2GN1A

Crystal structure of dimeric biodegradative threonine deaminase (tdcb) from salmonella typhimurium at 2.2a resolution (triclinic form with one dimer of tdcb in the asymmetric unit)
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
327
structure length
326
Chain Sequence
MASHITYDLPVAIEDILEAKKRLAGKIYKTGMPRSNYFSERCKGEIFLKFENMQRTGSFIRGAFNKLSSLTEAEKRKGVVACSAGNHAQGVSLSCAMLGIDGKVVMPKGAPKSKVAATCDYSAEVVLHGDNFNDTIAKVSEIVETEGRIFIPPYDDPKVIAGQGTIGLEIMEDLYDVDNVIVPIGGGGLIAGIAIAIKSINPTIKVIGVQAENVHGMAASYYTGEITTHRTTGTLADGCDVSRPGNLTYEIVRELVDDIVLVSEDEIRNSMIALIQRNKVITEGAGALACAALLSGKLDSHIQNRKTVSIISGGNIDLSRVSQITG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of Salmonella typhimurium biodegradative threonine deaminase and its complex with CMP provide structural insights into ligand-induced oligomerization and enzyme activation.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Lyase
molecule keywords Threonine dehydratase catabolic
total genus 118
structure length 326
sequence length 327
chains with identical sequence B
ec nomenclature ec 4.3.1.17: L-serine ammonia-lyase.
pdb deposition date 2006-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00291 PALP Pyridoxal-phosphate dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2gn1A01
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2gn1A02
4HO1X 3X43A 4AIRA 5D86A 3PC4A 2CLFB 1C29B 1F2DA 1WBJB 3CEPB 1TTPB 1J0BA 1M54A 1FCJA 5KZMB 2TYSB 2DH5A 1KFKB 2RKBA 2BHSA 4H27A 5I7AA 4HPJB 4D99A 2D1FA 2EFYA 1A5SB 5IW8A 1V71A 1KFCB 5B1IA 1J0EA 1J0CA 4L27A 5DW0A 4D9BA 1UIMA 4IL5A 2J9XB 5D84A 1PWHA 2ISQA 2JC3A 3SPXA 3TBHA 4D8WA 3L6RA 1V7CA 2CLLB 2WSYB 4NEGA 3V7NA 1WTCA 1K7EB 1Z7YA 5CVCA 3PR2B 4OREX 4L3VA 1KL7A 2GN0A 3DKIA 1KFJB 5CGQB 2Q3BA 4D92A 1TZ2A 1TDJA 1VE5A 5DW3A 2DH6A 5B3AA 3BM5A 1KFBB 4ZQCB 5C3UA 4D9NA 2CLKB 4F4FA 1JBQA 3L6CA 3L6BA 1J0DA 2CLMB 5DBHX 4LMAA 1P5JA 2ECQA 4JBNA 1VB3A 3FGPA 4JBLA 4OFXA 1CX9B 5B55A 1CW2B 4HN4B 1BKSB 4Y6GB 1FUYB 5B53A 2EGUA 3R0ZA 3FCAA 2RH9B 2CLHB 1K3UB 1VE1A 3AEXA 4D8TA 3PC3A 4L28A 5IXJA 5E0KB 1BEUB 2CLOB 2O2JA 4D9KA 4D9FA 4PCUA 4D96A 1C9DB 2GN1A 5HBGA 2TRSB 5JJCA 5B36A 3SS9X 1TZJA 3VSDA 2Q3DA 1WDWB 1X1QA 3X44A 3RR2A 2CLEB 3IQIX 4NU8X 2CLIB 1C8VB 5EY5B 4D8UA 1TYZA 2J9ZB 1TZKA 5D87A 3ZEIA 1WKVA 5KINB 1O58A 2V03A 4D9GA 3SS7X 4ZU6X 5IWCA 1K8ZB 4ZU1X 4I1YA 1QOPB 2C2GA 2ECOA 4XUGB 3PC2A 4LMBA 4D9CA 5JISA 1A50B 1K8YB 3DWGA 3VSCA 2RHGB 1PWEA 2ZPUA 4QYSA 5B1HA 3VSAA 1K7XB 3IQHX 4D97A 3T4PA 4D9MA 3AEYA 3VBEA 2J9YB 1E5XA 5I7HA 1Z7WA 1A5BB 1QOQB 3IQGX 5D85A 1V8ZA 2GN2A 4L0DA 5I7RA 1J0AA 1Y7LA 3R0XA 1TJPB 4LI3X 3VC3A 5J43A 5I7OA 3HMKA 2ZR8A 1UBSB 1TZMA 5BW6B 4COOA 5DVZA 5I7WA 2O2EA 3IAUA 1K7FB 2TSYB 4HT3B 3DWIA 4WX2B 5I6DA 1TTQB 4HPXB 2ZSJA 1K8XB 1D6SA 1KFEB 1UINA 2Q3CA 4KKXB 5J5VA 2C2BA 1RQXA 4D9EA 2PQMA 4AECA 1A5AB 1OASA 4D9IA 5DBEX 5T6MA 2BHTA
chains in the Genus database with same CATH superfamily
1R0RE 4M54A 2R7NA 2I7TA 2Z2XA 4DPKA 2PWPA 2I7CA 2EX0A 1HLDA 3OU7A 3FUCA 2ZTVA 3IAS6 4HQRA 2ZYWX 1MAUA 3CEPB 4JEMA 4Q9HA 5K2MA 4IIGA 1XZHA 4YT4A 1C80A 1EK1A 2AF3C 4NYJQ 2O1WA 5KKCA 4YRNA 2E5WA 1ZA2A 4KIWA 3X1XA 1A5SB 1UBCA 5KYYA 3Q6NA 9ATCA 4F3TA 5DW0A 1ZNWA 2X23A 3HR7A 1EFHA 1AG9A 2QLNA 3X1WA 4N49A 2DHCA 3E23A 4GI3A 5D00A 1GAXA 4P2GA 4IJWA 2GM3A 5TVGA 3I2YX 2W70A 3VJMA 5BMOA 2MU1A 1PW5A 1SGWA 2F17A 1C3VA 2A94A 2ZAYA 1M1ZA 4Y9RA 4ZRDA 4BNJA 1R12A 4M36A 4YCSA 1HKHA 2P4EA 1QBKC 1DU4A 1WCYA 3RSSA 3VGJA 2Y4OA 4LSWA 4WIAA 5KYXB 3VNUA 3A9TA 4J2TA 1XNGA 4Z9XA 1V8OA 3NJ8A 4GX0A 1PJ2A 2IYVA 4L0MA 3NV9A 1IM5A 4MQEB 1QRSA 3B1ZA 4OI0A 4NBRA 3AR8A 4CDNA 5ADHA 1GPAA 4TMFA 3DAYA 3ABIA 1HGXA 2IOYA 1ORDA 5BOSB 1ENYA 2HDOA 1VKNA 3IEUA 5LQAA 3QEAZ 3ETGA 2QM0A 5BVHA 2JNWA 4D0GA 4POAA 1YVRA 2UYGA 2VTEA 1B8PA 1YJAA 2C9MA 1J2TA 2FB9A 1LEHA 3MBIA 4LRXA 4RSHA 4TUYF 1T36B 5CM2Z 3C45A 3UJ7A 4IMPA 1AKNA 1YTUA 1XX6A 3CT6A 1V5FA 4IHJF 3F96A 1R5JA 1JUDA 1U9CA 1Z5GA 2IRWA 3MB8A 2AC2A 3H8SA 2EU8A 3WE7A 5AW3A 1L8QA 1VL1A 2B82A 3ZEIA 3ADCA 3KBOA 1B6SA 1W2HA 3HN6A 5K9ZA 3LC2O 4W9RA 1FFGA 2YHIB 3KOOA 4NNPA 2OV1A 4Q3BA 1P19A 1ODKA 3K0CC 3GEEA 3K0FA 2QYOA 4KFSA 2QP9X 3WO1A 3QKUA 1B2LA 2WWTA 1KH2A 3SOZA 2YN4A 3E84A 1IUKA 1SVOA 4FU0A 3WQQA 4ESVA 3F2IA 3T7CA 3V8QA 5A9SA 3A4NA 5AVRA 2IOHA 3AR7A 3DZJA 3G9TA 2C20A 1W4RA 2OKGA 2ORIA 2QEQA 3LHIA 4EZBA 3K70D 2EEZA 5T4EA 2D59A 4I5FA 1J2UA 1DLJA 4HRVA 4X90A 4E31A 4YUZA 1DAGA 5B3JC 1KWGA 1W0KA 5FUVA 3H11B 4ZT5A 2A58A 1XTTA 4H3VA 4NSNA 4EABA 1FQWA 1KS9A 4BL5A 4HNQA 2O2EA 2ZRGA 5DRYA 1CR4A 4L9AA 5IYZB 2BH2A 1J00A 3SYNA 1TCUA 4WFQA 2BW0A 4FYMA 5L9AA 3A3PA 3NB0A 1KQPA 1N5IA 5ESXA 3FHJA 1ZCBA 2O7RA 3E7PA 1Q0UA 2A1UA 3QTBA 3RPEA 5JDCA 2FOXA 3BSYA 4REMA 3JPYA 1FSZA 1BYUA 2WFLA 3DVQX 3OE7A 1S3GA 4RV9A 5AKXA 5DO9A 5FRDA 1QFMA 1YSCA 2DZDA 2GRUA 2JH8A 4TSFD 3LXRA 1CD5A 1ZDMA 5DBEX 3P20A 2WWYA 1VZ2A 4FUTA 1GTZA 4OB7A 1GQ2A 1VM6A 3KKNA 2I2CA 1P18A 2Q41A 2E87A 3KR2A 4ENRA 1LSOA 1G18A 5DCUA 2JGFA 4ZI7A 1I4DD 3K35A 2YJ5A 1SB9A 3N5CA 2VP5A 1GRNA 1UBKS 2KBFA 1DO2A 4LRUA 3QLTA 3OHPA 2HQ1A 4U0KA 4IFEA 5GY7A 4ER7A 1E6LA 3GDOA 2GB4A 1OXVA 4V39A 4G23A 4WOPA 1YI8A 3ROZA 3V4PB 1LNSA 