2ISQA

Crystal structure of o-acetylserine sulfhydrylase from arabidopsis thaliana in complex with c-terminal peptide from arabidopsis serine acetyltransferase
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
320
structure length
320
Chain Sequence
SRIAKDVTELIGNTPLVYLNNVAEGCVGRVAAKLEMMEPCSSVKDRIGFSMISDAEKKGLIKPGESVLIEPTSGNTGVGLAFTAAAKGYKLIITMPASMSTERRIILLAFGVELVLTDPAKGMKGAIAKAEEILAKTPNGYMLQQFENPANPKIHYETTGPEIWKGTGGKIDGFVSGIGTGGTITGAGKYLKEQNANVKLYGVEPVESAILSGGKPGPHKIQGIGAGFIPSVLNVDLIDEVVQVSSDESIDMARQLALKEGLLVGISSGAAAAAAIKLAQRPENAGKLFVAIFPSFGERYLSTVLFDATRKEAEAMTFEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cysteine synthase
publication title Structural basis for interaction of o-acetylserine sulfhydrylase and serine acetyltransferase in the Arabidopsis cysteine synthase complex.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transferase
total genus 118
structure length 320
sequence length 320
ec nomenclature ec 2.5.1.47: Cysteine synthase.
pdb deposition date 2006-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00291 PALP Pyridoxal-phosphate dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2isqA01
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2isqA02
4JBLA 1TZKA 3IAUA 4XUGB 3ZEIA 3L6RA 1JBQA 1WDWB 1K8YB 1Y7LA 3FGPA 3IQGX 4ZQCB 5JISA 4HN4B 3T4PA 1WTCA 1A5BB 1CW2B 1UIMA 2WSYB 5T6MA 2DH6A 1D6SA 2GN2A 3V7NA 1UBSB 2RHGB 1J0AA 2TSYB 5B55A 2ZSJA 5C3UA 2PQMA 2Q3CA 3FCAA 2EFYA 3L6CA 3PR2B 2BHSA 3DWIA 3DWGA 5B1HA 5D87A 5J43A 2J9YB 3VC3A 1TTQB 3R0XA 3PC4A 4D9BA 4LMAA 3CEPB 1WKVA 4PCUA 1BKSB 1BEUB 2JC3A 2J9XB 4I1YA 4D8WA 2Q3BA 1TZJA 3PC3A 4ZU6X 5E0KB 1KFJB 1V8ZA 3BM5A 2TYSB 4WX2B 2TRSB 1TZMA 1C8VB 4D9MA 2CLIB 4HO1X 4F4FA 2RKBA 1KL7A 1K3UB 1PWHA 2DH5A 2O2JA 5CGQB 1TTPB 3RR2A 3SS7X 4D9CA 1TZ2A 4LI3X 1VB3A 2O2EA 1QOPB 1A50B 1C29B 1J0EA 5DW0A 2CLOB 2J9ZB 1TJPB 4L28A 4AECA 2CLKB 3L6BA 4QYSA 1UINA 4D9KA 5I7HA 5DBEX 3R0ZA 1E5XA 2RH9B 4HPJB 1PWEA 5B53A 5J5VA 1TYZA 1O58A 2ZPUA 1X1QA 4D96A 4D92A 5DVZA 5IXJA 4KKXB 5D85A 3VSCA 4NU8X 5DBHX 3SPXA 5BW6B 1V71A 1J0CA 4Y6GB 3DKIA 5B3AA 5KZMB 2CLHB 4HPXB 2ECOA 1TDJA 4D9NA 5B1IA 4D8TA 1J0BA 1Z7YA 1CX9B 3IQHX 2D1FA 3SS9X 4D99A 3PC2A 4D9IA 5KINB 1QOQB 2ISQA 3X44A 4OFXA 1M54A 3VBEA 1A5AB 1P5JA 4L0DA 5D84A 4D9GA 2EGUA 4IL5A 3HMKA 2CLEB 5IW8A 1FUYB 1WBJB 2GN1A 1V7CA 3AEXA 5DW3A 5I7WA 1KFKB 1K7FB 4L3VA 4HT3B 2CLFB 1K8XB 1KFCB 5I7RA 1VE5A 1C9DB 2C2BA 1J0DA 1KFEB 1VE1A 3TBHA 5HBGA 2ECQA 3IQIX 4H27A 4LMBA 4D8UA 1F2DA 1OASA 3X43A 5JJCA 4NEGA 4D9FA 3VSDA 4D9EA 1K8ZB 3VSAA 1KFBB 2C2GA 2CLLB 1K7EB 2GN0A 4OREX 2CLMB 4ZU1X 3AEYA 4L27A 1Z7WA 5D86A 5IWCA 2ZR8A 4D97A 1A5SB 5I7OA 1FCJA 1K7XB 2Q3DA 5EY5B 1RQXA 5B36A 2BHTA 5CVCA 4AIRA 5I6DA 4COOA 2V03A 5I7AA 4JBNA
chains in the Genus database with same CATH superfamily
1TUGA 4A73A 4CMEA 4I99A 1ZK4A 2CHQA 4EHFA 4EAAA 1P44A 5I3CA 3T06B 3T41A 3K0CC 1VE7A 1YOBA 4FFOA 1CUGA 2M6SA 2AJDA 4PHCA 2ZBRA 3A14A 4W5JA 4YJGB 1P9LA 2VT3A 5DGTA 4B5LA 4M1EA 5DT9A 4CVNA 1SXJB 4NECA 2GMWA 4OFWA 4IY1A 5AVZA 2NTJA 2SCUA 1U7WA 3ECSA 1UJNA 3F7OA 3HDYA 4JJAA 5EWJA 4B35A 3ENVA 4DUGA 4EJ6A 6REQA 2J7PA 5JPDA 1D4OA 2ZCJA 3RJTA 1CUDA 4D0LB 2CVZA 4Z3OA 4CQMB 1SPBS 2DF8A 4OJQA 1FNNA 1KK2A 5BMVA 1VE9A 5CBPA 1GGFA 3L0ZA 4PCUA 4LDJA 1I3NA 5F3RA 3SLGA 2IF0A 5EGNA 3U40A 1ZISA 4YIHA 3C4QA 3JASB 1TZJA 4BE4A 4BO6A 4KQ2A 1IBKB 1KYIA 1ZM9A 3BM5A 3EH1A 3G0BA 5AVYA 4WWHA 3SVTA 2V7WA 1RXVA 4JIGA 5ALOA 4FYIA 2PQ6A 5ADHA 1HH4A 1MEOA 4JELA 3FPKA 3DDUA 5A03A 1XLTA 3BEOA 4RQBA 2H5EA 1OVMA 3HV2A 2XBLA 3IAM1 2AZTA 3L41A 4Q9DA 3X1WA 1PR3A 4B4OA 2JZNA 4C03A 4RKYA 4IDPA 3R41A 2PS9A 2EFHB 3PYXA 1UXHA 3D6UA 4I19A 4YAWA 5U1PA 3GLFE 2I62A 2QG6A 4WEOA 5IZCA 4BFTA 3Q3JB 2HPZA 3R1IA 3AVQA 1QNFA 4L3WA 2DGDA 2VSXA 2XGJA 3ONEA 3HRIA 4KQIA 3W06A 2H1LA 3PC7A 3Q9NA 2YOHA 4A82A 4O2BB 3GXBA 1KP3A 3T7AA 3W6PA 2J46A 4Z0PA 2Q4DA 3ZCQA 5IJ0B 1C9JA 1KU6A 4RD2A 1SOVA 2C78A 2BFMA 1VL5A 3L8GA 1TMYA 2Z3ZA 4NAHA 2CF6A 2O7QA 5FJJA 5K0SA 1TM7E 1ZS9A 3LC7O 4Q7MB 4D8XA 4F2HA 3I72A 1Q19A 1B73A 1G55A 4U6QA 2I6TA 4BO8A 4EI8A 2AGVA 3RIGA 4JT4A 4JLUA 3ELWA 2P9BA 3KSRA 2N1BA 1HNXB 1KI4A 1IZ0A 1ISHA 4U5XA 1S2LA 1PT9A 4FHCA 2FUEA 1NAHA 1UKEA 5C7OO 4ESVA 5TMEA 1TYEB 1ZGZA 4YX9A 4FUQA 3CVWA 2DPYA 2X2PA 4CM5A 2IXDA 2IXAA 2NZ8A 2ZFUA 3MLAA 2W2PA 2M6KA 2PVPA 3VH3A 3JQAB 4BU1A 1AKYA 4AVYA 4KOAA 2Q2WA 2WHPB 3RHTA 1AQIA 4ENRA 2EX4A 1L5QA 1ZHOA 3U44B 1K3TA 5D7NA 2JEYA 4NZYA 4FYVA 4NZPA 4DCVA 1K6JA 2BFEB 1YRAA 1V5WA 1FJHA 1L9KA 1XDDA 2IYVA 1VG8A 5JSKA 3THSA 1OXMA 1U7HA 3LY5A 1FZQA 4UASA 2IVFA 1M34E 4PRKA 3VSAA 2BZ1A 2UVPB 3F90A 3ZHQA 4CTJA 3WI7A 1BDHA 4V39A 5BR4A 4G07A 1A9YA 2NQ8A 2XYHA 4P3PA 1E3WB 1WP4A 3ZCRA 2P40A 3FYTA 1UXIA 2C7QA 1LDMA 2NADA 4BFXA 2BHLA 4K6GA 1O95D 5IKXA 3MJSA 2VCHA 1BIFA 3EGEA 3PHHA 4BN0A 4ZCRA 4CL3A 1G2PA 1HYQA 1U0HC 4HDSB 3HB0A 3T1YB 2QQGA 5C4MA 2DPXA 5AXAA 2HLPA 3UMSA 2V7VA 3MWGA 4FFPA 3IUBA 4FHGA 2H07A 4YONB 4Q47A 1OD6A 1MBZA 3MOSA 4UU1A 4WQMA 2PPVA 2HL6A 2XJ9A 3FYDA 1ZEJA 3RUPA 4C4ZA 4J1TC 3EPHA 3TH5A 1PJSA 4XDGA 3B3GA 2FR1A 2WFLA 3VKVA 1T8WA 4C7OB 3BA1A 4ID3A 4YHBA 1YQDA 3SCZA 1GQSA 3L6CA 5KC8A 