2ISQA

Crystal structure of o-acetylserine sulfhydrylase from arabidopsis thaliana in complex with c-terminal peptide from arabidopsis serine acetyltransferase
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
320
structure length
320
Chain Sequence
SRIAKDVTELIGNTPLVYLNNVAEGCVGRVAAKLEMMEPCSSVKDRIGFSMISDAEKKGLIKPGESVLIEPTSGNTGVGLAFTAAAKGYKLIITMPASMSTERRIILLAFGVELVLTDPAKGMKGAIAKAEEILAKTPNGYMLQQFENPANPKIHYETTGPEIWKGTGGKIDGFVSGIGTGGTITGAGKYLKEQNANVKLYGVEPVESAILSGGKPGPHKIQGIGAGFIPSVLNVDLIDEVVQVSSDESIDMARQLALKEGLLVGISSGAAAAAAIKLAQRPENAGKLFVAIFPSFGERYLSTVLFDATRKEAEAMTFEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for interaction of o-acetylserine sulfhydrylase and serine acetyltransferase in the Arabidopsis cysteine synthase complex.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transferase
molecule keywords Cysteine synthase
total genus 118
structure length 320
sequence length 320
ec nomenclature ec 2.5.1.47: Cysteine synthase.
pdb deposition date 2006-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00291 PALP Pyridoxal-phosphate dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2isqA01
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2isqA02
1V7CA 1PWEA 5D86A 3BM5A 4NU8X 1WKVA 1OASA 2ECQA 3R0XA 1K8XB 3V7NA 1BKSB 3X44A 4D8TA 4HT3B 5B36A 5KINB 4IL5A 3VBEA 3IAUA 4COOA 2EFYA 1V71A 1WBJB 4D9NA 2RH9B 2J9XB 2GN0A 4WX2B 4PCUA 1QOPB 1KFKB 1TZJA 1VE5A 1CW2B 2DH6A 3IQHX 5IXJA 1KFJB 1C29B 3DKIA 4HN4B 4LMAA 3SS7X 3SS9X 4D9KA 1X1QA 5D84A 2TYSB 2RHGB 1TZ2A 2GN1A 2ZPUA 3CEPB 3DWIA 2CLLB 4L0DA 2C2BA 1A5BB 4L28A 3FCAA 1A50B 3HMKA 3VSAA 2RKBA 3DWGA 5I7HA 5J43A 3L6RA 4XUGB 1P5JA 2Q3BA 3T4PA 2J9ZB 1TDJA 2EGUA 4HPXB 5DW3A 1K8ZB 5I7OA 3ZEIA 1J0BA 4JBLA 4LMBA 1UIMA 2ISQA 4I1YA 1K7XB 5DVZA 4ZU6X 1CX9B 3VSDA 2TSYB 5KZMB 5B1HA 2V03A 3FGPA 3X43A 1RQXA 3SPXA 1WTCA 2PQMA 4D8UA 5I7WA 4D92A 2DH5A 1D6SA 1J0EA 1KFBB 2CLKB 4L3VA 2ZSJA 5I7AA 4D96A 1A5SB 2D1FA 1Z7WA 1TZKA 2J9YB 2GN2A 3AEYA 4JBNA 1FCJA 5JJCA 1J0CA 2WSYB 3RR2A 2CLEB 2JC3A 1E5XA 1VB3A 1TZMA 5I6DA 1VE1A 3VSCA 1KL7A 1Y7LA 1BEUB 4ZQCB 5E0KB 5D85A 1K3UB 2O2EA 1J0AA 4HPJB 5B53A 1TJPB 4D9IA 1TTPB 4OREX 4Y6GB 4D9CA 1JBQA 4D97A 5DBHX 4F4FA 4HO1X 1KFEB 3PR2B 5I7RA 1C8VB 2Q3DA 3PC2A 1TYZA 3AEXA 2CLIB 4D9BA 5B55A 5B3AA 3R0ZA 1J0DA 4KKXB 5B1IA 2TRSB 5IW8A 4D9EA 3PC3A 2Q3CA 1WDWB 1QOQB 2BHSA 1V8ZA 3PC4A 4NEGA 5CGQB 5DBEX 2C2GA 1KFCB 1K7FB 5D87A 3VC3A 4AECA 4D9FA 1Z7YA 5BW6B 4D9GA 1PWHA 1C9DB 2ECOA 3IQGX 2ZR8A 1UBSB 4QYSA 1O58A 4AIRA 4D8WA 2BHTA 4D99A 2CLHB 3IQIX 1A5AB 1FUYB 2CLOB 4H27A 3TBHA 5T6MA 4LI3X 1TTQB 2CLFB 5DW0A 1F2DA 4D9MA 2O2JA 5EY5B 5CVCA 5HBGA 3L6BA 1K8YB 5C3UA 2CLMB 3L6CA 4L27A 1M54A 1K7EB 4OFXA 5JISA 4ZU1X 5IWCA 1UINA 5J5VA
chains in the Genus database with same CATH superfamily
2Q41A 2J5XA 3UK2A 4B3HA 4KRFA 1NW3A 1Q92A 4LBWA 4ND2A 4AKGA 2CBGA 5AVYA 3RTGA 3H3JA 1R6DA 3QE4A 2I1QA 3QE2A 2OE2A 3QIAA 4O2LA 3KFVA 4WKCA 5IVDA 2XE8A 1SBNE 1Q50A 3VZSA 4IW3B 1XMVA 3EJ6A 3P27A 3B1VA 4Y6SA 1XE3A 3DCNA 5CHEA 2EW2A 3HJTA 4WBNA 2GAJA 5B6PA 2XCQA 5IVHA 1T4MA 4CKXA 3EA0A 5BNTA 4QBKA 5LOVF 4R2KA 3AHGA 3GX1A 2JJ2D 3NHKA 2ERCA 4GMGA 5A7HA 2WK1A 4BMCA 3UMFA 4BQOA 2ACKA 3KQVA 5JH7F 2XVXA 4LYGA 1BH2A 2YY7A 1KQ3A 3LLCA 4YAJA 4UULA 2AFIE 4TKVB 3T5GA 3BMCB 2WAXA 4GWGA 3QYJA 3R9KA 4TSRA 1KHHA 5F23A 5ELXA 4TMWA 2YKGA 2CNWD 3IT0A 2JA2A 2HA3A 4OQNA 3AI1A 3KQOA 4RYLA 5FOTA 1D7OA 4UCQA 4L9SA 5LZ2A 1QG6A 3E22A 3ZEIA 3WX0A 4XYEA 2Z4TA 3DEJA 3PCXA 4BQIA 4JP5A 3ROFA 1I01A 2OKCA 1NPYA 2VO1A 4H7IA 2V8OA 5ECGC 3ZXIA 1P2SA 4M8IA 5K8LA 1SXJC 3QFFA 2Y1FA 2C2XA 4UNIA 5LU8A 4IIBA 3SF8A 3F7TA 3QU9A 3U2QA 3KEOA 1EUDB 1WE2A 3DAPA 5CVJA 1I7LA 5KTOA 2IKSA 3ROTA 4KQEA 2BEWB 3WQBA 4DKXA 5JCOC 2HIHA 3BE8A 1OFTA 2OC4A 2P2CA 3CY6A 4FS3A 3ZWCA 4BNMA 2QE7D 4H4DA 5E3HA 3ECCA 3LZCA 2QTRA 3QUTA 4C7XA 1SXPA 1KRWA 2XUQA 3KDAA 3PGJA 2JFHA 3NYQA 5GIOE 1E79D 1UODA 2GZ3A 2HY7A 2XMGA 4R2JA 4P36A 2ASVA 3NC1C 1ZDMA 4E51A 1XZIA 2WFMA 2CLDX 3G88A 4IDAA 3Q72A 4KXYA 4S0XA 2F55A 3ZGYA 3ZJUA 1Y7HA 1G5FA 4NBUA 5AYVA 1CHNA 1CG6A 2HWYA 5LP1A 3DWFA 3K5HA 4EK9A 4P1ZA 1GD1O 1GUZA 1P1FA 3TG2A 2WHYA 2EBHX 1Z0IA 3S44A 3FMFA 4X64B 5AQ1A 3W7AA 3MWDA 4UXJA 3WV5A 4UD6A 4HH1A 1NNSA 1DARA 2PHZA 4D9EA 2NZXA 4FJ0A 2I65A 4CMIB 2XODA 3RVNA 1ZONA 2VDNB 5BR7A 1E58A 2O8CB 5CHYA 2K5UA 1DG1G 3GZJA 3R4VA 4D9FA 4W8OA 1VL0A 1PAUA 2HYDA 2QRQA 4H3VA 3BWMA 3EEOA 3EMKA 2VJDA 4LOJA 4CIDA 3URMA 2L17A 5A62A 1NBAA 1ONSA 1LA2A 1Z34A 4H6XA 4M0MA 3SYTA 1Z9BA 4A7PA 1GPJA 3VU8A 3KZXA 3OQBA 3ZY4A 1P62B 4PCAA 2WU0A 1GZ5A 3NGXA 1JKJA 4U9IS 4HDMA 1BYUA 1EFCA 1YGPA 2WJYA 4RFSB 2HJRA 3F6RA 4Z8XA 4HI0E 5DYTA 4EHBA 3ILVA 4BUJA 2RFLA 5BXYA 4KX3A 5E7MA 2WM2A 3O5AA 5TMPA 4D9HA 1NQ5A 2C2KA 5HX7A 4NK5A 1H6BA 1QAMA 4UU1A 5ALWA 2NTNA 2FH5B 4B1FA 2QM7A 3E23A 4FPXA 3MJDA 5E1DA 3JCZA 2YFKA 3FE2A 2QD5A 2OGZA 2QJTA 2I7CA 3KT8A 3QVWA 3ZV7A 1MO2A 1SXJD 4P0QB 3R9XB 5EMHA 1I0LA 3CTMA 3HKCA 3OMWA 4TZTA 3T52A 3Q9SA 3LTNC 4N5DA 1NW6A 3TZCA 1Y9JA 3H17A 4OQDA 5ENDA 3UJBA 1NQAO 2PT6A 4TMZA 4E6EA 3U56A 2HRDA 1PKXA 4QE3A 3O93A 4MYDA 1A88A 1U3VA 1X80A 2JHAA 1GXSA 2JRLA 3B9BA 4EG3A 2R7AA 4UHCA 