2ISQA

Crystal structure of o-acetylserine sulfhydrylase from arabidopsis thaliana in complex with c-terminal peptide from arabidopsis serine acetyltransferase
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
320
structure length
320
Chain Sequence
SRIAKDVTELIGNTPLVYLNNVAEGCVGRVAAKLEMMEPCSSVKDRIGFSMISDAEKKGLIKPGESVLIEPTSGNTGVGLAFTAAAKGYKLIITMPASMSTERRIILLAFGVELVLTDPAKGMKGAIAKAEEILAKTPNGYMLQQFENPANPKIHYETTGPEIWKGTGGKIDGFVSGIGTGGTITGAGKYLKEQNANVKLYGVEPVESAILSGGKPGPHKIQGIGAGFIPSVLNVDLIDEVVQVSSDESIDMARQLALKEGLLVGISSGAAAAAAIKLAQRPENAGKLFVAIFPSFGERYLSTVLFDATRKEAEAMTFEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Cysteine synthase
publication title Structural basis for interaction of o-acetylserine sulfhydrylase and serine acetyltransferase in the Arabidopsis cysteine synthase complex.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 118
structure length 320
sequence length 320
ec nomenclature ec 2.5.1.47: Cysteine synthase.
pdb deposition date 2006-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00291 PALP Pyridoxal-phosphate dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2isqA01
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2isqA02
1TDJA 5DW3A 1TTPB 2J9YB 1TJPB 2ZR8A 5B1IA 3R0ZA 4D99A 1KFCB 2RH9B 4D8TA 4D9GA 5I6DA 1KFEB 3PC2A 1WDWB 5DW0A 2O2JA 1Z7WA 3SPXA 2ISQA 3X43A 1FCJA 4IL5A 5B55A 1UIMA 4D9FA 1M54A 2CLIB 5B3AA 1TZKA 2CLLB 1UBSB 3PC4A 5IW8A 3TBHA 2J9XB 4HN4B 4D9IA 1A5AB 5D84A 3IQHX 1PWEA 2CLEB 5EY5B 1V71A 2BHTA 3DKIA 3RR2A 4COOA 1X1QA 4JBLA 4D9KA 3BM5A 2DH6A 5IXJA 4D9NA 1TZ2A 3ZEIA 3CEPB 2TYSB 4ZQCB 4KKXB 2RKBA 2C2BA 5I7OA 4ZU6X 2Q3BA 5IWCA 2ECQA 1J0DA 3VSAA 3PC3A 1E5XA 4HPXB 1BKSB 4AECA 5J5VA 4HT3B 4AIRA 5DBHX 3L6BA 2WSYB 1A50B 1K3UB 1TZJA 5CGQB 2V03A 1Z7YA 1A5SB 1BEUB 1TZMA 1WKVA 4D97A 5KZMB 2Q3DA 2PQMA 1VE5A 2ZPUA 1K8ZB 2EFYA 3DWGA 4ZU1X 4F4FA 1PWHA 2Q3CA 5I7RA 3DWIA 4L28A 1V8ZA 5J43A 2GN0A 5JJCA 1J0CA 1UINA 4L27A 4Y6GB 3SS9X 4QYSA 3L6RA 5CVCA 3VSDA 1QOPB 5KINB 1FUYB 1C29B 5E0KB 1A5BB 1CX9B 1KFKB 2CLOB 5D85A 3IQIX 5JISA 1JBQA 1K7XB 2GN1A 4PCUA 3SS7X 1V7CA 5DBEX 5B53A 5B36A 5I7WA 1K8XB 4NU8X 1J0EA 5C3UA 3FGPA 4JBNA 5I7HA 4HO1X 1F2DA 4D9EA 2EGUA 3IAUA 4HPJB 1CW2B 5B1HA 1RQXA 1WBJB 2CLKB 5BW6B 3V7NA 3VSCA 2TSYB 1D6SA 4D9BA 4D8WA 2O2EA 2D1FA 1J0BA 2GN2A 3AEXA 4NEGA 1K7FB 5HBGA 4D92A 2C2GA 1O58A 3X44A 4WX2B 5DVZA 4D9CA 3VC3A 1WTCA 4LMBA 2ZSJA 4OFXA 2CLFB 3HMKA 5D87A 3T4PA 1KL7A 1P5JA 1KFBB 1Y7LA 3AEYA 2CLMB 4D8UA 2JC3A 1C9DB 2J9ZB 3PR2B 1TTQB 3L6CA 1K8YB 1J0AA 4OREX 5T6MA 2CLHB 2DH5A 3IQGX 4D9MA 1TYZA 2TRSB 1VB3A 3VBEA 2ECOA 4L3VA 4H27A 1K7EB 1KFJB 3R0XA 4XUGB 5D86A 5I7AA 1OASA 2RHGB 1QOQB 4I1YA 4L0DA 4LMAA 4LI3X 4D96A 1C8VB 1VE1A 2BHSA 3FCAA
chains in the Genus database with same CATH superfamily
3OT5A 3EY9A 2WHPB 1E79A 3GUCA 4QVIA 3Q5GA 3QVUA 1KJZA 4PPFA 1V2GA 1YR2A 2AZ4A 2LR0A 2VSFA 3THYA 1P4AA 1KFEB 3MBKA 3BL6A 3QEMB 3EK2A 1IM5A 3RRNA 3X1WA 3H2JA 4A8TA 3DKPA 1WZNA 1B8OA 621PA 1MT3A 1YULA 4HCJA 2V7XA 2QU7A 3W9BA 2QSJA 3WYBA 4DLVA 4LPKA 3V1YA 2WSSA 3L7OA 4FBGA 3AY6A 2R8ZA 1L5HB 1V3UA 1BH2A 1Z4KA 2C59A 2IOQA 3MW8A 4ZJPA 4ZJUA 1ZMOA 4FWTA 3A9SA 4PLCA 1FU4A 2BM1A 1J56A 3HH8A 2YZNA 4YAEA 1YFLA 2X9VA 2YQ5A 2YYZA 4H1HA 5IXJA 1EKXA 2H48A 4XCXA 3VSBA 3IPLA 3QSYA 4TV8F 3TPFA 1A7KA 2ALJA 1BXZA 3BGVA 1TI7A 2PTHA 1SURA 1M76A 2QTLA 2GHIA 4NBWA 1CETA 2JCXA 2W2LA 3VAZA 1K06A 5KJ6A 4O4LB 2H16A 4LJRA 4CEJB 4A36A 2UXCB 3AM3A 3D3JA 1UXOA 1L4FA 4AU1A 1W9HA 1B73A 2VF7A 5FLKA 2VJCA 4QA9A 3ZZ1A 3GQBB 4ZQIA 3SK0A 4CE6A 2Z2IA 4D4HA 3G7UA 1TCBA 5JQWA 2GYWA 4U00A 4Q4HB 5B5SA 4B5KA 2E5FA 2P2NA 4PW0A 2OILA 1G59A 1NGSA 1LXCA 4ACBA 1GNVA 5ER9A 3FHCB 5CM9C 3MJVA 4YNBA 4B4UA 4DJEC 4RTPA 3HCFA 1RZUA 5ERXA 1BDJA 2VDOB 1F0PA 3D81A 1ONNA 5ICMA 1JTEA 3LIIA 1NI3A 1WB5A 2ZE7A 3H19A 4LV6A 1GJRA 2DPHA 5LA6B 3NM5A 5AKZA 1MQ9A 2WUWE 4ALIA 2NUAA 1YFKA 2O05A 3PPWA 4HBGA 5DX1A 5IKEA 3IBGA 4KAFA 4AJ1A 4V2UA 1D2MA 4NE9A 2R62A 4RD6A 1EFVB 3OU2A 1GZUA 3DCNA 5EC8A 1G1MA 1ZJWA 1FFAA 1EEXB 3MS7A 4UEKA 3D0KA 3RSFA 1R4NB 1G20B 4IWXA 3V80A 3G1WA 3COSA 2WG1A 2ZWMA 4I8IA 4L0QA 1QGOA 2NV6A 1YZUA 4U6SA 1TUIA 3UGJA 4YAFA 1XZMA 3QVXA 2B61A 1KSGA 4F3YA 4IINA 4WD3A 3EYAA 1GAQA 2YKGA 4AZWA 3L46A 3LYUA 2XTZA 4HRVA 3MPOA 4NC9A 1USIA 4XGQA 4B35A 4E1BA 1PE0A 3R3WA 3GLFB 3TOZA 1E9SA 4ZZ1A 5IVPA 1EFRD 1N6KA 2XSZD 2FW6A 4UVEA 1QDEA 7YASA 2OG2A 4NJOA 3CTPA 1AKNA 4EIWA 1QKIA 1KYQA 1SUDA 2VOJA 3NH9A 4BLWA 3UPDA 1YMQA 3R0VA 1W35A 4HDCA 1G7RA 1ZN8A 2D4AA 3G02A 5AQ1A 3K8QA 3QOYA 4YMSA 4BWFB 2FPLA 4JJZA 3U4AA 1KMHA 1Y7PA 3JARA 3FWNA 1NVKA 4O59O 1P9OA 2HWUA 3QIAA 1U28A 2OHFA 4OBBA 3VC2A 4ECAA 3AEQB 4INAA 1W19A 5LQMA 1R3UA 1NTOA 1ZYUA 2GGSA 2Y1EA 3OBBA 4CKBB 5A5VA 3PRYA 4JGGA 1O08A 3GFGA 3PE3A 4DZTA 4R9NA 1H3EA 1F6BA 2VDUE 1SM4A 1S9DA 1CVRA 3FSRA 1K88A 1XKXA 4MR8A 3O84A 4K81B 2C42A 4KV9A 1A7AA 4Z7NB 3VO9A 4YAKA 1Q0ZA 4MPPA 4BGDA 4E5PA 2XGJA 1M1YB 4BO5A 2VG8A 2WJ6A 4M9ZA 4O2AA 1EVKA 1PK9A 3QE4A 3VUEA 2H2DA 1E2JA 2C4MA 1C4KA 2EHDA 3OIFA 1ZH4A 2A9JA 1X7HA 2QRHA 3STVA 3O91A 1DKLA 2YR0A 2Z3WA 2QJOA 4XYEA 5ALZA 4IIJA 1OPXA 4JVMA 4I1VA 5EN4A 3RAFC 3UUWA 1YR6A 