3UJHA 5LB4A 4HQNA 1EDEA 1VSVA 2MSWA 3DF9A 4REOA 4A6EA 4FX2A 1X9IA 2A5GA 5E6SB 1NY5A 5LWHA 4BEVA 2HJSA 4DYDA 3TBHA 2C8LA 1S7CA 3I62A 3WLFA 3RVOA 1WUIS 1IHDA 1Y82A 1VP9A 1SIWA 3VO8A 2BE9A 3I01A 3N0WA 3MSCA 4FJ1A 1OY1A 1U6JA 3B6JA 1N6IA 1QH0A 4QPZA 1E1CA 2P1ZA 4Z8YA 4TN5A 2PD4A 2WWWA 3NHRA 3Q3EA 3QLJA 4IOMA 4NVRA 3ZU6A 2IZ7A 3BM5A 5JAMA 1QZUA 5KU7A 2YOGA 4W9NA 4GBJA 4LSZA 1TQ4A 3CJRA 3R7FA 1SOWA 4MDHA 1CJKC 2R1TA 2IELA 2WW8A 3B20A 3BJIC 4YB8A 3RJ5A 4UPEA 5EJ4A 5EKSA 4U7HA 4JI3B 3T1VA 3EF1A 2FUNB 3RS0A 2X8LA 3LMKA 3ZDZB 5F3WB 1HYBA 2QZ9A 2ZSHA 3NHWA 4Q1BA 4RPIA 3KJIA 2BMFA 5DYWA 4Q4JA 2BFFA 1A5ZA 1SULA 1YB5A 2NYAA 4BZXA 1OZHA 1YUBA 2Q7XA 4JP3A 1GT91 4GYWA 4M0CA 2CVFA 221PA 4ZYWA 1GSIA 2ZSUA 1RU3A 3TZHA 2JLSA 3AIOA 1EFUA 4XPZA 5I9SA 4QT4A 4JDUA 1DX6A 2RGBA 4DYVA 3PEEA 4GPEA 1ZN9A 2J9RA 4UNPA 1AC5A 1IUOA 5EKTA 5C8ZA 1A69A 3N2YA 1XEFA 5KNBH 2O1XA 3DFMA 2ZXUA 1B8NA 4CIVA 2D13A 2CC2A 2CZCA 3AUYA 3Q7RA 3NAGA 3VR4D 3ZE0B 4D0SA 1WZNA 2F1RA 3LY5A 3VDRA 4EW2A 1F9EA 3DNFA 1G5RA 3ZE8A 2QTZA 4XWWA 3O5AA 1GZ6A 5HRUA 2RD2A 1J0XO 1NNEA 2R6ZA 2QI9C 2Y6UA 4HDNA 1DJQA 2VSQA 4PICA 4FYYA 3N5KA 4JR0A 3ZWVA 1T0UA 2OG2A 3NHKA 2BE7A 5FTMA 1QF7A 5FUMA 4HBGA 4TUYA 3ISVA 2VS1A 4EATA 2RKWA 2RHOA 1K7CA 3T1OA 2Y66A 2WUFA 3TW6A 3ZGOA 2XADA 1L4EA 3A1DA 4DBZA 4B17A 3RFTA 4TTSA 2QM7A 1Z6XA 4HJRA 3GEIA 4BAUA 4QG7A 5MGNA 3BGWA 4AIIA 1XROA 2ZW9A 2J59A 3F4BA 3RKRA 5C9ZA 4GUAA 2NIPA 1WDLA 4B6OA 3N28A 1N3YA 2K4MA 3R3YA 3AKDA 2A0UA 4O4IA 1PE0A 2C2BA 1ZLYA 5FWYB 3OZVA 2P3SA 3EPLA 4IPTA 4I8IA 4TVSA 6PFKA 1JWLA 2ZRIA 1QHYA 3MSXA 2ZJ5A 5I9LA 5LXTB 5SZIA 3UFXA 3ZNQA 1P2UA 3ICVA 5JMWA 1IJEA 2R0QC 3GDFA 1D2MA 2B1RA 4BRZA 1RWXA 5TPWB 5K01A 4DC0A 2QTTA 4TSRA 5KZMB 1GGVA 3HY6A 3JYLA 2L42A 4MWSA 2PZLA 1V5EA 4L6CA 1LKZA 1VFPA 4WKOA 1FRFS 4BNXA 2IC5A 3ZE1B 4G8CA 5EEHA 1FY2A 4FW8A 2QLJA 4WN9B 3TK1A 1WB9A 3B3AA 3MAJA 4LNHA 5TQ0A 5ENZA 1SU6A 5JS7A 3FHTA 3RC8A 4HQ0A 4IX9A 5CK4A 1L4HA 3KJNA 4HEA6 2EFDB 1HUQA 1U1CA 4WGFA 5I9NA 5AW5A 4CLRA 2GPTA 3ILVA 1GLNA 4X9XA 1A0OA 1IU9A 2GN0A 2Y1LA 4GRAA 2WFMA 5BOVA 2LCIA 2HHAA 2VHUA 1ADBA 1Y3IA 4JAVC 2IEDA 1MO3A 5CA1F 2G5CA 1A9RA 1SB8A 1KEEA 4YRJA 1Z22A 3AFGA 3NP7A 3KVRA 3ZE2B 5IN4A 1M6NA 3R9KA 4XFJA 4P3OA 3L0SA 4F7WA 4KRYA 4CBVA 4F7DA 2QSJA 1DAEA 2BFFB 1H6DA 5DB4A 4OFXA 4MUKA 3CSDA 2V6BA 1CULC 1O94A 2F90A 2FN3A 3GLIE 2C7VA 1EJ2A 4ES6A 2WAXA 4J7UA 4NMHA 3T3DA 3V1TC 4RTRA 3QWHA 3D0QA 1XZ8A 4JGIA 3AT1A 4OJNA 5DGTA 1Z2AA 4P5PA 4UUMA 4CL3A 2Q4OA 1GZ4A 3EC7A 4PCUA 2PH1A 5ANRB 1KF0A 3BGVA 3A1TA 4DRZA 1QK5A 3T4UA 1X1QA 2FG5A 1XHEA 1NOKA 4IGIA 3WGMA 4W7IA 5HKKD 5ALMA 1QLJA 3P8ZA 1E2MA 4IWYA 4MRAA 5CUQA 5GGXA 4LWOA 1F3OA 3NC1C 1F38A 4RPKA 2JEZA 3CPEA 4G26A 4C2BA 1RT9A 3WS7A 2VEDA 3WQRA 2HW8A 3CNLA 4L8GA 3OQ1A 1RPJA 4XQ9A 1OF1A 1DKRA 1PR4A 3SKYA 1Z36A 1QS0B 1T36A 4GBGA 1GITA 5CH3A 3W5CA 2I76A 2JPDA 2HT6A 3H42B 3A36A 3PWZA 1HDIA 2BMVA 5H68A 3W1WA 4C20A 4CIDA 2BFAA 3GU3A 5I3ZA 2HLDD 1U2DC 2X0NA 4DPMA 3HXLA 2GCNA 4B3RB 3N2KB 2X0RA 2C83A 3PHBE 5AI8A 3ORHA 1PR2A 3F3YA 5DM4A 5JNUA 3Q5DA 1IBKB 3Q3JB 1N8TA 1E92A 4J9VA 3MUOA 4M1TA 4XPIA 5JALA 1NVEA 3N05A 4MR9B 3ZLVA 5FX2A 2KWIA 2QAGC 1Q0TA 1W87A 2X7JA 3LCMA 2V1UA 4KV7A 1A1VA 5K6AC 1FFXB 3JASA 4NENB 2G63A 3OIDA 3DV0A 4WW0A 1C4XA 4TLEA 1MRZA 5JQGF 1UC5B 3K9NA 5DXJA 3K9GA 1IEXA 3VYUB 2II6A 4KIUA 4UUNA 2B1QA 1NUHA 3I2JA 1OWLA 1JB1A 3CUVA 3ITDA 4AF8A 1JIQA 2Q1WA 3GUZA 2IYAA 5B7NA 4LYFA 4IHJB 1GUFA 3T3IA 2HXGA 1RC1A 1ZL0A 2FMHA 1F4VA 1M1NB 2QR3A 2Y9MB 3BB3A 3HXKA 1JR4A 3IAM1 3V8MA 3ZHYA 4Z4HA 2ZYIA 5JAOA 4EY5A 3MWGA 1AUPA 1XPRA 2ZI3A 4FT4A 1SQ6A 1CZNA 2FRDC 3R44A 1VPWA 3FTEA 1GQFA 1XB2A 2IDJA 2XVMA 4E5VA 5HQ3B 3I6MA 3DSRA 4TKMA 5C35A 5ICCA 1T6BY 3EYWA 2IWHA 2HLNA 4WSOA 3RUAA 4BNIA 4TGLA 1FNCA 3R6DA 1H2RS 1YS7A 2YL2A 2Q5CA 1BCSA 3D3EA 3DZ8A 3OKCA 1WP4A 1WCWA 4H35A 5C8DA 4OJTA 2VCHA 4B2IA 1U8AA 3G6KA 3L9XA 2MMGA 4AK9A 2EP7A 5EE5B 1P0IA 2I03A 5LA6B 4DCGA 1KFJB 4O4JA 1HXHA 4MTCA 5B7GA 1MW9X 4EQZA 4QXMA 1WHTA 3T5MA 5KQRA 4R16A 3L4SO 2YW9A 2HCJB 3HB4X 1MZPA 1EJ6A 3W3AA 1NXQA 4QATA 4RQBA 4UBKA 3C8MA 4JI6B 1QIKA 1UM8A 2YH2A 3MW8A 4FXPA 1YBMA 2OV3A 1Z4OA 4E15A 3Q6MA 4BV9A 5DCLA 5J2UB 2PUCA 1V7PC 4DCCA 1T8RA 1XZNA 2BGJA 5TNXA 1VXOA 1WULS 1NYTA 3CJTA 3I3SR 3MPOA 4AWXA 2ZCJA 1A9ZA 4M9ZA 5JZSA 1L4UA 3HB1A 3OZCA 1H0KA 3EXG1 3PHIA 2R7LA 2PBRA 2VNIA 4YRDA 5YASA 4AZ0B 5KVSA 1YQUA 4MVJP 2LVBA 1A9XA 4PR0A 4BKQA 1FTGA 2F1IA 1NV8A 3P97A 3O95A 3I5UA 1HMYA 2J9ZB 2P2YA 2CHUA 2X1HA 2XCLA 3L1UA 4QAJA 1LI4A 4XYMA 5HQJA 3PJDA 4BNTA 2JBHA 3OEHD 3R7LA 3IPCA 2CFCA 3KTAB 1AB6A 2FJ0A 1X3LA 5A6SB 3SF8A 4GGMX 2QP3A 2PGAA 3STUA 1NN3A 2XUOA 1B4DA 1J56A 2YHBA 1W1WA 1RXWA 3UK7A 5HOEA 4CF7A 3ZTTA 3SWWA 3EXFA 1RRKA 4RD1A 2G67A 2ONKA 4D5EA 5CIYA 4DB2A 1BVHA 1OT5A 1Z08A 3IC5A 1KZ6A 3GELA 3SMVA 4YRKA 1CQIB 3NCTA 2HMAA 4Q4AA 1ZNQO 2BJVA 3A1CA 1R9NA 4QZVA 4YO8A 4LF6B 1EP3B 1R0YA 1RHRA 1OLXA 1B43A 2B0CA 2W2LA 2FEWB 2DHQA 2BC9A 2YINC 3GYGA 4L9WA 4TXMA 4ZVMA 3V9AA 2XCQA 1KI9A 1DRKA 1WP9A 4QEZA 1ONBA 5IUNC 2IIVA 3OWHA 1JGTA 1PR9A 3MD9A 1E98A 4HRXA 4NBNA 2XDWA 1IBLB 2G8NA 2XMQA 4J0CA 1X7XA 2G6TA 1H0RA 1ZMTA 3LYLA 3OCZA 3AP2A 4K5QA 4MA5A 2WU3A 1RRMA 3OM0A 4RCYA 2QGNA 4V3BA 