2GN1A

Crystal structure of dimeric biodegradative threonine deaminase (tdcb) from salmonella typhimurium at 2.2a resolution (triclinic form with one dimer of tdcb in the asymmetric unit)
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
327
structure length
326
Chain Sequence
MASHITYDLPVAIEDILEAKKRLAGKIYKTGMPRSNYFSERCKGEIFLKFENMQRTGSFIRGAFNKLSSLTEAEKRKGVVACSAGNHAQGVSLSCAMLGIDGKVVMPKGAPKSKVAATCDYSAEVVLHGDNFNDTIAKVSEIVETEGRIFIPPYDDPKVIAGQGTIGLEIMEDLYDVDNVIVPIGGGGLIAGIAIAIKSINPTIKVIGVQAENVHGMAASYYTGEITTHRTTGTLADGCDVSRPGNLTYEIVRELVDDIVLVSEDEIRNSMIALIQRNKVITEGAGALACAALLSGKLDSHIQNRKTVSIISGGNIDLSRVSQITG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Threonine dehydratase catabolic
publication title Crystal structures of Salmonella typhimurium biodegradative threonine deaminase and its complex with CMP provide structural insights into ligand-induced oligomerization and enzyme activation.
pubmed doi rcsb
source organism Salmonella typhimurium
total genus 118
structure length 326
sequence length 327
chains with identical sequence B
ec nomenclature ec 4.3.1.17: L-serine ammonia-lyase.
pdb deposition date 2006-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00291 PALP Pyridoxal-phosphate dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2gn1A01
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2gn1A02
5JJCA 4D97A 1V7CA 5KINB 5D86A 5DW0A 1P5JA 5C3UA 1BKSB 2WSYB 5I6DA 1V8ZA 3ZEIA 4HPJB 1VE5A 2TRSB 4JBNA 1A5AB 1UINA 4NU8X 1WBJB 2ZR8A 5DBHX 5IXJA 4KKXB 1K7XB 5DBEX 1A50B 4ZU6X 2C2GA 2ISQA 4COOA 3IQIX 2O2EA 4D9IA 2JC3A 5DW3A 4L3VA 5I7RA 2CLMB 2EFYA 1TTQB 5I7WA 2TYSB 4PCUA 1QOQB 1Z7YA 1Z7WA 3X44A 4D9EA 4Y6GB 2Q3DA 1VE1A 4D9GA 1J0EA 3CEPB 3DWIA 3X43A 1K8YB 1TJPB 3BM5A 1FUYB 1OASA 1PWEA 1TZ2A 4OREX 5E0KB 4D8WA 2CLFB 3L6CA 4D92A 2ECOA 5B1IA 1C29B 5I7OA 1J0CA 2CLLB 3R0XA 4I1YA 1A5BB 4LI3X 1KFCB 1PWHA 4D9NA 3VC3A 5IWCA 2DH5A 1WTCA 1KFBB 4D9MA 4XUGB 1K7FB 1WDWB 4OFXA 3IQHX 5T6MA 3T4PA 4HPXB 1K8XB 2D1FA 4ZU1X 1M54A 1TZMA 3IAUA 5D84A 2BHSA 5I7HA 1BEUB 5IW8A 1VB3A 1C9DB 1J0BA 2CLKB 3PC4A 1TDJA 4H27A 4HO1X 5D85A 1UBSB 2CLOB 2EGUA 2DH6A 2O2JA 4D96A 3FGPA 4HN4B 5I7AA 1F2DA 1UIMA 2V03A 3PC3A 5J5VA 3DWGA 4WX2B 4L0DA 2RKBA 1K3UB 3SPXA 1K7EB 3AEYA 4L27A 2ZSJA 1TZKA 5J43A 4ZQCB 1A5SB 2J9ZB 5DVZA 1KFEB 3IQGX 4LMAA 3HMKA 3L6BA 3TBHA 4IL5A 2PQMA 1KFJB 1TZJA 2CLHB 2ZPUA 4D9BA 1J0AA 3VBEA 2RH9B 5HBGA 5B55A 2GN0A 2J9YB 5B36A 3RR2A 3PC2A 2GN2A 4D99A 1O58A 4AECA 5CGQB 5KZMB 1TTPB 1KFKB 5B3AA 5JISA 1JBQA 3DKIA 3AEXA 4NEGA 4D8TA 1D6SA 2TSYB 5CVCA 3SS7X 4D9CA 3FCAA 2ECQA 2GN1A 1X1QA 1QOPB 4D8UA 1RQXA 4LMBA 3V7NA 3VSDA 1V71A 1E5XA 4F4FA 2J9XB 2Q3BA 2BHTA 4D9KA 5D87A 3VSCA 1FCJA 2RHGB 2Q3CA 5EY5B 4L28A 1J0DA 5BW6B 5B1HA 3SS9X 4AIRA 1CX9B 3L6RA 1CW2B 1K8ZB 2CLEB 2CLIB 4QYSA 4D9FA 3VSAA 3PR2B 2C2BA 4HT3B 3R0ZA 1TYZA 4JBLA 1WKVA 1C8VB 1KL7A 5B53A 1Y7LA
chains in the Genus database with same CATH superfamily
4K26A 3EBOA 4UXJA 3DE0X 3ZEIA 3WYBA 3NEPX 4LTDA 5A6SB 2GCEA 1K3TA 3HSSA 4G56A 4L02A 4P7FA 1WW8A 4KOAA 4PV7A 3WLTA 4C89A 2PIDA 4RTRA 2B4QA 3BWCA 2YMMA 3BHMA 2W70A 1J42A 5JSYA 2FJPA 4LVNA 4YREA 3H1GA 5LQKA 4HL6A 2EL9A 3CMMA 1IWOA 1MABB 4JJZA 4U3JB 4C4PA 1PO7A 3COYA 3ZX4A 4FOLA 3GFGA 2KI5A 1SU4A 4GOLD 1IAQA 1XDBA 4O3FA 3RHZA 3UBMA 3ZQ4A 4YJ2A 4FOPA 1RWVA 1MC4A 3S4YA 2EX4A 3PXCX 2RGXA 4ECAA 1BKYA 3QLUA 3W2IA 5TY0A 2FWJA 3E3OA 2CL7X 1SUSA 2X8LA 4I8DA 2J4CA 4QUDA 3VU3A 1SC3A 4B17A 5F51A 1ENPA 4B3IA 2KX7A 4HBGA 2VATA 5CW2A 4ZYUA 4Y1EA 1SUEA 4AP9A 2XUKA 3IQDB 3UYLA 2GXSA 1KMQA 4WZBB 5HDBB 2IDMA 3X1MA 1RCUA 1E5QA 1DEXA 3QLVA 5EMHA 1SBZA 1I5OA 3IA2A 4A0SA 4HDRA 4AVYA 5G1NA 3P94A 2QT0A 2GD6A 3PTZA 3T5PA 2E4YA 3C1TA 1Q7TA 2C2KA 4PGGA 4WZAE 2OKGA 3WV4A 3JRNA 2DULA 1QQ5A 2BKXA 2P4EA 2YWJA 4BV2A 4CDGA 1ODJA 3NYWA 4JGIA 3I23A 4RQTA 5BVHA 4HDOB 4GR4A 4W1SA 3JQAB 4DCPA 2F2TA 1FF9A 2ZWAA 1IJBA 2MWMA 3DD1A 3IXMA 4G5RA 1OLOA 4JLAA 2JJ2D 1L8AA 4OCZA 3VPFA 2PS9A 3PE6A 1MENA 4I1RA 3IMEA 4FT4A 4Q9HA 5BR8B 4I4TB 1PD1A 2NU7B 2X23A 2FRDA 3FDFA 4X6XA 5KOJA 3OOYA 3PCRB 3IEXA 4PNEA 2OD9A 3I3OA 1FFDA 1TM7E 2VHZA 2D8MA 3AKEA 4MVJH 2J9ZB 3GWGA 3PXAA 5DVZA 5IBRA 4TN5A 1G3IA 1O0CA 4DTCA 1LC0A 1LDMA 1EXMA 4TKUA 4FFNA 3COZA 4C14A 4DQXA 3T1OA 2WAYA 2IOFK 2QV7A 4MKFA 4X24A 3C4VA 3O3CA 1ZR2A 2P9HA 3IAFA 9MHTA 1RXVA 4FMPA 4PHTA 4OFZA 3KOZA 4MAMA 3CH5A 2PU5A 4YX9A 2O8FB 2R751 2FEMA 2X6QA 3B6MA 3IUMA 1WCIA 1DI0A 3MERA 2WB2A 4WOBA 2BMFA 3K6KA 4S0XA 4WCFA 3FN4A 1CZOA 1O08A 2H08A 3RE1A 3SEAA 3O9VA 5HX7A 2NT4A 2ACWA 2J33A 3SC3A 4GD3Q 4HAUA 4BQEA 5AESA 3SU8A 3IP9A 4KXUA 3UMGA 4EY7A 3M6IA 3K2IA 1L5VA 5FOSA 3NJ4A 1A7AA 1M3SA 1ONSA 3PHLA 4E5KA 3T34A 1GTG1 3BD9A 2VI5A 4G84A 5LCXA 4MRMA 4E5YA 2NMVA 1FCJA 5JMOA 4W9RA 4KH1A 2I3BA 1IY2A 1GRVA 4IQ0A 4MO9A 1CXZA 4JHLA 1FDSA 4XFKA 2GOYA 3JVEA 2WU1A 3KOXA 1ZIPA 1J24A 2EBWA 5EOVA 2ZT6A 3RSGA 4N5NA 2GXQA 4PZDA 3S1AA 1RYNA 2PZ8A 1BAPA 4ZI7F 3JZMA 2H4HA 2X5KO 1PBNA 3CLHA 3QRWA 3HVIA 1X87A 2AB0A 1GTMA 3C3PA 1HTTA 3N2NA 3VAYA 4QGSA 2OUKA 5KYUB 3OC6A 3ZG6A 5IKXA 1U2TA 4KXLA 4H3HB 4TKZA 1W36B 3JYLA 1GILA 1P3DA 2RONA 3SR3A 5DV9A 2HWUA 4N3BA 4YPVA 4MJ7A 4HB0A 4O29A 