2GN1A

Crystal structure of dimeric biodegradative threonine deaminase (tdcb) from salmonella typhimurium at 2.2a resolution (triclinic form with one dimer of tdcb in the asymmetric unit)
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
327
structure length
326
Chain Sequence
MASHITYDLPVAIEDILEAKKRLAGKIYKTGMPRSNYFSERCKGEIFLKFENMQRTGSFIRGAFNKLSSLTEAEKRKGVVACSAGNHAQGVSLSCAMLGIDGKVVMPKGAPKSKVAATCDYSAEVVLHGDNFNDTIAKVSEIVETEGRIFIPPYDDPKVIAGQGTIGLEIMEDLYDVDNVIVPIGGGGLIAGIAIAIKSINPTIKVIGVQAENVHGMAASYYTGEITTHRTTGTLADGCDVSRPGNLTYEIVRELVDDIVLVSEDEIRNSMIALIQRNKVITEGAGALACAALLSGKLDSHIQNRKTVSIISGGNIDLSRVSQITG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Threonine dehydratase catabolic
publication title Crystal structures of Salmonella typhimurium biodegradative threonine deaminase and its complex with CMP provide structural insights into ligand-induced oligomerization and enzyme activation.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Lyase
total genus 118
structure length 326
sequence length 327
chains with identical sequence B
ec nomenclature ec 4.3.1.17: L-serine ammonia-lyase.
pdb deposition date 2006-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00291 PALP Pyridoxal-phosphate dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2gn1A01
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2gn1A02
2BHTA 4ZU6X 3R0XA 2PQMA 5KZMB 4L27A 4D9CA 1TDJA 3VSCA 2GN2A 5DBHX 3FGPA 4L28A 1M54A 3V7NA 4QYSA 5I7AA 1JBQA 1TZMA 2RHGB 1TZKA 4HT3B 1Z7YA 5EY5B 1QOQB 1J0DA 2JC3A 4IL5A 5B36A 3CEPB 2RKBA 4JBNA 4LMAA 4L0DA 4Y6GB 3SPXA 2GN1A 2C2BA 3TBHA 1KFKB 2C2GA 1KFEB 1A5BB 2ECQA 5DW0A 4I1YA 3IQGX 2J9XB 2GN0A 2J9YB 3VBEA 5IXJA 1KFBB 1VE1A 4AECA 3DKIA 3PC3A 4D96A 2ZSJA 4OFXA 1Z7WA 2Q3DA 5I7WA 1K3UB 4COOA 1V71A 4D8WA 4D9GA 5D86A 5DVZA 2D1FA 3R0ZA 1WTCA 1UINA 3FCAA 5I7RA 5CVCA 1A5AB 3DWIA 5DBEX 1VB3A 2O2EA 1UIMA 2EFYA 5I7HA 5KINB 1K7FB 2CLIB 5BW6B 1FUYB 4LMBA 5C3UA 2DH6A 1C9DB 4D9IA 1Y7LA 3T4PA 3L6CA 4PCUA 5CGQB 3IQHX 4F4FA 2CLLB 1V8ZA 1RQXA 2TRSB 5T6MA 1K8YB 2CLFB 1VE5A 5JJCA 4D9KA 1J0CA 4HO1X 2O2JA 5D87A 1K7XB 2WSYB 5D84A 2ECOA 5B55A 5DW3A 1BKSB 1K8ZB 2TYSB 2V03A 1TTQB 1TZ2A 1UBSB 1D6SA 2RH9B 1F2DA 4JBLA 5B53A 1QOPB 4LI3X 3HMKA 2CLHB 1CW2B 3VSAA 1TYZA 4AIRA 3ZEIA 5B3AA 2J9ZB 4H27A 4OREX 2ZR8A 3L6RA 3SS7X 4D97A 1TJPB 4D9MA 1O58A 5I7OA 3IAUA 5IW8A 3SS9X 1TTPB 1WBJB 2ZPUA 4ZU1X 1BEUB 1J0BA 4WX2B 2CLOB 3IQIX 2Q3BA 5D85A 5JISA 1WDWB 3AEYA 3L6BA 1PWEA 4NEGA 5J5VA 3PC2A 1A50B 1WKVA 3BM5A 3RR2A 1KFCB 1C8VB 1P5JA 1K8XB 2TSYB 4HPXB 2CLMB 4XUGB 5I6DA 1TZJA 2EGUA 1E5XA 3X44A 4KKXB 1KFJB 3DWGA 5HBGA 1CX9B 4D9EA 4NU8X 4D99A 1J0AA 3X43A 4D9FA 4D9BA 3PR2B 4HN4B 3VSDA 5E0KB 1PWHA 4D8TA 1J0EA 1C29B 2CLEB 3PC4A 1OASA 2BHSA 2CLKB 4D8UA 1K7EB 1V7CA 4L3VA 3AEXA 3VC3A 4ZQCB 5IWCA 5B1HA 1X1QA 1A5SB 2DH5A 2ISQA 5B1IA 5J43A 1KL7A 2Q3CA 4HPJB 4D9NA 1FCJA 4D92A
chains in the Genus database with same CATH superfamily
4X9XA 1O8BA 4LYGA 4W5JA 1M2JA 3B38A 3H05A 2BGMA 3WAJA 2ORWA 4DG8A 1HURA 3DD1A 1GXSA 3LCMA 4ZIRB 4I9NA 2GCPA 3M2PA 4LNAA 5TX7A 4C3ZA 5EJ5A 3AL0C 4HLUA 1XNGA 4M0FA 5JWRA 4QYSA 3ZEAA 4KXXA 3CG4A 4BNDA 3JVVA 3KVRA 3N2IA 3MS2A 4DJFC 3WGJA 4NR0A 3V97A 4X1IA 4CF3A 3ETCA 5HX7A 2FEKA 2XDWA 1Z5ZA 4ARIA 1W4CA 3W3AA 2PUEA 2PA3A 1SBZA 2PV0A 5KUTA 3GAFA 1NI3A 4R8LA 4HJRA 4XRGA 1I7DA 1TUIA 3ASUA 5HKKD 5JYEA 2IF2A 3VU3A 4J4BA 5FWYB 3ZBPA 3TCKA 2G5PA 2ECQA 3QZUA 5A06A 4I1YA 5AESA 1RAEA 3C7DB 5B64A 3NTLA 2FLWA 2WM3A 3A6FA 4NECA 3V8NA 3VH3A 2A9KA 4KV7A 1PWXA 3ZJ4A 4C07A 4E70A 5EE9A 3F90A 5EUQB 4I7EA 1XLTC 1XU9A 4H17A 4HUQB 3SK0A 1EA5A 2BSAA 2I6UA 1E8MA 3FSEA 4GBED 3SJCA 2JBAB 4TUYA 1P81A 4JUAA 2FXIA 2GEDA 2H29A 3WZLA 1T9DA 2AK2A 2W2OA 5BSFA 4ZXPA 2XB4A 3TW0A 3P0HA 1YB2A 2XZDA 5CT9A 1S89A 3VPFA 5B7NA 4GPBA 4AJIA 4D4IA 2W83A 1JR3D 4R2KA 3FVWA 4BQQA 2C77A 5EKTA 4C0SA 4D5GA 4HAUA 2ZJ0A 3P2YA 4CMEC 2Z6UA 5CFMA 1B74A 2QN8A 1H6DA 2ZI4A 4OD0A 3ZE0B 3QQPA 5AJVB 1UBCA 4PANA 2LNDA 2PCJA 3P2EA 1GPJA 1H3NA 3ZE8A 2XWQA 3S40A 3V4RA 2WVHA 4AVYA 4HB4A 3PDCA 1RMYA 1SVIA 2GNPA 4EPXA 4E5PA 5IJ0A 5I9NA 2GN4A 5JYBA 1FVHA 4US1R 5BNIA 1LLFA 4IVQA 1OROA 5GONB 2CY0A 2D5BA 5JY1A 1HDCA 4FT2A 1FLVA 1S5PA 2RKOA 3G79A 4NBTA 4O4HB 3VKWA 2WAOA 5EVJA 2CXPA 3W9YA 1H2RS 3SJBA 1L5QA 2OFFA 4D8XA 3N0TA 2IXEA 4PQFA 3TUJC 4UOZA 3CF2A 1FTNA 1GFZA 3MIZA 4HRVA 4PAGA 1RR6A 3KCQA 3GO4A 4Y9TA 5ECGC 3ZI4A 5I5EA 2IZ5A 1GDDA 3QFTA 2EGGA 3B1VA 1PZHA 2J3EA 1VHLA 1WDWB 5C8YF 4X62B 3C3BA 1YS2X 1QWOA 2P5SA 2V74B 3RR2A 5JAOA 3VTKA 2IW1A 3GMIA 5NULA 3T1OA 1P4SA 2YNMC 4BFLA 1M8FA 1KGSA 1GITA 4OXRA 4D3DA 1YJBA 1QGAA 3AIIA 3QHQA 3WIOA 1L7QA 1EUCA 1VBMA 2QU8A 5BYKA 3VR4A 4B8YA 4DOMA 1I2MA 2WM8A 1UJ4A 1T3TA 4DBLE 3I2YX 5KYVA 4A6XA 4DW8A 1QB8A 1W5TA 1RWBA 5L3RA 5C7IO 3I5UA 4UUOA 4QDKA 3VC3A 3CEHA 2DE0X 3WC4A 3KZCA 1TK9A 2PUHA 5AVQA 1HPLA 1WCXA 1M73E 1XFAA 2IOFA 4WXMA 4H3KB 1M2VA 4RAQA 5ALHA 3PQ5A 2ZTMA 4GGOA 2W2NA 4QJ5A 4K9KA 2QTBA 5BUSA 4YRKA 1BXKA 3PT5A 2KM1A 1MRSA 2P1RA 5KKNB 4G6ZA 4GP9A 4IJUA 1G3RA 1R66A 3K96A 5FOSA 2JGLA 2M6SA 2V7GA 4OB8A 3U4HA 5G1PA 4F21A 3S2SA 1NASA 1PNTA 2Y9MB 3DTYA 1T6ZA 5CAEB 2W6QA 4CMHA 1G20A 1KEEA 