1MA3A 2C3YA 2I55A 1OLXB 2WIBA 1Q44A 5ALHA 2TS1A 1I13A 3TTXA 4DCOA 4WAUA 1JXMA 1L5OA 1ENZA 2NOAA 1RAGA 4JCCA 4LUCA 4DEVA 1GG2A 1B3BA 2HF8A 3C24A 4W5HA 1GGKA 1NUUA 2D8MA 1R74A 5AKEA 3AHHA 2JCXA 4WLFA 1JL3A 3C70A 2JJ2A 3B7PA 3UW1A 3T9AA 4ARAA 4KGDA 2J31A 3IT0A 2R8BA 2FSHA 4MS1A 2WQ6A 4DM7A 4INJA 4IJMA 1JAZA 2H18A 4QYIA 4H27A 5K3FB 2SKEA 1H22A 2Q21A 5D7NA 1XZAA 5HG0A 5TMDA 3RU7A 4X8MA 5EFOA 1RLOA 1E7QA 3I0ZA 4JXJA 2WZDA 1O6GA 2AW3A 1DELA 2VYFA 1F2VA 3LKBA 4MI3A 1JDPA 4QULA 3X2SA 4CUKA 4UTVA 3OZTA 1W5FA 1S8NA 2FWIA 4DR6B 2Q6OA 4HAOA 1GFIA 4D7AA 4E21A 3TWOA 3EY4A 3GLGE 2XTJA 5DK6A 3T6KA 5C80A 1QXSA 3D54D 1E4OA 4R9SA 4JI7B 3KLNA 8AT1A 4LMRA 4TL9A 4WMLA 1DAOA 1E1DA 4QYIB 3I5MA 4F06A 2J07A 4CKWA 2C2HA 4N9WA 1DZ3A 2GM9A 3A4YA 5LN1A 2NACA 1DC8A 3WL8A 4KGZA 5IJZA 4N9QA 4XVRA 5FT9A 4BUJA 2AWNA 3PHHA 2Y92A 1H4VB 2AJLI 1A27A 5B53A 1U99A 2HIMA 3DB1A 5MGBA 1BIFA 1AQUA 1JFRA 2V6IA 2HH9A 2MDTA 5COAA 3WMFA 2O3JA 2G9UA 2P5YA 1ZQ1A 1EGAA 4V2IA 2C95A 2ERCA 3I2GA 3JVEA 4DJDC 5JRJA 3PFCA 1KAGA 2IQIA 1YFZA 3B48A 1BGWA 3FVQA 3LVQE 4NICA 4Q9KA 1T9ZA 3K71B 3VHXA 5BNWA 3AZQA 1GD1O 1ORTA 2CSUA 4KGXA 2X7XA 5IAJA 4EW6A 1CEEA 1BHQ1 1BE0A 5ALZA 2FFQA 5AUQA 2F55A 1CQPA 5D87A 1NLFA 4WY2A 2AKYA 2BDEA 3FPBA 3ZWPA 4QDZA 1ECCA 2SBTA 3KSUA 4N8EA 5ESDA 2JI6A 1ZIYA 3LRPA 4INOA 3ZWXA 3OJEA 1E62A 2IVZA 2DUJA 4RFLA 3T3GA 3AUKA 2C42A 3WBJA 2OV6A 4Q66C 4XCVA 3TEMA 4C78A 3TECE 4YJKA 1I5OA 3H9JA 4KK4A 1QQBA 4RL4A 1RMYA 3ONNA 3UJ9A 2G04A 4D8YA 5F9FA 5CB4B 3K5HA 1SCJA 3DJFA 4K6MA 1YZHA 3PEFA 2HHLA 2QMOA 4AY4A 3M5CA 3PDWA 1KERA 1J49A 5LOVF 1M7HA 4FGUA 2EQAA 4QBTA 1LW7A 3TZEA 3AW8A 5D85A 4WOJA 1O5TA 2JGLA 4ZAVA 4Z0HO 3T5DA 1SKMA 3HBAA 5DX8A 3QXHA 4JLAA 2UUBB 4MCJA 2IPLA 1LH0A 2H16A 3JQ8A 3FTNA 3GLSA 2R8RA 3HJTA 2NVUA 4FD2A 2C2OA 3KEGA 2ZSBA 3EGXB 1C7RA 1UINA 4O1MA 1W2WB 1HZZA 2VHYA 3D7RA 2ZI5A 3LT5A 1AUVA 2EHDA 4ARSA 4L08A 1RKQA 2ZYUX 3HJRA 2AXPA 1BGXT 3AUFA 3FJYA 4WRRA 2B35A 3HKBB 3SKVA 2R44A 4FHEA 1EK5A 1N2OA 3T7RA 2C5GA 5BSGA 1DMSA 4LF9B 2H1IA 4Z4EA 2P9BA 2R2GA 3SJCA 2YC2C 1UBFA 4CEIB 3IDQA 3WI7A 4XYLA 1Z0KA 4EI7A 1ID8A 2XE7A 3ZG6A 1FNSA 5IVKA 1V5GA 4M9CA 1ZSYA 2UYQA 1MVNA 3QVGB 4Y2XA 2NZJA 4LTDA 1ZD2P 5DP2A 3IEMA 3EEOA 1MVOA 1R50A 4ITUA 4RS3A 5ALGA 1F6DA 2IHBA 1N3BA 3G17A 4TKVB 4F1WA 1EH5A 1JE1A 2QX8A 3L9WA 4ARBA 1ULSA 3OHSX 3THOA 1BNCA 1PS9A 4B8YA 1BMFA 1VHLA 2GMWA 2JFQA 2YJZA 5IT9A 4L16A 4YRLA 2FU5C 4OATA 4ER0A 5JXWA 5EJ9A 2PVCA 5BR1A 2C4NA 1KMQA 2KS6A 3WQBA 3V55A 2NO5A 4NG4A 3O74A 3EZFA 5FL7D 4D0LB 4EYOA 4YV2A 3GJ5A 1W46A 3I8OA 4HVAA 4P7KA 3LK7A 3OX2A 4B4OA 1AURA 3TQQA 5I4IA 4YQYA 4ZI3A 4EBBA 4ITVA 3W5DA 1BVUA 2PH5A 2R7AA 1JKJA 2G77B 2GPYA 1WPXA 2ETXA 4IIEA 4HGOA 3HBMA 3U3ZA 1V4NA 1YBAA 3OM9A 1JTFA 1HFJA 4AG5A 1R0CA 1WZ2A 1VE6A 1J20A 2ZIXB 1YQ9A 3SZRA 2GARA 3PUZA 3PL1A 1HEYA 1K3UB 2JFUA 3G2JA 3IT2A 3GGPA 2MINB 5AXDA 4LWZA 4CV2A 4DA6A 2ZTSA 2ODAA 5KEIA 1NVGA 4MK4A 5KUTA 2WICA 1Z2CA 2QTCA 1Q95A 1W9HA 3IUYA 2QT1A 3MT7A 2JIBA 5FNZA 1Z4LA 3KJQA 5H3HA 4RACA 2J30A 5JY6A 4NCBA 2JFFA 4IVPA 2O1EA 3ZTYA 2DUWA 3PQ4A 4G8JA 3GFVA 4LJ4A 4EFLA 2WWVD 5KNDA 2CLIB 2IW1A 1S4QA 1F2TB 1IHXA 2O7VA 2HQOA 2R25B 2H9YA 2RHRA 4JSTA 3CW2A 1JG6A 1P72A 1T9DA 2AKAB 2W6IA 4K9DA 4MMYB 3PRJA 5HP4A 3L0YA 2ZBGA 1S01A 5GONA 1UOPA 1EP2B 1T34A 1CT9A 4HUTA 1OIWA 1XEXB 1HPLA 4FR2A 4X6XA 3RSHA 3BCHA 3CONA 4ODIA 2J3QA 2RJOA 1GG5A 3H2HA 5AKKA 3ODPA 3E8MA 3OO0A 3W4JA 3R8FA 2PJUA 4RYDA 3H4IA 3OMLA 4C21A 3R6LA 2DKOA 1YJQA 3FNHA 2RGGA 3IE1A 3LXXA 4PLCA 5DLDA 3L43A 3TAUA 2NO0A 3N8GA 4RDXA 2XD9A 3M9XA 3C8UA 3NNNA 4C3VA 4QG3A 4C0KA 4DDHA 5DIZA 3K4PA 3KPVA 4XI9A 3OP1A 2IH2A 2C2WA 1PLJA 3QMWA 2ZPAA 1R7RA 1P0MA 1MQ9A 1RYDA 3AF0A 3PKZA 4ONEA 3KYDA 4NBSA 4LYYA 3C7KA 3F4KA 4M6WB 1A8UA 5HJ7A 3X1DA 5BR4A 3OTHA 3BRQA 3STWA 4MI9A 2HSEA 3KVOA 3KXIA 1Z13A 1YNSA 3PDUA 2YDYA 2HM7A 1RYYA 4JGGA 1WXIA 2GPBA 2VSOA 3HU1A 4OGLA 4XKJA 1RBQA 1YZYA 4PIMA 3UAWA 4WCFA 2XUPA 3JAWA 5L7YA 4REQA 4OP2A 4Y1RB 4L95C 4F5EA 4LCJA 1WHTB 4KXUA 1KI4A 2H5LA 4IIXA 1KA9H 2PU5A 2VPXA 1CVIA 4C0LA 3NHPA 1XYVA 5LQUA 2YS7A 4ZCTA 1AUXA 1AX9A 5HKLA 3R4CA 4RXTA 2GYUA 1O97D 3I09A 4OXQA 3D6AA 4C7KA 5EWLB 1WCIB 3SNKA 1UPCA 2DWOA 1TVKA 1NX9A 2Z4TA 1LSSA 1WUTA 2FLWA 4NONA 2CFTA 2LBPA 2OMEA 4TVOA 1FFAA 2YHUA 4J1SA 1EFRA 1DOHA 4H16A 1J25A 1XN1A 1JLKA 1UBOS 2QLLA 5AXAA 4OV6B 4WXMA 2VHQA 1MTZA 4RETA 3I28A 2P41A 2VRNA 5DP1A 3RYTC 3KSBC 4EJSB 4L85A 1PJ4A 3KNZA 3IR7A 5IG2A 2MIIA 2MSKA 2PAAA 2QQEA 2YWEA 3GJXC 2BGIA 3W1EA 2GYWA 1PD0A 4GPZA 1BDHA 1K98A 4GD3Q 4FI3F 3ZCQA 1KK2A 1OKKA 1TYEB 2JDIA 2WV9A 4GP7A 5FL7A 2VWQA 2JA2A 3R0JA 5EMMA 3DH0A 2XVZA 3A1NA 5F5XA 5DM60 4J76A 1H1TA 1PR0A 1RWOA 3D6UA 5E6RB 5CLJA 1NWCA 1OT3A 3KKPA 1R4MB 3O90A 4D3XA 1FLVA 2E21A 4RHFA 3WHIA 3ER9A 3WLOA 5EIOA 3GFFA 3ZCXA 2Q07A 1I30A 1L5FA 1LJLA 3O38A 1GILA 1W4AA 3QVOA 4ATNA 3QOFA 4UDNA 1L7MA 2XWQA 1QLHA 5ELXA 3MEQA 3IV9A 4QLBA 2RI6A 5AI0A 2GD1O 3CVYA 2NU6A 5KTNA 1T4BA 2P91A 3B36A 3Q3VA 1IEVA 5E3HA 1Y3BE 4CL8A 4EZEA 3ZVNA 2J4CA 3B9PA 3NYRA 4AU1A 1QIJA 1O94C 5T5QA 3HNRA 3ZTWA 3LA6A 5ALVA 2QMUA 2WA2A 3K9BA 4AN4A 3JQCA 3OLZA 3U61B 2BDUA 4JZKA 1E2BA 3MLAA 1IUNA 2VQFB 4FM9A 3DOCA 1LV8A 3CYFA 4MVXA 1Z15A 3PD1A 