5B1EA 4E7PA 1P0MA 1X14A 1I7QB 3OUTA 4GW3A 2DRIA 3I2KA 4JNCA 2CJYA 4IINA 5HCNA 1ULAA 3I01M 3T0GA 1N8KA 3L7JA 1LF5A 2CNLA 3MERA 1JR3E 3C48A 1ZIOA 2CLLB 3SF8B 1NTOA 1W35A 1YB4A 3ZY3A 3VVCA 4PIPA 1V6SA 4BB9A 1Y42X 3BORA 4PQEA 4U4AA 3WYNA 1E69A 1N8SA 4IZ6A 5AJZA 3M5DA 3MMNA 5DYIA 3L6OO 4BCDA 2QRMA 1VJ5A 3PU6A 2D06A 2HGSA 2WHXA 4JJ7A 4OBEA 3ML1A 5TGTA 3LZDA 4TMTA 3TKYA 3ZGOA 2EFCB 2Q0HA 5DO9A 1XP8A 3HCRA 1UMBA 3AFOA 4PZ0A 2XTAA 5TDHA 2YR0A 3V97A 1KQFA 1UP4A 1WHTA 1VKZA 5F1PA 3R0IA 4GI5A 3U80A 2R8XA 2OP0A 3DBLA 1SKAA 1Z3CA 1DIRA 1R15A 4FSDA 3U1TA 1KOGA 1DHTA 3OX2A 4RTJA 4R1SA 5A6SA 1JAHA 1MB0A 1QGAA 1MAWA 1EGVB 3E9ZA 3O1JC 1M8KA 3B20A 4XIJA 4ZIRB 2QI9F 1E7SA 2FWAA 3ENWA 4JGIA 2QDKA 5JAQA 3WSWA 1U0HC 4V0ME 4LXQA 4P3PA 1R0LA 1US8A 4HK4A 4I66A 3M4NA 3IDFA 3TNJA 5LOVA 1JHDA 3MBIA 4MS4B 3PQCA 4XD7A 3LQRA 4WBNF 2HGZA 2MCFA 5AMXA 1JXOA 3DEKA 3O47A 3RYHB 2IEAA 1RW4A 4NX2A 3RSSA 1D1SA 1ZGHA 1ZRNA 2QRVA 1CDZA 3CLUC 1A71A 3UJAA 2IU6A 1JPJA 4FKBA 1K4MA 2H7VA 4E5DA 1RRMA 2EX4A 2XIQA 5JWHA 3PQ3A 3GF4A 4LCBA 1KQOA 3OC0A 3S3TA 2ZWIA 1XAGA 3VAYA 3PGKA 2OBLA 1GGVA 1AG9A 2JW5A 2Z5GA 1T6BY 3UAGA 1Z2OX 5EMKA 1GG9A 1T8RA 3D6NB 3N8IA 5A7FA 3UWMA 4KVFA 2VWGA 4TKLA 2PKCA 4QELA 1Z4MA 1USGA 2QBYB 4GPD1 4DV6B 1KH1A 3RTDA 4AK9A 4OB6A 1Z82A 1Z4IA 1ZO8A 3RKRA 1Y3FE 1W2GA 3OEWA 2XBLA 3E70C 3E15A 1LTQA 2CNOA 4L6IA 1WWKA 3OE4A 4MKIA 1IBLB 1JWBB 3GLHA 4TOIA 4YV1A 4ZHSA 1G2IA 3N5KA 3ASYA 1Q12A 4MWOA 1IMOA 2BCJQ 3N8HA 3KPVA 3ZI4A 2REQA 3PUWA 1R3UA 4AL4A 2R8RA 3D4IA 4KV9A 5HJ5A 1N2IA 4ZEOA 5BV7A 3CTPA 3D02A 2CE2X 4IX9A 4MWDA 3QXGA 3VAZA 3ZKAA 4AT1A 2R2GA 2YOHA 3W1VA 2VDUE 1UWCA 1E62A 1FBTA 1CQXA 2R8BA 3DGEC 4KC0A 1A7KA 4FZVA 4ZVSA 3W2IA 1U1DA 3MGBA 2FWJA 3O3NB 2R4UA 4MS4A 2P2SA 4YRMA 3A28A 3EQZA 4J0HA 4OA8A 2DECA 1XZCA 4FT2A 1IEVA 1XI2A 3DEAA 1SQGA 2FR1A 1L7XA 4NF2A 1NRXA 2GT1A 3OT5A 1YQGA 3JALB 3DCJA 3FDZA 1P77A 4UBMA 1T3SA 4P7JA 3UFBA 2ZSDA 1Z33A 3DUFA 1ZNXA 4V03A 1JKXA 4ANFA 4QM6A 2X2FA 4FE4A 3WKDA 5K8TA 1Z63A 2M1XA 1BCRB 1V96A 3KHSA 1MIHA 1IK6A 3FPGA 2FZCA 3CYFA 4KQFA 2F62A 1GPUA 2AGVA 4RMNA 3FVTA 1PFYA 3UUFA 1U5BB 2HA0A 1CXZA 4KR6A 4NTZA 2Y92A 1KI2A 5L9AA 2IBSA 3Q6MA 3DUWA 4ZVLA 5SV2A 3TSOA 4U7JA 4R83A 4NCXA 1X3SA 2B94A 2N1BA 4C7MA 2Z09A 3CWQA 2BM1A 1GLGA 5I7OA 4IJWA 1G7CA 4OAQA 1L4UA 9MHTA 4I1YA 4F46A 4JI0B 2R11A 4FFSA 1J2YA 3Q7EA 2NVWA 1A9OA 2FYTA 3T12A 3CZ5A 4NHEA 1GU0A 2QW8A 4U0JA 3A04A 5BV8A 3ZLUA 4YLYA 3BGWA 1IEQA 2J6CA 5ITZA 2XVYA 4OXIA 3OZUA 1ETHA 1VL1A 2IXFA 5ALSA 3I72A 4IFEA 4L07A 2NNWB 2VS1A 4WVFA 1KYYA 2B1IA 4UXHA 4BNWA 1HT0A 2PX5A 3FBGA 3KLBA 4GKVA 4O5OA 4KXQA 3WNZA 1PVDA 1DV1A 4WFJA 3ZDRA 3ZWNA 1R0XA 3NV7A 3U48A 1KI4A 2WFAA 1EFVA 1DXQA 3CT4A 2ATIA 1Q77A 2K7FA 3QVLA 3LLVA 4M99A 3E9QA 2DP4E 4DNOA 4CT5A 5I45A 2IPAB 2VPYA 2NTVA 3GVXA 3Q11A 1IY1A 3I4LA 1OGJA 3K92A 3F1LA 1Z2PX 3TZKA 5HVNA 1VL2A 1AT1A 3D1JA 3LC0A 2BV3A 4DIBA 3JQEA 1AS0A 3I2HA 3LPLA 1TD9A 5KQPA 1NBMD 2VOJA 1PQYA 3JWHA 3NBAA 2VEDA 4HRVA 3V2GA 4DT1B 2AEEA 3K4PA 4HDQB 4YN3A 4XW2A 5CFLA 2DWOA 5DSXA 4MW2A 3SQMA 2O8DA 1H2AS 3ESDA 2GYWA 2RGWA 3V8BA 1OPRA 1UMKA 4QOGA 4QNMA 1AS3A 4ZT7A 3DLBA 3CRMA 2NG1A 2I4LA 2YW9A 4XEHA 5CT6A 1N9KA 3HBLA 5EP3A 4ASUA 3ILXA 4C78A 2AMYA 2IPOA 3ZN2A 4CCYB 3KO8A 2GZDA 3VNRA 1CZOA 1PW7A 5D00A 5HKLA 2IZ7A 2ZJ8A 3ESZA 3P5BA 1UJ6A 1FB5A 2YQ4A 3TIXB 2O8CA 4WLNA 5GVSA 1NN3A 3IBGA 2Q6OA 4G4IA 4RPJA 2JBAB 2B78A 4IF4A 4RY8A 2BUBA 5SZJA 3C3DA 1DQPA 1DT5A 4BCBA 4ITUA 4DANA 4WN3A 3EY4A 2PUWA 1AKNA 2Y76A 5FCDA 3G23A 1QB8A 3FDZB 2GOYA 4GKAA 3E27A 4E70A 4LWOA 4EZEA 5L3QA 2HJVA 4OG2A 1WD7A 4AY3A 3BM5A 1ZMTA 1G55A 1ZK4A 3D2CA 3N6XA 4L4SA 4D46A 3LCVB 3GRUA 4RKYA 5ESWA 3K9QO 3M6WA 5CFRA 4KW7A 4BLPA 1Y63A 1TYEB 2EFYA 2FXIA 3QOFA 4PN7A 1XRNA 4C88A 2VZ0A 1HRKA 3WKEA 4O2RA 1D1QA 1NY5A 5B58T 1V6AA 4CF6A 4YAFA 1DC5A 3S8YA 1S8NA 2C84A 4B6OA 4N39A 3D54D 2WRZA 3NTQA 3VO2A 1L4BA 3PWKA 5FLXA 1EWRA 3FSRA 3IVRA 4RHTA 1QONA 3ON5A 1KYWA 3W34A 2HCFA 4P4LA 4G0PA 4Q4HB 2JK0A 5GGXA 1SZJG 1YC5A 3M2TA 1DGQA 2IH2A 4CQMD 1UPTA 1TC2A 1GDDA 1W19A 2O3JA 5CJPA 4ZYUA 4BTVA 2GBLA 3NP9A 4P3KA 4Z53A 2W37A 4KOEC 4Z1OA 3PJGA 2JEZA 4F56A 2B30A 3SYKA 4MV6A 3UJ9A 1CT9A 3LCCA 1K8QA 1V16A 1Z45A 3L6RA 4FI3C 3C43A 5FO0A 4DWJA 1VJGA 4NG4A 3EXG1 4AY2A 3DBHB 2QVLA 2ISSD 1BD4A 5HS6A 4DIKA 3ADDA 2P27A 2QA5A 3UJHA 3GGGA 1V16B 1A9QA 2B1RA 1CUGA 2Q3JA 2X58A 3E2MA 3OPQA 4N5NA 4D56A 2BTEA 4JYCA 3H1GA 3TE7A 1GTMA 4D43A 3FPEA 4ZDIA 1RXUA 4AS3A 3TW0A 2C2MA 2KX7A 3V1MA 1HDIA 3HCAA 4KDCA 3WGHA 4Y0VA 1ATZA 2AV6A 2C3YA 1S2DA 2ON6A 4IDCA 1XQWA 3TD9A 2AW5A 4EBFA 1Y8QA 4QATA 1B2LA 4XXHA 5LDGA 4OF4A 5I8PA 3B5JA 4B7UA 2VDMB 4G1CA 2O1WA 3D8RA 2UXDB 4RZIA 2DY0A 3I2JA 1M6EX 3PGXA 4NDZA 4PC1A 5TVGA 4AF7A 4Q21A 1N7JA 2UZ1B 2Q5LA 4GWLA 1ZN8A 5DWVA 1NN0A 4QJ3A 5KYWA 1TOAA 4RFLA 2CHGA 3H2GA 4GOND 4LGYA 5KSWB 1T2DA 1O95A 1QIKA 2B9EA 3B3QA 2AI2A 1GZ6A 3OQPA 2IF2A 3I8XA 3QKIA 4WTOA 3E7PA 3LA8A 4UFOA 4B3IA 4MWSA 3CRZA 2ZIVB 3F6PA 2VHVA 3FDFA 1O9HA 3FWNA 3PG5A 1OREA 4KUEA 1EK2A 1FRZA 2C8KA 3H4VA 3LPMA 4C3ZA 4C7OA 1JH9A 1DRJA 5EP4A 4G5GA 1ESMA 3AESA 1N7HA 5SY6A 1H6AA 4F5ZA 2EG5A 2FEKA 4P6VF 4PEVA 2VHTA 1EEHA 3A0RB 3EFHA 4TTPA 1SM4A 4HNQA 5B3AA 