2GN1A

Crystal structure of dimeric biodegradative threonine deaminase (tdcb) from salmonella typhimurium at 2.2a resolution (triclinic form with one dimer of tdcb in the asymmetric unit)
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
327
structure length
326
Chain Sequence
MASHITYDLPVAIEDILEAKKRLAGKIYKTGMPRSNYFSERCKGEIFLKFENMQRTGSFIRGAFNKLSSLTEAEKRKGVVACSAGNHAQGVSLSCAMLGIDGKVVMPKGAPKSKVAATCDYSAEVVLHGDNFNDTIAKVSEIVETEGRIFIPPYDDPKVIAGQGTIGLEIMEDLYDVDNVIVPIGGGGLIAGIAIAIKSINPTIKVIGVQAENVHGMAASYYTGEITTHRTTGTLADGCDVSRPGNLTYEIVRELVDDIVLVSEDEIRNSMIALIQRNKVITEGAGALACAALLSGKLDSHIQNRKTVSIISGGNIDLSRVSQITG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of Salmonella typhimurium biodegradative threonine deaminase and its complex with CMP provide structural insights into ligand-induced oligomerization and enzyme activation.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Lyase
molecule keywords Threonine dehydratase catabolic
total genus 118
structure length 326
sequence length 327
chains with identical sequence B
ec nomenclature ec 4.3.1.17: L-serine ammonia-lyase.
pdb deposition date 2006-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00291 PALP Pyridoxal-phosphate dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2gn1A01
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2gn1A02
2BHSA 1UIMA 1K8YB 4IL5A 4ZU6X 2Q3CA 4D8UA 1K7FB 1KL7A 5B36A 1K7XB 1QOPB 2ISQA 4QYSA 1M54A 2EGUA 2DH5A 5I7HA 5J5VA 3SS7X 5KINB 1BKSB 2RHGB 5D86A 1A5BB 1BEUB 3VSCA 4D8TA 1UINA 4D99A 4D9EA 3ZEIA 4D97A 5CGQB 4AECA 1PWHA 4LI3X 2EFYA 1WKVA 4D9KA 1KFEB 3R0ZA 2J9YB 1V8ZA 4D8WA 4KKXB 1CX9B 5DW3A 1J0BA 1K7EB 3DWGA 1P5JA 5JISA 1TZJA 5B3AA 4D9NA 5JJCA 4D9CA 4D9GA 5IWCA 1KFKB 2V03A 3BM5A 2DH6A 3AEYA 2BHTA 1F2DA 3SS9X 4H27A 4HPJB 3X43A 1A50B 2C2GA 3IQIX 2J9ZB 1Y7LA 2TSYB 2O2EA 3FCAA 2D1FA 5J43A 1D6SA 4L0DA 3VC3A 4D92A 1TDJA 4NEGA 2Q3BA 1X1QA 2GN0A 1A5SB 5IXJA 3CEPB 4D96A 1FUYB 3PC2A 1PWEA 3IQGX 2TRSB 3IQHX 5E0KB 4LMBA 1CW2B 4XUGB 5CVCA 5D85A 1KFBB 1Z7YA 2CLHB 1JBQA 1K3UB 5B53A 2C2BA 4NU8X 1V7CA 4D9BA 5B1HA 4JBLA 1J0EA 1J0CA 4HO1X 5I7AA 2CLLB 5I7OA 4L27A 1RQXA 4JBNA 2PQMA 4COOA 1KFJB 1C8VB 2ZPUA 4PCUA 5B55A 1QOQB 1J0AA 1C9DB 3L6BA 5EY5B 5B1IA 1C29B 3DKIA 4Y6GB 4I1YA 1VE1A 1VE5A 2RH9B 5D87A 1K8XB 1KFCB 3RR2A 3SPXA 1TZKA 2ECOA 2TYSB 4AIRA 1UBSB 3HMKA 2J9XB 4ZQCB 1TJPB 5T6MA 5KZMB 5D84A 1E5XA 4WX2B 3R0XA 2GN1A 3PR2B 5I7RA 3L6CA 2ZSJA 5BW6B 4OREX 4L28A 1TZMA 3IAUA 1A5AB 5HBGA 4HPXB 3PC4A 3T4PA 4F4FA 2CLEB 3PC3A 2CLIB 1VB3A 2CLMB 4LMAA 4OFXA 2CLKB 1TTQB 2CLFB 5DW0A 4D9MA 5I7WA 1WDWB 2Q3DA 2RKBA 4L3VA 2ZR8A 5I6DA 4HT3B 5DBHX 1TZ2A 3FGPA 4D9FA 5C3UA 1K8ZB 3TBHA 2O2JA 1J0DA 2CLOB 1WBJB 3DWIA 3V7NA 1TTPB 2WSYB 1FCJA 3AEXA 4ZU1X 1O58A 1TYZA 5DVZA 1Z7WA 1OASA 4HN4B 3VSDA 2JC3A 4D9IA 2ECQA 2GN2A 3VBEA 1WTCA 3X44A 3L6RA 3VSAA 1V71A 5DBEX 5IW8A
chains in the Genus database with same CATH superfamily
3EBPA 2OQVA 2WA1A 2YJ4A 2VDNB 5JCPA 4L75A 2XV1A 3HXTA 4AY2A 1E6WA 1QOPB 1DAGA 2PG3A 2BISA 1GSIA 1ZEJA 4YMHA 4BNHA 4JKYA 3UWOA 5HZGA 3HYNA 5JHGB 1M54A 3H6KA 3DOEA 1GA6A 1AQLA 2ZT5A 5EYPB 1NJ6A 3VSCA 2ZT6A 2L42A 3DAOA 2ERXA 2NNWB 5REQB 4A23A 1V1MA 2LDBA 3PI7A 5LZ2A 1PDVA 2ERCA 1ECFA 2FPXA 4A5SA 4LYYA 3VNBA 1RAEA 5TJHA 4TS9A 1A8UA 1UOQA 3E58A 2WSSD 3E5MA 4JP1A 1HDOA 3HWRA 1OGYA 2BN4A 1D5WA 3H7IA 4HG2A 4BRSA 1ZW1A 2EQ5A 3PP8A 3WV4A 1ZSYA 3FNFA 4PLCA 3UWKA 2BHTA 4X9XA 3TWOA 3UPUA 3GT4A 2GO1A 1L5WA 2PX3A 5A4KA 4RGQA 2WFLB 1P7VA 2OO5A 3TR6A 3BA1A 3EQ2A 2I9KA 3V55A 5DT2A 1T4GA 2C88A 2XNJA 2Y1DA 4KFRA 1RYMA 2XT0A 4GEGA 1ZVKA 5AKJA 4A0SA 3K6SB 1K9SA 4HDSB 1IZYA 4RJ2A 1T9CA 3G9UA 3TSYA 3ZNNA 1UPTA 3DLAA 4TPKA 2BI7A 5HILA 3U3KA 5FV4A 1P60A 1Z4MA 4K9LA 4QEZA 1SOWA 4Q1VA 3QJGA 2PMEA 1AS2A 2CLHB 3G85A 1YOVB 1NN5A 3SGLA 4KBYA 3K94A 1BCRB 1JKJA 4HAVA 4WOCA 1N2OA 3I9V6 2ODNA 3SSNA 5IYZB 2VWQA 3DVLA 1H6CA 1FS6A 1QUFA 4AG6A 3LLMA 4Z0HO 3HBJA 4D6XA 4DSTA 2NVBA 3U7HB 1YA6A 4BO1A 1U1FA 5IAGA 1JXMA 3ZHQA 3VMFA 4AUEA 4BZXA 1VE1A 4CT4B 3CGGA 1T36A 3S1AA 1FXWF 2J9XB 3Q1LA 4KXMA 2RGEA 1OHHD 3C87A 3A36A 1F2VA 3MCUA 3IQEA 1XDGA 2YR0A 2IEYA 4FZ3A 4LBZA 3WLEA 3DZIA 4CUZA 4H7PA 5IDXA 1QK5A 3LOPA 1SKAA 4MIKA 4UQPA 2X1MA 2BKUA 3HA5A 4HPXB 5A9RA 3ILVA 1AA6A 1Z68A 3DAHA 3SYMA 1VI5A 3MOSA 4CIAA 3BN3A 1GTG1 1NLUA 3CTMA 2PUCA 2YZGA 1USKA 1MAAA 2BW0A 3AJ9A 3KOMA 1E7SA 4FYJA 4KE8A 2IYLD 3GD5A 4NCAA 1EVYA 3DAGA 1N6HA 5I9SA 4DR3B 1W9MA 3V42A 3O21A 3ESYA 3ZE1B 4TSRA 4KR2A 5H4HA 5AK6A 2P2DA 1IPFA 2GZRA 3IKLA 4BNXA 5BMOA 2XCOA 1M2VA 2UYYA 3SF8A 2ZTSA 2O3JA 3JQBC 1O5TA 1O96A 3TRFA 3O83A 3VSDA 3JATB 2E21A 4X3PA 1Y80A 3EW7A 4WFJA 2YJ5A 4B33A 4NZZA 2P8SA 4GE3A 1PSDA 4B32A 1XZQA 4DLZA 4NZYA 3TPFA 4N49A 3IP9A 4HD8A 3WHPA 1HQCA 1MORA 1YZFA 3EODA 4J16A 2TMYA 3DZJA 3IQZA 5DEIA 5K3FB 3TIIA 4MWTA 1L6RA 3KU4A 5A4DA 5KC8A 3AVVA 2PMDA 4QFCA 5ALRA 1YDMA 1LKZA 5HG0A 1JQLB 3NIFB 1OKKA 3DCJA 4KLAA 2SCUA 4M60A 1XCOA 4D79A 2DULA 3USZA 5A4IS 2P78A 1KDZA 5FWXA 5T7BA 7REQA 3EZXA 4D97A 1GPMA 3N0RA 3OFKA 1U9JA 1S3GA 2XYHA 4Q1DA 1F8XA 1BCSB 1LPBB 1KZ1A 5JCZA 3OCYA 4OGKA 2YVKA 4MW0A 1UQTA 1YHNA 3KKQA 5C3MA 5ESDA 4NY1A 3OQ6A 3HJNA 