2N42A

Ec-nmr structure of human h-rast35s mutant protein determined by combining evolutionary couplings (ec) and sparse nmr data
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPSIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Protein structure determination by combining sparse NMR data with evolutionary couplings.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords GTPase HRas
total genus 54
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2015-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2n42A00
3MGCA 3E1SA 2VSFA 1KK0A 1YR7A 4PQFA 1CR0A 1M2OB 1YZQA 2WJHA 2X19A 3VX3A 2R8RA 2ZQ5A 3WMGA 1AJEA 2DWPA 4FI3C 4YC7A 3K09C 3QQ5A 5AWFC 4E07A 4LOAA 2GAAA 1W7AA 4IDNA 3ZD6A 2QTVB 3QBVA 4OQFA 2HV8A 3RDPA 3LX5A 2G88A 2XJ9A 2F9LA 4BFTA 4NBSA 4PHFA 1QHYA 3JVUA 3LXXA 4R2HA 5FPHA 3AP3A 3DPUA 2ZM5A 5SZKB 1IXSB 2IYZA 4XWOA 5BN3A 4B3FX 2YOHA 5DYIA 1U8ZA 3UATA 2HXSA 2V55B 1YZNA 1P2SA 3H0KA 2LKCA 2XTZA 3LBIA 1W36D 3AVVA 5LB2A 1R5OA 1NP6A 3MUFA 2KSQA 4US0R 1NJGA 4HAUA 3G0HA 4URWR 4KHZA 4OK5A 1XDBA 1NJFA 2H92A 2PMDA 4Q7KA 2GK6A 4MGKR 3SHWA 3Q72A 2O0JA 3MMPA 2Q3MA 1R0XA 3CNLA 5DHFA 2BBWA 4BUJA 2W0SA 1XEWX 1EX7A 4JYBA 4DT1B 5K8TA 3K0EA 1PVOA 3VKGA 2RGCA 3PEYA 4ACAA 1G3UA 1QHXA 1VYVA 2DFTA 1ZM2A 2FG5A 4OI4A 4TMXA 1DELA 2QSZA 4TMVA 3VR6A 1Z83A 4C0LA 2KBEA 4YXWD 2IL1A 3CLVA 2J7KA 2IXFA 2G3YA 2IYUA 2BBOA 3QKTA 3Q9LA 1MRNA 3ZVNA 3SN6A 3RAPR 2RHMA 3UG7A 2VP0A 4GRAA 2VBCA 5FOXA 4FMDF 1KY3A 1E2EA 4NYMR 5E4FA 4C0JA 5L3QB 4W5JA 3IGFA 4YMVA 3CH5A 1XCMA 1SKYB 3U44B 3QKRB 4QBIA 4OYHA 3M1IA 4BWYA 4NU0A 2AXNA 2GCOB 4HDCA 1I4LD 4URYR 1NN3A 3GD7A 2O0HA 2QT1A 4NTZA 3K53A 1S3GA 3OEEA 2GK7A 2IS4A 3AGQA 4QGAA 4OI0A 2GXQA 3L0IB 3PQCA 4JLDA 5JSZA 5FBQB 1MO6A 8OHMA 2FGJA 3AVPA 4JJKA 3THWB 1KAGA 2ERYA 1COWA 3IO3A 2GJ9A 1XX6A 4IXNA 1A4RA 2PCLA 3IIJA 5HKKA 3GLFB 4TZ6A 5GVSA 3E70C 3MLEA 5KSZA 1KSJA 2OV2A 1JALA 2BDTA 2FGKA 1BIFA 3QVVA 4G5GA 3VMFA 3ZH9B 2VTKA 1S9DA 3D31A 3TUJC 4E09A 4ZCLA 3EZ9A 2AN9A 2IC5A 4A0FA 1N6LA 2QRZA 2P6UA 3PIRA 1HQYE 2JDIA 4F93B 3HPQA 1FP7A 1W1WA 2GJAA 3FE2A 4IFBA 2QBYA 1E4YA 4NPHA 4QM7A 4M22A 4M53A 3VNUA 1XEWY 1EFTA 3QE0A 4IHQA 4TMZA 4OKSA 3TKLA 1HTWA 3BB4A 3RWMB 4D4MA 3FTQA 4DLRA 5H8WA 1E9SA 2I4IA 2QL6A 2HXYA 1CJVC 1JXMA 4EDHA 4QNRA 521PA 2GZDA 4EUNA 4B3XA 1G8FA 3B1XA 3C41J 4JLNA 4RFVA 5J4VA 3GFOA 4FMCF 4PSVA 4ESHA 1DO0A 1D6JA 2AFHE 3U3MA 3PITA 2PX3A 4TQ9A 2WKPA 4M2LA 1XRJA 5JCPA 2QAGC 4Q9LA 3S1AA 4K46A 4A1FA 4ZDJA 3ZS8A 2G1JA 4KSCA 2AKYA 2V3CC 4Z51A 4BLTA 2BHRA 4WIAA 4KCGA 3BXZA 3M6AA 2JLVA 1GL6A 4HAZA 1HT2E 1XFAA 2HLDA 1M74A 5FTKA 1CR2A 4RFSA 1XTKA 3MCAA 1E2GA 4A8JC 3ZVMA 3PENA 1U99A 3X1YA 5KYKA 1E2JA 1X8KA 4Q1FA 2WKRA 1YZUA 3R8FA 4FCWA 1W47A 2V4ZA 4IW3B 4JYCA 3EZ6A 5TARA 5B57C 4ZDWA 2IXEA 1OXXK 3NBXX 4IOLA 4Q9JA 2D2FA 1OPXA 1ZUNB 3QKSB 3RS5A 2B8WA 4C0BA 5CJ2A 1IBRA 5FOVA 5IRCD 4KFRA 4MKIA 3VR1A 4C0QC 3BIFA 1QVRA 3QG5A 2VP6A 1BMFD 2YZ2A 3W3ZB 3OZXA 4C30A 1HEIA 1DAIA 2P5SA 2W0MA 1EFRD 1T91A 4Q9HA 1KHTA 2Z83A 5F2EA 3BOSA 1TX4B 3W5JA 4D81A 2FH5B 4X8OA 3I72A 1R8SA 1HH4A 5AJWA 4TL8A 2IK8A 4P33A 3UKDA 1ZAKA 4TL7A 4AKIA 2VYFA 4KODA 4B75A 3LRPA 1RRFA 6Q21A 1G7RA 1TQDA 1R10A 3FHCB 1LTQA 3U2QA 3OIUA 1P5ZB 1G8HA 1E2MA 4PXAA 5DN6A 3TW8B 3CRQA 1VG1A 1I2MA 1Z3IX 1W44A 3EG5A 2QSYA 3H86A 3QF4A 2A5YB 3Q7QA 3KQLA 2OCPA 2J7PD 2WTUA 4MYUA 1XEXB 2VHJA 2BWJA 4PC6A 2VEDA 2KB0A 3B1ZA 4TSFA 3FMPB 3TJZA 3QSYA 2YWGA 1AS2A 3IHWA 2A2ZA 2YYZA 5JZVA 1C9KA 4GT1A 3QG1A 4NL4H 4OJQA 3R20A 3LD9A 2CL6X 2DB3A 2F1RA 821PA 4KYIB 3ZVRA 1F6BA 2W00A 1Q3TA 3EWSA 2XZPA 1E0KA 5CDFE 4B76A 2G83A 2Q21A 4G5OA 3N5CA 1XZQA 2JGNA 2VL7A 4KJZA 4LSGA 4FWTA 3AVQA 1GKYA 1ESNA 1KI3A 3DOFA 1D2MA 1JQJC 1KKMA 4A2QA 3U60B 2C96A 1AS3A 1YRBA 3T5GA 4KXFB 1OFUX 2CHVA 3IDQA 4HB0A 3ZYCA 2DYKA 3GJ3A 4Q00A 3OEED 1J2JA 1JR3A 2GAOA 1KI7A 3NVAA 2G6BA 3QOFA 4EFMA 4FCTA 1W2HA 3KXIA 2D62A 2MSCB 3Q5DA 4GL2A 3BH0A 2FSIA 2GVZC 1W4BA 2XTNA 4K8OA 1CLUA 3SC3A 3KB1A 2OE2A 2AX4A 1E9RA 5JEEA 3ONWA 1R4AA 1R2QA 5J40A 4QBGB 4HAVA 4P31A 5JHHB 1P2UA 4TTRA 3SQXA 3CWZA 1ZD8A 2VHQA 3THXB 4URUR 2VIIA 3BH7A 2QGZA 1G8YA 2WMNB 1N0UA 4CT4B 1E1RD 3TK1A 1G3QA 1G1MA 4HAXA 1H65A 1A7JA 3B5JA 4GBMA 2Z43A 1ZM3A 1YU9A 3RNLA 3F5FA 3FMIA 4DXAA 3HDTA 2CJWA 3GLGA 1WDTA 1EXMA 2P3SA 3QBTA 4FINA 1YQTA 4M21A 1ZNXA 4DEXA 3A1UA 2QTHA 1E2IA 1T8UA 2A5JA 2FEMA 1EGAA 3HJNA 5SZHB 3R8CA 2O5VA 1GRRA 2D2EA 4YONB 4EJSC 1KI6B 3NWJA 2C78A 4MUAA 4Q5IA 3QVUA 4KBGA 4PPGA 3I61A 1P73A 3ZGXA 5FTNA 3U7EB 1F2UB 3KJHA 1T0HB 4QG7A 2YC4C 2ZRHA 3KQKA 2QENA 2WWWA 2FEOA 4M0LA 4MRVA 1T3LA 4LJAA 2FFHA 2RGNC 4UQOA 5DN6D 3AM1A 4ESVA 1NN5A 2FPKA 3ND9A 3IIMA 1Z06A 5L3SB 4M9SA 5JMTA 1GVNB 1Q1BA 1ZVQA 1XCPA 3FOZA 3IQWA 1OB2A 4I1VA 3M4YA 4HLCA 2ZSEA 1D2EA 3OE7A 1II8A 2REBA 5AUOB 3DMNA 1G7CA 2ZRFA 3HR8A 3PEUA 3QXSA 3NEJA 3R9IA 1TQ4A 4QXAA 1UDXA 1XTRA 2WWYA 3MSXA 2GA8A 4WXRA 2ZUDA 2GJKA 2OESA 1NY5A 4FMDB 1BH2A 4PFSA 5IT5A 4PHGA 3SR0A 3SHFA 2JEOA 3KTAA 5C46F 