2MR6A 4QPJC 2Z83A 4MKHA 3Q8WA 3C6BA 1JPUA 1ULHA 4UU8A 5A02A 1VG9B 3IT1A 1CERA 1DC7A 2JFZA 2ONZA 4QGAA 1J7JA 2H85A 4S04A 2C3PA 3UA3A 2ZUWA 3LYUA 1Z7WA 3AOEA 4B4VA 4D6YA 1CYEA 4HDNB 3AKCA 3AVYA 1J06A 1MRNA 3OLYA 1XRSB 2O14A 4MB6A 5LBUA 4DQDA 5G41A 1KI8A 5EWMB 4LJ7A 4EECA 5KBYA 1NMSA 1JG1A 2O5CA 3NW9A 2NV6A 2A0YA 2UUCB 2Y93A 1HNNA 3U4HA 3UJPA 3OQMA 2IYQA 2I8LA 2J85A 4AJ2A 1KAQA 3EXFB 4QBIA 1E94E 3O8NA 4REQB 1YV9A 2DHDA 1AHHA 1ISSA 4D4KA 1MJFA 1G7RA 3MTJA 3BGIA 3ONWA 1M6VB 2QG9A 3MOGA 2H5IA 2WRZA 4GGOA 3SM3A 5JJBA 4G1BA 1RJWA 1V1JA 4HEJA 4IZ6A 1QFZA 2B4QA 4OHMA 2NO7A 3KB1A 3MWEB 5ES4B 5KX5F 2D5BA 3IERA 2X4GA 3EGIA 4XVCA 2EFCB 4NZPA 1LTQA 1Y8RA 2ANBA 1HE5A 2Y0CA 3IIJA 3PFFA 2P4SA 3DBIA 5TEWA 3TPFA 3GPLA 1W6UA 3WAJA 3W34A 1T9HA 4TRRA 1JHRA 1OWOA 2WF7A 3NDPA 3IEIA 4K2HA 2G6BA 3KZOA 1Y98A 5EHIA 5HFJA 3RJTA 4I4TF 3VVBA 5KQSA 3TLYA 4Z4GA 2J9XB 6Q21A 4MARA 1JB9A 1NBIA 1U0SY 2ZJ2A 3PUIA 5TEVA 4TL8A 5EHGA 3K0KA 3P0HA 3TX2A 3V7WA 4QGSA 4DR7B 3AP1A 3F98A 3JYQA 2NXNA 4N3NA 3QY0A 2GN8A 2BEUB 1K7EB 3GJYA 3O31A 3P0EA 3PGVA 4OL0A 4U39A 1MRSA 2WYOA 4Q1AA 2QRLA 2UXDB 3DO8A 3VO9A 2VAPA 2JFGA 5BQ3A 1SK9A 2G08A 3H1FA 4RVHA 1L5KA 4BNUA 4X20A 1O03A 2XDQA 3KL4A 3ZJVA 2PTHA 1TM4E 2BIFA 4DXHA 4C01A 4KO3S 2WAYA 3HBJA 1T3HA 2QD2A 1FW8A 3CH5A 4EHKA 4CM8B 4AZVA 1SO8A 1IN8A 3H75A 1E3DA 1NBHA 3V1NA 5CFZA 1RQNA 4NMLA 5JW6A 1XGKA 4XUDA 1XKLA 4OSPA 2QENA 4KSYA 3UANA 5JHHB 1ETUA 1CHDA 2O2JA 1RLUA 3HFRA 4MQEA 2HCTA 2MYUA 3HB7A 1CUCA 3ROXA 4BMXA 5KDDA 5JJCA 4ZTUB 3WRXC 4YJFA 1PZMA 2WUEA 3T7IA 1WM1A 3BXFA 5ALNA 1NI3A 3IQIX 2W90A 3F78A 2QJRA 1OHHA 1C8VB 2V0NA 3HWX1 1WY5A 1RCTE 1ZPDA 3GRCA 3P32A 1V0JA 4XIFA 2ATCA 4F2HA 2GPWA 2XB9A 4TUYB 4BNKA 5HUHA 2E6UX 4DUGD 1UBLS 3EXIB 3RTGA 2D0PB 1PV1A 1U2RA 2RKOA 4QECA 1G7TA 1ZSNA 4WL0A 3K1ZA 4CT5A 4ND8A 1DQRA 4WESB 1ZHOA 3GVPA 3UZUA 3O8OA 4QUAA 2Y2VA 1KMCA 3DV0B 3LKDA 3UK1A 2OAP1 4CMIB 2VXOA 1D1SA 1XTPA 3FNQA 3II6X 4JODA 1E2DA 3KZCA 2C9OA 1PTKA 2VBCA 4HMPA 3K70B 5EZYF 4HQFA 2DHRA 2IYRA 5B1DA 5DRTA 1Q16A 1E5TA 4D1YA 1BS1A 2OZKA 3T3MB 2AZMA 1BCRA 1EX6A 2XZPA 2ZRNA 1U90A 2BZSA 4F6RB 4AKHA 1FRQA 5JO9A 8ATCA 1P7YA 1CY0A 4NL4H 3T1TA 3BOSA 3MPUA 4V2UA 4COOA 3IV6A 1V48A 1AV7A 5COBA 2BFCA 2EKBA 1JDBB 4P4NA 2XZDA 3QW4B 2G0AA 1WLSA 4FDLA 1WMDA 1C3EA 4GM4A 3ZXXA 5IF3A 1SA0B 2AD1A 3L6DA 4KOAA 4EG3A 4FE7A 2VSNA 2EVWX 4EGQA 1D5WA 5KAMA 2C5SA 2BMJA 1NSTA 2XLCA 1L5HB 3QI7A 4UXJA 1S2IA 5H4HA 4QJ4A 1QQAA 2I4NA 2O6LA 3MGCA 1CU1A 2CCJA 3VTZA 5K8CA 1AA6A 1XMIA 9GPBA 3NH9A 4A27A 1WDMA 1YL5A 2PUEA 2HZBA 3VKVA 1AQYA 1C29B 1PEKE 2CLSA 3D8HA 3KAKA 1C0EA 1LS6A 3DMPA 1ZS9A 4MEJA 4Y2SA 1Q7BA 3OE7D 3ZIUA 1X9GA 4QL3A 4BKUA 4XGKA 2B2CA 4N03A 3MFQA 1HDOA 2H92A 2DULA 2F1OA 3GCWA 1NW6A 2ACEA 3B1JA 1T6YA 2AIRA 1Z6PA 3PKIA 4B81A 4EUEA 6YASA 1L5WA 3G9UA 1WF6A 5EQTA 5HEKA 3BQ9A 5LBIA 4PC6A 1AU9A 4NBWA 4ROTA 3C5EA 4MUEA 5JASA 1UBRS 5ERGB 4I3FA 4DLZA 3JZMA 4XWAA 4C3ZA 2DWQA 3MAAC 2GPAA 2YJ4A 1MN6A 1YHNA 2PXCA 2ZVDA 2XMBA 3A4MA 4RORA 5ED0A 1G55A 1VE5A 4RQAA 3UN1A 1ZOIA 1L5RA 2CXUA 3HZRA 3I9JA 4MIOA 3EG9B 1TVKB 3ETEA 5ERYA 3N8NA 4B4UA 5AIBA 4RKWA 1CUGA 4MITA 5KJCA 5KX5A 1NP7A 1Y7IA 1RMQA 2QN9A 4NOLA 3Q8KA 2CHEA 1JLMA 2NV0A 4LVUA 4ZU3A 1GPNA 1SFRA 2BUAA 1WEHA 2XJ9A 4ND7A 3R76A 2AEFA 3AUJB 1Z6AA 4D3DA 3ZZTA 3KAJA 2O7SA 4ENUA 4NJMB 5C7LO 4OLAA 1OC2A 5FPKA 3BWMA 4J0QA 4UTNA 4EY8A 5TDHA 1RKXA 2OZEA 3A4LA 4HB4A 2C59A 1C1DA 2PRZA 2XDAA 4RF2A 4E11A 5B36A 1E7RA 4AY3A 2R6AA 3S2SA 3EVCA 5A5VA 1XXHB 3A9WA 3COYA 4G5HA 1H1DA 4W5OA 4LDZA 4RVNA 2EQBA 4IMRA 1RS0A 4KHPB 1EGVB 3I32A 1UDXA 1Y5IA 3RNLA 3V2GA 2PVSA 1FXUA 1G42A 4G9BA 5J2TA 2BPOA 1R0BA 2PY6A 4J1QA 4RCZA 5CLFA 1Q7GA 3TSCA 16PKA 5JBIA 1VCNA 4P4GA 3UWPA 1YUMA 4CTJA 2Q6KA 4R1NA 4XJVA 1ZVVA 1XMPA 4BFYA 4PYIA 3GPIA 1D04A 2VNKA 4O6VA 1K8YB 2QJWA 4QUBA 1VLZA 3KXPA 1L7RA 3OE5A 5JIBA 4JJ6A 2J48A 2OGTA 3BYZA 1L7DA 4RLFA 4WCFC 2FUG6 1HZZC 2Y71A 4KE8A 3VC7A 1WNFA 3SIPA 2ZYVX 4QO8A 3EMBA 1SHLA 2G83A 2PFKA 1ICIA 1CJBA 3QMVA 3DVLA 1VL2A 3FDZB 3QOYA 1A97A 2HEIA 4HZUA 1SZDA 1Z8NA 1Q19A 5EJ5A 5ITVA 4KMSA 1GNPA 1ZI6A 5LDDC 2JGMA 4FT2A 5HIAA 2IU4A 3QX8A 1N2ZA 5F4BA 1JV2B 4QM7A 3A6PC 1I7SB 3IDSA 2J41A 4ZV9A 4U3JB 4BFSA 5T67A 4E7OA 1C3LA 1JG4A 1CKEA 4MYHA 2IYYA 2UYCA 1NU8A 4WT7A 2XNDA 1UK9A 3B5JA 1T5IA 2YC4C 4TL6A 4U5QA 2C0CA 4KKXB 1HO3A 4MWTA 3IHKA 1Z8DA 3E7XA 1IWPB 5JSYA 3IAS1 4GOMD 1LQTA 3DBLA 4I5DA 2XUGA 3PJGA 3HXOA 4D4MA 2GZMA 5EUQB 3L2OB 1NFQA 1OW3B 5GQSA 2ZWAA 4QPNA 4QYTA 1WF3A 2XECA 1G5HA 1XMVA 3EIXA 4TKUB 5GPBA 3ZKWA 4Z9YA 3E35A 3AHIA 4EKYA 3SZGA 4ZCQA 1IHOA 4FYIA 4CDGA 3CUTA 1NIJA 1VKHA 1ZYUA 2YJTD 5A3JA 1KGSA 4QO7A 1ZU4A 2XXAB 2OO5A 4OHCA 4DMCA 5TR9A 4GW3A 1UZMA 4R7GA 3NOOA 3NUZA 3M6LA 4B79A 4O2RA 2JFWA 5JOQA 2G7MC 4RJKA 4N5LA 2ZWMA 3DBRA 3K7EA 2AQ8A 2M6LA 3MQ4A 4JJGA 3GPCA 3LDHA 3E9CA 4H7IA 4BXOB 3FTPA 4AUMA 1MXHA 1N92A 1Y8CA 1Z7BA 2OM2A 4N3BA 3UCXA 3P9KA 3M0EA 3ZHVA 2OQIA 3BH0A 4BGDA 1USIA 1VRVA 4UTRA 3BREA 2PDAA 1NRXA 3H9UA 1JI0A 1TTHA 3R09A 4WZZA 4BO4A 2EATA 4J3NA 3UKDA 4KK3A 2RHHA 2WJPA 4XEHA 2R6FA 4ZEVA 2JZCA 1SBCA 5BSFA 5I51A 1P81A 4HAYA 1U98A 5BSTA 3TI7A 2QRVA 1HG1A 4JU8A 4RA9A 1RRFA 2BGKA 5DHSA 3VPSA 3WLHA 5DNWA 1YD7A 3C6MA 