2GN1A

Crystal structure of dimeric biodegradative threonine deaminase (tdcb) from salmonella typhimurium at 2.2a resolution (triclinic form with one dimer of tdcb in the asymmetric unit)
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
327
structure length
326
Chain Sequence
MASHITYDLPVAIEDILEAKKRLAGKIYKTGMPRSNYFSERCKGEIFLKFENMQRTGSFIRGAFNKLSSLTEAEKRKGVVACSAGNHAQGVSLSCAMLGIDGKVVMPKGAPKSKVAATCDYSAEVVLHGDNFNDTIAKVSEIVETEGRIFIPPYDDPKVIAGQGTIGLEIMEDLYDVDNVIVPIGGGGLIAGIAIAIKSINPTIKVIGVQAENVHGMAASYYTGEITTHRTTGTLADGCDVSRPGNLTYEIVRELVDDIVLVSEDEIRNSMIALIQRNKVITEGAGALACAALLSGKLDSHIQNRKTVSIISGGNIDLSRVSQITG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Threonine dehydratase catabolic
publication title Crystal structures of Salmonella typhimurium biodegradative threonine deaminase and its complex with CMP provide structural insights into ligand-induced oligomerization and enzyme activation.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Lyase
total genus 118
structure length 326
sequence length 327
chains with identical sequence B
ec nomenclature ec 4.3.1.17: L-serine ammonia-lyase.
pdb deposition date 2006-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00291 PALP Pyridoxal-phosphate dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2gn1A01
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2gn1A02
3VSAA 5B36A 1X1QA 5I6DA 4L28A 1BEUB 1Y7LA 1QOQB 4D8TA 2V03A 3DKIA 2CLFB 1A5BB 4JBLA 3L6CA 5I7HA 5J5VA 1K3UB 5IXJA 4D9NA 1TDJA 1CW2B 1K7EB 4D9GA 2ZPUA 2C2BA 2Q3DA 4ZQCB 1KFJB 1TZJA 5HBGA 3PC3A 1F2DA 3R0ZA 4HPXB 5J43A 1UIMA 1PWEA 3PC2A 1BKSB 1PWHA 2DH6A 1A50B 3IQHX 1J0DA 1VE5A 1VB3A 4OFXA 3SPXA 4HPJB 2GN1A 4D9FA 4NEGA 3V7NA 3X43A 1C8VB 2PQMA 5B1HA 3BM5A 1RQXA 4AECA 1K7XB 2CLIB 1K8YB 2D1FA 3SS7X 3DWGA 3IQGX 5IW8A 1E5XA 3R0XA 5DW3A 1C9DB 3L6BA 1WDWB 2O2JA 2RKBA 1A5AB 2CLEB 4D9EA 4L3VA 1KFEB 4LMAA 4D9CA 5IWCA 4AIRA 3TBHA 1TZ2A 1FUYB 1VE1A 4L0DA 1Z7WA 4ZU1X 5B1IA 4LMBA 3T4PA 2C2GA 4D9IA 1KFKB 3DWIA 5KINB 5D84A 4XUGB 2CLHB 1K7FB 3FGPA 4KKXB 5C3UA 4OREX 2TSYB 1KL7A 2J9XB 2ISQA 4D97A 5KZMB 2Q3BA 2ECQA 3IQIX 4JBNA 2RHGB 3PC4A 3HMKA 1J0BA 1WTCA 5CGQB 1CX9B 5I7AA 1UINA 4I1YA 4IL5A 5CVCA 2ZSJA 4HN4B 1UBSB 4D8WA 4QYSA 5D87A 1KFBB 2J9ZB 1TZKA 4COOA 2CLOB 1J0AA 5EY5B 1TJPB 2BHTA 3RR2A 1K8XB 3VC3A 4H27A 3PR2B 1WKVA 3X44A 3VBEA 1C29B 5JISA 2GN0A 3ZEIA 5B3AA 5DBHX 1J0CA 4Y6GB 4NU8X 5T6MA 3IAUA 1TTPB 1M54A 3CEPB 3VSDA 5I7OA 4WX2B 1K8ZB 1TYZA 2JC3A 4D9KA 4LI3X 2J9YB 4ZU6X 2WSYB 2O2EA 5D86A 4PCUA 1V7CA 2DH5A 5B55A 4F4FA 4HT3B 1V8ZA 3AEXA 3VSCA 1WBJB 2ECOA 5E0KB 5I7RA 1KFCB 1P5JA 2GN2A 4D9MA 1Z7YA 2EFYA 2EGUA 3SS9X 2ZR8A 5B53A 4L27A 1D6SA 1OASA 2TYSB 1TTQB 2CLMB 3AEYA 4D8UA 4HO1X 2RH9B 1A5SB 1V71A 1J0EA 5DW0A 1FCJA 4D92A 2Q3CA 2BHSA 5I7WA 2TRSB 5BW6B 5D85A 1TZMA 3L6RA 5DBEX 4D9BA 1O58A 5JJCA 5DVZA 1JBQA 2CLKB 4D96A 1QOPB 4D99A 2CLLB 3FCAA
chains in the Genus database with same CATH superfamily
2GBCA 3F4KA 3FN4A 4EA8A 1I3LA 3HP4A 5EPUA 1ODSA 3ET5A 5D7NA 1H4VB 1UBLS 3LL7A 4PEVA 4I4CA 5IBQA 3LVRE 2V3WA 3V8BA 1TMYA 5ED4A 4R7ZA 3TTWA 4B2PA 1YZFA 2ZPAA 4DCNA 3PA8A 1U9IC 3ROTA 4F1KA 5JATA 1JQ3A 4XQGA 4D3SA 3TB4A 4D4JA 5AOCA 3V46A 1LPOA 2C59A 3AG5A 1DIAA 1S01A 3ESRA 1PWYE 3PNYA 2GK4A 2V7XA 5C31A 4W1SA 2GLXA 4GI5A 1ZOLA 1A5TA 2GBIA 5IVPA 3NTVA 3AF5A 3ESZA 4P4LA 2X7HA 2DHQA 2ABWA 3SX2A 3VTAA 4EGSA 4B6QA 5LMZA 2IUFA 1O3YA 3FYDA 4FC7A 2G67A 2WYIA 2G9ZA 3ZHQA 1CQWA 2WNIA 4Z7JA 2ROQA 3BE6A 3LXRA 1XC7A 1FPMA 1PFKA 3NP7A 3P52A 3RQIA 1RTKA 3NETA 4KAAA 1F48A 4CQLA 1S9DA 4EYGA 3ZY2A 1UPFA 3AQIA 2V7WA 2RGUA 3ZU3A 4MLPA 1Z8DA 1RYFA 2OLEA 2VDKB 3A6DA 3SQMA 1GGEA 3BJRA 1GEGA 2WTUA 3PWZA 3C3EA 2EFCB 4ZZ3A 1KJIA 2GM9A 1JDUA 4LC0A 3ECCA 5AOBA 3VU9A 4ZAGA 4FHFA 2B6HA 3DE5X 4X7BA 1Z17A 4UHCA 3ETLA 5EIOA 4F2WA 1QX4A 2P2NA 2GSWA 1CCWA 2WICA 1SM4A 5H4HA 2DWUA 1YQWA 2XXJA 2X76A 4IINA 4NJMA 1BAPA 2I2FA 1L5LA 2XVMA 3TUJC 3K2BA 1JR3E 5ILGA 5HSGA 1GKUB 1PSWA 4LECA 5CMLA 5AFSA 1E59A 3AVOA 2O8EB 5JZ9A 1XCGB 4GXTA 1GYRA 5HNKA 5KMGB 1J42A 3FI9A 3NQ41 2H7XA 2BEVB 3ONWA 1M66A 1M2WA 5JNRA 1SHJA 3QWAA 5B7PA 2ZLBA 4LF7B 4CEIA 1XCBA 2WSBA 3M5WA 4PXAA 4KR0A 4GRDA 3SZLA 4R8MA 1GTJ1 1YK0A 2MU1A 2IUEA 3D5QA 4FR5A 5DF1A 1JWLA 2RMKA 2VK2A 2ERXA 3GXBA 3LIIA 1KSHA 2W6JA 4FYKA 4GOMD 2YN4A 4GSLA 4YCJA 4YUXA 5M04A 4D02A 3KAJA 2WNHA 4R8SA 1IN8A 3FSGD 3UHOA 3CVVA 1D8TA 2FU5C 2LRHA 1S2MA 2DY1A 2G72A 4XIIA 1Y63A 5B55A 1DAIA 1D4AA 2E37A 1DKLA 1RYMA 3ND8A 3GJ8A 2IXGA 3ZHTA 3KZMA 1V1JA 5GJBA 1USKA 4NU5A 2TS1A 3CJQA 4LJRA 2V7QA 1QTIA 1J2YA 2NNWB 5HTKA 4QLBA 1YI1A 1RJDA 2BFCA 2ST1A 1J8YF 1KY4A 2CZQA 2HDOA 3QXCA 2ID7A 3FHLA 5E6UB 4M22A 5EE0A 1PGPA 2O59A 2O8BA 2UYOA 3G9ZA 2MINB 3U26A 1AH2A 5ADHA 3RC8A 1NLMA 1SHLA 4F60A 3MQ4A 4B7UA 4AL4A 1CP2A 2ZBQA 2CV1A 4WCFC 3EPPA 3AHDA 1LZKA 1DRWA 3AVQA 3EWAA 4IAOA 3ZX4A 5DU2A 2HA5A 3A1FA 4MW5A 1Y1PA 4YA6A 1AMOA 1YVUA 3AESA 2HRRA 5K0FA 1BMTA 1WKCA 3FPGA 3GHYA 3KQNA 2P0YA 4HDMA 4QD3A 1ESZA 4JLBA 4RVNA 3B9QA 3HFSA 1NLYA 4L4UA 4PF1A 3HBMA 4OH1A 3L1HA 3CISA 4ZHSA 3ZVMA 1FJHA 5EJMA 5M2QA 4UASA 1VL1A 1U0RA 2Y0CA 3O4RA 1VECA 2GPYA 5JTTA 4EHHA 1KO1A 2H3EA 3ER8A 1UFKA 4X6XA 