase from arabidopsis thaliana in complex with c-terminal peptide from arabidopsis serine acetyltransferase
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
320
structure length
320
Chain Sequence
b'SRIAKDVTELIGNTPLVYLNNVAEGCVGRVAAKLEMMEPCSSVKDRIGFSMISDAEKKGLIKPGESVLIEPTSGNTGVGLAFTAAAKGYKLIITMPASMSTERRIILLAFGVELVLTDPAKGMKGAIAKAEEILAKTPNGYMLQQFENPANPKIHYETTGPEIWKGTGGKIDGFVSGIGTGGTITGAGKYLKEQNANVKLYGVEPVESAILSGGKPGPHKIQGIGAGFIPSVLNVDLIDEVVQVSSDESIDMARQLALKEGLLVGISSGAAAAAAIKLAQRPENAGKLFVAIFPSFGERYLSTVLFDATRKEAEAMTFEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cysteine synthase
publication title Structural basis for interaction of o-acetylserine sulfhydrylase and serine acetyltransferase in the Arabidopsis cysteine synthase complex.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transferase
total genus 118
structure length 320
sequence length 320
ec nomenclature ec 2.5.1.47: Cysteine synthase.
pdb deposition date 2006-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00291 PALP Pyridoxal-phosphate dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2isqA01
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2isqA02
2TYSB 3R0XA 3VC3A 2J9XB 3VSDA 5I7RA 4D97A 4ZU1X 5KZMB 3PC3A 1OASA 5DBEX 5B1HA 4D9MA 1TZMA 1WTCA 2ECQA 5T6MA 3TBHA 1TZ2A 3ZEIA 5B55A 3DKIA 3X43A 3DWGA 3PC4A 1V71A 3SPXA 5KINB 2GN0A 3RR2A 2WSYB 3BM5A 1KFBB 2ZR8A 4HO1X 4ZU6X 5IW8A 4D9CA 5DW3A 2ISQA 4D9BA 4L0DA 2CLKB 1VE1A 4D96A 3PR2B 1FUYB 5I7AA 4JBNA 1D6SA 4HN4B 3VSAA 3SS9X 1V7CA 3FCAA 1A5SB 1J0BA 5D85A 5E0KB 3CEPB 5CGQB 3HMKA 1J0DA 1P5JA 3X44A 1K7XB 5D87A 4L28A 1QOQB 2GN2A 4D8WA 5IWCA 1TYZA 2CLEB 2D1FA 4LMBA 2TSYB 4QYSA 2CLOB 4D9KA 1KL7A 1Y7LA 4D8UA 1Z7YA 3L6RA 3AEYA 2EGUA 4NEGA 2PQMA 1BKSB 5JISA 4KKXB 1CW2B 1X1QA 3IQHX 5HBGA 1K8YB 3IAUA 1F2DA 2O2JA 3L6CA 1O58A 4HPXB 1WBJB 1C8VB 1TDJA 2BHTA 2CLHB 1K7FB 2TRSB 3AEXA 3R0ZA 5B53A 4COOA 5I7OA 2Q3BA 4IL5A 1RQXA 3FGPA 5D84A 5B36A 1TTPB 1JBQA 1QOPB 3VSCA 1Z7WA 2RHGB 2CLFB 4F4FA 1E5XA 1WKVA 4D9EA 2JC3A 5B1IA 1KFEB 2C2GA 1TZKA 4D92A 4OREX 4OFXA 5J5VA 1A5BB 2J9ZB 3SS7X 2DH5A 1C29B 5DBHX 3VBEA 5J43A 1CX9B 5CVCA 4I1YA 2CLMB 3T4PA 1A50B 4D9NA 4D9GA 5IXJA 4D9FA 5DVZA 1PWEA 1C9DB 4D8TA 1J0EA 2J9YB 3IQIX 3V7NA 2Q3DA 4AIRA 1J0CA 3IQGX 5DW0A 5C3UA 5JJCA 4HT3B 2ZSJA 1K3UB 1TTQB 1V8ZA 1UINA 2V03A 1K8XB 2DH6A 4L27A 2ECOA 4NU8X 5I6DA 5I7WA 1UIMA 2CLLB 4Y6GB 1BEUB 2RKBA 1WDWB 1M54A 2CLIB 2Q3CA 4H27A 4L3VA 4LI3X 4ZQCB 5B3AA 5I7HA 1A5AB 1KFCB 3L6BA 5BW6B 4AECA 2ZPUA 4LMAA 1TZJA 1K7EB 2EFYA 3DWIA 2RH9B 1PWHA 2C2BA 1KFKB 4HPJB 4JBLA 4XUGB 4WX2B 5D86A 2BHSA 5EY5B 1KFJB 1J0AA 1FCJA 2O2EA 2GN1A 3PC2A 1VB3A 4D9IA 4D99A 1K8ZB 1UBSB 1TJPB 1VE5A 4PCUA
chains in the Genus database with same CATH superfamily
5FUVA 1P0MA 1SC6A 2VUSA 1P1IA 1QQ7A 4ZO4A 1SVMA 3UT5A 3UCXA 3RFFA 1HNXB 3MOIA 4DLYA 4HFRA 4A6XA 2YNMA 1G8GA 1SOAA 5JNVA 3X2EA 2JB9A 2ISSD 2EQBA 3MCUA 4B43A 1DRJA 5HM6A 2PZMA 4TV8B 2ZT5A 4UJ3A 5K3AA 4MJ3A 4RD2A 3UOWA 3PP8A 1GV0A 6REQA 3GA5A 3ABRB 4UDNA 2O7SA 3JRWA 5F9HA 1ZDMA 5TSDA 4H77A 4HQLA 3VAAA 1RI1A 13PKA 1VSVA 2X77A 4MW7A 5C52B 5KTMA 1CTQA 2RGNC 1Y33E 1V2GA 3ND5A 4EY7A 2EFDB 4ISCA 2WHPA 3HCDA 4C0JA 2VKTA 1Q44A 2H54A 5CGQB 4N5NA 1RLMA 5CDFA 2FGJA 2OQRA 3EF0A 4XWOA 1UKBA 5KYUA 2WAAA 2C4WA 1UZAA 3ZXYA 1YT5A 2AW5A 5FX2A 3UV6A 1P5ZB 3DBLA 3OTOB 3HJFA 1YA8A 2JJYA 3EY9A 1XJ0A 4FFRA 3SXUA 5AJUA 5FH9A 3ZH2A 2QIPA 4UEQA 3EFBA 5B1DA 1ANKA 3DL2A 1EHIA 3KYBA 1X8KA 2HPAA 3LDHA 4EEXA 1RKUA 3VTFA 5E1DA 2R11A 3WGYA 1F4PA 1H3FA 2VJLA 4MRAA 3WB2A 4FWTA 1QC5A 2EFJA 4WLUA 1ORHA 2GPWA 3DJFA 1H9BA 4L0QA 5AK4A 1JL3A 4UDXX 4HH4A 4X95A 4ZHQA 1Q11A 2A30A 3EGXA 5K9ZA 2UXBB 5DBHX 2WABA 3DM9B 5HK9A 1KJZA 1EGHA 5KWJA 2CLMB 4IUDS 1RYHA 4X6LA 2R1TB 3IB3A 4PLFA 3WLIA 4RJTA 1GPAA 4MW9A 3LF2A 4RIEA 1HEUA 4CLRA 1VBNA 4F2PA 3C6MA 3TD9A 5KPDA 1US8A 3LX8A 1GNLA 1Z16A 1JIIA 3VR6A 3L79A 2GXAA 4MPRA 1Z0SA 1N2EA 2J31A 2XT0A 3K0FB 2XTJA 1DTEA 1RVDA 1I9CA 5JOQA 2QTVA 2R9VA 4QUIA 4BUCA 3GLFA 2IOFK 4JXJA 4MO2A 2QIOA 3UT0A 1L7BA 4Q3OA 1ZD8A 2V98A 3KKZA 3DTVD 4CFSA 1OH8A 2UUCB 1C7IA 2VSOA 1P1BA 2CJYA 3CE6A 4FDTA 2P3LA 4UHBA 1J5PA 5A2GA 4BBZA 4UCWA 4G5FA 4P3YA 1E6EA 3ZNQA 1PVDA 3IVXA 3KEFA 5D51S 2XD9A 1JEJA 1OZFA 2PV7A 3SYKA 2DPHA 1M5RA 3OX4A 3PQDA 2PLWA 4LGYA 3C3WA 3RABA 1JILA 3FDIA 4GZ6A 2BTQA 1E4OA 4ILEA 2H1VA 2F4VB 1ATZA 4MQBA 3CF4G 4UU1A 4XYGA 2NUPA 3RIGA 1A96A 4QLBA 3C6ZA 1U0RA 4NPHA 4D99A 4ZZIA 1B93A 4P08A 1WEHA 1GQSA 3VC3A 4MEJA 5K4AA 1A7JA 1UDWA 1KRXA 4PGMA 5IK2A 2PWYA 4BLOA 4AKGA 4HRXA 2WNSA 4MSUA 1NMQA 1RMTA 2LTAA 3UPDA 1CULC 3MBIA 1X3LA 4Y67A 4ZOEA 3FVWA 3PDIA 3RSCA 1NA5A 3ZZ1A 4BKMA 3NATA 2CC2A 1JWBB 2VHUA 3H65A 4P33A 4BVEA 4CM4A 2BKVA 4BX0A 5MN6A 2P0YA 3RR2A 3JWIA 4I55A 1JYFA 4UXHA 5M7EA 1Y1KE 1OJLA 1JDPA 3DHVA 1QHYA 5JVDA 3RRMA 3ERCA 2VHVA 3L7DA 5KU7A 1ZIDA 2EFCB 6PFKA 4FSHA 1GPWB 1PWXA 2FN9A 4HGOA 3RREA 2XMBA 1V5IA 4Y6LA 4DA0A 4Y0NA 1D9XA 5FO0A 4B87A 3PX2A 3ZHBA 2ZIXA 4OV6B 3TOVA 3HNOA 2QRKA 4IHKA 5EN4A 5MN4A 4PPQA 4LRWA 5MGNA 1TYZA 2GWRA 3GLHA 4HLQB 4J2OA 3ICEA 4JUFA 1EGQA 1VZ3A 2Q5CA 2X5NA 4XCVA 3IP9A 4J0FA 3KR0A 5AHWA 1YMUA 1VP9A 