3C70A 2ZSUA 5BSGA 2Y1XA 3TEMA 5JXHA 3KZKA 3PQ8A 2W58A 2CJWB 2NN3C 3ZW7A 2NXCA 2VOEA 1T8SA 1I9GA 4XEHA 4ZAWA 1JH8A 1VPVA 1QAOA 2GKSA 4CZ2A 2K2WA 3CISA 5CG2A 5CCXA 5AVSA 4XSVA 4OXNA 4RF4A 3PC3A 5IJAA 1BG6A 2EZ4A 4Z1OA 4LYYA 1W5TA 4MDHA 4XZ3A 3I2YX 4XSHA 3ZCPA 4IJ5A 4LKRA 3LQYA 1QR2A 2DQ4A 2EYQA 1JEQB 4UTOA 1SEVA 3O8BA 5KSYA 3B2QA 4DA8A 5AVRA 2FMFA 3QEMB 5EWLB 1LRLA 3R3HA 1IVSA 4MHTA 1CDDA 1FP4B 2CYCA 2LDXA 2W37A 3O26A 3QTTA 4NYMR 3RFXA 1AS2A 1JR6A 3PXBA 2PEYA 1SVIA 2C9MA 1EMDA 2WDZA 3K70D 1D4FA 2R1VA 2XQGA 4HJXA 5K6TA 3MFYA 4LRUA 2NTYC 5HS4A 4BV9A 5JTTA 5HGXA 1RWWA 4D3DA 4FC7A 4AN4A 3UJHA 1G38A 3H2KA 1GZUA 4NYMQ 4PRLA 1HGXA 5CX1A 4ZCTA 2BCJQ 4LG1A 1FDSA 3OCVA 3W8NA 1P6XA 1QLJA 1T1JA 1F38A 1SCDA 5FOVA 2VYCA 4U02A 5ILOA 1L7DA 2KHZA 3D8NA 4NY1A 4DEYA 5THKA 3F9IA 1MENA 4G81A 5HM6A 4TN1A 4ZQIA 3WR5A 4FR5A 4WKOA 3NO4A 1I51A 1CS0A 1PZGA 4KHZA 4U9HS 5CH3A 3LUFA 2HUPA 3SIRA 4RF5A 2VPPA 3E2MA 1R4NA 4PVCA 2VHUA 1FYXA 3ILYA 1U99A 1Z0JA 1LVGA 2YIJA 2RGEA 4F71A 5JDIA 1YJAA 1P77A 4K9LA 3AEXA 5EIFA 4ZI7F 4O3FA 1EFDN 3V9PA 1N1MA 1DX9A 4LOJA 4YR9A 5A1TA 3RGWS 1WSWA 1F0KA 4OP2A 3SYNA 3GB9A 1MGOA 2VDUE 4B6RA 1JEDA 2QUIA 2CLFB 2Q1UA 4C4YA 5TQ0B 5ALDA 4YASA 2HO5A 3W78A 1X39A 5BMVF 1BX3A 2VSNA 4LGCA 1Z8HA 4TLMB 1EG2A 1T0UA 1CQJB 2NYUA 3U62A 1EA7A 1EDDA 3EXAA 3AT1A 1XZAA 1V16B 2PZMA 2XDAA 3D2LA 3KPWA 2AMLA 1TW3A 2W0SA 1M5TA 4KSBA 4XVCA 5L3SA 3B3FA 1MOQA 3K8YA 4RYDA 2COEA 4N5LA 2WD9A 1PGJA 2DWOA 2FSFA 3LDUA 2R6CA 4ZO9A 4I1IA 1X7ZA 4D2IA 1RQXA 4BQNA 3FKJA 1E1DA 4EB6A 3P2YA 4Y98A 1YDGA 2VH1A 3PHIA 4YRRA 3TFWA 4C0JA 1JSZA 3GW8A 3NOOA 1O7JA 1NNI1 4Q9NA 4AWBA 5K8VA 1D2EA 2EKBA 3K0HA 1FP2A 1TPYA 1WOYA 4LXTA 4U7TB 3AY7A 2R4QA 2A9RA 4R8KA 3B48A 3V8RA 5B6JA 5HIKA 1EXDA 1G3IA 1N3BA 3F6RA 3ZN2A 3KPUA 2XWSA 2JFNA 3E84A 3JVUA 4QT4A 1E9RA 1NY6A 4PIMA 2Q3CA 1A2QA 4BO4A 1GXSB 2OV1A 1CLEA 4Q1CA 1LPPA 2R66A 3O1LA 3IEKA 3TEFA 4ROTA 3KHTA 4J90A 1ORVA 1GNRA 1T6BY 3FPAA 4DEXA 4Q24A 1EXVA 2G67A 1YJQA 4MYCA 4UC0A 3CRQA 5ALRA 4HP8A 3TB6A 2JIOA 4CDNA 3IV6A 3FGNA 3SN6A 1N5OX 1VG0B 1TVKA 1C14A 2HA3A 4B74A 2GD0A 3H11B 1V95A 3U3DA 1PHPA 2RGUA 2KBEA 2YWCA 4BKPA 5JCJD 2VJMB 1ZMTA 3TQQA 3JQ6A 3OCXA 3ZS9A 1MX9A 5LIRA 1J97A 3D4IA 4KLZA 2ZYRA 3CCBA 2JKVA 3FYCA 4N40A 4UZSA 1NI4A 4JVSB 3VZSA 4ZV4A 4F5ZA 5CDGA 1AUOA 1NLMA 2PGLA 3MWEB 2FPXA 1LFDB 2Z83A 1RXSA 3BAFA 3FA2A 3FWPA 3IPCA 4UXHA 3O95A 5K3OA 4RTSA 3GWGA 1JF8A 2X19A 2QPOA 3U9TA 5HJ5A 2IITA 1JPNA 3OFND 2E4WA 3OQIB 3E5HA 4GHWA 3WRXA 5A3VA 3RJMA 5EQTA 5C35A 4KYTA 4BO1A 2XECA 2RH9B 3WLEA 3NMUF 4I3GA 1QIIA 2CF5A 3BD8A 1U8YA 2CUKA 2IUFA 4NARA 4GGOA 4IVRA 4M2LA 5JYDA 1K6IA 4U2CA 3C97A 4BAUA 4C22A 4Y30A 1ZKMA 3LX8A 3CNNA 1V3QE 4BX3A 4AN1A 1IXKA 1E2BA 3PXUA 3PNLA 5A2GA 2ODNA 1LSOA 4FSXA 1D1QA 2Y4NA 5BT9A 1ZH8A 4J0GA 4BX8A 4PPGA 4PLGA 4GWKA 2R68A 2VSYA 3OF5A 4HZUB 2BFPA 3NEJA 3HRHA 1MO4A 4IQ4A 1KI6B 2V7QD 3KQPA 3EE6A 3VNBA 2EWWA 4X1IA 2PH5A 3AL3A 5BVGB 1F2UB 1SB8A 1YF3A 1Y42X 2PT5A 2RC6A 2JHFA 3LH5A 2WT4A 4OSOA 1X7HA 2G06A 4E3WA 1JHPA 1F6WA 2WF9A 2D74A 2E4ZA 1HTTA 1R6BX 2R8OA 1SKYB 3QF4A 3HS3A 3QU2A 3AM3A 3DZKA 4MGKR 3D8TA 4NCNA 3V97A 4CV2A 4Q4HB 2ZTLA 2X41A 3CY6A 5KAPA 1ZIPA 3JD1A 7AT1A 3TFQA 4MWEA 3UCEA 4B3XA 1V8BA 2X9LA 1XI2A 3HFRA 4I50B 2HPHA 2W8BA 2ZS9A 3NGLA 3BMNB 2CLLB 4G4JA 3CZMA 3JQEA 1K7EB 4BQFA 3WGZA 1J8QA 4MQ6A 3UHFA 4DDUA 1L7VC 1R5BA 4RJ2A 3BFPA 2BBSA 1U28A 1T9CA 2WY2D 4FFBA 3ZHCA 4EW3A 3PTAA 5FBQB 2R00A 3DV0B 1NNUA 1FMJA 1G6HA 1Z6YA 2WMOB 5EIBC 3RW9A 4AMUA 5LJIA 1ENZA 3WYFA 2OV3A 2XYVA 1V8DA 2AT1A 3TTXA 5CBKA 1RYDA 1H3EA 3MTIA 2VTBB 5ED4A 1AGNA 1E2JA 1LZKA 4P31A 1Y8QB 3VDMA 2CEAA 4PBTA 3TINA 4CW7A 5I7SA 2YYSA 2Y3IA 1SC9A 5EIEA 5IYZA 2VT6A 1S4MA 2BUBA 4F9TA 2QM0A 2RHBA 1BHSA 2CCKA 1UH5A 3RC9A 4EEKA 5KWVA 1OXUA 1HA3A 2ZIVB 4M87A 3RC1A 3ZOKA 3SSNA 3B38A 2I2DA 4NZOA 3TS1A 2FPIA 2HXGA 3E8SA 2QWXA 5DNVA 1ZMRA 4F2DA 4CKBB 4BIIA 3RM3A 3STTA 4MWSA 2FE4A 3OQ1A 3V1LA 2CNDA 1H0HA 2N47A 1EHYA 4EBFA 3OPYA 2NO4A 1PR9A 3KUCA 3AUKA 2B36A 1GNSA 4ND2A 5A3QA 1X7WB 3RASA 1A8UA 2F1OA 1ZH2A 4B46A 4LFAB 5FPTA 1FFSA 3DLPX 3GLRA 1MX5A 1XT6A 2EBWA 2RFLA 2W7TA 1DTWB 1U04A 1X1BA 3SLRA 4EHAA 2C20A 4IIHA 5CB8A 3RODA 3VYWA 2YVKA 1UT6A 4R98A 3QVMA 4WNYA 2VYNA 4OBEA 3RRFA 4PZPA 2OBMA 3U37A 3U4QA 4D82A 2H1OA 2VJPA 1JQEA 1P3JA 3MCTA 3V4SA 2ZIFA 3I0ZA 1TU3A 3AM4A 3WBFA 3WL3A 3DMPA 4MLPA 4HAVA 2Z8ZA 4HS9A 3JAKB 4PQYA 2FG6C 4ZDIA 1SGWA 3SX0A 4O2AB 4LRWA 4RJTA 4BIMA 3UG6A 4P4UA 5FLYA 3KEGA 4BFCA 4ARZA 2VL7A 1CNMA 1CB0A 3B13B 3VJMA 1XEFA 2E82A 3F7TA 3KD3A 4IMIB 4X20B 1V1JA 1Z4NA 1EUCB 1NSYA 3GFTA 3HCFA 3KKNA 4OY3A 4PS1A 3HBLA 3FDJA 1VJGA 4DVJA 1NKVA 4EG1A 4XWWA 2JG3A 4JI7B 2UUOA 4DMHA 1N6KA 1FP1D 1IH8A 3P9QA 4NQZA 4QYMA 5B4UA 3QYFA 3E9YA 5I7UA 4LDRA 4ACBA 1LPOA 1DRVA 2AEFA 2OHGA 1S3FA 1VGRA 2XRMA 5FBZA 4CCYA 3K6JA 1KYWA 1OYVA 2QTMA 3G13A 3TLKA 2FP4B 4FNGA 2Y76A 5E2BA 1JFVA 5IVKA 1DFGA 1EAYA 2QS9A 3NVAA 1CFJA 5AK6A 3RVSA 5A6VA 1KEKA 4RK4A 3QX8A 2FUKA 5HFJA 3WNBA 4B3FX 3NIWA 1GTSA 1B8NA 4CTMA 1RD4A 1RIIA 1WLYA 2FR8A 1QPGA 2FJPA 2VT2A 4P82A 3ZK8A 2I80A 4E14A 4V24A 1WE2A 2VHTA 1PEYA 2IYYA 4QDXA 5JQGF 3N1UA 1R10A 1K8ZB 1DB3A 4IKPA 2ODTX 3B1FA 5AVKA 4CMEC 5TQ2A 