3QBTA 2YINC 4MJLA 5DBIA 1GTZA 4CMIA 4D0NA 3PFNA 4ZO7A 1YQEA 5DV9A 3TOVA 1XNHA 4UHKA 1V2GA 3T3NA 2AZMA 1NRIA 2PVPA 4FGWA 4HNSA 4R83A 1DIBA 2HFKA 1TF2A 1CRWG 1D5WA 2AWNA 1R0KA 1WXEA 1LK5A 2PBFA 3RVQA 3U9LA 2QSYA 3SI7A 1B8OA 1GUFA 2DQSA 4YT8A 3OA2A 4N40A 1J2JA 3UHPA 1PL8A 1P9NA 1XRSB 1ADFA 2I5PO 7ADHA 4R1QA 1PT8A 3OJFA 3RVOA 1O89A 4MGHA 1M2HA 1DKOA 1UXOA 2RHDA 1LSUA 3AETA 3LLSA 5F2KA 2JCBA 4EVQA 5CDUA 4A26A 4RK4A 3KLNA 3VMMA 3KVYA 5LMZA 4A92A 3BE6A 2X13A 3PQ4A 4W7HA 3ZJVA 9LDBA 2ZJOA 3RSFA 2PMEA 2IQIA 2P41A 1OKKA 3TXXA 2O06A 2O6LA 1PJSA 4YQYA 3WBFA 3H16A 4WL0A 3V4ZA 1DZ3A 1YK0A 2DTDA 2HJRA 1YI0A 4RS4A 3T3EA 3OOSA 3UTDA 3DZGA 2LBPA 5C7OO 1RVV1 2CLFB 3Q87B 4X85A 4E5KA 2QG6A 2EFDB 4GI5A 4PXYA 3ADCA 2YJ5A 4QYIB 1LBIA 2C7GA 2CJYA 2C4WA 2E4XA 3DQZA 3T6KA 3W77A 3KR2A 3LLVA 3KSAC 2GVNA 3SFVA 1P7YA 4WV3A 5AKYA 5EERA 1YC5A 2PKRA 4ZYUA 5HKBA 5HM6A 5KTMA 1J33A 2R65A 2VCYA 4YJGA 5F12A 4E5YA 4I0WB 1XRRA 2HREA 4BVKA 1UK7A 4CI9A 1KYWA 5TMPA 3REQB 3T7RA 3ZHUA 1C8LA 1OX6A 4PZAA 4A0FA 4HZUB 4Q3EA 4R5HA 1C1HA 4NBWA 3ZD6A 4GMGA 2YFKA 4Z0PA 2DQKA 4S2EA 3EXG2 5BOSB 3DVSX 3IBYA 3LZ6A 4L78A 5LP6F 4J4HA 3RF6A 1F9EA 5FAKA 2OGZA 4Z7OB 2PPLA 2JLXA 1P1JA 4MV8A 4Q0MA 2OYRA 4NENB 1SD5A 5BR1A 2QS9A 4OBBA 5DNCA 1E3MA 3GVHA 2OQ2A 1YKGA 3HKDB 3AHEA 1DX6A 4GHWA 4JN6B 3H9UA 1HI9A 1HFKA 2JFGA 4JLKA 3KNZA 2D7CA 3H8JA 4GPIB 3QHAA 4MCAA 5DFAA 4C7VA 2G36A 5DH9A 4HGNA 2ADFA 4RHXA 4DIDA 5HXAA 2PD4A 1K7EB 2B69A 1ARZA 4WEQA 1O54A 2WG2A 1JG7A 4WUTA 4ENWA 3GHHA 3GRVA 3VVMA 3WKAA 1I80A 1BXRA 5FWAA 3GFFA 4E2FA 1X6VA 2ISQA 3KQKA 3R8CA 1PBNA 3NYRA 4J0DA 1KI7A 2RGWA 3LKBA 4M38A 2VS1A 2X4IA 4ZU6X 1RHMA 1XHEA 2X5NA 5FUQA 3ORQA 1JKFA 4YRMA 3NEPX 2J0SA 3NWPA 2OK8A 4KWEA 1PQYA 3D6UA 3C3KA 4Y6PA 5DU2A 1DGQA 3EWAA 4JBWA 1YUMA 1JBQA 4P4SA 4R98A 4V1CI 2JIZD 2Q0QA 4Z3DA 4GSLA 3ZPXA 5LU9A 1QAQA 2XZLA 2H4WA 4NV3A 1RI3A 2IVZA 3PNPA 1SCUA 4I3FA 2W2QA 2XY4A 5JMPA 3X2FA 3ZHSA 4B76A 4AC9A 4YCMA 3M1IA 1KK0A 2BBWA 3G5UA 3KOMA 3LK6A 3RUHA 1P45A 3WJ1A 3QBEA 5TRTA 4BBPA 1KBZA 4K6OA 3DTNA 3DGFC 4FCTA 3DB2A 5CX4A 5EFOA 2NZYA 3I8SA 5TQVA 3UOAB 1R0YA 3NM6B 1NF3A 1CYDA 1D7AA 2QW1A 2W90A 3MINB 1ST2A 4G0OA 4L4ZA 3ETDA 5C35A 1ZCBA 3SQWA 4GE3A 3DOJA 3SX4A 1AQ6A 2O7NA 4PTLA 3CF4A 4UEKA 3VPAA 3OE7D 5FUVA 2Q3DA 4P80A 2C99A 2QM0A 5E3JA 2QG4A 4E30A 4AQYB 2B83A 3HI6A 3ND5A 4I1IA 2CK3A 1E8DA 1SWWA 2R7AA 3IDAA 4MZXA 1SXJB 1JG3A 2FMUA 3O92A 4Z1OA 5KYWB 3CF0A 1POWA 3MN1A 3OT5A 4P2GA 3BWVA 2CXTA 4V24A 5BSWA 7AT1A 1J2RA 5JWHA 1NY5A 1R00A 4M9CA 4DCVA 1NVAA 1PW5A 2X77A 3GJ4A 3RHTA 5LM3A 4OHKA 5JMWA 5D51S 2H9AA 1QP7A 4F06A 4RPCA 4ZGBA 4KAFA 2PZAA 5AVTA 3MW8A 4U7JA 4LQCA 1T4CA 621PA 1PV1A 2Y6UA 3JYQA 5JRJA 5J58A 3IOMA 3Q15C 1XPUA 3QRWA 4CTKA 3W2IA 2ZYHA 4IDFA 1K7XB 4ND1A 4FGSA 4LSWA 4W5WA 3C6YA 3EZYA 3KT8A 1OXXK 2IZ1A 1SN7A 2YZ7A 3AKEA 3KE9A 3R77A 2D2EA 3WADA 4BZWA 2IF0A 1QOPB 1WMFA 1TMKA 2DWPA 3HMKA 1P80A 2VZLA 2QJRA 1K6MA 1L1EA 1MZVA 1XRPA 3FWPA 1WB5A 1D2GA 2OV2A 3V8MA 5KNDA 1NVGA 2DX7A 1E4EB 1Q83A 3HUFA 4H6VA 2J3QA 4JT4A 5HTKA 1T6YA 5LYYA 1P2SA 1QHEA 2AS0A 3A9WA 1YR1A 3T38A 5ADVA 1UP6A 2EXXA 2PMBA 1GSHA 3CA8A 3D1VA 1KSFX 3OZUA 1WUTA 2CLSA 1AXEA 4UTZA 3SOZA 4PHFA 3TRHA 4UZFA 3OQ6A 1DKPA 4DM7A 1G7CA 3WIUA 1JU9A 1QX4A 3KEQA 1COWA 3H5AA 1A8SA 1V7QA 2BM1A 4E14A 4PG6A 3ABQB 1HNXB 2RGYA 1ZCZA 3NNSA 1YJ8A 1FVOA 4KO2S 5ILOA 4ZU3A 1CUVA 3N05A 4V2UA 1XSEA 2HWUA 4JENA 1SXGA 4YGXB 1ZXXA 3G02A 1P73A 2IKSA 2FR8C 2R97A 3IP5A 2FLVA 2VIIA 2AIRA 2FFRA 4FD2A 3CVWA 1LDEA 2SKCA 3JQBC 3VRHA 4YR9A 3A6PC 4QBGB 1IN1A 1G2IA 2G76A 3GY0A 3KRTA 4AP6A 1TADA 5H4GA 2F1RA 4G8BA 2FW9A 3SF8A 2DETA 4QHYA 3ZHYA 4I9GA 1OFUX 2GRJA 4YQEA 2B36A 3I5AA 3NASA 1I6KA 3L7IA 1ZZGA 2WP8J 4IJKA 4R1TA 1Z0ZA 1E96A 1ZW6A 2XRFA 5IC4A 3UBTA 1N5MA 1X13A 3UMRA 1WVGA 4E12A 3DAYA 2VPYA 4LS3A 4PC3A 1EGMB 2EVWX 5L45A 4P86A 5HA5A 1V6AA 4KQXA 4UASA 1LDBA 3TTXA 5F1PA 1L5RA 3O83A 2MINB 1V1RA 1RI2A 2HMTA 2I3BA 3G2NA 4MW0A 3I05A 5D3QA 4RZSA 1ZN8A 4Q05A 3FVQA 4MVYA 1S3SA 5B58T 4UAVA 4YV7A 2J5QA 1JJAA 5PGMA 2KS6A 4F04A 4RDIA 5IUNC 2IOYA 5TMEA 2Q5IA 1VJ1A 4OI1A 5EXEA 4KV9A 2BEWA 1KMHB 1TKRA 2QUBA 2X7XA 4KDRA 1TYEB 2F3SA 4M7WA 1G1MA 4Y6OA 3LWNA 1JDBB 2G9ZA 3FW1A 3N8GA 4G1EB 521PA 1E2HA 4X92A 2BTEA 1D3AA 1ESCA 2ZWVA 1JR3A 4AULA 5K3OA 1L5WA 2X8WA 1QIJA 4O08A 4RGBA 3IQZA 4QVKA 5BWMA 4HSGA 3UMMA 1OLSA 3QE2A 3QKSA 5CR9A 2OGTA 3R5JA 2IYSA 3AJDA 5LPNA 1PS8A 2CNLA 1T4BA 3FPBA 1KORA 4P5DA 5BWCA 5I7EA 4ND7A 4MVXA 2V6IA 1U81A 2LGJA 4CKBA 2ZM5A 4LXIA 1F8UA 1OQAA 2NAPA 3LQ4A 4LXGA 4PZ0A 2C8KA 2P6PA 4M99A 3QK7A 1EXWA 4Q7JB 4WD3A 2VTDA 5E4FA 5F4BA 2XJ4A 3IUMA 1M0EA 3R4CA 3OTWA 2PXHA 3Q3JB 1SHLA 2VKTA 3SQLA 5L7WA 2ZRQA 1OILA 1VE9A 3DLPX 1M83A 4RY0A 4YIHA 1ISJA 1A1VA 3QVUA 4MJ7A 2VPTA 3THWA 4WJKB 4KWTA 2VR1A 3GEEA 4QXMA 2RGBA 5FNVA 5BWNA 4DIMA 1U3CA 1UT6A 3IIKA 1N1EA 3D43A 3NG1A 5A2QA 5DX0A 1X7GA 2OV8A 4Q1EA 5T4HA 3X1YA 3FOZA 1DEHA 2UXDB 3I76A 4OMUA 1OZFA 1I1OA 3NUQA 4PZUA 2GAAA 2BONA 4RZQA 3VOAA 3SWWA 1O58A 1ZJ5A 2CCJA 3CTPA 2J3KA 2XADA 2XTAA 3QPAA 5IN5A 1NNI1 1P74A 4AZWA 4QM7A 3VU9A 1S2IA 3W34A 4OCZA 1OWNA 3HR4A 9ABPA 4GDFA 2DFPA 4G0VA 2KLHA 4XVCA 1GCGA 3II6X 3ZX5A 2A9JA 3PVCA 2DULA 2E1PA 2HBZA 5I7SA 