4MS3A 2GTHA 2XVAA 3I5AA 3CXRA 4WBXC 1H2EA 4N5LA 5GVRA 3FZGA 2HEGA 2RK6A 5HBGA 1SU7A 4I9UA 2JATA 3F5MA 4IKPA 2Q3JA 1PIWA 2KB0A 3LWDA 1U0EA 3B1JA 2YQ4A 3Q88A 1NXVA 4UM9B 3T3IA 1PFWA 1A2QA 4QXRA 1TPYA 5LP6C 4ER5A 4F4FA 4PZ0A 2XB4A 5K0LA 3DNPA 5M3BA 4B09A 3V6MA 4R83A 1Z36A 1Z5VA 4CMHA 1BFKA 4FR5A 2VRCA 3BC1A 3VZQA 3QYAA 1JU4A 1J6UA 1TB4A 5NULA 1OLUA 2D7CA 1E9VA 1YTUA 4JYCA 1BXRA 3QVMA 4OCZA 3IXMA 4KMSA 5AKXA 3ZJUA 5LP6F 3ZTWA 1XYGA 2GFHA 3K4QA 4K6OA 1GPH1 1FMLA 1SG0A 4O6VA 5SZJA 4C4AA 5JJCA 5KVAA 2ZZNA 4GLFA 2BP7B 4TUYA 5JSUA 2NW6A 5ECDA 4AIIA 2I2DA 3OD1A 3THWA 5EFOA 2ATEA 2VSQA 3Q3VA 3WA6A 2FMXA 5CMLA 4RTMA 5BQPA 4L1KA 4BPRA 5HWSA 4Q19A 3SJAA 3O1LA 1NY6A 3BF8A 3RBZA 3AFOA 4AROA 4RMHA 2BR3A 1R3DA 1D6JA 2XDAA 4US2R 1J97A 4ABTA 4ATNA 5AW1A 1HKUA 5EWLB 3EVNA 3WIEA 4NHEA 5DHQA 3O73A 2Q0SA 1UBMS 3BWDD 3NP9A 5TEWA 4UUPA 4EBBA 2VF2A 3HBNA 5JHHB 3B20A 3QVJA 4BHTA 4CCSA 3ABQB 5GINE 3I73A 2BGMA 1UJ2A 4F5WA 3RFVA 1M10A 2CN1A 3H9UA 3NDIA 4KAFA 5EMNA 4R3NA 4MCAA 1M72A 1XRRA 2HXGA 5LA6F 3THOA 4D45A 1DB3A 1TFRA 3KRTA 4UNIA 5JJIA 3B85A 4R8SA 1HDZA 3ICVA 2H48A 2H29A 3BZUA 4Q9DA 1PFGA 4G0XA 5DX1A 5EYPA 4PHGA 2IPOA 2QLFA 2PX2A 3EODA 1G8YA 2B4TO 1Y5LA 3R6LA 3FLAA 4UTOA 3GF4A 4EKGA 3CR8A 1B3RA 1XVTA 1GUFA 2GLUA 2WA2A 3ZGNA 1M6VB 2O0LA 1J24A 4J4TA 4HTFB 2K5UA 2MINA 2FPKA 5H7XA 3AR2A 2EF1A 4N0DA 4CU2A 1MKYA 4NG4A 4YJ3A 4XZ3A 4L0DA 3TAUA 1MQSA 3L41A 4H4CA 4MIYA 4KPFC 1E1CA 4YMSA 1K5GA 4B6SA 2NUTB 2HHAA 2ZJ0A 1YMVA 3CZMA 3EDOA 1GZHB 1J5EB 3GRRA 4X1YA 1KQNA 4C2AA 2PFKA 5LUAA 1VMIA 3WKEA 5KIAA 4M1EA 1P73A 5I9LA 3C7AA 1XL1A 2P6NA 4ON9A 3U0VA 3GU3A 3K0CC 4A73A 2YCLA 4MUJA 4I1OA 1PR9A 2BD0A 2O0JA 3AJRA 3RGGA 5IWCA 2DPGA 3TI9A 2QVLA 1QCCA 4Q3BA 1OUMA 4QU8A 1J49A 5CYOA 2C0QA 4FMCB 4BNJA 3RODA 3H8SA 3KAQA 2CEKA 5DDIP 2DBRA 3GJZA 2VJNA 3ZIAD 4OJKA 3OLWA 7MDHA 3N8GA 1IK4A 4OI0A 3TVTA 5DTEA 2NAFA 5EGSA 5GADl 3RHFA 2IBMA 2AJCA 3HPRA 4K81B 4EB8A 2ZWOA 1G3IA 2X8BA 4RS3A 1R15A 2AI1A 4TYQA 4LWZA 1MQAA 3AWDA 3OZ7A 4COKA 4B85A 1NJ5A 4HAIA 1UMDB 2ZSBA 2HA3A 4GBMA 3D4BA 2NGRA 1CUEA 3ND7A 4L6CA 5I5GA 3WICA 4B33A 4A23A 4E1VA 1PK7A 1PJ4A 2WLTA 2H9YA 3F2VA 1CCWA 3GEPA 5CXUA 5JH7B 2GEKA 3PA6A 4FR2A 4QOEA 1QFMA 2IPAB 4N3BA 3TIFA 5A6SA 5AYVA 5LU9A 1XRPA 1J90A 1FE8A 1UAAA 3THRA 5BV1A 2WIFA 4OHKA 1Y1SA 1B6SA 1Z8NA 3UXHA 1T5OA 1UBNA 3RROA 1CUXA 1H85A 1EFVB 2QXTA 4YB8A 2PSJA 3TX2A 3LWZA 1WUJS 4YQYA 4QDUA 3ZCQA 2IHYA 1JR3A 3LO8A 3FHCB 3ZK7A 3VOTA 2C5AA 2AK3A 1KYXA 1XZ8A 4BJ5A 4HNAA 3K0EA 2VPQA 1GAQA 1WMEA 1K88A 3F6RA 1S4QA 4R2KA 1GGNA 1UFOA 2AOTB 4YI3A 3AVOA 5CCBA 3NTOA 3C45A 2Q99A 1IG3A 2OEPA 4P35A 1KSFX 3QTBA 2IZZA 3EWNA 1LEHA 1NW5A 2FSPA 2GHQA 2D2FA 3DLCA 1PR6A 2Q3EA 2XVYA 5AVZA 1YA6A 4H0CA 4E0BA 3G8BA 5BMOA 2WBLC 2A7XA 1K7CA 3WYNA 4FHFA 3VZRA 3EE6A 3KZVA 4MV6A 1T13A 4FMDB 4NNPA 2Z8YA 4D4KA 1Z06A 1CUJA 1EG2A 4YCDA 1B3BA 3ZN2A 2G9UA 2VBFA 2HSJA 4OU5A 3VR5H 1L0BA 2JJ1D 3VDNB 1T9CA 4F60A 2E21A 4GYKA 4V0RA 5JYBA 3O8NA 3T3PB 1ZJ5A 1V8BA 2W98A 1N1GA 4D4MA 2ZJ2A 2BISA 1ZO8A 3PUKA 4I5GA 1TMOA 3FYHA 4PHHA 4MV5A 4DNQA 2PNJA 2H1IA 3DAFA 2WMOB 3OUUA 1E0DA 3DTVB 3DDZX 3P9PA 4R71A 3LPLA 1VZ2A 2P2CA 1Y1PA 3HU5A 1V71A 4EY5A 3JR3A 1UBLS 5C80A 1DRWA 3IBSA 2HMVA 3WGJA 1KPHA 3TCNA 3W5HA 4CM8B 2C00A 3H11A 4M8SA 3IA2A 4GOJA 5E3IA 4LXUA 3ONVA 1DINA 4MDYA 4NF2A 1CQIB 4D96A 3AVYA 1HDOA 1QGYA 2XF8A 4YAOA 3CONA 4X8HA 1DSSG 1GILA 3HHEA 1P3Y1 3TBFA 5C3MA 2O9JA 1OLSB 1OXUA 2I8LA 3OPXA 3PUZA 4DWVA 3KOUA 1NGSA 4DTIA 4IIJA 4BMSA 1CKEA 3NHLA 4NICA 5DU2A 1EM8B 2PR7A 3C6YA 3FW1A 3LDAA 1XAIA 5JAQA 4JUCA 3LQ2A 1IWPB 3QITA 1MVNA 1UPBA 1CUDA 2HSZA 3FHJA 1MX5A 1XWFA 2R7NA 2GBLA 3FKJA 3LBIA 3O1JC 2I3AA 2E3JA 4M6WB 1V5GA 3JW8A 4Q82A 5CXXA 5K05A 2A6PA 3K1AA 3P5SA 5F3DA 1N32B 5CDGA 5LD2C 2XYHA 3LV8A 1C9KA 5EXTA 5HGJA 3A6LA 4YRQA 5HILA 2O8EB 1LDYA 3WG9A 1GTL1 1ZZGA 3OBBA 4I3FA 1W5SA 5EJ2A 2VH2A 3RS5A 1D9ZA 4KWHA 4D46A 3KPWA 2VPZA 5IDWA 4HRVA 5DBOA 2B34A 4WCVA 4MRMB 3KJGA 4INZA 1YQEA 5TGDA 4FDMA 2OMKA 1LRJA 4FC6A 3OTWA 1CJSA 2Z2ZA 1CETA 3M2TA 4J0CA 1Z47A 2YZGA 1G0NA 4BGIA 5CFOA 2XQVA 3NC4A 3IOEA 2QHXA 4KNWA 4MR7A 4UBNA 4JP5A 3AF2A 4FVTA 2CYBA 3MGAA 5FPPA 5BNWA 5KTRA 3LUPA 3PDHA 3O3NB 4NONA 5SYAA 4O4LA 4TXJA 7GPBA 3JSXA 3RRZA 5EJ4A 3CX8A 2VCHA 3KXIA 1IHDA 1YWGO 2DBYA 3QYFA 4N0EA 3WB1A 3B3JA 3TLYA 5DT9A 5KSYA 2C2KA 5ALRA 1U0BB 2XZPA 2REXB 1PT9A 4JGIA 2BR4A 2Q2WA 5E1BA 4C22A 2VYQA 1EPUA 4NLLA 5FIUA 2XI4A 1P75A 1ZAKA 2H2DA 4G5QA 3DB1A 1Q7CA 4WZ6A 3KETA 2AT1A 2ID4A 3U3XA 4RTLA 1DOZA 4KXWA 3RYFA 4AU1A 3MRXA 2PSEA 5K0EA 3OQ6A 1JMKC 2JRCA 2D4HA 3FFWA 2FDCA 2FW9A 1E3DA 5BW4A 3VZDA 2NM0A 1SUAA 2GO1A 1TXGA 1JEOA 3PNYA 3AHJA 5CB4A 1MO4A 1DC8A 4GXRA 1VJTA 5DKFA 2W9XA 4H6WA 3IEXA 1TKCA 2O1XA 3T9EA 4B31A 2CXPA 2XDWA 3OX2A 4W7HA 1KEKA 3JAMA 5I9TA 2G1AA 5EY5B 5JZOA 1NBEA 1NBME 1X2EA 1JNYA 3OD5A 1XZIA 4G24A 3P94A 3B1VA 4L7VA 1OX5A 4AYXA 4KIGA 5BW5A 1C3OA 2FW6A 2LIVA 4DSUA 1JR4A 3U6KA 2O7VA 4PF1A 3K15A 3GDHA 2DPLA 4TXMA 3GVHA 2FCRA 1GCAA 2HCRA 2QPTA 2IUTA 2C2OA 2HL6A 2YMPA 3GEGA 5DHTA 3TI7A 4YRSA 4HY3A 4Q4CA 1JXMA 2OZVA 2O52A 3MWDB 2QY6A 4ACAA 4LOHA 1ZIYA 4TL9A 4CFYA 1Y7PA 3TIVA 2B7CA 1KVQA 1TJ3A 5K0FA 3K3PA 4LTMA 3QF4B 