3SZ3A 3A9WA 4X66B 4EVIA 3J81A 2UUOA 3DOEA 3ZEIA 2NXCA 3LSTA 1E79D 2OHJA 4R8RA 1TO6A 5HVNA 4X91A 2JVKA 1RLUA 2DSTA 3LP6A 2C2OA 3B52X 3HSKA 5ELLA 1I7NA 2P7IA 1JA1A 3FTQA 4B76A 2HWKA 3ZWVA 1PJRA 3L7MA 3MWDA 2IOHA 4TPKA 3K9FC 3DW1X 1LPAB 1Y5MA 2ID8A 1J24A 2OXEA 4WOKA 2IIPA 4I1PA 1CRLA 4BZPA 4PZLA 4LC1A 3UEOA 2PZAA 3P5BA 3NGMA 1SBTA 3S2ZA 3AKZA 5D3ZA 4DXDA 5JI2E 5JCJA 4BVGA 4DG9A 4OAPA 3MD9A 3RRXA 3V4ZA 1P6XA 3D9QX 5J43A 2BLLA 4YJHB 3FOWA 2XBUA 3A28A 4GH5A 1IHOA 3VTFA 1BTOA 1TT5B 3VH2A 3PWKA 1BX3A 1ESZA 3ITKA 4TLEA 5E0KB 1M7GA 1N5OX 2RGEA 3LE8A 3K2QA 1ZINA 1YR7A 3IE2A 1M72A 2INGX 3GU3A 2Z5GA 3KAKA 4POAA 4WLFA 5FNVB 2GDZA 3CRQA 3HP7A 3LVQE 1NA5A 1EZZA 2GF2A 1SVWA 1PL0A 2A5JA 2R5FA 1YB4A 3GWGA 1RCTE 1LPNA 1WW2A 2WF9A 3L8FA 4IVPA 3RTCA 4C5AA 3KR9A 4OHRA 1CR0A 5FEMA 5I7HA 1VLZA 1ECGA 4CF7A 1JUDA 1H2RS 5ARDA 1ZY2A 1WCYA 2QL7A 3OE1A 2MU1A 3D2AA 2RSLA 3HR4A 2GXAA 5FI3A 5KQPA 1X15A 1EIWA 2BSXA 1YO6A 3CBGA 4RTQA 4GXTA 2O2EA 1NBOA 1RXUA 3EG9A 1M2VA 1E60A 5AVQA 4DR4B 3X1DA 2AV6A 3MAAC 3P96A 4G4IA 4YJDA 5KHOC 1REQB 3C3CA 4NENB 5A6SA 1CC1S 5CVDA 4GICA 2VSYA 1U7PA 3QLJA 3HGMA 4RE6A 1J23A 1YRHA 4J1TA 1FRFS 2ACEA 2FN8A 4IIHA 3NAGA 4Q7LA 2X8AA 1R0XA 2C7GA 3I05A 4Q4DA 4U2DA 2YASA 3VISA 3IMEA 4RPJA 2DHCA 4EHBA 1B26A 1D2HA 2XITA 4P1ZA 2VP3A 3A4LA 1OZGA 2YWRA 2PU5A 1CULC 3SG0A 3ZGNA 1X42A 2Q5LA 2VP0A 3LBNA 3GJ4A 4MI3A 4CL3A 4LHXA 2XMDA 3EVCA 3FYDA 1E9DA 1KMMA 1U9IA 1ZN7A 2Q99A 3QLUA 4GPIB 5TPWB 3WIBA 3WI7A 4AROA 1QGUA 1FY2A 5TMBA 5JMWA 2FZVA 4JXZA 1SB9A 2XMPA 1P31A 2BHNA 5P8WA 3DM9B 3L7BA 4O4JF 4I5FA 4CFZA 3LRXA 4HQLA 4AJJA 2CYAA 1KFCB 2Q2WA 4MWOA 4QFMA 4WBNA 4R2WA 2FZEA 3BMOA 4PNPA 3GP3A 5HTOA 1MG0A 1I7LA 3C1AA 1DKMA 3HJAA 2ZANA 2VP5A 4HDMA 5IJ9B 2R7MA 5HKKD 4X62B 5I9LA 2O5VA 1Z2PX 4L6AA 3MK31 2GJ4A 3DNFA 2O20A 3AT1A 2FKNA 3OLQA 4K88A 4DFDA 3SN6A 1ANKA 3H9QA 4MARA 3GEIA 3PC4A 2EARA 2X58A 4AJHA 3GJ8A 2DY0A 2VNAA 4L02A 4NVRA 5EJMA 4PZAA 4E5SA 1IEXA 2ZRPA 3PNQA 4OA5A 3GROA 3WLTA 2FLVA 2G0AA 2XB4A 3IE0A 1UKVY 4GOND 7ABPA 3W2IA 1PT7A 4QC2A 2EEPA 2ORVA 4V0OA 5HEKA 2ZYRA 4BGUA 4F86A 3CV3A 1P1IA 4UOQA 5D51S 1E0AA 3FB1A 1PZXA 4GR9A 2GCPA 1T5HX 1TCAA 1E1DA 5E9JA 3B9QA 5FTLA 4OK5A 4X6YA 3RH0A 3UCXA 4D26A 3W90A 2C2MA 3SVLA 3TW8A 2F67A 3NDPA 4MHOA 3QTLA 5I9MA 1ABEA 2QVBA 5CFMA 2O3JA 3BFVA 4WA7A 2MYUA 3C74A 3DDNA 1EFKA 1ZA2A 4IDDA 3KKEA 3ON5A 4KSBA 2XRZA 2NV0A 2O3RA 4QRHA 1DC7A 5HMLA 4OL9A 2EAUA 3C3KA 4YTEA 4IVNA 2ZTLA 3AB3A 1P80A 5FTMA 3DBHB 1E4EB 1JPVA 3EC7A 2UYHA 3QBVA 3BSYA 4GGMX 4NQZA 4F6CA 1RBYA 1XTQA 1L1FA 2ZRAA 3OPYI 1IPHA 2DBZA 2QJRA 4FGWA 5JFTA 3HUTA 3JAMA 2P6PA 3KALA 4K5QA 3ENWA 5JISA 1PR6A 1Z5ZA 3NS7A 1OIWA 6REQA 4EQZA 2BGTA 2A0XA 2DE0X 4MVXA 4P4UA 4M36A 5FWXA 5L7WA 1X1SA 4KPEC 3C3AA 5G0VA 2ZI7A 3KBOA 4OFZA 1LRJA 1FDRA 3WIDA 2V8BA 2Q5CA 3AR9A 5JCJD 4JVNA 4QBKA 1P3JA 2AN4A 3WTCA 1TYAE 1RWQA 2E4XA 5IRCD 1SOMA 4DLSA 1H1DA 4BX2A 2WIFA 1SKAA 3G9ZA 4W63A 1YSCA 3VYTB 2NUTB 4NBUA 2DSNA 2GN2A 2FMIA 3FETA 4HTAA 4AULA 2J45A 1BD3A 3RD5A 2CCJA 3GA7A 1M9NA 4GRIA 2FZCA 3BILA 1E6MA 1M2NA 3UJAA 2WTXA 3HDVA 2GBLC 3VJKA 3GFPA 1OA1A 3BGOS 2A5YB 4MI9A 4PCAA 3BN3A 2SKDA 3IELA 5EP4A 1L7DA 3R3JA 3NIDB 3ZUGA 1GKKA 2VWPA 2COEA 4B3MB 4LF8B 4JASB 3R7NA 5JXGA 2XQIA 1XJ5A 1EDBA 4QPJC 4X97A 1NYTA 4EG0A 2YV4A 2ZSEA 4JI6B 2PL1A 3BHNA 4B73A 4EZBA 1SC3A 3FGZA 4KPUA 1ZLXA 5CH5A 1JFFB 5CD1A 5JRJA 2B9EA 2AH5A 4V1CA 2OGSA 2A3NA 1OYVA 3AY7A 3ECSA 1HF3A 3H2KA 2OGUA 4MA5A 1W2WB 3U3OA 3RO7A 4FFDA 1ZVQA 3MJSA 2AXPA 3V4SA 1PR9A 2DQZA 4YGXB 4OVKA 1NONA 3ETEA 1DBSA 2G0TA 2ZJAA 2PRKA 3UT0A 3ED5A 4BEWA 3PEUA 5EKXA 5FLYA 3SQNA 1U7UA 1P2UA 1Q0LA 2H17A 4C07A 1M8KA 4BVKA 3RCBA 1RE0A 4O1IA 4KCGA 3FMVA 5EL0A 1XD2B 1QS0A 4HN4B 1PJ2A 3CG4A 3EVTA 4H4CA 1KE2A 1O9HA 2W90A 2GPAA 3HN7A 3QUSA 1K4KA 1E4OA 3FM9A 1FTYA 4CLOA 3V3KA 4LGYA 2FP4B 2GFIA 3KZKA 2IKSA 4QFDA 1VKNA 4O4JB 4ZU6X 1YJXA 2VRBA 2XVMA 4TT8A 4RHUA 3Q7PA 1M74A 4WKBA 4RD4A 5LYJF 5FXMA 4CM7A 3TFOA 4MI6A 3SYLA 1M6NA 1T1SA 3QELA 3RABA 1BJTA 2JD1A 1JG3A 3U3ZA 4CM6A 1IJBA 5AOAA 2XUDA 1XTSA 1VBKA 3CLKA 3SD7A 5AJVB 4Z4HA 3M3HA 5E3IA 1P4GA 1YNOA 4WZAE 2O1EA 4ZOBA 3H1FA 2VYVA 3NWEA 2QUBA 1GQ2A 2QUAA 4IXNA 4KHZA 4PFQA 4YJ3A 3CNNA 4IH4A 3DO8A 4ZQEA 1WOMA 3ZHBA 2WV7A 3F97A 2PX2A 2ON6A 3B3QA 2R5NA 1O4WA 3F6RA 4M7PA 4WW0A 4DJ5X 3ZWDA 3LT4A 4BLVA 1VSVA 1GQRA 1BH6A 1XTKA 3B5EA 1V16A 4RGQA 1Y4UA 1LVHA 1QB8A 1VCMA 2FTKE 5CDSA 4NDAA 5E95A 2UUCB 4XPIB 1HYBA 2G8NA 4UNPA 3RS2A 4EKDA 1OIVA 2Z43A 4LZAA 2HPZA 5DM1A 5KDOA 1IUKA 2R7KA 4IJWA 3GVPA 4PLPA 3TW6A 2GWHA 2EVWX 4H4EA 2P79A 1WUHS 4LXGA 4IZHA 3TKAA 3G2NA 3HGTA 3RVRA 4Y2HA 1MQ8B 5DHUA 2GAFA 2V59A 1A9SA 3SBDA 3CCCA 3IUQA 4H6XA 4NF2A 1LTHR 4PPGA 5FV4A 4Z9BA 3O1LA 5FP0A 2OHHA 2HKIA 5JH7A 4M55A 1R37A 2HJ9A 3IP5A 3OUTA 3VI3B 4OFBA 5CB4B 5HS4A 2Q7XA 4H16A 2C9CA 3SYNA 3T9AA 4DCMA 2R7LA 1JJFA 5AKKA 4MQ5A 3CQ9A 2DFVA 1A77A 2C82A 4I1SA 2F1IA 2HQRA 3BL8A 2IYXA 5BNWA 1Q1ZA 1G64A 1TKRA 2XQKA 3F74A 3P9QA 2HA5A 4LZPA 4QUEA 4WK4B 4KXXA 2ADFA 2ZJ0A 3AUJB 3SXUB 4UASA 3WGUA 1NVVR 2PMFA 3B7GA 5AW0A 2VOEA 1OH7A 3OCWA 5BSHA 2ZDQA 2R6DA 1XAGA 3H42B 3ORQA 2J3LA 1B15A 4OREX 2H4JA 1K97A 2W58A 4K6OA 4DLZA 2C9DA 1EWVA 1TVEA 