1M10A 1UDCA 1YD7A 1FVHA 3JQGA 4INOA 4JHXA 3SHFA 2JDIA 1N8NA 3C70A 4LQDA 4Q15A 1T3SA 3RRNA 3A9CA 1PFGA 1LDMA 2P69A 4J75A 3N8DA 4RJKA 3LGSA 1B73A 2V1XA 3KOYA 1G8AA 2KJQA 3OIYA 5JAPA 3Q15C 2NUTA 1N1GA 2BUCA 2GKGA 3MTJA 4E3WA 1G7CA 5EHNA 1SUFA 2JARA 3MD0A 4MWGA 4KHPB 1SG0A 4HYQA 4YEDA 3OMLA 1XP5A 3NTUA 4QC2A 1KJQA 4DZZA 3UVEA 4D4GA 2HL6A 4D43A 1KPIA 3BAFA 3FUTA 3IHWA 2NU7B 4LBYA 1Y6RA 4RDHA 1YHYA 3GJXC 3OOHA 2A1TS 2Z5VA 3WDKA 2ZI6A 1BMTA 1V43A 5F52A 1U1IA 4X93A 2I1LA 1E64A 4RPIA 4XOIA 3W1VA 4MGEA 3E0QA 3WXBA 4WY8A 4BLSA 3UO8B 3B78A 4HEA1 3Q8LA 3RYFA 5B1HA 4JBLA 5GVRA 2YX1A 1PR1A 1RZRA 5NULA 1CV2A 4FOOA 4JVLA 3CEHA 1DPFA 4LVNA 3DMFA 2B8NA 3JSAA 4RHEA 4L78A 2C8LA 2NZWA 4U7WA 5DHUA 5JE8A 5JANA 4JB8A 2KWIA 2VDKB 1NVTA 3CJRA 3HCAA 3OBBA 2BELA 4EF5A 4RZSA 1EJ0A 3N6VA 2CVQA 4GL4A 3SF8B 5AKEA 3DV0A 2WNHA 1XD8A 3TD9A 5GINE 4F3TA 1FDTA 5AM5A 2VT3A 2CKDA 4TWAA 3S2ZA 1U04A 2ZTVA 2V7GA 2UUCB 5C5CA 5EJEA 2X6TA 4NCBA 1JSLA 3DMNA 5K3FA 2J33A 2D6FA 2HIGA 1DO2A 4EHFA 3CZAA 1L1QA 4ASUA 5P21A 3IL2A 2VP5A 2Z1DA 3ZJ5A 1NASA 2H1IA 2I7VA 4QYXA 2PAFA 4I08A 3DEYX 2PGJA 2PUGA 3IJ5A 3MJ4A 4MLZA 1F6BA 1SA0A 4PR3A 4D46A 2IQIA 4NENA 4RL4A 9GPBA 1O9BA 1CUAA 4MQEA 2PRSA 5GP1A 2R4QA 2C3UA 1JEOA 1V1MB 3EA0A 1MX5A 2EP8A 5HQTA 4RA9B 2VZ8A 1JMVA 1L3BA 3WI7A 3ROQA 5CFMA 3L4EA 3K71B 4YJFA 3IDQA 5B1DA 2GARA 3OLZA 4RU1A 3IP8A 2Q1WA 2K7FA 3UMSA 2EF0A 5FUVA 5B37A 1SKYB 4M99A 1V4VA 5H59A 3WMEA 5FPYA 2I3GA 2V98A 2Y76A 3HUUA 5CT8A 3QQ5A 3TW6A 1LEHA 1M5UA 3IR5A 4C89A 4LVUA 4D9EA 2P77A 3BREA 4KQCA 4EIWA 4HGZA 1W581 3X1KA 2M1ZA 5ALZA 3ZS8A 1ZOIA 1I7QB 2RSLA 1FQWA 4C5AA 3ETEA 4KQFA 3MWFA 4BFVA 5BSWA 3L7DA 1K5HA 2OG2A 2WF6A 3I05A 4GR4A 3CLUD 1GZ5A 4BP8A 5JZVA 2AN5A 2JLSA 3QEMA 2NN3C 1QE3A 3L0OA 3WB1A 1QC5B 4Z9BA 2B4AA 3ESBA 2I3DA 2I99A 3HXMA 1QAOA 4A27A 4C06A 4OV6B 4CL0A 2IUEA 4UBMA 3KPWA 4JLMA 4RMGA 3TLGB 4WQMA 1P2TA 1JKJB 4QQKA 3AJAA 1L4BA 3FHOA 1KEKA 1BGVA 3LUHA 5BW4A 4Y3UA 2DWQA 1E3QA 2E82A 1DFIA 4LDJA 6LDHA 2PQ0A 2Y1WA 1QVAA 3W5AA 5FLKA 4J0HA 3JQ7A 4WESB 3WB9A 5I7SA 5KHLB 1OX4A 1EP9A 2LRHA 1J56A 2TRSB 2GPTA 3CN9A 3HB5X 3LS2A 4BYGA 4PG5A 4KC0A 3PDIB 1NQUA 3UM9A 3EZ6A 4EHKA 1IDOA 3EXIB 2OFFA 2XXAB 5IXYA 5JSHA 2IGBA 2CD9A 2XDAA 3M1IA 1XRPA 1HSOA 2FEKA 1H8EA 3L2OB 4W7IA 4EFLA 1QFXA 4FIZA 4H31A 4X6LA 1EGMB 3NEAA 3R1IA 4HS4A 1GZVA 1AGRA 2DWCA 3OQVA 4U2KA 5LPNA 4RD1A 1JEJA 2KYRA 3CA8A 3F2VA 5G40A 2QN8A 3BRCA 3BVPA 2E18A 3OX4A 3U48A 4JWTA 4F8YA 5F9FA 4M0KA 1GSOA 1ZKDA 3QXSA 4MGIR 1P0PA 1T1GA 2CLCX 2FA9A 2GFQA 4MKFA 3WLIA 2P79A 4FE7A 1JWLA 1A2BA 3IIJA 1VTKA 2BEJA 2BMEA 5IM4F 2ZXFA 2O2HA 2XGSA 1RPNA 5F7JA 3NAGA 2YY7A 1G2IA 1XMSA 1N9GA 2ILTA 4OREX 5M04A 1XMPA 5C2JB 4RY0A 5IVHA 4JI0B 3QVGA 1SRQA 4R2IA 3HNPA 1MAHA 2X8JB 5IJWA 5SZJA 1FUIA 4JQZA 4GM4A 1SIOA 2H7CA 3U4MA 5CMLA 3WGMA 2IP4A 3PK0A 1FNCA 1WXWA 4HAZA 5AW4A 1Y42X 4PANA 3TE7A 2P9TA 3FTPA 3N2IA 4KVGA 4C6RA 4N0PA 3RB8A 3DE2X 4HP8A 4PYKA 4YLGA 3RFCA 2YYZA 4ARZA 4E94A 1UM8A 4GUDA 3TW4A 1TCCA 2X3UA 1LDBA 3GLGA 4S05A 2R9VA 3DKVA 5BVGA 5FPQA 5KOJA 2DE0X 1EDZA 1QUEA 1I2CA 2PWZA 4M0EA 4BWGA 2QTTA 4PZ0A 5ABPA 4URXR 1NW7A 4D0SA 2EKBA 3JQ8A 4GYKA 1JXQA 1NSYA 2J5XA 2XH8A 3CW8X 4QELA 5DM70 1ZMTA 5BT9A 2Q8QA 1CQXA 1U11A 2VUIB 5TS2A 2D1TA 2ZTHA 3C8HA 3RSFA 5COBA 3ZXYA 3DBRB 4YJGB 1Q95A 3C7AA 3CSSA 4LKOA 1PJAA 3SMQA 4B0PA 2B25A 1GKKA 1OBOA 1XQ1A 2PIDA 4FI3F 2PZAA 1U7ZA 3AFGA 4XPIA 4D98A 4YT2A 2OCXA 1R0CA 2N42A 2NW6A 2VPZA 4HN2A 5K8UA 1DV2A 1MQAA 1BVYF 1P7CA 1Y5RA 2AMFA 1IY0A 3ENVA 3IJEB 3L7IA 3ONDA 3QRWA 4PTZA 4BKPA 1TB4A 4HVTA 3VH2A 4DPKA 2WTNA 4P1ZA 4HDMA 3O38A 4TMVA 5K4AA 2BEKA 3KV1A 4AI6A 16PKA 1JI3A 1X13A 5AICA 1G41A 3H0EA 3DBLA 3K5WA 1I33A 2WJPA 1Q5PA 3LUDA 4KGVA 5C81A 5HSGA 5ALYA 2GYVA 1SKMA 5L4LA 2ZAGA 1ZD4A 1NBMD 3KEOA 5ICFA 1NZJA 2OCYC 1KH1A 2ORWA 2P68A 3H05A 1QYXA 4IHQA 4MA4A 1C1XA 1WG8A 2X5JO 1MP0A 1Y0BA 3TFWA 4ZN6A 4BGEA 3LWDA 4KSCA 3WRYA 3I4LA 1M1XB 1SXIA 3LRXA 3G6KA 3AYXB 1CHDA 3EVNA 3NTVA 1KYZA 4H7KA 1YAHA 1MB4A 4JUDX 3RBVA 4C4XA 4R8VA 5HTOA 1U3WA 2J4FA 2P4UA 1H9CA 1YBHA 2VT2A 3OPQA 3BMCB 5K20A 1GU1A 2Y68A 4U39A 1OH6A 1ANKA 2JHCA 3F5QA 4N0MA 1AKEA 3LL4A 1UAAA 3TRHA 1WZEA 4I5DA 1E94E 2AWOA 1R9JA 2J45A 2WICA 3OE7A 1Z0AA 5KTOA 1FDIA 3E9RA 2C99A 3L5KA 4G0ZA 4CQLA 5HCNA 5LXTF 4OH7A 1TA9A 1KIFA 5JI3E 3NHKA 2NU9B 3NP7A 1KOGA 1XCLA 1E1LA 4CM1A 4Q9KA 2ZAOA 4X54A 4LF9B 4KG7A 1JR2A 4C0AC 3SQNA 2WJWA 2IYNA 4RVNA 3LTEA 1BMQA 1L7RA 1NWCA 3K4QA 2CHVA 5A6SB 4F4UA 1WZNA 2O8CA 5LIRA 3G5AA 1DJLA 1SCQA 1E2FA 1HEIA 1VG0B 3BRQA 4DCCA 3O82A 2ZBFA 1KJNA 1OREA 1JU3A 4NTZA 4WVFA 3IIEA 3T4PA 3UOGA 2D2XA 4BQOA 3GCWA 2R5NA 3HXKA 4PQEA 5DTQA 3O4RA 2CEKA 2WJGA 3O94A 2V5UA 5D7BA 4US1R 3FCUB 1WDWB 2CHFA 2GWRA 3MT0A 4A0HA 1ZUWA 4KPGA 4XRRA 4RIIA 5TIIA 1EUCA 2ONJA 1CY1A 4BLWA 2PZ8A 3IS3A 1FOEB 1LBEA 4D8VA 5F77A 1LSOA 3QF4A 4FMPA 4MIOA 3OICA 1PN3A 2CNDA 2OM2A 3LCCA 4DTIA 1LI7A 1XLUA 2GPAA 3GLQA 5JH7A 1QP0A 4ZMBA 2ODPA 1YR6A 3PTZA 2BFAA 5EIOA 4B73A 2R4TA 4IMPA 4ILEA 3RIMA 2CXNA 5BORA 2CBGA 1IXYA 2CXHA 5BY2A 5E1BA 1XF9A 3BEDA 5HKLA 1XSEA 1SG6A 5AKYA 1Q11A 5FQOA 4JLPA 4R51A 5AM4A 3CLTD 5IWAB 5G4KB 4Z51A 4QATA 5EP4A 2B8EA 3DJFA 3A6KA 3D6TB 4MR9B 1M5RA 2XSZA 3LIPA 1DHTA 