2X9NA 1N8KA 1XZIA 2VDKB 1XZ8A 4LSZA 1THTA 3RB8A 1QP4A 4HNAA 4JN6B 2R4UA 3SD7A 5HSGA 3KQUA 1L8QA 3HXPA 2RGBA 5HRUA 2EQAA 2VXYA 5TF4A 1KMQA 2DPGA 4YFYA 4ZP1A 1P2BA 4KPYA 2HSWA 1Z73A 2Q07A 2YVQA 2YIMA 3GPLA 4MB6A 2AYXA 2MOKA 1HQKA 2AN9A 1C4KA 4E4RA 1EWTA 2QQ0A 3RGGA 3DDNA 3VJRA 4L9AA 3HWX1 4LRSB 4XQ9A 1OKKD 1XHEA 4QUBA 4B82A 1HDOA 1H3FA 4EZIA 2XDYA 3CCFA 2HA5A 5B6IA 2JLWA 1V26A 2PMCA 4DDHA 4FNAA 4BV8A 5JH7B 1DWQA 1EFRD 3PL5A 3KZOA 4ODIA 1THGA 5GOZA 3S55A 1CY4A 1YDMA 4DJ5X 3RIHA 3VMMA 4LZAA 2QX9A 1M1YE 1QK4A 4QDOA 1IBSA 4E11A 1QIKA 1CZLA 4R4JA 2TMKA 2YYAA 5T67A 5BV2P 3AR7A 3OP1A 2CNWA 1KH2A 1G60A 4IHJA 2RGCA 4OFBA 3WG9A 5IUNC 4GMFA 4HATA 4JI8B 1XLTC 3OZRA 1Z2DA 5KVSA 4OJMX 5GZ1A 2XVAA 1WCWA 2ALJA 3Q15C 4PO3X 4XUCA 2A3RA 1AUXA 2B69A 3GUCA 3TWOA 4UNIA 3KAKA 1GKYA 1JXQA 2VHZA 2X13A 4N6NA 5EJMA 5M34A 2GYUA 4INAA 5CGQB 3DHYA 2EDAA 3A6KA 4BLUA 1G8GA 3PA8A 4E2YA 2C96A 2WSMA 1RI5A 2H4WA 1N5IA 3MRVA 4NG5A 2J3JA 4RVSA 5L40A 2ZREA 1PW5A 2IDMA 3GZNB 2J9ZB 2YNMC 3ZWVA 1DC7A 2HSEA 2RHOA 5AW9A 4Y2RA 2CDBA 2GHTA 3MHPA 4RLQA 4GSKA 3U13A 4UQLA 3ESAA 3JPWA 4BLOA 2P2NA 3DQPA 3I04M 2VH2A 3L1VA 2PL3A 1MC8A 3SDZA 3PITA 1C1XA 1NBHA 1BCRA 3BSWA 3E4DA 4U00A 3H19A 4CQMA 2H4FA 4KXLA 2VRBA 4N8EA 4FCCA 2WYWA 4DR1B 5IVHA 2ZE8A 2AFVA 3NC0C 3O3CA 4FE4A 3EMKA 1QH0A 4ILEA 4IM7A 2F67A 2XNJA 1JWLA 2ZJ6A 4A0SA 2OSBA 5EKUA 4D99A 5DM1A 4AUKA 3Q5DA 2A1TS 1ZY2A 2VHXA 3QJYA 1NTRA 3SFZA 4QXOA 1OGYA 5C34B 1T9HA 2O3JA 4YQFA 2WF5A 5IH7A 1LDYA 4RVOA 2QE7A 5JLAA 3G23A 2VDPB 1E20A 1NRIA 3KYCA 1Z07A 1AK1A 4YMSA 3DMGA 1MX1A 1PQ4A 1YUBA 3CG4A 3UW3A 2IOFA 2IRWA 1TGVA 1HMYA 4C7JA 2CXSA 2OILA 3OX3A 2HDNB 2RGRA 1VCOA 3K8OE 1IY8A 1IM2A 1VMEA 2LVBA 3GRVA 1QZUA 3WJAA 3FSGD 1RI1A 2CFOA 3QA3E 3HMQA 1RLUA 3L05A 4YS6A 1Z6TA 1PNRA 1CYEA 5K03A 1F8FA 3G89A 2VAVA 3HA7A 4WV3A 4RTJA 3F1KA 2FQYA 3VPHA 4C0XA 4D57A 4WLVA 3CVVA 4HAXA 4F3RA 2IHYA 2C4TA 3N0VA 4R16A 4TS3A 4WZAE 5K8IA 4U8HA 4DLBA 4JYZA 4Q19A 4W8HA 2JAXA 2A9JA 2FMHA 3VU8A 5C1PA 2BE9A 3PDJA 3Q5EA 1OLOA 1OROA 2O3TA 4M6WA 1JT2A 4HEA1 4UVGA 5LA6B 2XE8A 4N0DA 3ZWBA 4X8OA 1B7GO 4F12A 4H1WA 1HQYE 2ANBA 4OBWA 4BKUA 3O75A 1UBJS 1OXVA 3P27A 2W6ZA 1J06A 5DP2A 4M1WA 3VHXB 3IAUA 4UXJA 1X0VA 2BFCA 2B8JA 1CEQA 2BDEA 3ACDA 1NVGA 3CF6R 3ET5A 3M5CA 4TRNA 3SG0A 3TDNA 1DKNA 3BICA 5BSUA 2DYKA 2VDLB 1TU0A 4HLUA 3AW8A 4XM1A 1Z6XA 4NFSA 1YQUA 3IODA 4NE2A 4TWIA 1E9BA 1THMA 1NZDA 1JR3D 2IVZA 3N2ZB 3NHFA 5EWMB 4HDOB 4RD4A 4F60A 1A1VA 1KBZA 3Q1LA 4I1SA 1C7IA 4NIMA 4TTTS 3U31A 5JYEA 4KOEC 1XRNA 2I33A 2R48A 4GSLA 1XRMA 2GO1A 3OSZA 3ROQA 3TZBA 3KTAA 2W6OA 3AKDA 4EY4A 3ONFA 3BMOA 1GTL1 3W4JA 1FSGA 1HE1C 1U0SY 3ORYA 4PRYA 2PL9A 1EXWA 2X8WA 2CHFA 2NWQA 3H17A 4GOOD 5CM9C 5GQSA 3LFHA 4MZXA 4H3KB 4Z3DA 3A10A 4UUQA 2ZXFA 3CE6A 4MKGA 4HRXA 5L9AA 5ADUS 3GPCA 2OM6A 1U1CA 2DH5A 3GDFA 3MGKA 3PV0A 4KC0A 1NNSA 2J09A 4PVDA 3I6QA 1O87A 1E1CA 5IAAA 3NRCA 4Z4FA 1ZG3A 2Q7XA 5DASA 3F0TA 2XZTA 5TPZA 1IQ0A 1SXGA 1DP4A 3E22A 1M8KA 3FVQA 4KU4A 4UM7A 5M2QA 4PG4A 2Q5IA 4HWKA 4C30A 1U0RA 1ZX1A 4M9QA 1NFRA 1XRJA 1JIIA 4YXWD 3UOGA 1CYDA 1KEZA 2Z95A 2BVNA 3C0KA 3LY8A 1Z7EA 3AERA 3L2OB 3N53A 4MAAA 2H3HA 5AOAA 3UC9A 3FR8A 4A7PA 2EBFX 5HA5A 1RWNA 4NCKA 1OFUX 2EP7A 4KPEC 1RAEA 2VKTA 3IP7A 1BD4A 1SAYA 3FTQA 3K96A 5KYUA 4X7MA 1CRZA 1B41A 1L3IA 3SX4A 3AJEA 5IC6A 1TYCA 2VP4A 3SPXA 1JEYA 1QB7A 1ESNA 2DUWA 2OB2A 2XOKD 4JL8A 2AVDA 1XMSA 3F4KA 3H0KA 5L3VA 3L40A 5JDIC 1S1CA 3SLKA 2IOYA 2ZVPX 1E6EA 4Q3EA 3PQ4A 2JGIA 3RYFA 4D9IA 3WGIA 1WB4A 2ERYA 3OCUA 1FBTA 4XFDA 3I28A 3JWEA 1M54A 3QV2A 4H16A 4DCTA 5A5FA 4C4RA 3P97A 4MWTA 3D4NA 4JYMA 5TB5A 4DAEA 2BEVA 5FUMA 1PN3A 1H2HA 1YAJA 1CUBA 3IOYA 2BIFA 3Q2IA 4FEYA 2PJUA 4NENA 5FI1B 2IUUA 3H83A 1XTBA 3B12A 3R7WA 1KH3A 1RRFA 3G5TA 1YRBA 4GPD1 2RHHA 3C5WP 2ZJ3A 3HVKA 4MUMA 4YIKA 3BQ9A 1TVCA 5AK3A 4YJ2A 4MGYR 4DB4A 3U61B 4WFJA 4DLTA 1I0IA 2GZ2A 1J2JA 4G09A 3INTA 3SNKA 4J0IA 5HK8A 4EA8A 2WILA 3FLEA 3KIPA 3DDOA 4LZPA 4GXQA 2I34A 4P6VF 4QBHA 1NXSA 2VN8A 4YMGA 1ZN2A 3DBHB 3DQZA 2YHUA 4WOJA 2F9FA 4BVKA 3EZYA 4NL4H 1QXSA 5ALZA 3YASA 3WO0A 1EFTA 3DFMA 3TOCA 1K6EA 4PW0A 4DWJA 5BRAA 4RH0A 1T91A 3KDSE 5AP9A 1DMSA 3GARA 1JQAA 2WSSA 3ZY5A 5JSUA 4B40A 1W25A 5IULC 4PC3A 1KTVA 4KUEA 1PEDA 2V03A 3SKVA 1L6IA 1JNXX 3C8MA 4NPAA 1TZKA 3NONA 3UWDA 3KUUA 4BNLA 4MKRA 4CDGA 4UATA 2P78A 5CVVA 4ZQCB 2GB4A 3RVLA 3SC4A 3MUOA 1BN7A 3DL4A 1LBEA 1FTGA 4EYEA 3O8QA 4U0KA 3BJIC 3H6KA 1AA9A 5E7JA 4LC9A 1G4AE 2HMVA 4C7KA 3SBXA 4WFIA 5C3UA 1LK5A 2NX2A 3Q7RA 3R5XA 4WUTA 4WBXC 1PBNA 4FGKA 2AYZA 1KJIA 1Z4JA 4WI1A 1NUPA 3FOBA 4RMHA 2HGSA 5JV5A 1RXWA 1SVOA 3UICA 3ETCA 4JL6A 4CQLA 2P9QA 3TKYA 1PZMA 5K8LA 1D07A 1BQ4A 4K6MA 1HV8A 4Q9AA 3FZQA 2QLBA 3LW7A 3S7ZA 5BXQC 4ENSA 3TCXB 4BWFB 1K75A 1NTOA 1ZUIA 4K28A 4DYDA 4XWTA 3F4BA 4NABA 3PHGA 5HFAA 2NU7A 2V0CA 4QRDA 1P7CA 2Q4BA 3SR4A 2O2ZA 5KI6A 1OPRA 1T3TA 2XBUA 2YZGA 3HNRA 3IBGA 4DG8A 3KKLA 4BEWA 2YS6A 3P9NA 3AUFA 4XRGA 3WRXC 4ZGBA 5DHTA 2FQ1A 4JSYA 2ZUVA 4YV1A 1SCQA 3THXB 3GLVA 3QMVA 5CEJA 1CJCA 3D2CA 3IEMA 3FB1A 3DZDA 3ZK7A 1E2PA 3K1ZA 2IKQA 5T3UA 1HDYA 2WLSA 4RHEA 4UM9B 5JALA 3E8MA 1ZYUA 3H2JA 4DJAA 2JLXA 4BCBA 3GFRA 4PQEA 3I5MA 4IIJA 1LCIA 2NLOA 2WUVA 