5BVGA 9GPBA 3L04A 1FEZA 3WXBA 4FX5A 5DLDA 2QL7A 2NU9B 2A9FA 2ZE5A 2FPPA 3IHLA 3T95A 3I2YX 1D09A 1V1RA 1NE7A 1N3YA 4LXXA 4QHYA 4Z9FA 2C9BA 4ZZ3A 2B2XA 4FP9A 1JBKA 5JMOA 1SCUA 3ORSA 4EB6B 5E9AA 3FFAA 1SVUA 1RR6A 4I5FA 3REQA 2OORA 4LVNA 1UC8A 2VSNA 2Q9CA 2HAEA 3T8YA 3UO8B 5F73A 2JBWA 4GP9A 3AFNA 3ND6A 1FFXA 4LV5B 3V2GA 4B35A 2IIBA 2HNKA 3CEPB 3RYIA 1VBFA 4H31A 4PONA 9LDTA 5IT0A 1BJRE 2NSJA 4BB6A 2XOKA 2WU4A 3N5CA 5LOVB 1VKZA 3T12A 3UAGA 3ZV5A 1EUZA 3V7WA 4RJLA 2Z8YM 4NV3A 4QBFA 1JAXA 4X20A 4PO9A 4RK1A 4X7BA 3F3YA 4UHCA 4ROSA 1GKIA 2HLPA 5CDFE 1Y82A 2GBGA 2E37A 1MW8X 4L3WA 1EVIA 2VDRB 5ENDA 5B1SA 1CW2B 2JI7A 4NAHA 1XZLA 3OIGA 1X38A 3IQHX 1QVWA 3EVFA 1Q95A 1UBCA 2LNDA 2V7XA 3O92A 3R0QA 1WKCA 3EA5A 5BSRA 2MSDB 1Z0IA 2P4QA 2AHOA 3ANXA 3DA8A 3DAHA 1NQTA 2IVZA 1GTG1 5AOBA 1LBEA 4WBNB 4ZPJA 2ST1A 4UBMA 5A5VA 3OFSA 1UWLA 1F0NA 3ER6A 2NVOA 5J2TB 2X13A 1K08A 4X1KA 2YC2C 3ZCUA 1CUIA 2G9ZA 4ZCIA 3CVOA 2IU4A 4N4AA 1C3JA 2RGYA 1MX9A 1PFQA 2GD2A 1X42A 2PPLA 2IYRA 4JEIA 2CJWA 4FB5A 4OH1A 1QIHA 3R3JA 3P45A 3B53X 3MRSA 1E8NA 4JKOA 4AY4A 3IEMA 3I1JA 4J0QA 4DV7B 2V9ZA 2HFKA 4EEKA 3FYCA 3GXBA 3MQ4A 1G2IA 3O8QB 4FU0A 4NTZA 4RIGA 4WQMA 3LCMA 5L8VA 3TZHA 5LDDC 4AJEA 2KBEA 2QAGA 2R62A 3OPYI 3VU9B 4FN5A 4CLOB 4QBHA 5BURA 5CDHA 5LMCA 1VJRA 1JI0A 1BMTA 4MLDA 1YE5A 1TEXA 3OURA 2A33A 3G2LA 2XXAB 3C85A 1HGXA 2A5DA 3H86A 1PW7A 3BSFA 4YJ2A 3R4CA 3DBRA 4MVJA 3AGPA 4B82A 2BTOA 4M4SA 1ZC4A 4YAWA 1R4ZA 4HBZA 4B71A 2AYXA 4LBVA 1NASA 3WLAA 1NZJA 3A3NA 4FHEA 3W6PA 4P3NA 4ZXPA 4YIKA 1X8JA 3O82A 2PRJA 4RYDA 3RBAA 3PLAE 5D7NA 4G36A 1Z39A 3G8YA 3R7WA 1GJRA 3TLMA 1XRQA 2G1JA 3QUBA 1ZH8A 1EAMA 3I28A 4MV0A 4RDHA 5C1BA 3C3KA 3DFUA 1OC4A 3KB8A 1I4TD 2ZB2A 1W2WB 3PNOA 2GYWA 5TS3A 5J4HA 4JLUA 1CF9A 1FXUA 1Z5PA 3A6JA 4FOTA 4YJFB 3W2TA 5F3WB 2AG0A 3LHFA 2HDOA 1IZZA 3C8ZA 1BTOA 1YZQA 4O4HF 3FFTA 2YXPX 3HFSA 4PZPA 3Q9LA 4QU5A 4RD6A 2HSDA 2VT3A 2X58A 1QV7A 4PX5A 1ZEJA 3L01A 3R5JA 4DIDA 3TGLA 3Q8KA 2FEMA 2ZJ5A 1CQJB 1NULA 2V74B 3K73O 4L5BA 4RH0A 3CW9A 1EGMB 3B60A 2QRLA 3I76A 1GA4A 3DEJA 1C0PA 1WF6A 2HCFA 1AV7A 1IPFA 2YZMA 2XDQB 1QORA 2VWGA 1AGPA 1QDLB 1QHGA 3HBFA 4Y6PA 4ZI5A 4EABA 3LY5A 1ZD3A 1WCWA 2A84A 3EB9A 2R4QA 3GOHA 2WFAA 1M34E 3F1LA 3IQXA 3L4JA 2G77B 1POXA 4TGLA 3D1LA 3ABZA 3JCZA 3MIZA 3O91A 4PYNA 4N3AA 1P0PA 1I7NA 1Y6QA 3OUZA 4Q4DA 3ZLBA 3OWXA 1FTNA 1L4EA 2E4XA 2RHBA 3HMKA 3PUWA 5IT4A 1W1UA 1Z4NA 2H6EA 4KPYA 5H3HA 5K03A 2JJ2D 3PEFA 1TTTA 1RXSA 2FPUA 3TZCA 3UMBA 2IDJA 1GPJA 2OXFA 3LPCA 4ZT5A 3ZGOA 1H0KA 2BKLA 2V7BA 2GTIA 4GHWA 3PCXA 4WJZA 4YACA 5PNTA 2W48A 3MOSA 4ZYWA 5IPFA 1XOIA 2IXTA 3OCYA 2BDTA 2R8ZA 1J06A 1XTBA 2OP0A 2P8JA 3B48A 5LQRA 5A0TA 5HFNA 5EUMA 1LDEA 4J16A 4OFBA 4MCJA 1Z2AA 4XX0A 3QWHA 2NZYA 2F00A 5HQJA 5KJEA 3FI0A 3KQWA 3RCBA 1OAKA 1DBIA 2ZBPA 3AUAA 2OL4A 6LDHA 3G88A 4LNUB 3CX6A 1HH4A 2XCUA 4J7CA 1GGKA 3ZCXA 4X3CA 5E4YA 1CK4A 3QE2A 2QQGA 1LJ8A 4QX6A 4AJ4A 1YD7A 1WKVA 3F2IA 5JXJA 4KWEA 5K20A 2VZ0A 2XVZA 1OWNA 5IBCA 1RRVA 4ESOA 3A1DA 1EFHA 1G98A 1VBKA 3W2HA 3KPVA 2XMRA 2B25A 3ZOKA 4MDFA 1HSZA 3DWFA 3PVSA 5ILGA 4FGJA 4HQKA 5JIBA 2HI0A 4A1FA 2IZ0A 2BFFB 1YIDA 1ULAA 3D0RA 1XDDA 2NZUG 2R5WA 3EEIA 3FPJA 2Y0EA 2DUNA 3PUYA 3R3ZA 3JYLA 1OAOA 3OE4A 4P80A 5FI3A 5E2BA 5J2UA 4ZI7F 2ZI3A 3DEKA 1YZNA 2OCDA 4HNRA 3LYLA 2J7PD 2JGJA 3L9XA 3R3XA 4QXMA 2HT1A 3OLVA 2EJWA 3OE7A 2EZTA 3UK0A 1BJTA 1Z62A 4PG8A 1XMOB 1C1DB 1XUOA 1V11B 3BJIC 5AKHA 3HA5A 4ER0A 4C6HA 4Z4IA 4YDRA 4E51A 3ZHRA 2ZQYA 1E4YA 1DRKA 3AR4A 1XRNA 2A4KA 3K96A 4Z8XA 1M75A 4PNHA 3OC6A 4LTDA 1NQWA 4YYEA 2P68A 3T7AA 4EHJA 4UATA 2NP7A 2B99A 4DCUA 4P86A 1OMOA 5JCZA 2CFSA 1YV9A 1OZHA 4PNZA 1P19A 3TQHA 4DBLC 4ARVA 2N1BA 2KWIA 4WZAB 2Y1XA 3IP7A 4Q66C 4BP3A 3SC2B 5I45A 3MAGA 4WZBA 3HVJA 4HXFB 4X97A 4Q01A 3U9LA 1Y8ZA 2W6MA 2AUMA 3LD9A 1VL1A 5DNUA 1OASA 2YYSA 2JIOA 2MYUA 3C7TA 3I09A 3KBBA 2DY1A 3O0TA 4DHWA 1E7RA 1OJ7A 1TW3A 2AR7A 4GGOA 5EJAA 1QU2A 4A2PA 5JPDA 3B2NA 1LWOA 4N8DA 5FHQA 4DSOA 2LDXA 2PZEA 2D74A 1PJ8A 1Z4LA 2V0CA 2OT3B 2X1LA 2XITA 2RHTA 2QD1A 3LUDA 5A2QA 2Y66A 1AQJA 3WNZA 4IY1A 5AFSA 2EEZA 4ZJUA 2OGTA 3UMFA 1J7JA 1R88A 4DCPA 3E9ZA 4IXNA 2VAPA 3RH0A 1KJQA 1I51A 3FHOA 3D3WA 1EA5A 4TLAA 5SV2A 4ZN6A 3DMGA 1NL3A 3PD1A 1E1MA 3TN7A 4MJ7A 1U2DC 3VPFA 5DM60 1JJAA 2CNDA 4DA9A 4KL8S 1TU4A 4N82A 5BQ5A 4CHTA 1ZK3A 2RONA 3H2YA 4B6RA 4UCQA 1AK9A 1VPDA 3NANA 4Q03A 1EWYA 2FNAA 3HJAA 3RFCA 3RUPA 3USES 5JI2E 3BHIA 5REQB 1H0SA 2OQIA 3A2LA 3SDSA 5B7PA 3M70A 3H9JA 4TOIA 4Z4GA 4BO0A 5JISA 2E1RA 3GVIA 2WKWA 1MVLA 1TD9A 3HVHA 3FG9A 2V1XA 3I32A 3B78A 3PUIA 3QQ5A 4M1ZA 4MVCA 3EMBA 2ZYAA 1D2GA 3PIIA 3WLFA 3HTXA 1IN1A 3H2KA 1N2BA 2C1XA 1M8KA 2YHIB 1DG1G 4ZQBA 5EUBA 4YRPA 3CNQS 2WFZA 1XXHE 3VC2A 4H4EA 4HS9A 3VVMA 4BNLA 1QLHA 4AWXA 1XNJA 5T5QA 3EULA 4ZYVA 2D00A 2QENA 3MLBA 5E6RB 3GD5A 4AF6A 2WWHA 3G5TA 1NC1A 5KQGA 1CZUA 1DAOA 1G17A 1U65A 3SHQA 5J5VA 1YZ3A 5IUJC 4YO7A 5ISMA 4IH4A 3AI3A 3IMGA 4HC4A 1RYBA 5AM0A 1XTQA 3W3AH 5IN5A 3ZUGA 1C9EA 3G9QA 3V4OA 1EFLA 3FPEA 5CX4A 4D8TA 4DM4A 2LKDA 2IEGA 3EZ6A 4QUGA 3T5BA 1EBUA 3M1LA 3O5AA 1X7GA 5DSXA 3PHGA 3H2GA 4M88A 4B75A 1YQUA 4EFLA 3KWLA 3HR7A 3WHLA 2BH9A 4C7OB 1UEIA 3RF6A 3IUYA 1SQ5A 