3CRZA 3GGJA 5FUXA 3CUSA 3KKLA 4HLCA 3ZJTA 2YRXA 4CMHA 1I9GA 5I5GA 1W29A 2VF2A 3M6LA 3V9AA 2JH3A 4EHLA 5KTTA 3GVXA 4GOND 5CDSA 3B3QA 2GDZA 5K0BA 2XQFA 3HYLA 5FTMA 3QENA 1Y34E 4GGMX 3J7AC 1Z4NA 3QOWA 4J7CA 3RDPA 1KQGA 4GBGA 4NZ9A 2ZAIA 2PMWB 1I4EB 4A8TA 4FJ0A 3U9LA 2H31A 1K7EB 1S2GA 3D6UA 3COSA 3RYTC 1Z06A 4AKTA 3KR1A 4JDUA 3C3JA 4AMGA 1NG1A 3AMVA 3ILHA 2XHZA 3RYCB 1B0PA 1QHSA 3KS9A 2Z8YA 4XD7A 3TECE 1EA7A 3K92A 4BFXA 4TRMA 4TWIA 2Q5IA 3BH0A 4RY2A 1MRZA 4DGSA 2VHZA 2Z6QA 1G42A 2WVHA 3HDTA 5EJ2A 1Y6FA 1XTKA 4E5KA 4UBIA 2GZ1A 3IIIA 4B43A 1SHKA 3IBGA 3GPIA 4WK2B 3UANA 3QMMA 2IQ5A 1T29A 1L4MA 3D31A 1R5BA 3ZWBA 2R11A 2FN3A 3PUZA 3CF0A 4HXEB 1ZQ1A 2NAFA 1JHDA 3Q87B 1G20A 2GERA 2I7CA 2Y2VA 3P0EA 2BKAA 4DMGA 3I5XA 1E1DA 3NBZC 1E0KA 1M7HA 3CZ5A 4GC5A 1CDOA 1IBMB 4RM2A 2UXBB 3ELDA 2EATA 4U2CA 3U09A 3L3BA 5F33A 2M6SA 4Z1MD 4GXRA 3RK0A 1I2MA 3TDKA 4J49A 3WLMA 3HK2A 3K70D 2WWHA 2YW2A 5ITWA 1N0IA 3FLEA 4HAUA 4ZCIA 1G38A 1SXJE 1P74A 1PL8A 4UVEA 3R9IA 3DXZA 3M5DA 2GAAA 3UK0A 5JW6A 1BDHA 4AO8A 3PNSA 3DA8A 4R54A 1YMQA 2PWYA 1W0JA 2Q2QA 2XUFA 3N87A 4U3JA 4FM9A 1E4EA 4S0ZA 1TECE 3HNRA 3QPDA 1UP4A 3MJHA 3RIXA 3HI6A 1R3UA 2XDWA 4QYIA 1M8KA 4MINA 1BJKA 1E5TA 1L4YA 3PBKA 1YUBA 1R4NB 1V41E 2G8NA 1ORWA 2H7XA 2HJRA 3GLTA 3JQAD 4MEBA 5ILGA 4BVJA 1PWYE 2WT4A 4HQLA 3S8EA 5K8JB 1S3SA 1QTNA 2IP2A 1X1DA 5LZ8A 1GQQA 3D2AA 4GZLA 3T3MB 3JVDA 1J8QA 1UC4B 1GTSA 3R3WA 4KXXA 4LHSA 2X77A 3FYCA 5FI5A 1GPYA 2HRBA 3DWIA 2GEBA 3HJUA 1WO8A 1TLLA 2QL6A 1Z5ZA 3ZHSA 3U19A 3PYXA 3DBHB 2AG8A 1MO2A 3AU8A 3DO8A 1IOWA 3MSXA 3PJDA 4XVQA 1Q15A 3TFQA 4X5OA 3I4FA 3B1XA 1Z4IA 1TJ4A 1XEFA 1JALA 4IDEA 4OM7A 1E1YA 1ZG3A 3ZE2B 3RGWS 5A5FA 3BD7A 4LGCA 4EJSA 4HDMB 1FY2A 4X7PA 2HT6A 4MZDA 3TB6A 1ZONA 3K70B 3NHRA 1KJYA 3NTXA 4M1YA 3FMVA 5T4EA 3SIPA 3UJPA 2WYOA 1CUYA 4MEJA 1JLRA 4ESHA 7MHTA 4Y1RA 1EGAA 1KMQA 3R5FA 4LRTB 4CG0A 2VBFA 1CB7A 3U40A 1CC1S 2GT1A 4B48A 2GNPA 5AT1A 2J3KA 2BGNA 4RZIA 1ZIXA 3WHKA 3I52A 3QBEA 1Z38A 2Y8EA 3QWBA 4AF8A 1L3IA 5JWRA 3ZV4A 1ZY2A 2OCAA 1WF6A 2XRYA 3LHKA 4FDTA 1U1GA 3F6RA 2RHDA 5EKDA 3VR5H 2IOHA 1FEZA 1HT2E 4BFSA 2ZVQX 1P5JA 4F9GA 1LPAB 1O95C 5CPBA 5KYXB 1IRIA 4URYR 2H2HA 2VA8A 3EC7A 4GU5A 2FMUA 3MFQA 1H2WA 4XUCA 4H7FA 2DH6A 5TVKA 4ACBA 3EA5A 3N2LA 1JG2A 1XZNA 2QT0A 1WZCA 1KAOA 1Z73A 3O0DA 5EMNA 2V8OA 4LTNA 5J63A 3CRMA 3IE2A 1TU3A 3RHSA 1O6CA 5D00A 1M0SA 1RQRA 2X2PA 3GP5A 3JWIA 2Y4NA 2Q3BA 1OFIA 1OVGA 3D4BA 3L8MA 4NMXB 3PQ6A 2AMYA 3EBLA 1YGYA 1FLNA 3KOZA 3EVGA 2WWTA 3ZDRA 1U0NA 1JJBA 2A7XA 3R3VA 1UQUA 3TFOA 3LQRA 2XGJA 2Q4TA 1N7HA 4ZD6A 3KAPA 3AFMA 1N9GB 3VPDA 2X5OA 1ADBA 4OQXA 3GZNB 2NU9A 3ZQUA 4FT2A 3HJHA 3SZRA 1JHVA 5AMXA 5HHTA 5IHPA 1LTKA 3U60B 2CLDX 3QLUA 1RQXA 1URPA 4XX0B 2YHAA 3JW8A 1HYBA 2K7ZA 2VTVA 5LKAA 4L15A 2Q5EA 1QG4A 1HEYA 1PQYA 2WIKA 3L82B 4K9DA 4EY6A 2R1TA 2BL4A 4OKNA 2QRUA 1A2OA 2CVPA 4ARZB 2IV2X 1K8XB 1R37A 3KJHA 5ITVA 3FZYA 1L4FA 3EGIA 1ZAYA 4J4BA 2HRZA 4RW0A 4ZQCB 5T6MA 2G5PA 2JGIA 4ZREA 5F1PA 1GNQA 4DWWA 4DA9A 1GNRA 1RWNA 4GVLA 1NW9B 2JI4A 3P71T 4QU5A 5CHYA 3IDOA 1JDTA 4MJ7A 4EI8A 5CFZA 1RWMA 3V1TC 3TSZA 4KV7A 2XLBA 1IXKA 2NZUG 4QSHA 5DXJA 1PJQA 4OY3A 1E0AA 5IYZA 4M1WA 4MYUA 2CDCA 1USIA 3KUKA 1SRRA 2J3HA 2GEUA 4M2LA 5EWLB 4FGKA 2CBZA 3EB9A 3HYCA 2FFRA 4KPYA 1GPUA 2IUUA 2NP6A 1L9KA 4OHPA 4WOJA 4LAFA 4W9NA 5DP2A 3AERB 1ZJYA 4W6ZA 1EVZA 1RHJA 1AM4D 1Z5VA 2ZBGA 4P4LA 1F20A 1XVUA 5EGSA 5BV2P 4EUNA 2HMSA 3JR3A 2HWYA 5GAJA 4D2IA 4R3NA 2IITA 4PPQA 4JT8A 4MO9A 4LF8B 2Q5CA 2GZHA 4XCQA 3WK7A 3YASA 1MQSA 1XMJA 4FJ2A 4X24A 4MUXA 4I1PA 3L41A 3QMPA 1V8FA 3VNRA 1S2MA 4IXWA 3BICA 1TQHA 3L6RA 3LPCA 3W2EA 1ADYA 1T1EA 1JS1X 2OWEA 1OA1A 5TB5A 4INAA 1W93A 3HE3A 3ILXA 2VZ0A 2WU0A 1Z74A 3DPUA 2QJOA 1JL3A 3GFBA 4M1KA 4EG7A 1PFUA 3SYLA 1TE2A 3BWEA 3DM5A 5DP1A 3QLVC 3W8NA 3RSGA 3TRDA 4PZAA 1EGVB 3OZDA 1E1CB 1U7OA 1A5BB 3OP1A 4JA0A 3PUXA 4NYMQ 4R4JA 4M8IA 5IUKC 3TI7A 3U37A 1DB3A 1I7SB 5TQ2A 2ZJ4A 3UMYA 1QDEA 3QW2A 2HLDA 3C3DA 2XADA 2GRUA 5DX8A 1E32A 3AVXA 2B1RA 2FE4A 1IHPA 1ZK3A 1SU7A 2J9YB 1FYXA 4GOKA 5KYUA 4F60A 3ZE6A 2HIHA 5C8VA 3AVYA 2HJWA 3OESA 3Q4GA 4NAHA 2DTDA 4UEKA 4XX1A 3OP4A 4A2PA 4MPRA 1IOVA 3P4XA 4PCLA 4DADA 4I99A 2FMXA 1YQQA 2LBPA 1N2CE 4Q00A 3RBZA 3ABQB 1OU4A 3ORSA 2XUAA 4Q82A 1Y81A 1J9EA 1ULSA 4GR9A 2QYSA 2CJWA 1RHQA 1FSSA 4BAGA 1MOZA 1S3FA 2YV4A 3SKXA 2XQGA 3LFHA 2BM8A 3ZK7A 1GEEA 3NHUA 3QW4B 4AMVA 2KPOA 3CCBA 5TMPA 4JC4A 3ZWOA 1EIZA 2R65A 2FZEA 5AW8A 1EUDB 3V7WA 3TBFA 4CLRB 3MTIA 4IGKA 4MVJI 4CTNA 4X7RA 1WL8A 3A2MA 4KR9A 2ETXA 1ZGZA 2LP4Y 4ZPXA 3SDZA 5IVDA 3FPHA 2D5AA 3BMNA 4C87A 1ZZGA 3UXMA 2QIOA 3TM4A 2VFAA 1A3CA 1KMMA 4N54A 5EHQA 3FZQA 3MCWA 3KT0A 5EWMA 3WSTA 4BMCA 4QOFA 1SULA 4NBUA 2F8TA 4CLRA 4IIFA 2I6UA 3OPNA 3ZC3A 2NXWA 4POOA 1G59A 2P90A 4CI9A 1D1SA 1Q7BA 1UANA 2IYVA 5THQA 2FR8A 4O4HF 4MVJD 2B8WA 4XWGA 2ZXEA 4K6MA 2P65A 2IBTA 2XX3A 2FRXA 3TPZA 4Q3OA 1KF0A 4YMLA 1R5OA 4E5MA 1E8DA 4C7VA 4LGVA 5LVAA 1EVJA 1MW9X 4WN9B 1AX9A 3U4HA 1E1QD 4OX9Y 4C20A 2ACEA 4JCCA 5EC8A 4X1YB 3FSRA 1K0UA 2JA1A 4LYAA 2MYPA 4Q1EA 2F9MA 2QV0A 4TS4A 5EFOA 2NU6B 5EGNA 1F5SA 2JIQA 3OT1A 1HO3A 4OU5A 1II8A 2DECA 3EIQA 3E7WA 4HDNA 4PC3A 4G0UA 1EDEA 1JHAA 1QKKA 4COOA 2CNWD 