2O8CB 4P0QB 2BEKA 5JAIA 5TQ2B 2O1XA 4OHMA 1V2HE 4RL4A 1JDPA 1J0AA 3OCVA 2AYXA 2Q45A 1XU7A 3PCRB 4HEA6 5TC4A 4EGSA 2H3EA 2GUGA 3EGXB 4CMAA 5HE9A 5BUCA 3IBGA 2LD4A 4G4JA 2CD7A 4DTCA 1RADA 3KFXA 3KPVA 1YVPA 4XTRA 4YJ3A 3OCJA 4HWKA 1AKVA 2FSIA 3G9QA 4P5PA 1P6UA 4UJ5A 2OWEA 2Q3CA 1QZXA 1SHZA 1D2EA 5KEIA 2JIDA 3HKEA 3I62A 1RABA 3ZD9A 4O2AB 1CP3A 1NX6A 4KR9A 2FVYA 3JZDA 4S1TA 4K9OA 2B61A 1VKHA 4WERA 4F91B 4S35A 4RETA 4D4KA 1XTTA 4XCQA 1UDCA 3RYTC 5EWMB 4QTUB 2HMWA 5LZ9A 1QIDA 1TCUA 3TLXA 1QFSA 4GG1A 4XYEA 2SECE 1ZPDA 4C3OB 1IY0A 2GKGA 1H69A 4J7CA 4Y6GB 3CXRA 4ARUA 2RJ3A 1N3BA 3DT9A 1E98A 4QNNA 2ORED 2WQ7A 4UVGA 1AXGA 2X8BA 1U0SY 4J7AA 5DWDA 2X6TA 4Q4AA 1I2ZA 1GL7A 5EXPA 2CT8A 4PWZA 1UJCA 2GN0A 4Y9DA 3ZWXA 4OBEA 5E1OA 4K9RA 1S7GA 1JQDA 3K0KA 4D96A 4QBFA 4Z4GA 4ND5A 1FNCA 2CWDA 4ESEA 3M1YA 3ZVKA 1ADBA 1Z5UA 3OFJA 4DRXB 1E9EA 2QQEA 1R0CA 4CR7A 2X0JA 5I8ZA 1E5QA 1I51A 4L73A 3R7WA 4ZFNA 3GQBA 4F5DA 4RXTA 4C08A 3DMTC 4GOXA 2OC4A 2J41A 2OHGA 3RJ5A 3HDYA 1DCMA 3H2IA 1VB3A 3NUGA 2EYQA 1IG0A 2IBMA 4TLAA 4MS1A 4C4OA 5AXBA 1CUJA 1IN6A 1SOWA 2QZZA 4X1YB 1Y5LA 1ID8A 4RVOA 4JGBA 1E3QA 5AH0A 5IDWA 1K8YB 2FZKA 3U81A 3CBGA 3PFGA 5B3KA 3PTAA 1RQ2A 5IZCA 1OI3A 5DW3A 2E55A 3N2YA 2YFHA 1GTG1 5IH3A 3DEKA 3OEHA 3ROKA 5BV0A 1JJVA 3ZH9B 3ZQUA 1YZVA 4LI3X 2P6RA 1HDIA 1NJ8A 2ZRAA 3L0IB 3N7TA 4BLRA 4PW0A 4ZYVA 3GPIA 4INJA 1KF0A 3DFUA 3QNUA 3D8UA 1Y3FE 4D97A 3E6AA 1G19A 3N75A 3PTLA 1EPUA 5ALKA 4B3GA 1TCCA 3BMCB 4G5OA 2IUYA 3CW9A 3I2KA 1FXWF 4GX5A 3ESXA 2NO5A 5LXTF 4BL5A 3HFJA 3HHPA 4MIYA 1O0CA 3VJKA 5TQ0A 5E6RB 3L84A 2XNJA 4FWBA 3JYLA 4LF4B 4BO2A 1KI2A 4L8VA 1XDSA 4IHJA 3VVCA 2I7VA 4BYGA 4AJLA 4XW2A 3MJEA 1ILEA 1O94C 2R44A 4R8KA 4V3BA 1CUYA 1OI4A 4OYYA 5HBRA 1K98A 5AXAA 4H0FA 2AFRA 1C7QA 1YQ9A 1LBQA 1XZBA 3DEIA 4PGGA 4YAGA 1E61A 2A5LA 5CUQA 3VC7A 5K0TA 2C0PA 3IAFA 3A70A 1MXFA 2I3DA 2H08A 4LUCA 2OFXA 4NQZA 1Y5MA 2R7NA 3LLCA 3P0FA 4BMZA 5BSHA 2JIZA 5DBGA 1UBTS 4J49A 1K9VF 1EK1A 1J97A 3UWMA 3PFFA 1BDHA 2DWOA 1ZVVA 3EVDA 4Q1CA 4AKTA 2XD4A 2YS7A 3FWYA 4PCLA 1HDOA 2N47A 1JR4A 2ZBRA 4RSRA 4ZWNA 5BN4B 1VTKA 3ST7A 1P3JA 1H4TA 1R6TA 4MGZR 2A33A 3FPFA 3VJLA 4ARCA 4EWLA 2KLBA 1FX1A 3TIXB 3FGPA 1V48A 3KD3A 1WCIA 3QLVC 2L42A 3QUCA 2ZW9A 2GKOA 3QVGB 4GKAA 4OIFA 4XLLA 5EIBD 1ABFA 3IDFA 2ST1A 5F35A 5DLPA 3PYLA 6GPBA 2YOGA 1C7JA 2C9BA 4HV4A 4F6RB 2ZQYA 1FMTA 3BJRA 4J0IA 1PO7A 2HU7A 1KZHA 5A4JA 1MVOA 5ESRA 4ZAYA 1OCEA 1ITZA 3EE6A 4KMSA 1LQ2A 3W5CA 2IGBA 2FOXA 3OCWA 3TIIA 4DVGA 1NKVA 5CGZA 3QFRA 4G1BA 2W71A 1XTSA 3EVAA 2NOAA 1PG0A 1ZWKA 3KSBC 5B3AA 3SIXA 1JAHA 1Q2UA 4TV9F 3TQTA 2YTZA 1PIWA 4MWOA 4C43A 3KS9A 3T7IA 2A1TS 5IHXA 1CKEA 4LC0A 1ZKDA 5FAXA 3ZI0A 1JFVA 1CFZA 1KI9A 1TEHA 1X94A 3A6KA 4G5XA 4ML3A 3W05A 1CHDA 5BSGA 2V4MA 1NE7A 2HUNA 1PUJA 4MWZA 4HOYA 5I47A 1DBRA 1ZSVA 2DUNA 4WCVA 3TLZA 1MTZA 3VNRA 3SEQA 4YT2A 5JJCA 4JV5B 4UU7A 5B4UA 3VNAA 2F4NA 2NQTA 3QJ5A 2QTVB 2J3DA 4IWYA 1NT4A 3V8VA 1T3LA 2Q5JA 2PY6A 3ZHRA 1ZU4A 3KXIA 2H2GA 3BF7A 1IG3A 4MVJH 4Y2JA 4D43A 4QLOA 5CM2Z 2G71A 4ER5A 3SYNA 1T5DX 4BQFA 4ZCRA 4FU0A 1EUDB 2F7SA 4Q4HB 3W1VA 3AZQA 3O2QB 3VI3B 1P0IA 5C1BA 4TYYA 1U8TA 2GNAA 3G89A 2BF7A 3AKDA 4TMZA 4B79A 1JQLB 2ZPUA 3CCBA 5HRCA 3LC2O 1W9HA 1TK3A 5HP4A 3CHYA 2D1SA 3V6LA 4GI2A 2EJVA 1B42A 1GN9A 1JILA 2JAUA 2QD2A 3CCFA 3PA6A 1AKYA 4IYJA 3F5FA 3RDPA 2SHKA 3LXXA 4JX9A 2LCQA 1FYVA 1II8B 2HBYA 2XE8A 1G9TA 1SCKA 5IC6A 3DLBA 3TSYA 4OGWA 1X80B 1NRWA 3M6UA 4A03A 2JKYA 3CH5A 1NN0A 3D54D 5IJ9A 1TRKA 5FLEX 3S27A 5DI9A 4M89A 3JW8A 2VJCA 5EHNA 5BV8A 4HQFA 3EFOA 3LCRA 2JK0A 1VMKA 2CNKA 3A9RA 2QMZA 4ZQCB 2ZI3A 2MYNA 1W52X 1B8UA 1GQRA 3E9DA 5BMVF 1TEVA 3PWZA 2JI9A 1IUNA 4D9NA 4LI0A 4H1VA 4UATA 3W0LB 4F71A 4C76A 5C5EA 5KOIA 1JHRA 2KPOA 4NC9A 1TFRA 3AF3A 5CP8A 2YQZA 3TAXA 4A73A 2ZBVA 2QV0A 4D0RA 5KZMB 4D4MA 1BEEA 2QNBA 1K89A 2W7TA 5EKXA 2Q1YA 3L0CA 5J1SB 1FP4B 1B0AA 3Q5GA 2VHZA 5ANRB 1YUBA 1K4YA 3AIKA 3B6KA 3QYPA 4G9EA 2WU3A 4P4LA 1KAMA 2PBRA 4RS3A 1IYZA 1JYSA 2JZCA 1VJTA 3C8UA 3O2NA 1PZXA 2AA3A 3WBBA 1U0TA 3E61A 4ABYA 4YP7A 2AC7A 3UOGA 4W82A 2RIRA 1CE8B 1XVLA 3QNMA 1X8KA 2RC6A 4CIWA 1V3UA 2V58A 1FYEA 2J9RA 1QCDA 3U13A 3GGOA 3J7TA 1D07A 2XCUA 4MUYA 3HJRA 2EFCB 3LE8A 3I5XA 2OBMA 3CMMA 3QA9A 2BE7A 1ENYA 4IIXA 4GD3Q 3ZQ6A 3ZJ5A 4ZHQA 1J1IA 3F3MA 1ZOIA 3H4TA 1QLWA 1ZRSA 2GBFA 2N1MA 3WGMA 4A82A 6REQB 2O8FB 3HABA 5G0WA 3PKJA 2YICA 4E5MA 1M67A 5AK4A 1J9EA 3HBNA 5FIUA 2IYYA 1ZX1A 5EQDA 2IW3A 1M7BA 3JQGA 3P9CA 4R69A 4AZVA 4ITVA 2GO1A 1IQRA 2H5JA 3FUUA 2HXSA 4AY3A 4RDXA 4FEYA 3BTOA 1ZNWA 3AY6A 4BNIA 1WOMA 4BVHA 2C9MA 2QVLA 1CQIA 2QTRA 2X86A 4MS3A 4PSDA 4ZDKA 4ZOEA 1EWKA 1QDUA 2E2WA 5CGQB 5C1PA 2PU5A 5LDDC 2O2GA 3TDKA 3U6BA 1Z9BA 1L5ZA 3CRQA 4KR0A 1NXSA 3I12A 2JD0A 4Z0TA 5IDVA 4WACA 5LBTA 1GA1A 5ABPA 2C57A 4WFQA 1E2QA 1X74A 4EFMA 4ZI7B 4B34A 4LYDA 3C4VA 2CE2X 1YZLA 2C1XA 3DNPA 4J1NA 1T8TA 1JXAA 3K94A 1SWVA 3MAJA 3NC0C 2I8LA 4GLOA 4P22A 2RBKA 2P9ZA 2QT0A 3EMDA 3LX8A 3MC1A 4WVFA 5AR1A 2X0RA 4M1TA 3TO5A 4F96A 5JNLA 1U1IA 3DW1X 4BKRA 1TLTA 3PCXA 1JLRA 1RRKA 2FYTA 2VI5A 5BY2A 3ZZTA 2FY8A 3N8IA 2FJUA 5CEFA 3CLRD 3ICPA 2NU7A 2QTZA 3VVLA 3EIWA 2G70A 3BXFA 2O8DB 1YRQA 4U2BA 4H4EA 1E3TA 2X7HA 1FFDA 4HFNA 1KAOA 