3HNPA 1KJNA 3V8MA 1X8KA 2EZ9A 4US1R 4D3YA 4Q05A 5DTQA 5JECA 2HAEA 3FFBA 5CLHA 2ETXA 3VKGA 3WKEA 5CT9A 4FZ5A 1KHHA 1QUEA 1V1MB 4K9OA 2IYUA 1D03A 2BSXA 1L7OA 2A5JA 3UB2A 5KS2A 3KKEA 1J8VA 4UVHA 1GCIA 2YQ4A 3QOXA 4KO8A 4Y6GB 3V42A 4A0HA 1EFKA 3L92A 1BAPA 3KUDA 1Q7RA 1O08A 1P1CA 3LHDA 1NW3A 4AMGA 3K6SA 3WYCA 4E21A 3RKRA 1W44A 1ESEA 3HB4X 1XTJA 1ADFA 2GN8A 2H17A 5ALWA 4TQGA 1P1FA 4D46A 2GVZC 3EA5A 3H86A 3SYTA 2I3ZA 2XDQB 2L69A 2ZVDA 5I9BA 4DR4B 4D9GA 4K6OA 5K20A 1FPMA 4GE0A 2XAUA 4XX1A 4DCCA 1R16A 4DF3A 1ULHA 5IH3A 2C95A 1GPJA 2Y67A 3FCEA 3QELA 2WU3A 4EGJA 5L4SA 3HYCA 3EXFA 1WX1A 2WFMA 1K7SN 3FNBA 4AZ3B 1GUAA 3S2YA 1A4XA 3H0EA 3P45A 2JJ8A 4F46A 1U28C 4EMTA 4Z7OB 5CD1A 1AZTA 1G9TA 3W6UA 4B2LA 2R00C 4TL8A 4EKDA 4TTPA 1C4OA 4EG8A 1GARA 5FOQA 4C7BA 1VBNA 4G9EA 1VXRA 4CI0B 1OVGA 4O25A 4UTPA 1E7YA 5M29A 3FNFA 4BFSA 4I5IA 2YV4A 3BXGA 1P5FA 5EA2A 3SEZA 1QFYA 3PXAA 3BK1A 4WGFA 3R6WA 1XA4A 5IAOA 3M4JA 1US8B 3LKDA 5GGYA 4MQFA 5JBIA 3F47A 3IAAA 1QYIA 3WGTA 4Y1GA 2WWYA 1V7ZA 5G3ZA 4ND3A 1K27A 1Z62A 1NURA 5C8YB 1LS1A 4R0MA 2AC2A 3FPHA 1JDBB 3SBDA 2GERA 5AESA 1MN6A 3CJQA 1E3IA 1O89A 1WTCA 1XSEA 2FG5A 5GVRA 4FILA 1IYZA 1FFXB 3OEHD 3F96A 5MGNA 4UFPA 2Y1EA 3TSOA 4IF4A 3ADOA 3Q6MA 3UFBA 1E0AA 3E1GA 2PKCA 1KYTA 2X5XA 1XMPA 1EXNA 5JSFA 2ADOA 3V2HA 4BVEA 3PC6A 1CUZA 1JI3A 1TMOA 1XU7A 2W2MA 3EUAA 5B1SA 2N75A 4E5SA 4CUKA 5LB2A 3C3YA 4KHPB 2V96A 5CAEB 3HADA 4RY9A 4DLVA 4Y9SA 4JJEA 4J16A 1M6WA 3LBFA 4A2CA 1FYEA 2DT8A 2VUSA 2B6NA 2I71A 2QY6A 4M1YA 1II8B 3NBAA 5DF1A 2B3TA 3JD3A 4B7AA 1RKXA 1UQRA 4YC7A 5E0KB 3V7FA 2JLBA 4KE6A 2NYRA 4LOHA 2IIVA 2VJLA 4TUYB 3ZZMA 2O2SA 3EISA 3VOSA 4Y1RA 4DIBA 3OZWA 1DVRA 2V7UA 5KO2A 1TF5A 2RG7A 1KF0A 4WTOA 1K3UB 2PWZA 1UJBA 3LU1A 3ZBTA 3G5UA 1M1YA 2G28A 4TXHA 2YWJA 1U7DA 1W8IA 2OGTA 1EUQA 2ZUFA 2JEZA 3E7WA 1GAXA 4OHRA 3W5CA 4A8PA 4ZVPA 3P2JA 1YDWA 2W6JA 1OAOA 6NULA 4UU8A 2FN4A 1CULC 3HWSA 3QHPA 1ZK1A 2LRHA 5EKSA 2B99A 2FEAA 2Q0SA 3K1AA 3WB1A 4FMDF 8AT1A 2QUAA 4PSUA 4JLPA 3VR2D 1XZPA 3C6MA 3S40A 2NOAA 1ZI8A 3TKLA 1UZAA 3SQWA 1JQBA 1RRGA 4AO7A 1W2HA 1E2KA 1QC5B 2TMGA 1UJ2A 3D4BA 4CMIA 4K1LA 1U5AA 2VZ0A 4YJHA 3AB8A 2RB4A 2QQ5A 4M8LA 3TE6A 3DT9A 3PCXA 4NZMA 4NBUA 1VRCA 4H7PA 5AVJA 4EELA 4YP6A 1GDDA 3CEJA 3WLLA 4EMBA 1ODLA 2GPSA 3EZ6A 2A0YA 2QTAA 1Z16A 2JGMA 2RARA 3Q2KA 3GRKA 4KBGA 3ULKA 3B6KA 1R0ZA 5FLKA 4XLLA 3F6EX 2PX6A 2X0EA 4JT2A 2FQWA 2RCYA 1R8JA 4RXTA 4M38A 4B4KA 4Y0VA 4Z9FA 4DQ0A 2FR8C 2HRBA 1NE7A 1WBJB 1YO6A 1YUNA 3D0QA 1J07A 3I6MA 5LZ5A 1SXIA 4RQTA 2Q46A 4ONEA 4DPMA 2WAOA 1FF9A 1LTQA 2CJPA 3AX6A 2VPWA 4G5XA 4EZBA 4G0MA 1NUTA 2ORED 3DHVA 4HNSA 2C3YA 3RAEC 8MHTA 3ES9A 1AIPA 1J0DA 2GRJA 5G1NA 4F06A 3U7GA 1WZ2A 3T7DA 4U63A 1N6NA 1V47A 3AVOA 2Q5QA 4W7HA 5FV7A 3TZQA 2W9XA 3KC2A 2Q3MA 3ZY2A 4IXDA 2FTKE 3GEIA 3HM2A 1QH8A 3G7UA 3U7RA 4BLQA 5JI3E 2KLBA 3MXOA 1GPYA 2LV8A 1X1DA 3GFFA 4QBGB 1VLHA 3ETLA 1RBYA 4P5DA 4RYLA 1DL5A 5E6RB 1U7UA 4AU1A 4XDZA 1YFKA 4HR7A 3TVDA 4DADA 1YHZA 4XPIB 5GZ3A 4IHAA 3A2LA 2C2ZA 3QFFA 4AY3A 4DWWA 2ZYWX 1BKDR 2HMAA 1I6MA 3PX2A 4GX2A 4FFMA 2FJUA 2P6OA 3A6ZA 2OOKA 1P2SA 4NEQA 4TMYA 3RJZA 3FPEA 2CK3D 1KS9A 4IIJF 3H2GA 4CIAA 3EJWA 5ER6A 3NHWA 3F98A 2WG0A 3LK6A 2BM0A 1GKIA 2DFPA 5FO0A 1WMDA 1B2LA 1DJNA 3S1SA 4V2UA 3VPBA 2UZ1B 4IPTA 2YJ3A 5TNXA 1X3LA 4QO8A 3IP8A 4S1OA 1C7RA 1MAAA 3W8DA 3IOBA 2H2DA 3MMZA 1KEPA 4P84A 2G04A 3U3KA 4ZIRB 2ZUUA 5HKKD 4HN9A 1P0IA 1G8AA 1L4NA 2X7JA 1F4PA 1BROA 4PYNA 1SQGA 2VF2A 1PX2A 5CNIA 4JXXA 5L3RA 2DERA 4UBJA 1DX6A 3HL4A 4E1VA 4TLLB 1GT6A 3OH8A 4LDZA 4LYJA 4N8SA 4YCMA 5IVPA 1UPAA 1N0VC 1WKCA 1NQUA 3I1JA 3WQRA 4Z4CA 1DIRA 2XY4A 1PZEA 4Q1DA 3REOA 5JU6A 4EZEA 5EXTA 2WJVA 1GRCA 5FTMA 2Z5LA 5LC1A 3HJGA 2XCRB 5C1OA 2FN7A 3FZGA 3OTQA 2YWGA 3GJ7A 4HX2A 5IN5A 2CMFA 2QW8A 1AMNA 1BH6A 3OT1B 3SC3A 2BGJA 2R6GA 2Y1CA 2A57A 1VJDA 1YFZA 4M1SA 3GAMA 4OM8A 1JB1A 3AV3A 4H7DA 1SC1A 2AMJA 3ZWPA 3X1KA 1PSZA 3KM0A 4CMCA 3I5UA 1DG3A 5FWXA 4U7GA 4AAYA 3EQ9A 1E1YA 4XGKA 2ZBUA 4MVJM 1P0FA 2LDBA 3MJEA 2QTFA 1GRNA 3U56A 2YN0A 1DO0A 1TO1E 1LRJA 4DV6B 3DA8A 4HPXB 5G0SA 3HGTA 1IHYA 3CN9A 4OXXA 2ZWPA 3I83A 2IYSA 4LYDA 1AQ6A 1D8AA 2YXPX 2VDMB 3UCFA 2Q3FA 1R6VA 2BGIA 3O83A 2QB5A 3MW8A 3Q41A 1Z4MA 2AOUB 2V45A 4TYMA 2C59A 1C9EA 2O7NA 5EMHA 2C31A 2WSLA 4MUBA 2ZPAA 5BSKA 1NRJB 1KE2A 5IG2A 4LJRA 1GGVA 2PTGA 4D9FA 3ANYB 1LF0A 3NEAA 3JARA 4QPCA 2ZPTX 3ZEAA 1RAAA 1U0FA 4PF1A 2R7KA 4B4VA 1GG5A 5BUQA 4RH1A 1IWBB 5HBGA 5KHOC 3GLGE 2MINA 1S4QA 1B42A 3G79A 2WTUA 2D5IA 1Y9AA 4X90A 3AVXA 3QH4A 2ZYHA 1C1HA 4MYRA 4ZQBA 3IURA 5SZJA 3FYUB 3OLCX 1W0KD 3V32A 2P4EA 3INYA 4FGUA 2H2AA 2CL6X 2OD2A 3K09A 1WY5A 3KVVA 2HDWA 1G5IA 4HGOA 4ZMSA 4ITUA 3GELA 1EUYA 1HI9A 3UOWA 5FULA 1YIOA 4L8FA 4HLUC 4HI0E 1WB5A 4FZ3A 5CLQA 3W9YA 2X8LA 2MT9A 4R8LA 4OL9A 3OM0A 1TMKA 1M2VB 5IMBA 2ZETA 1GZSA 4OUDA 1NRXA 3I4LA 5EZYA 3K5IA 4IJUA 1F48A 2B25A 3IVCA 3Q0EA 1C7FA 1W94A 4KI0A 4FJ1A 4YBZA 3ZCXA 3GDOA 3GY0A 3DB1A 1OSNA 4MJXA 1M8PA 1L7AA 1WABA 5F1YA 1G41A 4JGBA 4ZT3A 2P6RA 1PVOA 1GTZA 1HDXA 1Z0DA 1M2KA 4DNPA 2OBBA 2OHOA 2WUGA 5EE0A 5IKEA 2FSVA 3O84A 5JXJA 4CEHB 5CFZA 3CZ4A 2C7OA 1P19A 4Y6LA 4D9HA 3W2IA 2DRIA 2E5FA 2AWOA 5MGBA 2JI7A 4B3RB 2W6ID 