1CHNA 1XAIA 4O2AA 2PZ8A 3MLEA 3NONA 1CIJA 4QHYA 3AF0A 4C0JA 1GUBA 4IJVA 3TQSA 3LYLA 4FR2A 3IVMA 1P2GA 3B8HA 1JBEA 1SOMA 3RT9A 2WHEA 4WBSA 4ID3A 2XZLA 3FMFA 4DLKA 1X1TA 1LPPA 1Z15A 2FMIA 2PT5A 1IZ8A 1OBOA 3DL2A 5KOJB 1L7RA 4PBSA 1ZWKA 4YONB 5KYUA 2ZQZA 1WUHS 2HA0A 3W9BA 3WBBA 2PDAA 5JWOA 4QVIA 1MX3A 1PGOA 4DE5A 1IEVA 2WVHA 4UEKA 2RKBA 2QL5A 3QUSA 2I34A 5EQJB 4JUBA 3RS9A 1B7GO 1GPAA 5JCOC 5HW0A 2XZPA 4KPEC 3W3ZB 1SB9A 3A70A 2V7UA 3K6RA 2GHQA 4HZUB 3AF2A 2YN2A 3WAJA 3CUVA 4DLUA 2F43B 4F3CA 2WPNA 3R3XA 2L69A 4LYHA 2WFAA 1PP4A 1TNDA 3F9CA 3HGQA 3KXLA 5KYVA 1EFTA 2N42A 2ORED 1UBFA 1F9EA 1G8AA 3QELB 4K1XA 1EDEA 4Q9JA 2Z8ZA 4BGVA 2XGJA 1S8OA 2N3ZA 2ZUWA 2O6HA 2IWHA 3TVYA 1H22A 4GKVA 1LBHA 2YJNA 2G4VA 3PXAA 1C0KA 4LTMA 1E61A 1SVIA 3PDIA 1DBSA 4I4TB 3LBNA 1F6WA 5EHXA 3DL4A 3C39A 5FPSA 3DE4X 2RJNA 1YJCA 2AXEA 1DC4A 4FCWA 4BJ1A 1ONPA 1BS9A 2PT7A 1CY8A 3OO0A 3ACDA 1BWRA 4IP0A 1C2TA 3GMDA 1TUBA 4OG2A 4PIVA 3QU4A 3WRXA 4A2CA 3DZKA 3QBDA 1G19A 5A5VA 3ULKA 2OMKA 3OQOA 3R7WA 4ZVMA 1GDTA 4LN1A 2BCGY 2NU7B 2F1KA 4M9SA 3AUSA 5B3JC 2ZBFA 2F1JA 1H2WA 1KARA 3WLLA 4J0JA 3IKLA 3LKBA 1QWSA 4ML3A 1FRFS 2SCUB 3H1BA 4JJAA 3ZKWB 1NUSA 4YRIA 4CUJA 2ZSBA 1H8HA 2FWPA 3PNMA 2YXLA 2P6RA 3QNUA 3WMGA 3PE4A 4MARA 3VU8A 3LDUA 4EB6B 3C7KA 1UPBA 4M60A 4BGUA 1E79A 5BSEA 1A8UA 5A9SB 2HTEA 2VZ0A 4N0QA 1E1CB 4YRGA 2Y99A 1UT5A 2ZULA 1E2KA 4RENA 5JXGA 1LI5A 3QHPA 1J09A 1SCQA 3FNBA 1Z39A 5IBRA 3E2PA 1HDGO 1NLFA 2HMUA 4DAOA 1F4LA 3C8HA 3N2GB 3SYMA 4HNSA 5DNVA 2CXUA 5IVIA 4BXOA 1IIBA 5LB2A 2D1QA 3FJ1A 1MQ9A 4AXXA 3CJRA 3OJXA 4FCVA 2JANA 1R15A 2G0AA 1YONA 3AUTA 5ALFA 3VR6A 3EGXA 4DLXA 1ZNQO 4YPVA 3RADC 1H85A 1U6JA 3KEFA 4KKVA 3VJMA 3FWPA 3IV9A 4QGAA 2ADFA 1JDBB 1EKXA 1BWQA 2CKMA 2I5PO 1O0BA 4X8LA 4FCTA 1ZHFA 2IHNA 1XPUA 4CDMA 2HF9A 4MV6A 5GTDA 3HP7A 2AT1A 3NIDB 4FBMA 3TDMA 2WIKA 1U7WA 4Y2HA 3LL4A 2HZBA 3E70C 4JYAB 2KMLA 2R66A 5LU9A 5D3KA 5C32A 1GXSA 1SY7A 1Z6ZA 2W71A 1ZK2A 4GBED 4E5DA 1QH0A 2QAGC 1O96A 2WD9A 2G17A 5T4HA 1VPWA 3RAEC 4TXJA 2FW6A 4U0KA 5AJUA 3VTZA 2WWYA 1Y1KE 2IYPA 1L5GB 1NF9A 2VJMA 3NC4A 1LDYA 1Q1GA 3EHEA 2IGBA 4DYDA 2WD7B 1EZ4A 2IPMA 1UANA 2VK4A 5CYPA 5B1YA 1QIIA 1SA0B 3RSLA 3LDAA 4IHJA 4BVHA 4GM1A 2PGLA 1FYXA 4FOSA 4HWPA 1WPGA 3LCRA 4J1QA 4LC1A 3B38A 1OWOA 1YFLA 4R1TA 2P2ZA 1AZSC 1Z5OA 3EQ8A 2VLIA 5K0BA 4DV2B 5BURA 1WCIB 2EU8A 3TRDA 2RBEA 1WTCA 3DKRA 3QLJA 2W6MA 1YR9A 4N49A 4PLCA 2I3DA 2G1KA 4NENB 4V2IA 1CUYA 4AS3A 4I1PA 2W2PA 4G5XA 4O6VA 2IU6A 5E1BA 5LQCA 4YRPA 1IRXA 1FF9A 1U0HC 3S44A 1B23P 5KWIA 4DMLA 5JWHA 2PSHA 1TPZA 1YZLA 2OV3A 5AM1A 4FHEA 1COWA 1S2DA 1M2KA 1SBNE 4BY9E 3EAFA 5AJVB 4WNIA 2DUUA 5AD1A 4GH5A 2JLQA 1EM6A 3FNGA 3IE1A 3QHAA 4MQEA 1KK1A 4XOIA 3RTDA 5K5EA 3KYCA 2B5WA 3I01A 4AWAA 2NO4A 3U3RA 3M4XA 3OQMA 2JC3A 2JJYA 2WM3A 5DCWA 2QDXA 4BQOA 1L6IA 1EFHA 3MPOA 5GINE 2BKXA 3CY6A 5DLDA 2C97A 3ZZ0A 4F3RA 3C87A 4MJ7A 3NWEA 3WTBA 3L04A 3YASA 2R8BA 1IBCA 1SKMA 3QITA 1XZLA 3CF4A 3PRJA 3LQRA 4BVJA 1ESNA 4EW1A 1OSNA 2VJBA 2IYUA 2NLOA 3D3QA 3DOJA 4L27A 1QHGA 4GP6A 5EP4A 5JDIA 2Q3FA 1NU8A 4D7AA 1Z2EA 9ATCA 3ICCA 3FXAA 1ADCA 2PA3A 3QUAA 4OO3A 1UQRA 1V7ZA 4F5EA 2R7LA 4I9FA 2J9RA 3KOOA 1KSGA 4JVSB 4IZOA 4ARSA 5DIZA 1HC7A 4U2FA 3C2QA 5KWSA 2CCGA 1OX5A 2YJZA 3DHWC 1PIWA 4FW8A 4NV3A 3FKSA 1GL7A 3H4VA 3ELYA 2VO1A 4B3RB 2VAWA 3G8DA 3VFDA 1P7YA 2YDYA 2G5PA 3BH7A 3L84A 3U9SA 3OZFA 1CZOA 3NIGB 3QEJA 1XKTA 1N3BA 4KN5A 3E5NA 3TQFA 1BA3A 4PSCA 1YD7A 1UDBA 3L7JA 4UHFA 2XTNA 2DFVA 1KYYA 4TTIA 3BYZA 2FGJA 1FUUA 2ONJA 5F2NA 1ZM3A 1RZRD 2XIJA 2WY2D 5FAKA 2QQ0A 1P81A 1RAFA 4WCVA 5H3LA 4ZEOA 5F7XA 1R0SA 3KNZA 4Y9UA 5BMVF 1LFAA 3WFZA 1DWPA 2VJKA 3AVVA 2JDID 2BF4A 2PKXA 4KQFA 5DWVA 3QU2A 2JVJA 1D5CA 4C2BA 1ZVMA 3OOSA 1D4ZA 4G09A 1ZUIA 3IPLA 1WW8A 4Y9TA 5FX2A 4Q4HA 3VDMA 1RKQA 1QYVA 5A2QA 2YWGA 1YRHA 5G4KB 5KVQA 1CUGA 1ZCAA 4HAVA 4JASB 2G1JA 3D8TA 4XRGA 5BT9A 2HWXA 2JI4A 2NW6A 2HPZA 4L3VA 2FN9A 4GKAA 4EI7A 2AEEA 3BL6A 1G6KA 1LPBB 1N34B 4IZIA 4RNDB 2ZUEA 2J4DA 2C2XA 2IZOA 5BV2P 4JLAA 3LDFA 3AEZA 4EG1A 4YFVA 2BI7A 4C0SA 1JIVA 2JLVA 4XASA 2EXXA 5J5AA 3WGUA 1RCTE 2W2VA 1ZINA 4IIJA 3H1TA 3LQ4A 4F1WA 4A0HA 3CH6A 1EUDA 1ZP6A 2ZBGA 1FFGA 3D6JA 2NX2A 2SKCA 4OY3A 5AO9A 1E2NA 3UXMA 4AP5A 1KMMA 4I81A 2JAPA 4MJXA 4B84A 4MS4A 5TEWA 2AX3A 4JX9A 4G97A 3UGQA 4HQNA 2PLRA 1C3OA 1PJ3A 5G53C 2YRWA 3IQZA 5C8ZA 1J24A 1KI2A 5FPYA 4FIDA 5BOVA 4I50F 2Q8QA 3HFRA 2B69A 5E0OA 4YCCA 1H3EA 4JB8A 3Q2IA 1TLTA 1NHGA 2XWQA 3DZBA 4HXFB 4UCXA 4NDAA 4GPEA 3RHTA 2YZKA 5G41A 4DCSA 4DPMA 5F1KA 3BMCA 4EHLA 3NIFB 1YTUA 3I2YX 3M81A 1GNTA 3ASZA 1F2UA 3S2GA 4JJFA 4IG4A 2X3UA 2WG0A 2HO4A 3CPEA 3I52A 1SELA 3N3AC 3MTDA 3SJCA 3WMEA 1L9KA 2PSDA 4E2ZA 5F23A 1SEVA 2A5LA 2WDPA 2ZR7A 2GZSA 3LO5A 4LJ7A 4BEJA 4GRIA 3I9V1 1FNBA 3IUPA 4HUJA 5LWQA 2CEKA 2CXNA 4XGKA 1QO7A 1IN7A 2DC1A 3UPUA 3GRUA 1VA4A 2QRZA 4KIGA 3ONEA 4O4LB 3CA8A 1XMSA 4UMFA 4DEXA 2IPLA 2I9KA 1BNCA 1OZAA 4FMCB 4C5BA 1ZXXA 2V65A 3ENVA 3KKZA 4G5YA 4KWEA 4UHJA 4PTZA 1SRRA 2VVTA 3C16C 4UM8B 3U4GA 5LQMA 3QWFA 4LX0A 4ZAXA 2ZGVA 4XWYA 3F78A 3IO5A 2FSFA 1M0TA 5CFMA 2JGRA 2PFGA 5EHIA 4AT1A 1CIVA 1WB9A 3SQNA 4E5MA 1R74A 5AVSA 2Z98A 2PRKA 3AERA 2PRJA 3PC7A 4Q24A 2PWZA 5JSYA 1GLVA 