3JPWA 2DZDA 2FUKA 2O5EA 2H5EA 1WDLA 2XB2A 3LQQA 4CCAA 1YCGA 2R48A 4V3CA 4YLGA 1USVA 1SKYB 3E9MA 2J87A 3DJYA 3EWAA 4I6JA 4YP5A 4JXXA 1FP1D 2BSAA 3OPVA 2P6RA 3QQPA 5HF6A 2O8BB 2FMTA 2B6HA 2PKWA 3OVMA 1JR3E 2J30A 3PYLA 3QVLA 2QLLA 1YB1A 2COKA 8LDHA 1AN0A 3MJSA 1BWQA 4OXKA 4M22A 3WQBA 1OXXK 3EFEA 3JQAD 5A4MS 1QR6A 4Z3KA 1IAQA 1JZSA 2FJPA 4F3YA 1VPWA 1OV6A 5DBFA 3KT8A 4PBRA 1KI9A 3KAKA 3DL0A 4PZZA 1LVUA 3PI6A 4M9ZA 2Y27A 4W1PA 1R16A 4ME6A 1E2UA 4HEQA 1ZYUA 4Q7KA 5I7RA 2R6DA 3QFTA 1PL7A 2X1VA 3PFBA 2EJCA 2WSLA 3V5NA 4DUZB 3NFRA 1XMIA 4DIKA 1S8FA 1W4LA 3P96A 3KWJA 1A0OA 1E77A 1NV8A 3C3XA 3IESA 4Q7JB 4DDKA 3TZKA 5AHXA 4EQ6B 3MJFA 5B55A 4WRRA 1Y1LA 4R01A 1M9NA 5TJHA 2XKKA 2W6JA 4OJMX 2DQ4A 5FTKA 4MWBA 1W8DA 5GQSA 1LA2A 1QYIA 3KVYA 1RQLA 2XMGA 3UKDA 5CG2A 1TGVA 2GASA 1CUZA 2ORWA 3NGMA 1W4CA 4L57A 4F4IA 1SVWA 5MN5A 1OGYA 1M83A 2NVUB 3HDHA 4C2UA 4M7PA 2ZXFA 4GX1A 5DM4A 3VO8A 3WMRA 1I01A 3WKBA 1W6UA 2NQ2C 3COSA 2I71A 1Q2XA 2BDEA 1WP9A 3QA9A 5D87A 5F7XA 3KZ1E 2GZ2A 4Q0MA 5H9WA 1Z13A 1MLDA 4ZHSA 3FPBA 4FONA 5K3CA 2WWWA 5KVQA 3GP3A 4PVCA 3GCDA 2EDAA 2HUPA 4J6EA 1YR1A 2H06A 2R8OA 2UYQA 3Q12A 4PPFA 5COQA 3RIMA 4B4OA 3PEUA 4HWSA 4DNPA 2A58A 2AIRA 1YFKA 1ZOPA 1U8XX 2TECE 1M8PA 1V9SA 3LLVA 4MWZA 4WK6A 4XTRA 3VHQA 3FCYA 1E2EA 2VDJA 3NC0C 4CV1A 3SQNA 4BWGA 3L93A 4B7UA 1QIFA 3DD1A 3G3EA 2TRSB 1F5SA 1KYVA 1CIPA 3BWYA 4JROA 4MUKA 1E5TA 3EQZA 3S2EA 4KLCA 4B2IA 4CKYA 4QLAA 3SJZA 3LVBA 3E58A 3G2MA 4IUYA 3OCCA 3PCTA 1VE9A 4RNCA 1I3OA 2HMUA 3ESAA 3HWSA 4XQ0A 4WV3A 3SDZA 5EQTA 2GESA 1L7OA 2FUNB 3D0QA 3GGOA 3AHHA 3II6X 1QZUA 4HZUA 4JBYA 4LVCA 3N53A 1IXRC 3K5WA 5F1PA 3VBEA 3I2GA 2REOA 4HDKA 3EIQA 3V3TA 1WXDA 4CLDA 4F4DA 4U39A 2HO4A 1EDDA 4I50B 3GLIA 2I1WA 4C6SA 3K1YA 2BFMA 1PWEA 1RZUA 4NWIA 3AL3A 5B6IA 1MVOA 3KTAA 5GONB 1QYCA 2VXOA 2QG4A 2RK3A 1TL7C 2QN8A 1D5CA 3QWFA 1EHCA 2JAQA 3QUAA 1RFGE 4E4YA 5GAJA 4JB0A 1U63A 4MLZA 1DZIA 2ORED 2G4VA 2LKCA 1EFKA 3E2MA 5DCWA 5IH3A 4D0SA 3ONWA 3H1GA 4C0HA 4N5IX 3KLMX 1JPVA 1PBNA 1G5RA 1Z17A 2HF9A 2ZSAA 5KX5A 4KAAA 3TOSA 1SVLA 5AKYA 1J56A 1K7EB 4E09A 2ISCA 1M33A 2WM9B 3FUCA 3T94A 4L50A 1QQTA 1U0OC 2JFZA 2MDTA 3MWFA 1PRYA 4J76A 1QB8A 4QQKA 5AVTA 2ODNA 3MBKA 1RWMA 5CM9C 3TJMA 2WFMA 5IWAB 5IAJA 5TMBA 5BVHB 2PN1A 1DBVO 3G8AA 3V9AA 2XDYA 4XW2A 5CXSA 1KHTA 4YV7A 4JI8B 3KUKA 3BXZA 3RASA 3T06B 4M86A 4BFZA 5ITWA 3U16A 1UOPA 1JHVA 1PV2A 1IBSA 4AZ3A 1YIAA 1F1JA 3COPA 2B20A 2C9DA 4YRBA 5DLQC 5C8YB 3Q2KA 4KODA 3I4CA 4XOUA 3TLCA 2P7HA 5ADWA 1AMOA 4FQ8A 1X7WB 3VYWA 1XMPA 1LTQA 3AEKA 4R2WA 3VC1A 2C83A 1K6JA 2ZUUA 4ZVUA 4YUAA 1UH5A 3EW9A 3L43A 5DYIA 3MCWA 2ZCUA 5B12A 4HWOA 2IU3A 1PYGA 4YRDA 1GPYA 1T3TA 4TVOA 2J3MA 2FX3A 3SPXA 2OZEA 3N59A 5TGZA 1NVVQ 5KJ1A 1AKNA 3EOZA 4KO4S 4AO7A 2JIBA 3BT7A 5BPHA 3UK2A 1RIIA 2DM6A 1GAJA 3PB3A 5AJXA 3K31A 4ARZB 2LCIA 4G6ZA 4WNYA 2VCYA 3E5HA 1SHLA 1DX4A 2HA4A 5K4HA 4WH0A 1EP1B 1Z38A 2PU5A 5JMPA 4ZMRA 3UBTA 3C5VA 3KCQA 5LR6A 3G0HA 3MIIA 3IH5A 3FOCA 1TW2A 3JWPA 3PUXA 5FNVB 1MB0A 3H5VA 1XMXA 5JNTA 1P4GA 1DARA 5DHSA 1F6WA 1XN4A 2CNOA 3MTAA 1PD1A 3UK7A 2WTEA 3N8DA 2ZIVB 1BKSB 1A82A 1IXKA 2C2HA 1FXSA 3AM5A 4DEYA 2FEKA 2ZJ1A 1ZSNA 1WAMA 2GK4A 4CTNA 3HYRA 1FUIA 3L7MA 4BN5A 1DG9A 5JNSA 1ORVA 2JRLA 5K5EA 4ZAXA 1D8AA 1G8FA 4RCZA 1W94A 2R8YA 3H1FA 3C6BA 2AFHA 3EXG2 3PE3A 4KQEA 3OQBA 1U0JA 3UB3A 2OHXA 2GD6A 2A9QA 3TUZC 2JL1A 3QLEA 4AKSA 2OXRA 3E5NA 3IV9A 1WS6A 2C77A 3PVCA 4Y2UA 4OREX 1H94A 5JQGB 2JIQA 1DBQA 4JU8A 4IVPA 4RA6A 3N70A 3V00A 5BT8A 4XM2A 5HE8A 3FLEA 3TW8A 2YIVX 3ZU6A 1H8HA 5G2OA 5KTOA 4D5GA 2C31A 3RQIA 4PLPA 1JXQA 1SIOA 4D82A 1QS0A 4XFDA 1WOMA 1ZH2A 4BGVA 3SS8A 1D4ZA 3TW4A 1T3HA 2F2TA 2HSGA 2VUTA 3UGQA 3WLEA 5LJLA 1L6RA 1RBZA 3SD7A 3D6UA 1T6NA 2UXDB 1Y80A 4MUIA 5BWMA 2Q2OA 1T8SA 3ONDA 4YJDA 3T7TA 1PZXA 2DSNA 2X7XA 2HQSA 3EGCA 3GRUA 3EPHA 4CKCA 4CKEA 1PGQA 2EW2A 1XHFA 4H27A 3A6DA 4S35A 2MOKA 1LJLA 2CFOA 3TUJC 4MOWA 2XJ4A 4PGHA 3WGGA 3RJMA 4JOCA 5KVSA 3M6AA 3KD3A 1NVKA 4U7PB 1RM5A 4AMZA 1DKLA 2FMKA 4JP3A 4LJLA 4MVJE 3L8YA 4ENUA 3G2IA 4LQCA 4E5KA 4UU8A 4PYJA 4E6EA 1ZCAA 2I2FA 4C0SA 4Q9KA 1UXJA 1WPGA 1MR3F 1VB3A 1YIOA 2HZ7A 3HXLA 3VQTA 1COWA 3RT9A 4UUQA 3UYLA 3OPYB 2HK7A 1MZPA 5T3YA 3OFJA 3CUUA 3HWWA 3QW2A 2PH1A 3LC2O 1RYFA 2Y1CA 1E1NA 3K35A 4Y1FA 1UBJS 4FI3C 2NQ8A 2VH1A 2VHEA 2YH2A 1NFQA 1DU4A 4G8BA 1S2DA 1AQIA 1D2HA 4GE3A 1T2CA 2VDNB 2I2XB 3TD2A 4CL0A 2X9QA 1EUYA 4I3HA 1V4NA 2HLDD 1J99A 3DOOA 2WAOA 2H2AA 2BY4A 1X7YA 2VDUE 4NYJR 3IAFA 1A9YA 2YX1A 1P4JA 3V9PA 1JEYA 1G3MA 3QJ5A 3NHUA 1TAGA 3LX4A 3BWEA 3EEBA 4J1TA 1P8JA 4JQZA 4FI3F 2QT1A 4I66A 4N0PA 4ECAA 1JAZA 1U6IA 3AU8A 3ZI4A 1VFNA 1N6OA 1ZOSA 4Z4HA 4CYMA 1FSGA 2PUAA 1XZQA 4Y6RA 3W9BA 3JVVA 1I2MA 5H59A 4R8LA 3U7GA 1O9BA 3L0CA 1CS4C 1PJLA 3FR8A 5KNCD 1OA1A 2CLEB 1XZDA 1NDUA 1OFUX 2FWNA 4QYIB 3M8KA 4M7WA 1J9ZA 1NOJA 3U26A 4NEGA 1GVNB 5BOSA 4RH1A 4AZVA 2OGUA 3SIWA 4IOMA 1JS1X 4KZKA 5FF9A 1VHDA 4I4IA 3FNHA 2HR1A 3SX4A 1TM3E 4JGBA 1I32A 4F1WA 2JBAA 1IPHA 1QGUB 1YL6A 4MUAA 4DXHA 3CJQA 5K45A 1QANA 4W8HA 1QFZA 2W8BA 5LYYA 3C7KA 4P4TA 3C8HA 2Q45A 5F7JA 5HNKA 1ZOIA 4CM1A 3WLNA 3NBZC 4G09A 4C7KA 2KLHA 1DRVA 3BHMA 2B94A 4WJKB 2QL5A 4LZLA 1G8AA 2RHHA 