3VPXA 3PDCA 5THQA 1DSSG 1U02A 3ZWMA 2ZT7A 4KXVA 4KN9S 2I71A 2VHTA 1CVRA 2XGMA 1MVLA 3EOAI 4JROA 5F51A 4IDNA 1WSAA 1I7NA 3A05A 5H83A 1VYUA 1CQXA 2FSVA 1GFZA 2X0JA 2XYHA 2HX1A 3OPYB 2Q5QA 3EARA 2UZ3A 3U7QB 4B48A 4BEWA 4LXGA 2X5JO 1F2TA 3H99A 5FO0A 1NVDA 3MB5A 4EARA 2DR3A 2IBSA 3WLSA 2B37A 5IT5A 2AMYA 1T0IA 3UJ3X 3WXBA 3OZWA 1K6MA 1A9PA 3FLAA 4B40A 5HSGA 2C2GA 1A2KC 4PW0A 1Y8QA 3WSTA 1MB4A 3EIFA 3GA0A 2B25A 3CCBA 5ADUS 3AVTA 3LLCA 4LXXA 2FWJA 5KMGB 3HXTA 3BWBA 2H59A 4BECA 2X77A 1JHVA 4P3YA 3KCQA 3VR5H 3LQKA 1E7SA 4JJFA 2XUQA 3O2QB 3IQHX 3T52A 1JSXA 2GR9A 1VYTA 4LF5B 5LQJA 1AK1A 4WY8A 1PR3A 3MYYA 4MLCA 1D2NA 1S96A 2HJHA 4ZQEA 5ITZA 1W19A 2UU9B 2EX1A 3H9CA 3LOUA 5IUKC 4V1CI 2FSPA 3MOIA 4OP1A 4KXWA 4HJXA 3WNDA 1P60A 4ZARA 5B6IA 2X22A 3VSEA 1H2EA 3IUNA 4FFBA 3T0IA 2H1LA 3LFUA 3PGMA 5BW6B 2PQ2A 2OXTA 1UZUA 2AN5A 5ECGC 5ARCA 4BKPA 3D3WB 3EUWA 2C7RA 2DERA 1D0SA 4DLTA 2FE1A 4YCAA 1RI3A 4MGIR 4O4HF 2AB0A 3VH1A 1FRZA 2FW7A 3C14C 3GO4A 3UHPA 5J4KA 3SZUA 5LMCA 4MINA 4NS4A 1CZRA 1WVMA 4DREA 3C3WA 1BCRB 2XTAA 1N2CA 5FTNA 4CMHA 4DA0A 1XF9A 3LAWA 2O1SA 2BM9A 3U09A 1O0CA 3K05A 1E0AA 3HB5X 1LLQA 1KMHB 3UV6A 3TLMA 3L1HA 1QP0A 4Y98A 3L7MA 1WQ1R 4MYUA 1L5QA 3KZKA 1J6UA 1WB4A 4KAFA 1NNUA 4ALIA 4NCHA 2OYCA 3FBTA 2R7MA 1A04A 4I1IA 3L4JA 1M2OB 3KELA 3CRRA 2BSXA 4JASB 2PLNA 4AN0A 2TMDA 3P2IA 1EM8A 4U7GA 1EFTA 1RD4A 3ECCA 4FGLA 1Q22A 2XNKA 3AB7A 1CIJA 1GAJA 3G2QA 1RAIA 4FNOA 4NI5A 3W05A 3WV5A 3PYXA 3IBCA 3P2OA 4R01A 3Q8LA 2BFMA 2BFBB 1Y6RA 2MSEB 4QOIA 2CYCA 2OL4A 3F7TA 3TW8B 2NYRA 2EW2A 2E4XA 3NBKA 3FOEC 1D6NA 3JWJA 1LPOA 1JS1X 1X14A 2E3JA 2JF0A 2VPTA 4D8WA 5L45A 1T2DA 1H23A 2XT6A 3LPDA 4YP5A 1OC4A 2FQXA 4S1TA 4YJFB 5DOVA 1AUOA 2JGJA 2N46A 3JYPA 1E99A 3CPSA 4OXYA 4IJKA 4AM8A 1PBNA 1TM1E 2A30A 1YQEA 2WKQA 1NXOA 2EDCA 3PD7A 1F8UA 3HO1A 2Q2NA 4IOKA 3I8SA 3ELDA 3KWMA 3NC4A 4H6PA 5D3ZA 1E9BA 1L5GB 3ZV7A 3LVFO 1BS2A 1GKYA 1QWOA 4HHEA 3FPGA 1SXJC 1LF0A 3PUWA 4TWRA 4I1SA 1RSZA 1Y4SA 1TE2A 1GL7A 2FSGA 4UHCA 2C8KA 2NWQA 5MF6A 3PFGA 4JBXA 2NPIA 4K6CA 4NV1A 2O8FB 3Q8XB 1WDKA 3IHWA 3AOGA 3TGLA 3MCAA 2NADA 1U7UA 4ZAGA 1A76A 3WOHA 2P8JA 3V7YA 1Y6GA 3BL6A 5L3SB 3R7NA 2YR0A 4RV5A 1IL0A 2ZJYA 1CE8B 4B83A 1TM3E 2PX5A 3M1LA 2Y1XA 1IVNA 5EPOA 3CGWA 1YRWA 1UPTA 5AK4A 3TNYA 1F3LA 4E88A 4IJVA 3SIXA 3SSOA 4DIFA 1P61B 2O8DB 4CFZA 1OBHA 3DUWA 1NM5A 4YY3B 2J33A 4Q82A 3FLMA 4RVUA 4ZU1X 3TOZA 1OIVA 4IH4A 2DMRA 1JT2A 4BJHB 1H5QA 2XOKA 4N6OA 4MV8A 5H5JA 4BO6A 4OX9B 1DDOA 1DRJA 4LJ9A 3OMXA 3HWSA 4ZZ1A 3E6AA 2A33A 3IMKA 3IXLA 3QFHA 4R9NA 1E7YA 2AFHB 4IHQA 3BBLA 4RYLA 4L2IB 1DG1G 1FDVA 2HADA 1U94A 3RVKA 4A73A 1AF4A 1P5RA 2I2AA 2H4HA 1S7GA 1ZAKA 1XR3A 2FR1A 2GD6A 4C5BA 4E0BA 1BDMA 1DADA 3THSA 4YYZA 4LBWA 4F8EA 6ADHA 5T3YA 1YCHA 5EJ8A 3Q1KA 4N65A 1HNXB 4B75A 5KQGA 3EAGA 1Z2NX 1IN1A 1J22A 3OCYA 1ZR4A 1IVSA 3VZQA 2D7DA 2QLMA 5KJ1A 1AGXA 3ACDA 5P21A 1YA4A 3BVPA 5BN1A 1VCIA 1JHUA 3RBXA 4XVUA 5A6VA 1BN7A 2RAFA 1UKZA 3E3MA 1G66A 3X1JA 1NP3A 3DZIA 4C08A 4ZHSA 1MC1A 3C6KA 5IK2A 4JEIA 4HZUB 2V59A 1MJGM 5T57A 2AS0A 2QUHA 3DOIA 5BSWA 1I3KA 5C4MA 1NMXA 2EIXA 4FDMA 1YASA 1CUWA 1NIPA 3L82B 1R3DA 5EPEA 1IDN1 1KR2A 4E1BA 3NUGA 2PUVA 5JDIC 2OR3A 3PNSA 3S8MA 4A92A 5JE8A 2BTQA 2X6RA 4M1EA 2ADFA 2XKBA 4GKAA 2OVFA 5FPHA 3R9IA 3FGNA 5JD3A 2MWMA 3D1VA 3DT8A 4PG7A 4N3CA 2RI1A 1KJYA 3SLKA 1KDPA 4L3OA 3T4EA 3SJUA 4HDMA 4AXBA 4RS4A 4Z5XA 2YRXA 5IARA 4UE2A 4GS5A 1ABBA 2CMHA 2Z2ZA 4HAZA 2ZUEA 3VDMA 5EG5A 4PN7A 3UFBA 3IH5A 2GILA 2B5OA 4WGGA 3H5TA 2GPSA 2GSWA 1WTCA 4M0LA 4KMMA 4Z7QB 2ZJFA 3TTSA 2I6UA 4L5YA 4UMEA 4LHSA 4GG1A 4DIDA 3NM4A 3I3OA 3N87A 4JLWA 1HLPA 1Z45A 3EIEA 1DWOA 4OHRA 5H59A 4JB0A 4N01A 2Q3FA 3AM4A 3MJ4A 4UDYX 3HXPA 2RGUA 4Y0AA 2K7FA 4IXDA 2IP1A 1U9ZA 1E2PA 3TMAA 3E1SA 5SY4A 1XFDA 1L4MA 4Y1FA 3FLBA 4E32A 1DT5A 1QG0A 1GU1A 1WX1A 1GGNA 2X2FA 2NU7A 2Z95A 3QPUA 4JWTA 5CR9A 3WKAA 4CQJA 1A98A 3DTVB 1UKCA 5CK5A 4D3FA 3UT6A 4KPGA 5EE1A 3NLLA 4D96A 5C1DA 1LX7A 5DM70 3O73A 2IHNA 4YS6A 4OHYA 2I4OA 2C7BA 4XQEA 1CFZA 3H2BA 1SOMA 4FC7A 3OZRA 4MVJM 1ZITA 2AVDA 1XLUA 3SQWA 4CZ2A 4XIGS 2A9KA 4D6XA 2X7HA 1KARA 1OPXA 4MHSA 3UMMA 1N34B 4HH1A 3BF8A 4M76B 5F78A 4XWOA 5CCDA 2ESRA 3L6UA 4BNVA 4F0JA 2L69A 3H5IA 1GADO 4UULA 4Y6LA 4YIKA 2W22A 2ECOA 3UM9A 4FOOA 1E60A 4LOAA 3SHWA 2IV2X 3P0RA 4QT0A 1Q0QA 2O6HA 4BMSA 1VB5A 1MD9A 4RHTA 3K1AA 3C1UA 4ZPXA 4U6SA 4LPKA 1CYDA 4S24A 1LVGA 3E03A 4OBBA 1KJQA 5ABPA 1MX3A 1A2QA 1Y7TA 3KKMA 2J3IA 3R9WA 2HF9A 2TECE 4M0MA 1YDEA 4J29A 4M7RA 2WF6A 5L3ZA 1II0A 2A0WA 2HMVA 2HTEA 2I29A 4F60A 5K4GA 3IOMA 3PK0A 1N6RA 2IE8A 4MZXA 4BWYA 4L0DA 2FZVA 4DC9A 1SUWA 4AMZA 2QKYA 3A2NA 3WFZA 4JP1A 4M2LA 4UATA 1H2ZA 5CEFA 3AI1A 2GBCA 3B3JA 1NBMA 4AS2A 1TJ4A 4QDUA 2RH4A 4CKYA 3CG4A 1S1MA 4KJXA 2QNBA 1X94A 5K7SA 2AV6A 3CEHA 4UU7A 3VR0A 2V9PA 4QGFA 4Y6RA 3TQTA 5FWXA 3UMCA 3H16A 2UUAB 4R40A 2D1TA 5AKZA 4CLXA 1TECE 4OHPA 1R00A 2H65A 4QOSA 3RGWS 4EX6A 1BN6A 3IUEA 1N2GA 2JRLA 2JVKA 1TNDA 1GGFA 1XRQA 3P9XA 4J90A 4PSUA 2ZWVA 3B3QA 1ZP6A 5JYBA 1MMFB 1WTAA 2P5TB 1SC3A 1VHTA 1Q20A 4IDQA 3UJNA 4UM5A 4UHBA 1Q12A 4EI8A 1EVYA 2XI4A 4JJAA 4MPDA 4OU5A 4BFWA 5JLAA 3R3JA 3KKOA 4YCDA 2HBYA 3A1VA 4HWGA 4PZZA 4TLAA 5CT9A 5G3ZA 1U8FO 