3PXUA 2FF7A 3AFMA 4NXNB 2IHNA 1CTQA 4BPBA 4HHEA 1A7KA 4OGKA 1CUFA 1GZHB 5LQNA 1MAAA 1PDVA 3QFFA 1Q84A 3PQDA 4LKRA 4WOPA 4DCPA 1U31A 1X7XB 2PRIA 2ZFUA 2DY0A 2Q9BA 1AO0A 5K8TA 3FLEA 3KC2A 3B5EA 2YDXA 3HB5X 4DV0B 1NDHA 5DX1A 3I34X 3U1BA 2A0WA 2QF7A 4BKQA 1NXOA 1K2VN 4AUKA 1TFUA 1T43A 2R66A 1JQAA 3MJFA 4GMFA 1YZGA 1CF9A 1WY5A 3KWLA 2FJ0A 1M75A 4UBMA 4EJ2A 2WAAA 3TLGB 1LEHA 2AEJA 1FP2A 2FEPA 3QG1A 4U3JB 3TW8A 4DGSA 5EJ6A 2UZ1A 2OZEA 4PBTA 4QDTA 4UKDA 3G8BA 5IABA 1VGRA 4IIJB 3T5DA 3VA7A 2ERCA 4BO1A 3K53A 4I1RA 2DCUA 1ZGHA 5J4LA 2X0NA 1DAHA 4D4GA 1MIOB 5GJVC 1EIZA 2HWXA 3CZ9A 2P2SA 4XGKA 1AK9A 3CVOA 3FTQA 4RF5A 4MAAA 4CQMB 5H8WA 3K70D 1QFMA 1I5RA 4UVIA 5B36A 3TJMA 3AIOA 2YV2A 1IZ7A 4QDOA 4ARSA 4EI9A 2IWRA 1CCWA 4CN8A 5KNBH 4JZYA 4EBFA 1VPWA 2ZJ6A 2CXSA 2CKDA 2JCGA 3ANSA 1YZ3A 4IIGA 1AQNA 1XNQB 1PS9A 3GGJA 4F3YA 2G77B 5ILQA 1LJUA 3D6FA 2ZTHA 4NYIR 1MABA 1BVUA 3NGXA 5EZQA 2WKRA 3UANA 4AURA 3RUFA 1TZCA 3W7BA 1JQ3A 1NDUA 4WZZA 1OAAA 3S7TA 1R6UA 3OZGA 5ICFA 1QV7A 4CIBA 1C0KA 3X2EA 1XTIA 1P3Y1 2Q9CA 4OB6A 4COOA 3Q7QA 3HXKA 1U9YA 3LTNC 1V7PC 4LXQA 3C3MA 5B7QA 2IP4A 3BBLA 4E1VA 2DERA 3HU1A 4AY6A 2GF9A 3A6JA 1B2RA 1U04A 4MWEA 1L5YA 3GELA 4P93A 3D7KA 3CLTC 4L5BA 4N7MA 1IWBB 5IVPA 1KJWA 2JRCA 5IKPA 4JB2A 2REQB 1LK7A 4W5QA 2QXUA 3PPYA 2XYVA 3CFYA 4KQCA 4OG2A 5AICA 5FNZA 3ZV3A 5ERYA 1QS0A 1RXSA 4MWTA 1VYTA 3OX4A 5LMNB 2OXRA 4HWTA 3PGJA 1JF8A 1TKBA 1NVMB 2NZVG 4N5NA 2UYOA 3DVLA 1NOJA 1O57A 1NXPA 3OE4A 4GQAA 1E7YA 2XGGA 3I6YA 4BMXA 1U1EA 3BH7A 1C3EA 3AHDA 3KOZA 3DVAB 1LZLA 1ZOPA 4QOGA 3MCVA 5EQFA 3QXXA 2H2DA 1C81A 3AESB 3LUDA 4XFJA 3E9NA 3GMTA 4KXQA 4QREA 2OV1A 4AZTA 2HRDA 1MDBA 5C4IA 1Q22A 3PNBA 4IBOA 5JCOA 5IAAA 4TRMA 4KZPA 1DPFA 2CDNA 3B1JA 3LLMA 5D85A 5KTNA 1XMVA 2I2AA 1XPRA 2FSGA 5CLIA 5DDIP 4E4RA 5DSXA 1F0NA 3H1PA 3SYKA 3L4EA 4AJNA 5LUBA 4WXYB 4CMCA 2O6HA 1Z47A 5B30A 1AHNA 3NDJA 3AERB 4BYMA 1QFZA 1Z0AA 4NI5A 4NYMQ 5CJJA 1QZUA 3RFUA 1XBTA 2XE7A 3U6KA 3JQ9C 4TMTA 1V9SA 4AJ1A 1I0LA 1X7HA 2XUGA 1WVMA 2EAUA 3INNA 3KM0A 4I2NA 4ZT3A 2BGWA 2FMIA 1NVXQ 3MXTA 4HDSB 3Q2IA 1RQNA 4NK5A 4TT8A 4J1TC 4XARA 2BZ0A 1IBCA 4WASA 5FO1A 3F6YA 1GYQA 1IAVA 2DHQA 2Q49A 5JAHA 4A7PA 3D8RA 4MINA 1GFSA 1TCAA 4OQFA 4MVJD 5D3MB 4OP3A 1ZBDA 2BHTA 2NZ2A 1ZCFA 3R0XA 4LYYA 4YMHA 4ZIRA 3NMUF 2ZAMA 7MHTA 1YDFA 4L27A 2GXSA 4XQCA 4XGRA 5D3KA 5F5LA 5CD1A 3QVXA 4Y9SA 4F3TA 3GEPA 4C5CA 1V41E 4W8OA 4XQ0A 2BR3A 3QYFA 3X1WA 1OH8A 3ETEA 3GW8A 1KPHA 1AUOA 1U90A 1W4ZA 1XJ0A 1JHZA 3HA7A 3L0ZA 3NX4A 2IDJA 3UKOA 2PGIA 5ULLA 3L46A 3VBCA 1N2CE 2ERYA 3AXSA 3IBTA 3PKIA 4EVSA 4Z8XA 1FU4A 5CITA 3G5TA 2FZ5A 4IX1A 5DOZA 5FWYA 5HQ3B 2ZYAA 3R9KA 1NGSA 4FEAA 1T26A 1N7GA 4XOIA 2WTXA 4FYJA 4O2LA 4Z0HO 3OI7A 3ANLA 4LNHA 2DFLA 3JPWA 5IARA 1V5EA 4UPEA 1SBIA 1VFNA 8MHTA 3ZGLA 3BHMA 4K9SA 4EM6A 3GRYA 2ZSJA 4HUQA 4A8HA 2RHCA 4C01A 2XLBA 4ZODA 4I3HA 4KH1A 4BU0A 5AM2A 1KEVA 1H23A 1WXXA 1ZGGA 3P4UA 4GMHA 3ANYB 5KVQA 2EW8A 4AUMA 4O3FA 1E69A 2NX2A 5CW2A 3B6EA 4R9RA 2MOKA 1QO9A 4KCGA 2AUTA 3VR0A 1L1FA 4MQ5A 4OXYA 4E32A 1HDXA 1R8YA 2JKVA 3IE0A 4WKCA 3RK4A 4CL0A 4QO7A 4EYSA 2O54A 3MRTA 3ENQA 4GUAA 3H99A 3KDPA 4OQLA 4TM8A 4NNOA 5FLKA 3OIYA 3AILA 5C3UA 3BOSA 1C9DB 2VDWB 1FRNA 5LJIA 1A77A 4N5DA 1ZICA 3GYBA 3AT1A 1THGA 3IR7A 4KEAA 5ETJA 4B3BA 2O9JA 2QENA 4B3FX 2PQ0A 4KP7A 5HOEA 3A37A 3E2IA 4LCBA 3R7LA 5B55A 2EJUA 1W73A 2VLBA 3U3OA 4F5YA 3BL5A 2TYSB 3KKOA 3E27A 1FYWA 4O6VA 2YXNA 1MX9A 5GONA 4CKXA 5DP2A 5F1OA 2I03A 2YZGA 5FWXA 1Z8DA 4C3VA 4IRMA 1N9GB 4A6DA 2XR1A 3JATB 1YTLA 4O4HA 3T3HA 2DBZA 3DKRA 4Y30A 3B12A 4HNVA 2H1LA 2NT4A 3DOFA 5IW8A 2IDKA 3RVKA 3H4MA 3AL3A 1DLIA 1JJFA 1I1QB 1X15A 3KTOA 4HCJA 4QQRA 4DCUA 3T0GA 3A58B 2G9NA 3H9GA 2Q3BA 3OHSX 2VP6A 4BP8A 3AOEA 1JEYB 1M0SA 4BWYA 4CMEA 3H2JA 4XB6B 4X66B 2V7WA 2GRAA 3PC8C 4FYYA 1A9ZA 2A0YA 2H63A 5IULC 3BZWA 3LUJA 1GCAA 1VL1A 2NYAA 1T1RA 3NS7A 4RK1A 5G0TA 4B8WA 1WLYA 1U1DA 4JASB 4A4DA 3NTRA 1P72A 1RZUA 3BKWA 4MR7B 1DIGA 2XE4A 1P44A 4HVLA 3E7PA 2D59A 2REXB 4LISA 2HHJA 5CA1B 5CH5A 4FFNA 2A9PA 3R1IA 1PKXA 1VKJA 2ZROA 1MR3F 5FPHA 2GEBA 3HJCA 3MWJA 4N0QA 2YKGA 4TZ6A 1KK1A 5LQAA 3G0HA 3FG9A 3HCEA 1Z0JA 3MJDA 3ZQ4A 1AA6A 3ICEA 3FMPB 1BJTA 1FCJA 1H8HA 4URYR 2HWYA 2SICE 3EA0A 4CT0A 4G0QA 1XL0A 3H5LA 2CMGA 4JQZA 4M46A 3ZGOA 2Z57A 1JNXX 5AW7A 2QX7A 1BH2A 5DE3A 3NWOA 5IXSA 4BRUA 3SSAA 2NWQA 2B5WA 1G6OA 2YH2A 2UZ0A 2VF2A 1CLUA 5CAEA 3JZAA 4DLVA 1IJBA 4HB3A 2JFBA 2R4QA 1NPTO 1C3LA 1RZVA 3M83A 2R6CA 4V0SA 4PFKA 3LT0A 4CKZA 2DPYA 1ICEA 4D81A 2TMGA 2GN9A 2C2BA 3CWCA 1BKYA 1ZIYA 4KUGA 2C97A 5HCNA 2ZYGA 2R6JA 3H3JA 4UOQA 1R27A 3V4VB 2BJWA 3VPXA 4FTWA 1XRJA 4GOKA 1MEEA 5JVDB 1HQKA 1HM5A 1KMCA 2OCPA 3NBYC 3LYLA 4R31A 1P5RA 2PCLA 3PGA1 4U8GA 4F45A 5KU7A 1P2DA 2XD9A 4HBZA 4H08A 5MN4A 5KNLA 3EDMA 5JZSA 3CT4A 4D44A 1F12A 4AB1A 5CB4B 3SIPA 1AQLA 4UVHA 2W6ID 4G89A 3WV5A 1DLJA 2ZAYA 2A5JA 4BNJA 1JPJA 4PFSA 3LBHA 4Y0NA 3I2FA 2Q0XA 5TEWA 2PGAA 3V7YA 3TB6A 2XUFA 3ZGZA 4KQKA 5HDQA 1E3IA 4N0DA 4IFIA 4PO1A 2CEAA 3IEIA 4EYGA 2HA4A 3FPJA 1HQCA 2VRCD 1Q0HA 4HWGA 4TRNA 1UJ5A 3H2ZA 2A5YB 3EIXA 1IIRA 1H3FA 1XUOA 1W0CA 2RARA 4RQTA 2A57A 5ES3A 2KE5A 4UBNA 1DC5A 1XGKA 5CVTA 4QYIA 2YN0A 4GMKA 5H0IA 1ZNYA 2NO1A 