5FXMA 1QU3A 3HXMA 2X1HA 4G9GA 2L18A 3FPGA 3QPBA 1CVRA 2JBAB 2V7EA 2EP7A 4XQ0A 2I3ZA 1I3MA 2AJCA 2CUZA 4JC0A 4CNQA 2J0QA 3ODPA 5KOHB 5C8ZA 1QCYA 5CLQA 3SHTA 3IP7A 4H3VA 3OECA 3PJFA 2XQKA 4O2AB 1LKZA 4Y9TA 1ILWA 1XQYA 4WCDA 2DOKA 3BXEA 3N2YA 3NETA 2AMLA 4QD3A 1VP9A 4P4SB 1VA4A 4BVAA 2I2AA 2H4XA 2QBYB 2DUWA 2OC4A 4GX2A 3CSSA 4NFYA 4UEOA 5I7FA 3AJRA 1GSAA 3O8RA 1JEYA 3AF3A 3DKKA 1NVGA 4O2BB 1RKBA 1QFXA 3QBEA 3NBMA 4A0QA 1NV8A 1Z88A 2ADOA 3BFVA 3JY6A 3KQPA 5JCXA 1C50A 1VLHA 4B4UA 1GTL1 3NLLA 3NG1A 3BDAA 4DRXB 1PAUA 2R2GA 3GU3A 3CA8A 1Z35A 1C3VA 2OK7A 2JCBA 1G21B 4TKVB 3EZ9A 4K9LA 4ZAGA 5DDIP 2GK7A 2GYYA 4LV8B 3UFBA 3ER8A 4EB3A 3EZ6A 1EWVA 3S68A 4K03A 1L0BA 1ZK3A 2EU8A 3AIIA 1S7CA 3TLZA 2CJFA 2Q0XA 2KLHA 3KIPA 1O7JA 5C8YF 5JADA 4IFIA 5LR6A 2IGBA 1E58A 1M2OB 4CIVA 1S4MA 5AW2A 5KCMA 4LG1A 3UA4A 3H7AA 4EFNA 1J8VA 3MRTA 4OHMA 2V8BA 1KYYA 1PR9A 1TJNA 1CRLA 1K3UB 1I4EB 4WNCA 4OGKA 2CFOA 2ZE6A 4KVGA 5KJ6A 4KJXA 4NOLA 4XGQA 2I91A 3DPUA 3R7AA 3TFWA 2IYLD 5IASA 3LQKA 4HDSA 1TQ6A 4Q3AA 3MQ2A 2NM0A 1CUAA 1T6YA 2CXPA 4HADA 9ATCA 3F3MA 1T3SA 2FRDC 2N42A 2HR1A 3G8BA 1Y8RA 1UWLA 1KSFX 1NRXA 3JSXA 4JP8A 1A88A 4GWKA 3ZCXA 2V9PA 3AZQA 1LVHA 4P7BA 1UKAA 1EK6A 1FNBA 2QM8A 1TECE 2V3WA 2Z58A 5FNVB 5CB4B 5JFOA 3ZVNA 4QJ3A 3PGLA 1JLMA 1IOLA 1FTGA 4L1KA 3MGCA 1GG2A 4UHCA 3QW4B 2FSVC 3K8YA 2BGWA 2D1TA 4KXFB 4IYRA 2ENUA 1R6TA 3ZHVA 4Q7QA 5BN3A 4S04A 3B36A 2Q3FA 1I7SB 3SFTA 1JIVA 4R0MA 1JR3A 4IQ4A 2IKQA 5KYYB 5DX8A 2Y1KA 1EGQA 1F14A 3I32A 3HGQA 4URUR 4HG2A 2PWYA 2BMDA 5GPBA 1QQ7A 3K1TA 2Q0SA 3L8MA 1E89A 1IIRA 1R5OA 1YDEA 1ORDA 2GEJA 4OQLA 1WO8A 3KLNA 1C3EA 4RPHA 3PUXA 2HNKA 3P26A 3WJAA 4U7WA 1W5AA 1NDUA 4Q4AA 1NQ5A 3UXEA 1L4GA 2NPIA 4A6EA 1T6XA 4AJPA 4LRTB 4Y9RA 4N40A 5IH7A 1VE5A 4KZPA 2XQFA 5IF9A 2WIDA 2YBEA 4MVJP 4CLRB 3LDUA 4Q1AA 3V3TA 3K1YA 1Z4IA 3WLPA 1ZOIA 3HVHA 3QVOA 3U1BA 1ZCFA 5DCWA 4B4WA 3OIUA 4EG0A 1SVKA 3QMVA 4KIUA 1T15A 1X7YB 5P8WA 4BE7B 5JO0A 5DW3A 1RXWA 4HWOA 3GEPA 4W5HA 4EG1A 3QW2A 2XD9A 5IBQA 3PPYA 3TJRA 4DUGD 1I13A 5DWDA 2FMIA 2M6RA 3JQBA 4LNAA 5I4KA 3ZS9A 4AF8A 1HKUA 4OXKA 4TYPA 3GUYA 3ZI0A 4LJSA 3SXPA 1O95A 4HZGA 1N2IA 2QD4A 2D1SA 5KAPA 4JSTA 1SBCA 2CNNA 3D59A 2Q1TA 4HMOA 2G71A 3LWDA 4QWWA 5F33A 4ETWA 1M8JA 4ZAXA 4PX3A 1ZOPA 5B3JA 2ZRLA 1FRZA 3QHQA 4FE7A 1KQNA 5L4SA 5IS2A 1ZMTA 5T6MA 4KQCA 4PBRA 3N74A 4GVPA 4E5NA 1EUYA 4ZVTA 1FU7A 1YULA 2QTMA 3WHKA 1SUFA 1E9BA 1E4VA 3IAUA 1MVOA 5FI5A 4H18A 1SKMA 1CJTC 1UFRA 2GYUA 4DS3A 3T3HA 3WLKX 1CF4A 1WD7A 3ENKA 2N1MA 1X7XB 4J7CA 3G1UA 1U1IA 3W8NA 4I3GA 3CKYA 4M9CA 4E08A 3LLCA 4ZMSA 1ONNA 2COUA 1NFRA 2YZ7A 1F2DA 4KAXA 1AOXA 5AJXA 1VDMA 3UOAB 4LZNA 1TKAA 4TMVA 1DBVO 3CJRA 2G72A 2RKBA 4J4HA 3P52A 3VKHA 1FE8A 1U1DA 1IUNA 4MW6A 4BC1A 3FOZA 3K9GA 5CJJA 2PRYA 1C7FA 5CLFA 2VNAA 3H65A 4IMPA 1FW8A 3BMCA 1VGRA 4NNOA 1F1JA 1W8IA 4LMPA 1CNEA 3H5VA 3TGPA 1OXUA 4F1JA 1Z5OA 2CLSA 4UE6A 2H2WA 3PDWA 5AHXA 4RSHA 1CRWG 3BQMB 1HEIA 5JDIA 1VM6A 8AT1A 5KWSA 4CBVA 2XQJA 3SMVA 2CDCA 1DOAA 5B6IA 3VYWA 1J1ZA 1VI6A 1CRZA 1G3MA 2OGZA 3H84A 4N3GA 4OQQA 2OLKA 4L8YA 2JPDA 3HADA 4ZVLA 5FPHA 3TL3A 5K4GA 3ZWMA 5BV1A 5JPDA 2IIPA 1C3JA 1W44A 2Q3JA 1L3CA 1SNYA 1SCNE 2Q8PA 3B7PA 2H59A 2UDPA 3JQQA 5AO9A 1HSZA 3T9DA 3ZY2A 4JJGA 2YN4A 1BDJA 2J9XB 3F4KA 4A23A 2AF4C 4IEIA 3AGPA 1P8JA 3E9RA 1GQSA 2XE8A 4YK7A 2RC6A 1FTSA 3CRRA 5DP2A 3P2IA 2RHGB 5FBKA 4ASUA 1PI3A 1EXWA 1OLSA 2GD2A 4PPGA 4WDRA 4ZVMA 2R1TA 3A2NA 3ZV5A 1UK7A 2IZZA 1G291 5ESXA 5HRCA 4LRUA 4BEJA 1UMDA 3HH8A 2G77B 1P5ZB 4FS8A 5IJ0A 2V3CC 1G5QA 2H3EA 3DM9B 1X0VA 1P1RA 1QO0D 2V97A 1NN3A 1ZM9A 3Q88A 2XADA 4X65B 3K70D 2Z9CA 1M76A 3QG5A 5C1DA 1J49A 3DO5A 2NWQA 5E7JA 4NPAA 3OFSA 5EIFA 1KSHA 2WOJA 4Q7KA 2IVZA 4BEVA 4C1NA 2FPGA 2ZJFA 4BBJA 3QEBZ 4NF2A 5BWOA 3A6FA 3JQCA 5HQJA 4Y0AA 4AJNA 1J33A 2JHGA 1GL6A 2NO4A 2ROQA 4BLSA 3AZOA 3IKJA 2VLBA 3WBKA 3D5EA 1L7AA 4HDRB 4OGFA 4TTPA 1GEEA 4G23A 5ALXA 2EQBA 3ZC3A 1XRRA 2IF0A 1E4EB 5KJFA 4WFQA 3MIZA 1M7HA 3KT6A 1CUYA 3BIXA 4URXR 4H4DA 1SVIA 3QY9A 5BVHB 4IS2A 2IOFA 4WNYA 1U7UA 5F73A 3KDPA 4UREA 3V7UA 3IVGA 4HJRA 2WFLB 1HTWA 4IDEA 4NWIA 1SA0A 5KOJB 1V4VA 4N48A 4X84A 5EVJA 1LBQA 4K1XA 2CLFB 1TF2A 1DXOA 2V7UA 2XTJA 3A1DA 1C29B 3B1ZA 3IIIA 4N47A 4NH4A 3TEJA 1CY1A 2J3JA 1YACA 2JAXA 3OZRA 2XTNA 4JJ4A 1B93A 4MKZA 1ZX1A 2BSXA 3IOBA 3IHLA 3TSWA 1KO8A 5HGXA 1K3FA 2Q7DA 4OBXA 3MEQA 3SSNA 3T4PA 5A4DA 3FLAA 4XDYA 1YS6A 1NU8A 4ZGGA 5K8JB 2XCTB 4LGVA 4IJ5A 4MVXA 5EIBC 4A1OA 4LZJA 9ABPA 3ZDBA 1NF2A 3CURA 4IMIB 1NN0A 3QQ5A 2G0AA 2JAPA 3UY4A 1T9HA 3H5TA 2GZ1A 1THGA 2E4WA 1SMKA 3DV0A 2G1KA 2H85A 4WCFB 4D96A 1YXMA 1C2TA 4PSVA 1XU4A 1ZRNA 4YMLA 2H17A 2WWYA 4O4JB 1N7GA 1K7SN 3HDTA 4O0LA 1MORA 2HPZA 4R7ZA 5JAMA 5JWOA 2Y1FA 1LNZA 1G60A 3VR3D 3HE3A 3AEYA 1FP4A 3NDIA 1AU9A 3HVUA 4NOKA 4UFOA 1U2DA 1XE3A 3O8NA 3CWQA 1KC3A 3G23A 1OU4A 2EVWX 1CUWA 4YDSA 3BWXA 2QNRA 3L6BA 3PF8A 4DLXA 5JAOA 3MS4A 4G1MB 4V0KA 5CYFA 5FBQB 1WIWA 4MJ3A 3EOZA 3S1AB 4QUAA 5LFAA 1NF9A 1ZH2A 3GVCA 3VPHA 3QKSB 2ATEA 1KEPA 4XIJA 4BDTA 2FZWA 2VJYA 4EUNA 5JS7A 4R2MA 3A3YA 3O73A 4W63A 1SK8A 3DVSX 3HY6A 3EQ2A 4EA6A 1N8NA 2Z9BA 1O1YA 1UP7A 4IGAA 1H94A 4FZ5A 3W4KA 1T5DX 2HDWA 4X45A 1EH5A 1VC2A 4OI4A 5TR9A 5LN1A 1CIVA 