5GP1A 1LC0A 4M3NA 1F60A 4INOA 4YTEA 3P0HA 2JFUA 2X5OA 1WQ1R 2YQ5A 4M0EA 2R9VA 1J1ZA 2CZCA 2ZI3A 2WWHA 2NU7A 1B42A 4KR7A 3IIKA 2FPMA 1EWVA 1PR5A 2AJLI 3EUWA 5ALMA 1A76A 3HDGA 1ZN2A 2QAGB 1CVIA 4FHCA 1D9XA 1XMXA 4IVRA 2Y9MB 4LBZA 1KAQA 4BN0A 5CXQA 4QEDA 2EHJA 1QP4A 4UOEA 3UOWA 1KYXA 3H0KA 3L3BA 4KLRA 4MWGA 1KXZA 3TBHA 3VKUA 1IM5A 5BN3B 2PUAA 2PUFA 4NSNA 1UXOA 2ZK7A 3C8HA 2BZSA 2PT9A 3HSKA 4NCBA 1JLSA 2B34A 2YXBA 2O0KA 3DG9A 3OA0A 2RJNA 4EJMA 3I9JA 1KR5A 4Z7JA 5TGZA 2FN3A 4WK4B 4F5DA 2CHUA 5IH3A 4B9EA 1G20E 3UY4A 1OMOA 3LOUA 1M74A 1WV0A 1GSAA 3NQ41 1LEHA 2Q5QA 3PFCA 2I2CA 2P67A 2YRFA 4FYKA 2BBOA 1B16A 3JYLA 4CNBA 3SZUA 1EB8A 4U9HS 2C3PA 2E37A 1SUWA 2Q0XA 1CNMA 3JQFC 3TQQA 1OD6A 4XQGA 1ZWLA 4Y0AA 5JDCA 1RS0A 2D5AA 5JCJD 2F9FA 2XBUA 4OXNA 4XD7D 2RG7A 1JNXX 2I3ZA 2PJZA 1KFKB 2ZUCA 2H2WA 2RMKA 3G5UA 3NPAA 1RYEA 2HREA 4M1EA 2VWQA 4UHKA 2LBPA 1PZNA 3ZGVA 1P2UA 3TUZC 3R9IA 3SFVA 3S29A 1E5DA 1I6KA 5IJ0B 3OFJA 1N3YA 3REQB 3QWIA 4JJ6A 4WNYA 2NXNA 1I5OA 2P78A 3A1TA 3C6MA 3ZK8A 3FVVA 1YZVA 4IX1A 4X95A 1U3DA 2XE4A 4COKA 3KXDA 4FDLA 2BDEA 2PXAA 4KWIA 4D57A 1JIUA 5KNDH 3QU7A 4FYVA 1XZPA 4NZYA 1W93A 1PCXA 1P2FA 1SCKA 3QJ5A 4DNQA 1EJ2A 2B1JA 3FYUB 1JNYA 2WINI 3GI1A 1J6UA 4K6FA 3PITA 2ISQA 2I8AA 1AK9A 2ZTVA 3U4GA 2Y4NA 3OPMA 2FSSA 5EHIA 3SYNA 2EZ4A 1AXGA 3A1NA 3C3EA 1Z2CA 4PRLA 4D8UA 3ZHYA 1CDDA 3WP0A 1QDUA 3GGPA 4HWSA 5I7AA 4AUEA 4S1PA 3BSFA 2AJ8A 3WYBA 2FKNA 1JTEA 3IIIA 2WC1A 3F4KA 4JEHA 7GPBA 1I6WA 3GPDG 4XWWA 3G5MA 2F7SA 3OZCA 4HQKA 3T7CA 3F0TA 3K32A 3FOBA 1T8YA 1AZWA 4PZPA 5KSOA 1XZKA 2OBNA 4ZJZA 1BEUB 5DSZA 3ZD8A 2C57A 1BEEA 2R7MA 4R0VA 3AF4A 1IBCA 1FPMA 2DTXA 1ZLYA 4JZYA 3IBSA 2D4HA 3LFHA 4A16A 4MJLA 3QYFA 3T3EA 1KFEB 3PR2B 1KEWA 1BAPA 1YCGA 2JAHA 2VJQA 4I55A 4FONA 3TNFA 3L9WA 3BIXA 2P3LA 5IAGA 5TT1A 3RVLA 3CCBA 4BQQA 3WL6A 2WMDA 1SKBA 1H66A 1L2TA 1AKTA 3Q3VA 2P3QA 4M1TA 1C81A 4MQFA 2ZBEA 1EVQA 3CMCO 3FHJA 4ILKA 3DLTA 5IUJC 4MA0A 3ZCXA 2IYSA 1XHLA 3M2PA 3C70A 5IHPA 1ZGJA 2RHOA 4GX2A 3U7FB 4WXMA 5CX4A 2ZTUA 2ZROA 2GK7A 4US1R 4F12A 2QK4A 4RU1A 1AQIA 5HZMA 1OF1A 2PWZA 1B26A 3K94A 4ZANA 4A6PA 1DMSA 1P91A 3ERCA 4YMWA 5KNCH 2C7GA 2CYBA 4JVOA 4NCIA 1YHYA 3AB7A 4ZAVA 1QH8A 3DBVO 5BUZA 2P9CA 5DW0A 1ZH6A 1N2OA 2GM3A 3ANMA 4WESB 3HUDA 4XPZA 4JVLA 3N7AA 3GN2A 3SY8A 1DAOA 2Q3HA 4DW8A 3TDNA 5JE8A 4IY1A 2GJKA 1HOXA 1RM0A 4NBKA 3OLYA 1V3VA 2CFSA 3TIIA 1C3XA 4KGZA 1G8GA 3AU9A 3KPYA 4EB3A 1N2EA 4ZI2A 5HM8A 1F5NA 1Y3BE 2WD9A 1V7CA 4O0LA 4WACA 4J3NA 4GMKA 1L1EA 2DAPA 1F5SA 3D2LA 4L95C 1MDBA 1TT7A 2R6FA 3NTUA 4MGYR 5AJUA 4OO3A 5ED0A 4ZVTA 3HUUA 4MPJA 3PE6A 3GG9A 2C5BA 1N6HA 1U3UA 4XLTA 3KCQA 2IE0A 3Q9UA 3JU3A 4OUDA 1QQTA 4WNAB 1YBFA 2I67A 2XLBA 1QIFA 1S3GA 1GPKA 1KEUA 1U0GA 2RGNA 2OD9A 4RKRA 4D9JA 2IHKA 5F3WB 1N77A 3RT1A 1IQ0A 1J2JA 4GBMA 4Q9JA 1UJBA 3ZX5A 3UMMA 4QVIA 2ASEA 3F6SA 2D54A 5ICCA 1L5LA 1Z22A 3WAJA 4LJRA 1F38A 3E18A 3L7BA 2CHFA 4DLLA 1FMTA 5L3QB 1H0RA 4E5VA 3NVKI 4E4YA 5LZ8A 3PQFA 1Q7RA 2WB2A 1E1NA 2IQ5A 2J9ZB 1O08A 3OE1A 3N2GB 4EPYA 2F3QA 4HJXA 4O3MA 4Y2SA 1C9MA 1G8YA 2HMWA 4CODB 2LIPA 2GBGA 1L3BA 4HFJA 3O7WA 3W5UA 4GXNA 3ZJVA 1L4NA 3PKJA 4OK5A 1ND6A 2DQYA 3BXXA 3K0FB 3TTSA 3CGWA 3LGSA 3CURA 4K7JA 5KYNA 2VUUA 3L4BA 1A04A 1L4LA 2Y4OA 2CCKA 3HA2A 3P2MA 1BRTA 1N0UA 1YR9A 2IE8A 4L16A 5INTA 3BSWA 3U4IA 2VIIA 2ZS9A 3LPNA 4KX5A 1I1OA 3BC1A 3DBRA 1R8XA 1UPBA 1KYVA 4NOMA 3WL3A 3DL0A 3B36A 3SKYA 3WLTA 2QTVA 4GL2A 3ABZA 1LI4A 4K6MA 1AMUA 3RIXA 3OCUA 2DUWA 3K30A 4EA9A 2I54A 1C0IA 2GZRA 3GGDA 1IWOA 1I51A 4DMUB 4EYKA 1X70A 5FWAA 5B4UA 3EJWA 3C15C 5CX1A 5CLJA 2VP2A 3GBSA 3INNA 3AHJA 4F3TA 1PS9A 1WB6A 2PQ6A 1CD5A 1WD5A 4WOPA 5T4BA 5C1BA 3O8OB 2Z3VA 3HLKA 2W43A 4K40A 2IK8A 2IEIA 1BW9A 3OWOA 2MYUA 4Q3KA 4Q24A 2SNIE 2XMPA 3O82A 1A95A 1RT9A 4LXUA 4DDKA 3SC2B 5AW1A 3D3WA 2D13A 2W58A 1FDRA 4FHGA 4LY0A 5D3KA 4XWOA 1S4QA 2E5LB 4C4YA 3TI9A 5EIWA 3UZUA 5F2EA 2DETA 2DBZA 3MXTA 1IEWA 1OIWA 3DT9A 4INAA 2ECOA 1YGYA 5CFMA 2PGNA 2FWNA 1R0RE 1BMQA 2XUOA 3VVLA 2DFTA 5D51S 1Z5WA 1T9AA 2B3DA 4Z9XA 4D99A 4ZI7A 3VU0A 3IPLA 5D3MB 5KHOC 2MMGA 2VXOA 3G13A 1AU9A 3QMVA 1YKFA 5ILGA 3R7WA 5I3CA 1LLDA 1LLQA 1N2CA 2HI0A 3FVQA 4AZ3B 1J00A 1OBFO 1FDSA 1L9XA 4FQ5A 2IOHA 3ISJA 3V4LA 4AWBA 2HWKA 4TMYA 2IP2A 2O7VA 2LPMA 3MN1A 4QAQA 4IIUA 4EZIA 3DYBA 1AQNA 3NHWA 2E0IA 3R8FA 3C1AA 1TI7A 1ECFA 1G3MA 1G5RA 1MORA 4PPGA 2O3UA 2Z4RA 3CLKA 2ZRAA 1FP2A 1XJ5A 3O1HB 4LGMA 2R6JA 3H5RA 4HQ0A 5H16A 3D64A 3TXAA 2O57A 3TS1A 2RH9B 2Q1WA 3HYTA 2FW9A 3KETA 3INTA 4D79A 1ZUD1 4JL6A 1VJCA 3AJAA 4K0RA 1OTXA 4DV3B 3PNSA 2I99A 3NOVA 2QMZA 4YQEA 3BXGA 5CLGA 3QSGA 3MZ0A 4H7PA 1YF3A 1QH0A 1J5XA 1OYWA 3GLFE 3ROQA 1NL3A 1SZDA 3GJZA 3UGQA 1ZHHA 3Q4GA 2Z2KA 4UAVA 1NVTA 2CUTA 3SQNA 1NVVQ 2AA3A 4Z0PA 4ZCTA 1ESZA 3KP1A 4HDNA 4MRSA 1OWMA 4IG4A 1AOXA 1ZQ9A 2H59A 2C82A 4M1ZA 1GPMA 3P2YA 3IHTA 1FU4A 3V1KA 2YINC 1KE1A 3Q5DA 1RYNA 3CX8A 3EWAA 1LD3A 1LJ8A 2HJHA 4KI7A 4LXYA 4YJKA 1B3BA 5CB4B 2WVAA 3FFXA 1IEXA 5FBZA 1VGVA 1XAIA 3RSLA 1M2WA 3EYAA 1O94A 4EJSB 2BI4A 1ZH4A 2YJ4A 3QFRA 5FPQA 3NI2A 5JV5A 3RNOA 3U4HA 2GSDA 2OG1A 1DL5A 1YJBA 1XTIA 3KUCA 2O23A 4IRXA 5BMVF 4PLZA 1JWLA 1DAPA 2J9YB 3K8ZA 5JBQA 4O63O 1LS6A 4BMXA 3DSRA 