1X8JA 2YZ2A 5JANA 4RX1A 4R7GA 1FNNA 1C3VA 2PUFA 2V3CC 1PU2A 3BRCA 2IW1A 4Q4LA 1F0NA 3FAZA 1JXMA 3WLNA 1AUQA 3ZGOA 3CZQA 2W9XA 1JLLA 3PR1A 2ZYIA 3RU2A 3TLCA 2FOXA 4Y2SA 1SA0B 1O6CA 4WJZA 4YB8A 3O9VA 4GX1A 4LECA 4YFYA 2BHLA 4D82A 4U3JB 1R4MA 3LPNA 5I4BA 4MR7A 1OX5A 3TBFA 1VSBA 2JL1A 1QONA 4FFMA 3AFNA 3TOXA 4CQLB 2H7VA 5IU6A 5K8LA 4Z54A 1SVKA 3RHSA 4LDAA 2VRCA 1M1YE 3E1KA 3IILA 3L7CA 4RJJA 3VOSA 1OAOA 4CU5A 1PQYA 1XZQA 2D2VA 4BUZA 5KDLA 3M6LA 4PBSA 5HJEA 2C99A 2GNAA 1QK5A 4NATA 3EZ9A 4KH1A 4BZXA 2W6JD 3BFXA 3SMVA 2C92A 1YZ3A 5DX0A 3RT9A 4XVUA 1PL6A 1GQFA 2Z4RA 2P7HA 3GGCA 1MABA 2REQA 2II6A 3CLTD 3I12A 4V0NA 1T0BA 4J2TA 3S70A 3ZCQA 5JAUA 4AL4A 4BOYA 1JGTA 2FZKA 1M2OB 3FYCA 4MYCA 4R01A 4D3FA 5JD6A 2G63A 3RIMA 5TLSA 4DWWA 2HFJA 1X1RA 1UMBB 1VMKA 3JVUA 4BNYA 4XIGS 5FPYA 1ES9A 4PBTA 5FBKA 3WTBA 2VJMB 4ENPA 4CMIA 4M0KA 4M98A 5IWCA 1F5SA 1TK9A 5TMDA 4KRFA 2BELA 1ZW1A 2F1HA 1JKJB 2EG5A 2ZQZA 2ZXFA 4YCDA 1V41E 3AEZA 4L08A 3SSNA 1C4OA 2B7BA 2CJFA 4QXAA 4A9AA 5A4JA 1LSOA 1UKYA 4IHJA 4ZGWA 1J00A 1K6EA 2XTNA 3R7WB 3EIOA 1A2OA 4W5NA 1EWKA 4M8IA 5CT6A 5JSFA 1Y8QB 1DC4A 1O96A 3KOYA 3M33A 4YA6A 1L8AA 4YJ2A 3ZDRA 3ZWKA 3FKSA 5JEDA 1SPXA 3HKEB 4MKFA 1GSOA 4XGRA 4KR2A 2FEPA 2R7NA 5HM8A 4FM9A 1XLVA 2HCJB 4RYDA 1Q2XA 4RS3A 4HVAA 2IDMA 3GLSA 2GBGA 3NEJA 3QJYA 3THWB 4WXRA 1C7JA 2ZW9A 3MB5A 4FI3F 4BCDA 2V7QD 4HN9A 4CQMB 4AY2A 4C0AC 2QTAA 5D85A 2CLCX 1QMGA 5ALQA 4DREA 1MQSA 1TK2A 2PDAA 3NORA 1I5RA 1NJ1A 4A73A 1PG0A 4DUGA 1DL5A 5CTJA 1BDMA 2J3JA 5BSUA 3OOYA 3X0DA 2ATVA 3QEOA 1Z0ZA 2IV3A 2WEKA 3JQAA 3DBRB 3NWOA 1KDRA 3WXMA 3AUSA 2VYVD 1NXOA 2VCHA 1WXDA 2H1HA 1NYLA 2ZVPX 2EBUA 3UBMA 4X3PA 5K0GA 1W4AA 2VVTA 2HWYA 3Q88A 4AZ0A 3GCDA 3HFJA 4TRNA 4B84A 3NM6B 1JDVA 3OQ6A 4BVFA 5J2TA 3E0XA 3CRMA 4ZO9A 2FWRA 4DBZA 3I5MA 4DSAA 1NF9A 1UPAA 5CGZA 5DYYA 4ETMA 5TE9A 2DTXA 3OQNA 5BPFA 1LV7A 4LMBA 1DP4A 5ER6A 1HETA 5CYPA 1SZCA 3ZXUB 2RC5A 3C87A 1PJQA 1BWQA 4TLAA 1XMXA 2IHYA 4ZXPA 4QDTA 4HJRA 2BCJQ 4IGIA 2ZP1A 4GYWA 3TL6A 3TZEA 1GDTA 1FSZA 3DZCA 5G53C 3WK6A 4OKIA 4LF7B 4PX2A 3OHMA 3OIGA 5TQ2B 4D3YA 4DA0A 4OHUA 2EOAA 3BHJA 3GJQA 1GOTA 2R44A 4KQKA 1VJDA 4I0WB 3ZXIA 3FNHA 2QZPA 1CUIA 3VGJA 1BDIA 3GFBA 2XYHA 4EJ0A 3S2FA 1E2MA 4LOAA 4RTRA 1T10A 3KLOA 4UEQA 2VHQA 3GRPA 4NP6A 5FBVB 3G2IA 4AVYA 1CIVA 4Z3KA 4PLVA 3Q8WA 1NQAO 3EXFB 3FTDA 4UJ5A 1J70A 1DFGA 3T3IA 5EMKA 4DLAA 3KHSA 3UJHA 3DBLA 3EQ7A 5GIOE 1ULAA 1QRTA 1Z4IA 3OZVA 5BVGA 2EZ4A 2A9VA 5JZSA 5J1TB 2FPIB 4KWIA 1UR5A 4O3FA 2AXNA 2NVWA 4W5QA 1Z08A 5HIIA 1SBQA 4TN5A 3H8SA 4ESOA 2G1AA 3RTAA 2ZULA 1WXXA 2OE2A 2C7OA 3NHRA 1OQAA 5T5QA 2E3JA 1IZ8A 1ODSA 2BT4A 4WLVA 2HJRA 2GDJA 2B4YA 4P3NA 1OVGA 5DCYA 1UUFA 4GX5A 1VE3A 4Y7DA 1ORWA 2C3YA 2E4AA 3IH5A 2JIBA 5H70A 4DAEA 3RS7A 3SE0A 1LGYA 4EAAA 4M53A 4NOKA 1C30A 1Y1PA 4MUBA 4RZ3A 1T3HA 2VRCD 2VTBB 2R86A 4C7OB 3LP8A 1JKIA 4MAAA 4X8HA 4CM4A 4JXKA 3EIXA 4WERA 3CVVA 2VTKA 2YHAA 3HA7A 4AUEA 5L3VA 1VCIA 3LBAA 1E64A 1P75A 3AFOA 4LJLA 2QU8A 3ZJ4A 2XZLA 2YHIB 5CNKA 3A7EA 3OQBA 5JAPA 2GJSA 2IITA 3CX4A 4PNZA 1LD3A 2IHUA 3OLXA 4BP1A 3QFHA 2G8LA 4LVCA 2FYTA 3WWOA 2V1XA 5KQLA 1QTIA 3EXIA 4IIGA 4OHWA 4ZT7A 2DAPA 1NDQA 2QXYA 4RMIA 3QF4A 2PSSA 2GR9A 1J0CA 1B8UA 1YKGA 1OH6A 3L41A 2HA4A 5I5EA 5I4IA 3WK9A 4EF4A 5FADA 1QOPB 1NY6A 2XT0A 4EO7A 1K7SN 3L2OB 1EVLA 5JDCA 4AJ2A 1T4DA 1EM8B 2VA9A 1FVFA 4JKYA 4V0MA 1BD4A 1CUEA 4BV9A 1TIBA 2BC9A 5T3UA 3PVCA 3T7TA 5IT0A 1RT9A 2JFBA 2DKFA 5AHXA 4G9GA 4QXMA 5D01A 1JR3A 3OM9A 9MHTA 3HCPA 1R15A 1XZHA 2G9VA 2KSQA 3PENA 1QZZA 2F6RA 2PUHA 3U40A 2AZMA 2RGNC 4PGAA 3LC2O 4G1VA 1ZDMA 2X9LA 5ENZA 2IH4A 3AW9A 2HRCA 3PXBA 4CIWA 4GZMA 5G1NA 5ARCA 3JQ6A 1MX3A 3BKWA 3S55A 1YJCA 2RI0A 1VL1A 2ZYHA 5K0SA 2HF2A 4YMWA 1P2VA 1JJ7A 2QE6A 1MEEA 5JVDB 1SIWA 3GN2A 4Y8VA 5HZHA 4WUVA 1YBFA 5EWJB 3KJQA 3D3WA 3ETDA 4P31A 4QO8A 4DUGD 2QJWA 3S0JA 2I2BA 5KPJA 2WWYA 4G4SP 1G2PA 3MTIA 2X7JA 3JQAD 4R2XA 1JE1A 1DEAA 4QIHA 1NW6A 2OB1A 1XCBA 2WJAA 3ZJYA 3D0RA 2YXNA 4BNZA 5CXUA 2YZ7A 4J1NA 4DCUA 5C53B 1DO2A 1Z4JA 4MQ4A 1E2KA 2OP0A 5FUWA 1FFSA 3PQCA 5D86A 5DGTA 5A02A 1GTSA 1L8LA 4KFTA 1E66A 1E18A 2RKOA 3P97A 3V2UA 4EVQA 3OQMA 3BZUA 4P34A 3MWYW 4UMVA 1G5IA 1BWRA 4QNMA 4B7ZA 3HE3A 1F8XA 1Q0TA 1XMJA 5K8VA 2ZTUA 1RHKA 1Z6QA 2RH4A 3G8CA 4ND8A 1ONBA 3STXA 3GY0A 5K0TA 3QE3A 5BRNA 2IZ1A 3ZE1B 4PZDA 3HK2A 4F2GA 3L5OA 4QHYA 2PH3A 3GIWA 3RBAA 3HYRA 5C8YA 5IM4A 4G01B 3UGKA 3EIUA 4CYMA 4JP5A 4FYKA 1Q91A 2DHQA 3PGXA 4OHKA 5BSMA 4B3XA 4R51A 5ALNA 3FOEC 3G8DA 4O8CA 4JYPA 4U7TB 1BDHA 3M1LA 5AKLA 3K71B 2VJBA 5TX7A 2FP3A 5IW8A 2VK8A 3PCXA 1RZVA 3SGLA 2LVBA 1NW9B 2P9QA 3FPFA 3O7WA 3B12A 4MYDA 3UM9A 3NAZA 5D84A 1DQZA 2X0RA 5EXTA 4DDWA 2CUNA 2L82A 4CMAA 4PG8A 1IPEA 3PEEA 2W42A 1X1QA 3ITDA 3I9OA 1VKHA 4Q9DA 3SEFA 2K7ZA 3CISA 2AN1A 1N8NA 1U02A 1L8QA 3HN2A 3ZHRA 1X80A 4N40A 1PWYE 1T8PA 1RI5A 3COZA 1EUCA 1QGAA 1L7QA 2CXHA 3DBIA 4QBIA 4QUDA 5LLTA 4MV6A 1PR1A 4CIBA 2XMCA 4XUEA 1ONOA 4IVQA 4JQOA 2RK4A 1MCZA 2FW1A 2X3YA 3II6X 3Q5EA 3KE8A 3O92A 1NY5A 3ZJVA 4K28A 4B32A 3SOPA 1ISPA 4EBFA 2ZU0C 3D0OA 4H3HB 4MS3B 2VS1A 2CDNA 4C0LA 1Y6QA 1UPBA 1YONA 4Y6RA 4MZXA 4CLEA 3UB4A 3ZVKA 4IICA 3QF7A 4JIMA 4TQ9A 5JSHA 4P4TA 2K2QB 4RK1A 