1EI9A 2FSGA 2YUTA 2CLDX 3I12A 4DTCA 4FE3A 3S81A 3EQ7A 1RHJA 5D01A 5I3CA 1XHEA 2WIDA 1G63A 1A95A 2ZIUB 4IM7A 2JGIA 4Z99A 2JK1A 1OX4B 6GPBA 4ZYXA 4K6GA 5FTLA 3VO2A 4QO7A 3HCWA 4N7MA 1RRKA 2ZI6A 3U3DA 2GT1A 2JBHA 2E89A 5U4QA 1G8JA 3OIFA 4G65A 1PG2A 1X9HA 2ZSJA 1GAXA 2XYVA 4O2RA 3WGZA 4B48A 4QJIA 2C2ZA 1FNCA 2CF6A 4R7GA 1P33A 3FPFA 4NFSA 2Z5LA 2XUOA 3DC7A 4A8JA 4CMKA 3U1BA 5CIQA 3AKYA 2XGMA 2C0CA 4HDRA 3WIOA 2QF7A 2Q5LA 4EYOA 4ARUA 3PGKA 3FA2A 1M7BA 2C5LA 1R00A 4JR0A 1E3EA 1ACLA 1ICEA 4NABA 3WP0A 1LXCA 2ZWVA 2OYRA 1J2EA 5HGXA 4Z4QA 4NBTA 3PK0A 2LD4A 1I5RA 2VZLA 3U4CA 4CL2A 2UYCA 3FPSA 1Z63A 1YRWA 5B3JA 1NJ2A 5GGXA 3V7UA 3WX0A 2WKRA 1F14A 2HGSA 3KQTA 4TV8A 5SZKB 2EP5A 3IVCA 3A27A 1R7RA 3K9CA 1RCTE 4R68A 4REMA 1N9ZA 2FAXA 3LC1O 4V0QA 1IULA 1C8KA 5IN4A 5DMXA 4BUJA 1II8B 5LMUB 4RA9B 2ERXA 2GZSA 3LJKA 3H3FA 4J75A 4X3OA 5KAPA 3UWKA 4ARAA 4Q6WA 4LDNA 3ZGLA 4KO2S 4BNZA 2BEKA 2H5LA 4JX8A 5E8JA 2C3OA 1WTCA 3EQ9A 1U8EA 3IQEA 2VK2A 4KMOA 3LL4A 3RYTC 2C2MA 3WSTA 2YASA 1U7UA 1V1JA 3BDIA 3KT6A 2B4QA 3EAQA 3QLVA 3DKIA 5EHQA 3O90A 4K7JA 1BROA 5AXAA 4DCVA 3SZOA 4EHBA 5KEIA 1R64A 2PMWB 4I4TA 3ZOZA 4GKVA 1PT6A 2IITA 2AC4A 3FTCA 4HN9A 4ERXA 1ITZA 2VTBA 1UC9A 3DZFA 3M49A 4YK7A 1YBVA 3MD9A 3BMXA 2B7BA 1SKYE 4WN9B 1NG1A 2FH5B 4A6PA 1FUEA 3TFWA 4CUKA 1M0EA 1R0KA 3A9WA 4TVBA 4EQZA 2I4LA 1LC3A 1GZ4A 4XPZA 3L8ZA 4LJ4A 4LY9A 5I01A 1W0JD 3WJ7A 1A9RA 5EIBC 4C89A 4Q9IA 4YRNA 1SJ9A 4IMJB 2CXQA 3QY9A 1DDGA 1QAQA 4RZQA 1K66A 2ZIAA 5ALUA 3EOAI 1HWYA 3RNOA 2IYUA 1KERA 4E14A 1Y4SA 3LX6A 5DSTA 4IDFA 3WTCA 3EWSA 2GPSA 1Z5ZA 4N5DA 3H7AA 3ZZUA 3OM8A 3MTJA 1Q1AA 1SCIA 4LPKA 1IY8A 3EPPA 3NW9A 5A02A 1FMCA 2REQB 1V25A 3EY4A 3P9KA 2BMDA 3QI7A 2IYLD 5ALWA 1P62B 4C4ZA 1E4VA 1VLLA 2PT7A 2R1TA 1EE1A 2CKMA 1U2SA 2EARA 2AZTA 1SXJC 1ORWA 2ZRFA 3F6CA 3LAWA 1UDAA 5BNTA 1UT6A 1BFDA 2DVMA 4FZRA 4DXDA 5BR7A 3RRXA 2ZUWA 1RHRA 1N4AA 4BZWA 3FNFA 1S4MA 3BXPA 4MPDA 5AI8A 4DR5B 1QJ4A 5DHFA 3K0FA 1I6MA 1SD5A 5C1DA 1Z4QA 1KAGA 4US1R 3GP8A 1JWLA 4V0OA 2JH3A 1LWNA 1GNTA 3GRCA 4EA6A 2BI8A 1VPEA 2A2ZA 4KRFA 1EB9A 3F4BA 4GPAA 4TPKA 4ENWA 3PXBA 4P7FA 3WHIA 5KTKA 2MHCA 5GV7A 1MQ9A 2JCXA 1JQ5A 2QN3A 4XM0A 1TMKA 1UQTA 2VPYA 5A0FA 2Z8ZA 4WLNA 2HSWA 1EK1A 4CN9A 2FSSA 3ZZTA 2ANBA 1FTYA 2XKBA 5TB5A 1X7ZB 2OM6A 1Q19A 4OHCA 5FV7A 3T7KA 4PG7A 5D6NA 3G8CA 1CSEE 3OT4A 3QFRA 2WU1A 3TAXA 3FGZA 1LW6E 2JAOA 3PR3A 3FCCA 4HAOA 5ERXA 5F78A 4D3ZA 4QASA 3KKQA 4BMXA 3NKVA 4ITUA 4WOJA 2RI1A 4U9UA 4BQRA 4E31A 1UXGA 2ODBA 3LA6A 3N2KA 4DVJA 1HURA 1X8XA 2C5EA 4KDRA 3F9RA 1M66A 1YBHA 4GOMD 1KFKB 3NX4A 4Q7EA 4FGZA 4QFMA 3H18A 2HNBA 3F97A 3KHTA 2ECKA 2EEPA 3FXAA 5GVSA 2IZ1A 3EA4A 3DUWA 2CK3A 1G7RA 1IU9A 1AXEA 2ZUCA 3EN0A 5DISB 3SM3A 4UW9A 5IDYA 4YQEA 1JKXA 1EWVA 2J3EA 1W9MA 3LXUX 3Q3GE 2WU8A 5KSPA 5FLYA 5DSZA 2IUFA 4Z8YA 1VSUA 4DC1A 3EXHA 4X24A 2Q5FA 3QVUA 5FUYA 4EH1A 3ZK9A 5A1TA 1G291 4MRVA 1Q83A 1RLUA 3W9YA 1KPIA 4G2NA 1F51E 1H66A 1RTTA 5CBKA 1KMQA 1MX1A 2FK7A 2H3EA 3QMPA 4HDSB 5EG5A 2GZMA 3A11A 2VYND 3MRVA 4KXLA 4JI5B 4JODA 1AD2A 1AKTA 2IYFA 5HW0A 1YQWA 4W5NA 1JMYA 1K75A 3C5CA 3JZAA 2IGBA 1CDZA 2OHFA 4WCFC 3EFHA 4IEIA 5D3QA 3PX3A 4Z2AA 1GRQA 4GD3Q 3RLFA 1AS2A 5CA1F 3MJVA 4UNPA 4M3NA 1N0UA 4UBKA 1IZ7A 4OLFA 5LQNA 2IF0A 2VT2A 1QO7A 3MTQA 1N75A 4G1EB 5TQ2B 3GJ6A 3LYUA 3IQZA 2OE2A 3M34A 3ZWPA 3DHEA 3GCXA 3CJTA 2IELA 1C4WA 1TUEA 4JCOA 1YZVA 3S8YA 1Q20A 1E3JA 1Z7YA 1KI6B 3ZWDA 2KW5A 1QZTA 4BFUA 1OH7A 3BXXA 1ZW1A 1QIJA 4JDPA 4OAOA 5F2NA 5I4KA 3OUTA 3FDZA 4MHSA 3HZHA 3IT2A 4JH0A 1CV2A 2FPRA 2PWAA 4WOBA 3ROKA 1P17A 5CVUA 2GB4A 3NDBB 3L7BA 4PE5B 3OTHA 2MYTA 4CTOA 4X91A 4MR8A 2ZJ8A 5P21A 3SHVA 2DFVA 4AUNA 1G8HA 4D6YA 2KPOA 8AT1A 4AF8A 5JCOA 2OAEA 3GYBA 3ZWBA 1CY0A 3FGPA 5LCXA 4IJQA 3LTEA 2BP7A 5KYTA 5IKXA 5LFAA 1G1AA 2YQ5A 4PZLA 5FOUA 4B6GA 4H17A 2I6TA 1SKMA 1C4KA 5FTNA 1KJYA 2LR0A 3ZXUB 4B7CA 3D2CA 4C0LA 4FZ3A 2ZJ6A 4POOA 3MC1A 4HDCA 3JPYA 1J5XA 4QHSA 1ULHA 4CMJA 1U2EA 1L8LA 4OBBA 4JB8A 2CFTA 1OTYA 1Q17A 2Z2YA 5EWLA 1YB6A 1VG0B 4BU0A 2EV9A 3GFRA 2FRDA 2Q1TA 3OKPA 4XUCA 1JLLB 1WHSB 1WPQA 4BKOA 5KBYA 1JFRA 2VEOA 3A9UA 4QHTA 2H51A 3KZOA 3DV0B 4K2HA 5AVQA 4WLOA 1I0LA 4XA8A 1NRWA 2J0UB 3WRYC 1M54A 4HNGA 1DHTA 3S2UA 1YR9A 4AFNA 4EA7A 3LKDA 4QYWA 2ZRDA 2GSDA 2COUA 1XI2A 2ANCA 1GNVA 4ZQFA 4DA8A 1Q15A 1N0VC 3OF3A 2X6RA 2O19A 3ADBA 5F12A 4YQZA 1NLMA 3NAQA 4QODA 1MTZA 1M6VA 1U8ZA 3OZUA 5FXMA 3BE4A 4JWTA 4HTFA 2ZYVX 1JF8A 3O6VA 3VDRA 5JXHA 1Q1GA 1RZRA 2R97A 5T4BA 5EQFA 2NSHA 3I45A 2P9QA 3L6OO 1BVYF 1NV9A 1XDGA 4RVFA 4HHEA 2NUTA 1EX7A 1FTWA 1EFTA 2FXVA 4QREA 3CVUA 4QFDA 4EG1A 3IUQA 1L4MA 5H4HA 2PMBA 3EA0A 4QNMA 5COAA 1C1XB 3I8XA 3X43A 2ZPAA 3RUAA 1LSSA 2I1LA 4NBWA 4OYRA 1MABB 2RHCA 3ZJYA 1E6WA 2C0PA 4X5OA 4JT8A 5BN3B 1KFBB 4MIKA 2RHLA 3K8OE 3KBOA 4ZREA 3K9FC 1PGJA 3CO5A 4LV6A 2TS1A 3C5WP 1EJBA 4ZEOA 1JQBA 3DG9A 5FAKA 3FIJA 4WLFA 3WYGA 4EW6A 3A1UA 1D7AA 1DLJA 4ZGGA 2OKCA 2HJGA 4IS2A 4P92A 1QYDA 1O95C 4N40A 3QEBZ 1JZTA 1V41E 4PLTA 4GZ5A 4W1QA 1SY7A 4YMUA 3KQQA 5DLEA 2FKNA 1ZICA 4ZA2A 1UMDA 1ZXXA 4RZHA 4EO4A 4RTKA 1DX9A 4OQ4A 1BHQ1 3L6DA 2JGFA 2YWXA 4CF4A 5ERGB 3BJMA 1ZCJA 4A8HA 2IXEA 2WYWA 5JH7A 2OCPA 3KJIA 2B4YA 4D7AA 1LPMA 