4YDQA 1T3HA 4LRUA 2JFQA 4XDGA 3ETHA 4DT1A 1OHHA 4LE1A 2XOEA 2VSQA 2O1EA 2QUAA 3FBTA 4PYQA 3E18A 3ZLBA 2BGMA 3TSAA 3BKWA 5TSDA 1KPHA 2BHLA 3WXMA 1WY5A 3ITDA 3OT1B 4JK3A 3QXHA 3VNSA 1DSSG 2IDZA 2BMJA 3G7UA 1PT7A 4ARUA 1REQB 3IUBA 3O5AA 3I42A 4N1AA 4EB6B 2M6LA 4LOAA 3HFSA 1LVGA 2IY9A 3WC4A 1NLMA 4MICA 2DETA 5FUBA 5FJJA 3PYLA 4RGVA 5K0GA 3VSAA 5BN5A 5TT0A 2LR0A 1NURA 1NV9A 3QBDA 2JAUA 1ZESA 1RI5A 3PVZA 5EERA 3SJAA 2PXXA 2W58A 2XB8A 1UXJA 4G0PA 4PZ9A 1LNZA 2H4XA 3JV7A 4Y2RA 5B36A 4JI2B 2R44A 3EIHA 2GH1A 1HYHA 2EWMA 3NUZA 3OZUA 3E3MA 1OY1A 3OZFA 3OM8A 4WXHA 3UV6A 1P2VA 2KLBA 1FLVA 1OBVA 2HK8A 5DHTA 3VVCA 4PYRA 4R2MA 3NBUA 1Q21A 4RLSA 1B76A 1G6HA 3ITKA 4D80A 2OCIA 3THYB 1R6UA 3LVFO 3GLFB 3K8QA 4WFIA 1DIOB 4JUFA 5J2UF 5KKNB 4RNDB 4NXNB 3IOEA 2H16A 2BFWA 4GUAA 5DBOA 4J0CA 3NWBA 4REQA 2PYDA 2VPYA 4JJEA 1S4QA 1NAIA 3FAKA 1KZYC 1OKKD 2BHNA 4C4ZA 2P1ZA 1TT7A 3LUPA 2FKAA 2AFIE 3K32A 1MJFA 1VPVA 4XR4A 3IE1A 1EUZA 3UJ6A 4MVJH 4QXPA 3FJ1A 1W75A 1YRYE 5EZYB 4YLYA 4BGDA 1I01A 3LGAA 4FIDA 2XRZA 2IZ6A 1KYYA 2BCJQ 1D6JA 1T8YA 3G17A 4NBTA 2XUDA 2SICE 3ABOB 2PT7A 3CR3C 1UJCA 1EFPB 2FSUA 5HIIA 4QNMA 5A7HA 2PT6A 2FSHA 2I1WA 3P1JA 4CV0A 1Q0LA 5IDWA 2DKFA 1L1EA 2FB9A 2FP3A 3D5QA 4ZA2A 4QZVA 4BUZA 3ML1A 3CMMA 3VAAA 2C4MA 5A0FA 3BD9A 4G4JA 1XA0A 3LI2A 3QLEA 2WJVA 4UAUA 5IAEA 3B53X 3MJDA 4C7KA 1OMOA 3GO4A 2CXPA 2J31A 3QWAA 2OCDA 1G4UR 2G6TA 4YRDA 3PITA 4BPRA 2HPAA 4IGAA 4EMSA 2G06A 2PR7A 2AMVA 2VJBA 3W3AA 1XPOA 1J07A 1M2KA 4HXGA 3LT4A 3G1WA 4UUNA 2JFYA 5JWHA 3ZW9A 5JMWA 6REQB 4F3KA 3KQQA 4GKAA 3HR8A 4YJKA 1KZ6A 4DQKA 3I62A 2BEWA 3Q3CA 4DV6B 4Z53A 4JJKA 2PZMA 2IZ1A 1N8TA 3DTVB 5CU7A 1JI0A 1Z35A 5LBUA 3WYNA 4BVAA 3LUJA 4LWPA 3SFTA 1UEIA 3PL5A 4YAUA 1ISIA 4L0QA 2Q07A 2REBA 3OPYI 5HVNA 5J3JA 3D7LA 4IEFB 3OTOB 4PAQA 2WHYA 3LC7O 1VSTA 1Z8HA 5AD1A 2H00A 3CW2A 1ZISA 4WLVA 1BHO1 2Y0PA 4EVIA 5DI3B 4X62B 3G0HA 4TKVB 3CZ4A 1FYFA 2BUAA 3ASUA 3PXXA 3O74A 4A6XA 5E9QA 3OQHA 4HB3A 1NVEA 1NBWB 3BSFA 3GEEA 5A05A 3DQPA 4DRZA 1D2EA 3IE0A 1RJ9A 1VXOA 4IWYA 4MV9A 4KQMA 5C5EA 3RVKA 1R0SA 4EZBA 5IS2A 1E9EA 3LMKA 1N3LA 1TZBA 1X1AA 3PGVA 1B14A 4V2IA 4BUJA 4TKVA 3TJRA 721PA 3BL5A 1B3RA 2ACVA 1VA5A 4E12A 1ECCA 4GKBA 2YVQA 1NUTA 1AKVA 3BMQB 2B4YA 3M4NA 1ACJA 1E3SA 3O8QA 5C7LO 5DVZA 4A8JB 2F90A 1TKAA 3ACDA 3ZX4A 4O25A 3U1VA 1ZNYA 2DF8A 4EYKA 5KNDD 1PJ8A 2JGFA 2VDVE 3K72B 3AR6A 2RHCA 4LXGA 4QDZA 4NFLA 5LMUB 1PGNA 4B4OA 4WFKA 2I80A 4HRVA 4KFUA 5J1SB 2JFWA 3TQSA 1V0JA 1Y4AE 1Y3AA 4MV1A 1AKQA 3N3AC 3R0IA 2M1XA 2J41A 1UZUA 2IPMA 4RETA 4Y67A 1UBTS 1G8HA 2OCPA 2OD7A 5FYQA 4IWXA 4K9OA 1C1DB 2A1UB 2X3YA 3RAEC 5EJ7A 1LDEA 1N5IA 2XNKA 4CMBA 1QV7A 1Z0IA 3QEMB 3HJGA 3VTZA 4DEYA 4F46A 5JTTA 5LB4A 1DOHA 1N1MA 1EHCA 2F3RA 5T67A 1KBQA 1BX3A 2PD6A 2C5AA 2ZIZA 2CXUA 2HJ9A 3B3AA 5BVHB 4WH0A 2HPZA 2JLCA 5SV2A 2CMDA 4AS3A 4DJAA 1XXHE 4GPD1 4N5HX 3GXBA 2VR1A 4RVHA 3N76A 3VR5D 3U26A 2FMKA 1DIBA 2FGKA 2Y1LA 3BMOB 3VOBA 2FXIA 1N0UA 2YY5A 2GXQA 4Z8YA 4B34A 1RLMA 1ZKMA 3Q85A 4NE2A 2B37A 1TI7A 3F6EX 5FTJA 2R5FA 2P11A 3IVGA 3LT0A 1IY2A 2EW2A 2GPYA 2YRFA 3EIWA 1FU7A 1NPDA 2IY8A 3IKJA 3MG9A 3KVVA 4TMKA 3UJ7A 4JI3B 2SBTA 1LK0A 3PQ8A 4D0NA 3KTDA 1PLLA 2W2OA 5IKOA 4EKEA 2WWGA 5CRIA 1NOIA 1T36B 1O94C 4TZ0A 1K08A 4X1KA 5JVDA 4JYPA 2ZUTA 2GK7A 3DBOB 1FFXB 1EFRD 5TT1A 4AP6A 5K0NA 1ISPA 5D8DA 5CCBA 1WCYA 3W7BA 2VP0A 4ZI7A 1YDHA 1LGYA 1ABFA 4L3OA 5KJFA 2UUAB 4ANFA 4OJMX 4TSFD 5BUSA 3C15C 1J39A 1D0VA 1NUPA 4FLMA 5GZ6A 3QVMA 4WTOA 1BIFA 4D9HA 3FPKA 5HM8A 4WXEA 3R7AA 2NU6A 3PGJA 2WYUA 5CB8A 1X1CA 3ECSA 1J2RA 3JRNA 4R69A 1ZNWA 3UA4A 3D8HA 4B2YA 3B9QA 4V0QA 2A9QA 1Q44A 2QW0X 4PSKA 1USGA 1YZVA 2HM7A 3VPCA 3F74A 3NWJA 2N75A 3UYLA 2OB1A 4HDKA 4OSPA 2G0TA 5A9SA 2YYSA 2NLOA 4ZI2A 1U94A 2G83A 5IZ4A 4Q3LA 5GJWC 1R4ZA 3CX3A 4PIPA 3IEIA 3GLIE 1J9ZA 4JLNA 1Z9BA 3KHTA 2AJ8A 3N58A 5C9ZA 3DE7X 5GGYA 1EVKA 5IASA 2YBEA 3UKDA 2AEFA 2A94A 1DXQA 3GU3A 2A0YA 3KXKA 4DCJA 2R6DA 5CLHA 1FJXA 2UZ1B 4RSMA 1ODTC 1OU0A 4JEUA 2BMWA 1E9FA 2I7TA 2SKDA 1YT5A 4A82A 1SBQA 4ZVPA 4YXWA 1WM1A 2IKQA 3WP0A 2ZJ8A 4QDUA 5AW5A 3SOPA 4D8XA 5D1HA 1KWGA 4FFSA 2DUNA 4GPIB 3VU8A 1XRQA 1RRPA 4AJ9A 1GZ3A 5DBGA 4RVDA 1DDGA 3MFYA 4XTCS 4QKQA 3HY6A 2OAP1 1BRTA 4K26A 4NG4A 3TIVA 2PGAA 2FMFA 2VTBB 4LVCA 1EXNA 1SQFA 1TVCA 2QTRA 4NP6A 4CPDA 4R1UA 2JLQA 5JBNA 4KIUA 2VUTA 4OD0A 3EDQA 4QUEA 1USWA 2NMVA 1MAWA 1JA0A 4X1IA 1D4FA 5I9BA 1JSCA 3AR5A 1U0JA 4ZDIA 4P4NA 1MG5A 2XPCA 4M37A 2EJBA 4J2HA 3PNPA 2PLWA 2Q2WA 3R4CA 3HCRA 4FHEA 4LXUA 3D3NA 4RL6A 2V4MA 3SJUA 3IUMA 1CD5A 4A0FA 3JQGB 4B5LA 5CA1A 4ND8B 3IXQA 4MS1B 3OQBA 1TQ2A 3KQWA 4E2FA 4NESA 5HKBA 5JO0A 3OPYA 3EFHA 2H2DA 1T2FA 1MDBA 1G21A 2YZKA 1DNPA 1KAHA 3TZQA 5HK8A 4DLRA 1SY7A 4EHHA 3N2KA 4LQLA 4CWAA 3R2JA 3SLRA 3ICEA 3MGAA 1BVUA 2VYCA 1I9CA 2I3AA 2WUWE 1T2VA 3HZRA 4HN9A 3A58B 3FB4A 1RWOA 2JIBA 3KTOA 5IWCA 1T5IA 1KFKB 2CCJA 1N32B 1T0IA 2A5YB 3PB3A 2IX9A 5ALHA 2AV6A 5KNCD 1CJKC 1KI4A 3OIDA 3QHQA 4UTXA 1ZHFA 1VZ3A 5GWXA 3WGKA 3R9WA 3TZ6A 4XCVA 1TLFA 4C4YA 3LZDA 3L4JA 1G20E 4GM1A 1KEVA 4YREA 3OKCA 1X9GA 1T3TA 4EB0A 1K2WA 4E33A 1QR2A 1KMNA 2V7TA 3KOXA 2GGSA 5AVQA 2AFRA 4ZEXA 4B82A 4WZBE 1LRJA 5EINA 4ZODA 2X7HA 4CEIA 3F96A 4E5PA 2X8WA 