3D7SA 3TSWA 1UC8A 1FNDA 1MQ9A 5CH8A 3HYLA 4CV0A 4CKWB 5L8VA 1FSGA 2G3YA 3NIDB 1E3LA 2GZMA 4YBZA 5C32A 1BE8A 2DECA 3ADBA 1HQYE 4P32A 3JQAB 5ALYA 6Q21A 4MNTA 1YD7A 3D1JA 1T8RA 4KQ1A 1OFTA 4L07A 4QGBA 2WYOA 4IXDA 4PPYA 2IV7A 3REQA 5HF9A 3VSAA 5CB0A 5G1NA 1EB8A 2GT1A 1W19A 3FF4A 5FBRB 1Z37A 4UPDA 5K0LA 4HZUA 4F2PA 3N74A 4DDUA 1NPYA 1OXUA 1WABA 2BV3A 3PFWO 3U60B 2Z6QA 1UP4A 3V8RA 5G53C 5BQPA 2VSYA 2E4WA 3KYCB 1H0RA 3MAAC 1O4VA 1PGJA 5C1OA 3BIFA 5ESWA 5EPUA 1NG9A 2CUZA 1XZAA 3LFUA 3OZTA 4NENA 3NOQA 5FA6A 3F8TA 3FKSD 3WKEA 1Z26A 1S2LA 1ZMOA 2YMMA 3CLUD 3D8TA 3DFFA 4WLOA 4A6EA 3C8HA 4O2BB 4D9JA 3HKDA 3I58A 2YVAA 1KTVA 4KXUA 4TRJA 1JQBA 4INPA 4NOLA 1I5OA 1YE5A 2YHSA 1U7PA 3C48A 3K2BA 1FFEA 3VPDA 4BGUA 4YMVA 4RTOA 2XRZA 4WZ6A 3U4QA 1V8OA 4L2IB 2JH9A 2MIIA 4QAQA 5AUPB 1GY8A 1QTRA 3DEAA 1IXRC 1J23A 3BK2A 4S24A 4YXWD 1HSZA 1O5IA 1H8ED 5FOQA 1IMOA 1LBHA 1PLLA 2I7XA 2R5WA 3CLSD 3ID6C 1OUMA 2NXEA 3H7IA 4OSPA 4P33A 4EG4A 2VTVA 3HB4X 4J76A 3SC6A 2H7VA 4Q16A 1P4JA 2WHYA 1AY0A 3JTEA 5AI4A 4G25A 4XR9A 2XWSA 2FN4A 1M6EX 2PE5A 2EIXA 3ZWMA 3FMGA 3UPTA 4R40A 1UXJA 5D1HA 1UKAA 1U5AA 2JFYA 5H80A 3GVXA 4JP1A 1JHUA 2PG3A 4I6GA 3WRVA 2NXNA 1DQYA 1TCBA 3QHPA 3ZZUA 3GVPA 3ZI7A 2E37A 2BMJA 3DAPA 3ZE2B 1E6LA 1V6SA 3JRNA 3AKYA 1YZYA 1G6Q1 1U4NA 2HFJA 1CY7A 5DHTA 5K2OA 3E5RA 4ZJPA 2P6UA 4HDMB 3RREA 1CUAA 3OLCX 2IT1A 2VNIA 3MINA 3QEOA 4O1MA 3GPLA 2C7OA 1WZEA 2QZJA 2R5NA 5ALRA 4H3SA 5F5XA 4EQZA 2ZS7A 2ZB4A 4A91A 3IIEA 1QHXA 1YS4A 2H1CA 3LF1A 3WLHA 2O23A 4KQWA 3K71B 3B51X 1ZG3A 4TTRA 2ID7A 1GCOA 3FAZA 5D5QA 3UK1A 2H2WA 1PT6A 4C0QC 1KJIA 5TGTA 1Z07A 1SXJA 3TPZA 4UHDA 3DVQX 4GWLA 3I6ZA 2EERA 4XIYA 4MH0R 5DCYA 4S0ZA 1PGPA 2EG5A 5LNK6 5JAQA 2XOKD 5MGNA 2ZAOA 3M6FA 3B20A 2EJCA 1N7HA 1FLAA 1Q1ZA 3PC6A 4IH1A 1AC5A 4DLUA 3U4CA 2F8TA 2IGTA 5I51A 5HMLA 4MUAA 2XGJA 2NYVA 2RC5A 4FUTA 1E9BA 4YCDA 4KXFB 1ZIPA 3E1KA 2ZIUB 1UBKS 2D5LA 1BS9A 3BDAA 3GRKA 4JWKA 5EPEA 4DEYA 4EUNA 4CEJB 3L6CA 1LB1B 1OPXA 4DDHA 3BGIA 2JVIA 1N2GA 3VH2A 4XVUA 4WK4B 4FNGA 1E1DA 4IDBA 2GN8A 4RHTA 4I4CA 1X1EA 5A5GA 4BXOB 1MJNA 1UBGA 1HMYA 3DE6X 2QRQA 5EG5A 5J23A 1YL7A 2GZAA 3JQQA 1I4LD 1U9ZA 2BCJQ 1MOPA 2HA0A 4HGOA 1ZMBA 2X3YA 5G1OA 3AY0A 4C4PA 1FLDA 2C2MA 3R7BA 1KI4A 5B2FA 4O3MA 2I91A 3NIGB 4ALJA 3K31A 5AW2A 2Q3FA 2MTBA 4CL3A 1E4EA 1G41A 1QE5A 2VSOA 3A6DA 4E2XA 2PWBA 5FO0A 3G9XA 3L0PA 4BJ6A 3M4YA 1ODTC 2QYHA 1Q6ZA 3WGTA 2FZVA 5IBRA 3KEMA 5H3CA 4FYPA 4Z9AA 4JI5B 3SJUA 1DZIA 2PLWA 5E2BA 2HSGA 3KR9A 1GQYA 3IC5A 3OM9A 1YXMA 4IDNA 3UJPA 4MDFA 2ODAA 2EW1A 5EHZA 1FOEB 2OP0A 1VE3A 3HY4A 4LKOA 3E3AA 3I6IA 1E7SA 3UQYS 2ZIFA 5K0EA 1XAGA 4ITUA 3MD9A 3UUWA 4EI2A 8AT1A 5IASA 3LHDA 3NHKA 2WU4A 4NOJA 2B94A 4RXUA 4BBJA 4P84A 2B4YA 3R44A 2Q1XA 5G2OA 3DP7A 3IA7A 2OZLA 4MVJA 4BC1A 4Q02A 4WKBA 4JVLA 4M1YA 1W49A 4ZJUA 1LKZA 4F2DA 4QPJC 2P35A 5FD8A 2IP1A 1X0XA 4MV0A 4RV9A 1Z5WA 3QX3A 1PZFA 1VL6A 2EZ4A 3RO7A 3QUSA 4UNNA 3RSZA 2BL4A 2H1WA 4LOLA 2B4KA 2VA9A 3ELYA 4QXRA 4WBXC 3LVFO 4D80A 1X1BA 2EDAA 5CXUA 3WTCA 4YAEA 3GLFB 1NI5A 1KNXA 3HJHA 1IHUA 3THXB 2XQJA 3H65A 1DNPA 2I1WA 2WF7A 2IY8A 3LGSA 5DHRA 3K4HA 3SQXA 2Z08A 4L28A 5T57A 4ZKEA 2MINA 4E51A 1GTVA 3UF0A 1KC1A 4LJRA 3NBZC 3F5MA 1GTRA 4RMNA 1DXYA 1KK3A 2BM0A 1QFYA 4UZEA 2VJPA 1XOIA 4TKUB 2RGUA 1JT9A 1WZIA 2G07A 3JYOA 4D3SA 1KMHA 4OFWA 3UYKA 1NQXA 2H54A 4I55B 4PZCA 3UVEA 3JQEA 1KI8A 2HHAA 3JQBA 1IXSB 1K5PA 4J16A 1ZM7A 1MA3A 4IIUA 1Y82A 3RSGA 1QG2A 2XUQA 1X38A 3P71T 3QTTA 4XSHA 4Y7CA 4ZKDA 3HJFA 1DAIA 2QU7A 5K09A 5EKUA 2FRXA 2BRUC 2XWPA 4RVSA 3QI7A 3RUAA 3BEDA 4BVFA 4YMSA 3CY6A 1E5DA 4OFXA 4U39A 3JQ8A 5C1IA 5ALFA 1K3UB 4PLTA 5JATA 5TVKA 3EDRA 3JQPA 1Z12A 2Y66A 4LHSA 8ATCA 4CBVA 3AV0B 1PT5A 3EPPA 4TT3D 4BX9A 4ZVLA 4M0KA 4QU8A 3WB2A 2QLTA 3DLCA 2PM8A 3BGVA 1WU7A 4GH5A 2GZ1A 3T3PB 4EUSA 1JR6A 4AKHA 4XDHA 4ZRDA 4BLPA 4TXJA 1X7DA 4O4JF 3BXGA 2I7CA 4KR2A 2Z6VA 2IZ6A 1EGAA 1FNNA 2O20A 2YRWA 3EXG1 3TQRA 4B5LA 4BNWA 1OA1A 3GGSA 3Q3IA 3Q3CA 4EA7A 4CEIB 3D3QA 3ROQA 3DBRB 2JFUA 1AG9A 3INYA 3ROMA 4K9NA 3FFBA 4C4RA 4TXNA 1PV4A 3KQQA 1SQSA 3R8XA 2HK6A 2I22A 4AN0A 3CF4G 4R2XA 1A71A 3FDZA 5BN5B 3EZ7A 4CTJA 3C43A 2IPOA 3LJKA 3VO1A 4B6RA 4OO3A 2RH9B 5ALLA 4KX3A 5EN4A 1P1RA 4B3DA 3KHSA 5LD2B 4U7PB 3ROZA 1AV6A 3HADA 3MUNA 3ND6A 3SM3A 1P3DA 4Q18A 3LX5A 4CTMA 3S2ZA 4XDGA 2H7XA 5EWJA 4JSYA 2IXGA 4ND8B 1CJTC 2QTGA 3WDMA 1KEPA 3EMVA 2JAPA 4RA6B 1KAEA 4C0AC 1PX0A 3IAEA 4HATA 1ISFA 2BMAA 4QFMA 2OBBA 2WBLC 3ZE9A 5JH7A 4GC9A 4Z49A 4CLHA 4AJ4A 3OETA 1RCFA 1UKZA 1MOQA 3Q88A 4G4IA 2E49A 2O8CA 1VCNA 2FZLA 3WA7A 4IUCS 5TQ2A 5AW1A 4PRKA 3E53A 2VT7A 2NADA 3TECE 4ZEOA 4UXJA 3W8FA 4BP3A 1PWZA 3F96A 2B3DA 4XAQA 5IVKA 4X1OA 1J07A 2Q4OA 3EGXA 1ECFA 5E7IA 3ZU5A 3MRVA 4A1FA 1X77A 2PUJA 8GPBA 3ZU4A 1FIUA 1N2IA 4AL4A 2DBYA 5IMSA 5BSMA 4B6PA 4GECA 4JC8A 4DEXA 2OG1A 2IODA 5ISMA 3MTBA 2AF3C 4KIJA 2HZBA 1B6RA 1BYIA 2EARA 1XK6A 2ZJAA 4F4DA 2V0GA 4XYMA 5B1HA 5B3LA 4WQMA 1UJ2A 2I8AA 4E09A 4PLFA 1Z34A 4O2AA 3ACBA 4NZPA 3IUYA 1VYUA 4EG0A 1TM4E 1AGPA 1JFFB 1PL0A 2IZOA 5FBZA 3NOOA 4S1OA 1GT91 1ZH4A 2HK8A 3L7JA 3Q6MA 3A3KA 2WV9A 3IVRA 4LSZA 2WZDA 4HTAA 4JMLA 3TL6A 5J5AA 1TMYA 4EELA 1KOGA 5EWMA 2ZRFA 2EJTA 1QONA 4YUVA 3P0RA 3TRDA 4OSEA 