3LDGA 3MTBA 4RFVA 1TT7A 2RG7A 5HRCA 2PJRA 3I04A 1ZRMA 1YQDA 4Q93A 5L4NA 3A9VA 3ADKA 2P1ZA 1XZNA 3PPVA 1M2OB 4YXWA 1EFVA 4U8GA 5CVVA 5JAMA 3BVPA 4HLNA 1TI7A 4XSHA 1J1UA 3EVCA 3S44A 3WQQA 1SH7A 4OVKA 1X14A 4MZDA 5JTTA 2OBLA 3DUFB 3UWMA 2X5OA 3EXIB 5I51A 5BSGA 2ZVJA 4JJFA 2ORIA 5FBHA 4AIRA 2WU0A 2P6UA 4IXDA 4K9MA 3H17A 5SYNA 1JTFA 2DT5A 3J80A 1NDQA 1G5HA 2BJWA 1QG4A 4NZYA 5DYWA 3UA3A 1K3UB 4DRYA 4F1KA 3DYIA 1Z6PA 4TXNA 5JARA 1ZNXA 2NLOA 3MJ4A 5LZ2A 4GP6A 4Y6SA 2AZDA 1T0BA 4JVSB 3K05A 2FP3A 1Z35A 3OSZA 3SSMA 3W6NA 2QRJA 4DJDC 4OOFA 4J7XA 4WJLA 2A0FA 1L5GB 5KTSA 3KZCA 2BCEA 3KAPA 4U00A 4WAUA 2PQ6A 1A5TA 3B89A 4PX9A 3AIMA 2IZ5A 2HZBA 4AMYA 3ZE0B 5JZMA 4EIWA 1GPDG 4UQLA 5JAPA 3MGBA 4YC7A 3P4UA 1YVPA 4HGNA 1ZUIA 2GJAA 4B4UA 4TS3A 2G80A 1WXWA 3S2SA 5EE3A 4CM8A 4FDVA 1L7DA 2C2YA 3GR6A 3ROQA 2ATXA 4HVCA 3U4QB 1CQIA 3SM9A 1JE1A 2ZRNA 3KDAA 2ZSUA 4UZFA 5ALSA 2JDIA 2JGDB 5E7IA 1U2TA 4HGYA 3KJFA 5G4KA 4DJTA 1GGMA 3GGJA 4LJ9A 3N75A 4G84A 4JBWA 5K8JB 4NYIR 4PHCA 5H82A 2QRHA 1GR1A 3KYCB 5K99A 4YMVA 2O54A 1EM8A 1Z82A 1YE8A 1YDHA 3PEVA 3Q9NA 1O5TA 3KX2A 4LX0A 5LP6B 4R51A 3TSAA 2H5IA 2WHRA 3L0BA 1NW7A 4M6WA 3WMEA 4OBWA 5A5DA 3HL0A 1U5BB 1FPQA 8ABPA 5LZ8A 2RGBA 2RKWA 3I9V6 1K97A 1W5EA 1W4BA 1K8RA 1P7WA 3L2OB 2W2PA 2I7TA 2PE5A 1CUCA 1KZYC 1W96A 1Y8CA 4TLBA 2OCGA 4XQGA 2AXEA 4RKRA 2HH9A 3G2OA 4FYYA 1VBMA 3P9CA 1JXOA 2YUIA 4A10A 1DKUA 4DAOA 2JF0A 1P1FA 3MYYA 3N0VA 2R5NA 1KF0A 3WO0A 2XT6A 2ATVA 3RWOA 2W2LD 4S1NA 4A0SA 3DWEX 1VMEA 4ZQGA 1MT0A 4Z7JA 1JDZA 1RAHA 2PZKA 3SNKA 1FXWA 5A5GA 2XUDA 1X94A 4XQCA 1FX1A 4CKZA 1Y37A 2Z30A 3AJEA 4JNCA 4IOJA 3U4DA 7REQA 4OUKX 1B8UA 4XPIB 5DFAA 4K88A 5LA6B 4ECEA 4RF4A 4KXFB 3A1SA 3HUFA 4LE0A 2G8NA 4D80A 2O3JA 2EOAA 1TZKA 2P9BA 4ND6A 1PQWA 3RVNA 1M76A 2CJFA 1P7CA 2NTJA 4H0FA 4LVUA 4QJBA 3EZ7A 1O94A 5EPEA 1GD1O 1QK5A 4DUGD 5CVJA 5J43A 1CX9B 4DB2A 3H8VA 4R0MA 3GFGA 2HK6A 1GPUA 3AXSA 2QZ4A 1QO0A 1WD7A 2X6TA 3ZGXA 3ZXXA 1I1QB 1NW8A 3ZGZA 4LEIA 3C97A 3TPZA 3EEFA 2CDBA 4IYJA 7ADHA 4GKAA 4HLDA 4I5EA 2VNJA 1G20B 1H65A 1GTJ1 1XDWA 3ROEA 5AD1A 4IZHA 3QBVA 1J70A 4YCAA 1H1TA 4NCKA 5CFLA 3HNRA 1OE0A 4EY4A 1PEYA 5EJ5A 5B4TA 3IPYA 1XZJA 4KE6A 5C8YA 2DLCX 2XUPA 3OEEA 5F2OA 3KSMA 3EGVA 4TV9B 1WQ4A 5YASA 2AJDA 4PZ9A 2WYOA 5KHAA 4MYDA 2I2CA 4FOLA 4B3SB 2W2TA 3KKKA 1HK7A 3G1WA 2H85A 3HDYA 2RH9B 1U1GA 2YVKA 1UJ4A 2G9NA 1I1NA 2NO1A 2NUAB 3RVJA 1BCSB 2A78A 2VYVA 3TWOA 4QOJA 1HFJA 3QF4A 1M8GA 3RU3A 2GQ0A 2H4WA 5D86A 4BNYA 3P1JA 4OYHA 5F98A 2QSUA 5IFLA 2NU9A 2GPTA 3RAEC 4OJTA 2WHQA 5EMKA 1N1DA 1WXXA 3Q5GA 5IC4A 4EB6A 2JEYA 3F4LA 4A7PA 3GAFA 2DLNA 4EYEA 3FUUA 5G1OA 3G5MA 4XGNA 1N2ZA 3ES9A 3UMYA 4UMEA 5DI9A 4GL4A 1V43A 1NYQA 3F78A 1V8OA 3N2YA 3ZDQA 2R96A 1ADCA 2D3TA 2WM2A 4N01A 2PH7A 4XJTA 3C5HA 4TQGA 2P67A 2YOHA 4C7VA 3AYZB 4YAJA 4RDXA 5TF0A 4YXFA 3LNCA 3UUFA 3HWRA 5LOVA 1Q7BA 1DV2A 1WMSA 1AUPA 1Z74A 1W7AA 1OI2A 5GPBA 2A3RA 2Y4OA 5DYGA 3FRJA 5KVVA 3LQ4A 4FCVA 4E5MA 2SHKA 1T0PA 2V0GA 3U9TA 3O7WA 2I3DA 3QVGA 5F33A 821PA 3PHHA 5CP8A 1KZ6A 1F2UB 1ZM9A 2JGEA 4TT3D 3HCNA 1V7CA 3ZCTA 5HA5A 1QGOA 2EYUA 4C6RA 1KO1A 4IUCS 1WSAA 4YAIA 1CYDA 3QOYA 3VNUA 4FEEA 2XUKA 4U2BA 4DYVA 4QAQA 5FA8A 3DE1X 3PJDA 2VDPB 5DX8A 2HDHA 3IULA 2JI4A 3K20A 5G40A 1KE1A 5J2TA 1R8XA 5DTRA 3LQ1A 3TM5A 4EG4A 1NPDA 5KC9A 3BL8A 3INGA 3R77A 1DAPA 4GKKB 1EWRA 3SKYA 1XZGA 3KOYA 2G1KA 5HIJA 5T67A 3BHNA 1FF9A 1M2VB 3Q3EA 4W1SA 4WACA 1WUKS 5ICGA 3A2MA 1KH3A 1TC1A 2VQ3A 3IUSA 1CZRA 4ZT7A 5J4LA 1W36D 4V1CB 2J1LA 4H7IA 1NP6A 3FWNA 3O8QA 1KDOA 2D59A 3AUUA 3DYVA 1NYRA 1Q1EA 1N5MA 2J0VA 5I9SA 4EATA 4Z0HO 2BLNA 4ZODA 3BJRA 5CEEA 4ZMBA 2BUBA 5C32A 2X3FA 3PE4A 1BGVA 1L4FA 3VU9A 4CQNA 3M9XA 4AW9A 1OB5A 4XIJA 4X61A 5LNK1 3ZD7A 1CY2A 2IHVA 1DEAA 2NACA 2P27A 3H7IA 5GM1A 1I13A 3DOUA 2XXAA 2O20A 2PWZA 4NJEB 4RK5A 4RUKA 5FPHA 4B44A 4B2PA 1G5QA 1ZGBA 1ZAYA 3HU1A 3F7OA 3ZY6A 3M1YA 4IG9A 3VR2D 3BDAA 4HFNA 2GZ1A 3CZAA 3CEMA 1SBZA 3DZJA 4YP1A 3KR2A 1C4OA 2VJMA 4V0LA 4WESA 3W8FA 2BL4A 1PAUA 3OCVA 4DQLA 1TD1A 3Q6NA 2AFIB 1W59A 4DCTA 1FDUA 2JKZA 3FX2A 2VQ6A 1BRTA 4XUEA 1LQ2A 2VLIA 3DOCA 2A0XA 4POAA 2JHCA 5LBIA 1ZVKA 3WK4A 2F43B 1A5AB 2BEUA 4JJZA 4YJFA 3T3DA 2QK4A 5DT2A 4C2TA 3PD7A 4AJ2A 1Z2NX 3TLAA 3GXOA 4WOKA 3C24A 3NIFB 1FLNA 5H68A 1P1JA 3IJEB 1MG0A 5I4IA 2YJ6A 3PUHA 3DGFC 4PO3X 1KK0A 5IVKA 1HYBA 5ALIA 2O2EA 1Z88A 3QKRB 2ZSEA 3UPUA 4JVLA 2IRWA 1ODCA 1Z0ZA 2NSDA 1VSTA 1U8FO 3O31A 4FCTA 4IH1A 3S6JA 1YVEI 3SEQA 1WVMA 3CKKA 2XGSA 5LVAA 2GHIA 3A25A 4JUBA 1L5QA 2AOUB 3A3OA 3E0XA 4O8CA 4YLEA 3UC5A 2R85A 5LD2B 2P91A 3H4TA 1W46A 2R7MA 4O4IF 3SVTA 2WW8A 2SKEA 4KQMA 1FQKA 4A0QA 1CNEA 1ESMA 2O8FB 1HTBA 4TWRA 2WJZB 3TJRA 2PQ2A 2YBEA 3D4NA 3IL2A 1IUNA 1L8OA 2WIJA 1CUUA 3PZBA 1YAJA 4ZARA 4LZPA 3R3UA 2Q07A 2XWJI 2F9MA 2B35A 2VRBA 2IUUA 3OG9A 3ORHA 5IW8A 1RLOA 3UJAA 1M6NA 3TTSA 4R69A 3THYB 3IEPA 4Z4CA 1BS1A 1YDMA 2DFPA 1IRXA 1H6DA 1ORRA 4Q5IA 4FD3A 2I9PA 1RJWA 1SCNE 1UK7A 2Q8PA 4OQDA 4ZGWA 1CRWG 4L4UA 4RMGA 1XQ1A 1G5FA 1ECGA 4NBSA 3E7WA 5LZ5A 5T3UA 2DFDA 2BZ1A 2AD1A 4LNUA 2FA9A 4IRUB 5KVCA 2DB3A 3IOMA 2ZYDA 3A28A 3I8SA 3ZHVA 2ODEA 3WK5A 4QWWA 1FFSA 1TJYA 1JI3A 1TC2A 3PX7A 3JQPA 3C98A 2IYEA 3EBOA 3KJEA 4P5PA 