4BZXA 1UEIA 2GETA 4RD3A 1MABB 2YJTD 1E98A 3TH5A 1KYIA 1ZIPA 5EE5B 4DJTA 4IFEA 2E87A 4BLPA 1ZJ6A 1A2KC 1C1YA 2JASA 3B9QA 2CE2X 4C7OA 1AKYA 1T0JB 4I99A 5FBVB 2R44A 1P4SA 2J59A 5GADl 4EQ6B 2FPLA 3L2OB 1G8PA 2OCAA 2VSOA 3ICEA 2H57A 1FX0B 4O3MA 2AWOA 3F0TA 3J81k 1Z6GA 4PPFA 1DEKA 3D8BA 4A9AA 4IVQA 3SJAA 2GF9A 3GJ5A 3WNBA 2QN6A 4PX9A 2P2LA 2BV3A 1DO2A 4RD2A 4RSGA 5AUNB 5J4YA 4Y0VA 1XXHA 1JECA 1M7BA 4LHWA 1XTQA 2NPFA 1GSIA 2OLJA 2E1RA 3CRVA 3U6BA 2WWIA 2R62A 4XOIA 3SYLA 4AIIA 3OIVA 4N1AA 1GILA 5GVRA 1KJZA 2QAGB 1TTTA 5IK2A 3FFBA 4AKGA 1KDRA 3T06B 4CEJA 1KSFX 4OQLA 4DLYA 1ZD1A 3T35A 5E7MA 2C9CA 1T5IA 1NRJB 1GG2A 5FR1A 2CVFA 4OQXA 3I4LA 4D82A 2JJ8A 2Q3HA 1LVGA 4TWZA 3U6KA 2BEJA 1P2VA 3RYTC 4MGYR 5GJVC 3RS7A 1W46A 4EFNA 2PEZA 1LV7A 3HP1A 2WHXA 3A37A 3FKSD 3LBHA 3SEAA 3SJBA 4PC7A 3ZS9A 3GP8A 1IY0A 1KK2A 1WXQA 1NNEA 2ORVA 4Q9KA 3C15C 3CF0A 5CDFA 1UKEA 1GNRA 2V54A 3KQHA 5G53C 4MDEA 2ATXA 4PHHA 1VCIA 1G41A 1U8AA 1CXZA 3WY9A 1JAIA 1J99A 5EP1A 2HT1A 2ZR9A 2EQBA 4KVGA 4L9SA 2ZRMA 4HUQB 4OHVA 4HLQB 3BJIC 1W0JD 2ORIA 1NSFA 1JR3E 2RGAA 1S1MA 4RKEA 3C5HA 4TN1A 4DLSA 5JWHA 2YHSA 4Q1DA 5B58C 4HDQB 1T8TA 2CDNA 4FD2A 2C03A 2IUUA 3E5HA 5EE0A 4MRSA 5H68A 4C3ZA 2IYWA 1IXRC 3C5CA 4LUCA 1E96A 2RCNA 5JRJA 1J70A 2Q9AA 2G9NA 2OXCA 4IEIA 4JLKA 3NHAA 4IRUB 3GJXC 1ZMXA 3DOEA 1VG0B 2I1QA 1J7KA 3KL4A 4PANA 3V4FA 4LWZA 4Q48A 3A6PC 1UKYA 3WMEA 1D8TA 1RZ3A 5EE3A 3BGWA 4LI0A 4OK6A 5HE8A 3FGNA 1UM8A 5DIFA 5ELXA 4LYAA 4GOXA 5FOTA 2FZ4A 1ZM9A 4AG5A 2H8KA 3QIAA 4KYUA 2YKGA 2WMOB 2JLZA 2VP2A 1GDDA 3CM0A 2EWVA 4DCNA 1UAAA 3MFYA 4P32A 1FP6A 2GWHA 1RE0A 4WZBE 1IM2A 4UXJA 3CR8A 3VQTA 3ETLA 2WSSD 3JVVA 1E1RA 1KSHA 1BMFA 3RS3A 4B3BA 2H17A 1XBTA 3A36A 3M0EA 5JS7A 1Y63A 3GFPA 2I1VB 3AVOA 3OE7D 2W2XA 5KDDA 1XD8A 5JJKA 5CM9C 3FVQA 1QZXA 2ECKA 3BC1A 1W48A 2WWGA 4JSYA 4UXIA 1YR6A 3BRWD 3SFZA 2EFGA 2XOKA 3AEZA 4G3XA 5EXSA 2ZETA 3W34A 4ILEA 5JECA 3NBFA 4A82A 4QJ4A 1N6KA 1NBMA 1P3JA 4QGGA 2OILA 2JIZA 3FMFA 1P61B 3NC0C 2IUSA 4NZYA 1RFLA 1Z47A 4ZCIA 1KZ7B 4G5QA 2X2FA 2A7QA 3KKPA 4B3GA 3OAAD 2N46A 3HPRA 3KTAB 4B3DA 3HU2A 2IA5A 1IN6A 4PZZA 3BK7A 1G6HA 1SVKA 2GEUA 3CX8A 3FWYA 4RKFA 621PA 1OH8A 1TQ6A 3LLUA 2ZRCA 1I4TD 2DFNA 3KFXA 4PAOA 1FUUA 1Z6AA 4PC1A 3KKMA 5G3ZA 2CLSA 3O8DA 3UWOA 4D4LA 1UBEA 2NO9A 1CU1A 3IILA 4D2IA 3A4MA 1KO8A 4HYYA 3GFTA 1RJ9B 1G20E 2ZE6A 4D4KA 3LV8A 2Z6VA 4US1R 2ZITA 2XJ4A 1E0JA 3AF3A 1U9IA 3MWJA 2J9RA 4LHVA 1W0KA 3PFIA 2YWHA 3MWKA 3VNVA 5C1BA 3GJ4A 2A3RA 5E7JA 5HTKA 5AUQA 2J45A 2CLDX 3I8SA 3K8YA 2WWXA 4N0EA 3IO5A 4OJKA 4DSUA 2ZU6A 1KI2A 4L8GA 2QAJA 3B9PA 3TUIC 3PJRA 1Z2AA 3CKLA 3MD0A 3ASYA 4A6PA 3DM5A 1AZSC 1O3YA 4UNNA 5DI3A 4BQSA 3IPYA 2G0TA 2XZOA 1W4AA 1VMAA 1K6MA 1GZSA 3LBNA 5TB5A 1S96A 4F4JA 5H1YA 4Q9IA 3B78A 3VX4A 1ANKA 2GILA 2J41A 2JJ1D 1BOFA 4LPKA 5CK4A 3TR0A 1XJCA 2CCJA 4DZZA 1SXJA 2QMEA 3CH4B 3LW8A 2BMFA 3OIYA 2GEDA 4TLDA 4A4DA 1OW3B 1ZINA 1S3SA 4LJ4A 3QNUA 3ZJYA 4RZ2A 5EE1A 2QY9A 3DZDA 1OYYA 2F7SA 2ZYUX 5TY0A 2XB4A 1ZP6A 1JJVA 1SVOA 2PZEA 2WJJA 4PR0A 4QJ3A 3WHKA 4V0MA 1TUEA 2ZREA 2F3TA 3VHXA 1FNMA 2R6DA 1N6HA 3UWKA 4B2IA 721PA 1B23P 1WMSA 2AD5A 2CCGA 1OHHA 2Z0MA 2QM7A 4JL8A 3HR7A 3R7WA 2DPXA 1KI4A 3WMFA 2D7CA 1LW7A 2XNDA 1HUQA 2N42A 4PSKA 4RD0A 2CL0X 3P4XA 2ZRGA 3ZDQA 2ZSBA 3O8RA 3ICQB 4IDOA 1IHUA 4XIGS 5D3MA 3FDIA 5KNBA 1ESMA 1M1YE 4PPNA 4QL3A 4TLEA 1IN8A 4BRUA 4CDGA 3OEHD 1CJTC 4M4SA 2EFHB 1R7RA 2VF7A 5HR5A 5KTYA 3I3SR 3ZIAA 2C04A 1KK3A 1Q20A 1KMHB 2ZRAA 4KBFA 3WYGA 4EPWA 1VCOA 4D0LB 2ZANA 2PH1A 3CNOA 1JPJA 3A1VA 3BB3A 4AG6A 2GVDC 5JWRA 3DM9B 2C95A 3ZQ6A 3A1WA 2J0SA 3BB1A 2IYRA 2JLSA 4HI0E 4QGHA 2BEKA 1U0HC 3GLGE 1E2PA 2VA8A 3REGA 3LX8A 3EPKA 1Z0AA 2VO1A 4LV5B 2V7QD 1LF0A 3PUXA 1G4UR 4IOJA 1LY1A 5HPYB 3SJZA 3GEHA 4QC2A 2Q3FA 1IJFA 2CK3A 1X6VA 1YE8A 3IIKA 4TMTA 5FPYA 1JBKA 2ZE8A 3K9NA 4KFTA 4ERNA 4EKDA 5L3VA 1J90A 1G5PA 2DR3A 2IYYA 4MITA 5F9FA 1YRAA 1GNPA 2J87A 1IONA 3LLMA 1HE1C 1TMKA 1NN0A 2BM0A 2R6GA 2ZROA 1NKSA 4HUTA 3PUWA 1E2DA 4I1OA 5EQTA 2FE4A 4B44A 3C14C 4Z8YA 4BPBA 1EESA 1GP2A 3SBEA 1E2QA 1XTIA 2J0VA 2AK3A 2C9YA 2LWIA 2NO6A 3BERA 3OHMA 4DDUA 5AUPB 3IHLA 3TGPA 3TNFA 2ZSFA 1HT1E 2H5EA 3EA5A 4JLMA 2ZAMA 4PO9A 3L8YA 2PLFA 5TMPA 1G7SA 2AR7A 1SKYE 3WP1B 4BFSA 2HUPA 1JQLB 2IEZA 3SQWA 3K0AA 5ANRB 3KXLA 5DISB 2O8DA 4ZKDA 3VAAA 1FPMA 5B2ZA 1N0VC 3CF6R 1OV4A 4M1YA 1FZQA 1ZUHA 4AKEA 3U4QA 4B71A 4O2LA 221PA 1JXOA 1G7TA 1HY3A 2CHGA 3B1VA 2QQ0A 1T6NA 4RD1A 4YMUA 4C0AC 3Q85A 3K70D 2LKDA 2O8FA 1G3IA 1RIFA 1LFDB 1R8QA 1VIYA 2ZJAA 1G17A 1SVMA 1MRSA 2IHYA 4JLBA 4KITB 1OXUA 1CULC 3EC2A 2VF8A 3WRXC 4D26A 2F9MA 2OBLA 2IXGA 3SZRA 3KDSE 2ZRJA 4FIDA 2PZFA 1K5DA 4LX0A 3OEHA 3DHWC 2Z4RA 4M9XA 1CIPA 3ADBA 2ZI7A 3KUDA 4WW0A 4IXMA 4G5RA 2B21A 2WJIA 2ZRNA 4ZO4A 4ZKEA 4BEBA 4DSOA 5EZ6B 1W4RA 2A5FA 1BYIA 3AVXA 4RVCA 1AS0A 1KOFA 1TUIA 1VHTA 4YXWA 2C9OA 4XVQA 3NG1A 4C0KA 2KE5A 4TLAA 2B8TA 4HB4A 2JA1A 5JEDA 1L4UA 1WB9A 2RGEA 4LZZA 2GJSA 3B6EA 1G3RA 4E03A 3T34A 5KSPA 1N6OA 