3WLHA 2FR8A 5HUJA 1LK7A 2Z8YM 2CYAA 5EIHA 2M6KA 4W7IA 1CU1A 2ZVPX 3Q12A 1DZ3A 1TCAA 1ZD5A 1YHYA 4QVGA 2GJ8A 2I7CA 1AA9A 1G21E 3I6ZA 3V33A 2RD2A 2I2AA 5A7GA 4HAZA 3H5RA 3THXA 2C94A 1J99A 4X95A 1EJ2A 4IWNA 4PO3X 5IEJA 1BO6A 2EAUA 5B57C 4Y2SA 2DPGA 1EEHA 4O4HA 4YAFA 3WRXC 3QX9A 1HPLA 2JBWA 3UOWA 4DDTA 4RLFA 2UUBB 3N8DA 1BEZA 3NVKI 3FTDA 1ODLA 1VFPA 1BMFA 2QY9A 4ZODA 3RLIA 5FIUA 5EJ5A 1ZH8A 2BEUB 3B5JA 3CH5A 2VWPA 5JT1A 3X2FA 2MJLA 3DONA 4ZXPA 4FDUA 4IDAA 2WKQA 4HDAA 1QRDA 3KL2A 4G4IA 3ZOKA 2XDQA 3NASA 3R9IA 3LBYA 4QYMA 3QZUA 4TKLA 3IVXA 2YTZA 1P60A 1TZ2A 4TTTS 2YFYA 3AFGA 3BICA 4LMBA 4XH9B 1KFKB 3DWIA 4OL0A 3VH1A 3BUSA 1XVTA 2GYUA 2QAJA 3H99A 1G2IA 4FEAA 4PQEA 4D74A 4LY9A 5A4MS 3HSKA 4B0PA 1LTKA 4CF4A 2D1RA 3MBKA 2O0JA 4R9UC 3H2JA 3KQKA 4AB1A 1V4VA 3HDJA 5CVCA 3WGNA 3Q7RA 4KI7A 1YR7A 4EGCB 5IDWA 2BMWA 4J7CA 3ZWXA 4LXUA 2Z6AA 421PA 1P1FA 1U0LA 3BQ9A 2Z57A 6LDHA 5LLTA 2FX3A 2OBMA 3R6LA 2P6OA 4I9GA 1JH9A 1WRBA 2HAEA 3BRWA 3OJLA 3RO7A 3OSUA 4DCOA 4L95C 3G17A 2Q62A 4PR3A 4POAA 1VTKA 5CPBA 2CV2A 4WZBB 2GPWA 3AXSA 4RESA 4BV2A 1MVOA 2ZS7A 1FY2A 1JFTA 5B6IA 2F62A 1A9OA 1ZQ9A 1TTPB 4NBNA 5ADWA 2IP4A 3HCEA 4M0CA 3GT7A 4QJ5A 3OIDA 1KOLA 3RODA 3K1JA 2R97A 5AVTA 1ZJJA 4K87A 3JAWB 3I92A 4ZQEA 1YZHA 1CR0A 1HZZA 1H8EA 4YPOA 4C4AA 1F12A 3A7EA 4R68A 2PY6A 2Q3JA 4JLVA 4CM8A 3L8EA 2E9SA 3HB4X 3OT1B 4RGBA 2CHQA 3NKVA 1G1AA 2NVBA 2GEJA 1MAUA 1YB1A 2ZAIA 3GJ3A 4PYQA 1RDFA 5E9QA 5B1SA 1IC6A 2OBFA 3NDPA 4LDAA 4MTLA 5I8WA 4FOTA 3K5IA 1FFSA 2H2GA 3TWOA 3QENA 4OLHA 2EDAA 3QLUA 4P4SB 2WBLC 5ALGA 1JR2A 3SM9A 2ZKIA 2UAGA 4RV4A 1D9ZA 1T8WA 2IPNA 4Q1AA 4MKFA 2G5CA 4OKNA 3IILA 1ZJWA 2ZJOA 1DGQA 2VHZA 3NEPX 3WNBA 4EUKA 4B9AA 4D99A 1KI6B 4S24A 4DZTA 3GT4A 3K9WA 3RU7A 2LZ0A 1BZYA 1KYVA 4ZREA 2DTDA 2QTCA 3GU3A 1N7GA 4FILA 5JMWA 2R4UA 4OLFA 1BX1A 1YRAA 1XR3A 1DE0A 2A0WA 2RBKA 5DIFA 4B9EA 1OCEA 4Y2TA 4KXQA 4YP6A 2QWXA 4L08A 4O25A 5MGBA 4UEQA 1EXDA 2X22A 1W44A 2MSNA 3QUCA 4BO7A 2GERA 3DFUA 4OJNA 3ZXXA 1DDGA 3HU2A 3HVIA 4OHXA 4C21A 5CGZA 2IXBA 5HMMA 1N5OX 4JLKA 4BV3A 3IIMA 5LP6B 3GPLA 1SCAA 1EFPA 1O5TA 5JCJA 3X0DA 3H2ZA 1DXYA 3QUBA 2XZTA 3UAGA 2X86A 3OBIA 2FWNA 2OYCA 1C4WA 1WMDA 1MB3A 3RRJA 1II0A 3IHWA 1A9PA 3MTJA 4EENA 1KR2A 1E98A 2FRXA 1AKVA 2R68A 3IDZA 1XK7A 3WYGA 1XJWA 3A3PA 3OO1A 3D5TA 4R69A 5JXWA 3VDQA 4CGYA 2ZYDA 3H17A 3CF2A 4B4KA 2V7VA 3HDVA 4YR7A 3G0OA 5LUAA 3P9XA 1M2FA 3L1KA 4XDZA 1KGDA 3RS2A 4DSTA 2VQ6A 5GONA 3BAFA 4N47A 2OCIA 1W5SA 2FK7A 4LRWA 4EYOA 3O74A 4IDFA 3L40A 1HL7A 3MRTA 4R51A 4O2AF 4ALKA 2HA2A 5LMNB 5IH3A 1RJ9A 3RBZA 4EG5A 4ENSA 3TSCA 5FO1A 3UG7A 1DIHA 4ZDWA 4H1VA 1E0JA 1NQ5A 4BJ5A 5TR9A 1RQRA 3DSRA 3PC4A 1P3Y1 2PIAA 4JOSA 3WIVA 3JQPA 3HKBB 5AM0A 1G8HA 3FR8A 1F2TA 4LDPA 3LG2A 3WE7A 3IT0A 2XSZA 3WGQA 4Y1GA 3USCS 4D8WA 2Z56A 3VHQA 1U8XX 3M4JA 3IUYA 4LGVA 5G3ZA 2D2IA 4CM3A 5AVYA 4EO7A 2WJAA 5J59A 5HXAA 4IS2A 1X1CA 5FQOA 3PNSA 4URZR 5ITWA 3BK1A 1TM5E 1ZH0A 2AFHA 2GCOB 2YH2A 3BTVA 1CHDA 2GZDA 3P0EA 4FDVA 3Q7QA 2XCLA 5TF0A 4ZJUA 4WVFA 2QUZA 2ZQYA 3N2IA 2J6HA 5DTRA 1BJKA 4LF5B 3O4JA 3LFTA 4TVSA 5FPKA 1ZD2P 4EHNA 2P2LA 1HY3A 2HK6A 2QVLA 4ZXFA 1ECCA 1VOTA 3HC7A 3SZUA 3TGPA 3W2HA 4LI3X 1C1DA 2D1YA 4PYNA 1O2DA 2RGNA 1KNXA 2QGFA 1MG5A 2VQDA 3OEHA 4AN4A 1P1JA 3QKIA 2H4YA 4Y6LA 4P92A 1Z68A 5EJ2A 1M2OA 1RBQA 1UOQA 5CW2A 3TM4A 1CVLA 1OWMA 3S70A 1RAIA 1QF6A 5FO0A 2HSWA 1DWQA 1MJFA 4X20B 4RC9A 3CN9A 1S3IA 5JSUA 4EY4A 4B3MB 3ND9A 2Y4NA 3U09A 1I9GA 4LYJA 4F86A 4RQTA 1MC1A 2CC2A 4U2CA 1A8PA 1U11A 5MN6A 1XNJA 4H7IA 5E4TA 1KYTA 4JYBA 2I2XB 2OD2A 1T9KA 4KR3A 1J8FA 2X8BA 3NOOA 4IGAA 5TQJA 4FMDB 1NVFA 4WOPA 4A5OA 3AF6A 5JROA 4RE6A 4C20A 3IAAA 4YJKA 2DR2A 2BGIA 4AN0A 4CFZA 4Q05A 4Y2VA 4OBBA 4R1OA 3HCCA 2EZUA 4F8JA 5FADA 3A4TA 3B70A 4N5MA 3ELDA 1OHHA 3GNSA 4JEIA 3SZOA 3U80A 2MYPA 3FOBA 1JQBA 1AO3A 1R9NA 1EINA 4G37A 3G1WA 3QMVA 1WB5A 4ZHQA 3Q88A 3I8SA 3C43A 3KPJA 3N8IA 4TT3D 4CKWA 1XWIA 2FSPA 1YZUA 3GRCA 3DBRA 5IVDA 4EX7A 4CZ2A 4V39A 1QP4A 5H8WA 3QIVA 2FMTA 1IK4A 4HVTA 3B82A 2FZKA 4O59O 4RIFA 5HF5A 2RHBA 4BLUA 4XX1A 1E3TA 2VAPA 4P7JA 1T0BA 2A86A 2YS7A 4EVRA 2ZJZA 3K35A 2H7YA 3TZQA 3C7DB 1IHUA 3QKRA 4JIGA 2CVOA 3RI3A 1EMDA 4QYIB 5CHEA 1S8FA 3AVUA 4B71A 5BR1A 4XXHA 1OV6A 1NDHA 2J6IA 1E2EA 2G77B 1Q1QA 1DC8A 4RIIA 1BVUA 1OTXA 1JG3A 4R8KA 1X80B 1RM5A 1M5UA 3UAOA 2W6ZA 2QM3A 1HT0A 3GQVA 2B0CA 3ZZ1A 2AC4A 2F1IA 1ULZA 4M87A 4NKRA 3TW0A 2JLXA 3RJ5A 1ZXBA 1J4AA 2FPIA 2I2DA 3CYFA 3JQGB 5KTKA 1VLQA 5IRCD 4QPDA 3I2GA 1OLUA 4KV7A 3DKVA 4QPCA 5BSTA 1N5DA 1LS1A 3QA9A 3QWBA 4E70A 5KTNA 2QT0A 4J7XA 4UPDA 2PN1A 4IHJF 4OMFG 3EARA 3VX4A 1Y6JA 2G25A 1P4RA 2I87A 1J0CA 2BWJA 5DI3B 4DW8A 4AI6A 3PQ7A 2HRDA 1C7QA 3N2ZB 4IM7A 1G2OA 2BFDA 3IKJA 4AF6A 3ASUA 3N5CA 4PCVA 3EUFA 1S2NA 1C81A 4DZZA 3NDBB 3H65A 2ZCUA 2FR8C 2Q5CA 4G6ZA 4I1OA 4UNIA 3F73A 1PS8A 1QG2A 2GGSA 4X1YA 2YC2C 1NXTA 3OZIA 3VSBA 3ADBA 5AMXA 3C4QA 1DAOA 2FPWA 1D07A 2I6XA 2XOKD 3AHIA 1MO6A 3IE0A 3RFXA 4HNAA 3OURA 3ZDBA 5CA0A 2HLPA 3G0DA 2QTZA 3H97A 3JASB 4KREA 3UQYS 3K9NA 2WG1A 4NZMA 4DUPA 1OFHA 2FW0A 5JE8A 1UC9A 4CFYA 5A5EA 2F2TA 4EFNA 4ZDJA 5JNVA 1FS4A 1ZW1A 4K8OA 1XF1A 3L4EA 4B2LA 3T5AA 2Q29A 4WA7A 3DM5A 4HZIA 1NBEA 5FNVA 3QU7A 1RHMA 5DLPA 