4NJEB 3ZIAA 1MDBA 3EQ9A 4BEVA 3B51X 2FMXA 1EGQA 1R6DA 4UDNA 3GJ0A 4UVGA 3H13A 4TWRA 2IX9A 4FLFA 4GBMA 1N0IA 3U3MA 1BXRA 2BYTA 4UEOA 1FUYB 1KVUA 2LV8A 4JJIA 4GI7A 4Z3DA 2B2CA 3ETJA 2X8WA 1F2UB 3IEKA 1OLOA 1BCSA 1P9NA 4X93A 1J2TA 3T15A 4B7XA 5KQSA 4Q19A 4B3SB 4QUHA 3OI7A 5JR3A 3O8QB 1QNLA 4GLOA 4BYGA 1DT3A 2QN6A 4DKXA 4BLOA 4CKCB 2X5KO 2J3QA 1DRVA 4N8DA 1JR2A 1KA9H 1GNTA 3ZE6A 5EKDA 1ECBA 2OZVA 2WJYA 3CIOA 1NMEA 4ZP1A 4IIEA 1CR4A 2VBGA 3BDAA 2NO9A 3NEYA 5HRAA 2UYYA 1MIHA 5CLLA 3RIHA 3LRPA 1P0PA 4MR9A 4TKVB 4JT9A 5KUTA 4E31A 3S8YA 4B6GA 4U7PB 1JX6A 5DVZA 5LQJA 4B6JA 3CNQS 4K87A 4K6FA 5FUYA 3TW0A 3UWDA 1U0SY 4BMCA 3I6ZA 4EDFA 3A9VA 2OV6A 4EG7A 5B2EA 1NI5A 1IHDA 4IZOA 1QFJA 4TV9A 2H3HA 2CZGA 3L1JA 5EMHA 3WWPA 1I2MA 5DWQA 2NPOA 1JR3D 4TXHA 2W6ZA 1ARZA 2PGIA 4P84A 3QMVA 1E5VA 4MTLA 4C3OB 3L82B 3GRCA 3ETGA 2WQZA 2V9PA 5HYVA 5D5PA 4FX2A 3O73A 3E5NA 1YA6A 5K9ZA 1IULA 4LE0A 5EJ4A 3TIIA 1XVVA 4QUGA 1W6UA 2GM4A 4KREA 1F12A 1RWMA 2QLTA 2J08A 3BSWA 3IV6A 2JKZA 3IVMA 4FZ5A 2WA1A 2P69A 3N05A 2ZIAA 3MZ0A 3JTEA 4K9SA 4KXFB 4RENA 1BXGB 4UBKA 5B3LA 3U4IA 1A9RA 5MN4A 1MB2A 5G3YA 1U63A 1GDDA 3H1GA 2JFVA 5K45A 5GJBA 4IEEA 1CRQA 3WE7A 3ZV7A 2GZSA 2Z5LA 2IZ0A 1ENPA 2PRSA 4LCEA 1NE2A 4KLAA 5G4KB 2VH1A 1UPCA 1QQTA 3P52A 4BIIA 4F21A 3C6MA 4KW7A 2HK6A 3DT8A 3ANMA 1GGNA 1SQFA 3TLGB 4A8JA 4RLSA 1Z3CA 2ZU6A 3UV7A 1GLVA 1U31A 4JSRA 4IMRA 1YQTA 2P11A 3LKBA 1B7GO 4B3TB 1PTKA 1P1JA 3KYDB 4TRMA 2E4ZA 1QBGA 1TF2A 5BSFA 1ST3A 3M4ZA 2FQQA 2VSQA 3GEMA 4CCYA 1VQ1A 3VMMA 3SLGA 4MINA 2AI2A 5ULLA 4Q4AA 1TLLA 3RLFA 3H87A 1PGJA 3BGWA 3TEFA 4HLNA 3WS7A 3ZCPA 4KSCA 3RRMA 2R8PA 2QQ0A 4F60A 3K6JA 1SU8A 1KE1A 1T8UA 1XDSA 2IA5A 4TYYA 4CKXA 1P44A 3FBTA 2YV2A 3PVSA 4Q3EA 1WDKA 1GZ7A 1CF2O 5B7QA 1NASA 1QYRA 3AR3A 1MEJA 5ELMA 4HDKA 2JK1A 3U39A 5K7SA 2O19A 1UKCA 5FI1B 1QVZA 4N5MA 8OHMA 3JQ8B 3LFHA 3HVUA 4QD3A 3C3MA 4ZQBA 3L6RA 3NOXA 3HV2A 2Q0XA 1KJWA 2YMMA 1UWCA 3I5XA 4HQNA 4EEXA 4OI4A 2VHZA 1HZJA 2RJNA 3PWZA 4YPOA 5LWHA 3DVAB 1MV8A 4QM7A 3UKOA 8LDHA 2I87A 5E0OA 1X19A 2J4FA 4TXLA 4B3GA 4D9JA 5E3HA 3LT0A 3CN9A 5M5BA 4C22A 4ZDIA 4IJ5A 1JHAA 1G1AA 1FFGA 3CJQA 1K98A 4JCCA 3ZNQA 4ODIA 1T35A 2PQ6A 3IAEA 3T8YA 5SICE 5CBPA 3V2HA 3AONB 1YTUA 3A2NA 2PZFA 2BMWA 2FR8A 1QZXA 4R6WA 1RAGA 1QHHB 1ZJJA 5DI3A 2BMVA 5TB5A 4JR0A 2WA2A 3HFRA 1N6PA 1WPRA 2B1GA 2W22A 3OZSA 3EUAA 4D5EA 4WX2B 5DGHA 1N2GA 4HLUA 1Z3IX 4AZSA 1NRIA 4ZOQI 3OJLA 1TLFA 4W5JA 4ALNA 3FOZA 3D43A 4G23A 2NO6A 5K3BA 1I7SB 1J8VA 3FDZB 5JROA 3SKXA 3PX2A 1LDNA 3CUTA 4AMUA 4Y18A 3ZTYA 2GRUA 4NRDA 3OJFA 5CCEA 4G6ZA 1U9CA 4GYJA 2V98A 3MVEA 2REBA 3IQGX 1URPA 3TE7A 1B1AA 3N7TA 4FFLA 3SJZA 3ZHUA 1AQ6A 2WFLB 4JL6A 4RV4A 3ZH2A 4K0KB 1N2CA 1NBMD 3IL2A 1DTSA 4DKJA 2YJTD 3L8ZA 4Y9UA 3T34A 1DAHA 1BHSA 1QVWA 5KYNA 4KGXA 1L6IA 1ZC4A 1CYEA 5F12A 3DL4A 2R66A 2YN4A 2XB8A 4WN3A 1FUUA 5DHFA 3U3DA 1VJCA 4RIFA 4AXBA 1FW6A 2SKCA 3PUVA 3NUGA 2BGNA 1ZEJA 2FDRA 5JSKA 1E3DA 1Q19A 2I5PO 3CZRA 1CVIA 4YAWA 5JASA 1J8YF 2AZTA 4MPTA 1TAGA 4WY8A 5AKEA 3DA8A 4H08A 4TWZA 5B2ZA 4GEGA 1Z34A 4G63A 2Z2XA 2B82A 4Q3KA 4R71A 2XE7A 1MIOB 1J4AA 4CM8A 1L8XA 2X0NA 5BWMA 2ADMA 4UQPA 3L8EA 4V02A 4W6ZA 5MHTA 1JJVA 1E7MA 4N41A 4Y98A 5KWIA 1A3CA 2MIIA 3FGNA 4PG5A 1JV2B 1UZMA 3PL1A 3R6GA 5TMEA 1IEVA 4BUJA 1SWWA 4JT2A 4E5MA 3CKLA 1KP2A 1OBCA 3KKZA 4U2KA 4BY9E 3W1WA 1KZGB 3D4BA 1V1MA 4ZANA 1JHDA 1Y9AA 3CCBA 4X8OA 3S3TA 3MELA 3VC7A 4CNBA 1YOBA 2J0SA 3A4TA 3QLEA 3VKFA 4DWJA 2EQ5A 4PN7A 1OI2A 4DPLA 3HLTA 4IOMA 4EKGA 1SN7A 3R9IA 5J2UA 4RS4A 4RZIA 1GCAA 1OFVA 4GO1A 1I9GA 4TSRA 3KNZA 1CR6A 2QRUA 4MQFA 2UZ0A 3EZYA 4BX0A 5BORA 2KJQA 3KZMA 2JAQA 4OJTA 1BS1A 3ICVA 3IUNA 5FR1A 1H5NA 2WFMA 3S1AA 5JXWA 4NLLA 1FRVA 3HG7A 5KVAA 3OZFA 4KQ6A 1U5CA 4MQMA 2JB9A 2ORIA 1A9PA 3T5MA 4EYGA 2J31A 1AKQA 2DXIA 2QM3A 2NYRA 1YE3A 2Q5EA 4AWBA 4ZCLA 3GRKA 2OHXA 4QTXA 3QVGA 4BFLA 3Q1KA 3HRKA 4DA8A 4K6GA 2IOYA 1YUNA 4HDSA 4GBJA 2PX4A 2G36A 3CLUD 4PSKA 3ZBTA 3ZE7A 2R00A 4IZIA 4Q1DA 4FZRA 2PX5A 3R2JA 1GN8A 3TNYA 3TZKA 1L8OA 2PX8A 1JR6A 5IWAB 1GSAA 3R4CA 2ZYDA 4G1FA 4D6YA 1NV8A 1II8B 3P2YA 2CSUA 1J09A 2D1RA 3MLEA 4ZAVA 3V7WA 4BRSA 2TMDA 4OJKA 4G26A 3MGGA 5JXJA 3HZRA 2C83A 5K3FB 2HJWA 2PD6A 1UM9A 2LE0A 2HMSA 2PR2A 3GRFA 5E6UA 5I9NA 2E4YA 3QVTA 1EXNA 4RD0A 1UFKA 4H3KB 4WUTA 2OECA 3LWNA 5E9WA 1LPPA 4HUQA 4X90A 3H9UA 5ALJA 2OA0A 2D5AA 1G8FA 1OBHA 1ZCZA 3CLHA 2QD1A 4KX3A 3RYHB 2HWXA 4MHSA 4J6EA 4D25A 1GAEO 3IPYA 4LRWA 1DO8A 2P3QA 4HH3C 4CM5A 1WD7A 1D2AA 1VG9B 4KAJA 3WAJA 3GRYA 2AOTA 2FUG1 2ZEJA 4QTZA 2QV0A 3RIGA 3WLKX 4CXMA 4MV4A 3L6CA 3PDHA 1SY7A 3PE4A 3PYLA 5KVCA 2J7PD 4QYXA 4E5KA 3IDQA 2R7AA 3V48A 1P2GA 2GWRA 2H9YA 3HJHA 2B4TO 3IHWA 2PD3A 3WFIA 5KBYA 3L7NA 4MRAA 1K7EB 4DMKA 3IBSA 3UOWA 1M2WA 1MPXA 3QBJA 3ZHZA 4P8RA 3ZNNA 3MT0A 4LWQA 3CC8A 3SLKA 5JRZA 2V0NA 1PJAA 4KBGA 4YRQA 2CV0A 3LECA 3MF4A 5BMVA 5LWQA 4I55A 3UGQA 2FFBA 4YRTA 2IUEA 4MP3A 1KAOA 2IZ7A 3TINA 2J6HA 3LX5A 5IBPA 2B92A 4D99A 1D9XA 1YB5A 4AK9A 4E4RA 1CDZA 2RHWA 3I2IA 5IC6A 1G17A 3OBIA 4O2LA 1IBCA 4FDUA 2WM9B 5DLDA 4CRWB 1QF9A 3TG2A 1FMTA 1XN4A 2I6UA 3PUWA 3I9NA 4ZT5A 1C0IA 3WLIA 3Q3JB 3PJDA 2JCSA 1RZRA 3B1ZA 3N2IA 5F52A 3ZQ4A 5FTWA 2EP7A 4EB8A 1CDOA 