4JVNA 2IWRA 1U2RA 1SULA 4O2RA 3WHLA 4BEJA 2N1BA 4AYTA 2F6RA 2XNDD 1ZNZA 2IYXA 3EASA 4CEIA 3T12A 4NH0A 1TU3A 3CONA 1JB1A 5J4LA 1XMIA 3W6PA 2BBTA 5C4MA 4IEEA 1Z6TA 3RWOA 4EJSB 3AB3A 1DARA 4P4TA 4BFZA 1GAJA 1EFHA 5TDHA 1P7CA 1G8GA 2QORA 4KVAA 4J0QA 2VP4A 3SBDA 4B74A 4TLBA 4M1OA 2PEYA 3R9XA 1N3BA 2G1KA 5FUVA 1N5LA 5FOSA 5CITA 1OHHD 4B43A 4BFXA 2CLCX 3P1JA 2BVNA 2JLRA 3AGPA 4DIEA 1SXJC 1ONBA 4EAQA 4HB3A 1UBGA 4V0NA 3B85A 4CF7A 3SFVA 3SE0A 2QP4A 4JBYA 3KUCA 1HE8B 5AK0A 4TYYA 2EWWA 4A2PA 4BZPA 1II9A 4GOJA 4V02A 1MT0A 2NMVA 4DCSA 2HDNB 1GL7A 2ZSDA 3W6NA 2RB4A 2CEAA 4WAUA 1WE2A 1U90A 4B48A 4CEHA 5JWOA 4H1UA 1QHNA 1QG2A 4BFVA 4G01B 5JS8A 3UXMA 1C4OA 4ZPXA 4NCKA 2DBYA 1XD2B 4PC3A 3IQXA 4IDHA 4LBVA 4MDFA 1GRNA 5SZIA 4AWXA 1E69A 4DUGA 2WJYA 4QOSA 4MQBA 1R5BA 2FFAA 3LNCA 3HU3A 3SS8A 5A5GA 2H18A 3TQFA 3GPLA 1KJWA 1FQKA 3PVSA 2H16A 2BCGY 5FL3A 1T9HA 2JIZD 2A5DA 3KQUA 3I92A 2KBFA 5GJCA 2C5LA 2NOAA 1LS6A 2XXAA 2ANCA 1PJRA 4JT2A 3W6OA 4F7WA 3NEYA 2OEPA 2B7CA 1QHIA 1LB1B 2YWFA 2OCBA 2WPDA 3K9GA 1K8RA 4AY2A 1E2NA 1NN1A 3EAQA 1TEXA 1W2GA 2EFEB 2ZS8A 3EZ2A 1HV8A 3C7KA 2RGBA 1J8MF 5H70A 4B6EA 2IS2A 1N25A 1YZGA 5CYOA 2QRNA 3X1DA 4ASUA 2IHBA 1FOEB 2BJVA 5KO2A 1II0A 3W8RA 2V7QA 4URZR 4TSFD 1NLZA 3QUSA 3I5YA 2W58A 4ABYA 4KU4A 1CR4A 1Z0JA 4URVR 5LD2B 3ZIAD 3VKWA 2ZU0C 3SOPA 2VLIA 3PUVA 4JBXA 2XSZD 3U3RA 2O8DB 1W36B 1UBFA 4I4LA 4DDWA 3TAUA 4EFLA 1I4DD 3BBPA 4M9QA 4UXHA 1ZIOA 2ZJBA 2C2HA 2F1HA 5K8IA 2ZI4A 1Z29A 4P3YA 1N2CE 4HZIA 5G3YA 3DL0A 3O8BA 4Q7JB 1G5RA 4HB2A 1XJ0A 3NH9A 3REFA 4HLDA 4CRWB 2VQSA 4U5XA 5CLQA 4AKHA 2P67A 2IT1A 4NONA 4AYWA 4QBFA 1CTQA 4Q21A 1IN4A 1NF3A 2NZJA 3A58B 2MSDB 2JCSA 5TVKA 3L8ZA 4M1SA 3RRYA 3K0FB 4Z8XA 1E9DA 1NLFA 5F98A 1E3MA 2BKUA 2B92A 2VP9A 1VECA 4L15A 4F4CA 3G82C 1UDWA 4PSAA 2HF8A 2JATA 3VU9A 2BM1A 3KX2A 1Q1EA 1YR8A 2GEVA 3MJHA 2EU8A 4EIWA 4JVMA 5HKKD 2W6IA 2W2TA 3GMTA 2ZRIA 5EP2A 1II8B 2ZI9A 2VH5R 3N2EA 4HLUA 3B7GA 2OFOA 4KO8A 5GJWC 1YJ5A 4PQRA 3X2SA 4BE7B 5KPDA 2QTFA 5BYJA 4Q18A 4D0NA 3U61B 2CNWA 3AQ4A 4H9GA 4PO1A 3P27A 4F4IA 2K5UA 2UKDA 2JJ2A 4Q4AA 4A92A 1SVIA 2AHOA 3KB2A 5SZJA 3U3OA 2RGGA 2WOOA 2YC2C 4RZ3A 2GZHA 4KSBA 4D4JA 3CRMA 2A78A 1GFIA 4AYXA 1Q0UA 1CKEA 2R65A 3JZMA 4MGIR 4DLTA 1GKIA 4Z1MA 4ZI3A 5K8UA 1QRAA 4QFMA 4W5WA 4MYCA 5G40A 1MO3A 2IS6A 3NHBA 1P72A 5DSZA 4G5SA 3AH8A 4XWKA 2P6RA 1YVDA 4GFDA 4X8MA 4Q66C 2KI5A 1YR9A 1Z07A 4PZLA 4I1SA 1RJ9A 3A4NA 1NL3A 1KGDA 4BASA 2IBMA 2EFDB 1QG4A 1NG1A 5KNDA 1G19A 4Q01A 2V9PA 2D4HA 4BFUA 5JHGB 1NVVR 5C4GB 4LPSA 1OB5A 1GOTA 3T15A 2V6JA 4EPRA 3ND8A 4R7ZA 4ZIRA 2GCPA 2WSMA 2AKAB 1E79D 2WBLC 5AJZA 1VPLA 1QHHB 2WV9A 1KO1A 2NGRA 5HE9A 3T61A 1MO5A 1AKEA 3BH6A 2WIAA 3KFVA 1NVUQ 3T5DA 1PLJA 1HYQA 1M34E 3WNDA 1OFHA 3Q5EA 4Q47A 1FTNA 2EYUA 3MRSA 4RZUA 1YHNA 2QT0A 1RW4A 1E94E 2P5TB 1X3SA 2ZTSA 4X8HA 1LS1A 5EZ5A 1TAGA 3UG6A 4A8JA 2O8CB 2PMKA 1UEJA 1M8PA 2BOVA 2IYQA 3KKNA 3UMFA 2P0EA 4QKQA 2D06A 2A9KA 3DDCA 1VG9B 1U98A 3LDAA 2OHFA 5DHAA 1KY2A 4D25A 5LDDC 1HURA 4Q19A 3SYKA 3VFDA 1B0UA 4EPTA 3VU9B 4GP7A 2Q6TA 2O0KA 1P6XA 4JLVA 3MWLA 5L8VA 1J8YF 3AF2A 4FCVA 5BW8A 1SQ5A 3ZQJA 3IBGA 1OIXA 1IN5A 4IOMA 4KFSA 3LQRA 3TRFA 1N6IA 2HCBA 1GKUB 4P4SA 5CK5A 2O8BA 1KK1A 2FMXA 2NZ8A 1JPNA 5KU1A 4XWAA 3PUYA 2GCOA 4ASUD 4L5BA 1Q44A 1JR6A 5D3MB 3RSOA 4TZ0A 4IDQA 2MSEB 1XPUA 5DO9A 4Q4HB 3TUZC 3K0CA 1F2TB 1KMQA 4LYJA 2OBMA 2ZI3A 3LY5A 2IYLD 4R9UC 1AQYA 1UPTA 4DCTA 1DAGA 4C0HA 1P9RA 4Q4HA 4V0KA 2B7BA 3ECCA 4MYHA 1H8EA 3KQNA 1MH1A 1A1VA 4TT3D 3AUXA 2ODBA 5EJEA 2IYVA 5FBLB 1D2NA 1LF5A 4M9ZA 2ZSAA 2CXXA 3A8TA 1Z28A 3GJ7A 4BECA 3THWA 1XJQA 3OFND 1F3OA 4LV8B 4IKEA 2QI9C 4DCUA 2GBLA 2NPIA 1RYHA 1W0JA 1TNDA 3I1FA 1MABA 2WIBA 3TSZA 2O52A 3EIHA 3LQQA 4V03A 2XAUA 2BJWA 4GZLA 1EG7A 1E9AA 4LJ5A 1R0YA 3L43A 2GKSA 1ZM7A 1IQPA 2HJVA 3RANA 3UANA 2OFXA 1JNYA 4JVLA 4MYTA 1DPFA 3BFVA 3F3YA 2ANBA 3U3KA 4ZDKA 3AF4A 5EE9A 5CB6A 3AVTA 1FW6A 1WBBA 5KDLA 3CRW1 5E95A 1E9FA 3THOA 1K5GA 2BMEA 3FFAA 4ZCMA 5FI1B 3VR2A 4NCIA 2ONJA 3VTKA 3EPLA 2DFKB 2JJ2D 2WSSA 1Q22A 1XU4A 2FU5C 2XGJA 3K70B 2OLKA 4XH9B 4HLUC 4TYNA 1L2TA 2P65A 1MKYA 1OYWA 4ZI2A 1Q3HA 1XCGB 4XSHA 2P6NA 3CB4A 1NBME 3I73A 5DYGA 1US8A 1KDOA 3S1AB 1CRQA 2CCKA 2QZ4A 2ZE7A 1OH5A 3FHTA 1CF4A 4NCHA 1E2KA 1N6PA 4Q7MB 3SNHA 1GL9B 4GNKA 3GLHE 2SHKA 4KI0A 1CJUC 1CRPA 2FX3A 2HJGA 1DAEA 3WP0A 3EX7C 4RD6A 4MKHA 4AURA 1EFCA 3FYHA 4GMDA 2W6JD 3D3QA 2CHQA 4TQUS 5DGXA 5J47A 1FQJA 3FKQA 3X1WA 1F2TA 2EFCB 2CVHA 4OHZA 1Z22A 3RS2A 4M1WA 2AWNA 3QKSA 4GP6A 3AVWA 2OZEA 3B2EA 5BWMA 2Z5FA 3GCGA 1NBMD 4LRWA 4PPQA 3HYTA 2NG1A 2IS1A 4JT4A 4LV6A 1DTSA 2UVQA 3RS0A 421PA 4DSTA 1JEEA 3MG9A 2J0QA 2RGXA 2O8EA 1IY1A 4E22A 4LC0A 2PT5A 4LK2A 1BYUA 3VKHA 1AQUA 2VHCA 3GLGB 1KIMA 1VIAA 1YKSA 4B3CA 3E2IA 3L82B 3FKSA 4PAQA 4ARZB 1UBCA 4LJYA 2WZQA 1HQCA 3OFNA 1PLLA 4DVGA 1OE0A 5FI0B 1GM5A 1T5LA 121PA 4M1KA 5DLQC 4YMTA 4XVRA 2QNRA 2L0XA 2RH5A 1PZNA 1DAKA 1ODFA 3K09A 4JMPA 1L7VC 1PUJA 4FMCB 3H1TA 1JJ7A 4B2PA 