1JIVA 1QGUA 1CF9A 2BCGY 2JC3A 1V5IA 3EXG2 1I6KA 4FW9A 2P68A 4DJJA 2HRQA 2AQ8A 5EKXA 3L1UA 4RORA 2EJUA 3ADKA 2E4AA 2HK6A 1MG5A 3K1YA 2YJ6A 2BEKA 3QRWA 2VHCA 3PEWA 3QWFA 3FUTA 4A6XA 1NUUA 1OBVA 1YU9A 4W5HA 1NY5A 1Q1GA 2WKSA 3W5SA 1PR1A 2IGTA 5BSVA 1QTQA 4AKTA 1CEEA 1ZBDA 1FFYA 2PUJA 5IBPA 1C3LA 2I8LA 4LWOA 4OXIA 2OXIA 1IHDA 4D1YA 1V3UA 3C8DA 3NWBA 5JNTA 4N5MA 4YN3A 4E09A 1RMQA 3MT0A 4P34A 2CE7A 2XCQA 3T7RA 1CB7A 1WPRA 2ZROA 1K5HA 3L1KA 5DX1A 1NASA 3V3KA 4CU2A 3O8NA 5LDHA 1WA5A 1P2DA 2GK3A 3Q98A 2G80A 2X1HA 3QXHA 4A0GA 1S2NA 5DVZA 3FGOA 2YC4C 1JFTA 3PJRA 1KRXA 1IEVA 2MSKA 5FAXA 3OZVA 4FI3C 1W87A 3NTLA 2BYTA 4P0QB 3N8GA 4PN7A 1BTOA 1F2TB 2QVXX 1XBTA 3O4FA 2M1XA 2GXSA 3GZTB 4O8CA 4W9NA 3AYXB 5DYIA 3OTHA 5E7MA 4BO7A 2ZZKA 3GGGA 4LTNA 5F51A 1GSOA 2ZGVA 4UUAA 3D4PA 5FL7A 3VHLB 1BS1A 1PQWA 4B3CA 4EFDA 3O7WA 1BU5A 3BF7A 3BRSA 3VU0A 1SMKA 5KX5A 4EO7A 4CLEA 1QANA 3HUTA 1WR8A 2F1RA 1OLXA 3CCCA 5K8JB 2B5OA 1TA9A 1ZM3A 4IR7A 2KWIA 1G2QA 3GRYA 1MV8A 3M6LA 1W0JD 2F3QA 3TNYA 3IUYA 3MWDB 3Q9LA 4W7IA 1XMQB 1KZ1A 2GAJA 1KEEA 1OI2A 2RBEA 5DCUA 4JP2A 1O9BA 3JQFA 1EGQA 1JTFA 3WDMA 2YUTA 3RK0A 1QCZA 1AG9A 5ALEA 3Q88A 2JH8A 4NH4A 1CR6A 2WLTA 3NTUA 3R7BA 4ZQEA 4TV8A 3KOWA 3A28A 3OJWA 1DEAA 3VGJA 5BR7A 2GPWA 1IPHA 3VSDA 5FP0A 1R4MA 2C5HA 1RQNA 1HSOA 3C8ZA 3E81A 4E07A 2P9EA 2AVNA 5EAIA 2PZFA 1EU1A 4NH0A 1X77A 3BWXA 1OU4A 2XD4A 1MW8X 3AVPA 1P1BA 3I9MA 1MVLA 2OKGA 1XU4A 2VDRB 4L0QA 2BKEA 3ESRA 3SYLA 1A9XB 1YAHA 1DO8A 3LVBA 2YJTD 4H17A 1D4AA 4J07A 1S01A 4RHCA 1L4FA 2ON6A 4IDFA 2DKOA 5LZ9A 2JL1A 3ND8A 1NR5A 4NCJA 3TSCA 4AWAA 4YRLA 3TX6A 4W9MC 1FMTA 3QKTA 2LGJA 4QXAA 3GZ4A 5GV7A 3C7TA 1NN5A 4KGXA 1J33A 5AJTA 4ILKA 1IN5A 4FFSA 1DQZA 3BSFA 2X22A 4W8GA 2XH8A 3I6ZA 4HDQB 3TMAA 2EFYA 1B8PA 2J3KA 3RRXA 1LK0A 3ZHXA 2NZUG 3M4XA 4X8MA 2WPDA 3DONA 4TYPA 3WYNA 1E5LA 1GRRA 4LZLA 4BNYA 3AIOA 1O9HA 1R66A 4U7DA 4GE3A 1TA0A 1FFCA 2B4QA 1P7VA 1I01A 3IQEA 1ST3A 4C6HA 3UMRA 2NZXA 3FROA 3WB9A 2Z0MA 4G0QA 1G2OA 4MUIA 5JS2A 2GF0A 3HLYA 3ISTA 4P4SA 4RPKA 4F4UA 2OB1A 2YHIB 1MZVA 1BXRB 2G3YA 2P9HA 4IDQA 1TEHA 3UJ7A 2ZDHA 2HSJA 1N2CB 1TB4A 3VKUA 1JJAA 1Z4KA 1RADA 3TLJA 1ZEMA 2ZYIA 4GR9A 3VO1A 2QN9A 1WNFA 5HX7A 5LIPA 5CFNA 4HXYA 4CIWA 3UYKA 4OCZA 3DGFC 1H5UA 3TOVA 3KLNA 4G4SP 3LO5A 3SOPA 4KPGA 2WTBA 4FUTA 4F6CA 2IXFA 2ZEJA 1YGYA 4UOQA 2IX3A 1Q44A 3F6PA 3OZ7A 4G26A 4G9BA 1WDKA 4LN1A 2CFTA 3O8DA 4LYAA 5C0OE 3K70B 3I2KA 1NBOA 3D2AA 1W8DA 3CE9A 2VQ3A 3C8UA 4OPMA 4PNZA 5BV1A 1O58A 3GFGA 2PT9A 3WGNA 3JRXA 3WY9A 2GVNA 1FK8A 3SYRA 3ZU5A 4RPLA 1N92A 1X74A 4J75A 4RLHA 4F1WA 5BWNA 1NPTO 5BYAA 1L5SA 5BV0A 4OJTA 1ZCZA 1U4OA 2ZI3A 3A3KA 4HGZA 3I3OA 5JE8A 1NW8A 3E9NA 2RBKA 5IABA 4NCAA 1NIJA 2F62A 3ZDXB 1J0BA 1DGQA 1B1CA 5EZYF 2VDWB 5DX0A 4PX5A 4QUIA 1S8FA 5K7SA 2A33A 4CR8A 1ONBA 4FKMA 4LTDA 1RSZA 1M2JA 2ZRAA 3P0FA 4ZOLB 3R5FA 3LIPA 4PX3A 2HC9A 3TUIC 1PT7A 4MQEB 1SD5A 1M8FA 3P71T 1H93A 4L5IA 3EFOA 3TRKA 5JXWA 2R97A 4WLFA 4L3VA 1W5EA 1TGYA 4DWOA 1HUQA 1UANA 2D2XA 3THOA 4ZVMA 1NYLA 4F5WA 4HNTA 4RAQA 4ZCPA 4IV0A 5IEBA 4AK9A 2O8EA 4UNSA 4I4TF 4IOLA 4L51A 5E6UA 2AN3A 2QJFA 2B5VA 2NVBA 3H18A 1OX6A 3FPBA 3K0FA 2FYTA 3COZA 3QITA 4B6SA 4WJLA 5H8WA 2WJWA 5DBFA 2P62A 4GQAA 1RXEA 3IAS1 1ICEA 4TMZA 5E6SA 4HQKA 5IX8A 2ZUBA 2CC2A 1Z63A 3VTFA 4P3YA 5I7OA 2GJ4A 1WCIB 3CF2A 2WOJA 1RWPA 1P8JA 1ULUA 4PO8A 3QWAA 2Z4SA 4ZT5A 3IQDB 5KWSA 1W4AA 1WHTB 3BGVA 1VL0A 2JARA 3IC5A 4AT1A 1CQXA 5CDFE 4R5HA 5H83A 2C2YA 3CLUD 4ZZ3A 3L7AA 3RRMA 4RPHA 1E9SA 5I9TA 5L3ZA 3VTAA 2VF7A 5CA0A 2PU5A 5BN3A 3CFYA 3T7EA 2JLYA 3EDCA 4A03A 2VNSA 1Q0SA 1Q11A 4N01A 4J16C 4J2HA 4CEJB 3VO9A 3ZW8A 5CFLA 1JLLA 4RY2A 3G0HA 3ESCA 2G70A 4O4IA 1Z06A 4OHZA 3KSZO 5DI3B 2IBMA 1LRKA 1UBHS 2XYRA 1DOAA 4PSAA 4OEHA 5H5JA 3WYEA 1GUBA 2HIHA 2EQ5A 1JJIA 1VHWA 2J9XB 5DNUA 1NDQA 1WXDA 2JS7A 4NFHA 1XEWY 3IKVA 3UVEA 5T4HA 1JH9A 1L7BA 2JW5A 1RCUA 3KTDA 3BMCB 2VP9A 1D0SA 3NEPX 1WU7A 2QORA 3DW3X 3PUXA 4Z9BA 2Y1OA 5KOJA 1OAOC 1TLFA 2X2EA 5FOSA 1WETA 2P3LA 1KL7A 2WTMA 4KVZA 2FZKA 3CIOA 3EXEB 3JSXA 4N54A 4O0LA 1KDZA 1L5KA 2RI0A 3AEQA 4C2TA 4MUKA 4I1VA 3GMSA 2OZVA 1M2GA 5DNAA 5DW0A 4X45A 3OX2A 4TV8F 2Q1SA 3S2GA 1E2GA 1TJPB 3RU9A 1HLGA 1WXIA 1ZNYA 3JD0A 1XCMA 3KJNA 3FFXA 3HB5X 4QDTA 4ZEXA 5FBRB 3BPSA 1E4YA 3LRPA 4FHEA 1W5SA 4D3FA 2CXTA 2ZPUA 4JB3A 4DR5B 4PCVA 1QZXA 1E79A 5NLLA 1HE2A 4M0EA 2E7ZA 3P19A 4BV3A 1VSUA 5CYFA 5IXJA 1NV9A 3AESB 4B2PA 2DQZA 3KXPA 1KRHA 1O94D 4YY3B 2NSHA 4MVJH 1LSJA 2D8AA 4RV5A 3DFZA 4RGYA 1KYXA 4H6WA 4I4NA 4BNUA 2Y1FA 5TT0A 4E6EA 5AJUA 1ZA1A 3EZ7A 1IMOA 3FG9A 3I39X 4R1NA 1UZLA 3BE8A 1Y4UA 3VNRA 1AN0A 1XZHA 3EPRA 3B1ZA 4FU0A 4NWIA 3D64A 3WHLA 5MDHA 1CY8A 4RTKA 1W4RA 3WP1B 3QPCA 4J0EA 3EIWA 3P0RA 1J1IA 4UJ5A 3LFTA 1WJGA 2HK9A 3H5NA 4H59A 3JR3A 3TRHA 3TW4A 4X00A 5AKGA 4AJNA 5JZVA 3L7YA 2FRVA 1NVDA 2CN1A 1GEGA 2WVHA 1HE3A 5DHPA 4KLCA 4YLEA 1D2GA 3I2FA 1GILA 1FXUA 1R4ZA 3H42B 3ZLVA 2AZXA 3JWHA 2UUBB 2FW0A 1F0YA 1EWKA 3TBFA 4DLAA 2XMCA 5CCDA 2F3RA 4QOIA 2Z58A 1SG6A 3Q11A 2GHRA 1Q7BA 4BNVA 1J8MF 3MJDA 4N03A 4YYEA 2WTXA 1WP9A 4CETA 2EKDA 2P2GA 2GLTA 2WHRA 4TV9B 1NC1A 1WDLA 3C45A 3K9NA 5LPNA 1TJNA 2E55A 3KZMA 4YUYA 1DUSA 5J3JA 4RM2A 4HNQA 4Q4AA 