1XWWA 4U2EA 1JVBA 1ULAA 821PA 4AY6A 2WQZA 1N6IA 3QPUA 4YB8A 4WESA 2J3QA 4XLLA 5FYQA 4ENVA 4ZJZA 1ZCZA 1KDPA 1GAWA 3LLCA 2CLDX 2VCHA 2BH9A 2EBFX 1TGYA 1ZGAA 1KAGA 3DQZA 5TSDA 5A0TA 1RS0A 4D3DA 2HPVA 3EGOA 1Y8RA 1UBOS 1NR1A 4R54A 5TY0A 1MP0A 4QHSA 4B81A 4BJHB 2Q9AA 1RQ7A 3MUEA 2WOJA 3T5BA 3FFWA 2GARA 1E2BA 2HOQA 1TZJA 1U8TA 5I7VA 4PNHA 1KE2A 2ZPTX 3C3KA 3OIVA 3P26A 2FPKA 4L4ZA 3WGKA 3U56A 3K1ZA 1NIPA 3EXHA 4DS3A 4N3GA 2CGEA 4X1KB 4FSXA 2VL7A 1VCHA 1VXRA 4S2UA 4AU1A 1AXGA 1I7LA 2DR3A 2AW5A 2QROA 4OP1A 3RK0A 3CRW1 3OKPA 2CUTA 3BQMB 1TCVA 1U0TA 3IEUA 1X6VA 3JD1A 2WINI 3O4IA 4IDHA 4XWKA 2BFFA 4N65A 4PRKA 4ZYWA 4BZZA 3CU5A 3IBCA 2CLIB 2G0NA 4M7PA 1P33A 4P7BA 1M0WA 1E5XA 4CCYA 4F06A 2OAP1 2EG5A 3FW1A 3RYHB 2ZYUX 1CJBA 2EFEB 2FMUA 3SIXA 2H4WA 3JVUA 3OE5A 3N9IA 3ZNOA 1HZZC 3NVDA 3NYRA 4F4CA 1Q7CA 1DMRA 2CNWA 5D00A 2JATA 3NAMA 5E7QA 4YUVA 3A2KA 4NZ9A 5HM6A 5D5QA 1F0YA 1GZ7A 3FUXA 3OLVA 3K9FC 3UUFA 1L5FA 2V3VA 2JK1A 2MSDB 3RSHA 4C7MA 1NHWA 1Z5NA 5AIAA 3VR1A 3ERCA 1XSEA 2A88A 4MV5A 4U3JA 4AS1A 4B32A 2OO5A 1RU3A 1RI4A 3KT0A 4CG2A 1Q77A 3QLUC 2WJJA 3RKSA 4F56A 3BWVA 4Q93A 2ES4A 4ZCRA 1GPUA 4M76B 1D2GA 1HDOA 5DHUA 5H16A 3IUMA 4LWQA 4A03A 4F9TA 4UU1A 4D0SA 2DRIA 1QIEA 5JMOA 3GJXC 4NP6A 5TB5A 4G4GA 4EMTA 3LGSA 3HUDA 3P45A 1QG0A 1WULS 5CCDA 1MEEA 4EF5A 2OXRA 2Y92A 1P7WA 4PW0A 3EDOA 4YXFA 4M1KA 5KPJA 2O52A 1Y8CA 1CLEA 1YZQA 4ZV4A 1UKYA 5DSXA 1V11A 1NBMD 2AG0A 2VDMB 2QD1A 3EQ7A 3M6AA 2D5AA 5F51A 5CA1A 4ZZ0A 2VSXA 4IIJF 3OTWA 3AUXA 4CTJA 2PVCA 3W06A 2VP3A 4PBTA 1W85B 2A1UA 2CD9A 3H1AA 4US0R 4OCZA 3K30A 2FEWB 4BQNA 2WJHA 1NVAA 5JRZA 2IS6A 2JD1A 4RTJA 1BIFA 1OFIA 1AQYA 1XEXB 4IHAA 3T1HB 3QGMA 3SHVA 2ONCA 1UOOA 2IIBA 3PEEA 4MV7A 3HXPA 5CDFA 4MWCA 1UAAA 4A2WA 2AF4C 3M3HA 4AWBA 2SNIE 1WF3A 3U16A 4E0BA 3N70A 4MRAA 1C7IA 3TE7A 1XMVA 4UE2A 1N6LA 3TW4A 4DC0A 3AI1A 3JR3A 1QTQA 3VV3A 1IOZA 3SSOA 2R8XA 4EVQA 2CWDA 3TLGB 2D5BA 3HYSA 1DJNA 2OHXA 3DEZA 4HAYA 4ZAWA 3L6UA 4HAIA 3U19A 3IT1A 4L51A 5BQOA 1ZQ1A 1MIHA 1FYVA 2AQ8A 2IDMA 2VPZA 3FG9A 3HZHA 1L7MA 4E2XA 1SUIA 2BKEA 4WJLA 5HZGA 4Z86A 2FPLA 1XP5A 2XADA 3DPUA 3K73O 3LX5A 2WABA 2C2OA 4JBLA 2Q4TA 3L6CA 3TCNA 5AKXA 3ZBTA 5EJIA 2GEBA 3AU9A 4GYYA 4M0UA 1NV8A 3GFBA 1GARA 2BR3A 4HFMA 1TM4E 3RRMA 1CUWA 3V00A 1I80A 1T29A 2COEA 3BHJA 4O5OA 5M7EA 3EW9A 3O95A 3OZDA 3UHFA 4PG8A 1FYFA 1U7PA 5H70A 1BU8A 5IG2A 5L3QA 3CNEA 1V48A 3MUFA 4QYTA 2B4AA 3RW9A 1CUBA 4L2IA 4IVRA 2CNNA 1HUQA 1G6OA 2NPIA 3QFCA 3ZTYA 2CNDA 3IDAA 3TL3A 5BR7A 1YBAA 4KLRA 4MITA 5KS2A 2NADA 2WYOA 1KWGA 3SPXA 1Z4LA 2WUFA 1GPBA 2FUEA 5J9FA 3S7TA 4RMHA 4JFRA 3D1VA 1BG6A 1EBFA 5LR6A 3RTEA 3E18A 1G9SA 1QV7A 2C1ZA 1EVQA 3FNEA 1X2EA 3FB1A 1RYNA 1KP2A 2XBUA 1ADYA 3OQPA 4URUR 1WDWB 4LCBA 5A9TA 2RGNC 2OE2A 3QE2A 3TJMA 5BUZA 1RLOA 4K7JA 4DXDA 4KXLA 4YPFA 1WU7A 1JLSA 1M74A 4V03A 3L43A 2GPSA 3MMSA 3MTEA 4GE3A 4QWMA 4WNYA 3K70C 1UH5A 2WWTA 4IMIB 1VDZA 2P11A 1AQUA 4KV9A 1ZICA 5FPHA 3A2MA 5B6JA 5KINB 1HG1A 1MH9A 2JD2A 2K7ZA 2BR5A 3OZWA 1YJAA 4FWTA 1IXYA 1XLWA 2R8YA 3U40A 1QVZA 1X0VA 4LBZA 4O4HF 2C9BA 5ALTA 1Q12A 5KU1A 3RYFA 1N36B 4LEIA 2Z08A 1DG1G 4OIMA 1M6YA 1AN0A 2HWUA 2BTQB 2IE8A 2PFKA 4KUGA 5DASA 3OT5A 3T95A 1A9XA 3PNOA 2R2AA 1XZ8A 1MR3F 5BYBA 1R8JA 2ZXFA 4HAXA 1RBYA 2UZ1A 1AK1A 4QYSA 5LVAA 2FSVA 1XCOA 4ZYLA 4A0QA 3L4JA 1DG3A 5IKPA 3PDCA 4B83A 3T7RA 4V0NA 5AI9A 1F4VA 4CWAA 1ABBA 4TTJA 5TNXA 4UZEA 4BGEA 1SXJC 1U5BB 5GGXA 3W5UA 3GJ4A 5TVKA 3GUHA 3K0CA 4DCVA 2JI7A 5CLHA 1MC8A 4KJZA 4W9MC 5ALQA 2A8YA 2X4DA 4BLRA 5TRTA 3LY8A 2ZIXB 3TEFA 4BLWA 4Q5IA 1PJ4A 1RZVA 1JDVA 1R5BA 2QI9F 5IAJA 4AFNA 5IF9A 2ZIUB 3SU8A 2Q4OA 3OJCA 1WQ3A 4HYQA 4NYIR 4KLCA 3U37A 1W9HA 3E3OA 1NU6A 4A8JA 2WUDA 4IICA 2OBLA 1KJWA 4IEFB 3U4QB 2ZB3A 4D3FA 5FWXA 2GHIA 3QF4B 5FR2A 2XB8A 4G85A 4CUKA 3MJSA 1TM1E 2A4MA 3DFMA 3LWNA 3I2FA 3BF8A 3E58A 3JYHA 2RHRA 3W9SA 4GBMA 1JG1A 1T0IA 3DZDA 2O3TA 3KK0A 3PLRA 3WY9A 1U2SA 3BL5A 4R2HA 1P29A 3O2SB 3R5HA 3QYJA 4EQZA 2YNMA 3K1YA 2PGNA 1OJLA 2IX9A 3S29A 2A5GA 4IGEA 3KTDA 5BXYA 2ZUUA 2MYNA 3B1WA 1G38A 2H2FA 4J0EA 4XM1A 4W63A 1KQPA 2OGZA 3TMYA 3AR7A 4LS3A 2ZIZA 1FVOA 4KWTA 3ZTTA 4LOIA 5EHNA 4WLOA 3QOWA 1SCKA 1E9CA 1IMOA 1PL0A 2LE0A 1FFHA 3FOAA 2C92A 2YFQA 2OUIA 1P6QA 3KHKA 4FFMA 4I9UA 4MV0A 2W70A 4X24A 3WWCA 2C03A 4E5KA 5HQ3A 1U3FA 3HV0A 1E2JA 4Y7CA 3OM9A 4BU1A 1P1CA 5HZMA 1BYUA 3KTOA 3L7KA 1KQNA 5EJEA 3CEJA 4MGEA 2O57A 3F9RA 5ALZA 4BJ3A 1TUEA 4XFJA 5B7GA 4G63A 1EEXB 3CW9A 4Z3DA 2XKKA 3BB4A 4EPWA 3Q41A 3EBLA 4EB0A 3CVXA 1SK9A 5KEIA 3TIIA 1OZHA 1P2BA 5GIPE 1E9EA 3O91A 4IRMA 4MICA 3FPSA 1XE3A 4ZEMA 3ABSB 2PQMA 2WJ4A 3GEMA 3BM5A 4OU4A 1R5JA 4CCAA 1XHEA 1U7OA 5F21A 1RP7A 2NO6A 3FDJA 1R4AA 1HBJA 1JG2A 1W48A 2FYTA 2NV0A 2Y9PB 3W7AA 4IEEA 3RIYA 3QKSA 4RHXA 4PO9A 5IXJA 4GDFA 3PTAA 3BVPA 2A1TS 2FWIA 3I9LA 3O9MA 4YRDA 4DTCA 3I2IA 5CFNA 1SC3A 4WFIA 2ZUSA 4XJTA 1VSUA 2REQA 5B1IA 2WJYA 3TW8A 5IDXA 3CE9A 1VM6A 3KU1A 3L8GA 5B64A 4YJ2A 3GO4A 3AK4A 1V25A 2GT1A 3LXUX 2AOTA 2GCIA 4PYIA 4WLEA 5PNTA 4IJUA 2HFKA 3P9SA 2Q3BA 3NO4A 1E2QA 3GT0A 3R3ZA 3Q8MA 1BXGB 5L3RA 1RHKA 2JW5A 1IWPB 1DQZA 3OQVA 4F5WA 1CQJA 1WOYA 3N7AA 4P0PB 1GKLA 4JLUA 4UXJA 4ZTUB 5FV4A 3E9NA 2GYWA 2FEMA 3I5YA 4QTXA 5CYFA 