4LHWA 3ZLJA 1R8YA 1ORRA 4Z7NB 1SU8A 2H11A 1Y1LA 3PZRA 5H70A 1N2CA 1Y8RB 3QUQA 3BJMA 4JX9A 4FCTA 4HB2A 4D6YA 1WKBA 4KXVA 2CMHA 3RJTA 2R8RA 4Y2VA 5H9WA 2YC4C 5K0FA 2E4ZA 1C9KA 1Z5NA 3IR7A 5JSFA 2BFDB 1P9WA 1XDUA 2CDRA 1EX9A 4J7XA 3TIFA 4ZRDA 2FWAA 5EIBD 1XHLA 4HYYA 1MAUA 2FJPA 3M6XA 5J2TA 2OE2A 3F7TA 1PR2A 2NUTB 1N1DA 1GZ7A 4N4AA 4PS0A 5KWSA 4DV1B 2EWWA 5IP5A 5A6VA 2O2DA 4M1OA 1BTOA 2ZSIA 4NEHB 4CV2A 8ATCA 2JIPA 4OB8A 3W8FA 4GT1A 2ZJ7A 2HXGA 3P4YA 1E4YA 1YJAA 4NONA 1H9BA 1FP2A 2ECFA 5TNXA 2P9EA 3SQLA 3K2IA 3JVVA 1DT5A 4MSUA 2UYCA 2IYPA 5ADUS 1A95A 1II9A 3ZY5A 5K4HA 1DKUA 5JH7B 1WQ4A 2QORA 4S2EA 2WTUA 3K20A 4Y2YA 3R75A 1GZ6A 1Y63A 1C3JA 2B9VA 2HA7A 3FPSA 2PX6A 4WGFA 2EBWA 5AXAA 4B1FA 3ZYZA 1NJ8A 1T4BA 5A3JA 2HQRA 1CERA 3A70A 5H02A 2JGRA 1LDYA 4R8RA 4Y0VA 3GPBA 2DR2A 2ZB4A 1JQKA 2VG8A 2IY7A 4R31A 3Q5DA 5JFOA 4ZU1X 1WZ2A 1S9HA 3EPPA 4YCLA 1SCUB 3T52A 2XUIA 2ZRKA 3DMYA 4J0IA 1Y4UA 2A30A 2QLNA 4M0CA 2RD2A 1ZK4A 2B6NA 3WKAA 1OFUX 4XA8A 1CF2O 1MO4A 3I83A 3FRHA 5BN4B 2HDHA 2W6CX 1TJYA 3O1HB 1C7ZA 4NCJA 2I54A 1CUFA 1QYRA 1UPUA 2VYVD 4W5WA 2WFLA 1VMKA 1QYCA 4YP5A 4Z4IA 2OHOA 1BG6A 3SNKA 1YVUA 5BNWA 1E0SA 4G5FA 4LA4A 3TLMA 3L8FA 2VJMB 4WJZA 4KIWA 3WL5A 4JYMA 4PTLA 3ZDYB 2Y6VA 2FW8A 3F6SA 4LQ4A 2A9PA 3E84A 5JVDF 1LQ2A 3O8OA 3JQRA 1F0YA 1P73A 3B9PA 2Z2IA 3IPYA 3JWPA 3NDRA 3BCHA 5KS2A 2NXNA 4JVOA 3ESRA 1G9XA 4E51A 2W2LA 2ROQA 3DE3X 3L1JA 2P4EA 5BPFA 4XWKA 3FZEA 1UWVA 3WLFA 4AURA 1BKYA 1QQ6A 5FULA 4WLOA 2A33A 5G2OA 1DTSA 2RHWA 2A9RA 3PXCX 3E5RA 2O6LA 2VF5X 4NS1A 4ZIRA 1XAHA 1NBEA 5IG2A 3D6HA 4XYMA 3W9SA 2VP9A 3G8CA 3WNZA 3QE0A 1O0SA 4HDSA 5LQAA 3KJIA 1ZR2A 2ZBDA 2P4SA 3DMPA 1EP2B 3USES 1E66A 1BXRA 5JXHA 4A8JC 3E1GA 4OHBA 1U0BB 1YAJA 2PN1A 2EZ4A 3D7SA 3EZNA 5K3CA 1QRSA 4YUYA 5KAPA 1IHUA 4GRIA 3U6BA 1CUZA 2QQGA 3FSJX 4P92A 1KI1A 4TTQA 4RTNA 1DIRA 1E6KA 1ZIDA 2I6GA 1H6BA 4XZ3A 1POWA 3SFZA 5E7IA 2H06A 4BB5A 4DQ0A 4FCVA 3LYAA 3N8IA 4RZUA 4IR7A 1KGSA 4BNDB 1HDZA 2QTAA 3UGKA 1JHXA 2JJ8A 1PUXA 1WV0A 2PZEA 2XITA 4XAQA 2QUHA 4K9MA 5HF6A 5ITSA 1IPHA 1XEWX 2QZ4A 3LC1O 1MC5A 4DR6B 2CK3D 5KTYA 1A97A 3C41J 1A71A 4MIYA 4UAJA 3OA2A 1CY8A 3NIWA 2YZ7A 4KIJA 4I9UA 4DUZB 5FBWB 3CVOA 3FTQA 1UBEA 2Z5LA 1N6LA 3L7KA 4M0UA 1DVRA 2VRBA 2YY6A 4I14A 3X1ZA 4LOHA 3R41A 3JQPA 1XFAA 2OZEA 4EFNA 1D2GA 3IKTA 4C43A 2WD7B 3SCZA 3OZXA 1X74A 4NMLA 4ZC1A 5GM2A 4RTLA 3RD5A 4G23A 4G0XA 2DXIA 1XJWA 2BFBB 2PD4A 4RADA 3ROFA 4FMCF 2ZSJA 4YJDA 5DHFA 2OO7A 2QR2A 5CB4B 2YUIA 3ZHZA 1T8TA 2Q5LA 3E3LA 5EQFA 1BVRA 2ZVDA 4MHTA 4K9PA 1PFKA 2XMRA 1USVA 2VCEA 3VNQA 2DT5A 3O9ZA 5JI2E 1NVXQ 4MUMA 4X3OA 2QL9A 2XXBA 2ZR8A 3ESQA 3IO3A 4GLBA 4BNNA 2R8XA 3JQAB 4JBWA 1W7AA 3U7JA 2VT6A 5ERGB 1M5TA 1VLQA 5K8VA 1JVBA 4FK8A 4JODA 3OIVA 3AKEA 4OHUA 2C9OA 1FCJA 2HIMA 1AK9A 2OAEA 3IMCA 3P19A 1PX0A 3DS8A 3N2YA 1XTQA 1Z08A 4WCFB 2HKIA 5HF8A 3VR6H 1FK8A 3R3UA 3LDUA 1QH0A 1A8HA 4KPUA 2FPGB 1CUDA 2QVGA 2YMQA 3HFGA 3T1VA 4OBXA 1IM2A 3AFOA 4P4SB 5TQJA 2V58A 3AEZA 1UBNA 4ZOEA 2FPPA 5EUCA 5IDQA 2F1KA 1G19A 1LK5A 4MVJM 4EI2A 4HX5A 4XIFA 3WK4A 4O2AB 1GVNB 4QULA 4ENWA 4UHBA 4HMQA 5D6NA 1ZUNB 4PLVA 4JT9A 4TLDA 3PHHA 4EJSC 2WM8A 2V6MA 1E5DA 4PICA 3WOVA 5T6BA 1CRWG 3C74A 1EM8B 4UHKA 1G8MA 1UZLA 3OZCA 1KORA 4YAOA 5TX7A 3TEMA 1WVGA 3COWA 1BEUB 3KDSE 3OZIA 5DTJA 1EGQA 3T12A 2W2KA 4C4OA 1FX0A 2G04A 2ZUEA 3O9VA 3RFXA 1SXJA 1XIVA 2YTZA 3AL2A 3CEMA 4URWR 1I7DA 1DAEA 2Q21A 2RIRA 2ST1A 5IC4A 2GVZC 4BZWA 1KFEB 3RKSA 3D3QA 3DXXA 5DMXA 3TLKA 1JBEA 3C6KA 3EEBA 3HUEA 4IICA 1PR5A 3GPCA 4DJDC 3C16C 3BE6A 4JD5A 2ZPAA 1SU6A 1MO6A 4K2AA 2XKKA 3LIIA 2YJ6A 4KOEC 1FFGA 2V0CA 3C8DA 4XQ9A 1R0LA 3I6IA 2UVDA 5FXMA 3SBXA 3SLGA 5AM2A 1SK8A 3AL3A 1EDDA 5DSTA 2YNMD 4QBHA 2PNFA 3GFRA 5B58T 4LY0A 2DFKB 4LTDA 1CNMA 3DFZA 3E9NA 2W7TA 4OEHA 4CW7A 1OILA 4CZ2A 4CR8A 3EGXA 1QFSA 1R7RA 3DV0B 1M73E 4UEQA 1ONSA 4I3HA 3UMMA 1O57A 4JLKA 3CNBA 3KALA 4B7XA 5JPIA 1WABA 5CFQA 1CW2B 3M5PA 2WUDA 1I0ZA 5F4ZA 1V26A 1ZQ9A 2G08A 3ZU4A 4DDMA 4FDUA 2GESA 4O4LA 4EVRA 5KQLA 3J80A 4NU8X 2IXFA 2C9BA 1M8FA 2W6ID 1ZL2A 2BH2A 3UHJA 2O8BA 1MOSA 4DLWA 3O8QB 1WA5A 2Q50A 4HVLA 4DCGA 3I6QA 2ZZKA 4NE7A 4JYZA 2AYZA 3K9CA 2M6RA 4GXQA 4NECA 1SOUA 5DBFA 3U31A 4EA6A 3WIDA 1QFZA 4BJ1A 1M2OA 1TJNA 5C1DA 4EEKA 1EAYA 3IDSA 4BVKA 2I91A 4F4CA 1KAGA 2VK1A 2W43A 3DC2A 4I36A 3VU0A 4UNPA 4V0OA 4YRBA 3IOMA 4FKBA 2HGZA 2AOUB 1Z18A 4ML3A 4RH3A 4D6PA 5FEUA 1FFEA 2O8FB 2HUNA 2ORED 1KBZA 2GD2A 4D4KA 4DLBA 3OFSA 1P7PA 1OT3A 3TQRA 1K4MA 1Z83A 2FN4A 3EZ7A 4UFNA 5J4VA 3HTXA 1CSEE 1ACLA 5DGDA 3RKRA 1ZL0A 1MAVA 5BWNA 3GHHA 1PTJC 3X1MA 1CS0A 3CUTA 4MQUA 4B8YA 5I9IA 5FORA 4FN5A 3A3NA 3WQBA 2WQ7A 1R6XA 4ZVKA 2P3SA 2OAGA 3HKEB 2PRJA 3P2MA 3W5BA 1KZGB 5DH9A 4EPYA 3ESZA 4EW6A 1P2GA 2RJ3A 1JSZA 3PJGA 5AW3A 4ZZ0A 3I01A 2E49A 2ADMA 3HABA 2HSZA 2A0KA 1RI3A 2OFPA 1X15A 1Z45A 1B0ZA 2VOEA 3P9SA 4H1TA 3FB1A 1OWMA 3N59A 5KNBH 3VDNB 3NRJA 5AUQA 1EQUA 4J1TC 1SIWA 3S28A 1TM4E 2B2XA 2H2IA 3HKEA 1Q0RA 3KJQA 1DINA 4YP1A 1D1QA 3N6RA 3WLKX 3I72A 3ZGNA 4O8ZA 3QU2A 4IQFA 1ECJA 2B82A 4F2DA 2PGOA 4NV0A 2C2OA 2DLDA 2E3JA 4Q6BA 1ISJA 4ERNA 4D44A 2ZKIA 2F43A 3X1JA 3EG9B 5IBRA 1UPBA 5DLEA 4O4JB 5ALIA 3TR0A 3WP1B 1K7FB 2FPLA 2C54A 1UDRA 2YXLA 