4HNHA 1OFVA 1TQ4A 1SHKA 4G0XA 1WETA 1F20A 3CSUA 4MQLA 1FW6A 3CGGA 1JEDA 4S1WA 4EWLA 3TB4A 3FOCA 1XLUA 2I1WA 2I4TA 4LJ8A 4WLEA 1E1CA 4AJPA 3G79A 3AB8A 1I94B 1H3EA 2QWXA 3TZLA 1QM5A 4FDTA 1ISSA 4I4LA 4B3CA 5T4HA 3GWGA 2AOTA 5EKSA 2ZZMA 2GBIA 4QU9A 2XOEA 2Y71A 3I9V1 3AKZA 2I8CA 2DMRA 4V2UA 1W8IA 2BFDA 3L8YA 2BTQA 4M9UA 4EAQA 5FA5A 5C5EA 5EJAA 3HJFA 1SCNE 1P7YA 1XKLA 3ZBTA 1JHRA 1JU9A 4I3GA 2AZMA 2BFBB 4BMDA 1GKYA 1WO8A 3CMMA 2IWRA 3LBFA 3L4EA 1N3IA 4ZP1A 2C5LA 2GEUA 4O3FA 3FYHA 3T0IA 2ZRHA 3TYXA 4EB8A 4E3ZA 5JWRA 1QIDA 4NENB 4G0MA 4L4XA 3ZWXA 5F7OA 1RDFA 4ZYXA 2XCRB 1ZGGA 5GQSA 2AXNA 1FLAA 3TPFA 2AF3C 2WLTA 1CUBA 4LI3X 3RTBA 1EGQA 1A9XB 2AC7A 3SZGA 1F2DA 4AIIA 3NNNA 1POWA 4GOKA 4I6JA 3VU9B 3O3MB 2Q45A 2OGWA 4ZI3A 1QVAA 1KEPA 4QRDA 5J58A 2VF8A 2VP4A 1UC5B 4GKBA 2XITA 3LAWA 1DAFA 2F4NA 1BE0A 4PAGA 1JLRA 1UFKA 1UFOA 4GF5A 1L5NA 3WP1B 2BSQA 1DELA 4O4LB 1DBPA 4ZZ2A 4G85A 3NGMA 1Q19A 2RB5A 4L1KA 3IE1A 2F9MA 1J42A 4HEA6 1QX4A 3B3FA 3OF3A 3UHOA 1IHDA 1X7ZB 4X5OA 1PDWA 2J9FB 4MUJA 1V3UA 4NCJA 2FFQA 4BVAA 4IVQA 4UM5A 1F3OA 3O8QA 2GVZC 2B92A 2C59A 1P8AA 2B82A 2RGAA 3DTVB 3HL0A 5BWOA 3IP8A 2X76A 2PAAA 1ZNWA 1GU1A 1LVUA 5A71A 5BNIA 1CUUA 4KXFB 5IYZB 5KMGB 4BFCA 4EZBA 4LHXA 1K92A 2V5UA 4X1KB 4TLLB 4B6SA 1P3JA 1QCYA 3TLEA 5LZ7A 4R81A 3PB3A 2BW0A 4JFAA 4ZVPA 1GGFA 5LQRA 1WCXA 4XDGA 1P9WA 1N0VC 2QZSA 4NBLA 1Z5VA 2H8KA 3EIQA 2O8NA 3JQBC 5KQLA 1PS0A 3A2NA 4EA7A 3GPBA 1RWPA 2X41A 3EIUA 3KM0A 2QY6A 4PE5B 4A0FA 9GPBA 3P45A 4WGFA 5TB5A 4E2XA 1SC4A 3OCXA 4XB2A 1A2KC 1JXAA 1OXSC 4NG5A 3WGOA 3WK6A 4F8EA 1F0PA 1H2XA 6NULA 3GLIA 1SNYA 2VNHA 1LX6A 3A9SA 5CM9C 5ESDA 3S27A 4DG9A 1KDZA 2D62A 1E98A 3B7WA 3KWFA 4H7EA 2R1ZA 3FUCA 4H6PA 5AOCA 4UFPA 4D5EA 1F51E 2KWIA 1PEYA 2APJA 5SYNA 1XTSA 3K9HA 2EJWA 2GO1A 3L1HA 3PPIA 5G1PA 3RU3A 2I1VB 3ZV6A 1CRLA 3HGTA 2VSFA 3WISA 3T5AA 5KREA 3ZWPA 2Q8NA 1LPOA 2OFXA 3BD7A 3QY0A 2J3MA 2J0SA 5BSHA 5FR1A 4G25A 1FP6A 4JI4B 1CJVC 1TMOA 3E61A 1RACA 2C1XA 4QOEA 5ELMA 5FNVB 5C5DA 1J97A 2W6ID 4KL8S 4KN6A 3R5TA 3BMNA 4NI5A 1RJEA 4DARA 2IZOA 1RI2A 4F0JA 1UXGA 1P0QA 2IF0A 3FMPB 4OA5A 5FUVA 4TQAA 2QQGA 2PTGA 3ICWA 4G0NA 4DUPA 1RPZA 3DR5A 3GLRA 3D9QX 4YO7A 3KJZA 3RS0A 4W9MC 1QOQB 9ATCA 1H9BA 2WTBA 2IKQA 3BXHA 4B83A 2EX0A 4ABTA 4ZPJA 3RSOA 4L8LA 5HNKA 1O95C 1NVWQ 1O89A 2PL5A 3HSSA 4IDGA 1CYDA 1TZBA 5BYAA 4R3WA 5DIFA 3T9BA 3LIIA 4CMIA 1NN1A 1M6YA 4IEIA 4TSFA 3IQIX 4RQTA 3C41J 2O2SA 1EK6A 1KH2A 2C7BA 2J3DA 3K72B 3AKDA 4RQUA 3RRZA 4BBZA 4E21A 1B0ZA 1W75A 4BXOA 3HFGA 3WHIA 5A0TA 3C8DA 4OH7A 2BP7B 4BFTA 4EUKA 1YU6A 3G5AA 4MP3A 3WMRA 1EUQA 2HW8A 2JIOA 2XSZA 3DBHA 4NYMR 3ACCA 2FW6A 3ZJ5A 4FCWA 2YRWA 4KLCA 1FNNA 4ZCLA 2Q50A 1SIOA 1DINA 1TMGE 5CW1A 3C2QA 3WAKA 4DBLC 4YRFA 3M6LA 2CLSA 2HMVA 4MJXA 1EZZA 4RIEA 1J56A 4TYPA 1XG5A 1EVIA 1V7PC 1TYDE 4HXFB 3V1LA 4MRMA 3WLOA 2M6SA 4MUNA 1M0SA 1O0CA 2EKZA 2Q1TA 3DFZA 1U3CA 5KVCA 4GR5A 4D9NA 5IDQA 2Q62A 4B6QA 1UOPA 3GUVA 4W99A 1KZ6A 2Y99A 4J4HA 2AXQA 4MUXA 5A9RA 1IUNA 2E2WA 1Z12A 2WJVA 5DNAA 1JX6A 2Q3EA 4HGQA 5E0OA 3DEIA 3SEFA 2XNSA 1RLUA 4U00A 1D2MA 1GQ2A 4PV7A 1USVA 3X1KA 4NQRA 3TQCA 4YBRA 4RVHA 3LXUX 3QVXA 1H69A 2P2NA 2Z8YA 3IP1A 2XYRA 4H0CA 5EJFA 4FIDA 2AK2A 3M4ZA 1ECBA 1Y9AA 2D1TA 5F51A 6Q21A 3UAXA 4MJ3A 3O3CA 1YT5A 5AO9A 5LQJA 1LW7A 4NKRA 3WLAA 2C83A 1DJMA 1BXRA 4X92A 3MNFA 4E4TA 4GMFA 1N34B 1DJPA 3AG5A 3KHTA 4Y9UA 1E1LA 3RSQA 1DAGA 3AP2A 1EVLA 4PW0A 1ZIDA 3FUXA 1R7RA 3OQNA 3HZRA 3NUGA 3PSHA 3ZDFA 4PTLA 5AJHA 2H2IA 1B8OA 4ND6A 2OFOA 4PFJA 5SZKB 2Y0CA 4M2LA 2BLLA 3WL8A 4OD0A 2LIVA 2QRVB 2ZBDA 4XGNA 2ZRBA 2VOEA 1FC0A 2OV4A 3LQKA 1J0EA 3QVVA 5CT4A 5A4AA 3L8HA 3JW8A 4FSXA 4QPNA 1N6PA 3MJCA 3RSFA 4Q19A 2V1XA 3FPKA 3UBMA 4ER7A 4RXTA 1Z0SA 3FWYA 3JZDA 2XZDA 4PHCA 4ZYTA 3PUVA 5K0BA 3KOUA 3UHJA 1NG1A 5FA8A 1M6WA 5BSMA 5K8JB 5J3JA 3WZMA 3EQ7A 3TNDA 1UJNA 3ZXSA 1V1RA 2ZJYA 4ZOBA 3O8LA 4CQNA 3GA5A 2M2IA 3ZV5A 2YRXA 2ZATA 2A58A 1I32A 1TJ5A 5DMHA 3I1FA 2CZGA 4HO1X 5F7JA 1X7YB 1NIPA 2VJOA 3HXTA 3EGCA 4QPPA 5JJ5A 3FOAA 5JALA 1V8FA 1JIQA 2I5PO 2WF8A 4M6WA 1Z8FA 2VQ6A 2PMEA 1CC1S 1SGWA 1Y80A 2VRCD 1Z4PX 1J8VA 2YWEA 3H5AA 3M7IA 3RD5A 1NRIA 1UBOS 4J0CA 3ZLTA 1HT1E 3L0BA 3ZHQA 4K9OA 3ROZA 2QU7A 4B2PA 2X5XA 2QG9A 5CFQA 1M3SA 2CKDA 2I6FA 2X5KO 3EXHC 2JG3A 3MD0A 5D87A 2AQHA 4MP6A 2PYDA 3F98A 4IEEA 2IVFA 4KQ2A 2G5CA 4BQFA 1R9MA 4IKPA 4KIUA 5KB3A 1T5DX 2NSYA 3WRYC 1SUAA 1W88B 4X54A 3H87A 1XEWY 4G23A 4AJ2A 1STOA 4NPAA 1H6DA 3TZHA 4CLHA 3VOBA 3QX8A 2BFMA 3H5OA 3PNPA 4DTIA 2QJWA 1HG1A 4UASA 3RREA 2GDJA 1PZGA 3HM2A 5E2IA 4EKYA 1E8DA 1TJNA 3NZEA 1C1HA 3QV1A 1ORTA 3PFKA 2JCBA 4GI7A 1E6UA 1RXSA 1QQ7A 1GZHB 4GDMA 1MQ8B 1SUCA 4RTSA 4II2A 4FCCA 5JCJA 4TWBA 1P80A 5L6LB 4K81B 1HLGA 3T7KA 4TYNA 1LU9A 5ALEA 1JG3A 5AKJA 3DKPA 4QBIA 3N2KA 1ZM3A 2GPNA 5D86A 2QL7A 2ETXA 4R4JA 4ZQFA 2P6MA 4HZGA 4DQVA 1E7QA 3PX3A 2YHUA 3AJRA 1UBFA 4LPKA 4X7BA 3RYFB 1N1GA 3ZVKA 3VOSA 3TEJA 1L5ZA 2R25B 1OWPA 2ZTMA 3CX7A 1SEPA 2B21A 2P0AA 3F9IA 4DA7A 3CRVA 3GWZA 3BN3A 2ZI4A 5HQ3A 4BUCA 4RLHA 4UPEA 2FWMX 5G02A 1G6HA 1Q95A 3QRWA 3AHEA 3ITDA 3DBOB 2V7TA 2AQIA 2VP3A 4I1RA 4YWHA 4EMUA 1HSOA 5E38A 1LFDB 3A6GA 2JPDA 3JWEA 1YB2A 4AKTA 1UBNA 2DWCA 3S6JA 