1UM9B 2F90A 1HX7A 4Q3KA 2PU5A 4LAFA 4H0CA 5CBKA 4RK6A 3BEDA 5CTJA 5GONF 4GO1A 2X77A 1K75A 3ISTA 1LRLA 4EKGA 2VP0A 3BIWA 4ZALA 1DAPA 2APJA 3EOAI 3KU4A 2F8MA 4I5IA 4ZQBA 1GILA 2SBTA 2J41A 1MN6A 1N1EA 4IEIA 1Y3IA 4FD2A 3OLXA 5LQNA 1DLIA 1QHEA 4EY3A 3L0BA 4OLBA 3IJEB 4D9KA 2EJUA 5BYKA 3GI1A 3JRXA 2IS2A 1WZCA 2D74A 2ZANA 4QHTA 5KHLB 2JBAA 2C2MA 5D2CA 5G0VA 3KKNA 4AJJA 3SDBA 3K0AB 4EY6A 2H00A 2YRXA 1Q15A 4PC1A 4YJGA 3HA5A 3KLPX 1RVV1 3EXHC 4LTDA 3DO8A 4MPJA 1V26A 2QM0A 2BHLA 3Q7EA 5HF6A 1GWNA 1DIOB 4RUKA 1LBEA 3FVRA 3FHTA 3SC3A 2ZCJA 5ALVA 2UUOA 5ELXA 1UC5B 4FFOA 3UF0A 4BFSA 1IEQA 1E4EB 3UAVA 4EYEA 4EKIA 2V6IA 5AVXA 3VUFA 2RONA 2JLWA 1G18A 4FKZA 1L4GA 4B2IA 2GH1A 4ZGWA 2X4IA 3QVJA 4L6IA 1E3QA 2PWYA 2CNLA 4LY6A 2PNFA 4OHZA 4ISBA 4URVR 2XCUA 1XCMA 4LE2A 1OXSC 2CCJA 4IO1A 2HLNA 2Z58A 2FA9A 4IR7A 1YMUA 4WUTA 2I80A 4Q7LA 1OAKA 3AEQA 4L5JA 1Q11A 4TLBA 3ZV5A 3VH4A 4CKBB 4D3YA 3EPKA 2JI9A 3EVNA 1GO2A 2FPXA 2H9YA 1CDOA 2YS6A 2Z4RA 3HZZA 5ELLA 3I12A 1AB5A 3KOXA 1NRXA 1UUFA 4LFBB 5T4FA 1K3UB 1HEYA 2OO5C 3S6JA 3ZDZB 1E2PA 2EZ9A 4NLLA 4ITRC 3IRUA 4JR2A 4PAMA 4QREA 4MRRA 4RFSB 1LPNA 4MVJP 3ZU4A 1NBAA 1O6BA 3M4YA 3V4LA 4LOLA 2ACVA 3OZGA 4YRKA 2EVWX 2H4HA 1HA3A 1PWHA 3LX8A 4O4IF 2Y2UA 2VP9A 3MF4A 4GE0A 4OXRA 3I5MA 3LCVB 2G06A 5FUVA 2Z6UA 3WQBA 4KFRA 3I6YA 1A9ZA 1POXA 4QDOA 1H05A 1OB5A 5JJLA 1ISGA 2EIHA 1FDUA 1Y4UA 4J03A 3DZIA 2HF2A 3GX1A 2Y0DA 4XJXA 2H1FA 4CL3A 1RACA 2B9EA 3UMRA 5ADUS 5J2UA 1VPVA 4ZCQA 1AGNA 2DMRA 1NULA 2Q3EA 4FBLA 2FFBA 1A3CA 4PIMA 3P2JA 5ES4B 1J6UA 2AZMA 1DSSG 2GD2A 1P5FA 3I1YA 5CDSA 3PYLA 1TXGA 2FEAA 4IUCS 3UW3A 4ABYA 2J0SA 1TFRA 4UDOA 1H2RS 1TC1A 1WDLA 4NECA 4RPHA 1IYZA 1KU6A 2GESA 1VJRA 4ZU1X 4DLSA 5BSKA 4ZT2A 4JXKA 4O2BB 1N2CA 4E6EA 1A5ZA 5KKAA 2PSJA 1ZUWA 3UJ6A 3WSTA 3KZXA 5A1JA 1EUQA 1H0RA 2JH8A 4G5OA 4FYWA 1MPTA 3EASA 2KX7A 4QNMA 2V6GA 2WTAA 4TVBA 4ETMA 1RWXA 1NI4B 2OQRA 3WL8A 1JG4A 2XQJA 1OA0A 1Z4QA 3IQDB 3QVTA 5AT1A 2HHAA 1K6MA 4NMHA 2YN0A 2ZYAA 4WE3A 3I6BA 3R3JA 4V0ME 1T2NA 5KUTA 1ADBA 1U28A 4B17A 1K9VF 4N7BA 4HRXA 2CZGA 2YHIA 4BZPA 3DBLB 3HH8A 4I7EA 3TGLA 2IU4A 1A8IA 3R0IA 3SX0A 1BU5A 3FMOB 4FEEA 3BB1A 4OUDB 5JVDB 3R75A 5BNTA 1EQUA 3B6JA 4N0PA 5LOVA 1BX3A 4NMWA 1GTSA 1RKXA 2YJ3A 1JIIA 4P0TA 2PUBA 2FE1A 4EPTA 1M2GA 1B3BA 1HYBA 1EB8A 1I4WA 2GXSA 2E4ZA 1KWKA 4B6RA 1GQOA 5EQTA 2OFOA 3BG5A 1M8PA 3JQEA 1P3DA 1JT2A 3PJRA 3P0HA 5TXGA 3BHNA 4KDCA 4FM9A 1Q14A 2RHWA 2SKEA 3BB3A 1NJ1A 3PR1A 5A7FA 3LPMA 1FXWA 3MTQA 3GYBA 4D25A 3RC7A 3UYKA 4HVCA 3FGOA 2CLMB 1Q3HA 1UK8A 3HJFA 2YQ5A 1GCGA 3MIZA 3UFXA 3S8EA 4MRVA 1NJ8A 4AYTA 2CXSA 2XEXA 2I6UA 4GZ6A 3I45A 4BO6A 1FFBA 1R0RE 2PWAA 4TM7A 5C1OA 1CQPA 1N9KA 2GNOA 3VX3A 1U2GC 4IDBA 4NY1A 5CW1A 1AN9A 4INAA 2CJPA 2X0EA 3S2EA 3ORYA 2IZ1A 5CH8A 1JHZA 4GPTA 2NTEA 1YC2A 5DNWA 5FWYA 1U8YA 3AFHA 3CIOA 5HOQA 2PIDA 1ULTA 2BW0A 2PTGA 2QX4A 1GNPA 2JFHA 4MW0A 4R16A 3T3GA 1KRWA 4MI6A 4NOLA 3F9IA 1O57A 5IKEA 3Q7PA 3GLFA 3JD0A 4M8KA 2VA8A 2BFBB 4EO4A 2CXPA 3MEQA 5LPNA 1WG8A 2L18A 4YQZA 1WS6A 3REQB 3ZIDA 1E7YA 2V0CA 3WLPA 3KPYA 5FR1A 3E23A 4GMGA 3BKWA 1UZMA 3D6VA 4RYDA 3RYCA 4KXWA 4Q6WA 4BLTA 2FSVC 5FNVF 2X7XA 2EQAA 3ZY3A 3ZW7A 3R7LA 4PTLA 1V7PC 3S55A 4E2YA 1IIRA 1BE8A 2VR1A 3O8DA 4QXAA 6GPBA 3SZMA 3ZLUA 1BKDR 3ONDA 1T10A 3WFIA 2G70A 4HUTA 3R7BA 1I2CA 2QGZA 3QPAA 3K0CC 2IC5A 4L8FA 1U8FO 2LD4A 4I8IA 2FWRA 4C4XA 4FONA 4KQMA 2BL4A 2C99A 4AMBA 1RT9A 1P2FA 3NX4A 3FLMA 2I7VA 3HJGA 2PL3A 1XTIA 1THTA 4ZKEA 3IAM6 3V1MA 4PZ0A 2FTKE 1YRBA 3MAGA 3NBYC 2R48A 1OC2A 1J22A 1LX6A 3BOSA 4S1PA 5DYNA 3VQTA 4A8JC 4XRRA 1YQGA 3OOWA 2R7MA 4Y0NA 1X1AA 3EA4A 4JP1A 3GZNB 5ALXA 1DBPA 5F7ZA 3T4XA 3ZD8A 4HKTA 5HHTA 3R41A 3D4NA 3KJNA 3SOZA 4MMZB 3MWKA 2C8JA 3CUSA 3MS4A 4HB4A 1QB7A 2Q5EA 2UVDA 5KQPA 3C8ZA 1W1IA 3EVZA 4FE4A 4J0DA 2J30A 5GZ6A 1DTEA 4AY5A 3PL1A 4NRDA 3P9YA 4EX6A 1KA9H 3GK3A 3ZGOA 2YNMC 5KYNA 3LLSA 5EJ6A 4XJSA 4CDGA 3HDGA 2W11A 3I3SR 4H1UA 2YWBA 3IJPA 2NGRA 3ZWMA 4P5PA 5KYXA 1LKZA 2V9CA 3VISA 2IOHA 4YMUA 1PDWA 1R3UA 2TMYA 3OCZA 3UQZA 4OYHA 1YFKA 3PXBA 1F1JA 3ZCVA 1QU2A 1QM5A 3H83A 1S1MA 3MJTA 2Q5JA 4ZZ1A 1DIBA 1F38A 3HXQA 1NRWA 2VA9A 4JXZA 4FFBB 4W99A 2H92A 5AVOA 1CNMA 2ZU6A 5H9WA 4RDCA 2AZ4A 4B8WA 2IYFA 1PDOA 5IS2A 1ZH4A 1UK6A 4KXNA 1Z7YA 2DULA 4YRJA 4JL6A 4H60A 3ZBPA 3KTAB 3BXEA 2Z30A 2I4LA 4TTPA 2QJRA 5JBQA 1UMBA 5ED0A 2BFOA 4J07A 1U7XA 3EEIA 4RQAA 2B94A 2RGDA 4N5LA 4A15A 1QO0A 2QVCA 1VIDA 3TI9A 3BL8A 4QPPA 5AW1A 1JW9B 2JH9A 5GAJA 2PEYA 3ANXA 3U7HB 2PKQP 2Q5OA 1GSOA 2GTIA 5CA1F 1KJYA 4BQRA 4TYWA 4B6SA 3ND7A 1V8BA 3O3CA 4LHEA 1S0UA 2BGKA 5TGDA 2X9VA 2C77A 3F7OA 2ACWA 1VKJA 4GQAA 5FHRA 1TJ4A 3C14C 3OWXA 3ZDRA 2GWHA 4LSGA 4Z4CA 2XUFA 1XRMA 2PZFA 4H1WA 1ENYA 2OT3B 1E7SA 2LPMA 2R00A 2EJWA 1KI4A 2I2WA 2C7GA 4FGUA 2O8CA 5AVUA 2X42A 1PLJA 3LM8A 4DLLA 4IIYA 3I4FA 2O2HA 2OXTA 4HGNA 3LP5A 1BE0A 1QIGA 3SHTA 5FV7A 1G8FA 2QM7A 1XELA 3A11A 4JP8A 1AZTA 1S96A 3MTIA 3N76A 1VL8A 2P4SA 2BSQA 1XB2A 5BV8A 1UXHA 3V7WA 3WLRA 1SCNE 1ND5A 4M2LA 2A94A 4RVFA 2BGMA 2WM9B 1G9XA 3DDSA 3AJRA 4X8HA 5DFAA 3SVZA 5J2TA 1CJUC 3AR3A 2VDJA 3QBEA 5B1HA 4B3BA 3MHTA 1CZUA 4D45A 3B3AA 1Q92A 4KNVA 1J8MF 1PZXA 4QUJA 4MYHA 5IW8A 1XI2A 2OKCA 2DLCX 3HUFA 1PQUA 1SHTX 