5DYNA 3RUIA 2Z57A 3R7NA 3R5KA 3DOHA 4UE2A 4PZAA 3DKPA 4GBGA 3RSGA 3VNQA 1SOWA 2XOXA 3ZDEA 5MFPA 4CMAA 1C7JA 4KDFA 2RJ3A 3HC7A 3LUAA 5E8RA 5KNBA 2PUBA 4FNMA 2BFFA 2Z9BA 1MOSA 1WPXA 4B5KA 2BHTA 2GM5A 2OCLA 2OD2A 3R6DA 5BMVB 4RF2A 3BFJA 3PXDA 1P8AA 1N7IA 3GH1A 3QPDA 4X7RA 1ZVQA 2BFEB 1BOFA 4HYTA 2K6GA 2Z3ZA 2XTAA 2MIIA 4D9EA 1SB9A 3O3MB 1SZPA 3DXXA 1DAEA 5HZMA 2V1UA 1AZSC 3M2PA 3HJBA 1C1DA 1MAWA 3EVGA 4OJNA 3KTOA 4BL5A 5A4FS 1JFSA 1V11A 2VPIA 3HYSA 3R5SA 4U0KA 1NQ5A 5FCDA 3R5HA 4ZCQA 5P8WA 3VAYA 1A4UA 3LKVA 2A9PA 3SVLA 3Q0EA 2ZGVA 2WHXA 3L5OA 4CDNA 4A15A 4EO7A 4YRMA 4DNFA 1E9FA 4EX6A 3JQDA 4XIGS 3IPAA 4LNHA 2ZP1A 5C1PA 3HA2A 5FJJA 4RPGA 3A9RA 3E3LA 3GPLA 3Q8LA 2R6ZA 1O4VA 1E59A 1LPSA 2CCGA 3BJZA 2IBSA 4WZAA 4INOA 3P2KA 4H3SA 4ESHA 1H1DA 2EKZA 2HD4A 2ZRBA 1K6IA 4IV0A 4E7PA 3P9NA 2XZDA 2GA9A 3HCEA 4KVFA 4F45A 2NPIA 1V5EA 1EE9A 1Q7RA 3V97A 4Y9DA 2KHZA 2ZYRA 3KPJA 1IB6A 4TKUB 1L7VC 2CBGA 5HKOA 3DXFA 2AE2A 4WY5A 1B7GO 1PFYA 2YNMC 2ZUFA 2ILVA 3SMQA 3CTPA 3WBBA 3ZTYA 5HZGA 3QXXA 5AW5A 3KT0A 4H3HB 1MOZA 1RLTA 1YRHA 4AS2A 4FUTA 3TXYA 1KS9A 1G38A 1ZNZA 1K8ZB 1NM5A 1PQYA 4QGAA 1IJFA 3K70B 3MW8A 5GJWC 3L9WA 2Y6UA 1UOQA 3DZIA 3MS4A 2R6JA 2Z8XA 3ASYA 1VLJA 4FS3A 4S2UA 5E7MA 1E18A 1GHTA 5IUNC 5F1YA 3LUKA 4LJ8A 5K09A 4ZVLA 3C0KA 4MUYA 2ZUSA 4R3UC 1T10A 3RFXA 1V3TA 3LOPA 1KMHB 2V6IA 2DKOA 4PLGA 3CW8X 3OZVA 4TKMA 3OPMA 2MT9A 1M6WA 1L5SA 2VBGA 1WHTB 4X8LA 2OZLB 3WNCA 2GPAA 2WSMA 2YJZA 3F7TA 3GRKA 3EC1A 1EZ1A 4K6KA 3TMKA 4TTPA 4YA6A 5LMZA 3A3YA 4WK0B 1ZK0A 2RCNA 3FAKA 3FOWA 2XCQA 1YDFA 3ZHQA 4JI1B 5JS2A 2I4OA 3CYFA 5A4JA 4RMNA 3PEYA 1GXSB 3DHNA 1DFHA 3EVZA 3Q0TA 4AYTA 1GUBA 1SBHA 3HDTA 3WADA 5AM3A 2IHBA 1T3ZA 1VCMA 3ZW7A 1NWHA 5JLAA 4G2TA 4TLMB 2I7VA 4D0LB 4DA7A 1EEHA 1J2UA 2YHIA 3F8TA 2PK3A 1QVAA 2BEWB 5JYDA 1U0LA 4HCJA 4MVJP 5GGYA 4QPCA 1IQPA 4PC7A 4F6CA 9ABPA 1I7DA 5E6RA 3U5ZB 1WLYA 3L6RA 2HHLA 4G56A 2FX2A 1GNPA 1XJWA 1OHHD 4WL0A 1C7EA 3WFZA 2BGGA 2I2WA 4XWKA 5EJIA 5ELLA 3VR1A 5LYJF 4BLRA 3CRVA 1V6CA 4W7IA 2GPJA 3O4FA 4QRDA 1LB1B 1E6KA 1G66A 1RQGA 2CXUA 2WTNA 4TRRA 2BGNA 2WSSA 4JJ4A 1UJMA 1P7ZA 2D5CA 1YASA 2OD9A 3VX4A 4ZHQF 5HMMA 2I6XA 4A5OA 2VQFB 1HKHA 1S5PA 3BB3A 3BDVA 4O4HB 4EYGA 1TCBA 1BW9B 5AKLA 4HP8A 2X15A 3RW9A 1AO3A 2AJLI 2J3IA 1MU0A 3GUCA 3EUWA 3HP4A 4QPDA 1KQPA 1P4SA 1R6DA 1EBBA 2OV8A 3H8JA 4X1IB 5CRIA 4E46A 1JHXA 1Z7GA 4DDHA 4KR9A 1XT6A 4EY6A 2C99A 3LCJA 1AURA 1B16A 1QO9A 1Q7EA 1KAOA 2G88A 3E82A 2YWRA 2M1XA 3I92A 3QIVA 4MMYB 1LPOA 2ZRGA 4QWMA 4X94A 5EE0A 3P4YA 2XYQA 4CI0B 3KUCA 2JFOA 2QORA 4WBSA 5K2OA 4HAYA 4CV0A 3UEOA 1GAEO 1CY8A 3MM4A 1P7VA 2NV0A 4TZKA 1I5EA 1V1MB 3LECA 3TE6A 4IIFA 2PYIA 3COVA 3AB8A 1I7SB 3ME5A 5C7IO 4I6GA 1JKJA 2ZJAA 3GGPA 3Q40A 1CY4A 5ALMA 3T1YB 4PHTA 2CHQA 5D3MB 1U81A 4FINA 1BEZA 2PA0A 2XUJA 2PS3A 3HN7A 4D3FA 3E27A 4BQNA 4YJKA 5E1OA 5CDYA 1FLDA 1DC6A 4B2YA 1FNDA 1OIXA 5JAUA 3O8LA 2NP6A 5F4BA 5LQCA 5BSUA 3WIDA 4RKWA 3OQPA 3MRTA 4V03A 1CUFA 1OBFO 4EQ6A 3M4NA 1JIJA 5DHRA 1AUXA 1F2TB 2V7WA 4HH3C 1HQCA 5GV8A 1WJGA 4EITA 3ND9A 5GIPE 4LMRA 4GC5A 3UV7A 3UN1A 3M9WA 2G0NA 1M2KA 2WKQA 4L3OA 4CM5A 3LBAA 3MXTA 2ZJ4A 4H3KB 2JFHA 3VPCA 2NVUA 4PAGA 2C1ZA 1JMVA 1UPXA 1IWBB 3EDQA 3KOZA 3PV0A 4IJVA 2EJUA 3E7PA 2QYOA 2YZ7A 4WUVA 5JAOA 2J67A 1G20E 2QUKA 5IUKC 4ILKA 2DLDA 3HV0A 3GBPA 2IZOA 5JSYA 4LYJA 2BUCA 1N5IA 1NAIA 1FQOA 1U1EA 2J9FB 2X8LA 3AVQA 3PXUA 4PSKA 4JI7B 4W5TA 5L3VA 2O48X 3PWZA 1IEVA 4GR5A 4JJ6A 5A3VA 3WLTA 3D3EA 1KYWA 3N28A 5CURA 4NK5A 2XMQA 1I2CA 4RIHA 4UOEA 621PA 1VL2A 3VGJA 5ECGC 4ZI7B 3HDVA 4BNDB 2VDVE 2DHDA 2QSJA 4LDQA 3USCS 5EP2A 1EIZA 1LDBA 1SRRA 3A7DA 3H4IA 3CNLA 4EZEA 3D2BA 1N6HA 4UVIA 4M9QA 4MUBA 4IOKA 4QRIA 4Q4AB 2R25B 2PQ0A 1UFRA 3LCVB 1CJKC 1W5AA 2FGKA 2Q50A 3GJTA 3MMNA 4UBLA 3EW7A 4R2XA 3TQSA 4J07A 1DOHA 1VHTA 1DO8A 3CRQA 3PKIA 4OGGA 1MJFA 2FCAA 2OB2A 5DGXA 4C4TA 1Z25A 4B6OA 1SU6A 1ZESA 5LDHA 2JFVA 3ANLA 1E6CA 4ARSA 2H2FA 3BXHA 1MC5A 2QQ0A 4JEUA 1DWOA 4AB1A 1FRZA 3FYUC 4J7UA 3IAXA 4YRIA 5BUQA 3NHMA 5PGMA 3ZTTA 1IZ9A 1LLUA 1Z73A 2PMEA 1CEEA 1B8NA 1FVXA 4O59O 4U3JB 3PDJA 1CDDA 3ESYA 2V97A 4CEHA 2JLVA 5GONA 2BMEA 2H18A 2IQ5A 2ZR7A 1M2HA 3M4JA 4WKCA 4IKEA 3BCUA 4HLUA 4UPVA 3W5SA 4F84A 5LKRA 1LLFA 3AW9A 3SZLA 3TUIC 3F71A 1OT3A 1JH8A 1TTPB 1RMQA 2QE7A 2R6HA 3B9BA 1EVZA 4IGIA 4R4JA 4F0JA 1YFLA 4Q4JB 3WLQA 2PZGA 3JQBA 3JQGA 1D0SA 1ZGJA 1ZL2A 4Q1DA 4E15A 3ZC3A 2CNBA 3I9JA 3ZD8A 4ZJZA 3SHWA 1Y8QB 3GVCA 4EPVA 4R40A 1MAUA 3DEZA 1YS1X 4D3DA 5JD5A 2DULA 3F7MA 1T1GA 3M3HA 4TUYF 4PRYA 2E6KA 3HSKA 5J40A 5ELXA 2OMEA 3PL1A 2CYAA 2FEAA 4I81A 4EDHA 5B30A 4MGYR 4TRJA 2RGAA 5DHAA 5BVHA 4FYJA 5JFGA 5TPZD 4WSOA 3L7IA 5CNJA 2DBQA 2I7CA 5K51A 5AKZA 1XVAA 3DE3X 4KVGA 10MHA 4JOSA 2CBZA 3TEFA 1AUVA 1ELOA 1GPNA 3I9LA 2BEJA 4A82A 9ATCA 2DR0A 1LD3A 1HT1E 4JBIA 1G5IA 1HT2E 1X7WA 3PXEA 1QFYA 2EJTA 3Q85A 4JHXA 1GDTA 1LTKA 2Q2VA 1EUCB 1OXVA 4K5QA 4QGBA 5GM2A 1ZGGA 2NU8A 4PLZA 3P9RA 4WD3A 4D57A 1CRZA 1T5SA 4R41A 2XCRB 4NOLA 4KRGA 3X1YA 2QRVB 1BQEA 1Y8RB 2ZFUA 3ZNOA 3AY7A 3RI3A 3NORA 4R98A 4BFCA 5B53A 1JKFA 4G89A 4KXXA 1VB5A 1WG8A 3R0XA 3FMGA 4KQIA 3GWZA 3N6RA 2AJBA 5HK8A 3K9WA 2EGGA 2YFYA 1RIFA 3ISTA 2EWMA 1H8ED 3MINB 