1Y34E 3MJTA 4E1VA 3TFOA 3C3PA 5CFLA 1BQ4A 2OFPA 1PNTA 4LEIA 1NNSA 2QTNA 4Q3OA 5DASA 1E2IA 4PBTA 6REQA 3QEJA 3DFIA 5J43A 4YRAA 2XCRB 1IULA 3RWOA 1MX5A 4WECA 1YR7A 1HLGA 2VZEA 1MX9A 1JPJA 3B1FA 1UDWA 2QN6A 2RGDA 1Z7YA 2VSFA 2VJPA 1B0ZA 3R3SA 5CVCA 4AWBA 4H1HA 1YKGA 1QVRA 2CCKA 2W6QA 3OIYA 1A7UA 2P9FA 5DBGA 1RR6A 3HACA 5CNKA 4I3GA 4X7BA 5KYXA 2GGSA 1R10A 3EFOB 4Q6BA 5CYPA 1EE9A 3QMPA 5AI6A 4P08A 1JBQA 2QXTA 5C4IA 5DHQA 3DC2A 5D1HA 2AG6A 1U8EA 4FWIB 2A1TR 4YJGA 3VUEA 4JX9A 2C4HA 3ECSA 3HUEA 1P0QA 4YJDA 1Z3CA 2Z5VA 3BFXA 1LFAA 2J67A 4WA8A 2PBZA 4QFMA 4GH5A 5JNRA 1JKJB 3U7JA 4B3IA 1V5IA 1QV9A 5M04A 1DTSA 1PEDA 3R6TA 1B6RA 3ROGA 2B7BA 1FZQA 3PXDA 2IXBA 4MS3B 4F5DA 1U2GC 4Z2AA 2MSDB 3PQFA 4QBKA 3MGAA 2FWPA 1R64A 1X7DA 2CFIA 2V8BA 4IX1A 4US1R 4CDMA 3CVUA 1SEVA 4ZQFA 3SX0A 4PYMA 1PWZA 1ACMA 2ZAGA 3EXAA 3L0OA 3L7OA 2X76A 1M8JA 3H04A 4ZI5A 1Q3HA 1V1RA 2VAWA 3H7IA 4YO7A 1XMJA 2I7VA 4L8WB 4YRTA 4UXIA 1MW8X 4FR5A 3W5AA 3KLMX 2O2GA 4EENA 4ETNA 2BFCB 3GEGA 3L0DA 2QUJA 3IAFA 1EWRA 2VPWA 1W5AA 4GDFA 3GDWA 4PZEA 1C1HA 2CW5A 4GQIA 1FXWF 2QG4A 1OX4B 3E81A 3VDXA 3KU1A 1V43A 4V0KA 3WZLA 4CLDA 5G2OA 3Q7PA 5K3EA 2O4CA 2QE6A 2ZG6A 3JATB 4BBZA 1CEQA 1E9CA 4CF5A 5CITA 1LU9A 4D25A 2QX6A 2IHZA 3H5LA 1EJ0A 3BH7A 1DIOB 4XIIA 4LI3X 3NMUF 4FCVA 1UBSB 4I8XA 3SI7A 1VHWA 2OCYC 4PWYA 5DMHA 3N70A 2O0JA 2ZM5A 5FOXA 5DHTA 3TRIA 4J2OA 7REQA 2I87A 3RU2A 5NULA 1X7ZA 1TIKA 2F9LA 2W6JD 3MGGA 3AINA 4P0PB 2Q3MA 2WLSA 5A5GA 3FNGA 5BRNA 5BT9A 2WJVA 5MN4A 4RTKA 3SXPA 2ZB3A 3M3PA 4HP8A 4J1NA 3OY2A 3ZHBA 5GAJA 3K1YA 2V4ZA 3B5IA 3RS9A 3GA7A 4BUCA 1HDXA 1CFJA 1OIXA 1GPMA 3DL7A 2PSHA 2RONA 2BM8A 5HIJA 1PJLA 2IZ1A 1KEKA 1D8AA 1SCIA 2ZJZA 1HDRA 1AY0A 5HNKA 1UMDA 1SXJA 3ZWWA 1X7ZB 3KE9A 1PAUA 4R4JA 4CG2A 3KLBA 2Q3JA 4FB5A 2RE8A 3WWYA 1QV7A 4HLDA 3EQ2A 2MCFA 1XHFA 3A6JA 1NY6A 1T1RA 4JLVA 4BZQA 1CJMA 4DMKA 3R7SA 1Q5PA 1FA9A 5K0ZA 1VC2A 2YZNA 2B9VA 3JAKB 4OCZA 3SHTA 2DY1A 1GVHA 3ESCA 3QBJA 1DTWA 2AUTA 3UKJA 1FLNA 3IDOA 2QG6A 4G0YA 3TZCA 3ZZ0A 4X95A 4IEFB 4CV0A 4ZJYA 2F8TA 3KDAA 4YX9A 3KSAC 1CQWA 2R1VB 2LKDA 3C85A 2UZ4A 1CK4A 4NEGA 4U4AA 2JLQA 1S8AA 1XTIA 4JJIA 2DQYA 4CQMA 5HKBA 3GG2A 2ZREA 1H2FA 3HP1A 4KPFC 5BNFA 1E3MA 4WFJA 4WEOA 1M3SA 5KOJB 1XD2A 2GWHA 3RFVA 2Q3EA 4RVOA 4ZQCB 2ZVJA 4TT3D 1RYBA 1ECGA 1AD2A 4F4FA 1KI3A 1JZSA 2RDMA 2Z4SA 2ZUSA 1OR8A 3TMKA 5DBHX 2EL7A 1S2MA 2OESA 3FGPA 4MO2A 1WXFA 3BX1A 3R3UA 4DQVA 4CODB 4ZMBA 1J5PA 3ULKA 2ZQYA 4WZAE 2PUAA 1ZIXA 2FPLA 1HRDA 3GF4A 3K4HA 5LR6A 1X0XA 5DSZA 4D46A 5B2EA 4MW0A 2NN3C 3Q0EA 5T4BA 4DDTA 3LNCA 1JU9A 1Z2EA 4GWKA 1I2DA 3BGOS 3H1TA 3HEBA 1JR6A 3A26A 4ENTA 3I9V6 4OQPA 1WETA 1Z6YA 4M38A 3DZDA 3GUUA 3ZGZA 2GEJA 5F9HA 3PNYA 3NTLA 3A9SA 2FP3A 3S3TA 1JJVA 1FNBA 1ODLA 3K8YA 3KQYA 3OICA 4LOKA 2XKAA 4LVCA 3U48A 5HJEA 1W581 1AJEA 3HZZA 1MQAA 1QOPB 2V9ZA 2Y4NA 4FGZA 3RARA 3WKEA 4PLGA 5GONF 4F3YA 4FMDB 3TVTA 2O8EB 3JQBC 1JFFA 5CW2A 5B58C 1IH8A 3PXAA 4X7RA 1AZSC 1RM3A 4A8PA 3RYCB 1L6IA 5JUWA 3G82C 2FPGB 5DI3A 5EJAA 5THKA 1UJMA 2W6ZA 3M4XA 3W3AD 4BNHA 5EP4A 3S70A 3KZVA 2PX2A 4X7PA 2QX7A 4DN6A 2R4QA 4EPWA 1DKQA 4LC1A 4AW9A 4P6VF 4DIBA 2B98A 3VFDA 1BQEA 2QQ5A 3DMTA 3GZTB 3H9GA 4KNVA 1XQ6A 1Z63A 1II8A 1PKEA 2YWHA 4CU5A 2AL7A 4BLWA 2HA0A 2ZITA 2R6JA 4B6GA 2FGKA 2O8EA 1L7OA 3GLHA 2PAFA 3VVCA 3D8BA 1P9NA 2NZVG 3JYNA 4KMOA 3ZZMA 2HWUA 4UZEA 2P6RA 1Z4MA 3NTXA 3LQFA 4TM7A 2CNLA 4TYPA 4RD3A 4E5NA 5JCZA 3T5PA 4MW5A 3RK4A 1DBPA 1XV5A 5CHEA 3CR3C 1XI2A 3MRTA 3N8IA 2ZUVA 2P1RA 1SVIA 2ZT5A 3CZ4A 1XQXA 2JLVA 1NYRA 3QW2A 4UM9D 3U7FB 4FYWA 4RU1A 4XQCA 4F04A 5AVUA 4J6FA 3EXHC 3V3KA 4DJ5X 4L57A 1XJ0A 1XL1A 3JQAA 1DCMA 3SJAA 2PT5A 4MRPA 3EAFA 3TZ6A 1GPKA 4AJOA 5AVZA 1ZR2A 1EDDA 5FBKA 1UJ4A 1MIHA 4HUQB 1ZGCA 1UWCA 2R47A 4LHWA 1R0KA 1SG6A 4KN6A 1WBJB 4CM4A 3V2IA 4KVGA 4DUYB 5BSHA 2JGDB 2WMOB 3E9NA 1RI5A 4IIDA 4BLOA 4Z86A 1GLVA 1W5BA 3EZLA 4IDPA 4PNHA 5LL6P 2W2LD 2FLKA 2IUYA 4HMQA 3UHOA 3L40A 4RH3A 1B1AA 2I6GA 4YACA 5K0CA 4CF3A 4EW3A 3K6SB 5J2UA 2AJDA 3GD5A 2PRIA 2OBFA 3DB2A 3EEBA 4NE9A 4F11A 4MVCA 2A9QA 4CIYA 5JO0A 1HR0B 1PJ3A 4I81A 4G0XA 1GSHA 1SURA 1NW9B 3GDGA 3VR4H 3ZIDA 2IYUA 2G76A 1TAUA 3RFFA 4MQ6A 1UAYA 2G5TA 1GCGA 2IV3A 3VPAA 2CJFA 4G0OA 4IO0A 1GTJ1 2EF1A 4GZ6A 3TCXB 5F2KA 4DMFA 4KSCA 3FJOA 5L40A 1Q1GA 1PYDA 4ZYTA 2LIVA 2GEDA 1KEPA 6REQB 1KJ9A 3JD2A 4C07A 5JC8A 4GICA 4BFCA 2DT5A 5E2IA 3S2ZA 1DHRA 2CD7A 2PH3A 2VJMA 2F3QA 3KETA 5GZ3A 5ALJA 2JHAA 4MUJA 1A82A 2YCLA 1EI9A 3M6AA 3KSMA 1IWOA 2ZS8A 3QHAA 1SKBA 2I1WA 1RJ9A 1Z0IA 4YV0A 2IX3A 2F4VB 3ADOA 4CM8A 4N0DA 2I2WA 1B41A 3B8HA 5L3RA 2GFIA 4KQMA 4E2ZA 4CN8A 1RLTA 1YH3A 3VOTA 2A5FA 2AMLA 2GVZC 1KP3A 4MQUA 4QOGA 2I4IA 4JSYA 3VVMA 3V7UA 4GPIB 5KNDH 3G1TA 4X1KA 2I3BA 3F5SA 4IQ4A 1OJLA 2Q6VA 4MS4A 4DXAA 2V3CC 3CR8A 2OXCA 2AXNA 3MQFA 3WDKA 4D0NA 1FFYA 1TB4A 4EG4A 5J5AA 5EHQA 4S1WA 4LVNA 3I2FA 5TB5A 1BHSA 2V3VA 3CZPA 3OZXA 4W82A 1R0ZA 1T1EA 1LDNA 2BT4A 4UZSA 4NG5A 5DE3A 3NANA 1YJXA 4H4EA 4HYQA 2DPYA 2BV3A 4C9BA 2RB4A 3JWGA 5K3OA 2C4KA 1A9OA 2FSFA 4XYBA 1U3UA 3SGLA 4HYTA 3ZWOA 1KY4A 2RJ3A 3VR2A 1DJNA 5G53C 5JFGA 3HB0A 1K2WA 4N8SA 4MIKA 2QRUA 1E9FA 4ZN6A 1JKFA 2ILTA 2H1RA 3B1YA 1OFTA 4EF6A 1VIYA 3LU1A 1RXUA 3ET5A 3OM1A 