2GWHA 3L1UA 5KSOA 3CVVA 2YOFA 4I4TF 3ESAA 4IIDA 3T5CA 3V46A 1ORTA 3M5CA 1E9AA 1SIBE 2OGWA 2PMKA 2X2OA 3DB1A 3TRIA 3WKCA 4JLSA 2Y6VA 1UPFA 4RKYA 3GRRA 4QHTA 4ZMBA 5A62A 3H87A 4PHCA 1UODA 5J40A 1A5BB 1PVDA 4B6OA 1LPNA 3M6IA 3RFFA 1Y4SA 3AR2A 1OD6A 3ZE1B 2AXNA 1U0EA 4TVSA 3VR1A 1U2DC 2WWRA 4DRXA 3FDFA 4MRMB 4M36A 5BRAA 2D4HA 5AIBA 4RULA 4QVGA 1RVDA 1EP3B 3U5TA 1L3CA 1ZNXA 2XVYA 5AO9A 1Z08A 2LWIA 3EVTA 4CM4B 4OHCA 5FDFA 2W6MA 3ENZA 2H07A 1C3VA 3PQFA 4WESB 4AN4A 3O21A 4X1YA 5ADWA 4YT5A 3FRJA 1JVBA 4JYCA 5FHQA 3VZQA 5KNBA 4DLAA 2F67A 1QX3A 1GPLA 3RC3A 3G1WA 4KO4S 3ZLUA 4QLBA 2RAPA 3AR7A 5MF6A 3PTZA 1EE9A 1HSOA 3L8YA 4R9UC 3M6WA 5BVHB 4P53A 1Q3KA 4NF2A 3KKLA 3ZGYA 1OB2A 4TLCA 2ZBPA 1U0LA 5LOVB 1N7IA 2V9CA 3O91A 3BH0A 4IEFB 4AJJA 4GLBA 3TVDA 2Q3JA 3ENNA 1M2FA 4AIRA 5KWEA 1LRJA 2AOTA 4RKRA 4UC0A 3BMCA 3ELDA 4V0NA 1ZL0A 1NQAO 3D6NB 4JUBA 2W0SA 5GAJA 1PEYA 3VKUA 4XIFA 4D8VA 4M53A 5E6RA 1IOWA 3AF1A 4EW2A 4FIZA 2LCIA 1JLHA 4BN5A 1M34B 2OPHA 3LO8A 4RMJA 3VISA 4B3MB 4YXWA 4D02A 1XDBA 4YDQA 4JP3A 3DMRA 4ZVMA 5H1YA 3RUPA 1EHYA 2QRNA 4G0XA 2D7DA 3F1LA 4K5QA 2Z8XA 3VH1A 2ZYTX 2N0SA 2IE8A 1IM5A 2HWWA 1VL5A 4WY2A 3F46A 4LV8B 1U99A 2FG5A 2VK1A 3R6GA 1YAHA 3H18A 4LJ5A 1PWHA 2ZUDA 2ENUA 3F0TA 3NEAA 4MPTA 4L3WA 1I2AA 1ENPA 1V9CA 2OK7A 2Q28A 1YQQA 1U3VA 1FRZA 3ET5A 3GAMA 4DNQA 1H2FA 4CIYA 3HGTA 5J4YA 1A4RA 2HF9A 4WA8A 2WFZA 4KRXA 5BN4A 1N3LA 3CVYA 1ZSYA 3MNFA 4G0ZA 3SHOA 1SC6A 4FDAA 1RXWA 4OFZA 2V5AA 4LJ4A 1JB9A 1DSSG 1HG1A 4GUDA 4NNJA 4GKKB 2JAQA 3PRHA 3QVGA 2VZ0A 4WLVA 3L1KA 2P2GA 3GFPA 4CIDA 3EVCA 5FF9A 2C5GA 2Q41A 1O94A 3RYCB 2GEVA 1CUDA 1RE0A 3C3JA 2PIDA 4JELA 1BRTA 4F6RA 3HDVA 1BE1A 1U8XX 1UEIA 2PVCA 2BDEA 1T1IA 2F59A 2QM7A 2IELA 2LUOA 4HYEA 4EVIA 1Q7RA 1TE2A 3HB0A 3GJSA 2FE1A 5LVAA 2WEKA 1E4OA 3WYGA 1XD2B 1DDOA 3GG9A 3UY4A 3PT9A 3ROEA 3QNWA 1Y48E 4CYMA 1ZN2A 4KFRA 4QYMA 4L9SA 1O9BA 4BQNA 1QIKA 3OQJA 2ZSFA 4GR9A 2GNOA 4JHLA 4BMVA 3FNRA 3GGDA 3G5AA 2GVDC 2ZUSA 2ROQA 4O4LF 4RZIA 3SNHA 2XUZA 3VKGA 3A25A 3RC2A 4NOKA 1PZNA 2DG2A 1Q1NA 5DYYA 1V43A 1Z0SA 1NJ1A 1DJOA 3AFGA 4J29A 4TYMA 2C1EA 2Y3IA 3RI3A 5FI3A 4HY3A 4HXFB 2F6RA 2I71A 3A0RB 4INZA 4RZ2A 4WN3A 4C21A 1C3OB 4INAA 4LF6B 2A78A 4EA6A 2VXOA 1XLVA 3KKQA 4FE4A 2C4MA 2JCVA 3DNMA 5BT9A 4YJKA 1IEVA 2G5GX 5T6MA 3GHYA 4L3OA 4W1SA 4OXQA 1V45E 1EFVB 4B80A 1E58A 4KMMA 4UQLA 2QTVA 1B4DA 3C74A 2PH5A 1PQWA 2VDUE 3O4FA 1OAOC 3DDZX 4REQB 4BBZA 5C8YB 4IS2A 1L4BA 2ODQA 4RESA 3PHGA 3PUYA 1EXDA 3EGIA 3RRYA 2QLLA 2Y0BA 1KZ1A 1XLWA 3AUYA 5K9ZA 2B8EA 1GQSA 1MO4A 3IX7A 4ENRA 5C5IA 5JEDA 5GJBA 3I52A 5JD5A 4Q12A 4Q4HA 3ELWA 3GYGA 4LECA 3THOA 3I1JA 3WRYA 3RAPR 2AG0A 4HLNA 2RG7A 4HBGA 3IKMB 3UCXA 4DREA 1IVYA 1NJFA 3M0EA 3KL4A 5GQSA 4LQ4A 3IAUA 1YS6A 1Z36A 3N7AA 4DIKA 3C6MA 4DMLA 4HVCA 1XL1A 3HYCA 3F7TA 3O82A 3U4DA 2P3OA 3I6QA 1UMBB 1Q1EA 2AR9A 2R3SA 4PSAA 5L53A 2C4VA 2R6ZA 1GKLA 2WD7B 3IAS1 2BKAA 3RT9A 4KHPB 1C1XB 4AJEA 2GO7A 1II8A 3Q7RA 4S12A 1FFXB 2WNSA 4PNHA 3KAJA 1X80A 1BAPA 3M4ZA 1ZA1A 4ALLA 3WWOA 4B6SA 4NX2A 3IKVA 1PJ3A 5KYNA 2GUWA 1Y3AA 2YXLA 2GERA 4MUEA 1RMQA 4N47A 3E2MA 2KHZA 1VKNA 2O2CA 1LTKA 1SUFA 4J2OA 4DADA 5JNTA 4LJ7A 4E5VA 1RJGA 1T6BY 4MXDA 2IOQA 1XTKA 1MV8A 1JV2B 2VXCA 3DV2A 1BXZA 2HSWA 2HXGA 3FBWA 2B4TO 3GP5A 4N8DA 4OP1A 4LDQA 5LYJF 1W44A 3ICOA 4PZ9A 2AFHB 2GZ3A 5JV5A 4HWRA 2ZR7A 4RKEA 1K66A 3CZQA 3BMQB 3PKZA 2O8BA 3B60A 1WB6A 1C1DB 5GMOA 3HNOA 1T0HB 3IOYA 3QKUA 4IZIA 3VHRA 7ABPA 2RCNA 1FP4A 1HL3A 2G4VA 2A2ZA 3D4PA 2CW5A 4Z8YA 2ZKLA 2WWVD 1VGVA 4CV2A 4Z4IA 1ZFNA 4IOJA 1TU3A 3GUZA 4Q39A 4O2RA 1OW3B 5I3ZA 1UOOA 2NUAA 2GFQA 4GZ5A 3ZHVA 3A04A 2QXTA 3WWEA 2GZHA 2JI4A 3C5EA 3I01A 2WU8A 1I4WA 4OQNA 1M76A 4Q9KA 3PDIB 5AW9A 4CT5A 1C9NA 5GINE 3SE0A 1JKMA 3OC6A 1CE8A 3G8AA 5DK6A 2AW5A 1EVEA 4G1FA 1KQPA 2BZGA 3WK4A 3FOWA 2I54A 1P2UA 4TT3A 1Z06A 3PXBA 1K6JA 2UKDA 5E9QA 3SZRA 4XX0B 1QK4A 2O4CA 1MB3A 5ENDA 5EZSA 3WAKA 2GRUA 3DEJA 3Q7TA 4YDSA 3NUZA 6REQA 1BN6A 3T54A 2O8FA 3F2VA 3N58A 4KG7A 2UUOA 3OESA 3HYTA 3P9YA 3FETA 2HI0A 1K5HA 1NMSA 2P0YA 4BO5A 1TAUA 3LUFA 3I1YA 3IR6A 4L75A 4PZPA 3DOHA 4HVAA 5KWIA 1MG0A 1CERA 4URFA 1JT2A 3QU7A 5KTKA 4WLUA 1TAQA 4BP1A 2G9QA 3I5MA 3QOFA 1PFVA 3HB9A 4KYUA 3WLJA 3WL6A 5IN4A 4LYJA 3DFKA 2P4SA 4FI3C 3WK9A 3H0KA 2ZCUA 4YMTA 3OQIA 4DMUB 3BJIC 1D03A 2ZJBA 4NHEA 4WI1A 3DBLB 1OXVA 1YB6A 3EF1A 3COZA 1E9VA 4GO1A 1G7SA 2ZWMA 4ZI7A 5LP6B 3AKZA 5AK3A 1D2NA 1FUKA 4DLNA 2VQDA 3HWRA 1GPUA 3SZUA 3QLEA 4BUJA 4EFNA 4K05A 1FUIA 1HFEL 1HMPA 1ZQ1A 4FNOA 2VYCA 4RJ2A 3AB8A 5AHWA 3UAGA 2NVWA 1PEKE 3OZBA 4ZAWA 2I4IA 4MLCA 3OP1A 5F51A 2B5VA 3BFPA 3G68A 4W9NA 2ERXA 2P67A 2AHRA 1M8JA 3LXRA 3SCZA 1Z2EA 2NPOA 2WPDD 3GJ5A 5COQA 3L82B 1V5FA 4PHGA 2O8DA 2PMCA 1PJRA 3A8TA 3RQSA 3T7TA 5CK4A 5GGYA 4EL5A 1E2IA 3AONB 2PGLA 3RSQA 2JK1A 2NXJA 1QFXA 1I9CA 1NWHA 2JEOA 2P8SA 2Q5FA 2WA1A 3C1TA 3CC8A 1K8XB 1UM8A 1JDVA 1YI8A 4PHHA 3UCEA 3RASA 1X7XA 3AHCA 2W11A 1UBHS 4QUBA 2GM5A 4F4HA 4Q1FA 2VPZA 1RXUA 4TLMB 2X8LA 1R8SA 1LNZA 4M7OA 2B4RO 2CMFA 2BBTA 5I7UA 2ZS9A 2HSZA 5CG1A 3CLUC 3COPA 1T8PA 4BWVA 3LPDA 4ZVSA 4CT4B 1UT5A 2A67A 1PI3A 4C3UA 5I45A 1Q16A 2EKBA 3I39X 4QT0A 4E15A 4RM2A 3UO8B 1ZD8A 1S96A 3TLGA 4Z3KA 4C4YA 2X3UA 1VJ0A 2J3IA 