2WNSA 3BDVA 3PUHA 5HF8A 2WSMA 1QF6A 1EQ2A 3JVUA 1PEKE 1MO6A 1WQ4A 4BZWA 3B78A 3QEKA 2I7DA 4OP2A 2ZUDA 1Q3KA 1ZM2A 3FA2A 3K0FA 3NJRA 1TIPA 1NLZA 3WADA 1BEZA 1LSSA 2AEMA 2ZIXA 5EWMA 1YTLA 3HEBA 5K0EA 5DYNA 3OTOB 3UMRA 1BCRA 1M2JA 2IYOA 3SD7A 3FHCB 3EPPA 2ORVA 1X94A 1RAIA 1XMSA 4JXZA 4B7ZA 1SU8A 1ZI8A 5LQMA 2BMVA 4ZCQA 1BCSB 1P1RA 4DBLE 1NI5A 1E9RA 1PK7A 3CEMA 5I8ZA 4DUGD 1JEYB 4BFXA 4Z4FA 1WUKS 1X7GA 5G4LA 1TMYA 4OGFA 1JQDA 3HN7A 3IQWA 1VG1A 4TV9A 4MO9A 4XGQA 3E4DA 2HLDA 3BQ9A 2QIPA 4GSLA 2O5EA 3MF4A 4OX9B 3GP5A 1U7OA 2P9TA 1JEAA 2PKRA 1Y5NA 2AX3A 3SJCA 1ZJZA 1EK5A 4OI4A 5AHXA 4F97A 4Z4HA 3ADCA 5J40A 2WABA 4YJ3A 1W46A 4DJFC 1JEQB 1T0UA 1PO7A 2YWXA 1OHHA 4IQ0A 2GJSA 2NU8A 2ZFUA 3U26A 3UHFA 3LT4A 3QTTA 1SKYB 4M38A 3RRJA 3O83A 1MUUA 2OAEA 3E9YA 1GCAA 3MA0A 1SKMA 1Q1QA 2HPZA 2O0JA 2FK7A 2W90A 4N3CA 4UM8B 4HVLA 2C54A 5C5IA 4GR9A 3S2GA 4DLVA 1CUXA 3C7DB 4FB4A 2DPGA 1T24A 2UVPB 3OTIA 1TCVA 1X42A 1O4VA 1WNTA 3E7DA 3SC6A 3U3MA 3V8RA 4BEJA 4UJ5A 4V0RA 4PNPA 4DS3A 3ND8A 5AK6A 3PR3A 3O8BA 4Y2YA 2AE2A 3SAJA 4URVR 3ZU5A 1ZOLA 1U28C 3KS9A 1LVGA 3GMDA 1H8EA 3JQAD 1NW4A 4PLPA 4OXRA 8ATCA 1NLUA 2JAXA 3P94A 2G9ZA 1E6CA 2ZR0A 1BOOA 1FMLA 1K7SN 2OLKA 4RS4A 5DNEA 5B3JA 4X0EA 4FE3A 2NZ8A 3L5KA 2RSLA 4EJFA 3EXAA 3JRNA 4B34A 2C31A 1DOZA 3BF7A 3IHKA 3ROEA 3AERB 3WYAA 3PPYA 1S7GA 1QMGA 3BQMB 2V0GA 5F3RA 3H75A 4WCFB 2YQZA 1NUAA 2DFVA 3W1WA 2C42A 3DXYA 3R3WA 4KYTA 2JLXA 3OEED 4C3UA 3C24A 1R5JA 4GYJA 3UQYS 3FFAA 2W6ZA 4GGMX 3A4YA 4DDTA 4HDSB 4CM5A 4GLBA 2XTMA 1CR1A 3IALA 1O54A 4WLOA 4YMTA 1OLSB 4IH4A 3STUA 1X38A 5TQ0A 3U7EB 4J0EA 3W1EA 1OROA 2JFWA 1WVIA 2A5GA 2J0EA 1B15A 1L4YA 3JTEA 3OKFA 2B4AA 5CDFA 3SNKA 3ZU2A 2PTHA 1L5HB 1XQ9A 5KTYA 1H9CA 3V1YA 3KVNA 2PX6A 3RU7A 3HFJA 2GVDC 3QKRA 4G26A 3NAZA 4OHRA 1XZGA 3KKQA 3TW4A 4HS4A 1E3SA 1SOWA 3IVAA 2YL2A 2A0UA 3CZRA 3QI2A 3TR6A 3K6SA 2ODQA 1ODLA 4M9ZA 2PY6A 3LDHA 1YS7A 1KI6A 2QUHA 3LHIA 1TUEA 3OZEA 1IJKA 3NC4A 3P97A 1NOKA 1W76A 3IAFA 1J7JA 4FEAA 2QZZA 2M6KA 1PN3A 2RIRA 5FWDA 2H2DA 2GPWA 3X2EA 4CG3A 3WGYA 1QZZA 5I9IA 1I2MA 2OBBA 2ZITA 4KLAA 1QAOA 3ZS9A 5DNUA 2G7ZA 2AFHE 4HQLA 4L74A 5KTKA 2BE9A 1JHZA 1U2TA 2BOVA 221PA 2X7HA 1IIRA 3GRFA 4EB6A 2CDAA 1XK6A 2AI3A 5E2BA 1YI0A 2F2TA 5IN5A 1GKIA 3IELA 5IKXA 5MHTA 2MSNA 4PZAA 3THXA 3WHPA 3U31A 1CUVA 2NTEA 3JATB 4KWEA 3VPGA 3CT6A 1HSZA 5JMWA 3I9FA 2X6RA 4I9GA 3SJZA 5BV2P 2YV1A 1HDCA 1M8JA 5EHNA 4YCJA 3ZHXA 1H2RS 3W2HA 4OGLA 5TMEA 3EPJA 5I6DA 3VNVA 4DDWA 3RT9A 3TVTA 4OHPA 4L2IB 1ZBDA 4ND4A 3DFFA 4GRIA 4QD3A 4CT4B 5ITZB 3K9FC 2ODEA 3I04A 3IPRA 4IIFA 3KOXA 1KZ4A 2YCLA 2QLMA 5HEKA 4Y7CA 3BIWA 1T43A 1E63A 1I5EA 2WG1A 5GOTA 5BR8B 4X60A 2FOLA 2IZ5A 3N87A 2BGNA 1NT4A 4P38A 4I50F 3UFXA 4AKEA 2XUPA 1GEGA 3C97A 4ERXA 2M98A 1OJ7A 3QLEA 4NYJR 3I30X 1R9NA 3ETGA 3CZ4A 1ZH8A 3PC3A 1V41E 4JROA 3E6AA 1CFZA 2AFIA 2ZI6A 2VHZA 3TOCA 1FEZA 2ZXFA 4PAQA 3TBFA 3AONB 2XD9A 2ZSEA 4HH0A 5AW7A 4YBZA 4PHGA 3AI3A 1JMKC 5JZBA 2VZ8A 5HQJA 1CS0A 1NGSA 2JATA 5E1BA 2O2CA 3DCIA 1O87A 3T7TA 5H8WA 1JDZA 1TTQB 3QVGA 4N5MA 3KTDA 5CVCA 1RC1A 2C9CA 4HFRA 4E94A 3TLKA 3PYLA 5KVAA 1T36B 1SC9A 2G17A 1DBIA 3D8SA 1HETA 1NFFA 2Z1MA 2AX4A 3ABQB 2ZB3A 4JXXA 4NZOA 2CSXA 4D45A 1QANA 1YDEA 4YRPA 3A1SA 4BCCA 4YFYA 4X7MA 2RHLA 4ZVQA 2WZCA 4R98A 3D0QA 2O1SA 3TTVA 3SIRA 3WMGA 1TX4B 2A5YB 1CRPA 1IPHA 1O77A 3TF5A 1BVYF 5C7YA 4DUGA 1Z18A 4AUKA 4IKEA 5HGXA 3WYDA 5H80A 4BC0A 1WUTA 2WMYA 4G8JA 2IOYA 2VDPB 3K1AB 1ZOOA 2WMOB 4FEYA 4Q9LA 1CRZA 2VVTA 5K0JA 2H3EA 2VJKA 4NCAA 5JYCA 2IW1A 3OE7A 5IAEA 2BGJA 2ZSFA 4P7FA 2QYSA 1S6YA 1G8KA 1X1QA 2XF2A 5EWLB 5TGDA 3RRFA 4BN4A 1TZ2A 1AMOA 1JDTA 1Y81A 3GUYA 3PXCX 3KSUA 1IAQA 4FHEA 2F3TA 1CEQA 3UMBA 3HBAA 1KNXA 4X85A 5DGCA 3PI7A 3NONA 3OM9A 4EH1A 3ZGNA 1EBFA 5JTUA 5CB4A 6LDHA 3IBCA 1FSPA 4PHFA 2C7PA 1D2EA 4L5IA 1ANKA 3VOTA 2EFEB 1KO8A 2VDVE 4PNHA 1KSGA 3S28A 4AS1A 4MJ7A 1U28A 4W4TA 2RI0A 1QV7A 2LCFA 4MPPA 5COAA 5THQA 3V8MA 4I81A 1T6YA 3EY9A 4KNVA 5ABPA 4ZYZA 2A57A 1COWD 3FR8A 4GE3A 5K8VA 4F3CA 2ORWA 1Q16A 2PQMA 2FR8A 3TO5A 4F4UA 3GAAA 3NTXA 2AE1A 3N8GA 4KBGA 4P35A 3RU9A 1W4ZA 3O31A 4DQLA 2FJUA 2WUFA 1XCGB 1BU5A 4RAQA 4HGNA 3PJRA 3OI7A 3DE7X 1PJZA 4L7QA 5LA6B 4TSFD 4DM3A 1SUBA 2ZRDA 3WLJA 1IM8A 3UG6A 5BQ3A 1T5BA 2CC2A 1OI3A 4V1CB 2XUGA 4ARAA 1XZHA 3JPWA 5BY2A 1RYDA 2VYVA 1OFUA 1C80A 3FPFA 2WU1A 4HPJB 3NRBA 1LDNA 2HU7A 3B85A 3I76A 4LHWA 4MKHA 1TAHA 3FSEA 5CM2Z 2JGEA 3EG9B 3EGXB 4EG4A 1O8CA 3K1TA 4LJKA 1HZZC 1TLFA 3QMMA 4L8GA 4U7WA 3VZCA 2O8FA 1DBRA 2W8BB 3S2FA 1D09A 3GH1A 4KKVA 4DMLA 1W5EA 2ZRIA 4QUDA 5A5FA 2CZQA 3HKCB 2Q5HA 5K9ZA 3QTBA 5FR2A 1PZHA 1DV2A 1PQWA 1PQUA 4BQSA 3KZOA 3PPXA 4QKQA 3QEMB 2FPKA 1ZW1A 1B6GA 1JWAB 3BBPA 3BILA 2OHVA 3E7WA 2BGTA 3D3KA 3HCPA 3OOJA 3Q87B 1QCDA 2WP8J 3IXMA 4HX2A 2IHVA 4F1WA 2Z56A 1TUGA 1E0KA 3IEUA 4YAKA 4YJGB 3S2EA 3AF2A 2CMDA 4EW6A 3T3GA 5CLFA 1VHLA 4JQCA 4PC3A 2QRZA 4NMLA 4M55A 5DGIA 4X6YA 4XYLA 3H5NA 1K8YB 4B73A 1RBQA 1JBEA 4KO3S 1Z8DA 5E8RA 2VP0A 3Q0TA 3VTFA 1YVPA 3GCDA 3I1IA 3BMNB 3U19A 3EXEA 4KDFA 2HO5A 5JSZA 2CDNA 3DNMA 2FDXA 2NN3C 2QR2A 4IFTA 4QGAA 4LXIA 1N6RA 1QC5A 3SF0A 4HMPA 5C80A 2J4DA 1YBAA 2WJPA 3CONA 2ZRGA 4ARZA 1EINA 3P2IA 3PF8A 5FBWB 