1DP4A 4DNXA 1O95D 1QONA 3KHTA 4D9EA 1F5SA 3ZS9A 1I7QB 1OH8A 8AT1A 1B6RA 1QHSA 1RWNA 1ZI8A 2QRHA 2W4QA 5F52A 3NOVA 2I0FA 2OCYC 2DFKB 2W00A 1DTWB 1MXHA 3DMYA 1JLLA 3JSXA 5C7IO 1I94B 1KVSA 3OX4A 2DKOA 2WKWA 3HCRA 4PCAA 4UAUA 3RC2A 3OKCA 3GFQA 1ARZA 3Q9SA 4AMYA 5EIBC 1UR5A 1W8DA 4NJOA 4BB9A 2WQ7A 1W0KA 3D02A 3TDKA 4HBZA 5A9RA 1MO5A 3SP1A 2ZU0C 4GDMA 2ZYGA 4ZT4A 2CYBA 2O3JA 3M1AA 4KE8A 4OSOA 4GNRA 1CTQA 1UJ4A 2OBNA 2WB4A 3EF1A 3F1LA 4Y2JA 1N8NA 2HLDA 1DDIA 1UKVY 4IYJA 3BFVA 1ZI6A 2B8NA 3AEUB 1E64A 1UMCA 5EUMA 1LFDB 4JI6B 1AB6A 3THYB 4RJTA 1XLVA 3BXHA 2KJQA 4BNLA 2A84A 1X39A 1PZFA 2PVPA 4QAQA 1ULUA 1ZAKA 2PYIA 5E2IA 3K4HA 4MKXA 4C5CA 1K6JA 5I9MA 2R0QC 1ZHOA 1I51A 2O54A 1P77A 3LUDA 1GTVA 5DULA 3SQOA 3HBJA 3VPCA 1CY0A 5CR9A 3SKXA 4MUGA 1MX1A 2BCJQ 1M8GA 4RMGA 2QD5A 1GPNA 2JZCA 1II8A 1KE1A 2XUDA 4UBKA 5TT1A 2YX1A 2AOUB 4AUMA 1J9EA 4DAEA 3EQ2A 1DKUA 3ZK8A 9LDBA 3DHYA 4OOFA 1JIXA 3G8BA 3HWSA 1Z8FA 1LUAA 4OEHA 1YC5A 2QW0X 4N5NA 1TU3A 1X7GA 3MUNA 3JV7A 5DEOA 4TWAA 3MLAA 1KDOA 3O21A 1MFPA 4NSNA 1XXHE 2P35A 2YHAA 5TGZA 5JPCA 4HNTA 16PKA 4KACA 3OD5A 1EGMB 3HKDA 4P3NA 2FG7C 2OD9A 3PSAA 4GLJA 2AS0A 4YRTA 4X8MA 1PBNA 3RHZA 4P38A 1T8PA 1EFLA 1W47A 1IQPA 3A10A 1OBFO 3K3PA 4IDNA 4LYYA 5ERXA 3JQ6A 4AJKA 1EG7A 2H5IA 4QRIA 5EJ7A 4HRYA 3OKAA 2W2LD 4YAWA 4LVUA 4R1LA 4AAYA 5T41A 3GMTA 3QUQA 1SHUX 1QGDA 4YEDA 1RXUA 1ONSA 4BVLA 2OZEA 2H9AA 2H29A 3AUKA 3HCAA 1AF7A 2DTXA 3BN3A 4PPGA 3TSZA 4R1MA 1IOLA 1KDZA 4DT1B 5J4YA 3COPA 3Q6IA 1XLUA 4Z1MD 3EEQA 1CFJA 1U28C 3CVOA 3PWSA 1JAYA 1BW9A 2Y1DA 5CBPA 2O07A 3CWCA 2D0OB 4C78A 3CURA 1NFQA 2GK7A 3UWPA 1BFKA 5JV5A 4KUHA 3OF2A 3P2IA 2OV1A 2QE7A 3T7AA 4Z9FA 4LRQA 5DMXA 5K8CA 5K8JB 3BGVA 4QFMA 3L01A 3T34A 3EYWA 1AKNA 4GS5A 2GVNA 4CM7A 3DEAA 3T7SA 2ZYIA 4DCUA 2AN3A 2QP4A 3OX3A 5G1PA 4OBXA 3C3JA 4U7PB 4Z7OB 2O2SA 3RSZA 4B3DA 3EH2A 3H4IA 2EATA 3T9CA 3L8YA 5HE8A 4OX9B 2XGSA 4E1AA 4EPRA 4EOGA 4N1AA 4S1WA 2WW8A 4KMRA 2ZS8A 2P3LA 5BR4A 1WU8A 4HNUA 2XA9A 5CH3A 3CLTD 2M6LA 1KL7A 5IT9A 4N5HX 3WK6A 2YIDA 3IBTA 3M83A 4URFA 1KETA 2F9LA 3IALA 4YRBA 1BJTA 3HBLA 3E1KA 2W2KB 3N2YA 1M1XB 4UMEA 1KTIA 4KDEA 3BCUA 2AXNA 2I4RA 4NCXA 4RHUA 1D2RA 4P32A 2XUKA 1QH1B 2NTYC 3IXMA 4U9UA 3S68A 3X1ZA 1ODKA 5FTNA 5TE9A 4JWTA 4XR9A 4DLVA 1UKCA 4MDHA 2C4UA 3S2IA 5IT0A 4KRFA 3EFHA 1JE1A 1BQ4A 3RUAA 4KQGA 1SU4A 4MDFA 4R6XA 3G82C 3M5DA 2CJFA 3H42B 1O6ZA 5E9WA 4YJ2F 2H2AA 4B7XA 1XALA 2AZXA 1LPAB 2Q8NA 1Y5NA 3IJ5A 1F7VA 5TMPA 4R0MA 2XX3A 2VHJA 2VTKA 3ZWNA 2C0QA 1Z6GA 2VIIA 1IXKA 2WZDA 4H3VA 4HWSA 5A7HA 2PJUA 4IQ4A 3COVA 1VJ5A 3GRVA 3DCYA 1P62B 2IT1A 2R8OA 2P9JA 1D2AA 4U7FA 4I66A 5KWVA 1T34A 1BFDA 1ULSA 2QTFA 3FSEA 2BI4A 1UIRA 5EAIA 3IOBA 3KQSA 4MROA 4JN6B 5HFNA 5K2OA 1G55A 3A1UA 1IBMB 4MW9A 4W8OA 3CBQA 4TYYA 3N2NA 4Z0TA 3O3NB 3TN7A 4AX8A 3W9UA 4DSUA 5BUQA 4A5SA 1QZXA 4WGGA 4NXMB 2OKGA 5IASA 4HJXA 2GBFA 2QZSA 4UDNA 5E1OA 4ZAZA 3AKZA 2O8EA 3H13A 2AD1A 3V1YA 4PHTA 1ONOA 4JBIA 1IJEA 3BXZA 1ZJ6A 5AJTA 5KMGA 3EVAA 4IJ6A 3KEGA 3LNTA 2F3RA 3F4LA 3HI4A 4G1FA 2BEVA 2CLKB 3LTEA 4PVCA 1OT3A 2J85A 3PFHA 2QIOA 4Y98A 5IN5A 3WHLA 2VJDA 1E2IA 5EZYB 2CFIA 3PNBA 5F9MA 1QGZA 4XYLA 5CCXA 2ZZNA 4XFKA 1F8FA 4INJA 3THRA 2QB5A 2XD4A 3CRZA 5EOVA 4C6RA 4NCBA 4IOMA 1QKKA 2FR0A 2RH4A 1TKBA 4RZUA 3RLFA 4UM9B 2EJVA 5I7HA 2JFFA 4ZVQA 4PZ9A 1USIA 3C24A 1ZA2A 1XQWA 3O1IC 3KALA 1Q50A 4HEA6 2C2BA 4C6HA 4HLDA 3K4PA 2FZ4A 2XTJA 3PC3A 1U81A 2QAIA 2XT6A 4PZZA 4UU0A 2JASA 3VO8A 2DT5A 1DWOA 1B6SA 1Z6TA 2J4FA 3C1UA 3DMNA 4PX3A 1L7NA 3WHKA 3IURA 4Z3OA 2WA2A 5C8YA 1G20B 4L8VA 2NIPA 2P62A 4DN6A 1VKRA 5EKTA 2DECA 1GQSA 4ZD6A 1ZK0A 5AHKA 5IKXA 4EJ0A 1L7BA 2AMLA 2PBZA 5E6UA 2OCPA 3OPYB 3RU2A 2ETXA 3S81A 4TMYA 4FW9A 5ALWA 3IEKA 1GKIA 1WUTA 2MINA 5INTA 1TF2A 3LBFA 2EBWA 1DCFA 3DF7A 2I8AA 5LYYA 3F46A 4TV9B 1EX1A 1GDDA 3AQ4A 2VXCA 4M99A 1WB4A 1E3LA 1PK7A 2NT3A 3R7FA 4ODIA 4LOAA 2MSWA 5EESA 3VNSA 5BN4B 2XECA 4UD6A 1CYEA 4PAWA 4XUGB 2HBRA 1N5MA 3AESB 3F3MA 5FF9A 4LE1A 1FRZA 1Y9EA 1XCPA 2FFQA 4TWBA 4QUAA 5AXCA 3U81A 3WXBA 1SC6A 1SKYE 2J3HA 2VPPA 1FW8A 3L82B 4MB6A 3VZDA 4DC9A 3B36A 2LIVA 5B12A 4KPUB 5M29A 1U1GA 1NN3A 2DHDA 3JWIA 4W9NA 5KDDA 4DA4A 3AB3A 5J2UF 4G41A 4YMLA 1GG2A 3KOYA 3R4VA 1NYTA 3GGPA 4D3XA 2AE1A 1I0ZA 3QNMA 3VOSA 4FNGA 1EM8B 2H5EA 3PNKA 3L0ZA 2FLVA 4DFDA 1CDEA 2R6ZA 1SXJD 2RAPA 3S1AB 1J1IA 1R6UA 3KKQA 1NRJB 2PYZA 2XDAA 1JEQA 1PJCA 1VZ3A 2YHUA 4PHHA 3GG9A 4GVPA 4JODA 5H0IA 3BFKA 4Z9XA 4LBYA 2B6NA 5KOJA 2WWWA 2ECFA 1GLGA 2IXEA 2ZWOA 3GGGA 4TMKA 2CJYA 2B1JA 4IDCA 3IP7A 4LF4B 4GOXA 2O0HA 3NHFA 1Y4SA 2R00C 2FMKA 1TYEB 1X0XA 2ESRA 2XUGA 3JWEA 2LXNA 3QIAA 4HZUA 4MLCA 4NU6A 2WM8A 4RK7A 4ZO8A 1MEJA 2F43A 3A6ZA 1WA5A 1Y6GA 2EF0A 1GG5A 1QFYA 3CF0A 4RKWA 1N2EA 1NUAA 3L7LA 2WMYA 3DKPA 3OUUA 3UJPA 3ZGVA 5CVUA 3ZQ4A 1VSTA 4L76A 1HE4A 1ZGBA 3LOUA 1L8OA 1SURA 3QELA 4NPAA 1CUXA 1GADO 1BS2A 1JFRA 2H1WA 4PQGA 5AK3A 4DNPA 2N47A 3EGVA 2DPHA 1RQLA 3CV3A 1IRIA 4HO1X 5JI3E 1XRRA 1AKWA 1K6IA 4JBXA 4I4TA 4C89A 4ZZIA 3PJGA 3B3GA 4HGZA 2C84A 1HG0A 1QZ3A 3TNFA 5LOVF 2A5DA 3EVCA 1I1NA 2O06A 3FD8A 2IEGA 4JDUA 4XKJA 4B75A 3B1JA 5ITZB 4HMOA 3K0SA 2EWVA 1TJ3A 1A97A 4DWVA 2V1UA 3DFZA 3OFNA 2FPMA 3KUUA 3UCXA 4HJRA 4K6MA 3W78A 2CFOA 