4RXMA 1L4NA 2AL7A 1E0JA 1UJMA 1DC6A 1W88A 2ONKA 3AINA 4M1EA 4QLAA 4UUMA 2B2NA 1YVRA 3RYFA 3BWEA 3V4VB 5C4GB 5IZCA 1QWOA 2C3UA 1C2TA 2BEUA 2JLAA 1PBTA 3X2FA 3AHFA 3VPFA 1HOXA 1GO2A 1JQ3A 4JLSA 1XL0A 4FZJA 4RVDA 3GX1A 3LW7A 2QMEA 3GBPA 1G60A 4KKXB 4ZEVA 1VYVA 2PLAA 1GKLA 4O6VA 4LHZA 4NBNA 2GN9A 1BJKA 1S3GA 2ZYAA 3G2OA 3O4RA 5BW5A 4DHWA 3CUKA 1UWVA 1V47A 1W5EA 1CQJB 1N6NA 4Y2TA 1AMUA 4Z4GA 1SCUA 4J2OA 4C03A 1U28C 3LUDA 4D57A 3ANXA 5KVSA 4QVKA 4D97A 3OCVA 2YY6A 2HT6A 4RLQA 3A1DA 1JIJA 4Y1EA 3MLAA 4C4OA 2OOKA 4LC0A 3RRJA 3PKZA 3RVSA 4MIYA 2BFDA 4O29A 4LY0A 4HDRB 3D2CA 4FYPA 1YRLA 1W2HA 4DJJA 1YDHA 2MMCA 2Y4NA 1AE1A 1AHNA 1EP3B 2QN8A 5J4KA 4BKPA 3K70D 1EESA 4HGNA 3KVNA 3D3NA 1VJRA 4FD3A 1G6Q1 3GARA 3G2HA 3I28A 3PCRB 4LDPA 3TNLA 1UFRA 1E59A 2YYYA 4OLAA 3I53A 3ERCA 4URHA 4LRXA 3E8XA 2B5VA 4PZ0A 3JAKA 5EXEA 2AD5A 3OLZA 5IDWA 4DCJA 1NKSA 1ZA1A 2EX0A 5J9FA 3HEAA 3PD0A 3HWSA 1E6EA 2ZSKA 5K6AA 1TYBE 1KI8A 1YIDA 3PDIB 5G0UA 3NT4A 1GFZA 4HB4A 4QXOA 1R6VA 4LE1A 4K86A 4LRQA 4JDUA 2PT6A 5LMNB 4N3GA 2F1JA 4KNWA 4LMPA 2NZUG 3WRVA 4D3XA 1H2HA 4EZIA 2ESRA 3HU3A 1KDOA 1JDNA 1XTUA 4FYWA 3WSTA 4P7KA 5K01A 1E8MA 4O25A 4OP2A 4WSOA 3AHJA 4D4GA 4XX0A 3R9XA 2HF8A 4X45A 1SULA 1NX9A 2FA9A 3OHSX 4MWEA 4BFSA 1KZ1A 3VQTA 3Q8KA 4X1YA 2PKQO 4FN4A 4X92A 4N5HX 2M2IA 4ER0A 1Y80A 4PQEA 3FIUA 3T7DA 4N0MA 4GM1A 1XZEA 1UJ2A 4PWYA 3KQNA 3F8SA 1NP7A 1QHYA 2ZI9A 3IOYA 3UXYA 4WNIA 1UXHA 1G41A 2CLHB 2Y0CA 5AVVA 2IXDA 5IULC 5K5EA 1N1GA 1FNDA 1F1JA 1XZPA 1MJGA 3E7XA 1ILWA 5JNRA 1RBQA 3UW1A 4ZCMA 3NIFB 2QD2A 2Z98A 4YUVA 4B2PA 3BZBA 4PPYA 4TM8A 5LOVA 2C5SA 3UHOA 5IF9A 4I9FA 1C8VB 3FJYA 2POQX 2PZBA 4HNVA 1UBUS 3L02A 5EYPA 3V8QA 1XTTA 2AYXA 3AKCA 1L4KA 3IB3A 1RVDA 3RYIB 1U0BB 3UJCA 1W5TA 4UATA 4Z8XA 4AO8A 5A0FA 1NJ6A 5DLPA 2ISQA 3A1EA 4G85A 1JILA 4CQJA 4QICA 4N0PA 5CUQA 2ZTSA 3WNBA 4EGQA 1M73E 2OM6A 4J6FA 3I73A 1FS6A 3ELWA 3KTOA 4M8KA 5IANA 4BFVA 1ZWKA 2ETXA 1PJ4A 1T0JB 2FHSA 2HRQA 4N12A 1OTXA 3QXCA 4J1TC 2IUFA 4MMYB 2A1UA 1TW2A 3P9ZA 4DXAA 3WYNA 2A6PA 3H83A 4WH0A 4EUHA 1KWKA 3QI7A 2QP4A 4OGLA 2A59A 2WR8A 2LW7A 3OY2A 4F71A 4GL2A 2P5SA 1DQSA 3P9NA 4A0HA 4NJMA 3Q7TA 5JRDS 4HN2A 3IEMA 5FL3A 4HGRA 1I4LD 2GK6A 2AF3C 1L7XA 3JSAA 2DFNA 1FXWF 1UCFA 2MHCA 4DB2A 1A50B 5K0LA 5LKRA 3QLUC 1U9IC 1ZM4A 2OD2A 2I2DA 2P9EA 1M2EA 3T41A 1VGRA 2C5GA 3ZIAD 1RZRD 1FDVA 3MWLA 1QE3A 2C03A 2QM0A 1D4AA 4QOFA 3WWZA 4WNCA 1NOKA 4A8HA 1MW9X 1XJCA 2XWSA 3NT2A 3T5PA 1BCRB 3HBMA 3LUCA 2E5LB 1N9GA 2G83A 1CY2A 1XDBA 2PKCA 3X3HA 2VPXA 4V0RA 1GPNA 1F9EA 1E96A 2DPXA 1N57A 5E6RA 7AT1A 1KXJA 2NUPB 2RHCA 4PO3X 4LJ5A 1AURA 4ZYTA 3LD9A 2P2GA 2OVFA 1ADJA 3WKDA 2BFCA 4URWR 1NURA 2OQRA 3ZXSA 4Y0NA 2FPMA 1K7XB 2EX4A 1ZRSA 2XB2A 4FEAA 4GDMA 2Q6KA 2R1UA 1J49A 2QXUA 2ERXA 4LSZA 3K0SA 2N42A 3UWMA 2NM0A 1N33B 1QRSA 1XEAA 2QRMA 1WCWA 2G76A 3AWDA 4G5GA 2CKDA 1FJGB 4OQMA 2LZ0A 3T7SA 4BJ5A 3E70C 5B1HA 3OJ0A 1QH8B 1R6UA 4D4KA 2QRZA 4Z1MA 1WXHA 1XHLA 2IYEA 4A3SA 5ABPA 1Y34E 4OK6A 5CIWA 4LZLA 1RDFA 1VSQA 2KMLA 1BE1A 1GPLA 2WIAA 1N34B 4OSPA 3K35A 3PC8A 5FBWB 2DJIA 3C5CA 1AQIA 2AN3A 3GH1A 4WFKA 5AO9A 5AOVA 3HXQA 4M88A 1IBMB 1S96A 2P2DA 3EXEA 1IG0A 4NBSA 3HBLA 3PR2B 4JNCA 5AXAA 3ZWMA 1K6MA 5CT8A 1J0AA 4JX8A 2AKYA 1QHEA 5L8VA 4YQYA 4Y6LA 3O0TA 3PQ6A 2HDOA 2EZ9A 1LLQA 3P4XA 3ZWXA 3R09A 1U2DA 2B36A 2NVUA 2IWRA 4E7PA 3TF5A 2C0PA 4WK0B 3JSXA 1UBTS 1T2CA 5YASA 2RIRA 3KYCA 1E9FA 1N78A 1RTTA 2HCFA 4WRRA 2IYAA 1JMVA 2B30A 2BH9A 3EQ8A 4LJ4A 4DT1A 1BX0A 2WT8A 4JJKA 5C34B 1DVRA 1M1NB 3QUQA 4X8MA 3MWKA 3FN4A 3M3PA 5HQ3A 4RZSA 3P0IA 3SZRA 2Z3VA 3G7NA 4PAWA 4JI8B 4K6MA 2C7RA 2DUNA 1TMGE 4H7EA 4IDHA 1M1UA 2ILVA 4E30A 4AURA 5HQJA 1EFHA 1TECE 1FXSA 3WMFA 1E3MA 2BEWA 3DFMA 1G0OA 1U90A 2G09A 4FXPA 1AQYA 1XQYA 2FEMA 721PA 5IPFA 2HV9A 1VCNA 2ILTA 3UYLA 2ZJ4A 2G77B 1KQGA 2X8BA 3HXTA 1M34B 2X0IA 2AFHA 3AM4A 1YK1A 4QXRA 2IHNA 4DLKA 2NU7A 4MITA 2E1RA 3RU7A 5B7PA 1ZU4A 5CNIA 5SZKB 2VXCA 3PXEA 4QVGA 1XF9A 5AI0A 2W8BB 2CNLA 1G3RA 4DQVA 2NTYC 3KHKA 3F4KA 2FX2A 5D2CA 1U2SA 1JHYA 1YIOA 1O03A 3B6KA 3CLTC 4KWCA 4N7BA 5CTAA 2XTAA 2RJOA 2WSYB 4UNSA 4AX8A 5BN4A 3DE1X 2ZYSA 2GPBA 1TJYA 4X95A 2Q1YA 5BYKA 1HFWA 1UDWA 4LNHA 4TKMA 3DWGA 4C7JA 5HUJA 2X7HA 1FP6A 1C9EA 2Q3CA 1LF5A 3Q2KA 4BO9A 5KYXB 1KDPA 1GYRA 4CEHA 1FC0A 1KJNA 4WCFA 3GAAA 3BAZA 5BT8A 3WLSA 5LR6A 1NW8A 5JI3E 1S2LA 3NP9A 4XAQA 1IVSA 2PEZA 4JQSA 1UBKS 3URKA 5JSZB 1Q0RA 1ZEMA 2QY9A 4W82A 1IBKB 3KWLA 2NG1A 1C9KA 3JQQA 1RI1A 4BQNA 1V8PA 4GQAA 1S2GA 3DFIA 3A11A 3F2VA 3GLGE 3KLPX 1XLUA 1E32A 1GPDG 4RQBA 4FGZA 4LYDA 2IY8A 5ICSA 1DJOA 1I3KA 3CH4B 2JI7A 3LNCA 1XF1A 5EXSA 1DAOA 1LX7A 4AJEA 4YRSA 4E11A 1E6WA 2V9CA 3TRKA 1EVEA 3A9UA 1GNLA 3R6DA 2WWVD 5AUNB 1LK5A 4YY3B 1P9WA 1T5DX 4H31A 4L5BA 4IGEA 5HBGA 4ARSA 3CNLA 1AS0A 4UTVA 3AFGA 2CYBA 2F3PA 1CBUA 2J0UB 1H2WA 2WJPA 3U7JA 3IPAA 1EAMA 4FX5A 4QO7A 1RYBA 3M82A 1JZQA 3DTVA 3IHLA 3H2GA 4WPGA 2LUOA 5KX5A 1U0NA 1ACLA 1N5KA 1F6WA 2QGFA 1SOWA 2WF6A 3WIUA 2XRYA 1WXWA 3EVFA 3IEVA 2HRRA 4AJLA 2O8BA 1KYIA 1F06A 1VJTA 1ZIPA 1P7VA 3FVTA 1ORDA 3IODA 3M5CA 4MUMA 3UMVA 5EXPA 2IUYA 4L16A 4ZMSA 1PJZA 3DZJA 5H7XA 3PXDA 4WI1A 4C7XA 2ZITA 2RAVA 2F8SA 3LUJA 4QQKA 5DSZA 1LS1A 1RRFA 