3FOBA 4C03A 3R8FA 3AM1A 4JP8A 2CL7X 2FG5A 4LHZA 2ZWIA 3A2LA 3UUEA 5JXJA 2QR5A 2EIHA 5THKA 2RI1A 3ZWVA 3T4UA 1GR1A 1DJPA 1FX1A 2FG6C 4WN3A 4GEKA 2C5GA 3GNQA 1R66A 4W9NC 4BJHB 2E4WA 3W04A 4F4HA 3AVUA 1TCUA 3NYIA 4HS9A 1SUIA 1MF7A 4DC0A 1H2ZA 1RACA 2DMRA 2KMLA 3CWCA 2X0KA 2HO4A 3HHPA 2IIVA 1YWGO 1F0KA 1G8GA 2QI9F 4IINA 4CI0B 3BEOA 4QG3A 5HDQA 3HB0A 5F51A 4RUKA 3DUFA 4UVHA 1XJ0A 4EW1A 4Q4JB 4BX8A 2CUTA 2POCA 4JVNA 3CUKA 1DZ3A 5I47A 2LD4A 2ESRA 2PKCA 3H87A 1W44A 3CVJA 3ODGA 3EUFA 3FHTA 5CLLA 1UOEA 2W9XA 4LE2A 4LY6A 2GM4A 2Y05A 3OFND 3OTHA 3GRVA 1TADA 2DSNA 5C53B 5AQEA 4MIEA 1ZOSA 3A6ZA 3TM5A 5KDDA 2PDAA 2GHIA 3DE6X 4I4CA 4JHLA 5EUQB 4ZI5A 5KDLA 2XQIA 4D0LB 2HCBA 4UEOA 3CTPA 3V8VA 3ER9A 1ZM3A 4Y9SA 1P9OA 9LDBA 1UMKA 1R0WA 2GOYA 4YMIA 3DONA 1FA9A 2B9EA 4XTRA 2JFUA 4JC5A 4ZAYA 5I7UA 3WLHA 3HI4A 4XSVA 2GAJA 3BE5A 3I64A 3MAGA 1B16A 4JMLA 4G5GA 1RCUA 1UKBA 1SAYA 2WTMA 1BXGA 3D0OA 1WP4A 4FNMA 4P08A 1BS2A 4RWEA 1SMKA 1YCGA 1PR4A 2Q5FA 1OFHA 2CKMA 1TMOA 2X8AA 3G13A 1KRWA 3G1TA 2BCEA 2C95A 2K2WA 5GGXA 3N70A 1W5BA 1VSUA 3HLTA 1YDFA 4KQKA 4YRIA 4XVHA 4Q4CA 3DNPA 1TJPB 1X7YA 3U39A 3EZ9A 3CPJB 1KC3A 4H4CA 4G86A 2BGKA 3GJ6A 3I8OA 3TTSA 4PN3A 5L3SB 1PS9A 1DIGA 3O3NB 3NM4A 3L6EA 2ZSKA 1MA3A 3WGQA 1DKMA 4JXXA 1HM5A 2PTGA 1H94A 4EPVA 3IB6A 3IMEA 4N3GA 3Q0IA 5IXSA 2JG3A 1G98A 2CFSA 4HR7A 2PHZA 1YE8A 2XYRA 2V45A 1RYEA 1V2HE 3A27A 1Z37A 2VLIA 5G02A 1MEJA 1CQIB 3SQMA 2HD4A 4AJNA 5CFOA 2DUMA 4LWZA 2BCGY 2R1VA 2FF7A 2GZAA 2B30A 4KNWA 4RH0A 2A3RA 1WXFA 4QAJA 4S35A 4UOQA 2QNBA 4YJHA 3H11A 3M3PA 2ZRHA 4QXQA 3M6WA 2O2JA 4TVOA 4BFCA 1N2HA 2COUA 1KAMA 4F91B 1FDWA 2JNWA 4ZQFA 3GLGE 1PVOA 2JJ2A 3KEQA 5JD4A 3Q3EA 4D9JA 1NF2A 2J0SA 3QX8A 4YR7A 4JIGA 4XCXA 3OWXA 3UJ8A 1YL6A 1A8QA 2DC1A 4GMFA 3QGMA 2AE1A 3DT9A 2YHUA 4C7OA 1FB5A 4NDAA 4US0R 3INRA 2EJWA 3AHIA 3KSRA 1HNZB 1SNYA 2KM1A 2XCUA 2D54A 4YLEA 2X9QA 1I7PA 4I4TB 5F35A 1FX0B 3TNJA 4BEBA 2W6IA 3FMFA 3K0FB 3D4IA 1T34A 1NW3A 1U0LA 1Y9ZA 1XF1A 4ZK2A 4E5DA 1QS0B 1EXDA 4UU8A 1SOVA 3ZDAA 1DKOA 1QIEA 3K35A 4RD6A 1PJ4A 4PLHA 4TUYB 3SE7A 1MG0A 4JLWA 4EBFA 3V97A 3WWYA 1N5RA 1K63A 1R0ZA 2JAQA 3CZCA 5K0TA 3RUDA 2V7QA 4ZYXA 4N3NA 3TKLA 4NPHA 2I9PA 3N2ZB 1K6XA 2A9VA 4PLWA 4C3VA 1TO2E 2IHKA 2VHCA 1A8PA 1ZC4A 4GVXA 1MEEA 4QEKA 2WIJA 2BMVA 3BWYA 1E6LA 5E6RA 4EATA 3MILA 3WBBA 2AVNA 5CB4F 4JXZA 4EJSB 5BSEA 1G7SA 4DJTA 5AWFC 1YVPA 1H2AS 3D4LA 3E9DA 5BRNA 1P45A 1EK1A 1YB5A 5DNVA 1GXSA 3PUIA 4JFAA 1IULA 4TOIA 4DUPA 2O2SA 4RO0A 1QG2A 2DQSA 3NFYA 4IKOA 4HWSA 4FYXA 2GUGA 4TTPA 3HA2A 5FD8A 3UH0A 2DHEA 1TEXA 2ZB8A 3CEPB 3NKLA 3F7NA 1FVFA 4RF3A 4G8JA 4AY4A 2E6UX 4C2AA 3N8HA 1R0KA 3U7QB 4B40A 5K6TA 3TGPA 2O19A 2OV3A 4GSLA 2OYCA 4UTZA 1O97C 3JVIA 5CVCA 5AJVB 1ZGHA 1CETA 1Z7YA 3D8RA 2RGXA 1WD5A 4LK3A 1OROA 2E4UA 3KSZO 3WL3A 5E6SA 3R0JA 2X5XA 1U7HA 3PT5A 1A9PA 1ZO8A 3SM3A 1Y37A 3LWBA 1RKVA 4CM7A 1LFDB 2ZU0C 4EY8A 3MRXA 2DERA 4CKXA 5IK2A 3F3MA 3K4PA 1YQ9A 1LI4A 5IHXA 2D1SA 2OGWA 5K0LA 1YH3A 2A8YA 4Q3AA 1ZGBA 1QHGA 4G6ZA 4MDFA 3ZHXA 3L0SA 3O03A 3QMVA 1PHRA 1QZUA 3TCNA 4ARVA 2LIPA 1PS8A 2AN9A 1QRRA 5E4TA 3S2YA 2ATCA 3H0CA 4MH0R 1CK4A 4TKMA 4LXHA 4W5QA 3DEZA 1U3VA 4XB2A 3P96A 4PPGA 4KYVA 3Q10A 2CF6A 4ZALA 2CLKB 1GYQA 3NBYC 3RIYA 2HMAA 4AF6A 1O54A 4V3CA 4YBZA 1T1JA 4JUIA 3K6JA 2QW1A 3H1FA 1NW6A 4MB2A 1ABBA 2OFXA 1LS1A 2FWNA 3U3JA 5LNK6 1AKYA 2DHCA 4B83A 1QS0A 1WKCA 5FTWA 5DT9A 3D8SA 5M7EA 3GGSA 4A1OA 1YRLA 4L76A 3F47A 1TAHA 3TNDA 1FRVA 3WMWA 5JNUA 2X6QA 5CT6A 3GCXA 1E2BA 3PWSA 2EYUA 5ICSA 2IZZA 2RB5A 3RRYA 1GKIA 4C04A 3K1YA 1VE9A 4L4SA 4LRSB 1TF7A 3WGJA 1RJ9B 2HHCA 4FW9A 2VNAA 2XMGA 3IOYA 3F73A 5AKXA 4OXXA 4YT5A 5FEMA 1CE8B 2AJDA 1MRNA 3M49A 3R5KA 4N0QA 4XKJA 4EKYA 5B3KA 5KOIA 2PKQO 3AP3A 1YQWA 1TX4B 2H2WA 4QDKA 3TG8A 3O8CA 2ON6A 3T7TA 3FVQA 4P3OA 3SD7A 1W30A 1IN8A 2NV6A 1CYEA 2VXOA 1HRDA 1OFUA 1T15A 1UC8A 3A11A 1K6IA 2DPGA 4INZA 5COQA 4B3RB 1D8TA 2IUYA 2VJKA 3DVSX 4IV0A 4KYTA 1PJTA 3PFIA 1C0KA 1GO2A 1K6MA 2HK9A 3GEGA 4JLOA 4DBZA 1CUJA 4OOEA 1GQRA 1HMYA 3EX7C 2COKA 1G8JA 2QAGA 4IRUB 4ER3A 5AW7A 1CR1A 4P4TA 2A58A 2VDMB 3RU9A 3ZWAA 4U7JA 3SYTA 2NO7A 3A1EA 4TLCA 4TKUB 4V0LA 2W4QA 2A1IA 1ZEMA 3QUCA 1UT6A 3BTVA 3T94A 1Y7LA 1RNLA 2O2EA 1GARA 2RGNC 1LBTA 3LQ1A 4ZO6A 1GAXA 2ZSFA 5DXAA 2YFHA 3DMRA 4F0JA 2EEPA 1BU8A 3RFFA 5AVSA 3I9JA 1W1WA 3EARA 5TF4A 4BP1A 4I8IA 1DFGA 2R6R1 1HDGO 1KFBB 2DR0A 1POXA 3HEMA 4L0CA 2OCGA 2JAHA 2UZAA 4EHDA 1PBNA 1JKFA 3IP7A 4PPNA 4WW0A 1G5PA 3WV5A 4LJSA 4UJ3A 4RDIA 4WJLA 1JDBC 1U2GC 1E1KA 4N6GA 3QKWA 3U5ZB 1ZHOA 4DDVA 2B5WA 4R8KA 5HK9A 4G1MB 4L9WA 2MCFA 3ZHCA 2YV1A 4C4SA 4NZNA 3Q2OA 1OYYA 3PT9A 5EP1A 3T4EA 1Z4LA 1XKXA 3ZWCA 2XZLA 2BFPA 3RSCA 4OJTA 3VKHA 4Y2UA 3WNDA 4QD3A 2OV4A 2AOXA 1NP3A 1O1YA 2YQ5A 4FYIA 4I8DA 5IFLA 4NXMB 3RW9A 4K1LA 4IF4A 4R9RA 5AP9A 1C41A 5D84A 2WE7A 4CG2A 2YYYA 3JQFA 4S1NA 2YHBA 1VE7A 1YI0A 3CKYA 3DCYA 1AGNA 3C4QA 4TN5A 1MJ5A 2PRKA 4L28A 3EXIA 2XXAA 5CJ2A 3I34X 1E3WB 5FFMA 3E9MA 1DKPA 4CM4A 3M4JA 2GZMA 4KITB 1CJCA 3LUGA 1B00A 2QSZA 4HATA 5SZKB 3CJTA 4U2FA 1Z3IX 2WOJA 3B52X 1UJ6A 3LBIA 4KQXA 4RX1A 4QUJA 5EJ4A 1JQDA 1WTAA 3PFKA 3A28A 4WDQA 3RODA 2JW5A 4B75A 3DLTA 1UC9A 2WIFA 4L51A 2BTEA 4Z0TA 2IVFA 2HI0A 