4U3JA 1IIBA 1BHSA 1HZZC 3JVEA 1PYDA 1ECLA 4J8PA 1G5FA 4UU0A 4IIJA 2PGJA 4LRTB 5ALSA 3EY4A 3R3WA 2EYUA 5AW6A 2UUBB 4URXR 4HH0A 4M83A 2IU4A 4MW1A 2XX3A 2X4GA 2B78A 1BFKA 1MIOA 3BCHA 5TSDA 4KXWA 5L4SA 1GR0A 1FDOA 2MWMA 1FTWA 4D74A 2BIFA 3KVNA 5E1MA 2P6MA 3W6NA 3ER9A 2X9VA 2XIJA 3QU4A 3UBMA 4CGZA 3B53X 1J09A 1KAGA 1XVIA 1SZJG 4M0PA 2A30A 4N49A 3AG6A 4X61A 4AD8A 9LDTA 2IH2A 1CYEA 3RTEA 2O5EA 3MTIA 2MR6A 3C87A 4QXPA 4K9PA 3LVRE 4QQNA 3HEMA 4BWGA 1U7UA 3UT6A 2Q8NA 1QTNA 3I45A 1E64A 1WWKA 2C2YA 4G5YA 2IJGX 2V1UA 2BGKA 1L3IA 2L2QA 1I24A 1K4MA 5A6VA 3O84A 1YRBA 5EVCA 1K5GA 1M7HA 1X7YB 4KWHA 2YIJA 1IK6A 4CVNA 3DW3X 4FFMA 1PE0A 3F8SA 2HCRA 3L7NA 3FSGD 1R12A 1XTBA 1DL5A 2CDRA 2DHRA 3AHIA 4R1UA 2HZ7A 1HUQA 3FUCA 2QX8A 4EG8A 3IQDB 3JY6A 5CBPB 4BV2A 3I32A 5DN6D 5EJ7A 4GZ6A 2WUEA 1MW9X 3JZMA 4NU0A 1MBZA 3L7CA 4PIMA 4X84A 2R25B 2QIOA 3EG5A 1N6LA 2X41A 3C4JA 4FINA 1Q19A 5JADA 2JHFA 2VDKB 3NHJA 3CZPA 1WMBA 3L9WA 3PENA 1JE1A 4QATA 4JOCA 3KT0A 5BNWA 4I8XA 3TZKA 4F4CA 4OKNA 1KYYA 3K05A 3QKWA 1O9GA 1PN3A 2REQA 1W85B 4KYIB 4LOKA 3RVDA 3USES 3C8ZA 3R6WA 3BJZA 3PF8A 2YQ5A 4IFTA 5E2AA 1WEHA 1KS9A 4HO1X 1N2SA 1X14A 3T4EA 1H1LB 1CZOA 2IQ5A 1E63A 2OL4A 4NYMR 2PWZA 1SOVA 4HGQA 2A14A 1E99A 2XIQA 3EGEA 1PJ8A 3SLGA 4BEJA 1WJGA 3FJYA 4PX9A 4KGXA 1ORHA 5KAPA 2QYTA 3A3OA 3HSSA 1B15A 1ADYA 4NDZA 3K0SA 3DVAA 1H2BA 1JSLA 2HDHA 2RH4A 1ZJ6A 2ZYVX 3D7MA 1CNMA 1DAMA 3AESA 3ESBA 3H8WA 1EQUA 4IDGA 5EE0A 5H02A 4NNPA 3VOBA 5D01A 1T0UA 3F4BA 4CF7A 1YR6A 3H83A 1XZCA 1Y7HA 1Q5PA 4LC1A 4OJQA 3OT1B 3FSJX 1CZKA 1V8PA 3GNQA 4WZAE 2H7YA 4FFWA 3MWDB 2F48A 2B8WA 3G1TA 1DJQA 2RAFA 2VQEB 4U6SA 2ATVA 1OFHA 2FUG1 2WT8A 3O7MA 4ZV4A 5C53B 1HLFA 1K08A 1P9WA 2PXAA 3ETJA 3OEYA 4H60A 3EEBA 3THRA 4E1AA 2C7RA 1Z29A 5IT4A 1KFJB 3AERA 5CVDA 4WINA 2YVLA 3TTVA 3WMGA 2BGLA 4RANA 3CR3C 3WQQA 4HDRB 4HDSA 4GC5A 2CLEB 3HGQA 3AP2A 4IMJB 1LBTA 2XF2A 5FBLB 4RZXA 5F1YA 3PNYA 4ZVTA 5IUKC 2FSFA 3NAQA 2F17A 1IY1A 2GHQA 2ID8A 1I7LA 5D3MA 3NDRA 2Z3WA 5L7TA 1GG8A 5E2IA 4WBNB 4IRXA 2D0OB 2Z5VA 4CDNA 3PWTA 2OFWA 1OWPA 1YZHA 3EXHB 1YBHA 2CJWB 2K7ZA 1E18A 1EMDA 1J42A 2WHQA 1B23P 2APJA 3TSZA 2QVBA 1CJBA 4IV0A 2VJYA 2ZE7A 3CISA 1JEAA 4UEJA 3LC0A 5AJHA 5I7AA 4UNPA 4DMHA 1Z6QA 1EFKA 2ODWA 1MNQA 2BFPA 4N7RA 3UMGA 2JC3A 5HQ3A 1TVKB 4P4GA 2GD6A 4RBNA 1G98A 4YK7A 5FTKA 3VYVA 1UPBA 2O0HA 1YRAA 2WYWA 3JQ9A 3OU7A 4LHXA 4F2GA 1QRRA 3M1LA 2JLBA 3O1LA 4H3HB 5CHYA 5IVIA 1ODJA 3REGA 2AEEA 1V1JA 2VP9A 1NN3A 4I8DA 3W2GA 3PQCA 3ZKAA 4DUYB 4J1TA 5CLHA 4G65A 3DXZA 4K8OA 4WKNA 4ARBA 3GROA 3NKFA 4QHSA 5MHTA 2ZYRA 4QPNA 5EUBA 4BQOA 3VZCA 2CJFA 1GPKA 4QDUA 1RRFA 1L1RA 4MRAA 2CFTA 5F3WB 1YB7A 4Q9AA 3SR0A 5HE8A 1DQRA 2Z8YA 4B46A 5F9FA 3FB4A 4LJ6A 2O8NA 1V9LA 2HJVA 4RPLA 4RUKA 4ALKA 1D1QA 5CU7A 3BTVA 3CGWA 4EHFA 3NHAA 4BNLA 3DAFA 3P5SA 4DUGD 1YU6A 1K0FA 1RS0A 2XNDD 9GPBA 1VPVA 1HE3A 2VHWA 2VSQA 1VG1A 3IKLA 3E9MA 4WCFC 3GLIB 1Q0TA 1THTA 4NCAA 1A8HA 1DE0A 2QEQA 3HLTA 5BRNA 2POCA 4G9GA 1QBKC 3BF8A 4P5EA 2FZ4A 1YMVA 5IM5A 1BMFD 4DL9A 1PQUA 4S04A 1JDZA 2G09A 2PR7A 2PJZA 4AW9A 4HZIA 3MZ0A 4OL0A 1CJKC 1ZVJA 4MQLA 4MCJA 1NUTA 1N9GA 1ZL2A 3BXZA 4MA0A 3ZQJA 3JATA 3Q40A 1G5PA 3CEAA 1E6CA 2DYKA 4DQDA 1YFKA 3E48A 2C07A 1KZ7B 2O3UA 4J2HA 2YHBA 4QDJA 4HGYA 1IPHA 4NSNA 3JQRA 4TWRA 2CXUA 1EDZA 3RS8A 2QMYA 1WSBA 1M66A 4QM6A 1KDTA 1JEYA 5DRYA 5FOUA 1L4KA 3QF7A 5CJPA 3QYJA 2WTUA 4J6FA 1CEEA 2PU7A 3FX2A 5CH3A 1ZN7A 2PNFA 3GLGE 1Y7TA 4TWIA 2AN4A 2BH2A 2XXAB 4J94A 1R4MA 4LZPA 1KARA 2XTMA 4N12A 4MR7A 1RBZA 3MCUA 3WYBA 3GEBA 3I83A 3OPNA 3PQ8A 4EA8A 2J7PD 2RHWA 4EJSB 4LF7B 5DCLA 2KI5A 3G2IA 2LPMA 5EP1A 3CEJA 3KZKA 5JECA 3EEIA 4YP5A 2OOKA 4JBIA 4MUMA 2Y0PA 4AQDA 4AWXA 1E5TA 2XB2A 5L3VA 1R4NB 4DZTA 1E1LA 4PQGA 2JLZA 2PJUA 2FB9A 2O3SA 5JQWA 4UCQA 4ABTA 1MB9A 1E9SA 1QCZA 4J0JA 1K7YA 4YCLA 2DRIA 3FGOA 1U0BB 4U2FA 1GPAA 2SBTA 4ZT2A 2D2IA 2VAXA 2XWBF 2AG8A 5EXXA 3ENWA 1P0PA 2H3HA 3FYSA 3IAAA 1C9MA 3TR6A 5LSAA 3U16A 1BD3A 3KOUA 5F9MA 3RM3A 3EOBI 4B7CA 3IBFA 4MRRA 3NTQA 3VSEA 3AYXB 2PZFA 5KI6A 1R5OA 3W3ZB 1GAQA 1HEYA 2G25A 3AY3A 3CNOA 3PC8A 4NBSA 4A16A 3AF5A 1T0IA 1YDGA 4KQ6A 4PRYA 1U7HA 5M2QA 3GUUA 3KUCA 2I9PA 4KBGA 5A7HA 3VPSA 1MB0A 3ANXA 1TYAE 1H93A 421PA 4H4DA 4UVDA 1TTTA 1CEYA 5FBKA 2C2KA 2P4UA 1SC1A 1VXOA 4E5DA 1IWOA 1YCGA 1H2AS 1YCFA 2PZEA 4HYYA 5G0UA 3LF2A 5B4VA 5L6MB 1ATIA 1GAJA 1VLZA 5JVDA 4NXMB 4FLEA 3KQHA 4JYAB 2FRDA 4IKEA 1WV1A 4BO4A 3ZZ1A 3QE0A 3A2KA 2GYWA 1D4FA 1DCTA 5DWVA 1RWKA 5LLDA 4ER6A 4HNTA 2CV0A 3KT3A 1SY7A 2JDID 5CB4A 2NUPB 4D98A 4ETMA 1KEZA 2VHXA 1SMKA 2VYVA 3RU2A 1MNAA 1T0PA 4JK3A 1FDWA 2XQGA 4NQRA 5FJJA 1KQNA 4C03A 1B3BA 2AN1A 2C00A 1AVTA 2DUJA 2HJSA 2WF9A 2WVJA 2YYSA 1F6BA 1JIVA 1GZUA 3F3SA 3EMKA 3MUEA 5E7JA 3OSZA 1OX5A 2ATEA 1Z0FA 4B4UA 5AVRA 5TLSA 3T1HB 4LF8B 2XI4A 4LFBB 5HKLA 3EDOA 4YWHA 1S02A 4MWGA 3NT5A 1I0ZA 1ZUWA 2XRYA 3B36A 1GT6A 1N8NA 4II2A 1E92A 3RKUA 2VHCA 4B84A 1L4MA 4Q4JA 5A4KA 1JZTA 3DZFA 4BV8A 3MJRA 3LC1O 1ZA2A 4N7JA 3BGDA 3UWOA 1SUIA 1B14A 1BWPA 4E88A 4CKWA 1GGNA 2YBDA 2WPDA 4U5XA 3H2GA 4K03A 3JQAA 1R18A 1R6DA 2Z98A 3A3NA 3BDVA 2YMQA 4R2JA 3TPFA 1XEXB 3CUSA 3E9RA 2ZTVA 4YUWA 4R68A 4M8KA 3SZLA 1PDWA 3ER8A 3PSHA 1RQPA 1R16A 4C7BA 