3LRPA 2D0DA 3NO4A 3O91A 4P9NA 4LE1A 5LA6B 5JECA 4D41A 1WXIA 1ODFA 1XZPA 3BFPA 3I04A 3NBUA 3WBJA 5I8PA 1ZN9A 3IC5A 2IHVA 4MICA 5CG1A 1ZJ4A 3N2LA 4AZSA 4FMCB 3D0OA 1RR6A 3OD1A 3D3QA 4OYLA 2F3UA 4NZMA 3WMXA 1DIHA 1NXPA 4TUYB 3L40A 4YACA 3W5CA 1L6RA 1TK9A 2I2WA 4S3MA 1V48A 4G85A 1IXSB 3HCEA 1OI7A 3PR2B 4ERXA 5CDSA 3ISTA 4LS3A 3MS2A 1P75A 2BLNA 1YQUA 2P0AA 5K03A 1XTPA 2JFGA 1V7CA 2OCBA 3AC0A 1PFQA 1TADA 1YB4A 1CG6A 1F20A 1EWYA 3FLEA 3FWZA 3MXTA 1ZUNB 4LPKA 5DMXA 5A7HA 4DBVO 4OQEA 3IT1A 4BUCA 1HLPA 4JBNA 1VBMA 3FTCA 4DA6A 1ZD2P 5TXGA 2MT9A 1GFZA 3HEAA 3IERA 3IR7A 4BVFA 3F98A 1XEWX 3LF2A 4DANA 2YNMA 4YRBA 1BJRE 3R7LA 2H11A 1CEXA 1KJ9A 3ZD6A 1SC1A 3C3AA 2EKDA 4AJIA 3C14C 1NU6A 2VF7A 4XASA 4RIFA 4WBNB 4IY1A 1IULA 1P2TA 1NLMA 5DIFA 2REOA 2IZ1A 1ZMOA 2QTAA 1OXBB 1QVZA 1ADBA 1V5WA 3ET4A 1QKJA 4C1BA 4R31A 2ZYGA 3LLUA 1NOKA 1R0ZA 5KQPA 5JD4A 5DTQA 4LY6A 1P17A 2VP0A 1HRDA 3KQQA 4FDVA 3OZFA 3VO1A 2BGLA 3IXQA 2BFFA 1GPYA 2JI7A 2WWIA 2GAOA 4ZALA 5CLGA 1DRUA 2PS3A 2PSHA 5AJYA 3KCNA 2FA9A 2JGRA 3P71T 4TZTA 4I08A 3OBBA 5ARDA 4LV6A 4BU0A 5GIPE 2AVNA 1YMQA 3A0RB 4ENVA 2QYTA 3LTNC 1JUDA 5D84A 2BHSA 1Y8RB 1GY8A 4YT4A 1A8PA 1MT0A 3OPYB 4UM9D 2IHTA 1DL5A 1Z2PX 3KSZO 2IZOA 1XD2A 2B99A 2Y1WA 3EVAA 3OCUA 4N7MA 1PQPA 4RWZA 1ESMA 2P9FA 3OUZA 4EYOA 1W85A 2O8DA 1JPUA 3K8QA 4CU5A 4D0SA 2JIZA 2VYQA 2X9LA 5DTEA 4ZFNA 1E20A 3H2YA 5GM2A 4RAQA 2C77A 3K9LA 1E5TA 1YDMA 2GZ2A 3PSHA 1I2DA 3IUYA 3RKUA 1L7MA 2YFYA 2QZZA 2EBFX 2AOUA 2R5FA 3JQ6A 5F5LA 4RMJA 3WRVA 4TYWA 1K97A 2GS9A 3SE0A 3USZA 1NY5A 4DM7A 1XMXA 3B38A 4RS3A 2HGZA 1BFDA 2PFKA 1R15A 1L5HB 2GJAA 3FNEA 2GT1A 4BQOA 5JNVA 2IYYA 4CDNA 3KKMA 2QQEA 2IVFA 2ST1A 5CNKA 3CVVA 3DMDA 2GBLA 1YZGA 3DP7A 3TL6A 3HUDA 4D8XA 2VH2A 3H4VA 3QVGB 4FE4A 3DT9A 5LQDA 2BKVA 4KB5A 4R3UC 4MQUA 3S3TA 1LD3A 1X1CA 1LWOA 3HN6A 1CHNA 2J30A 1URPA 1Q11A 1D6SA 1WS6A 2ORWA 2VO1A 4DARA 4LW8A 2PVCA 5CM9C 1ZUWA 5EP4A 4CF4A 2GN1A 3UJDA 4H4EA 2ONZA 1PNQA 3V7NA 3JZFA 3FUVA 4FUQA 4ZZIA 5EIEA 4LISA 3NOOA 5JVDA 4D9KA 4KDCA 4ALMA 1MN6A 1PFWA 3G13A 3G5UA 2HF2A 4M0PA 4MR9A 3TXXA 5BV7A 1E60A 3AUUA 1EVIA 3E2PA 2W8ZA 1N2GA 3R3XA 4PWYA 3K0KA 2VWQA 4ER6A 1UWKA 4GOMD 1N5OX 5BW6B 3I9MA 2CXHA 2WJHA 1B0ZA 3CRZA 2I22A 4G4GA 4ZIRA 5EJAA 3NCTA 2XCLA 3A3OA 1YZFA 3AHGA 1Y4ZA 2HXYA 3AESB 1PVVA 3JS5A 4B09A 1M1ZA 1QK5A 3O1HB 1U8AA 1CQJB 1C0IA 1AQJA 5HF5A 1QIFA 1DG1G 1WZ2A 3AUTA 5TV2A 3QYFA 3GA5A 5HBRA 3Q7SA 4ZD6A 2QVGA 4JFRA 1XJQA 3AO0B 2PAAA 5AI9A 1WZUA 5L45A 3T35A 4M1MA 4BNLA 4JP3A 5EZYA 3RKSA 2W58A 1V7ZA 2ZROA 1QF7A 4FUTA 3NVMB 4KKXB 3WWEA 3Q12A 5AUPB 2C8LA 2SBTA 1RYDA 1QCCA 2QW1A 3LBYA 5FKJA 3ZJ4A 2Z8YA 3L7OA 4MV9A 1KJZA 3KQWA 4BVKA 1RIFA 2COKA 2QTBA 4Z9BA 4FN4A 2DHQA 3RF6A 2CFRA 3C41J 2EHJA 3P0FA 5IAAA 1E0JA 5IZCA 2OT3B 3B8HA 2E9SA 2FG6C 3L0CA 4ND4A 3ZCTA 1CUBA 2J08A 3DXXA 1WV0A 3LC2O 1G4AE 4NEQA 2YNMC 3VX4A 4XCVA 1EP9A 4CV3A 1JZTA 3BM5A 2WDZA 2V54A 5K8CA 2XNDA 3PFWO 3N28A 1QIEA 2J07A 3GCWA 3E5RA 5JS8A 1E9FA 4FIZA 4CEJA 1Z5WA 3VAAA 4LKRA 1T6BY 4KFRA 4E2WA 4FHDA 1GA1A 3BMCB 1M0TA 1P9OA 3BN3A 1E2KA 3VFDA 4LC1A 3Q5DA 1MNAA 4B33A 3RCBA 1CEYA 5AM0A 4JI6B 3T9EA 2YVQA 4MS3B 1V6AA 5IM4F 1DG3A 2H4ZA 3TDMA 3ZHZA 1U0HC 5BMVB 4RETA 1I2MA 3H4IA 1EIZA 2DXIA 1NR1A 2JIQA 3MHPA 2ZRDA 2HLHA 3P9IA 1XTQA 2QL9A 4QOGA 1JFLA 2O19A 5IVHA 4TLDA 4NYIQ 5GINE 3HWSA 4GBJA 1TRKA 1KY5A 4WVFA 4C0AC 3QPUA 1E9DA 2QU7A 3I6YA 2HHCA 2ONYA 3TEFA 2LIPA 5FV7A 1SQ5A 4BXOB 3O90A 3EIHA 3NP7A 3WNBA 2Z30A 1WA5A 1OLSB 3CBGA 2R1TB 3TLMA 3I2KA 3DE1X 1XMOB 4JJIA 1I2ZA 4Y1RA 1UMDB 2O57A 1E6UA 1FB5A 3L8EA 4OB8A 5JMPA 3LP6A 4C2BA 1RM0A 3PB3A 4JLBA 4L51A 3PLNA 1A7UA 5T6BA 1FRNA 2VUTA 2YWDA 4N0DA 3U61B 1J8FA 3DNFA 2WOOA 3SR0A 2VPIA 4FNGA 5CX1A 4BNIA 2BMEA 2FPGB 2PX3A 3QBVA 5K2MA 4GL2A 2DUMA 3N6XA 3RYIA 2ZS7A 3CRNA 4R9NA 1P9LA 2AMFA 4EA7A 3IQEA 1N2OA 4LF8B 1TD9A 4OMDA 4RTMA 4ZYWA 2OBNA 3BDIA 3R8FA 1AQ6A 3AOEA 1UZAA 1P77A 3QLJA 4GP6A 2GDJA 1LFAA 3NHLA 3E6AA 4QGFA 5DYGA 4ZT6A 1XRMA 2IA5A 4MWDA 3L18A 4RVOA 1NHWA 2C5EA 1V2HE 1Z45A 2OVBA 3KR0A 3RASA 3EIQA 2IU0A 1J07A 2GCIA 3OH8A 2MSEB 3R7NA 1KS9A 1PJTA 3ZQKA 2AKAB 5CLHA 3DWFA 2J31A 3KDSE 2TECE 3TRIA 1SA0B 1SD5A 1U6KA 2JHFA 1QRSA 3H17A 4MIKA 2W48A 1VXRA 3GYBA 2FMKA 3N58A 5GOZA 3SKYA 3AUKA 5IULC 3TCNA 3PFFA 1GUFA 1I3NA 2QMOA 2B1JA 2ZYUX 4QJ4A 4R5MA 4ZCIA 5C4MA 2ZTSA 4AWXA 2YYYA 4GM0A 2VAPA 4LWPA 1MT3A 4A16A 5INTA 4EGAA 1U28A 1UOQA 1P7VA 3R5XA 2WKQA 4B3BA 4PLGA 1IBLB 1OWOA 4FYMA 3ZHSA 5HK8A 1RAFA 4JQZA 4YLYA 5FWDA 3ZX5A 2DUUA 2POQX 1SPXA 4RPCA 1YUBA 3STHA 3WK5A 3ZLUA 4EW1A 4FFLA 1LPNA 3P2MA 3E7PA 1IN8A 4EQ6A 1KZ6A 2QVZX 3DV0B 1JALA 3RIGA 1UT6A 1UZLA 1XAGA 3NUZA 3NU1A 2E1PA 2BZ1A 4MW7A 1KJIA 5EGSA 1ZAKA 4Z86A 1LLDA 4IW3B 4D6XA 5C8DA 2P6RA 1AMNA 3T5CA 1J5PA 1QAOA 4DRYA 4NZYA 1XZGA 2Q9CA 2CFCA 3CLRC 3KUCA 4BQFA 1NNUA 2V98A 1FP4B 1IE3A 3ETLA 3FNHA 4D92A 3T3DA 5HM6A 1K6JA 1DWPA 3WMEA 2VPTA 1KFBB 2NXCA 1I36A 2GFQA 1JDUA 1PYDA 3EGCA 3QMWA 5HF9A 2CMDA 5K0LA 1UM9B 1MJGA 2QSUA 3EGEA 4GAEA 2BHLA 1YI8A 3C45A 4ZRNA 3V2IA 1G59A 2Q6TA 4E33A 1P2SA 2FW8A 1PK8A 3GZTB 4WGGA 5F76A 3HV2A 1Q20A 1OH8A 4BMSA 4QL3A 4Z4FA 3MLAA 1AJEA 3RVQA 4KR9A 4QXPA 4EVIA 3A06A 1OVGA 4RV5A 4Y2SA 4PG4A 1G4UR 1RZRD 