3ZHBA 1AQNA 3K5IA 2FJ0A 1SH7A 4WOBA 1N2XA 1Z28A 3VR3A 1AHHA 2GJ4A 3B38A 2OLKA 3ICWA 1DJNA 4LRQA 4Q3DA 2XQJA 2VNHA 1UH5A 1QGOA 2L82A 3FPEA 4DV3B 1C0LA 3V4OA 2GJAA 2FR0A 5B3LA 1N7GA 3FWYA 3LBFA 3UAOA 2BGUA 3F8WA 5D51S 5HQ3A 1YB7A 1EZ4A 2IDMA 2NADA 3MGCA 4KH1A 1QONA 3C3PA 4G9BA 3OURA 1KSGA 2PUJA 1FDSA 2JBAB 3ZHYA 1V71A 3HGMA 1CUUA 1GZSA 4GZMA 2ORVA 4L5BA 2FLKA 3I3SR 4BLTA 4X85A 4DLPA 2JLYA 4C05A 3K30A 1F2TB 1VIMA 2H8KA 2QLJA 4XDHA 4CQMA 1KSFX 3CEAA 3QG5A 4G36A 4TKUA 2CB9A 3BZBA 1C9YA 4TXMA 3SIWA 2ZE5A 2HH9A 4U2GA 2FQXA 1GPAA 3EMDA 1ENZA 3FUCA 1PCXA 1WUJS 3T7DA 5I48A 1PJZA 3LYUA 3PWTA 1CJBA 1SURA 4IMRA 4YCJA 4RD4A 1AMOA 1HYQA 2GLXA 3L79A 3RUAA 1ZH0A 4HWKA 3AW9A 1GGFA 1SUPA 3QLUC 4X71A 3D0KA 1J5XA 3BH7A 2BR4A 1DEKA 4GZ5A 1TIBA 3LW7A 5JV5A 1QVWA 1I5RA 1NMYA 1WU8A 2KB0A 4KO2S 2CZQA 2AR9A 1F0PA 4BE4A 5KVSA 4Q7LA 3FYTA 3W8RA 4X63A 5BYJA 3G2KA 4Z7JA 2NP7A 1QH8A 2J9ZB 2AD1A 1ZM2A 3JWEA 5AQ1A 5LYJF 1QGYA 3UAWA 1QFJA 3EULA 2B7LA 4MYTA 1A69A 2AI2A 4PHTA 3EEFA 2AXNA 1E2PA 1VCMA 4NV1A 2W6NA 4EH1A 4JC0A 2G6BA 4IXMA 2RJNA 2VF8A 1L5RA 2C8KA 3RJMA 3GCGA 3IBSA 5A6SA 2VHWA 1GCAA 4HQ0A 4EKDA 5IAOA 4F6CA 5B53A 2Q62A 3BWMA 4A6EA 1F6WA 4YYZA 2CXSA 1VRWA 2EKQA 2OK8A 2DCMA 1ZD5A 2DUJA 2X0FA 2P75A 2W00A 3NIDB 1X8XA 4EY4A 3HO1A 2J32A 4LJKA 3P9YA 1M2JA 5KVQA 3ULKA 5JYEA 2CXOA 4FLEA 4G0QA 4RQTA 2GAOA 3WGGA 2O59A 3N0TA 1K7YA 1I4WA 1TCAA 3QYFA 4QREA 3KL2A 2PZJA 3M6MD 1D1TA 4PSVA 4BS9A 1Y1PA 1XA3A 2DFDA 2J07A 4LZPA 4Z99A 2DAPA 2I2AA 1Q0UA 4WGGA 5EQTA 1NIPA 2GRJA 3ZJYA 2R47A 4LVOA 4OQQA 3GJ0A 1RRVA 2C5FA 2NYVA 1OLUA 1UDWA 1D0IA 2BLNA 2O07A 1G5QA 3A31A 3CX8A 3PS9A 1Q12A 1PTJA 2WLSA 3K5HA 4M0LA 1L9XA 2ZQYA 1G3QA 3E22A 4U02A 4EUEA 3LF1A 3HLKA 5LQDA 3L49A 4W5NA 3VDXA 4BGUA 5DCUA 3W5HA 4DIDA 1G1AA 1GPLA 3LVRE 1CF9A 3HN6A 3M2TA 3QF7A 4LJLA 5CX1A 1T9GS 2C9ZA 3M8KA 5B7GA 5I4BA 4B3TB 3WLPA 4EAQA 3LT5A 4CCYB 3FCYA 5ANRB 1TTQB 5J59A 1FP4B 1WXXA 4L9SA 4TXHA 4BKMA 5BN3B 4RTQA 1X1EA 2C03A 3L4BA 5ERYA 5AUOB 3EOBI 2OORC 4DCPA 3CW9A 4EWLA 3VR4H 2B99A 1HE3A 3V6MA 2Q5QA 2UYOA 5C4GB 4WASA 3H84A 4J3FA 3STHA 4L50A 2X76A 4ZVVA 2YL2A 4Y18A 3DE5X 4YIKA 5MN6A 3RSQA 1QZXA 1Z34A 3MLAA 4L5IA 3NWOA 2VATA 1Z26A 1WB4A 121PA 1IAQA 1GAJA 1U63A 621PA 2HQ1A 5JAUA 1OIXA 1RLIA 1I1OA 3DDZX 1B93A 3O1LA 3VZSA 2NO4A 4Q93A 5CA0B 2E9SA 5BVHA 2GBCA 1EX7A 1Q50A 3AM3A 2E0IA 4N5DA 4QYSA 3HXPA 3UWSA 1S8FA 2XA2A 1VE3A 3HB1A 4IO0A 1KEEA 3C1TA 5DNEA 1KU0A 3AX6A 3FCXA 1JILA 1ZN9A 3HKCB 3IBCA 4JGGA 4KAJA 4KMRA 4NHEA 4O2BA 4D3YA 4AQDA 3RT1A 1FMCA 4O2LA 4OIMA 4AJ2A 4GQAA 1XTRA 2G1JA 4Q02A 1E0JA 2GK4A 3LHIA 1XXHA 1L4EA 3DH0A 4NI5A 1N6IA 5FRDA 3R6TA 1P3Y1 2CJXA 2HPVA 3GUUA 3R0QA 4MRAA 1ODCA 2XSZD 4QOIA 2XNCA 3PPYA 1F06A 2O48X 4NS4A 4AJIA 1KMIY 4P7FA 5ITZB 3UGTA 2AXEA 2XJ4A 2VVTA 4PSAA 2DX7A 5G0WA 2ZJ5A 2H6EA 3K1ZA 3GN1A 2KHZA 1XKQA 3FCAA 1F4VA 4WT7A 3KYJB 3H9GA 3NHJA 3S7ZA 2H5EA 2QD5A 4OGLA 1E5LA 3B1JA 1WMBA 1YK0A 2PZKA 2Q2OA 3TVDA 1PJ2A 4OCZA 3I53A 1H2BA 4LZAA 3WIBA 2AFHA 1NVFA 2ZJBA 1Z25A 2CNLA 5DRTA 2G77B 5EESA 3W34A 1ENPA 1NMSA 4MA0A 3T34A 3ZNQA 4NDNE 2H1LA 4MKXA 2OBYA 5KKCA 1FQJA 5IAKA 3VUEA 4PBRA 5LJIA 5LZ4A 2H52A 3TH5A 3I9KA 4YRSA 3THXA 1GKLA 2HF2A 4RFVA 3I0MA 5A1JA 1I5OA 3Q3VA 2W8BA 5F64A 4CEHB 2E48A 1W36D 5LP6F 3Q0EA 3KHKA 4N03A 3FOEC 3AUSA 5D1NA 3Q8KA 1G8KA 4X8HA 3T5TA 4C3OB 1QRDA 3DR3A 3GQBA 1YB1A 4I4NA 4BNFA 4IJUA 3IHLA 1RP1A 2QE7A 3KHSA 2NTVA 3QXJA 1K88A 1XEXA 3GLHB 1Z6PA 2ZBUA 4LJ9A 1ZK2A 5TQ0B 3LXMA 2OO5C 3ICCA 3TTXA 1WBBA 3CLSC 1YK1A 4R6XA 5K0EA 1K4KA 3Q7IA 1CZUA 1FJHA 3GDOA 3DBIA 2CY0A 1L7DA 5FUQA 2CSXA 2ENWA 3NGXA 4WX2B 4DMCA 2C4KA 4FFLA 4YUZA 1B6TA 4XWAA 2C98A 4WNYA 2QZ9A 2RKWA 3F3KA 3ZWXA 1RXVA 4MVXA 3AETA 5DIFA 3DKPA 4Y2JA 4YUWA 1ZMXA 2VPPA 1FYVA 1JKMA 4NK5A 5MFPA 3ZU2A 3DB2A 1XEXB 3GLHA 3QU9A 4PBTA 4YCAA 5TQ0A 2JI9A 3AVOA 2BP7A 4Q24A 1FBNA 1UJ4A 1AF7A 1NTOA 3HCNA 1CZLA 1L8OA 1P19A 1V9SA 1P4SA 2W2QA 4PFKA 5KAMA 3TN7A 3AIOA 3VA7A 3KQOA 1X2EA 2K87A 4OYLA 3IVXA 1Y9AA 2JIOA 1ETUA 2J5QA 5B2ZA 4W7HA 3EWNA 4ND8A 5EE0A 5EEGA 5FAXA 2E1RA 1DRVA 1P75A 1T10A 5HR5A 2YIVX 3DLIA 3G23A 1OBCA 2BP7B 1RPJA 2V5VA 1YCHA 2I6QA 3KZNA 4GF5A 4HZIA 5D3MB 4I9FA 1EWKA 5KSZA 2F62A 1BOFA 1EXMA 1P17A 3ED5A 2P6RA 2LW7A 1FDVA 1DC7A 1JG4A 3M6IA 3THYA 4TL7A 1ZX1A 1ZBQA 1QHHA 4DR7B 4QM6A 4OUDA 1P2UA 4U1RA 3WLTA 3MWEA 1R10A 9ATCA 2CXQA 1W5SA 2CF5A 4U6SA 3RG2A 1I6WA 1CT9A 1Z4OA 1FMLA 3EVCA 3OHSX 1SXHA 4KZKA 4RVGA 1U1EA 3O3MB 5DHSA 1BSVA 3ISJA 5LCXA 4BNVA 4B2LA 3R3YA 2OILA 3WTBA 2H5IA 1QCZA 2P7IA 3BORA 2ZUDA 3M1LA 3NBAA 1X3SA 2C7VA 2C4TA 3INYA 3BTOA 3TD6A 3L8ZA 1I1QB 4QDXA 1NQTA 4B80A 4BZPA 3TX6A 5JISA 3IGFA 1NA5A 1ZCAA 3CLTC 4M88A 3IP3A 3ORFA 4UHJA 4AX8A 2GWHA 4F2PA 2IHVA 4LQCA 4UTRA 5FTNA 4RK6A 1W4LA 5KWJA 4CG3A 2BPOA 3HU5A 2VEOA 3JZMA 3OJOA 3TMYA 1H8HD 3FE2A 4UXHA 2O14A 1WRBA 5DI3A 5FR1A 4LBVA 1MCZA 5HKKA 2HK6A 3FR8A 4MVJF 1TQDA 2NSJA 3T7SA 3H9BA 1E7RA 1Y4ZA 4Q9DA 1KO5A 5CEJA 4BE7B 1PK7A 1C4KA 1UZMA 4CYMA 2MJLA 1PQUA 1IPEA 2AT1A 2HK7A 3ORQA 4TV9F 5C8ZA 5C1IA 1P0FA 5BMVA 4L07A 4OF4A 4G84A 3S6JA 1O94A 5TGZA 2BF4A 2ICAA 1LLQA 3CBQA 4LKRA 6REQA 5JRZA 3QPAA 3RI3A 1I4TD 1TNDA 3UXEA 2AYXA 1ZXLA 1DJQA 1HL3A 2VDLB 2WC1A 3DGEC 4JJAA 4TYPA 