5EJ8A 4G0NA 3LXXA 5K20A 2PWPA 3R5JA 5BSKA 5EMJA 2XNDA 2Y66A 4GVLA 2VYFA 3BIOA 5KYVA 4JVOA 3MWEA 5ITVA 4AZVA 3H1AA 3NBAA 3QU9A 4V3CA 4NNOA 2UZ1B 4IQ4A 5HILA 4D3DA 5H0IA 5C7YA 2RH5A 1EVQA 1QIJA 4Q1FA 4MEAA 1FL9A 3FPKA 4U6QA 3PRHA 3ENQA 1ULUA 2ZJ2A 2ZIZA 3NKLA 2JF0A 4P3KA 5BO5A 3ZLVA 4BPRA 4DG5A 2EFJA 3R5HA 4HDNB 3UTCA 1NUUA 3NHMA 4PLYA 4S24A 4PC3A 2X5OA 4M60A 2ZJ7A 3VNSA 1J07A 3AP1A 1VYHA 3P4YA 5HCIA 3KZNA 1N1EA 3IS3A 3ZN2A 4ICIA 1X0VA 5BSVA 4RTNA 1TEZA 2IPAB 1BQEA 2FJUA 3BGIA 4G56A 1W25A 5NLLA 4B2IA 4FB4A 2CNBA 2NU6A 2X13A 3AU8A 4PC2A 5EZYB 3NXSA 1IFXA 5BWCA 5K4GA 1IVYA 2VYNA 4MKZA 4MIEA 4CODB 1U3UA 1O2DA 4YAOA 3HFGA 4YRPA 4I9HA 1SVNA 4DRYA 1J5XA 2M1XA 1Q95A 5UKDA 1T6YA 3CW9A 4BLUA 3OMLA 2HA6A 4E22A 2LD4A 4EPTA 3B7WA 3ULKA 1MAAA 1MZVA 3DDSA 4WINA 2I33A 2EWMA 2QN3A 4YCBA 5AXDA 2FAXA 4QUAA 4V0SA 5LPNA 3JALB 1RXEA 3L6OO 3WRXC 4WKCA 1FUIA 3CINA 1JHRA 1YZGA 1OAOC 2JCVA 3H5TA 3MYRA 3VH1A 4DJFC 5AVUA 2IKQA 5TQ0A 1U8AA 1E1MA 3TJMA 5L51A 1WSDA 1OV4A 1RMTA 3LPAA 3NATA 4UUOA 3H4MA 4Z5XA 2JFWA 2H1CA 1W0JD 3QYFA 2UVPB 4I5DA 4C78A 2XCUA 3PDJA 2UV8A 3PNYA 4Q05A 4BFCA 1P7WA 1A8IA 4TL7A 3AY0A 1U81A 4UHEA 3TR5A 4BFZA 4DSUA 4G8BA 1KS2A 2BFFB 4DV2B 1S8NA 2EFHB 3D8UA 1VJ0A 3DXZA 2VDWA 4HEQA 5JE8A 1NBAA 3PD1A 2YDXA 3ASZA 3SF0A 4Y0VA 1ISSA 2YCBA 3BX1A 4Z4CA 1QC5A 1F17A 3WLFA 2IXFA 4FJ0A 4F97A 2FRVA 2IXGA 1KZHA 2XUAA 4MJLA 4JLNA 2PGOA 5JBQA 5I47A 2QP3A 3KO8A 1Y37A 2OZEA 1UBEA 4PE5B 1PO7A 3U7RA 1RC8A 3E9RA 5KNBH 4MUGA 3TL2A 3THYB 4ARZA 2Y3IA 3L04A 3E7DA 4UD2A 1ZHHA 2D1TA 1QQ6A 3KTFA 1RLIA 3KQWA 2VDPB 4PYNA 4YQFA 1DX9A 4QDUA 5IAOA 1CUXA 1VLMA 2ZQ5A 3B8HA 2VPTA 2ZIWB 2PNJA 1U7WA 3WV4A 5CD9A 4HHEA 4QOSA 4PAQA 3RUHA 4HWKA 5GIPE 3CIFA 3PT9A 1K5GA 2FWJA 3DD5A 4FYJA 5CHYA 4CETA 4KFCA 1Z28A 2X0FA 2NZ2A 3EISA 1HY3A 3LX8A 1B41A 3ZV4A 5JJKA 2PX6A 3FWHA 3E5MA 4WE3A 2PY6A 1FTSA 2VN8A 3AI7A 3AYXB 1BRTA 1YVEI 5BNFA 3JQ7A 2HADA 4E3ZA 2BFPA 3O38A 4NZMA 2ZI6A 1JEYA 4I81A 1RRPA 4EX7A 1IZYA 1OE0A 2V7BA 1UT6A 4ZOLF 2Q2NA 4XQ9A 4ZI7F 2WWRA 2YBEA 4JUBA 4D8TA 4Z7QB 2ZUWA 3PPVA 3COVA 1H4SA 1BMDA 1Z7WA 3NGLA 1BQ3A 4RSMA 1PDVA 4PS0A 2LDBA 2IHTA 2YMPA 2YFQA 3IA2A 4Q66C 1KI2A 4C30A 1BE6A 2J5KA 4A2PA 2QVCA 1JHOA 1Y48E 3EQZA 3L8HA 3FD8A 4RF3A 2CMKA 1H6AA 2Y9MB 1RFGE 3RVDA 1AGYA 1X70A 1PEYA 1XR3A 1MR3F 4AYWA 3SIPA 2XCTB 1W4CA 2EIXA 4AS3A 4AWXA 1KS9A 1G8JA 3I72A 1VKZA 2VJNA 1YCDA 1P1HA 1ZK2A 3KK0A 2Z4SA 4CUKA 1KGSA 5JS2A 4QDXA 2XNDD 4FFBA 1CG6A 3CVXA 4JXXA 2QGZA 3GNLA 3VH4A 1AUVA 3IHKA 4HPXB 1S3SA 3C7KA 3FCEA 2OK8A 2OR3A 3HL0A 3O9ZA 3OO0A 3QPAA 4J91A 3DLAA 1C1DA 2FEOA 2GT1A 4L7QA 4MW4A 1JTFA 4D41A 4MVJA 1KVTA 1BGXT 4NKRA 3DDUA 1QGDA 4GBGA 2ZWAA 1WAMA 1U1FA 2OHGA 3DM5A 1P6UA 4BVAA 1ORVA 4MWTA 4RLFA 4BKUA 4O4HA 4YVFA 5E6SA 4KR9A 3NVMB 3W34A 3W5AA 1XKTA 1UPUA 1SCNE 2AGVA 3N28A 3N2ZB 5JG7A 3T54A 4OM8A 2FN4A 2JLUA 2HPVA 2J07A 4GG1A 2PXCA 4QYSA 3DE6X 1O6GA 2AR7A 2QLLA 1KO4A 2W6MA 2ZE6A 3BFKA 1R12A 2VHWA 1W4RA 3TAHA 4I36A 3GPIA 3WSVA 4C6SA 4MGZR 1E5QA 3E58A 2BSAA 3G59A 4O2BA 3OWHA 1WDTA 4Q47A 4P3PA 1DPGA 4QGAA 3QPDA 3TDKA 5DBEX 3USES 2WE7A 4FZVA 1VIAA 3WA6A 4X1OA 1SWVA 3I1FA 3H1TA 3JCZA 5CA1A 5C5CA 4B48A 1DADA 1C9JA 3MWGA 2H4ZA 3H2BA 1RJFA 3VR3A 3CEMA 3JARB 5JHHB 3P19A 1RQXA 3NH6A 4ZVNA 2VR1A 3PHGA 3EUWA 3GDFA 2PZKA 4L74A 4ANFA 4L8FA 1JLSA 3LQ1A 3AIIA 1FRNA 1SZPA 2ZZKA 3CYFA 3ZIUA 3ICCA 3ABIA 2IWHA 3KVYA 1X7YA 1HRKA 1TA4A 5DSTA 1I7QB 4O4IB 3LO5A 4HMQA 3MG9A 3VR5H 2EXXA 2B8NA 3GEHA 1YNSA 4BU0A 3Q2OA 1FFHA 2XECA 1PBNA 1T25A 2OD7A 2Q6IA 3HXKA 4QRDA 5U4XA 4DIBA 3ZW9A 4H18A 3TRDA 1W87A 5B30A 1LNQA 5K4AA 4MR8B 3C3PA 3SZLA 2JKVA 3JR3A 3TLYA 4QG7A 1X8LA 1CEEA 3AF4A 2DH5A 2PRJA 5LQCA 1V3VA 3OFKA 3O8OB 3C3JA 4O2AB 1NDUA 4XPZA 4AJPA 2PWZA 3TPCA 3OZRA 5FJIA 3IP8A 4XW2A 3BK1A 2OFWA 4EATA 1JJAA 4OP3A 4R8KA 5JDCC 2IDKA 4IIJB 5T4HA 1VZ2A 3ZDCA 2YIMA 2IU6A 1UC8A 2IC5A 3GD5A 1WTAA 2W93A 1OWLA 3A58B 3WMWA 2IGBA 5EE0A 2CT8A 1W44A 3B78A 5LP6B 2J48A 2IEGA 2WHPA 1N7JA 3L93A 3M89A 4XWTA 1SQ6A 1NAHA 1DEKA 3FPCA 1G5PA 2AFVA 2PEYA 3E1GA 3GEDA 4G9EA 2KPOA 1CS0A 3MWDB 4H0FA 2AOUA 4AUMA 2YW9A 4EUKA 3FJ1A 5LP1A 4Q39A 1X77A 4FJ2A 2IELA 3VBCA 1B3BA 1JWBB 3MBIA 5DBIA 1KKLA 4M3NA 1M34E 3PLNA 4HKTA 1UBNA 2PS9A 3P20A 1CHNA 4FBMA 4WKPA 4AWAA 1DJLA 3GJZA 2ZPAA 4CU2A 5DN6D 1CZKA 3QRWA 5DYIA 2QMQA 3OTWA 3STUA 2Y68A 1I5OA 1DIOB 1FDTA 2B25A 2DTDA 1LJUA 3L79A 4NOJA 3IJPA 1M2HA 1W4LA 2EW1A 1NUSA 5AXBA 4JI3B 2XCOA 4KQXA 2I4TA 2D5CA 4GC5A 2LBPA 2P67A 5L53A 1MNQA 3K3PA 4BJ6A 3MTEA 2I2FA 4CEJA 3IOEA 3OP4A 2ET6A 3IQDB 4Y2XA 2BM8A 5EYPB 3R7DA 3R74A 4BBJA 4DZRA 3DEHA 1U2ZA 1KQFA 3GP5A 5LOVF 1EPUA 1N3BA 1SHJA 3LVBA 2Q62A 3S2EA 3GQBA 4EY7A 1A5SB 4A23A 3HNPA 4P98A 3ZI0A 2WJVA 3EHEA 5DM70 2XF8A 2R6CA 3EH1A 4J4BA 4G2NA 2RHTA 4FD2A 2WB2A 5AVRA 5D7BA 3MUFA 1XELA 2Q2OA 4RSRA 4HAVA 3EG9B 3KZ1E 1M2VB 5GINE 5KKAA 1QFXA 3VPSA 3K30A 1RQLA 2NO7A 2CXXA 2X4LA 3RAGA 4ZQFA 1ESMA 1PTJA 2FQ1A 2C3OA 1YJ8A 3AR4A 3LUKA 5IAKA 4ZI3A 1PFVA 2ODTX 5LUBA 3ZE0B 1CY7A 2CJPA 2AJ8A 4MV8A 1W85B 2HFKA 4UHHA 1E9BA 3ZDFA 1IMJA 3INTA 5GOZA 3RVMA 2P9BA 4C5CA 1E3JA 1VG8A 3CR8A 4QYMA 2I0FA 4NCXA 1Y3CE 5A2GA 2NTNA 2QLNA 3F78A 3RRYA 2FZ4A 2XMRA 4LSWA 4RY2A 