2VATA 3DE2X 3CGGA 4FU0A 2NU7A 1DCTA 4PCLA 1XAGA 4GI1A 5C0OE 4CKXA 3T5CA 4MEJA 4L7VA 1Z2AA 4OHVA 1W52X 1RE1A 4UXHA 3BMNB 2SCUA 1XYGA 3F1KA 3BTSA 1G2QA 1E3EA 2H17A 3ZKWA 3ZWWA 1KMHB 2Z1DA 5H3HA 3W0LB 4DG9A 3WLQA 1XZNA 3SFTA 3QEBZ 4MP3A 4R9VA 2UKDA 3BZWA 1LB1B 1Z0DA 1Z2NX 1Y42X 2P9BA 3FZYA 4WLFA 5ECYA 3SJ7A 3W5HA 2O5EA 4C76A 3GXOA 4P4UA 4EB6A 3MAJA 3GF4A 3LECA 1KYQA 3KQYA 3T5DA 5A9SA 5TPZA 2Y66A 1E1CA 1IQUA 3G6WA 3MCUA 1DAFA 4B3TB 4QTTB 1FDTA 2BHNA 2FZWA 3ADDA 4E88A 3O8QB 4E32A 2YCBA 4B4VA 1XRNA 3N2GA 1E1RA 3BTUA 3D3WB 3MTGA 1Q20A 3WGIA 3OFSA 3WOHA 3OUTA 4FCCA 3FMVA 1XTKA 1ZD8A 4I4IA 5DM70 5LMUB 2IH2A 5JJIA 1X7HA 1NUUA 3DNPA 1VLMA 3K2EA 1RIIA 3GRPA 5AHWA 5ALHA 1TQHA 4EMBA 1MRSA 2VWHA 3EGXB 4HX5A 4I9NA 1QQ6A 1WPRA 1R10A 1FVHA 4KKXB 1G8PA 4ZJPA 5CIWA 4YV2A 3KWLA 4XSVA 1U7DA 5SY9A 3S2YA 4HV4A 1KEEB 2OTCA 1CJVC 2XODA 3QYAA 2V9PA 3DEYX 1G8SA 3PPWA 2WT9A 1HNWB 2QRUA 3C97A 3DBHB 1HO3A 1P45A 5DP2A 5DYWA 5K0EA 3LQFA 3P5BA 4NEHB 4B45A 4DKXA 4YUAA 1FL9A 4IQ8A 1ZC4A 4HS9A 4WINA 1NWCA 3D8BA 5DRTA 3KOUA 4IDEA 1J49A 2WYUA 3ESBA 1JRLA 4QDKA 1EWVA 3UOGA 4CG1A 3EMDA 4M55A 4CL2A 5LQKA 4F2DA 3RC9A 4Z54A 1WF6A 1KDYA 1JQ5A 1N5KA 5FEMA 5KSPA 3S27A 4OI4A 3OJEA 3AO0B 1FYDA 4C3ZA 3MA0A 3HB7A 1B4DA 3LRPA 2AG1A 1AZWA 3UYLA 4B6PA 3JU3A 2B30A 3QVGB 4CT5A 2WD7A 4HX2A 3O7MA 2WSSA 5CT6A 7MHTA 2XKAA 1TYZA 3L3BA 3IX7A 1RYZA 2ZUCA 2GYVA 4GHWA 4RCYA 4AROA 1NMEA 1SA0A 1UKBA 2ODWA 2RG1A 4JVOA 2O2EA 5D86A 4J16A 4UQPA 3ZU2A 3DOOA 2JAQA 3ENQA 2AFRA 1L8LA 4NYMR 3TR0A 4LK2A 2XNDD 1XDUA 3IB6A 2NZUG 4MS1B 4TROA 3HU5A 5KB3A 2AEMA 2WWFA 4HQ6A 1WCIA 3R3VA 3TG8A 4AKHA 2Z43A 3DDUA 1PT9A 4WBXC 1GYPA 3ETNA 4W9RA 4NENA 2TECE 3GLUA 3SYLA 4XPIB 3E03A 2XQVA 3CJTA 4LWPA 1YKSA 5B2ZA 3QPWA 1GU1A 4G3XA 4DCJA 4BX9A 4IDQA 5D85A 3OT4A 5CNJA 2F1HA 1UBJS 3CO0S 1U2ZA 3B13B 1Z2OX 1Z4OA 2VC2B 4R8RA 4UVHA 1O58A 4DDHA 3EWSA 1EDZA 3NB0A 1L5WA 4JI4B 5LQSA 3EXG1 3GIDA 1NAIA 1E5TA 2WUVA 5KNBA 3FZQA 2IU3A 3CUYA 5TIIA 1EXVA 4UOQA 5CFQA 1IM8A 1ORTA 3JVIA 3DUWA 3F7MA 2JIOA 2JKZA 3LC2O 2OORC 2VZ9A 1RI5A 2VUHB 3TDNA 1OH6A 3G5LA 1K7EB 4OM7A 1Z82A 1Y4ZA 4PXSA 3ZD6A 2J7PD 1EH5A 1NMZA 2FMFA 3VU1A 4JY7A 1GD1O 2FAXA 3R0ZA 3STYA 4OHBA 1V6SA 2QX6A 3NNSA 1Z0UA 1XRPA 3W2EA 2I6TA 1L5MA 1XYYA 2FPRA 3SXJA 3Q87B 3AJ8A 4D9JA 1C9EA 1TA9A 2H0RA 2NXWA 3DT6A 3LA8A 3V4OA 4AN1A 1IPFA 1NV9A 4RX1A 4KH0A 4E1BA 3H3JA 2HSGA 4A6DA 2EKDA 2QTNA 4B3CA 4XVQA 1CR1A 2A78A 2D5CA 5GV7A 1KO8A 1LV8A 3IMKA 1JQDA 3ZCSA 2P91A 2IEDA 1G1MA 4Z4FA 2E2WA 3TZLA 4YJ3B 3GAZA 1W2WB 2ZSIA 3W4KA 5ALMA 3GH3A 4L0CA 2XKBA 3EC2A 4MUJA 4R9RA 1FDOA 5AYVA 3ZK7A 2DLDA 3EZXA 3LT1A 3CLSC 2FQQA 2X1MA 1JU9A 3ANMA 1PUXA 2PMEA 3DT8A 4DIBA 3SE7A 4KVZA 3GMSA 3VVMA 1FNCA 3RV4A 2J9XB 1SIUA 1P80A 1EVEA 2QU8A 5SZHB 3RIHA 2Q3HA 3G0GA 1MTZA 5F2KA 5CGQB 3MFYA 5J2TF 4X3OA 1L4FA 2CL0X 5KTRA 1NDUA 1T8TA 4AKGA 1J21A 1WIWA 1YB2A 4V0OA 5AUQA 1R8XA 3RS3A 5C1IA 4IXDA 1C2YA 4CKCB 5FL7D 2MSLA 1TZKA 1LJUA 3F4BA 1QDUA 2J33A 1JZSA 1NVXQ 4JSRA 4RAOA 1YACA 2OEPA 3NXSA 3ROKA 2AMJA 3R0QA 1XQVA 3OAAD 2X58A 2P2DA 3K71B 1X1DA 2MSKA 3K9BA 4MVJG 3B1KA 4MYUA 3JX9A 1Y89A 5G4KA 4GLBA 5LUBA 3QJYA 1S7GA 3PBKA 4H7DA 2F3PA 1WDMA 4X84A 3V4VB 3VR4H 3EZGA 2MTBA 1F9AA 3D3KA 1XMJA 3DW3X 1L4YA 3HRIA 1RMYA 4WEOA 1CT9A 3HO8A 3KV1A 5EHZA 1ZBQA 2WUEA 1O89A 4OI0A 3ROGA 5G3YA 1YQUA 5FJIA 1PF7E 2XCIA 5EIAA 5FJJA 1CWUA 3WNDA 4WXRA 3VHLB 2WEKA 2GKGA 1CDDA 1DO0A 1NFFA 2EGUA 3G2KA 4JYPA 4PAOA 5CT5A 4NK5A 3RAPR 4L8WB 1KQGA 4DLYA 1E69A 3HBAA 4U6QA 4I3FA 5HM8A 3HR8A 2I99A 1N5IA 4OFWA 3IMCA 4R9SA 1KOGA 3B5IA 2E49A 1NVEA 1G0OA 4R2XA 3UWMA 2CSUA 4BV8A 1NP3A 3S5JA 3TYXA 3IR7A 2O8DB 1BXRB 4MS4B 3TZBA 2Z8XA 1AUVA 5FFNA 1JNXX 5ILQA 4ENTA 4EG7A 2DBYA 3I5AA 3R7DA 2OZKA 3AUUA 4L5AA 4R2KA 3D6AA 4RHTA 2B3TA 5I9NA 4RPLA 1SVNA 1GUDA 1ZIYA 1SBTA 2GPJA 3NVAA 1HYQA 3M0EA 4GR9A 3UJNA 1GTL1 5DEIA 1Y5IA 4JMLA 1H66A 4YO7A 5ISMA 4UJ3A 1K86A 1EFCA 3VMMA 2XUIA 1ZX1A 1J5EB 4HTFB 3RTBA 3SBEA 2VDWB 3LGAA 4W9NC 2Z6QA 4OGFA 4ZOEA 1E5DA 3ZLTA 4AO7A 1MGPA 3REOA 2CY0A 2FNAA 4LZZA 1QUEA 1P4HA 3BGWA 4F72A 2A58A 1F2UB 5KNCA 4EY8A 2VHQA 1K06A 2OGTA 4NCHA 4ND1A 4R31A 3L6DA 1LQTA 4IV0A 3OQ6A 1W6UA 2XVYA 3P9RA 4YV1A 2VXYA 2YY5A 5CH5A 3V8NA 4XGNA 3L77A 4KXUA 1PFVA 3AL2A 4HH0A 4K0RA 1E1QA 4JI0B 4PAQA 3VR4D 2GPBA 2ZIWB 4MRPA 1A4UA 3V7NA 2JGJA 2GRAA 2C29D 1OXBB 2R751 2RB5A 4GPD1 4O4LA 6CHYA 1IM5A 3DV2A 2Z3WA 1LPMA 5BPHA 1IY8A 3F6RA 5A1TA 3JYOA 1FTYA 4BQEA 3VR3D 1P6XA 1VIVA 3NBAA 3GLQA 1YU9A 4M9RA 2A57A 3OLCX 4RKFA 4FMBB 3FDZB 1FTWA 2A0UA 3ZQUA 4YQYA 4C7JA 1K7YA 4IFIA 3ZE7A 2YV2A 1SCUB 5IAKA 3ZVRA 4R1QA 4IZ6A 3SBDA 2VQFB 3KEOA 4GL2A 3ANSA 1JT9A 2RHOA 2XNCA 5D3ZA 3K96A 1AKEA 3A6EA 3UKJA 3N7TA 4GXNA 3WRVA 5IYZB 4RW0A 3DTNA 3V32A 4PM4A 1XGKA 2NACA 1T5SA 3OFJA 4Y18A 4YROA 1B1AA 1AM4D 4JBWA 2HN9A 4KSBA 4TTVA 4Q1FA 3WTCA 2J3EA 4YMWA 3CRMA 4DA9A 2GM4A 2DKFA 2EQBA 2PO5A 4QGSA 5KOYA 1IDOA 3A3NA 4YCMA 5DM2A 1Z74A 3RRNA 4A91A 4IDOA 2BHTA 3L7NA 5ICFA 4ENRA 4JVMA 3VC3A 3IB3A 4G5HA 3I28A 3DMRA 4AJ4A 3RIXA 4LMRA 1JLHA 3MOIA 1P18A 2BEUA 5DBHX 3JVVA 1OFUA 3PGMA 5C35A 3O83A 1TVKB 3WJ2A 3KQTA 3AY6A 5I7OA 1MPXA 2I6SA 2OV4A 3I73A 4GG1A 4GM4A 4C4SA 1AG9A 1TLLA 3K1AB 3NM4A 3B5EA 5IJ9B 