3PEWA 4TL6A 4I81A 1N0WA 4PTLA 3L0SA 2FSHA 1A82A 2QP3A 1E1QD 1I2DA 4V0OA 3ZZUA 4Q4JA 4S2EA 5FOWA 4JLPA 1IOZA 1ETUA 4OHXA 1A2BA 5JI3E 2GRJA 3KKQA 4D80A 5L3QA 4AC9A 3OIWA 3CX6A 2QM8A 4OQNA 2R2AA 4EPXA 4V0ME 1F2UA 1Z6XA 4OHWA 3X1XA 2Q9CA 3WXMA 3RC8A 2ZJOA 4R98A 4YMWA 2HT6A 3KJIA 5CIWA 5CM8B 1PUIA 4Q4AB 2ZAOA 4UNQA 3I8XA 3V4RA 1QBKC 1XD9A 1XMVA 3EPHA 2EVWX 4Q1BA 4UKDA 2WAXA 3BE4A 2HCJB 4WA7A 4NCNA 1VYUA 3P20A 1X1RA 2XOKD 3Q7PA 2RKOA 4LYHA 3LXRA 3HYRA 5JSZB 5KUTA 1G21E 3EZ7A 1ZRHA 3BORA 1DAFA 4TMWA 3QF7A 4FN5A 2QG6A 2ZS9A 3BD9A 1PV4A 1G3MA 1WCV1 2F43B 4JS0A 2NO1A 2FNAA 4P4UA 5A0FA 4US2R 4LY6A 3VR4A 1X8LA 2GNOA 4BGDA 1YZKA 2DY1A 2OCYC 1N6NA 3KXKA 1XF9A 2C99A 4KLNA 5K8LA 5UKDA 1ZNWA 1UFQA 2W83A 1SZPA 1ZU4A 1U0LA 3AUYA 3CPEA 2FJUA 2GBLC 5B30A 2FDCA 1OKKD 4RD4A 4R2IA 1Z5ZA 4YDHB 2IX3A 5BN4A 1D9ZA 5HZKA 1HA3A 2ZYWX 1V43A 4ON9A 5EP3A 4BLQA 1O87A 1XMJA 1CJKC 3F8TA 4KV9A 4V0LA 5BQ5A 1D9XA 4QNMA 3CWQA 4A8JB 4BRWA 2O8CA 4TQAA 3A1TA 4W7SA 5M04A 2QE7A 4WVFA 3MAAC 3ZZ0A 1UKZA 4N3NA 1DVRA 1JI0A 2REOA 3EWAA 5KSOA 3UK6A 1FX0A 1DOAA 2PL3A 4TYQA 1KI6A 4PC2A 3LFUA 1OIWA 4QJ5A 2QU8A 2FSGA 4NE2A 2TMKA 2X2EA 4RY2A 3LWNA 5C2JB 1TU4A 5FOUA 3CNNA 4FXPA 1U0JA 3U7FB 3DEFA 2RHDA 4RJLA 2FN4A 2WWFA 4TL9A 2CNWD 4JJZA 3WYFA 4XJXA 4NYIR 1X1SA 1XP8A 2FZLA 1E2HA 1G291 4RFSB 5G41A 4QRHA 3CRRA 2GESA 4CEJB 1UF9A 2DFLA 3TLXA 2C98A 2IYTA 3B1YA 3UMRA 1KDTA 2KWIA 3K0AB 5KHOC 3R9WA 1QDEA 2BMDA 4DDTA 3CF2A 3QJYA 4Z1MD 5KSYA 1SXJB 1COWD 1E9EA 3A1SA 2IYSA 1DS6A 3HU1A 5FBWB 4DBLC 4EJSA 1ZCAA 1TEVA 1LNZA 3R7WB 3C16C 4OBEA 2X8AA 3NBYC 5A4JA 1G5TA 2REXB 1NMXA 3WYAA 1G9XA 1RKBA 2DWQA 1OXSC 3CIOA 4ACBA 5JJLA 1S4QA 1KZGB 2J7PA 4JL5A 4O0MA 1XTJA 4OK3A 4EQ6A 3CO5A 4JL6A 3NKVA 2DWOA 4TTPA 2ZS7A 4HSEA 4RCYA 3RRZA 2YNMA 2AXPA 3LH5A 3W3AA 2BBSA 3CPJB 2F55A 1T3HA 4Q7LA 3QEOA 4BLSA 3TE6A 3EW9A 4Y0AA 3AV0B 5LD2C 2YWEA 3NC1C 4JIMA 5EXTA 3PG5A 2FSFA 2QROA 4C0SA 1GWNA 1UADA 3B1WA 4DEYA 2GDJA 1Z6YA 2J5XA 2Q0HA 2PLRA 4LBYA 2J0UB 2ZRDA 3U3JA 5DI9A 5P21A 2A30A 1S1CA 2HYIC 2C77A 1W5SA 3GJ0A 5FTMA 4Q1AA 1P62B 3GLFA 4OL0A 3GQBA 3AVUA 2OM2A 3ZVLA 5FTLA 2ATVA 2ZXUA 1CR1A 1SHZA 3LA6A 2IEYA 1PLKA 2IW3A 2CL7X 1QVAA 1U8YA 3NDPA 4FWIB 1ZW6A 2LCFA 3LAWA 4NYMQ 1UKVY 4UNRA 3DKVA 2H1LA 2QMHA 4Q4LA 4F38A 1EWQA 1WRBA 2XNSA 1KO7A 3QPWA 1DG3A 3CBQA 1GRQA 1MV5A 2R6FA 2Y8EA 1EX6A 4G0NA 5KPJA 1TQ2A 3KJEA 3SI7A 3ASZA 2NO7A 1G6OA 1KNXA 2QPTA 1X8JA 2R6CA 1YZTA 3TSOA 4DB4A 4PHTA 2C8VA 4CGZA 1P9WA 1W49A 2F1IA 4QHSA 1KKLA 5EP4A 1H8HA 5E3HA 4LJ6A 1FNNA 1E32A 1M7GA 1NLYA 5BXQC 4W9MC 4RCZA 3PUZA 4A36A 1OLOA 5FH9A 3V00A 1MR3F 2AK2A 3NDBB 5DE3A 5FL7A 3EIEA 4K81B 1XPRA 4NKRA 1GIAA 4X8LA 1FUKA 3GLIB 2Q9BA 1AZTA 4LCBA 1E1QA 2OO7A 2AD1A 3OESA 2ORWA 1Z08A 2G77B 2WWHA 5CJPA 2PJZA 1KTVA 1KO4A 3N70A 2HYDA 3BS4A 2OG2A 4ITRC 3L0OA 5FBRB 1E99A 4LC1A 5HCNA 4MH0R 4OI2A 4HATA 4M1TA 2WICA 4UNSA 4CEHB 3U4QB 4JLOA 2O8FB 5IK2D 2IF0A 5B64A 4DLUA 3GLFE 1UJ2A 2RGNA 2XX3A 2ZI5A 3GJ6A 4ARZA 1W4CA 3N2IA 3WBJA 4DUGD 1ZU5A 2MMGA 1RRPA 3T1QA 3QXHA 2CJWB 1D5CA 2HF9A 2NQ2C 3RS4A 1RVDA 2XSZA 4JLAA 1IY2A 1KI1A 3CX7A 3QEJA 2R9VA 4C2TA 1Y3AA 4L4UA 4R71A 3VHLB 2BKEA 2WVJA 2FV8A 5KNCA 1IXZA 1OF1A 2OT3B 2V8OA 4DLVA 1FMJA 2OAP1 1MOZA 3WNCA 2E9SA 2VHTA 2PX0A 4XTRA 3JZAA 3THYA 1S9HA 1Z2CA 4NYIQ 4FMBB 2ODEA 3TAHA 3IEVA 4WXPA 3QF4B 4W5HA 2XXAB 3K1JA 4XD7D 3NTUA 4BLRA 1M7HA 1F5NA 2ZR0A 3BAFA 1NY6A 4DT1A 5FUWA 4MKGA 1Z0DA 4Q4JB 4POAA 3RRMA 4CIDA 2J46A 1Q57A 5HCIA 3RHFA 1DADA 1VCMA 3C4JA 2ZEJA 2D74A 4A2WA 1AN0A 2WJGA 4BFWA 1P75A 1L8QA 3W90A 2ASEA 1RRGA 4A0HA 5JFGA 3TVTA 3VR5A 3A4LA 2ONKA 4LJ8A 3U7HB 4YQFA 1CEEA 4GMXA 4NDZA 3TBKA 5BYKA 3CZPA 3EPJA 1E9BA 4NYJQ 1AK2A 4MRPA 3AKDA 4Q1EA 3LW7A 3K70C 1R0ZA 1E4VA 4GDFA 4GPTA 1U9IC 3G5UA 1AGRA 1AM4D 5CB8A 2ZVQX 3H2YA 4DCVA 3FPAA 4UNPA 3TW4A 1NVXQ 1SKQA 1TF5A 2RGDA 4DKXA 3P32A 1WBDA 4ZV4A 4GOKA 2ZE5A 5LPNA 1R0WA 3QKRA 4HAYA 4KLZA 1KDPA 4LBWA 4MGZR 2ODNA 4BZQA 4Z54A 2J1LA 3SJCA 5GJBA 2FOLA 4EPYA 3Q3JB 1IN7A 1KI9A 3MJRA 4TMKA 1XPOA 1NIPA 1OXVA 3PR1A 4F92B 1P60A 2BC9A 4LHYA 1OFIA 4HEJA 2QAGA 1XXHE 3AF0A 4P0TA 3X1ZA 4DDVA 4LHXA 4DLZA 2WAYA 5D3QA 1SVLA 1QHHA 3LVRE 2PBRA 5JI2E 1OXTA 4C2UA 4Q02A 2V1XA 4DIDA 1BO6A 3PEVA 4C9BA 4AI6A 2QP9X 3THXA 2PZGA 2YV5A 3O47A 2R6AA 2ZR7A 1TADA 1EWRA 5KOYA 2Z4SA 1ELOA 1F60A 4KAXA 2BCJQ 2AL7A 1DAHA 3QI2A 4HDOB 2QBYB 4WOPA 1WP9A 2V6IA 5EUQB 1KNQA 4QBHA 3NBZC 3RABA 3GJ8A 4TTQA 2JLUA 3TVDA 1G64A 4GZMA 2ZPTX 4JLJA 3O8CA 3THYB 1Q12A 2B6HA 4FW9A 1Z8FA 1L4YA 4WZ6A 1Q21A 3W5IA 2OUKA 4TLCA 3KJGA 1CS4C 1XB2A 3OF5A 1OKKA 5FPKA 2YOGA 1NG9A 3L0PA 3QXXA 3TMKA 4PZYA 2EYQA 1E0SA 3CUEF 1VTKA 1SGWA 1ZUIA 4XTCS 4L16A 2ZUBA 1U81A 1ZC3A 1RC8A 1DG1G 3SDZA 2ZJ8A 1MO4A 1GTVA 3H4MA 3GLIE 3H84A 1N5KA 3RRNA 1WF3A 2NTYC 1ZNYA 2V1UA 3P4YA 4JKIA 2XEXA 2OXRA 4B35A 4HUQA 1Z0IA 2QA5A 4CW7A 4DC9A 2ZIAA 4IOKA 1RRCA 1AIPA 2AFIE 1E9CA 2ZRLA 4IJMA 4MA4A 5J4KA 3U7GA 1OJLA 2QQEA 4CVNA 2VPPA 3EC1A 4IVPA 4LHZA 3AKCA 2ZJYA 3V9PA 2O8EB 