1KVQA 4NPAA 3KDSE 4XYEA 1KY5A 3AEUA 3K4QA 4FN5A 3ENKA 2ZU6A 1EM8B 2FJUA 4S0ZA 2NVUB 3PV0A 3B3GA 4MZDA 3KQWA 3DQQA 3ZH9B 1SKAA 4UVEA 1I33A 3INTA 4ZXFA 3PFWO 4B8ZA 3ZWCA 4IFIA 3K31A 3C41J 2PWYA 5JSHA 4ND1A 1SQGA 4L1KA 3WHLA 1KRWA 3OTIA 2NUAA 3NBAA 3I73A 5JSFA 3GWZA 4E5KA 2FQYA 1NVVR 5FUYA 4YJ3A 4J2HA 3T1HB 3HTXA 2C94A 1ZRNA 2C7GA 1P5ZB 2N42A 4YJ2A 3PQ5A 2RB5A 1V7QA 2OLEA 1IHPA 1JT9A 4QUDA 2WG2A 3TCNA 4EPYA 4OAQA 3BSSA 1N2BA 3CZMA 3QWBA 3CUWA 1MV8A 1P45A 3VR4A 1FCJA 1RI4A 1QHGA 3BICA 3DOOA 3GT7A 2J7KA 2YV2A 3E9RA 1XDBA 4AF7A 2QOEA 1IB0A 2PL3A 5JAIA 1V71A 3HSSA 3BD9A 4LJLA 5KTPA 1TPZA 3IVCA 2FRVA 4IVQA 1SCQA 2A9JA 5FPTA 1M2EA 3P27A 3WOVA 3CE9A 4EEXA 2IHJA 3OEEA 1F4PA 1SUEA 2I3DA 4YALA 5ALDA 1SD2A 3V8VA 1JSRA 1L9XA 7GPBA 3H9QA 4N7JA 5DXAA 3KT3A 1FUEA 1JMYA 5JADA 4GLLA 3C8DA 1IOVA 1H8ED 2I3AA 1SCUA 4WBSA 2FK7A 4X00A 3MN1A 2P9HA 2KHZA 3G13A 3EZYA 1IY9A 1XCPA 2LNDA 5JS2A 2OORC 1JFSA 4JBLA 2Q9UA 3WB2A 1YC2A 2A5YB 3EUAA 5C8YF 3FCAA 2YWJA 4YFYA 4ZZ3A 3IP5A 3QYPA 1OX4A 2FEXA 2PANA 4QBGB 3GWGA 2IODA 4XQGA 2FV8A 2X8WA 1MEOA 3EDCA 1ZXBA 3QVWA 5AHRA 1IQPA 3KB2A 4Q1CA 2BFDA 4WNIA 2G4CA 4TZTA 3TUJC 1A71A 4ZVTA 3DFZA 4HWOA 4TQUS 4P36A 3M1IA 2XZLA 2FAXA 4OU4A 4YAWA 1Z26A 5G0SA 4EVSA 2HPAA 5GINE 4G1FA 1VDMA 2DTEA 3NU1A 1MX1A 4FN4A 3ES9A 1RAEA 3OKAA 4DQUA 3O8LA 3QKSA 1RDFA 3HL0A 2WWFA 4RZUA 4MLZA 5BWOA 4AZWA 1ZM7A 1YB2A 3W2TA 4N6NA 3SQNA 4K46A 1FS4A 3ZDEA 1VIAA 4MA0A 4ZV4A 3V1KA 3ZI7A 1TFRA 4LMBA 4FKMA 3UXMA 3F6SA 4I4LA 3LL7A 4KW7A 1U8YA 3BXGA 3I45A 5CGZA 3LBAA 4XJSA 1DMRA 5GGYA 1NOIA 4FNAA 1AV6A 3ZKAA 2F1KA 3HXMA 2BP7B 1OH8A 2BL4A 2D5LA 3BMQA 1M33A 3AHEA 4RVSA 4AZTA 1PGOA 1QOQB 3B51X 4HNAB 3WWDA 4AY5A 1J0AA 2XGOA 3OLVA 3MNFA 4I9NA 4FPXA 3JW8A 1BS9A 1BFUA 1JWAB 1LQ2A 1YOVB 2I1QA 4EKEA 3G0HA 4HN9A 2ZTHA 2AQIA 2FPXA 2CNOA 2BEJA 4H1TA 4R2WA 1GUYA 3OPXA 1RXVA 5G02A 3TFQA 1Z3IX 1PFKA 3C3JA 3EWAA 4RHXA 4U6QA 2BR4A 1T9GR 2IV7A 2WUGA 4HNAA 4R1LA 2B4YA 3DPSA 5ILGA 1UWVA 3T12A 4FXOA 4UQOA 3L41A 4AECA 2B8NA 2FEMA 1MQ8B 3Q15C 2FR8A 5AKGA 5IT4A 3R5FA 1UFKA 4MVJG 2NXEA 2WY2D 3WGOA 1N4DA 3WWEA 3G2MA 4MQMA 3M4YA 3WGYA 4EA7A 4I19A 4R5HA 3G9XA 3JQDA 4OTZA 5FTKA 5GVRA 8ABPA 2QROA 2WOOA 3AYXB 4BMDA 3CVXA 3V1MA 5AQ1A 4V02A 3DEFA 1X87A 3LUCA 4EWLA 1B76A 4F72A 2QTVA 2H48A 1J8FA 4IFTA 4ND6A 1O57A 3IA7A 5LFAA 4KNWA 1UBJS 3GFTA 1WY7A 3QITA 2J45A 2F00A 3B12A 3EWSA 3L04A 5PGMA 2BFWA 4RLQA 4LN1A 1G6Q1 4NJEB 2VTBB 2H7XA 2KLBA 2WSBA 2PEYA 4URHA 5CYFA 4OK6A 1T4DA 4MQ4A 2P2GA 2QP4A 4RJJA 3GEMA 1W4LA 5AQEA 1T6XA 5DXFA 3NIGB 3JQ9A 5LIRA 5DLQC 1T3LA 3W5UA 1WBBA 2OSBA 2X13A 4Z0NA 2O8CB 1TCBA 4L3WA 3KLPX 2Y1EA 3VI4B 4DSZA 3HDQA 2IU6A 2ZQZA 3LHKA 2PJRA 4RH1A 2AC7A 1U1IA 1WV1A 2YQ5A 3LIPA 1GL3A 4I2VA 1USUA 4I55F 2A9VA 2EV9A 4UQPA 3FY4A 4BO7A 3OFNA 1PJZA 1F14A 2YWDA 2QTLA 3FSJX 4N47A 3LBHA 1BJKA 1CDZA 3LUKA 5HUQA 1RXYA 1XU7A 3CW8X 3MK31 4HN2A 1DAPA 4M99A 4PYKA 4QFDA 5F5NA 3ST7A 1WKBA 1UFRA 3PWTA 3IAAA 3ZQKA 2GN1A 1T4MA 1W8IA 4WNAA 2X58A 3ZIAA 5A03A 2VZ8A 5AM3A 2J5BA 1DI0A 1Y5NA 3U9LA 4A8HA 3PUKA 4P35A 4BIMA 4B6JA 3E1KA 1IAVA 1IN4A 1ZCFA 1FZTA 1NVXQ 3SFTA 4AD8A 1PCXA 3UUEA 4K9PA 1NQXA 1SG9A 2AE2A 1PR1A 1BOOA 1PX2A 2GCGA 1ONSA 3H8JA 5EIFA 1TF2A 1GPWB 4FZ3A 2LDXA 2NQ8A 3DONA 4AL4A 3I72A 2ATXA 3VMMA 1PFWA 1J1IA 1E66A 1RM0A 2FHPA 3H1BA 1I3OA 2QGZA 3JVVA 1TT5B 3H1AA 2C5HA 2XGSA 3KTDA 3N8DA 4M0FA 1XDZA 3YASA 4B6PA 1BRMA 1P7PA 2Z1NA 3WL4A 5I7UA 4RK0A 3FR7A 4DV3B 2JKZA 3FOCA 2I80A 2W6PA 2IUFA 821PA 1DCKA 3TSZA 2YVAA 4HYEA 2HK8A 2PGDA 1U80A 3T0GA 1SHJA 1K1EA 3QNMA 3WRXA 4BO3A 1LGYA 1ZVKA 3C1OA 3HN2A 3FAZA 3THXB 3P71T 3LUGA 2Q4RA 5T4HA 2A84A 3TB4A 1G17A 1RBZA 1YXMA 1DS6A 1U7XA 3EB9A 3W77A 1GZHB 5KPDA 3HXQA 3H6HA 5FR1A 4X62B 4UMFA 5F2EA 1LBSA 1EQUA 5ETJA 3E9EA 4HXGA 2EARA 1GPDG 3FDJA 4LNUA 1Y9DA 1G3MA 1QH1A 3QTTA 2WJ6A 2ZI6A 3BD7A 5JJ5A 1JVNA 4JLOA 1BJTA 2PGLA 1R88A 2CVPA 1HLFA 4I50F 4JR1A 2C92A 5LD2B 3DDSA 5DM2A 4GZ5A 2YWCA 3QVKA 4MYDA 1NVAA 3G2NA 3RJMA 2OP1A 1N8SA 2PUTA 3R7WA 3SEAA 1Y89A 3ABQB 4CGZA 1MC8A 4CKBA 4KIJA 4YAJA 1N9KA 3S0JA 2M32A 3QGMA 3RAPR 2G1PA 2WM2A 2WNHA 3PLRA 4G9EA 4AP6A 4CM9A 1RACA 3PTLA 4EK9A 4UM8B 4FFSA 5JCOC 4G0PA 3WXMA 4WLEA 3K0SA 1P33A 4MS3A 1YA6A 1T5TA 1COWA 2JC3A 2VHWA 1P9WA 4GQAA 4LZWA 2A88A 3FBWA 4QM6A 5DWDA 3ZGLA 8OHMA 2COUA 1GOTA 2CZGA 4AB1A 2WSYB 2Y1CA 3EGWA 3LX5A 4PIPA 4Y2PA 3ZY4A 5F3DA 4RFVA 2J8ZA 2JAPA 3QU4A 5TQ2B 4E5MA 1KQGA 4CKBB 1HNZB 3RAJA 3SBXA 3WLMA 4YFVA 3LUDA 3SOPA 4Y6OA 5FAXA 4CE6A 4LK2A 1W88B 1IRXA 1CZLA 2BEVB 4IF4A 2SCUB 4N12A 2UZAA 1KFBB 4ABYA 1QYWA 1GGHA 1G41A 2ILVA 1TA9A 2C2XA 4JLMA 5DNVA 5B2FA 3TLEA 4K6FA 1K92A 4PLWA 1ISMA 5K03A 3EQ9A 5EUBA 4WK2B 1C4KA 4MVJD 4YNBA 1YMUA 4CKWB 3MG9A 1FYWA 3N8KA 1LNQA 4BXOA 4CN9A 3DKPA 4PTLA 5LOVA 2OT3B 1QOZA 2XBUA 4MP6A 5E8RA 1TVCA 4R1MA 4UTPA 4RSMA 2IE0A 1GEGA 2WTEA 2QUKA 3NT5A 1QCZA 1PD1A 1UJNA 3EVGA 1L5YA 2YZMA 1QKKA 3P5SA 1FTQA 1Y8AA 4S2UA 4B33A 1E79D 4TXNA 5FI5A 4E2YA 2WYHA 1QGZA 2GEKA 4M7WA 3EVBA 3DMHA 3SDSA 2LGJA 2ZJ4A 3CLRD 3IEXA 1YB6A 3ZHRA 5DZSA 3UEOA 4L74A 3FYHA 4KL8S 1F1JA 5FWNA 3H2KA 1RADA 1ODFA 1HDZA 2VAMA 4Y1EA 3IUPA 1WMFA 2OCXA 2ZP1A 3GJTA 5LJIA 1G21B 2BI8A 4ZOBA 1RHJA 4K8RB 1H9BA 3GLQA 4XRGA 5A4FS 