4GUAA 4MV9A 4V2IA 4ZAXA 4KLNA 2Z56A 3RUFA 2XWJI 4FS8A 3FSJX 1XALA 4HSGA 1KQGA 5FEUA 3W4IA 2FRXA 3DZIA 5LBTA 5EMJA 2LP4Y 1BFKA 4INOA 1PNTA 4R2KA 5FYDA 1EK5A 3Q85A 4RZ3A 4B6QA 1T1IA 1V6CA 4HRYA 2NNWB 5G41A 1PZNA 4GSYA 1EX6A 3NTXA 4FWIB 1EDEA 3V4PB 4DY6A 5JS8A 1TCBA 4DJDC 1HXHA 4TKUB 5LLDA 2CXPA 3A9UA 5SICE 3SI7A 1KDOA 4X8HA 3FFAA 4PX2A 3IBSA 4QGGA 2D4HA 4BQQA 1K08A 3BE5A 2BELA 3R5JA 5A02A 4B3DA 2FW6A 4R2IA 3UUWA 1QPZA 1HPLA 2ONKA 3DE1X 3TBKA 2BMVA 5CFQA 5KTMA 1D6JA 2HQRA 2L17A 4LTMA 3AINA 4CEIB 3AG6A 4QVIA 1QK5A 3AIIA 3L5OA 5A7HA 3WLHA 1EDZA 3B9RA 3ZDQA 1JKJA 4ZU3A 1GQ2A 1TLLA 3BZBA 1DSSG 3P0HA 5FI3A 1JJVA 3VNAA 3WLSA 2H0QA 1SXPA 1LTHR 4U7WA 3QWHA 4F9EA 3I62A 1E9AA 4EUEA 2HB6A 5AJHA 3VKWA 2AG1A 3HRKA 1K2WA 4JQSA 2PA0A 3VJKA 5FPPA 3ZWYA 1XNRB 4FZVA 2O8BB 3E8XA 1G21A 1VPWA 1QOPB 2DBVO 1FRNA 1H66A 2WJZB 4ZARA 1N4DA 4HBGA 1CV2A 5LQKA 3TRJA 1XPRA 2ODWA 2UZIR 4G0WA 1ZIYA 1V8FA 2GA8A 3BIFA 3KXDA 3GQBB 4DGQA 3T0FA 4FT2A 2ZWIA 5JNVA 4M53A 1GYRA 3UH1A 5FTKA 1SHLA 4IIBA 1OIVA 5KTYA 4KMSA 1SB9A 4ZZ2A 4G0OA 3JZMA 4JQYA 1N0IA 1RM4A 3IDSA 5BW4A 5IM4A 1OUMA 1KETA 1TFRA 3FKSD 2WD7A 2QROA 2CLSA 3QUBA 5HILA 1LEHA 4DCNA 5LVAA 1JQKA 2J3DA 3ILVA 4MI9A 4R9SA 3NBXX 4B8ZA 1JMYA 4MV3A 4YJGA 7REQB 5KVCA 2OZLB 2WYOA 2Q8NA 3AJDA 1REQB 3RC8A 2CXQA 2P90A 4MB0A 4ZRNA 5I7EA 3M34A 1NT2A 1IUKA 1LBIA 1SXJA 4ZYUA 5I8PA 2HWYA 2QBYB 3PFWO 5CA0F 4JIMA 2B94A 3WGHA 3L01A 1LBQA 1NXPA 1S2MA 3I1YA 1E92A 2AN5A 5F5XA 4YPFA 5IW8A 4ZJUA 2BBTA 3JS5A 4EUSA 1QF7A 1DCKA 4O4IF 1XTTA 4QTXA 1DJQA 3AI2A 3LF2A 4ARCA 1ESMA 5F1KA 3DTTA 4BATA 3JASA 1IWPB 4X92A 4ZHSA 5LUAA 1DUVG 3K09C 5I7RA 4BWYA 3KP1A 3NZEA 3FTNA 4JI0B 3IVMA 1HTBA 3EJ6A 5AKLA 2DPHA 2G1KA 3MT8A 3ODPA 3W7BA 4JUFA 3DSRA 2CEKA 5I9LA 4J7XA 2PX8A 2XPCA 3W4KA 2V6IA 4FM9A 1BA2A 1N6OA 1RWMA 1LI5A 2V0NA 1G0NA 4IDAA 4OHBA 1VIYA 1BQ3A 1CP3A 2GBCA 3GT4A 2WIKA 5G40A 2J30A 5K8CA 1GYPA 4AMZA 2JD2A 5E7IA 3OETA 5L4LA 1C4XA 2B4TO 1VJ1A 4KIFA 1JR3E 2HREA 4QGHA 1D9ZA 2GD1O 4ARSA 3ZGLA 2QYSA 1PQPA 3UMVA 3AUXA 4YT4A 5HKAA 1VHLA 4BAGA 2P6UA 3PKIA 2YOFA 1YKSA 4O2BA 4MYUA 1K8YB 1WY7A 2VLBA 5ICFA 3LD9A 1PKEA 3U48A 3WK5A 2X2FA 1V96A 1P2FA 2O7SA 4X3OA 1V37A 2YFQA 1NZFA 4PFSA 4CPDA 4EYOA 5IJ0A 3EW7A 4CNBA 4QKQA 1XPUA 4LY9A 3DT6A 4Q7KA 2BMEA 1JDNA 4KSYA 3SC2A 1DJLA 5DU2A 1PGPA 1XMOB 1QGYA 3NS7A 3OLQA 1VLQA 1KJZA 3EZXA 4RK5A 3NBKA 3P8ZA 3VC1A 2EF0A 4UOZA 4QNMA 1NVKA 5KMGA 4FBGA 1A7KA 2WJ4A 3CF4G 3E9QA 3F3YA 3R23A 5FAKA 1QTRA 3KKKA 2XADA 3K3PA 3CLRC 3KLBA 3R74A 4AYWA 4L4XA 3A70A 3DTVB 3A1FA 4HH0A 2QQFA 4DYVA 3QEKA 3QVOA 2VZ8A 4EHBA 4EQZA 5HZKA 4QDJA 4C21A 4MTLA 5FA5A 3D6AA 3ED1A 3EUFA 2FW9A 3B3AA 4QPDA 5CM2Z 5F4ZA 1ZOOA 2V97A 4WN9B 1GZ4A 1YZUA 5EUCA 4CKCB 1QU3A 5G4LA 1QRDA 3OMWA 4NZNA 4HTFA 1MHTA 2QE6A 2BFEA 2P9FA 3Q6NA 1FXSA 3B6JA 3U0VA 4CMJA 2JF0A 1H8EA 4G5FA 2CMGA 2VWGA 4QELA 3TW6A 1GG9A 1Y5RA 3GXOA 3AG5A 1YR8A 1KSHA 1RTTA 2UVPA 1PR6A 2CLOB 3RS5A 5JWRA 4BKMA 1YBHA 3DEAA 4GW3A 4MA0A 5KEIA 4MPTA 2AIRA 1E3WA 4DQDA 5JBQA 1WWKA 4W9NC 5ECGC 4CM9D 4PWYA 2FK7A 4S1PA 2YY7A 5C1DA 2ZT7A 1ZCJA 3DW1X 4LDNA 4NDNE 4GRIA 1U3UA 1H05A 1ZJJA 2P8SA 4HDSA 5DB4A 5L7YA 2HKIA 4QYWA 4RVCA 1CBUA 4RCYA 4U39A 3M4ZA 1GLGA 3C1UA 2G36A 1YR1A 2IXTA 1Y9DA 3AM5A 5DM60 4BGEA 3CO5A 1K68A 2WUDA 3B9PA 3SQNA 5A4MS 1O9GA 1DQYA 4C78A 5CEEA 2FEWB 3JQFC 1SCUA 2BFBB 4C7OA 1BMQA 1OOEA 1QH1A 4R01A 3V2IA 3SFTA 2HO4A 5B1EA 5CDTA 2G0TA 3J7AC 1G7SA 1KAOA 1YS4A 2YJNA 4HDAA 4CIXA 4ARIA 3OZUA 2ZRQA 2I6GA 5FEMA 4P7BA 5L51A 5LXTB 2PBLA 1T5LA 3DWEX 1GPUA 1T25A 1SXQA 2YOGA 1WMEA 1U2GA 1N7IA 4JYAB 1XRLA 2GFQA 4OAOA 1JU9A 3BRCA 1JAXA 4TT8A 4P7JA 4D02A 1M2WA 2HMUA 3ICCA 5BSTA 4EPRA 2QIOA 5AM1A 5FFFA 1NA5A 1F3LA 1SHTX 3MINB 3O21A 5JD3A 2JBAB 1PJ2A 2OQIA 2G25A 5KHAA 1GTMA 1TU4A 3ROFA 4BLWA 1KU0A 1LWOA 3UJ6A 1AZWA 3CVOA 3V80A 2BZSA 2OZEA 3D6FA 3HR4A 3QEMA 4A5SA 4R51A 5LFAA 1WU8A 1UEIA 3T3EA 3AIMA 3ITEA 1PDOA 4O1MA 4WGGA 5IWCA 5J1TB 2UXCB 4O63O 4FN4A 4WDQA 3TJRA 2FSUA 4LBVA 5CVCA 4GF5A 4TZ6A 1PV4A 3QOWA 3TNJA 3SQXA 4KODA 1XQ6A 2B2XA 3SWWA 4U7JA 4RK0A 4RIIA 4KVFA 3A1UA 3RKSA 4BB0A 1VZ3A 3W1EA 5ALQA 1JYEA 5CCBA 1TAGA 4DDKA 2J31A 3L0YA 5F7JA 2HA2A 5KHLB 1HDCA 1XWIA 1UKCA 2ZVJA 3EC2A 3AWIA 2BGTA 5IM4F 4COKA 2QTCA 3ZWDA 3ECAA 2JAOA 3AEZA 1YL5A 2WAAA 3ABOB 1PLJA 4F2PA 4KRGA 2ZSFA 4PONA 1BE6A 5HNKA 1COWD 2VUIB 1J9GA 2WMDA 4N9WA 4ND8A 2Z3VA 4Z6KA 5JMTA 5C1IA 1I4EB 2MDTA 2XGMA 3PC4A 3RRYA 1K2VN 3DLIA 3F8SA 3LA8A 3QU7A 4LHSA 5AO9A 1YRQA 3A1EA 5E3JA 4IZHA 5FX2A 5HUJA 3K71B 2R751 4P3XA 1QE3A 2SKDA 3ASZA 1KOFA 4MRRA 4P5PA 3OA2A 5D01A 4ATNA 2ROQA 2OHXA 3UPTA 1QFJA 4A92A 2YXEA 1C2YA 2R25B 1H6AA 3OCCA 2P2CA 3OVMA 3TPZA 2O8FA 4LF6B 3T1TA 1YJ5A 3GH3A 3PQ7A 1MNQA 2GLXA 5A7GA 1H2ZA 2C54A 4BEJA 2AJ8A 2HJSA 3AHEA 2MMGA 1RJ9B 2VDQB 3A6EA 4TXNA 1CQJA 4PNPA 1Z2AA 1V16A 1L3BA 4NICA 1SUWA 4ZCQA 2EATA 1U9CA 1UINA 3TPCA 4F0JA 1AUVA 5IF9A 2X8BA 2C2HA 3PHCA 5LZ7A 2FFAA 3BE6A 4WY8A 4MRMA 2V4ZA 4ND1A 4WASA 2GDZA 3VX4A 4EAQA 1DQSA 1KY3A 2F43A 2IW1A 4LYGA 1U2DA 3NTOA 5BT8A 3V2UA 3WFIA 2VFAA 1ZMOA 1TCAA 1C1DB 2PXHA 2VUHB 3WMEA 1AY0A 1W36C 3HZZA 6YASA 3K94A 1SNYA 3W2EA 3A6PC 1EWVA 2W98A 1BZYA 1ZD9A 2VNJA 4B85A 1SURA 3A7EA 1FTQA 