3EZFA 2GXUA 4QM6A 3D7MA 2ZJZA 3OAAA 3K0SA 2FFQA 4UJ3A 1DBSA 5J5CA 4DHEA 3AF1A 1SHKA 3NIBA 4ZDIA 5TV2A 2DCUA 1TL7C 4B32A 2QMUA 2J0UA 2VRWA 2WM9B 3LO5A 5LB4A 1VYTA 3I62A 4DLXA 3QXCA 1QF9A 3SYNA 1WA5A 3TQCA 1GNQA 1G16A 1Q1ZA 3QXJA 1DE0A 2IUTA 3ADKA 4HAWA 4B33A 2YVUA 1N6RA 5CYPA 5IF9A 2GJ8A 2FPMA 2ODWA 2WOJA 2QE7D 5FPTA 4D6PA 1JEDA 5JCZA 2CMKA 5CLLA 1KAOA 5HZHA 2PT7A 1ZM4A 2JLQA 3K0FA 3DO6A 2WKQA 2EW1A 1V5WA 4PO8A 3SU8A 2NIPA 4U00A 2VSXA 2G0NA 5TXGA 4CEIB 4DLWA 3UIEA 3DKPA 1OH6A 2F3RA 5AJYA 2JLYA 5DH9A 4NP6A 5FL7D 4JSTA 4M8NE 4NYJR 3B82A 4QGFA 1AGPA 1VHLA 2OFWA 2X77A 2GCNA 3ZD7A 4HZUA 4AD8A 1XTSA 2JJ1A 1NIJA 3PCRB 3U44A 1W5TA 1TF7A 2RMKA 1Z63A 1E0AA 1XEXA 2ZYVX 4Q1CA 2GXSA 1VCNA 3IUYA 3GEIA 4NCJA 1NMZA 3I5XA 4XSGA 2BIFA 4TYWA 2IWHA 2JAQA 3QPUA 2ZUCA 1OFTA 3MWYW 3NXSA 3EA0A 2UZIR 4YDSA 4IVRA 5F9HA 2QMOA 3AVYA 1NVVQ 4E5UA 3CZQA 3PV0A 4G1UC 1OSNA 2BMJA 2WPDD 1XEFA 3EARA 1N5IA 3FMOB 4NHOA 3K0CC 1FL9A 2PCJA 4N0DA 5F3WB 3DVLA 1GITA 4IDPA 3GLIA 1EFRA 3BWDD 1M6NA 1S8FA 3DMDA 1FMLA 5FPSA 3P26A 3W9YA 3DZ8A 2A5GA 2PJRA 3FHOA 1KJYA 3FB4A 3QKUA 2DHRA 4S35A 3Q8XB 4TT3A 4WBSA 1NMYA 1XXHB 3EIQA 1SVSA 2QPAA 5J4HA 1E6CA 2YOFA 3TIFA 4LDJA 1NKTA 2W6ID 3B8HA 4GSYA 4CYMA 1E2LA 1X86B 3WBKA 1FTSA 4ZIRB 1H8HD 4LBZA 1CP2A 4BLOA 1ZD9A 1JAHA 1KSGA 2CBZA 4YLGA 1BS1A 2ERXA 3WRYC 1G18A 4A0GA 2JLWA 4CT5A 3RLFA 2FF7A 1CJMA 4WZAE 4DRZA 3ADDA 2QPOA 2HLDD 3D6TB 3AKEA 3NH6A 1OH7A 1E2FA 1EK0A 1S2MA 4QHTA 4EPVA 2ZYTX 2UZ3A 5E7IA 5AJVB 4CZ2A 3ZZTA 2FFBA 1R5NA 3IPXA 4H1VA 3KZ1E 2VP5A 3K9HA 1S0UA 4P4SB 3I32A 5CIQA 2O8BB 2OAQ1 3EXAA 5L3RA 1QHSA 4U02A 3ZLJA 1IAQA 4JKYA 3RSLA 5DNYB 3K9LA 3GLHA 4OHYA 1RYFA 1US8B 5FR2A 3CR7A 2JLXA 5IDVA 2XITA 3B60A 3CPHA 1A5TA 1G4AE 3BFKA 4L9WA 5BN5A 1AA9A 1SVWA 2OBNA 2QUZA 3GEEA 2YINC 3GLHB 1VG8A 1T3SA 4YMSA 2JDID 3IKJA 4MRRA 4AK9A 4XD7A 4II7A 3W8NA 2D7DA 4JVSB 5FUXA 2XZLA 3TR5A 2KJQA 4Q03A 4TYPA 1XNJA 5EXPA 1T4GA 2GXAA 1QHGA 3AKYA 5FUYA 5L3SA 4OQMA 4XVUA 1ZC4A 2GZAA 3HWSA 4URXR 2RAPA 1GUAA 1BKDR 1KO5A 2X1VA 4JBWA 2XTMA 4BFYA 4B73A 3QY0A 4A6XA 2CE7A 1VKJA 1E79A 1VDZA 3T1TA 2D3WA 1KMHA 2ZRKA 4U7DA 1XD2A 3LVQE 5LBIA 2F43A 5KDOA 4C7OB 5JBQA 2QGNA 4C4PA 5AR1A 1OIVA 3CW2A 4QHYA 2W6JA 3PXGA 1N5JA 2ZVPX 5C18A 1TF2A 3UPUA 4DSNA 3C8UA 1CBUA 4MRNA 3AP1A 1ZCBA 4PAMA 3RVBA 4LJ9A 1XWIA 3ADCA 4A15A 5IHPA 4DB2A 2GTPA 2I3BA 1NSTA 1F48A 4O25A 1YZLA 1TPZA 4MKFA 2OSBA 1JR3D 2NO0A 1P9NA 2ZJ2A 1W0KD 1Z0FA 1SXJD 2ZJ5A 1W36C 2XB2A 2J3EA 1KI8A 2VHUA 3QENA 4I1UA 3AP2A 3IEUA 4LJ7A 4UJ5A 2ZRBA 4B34A 1XZPA 4KFUA 2FWRA 4F91B 5AJXA 3QPVA 1P2TA 4DWJA 1RPZA 4OI1A 3VR3A 3TSWA 2IF2A 1Q1QA 1WQ1R 4B47A 4A0RA 1EFUA 2WJVA 3B13B 4NMMA 1ZYUA 4MUBA 4B2LA 2HEIA 5JLJA 4LGMA 3RC3A 4B6FA 4D0GA 1R6BX 2ZRPA 3IBYA 4RZXA 2CK3D 1NVWQ 1DAMA 1XMSA 4LYFA 5DI3B 1Z0KA 3KKOA 2QEQA 2GF0A 5EUMA 1SXJE 2ZI6A 4GI7A 1H8ED 1OT3A 1FFHA 4HZUB 4JZKA 1NI3A 1IJEA 3UMSA 1U94A 2MMCA 3BFXA 4M1MA 5FFMA 5FTJA 5JJIA 2W2VA 2F1JA 4PQYA 3T1VA 5EXXA 2GHIA 2FA9A 3T1OA 5JRZA 3U5ZB 2H7VA 1ZBDA
chains in the Genus database with same CATH superfamily
1JXQA 4YDRA 3WGYA 2GYYA 4ZAWA 4BYMA 2I2BA 2ZT5A 4FT4A 1KK0A 1CR0A 1M2OB 1YZQA 2G07A 1NULA 2X19A 3VX3A 1Z13A 1TYZA 3ESZA 4HLNA 4LRTB 3WMGA 5HIJA 4N8DA 2DWPA 2DBRA 3QY9A 1TEZA 2VXCA 3QQ5A 3IVRA 4E7PA 4DBLE 4E07A 2PUBA 4ADSG 1DWOA 1RD4A 2MTBA 5A5VA 1W7AA 4IDNA 2C9DA 2QTVB 3IAXA 3QBVA 2O5RA 3KT0A 2HV8A 1P1KA 3LX5A 2R1VA 4H7HA 2QN1A 2VBGA 3E1KA 3QLUC 1UPUA 4IIBA 5J5AA 3KSBC 4NBSA 4F1KA 2YV3A 1CUUA 5U1PA 1JDJA 2XE7A 2Q3BA 6REQA 3MUOA 4NV0A 1FDWA 5GM2A 1X0VA 2DZDA 1KY4A 1RIIA 1R0BA 2CW5A 1C9MA 2IYZA 2WRZA 2Z5GA 3GRZA 4Y9SA 4AMUA 2WUEA 4B3FX 3HO1A 1AK9A 1Y4SA 1V8PA 1UDBA 3BSYA 5DYIA 3EGOA 1U8ZA 4DKJA 3UATA 2FPWA 4H27A 5TVGA 4M1EA 3H0KA 4M0CA 2LKCA 3IQEA 4EVIA 1W36D 1X7YA 4P83A 1PTJC 5B4VA 3ZCTA 2FZCA 5K7SA 3V8PA 2IBSA 4URWR 4F45A 4OK5A 4U39A 2H92A 4O8CA 4XUCA 3MN1A 3SHWA 4JJ4A 3EDYA 2OMKA 2B1JA 2Q3MA 3DTVA 3MMPA 3QOXA 4LWPA 4LXXA 2WJ6A 3E61A 5DHFA 1YCGA 4EI9A 3BXGA 4YAGA 4XRRA 4HQFA 3BHJA 4NBKA 5IANA 4G1CA 3PEYA 1WXFA 4ACAA 1QHXA 1SEVA 1ZM2A 3VI4B 3UB3A 3DOIA 1Q6YA 3HJUA 2WWVD 2QR2A 3ILYA 3LCCA 5C3UA 4YXWD 1XTBA 2R8PA 3CLVA 2GM9A 2G3YA 1OASA 2BR5A 2BBOA 1C0LA 3ZWOA 3Q9LA 1MRNA 3H5IA 4MYRA 3VSBA 1QJCA 2QHXA 3L8HA 4P0QB 1T4CB 3U16A 3RC1A 1RI3A 1GZ3A 1NUAA 3E48A 3O91A 3V7NA 1O97C 2VBCA 4YB8A 4C0JA 4FE4A 1WULS 1Q11A 4NJEB 5E4FA 3SEFA 4EJMA 5L3QB 5LMNB 1KYXA 2XMPA 2VEOA 3NORA 4HMQA 1RKXA 3M1IA 4GHWA 5A2GA 2AXNA 4I4TA 3QX7A 1A8HA 1J1IA 4HDCA 1NN3A 4MI3A 5H3LA 5B6IA 2QG9A 4LDPA 2JAWA 4HUJA 1POXA 3OC0A 1M8FA 4NH4A 1D6MA 1UZNA 1ZGJA 3AGQA 3BXPA 3LPAA 2GXQA 4JLDA 2IS4A 2AI3A 1AGYA 2ECFA 4FDAA 1EP3B 2WUDA 3ZC3A 4B9EA 2FGJA 3E4CA 1I3LA 5L40A 1WS6A 3AI3A 1LK5A 1COWA 3WIDA 3IO3A 2FWAA 4EEKA 2IH5A 2QMZA 1SOUA 2PCLA 4TZ6A 3E70C 5KSZA 1KSJA 2OV2A 2BDTA 2XE4A 3QVVA 1BIFA 4KXNA 5A4FS 5LZ5A 3N0RA 5JD3A 1GQFA 1CE8B 1NJ2A 4KL8S 3ME5A 1KEWA 2RHOA 4AJ2A 1ISRA 1YJAA 4N5LA 1PEAA 2X8BA 4QYMA 