4Q3LA 4DJJA 4TVBA 5CDSA 2WJHA 4RZUA 5CDGA 1Z6YA 3DF7A 4QXOA 4CL8A 2WF9A 5KPJA 8AT1A 1QGED 2XDQA 3A32A 1GFSA 3P4XA 4O4HA 4PVDA 4S2UA 1V5EA 1DWOA 1OIXA 3BL5A 4DMRA 3LK6A 3BMOA 4JXKA 1IRXA 1FFBA 1FDUA 3ZHRA 4DV1B 2Q3MA 4WCVA 1DO0A 1SVSA 1YKSA 2MSWA 4JT4A 2GUGA 4R1MA 2NVUB 3HI4A 5T57A 3HJGA 2YHBA 2CFIA 1XMIA 4ER6A 4BMOB 2AOVA 2HO4A 1GAWA 2PEYA 2PXCA 3OOEA 2EWVA 1HKUA 1M7HA 4EUNA 2P91A 4K6CA 5HQTA 4UMVA 4R9SA 3LCJA 1LPSA 3UIEA 4JYMA 3ZCRA 4X00A 4YJGA 1R1DA 5KQRA 1RADA 2RC6A 1KO4A 1KMHA 2OO5A 4LMRA 4MICA 4Q0MA 1VCNA 2H00A 4UU7A 3UXEA 4P53A 4X7PA 3AETA 5AI9A 3X1JA 5CH8A 4CJXA 1LVHA 2XH8A 3KNZA 2W6JA 2FV8A 1L4MA 1NMYA 1IHXA 4OOEA 2VBIA 1V11B 5JXHA 2YZ2A 4TN5A 3GJYA 3AM3A 2UUCB 2W6NA 5B12A 3DDWA 3O90A 3THWA 2HT6A 4IVPA 1MHTA 4MSUA 1L7VC 1CQJB 1N7IA 5AXCA 4XRGA 3QVSA 3EFOA 4UVHA 5FORA 4ZCPA 4OQEA 2GN2A 1NMQA 2X8AA 4GQIA 2ZQ5A 1G8HA 5FHRA 4K87A 2A84A 3H83A 3UJ3X 3VX4A 4EX7A 2UUAB 1C1XB 1LPBB 1GILA 2IEZA 1RBMA 3OQ1A 3UTDA 2ZB2A 4WT7A 1H5NA 2C4VA 2PNFA 3GJTA 4FEGA 4DSOA 1JXMA 4E09A 5FOQA 1WTAA 3R5FA 1W9MA 1YDMA 3COVA 4YH1A 3DF9A 4M54A 1JG2A 3RRNA 1PBNA 4GPEA 4NXMB 5CCDA 5BSVA 1NP3A 3QU4A 4RD2A 2CXUA 3ABOB 2ZJZA 5BUSA 1QZUA 2PD3A 4IRMA 3WMWA 1A3CA 2AWNA 3DEFA 2FPPA 3FFBA 3IT2A 5JQGA 2OO7A 1CJSA 1NMXA 2PXXA 2D0PB 1E3WB 2HXSA 5U1PA 5JS1A 2NP7A 1GRVA 3AMVA 3K15A 1MJ5A 3OA2A 4PQRA 4KPGA 1KFCB 2R62A 1VFPA 1Z0JA 1M2GA 3WGLA 4BZZA 4EF5A 3D5EA 4BV3A 1E3EA 1MT0A 4FDVA 5KNDA 1UBRS 4FX2A 1ZL2A 4LE1A 4BEBA 1YQ9A 2EZ9A 5EHQA 1M2VA 1O3YA 4IGAA 4U7FA 1RWKA 3ECSA 1NKVA 4JZKA 3HTXA 4M9XA 5DWDA 4UU0A 3M34A 4I6EA 4ALLA 2CL6X 4ZJYA 1M54A 1ADYA 1RYBA 4IIYA 1YR1A 4MGZR 1GY8A 2ZYAA 4ZXPA 3H11A 5TE9A 4AJ1A 1NQXA 4NOJA 4YC7A 1FXSA 1RWVA 2P90A 4FZ5A 4N6OA 4EVQA 1RRVA 3ELWA 4S1VA 2GF2A 2P6UA 1XEXB 3CZQA 2C3UA 4DMFA 2XRFA 3PD7A 2FUG6 3U44A 2QRUA 2BKUA 1QHHA 3KAPA 3QQPA 2BRUA 3C85A 2VA9A 1RI4A 1QB7A 1RWBA 1WKBA 3T7AA 4O2BF 3O03A 1WB9A 5DP2A 1GZVA 4Q82A 4MH0R 1B7GO 5FUXA 4CW7A 4BASA 1WB4A 2SKDA 4CMEC 2FQYA 1P7CA 1RMTA 4JUIA 3HLYA 1Y4SA 5ERYA 3CM0A 3V4OA 3R41A 2FLKA 2I4MA 2HQSA 4ZRNA 1F6DA 2CCJA 1GQOA 2X40A 1M8GA 4FFBB 2ZKIA 2JF0A 3D0RA 3EOZA 5AICA 3VR5A 5JYEA 1IC6A 1VE7A 3FI0A 3FB1A 2MTBA 5HJ2A 4KQKA 3PR1A 1H2EA 4QGHA 4XJSA 2RKBA 2ALJA 5ICFA 3MWKA 1SMKA 3NB0A 4MW1A 1CUYA 5CITA 4DLUA 5FO1A 3UJCA 5A1JA 2PRSA 4QJ5A 4AD8A 4TMXA 1E2MA 3SSAA 4CMGA 3JD0A 3PJFA 5K6AC 1N0WA 5CFNA 2EL7A 3MB5A 1AUXA 3FFWA 1BNCA 2JGDA 3HKDA 2GM4A 2GYUA 2O3TA 5KYUA 3GV0A 2QD3A 1LNZA 4I5GA 3MRSA 1ENOA 1VA4A 3HO1A 2VQSA 5K3AA 1P2BA 3L0CA 1WY7A 5LIRA 3X0DA 2GLXA 1XN1A 1Q7TA 5I7UA 3MCVA 1IUOA 1CVLA 1L8QA 1UUFA 3LSTA 3HYSA 4M0UA 1J0CA 2Z6VA 4PLYA 5EYPA 1WXWA 4JH0A 1XDZA 4MHOA 821PA 1J4AA 1RPTA 3NWEA 1SULA 2PRJA 5K4GA 5E0KB 3MAJA 2DC1A 1JQ5A 3EFOB 5A4IS 1TJPB 1W34A 1SCUA 2AR0A 1WUIS 2NLOA 1OX5A 1SHTX 1E1RD 3WBJA 5KKCA 1QK3A 4XOIA 2F1RA 2I7VA 3KPJA 1WW8A 1IATA 2FEPA 4PX2A 3JASA 3P5SA 1DEAA 2JLRA 4G63A 4ZEXA 3GUUA 1JE0A 3ORSA 5JT1A 3KKPA 3LS2A 4W1RA 1QKIA 3CF2A 3EGOA 1T1EA 3ZCTA 4OU5A 2IYLD 3USES 2ZDHA 3PA6A 2Z5LA 4LJLA 3MSXA 2FSVC 3C6XA 3ICPA 4WNIA 2BHSA 1AZSC 3EISA 2YJTD 4GPBA 1YQWA 1ZK0A 1NOIA 2O50A 2VJPA 4POAA 1FXWA 2YZNA 3MGKA 4UNSA 5E8JA 3WL7A 4FYHA 4DNFA 1SUIA 3KHKA 1U04A 3DXZA 1MJGA 1JKMA 4EITA 4KXWA 3ANYB 4RELA 3MIIA 1XKXA 1ZK2A 1RE0A 2G77B 5DBGA 5BWMA 5C8DA 3GEGA 4OYHA 3ZWAA 1W2WB 3H9QA 2OCPA 2ZVPX 3FPBA 1CJKC 3I0NA 3JARA 5CTAA 2CLOB 4UE3S 2ZRNA 4A2WA 3F2VA 1I8TA 2JGDB 5DGTA 3FRJA 3EDRA 5EPUA 4HMQA 3IUYA 2ZAOA 4I5DA 1R88A 1O9GA 1XNJA 2H5EA 2JIQA 1AHIA 2C0CA 2PMDA 4RF4A 5FBLB 3SBDA 4HD8A 1KYQA 5A06A 1NAHA 1WR8A 5C4IA 1URPA 4EVRA 5AESA 5JISA 4TMVA 1SVMA 2I55A 4LKOA 5BSFA 2RHDA 3R5SA 3LE8A 4DV7B 2VKTA 1F9AA 3FYDA 1ZP6A 4YPFA 1W1WA 3IV7A 1Z62A 4QODA 2ECQA 5J2TA 4PHHA 3CUVA 2FVYA 2ZTLA 2A1TR 3BGSA 4CM4A 3K20A 2I2BA 3BICA 4BQRA 1BFKA 2BM9A 2BMAA 2X42A 3OICA 3G2IA 3KT6A 4FOTA 3PQ5A 3HNPA 3CPEA 5A3VA 1WMEA 1E0DA 2EIXA 2GKGA 1BC5A 2VEOA 4AN0A 2P0EA 4LXGA 3N75A 1L4EA 4IHAA 2SCUA 4MPDA 4ZAYA 4RTRA 4RTKA 4QDOA 4QREA 4R2HA 1EAMA 4R8RA 1CR4A 3ZJ4A 3ENQA 4UEKA 4TL8A 1OT3A 2Z3ZA 4QU5A 4K9RA 1T1SA 2EZ8A 1MXFA 1KSFX 2XRZA 1ABFA 2R86A 2ZAMA 4RF2A 4RMGA 1FNBA 3R40A 4JC0A 1H1LA 4KU4A 2D3TA 2QM3A 1EDZA 4XDYA 2JD2A 2KBEA 2WW8A 3OAAA 4QXRA 3LXRA 1O5TA 5EIBC 4CUJA 5C18A 3NVAA 2YH2A 4BRWA 5JS8A 1FSFA 3U7QB 4XJVA 2OZKA 2VFAA 2DBYA 1XVVA 2E9SA 3GOQA 4YI3A 4ARVA 2FWPA 3AH8A 2Y8EA 5KC8A 3WXBA 3VOAA 3S70A 4B31A 3K4QA 3NTLA 1KJWA 1B6TA 2IZ6A 3VDXA 3C5CA 4ZV7A 3IOEA 3EW9A 3ND5A 4KAAA 4KPFC 3G6KA 3X43A 4BZXA 8LDHA 2ZIFA 4TYYA 4DR7B 4QVKA 1K5HA 721PA 4YRLA 1X7WA 4MQ4A 3T35A 1ZLXA 4YHHB 1XN4A 3IERA 5TF0A 2VG8A 3IOYA 4JKYA 8OHMA 3QPDA 2PN1A 3OG9A 1E1MA 1RCFA 4IO0A 3WMEA 4CXMA 2VQ3A 1KI8A 3G7UA 3Q10A 4KH1A 5HPYB 1S1MA 2I6UA 1AKQA 3QPVA 5IANA 2L82A 2O2EA 4IIJB 4K26A 1LV8A 4FBMA 4K9NA 4C7JA 4D9IA 1MBZA 3VR6H 3GEHA 4G5SA 4FYJA 1QYDA 2QUAA 2RARA 3EF1A 2VYND 4TWJA 4F4FA 1DIBA 1ENZA 2ZAGA 4W7SA 2Y0PA 1DJLA 1UAGA 4L51A 4DRXB 3CRQA 3TLJA 3WB9A 3K8YA 1OWOA 3JYPA 3WYEA 3OECA 4B35A 4L4RA 4Z99A 5T7BA 3OX4A 2C4NA 1KMMA 1AK2A 5DE3A 1TFUA 4RMJA 1HMYA 1VC2A 5A6SB 4BFVA 1B23P 2R7KA 2NP6A 1HL7A 2I3AA 4I7EA 3EQ2A 4NYIR 1NJ5A 3E81A 