3BWYA 4NBSA 3CUKA 2Q45A 1TJYA 5DSZA 5E0KB 3I72A 1IXSB 1UFQA 1AVTA 1WNFA 3K20A 3M3PA 4TZ6A 4KVFA 4ANFA 1I6WA 2HJHA 2B37A 2QA5A 3W5DA 2GMWA 3RIMA 1VG8A 5DT9A 1OI2A 4TMVA 5DGDA 3PPXA 3SN6A 3G68A 4KBFA 3P9CA 3V8PA 3K0BA 2F1OA 4MW7A 4N82A 4ZGGA 2RDMA 3JQDA 4C87A 4XDYA 4AX4A 5IC4A 2H0AA 2EYQA 1WSDA 2CHEA 3OE7D 5DBEX 5DKFA 5BUSA 4YP0A 3K70B 4KEAA 4ND5A 4RMJA 5JAPA 3R3HA 4IOLA 5EIWA 2NVOA 1IY1A 2JLBA 1XX6A 3H05A 3IVAA 3AKYA 3KQVA 3NWOA 3QG1A 3FHCB 4G1CA 4J1NA 4K40A 4WZBA 3T1VA 3UXEA 3T1QA 3EZFA 1KVRA 2FKAA 1SPXA 3WK7A 1E92A 2CJXA 3WIOA 4BKQA 1JDBC 3OI7A 2CLFB 4FX5A 2EDCA 2PRSA 4LKRA 4I3HA 7GPBA 3JAWA 5EVJA 4LZJA 3QVOA 2YJTD 4DJDC 2YOFA 1H6AA 4E11A 5AXBA 4D9HA 3AW9A 4MVJI 4KR7A 3ZQKA 1SO8A 2MOKA 2PH3A 1Q0SA 5IK2A 2ZYWX 3BIFA 1R8SA 1OZ0A 1R4ZA 4ARZB 3EVFA 2GM3A 2CNKA 2OZPA 2OUKA 5DE3A 3RKUA 3V4FA 1W6RA 3U13A 4G84A 4G4SO 1QLWA 3QOFA 3DZGA 2YICA 3WHPA 4AUNA 4OQDA 1EGHA 4DANA 3HJHA 2IYRA 3AV0B 4TTQA 3OTIA 4BCCA 2V9ZA 1CNFA 1RM4A 2YMMA 1EFRD 4P4SA 4KIWA 4NOMA 4C05A 1Y5RA 4QZVA 5JD5A 1K7XB 4HSEA 2C5FA 1HNXB 1B15A 1NN1A 1SAYA 4EL5A 1GL9B 2WD8A 1RWKA 1TA0A 4QUBA 3V2UA 3G7NA 2JLRA 4Y2QA 1G8JA 1KI6A 3VGJA 2PS9A 3I53A 3I30X 3Q3CA 1SULA 3NHJA 4QGHA 2JFNA 5EFZA 1NVMB 2RCYA 4J16C 5LWHA 1MZVA 3GT3A 1Y7PA 3SHOA 4AZVA 1UPCA 1PZHA 1WCYA 1Y3HA 2I55A 2BBOA 5IF3A 3QW4B 4C9BA 3FCEA 1CUZA 5EIBD 2XR1A 2SKDA 1PNRA 1MKYA 1T4CB 2IYEA 1JHMA 5ALDA 4CU5A 4D1YA 5C8YF 5JCZA 1M6WA 1PW7A 2NPOA 4MIYA 4YRRA 4RZQA 1RM3A 1M73E 5HZKA 1HI9A 3B2QA 5KTOA 4N03A 1SCIA 2QUIA 2V6FA 4WQMA 4P31A 1Z0IA 3OIGA 5IHXA 1QHYA 1GKYA 2ZBEA 2ODTX 1P1KA 3ICOA 4G0NA 1K63A 4LV8B 3ZHUA 5LP6A 3UWKA 3W79A 4DV4B 1EI9A 1QYRA 2XUPA 4C03A 5DN9A 1OQAA 2A9RA 2VP5A 1RADA 2CJWB 2BZ1A 3GFOA 4B6GA 5D6NA 1ZL2A 4DEVA 4RAQA 1GZ4A 2WKRA 2PUAA 3R3UA 5CFOA 1FTGA 5JPDA 1TQ8A 1FP6A 1XJ5A 3A9RA 1SIBE 3WGTA 3COJA 3C3MA 3LXXA 4RK1A 3TFWA 2AUMA 4GGPA 4ARCA 5ALYA 1YDHA 2REOA 1SQ6A 4FKMA 4JQOA 1POWA 2ZUDA 2PGOA 3BWXA 4N54A 4XCXA 3LC7O 5ITVA 1MIOB 2W2NA 2AXPA 1O97D 1XMIA 1X9HA 3C48A 3FUCA 4UCFA 5H9VA 3UK6A 1DT3A 3WWOA 1OU0A 2EX1A 2WSYB 4CT0A 1CZKA 3EIFA 1N6NA 4MCJA 4YC7A 3WWYA 1FS5A 1W4ZA 3CHYA 5CVVA 4J2OA 3BD6A 3MVEA 4J1TA 5JNWA 1Y37A 1S4QA 3M2TA 5E3IA 1GJRA 1QLJA 4NBVA 5LQRA 4HAOA 2QMUA 3QA3E 1VCOA 3EPJA 2QX8A 3HKBA 3LXMA 1BD3A 4J6EA 3MRXA 3OEEA 3FOWA 1Q6YA 4RADA 2UXCB 3FM9A 2JJ2D 3GJ6A 4Q4LA 3FPJA 5A4DA 5CITA 4X62B 3LUCA 1OIVA 1U94A 2X15A 3FYHA 5DYGA 5SZIA 3ELUA 3TZCA 4PGMA 4RK0A 1OD6A 4J94A 2WPDA 1I7DA 3PHLA 2GCOA 2VRWA 2NTJA 1L4KA 1WZNA 4EJ2A 2Q4RA 3OZSA 3PTLA 3QEAZ 3T5MA 2FRVA 2OM2A 4FWIB 1JUDA 3B7WA 1JVNA 2OGUA 3GNQA 1JX6A 5B1DA 1ABFA 1E5VA 1RAAA 3VZRA 5A06A 4ZANA 5JTUA 5GADl 1TB4A 4DNOA 5GOTA 3AILA 2OP1A 3MC1A 4G8JA 5EZQA 1PO7A 2Q27A 3HKEB 2QRQA 4FLFA 3EFBA 1ZOPA 2PANA 2W6IA 1DQYA 1CW2B 3FHJA 5ER6A 1WVIA 4C0HA 1ISJA 3C7TA 4FC6A 4I4TF 3GLGE 3MIIA 1XG5A 2BUCA 2AI3A 1MD9A 1WMEA 4LXYA 3D2CA 1LK5A 1M2OB 2AN4A 2B20A 4EY5A 1P5HA 2Q2WA 2Q7XA 3IC5A 1M2EA 1Z4MA 1A4XA 4X20A 1T9GS 4L4YA 5C3MA 3O84A 1J0DA 2JGDA 3OEYA 1HSZA 1Z4KA 4NCIA 2IWRA 4F2HA 3G5TA 5G1OA 4BRWA 1JZTA 3BHIA 3RJTA 1C8VB 3L05A 4RTPA 2JEOA 5C34B 5HRUA 1L5HB 3LSYA 2CHVA 1CIPA 2EW2A 1KEPA 2D1SA 2YV1A 3PQ8A 4O4IB 4NZZA 5I45A 5CEJA 1CJTC 3PFBA 1YDMA 1KFEB 1JHQA 2OCXA 2ISCA 3L7AA 4UUNA 3M6WA 3T7JA 1CEEA 1PFWA 3S5UA 5LLDA 2HBQA 2I67A 2P5UA 4DDWA 3KRTA 2PH5A 3F3YA 4PANA 3QXJA 4YRLA 1TF5A 3WK8A 3Q9NA 4U2KA 4PLYA 1W73A 3IQFA 4H6PA 5ALPA 3KKOA 2X13A 4CMGA 1R3DA 3BD7A 1XL1A 4BEVA 2XWJI 5IM4A 1LWNA 4IRXA 1IY9A 3DS8A 3IIKA 3PUHA 2ZWMA 3ZDQA 5IXSA 2ZITA 3ZS8A 4E5NA 1U8UA 2OP0A 1I6KA 2H57A 1TM3E 1KJNA 1QVVA 2J31A 4ERNA 1ZM7A 2G4LA 2B4RO 4LHVA 4GMXA 4Q1DA 3K8YA 2WM2A 3AFIA 4E7PA 3NHRA 3RUHA 3U6KA 2CT8A 4Q7KA 2QS9A 1ZVQA 1KS9A 1O5OA 1TKCA 1O94D 1YA4A 4INZA 4LHSA 5GY7A 3KWJA 3AYXB 1RYEA 2CXHA 4AO8A 3PPVA 1Z4PX 2Q6IA 4L07A 3RG8A 1KAOA 3BT7A 2ZI5A 1EK5A 3QXGA 4QYIA 4YDHB 3RANA 4CHGA 2D06A 2X40A 1FC0A 4ZDIA 4YHHB 1U7HA 1MJGM 2NZVG 3SYTA 4AZTA 3G59A 3VSCA 4XQEA 1X80A 2R85A 3I34X 3TXXA 3I42A 4JI7B 1YCHA 3LO8A 1UAYA 3O1HB 5A3VA 5LU8A 1KVUA 2OV6A 4Y2RA 1WSBA 3IBFA 3UEOA 3VR5H 1ABEA 4D8XA 4M7RA 3H7AA 3I8XA 4OH7A 4BLVA 1TK9A 2E4XA 3K0FB 3Q5DA 3UJDA 3JQGA 3PZRA 5DW0A 2NU9A 2JFQA 2MCFA 4X65B 2WYHA 4LJ8A 4PYKA 4RANA 5AI5A 3FNIA 3P8ZA 5BV0A 2Y8EA 1E62A 1OLUB 2WP8J 4UEWA 1FYEA 1WL8A 5FWNA 3FYUB 4K1LA 3STVA 4V0LA 4IIVA 2JZOA 4NE7A 3UW1A 2SICE 3UH0A 3K0KA 3R0VA 4UVEA 3W4IA 1I5RA 1E2DA 3WJ7A 5DI3A 1R6XA 1N6PA 3BMOB 1WXGA 2C5SA 2G08A 1WHTA 3DDCA 3QFHA 1AKYA 4R0VA 1GQYA 2VAXA 2BBSA 3H9GA 3JQFA 2HO5A 2XVZA 2ZR9A 4TLMB 4N01A 1HURA 3F6SA 4IMRA 3RRZA 2FG6C 2GN6A 1Y6RA 5FUXA 4JR0A 3WA7A 3BFXA 3G0IA 4QQ8A 1SXJE 1CY1A 3R0JA 1FQWA 3AHEA 1U0BB 4OBWA 2GEKA 1N57A 1AF4A 2HYDA 4IG9A 1ACMA 3JASA 4D3ZA 4DR3B 3CH4B 4HWGA 2M1XA 3CG0A 4M0EA 1RXEA 1Z56C 3PRKE 4WY2A 4BRUA 5JR3A 1KY5A 1WEHA 3PC8A 1DADA 1W29A 2HI0A 3AP1A 4XB6B 4NDZA 5AP9A 1GU0A 3AF1A 2YV4A 3PUZA 5JMPA 3S99A 2DQKA 2WUWE 1SXQA 1AJEA 3P0RA 1P9LA 5TF4A 5I3CA 3CZMA 2L2QA 4CM6A 2D59A 1VJCA 1VGRA 2VYVA 4TRMA 4D5EA 1QG4A 3OG9A 2D0IA 4H6WA 1GFIA 1TTTA 3DH0A 1CE8A 1ZDMA 5CG2A 1PL6A 1ZAYA 1C9NA 3VR5D 1N8TA 1FTSA 4OYYA 3RUIA 4IQGA 4PQRA 3N8GA 4WLNA 1O4VA 3AUYA