1DTWB 4RESA 2DF8A 2DWOA 3D7LA 2F9LA 1PTJC 1G18A 2AFIE 3KKQA 5FL7D 3H9UA 3U3DA 4GW3A 4LYJA 4ENPA 1RHJA 2VT6A 4XWOA 6Q21A 5B1EA 3HTXA 3I8XA 3RQSA 3HA2A 3COWA 4JX8A 3L0YA 1CR6A 4TMZA 1TUGA 1V43A 3DLHA 3CF2A 1T24A 3Q41A 4CFSA 1U04A 3DMHA 2I66A 3K1JA 3WIBA 4HJXA 3JALA 1OWNA 4JP1A 5BQPA 4BWYA 1MHTA 1Q6ZA 4JCCA 3VBEA 4OG2A 1F3OA 1XTUA 2RH9B 2WABA 3PR3A 1NV9A 4D99A 4TWRA 3N8DA 1ZYUA 5C1PA 3C3JA 2HK9A 2VSXA 2G5GX 3BRWA 3BL8A 3HLTA 1U2GA 4U8HA 1QE5A 1KMCA 1VJTA 3NDJA 1F5SA 4R8RA 4WFKA 2H7XA 5AJHA 1P3Y1 1J9EA 4DCSA 1HM5A 2PWPA 3FYCA 1X80B 2ZAGA 2UUBB 1QCZA 3E18A 3I6IA 3OM9A 3F78A 2Y2UA 1ZM4A 2ZJOA 1WPQA 5FFFA 1W49A 2ISCA 4FMDF 5IAOA 3ENWA 3O2QB 4HMQA 5KTMA 4Q9JA 3CZ4A 3H2IA 4JSRA 3TI7A 4G81A 3UMFA 1RWBA 3NT5A 1CLEA 3E9MA 4I81A 2I8AA 3N7AA 2VHXA 1N5LA 3HWX1 4XARA 5F1KA 2WHQA 3G79A 4MWOA 3OU7A 1W76A 1OKKD 4O1HA 3DL2A 3KCQA 5ESRA 1JLHA 5FLEX 3UXMA 1THTA 4JBLA 4JUCA 2C7OA 2AMJA 4WWHA 2BFFB 4RY0A 1ZMXA 4B43A 2FMFA 1SBYA 3WSTA 4B6QA 2N3ZA 4L4RA 1U31A 3THWA 4PONA 2ZDHA 5JNLA 3INTA 3ZLJA 2PMDA 3BJZA 3KL4A 3LO8A 3RS2A 3R6WA 1OROA 1COWD 2D2VA 3FFBA 3FETA 1FRFS 3G0DA 3DMFA 3V4ZA 1YJ8A 1ECPA 2DT5A 2R9VA 3C3XA 4C4AA 3DZ8A 5KSYA 1QZ3A 1IHOA 1XD2B 3PSAA 5EFOA 2O8DB 2X77A 1NRWA 1U28C 2D7DA 3F6PA 3ZCVA 1EK1A 4W5WA 2WNIA 1KRXA 4M0UA 1YBHA 3TFQA 1KP2A 3QU7A 4RKYA 4GDFA 3K32A 4IV8A 4GWLA 3HM2A 2AOUB 3F2IA 4HN9A 2ACVA 5FLKA 2F3QA 3GFOA 3VH3A 3GFVA 2Y4OA 1KP9A 1Z13A 4C7VA 4D3DA 4NJEA 4NZ9A 4OQFA 3FWPA 2I4IA 2I6QA 4TKLA 2WMNB 4ESHA 4RZ2A 3UCFA 1TU4A 2XYRA 2CHEA 2HCRA 2Q8NA 3F6BX 1WLYA 1TM3E 4IOKA 3F9CA 3KTOA 1ZC3A 5F5XA 1J99A 3AVUA 2XB4A 2XEDA 5I7HA 2OHFA 3JAMA 1N77A 3PNVA 1HO3A 1NPDA 2W8BB 4I5GA 1Z0DA 3HKBB 3L1JA 1LWNA 3D8HA 1ENYA 4CYMA 4DPLA 4RORA 5KOYA 2FMHA 2Y77A 1ZZEA 3ADBA 2B25A 4COKA 1II0A 2QM7A 2QTZA 2QJRA 4Q7LA 3IHKA 4KIFA 3ZZNA 2M9MA 2X0DA 4DUGA 1D2EA 1SVSA 4EHHA 1VBFA 5JVDB 1I8TA 1B6RA 3LY7A 4JZYA 4UTNA 4AJJA 1XT6A 5ES3A 4ZAYA 1D0SA 5A7FA 1K06A 3CPSA 3QWAA 3F4BA 3KWJA 1R66A 1PR3A 1QH8A 3GEIA 4MR9B 4K0RA 4IXMA 3WIOA 2IU3A 2RARA 4DA9A 5M5BA 3GJSA 2GBIA 2X9VA 4RJ2A 1U6IA 1VJ0A 3W0LB 1JFFA 2WTEA 3DT6A 5BR7A 2QRJA 4DA7A 2BFWA 3JWGA 5DGIA 4A27A 2O54A 3K0SA 4O33A 4BBZA 1ZEMA 4D44A 5LQUA 3HL0A 4EATA 4YMWA 4W7HA 1YVRA 1NSTA 2CFIA 2JAUA 3VO9A 4JVSB 1TTPB 1RKQA 3F1LA 3KOYA 4XOIA 5KCZA 3C2QA 4OMFG 1T91A 2VVTA 1KI2A 3A1SA 4LY0A 2JZOA 4R1QA 4AF7A 1EWKA 3ABZA 4KK4A 3C43A 4YQZA 4EI8A 2WR8A 1GOTA 521PA 2Q3MA 4DSOA 4BNUA 1WHSB 2BI7A 3EGIA 5FYQA 1XTBA 1QGDA 2MINA 1OWMA 2ZI6A 2Z5GA 1VLJA 3O4JA 2HCBA 4R1LA 2CNWA 2EJBA 5EUQB 1U2GC 5LZ5A 3F5FA 3ZIAD 2WF9A 4DLAA 1HORA 2LW7A 1IQ0A 1RXEA 3B60A 1WW3A 5FJJA 1JIQA 1KTIA 3UF0A 2BDTA 4X7MA 1HNZB 3CVWA 3UV3A 1AKNA 1DXYA 3OPQA 2HXGA 1UQUA 4TKMA 3GFRA 4XJSA 3B52X 3IVRA 4YRAA 4YV2A 3F96A 3OIDA 3U3JA 3QTBA 1EFPB 3ABIA 5BSWA 1E69A 4DILA 4CIXA 4TWBA 1Y89A 4FR2A 5ALLA 4JNKA 4EPWA 4YPOA 4OI1A 4R8KA 3RJMA 2GZRA 1HSOA 2H1VA 4UHDA 1LQ2A 2F8TA 1UT8A 2FKNA 3AL0C 3IIMA 3LT5A 3NHYA 3G0IA 2MSCB 4RGBA 3W04A 3WGZA 2GPBA 4EG5A 5JCZA 4YT8A 2RGUA 2HHJA 2ANCA 1O9BA 2HRQA 2CVQA 4QLAA 2JFQA 4QXAA 1LPSA 2CLCX 3C16C 2DGDA 5ESDA 3GLIE 3NAZA 3WGMA 1ZIDA 1ATZA 3MWYW 2PQ6A 3PGXA 3X0DA 2VHVA 3THXA 2XH8A 3IPCA 4YP6A 1REQA 5A4IS 5B2FA 1TAHA 3HKEA 3JVIA 4H1VA 4MTCA 3TE7A 3Q8MA 3GP8A 1I5EA 3LU1A 4PG8A 3HKCA 3U60B 1HYBA 3IB3A 4IIXA 4KGXA 2Q3DA 5ICEA 3TRFA 2F1RA 1QGAA 2I2DA 1QIGA 2P7HA 2CJPA 2H7VA 4KKVA 2QT1A 4LFBB 4R05A 1BYUA 1E9SA 5C5IA 1ACMA 4JBIA 4L0QA 1G8MA 3N0WA 3VR6H 3QU9A 1T29A 1S3FA 4P5DA 5AKJA 3JASB 2CVOA 3SYTA 1WTCA 3WB2A 4ZYLA 3Q8KA 1JEAA 1FLNA 1QIMA 2Y93A 1WDWB 3QXGA 4Y1RB 1NMQA 2O4UX 5FLXA 4JJKA 2JLQA 4HUTA 4WDQA 4XCQA 4I19A 4CTNA 3BTSA 3FHJA 4NOMA 4PM4A 3EPLA 3ZD8A 1U1FA 4GXTA 5KYKA 4CKCA 1WETA 3HV0A 2YXNA 4H6XA 4WXRA 4C05A 5DHSA 3RC1A 2DJIA 4TTJA 5A3QA 4RF4A 4CEIB 3E7DA 4GI2A 3NVDA 4BB0A 2P27A 5AUNB 3K09C 3TOXA 4RJIA 4ZWNA 2J5QA 3ELWA 4IUCS 3TZEA 3EXAA 1EVEA 5A05A 1LEHA 4CIYA 1BCSB 3OCWA 3VPBA 2C82A 3DUFA 3M3HA 1XUOA 4TTVA 2XTZA 1ZHOA 4YLEA 2H2IA 3U13A 3IBGA 2O8BB 1F0KA 5FFMA 2XZOA 1PT8A 3MFYA 4MYDA 3KE9A 1CDZA 3HFJA 3ZWWA 4PSUA 4X7RA 4XIFA 3ZBUA 3DZGA 1OFGA 3G1WA 1ZN7A 2CYBA 1JR6A 3OJFA 1R4ZA 1CZNA 3NHRA 4HNTA 5KB3A 2BONA 4OK6A 1KR5A 4JJFA 2BTEA 1DQRA 1GT6A 1VB5A 1ODCA 1XDDA 2CYAA 3EFBA 1KK2A 3QEMA 4GM1A 2V9ZA 4J1NA 3WGKA 3MJ4A 3EZ2A 5BW8A 2WWWA 1LDNA 3KB2A 3IE2A 2WJ6A 5CLJA 6REQB 4QXRA 2R6HA 4WQMA 1LPMA 4HTFB 4C0KA 5IXSA 2PUGA 2ZBGA 1UK8A 5F3RA 5FLYA 2V0CA 3PITA 5AVUA 2CZGA 1RWQA 2YJTD 2A6PA 1S1CA 3AB7A 1NM5A 3FTFA 4IIEA 5BOVA 1VSTA 3ZH2A 3VAZA 2YZMA 1DBSA 3IS3A 1UJ5A 1BWRA 2FZKA 1J2JA 3OCVA 4UZFA 3T4EA 1I7NA 2J1LA 4JSYA 4HQLA 4YJDA 2J6IA 2Q2NA 1CW2B 1VG8A 2RH5A 1A69A 2C98A 2VQSA 3RWOA 3U0BA 3ZHTA 5HUJA 3ZJVA 2PPVA 2TMYA 4JVMA 1F8XA 4M4SA 4MKHA 3KLBA 1C0KA 5IT9A 1R27A 1XNHA 1YHNA 2HEIA 2K6GA 4JBWA 5LP6A 1XZJA 2PV0A 3SX2A 1SULA 2VJDA 3AJ8A 3CUUA 4ZO8A 4LMRA 1P62B 4CN9A 1HE3A 2C9CA 5IKOA 1DDOA 2W0MA 3TQSA 1ENZA 1ZCZA 4WLFA 5F23A 5CM2Z 3UAOA 1GT91 1WBJB 3DLIA 5KS2A 1CUJA 5K4AA 1VL1A 5ALRA 2QTRA 5ADUS 2WZBA 1GAWA 3WL4A 1J7KA 4NFHA 4LXGA 3ND6A 4XE5A 1CNMA 2FSPA 5ENDA 1Y3DE 3MGKA 2NAPA 4KDRA 2HA5A 2YV1A 1L9XA 3INYA 1AQYA 3EZLA 2VQEB 1MX3A 1N3IA 3LUBA 