4J16C 4NEGA 5A7GA 3HNRA 3KTOA 2XZOA 1QH8B 2D7DA 2CYAA 3MWGA 3KQSA 3WKCA 2VKQA 2WYOA 2IXAA 2O3RA 2VPZA 2YFHA 3QITA 4LW8A 4F92B 2IRWA 3D2BA 5JAIA 4L4ZA 1P7WA 3OJCA 2Z57A 2EEZA 4E5SA 4XQEA 1UXIA 2B3TA 4P08A 3G0CA 2GFHA 2H5LA 3WTCA 1PZXA 1TKBA 1CKEA 1YJQA 5JZVA 3DHYA 2UUOA 4OJNA 4FW8A 5TIIA 4YJ3F 4FOPA 3L6BA 2RIPA 2FTKE 1PNOA 2W2KB 4MDHA 4LTDA 3IOBA 2YBDA 4D81A 3A6PC 5F1KA 4TZ6A 1YRYE 3HHPA 3NYIA 1QKKA 2DR0A 1H1DA 4HDRA 1KJ8A 5NULA 3ZXXA 3RK0A 1AURA 1DFHA 3PYMA 4AUNA 1P5HA 2NU9A 3F5DA 3JWGA 1X80B 3IR6A 2W8ZA 2YHSA 3EXIB 2F8LA 2P79A 4TV9F 2BF7A 2GD6A 2PZJA 4RIHA 3WAGA 3KAJA 4BLSA 5AVVA 1SUSA 5F73A 1VSQA 5JUWA 3W9BA 1FX0B 2RH8A 2XRYA 4RQBA 3DZBA 3RYFA 2RAUA 2PBZA 3GFPA 2J9XB 4FUTA 1TUIA 3IEIA 4PG5A 1U2DA 5A02A 5AK3A 1G4UR 5ES3A 2J59A 3H2KA 3R3VA 4MCJA 5IXJA 4KQ9A 5AKKA 3CEJA 5DX8A 3C14C 2IYXA 3M6AA 3KQNA 5ICMA 2G40A 4PYKA 4L2IA 2ZBRA 4D9KA 3M3HA 3WLQA 4HNVA 2XWSA 4GLJA 2RHGB 4X66B 1ORWA 4LRUA 2PBRA 3AUFA 2XMQA 4PINA 2D2VA 4ZODA 4M0KA 3KOZA 1W85A 4IKOA 2W2OA 2XB6A 1H85A 5EJ6A 3AVUA 2ZOSA 3DZ8A 2HC9A 2XE7A 4GVLA 3C5WP 2ZRJA 2EKDA 2FOIA 4JI3B 3V00A 1FS6A 4B80A 3A3KA 3FM9A 1LRKA 1TNDA 4FZ3A 3NHYA 3TTTA 1RKXA 3FOZA 4MITA 2WSLA 4JMPA 4M9SA 5IAJA 3INYA 3C6ZA 4CDGA 4YNBA 2HLPA 1ST2A 3RH0A 2HBQA 2CVHA 3H2YA 4EGAA 3DTNA 5HF9A 2GZHA 4RPCA 5G0TA 1O6FA 1ZR4A 1Y5MA 1P45A 2X1VA 4D1YA 5AVZA 3M81A 4DCGA 3ZDCA 5EZSA 3LQ4A 1FSZA 3JQ8A 4EMSA 1WDLA 2VTKA 3P52A 1XEFA 2P11A 3KT0A 1CUWA 4Z8YA 4OHKA 2CK3D 2RKOA 3W8EA 1KKLA 5JBNA 2GH1A 1FLVA 4HEHA 4MS3A 5EL0A 1P1BA 3BA1A 1FX0A 4I9FA 2BVNA 3VPCA 4B46A 1O7JA 4OREX 5FXMA 1H05A 3DPSA 4J1SA 3L05A 4Y0NA 4D9CA 5JHHB 3ND7A 1VSVA 3C4JA 3FKQA 3ICVA 3OE5A 1G7RA 5CJJA 5DHUA 5AXBA 4HUJA 1L5HA 3CB4A 3VISA 1QQBA 2YHIA 1HYGA 2BKVA 2HWXA 3L0OA 3LBIA 4GU5A 2C2HA 4OHUA 2H1RA 4R2IA 4Y1GA 5IJXA 3BD8A 2XQFA 3GFSA 1DBVO 2AR7A 2J09A 3AEXA 1RHJA 3IP6A 3R6WA 4QHTA 3ZDYB 4FZRA 4I4TB 4EUFA 4IDBA 2ZYRA 1RRCA 1XD8A 1DJOA 4DDVA 1PWYE 4Z4IA 5K0NA 3WSTA 4WHMA 1A7JA 1W36D 1FFAA 4YCBA 2C4UA 3DT8A 5KVVA 1P1CA 2QX6A 2CKMA 1U31A 1QRAA 2QJOA 3VXKA 3DMNA 3PCRB 3ZKWB 1BDHA 2BGGA 3K2QA 1NBOA 1BQ4A 4JWKA 2BISA 3T1TA 3B9RA 4FYPA 4E13A 4QUEA 2HQBA 2A0FA 1VHJA 4RTLA 4GZ3A 3S2YA 3EWNA 3B3JA 3K4HA 3TCNA 3OOSA 3HLTA 1IONA 1H5UA 5F35A 4BNYA 2WWXA 4HWGA 4JASB 2A7QA 2AFRA 2VF5X 1G8FA 4G24A 4WECA 4RTMA 4KR2A 2QP4A 5DKFA 4MTLA 5LLTA 2OCIA 4E46A 2AN4A 3BWBA 3CINA 4EGSA 2RAVA 3M1IA 4K2AA 3ZVNA 4JL5A 3EULA 1GLNA 1CF9A 4O4JF 3O92A 1G5QA 2WVGA 4W1PA 2PR2A 3VR0A 3WQSB 1TADA 4UAGA 4MUFA 3W2TA 2HDOA 1ZITA 4IL5A 3I9V6 1VDMA 1T6XA 2QV0A 2X8BA 1X9IA 4J6EA 2CW5A 2PZMA 1HZJA 1ETUA 1BQ3A 3U6KA 3G9XA 2CXQA 5EWJA 5CEJA 1LPMA 5CIYA 2A2ZA 2Z5FA 3D3JA 3HVUA 2WYUA 4O2BB 3IQZA 4Q1DA 4P3YA 5DLPA 1BN6A 4PYMA 4CIBA 5LWQA 2VT6A 1TO6A 3PVSA 2AG5A 1Z6XA 4S2EA 3TZQA 3VTAA 4MUHA 4CTNA 4ZIRA 5MDHA 3R7DA 1YL5A 4JT9A 3NMUF 3IVGA 2P77A 4CHGA 2R6ZA 5CXSA 3KOMA 2R8YA 1Y82A 3P0EA 4OP1A 4Q3EA 4C20A 3FZEA 4DCOA 3L7IA 5T41A 1EXMA 1GM5A 1LK5A 3IRUA 4BKMA 1Y1TA 4NNPA 1TUBB 3G5TA 5C8YA 2QTWB 5E9QA 1ZU5A 2HWWA 2WT9A 3Q7IA 2OCBA 4GRDA 1FMJA 2ZSIA 2FPWA 5EZYA 1ZN9A 3K35A 4F9FA 2AL7A 5JMOA 3OU2A 3H18A 3I5AA 4MKGA 3QHPA 3IUNA 4RF5A 2YS6A 2WHPA 1LUAA 4AMUA 4AG3A 1F8UA 2I2AA 1ODKA 3BA6A 4RPLA 2C2OA 5CLLA 5FOSA 2HF7A 3BRSA 2JIDA 2PNJA 3BRQA 4AP9A 2RHHA 1BX3A 3WSVA 4ND1A 3Q0EA 1AGPA 1JQJC 1W5AA 2DSNA 2OFWA 1KU6A 1H22A 4NJMB 3AJ8A 4DILA 2ORYA 1KC1A 4EVSA 1PL6A 4MIOA 4WEOA 2ID4A 4XGKA 1T2CA 4KYUA 4LF6B 3E5RA 3E9EA 3WNVA 1ULTA 4PSAA 4P98A 4EA8A 1O94D 4P82A 2K6GA 4X20A 1U63A 4UUBA 5LZ5A 2K87A 4LNAA 4BU1A 2H6EA 1KJIA 4X41A 3QV2A 1YZFA 2HFJA 4G37A 1YTUA 2H4XA 3W5VA 1CEYA 4K46A 2J32A 1NQWA 2WSSD 2R6R1 4BBAA 2P5UA 3OTHA 2ZRQA 4WY2A 4F2PA 1AJEA 5DYWA 1S4MA 1J20A 3O4FA 2DJIA 3KJQA 1ZJWA 4U2CA 2QRJA 1JDVA 1OW3B 3QF7A 4BNVA 3CKMA 1R74A 3QUAA 1S2MA 3SVZA 3LCUA 2QYHA 1KK0A 1K7FB 1GGMA 3DV9A 3R7WB 1GGKA 2WV7A 4AECA 3GQBA 3E0QA 4ZO8A 5IAKA 3THOA 1W4CA 3PJEA 2KBFA 1P0PA 1PHRA 4BO5A 3QPUA 2QX9A 1WF6A 2H18A 2BEUA 3B9QA 1R0ZA 3C1UA 3MGAA 2ORED 3KU4A 1GQQA 1IZ0A 3KUDA 3VR4D 2VZEA 3MFYA 1DDGA 4L8YA 3IXLA 3Q7PA 2Y2VA 2PWAA 3JQ9C 2XQIA 5F4ZA 2WQZA 3OZWA 4OQXA 3TM4A 3R3XA 4PLCA 3GELA 3RDPA 1OILA 3E3OA 1NASA 1PYGA 1U02A 1K3TA 1Y9EA 1QP8A 2ECFA 2YIVX 2G1KA 2JANA 3OM0A 4HSGA 3VBCA 5M7EA 3AUXA 5I01A 5DMXA 2QX4A 5AHRA 5H5JA 1SVLA 4U63A 2BI7A 1RPNA 4M88A 4MW9A 3RRBA 1GYQA 1YR2A 5F64A 4EF6A 2IZ1A 1T10A 3CW8X 2IC5A 4KXLA 1R0KA 1XWFA 3UMCA 1A77A 1FS4A 4HT3B 5F2NA 3J7AC 1F12A 3KQQA 1HDOA 1VE3A 2WUWE 1DLIA 4NMHA 5JDCC 3CEAA 2HV8A 3SKXA 2H17A 2HA7A 3L7YA 4X20B 1ADJA 1X13A 2XJ4A 2POCA 4YRSA 3KSRA 2WYVA 4UUOA 3WKAA 1Z68A 3ZDZB 5K3FB 4NECA 3VSEA 5H81A 2OQVA 5F9FA 4DOMA 3M6UA 3B12A 4DJAA 2RGEA 2ZJ4A 5CM8B 1JG6A 5HILA 4V3CA 5DYGA 5HMLA 1LK7A 4FUQA 4KE9A 2V7VA 4F4JA 3E05A 1QZ3A 4LS3A 1KBZA 4Q05A 2XGGA 3CUTA 1CF4A 4L28A 3PZBA 3S68A 1HO3A 5C3MA 5FEUA 4CGZA 3E9CA 3MRTA 1R8SA 1WPXA 3H4TA 2Q3BA 2Z8ZA 4R8SA 2VA8A 3H16A 5JEDA 3D2AA 4IUCS 2CB0A 3ZIDA 4CIYA 4QT4A 3GZ4A 1IY2A 3CJRA 2H1LA 3CF4G 5AVRA 1UIMA 5EZYF 1UP6A 5LQUA 5KNBA 1J23A 1QNLA 1W5SA 1L9KA 2CXXA 2FFHA 1VE6A 3MT9A 4MQ6A 1X8KA 4X97A 4BBPA 3K5WA 3M6MD 1IFXA 4CYMA 2HCJB 2WJ3A 2ZE8A 