2V7QA 2X3UA 3VU3A 1PG0A 1JP7A 3OEED 4BWFB 4YT2A 4PE5B 1XTJA 2IA5A 1IE3A 1W0JA 5BPFA 1JLLA 1NG9A 2OOSA 5IKOA 3HZHA 1XWWA 3C98A 4C4RA 5KSOA 2Z8ZA 2J3DA 2CDCA 3LBIA 4N54A 4EI9A 1E20A 1OGJA 3O3CA 4GWLA 4ZO6A 1EWVA 1YMVA 2VPPA 3DVRX 3ZJ5A 3GLHE 2XTMA 5CFPA 3O3NB 3DWIA 3ZU3A 5I6DA 4XGIA 3CLRC 1OILA 2AZXA 2RGWA 3EW9A 2ZBDA 2YQZA 1AZWA 1JIUA 1GPH1 1IB6A 1Y1PA 3BMCB 3NPAA 1TMKA 3VA7A 4II2A 4AO6A 2AW5A 3K0CA 4HTFA 1Z17A 3COSA 3QUSA 4NRDA 1R16A 1H85A 3B6MA 2ECKA 3A31A 4X3CA 4Q34A 3GJ4A 4YIHA 2HO5A 4IUDS 4AIRA 3P9YA 4M7PA 4BCBA 4D44A 4F4CA 3RTAA 3A6DA 4MVJI 4YRZA 2R7KA 2XBMA 3S1AB 1MDBA 2PA3A 4EHLA 2GAOA 4CLHA 1G8MA 1X1DA 1ZFNA 1C3JA 1Z39A 4HAWA 5EMNA 1ZWLA 1YT5A 1SWVA 3PQ3A 2VUIB 3QBTA 4RVCA 3F6RA 2B99A 2QM8A 1QP7A 3NWPA 2OHHA 1XZPA 1D7AA 3O7MA 2VDKB 3JD1A 1ULZA 3MS4A 4YECA 5EMLA 3C3YA 5BSUA 2JANA 3ZX5A 1VJ5A 4HMOA 5BV1A 4F1JA 5EYPB 4J3FA 4CUZA 3EN0A 2AQKA 4WNYA 3F3SA 4E09A 4J4HA 2HPHA 1L7AA 5I3CA 4NFHA 1DTWB 1P7VA 4JZYA 1KL7A 3EA4A 5JPIA 2O8BB 5CX1B 3OESA 5B1EA 1O4VA 3K6RA 1P31A 3PGKA 2VWGA 3VKHA 5K45A 3N6RA 5IT0A 3FPAA 4KVFA 2QV7A 2C0QA 3VNSA 1JPNA 5ISMA 3SYMA 4NU5A 4A7PA 5D5PA 1X13A 1COWD 3HA5A 3EXIA 4GE0A 3BXEA 2V7WA 4M8KA 2P4HX 5DTJA 3C6QA 3ZDCA 3O9VA 3PIDA 4IJQA 4ON9A 4Q4CA 5KYTA 2ZFUA 2YYYA 4FZVA 4K05A 4KYVA 1BMTA 2J0UA 2PMWB 4YTEA 5H02A 2CL5A 3J80A 4KR3A 2J0QA 2PGNA 4WKCA 1RYHA 3GIDA 3WIBA 3BDIA 1NQAO 3UGQA 3D8RA 5AW7A 3LCCA 4BPBA 2C96A 2FPOA 1SN7A 1WUHS 1G20E 2NQTA 3JQ9C 1SXHA 1TQHA 3MCUA 4GYJA 3V2HA 1LQUA 1E2EA 1KKLA 4OQLA 4C0HA 1WU7A 4K0KB 4MHTA 4EMSA 3CIFA 2CKDA 3CLSC 5J3JA 1XZDA 1KI7A 3VAYA 3OCXA 2GXQA 4XOIA 5J2TB 2FZWA 1FDRA 1I3NA 1XALA 1FPQA 3TRFA 1PX0A 3RSFA 2JAXA 4DC1A 5JBQA 1RLJA 1TEVA 3PL5A 2JZOA 3U3DA 4IWXA 3U37A 1NZDA 4NYMR 5DCWA 1Y80A 1B15A 2B1GA 2ZUBA 3KQKA 3DDZX 1KRXA 2IF2A 4RPLA 5DYIA 5EWJA 5HX7A 1XNHA 1YAHA 3GEBA 3ML1A 5LDHA 2VDOB 3FH0A 5F64A 3DXYA 4KTTE 1IMOA 5HIIA 2PLFA 4NBLA 1QTIA 2ZB7A 4ADSG 3AKEA 5KWVA 4C3OB 3E7WA 3L4EA 1SVMA 4N5NA 1SOVA 5CBKA 5IABA 2IK8A 4P22A 1UOQA 3W04A 5JYEA 5HDQA 1WDTA 2AFIE 1ST3A 1NG1A 4GFDA 3TTVA 2DBYA 2CE2X 1U3TA 1B3RA 2WP8J 1EB9A 4G5XA 3T7SA 4DAEA 4Z4CA 3SQXA 1CY7A 1TJYA 1FFBA 1WW2A 2W6CX 3AF1A 3CR7A 4B3DA 3AFHA 2GK7A 3O4RA 4JFAA 2QVZX 4X97A 4DA8A 1JEYA 5DHRA 5A1JA 5IHPA 1QVVA 1WW8A 1YR1A 4JHLA 2Y8EA 1T3TA 1ODTC 1NPYA 1W85A 1UBHS 4RLHA 1QGAA 4GI7A 4KAXA 2BWJA 1S02A 2A67A 2N47A 4F8JA 3E58A 4WI1A 1YU9A 4A9AA 2IUTA 2QMEA 1SH7A 3ZIAD 2JI4A 3MD0A 4XX0A 1U8UA 3IDAA 1FBTA 4Z0TA 2GLUA 4DE5A 4YP9A 3LO5A 4IUYA 3OJFA 3CO0S 3W5JA 4IGEA 2PBLA 2J6CA 3TOCA 4BLRA 3W2FA 2WKSA 3IO3A 1KYZA 5EYPA 1D4FA 2FZ5A 1GGEA 4JVSB 4B6FA 3ZXIA 4PGGA 1RZUA 2FFHA 3M6IA 5GJBA 1SR8A 3L1KA 3Q10A 4GZ3A 1QCYA 5AVOA 5AW1A 3T5AA 3ZS9A 1X15A 2PA0A 4UDOA 2Q27A 4JT4A 3IBGA 4XSVA 1P9OA 4X45A 1N0IA 2CLLB 2BEUA 1JLRA 2NTYC 5HRAA 4HVTA 3BHJA 4F2PA 4QHTA 4G4SO 5BSVA 4ZAZA 1CUIA 4KWHA 3ZHCA 5JS6A 3HC7A 1FVXA 1OVMA 3DLTA 1FDIA 1JPVA 4PVDA 2XNDD 4TMTA 4TLLB 3IELA 1C9KA 3BQNB 3ER8A 4FZRA 4HPWA 1OJ7A 1QF9A 5JAPA 2FTKE 5AOCA 1ISHA 1ZM4A 2EJTA 2YZKA 3DD5A 3F6PA 3GBSA 4BQEA 4F3RA 5JH7F 1NAHA 2H4JA 3L3BA 3PZBA 1TUIA 5CU7A 3ZEAA 5DI9A 1CDDA 4C7MA 3S8EA 3AFMA 1A88A 1KJ8A 3HHEA 1K5PA 2B94A 4V0LA 3EVEA 3MMZA 1JG7A 2RGEA 1KDYA 1B74A 2QXYA 4O4HA 4EUFA 4IOLA 3RE1A 1SQSA 1TJNA 4P32A 3ROEA 3VJLA 2OVBA 5HBGA 3UG6A 1MB0A 3FSRA 3S5JA 2FLVA 4BVAA 3DZBA 1T8WA 2REXB 5KIAA 5MFZA 3OTOB 1J42A 2Z5GA 3GCZA 1E63A 1NURA 4P3NA 4OQ4A 2PMFA 5A3VA 4ZGBA 2RGRA 1JU4A 1UM9A 2JHPA 5F1PA 2BGGA 2JFPA 5H80A 5EY5B 1RHUA 1ZKDA 1ZD3A 4CU2A 3ESYA 2QD5A 4D3SA 5JAQA 4RPHA 1W25A 3VQTA 2V03A 4D43A 4N7BA 4PC7A 1IY1A 1M7BA 2VTVA 4RA6B 4KC0A 5EWJB 4AJJA 5AXBA 5BVGA 3I4FA 3IALA 4EGAA 3VYVA 4HQLA 1QHNA 4UEKA 2FOLA 1H05A 2IOFK 3DWGA 3HCFA 4AURA 3QVUA 4DCJA 3K94A 4TV8A 1QZXA 1T5SA 4TTRA 4E2FA 3R5KA 1TJ5A 3VPBA 3QEMB 4NFLA 2W2NA 3SICE 3LT0A 4DR1B 1YRYE 1ORRA 1XK7A 3QXCA 4G1CA 2FCRA 4OXIA 2QD3A 1P80A 2GETA 3LTEA 3S28A 4HNUA 1GUZA 2A3NA 4OGGA 4BVGA 1JWBB 1SCAA 2BISA 2EP8A 1XXLA 1W44A 1AO3A 3KVNA 3MWKA 4TYMA 2QZJA 3QE4A 1VLQA 4I4TA 1XMQB 4HTAA 1USWA 5D1NA 1ZI9A 1EQ2A 3EPRA 1IWBB 3QSGA 2LWIA 1V3TA 4UUAA 4ZCLA 5LA6F 4EYEA 4XDHA 1E4VA 2ON6A 1ZUNB 4X61A 2C9YA 3ZD7A 3VR3A 1CLUA 4IO1A 4S3MA 1UJBA 5HF5A 4BQFA 1SC1A 1ODCA 2L17A 3ESDA 2DETA 1JA9A 1G3UA 1TZCA 2NYVA 1VSBA 2R5FA 1GYPA 2UVPA 4R3WA 5HFAA 3TVYA 1KMNA 1Y1TA 5K0JA 3BH6A 1CBUA 3D8TA 4JL5A 3MCZA 4IICA 2H2WA 2QU7A 5FUQA 1E7MA 2R8YA 1VECA 3NAMA 3VC2A 2IXEA 3L8FA 3UB4A 4EHIA 4PQYA 2V7UA 2EEPA 2PN1A 1BC5A 3VZDA 1AUQA 1G38A 3RS7A 3CN7A 4XB6B 1D6MA 2WT9A 3P2JA 3HN7A 5ALYA 1M1YB 1IOZA 3QE9Y 1E5DA 2QSYA 2QU8A 2I78A 1S3IA 4PG5A 1DUSA 5DBIA 3GVCA 2HFKA 3HI4A 4BASA 1EFKA 4YHHB 3X0DA 4L8YA 2BF4A 2JHFA 1YE8A 4UCQA 3D2LA 1C4WA 1UJ6A 4HV4A 1PT5A 5CT6A 1WUYA 4ZVUA 1QP4A 3LY9A 1C3XA 2RHJA 2PBFA 4MI1A 1GXSB 3BJMA 3I04M 4FHZA 1ISRA 1XRMA 3K0AB 3NI2A 2VC2B 3KQOA 3EF3A 4NKRA 1MOPA 4TV9B 1C81A 1RTTA 4P4SB 4LF4B 5KYGA 3HVUA 3QFSA 5AUNB 3T7JA 1OLUB 1O4WA 3L6CA 4IDCA 4ZHQF 4UPVA 2JLCA 4RQUA 3N58A 3KZ1E 3WGLA 1X7GA 5I9IA 1PT7A 3ABZA 1GT6A 3H1GA 1W7AA 1DQNA 2G0TA 3KT0A 3EFEA 3K8QA 3DR3A 1ZL2A 3DNPA 4MUAA 2VUUA 4RK6A 1IBCA 4UE3S 3U4AA 3WK5A 1GA6A 1KVTA 5E0KB