5JC8A 3X0DA 1GQSA 2KSQA 1JIUA 1J0AA 1DQPA 3DLCA 2Z9BA 5I45A 3DDNA 3I1YA 1QF7A 3QELB 1EG2A 5I4CA 3IDZA 3QE9Y 1QCDA 1E6CA 1WHTA 5HZKA 4JP5A 1MW8X 2NYRA 4TWRA 2FJUA 5HIAA 2CNWA 4AS1A 1TAQA 2FEPA 1JXOA 3RAPR 4H17A 1AK1A 3F4LA 3S5UA 4NLLA 4PG6A 1P8AA 1NXTA 3QELA 5T41A 1KDVA 3REGA 1QLHA 3L9WA 3Q6NA 4YJ3B 1EFLA 1U0HC 2MYTA 1H4SA 2R00A 2C61A 1JH8A 2XODA 3ANNA 4MAAA 2G07A 2HF9A 4H0CA 1WQ3A 1WIWA 1CLEA 1G291 2JGDA 3L7BA 3OHPA 1X87A 3AOEC 3PPXA 4XFJA 4TTAA 5B3JA 3X2SA 4CIVA 1LS6A 4L3VA 3OLWA 2BT4A 1IATA 3OLYA 4D4HA 3VYWA 3OI7A 1F8UA 3HRKA 1HY3A 2DWPA 2ZIAA 4BO4A 3BHIA 1UKAA 5G0UA 4LSZA 1G55A 4Q9JA 1IVSA 2COEA 1GL9B 2EQBA 1WOMA 3O4FA 3IURA 4QBFA 4BKQA 3VR4A 2YHIA 2IXAA 3QU5A 1K8RA 4IDPA 5FWYA 3HQ4O 3A1CA 3U81A 3IPAA 3OTIA 2JC3A 4Z9AA 5DHRA 5LDHA 4DV0B 2RCYA 3MTQA 3P7MA 3MHPA 4BMOB 1N78A 5GV7A 2Q1SA 2Z4SA 1FRFS 4RACA 5CFRA 4GSKA 3EH1A 1RAAA 4ETIA 3VO1A 3TTVA 5IABA 2F6RA 1J23A 1RSZA 4F9FA 1JXAA 1SCIA 1YUNA 5DF1A 2WIBA 4G25A 3SC3A 5ALVA 3THSA 2Y67A 3E2IA 3H16A 4YCSA 3TE6A 4AQYB 2A88A 2PD3A 2BFFB 3AINA 4FE3A 2BGIA 4DMFA 4WI1A 1JF8A 1KDTA 2BOVA 1P3DA 3PICA 2PUTA 1S0UA 3ND8A 3HA3A 1BQEA 2E1PA 4YVFA 10MHA 2G1PA 5JY6A 3DG9A 2JEZA 1VL8A 5DW3A 3UB2A 1R0BA 3LX8A 3PG5A 4R9VA 4YAJA 1YQTA 5AK5A 1O8CA 3W9YA 4RTKA 3LFUA 3NEJA 5B3AA 4EW2A 4TVSA 4G0WA 1DWPA 2OXCA 2ZYTX 4NJEA 4TSKA 4DBVO 4FHGA 3PFHA 2HCJB 4XI9A 3ENWA 4W1QA 3EY9A 1XRSB 3F4KA 2JGEA 4PU0A 3S8MA 3VKWA 3FMGA 1L7MA 4YDHB 1RIIA 1FTNA 5A62A 1K4YA 1XKLA 5GJVC 3AEKA 1JA9A 3LY7A 3M34A 1CFZA 3WOHA 1XROA 4AZ0A 4YRNA 5HGXA 3PFCA 4FXOA 3V1MA 2OZKA 1X7YB 1KJZA 2MSDB 1T2NA 3DHWC 2P9ZA 2HU2A 3JVEA 1YR1A 1NHWA 3NTLA 4J29A 4WA8A 4GFDA 4N3AA 5CG1A 1K66A 1PWEA 1IG3A 3QNMA 2VUHB 4I2NA 5EZ6B 1BXGB 4HLUA 1MPTA 4G37A 1T0UA 5AI9A 3FPJA 2WIGA 2IYRA 1AKMA 1QIHA 4AKSA 4CKEB 2P3LA 4RDXA 4LHYA 3BILA 4YRTA 2LTAA 2R0QC 4XB1A 2HF7A 4GPZA 1OB2A 4XRGA 1P0QA 1U0FA 2IVZA 4MLCA 3OQ1A 1IMJA 1YNOA 3OZWA 3FFBA 2X7XA 1KDYA 2ZDGA 3SHTA 2YINC 2P7HA 5CEEA 5JDIA 4RULA 3ITNA 1WCIA 2GZDA 2PKXA 1ZSNA 2I6TA 2O54A 5AXCA 3RUEA 2AC7A 1KQPA 4IXTA 3ONEA 2Y4OA 1XNQB 1C3LA 4TXLA 1Q7TA 3VTKA 4A26A 1EFTA 3SIXA 1R8XA 4B76A 1O77A 1DLJA 1UDBA 1PZGA 2ZBEA 3H83A 1T5TA 2OCKA 5IRCD 4MGHA 3RM3A 4ISCA 5ARDA 3BMXA 5EZ5A 3RQSA 5AO9A 1T6NA 3H11B 1F5NA 4DLSA 2Q2VA 4DG9A 1P3JA 3RU3A 1J5EB 2H4WA 2CLIB 1JG3A 5DIZA 4E5VA 5JD5A 1XU9A 3QYAA 3SJ7A 1YB2A 2H5JA 2DWUA 4C0BA 3WQRA 3HH8A 4H35A 2BLLA 4RF2A 4A91A 4EG4A 1U6IA 3NANA 2JLXA 1TZ2A 2O2GA 2BHRA 4WZAA 1I3NA 3TBHA 3U5TA 2ZYVX 3EAQA 1DQRA 1XZHA 3Q98A 4RDCA 3ZI7A 1B2RA 4HPWA 1U2RA 1PJSA 3O2QB 4TT3A 5DSZA 5F21A 2QVCA 3O8DA 5HEKA 4RE6A 2O3QA 2QMHA 4QPJC 4FXPA 5C1OA 1QRAA 4O4HA 2QD4A 3HR4A 3UUFA 1FW8A 3EF3A 3HV0A 5IM4A 3BGOS 3BT7A 4P53A 4AXBA 4DS3A 5C5DA 3DZHA 3KYDB 3FLMA 5IULC 2WHRA 3KAQA 5HCIA 3CM0A 5CG2A 1XQYA 1M0EA 3H1EA 3QKRB 1ML3A 4BBAA 5CTJA 4YFYA 1ONPA 3MW8A 5EHGA 4J4TA 5INTA 5A5DA 4YUVA 2EGUA 2DH5A 2RGGA 5D86A 3JZDA 1T9ZA 2EYQA 5ETJA 4E21A 3LQ4A 5ER6A 4W63A 2P5TB 1GL7A 2WKWA 3N2KB 5CVJA 4ZO9A 1DAKA 4O0LA 4RZ2A 3T35A 3GP8A 2RAUA 4U4AA 3NHYA 4LOJA 4MV5A 4A16A 5KJ6A 2Y71A 1Q77A 2ZRNA 3AHEA 1RC0A 3ZV7A 3SX2A 1NQVA 1O7JA 4RHYA 4CQLB 2RHMA 1FNDA 3SM9A 2G9ZA 2Z5FA 1PKXA 3NQ41 4MW6A 3SLKA 5EJMA 4ZCSA 3EQ7A 5CYPA 1EKXA 1MT3A 1US8A 2R86A 1M6YA 5BNZA 4LYFA 2BBSA 2PX0A 4TVBA 4P35A 1OXXK 3DEIA 1SOMA 2PGLA 1QPBA 2DHRA 2JBWA 3JYLA 3L43A 2IE8A 4G5QA 2BF7A 2HJVA 1EE2A 4TLEA 4TX1A 4Y6GB 5UKDA 2C5SA 3WQHA 4D02A 1N8KA 1WW8A 5JDCC 1OOEA 3DTYA 2AJLI 3ETJA 5K05A 3KXIA 2GBPA 3TO5A 1XWFA 2WA2A 1JN0A 5KTRA 4OM8A 3QVJA 3GVPA 2H1WA 4RTOA 3GDHA 1N0HA 2HV8A 3IQGX 4WKOA 3TYXA 4CKBB 2IX3A 1AF4A 2E85A 2G1AA 2XD4A 5E0KB 4ESEA 3TZEA 4FWTA 4AROA 1JEYA 1FMTA 2BVNA 3KQUA 4KXNA 3FCOA 1V5GA 2R7LA 3PHLA 4HWGA 4I1SA 3DDWA 4ZO8A 4AZVA 4EVQA 4ZJUA 5H82A 1IZ8A 4IDCA 5FI0B 5JMOA 1FPQA 4N40A 3A04A 1PL6A 1DBSA 3FTFA 4ERXA 3V4LA 3ZWDA 5D5QA 1MH9A 2CHUA 1DJMA 4EG8A 4DM3A 3H9UA 4M8SA 3VSEA 4JI7B 5CD1A 4Q37A 5DHAA 2YCBA 3IUNA 2CVHA 5C5IA 3FPLA 5KNDH 2ECOA 4MB6A 3BS4A 4EI7A 4Q34A 3WK9A 4M8KA 1C9JA 1E3EA 1GPNA 2A5JA 4HQKA 4QU0A 3NH9A 5SY9A 2EKPA 1JJVA 2ZRLA 3VO8A 5BN4A 1KI6B 1U8UA 4XM1A 3W79A 5I7EA 5GJBA 2HU8A 1TFRA 3UQZA 2P30A 2MHCA 1RMYA 4MITA 3VPSA 4CU5A 2O0HA 1Z4PX 2D5BA 3IOCA 4HQRA 2VK8A 3H5RA 1T4MA 3LUBA 3ZZUA 2PNJA 3ZCVA 4DHWA 1NQ5A 1X86B 4QWMA 3UHAA 1G21E 2B6HA 4AMBA 4YONB 4KQWA 3I9NA 4P4UA 3GARA 2AC4A 2D2IA 1E99A 2PMCA 2O8DA 1YS4A 1FNBA 1A9OA 3ER8A 3H2HA 1K8ZB 2HLHA 1K6EA 3R9KA 1YZLA 2R4UA 1RXIA 2C2ZA 4ZOBA 4ZPJA 2PVCA 3OOYA 1N6RA 3EVTA 4E5NA 3RLIA 1NX6A 1ZICA 4LJYA 1HMPA 4GLFA 1WSAA 4KEAA 1S7GA 1DELA 1PT9A 1PZHA 2Q0HA 3HJRA 3JARB 3WNCA 4DRXA 3IV9A 1E59A 1NSTA 1WVIA 5JS2A 4QX6A 4EHIA 4ZYLA 3J7TA 3U4DA 1AMNA 4Z1MA 1NYRA 1YBFA 3CG4A 4IH4A 1TK2A 3AZOA 2FX3A 3FOCA 3EGDB 2DLCX 1A2QA 3HVJA 2BFOA 1NNI1 2BGGA 1JDNA 1E62A 2J67A 1WXIA 3IEXA 4M55A 3GQVA 3R4VA 5BNIA 4HH3C 4XLZA 3ST7A 1LJUA 1QORA 3CLUC 4E7OA 9LDTA 5G1NA 5T8KA 2QJWA 2RCNA 3A6GA 1ZI6A 2Y1OA 3FPCA 4ZV4A 1WLSA 2PWBA 1RAHA 3S8YA 1WUYA 1P9NA 2XGMA 3S68A 4LI3X 3UPDA 4CG1A 2FZ5A 2WAYA 4PFJA 1CR0A 3ZU3A 4AJKA 5DM1A 3JD3A 2WNSA 5TMBA 1KJ9A 2VJOA 1NT4A 3LXXA 2WE8A 2WAOA 3IELA 3N9IA 3WDSA 3R7BA 2XVZA 1PEYA