4ZCLA 4E11A 2YHIA 1IVSA 1U63A 2IC5A 3ABRB 3PIRA 4LZOA 4MVJE 2HWYA 1ENZA 2Q6OA 3HPQA 4HYEA 4EHAA 3OQNA 4JI2B 1W1WA 3FE2A 4EUFA 4IUCS 1NZDA 3OSUA 3ZU4A 4M22A 4BTVA 5DBGA 2BJHA 2V45A 1FXSA 5IPFA 4B7AA 3MCVA 4OKSA 5FA5A 5BN4B 3ZJTA 1C4XA 2NU6A 2C83A 1HTWA 3TKLA 2IHNA 2IU6A 3RWMB 3W4KA 2HJ9A 2I4IA 1Y5RA 1QCCA 3RROA 1MDBA 2RHWA 3G2LA 3TLJA 3UKOA 4PO3X 3A32A 2HXYA 2FRXA 5EKXA 3L92A 1RI2A 2HM7A 521PA 2QVBA 4B4OA 2H1HA 4LFAB 2WJ4A 4LMRA 3UTDA 1H2WA 1ORTA 1DXHA 4G5FA 3ROQA 5C7YA 2WPNA 4BQQA 2JGMA 3GNTA 1AU9A 2FWBA 4JLNA 5J4VA 5HJ2A 1FYFA 5JFOA 4ESHA 2P2DA 4J0CA 1RP1A 1T2DA 4JUBA 3U3MA 3D8RA 5FDFA 2PSFA 4Z4EA 3ONNA 1ADFA 4C06A 1D2HA 4I9GA 5I9TA 1GA1A 1FXUA 1HSZA 3S1AA 1R0SA 4K46A 5AOAA 2NUAA 3ZS8A 2D0IA 2AKYA 1JG3A 2AEMA 4J07A 1ABEA 2BHRA 5CPFA 1W2WB 2G28A 3MGAA 1O95D 1AA6A 3ZWMA 3RREA 4GOLD 3M6AA 1HORA 1IUKA 2BGJA 1T3ZA 3BMXA 3GMSA 4HAZA 4TVKA 3MT8A 5E2AA 3L6RA 2RBKA 1M74A 4RFSA 3MCAA 4N5IX 3GEGA 3EEQA 4DA0A 1U99A 2P3QA 1G5FA 1UOOA 2W6QA 3D0QA 3S5UA 2AJ8A 4ER0A 3G0OA 3TQSA 4OQ4A 3DZJA 1YZUA 4FCWA 2V4ZA 4JYCA 1X38A 3EZ6A 3AESA 3W2HA 4ZDWA 1OBVA 1NMSA 2H4JA 1T5DX 4DIOA 3Q3CA 1LJUA 1ZUNB 3F6BX 4QDKA 2B8WA 1PJ3A 1GGVA 1QGUA 1UMBB 2P9YA 4CM3A 4RTKA 3KUUA 2HWWA 2IHUA 1FU8A 3RUEA 3ZNPA 3BIFA 3A25A 1QVRA 4IG4A 4HF7A 3T95A 4C0QC 1RS0A 2WA2A 2YZ2A 4KMOA 1Y6FA 4NBVA 3HCCA 1WOMA 1TIPA 2HF7A 2Q4BA 4K9DA 4RVOA 1S4MA 1YQ9A 4O4LF 5IXJA 2BGLA 3IT0A 4QFBA 2WIDA 3HEBA 3AEKA 1NQVA 1U65A 3EXFB 3QXGA 2OXIA 4WVLA 3C3XA 3QPBA 3RTGA 4ZICA 2AZDA 4D81A 2FH5B 1SIWA 2FR8C 5IKXA 3F5SA 2C2YA 2DR2A 5LXTA 1Z39A 1NU6A 3KJFA 1WXDA 2VYFA 4D8TA 4ZGWA 1Y81A 2V7VA 3DBHA 5DX8A 3KZNA 2Z3WA 2FRVA 4P86A 3CJRA 2PZLA 4FNOA 1ZK0A 2I6UA 3DFMA 3AJEA 3GQBB 2O1XA 3EH1A 4GXTA 4MP6A 5DRTA 4A8HA 4AP5A 4ZEMA 3I5AA 3L0DA 3UAZA 2AN5A 4PNHA 1IZ0A 3COZA 1I2MA 4GD3Q 5J59A 4UHEA 1EH5A 1PG5A 3H86A 2ILVA 1JPVA 2A5YB 5I4KA 4TVSA 4LA4A 4Y2VA 4MYUA 4H3HB 2G6TA 4JC0A 1XEXB 4WKOA 1DCKA 4UU7A 3ITKA 2BWJA 3FLBA 3B7PA 4IQFA 2HQSA 4PC6A 3OUZA 1OWMA 2VEDA 5K0FA 3ZGZA 3NOXA 4E14A 5I7UA 2DFVA 2DULA 4YO8A 4NAHA 3QWBA 4KX3A 2YYZA 3ZE1B 5CLHA 5FLXA 3QG1A 3MBIA 2HOQA 4NL4H 1K6IA 3E6AA 3OETA 2E82A 4MV1A 4LY3A 1GGKA 4YP7A 2ROQA 3ZVRA 821PA 1Y1KE 4L0MA 3MCTA 1W76A 1YR2A 2ZB4A 1UCFA 4PG7A 4NI5A 1X2BA 3ES9A 3SQOA 1E0KA 4H6PA 4BVLA 2X86A 5CDFE 1UXIA 4B76A 3LRXA 1Z5VA 5L9AA 3UMCA 4FWTA 1XZIA 1XZQA 2W93A 3U26A 4AF8A 1GKYA 2FSSA 1Z16A 1KKMA 4H3KB 4IKPA 4EAAA 2VI5A 2BSQA 4BNDB 2IE8A 1FVXA 4LOHA 3STVA 4M46A 1E2BA 3UWMA 2DYKA 1SU7A 2XGMA 1X1CA 3GJ3A 3OEED 4FM9A 2VJMA 3LQYA 3ROXA 1JR3A 3WV4A 1QZTA 2I4NA 2QSJA 1WSDA 2V7EA 4H15A 2DC1A 2YQ5A 3IKMB 5HBGA 1U2PA 2VNIA 1HNNA 4Q1VA 5D51S 2VPWA 2FSIA 2GVZC 2XMGA 1V2HE 4J91A 5BY2A 3DB2A 1W35A 1CLUA 4XUEA 1HFEL 3K8ZA 5EKTA 1L9XA 1PWYE 3TTYA 1SC3A 4TTTS 3ZBQA 1E9RA 5B7GA 5BSKA 5JEEA 1TVMA 2FG7C 5LJIA 4R1TA 4NOMA 4HAVA 4P31A 1VKZA 1YUBA 4YUXA 3SQXA 2OL4A 3DMPA 4KQ6A 3TPFA 2F3PA 3HSKA 4PZCA 3BH7A 3C3DA 1G8YA 1TLFA 1QE5A 2BE7A 3P4UA 3EQ2A 2ID8A 4JMLA 4NWIA 4BDSA 3TK1A 3L4BC 3OUUA 3B5JA 1IL0A 3C39A 3OLVA 2CXPA 3JS5A 2B35A 3KV3O 3NV7A 3FMIA 1Y34E 3QLEA 3DGFC 3RNLA 3VPBA 3IVMA 3ETCA 5A4IS 1EXMA 1SHLA 3QBTA 4M21A 1YQTA 2I2CA 1J07A 1EG2A 2O3UA 2PUEA 3KO8A 2XVZA 1E2IA 2A5JA 5F1KA 1RQ7A 2FEMA 4HC4A 1RLIA 2O5VA 1PL8A 2V9ZA 1IVNA 2D2EA 4KBYA 4L57A 4YONB 1R64A 2OQ2A 1ZMTA 1Y7HA 2W42A 4PPGA 5FTNA 1DMRA 1T0HB 4LF7B 1U2EA 2P3OA 2WAOA 3A0UA 2AQ8A 2YWJA 1JU4A 1Y6ZA 3F67A 4L5AA 4MRVA 5HK9A 1Z5GA 4AJEA 4OJMX 2FFHA 3WFZA 4DMUB 5DN6D 3AM1A 3AR3A 3NTOA 4K87A 1NN5A 1QGYA 1WQ4A 2BMWA 2FPKA 3N8HA 4RQTA 1BEUB 5IS2A 4NFHA 3RM3A 5L3SB 5H4HA 4J0HA 2ET6A 3TBFA 3M70A 3SDBA 5IDXA 5JD6A 1NJ5A 5CXUA 3T1YB 2TYSB 4UREA 4HLCA 1TZJA 4KMRA 5ALTA 1D2EA 3ZGYA 4E31A 1XP5A 1U0EA 4JB2A 1GG5A 5H3HA 3AETB 3OIGA 4E51A 3DMNA 1EWKA 3HBAA 4GKBA 4F6CA 2ZRFA 3HR8A 3R9IA 3PI6A 4WPGA 1V8FA 4QXAA 1B74A 1SOVA 2FYTA 3L0CA 3IV6A 5DX0A 4CKBA 3A3KA 3F4LA 2J33A 5E4JA 1CQJA 4TWIA 4XGKA 5A6VA 4UM8B 2Q5FA 2Q62A 1BH2A 4PFSA 3S2SA 5IXYA 1A95A 2IP2A 1QOZA 2JZOA 3DJFA 3HGTA 3LUCA 2P11A 3H5VA 4JQCA 1XQ1A 1LPPA 4NAVA 3ZJVA 4BQNA 2IZ5A 1C7QA 4RD3A 4Y18A 4M87A 5GGXA 1G6Q1 2YJTD 4RXUA 1EM6A 3LA8A 3T9BA 3TH5A 3WWYA 4EUHA 2VZ8A 1FP4B 5EE5B 3WL8A 4MA0A 2R4QA 3LL4A 1FF9A 3EYWA 4UM7A 3BD7A 2SICE 1BD4A 1ZX1A 4RH3A 3A9CA 4K9MA 3H42B 3UW1A 2V7WA 4MVWA 4U7HA 1PR9A 2X4GA 4C7OA 3S4YA 2D7JA 2B2CA 2I76A 3RFCA 1Y6JA 4I99A 5E9AA 1OA1A 2R44A 1P4SA 4OHPA 3VZCA 5K3CA 4EQ6B 1MC4A 2FPLA 3U4CA 3ICEA 5JSFA 4JV5B 2XRMA 2QTMA 4YP1A 3FAKA 1CZUA 4V0QA 3VMMA 5ALHA 1QV7A 2QZSA 3GJ5A 1PR3A 1F2VA 1S2IA 3MEQA 3DB1A 4PX9A 3M5CA 5DHRA 2R1UA 3AJ8A 3RKRA 3GHYA 4KN8A 4Y0VA 4P9NA 4WZAB 2FUKA 1X39A 2QZ9A 3VOTA 1QR6A 1C8KA 4G4IA 3TTTA 2E1RA 3CNBA 4QDOA 3U6BA 5E2BA 2C88A 1GGHA 2INGX 4HDRB 4XOIA 5I7WA 2P30A 3I76A 4WUVA 2BTQA 3LWBA 1B4DA 2QAGB 3C3CA 1PIWA 3GVCA 3O0DA 4PBSA 2OVFA 3FFBA 1KDRA 5IK2A 4BP3A 2O8VA 4NJMB 2Y0DA 1DFIA 4F72A 5TQ2B 4DLYA 1KEKA 1NF9A 3S7ZA 5ITVA 5I48A 5F2NA 2C9CA 