4JWTA 4FUQA 4OI2A 1Z56C 1DKUA 1Q20A 3SE7A 3OWXA 3PFHA 4DMFA 1XEAA 1IOLA 1TJYA 3O1HB 3AWIA 1G55A 3HXPA 2PAFA 3AEYA 4XM1A 3KAPA 4Q7KA 3NGMA 4FWIB 5WRFA 4Q3BA 3B6ZA 4KRFA 1T25A 2QD1A 1O6FA 1KHHA 2Q46A 1Z38A 1ZNZA 4FYIA 2PTHA 2ONYA 3IIMA 3IP1A 2ASEA 2WAXA 3JQ7B 5KBYA 3DE7X 2CBXA 2AWOA 4HN4B 4IQ8A 4Q1DA 3A9VA 1CZHA 1VL0A 1F38A 3OQHA 1LC0A 4J1QA 1Y9EA 3HS3A 2Z3VA 3WJ7A 2WU1A 4DPKA 3H1AA 2WJJA 3G2LA 4Y2XA 1NKTA 5ALVA 5GP1A 3ZNOA 1NFFA 1DFIA 3C5HA 4FFPA 4R05A 1OAKA 2CFSA 4IFEA 2GLXA 2WILA 3ZCXA 4KTTE 1RWWA 3ZDFA 2FPIB 5C5CA 1AIPA 4ZDWA 1KYIA 3BTSA 3DV9A 3HQ4O 5DP1A 2G17A 3C5WP 3E7WA 3NTVA 1U7WA 2ZQZA 3KPWA 4GM4A 5GOTA 1YTUA 1XA0A 2YW9A 2GXQA 2QRVB 3FSGA 4J6EA 4ZCSA 4YMGA 4GP6A 4MDHA 4HDMA 1SVLA 1U8UA 4PX2A 4YRTA 2GMWA 2P91A 4TV9B 4CM7A 1HYBA 4DLTA 1WBBA 1JIJA 3NORA 2GN6A 4U6NA 1FLNA 4FN4A 4U02A 2G1PA 3AVUA 1SQFA 4PC2A 3RAJA 2B99A 4HUJA 5BSTA 1HL7A 3RTBA 1YNOA 2GCOA 3TQOA 4Q24A 3FR8A 1E32A 2FUEA 1GN8A 5LZ5A 1KI1A 2AQIA 2QLMA 2R8PA 3COVA 3FMVA 2LXNA 4FSDA 4ZC8A 4DEVA 1TGYA 1JHXA 2JH3A 1XTQA 2LP4Y 3CX3A 3GG2A 1T13A 3R5TA 3VR2D 1P18A 4Z2YA 1U4OA 1CUHA 1JR2A 4BFWA 2GA9A 3K0BA 2A4KA 3QP9A 1RJDA 3LGXA 3CRZA 1N5LA 3M1AA 5EPOA 1YS7A 3NFRA 5J2TA 2AJCA 2F62A 2IXAA 2ZT7A 4NG4A 2W70A 1JLSA 3T41A 3JWPA 3V42A 3N3AC 3U31A 4AYXA 3ZBTA 4EF4A 5INTA 4D0LB 1FTYA 4CEJA 2DH6A 3VYSB 4DNXA 3RH0A 4AX4A 2CUTA 1N33B 3ZVLA 1TRHA 1ZD1A 1N7JA 2RGXA 4YP1A 4TS3A 1E6WA 1TQHA 2FZCA 2P30A 3K0AA 4NZNA 4F8EA 1KO7A 4I36A 4Q3AA 4QWWA 2XT6A 5ICGA 3OFNA 4NRDA 1XQXA 2BGTA 4E4TA 4MPRA 4GBGA 3OLQA 2HCBA 1L8AA 2XAUA 1S1MA 3R41A 3A6GA 4OJNA 1I8TA 3FVTA 2WJAA 4Q3LA 5GPBA 3ZU2A 1NTOA 3ZHBA 3K0CC 4MHTA 3HVHA 2WYIA 3L02A 4PX5A 2VAVA 3LQFA 1FMFA 1PJAA 2C8JA 3OICA 2ZJ4A 2IV2X 4EHLA 3PJGA 2EWMA 1USIA 2D6FA 3MG9A 4RZHA 2BKXA 4LDRA 5A3SA 4YQFA 3QKRB 4DY4A 4HTFB 2ZXUA 5DK4A 4JLWA 4RMIA 1XO1A 1P5ZB 1Z4IA 2HIGA 4AMGA 3JYNA 2OBLA 4RQAA 3MWEB 3T3DA 4KI0A 5BMVB 1B2LA 4DV3B 1IZZA 1J8DA 1XAJA 2FDRA 4WECA 3VZBA 3CVUA 3F4KA 4O5AA 4UEWA 5AOCA 1NL3A 2TSYB 3ODGA 4KRYA 3RRZA 4BO3A 4HNUA 3W5JA 2EGUA 4MGKR 3FHLA 1Y1KE 3U62A 1C4KA 1JU4A 3C3YA 1A9XB 2Z2KA 1SD1A 3DWGA 3M6LA 5U1PA 1Z33A 3GB9A 3BWYA 4N7BA 2AMJA 1IZ0A 2H17A 1RP7A 3OY7A 4QBIA 1UKBA 5FKJA 2CVFA 4K9LA 4BNVA 3WO1A 1N3IA 3B2NA 1ZLXA 3CURA 2UVPA 4P1ZA 5DXFA 4ZO8A 1ESEA 4GL2A 2JATA 4E33A 2QMOA 3CG0A 4FBMA 3KXDA 4LX8A 2KX7A 2PWYA 2VG8A 1D2HA 4GZLA 4Q5IA 3NHWA 3GLFA 3NM5A 1KEUA 1KH3A 1AE1A 3THXA 4EHHA 1H2WA 5IFLA 2HXYA 3NRBA 4NBRA 1ADCA 4UHFA 3JCZA 3OKAA 1P2FA 2Q1SA 2JCYA 2C83A 2IHJA 2XLCA 3VSCA 3Q6IA 1SC4A 1WHTB 4Q3CA 2AN5A 2PWPA 4MA4A 4NZYA 4LVOA 2OFPA 5LBIA 3BE5A 3H1FA 4OHWA 3ZIAD 3NM4A 5L51A 2YIDA 3RSCA 1QOQB 4JUFA 4EG3A 4ZO4A 1N5RA 2GYVA 2D0DA 1RKBA 2L0XA 4YAIA 4B40A 5IAOA 4I55A 1ZVKA 1D9ZA 1HEUA 2P4EA 3S8YA 4IOMA 4L0DA 5DN9A 1KKLA 2PL9A 2WMNB 2R96A 4NS4A 4YPFA 1U63A 4JXZA 5EYPB 1N25A 1WXDA 2AKAB 3V1MA 5CEJA 2JRLA 1XRQA 2XCIA 3UAVA 5CD9A 4O59O 5KVAA 1J2YA 3FXAA 2OORA 2F9LA 2WIAA 3VBEA 4DUGA 1CLEA 4N76A 1ZD5A 2XNDA 2D74A 3UB3A 4I3GA 4MUXA 2PZKA 4V0KA 4MEAA 1XQ6A 4M7RA 4CL2A 1ZXBA 2QT1A 2XNCA 3HHEA 3KQWA 3S5UA 5C9ZA 3QW4B 1CY1A 4TKMA 3NHBA 4EB0A 1YF3A 3K3PA 1OZGA 4LTDA 2QMHA 4AF6A 1BMFA 3FTPA 2B1IA 1EVZA 5KWVA 3DWIA 4L95C 4AZ0B 3C3DA 1M6HA 3ZWPA 2ZI9A 3EOAI 1AHIA 3IULA 4BB5A 4CEIA 2B4AA 5FL7A 4JODA 3RPEA 3DBRA 4YN3A 3GC6A 1PHPA 4LZWA 3BH6A 5DM60 2JGJA 4QULA 2Z43A 3LKDA 4AAYA 1JEJA 5BN5A 2IHBA 1EWYA 2XHEA 3GU3A 4EI8A 3L8FA 2Q5OA 5MN5A 1LV8A 1J70A 5F21A 3R76A 3E3LA 2PWAA 5JDIC 4RD3A 3NU1A 4UDOA 1WMAA 1KWKA 2GEFA 3HZOA 3FOFC 3AB7A 4N01A 1QR6A 4ND8A 2DHEA 4GSKA 3RIHA 2VPQA 3EVEA 5KHAA 3KTFA 5ARDA 1JFTA 4XD7D 4IYRA 1ZN9A 3O95A 5E1BA 2RG1A 4YRPA 1EE2A 2ZJ8A 3NHFA 3UB2A 2OD9A 4DNFA 5LMCA 4DCMA 5HOQA 4Q3KA 3IMEA 1ZGJA 3FYDA 3GPDG 3O38A 3RU7A 3WSVA 5H9WA 2D2FA 2F2TA 2ZSAA 1Y8RB 1EXMA 2JGAA 3QLUA 1P31A 2CUNA 1KMIY 1Z3CA 2VK2A 2RIPA 4C7OB 5KWJA 1E1MA 2BGUA 2WK1A 3ADOA 3TI7A 3FNGA 4C89A 4BVJA 3KZMA 1KYVA 1R8QA 1JPNA 2JLQA 5YASA 2SNIE 2QVZX 4GZMA 2ADOA 1KY5A 2O1SA 3TJZA 3F6BX 4AG3A 2IS2A 4IOLA 3RWMB 1GV1A 2ZR0A 4V39A 3HWWA 4BQRA 4LOJA 1DDGA 4LSGA 3GZ4A 1YR7A 3CLKA 4KOAA 4L8LA 3A4YA 3IP8A 3QOXA 4IXNA 2WW8A 5IMBA 4C22A 3LHFA 4MO9A 1IBKB 2HQ1A 3GJTA 1U2ZA 3A4VA 5DNDA 2ZJ3A 4IUYA 5AW0A 2JGDB 1SIWA 3T7SA 3IUPA 5HKKA 4J03A 3RS3A 1JFFA 2QLFA 4EFLA 2RHJA 3UA4A 5KHOC 4BJ5A 1N9KA 3L0BA 3CRRA 3UJNA 2C88A 2PFGA 2NACA 2WIGA 3EAGA 5BRJA 4OLJA 1UBMS 2OVFA 3KD2A 4JC5A 4P58A 4AS2A 3KU4A 2FFHA 5ALGA 4DSOA 2K87A 1K6EA 3TSOA 4MVJG 4EL0A 1K06A 5IT9A 1EKXA 1A0OA 2IYOA 2RE8A 3QU9A 4GXQA 1IY9A 2QUHA 3C4QA 1F0YA 1FSSA 3JWGA 4HQOA 2DB3A 2JDIA 1TYBE 2WV7A 5K3FA 4YPVA 3PIDA 4OXXA 3IHLA 3LBAA 1FL9A 2OENG 2P2ZA 3ORYA 4MI6A 1L5GB 4EKDA 4B3RB 2GN1A 1VB5A 3LTEA 3GGCA 5ECDA 1V47A 2XCLA 4JITA 1M5TA 3PGXA 4R1PA 5LDGA 2PX8A 1IOZA 5F3DA 3FYUC 5E3IA 1RWQA 4HWPA 5FYDA 2XUIA 1EH5A 1KOJA 2AZXA 2OECA 3I9V1 4RZUA 2NZUG 2OO7A 4NE2A 4UM5A 3PC7A 1RXIA 1DBIA 1FMCA 1T5LA 4MRMA 2CYCA 4NMXB 4AY5A 2CXOA 1HE8B 4P0TA 1EJ0A 4TL9A 3HY3A 1Y9JA 1N6IA 3VU0A 1N2JA 4I1VA 4CM4A 2OXEA 5KTRA 4O5OA 5EI5A 3D6VA 3VX4A 1DKQA 2B2XA 1XCGB 2FPSA 2PZBA 4WESA 4EX6A 4Y1EA 5A7FA 1EFTA 1ESDA 3DTVB 1O95C 4AKGA 4RW0A 2ZIEA 3ZWAA 2XMSA