4C7MA 3HZHA 3WX0A 5EJFA 5JEEA 1QZXA 1AZWA 4Z0NA 3TNDA 5GV8A 2AEMA 4L08A 3CW2A 3EWSA 1TUEA 4K6KA 4MV0A 1GVHA 1J0EA 4U6NA 2NU8B 3OOEA 1U7PA 3UK1A 3G2NA 3VUFA 1QYRA 4KGZA 1L4KA 4WNAA 3R09A 1AQIA 5ADWA 4XWGA 3R5KA 4FB4A 1XJWA 2EQAA 1L5WA 3KWMA 1QORA 4BWVA 4YAJA 4IQGA 5CYGA 2EV9A 4IDCA 3COSA 3JALB 4B3FX 4XWWA 1Y82A 1XDZA 3A31A 4ARUA 3JZDA 5CA1F 2F8LA 2CFTA 4ZQIA 5BNWA 3DEHA 2CXRA 3QBJA 3Q5EA 3ZHCA 3IB6A 5JEDA 4BMPB 1FVXA 2B1QA 2J5KA 4JXXA 5K6AC 5KQSA 4YROA 1VIMA 4KQ6A 2M6KA 4LXXA 3K70C 1SKYE 5CR9A 2MJLA 3WGTA 5JMTA 1KH2A 3DLBA 2QNIA 1AF7A 4EG7A 4PHGA 5F2OA 1NVTA 1YU9A 1BX3A 4A0HA 2R47A 3ROQA 4HRVA 1FVFA 3UGTA 1ZVKA 1CZHA 4LTMA 2A8YA 3IGFA 2V65A 3CISA 4MV1A 4P83A 5A5EA 2BGKA 2IRWA 3S5UA 1NA5A 4HNQA 4ZAVA 1NQVA 2DVMA 5CNMA 1DCFA 1CUHA 3RC9A 5JBQA 1T1EA 2GFHA 5EIXA 2ZSIA 3F6SA 1HE1C 1T8UA 1FDUA 3H04A 3LNTA 2ZB3A 4MIOA 3EH1A 3M3PA 3U6BA 2QXUA 1QH0A 1NW9B 3QVJA 3IQGX 4F5DA 2A9FA 2IXAA 4TZ6A 4R6WA 4Q39A 3HS3A 5FOTA 1UCFA 4F38A 2W2LA 2OZKA 2UUAB 3L77A 5CLIA 2AFVA 1Q1GA 5LJIA 2GN0A 1LFDB 3CINA 4I9HA 3MJVA 2HX1A 2O2DA 2XMBA 4FFDA 4UW9A 1GYPA 2D54A 5LLSA 4GOJA 2BM9A 2XMCA 3I9OA 3LCJA 4XDZA 4KN6A 1RI3A 1ZSYA 2I6XA 2PGAA 3MTQA 3F7MA 1P0CA 4I6EA 1SVNA 2GM3A 2VHEA 2AE1A 2HIHA 2PLWA 4JU9A 3THWB 4II7A 1A27A 4B7CA 5TVKA 2DPLA 2VRNA 4IXTA 1L5NA 2JFVA 1YRLA 3HYCA 3ZCSA 1H0KA 4KMSA 4YN3A 4TS4A 1LQTA 1CQIA 4LRYA 1NJSA 1QR6A 4UHFA 3NEJA 2XE7A 4RD0A 4Y2VA 5AW9A 3ROGA 1APBA 3VNVA 3D1JA 1CJVC 3LQ2A 4OTZA 4OJQA 3U62A 3N2KA 4LFCB 2QJWA 3KG2A 3A10A 5I7RA 2QTVA 1IY0A 2X42A 4ID3A 3WWDA 1PFVA 2GEBA 5MN6A 2NIPA 3PQ5A 5FUWA 2Y3IA 1NM5C 4J29A 1PLKA 3WK8A 4QRHA 3VGJA 1D2AA 3QH4A 4QRIA 1KTVA 2BTQB 2AN9A 5B1IA 3VNRA 2C7BA 1Y9ZA 1I01A 3K94A 3RC8A 2ZBDA 3GFPA 3ETNA 5GONF 1QKIA 1VL2A 3A58B 3P9QA 4WN9B 3BXZA 1PR5A 1UL1X 2ZR8A 4W9NA 3NDRA 1E9RA 1R9NA 2O2YA 4MI6A 4HFRA 5AJTA 4AROA 5AVQA 2ZSBA 2LDBA 4OL9A 4ZU6X 3EYAA 1A97A 2R86A 4XCXA 4CTJA 1H0RA 1P7YA 1JGTA 2G6TA 2NADA 5IJAA 1JQ3A 4ENUA 3ICQB 1FXWF 3HUTA 3LP5A 3EDOA 4RHCA 1TTQB 4PLWA 3AEKA 3EFOB 2XVAA 2NVWA 2J5XA 2PFGA 3GLVA 4D9JA 2HZBA 3VH1A 3WLOA 5I4IA 2ZCJA 2XYVA 3A6JA 4DDHA 4RS4A 3TM5A 1V95A 2F17A 3G8AA 1HFKA 5DE3A 1KKMA 3K73O 3NFYA 3B5EA 3PX3A 4FCVA 4MQBA 4ZVNA 5IUKC 3ZJTA 1QH8B 3BFKA 5AKLA 5KX5A 1N25A 2W6IA 3N59A 3GY0A 3WOHA 2GX6A 2WFAA 3WKEA 3TR6A 4C76A 4EI9A 5A3JA 1QF6A 4LHEA 3WZLA 3SYNA 4MWBA 1A5BB 2NU9A 3JD3A 3DF7A 4F97A 4AKIA 2X22A 3NCHA 3O1JC 1UBUS 2ZR0A 5JHGB 4TMXA 4KOEC 3EVTA 3IA7A 5FR1A 4DL9A 2PUCA 1WRBA 2OB1A 1IMOA 2PHZA 3DBOB 1A8QA 3HCOA 1RTKA 1BGXT 1T5IA 3QNWA 3VI3B 621PA 2YXLA 1GPAA 3B6IA 4GU5A 2G1AA 4X7BA 2R6DA 1NFQA 5H3LA 1NXSA 2NZYA 3U7JA 1H5NA 1JDSA 3IUJA 4AMGA 4M0CA 4MP6A 4ZVPA 7REQA 1HBJA 4QELA 1E2UA 3ZGVA 2MINB 2RGYA 1RWOA 1JI3A 5CT8A 1UJ4A 2EJTA 4KQ2A 3F9IA 1Q17A 3WZMA 5CA0B 1W46A 4IGIA 4I36A 4ZCSA 1V5EA 3V8PA 2ZANA 4G0ZA 4BO2A 5K0ZA 4J9VA 3TIGA 2ZAYA 2V7WA 2XMSA 1BWQA 5JWHA 1SGWA 1B14A 3MC1A 2AF3C 1FP7A 1U0LA 1AQUA 1ML3A 1R6AA 1PGPA 1V7QA 2R7LA 1UKYA 3OZXA 1PGNA 2Y1GA 3WQQA 2O2XA 2GARA 2GPYA 4MDEA 5LDDC 5FI0B 1RM5A 4XIYA 2BCJQ 1PEDA 1UJ6A 1UOOA 4GEKA 5HK9A 5DH9A 3HLKA 3E9EA 3QOYA 3T3OA 1GHTA 3A04A 4G8CA 4TSFD 5CYOA 5IAEA 5TF4A 1UUFA 1CSEE 2YC4C 3RIYA 3TRHA 3ZWBA 4J0KA 1ICEA 1VQ1A 3QU5A 5CDUA 5KU7A 3THXB 3AI1A 3D3NA 4LK3A 4L78A 1O0BA 2Z83A 2DP4E 4AWBA 3HKEB 1A8SA 4KIWA 4BU1A 1YCDA 1HT0A 5EXPA 4OHBA 1YUNA 3BX1A 3HKCB 5B1DA 2Z95A 5LYJA 3AF4A 5DGXA 5TT1A 1KI8A 1WSWA 2A67A 1UMBB 1IDN1 1HLFA 1O97D 1OXTA 1JA1A 4CJXA 4LYFA 4HT3B 1YAJA 3D2LA 1KOFA 5DM70 4HH3C 2OXIA 3BMNA 1B16A 2GCOA 2R8BA 3S2YA 3K70B 2WG1A 2FKAA 3AERA 4IV0A 5K2OA 2CWDA 4CM8A 5HW0A 1STOA 4L5JA 1NRJB 2H07A 2OGUA 4L72A 3OU6A 2PMWB 3EZ7A 1T9GS 1I9GA 4XX0A 1XXLA 2WIGA 5J2UF 3QX9A 2OTCA 1Y1TA 3DOOA 1I7LA 5DBEX 4I9FA 2IYUA 3F9RA 4FNAA 4MARA 5E7IA 4XGKA 5AVKA 3ZHQA 4CKEA 1JQLB 5AW5A 2W83A 3V6LA 4CKCB 4AO8A 4QGGA 1GTSA 4CQNA 2AJTA 2HMTA 4K9QA 2J3IA 3N2EA 1JDTA 4W9NC 4D3FA 2MSKA 5J47A 1EYZA 2XWSA 1PJAA 3URMA 4DR2B 5KTOA 4BGUA 1R8XA 4DIEA 4XTRA 5TQVA 1T5OA 1TB4A 3EVDA 3RUPA 1ABFA 1R9JA 4H15A 3QV1A 3QENA 5CT9A 1QG4A 4FJ0A 4I2VA 1K0UA 4RSGA 4PHHA 3EB9A 4KRGA 3K3PA 4HB3A 2XI4A 5B3KA 1ZD1A 4FP9A 3OUUA 2DH5A 3UJCA 2P62A 5TMDA 1Y1LA 5ALNA 1G41A 1ZGCA 2LGJA 5CK5A 4UVEA 4BFLA 2BGUA 4R84A 3KM0A 4ZQGA 5G4LA 3CNLA 4QX6A 3O95A 2GLUA 5T4BA 4DV7B 3EMBA 3FE2A 1XQ9A 4UU1A 4UJ3A 4F2DA 5KJ1A 3QEMB 4ZVKA 1MX1A 5IJWA 4UD6A 3T3EA 4QVIA 5JJIA 3U4MA 5DEIA 1AGXA 2B36A 4I1PA 1D4AA 5JNTA 4L2IA 1KC1A 1YL6A 3DDCA 4A6PA 2IYXA 2YQZA 3L49A 5FWXA 4PC2A 5FBZA 4RKEA 1MV8A 2Q9AA 1RLTA 3X2SA 4QLBA 1TZKA 3E1KA 4RTLA 1IUPA 5AQ1A 5EYPA 1R8JA 1RHUA 3CVJA 4KRYA 4TRMA 3UMYA 4LF4B 3IR6A 4KRFA 2RBKA 2PRKA 5E9QA 1UEXC 3KJIA 3VYSB 3MWEA 4BE4A 5B12A 2HV9A 5A2GA 1J0XO 3RR2A 1PG5A 1PG0A 1YGPA 3FYUA 5B57C 2IITA 1DJOA 5JD3A 2O5RA 1TL7C 3UMBA 3N7UA 4F56A 1X8JA 4YUWA 3A1TA 1DAKA 2JAOA 1BWPA 4CHTA 2H51A 5IG2A 3ONNA 3FYSA 4N5IX 3LUDA 5AVSA 3BHNA 1KJNA 4WZAA 1KOGA 3M1LA 1UZNA 3NB0A 5CDFA 1QP0A 3UFXB 4DIBA 2P4SA 5KJCA 2X8JA 2D8AA 1MJNA 2X5OA 4BFZA 5DOZA 2RHRA 3QE2A 1ZM7A 3I9KA 3QWIA 1I0ZA 1SRRA 1YH3A 5T64A 3PD1A 5T4FA 3VNSA 1K8ZB 3O31A 4EGCB 3ESDA 2O4CA 5HQTA 1YWGO 4R68A 1AMUA 2QLTA 4DWJA 1JHDA 