1LK0A 5EMLA 3VTKA 3ZDYB 3W90A 1ZSVA 4QEKA 3U4GA 1ISRA 4Q4LA 5TNXA 3JQ7B 2IXBA 1AZTA 5CLJA 2A1UB 5B58C 2FK8A 2M2IA 3QTTA 5FNVA 3VVCA 3CC8A 4NE7A 1CZHA 4IJKA 1GLNA 1C3VA 4DMRA 2FQQA 3SWWA 4EMSA 1JJIA 3CM0A 2NNLD 3H84A 4LYYA 1YR6A 3SG0A 4I9NA 3VM6A 4ZRNA 1E2PA 2I87A 3U7IA 1K2VN 4NOMA 4QGHA 4BTVA 1JZQA 1E0JA 3AF5A 1F1BA 2QDXA 3A32A 3O8OA 4GZLA 3HYTA 4ALMA 2M9MA 1O96B 3VKUA 1E6UA 1RLIA 1K7XB 1Y1TA 3PSHA 3QVOA 2VPXA 1Q12A 2O2SA 4FFPA 4C01A 3NUZA 4HEA1 1NJ1A 3GN2A 3D7LA 2E1PA 4K3VA 1A4IA 5IBRA 4CGZA 2FWAA 2WRZA 1IIRA 3G85A 1DJLA 4GIBA 3ZE7A 1BE8A 5JQGA 3VOBA 4RADA 1CY1A 4BQPA 2QN6A 1P2FA 2NVBA 1BXZA 4Q15A 4F21A 2BE9A 1FDSA 4YV0A 1M7HA 1T29A 1P81A 4NCIA 1QFSA 5T4HA 4COOA 1Z8FA 3HM9A 2A1IA 4B4WA 2Q3BA 1R18A 2XUGA 4IJMA 2N1MA 1ZQ9A 1JEQA 4MUXA 1FSZA 3KSAC 2J4DA 2HQ1A 4MYTA 2VQDA 3ZVKA 2PS1A 3R74A 3FYDA 2CKDA 4GP7A 4G1MB 5IH7A 1KAQA 1YSCA 4G25A 4I4CA 4ZPXA 3CVVA 3YASA 1DI0A 1U98A 5JZBA 5IAEA 3NO4A 2CWDA 3O2NA 4BO2A 1X6VA 2FF5A 4I1YA 3KKLA 4AJIA 3OJOA 4AUKA 2XB9A 3F8WA 4XVHA 3ML1A 3QWIA 1WXIA 1W0KA 3AEUB 3IRUA 4Z9YA 1EDEA 2FPIB 1H2ZA 4KQGA 1NVXQ 2INGX 1THZA 2OXCA 3CU5A 4NP6A 4PAMA 1GRCA 4K9KA 1UDXA 1RWBA 2O2HA 1D8TA 1Q77A 2GTPA 3QGMA 2EFEB 1L5KA 3VI3B 4CEIA 4K9RA 1MJHA 16PKA 4X7PA 1EP2B 4Y6GB 5EZ6B 3UENA 1J21A 4NCNA 1NMZA 3OPYA 4ZCMA 1W34A 3S70A 4AT1A 5HKAA 4URZR 2IDKA 4XDYA 1N9GB 1U31A 1XCMA 2PX5A 5J47A 4JEMA 4F6LA 2JHGA 3WMGA 1HFWA 3FWKA 3T1TA 1GG2A 3GIWA 3W8EA 1HYHA 2CDRA 4HB2A 5C53B 5EVJA 3O8BA 5HJ2A 2FZWA 3OZAA 5ELMA 3AR9A 2XNDD 3RWBA 3KQSA 1E7YA 1DZ3A 3HGQA 3OAAD 1L7RA 1OLXB 1TMYA 4TSRA 2HYIC 3B6JA 4FNGA 2PL1A 1PEAA 4FX2A 4PYLA 3VH2A 4CFZA 4DGQA 2FR0A 1H93A 2VPWA 3A6ZA 3BFVA 3L8GA 4QATA 5HQ3B 1VJDA 2WUEA 3FTNA 4GQBA 1G7SA 4H7FA 3ZWWA 1G8KA 2PCLA 3PXGA 4EHHA 3TLZA 5JQWA 1YZTA 3E81A 4ZVMA 4I1PA 1A4XA 1RPTA 1JDJA 1BE0A 4G81A 3F6EX 1L7XA 2AVNA 3DPSA 2WJYA 4QDOA 5DGTA 2QBYB 1UJ5A 1AT1A 2OHJA 1NMSA 1NVTA 4BKRA 1HFKA 3TNLA 4ENSA 4PBTA 1I0IA 3B38A 4IHJF 1ZGAA 4RL6A 2YYYA 2AWNA 3GGCA 4QYIA 2J9GA 3BQNB 2GBLC 5DW3A 4KIJA 2B82A 2FPOA 3SJ7A 4D9BA 3G7UA 1Y9ZA 5J58A 1HRDA 4OQYA 2H4HA 2CD9A 2J59A 4XWWA 2WC1A 4QXPA 2WDPA 3QEKA 4BATA 4FWBA 121PA 1GFZA 4IIJF 2EYQA 2XCLA 4FKZA 1NPYA 4BIMA 3HJUA 5TQ0A 3MT0A 3B1KA 1WQ3A 2CGEA 3CPJB 3ON5A 2QXUA 4WDQA 3RT7A 2HJRA 2XY4A 3OJXA 1JAIA 4LJ7A 4A16A 1HLGA 3HRKA 3V2UA 3OFKA 3BE5A 3GJXC 4YMGA 2XLBA 5AJVB 3A70A 5JC1A 5DK6A 1ADGA 1KDTA 1S0UA 2C4HA 2Q8NA 2XTNA 3QBJA 1MEOA 4N47A 3RTBA 3OF5A 4LY0A 1RAIA 2HU8A 5GJVC 2C9YA 3B6IA 3K9HA 3EPJA 4S05A 4NEQA 3NH9A 5C8DA 1WETA 4ZEVA 2ZB7A 1B8OA 2EATA 1E6LA 3J81A 1H0HA 1ZJYA 1O58A 3DHYA 4U6NA 3ROXA 3BEDA 2JAPA 3AFIA 1JDUA 1QFXA 4LOIA 3VR3D 3WKCA 4B6QA 4IX9A 1MIOB 2AQ8A 5EIXA 2Q5OA 2ZBVA 3F74A 3LRTA 4NV0A 5C8XA 1GZUA 4FM9A 3HY3A 4A0GA 1DQPA 1TA9A 3GARA 3N05A 2AXPA 4PG5A 3OPQA 3HFRA 5K8CA 1QX3A 4XJXA 4Q1FA 3FUXA 1YGPA 3ZPXA 4HAWA 2GRUA 1DT5A 1DDIA 2O1EA 3EZLA 3PRJA 4FFBB 4X6YA 3BRSA 3H42B 4KPUB 4PSAA 2A67A 5IBQA 5LC1A 3ZEAA 4AZ0B 2ZVDA 4DDTA 1GGHA 1J23A 3JATB 3HA7A 2J6IA 1FL9A 2KYRA 1XVLA 5CH3A 5KREA 4U9HS 4XGRA 5JT1A 1JPUA 2VS1A 1HDYA 2OV1A 3HCOA 1IVSA 2HQBA 3DCNA 2YN0A 1UANA 1K86A 2DH6A 3M6FA 1NN3A 1CB0A 3WP1B 1X39A 3UPTA 3AZQA 3BSWA 2O5RA 3PWTA 5EZQA 2YY7A 4LFCB 4BU1A 4ER6A 5JDIC 2W6CX 1HOTA 3MUFA 1P31A 2HPZA 4L02A 3RJ9A 2BYTA 4AQYB 2O6LA 2VH5R 1II8A 2QPAA 4RZIA 1S1MA 5CB4F 3EDRA 4KSBA 4RKEA 3B7WA 4LDRA 4OSPA 3H2BA 4LHZA 4N7RA 4PTZA 1N2JA 5FBLB 3WYDA 2P9JA 2OHOA 5HZHA 1AB6A 4BMOB 1MO5A 4H59A 5IVIA 3B2QA 3SBXA 3LSTA 1JG6A 2BHLA 1TM7E 2BRUA 2YYAA 3AFHA 1EFRD 3L0YA 5BN5B 3DQZA 1U2PA 2QROA 2Q4RA 3RS9A 4E08A 1D2AA 2WQ7A 2QJWA 4NAVA 3EVTA 5ER9A 4LF8B 1R9NA 4K1XA 5FLKA 2PGJA 3E35A 1TK3A 3KQLA 2RI6A 4Q47A 5AK3A 1U94A 3GG2A 4GXTA 5IFKA 1E4EA 2FPWA 3L8FA 4G07A 4H3VA 4JYMA 4WN9A 2X1MA 3PC3A 2OORC 4XSVA 3R41A 3F98A 5DIZA 4Y0VA 4YRJA 3RG8A 2I76A 1WO8A 1XLTC 1PQUA 4HB0A 4OQZA 5A4IS 2FMIA 5FDFA 1Y5RA 4C76A 4BZQA 1XLWA 2I4MA 1TX4B 4D44A 4MV1A 3EG9B 4DM7A 2BGIA 2BGWA 4L8LA 2GILA 2FLKA 3DLTA 2F3QA 4ND4A 5JFTA 4BNUA 2QD4A 1P1KA 4XM1A 5KJCA 4HQFA 3EMDA 2Z04A 1JKIA 2GN6A 2FVXA 1ECBA 2YFQA 4L74A 3NTRA 1FLVA 2HF7A 1KY5A 2MYNA 2Q1XA 4OHVA 2V9PA 3QG1A 2DC1A 2QXYA 2AC7A 4LZJA 4HGQA 1SZCA 5IAKA 1Z2DA 2Q3FA 3PT5A 4MGEA 3JV7A 1V8FA 2REQA 4OM8A 3V80A 1HDEA 5JHGB 3G1UA 2QMHA 2VBCA 5CIWA 3CB2A 3SR3A 1E9RA 2V4MA 4AJ1A 2FY8A 1QIEA 2QGNA 3G59A 4B3TB 1JIVA 4KBGA 1OWMA 2D62A 2ZBFA 2EWWA 1O08A 1BGXT 1G2QA 4GVLA 3B3AA 2D1FA 1R6UA 2UVQA 3KL2A 1AX9A 2CLOB 3OU6A 4ZTZB 1FSPA 4OHWA 4PC6A 1X8LA 3IJ5A 2GEVA 2QAIA 3DO5A 2WHEA 1GUYA 2XH8A 5B2EA 2Q8QA 1B43A 2OG2A 3WLMA 3DVSX 3P9IA 1L4BA 3NOXA 4LOJA 4W7SA 3TZLA 4C08A 4EB3A 2ZBQA 2ONKA 4CQMD 1UOEA 4PRLA 3UZUA 3NWJA 5JCJA 1JQKA 2GAIA 2BTEA 1W73A 2QAGC 3GJ0A 3QF7A 4FYMA 4YQFA 5DOZA 4OP2A 3M83A 3P2JA 3WVNA 3B36A 2OO5A 4B7AA 1B8VA 1EXWA 4K9DA 3KDSE 1PV1A 2C2GA 1X7ZA 4OLJA 1CR2A 2Q3LA 3NTUA 4IXTA 1YMQA 5IJAA 1E3LA 3NH6A 4IDAA 3MTDA 3IEKA 5KYWA 1IONA 3GUHA 3TL3A 1AVTA 1QKJA 5DGHA 3UAZA 2HA7A 4XWTA 1MAHA 4Y9UA 2X0NA 2BDUA 3QHAA 1IBLB 4JJEA 4WKOA 2O5CA 1W88B 3EMVA 3PSAA 1UT8A 3IQGX 2CXRA 3P7MA 1DPGA 3MBOA 3E9QA 3ZDCA 3G2KA 4GOLD 5JE8A 1CR4A 2RK4A 4MVJF 3V33A