5F77A 5KSPA 4BMXA 1A77A 1INLA 4MARA 2D7DA 3UGJA 1GXSA 2HT1A 3DD5A 1YBVA 2CY0A 1QWOA 3D7LA 4JBHA 1HC7A 4OBXA 3GJ8A 3CIFA 2QI9F 3GEBA 3OY2A 3ZWWA 3TAUA 1DQRA 4DNFA 5ESWA 1QIGA 1QO7A 2HNBA 1WW3A 3H1FA 4HQFA 5EGSA 1JSCA 1POWA 2J5XA 1Q0LA 3BXHA 3M1YA 3ORHA 4BO5A 4BB9A 1P3DA 3HI6A 2C7RA 1TM3E 2C9ZA 4RF3A 1MPTA 4H3VA 2C8JA 1R00A 2JJYA 1YVRA 3PZBA 3K7EA 3LPDA 5EIBD 3PWZA 5CVTA 4RGQA 1JFFB 2F8LA 3QXXA 3X2FA 4BS9A 4OHYA 3EEFA 2VJMA 3A0RB 3CYFA 1H65A 2YZMA 1B6SA 1WW8A 2QMUA 3BXZA 3BA6A 2QL6A 3LOQA 1PVDA 2OBFA 4L0CA 3UHAA 4KXWA 5H3LA 5KTRA 3TF5A 3A3YA 3K4PA 4TWBA 2NUTB 2XOEA 2I2BA 3D8BA 1NVMB 1BFUA 1GTVA 1UK9A 1G6OA 4N3CA 1X2EA 3CC8A 3BSSA 3F5FA 2PGDA 1FCJA 3ZDRA 4HNVA 1SRRA 2GZMA 1SQFA 3OQIA 4LSMA 2XUZA 2I99A 4KTVE 4M0KA 1MO6A 4LV5B 3HKCB 4TKZA 3QSYA 1M7HA 3DT8A 2C5FA 3U3OA 1DV1A 5DH9A 1Y7LA 2I7TA 2P67A 3P2KA 3PNPA 4HB3A 5JISA 3Q8XB 4NX2A 1LU9A 1UBKS 4EQ6A 1NVFA 3HCCA 2IDKA 2V6MA 2FXIA 2E87A 3MJCA 3PDCA 2RMKA 3EN0A 3BB1A 1ZW6A 5FORA 1Z82A 4C4TA 1N57A 1EUDB 2VDNB 4M89A 4DNQA 2ZRNA 3GRUA 3ZWXA 2ZI6A 4GR4A 1AJEA 3NNSA 1VKHA 4RY0A 2V5UA 5EXPA 1QDEA 4JU9A 4EVSA 3B1JA 1T35A 2PLRA 1PP4A 4L4RA 1GO2A 2QRKA 4AJHA 5JFTA 2G5CA 3RHSA 1KI6A 4Y7DA 4TWJA 4YMLA 1XCOA 4ER0A 4FZRA 1OJLA 1I30A 4XR9A 1KWKA 4QASA 1Q2XA 4HGPA 5BVGA 4R9UC 1F2UA 2BF7A 3L4JA 1RKVA 2J9FB 1NVWQ 3R0JA 3BCHA 4Y1FA 4RZQA 5HE9A 1GSAA 5F73A 3LK7A 4KMRA 4C29A 5IBQA 1F1BA 2W11A 4REOA 4X1KB 4Z7NB 3ZHSA 4KO3S 1QG4A 4BNIA 3C48A 3AKYA 2A35A 5E3IA 1NBMA 1FQOA 2C2OA 1NNLA 4PZ9A 4Q4HA 3T6KA 1RE0A 2B9EA 2C0QA 3ZCUA 2CL7X 2I4MA 1XYGA 3MT9A 1YZTA 4QICA 9ATCA 2Q62A 3HB7A 4I50A 3NIBA 4IX1A 4YMIA 4BEVA 4KR2A 1KEVA 3BMNA 1EKXA 4OXQA 1E99A 1YC5A 2BH9A 2V58A 3BWVA 3V4VB 4JLMA 5HF5A 3TLZA 5ANRB 1E6LA 2AKAB 4IAOA 1T2CA 4NBVA 1EFVA 3UJAA 2PUAA 3DV0A 1RTKA 4U4AA 4WFKA 3JD2A 1I4DD 1TYZA 2JGFA 1CQPA 2PO5A 1V6AA 3TLXA 1M2EA 1U1IA 1AK9A 1U3CA 4NCHA 4ZWNA 4RACA 1BE1A 1QTNA 3LXMA 5AQEA 1ACJA 5ABPA 1N9KA 2YYZA 2Z3WA 4MV1A 4RADA 1P4AA 3UPUA 1V48A 1Y0BA 1G20A 2L19A 4O29A 3E70C 5B1IA 3R75A 3WGJA 4QQKA 3QEJA 5AJWA 2P4UA 1XZNA 3E05A 1YDHA 4IQ8A 2ET6A 4C3OB 1FA9A 5HUHA 4MMXB 1P1JA 1RABA 2FPPA 3GU3A 4KX5A 4DT1A 2WBLC 5TVKA 3S8YA 3TNLA 2XDWA 2R9VA 1XXHE 2LCFA 5CFPA 3PYLA 4RJJA 3KOXA 4BVBA 4YYZA 5FDFA 5EJ7A 1IE3A 4PLHA 2VAMA 3BH6A 2ADMA 3PFFA 4GPBA 5LQNA 1AA6A 1U2ZA 4BPBA 2IS4A 2JFOA 2GEKA 4HL6A 4RDCA 2IU0A 2QDXA 4BVLA 1K98A 2X4LA 4TLCA 3CX3A 2YZNA 3OPMA 2A1IA 4M3NA 4BUCA 2WAXA 3DVLA 3CLTC 3DAPA 3UF0A 3O8CA 4WD3A 2IWRA 3HYLA 3RSLA 3TLBA 1WUTA 3NHAA 3C4JA 3VKFA 2GUWA 4ZO7A 3QA9A 2FP3A 3NHLA 4DUGD 2XKKA 5KOYA 2J7PD 5LCXA 1PT5A 2O05A 5HMMA 2ODQA 2ZYUX 2BWJA 5K8TA 3C41J 2QLLA 3UBTA 4OJYA 3FWZA 4TYQA 3KETA 1AUQA 1Z34A 3D3KA 3WS7A 4NNPA 2OYSA 3CMCO 3R9IA 5LSAA 5LD2C 1N3IA 2P9CA 1W85B 5H4HA 5F2OA 3ETDA 5P8WA 2NU9B 3TGWA 1R3UA 3LY9A 4KO4S 4MVJA 1LF5A 3S70A 2A67A 4UPEA 1T5IA 4ECAA 1G8HA 4YP9A 4NF2A 2E1RA 4UNNA 3CLSC 1ULAA 4QFCA 1YVEI 2G07A 3Q7SA 5FNVA 1YIDA 5JZOA 3ZDAA 2CGEA 3AZQA 3D0RA 4PZLA 3EXHB 4OL0A 1IZ8A 5HQ3A 4AF6A 4C89A 4OAQA 3AVVA 1EUCA 2FPLA 1O6BA 5DYWA 3VO8A 1RKUA 4QXRA 5BO5A 5LD2B 1J23A 4X9XA 4WXHA 1GHTA 5CUQA 1PX0A 4MS1B 4FMPA 4DBZA 4GICA 1DAOA 3CEPB 1ZUNA 3C5EA 4IJMA 2VHEA 4R9NA 2RE8A 1I3MA 5MN4A 4RKFA 3BHMA 4DSTA 3T4UA 2FP4A 4E22A 4MLDA 3T5CA 1OI7A 1M1UA 2QA5A 2HWKA 3A9WA 4RA6B 4KWTA 3M6XA 2XB9A 3PLAE 4PG7A 4DUZB 1FJ2A 2QGFA 4B17A 3WAJA 3NB0A 4ZKDA 4WBNA 4XUDA 4RVHA 2GAAA 4DCJA 5CP8A 3BD7A 5NULA 3NTVA 4YHHB 4G84A 3LQ4A 3UUFA 2I3BA 4QTYA 2PWYA 3IVAA 5CFRA 8OHMA 5A6SB 1JQJC 4F8JA 5F7XA 1J0EA 2JJ1A 2QLTA 5BWMA 1XR3A 3IRUA 1RZVA 3GLQA 4N3BA 4PLCA 1PCXA 1O1YA 4LC1A 5A4KA 2O0JA 2MYNA 3LP5A 3SKYA 1QIMA 3WDKA 3ZBUA 4K0RA 3C6ZA 3B2NA 3GUHA 2Q9UA 1I2MA 2HFKA 1PGQA 3BDAA 5DO9A 2OA0A 4HDMB 4JBIA 4HYTA 2IIBA 3E9DA 3GUUA 3I2GA 1SXJC 1LI7A 1OLUA 1YOVA 1VE3A 2XR1A 3TRIA 1G3MA 2G6TA 3PSAA 1UPCA 2PKQP 4Z5XA 2C42A 2QAGB 2ZTHA 5MFZA 2VRNA 2E21A 2ID8A 2FDXA 3MLEA 1U0OC 5SY6A 1NZJA 1Q3KA 1H22A 2CD7A 4DDMA 2V3WA 2HM7A 3GAFA 1KO4A 1XN4A 4BHTA 5LQDA 5J2UB 1T1SA 5JH7A 4X93A 3OOHA 3TX2A 1LB1B 3DV9A 3MG9A 5KYVA 4BJ5A 3PA6A 4MUAA 1PR0A 2IEZA 3ICVA 1Q2UA 1DBWA 5H81A 4KGDA 4ETMA 1R8YA 4G01B 4UVDA 4CQNA 1X92A 1A5ZA 1ZNQO 3HFJA 4UDNA 1C7EA 2ONZA 4QUHA 4NOKA 5F33A 5SZIA 3ZIAD 4GL2A 1S0UA 4O4LA 3GLKA 1U8XX 2RHCA 2QIPA 3AHDA 4Q3KA 1D0IA 2VDJA 4K2HA 2XUKA 3Q0IA 5B1YA 4JBXA 1AGYA 5ECYA 3O3OB 4CHGA 3KPYA 3AETB 1XJWA 1YS7A 2FW7A 2PIDA 3B5JA 3C7CB 5JAZA 3O1HB 3KQNA 4DA4A 1P3Y1 1FB5A 3C24A 1QGZA 1LD3A 1UT8A 1K4KA 4G86A 3RUAA 1C3JA 3BILA 2FZLA 3GZNA 3O82A 4YV2A 2D1SA 3C7AA 1K7XB 2AI2A 3BGDA 5DN9A 5DV9A 4DPKA 3Q3CA 3GFOA 2ODAA 2VPQA 3DE2X 1PU2A 3EVZA 3KFLA 4DV3B 3CZAA 4ZC1A 1L4GA 2QI9C 1IJFA 3ONWA 3QKIA 4IFIA 4YB8A 3KWJA 3MPUA 4Q93A 4EPTA 3E3MA 4I55F 5CLGA 2QV0A 5AI9A 2XKBA 2C0PA 2CZQA 3CBQA 1U9ZA 1UUFA 1EK2A 2DTEA 5AW6A 4B84A 1P91A 4R7ZA 4EJMA 1RNLA 4UEQA 5EZQA 4L72A 3OKCA 2PS3A 1Y8RB 1OBFO 2C1ZA 3BIXA 3FTDA 3GDGA 1PJ4A 1QG0A 2IHBA 2Q21A 3DAGA 2IPMA 3D5EA 3EGIA 5GADl 3DWIA 2MYPA 3NBFA 4OGKA 2UVQA 1Z28A 5JRZA 2HBYA 2XEDA 1GJRA 1Y5LA 4GKAA 4DANA 2EWMA 1W0CA 4ISCA 3G0OA 1K6MA 2PXCA 1SQ0A 4JJIA 4RAOA 4EKNB 2AZ4A 4Q3AA 4QLBA 1QU2A 3OX4A 4MITA 2FEMA 