2QPAA 2FI1A 3D4PA 5AK5A 2F00A 2XZDA 3A4YA 4R98A 4R9VA 3P7MA 4JUFA 5DHRA 4BLSA 4WMLA 4EYSA 3IDOA 4OHFA 2FPXA 1QO0A 1Q17A 2AE2A 2YHSA 4BJ3A 2PQ0A 4X63A 4LVOA 2IJGX 3TPZA 4C0JA 3NHAA 2XXAA 3OOEA 4CLHA 2F4VB 2XQJA 1M7HA 1TOAA 2I6GA 2RHJA 4WBNB 3CH5A 2YJ5A 4YRZA 1PHPA 1PT6A 4ZICA 2GVDC 4HDMB 5KJEA 1IPFA 2Q4DA 2AJBA 3PXGA 2H2AA 1LNSA 1G8GA 3IDSA 4Y67A 4XTRA 3TN7A 1JG1A 2NVOA 4UAUA 3ZZ0A 5G3ZA 3I1IA 3VR3D 3VHXA 3T38A 1S89A 2A58A 4ZO7A 2Z5VA 5AKXA 2O48X 4QREA 5K0CA 5IVDA 4R2JA 1Q74A 4FPXA 2IYPA 3AHCA 4I8XA 3NCHA 4FOSA 1YTLA 3E18A 1FEZA 2BFAA 2ZPTX 3CWCA 3HVRA 1H6DA 2X15A 4MJXA 2C5FA 2GK3A 4S1NA 4L9SA 3M6IA 1P1RA 4WZBE 3UMSA 3LLSA 4FCCA 3GLHA 3A25A 3I9LA 3RF6A 3JWPA 1S8OA 2VPIA 3TW8B 4YAIA 2HBRA 3M81A 4TMFA 4F9TA 1W52X 3AERB 3EVGA 1NPTO 3O3MB 3U0VA 3EX7C 1EXDA 1P1KA 2HMYB 2NSYA 3L0DA 2PV0A 4P7JA 4PHCA 4G5HA 3T9CA 3SXJA 3W04A 1PJ3A 4CIDA 2WD7A 5CAEA 1KSJA 4DNPA 2JLVA 3WQBA 2J4CA 3DV2A 2C84A 3MIIA 3NOOA 1ZH2A 4EABA 7GPBA 3PC7A 3QY9A 5T4FA 2DPGA 4RF4A 1Q1NA 4FMDF 3V1LA 1NTRA 3FH0A 4J03A 5KTRA 3C3WA 2OQVA 1ENYA 5A5FA 1GQOA 1JIVA 4RD1A 6REQB 2CV2A 4OBEA 4IDPA 1QIGA 4B47A 1G66A 1KQ3A 2HOQA 3VKWA 1W73A 2HA3A 3CO0S 2YOHA 4KQFA 2ZAYA 3L6EA 1EDEA 4LHWA 1KO1A 3N39C 4PZEA 3WIOA 5FWXB 1AS2A 3J81k 1P1BA 4FQ7A 4J7XA 1VE5A 4OXKA 1L5LA 2XCQA 2OBLA 3MGKA 3VPHA 4TKUA 4EZEA 2DLNA 2J46A 2IE8A 3D6HA 1RW4A 4JLJA 3OA0A 1O6BA 3EGXA 4LTNA 4R3UC 4GU5A 5F51A 1ID8A 1Y8ZA 1HFEL 1T36A 4YJHA 3PVZA 3FI9A 4NARA 5G4LA 3T3GA 2HREA 2QYHA 4MWZA 1I3NA 1NXWA 3D4IA 4IFEA 4RL4A 4A8JC 5KNBD 2XE4A 1HEYA 4KPYA 3VVLA 5LZ2A 1XN1A 1KEEA 2OHIA 2W71A 3KHUA 4GOMD 4IUCS 1U3GA 4JYBA 5EZ5A 5KWSA 1FDOA 1HTBA 2GD2A 2EJCA 2X4GA 5AUOB 5KCMA 2EL7A 3CSUA 1U2EA 3UMRA 1DAFA 4JIGA 2BF7A 3ROXA 3CLUC 3IAS1 5BW6B 1HQCA 2J3HA 1PR0A 4HVTA 3DYIA 4KPUB 1YU9A 4TXNA 4EJFA 4F12A 4YK7A 3S40A 1SCKA 3LDGA 4GYKA 3KTDA 3D6AA 3N6XA 5DWDA 2BFWA 4V1CB 2QMZA 1X7WB 1EK0A 2X3FA 4ZD6A 2O0JA 1T6ZA 3CUSA 1HE1C 2Z3ZA 5ILQA 4BLTA 2O8DB 4V1CI 2H54A 2PKQP 5E9QA 3SHVA 3UQYS 1NYQA 1FJXA 2QK4A 3AMVA 3EFHA 4P0TA 1FLAA 2WSMA 4YUZA 2RE8A 4RVFA 4KE8A 4Q7KA 1T2NA 1Z4PX 2Z5FA 2C20A 1M6VB 2Q1UA 1KDZA 5ESRA 4S1TA 2O0MA 4DLUA 4TN1A 2FUG6 2W48A 4OYLA 4C7KA 4H7FA 4NBVA 1C81A 3QVVA 4R83A 3Q6IA 4AJ4A 5WRFA 3ICWA 3U6BA 4CLOB 1IHPA 2X4DA 3WMXA 1IJEA 1YS7A 4HFRA 5GM2A 4DS3A 1X38A 1ZAYA 1SBYA 1HT3A 2HUNA 2AW3A 2BHSA 1HDEA 2PXXA 3K1YA 4GRAA 4EL0A 1FIUA 1EFLA 4NY1A 2D0DA 2X5JO 5AJUA 3W6OA 2R8YA 8ADHA 3W5IA 2F3RA 2O23A 1W9MA 1YZTA 2BN4A 2ZGVA 3GMSA 3OZWA 4M83A 4N1AA 1IWBB 1DOZA 5ICEA 3GP8A 2V7TA 5IKMA 1MGOA 1DWQA 1TCVA 3PCTA 5IJ9A 4GLFA 3ZZTA 4ZA2A 1EFUA 1PJLA 1RQNA 1TCCA 2AK2A 1WY7A 1DJNA 3ROTA 5FLEX 1B4DA 4GE0A 2H4HA 1KORA 2WAAA 3Q9UA 4YJ3B 2V55B 2NP6A 5ADUS 2X0EA 1XQVA 1NBIA 4HLUC 5J2TF 1DO0A 3RFTA 4UVDA 2R85A 5BV0A 5KTYA 4D44A 1V71A 1ITZA 4GI1A 2GN6A 4GKJB 1P60A 1Z4OA 2VYCA 1IZ0A 1WKBA 5CLIA 5FBQB 4B3HA 5TMPA 2ADOA 3AG5A 4CLDA 3VR0A 2GARA 5DM4A 5DO9A 2GN4A 1LBTA 4EY6A 2EBWA 4P4SB 4CHGA 1A9XA 1FW8A 3TJZA 3G5AA 5J23A 4M6WA 4DNXA 4QWMA 3VV3A 1JB1A 3JQRA 3JYHA 1SJ9A 4ZO8A 2WJGA 1T2FA 3FYUA 2GEJA 3QW2A 3NMUF 3V7YA 3O93A 4E09A 1F4PA 1SC6A 4LUCA 2DWQA 4ND6A 5HSGA 5JH7B 1X92A 5EPEA 2NO5A 2G9ZA 3OD1A 2QVXX 3WGVA 1J5EB 3ENVA 2Z2JA 4M0LA 4L5YA 2P2SA 3DBHA 1G8YA 3R5FA 3ZCUA 2ERCA 4OJNA 2ZBPA 5I9SA 1E8NA 4FONA 3DZDA 4S1OA 2IHVA 4LY3A 2O2XA 2JKYA 5HX7A 3ADOA 3CWZA 3LBYA 4LNAA 5I5GA 2PCJA 3VR5D 4D56A 2W0SA 3RS3A 4MW6A 3HB7A 5DZSA 1THZA 1X9IA 2QS9A 4U5XA 4ZCRA 5F2NA 1MX1A 3PTAA 1V7CA 1TU3A 4FFPA 3UV6A 1KR2A 1TK3A 3IDAA 2VWQA 2X9GA 1LQTA 4QELA 2WAXA 4L72A 2C54A 4F46A 2ENWA 3JW8A 1JLLB 1UBOS 1O5OA 2WJIA 3CLRD 3IQEA 4G1EB 3DF9A 3OE4A 4WN9A 4LFAB 3OIWA 2P41A 5K05A 4NMWA 3KE9A 4WBSA 2X9QA 1WD5A 2F8LA 1S02A 2OKGA 3BMXA 4ILEA 1R4MB 4K26A 4MRMB 4MR7B 2NUTA 2AX3A 2GZ1A 3NIBA 3QP9A 4KMRA 2P9GA 1V95A 4NK4A 3I8OA 2P65A 3G79A 3ZE2B 5EJ7A 1TQ2A 1RBMA 1PZFA 1PDWA 4EM6A 1JQ5A 5TDHA 2F1RA 3BE8A 4DCGA 1KJQA 4GI2A 3RKUA 3WDLA 1Z13A 1KDYA 1N2SA 2ZB7A 3BWCA 4MPJA 3EFOA 3ILXA 4Q5IA 4XSHA 1W46A 3Q3HA 2B8JA 4DBVO 1IZ7A 3AP3A 3OQIA 1MABB 2REQB 2HLHA 3EXHA 2Q45A 1HDYA 3OM1A 1D6JA 3KVRA 4TZKA 2I9KA 2E49A 2R00C 4YQEA 2I22A 4OQXA 2NYAA 2J0EA 5H80A 2VT2A 1C5KA 3MT8A 2VJDA 1XPRA 3WGHA 4HXYA 4LRUA 1SQGA 2VCEA 5F1KA 4ZAXA 2FQXA 4WVFA 5GP1A 3T95A 2IEAA 3CW2A 3FVVA 1M2FA 1DLJA 1Q77A 4GOXA 4QATA 4Y7CA 3W3ZB 4GDFA 3DC7A 1XK7A 1VP9A 4RSHA 3U1TA 2GBIA 1FZTA 1NC1A 4F8YA 2SECE 4H6PA 4IHJB 2P75A 4UEWA 1GZHB 3X43A 1WHTA 2PIAA 4L1KA 4D74A 4AUKA 1WCXA 3GLKA 5KVQA 4BX8A 3BRSA 4ZI5A 4FK8A 4JK3A 5AICA 1GL9B 1OSNA 3WA7A 1KARA 1O96B 4LXTA 1CU1A 4YJ2B 2D1QA 4F5EA 1W96A 5C8VA 5IDQA 2ZT5A 2HGSA 1U7XA 4O08A 3KSAC 3R3XA 5JAHA 2V0CA 5ED4A 1LDBA 1FLNA 3OZAA 4GOJA 4U2EA 4WJKB 2P1ZA 4YO8A 5DFAA 3ZK8A 1H69A 2FP4A 5JS6A 3CEPB 3B5JA 4FFVA 5C8ZA 3DYVA 2Y05A 2QVGA 1P0QA 2XD9A 2YYSA 3ND9A 1GV1A 3PIIA 4BE7B 1Q16A 3DHWC 4YIKA 5EMNA 1Z73A 2JLZA 3VNAA 2AQHA 1JAIA 3AXTA 4NIMA 4MYUA 2NIPA 4DMLA 1CJSA 2H2IA 3ABZA 2NNWB 3JQAB 1U9JA 3WISA 2ANCA 4MGIR 5KJFA 2ZZNA 1VTKA 3K6SB 1FUEA 2XDYA 4JI7B 2ZRDA 1K75A 1VHQA 4QBGB 3VZQA 4U0KA 5LXTF 2FZGA 2C95A 4GXNA 2R1TA 2VDMB 2WYWA 5AW2A 5J2TB 3EBLA 3LBHA 4L73A 3C1TA 1Y1RA 