4XM1A 3MQ4A 5CDGA 5KX5F 1GG2A 1JTEA 1FB5A 1RZUA 2OG1A 4QUAA 1HDYA 4D82A 4KWIA 1LVGA 1PHPA 2GCGA 3AMVA 2YASA 2AEJA 2BEJA 4MGYR 2UYQA 3HADA 3P2JA 1W46A 1KETA 1RI5A 3QW4B 5JU6A 3AR9A 1DKNA 1SR8A 1WCYA 2WHXA 3HP1A 3AHEA 4BY9E 3SZOA 1NDQA 2W6MA 4PC7A 1SQFA 2WNSA 5F1OA 1QRTA 4Q9KA 5K0LA 1UKEA 1GNRA 3HE3A 1WZNA 2ATXA 1VCIA 1G41A 1U8AA 3PD7A 4PHHA 5LNK1 2JKVA 3WY9A 2GCIA 5IMSA 5JAZA 1UM9A 1SWVA 4QYSA 5IZ4A 2HT1A 1WKVA 4KVGA 4ZTZB 2IRWA 3FX2A 4MV3A 2CZQA 1PJ8A 1W0JD 1Y48E 2ZPAA 2Y0CA 1PQYA 2I4RA 4JFRA 2W6PA 1BKYA 2BYTA 2C54A 2FJPA 2NWQA 3PYMA 4WL0A 5FXMA 4MUGA 2VJQA 4DLSA 5JWHA 2HA4A 2YHSA 1BCRB 4EARA 2F67A 3F6EX 1TM7E 5K6RA 2HHAA 3FJ1A 5B58C 4HDQB 2BGGA 1W4ZA 3JZIA 1T8YA 1XCOA 1M1NA 3QU2A 2JFQA 3E5HA 4HNUA 4NBWA 1L8AA 3LK6A 1DBIA 1OAAA 2MHCA 3DE6X 3HN6A 1E96A 3LVFO 4LUCA 2ZIXA 5J5VA 1J70A 2NSYA 4JP5A 1TM2A 4W5RA 2G9NA 3AOGA 4DBZA 4IEIA 3E15A 2QTNA 3NHAA 3WFIA 4QQFA 4IRUB 4B82A 3BFPA 3L1JA 2I55A 1ZMXA 2EZ4A 1UZUA 4JYAB 4PANA 1JHXA 4LWZA 5BSUA 3FMGA 3A6PC 3DE7X 1I36A 3WMEA 1TT7A 2XBUA 1Y8RA 3C70A 2SCUB 4NBRA 4YRFA 3T5BA 4MR8B 3I64A 4PLPA 4ESOA 1DQZA 1SHJA 5HE8A 1GUYA 5CCDA 4EG3A 1J0DA 5DIFA 5ELXA 4QYWA 5IKPA 3ILSA 1KJ9A 4QUJA 1H0SA 4KJXA 4D5GA 2AMYA 3QIAA 4BMPB 2YKGA 4ZEVA 2JLZA 1YRQA 4CG0A 4ZJZA 2OK8A 4LNUA 3T0GA 1G6KA 1SC4A 1UAAA 1EFDN 2DRIA 3HFGA 1FP6A 2J4DA 4U9UA 3WGMA 3PC8C 3GC6A 2QTZA 2AW5A 2NO4A 1XQVA 2HBYA 3VR0A 2ATIA 4W5NA 4UXJA 5B4TA 2KLHA 4WNIA 1ULZA 3VQTA 4DMHA 4NE7A 1E1RA 1BMFA 3AWIA 4CQMB 1XBTA 1XF1A 3GFPA 4JJFA 4UUBA 1MUUA 2UYYA 5CM9C 1IUOA 5DTEA 2LP4Y 4GPBA 2QQ5A 3IS3A 1DDOA 1FUYB 1BROA 1M0WA 2CZGA 3V7UA 3SP1A 3SFZA 4TS4A 4MLCA 1JDBB 2EZUA 3H11A 4I9FA 1N6KA 1NBMA 1YU6A 4UE3S 1P3JA 5LOVF 4URHA 1VL8A 3AM5A 1EUDA 1H69A 1KY5A 2CFTA 2ZJFA 3KJQA 4J6FA 4AP9A 2IUSA 4DR7B 4NZYA 2XKAA 1RFLA 1R9MA 1L3BA 1X2EA 2PXHA 1Q0HA 3GELA 5FHRA 2B61A 2X2FA 2A7QA 2AXQA 3FWKA 3KKPA 5LQJA 4D44A 2N46A 3H1BA 2A58A 4MEJA 3KTAB 2X0EA 1XGKA 2OQIA 4PZZA 1C3OB 3FOCA 4P93A 3VTZA 5FA8A 2Y0EA 3CX8A 1SCIA 4F9EA 1GGMA 2XZTA 4ETIA 2ZT7A 4N65A 4RTRA 3LPCA 2F59A 3LLUA 1GAEO 1I4TD 1QFMA 4X85A 4R7GA 5FQNA 4DQKA 4PC1A 3UWOA 1TFUA 2CLSA 2IXTA 3KB8A 4ID3A 3U17A 1DC3A 4ID9A 1UBEA 1YONA 2NO9A 3PFFA 4ZHQB 3IILA 3TN7A 1D4ZA 1I7NA 3A4MA 3LIIA 1LD3A 3BWEA 4XCXA 2V8BA 2XE8A 4REQB 3R7FA 5TE9A 4D8XA 1TYBE 2XMZA 3O4GA 5ECDA 1UT6A 1E0JA 4GDMA 4LHVA 1T10A 4KQWA 1EP2B 4P4LA 3WRVA 2QXTA 4Q7QA 5CT9A 2CJYA 3B52X 3HWX1 4IHJF 2ETVA 5FWNA 1JR4A 2WFLB 4CN9A 2AN3A 1XYYA 2CLDX 3K8YA 4KZKA 1OILA 4OJKA 4D56A 4BEVA 4RW0A 5IFLA 4UDYX 4OXRA 3SVZA 2B4AA 4D9HA 1OD6A 2QAJA 3MD9A 1TM4E 1SRQA 1Z2AA 1ECFA 4JCOA 3PJRA 4OIMA 5F35A 1EZ4A 3MAJA 5G4KB 2HX1A 1XDDA 2QLNA 3IPYA 5BNZA 4FNGA 1VMAA 1K6MA 2GX6A 2I87A 3LBNA 1S96A 4C2AA 1ANKA 2GILA 4D3YA 2WYOA 4X95A 2KS6A 1C9YA 4LPKA 1V7ZA 4X8LA 4CMBA 4GX5A 3PNSA 1SZJG 4N8EA 4A03A 4G84A 3EDCA 4OHFA 4PU0A 3VBEA 4YUAA 3HKDB 4E1VA 3B12A 4KGVA 2BELA 1R8JA 3CC8A 1JR2A 2TECE 3CTMA 3OIYA 5BWLA 1XRRA 4U7PB 5CT8A 2JCVA 3EVNA 1Q2UA 4RZ2A 1YK0A 5EIFA 2QY9A 1DEHA 4KXWA 1QH1B 1HZJA 3N6XA 5EZYB 3DZDA 1OYYA 5CGZA 4ZVVA 4GNRA 3O8NA 4TS1A 1GV0A 1GU0A 3H5LA 1JJVA 4MIYA 4GIBA 2WJJA 4YRZA 2O20A 2W2KB 2ZBEA 3WJ2A 2V7TA 4RA6A 2D6FA 3TYXA 4IHAA 4GPZA 1TVKA 3UWKA 1B23P 2Z0MA 1FYDA 2VPTA 1QQBA 4ZQBA 3WMFA 4AZ0B 3HR7A 3KWMA 1L3CA 3Q1KA 2DPYA 2D7CA 2OCKA 1XLTA 2N42A 2ZAYA 1T0BA 4GRDA 5K3BA 3HVJA 2NU9A 1I3NA 5I9IA 4C3OB 1U9YA 5KWJA 3MT7A 1AMNA 3FDIA 3H2HA 1R6TA 1M1YE 4PPNA 2X40A 3MTQA 4QL3A 1IN8A 3ED1A 3OEHD 1CJTC 4X7MA 1E60A 3U31A 4KXMA 3ZXIA 3ZWCA 5HM8A 3OT5A 1X1TA 1XSEA 2XMDA 1N2EA 3I3SR 5HF6A 1NW7A 3T7KA 4C6TA 1G55A 5EEHA 1C30B 1KMHB 1ADYA 5IC6A 3WYGA 1GVHA 4D0LB 1V41E 1F8GA 2PH1A 2UYGA 3CNOA 4X00A 4AG6A 5EHXA 2AJLI 2VTDA 2C95A 5KJFA 2J0SA 2X2PA 1E6EA 2I6SA 3IUJA 1A69A 4ZP1A 2BEKA 2EKDA 3GOHA 2VA8A 2Q29A 1Z0AA 2VO1A 3JWHA 5B2EA 5CEJA 1IN1A 3ZGVA 4D41A 4IOJA 4M3NA 5HPYB 1EGQA 1YS1X 3SJZA 1P8JA 3GEHA 2ZBRA 5A7HA 2Q3FA 3O3OB 1FLDA 1WPGA 4IDCA 5E6UA 1HM5A 3IIKA 1YE8A 2CMDA 4TMTA 3ECAA 3D3JA 1DT5A 1JBKA 5AKEA 2ZE8A 1T3TA 3K9NA 2OC4A 2ZTHA 3ANSA 5EIBD 3RVPA 3BICA 4Q24A 2PUAA 3B6ZA 1G5PA 2DHDA 2DR3A 2IYYA 1PGQA 3A6FA 4EG1A 3UGJA 2ZYAA 1H2BA 4JBIA 4R5HA 3LLSA 2Q4OA 1MW8X 2AMLA 1TT5B 2SKEA 3H6KA 4TKZA 4DLBA 1E2DA 3EVEA 4C3VA 2I7XA 4B09A 4HJRA 1KR2A 5EN4A 5B55A 1GP2A 1BG6A 1LJLA 1RM5A 3D4PA 4WGGA 2A4MA 2AK3A 3DTYA 4XB6B 3OHMA 1CJSA 2H4ZA 2IU0A 4CJXA 1H2XA 1HRDA 2MSLA 3OU6A 5LMZA 4FEAA 2ZSFA 3OMXA 1JG2A 4I6JA 4J1SA 4JLMA 5KJCA 2C00A 3L8YA 3MQ2A 3PIIA 5ILGA 1XV5A 1ZI8A 3FOFC 4YVFA 3H3FA 1NRWA 3WP1B 3SQWA 4QT0A 5HVNA 2IEZA 1RWVA 1JIJA 3KXLA 2BSAA 4WTOA 4JROA 1NJ6A 2PKQO 1G2QA 1OV4A 4M1YA 5LA6F 5HRCA 4RO0A 5JADA 3RHZA 1ZUHA 2XB9A 5KJEA 5BNTA 1LBQA 3A6EA 4WKBA 4AKEA 4B80A 1V5FA 4N5MA 3SMQA 3BMQB 4P4GA 1HY3A 4ZO7A 3UAWA 1ENPA 3B1VA 4BMOB 1T6NA 4RD1A 4YMUA 2Q2VA 4RABA 4AX8A 3MT0A 1PW7A 1AO0A 1UPXA 4MB2A 2ABWA 2IXDA 9LDBA 2WFZA 1ZZEA 3HTXA 1SU4A 4IIJA 2QXYA 3GW8A 3RYFA 1JBQA 1PZFA 1PUXA 