1ZN7A 3DTVA 3W8DA 2C4TA 1BXGA 3QU5A 1FVHA 3OHSX 1LNSA 1VL5A 4KTVE 1QYRA 1U8AA 4UD2A 1WIWA 3CLSC 3HB7A 1ISGA 4OYYA 3CX4A 1T5OA 2X22A 3SLGA 5ALKA 1E4OA 2V9PA 4ODIA 5LMZA 2ZB7A 1D5CA 3W5SA 2ATXA 1CY7A 3IVCA 5C4GB 3EG9A 3JVEA 4MPRA 2QMHA 4HGPA 1XLWA 2IFTA 2NXJA 3U40A 4F6RA 2V4ZA 1VJDA 3UMYA 1MNQA 1TVKB 3KB8A 2JFBA 4CL0A 3M6IA 4HDKB 2C95A 4N8EA 1EXNA 4RK6A 3THRA 3KYBA 1A9SA 1JKIA 1XQVA 3O4JA 3TR5A 5I4IA 2WTUA 3I64A 2XMZA 2G36A 2VNSA 1BIFA 1MOQA 4H1VA 4WK2B 4NS1A 2Z43A 2GPTA 1OYYA 1ULHA 3PQ7A 4PGGA 1GZ7A 3WGMA 2R4QA 1DEHA 2CCGA 4QYWA 2IYTA 1P44A 4RENA 2DHQA 5FTKA 2V9CA 3C3XA 3RK4A 3PTAA 2F00A 4X1YA 1CUHA 4YJ2A 1CU1A 2YWDA 3MWEB 1BZYA 1NZFA 3HYNA 5B37A 1TAGA 1V4BA 1MF7A 1GFIA 2MSCB 3DS8A 1WVMA 4L73A 4MR9A 3ABIA 3AXTA 4Z6KA 1GRCA 1DE0A 3DP9A 1YKGA 2RAFA 4CKEB 5HFAA 1EA7A 4TT3A 1HA3A 4HYTA 3WC4A 4OMDA 4NAHA 4YR9A 4EYOA 4YECA 3TNYA 1HEIA 2FWIA 1JEEA 4TPKA 4Q4HA 4ACBA 5KAPA 1WSWA 5CH3A 3TGLA 2V8BA 3EVAA 4U7DA 3FGOA 3FZYA 3TOVA 2KW5A 3DAHA 3E82A 4PWZA 4G9GA 2FW8A 4L50A 2QG4A 4PC6A 5ALIA 3OFKA 4DZZA 3A31A 1EK0A 1RFLA 2L0XA 4NR0A 5CEFA 4DMGA 2A9KA 2ZT7A 4G0OA 4F6RB 1NKSA 1WCIA 4YIKA 1PFQA 5SYAA 5HCIA 3AEKB 2IXGA 1JPUA 3OQ6A 5JD5A 5E6UB 4L5YA 3IMFA 4TTRA 3W4JA 1B1AA 3CLSD 4YJFB 1KZGB 2AD5A 5K6RA 4FD3A 1HT3A 1E9DA 1TZJA 2FFAA 1Y5RA 4JVSB 3GVIA 1JSZA 2BM8A 2J3KA 3SR4A 5GJBA 1E8MA 1GTVA 5EERA 5EUMA 1FZQA 3SS9X 2A14A 2HMAA 4MR8A 4QAJA 4UVEA 4G1FA 5BT8A 4UUQA 3RHTA 4DQXA 2P1ZA 3P9YA 1BWPA 3JAKA 3T15A 1DRWA 4NBNA 2YJ5A 2IOFK 1SG6A 1T15A 2XWJI 1CNEA 1ZAKA 3STVA 2REBA 1VXOA 4FCTA 3D1VA 2R6AA 1OBCA 1KY2A 1JJ7A 2A59A 3E3MA 1ONNA 1CQIB 2I7TA 4G5YA 2A9PA 1AGYA 2XYPA 4C6RA 4ZAZA 1YZUA 2CJWB 2ZJ1A 2IU3A 1GUFA 4JI8B 1S01A 1WPQA 5AWFC 3VC1A 1EUZA 1YWGO 2AUMA 1ZZGA 3OIYA 3J81k 3IR7A 2FSVA 3IMEA 2OL4A 1SRRA 3MJVA 2Y77A 3I4CA 5F5NA 5HDQA 3RJ5A 3CX3A 1MV5A 2DLDA 2JLSA 3I8SA 3KLNA 4FZJA 4G4GA 3TUIC 1ZX1A 5BQ5A 2D1FA 3VDRA 3CNNA 1YBHA 1R4AA 4ETIA 1I4DD 3PHGA 4JV5B 1FW8A 3F4BA 1EUYA 3FYUC 3AIMA 3K8QA 1X0VA 1ZCAA 4WV3A 1WBBA 1RJFA 3GVPA 3AI7A 4BNDB 2D5LA 4ZCSA 2GUWA 3TFQA 3G0BA 3FYCA 2GETA 3UKJA 3D4BA 2WUGA 4EMTA 4AMVA 4QRIA 4QIHA 1VCMA 5REQA 4CDRA 2Z8XA 3ELUA 3F46A 1GP2A 4P4SB 2XDYA 4WH0A 4KQCA 3A4VA 3TRDA 4IDDA 2IH5A 1V35A 2IGTA 2UYCA 1PE0A 2E5FA 4GUDA 3VU1A 4TZ0A 3HEAA 3OPVA 3V1TC 4ZI7F 5KU1A 1PNVA 4NZZA 4R3UC 4H9GA 1EG7A 1IAVA 1JYFA 5CVUA 1ENYA 1YJCA 3LIPA 4JNKA 4AYTA 1ECGA 4HDRB 1SWVA 5CA0F 5JVDF 2PANA 4LZPA 2WJ6A 4ZKDA 1U5CA 2V6BA 2YN0A 3LG2A 3F74A 4KN5A 3BZUA 3FRIA 4C0HA 4QG3A 5T6BA 3IQGX 1GCIA 4BEVA 1C7QA 1F0KA 4J75A 5I47A 5FFMA 1OB5A 3MCUA 1EKXA 3VU9A 5C51B 1OGYA 2WOOA 1R0YA 4RLFA 4DAOA 1I4TD 5KX5A 3AUUA 4GBGA 4IHKA 1U5BA 3K1JA 4EFLA 1BGXT 1JJVA 1UDAA 3WWDA 2X2OA 4L9RA 4XM0A 1ISFA 2YZKA 1E2LA 1VG8A 4CMKA 3AB3A 1G2OA 2LTAA 4PSCA 1PKEA 4H35A 5CDHA 1U7WA 4OUDB 2AS0A 1CUJA 1GSIA 1WXQA 2I4IA 3QBVA 4P0TA 4TV8B 5IBPA 4A2CA 3MYYA 2HBRA 5CMLA 2ZJAA 1MU0A 4AC9A 3W7VA 1GCGA 2QAGC 2II6A 4KK4A 3M33A 5BT9A 4LNUA 1JS1X 4BKPA 1N1EA 4G07A 1IG0A 3UQZA 1MOSA 1E0JA 2ZRPA 3N74A 4PLHA 5ECYA 5MGNA 3ZCPA 4Y6QA 3T6KA 5DNDA 3LP8A 1P4AA 1NP6A 1LQTA 1BHO1 1QF7A 1J9EA 2NV6A 4K0KB 1SD1A 4DC9A 5CA1F 3DA8A 3QX9A 3SYLA 5JYBA 1GFWA 2HNKA 1T3LA 3JQGA 4JUCA 1P3DA 4E15A 2V45A 4OHZA 4ZDKA 5JZSA 3LUHA 3EBPA 1QK4A 4EQ6B 4GXRA 4EARA 1Y4UA 2O7SA 1I33A 1UMCB 2IXEA 2OB2A 4JP2A 4UU8A 4YDQA 3BWDD 6ABPA 3TH5A 2WKRA 1KSHA 2JGIA 3SJAA 5AW4A 5EJEA 3WB2A 5JY6A 1MVNA 3V4VB 3PFIA 1ST3A 3X1DA 1PSWA 3U5ZB 3HV2A 1ZNYA 3QYPA 4GUAA 2BR3A 3UT6A 1DQYA 1Z4LA 4NBSA 3EUAA 1FQOA 4XASA 5IDVA 1JTVA 2ENWA 2XUJA 1KO7A 1LFAA 5JAMA 2XXAA 3C98A 2GZ1A 3ETJA 3V6LA 4MVXA 2NZJA 2F43A 2OXFA 3F9RA 3GUHA 3ICCA 3HDTA 4L76A 4IUDS 1A2OA 4ND5A 3T7IA 1TTTA 1QWOA 4OIFA 2GJAA 1U98A 1W9HA 2OCXA 2Q5CA 4H17A 4IGIA 2QL9A 4AZVA 5I7FA 5ICEA 3WQRA 3KXIA 3UWSA 4E3WA 1XCMA 2O20A 4NAUA 2BCEA 4R5HA 4P9NA 2NQTA 3INRA 4UMDA 3VR4H 5JAHA 2OUKA 4L02A 1MW8X 3L7NA 1XR3A 5C37A 3RS9A 1PP4A 4R8LA 2WWVD 3K9GA 4BBJA 3ZWKA 3U49A 3W5DA 2ILTA 4N41A 2VJNA 1PGJA 1FVXA 3HU3A 4P4NA 3QJYA 1JDSA 5EKXA 5K0CA 4E07A 2EGGA 5F4BA 3NBYC 3BIOA 2X4IA 5AHKA 4MUYA 3HS3A 5IULC 2HLDD 2QD1A 2BBWA 4I1UA 1U0EA 4OAOA 4RD1A 2YIJA 3A70A 2P2YA 3B7GA 2CVFA 4E1VA 2F3UA 2ZSHA 2VPXA 4FKMA 5FWNA 2OVBA 2O4UX 1F17A 3OD1A 1ZY2A 3CVVA 1U7TA 4RKWA 1OBVA 1P2GA 1OFUX 5ALFA 2EKPA 2NAPA 1FP4B 2DBVO 1C9DB 1VCOA 3LW8A 2FSFA 4OHXA 4ZQEA 5E9AA 3UWOA 4PAOA 4EECA 1N6OA 4RZHA 5HWSA 2RJ3A 5TR9A 4PG7A 1SPXA 5JTTA 2Z9BA 3GEBA 4J90A 4F06A 4B32A 3MRXA 2X86A 3WLEA 4Q3NA 1Y3DE 1HE2A 3FPSA 4YCSA 5JSFA 1B0UA 1SA0A 1EWKA 4MUIA 3HY4A 2B35A 5IC6A 5DTJA 1YS9A 4QLAA 4TT3D 3FBWA 4BNHA 3FMVA 2YY5A 2XR1A 4MV4A 4JC4A 4BHTA 3DVAB 4J94A 2J7PA 1WP4A 3ROKA 2HSJA 1CJTC 3LW7A 3G85A 4MRRA 1WMAA 3B2NA 2IS1A 2A9FA 2I9KA 1WDKA 2NVOA 4H6VA 4PYIA 4CFZA 1H9AA 1VG0B 3A6JA 3KVOA 3STHA 3FROA 3PDIB 1VMKA 1QV6A 1AGRA 3MWFA 4UMFA 3VR5H 4BVKA 5TS3A 3Q3IA 2P9FA 1K8XB 4J1NA 3WIBA 3WLFA 3HDJA 4B71A 2CUZA 4YCCA 3H1FA 2YYSA 1P9NA 2VZ9A 4J2OA 4GOXA 4ZA2A 4EY3A 3F7NA 1VLHA 3TQFA 2CVOA 2OB1A 2P9JA 2Z9DA 3EVBA 3L0PA 2JFFA 3TOZA 2A3NA 1XNRB 1N2GA 3NALA 5DCLA 1IY8A 3I6BA 3DEHA 3BB4A 4LMPA 5FPPA 1PGOA 2IV7A 2XNDA 3DTYA 4XR4A 3A9CA 3OIVA