4PSKA 5IN4A 1XLVA 2QUAA 4WNAB 1OYOA 3AUFA 4XI9A 4S2EA 2JKYA 2J4DA 3ZY3A 1Z7BA 1Q19A 2WW8A 1TCVA 3NBFA 2JVJA 2QL5A 3L01A 3ZK8A 3PJRA 4I50F 5CDGA 1CLUA 1PX2A 4FGUA 2PTHA 3ZS8A 1JT2A 2PSDA 4H6VA 1QGED 3FPSA 5IF3A 1G8YA 5T8KA 3M6UA 4POAA 4UAJA 4RJTA 2HLPA 4UCWA 4KIJA 4LXHA 4YRMA 2OV2A 1BXRA 4RK4A 1BO6A 2PK3A 1Z4JA 5EVCA 3ZLBA 2EZ8A 4EVQA 4AD8A 4FFSA 3IKLA 1Z6XA 1RE1A 3UUFA 5J23A 4W1RA 3CE6A 2Z2JA 3H0EA 3QBDA 3R4CA 3WL6A 2JZNA 4W99A 3ZHBA 4DQDA 4LJYA 4PZ0A 3NNNA 5CJ2A 1S2IA 1PP4A 2QAGA 1TQDA 5C52B 1MW9X 4LI3X 4H7EA 5K51A 2ZSFA 3UH0A 4C4SA 2H1HA 4V02A 1T4CA 1TUIA 4AKSA 5ELMA 3UK6A 1B8VA 5PGMA 3NC4A 3QEOA 5A4MS 3ZD7A 1E79A 5IC4A 3AEQB 1EFRA 3OZCA 3QG1A 1L5FA 3HU5A 4UM9B 3DS8A 3B6KA 1YRQA 3W7VA 1CBUA 3OT1A 2FMXA 1Y33E 4MRSA 4YJ3F 1FU4A 1XRQA 2OQIA 1QVAA 2C57A 1LI4A 2X5JO 3EVBA 3P0HA 3W34A 3SHWA 2VAWA 2VBCA 3DFKA 2SKDA 2Q5JA 4HWSA 4G8BA 1SIUA 2Y0DA 4MRRA 4KSBA 1Z15A 3A1WA 4RLFA 3WLRA 5BSRA 4DFDA 1K7EB 5FYDA 4FW8A 2UVQA 1RRGA 3RUHA 5KYWA 1CB7A 2R3SA 3EEIA 2X6RA 2OD7A 3KVOA 4H3KB 3N2KB 5ESWA 4JLDA 3DZCA 2D3WA 2WHYA 4Y6PA 1TZJA 3S40A 1ORWA 1JTVA 2A0XA 2QTVB 4EZIA 3OP4A 3WA6A 4DCNA 4Z3OA 4QVKA 1C7RA 5AM3A 1WUKS 2LCIA 5DSXA 2L82A 1FMJA 3WJ7A 1ZA2A 4BFVA 2KYRA 3UNXA 2VXCA 1ZVJA 2CHFA 1JFVA 2GESA 1SVUA 3QUTA 1YZYA 4RKWA 4UMFA 5IVDA 4CU2A 4CIWA 1E77A 1TO6A 1Z6QA 2CJWA 2D7JA 4IIVA 2ZIUB 4FVTA 1WW2A 2FGJA 1UODA 3IDSA 3PQEA 3FYUC 1FXSA 4R0VA 1HPLA 5FT9A 4UFPA 3AF5A 4OPMA 1CHDA 2HBZA 2HSWA 3KOOA 2IWHA 3C70A 5KPDA 4EGQA 3L2OB 2V4MA 4FTWA 1YRWA 4LZPA 1U2SA 2ZQZA 2R00C 3AEKB 2IE8A 1A9QA 4M1WA 4ZQFA 3FCCA 3NI2A 1YA8A 4P3PA 2AW5A 5FBWB 1ST2A 5FUXA 4MRVA 4MJLA 1CY2A 2W4MA 1V96A 4ITVA 1Q1QA 3KJEA 3MLEA 1NNLA 3K9WA 4PF1A 3R0ZA 1Q0PA 4FJ1A 4B4DA 4HXYA 1ID8A 4MNTA 4YDQA 2P6UA 4DJDC 3KOMA 1N7HA 5BRAA 3AV0B 1PUXA 3QTLA 4WZBE 5CIQA 2OVFA 4Q21A 2VP9A 4IIJB 1UKCA 4JYPA 3THYA 1PZHA 2PRJA 3K9BA 2ATVA 1EFDN 3KR2A 4GGOA 5TPWA 2EEZA 4ZOAA 4RKQA 4QM7A 3Q0TA 1IZZA 1FLDA 2EFGA 4NYJQ 4MB6A 5E6UA 1CF2O 5K0FA 2XCRB 1UC5B 2C54A 5JPIA 1MAVA 3ZGZA 1JEQB 4M0EA 3GL9A 2FR1A 3PDUA 1XZLA 2C0PA 4KH0A 3IXLA 2Q6OA 4MITA 3W4JA 4EITA 1RSZA 3OIGA 2VDRB 2NYUA 1NBWB 2ZK7A 4RK1A 3EULA 1VRCA 5T8KC 3EG9B 3X44A 2ODBA 3PQ7A 7REQB 2HY7A 3EVZA 3ZDAA 4KBYA 3B89A 1BOOA 1TJYA 3LBAA 1DAOA 1BA2A 2O20A 4P33A 5TDHA 4HAOA 6NULA 3ZVKA 4ECEA 1GAEO 2J9FA 3DH0A 4G1FA 2ON6A 5CH5A 5CMLA 4ILEA 5EEHA 4Q9KA 4PLFA 4ZOQI 2LXNA 2AL7A 3CLSC 2OPBA 1WY7A 3V6MA 3JXEA 4EAQA 2VYND 5JQWA 4L22A 4E7OA 3GW8A 1CUGA 3SCZA 4EG6A 4PC1A 2EZ4A 1L7QA 3NYIA 4G0QA 3KVRA 1TTHA 1C30A 1Z4PX 3ELUA 3INGA 3IBYA 3M2PA 5IAKA 1WPXA 2ZAMA 1ZQ9A 4JNCA 4B3GA 3JARA 1E7YA 5LVAA 2QAGC 1FBNA 1N33B 3EN0A 4H1HA 3NVKI 4HXGA 2TS1A 1X70A 1WXFA 2ZCUA 3BDVA 4INZA 4QTTB 5A71A 1EBFA 1O9HA 3C6ZA 4B4OA 3I45A 4FQ7A 4TRNA 2FWPA 3LCCA 1V4BA 1NVVQ 1US8B 1NKTA 2Q0QA 3VR5D 3H8JA 3DZDA 1E3WA 3EGDA 1RYBA 2Z2ZA 5L53A 1JE0A 3OQJA 4YMUA 3P19A 2II6A 2ESRA 3ESXA 4EHFA 3PFCA 1M74A 1KK1A 3KALA 1K27A 4LJ4A 3QFTA 4LBYA 4O2LA 4QTUB 2BI8A 4N0PA 4X8LA 5HKLA 2A30A 3NRBA 4GMXA 2C7PA 1SHTX 2CKDA 2H3HA 5JANA 3DKRA 2X0RA 3B3FA 2AXEA 1FP6A 4H0FA 4OFWA 4DMRA 2JFBA 3RADC 5ALTA 2A4KA 3OBIA 5BT9A 4PRZA 1ISGA 2WJZB 3KK0A 1UF9A 1CEEA 3I4CA 4MLDA 3WK7A 1NC3A 4LGMA 1GFWA 2XHEA 3BMNB 4N65A 4AQDA 3BSFA 2PT5A 1NAHA 4H4CA 2NYRA 3V7WA 1U3VA 3G5AA 4IO1A 1L1RA 4F92B 1U1EA 2BDUA 4HVTA 4I8XA 1HYQA 1OT5A 1BE6A 1V16A 2G88A 4F6RA 3EPKA 4IVRA 1YA4A 2NZJA 1EHCA 2HAEA 1LU9A 4B75A 4XX0B 1UMKA 2QNBA 2VAMA 3IH5A 1Y7IA 2EJWA 4GR5A 4A15A 4JYZA 4GGMX 5T3UA 3NJRA 1TIBA 4YXWA 3PEVA 5AOAA 1I6WA 1E3EA 4J2OA 4KQFA 2HSDA 4AIIA 2QPTA 3WO1A 5H02A 3TCXB 1IHXA 2B3TA 4L6CA 1EU1A 2E6UX 3KZMA 4YWJA 3Q11A 2WTUA 3QF4A 3FHCB 3H18A 3QEKA 4I7EA 1KIFA 1KYTA 4Q3CA 5DLEA 1T2NA 3D7MA 4MPDA 4HX9A 4NU0A 4B8YA 3HJBA 3X1WA 2A78A 2C9YA 1HFWA 4LHVA 4ZCLA 4YV7A 4O2AF 1OZAA 3NWEA 3ORHA 4IJMA 1G7CA 2I7CA 1P4AA 4GOND 3VTAA 2EWWA 1G21E 1N5JA 3AY7A 2O3UA 4CDRA 4DXHA 3LXRA 1SEVA 4G1BA 1DDIA 4TT3D 1VYVA 1FS5A 2R25B 3IO5A 4MULA 3WIUA 3U3MA 4O2BF 2AZ4A 3GLFB 3TW8A 4B7AA 1M1UA 1U3TA 4WA7A 4PRLA 2YJZA 1U94A 3MZ0A 4R9VA 4WK2B 4A3SA 4OMUA 1ODLA 1IVNA 2QD3A 1JQKA 1QMPA 2ZYIA 3L1VA 2QN3A 5HQ3A 2VDVE 3FWKA 5CFQA 2RJNA 2WJWA 1AIPA 4JD5A 2ZUDA 4TWAA 3L9XA 5BV2P 1MJ5A 4QYTA 2H16A 4N7JA 4J43A 5DULA 5FWXB 5EMMA 2QRVA 3PXDA 3RF7A 1FP2A 1XXHA 3W9UA 4EPTA 4KITB 1GU0A 2PO7A 2OSVA 2WIJA 4ONEA 2B8NA 2PD4A 1BVUA 2O06A 3O7MA 3QXHA 3RTDA 2PQ2A 4FYYA 1E64A 3M9XA 1SWVA 4Q9LA 1ND5A 4F4IA 2J3DA 3NBQA 3B3JA 3OHMA 1Y1SA 4JEMA 3FYUB 4HLQB 3LWBA 2E5LB 3HY3A 2HBQA 2OECA 2ZYDA 5CX4A 5IDQA 5L51A 3UK0A 3AYXB 5HS4A 3PTAA 4MUKA 2PE5A 4PIMA 3LKBA 3V4OA 2MHCA 1PT5A 4BNNA 2ZR9A 3RSCA 4HDQB 3RVSA 3O74A 1MAAA 2A92A 2FUNB 3DDUA 4GRAA 4KBFA 1T36A 3DAFA 1AA9A 5BO5A 4UU0A 5ALSA 1YS9A 1VKHA 1NSFA 2BFBA 1KYIA 1KJWA 2P5UA 3H1BA 1J4AA 1YBVA 2ODWA 3Q3IA 4M9XA 3BQ9A 4BQNA 4DXAA 4KR7A 1RABA 4LJ9A 2VXOA 4OYRA 1D4OA 4S1VA 2ZSJA 2AHRA 4FONA 5FNVF 4OI0A 2DB3A 3VYRB 1SY7A 2VRBA 3M7IA 2D2IA 2COEA 4ZT7A 5AM5A 3DEIA 4JAVC 3R76A 5AVRA 1R37A 4J0CA 4KN5A 5D51S 1QNLA 1BGVA 3AHDA 1ECFA 2E4VA 4YMTA 1UFOA 2Q2OA 1EM8A 2XSZD 2QPOA 5FD8A 3RBZA 2I71A 5TC4A 5J1TB 4M8NE 4I0WB 4B6FA 4ZQBA 3N05A 2JFWA 1ZD9A 3QXCA 3OF5A 