4H18A 4CMKA 4YAIA 2QZJA 2R6DA 3NKVA 3K6RA 4GEKA 4B3IA 1IWOA 2IUTA 2ZAMA 2YCLA 1WSBA 4ZYLA 2NU6B 4JFAA 2GHQA 1TZMA 1WF6A 4DIFA 1HM5A 4BTLA 4O1HA 4GRAA 4F4FA 2QENA 3ST7A 5JXGA 5GJBA 1QAQA 2B61A 1XTSA 1T13A 4G65A 4JP1A 1G8YA 4YRJA 3GA5A 2C9CA 2WM9B 3AL2A 4GPZA 1ZC4A 2H0AA 1KMHA 2XCTB 4JCCA 5LU8A 3OMLA 3AQ4A 3MRXA 2PWBA 4KK3A 2CDRA 1NPYA 2ZI5A 2ZBDA 5E0OA 3TVTA 2OORC 5DCLA 1PJTA 1VBFA 1XAJA 3V2GA 4S04A 3UK1A 4HUJA 5ULLA 1E5XA 4C4PA 3CUTA 1FDWA 4DBLC 1A7UA 4KH1A 1WZNA 1T5DX 5HHTA 3TGLA 1FRVA 1Z68A 4Q66C 2CFSA 3ROGA 1MDFA 1S6YA 4U3JA 3MBOA 3PI7A 3MYYA 4WZBE 1GNTA 1PYGA 1ZIOA 3L0SA 2EU8A 4IJKA 3EWAA 3A4IA 2CXHA 1VG1A 2EKPA 2LKCA 4GM1A 2BH2A 3OJLA 2F3UA 3L8CA 5JATA 4KR0A 4BECA 5EIXA 5EWMA 5GIOE 2AKYA 2FZVA 1U2GC 3IUPA 3WXMA 1Q6ZA 1QOQB 3AILA 4DV1B 2ESRA 1U8FO 2X3YA 4HB4A 5FNVF 2PZBA 1T2FA 5DSXA 3O1JC 3ZE9A 1HRKA 2Z6AA 4WAUA 3M3HA 5TT1A 3V4ZA 4JEHA 3QVVA 4LZJA 2CYBA 5GINE 5EIAA 1S8NA 3QENA 1XTZA 2FFRA 3BCSA 2CZGA 4D3SA 2CKMA 2XUJA 3HR8A 1CZOA 5IT0A 2DSTA 4A0QA 4HKTA 4DV5B 1Q0PA 2I6QA 4ZGWA 5IAJA 3DWFA 4ZXPA 2QRVB 3FY4A 3UYLA 4AUMA 1KP2A 5GY7A 3TW0A 1X8LA 3RFFA 1EDOA 1IUOA 4P5EA 1C30A 4TXLA 3KD2A 1LSSA 3F4LA 3EX7C 4PHTA 5DDIP 5LMZA 1IY2A 2OVBA 4GUDA 5HFNA 1DXQA 3ANNA 3I8SA 4NULA 3GNTA 3VU9B 1S2IA 4EI9A 4WBNF 5BUZA 4KXUA 1ZVKA 1YK0A 3D0KA 1E1RA 5U4QA 1YCFA 3TSAA 3VVCA 1WXGA 3OJFA 5E8JA 4MGZR 1F4VA 4OYLA 1PFGA 2QXTA 4NYJR 5CT8A 4PTZA 2Z5GA 1SKUA 1VC2A 4W1QA 4F7DA 1L4KA 3H75A 3P9PA 2FG7C 2REBA 3OQOA 4GPEA 3KVNA 4S0ZA 4E2ZA 4GO1A 2CMKA 1UIMA 1JZSA 2FKNA 3CUWA 3OZAA 1ZZGA 5I9MA 4G23A 3O47A 5JNUA 3TGPA 4Q21A 4DLRA 1V5GA 3DEZA 1Z6GA 3UQYS 5A06A 3I73A 1OMOA 2O4CA 5FOTA 3LT2A 3QKRB 3VC3A 2ZP1A 1DMRA 4GI2A 3RVJA 4AICA 2XMBA 1TM2A 2ZR0A 2AF3C 3MA0A 5LJLA 2P5UA 1T2EA 2C03A 2B7BA 3NR2A 4KXVA 4C0QC 1GAWA 1Q83A 1WZIA 4QFBA 1NF8A 1Y8CA 3WDLA 2QTRA 3O8OA 3DO8A 1YZNA 3GVXA 2NPIA 1QQAA 4Z7QB 4V0SA 5JAUA 3FFTA 3JXEA 3B7GA 1CVIA 4MV0A 1N2SA 2NU8A 3OLVA 5JROA 5KYKA 3ONDA 1E6CA 4AP9A 4ENTA 4BXOB 4WMLA 5KCMA 4O4LF 5A62A 1CUXA 2C2MA 2OCKA 4PR0A 1C5KA 2C4NA 4EY7A 3DBHA 3H6HA 1PD1A 1U2DC 3PNVA 2G8LA 3JVEA 2Z2ZA 1NVTA 1UMDB 5A04A 1CIJA 1J21A 3GHHA 2JFZA 2OECA 1ORRA 2FZGA 2P3QA 1N2HA 2R6FA 1DOHA 3NC1C 1BX0A 1KI9A 3NJRA 4B33A 4TS9A 4F97A 3QV1A 1D2MA 1T43A 4BZQA 1CJSA 4UHFA 4MR8A 3A3PA 5FPSA 2X9GA 1DI0A 3TE7A 1W76A 5DBHX 1V0JA 2BY4A 2VP5A 3BQMB 3DKIA 3KJXA 1L2TA 4IIFA 5ALVA 3BD6A 4YAJA 5AVOA 4AN0A 1I9CA 4IOMA 3A06A 3PUZA 1OX4B 1DTSA 1EVIA 4GVXA 3VFDA 3G7NA 1LPMA 4JGIA 5KWIA 1M6VB 2ZDGA 3DJYA 4OFXA 4DHWA 1W7AA 1W6UA 1HOXA 1E6UA 1G6Q1 1BVUA 2GBLA 5FA8A 1UR5A 4NEHB 4B6PA 5I47A 1WO8A 3SNHA 3R7NA 1Q1NA 1PJ8A 2ID9A 1GPNA 4EY3A 1SBZA 4WECA 1HEUA 4QQFA 5BQ5A 1AB5A 1HT3A 1NJ6A 1S89A 2YHBA 3INRA 3UCXA 4YMVA 1AQJA 1ZL2A 3I6IA 5FPQA 4R2LA 1TYAE 2E0IA 3BRWA 2Z1NA 3C6KA 1RLMA 3FDFA 4M1TA 3TDKA 5KTKA 5HRAA 1TAQA 1X1SA 4FLFA 1KJ9A 4POOA 1C3XA 1J2RA 1T3LA 4M1KA 5AHOA 4L2IA 5K0FA 3D6TB 3AONB 1F5SA 4FOPA 1FDTA 3FYSA 1YQEA 3O4IA 2A9QA 4YCJA 1L3CA 1SULA 1NLUA 1UMBB 2ISSD 3ABZA 5DNCA 4UDYX 4LSGA 2ZULA 4NESA 2QM3A 1BXGB 3HSYA 5J2TB 2J6BA 4FKZA 1JXMA 4X6UA 1Q77A 4Q1VA 4EFLA 3USES 5I7AA 2QZZA 3O73A 3BK7A 3HA3A 4FR0A 2JAUA 2ID4A 3FNQA 3PFIA 3R6GA 1R0CA 1XNHA 3NGXA 4R81A 4PLFA 4NAVA 4ZHQB 5A5EA 3RYHB 2YV3A 3GRZA 3CH5A 2R60A 5FUBA 1V1MA 3P5BA 3T4PA 4QL3A 5FV4A 4J43A 2PKWA 2CB0A 2ZCVA 3MD9A 1GV0A 2BGMA 1GU1A 5D3MA 1XUOA 3RUIA 3TDMA 3GBVA 2B8WA 2VYND 3KU4A 2ZSKA 1T4MA 1ECBA 1D6MA 3TIVA 5TLSA 1XB2A 3AWDA 1XHLA 2K6GA 4FQ7A 5F3WB 1X7GA 2O23A 1RCFA 3N39C 1A95A 3ABRB 5E38A 4CN9A 4DCMA 5AFSA 3WSWA 3IKLA 4IJQA 4FHZA 4C6TB 4YV7A 4U0JA 4ZU6X 4TN5A 4IIUA 1E7MA 5HKOA 2HK7A 2BEWB 4ZAYA 3KT0A 4QIHA 1U4NA 5IWAB 1SRQA 3V7UA 2GNPA 5CLLA 1UZUA 2WWFA 2XVYA 1B0ZA 3AU9A 3N7UA 1DIAA 1XFDA 4GECA 4AZ3A 3I37X 3T3IA 1QR6A 2VHYA 3D6HA 5HWSA 2ECFA 2XQJA 3MK31 2QL7A 2DP4E 3EIFA 1IOWA 4J2OA 2IS1A 4AQDA 4BDTA 3TI7A 2Z1DA 3TG8A 1Q21A 2D00A 3U39A 2RJ3A 3G0IA 3H9UA 4CN8A 3B70A 1XP8A 4YCAA 2B0JA 3CW9A 4RJLA 3NT2A 1NVVQ 3NHBA 3OQ6A 2XB2A 3PG5A 2JCSA 3UN1A 2IL1A 2AG8A 2O1EA 5FD8A 2V7PA 1SU6A 1US8A 5HP4A 1DIHA 2R4TA 4FR2A 1IQUA 4R41A 5IMSA 2CVOA 2I7VA 2WFAA 4L7VA 2BMDA 5EMLA 1ADJA 1O4VA 5C8YA 1FVFA 1TF7A 4GMGA 3DEJA 3FPFA 2WKWA 4C5AA 1VLVA 3UT5A 1SHJA 4AJ1A 2CLHB 3GV0A 1USKA 1VJ0A 4A9AA 3ROPA 3I52A 1XZMA 1YIAA 4XAQA 1QGED 4XLZA 2R11A 2O5CA 5C5DA 1JGTA 1WD7A 4UBNA 3WVNA 4FYJA 5D5QA 2REQA 2PWPA 1AOXA 5BQPA 3L0OA 3SJAA 3ZV5A 4JQOA 4MWZA 4MJ3A 3Q3EA 1D6NA 2L82A 4MEAA 2YQ5A 1NYTA 4U9UA 2HQ1A 3B1WA 3MGGA 4OGGA 1JAIA 2CV1A 3OLXA 5AJYA 4EDFA 4XR4A 1HEYA 1PJAA 4M54A 3WYBA 1HNWB 4B32A 1RC8A 4PC1A 1O54A 3FOAA 4TUYA 1IZYA 3C87A 3S4YA 2BUAA 4O4JB 2YIDA 3DZJA 2ZWVA 3O8RA 1L5YA 2QAJA 4KFRA 5JCXA 5C8ZA 1MFPA 3GO4A 4YH1A 1BDJA 3WBBA 3PKZA 2CNWD 2BONA 1P7YA 4BO9A 1P0MA 3U4CA 1BX1A 1EINA 4YPOA 1GM5A 5AMXA 2M9MA 1VI5A 1OREA 1UPUA 4R40A 2ZSHA 1OILA 4BB6A 1PJQA 1MORA 2GAFA 3PJFA 1JRLA 4E03A 3O92A 3IKTA 1GGNA 1XZBA 3EQ2A 1P39A 1QC5A 2EVWX 1C0PA 2OCIA 3AHGA 1AQLA 3PWKA 1ECJA 1Z0UA 4G1EB 4HN4B 1P8AA 3GJ6A 1QYDA 3IV9A 3R3WA 4MB2A 3HKEB 4NU5A 2NVUB 3U1BA 2J0UA 2LNDA 4G0XA 4JCOA 2OPHA 2C9DA 2CDNA 2A2ZA 4MO2A 3E9RA 3HVJA 4AKHA 4XM0A 1YULA