3VDRA 3VPAA 4YRGA 3A3YA 1XROA 4LQ4A 2PE5A 3SHOA 4BMSA 4BQIA 3N0XA 3N8DA 2QD5A 1MB3A 2VWGA 3ZJ5A 2PLNA 4X44A 4JOQA 2P9HA 4BCBA 4HAXA 3NBQA 1EJ0A 4FSXA 4OY3A 3UBTA 4B83A 3QKUA 4QDOA 1PFYA 1GU7A 1H4TA 1NNLA 3GGDA 5T57A 4F9EA 2PUVA 5LBUA 5A3RA 5AW7A 4IY1A 4JOBA 1SPBS 2QUJA 3LQRA 1TU4A 2JGDA 3QU2A 5K1ZA 2A57A 2FSPA 3K73O 5IZCC 2CLSA 4D02A 4R3NA 5KI6A 5D3QA 3ESZA 3FYHA 1DIGA 5I51A 2FOIA 4MLPA 4D9EA 1UOEA 4TMYA 2XAAA 1P2BA 1RC1A 4OATA 2CDAA 3VJRA 3DG9A 1T24A 4Y1GA 3EUEA 3H05A 4LZJA 2F43A 4JNKA 5IMBA 5I3CA 2YJNA 2IUUA 1OXMA 4DRZA 2YRWA 1ACMA 1SCQA 3LY5A 4MUHA 3HNRA 4LKOA 1FX1A 4Z9XA 4OQ4A 2OCDA 4KXLA 5BXQC 1NF3A 3GZNA 4KYTA 1H42A 1HTWA 5HFNA 3HCDA 4XWAA 4EMUA 2ZE5A 2IH5A 1J9ZA 1IN6A 2OZPA 5CLFA 1QCZA 2YOFA 2HRBA 5BVGB 2I6XA 3V1TC 4HYEA 2XLCA 4JMLA 5TF0A 2ZUCA 2XI4A 3KKNA 3P0RA 3TDMA 1U7TA 2P4HX 4N7JA 1T6BY 4A6XA 3HU1A 1Z75A 2IYWA 4HB0A 3M4NA 3ZU3A 3RADC 1RYDA 3MD0A 3GLVA 1KHTA 1RWBA 4M49A 4RXTA 5A4AA 3E3LA 4FWBA 1YCFA 1ZN9A 1E6UA 3PI7A 3R8FA 3FCCA 3PE6A 4J7UA 1D1TA 2Q21A 2XNJA 1UBCA 2EF1A 3EWAA 3N8KA 3C3XA 4Y9RA 4AP5A 5BSGA 1C30B 2CGEA 1MB0A 1JFRA 4ZZ0A 5K6AC 2C00A 2OC4A 5F23A 5GONF 2ATXA 3M1YA 4EO4A 1XRNA 1T8TA 3HWX1 1E3EA 1LBIA 1KY3A 3RUFA 3U2QA 2JFNA 2GBCA 1Y9ZA 1K4MA 5DX8A 2QL5A 3T0FA 5IH3A 2TECE 3JX9A 4N8EA 2GSDA 1SQSA 4MGKR 2G4CA 3BQNB 1MO2A 4LOIA 5G0WA 3LC1O 2G25A 3C6XA 1D2GA 4RWEA 5D8DA 3TVDA 3EXIB 5IM5A 4XTCS 4WFIA 3H5VA 3K9BA 1FYVA 3UMGA 4EVSA 5JS1A 1PWEA 1U0OC 3HU5A 3QF4B 4TS1A 5BNTA 2GZ3A 1A8SA 1GAJA 3J7TA 4BVHA 1Z6ZA 3KOZA 5GY7A 4E08A 5I45A 1UMBA 1X6VA 5TXGA 5EEGA 2VDQB 3OLYA 4YYZA 2VJMA 4MYRA 4CI9A 3LL4A 2Q8PA 4KQEA 4MDYA 3RSQA 2H0AA 4EA8A 4XR9A 4KEAA 1XRSB 1JKJA 5JCOA 3G1UA 1M8JA 2BCEA 1OGYA 3H8VA 4PQFA 5ALFA 2Z6QA 2P5TB 1XAIA 3T1OA 4RE5A 4HNUA 4DUZB 7ADHA 1UOOA 3LHSA 3FCUB 1HZZA 3FRIA 1B6RA 1QYVA 1U94A 2HMWA 3AXSA 3IKMB 5T4EA 3LUFA 4F93B 1SC4A 2Y0DA 4MH0R 3CH6A 1D09A 1CZRA 3TXYA 2L18A 2ZXEA 1VG1A 2QYTA 4FLMA 1EU1A 5EIHA 1WE2A 3MQ4A 3IFSA 3R24A 3FFXA 2GQ0A 1MDFA 4BL5A 4RADA 2IPNA 5EHIA 3GFOA 1SUWA 4IHQA 2VRNA 2G0NA 3V6MA 3LWDA 5L7TA 3CRRA 3S8EA 1A5ZA 1PVOA 2Y92A 2BGLA 3D3WB 3SX2A 1NF2A 1K5HA 1YRBA 2HUPA 4DLPA 3QK7A 3MRXA 4EF6A 1KTVA 4LYYA 4UXIA 1XV5A 3B6ZA 3EA4A 3NTLA 1WXFA 3SS7X 5T8KC 3CVWA 3BD8A 3HM2A 2R4UA 2GEUA 2J3KA 3WDKA 1Z07A 3JD2A 5T64A 2AHOA 3KM0A 4HPJB 1GG8A 2BISA 4QLOA 1FPQA 4D80A 1JG6A 1R8SA 1RPJA 4DLLA 1XOIA 1XVIA 3R3VA 1A8QA 3OFND 3TUZC 1N8KA 2JFQA 1WETA 2G1JA 3FF1A 3H1BA 2HDHA 3LT5A 3FCSB 3C0KA 4MQUA 3BGDA 3DL0A 1JFVA 2IHJA 3DWEX 1O58A 4PC1A 1EUYA 1P19A 1U4NA 2ENUA 2TMKA 4FNMA 3IB6A 1VPDA 2YL2A 4RA6A 1ONSA 1E3WB 1Y1SA 4RGBA 4ZOCA 1IDN1 4DVJA 3BB1A 3WK4A 2PSDA 5C8YB 4LI0A 3W6ZA 2IYZA 1XX6A 3PUHA 1HDGO 2IU4A 2OO5A 4DB4A 2QY6A 4JWKA 1S1CA 2ZVQX 1G4UR 3OJWA 4ON9A 2J3MA 1AOXA 1M8PA 9ATCA 2YXLA 1P39A 3FWZA 4DADA 2DYKA 4EMTA 1CP2A 1RYMA 4GWKA 5E1OA 1G6KA 3HKCB 1MHPA 1N6RA 4K9NA 4JWTA 4B75A 2ZTMA 3K53A 1OD6A 1NUHA 1NZDA 3O7MA 1ENZA 4K40A 1RC0A 1X80B 2AI3A 4O2RA 2QTBA 4ZAWA 4XM1A 4EGJA 5EIXA 1EUCB 4M1QA 4NYIR 5BVHA 4TUYF 5C4MA 4RHYA 5L3RA 3KL4A 3TQHA 4Y1FA 4DCTA 4K6CA 2PLRA 1MBZA 2IYNA 5G0SA 1XT6A 2CE2X 4WT7A 2N3ZA 4XWGA 4LDJA 4RZXA 4ETIA 4BRZA 3VI4B 3AF3A 2OCYC 2ZSAA 1KY4A 3Q8XB 1K7CA 1KDTA 2FWAA 5BRJA 4FUTA 1ADYA 4OUDB 2PWAA 2R2AA 4PNHA 4NZ9A 4Q4JA 4F3CA 2CHEA 1R64A 5ISMA 4CDNA 4GEKA 3PC8C 1Z15A 3HY4A 4X94A 1P5ZB 2DPLA 1Z2DA 2HCRA 3NHFA 1H05A 2OSBA 3TQIA 4AN1A 2CEAA 1RKQA 4II3A 4XVHA 5E7IA 1BXRB 2G28A 2HNAA 3CGWA 1CF9A 5KNCH 2VTBA 2PV7A 1XQ9A 1YQGA 4G0OA 4C7OA 4OIMA 1BCSB 3B6MA 1MC8A 3AC0A 2WW8A 4LX0A 4ZQGA 3C16C 4WXHA 1E2LA 1U2DC 2G9UA 4A6EA 4P7FA 3U7FB 2WIBA 1ZHOA 2YHIA 1U8XX 3ZYCA 2Y1CA 3EXG1 1I13A 4B4WA 4Q0MA 4PQRA 3PUYA 4F5YA 2BFMA 3N9IA 4WY5A 2AI1A 3PHBE 4CKEA 1ZZEA 2PM8A 4X5OA 4ZV9A 1CQZA 1ECCA 3IUJA 3FWKA 4MR9B 4Z4IA 4G09A 3ISTA 3BJIC 4MJ7A 4ZI7B 4JAVC 1ESCA 1T1IA 1GNRA 4I50B 4LHYA 2IUSA 4IIYA 4ABTA 2E55A 2XNCA 3NIWA 4UTXA 1MVNA 3F96A 4IKOA 3RC9A 2G9QA 4DIKA 1ZN2A 1D7AA 2JJ8A 5LZ9A 4TV9B 4MW9A 4R1SA 3LLUA 2QA5A 3KDAA 3N6RA 5AM3A 3AVQA 1G18A 4A10A 2DF8A 4CKYA 4XA8A 4BBZA 1S1MA 5LYYA 3IBTA 1SD5A 4J9VA 2VH2A 1EBUA 3MA0A 5C51B 4KQIA 4UTOA 3V32A 2YVQA 4AAYA 5G40A 3RU3A 4KVZA 1FFYA 1KY5A 2QMHA 1X14A 3P2EA 4YRNA 3CKYA 2ZXUA 3HO8A 4RABA 4D8WA 2O8EA 1W8DA 3O1IC 4DMMA 1SQ0A 1JALA 3BVPA 4PYJA 3BMNA 1EVIA 1X1BA 1RRCA 1RP1A 1RIFA 1M67A 2A5LA 2FSGA 5JNLA 4JV5B 1FLVA 4JP2A 1RPTA 2VDJA 4EQ6B 1VL2A 3UOAB 3J80A 1Y1LA 4L76A 1VA4A 2Z8XA 4A8JB 1NR1A 1FRZA 1AKRA 4KE9A 4WCFC 4X61A 1DKUA 4DGSA 2Q41A 2CJYA 3RG8A 2ZJ5A 2P4SA 4X24A 4G89A 4F1KA 4MLDA 2QT1A 4AQYB 3SZGA 3FRJA 1X1TA 4QSHA 1MEOA 1M8FA 4Q9AA 4ZV7A 4C4RA 4UD6A 4P7BA 4GBED 4BZQA 3F5DA 3GT3A 3A3OA 4LI3X 5SYMA 4UNRA 5IDXA 1UBJS 3KAPA 1JS1X 1AK2A 1NMXA 3M8KA 4HTFA 4IDAA 1PR5A 3U5TA 4CCYB 3PNVA 4RFSB 2EKPA 1AS3A 4Q4AB 3AX6A 3DMFA 3WLHA 4CNQA 1XRMA 1HLFA 2CFRA 3NYQA 5BYBA 3T3EA 1IG3A 1TPYA 3TXXA 4BFXA 2FGKA 3AUAA 1UWLA 4P83A 1YL7A 1CSEE 3CB2A 5TVKA 1IB6A 1BW9A 2J85A 1GZSA 1UBSB 2X9NA 2HB6A 4TZ0A 2B78A 1E69A 3E1SA 4RMJA 4HDKB 1A9QA 1A5TA 5CVJA 5HUQA 4QOHA 1BHJA 1S6YA 1I5EA 3ELUA 4RY9A 4YRBA 4JODA 3DB1A 4I66A 3RWOA 4AF6A 1IBLB 3QLVA 5LLDA 2F3SA 1A8PA 1HYEA