3LYAA 1SCUB 5LIRA 5IDYA 4OJMX 5D6OA 3M6LA 3PGVA 4EEZA 3AVPA 5LC1A 2IS2A 3QUCA 3MOSA 4I5FA 2AOTA 4EJ6A 4UQLA 2H2DA 3IPRA 3V32A 2A0FA 1KQGA 3JYNA 3TSOA 1XKTA 1NW6A 1NN1A 1BXRB 1NKVA 3I2HA 3R74A 4CMIB 1WQ4A 1WUJS 1P7CA 2A9QA 1QFYA 3PT5A 5AXCA 2HJRA 3S28A 4DSUA 3AVVA 1OE0A 1RLOA 5THXA 4DIFA 4G0XA 1TD1A 3MWDA 4ESVA 1K6MA 4A8TA 3MB8A 2P8JA 4Z1MA 3C3CA 1Y6RA 2ZULA 2J7PD 3HBAA 5KTPA 3OQPA 3FLBA 2XOEA 3KSMA 4JWKA 4CLXA 4ALNA 1Q1ZA 5TJ9A 4Z4HA 1VFPA 2XODA 2QAGB 1YR7A 1P45A 3NFRA 3GK3A 5G4KB 2WWXA 4HDCA 4O4LF 3RSFA 6LDHA 1WDTA 1T4CB 1SU8A 1E7SA 3DBRA 1JWBB 1ZXBA 1KE1A 2EW2A 5JFTA 3AY6A 3MUFA 3LIPA 3QKIA 2K4MA 3AK4A 1OAKA 3QXXA 1BCRB 3F0TA 4NPCA 3OOJA 5DNCA 4WY2A 3LVBA 4UATA 2ZJ3A 3OT1B 4Q02A 1JJFA 4DLLA 2BT4A 2Z6AA 1KO1A 2FH5B 4GMHA 1XN4A 1W4RA 3CH7A 4M1YA 2I62A 5TGZA 4UDNA 4UUBA 3W3ZB 3PHHA 1XMIA 1FJHA 2WFZA 3ZE8A 2R11A 1NI4A 3ED5A 4KSCA 1JZSA 3D7SA 4IFBA 5KYWB 1NP3A 3DB1A 3CT6A 4K46A 1XU9A 4FU0A 1ZK4A 1TQ8A 4N6NA 4G0MA 3GC6A 4R71A 3UUEA 3BF7A 2RGAA 3AP1A 1ENOA 3LYLA 3KLPX 4N7RA 1JKFA 3QUBA 3RRNA 3CYFA 4DSZA 4IM7A 5EP3A 2JH9A 3C8DA 4DM4A 3LGSA 4KO1S 3T9BA 4XDGA 1NN5A 5EUBA 1G7TA 3TIFA 2R1VA 1B8NA 1Z0ZA 3LUPA 2NACA 4CMEC 2O5CA 3TNYA 2X4IA 4KXMA 1TAUA 4LOHA 3SS8A 4EBBA 4PGHA 3EXFA 3QYJA 4I9UA 4BKOA 2XXJA 5B64A 2E21A 4ZVOA 4K9OA 4TGLA 2ZTLA 3B5JA 2PH3A 1WDLA 5EKUA 4HEJA 1SUIA 3RI3A 1Z34A 1A9YA 2X0JA 5JS2A 4F4HA 1U5AA 3IKTA 1XQ6A 2BFOA 1MDFA 3RBAA 3SOPA 1DLJA 4B3SB 2R6ZA 5BN5A 2VZEA 3ED1A 3KEQA 4YMIA 3HGMA 4F2HA 4RZ3A 3K5HA 3RIMA 4P32A 4UULA 2RGGA 3KJGA 1KHTA 3ANXA 4C3ZA 4X8HA 2XW6A 4GRIA 4IL5A 4LZOA 3ZWYA 5I4BA 1KQPA 3MJFA 1C9MA 4N0EA 1KVSA 1S2MA 1NX6A 4QXOA 4FSHA 3OEED 4KGVA 4ZP1A 3FYTA 3OA0A 2B78A 4LDQA 2Y1XA 2ZTVA 4HAIA 1E5DA 5C1BA 4WUTA 2IP2A 3QGMA 4H1UA 1E2NA 1M2JA 7ABPA 4KQJA 4WJLA 5JXWA 3MAAC 4HFNA 2PUDA 4YJ2F 3GNLA 2OHXA 4EUHA 2GMWA 3DHWC 1EVQA 4LHWA 1RQRA 4D5EA 1PWXA 2FMUA 3H3FA 2C7QA 4BUZA 1M2FA 4GF5A 2VPQA 5GOTA 2OHJA 2PYZA 2VP6A 4D57A 1T9KA 1L9KA 2VEDA 3DDZX 1PZNA 5E4YA 2J9GA 5IC5A 5BSFA 4OY3A 3L8ZA 4BNGA 2WHRA 3MCTA 4P31A 5KO2A 4EELA 5JS6A 1CX9B 2VTKA 1RZUA 1KMIY 4FIDA 1SC6A 1T5SA 5A5GA 1PJRA 2VR1A 3BXPA 4R01A 4V0OA 3RYHB 5BN1A 4Q82A 4BLQA 4RF5A 2EDCA 1WL8A 3R5JA 3BA6A 2D00A 1I7PA 2I55A 4RCYA 3TVYA 4AKTA 4EL0A 2ID7A 4N6OA 4ZVUA 4RV4A 4L8VA 3TD2A 3LZ6A 1IZYA 3OE7A 4QAQA 3UWPA 3PXBA 3ZIUA 2RKOA 4Z4CA 4FQ5A 5K0CA 4BV3A 4X41A 3ESBA 4L9AA 4WXYB 5DMHA 4HUQB 2VPXA 3JARB 2W4IA 3CCCA 4BMZA 4LZAA 2NAFA 3PU6A 3ZOKA 2FPXA 2P67A 4RDIA 4C4OA 1ZKMA 1QOQB 3A2KA 3QX8A 3EY9A 3I6BA 1RVV1 3MQFA 1II9A 3NIGB 1XROA 2WYUA 3BK1A 3E4CA 4LXQA 2CJYA 3WSWA 3EGDB 1E3WB 2QUZA 3OJCA 5F1PA 1TZCA 1FFXA 3LW7A 1AZLA 1PG2A 2ZJ8A 5EE9A 1P61B 2HA7A 4A5OA 4BKMA 1M10A 1JNXX 4E11A 3PGJA 1Z4MA 2NVUB 5CXQA 5AWFC 2X40A 4KRXA 3ZK7A 4DIMA 5FWYA 4ZVRA 1KZ9A 1YC5A 3FXAA 1GR0A 1H8HA 2IOHA 4D4KA 5BN4A 1YS4A 4DOMA 3M81A 1UOEA 3MUEA 3B3GA 4PAQA 4YHHB 1DJMA 3BE8A 2Q2VA 5DGTA 4H59A 3VVCA 1OMOA 1X19A 3C7AA 3AIOA 5DT9A 2I7DA 4W5QA 1AHPA 4IIUA 1MZVA 1SEPA 3AILA 3T7KA 2N46A 1TEZA 2XUZA 1HE5A 1V16B 2OV8A 1X7ZA 2XUOA 4YAFA 5EGNA 3GYGA 1U4NA 3KU1A 5D1HA 1J9ZA 5DBFA 4OM8A 1ZD4A 4EHLA 5JYDA 3CVUA 2A7QA 4ZQHA 5JTTA 5KDLA 3GLRA 4N3AA 2C31A 1W2GA 3ZHUA 4CKXA 4QPDA 4Z0PA 1T0PA 1E3MA 1LZLA 3L6EA 4Z0HO 3HCPA 3IJRA 3BREA 1XKQA 4YCLA 2W90A 4J3FA 1XZKA 1OJLA 3E9ZA 2Z8YM 3A9VA 3QF4B 4MGHA 4ZANA 3VH2A 5B55A 5AHRA 1P0IA 2Q4RA 2QW0X 3ORQA 4BNVA 1ZGGA 1O58A 3CWCA 3MSCA 4LF7B 2HHLA 1L7NA 3H2GA 3ISVA 3KZKA 4OUDA 4C6RA 1DGQA 1U8ZA 2QR5A 4R7GA 1H6BA 3DD5A 1PNRA 5BNIA 1UBOS 3TLKA 2BEUA 5JI3E 4ZOLA 2VNJA 1CUSA 2B1RA 2ZI3A 3OTWA 3FAKA 4K6FA 4BYGA 4G1EB 2IBSA 4F3KA 1M2GA 2ECKA 2P2SA 3TW8B 3QPDA 2JD2A 1Z47A 3REOA 2YW2A 1P7WA 1XLUA 2PBRA 4ITUA 3DZBA 4X0EA 3RQIA 1TU0A 2LIVA 2YASA 4GZ3A 4C5AA 4KWTA 4BBAA 3L6RA 3SOZA 4NBTA 3W6UA 1J25A 1G2IA 2ACEA 5CHYA 3A4TA 2PYIA 4H77A 2FN8A 4NENB 5K8LA 1JB1A 2QRVB 3HB0A 2AQKA 1Y7LA 1XXHB 3ZU3A 5KWJA 1EFUA 4BVEA 4XM0A 4KR3A 2O5EA 1ZICA 2C3UA 5CAEA 1Q14A 4H7PA 5DM2A 5KNBA 2QP9X 2AEEA 4OQZA 1L5GB 4AM8A 3HO6A 3COVA 4FYXA 4KDEA 3CR8A 4IV5A 3QM1A 3TB4A 3BH0A 2XA9A 1CY6A 3DFIA 1Y5RA 2BEWB 3DE2X 1UDCA 4PHCA 3TIXB 4AKEA 3H8SA 2WIBA 1C4XA 3DVAB 3GOQA 2BBOA 3IQIX 4UVDA 4BFUA 3O92A 4GBMA 3VZBA 4D0NA 3ADDA 2F3RA 5FDFA 2CLMB 2VAXA 1WKCA 3F6RA 1FY2A 5BP7A 4JEUA 2OHIA 3QZUA 4GYKA 5IYZF 3LZCA 2UXCB 2WLTA 3A9CA 3T7JA 3TINA 2XUAA 4IXNA 3IVCA 3OX1A 4P4GA 4D9GA 3QV2A 3A6ZA 2BFBB 3KB6A 5AW0A 3OCXA 2KBFA 4ENTA 5DI3B 4Q1VA 4EHAA 4W8HA 3IBFA 2Q62A 4EGJA 2Y67A 5FIUA 1A76A 2WUWE 3DMRA 4TV9A 1U8XX 1MAWA 3FGZA 4F85A 1WF3A 2C3OA 2XMGA 3C4QA 3R3VA 2HNAA 2PUWA 2FEXA 4CNBA 1NONA 1H6AA 1SURA 4J0GA 4KQIA 2AXNA 4B85A 2OFXA 1O97C 1VCOA 3MPOA 3TQFA 3WSVA 5KVAA 2ZUSA 2JFZA 3B9QA 3LY5A 1EM8B 2GF9A 2HRDA 3FOAA 1IZ7A 1YR1A 3FSGD 3QHPA 4H27A 4LWQA 4MW1A 5G1OA 1T13A 1BRTA 3C7KA 1P19A 1KA9H 1Z2NX 221PA 3I9FA 4ZEWA 4G8DA 1N6NA 4UMEA 3GUZA 3EOAI 3JQ7A 4I4CA 3PZBA 3CRQA 4TLLB 4C22A 4UTXA 2WE7A 4ZJUA 2AOTB 4OV6B 3DLAA 2WY2D 1BMQA 4J0HA 4CFYA 2AR9A 2NUPA 3UYKA 1DXQA 3PNYA 3DMYA 3PUHA 2X4GA 1C3OB 3M4JA 4H16A 3O9ZA 4NONA 3UJBA 4GLBA 3AHIA 4Y6RA 4I1OA 1NXTA 1RJEA 2IIVA 1DQSA 3MWDB 4C4TA 1WKBA 2JHPA 2PQMA 2FVYA 3A4MA 4L5CA 3TTYA 4DIKA 1OILA 4KGDA 3T3PB 2BUAA 4UBLA 4ZCTA 3RFVA 1F48A 1SR8A 1ZGBA 3AM4A 2HCFA 4C08A 2YJ4A 2EF1A 1OBCA 4M46A 3CFYA 1KETA 1WTAA 4QVGA 1PZMA 1VE9A 2GRJA 1HDYA 3OLYA 1JVSA 2DFLA 1M1YA 3CKLA 3DBRB 3FCAA 4JBXA 4TROA 3VOSA 4BLWA 3GRUA 5JR3A 2FFBA 3SEFA 3BGIA 4HDNB 3IAM6 4YQFA 5L3QB 2Y8EA 3PGMA 4C0SA 3IDOA 1MOSA 1O5OA 3F8TA 5AKGA 1DDGA 5DKFA 3ONVA 5K6TA 1M5TA 2NP7A 1E98A 4PR0A 1W5EA 2BEVB 2Z3VA 5F2EA 3W90A 5F2KA 5F52A 4YUZA 3H4MA 1MJGM 1DIGA 1IBCA 1E3LA 1T1IA 1YZLA 1GTJ1 3CLTC 3NXSA 4IRUB 4U00A 4RK7A 3RREA 4B2IA 2P9YA 4M7RA 3O6VA 1YFZA 3LQRA 1Q1BA 2ZUEA 1NI4B 4AULA 2FPSA 3HJHA 2AJBA 3G7SA 3ZLVA 2DHCA 1P6QA 2D7CA 2NZVG 2Q4DA 5IH3A 1N6LA 3NOQA 5KSZA 3GP3A 4AT1A 1Q0TA 3IIJA 4FS3A 2FWNA 3OIYA 3I37X 5ALOA 1KDYA 3E9QA 5C31A 3T7RA 5CEFA 1CYDA 1ETHA 3GAZA 2GN4A 4YMHA 4E0BA 5EJIA 2B5WA 1AO0A 4NR0A 1PNVA 1HE2A 4XWTA 4AZ3B 5BR4A 1WXWA 1VCNA 2UZ1A 5IARA 2JB9A 2EG9A 1OFUA 1GP2A 1GSHA 2FZ5A 1B42A 2VRCA 1JAXA 1L8QA 1L5YA 1PUIA 2XDQA 3BBPA 3MYRA 1V37A 3PRHA 4TWIA 4RH3A 4DAOA 2ZIGA 4G1UC 4AJ2A 5JH7A 4N5DA 1C1DB 1XP5A 1Y5MA 3B12A 3IAEA 1R9MA 4A10A 3A9UA 4V24A 1XTIA 1XELA 4A0FA 4XW2A 3Q6MA 5ARBA 1QRTA 1TM2A 1MQ9A 4HZUB 5H3HA 2C4WA 1V11A 2QV0A 4PR3A 5ALWA 3L07A 1DC6A 5SYMA 4QBFA 5L40A 1E6KA 3ZU5A 4CM3A 1ZMBA 1THZA 4BB5A 1UXKA 1GCAA 1H2BA 1VMKA 1WEKA 4B6GA 1GGVA 3RABA 1PEYA 1J09A 3ETJA 1F38A 3DV9A 1PS0A 5MN5A 1WU8A 2I7VA 4LVCA 1HMYA 2C59A 2OCDA 1W47A 2B7CA 2VNHA 4NZZA 2XZPA 5C81A 3WL5A 1F9AA 4L85A 3KQUA 5EHQA 1W96A 4Y7CA 1TT7A 2QQFA 5I7UA 4ZQEA 2NQTA 4HGQA 1BJTA 4Y2HA 1SK9A 2EZ9A 4INAA 2D6FA 1N0IA 4IDAA 4RIIA 5KMGA 3GRKA 4LV5B 2E82A 4BAUA 1FQJA 4ND8A 3VZPA 3D4IA 4FGKA 4EQZA 3HJTA 3OTGA 5FUVA 2FLWA 2GK3A 3DMTC 1QE0A 4GRDA 4D3ZA 5CVDA 2PG3A 1IEWA 4PNZA 1E0KA 4U2BA 4XJVA 4KPUB 2ZETA 1ISFA 3CGGA 1VMAA 4JROA 3PNQA 4E5SA 5HR5A 1V25A 4QDKA 2IBMA 1GA6A 2Q5CA 1XVTA 5KNCD 1XQVA 2YL2A 3GGJA 3JR7A 4OGGA 4HKTA 1ZUIA 1M2VA 4UEJA 2IZ0A 2JA2A 4XYBA 2F8SA 3EAGA 1JBQA 4FKMA 1J97A 2K5UA 1X1AA 1PL0A 5I48A 4HGNA 4UMVA 1YVEI 2JVKA 4KQMA 2PH7A 5KYTA 2QRHA 3ZCRA 1Q1NA 2FDCA 4NE7A 1V71A 3PA8A 4OHVA 2SCUB 4QTZA 4P98A 3RG8A 5H16A 3BCRA 2JGMA 2BKUA 3HZZA 3C5VA 2QP3A 3RSHA 3PEYA 2ZIZA 2KW5A 5I5GA 1X14A 3VSCA 4Y1FA 4R0NA 4JYCA 4ZZ2A 2DSNA 4ZO9A 4ZJZA 3UATA 1W94A 1BX0A 1XFDA 3LUJA 1VECA 5JZOA 1JAZA 4IJUA 1S3SA 5AW7A 3KETA 4IVNA 3LK7A 1SZDA 2VJLA 4M86A 3BD6A 4PSDA 1FFXB 2IEBA 4J07A 3EZFA 3LMKA 2H7CA 4W8GA 5HZHA 3U4AA 1M6YA 3RBXA 2ZUFA 1HZZC 2NSJA 2OK8A 3M5CA 2QN7A 4MV4A 2DECA 2ZBEA 4RHUA 5DO9A 4MLCA 1BHSA 5K0JA 1PQYA 2QX7A 1W29A 3X1ZA 3O8QA 1DFIA 2NV6A 2WD8A 3IOMA 1T26A 4TXHA 2HQOA 4EYEA 1U8EA 4YONB 2JI4A 2BKAA 2FB9A 5EXEA 3DLPX 3GRVA 4QQFA 1P2FA 3QQPA 3PX2A 1W52X 3K5WA 2I34A 1TT5B 3P20A 3FUWA 2VZ9A 3HRKA 3K8ZA 4QQRA 5FTMA 2BGNA 3OD5A 1HKHA 1FSPA 4EHNA 4FZJA 4DLZA 1U8YA 2OCYC 3GXOA 1I0IA 2MR5A 5C3MA 2PX4A 4G0OA 1QIJA 1ZS9A 4BE9A 2O3JA 3GGDA 4ZI5A 1RAHA 4PCVA 1ZU5A 3MTDA 5LMCA 3OVMA 1KZ1A 2WT4A 3NHFA 4O25A 4C4YA 1BHQ1 2A3RA 2REQA 4G65A 3HXLA 1SUBA 1GGEA 1YJ5A 3HYSA 4XX1A 3OZSA 2Q49A 4FX2A 2OFWA 5FBLB 1GPMA 4FD3A 2PNFA 1NVXQ 5ECYA 4DC1A 2WUEA 1O5IA 1SOVA 2ALJA 4JT8A 4B0OA 1DFHA 1IQPA 4DLNA 7MDHA 4D4IA 3R5TA 4E32A 2R4UA 3MWJA 3CVYA 1YO6A 1QZUA 3UWKA 5COAA 2IV7A 4CGYA 2JLZA 2GZ3A 4EF5A 3GLIA 4OUDB 4Q1EA 4KR2A 4QNRA 4WTOA 3ODGA 4MHTA 5TT0A 2O2JA 5DOVA 1K5GA 4HLDA 4QM6A 3AOGA 4Q9DA 2I1LA 2MTBA 3ZH9B 2FEAA 2O8EA 2G09A 2CXXA 4C5BA 1SQ6A 4JC4A 5EEGA 2VQFB 2XBMA 4OB7A 3WICA 4PEVA 3ZHRA 4F86A 2G9NA 2OO5A 1WDMA 2CVHA 2A9JA 2E18A 2P9JA 4Q01A 1YGYA 1AKTA 3H75A 4IEEA 3W2GA 3HC7A 4E4YA 1ZNQO 1VHTA 2CZQA 3P2EA 3FWNA 3TAUA 4B2LA 2RGCA 3I0ZA 3TFOA 1DIAA 3AV3A 4Q9AA 1H8ED 3SDZA 3WYCA 2Z56A 5FHRA 2FWIA 2HNBA 5DB4A 4RTKA 2E89A 3IESA 1ECCA 4L74A 1LX7A 1A9OA 1E2EA 2VTVA 3RVLA 1P1BA 5C1OA 4G01B 3U7GA 1JQAA 3N3BC 1ZI8A 4R2XA 3EFEA 1NQWA 2CCKA 4PSCA 4EGSA 5EMJA 3S0JA 2IUTA 5CAEB 3KEMA 3S2GA 5G3ZA 2BSQA 2V3VA 3LPCA 4KR0A 4O3MA 1DQZA 1KJQA 1YZVA 2IYQA 3RVMA 1JG6A 3TG2A 2FR8A 3DHNA 4J16C 4YAEA 4PPFA 1T9BA 1FK8A 2IBTA 4E09A 2BBWA 1R4MA 2YS7A 2CLDX 3M89A 1IN5A 2Q3CA 5DXAA 4YC7A 2H9AA 2ZB7A 2OO7A 4XB6B 3G0HA 2V7VA 2C3YA 3QOWA 4PXSA 5L6LB 3TQCA 2F7SA 3HP1A 3V1UA 4NS1A 1JLLA 1OSNA 2EOAA 2JEOA 4AY5A 1SB9A 4D9FA 3INNA 2C2BA 5GJWC 5DGDA 2K7FA 4AJ9A 4ARZA 4OKIA 2VDMB 3E82A 3RTGA 1TJ3A 1DKPA 1KGSA 3LI2A 1QVWA 5G53C 1VA5A 2PT9A 2W6NA 4U4AA 5HMLA 2XE6A 1Q95A 5T57A 2QE7A 3OF2A 1SU7A 2UUPA 4HRXA 5M2QA 4RVDA 2NO5A 2QT9A 2R6JA 3QFSA 1ZH4A 3RD5A 1CY8A 3AJEA 3KKKA 2ERYA 3B5IA 3LD9A 3HO8A 4GS5A 4CV0A 1TW3A 3E58A 4UXHA 2P3SA 2B9EA 3NM6B 4HLNA 2IZ6A 2I0FA 4PAGA 1G8GA 2JARA 3SY8A 2CW5A 2WIAA 4ON9A 4TVBA 3LPLA 3PQFA 4ZO6A 3DV2A 5JMWA 2YYAA 2HT1A 4GQBA 1E6LA 1CS4C 3JQ7B 4JP5A 4NAUA 3UH1A 1QHEA 1YI0A 4OQMA 1Z3IX 3OQNA 4TMFA 4TMTA 4QOHA 2GYVA 3VJMA 1QV6A 4TOIA 2IYNA 4ZHQA 2H2AA 1QPBA 4N01A 2ZYRA 2X0FA 5HJEA 4DT1A 3DDWA 3LA8A 5K3EA 3PG5A 3WLAA 3CX8A 3IQFA 3B6JA 1JJIA 2ECOA 3E3MA 4OHXA 1U63A 2WUGA 1IL0A 3DDNA 3CW8X 3G9QA 1ISPA 4WLOA 1JYEA 3ETCA 3WOVA 5I47A 2Z1NA 2C0QA 1JAHA 1GGJA 2QD1A 3LP8A 1MBZA 2EQ5A 2WV9A 1PV1A 3QHAA 4J1TC 4B44A 2HADA 2LPMA 3PFBA 3VNAA 4E07A 3HJFA 3PCXA 1WG8A 2OOKA 3S2IA 1ISMA 4IIDA 4N9QA 2GH1A 2YHAA 2R66A 4OP3A