4EO9A 4KITB 1A8QA 1OXUA 3K0BA 4UUQA 2VF8A 3NP7A 4EW2A 2OBLA 4J0KA 1QB8A 4EGJA 1UMCB 1KVTA 1W52X 2BZSA 2QSUA 3KDSE 3P9ZA 2Q9UA 5HKLA 1K9VF 4AECA 3DT6A 2C2XA 4PCAA 4Y1EA 4LX0A 3OEHA 2XRZA 1JHZA 2Z4RA 3DHWC 3KALA 1B6TA 4M9XA 1LRKA 3KUDA 4LY0A 4MW0A 2B36A 5JLAA 1EZ1A 1QAQA 3DE3X 4HDMA 4G5RA 4GX2A 5GZ3A 4DSOA 5EZ6B 2A5FA 1XDZA 1U7TA 2B4TO 3IHKA 3MHTA 3WDKA 1LBSA 4QRIA 4MAFA 3DDHA 1HFJA 1KOFA 1BEEA 4HQLA 4Z9FA 9ATCA 3HYCA 2KE5A 4CLOA 4HB4A 4PZ9A 2JA1A 1WB9A 2GJSA 2I7TA 3FBGA 1AMOA 2IYAA 1UKAA 4MV5A 1ZEMA 2ZIFA 4D9MA 2BHSA 3CN9A 1TMGE 3JQBC 4GE3A 4XEUA 4DPKA 4A1OA 1JYEA 1I1OA 3OI7A 4O2RA 1TW2A 3WHLA 4KN9S 2QD1A 1ONPA 4QOFA 2F6RA 4JZYA 1ZNZA 1TLTA 2QN3A 4W1RA 2G70A 4DNQA 8AT1A 3PKIA 1V7CA 2VRNA 4GVXA 2ICAA 4NH0A 2DT5A 4QEDA 3T12A 4CEIA 1XMIA 5KU7A 3UCEA 3W6PA 5DLPA 2E5LB 1NXOA 3GFGA 2WTNA 4IJQA 3RWOA 3EGXB 5AW1A 2ORYA 1A4UA 1JFRA 2HLHA 1DXQA 3NHPA 4P5PA 1DARA 3MINB 3BQ9A 4QECA 3V1YA 4BFZA 2HWKA 1PZGA 3QTTA 3MJVA 1JX6A 3IXLA 4J0QA 4B74A 1E3EA 6LDHA 4TLBA 2V96A 1S3IA 1N3BA 2G1KA 2OV8A 2PAAA 1RQPA 4KXXA 1SU6A 5FOSA 5FUVA 4NAUA 3O1HB 1OHHD 2G76A 1Y4AE 4YHBA 1KWKA 4QJBA 1LNQA 2Y76A 4RJ2A 2WWTA 3C4QA 3FNEA 4PLWA 3VGJA 4QQNA 2OZLB 5K0CA 4MQFB 4KPFC 3KB6A 1G1AA 1Q2XA 2O7QA 1UH5A 2YZGA 1RCTE 1U1FA 4MDHA 3A1CA 1H1DA 3PFHA 2LNDA 1FNSA 5KNBD 3W5BA 4LWOA 3O03A 1VHJA 5J63A 3KUCA 2I99A 2VDLB 5ES3A 1T9DA 1NURA 1E59A 4A2PA 3L1VA 3FPLA 4X5OA 4BZPA 3L49A 1H42A 2NMVA 2FWIA 3UT5B 4DCSA 4A0SA 3WGGA 3RK0A 3EHDA 1PWXA 2IFTA 2EW2A 1IVYA 3OTWA 2W70A 3UCFA 1WE2A 3BREA 4YJFA 4EMTA 4W8GA 2VPYA 1QHNA 1QG2A 3HA2A 4BFVA 3NHJA 1M34A 2JCXA 4G01B 4UUNA 3UXMA 4ZPXA 3LQ2A 2X6TA 2V7UA 1N8NA 2DBYA 2WZDA 4AS3A 1Z4OA 3IQXA 4E2ZA 2GMWA 4YPVA 5GONF 3K6RA 4BNWA 2ONZA 1E69A 1UC5B 5C7IO 5JQGA 4TV9F 1YI8A 4G4SP 4EGQA 1R5BA 3OQ6A 1LK7A 3SS8A 4LRYA 4RH0A 2WP8J 1EDOA 2QVYX 3HY4A 1N3YA 2CJXA 4GWGA 4KXQA 4U63A 2AJBA 2CL5A 3BA6A 1CY4A 4H17A 3TQFA 3TM4A 2V0GA 1UZLA 2C4KA 1MIOA 2H16A 2K2WA 2BCGY 2PA0A 4LQCA 4MUNA 2JIZD 5JYBA 2A5DA 2LCIA 1NV8A 3NWEA 2P2ZA 4M0MA 1GARA 4KQIA 2C5LA 1PSDA 3FTCA 1UP6A 2HFKA 3HEAA 1MA3A 4GLOA 5LQKA 1W87A 3H2IA 1PJRA 4FFBB 4JT2A 4D97A 3FUVA 3W6OA 1J49A 4YRBA 4F7WA 5JZOA 4NMLA 3E2PA 4PPYA 1U9CA 1EWTA 3W8EA 4EYSA 2YWFA 1Z75A 2JI7A 4M9CA 4B6OA 3AOEA 3U40A 3NIDB 1ZAYA 2N3ZA 1BZYA 4C7MA 2EL9A 1WTCA 2H9AA 2X14A 4XCQA 3LBYA 5LWHA 3C7KA 3GUUA 1ZEJA 3N2ZB 5H70A 3M9LA 2RHBA 3OZ7A 4AY4A 1GN8A 5E3IA 2HHHB 1K92A 3EDOA 3X1DA 4ASUA 1HYHA 2CGEA 1KDZA 1JHUA 1AK1A 2DKOA 5KYWB 3F3MA 4HDKA 1ZGBA 3CW8X 1LK0A 2YY6A 1NLZA 1DKPA 1L5HB 3NAQA 4WHMA 1MQ9A 4KU4A 2F9FA 4JUFA 3V8EA 4URVR 3ZIAD 4RMJA 4W4TA 3NHWA 3UBTA 3IDSA 4RBNA 1Y7IA 2VLIA 3U3RA 1JHAA 4J3NA 2O8DB 5ALXA 4S24A 2Q27A 3G6KA 3QHQA 1D4FA 4EB3A 3SXUB 2RHCA 1GPLA 1E3LA 3LIPA 1ZIOA 4L8WB 3UPDA 1VBKA 2F1HA 2QUIA 3EDMA 3D4BA 4P3PA 3I6IA 5T6MA 4UEJA 5EJ7A 4C14A 4FLFA 1NRXA 5JS6A 3R7SA 1E64A 4WCVA 4KQXA 3Q2IA 1N2CE 2B1IA 2EEZA 5G3YA 2JLAA 3DL0A 1CHDA 1RYYA 2CKDA 3K7EA 3WXBA 3ZE9A 4LVUA 5JH7F 5KTNA 5AMXA 1G5RA 2YFQA 4HB2A 1XJ0A 3ND7A 3NH9A 4OAOA 3ZXYA 4HLDA 5B53A 1EXVA 2V65A 1CR6A 2W71A 4NONA 2PT9A 4QBFA 1CTQA 4R84A 2P9JA 4IILA 3I09A 1LDGA 2GM5A 4G5XA 3L8ZA 5TVKA 3RRYA 2J85A 5HQTA 1Z5PA 2FE1A 1W6UA 2I6FA 1E9DA 1MN6A 2HK7A 2HTFA 2XCQA 2B92A 7GPBA 4JEUA 1YRWA 3M89A 3BSWA 1E6LA 2JGDA 4DTIA 2I8CA 5A1JA 2FEKA 1UDWA 5C34B 2PLNA 2OBBA 4PSAA 3O1IC 4UNIA 4WINA 3NANA 4R2KA 4MW6A 3KX2A 1J21A 1YIDA 3M6MD 1M8KA 3MJHA 5BUSA 3C6XA 1Y1LA 5JNRA 2AE2A 1V8OA 1O96B 2A0YA 3GMTA 2EJBA 5EP2A 2ZRIA 2CFOA 2O2ZA 3WO1A 1UINA 1II8B 2I2FA 2PPLA 3H4TA 2ZI9A 4MWGA 2VH5R 3I2HA 4HLUA 3B7GA 2OFOA 3QPDA 1X42A 1YJ5A 1K9SA 4R0VA 4DQUA 1P4GA 1ZESA 1IJKA 2LVBA 2CNWA 1EUCA 4H9GA 4R51A 4O1MA 3RUDA 1C1DB 3O93A 1R74A 3AEXA 1BRMA 5ESRA 4B8ZA 3IQFA 1E66A 3P52A 3QFRA 4G9EA 1KARA 1SVIA 3NT4A 1FJ2A 3KB2A 5ABPA 1QB7A 4OGGA 2WOOA 3DBVO 3L05A 2Q7XA 4TM8A 5D1HA 4KSBA 3CVUA 4FR0A 4BPBA 1EESA 5I7HA 1CKEA 4MGIR 4FFMA 3DA8A 3AHDA 2WSLA 4O2BF 1ZONA 5K8UA 1QRAA 2Q3DA 1RZVA 3KYDA 3M33A 4MYCA 4CNBA 4RDCA 3ZXXA 1V11A 2F64A 4BNZA 5GMOA 3TTUA 2DG2A 1JKJB 1P72A 1BC5A 3AH8A 4XWKA 4IIYA 1QK5A 1YWGO 2C3UA 4ENVA 3VDNB 3BVPA 2PUHA 1QH8B 1FQOA 4EWLA 1NE7A 1NR7A 4QJIA 4YRKA 2HI0A 4NZ9A 2ACVA 3G0CA 3IALA 3KOZA 4R6WA 5KCMA 3Q3EA 4HADA 5KYYA 5JH7B 2ODAA 3I23A 3S2UA 1Z36A 3KQKA 2F1OA 2XCUA 1T6ZA 3SY8A 4RLQA 2IZ7A 2P1DA 3A4IA 3AIKA 2P27A 1PS8A 5SY4A 2P0YA 3ENQA 4R8KA 4D0SA 4FCCA 4RXMA 1OB5A 1GOTA 3HNRA 3KD3A 5EIAA 1HNZB 2V6JA 3EIXA 4EPRA 2XODA 5K2OA 4EW3A 3REOA 4DR6B 3FCCA 2WSMA 3GT3A 2B9EA 1E79D 2CXNA 3BWYA 2JCYA 3N8NA 5EJFA 1GNSA 1QHHB 1VPLA 1KO1A 2OBYA 5B1IA 1QRUA 4O4HF 1K66A 3BH6A 3D8TA 2WD7A 5T41A 2VJPA 1NVUQ 5T64A 3WYNA 1NR1A 3GXOA 1E62A 5BYBA 2PGLA 1PR5A 3BWVA 5COAA 3AZOA 1CYEA 4ZZ3A 1K68A 5B3KA 1OFHA 1FTNA 4YQEA 5D01A 1V26A 3GNLA 5C52B 1HOTA 4YCSA 1FDSA 4RZUA 3LQ1A 4GP9A 5FUQA 1XNHA 3KSZO 1E94E 2P5TB 3K5PA 3TLBA 3LXMA 4HPXB 2Q5OA 1VSBA 4MGHA 3KHUA 1ZXLA 5IARA 1J8FA 4CV0A 1T9GR 2BOVA 2IYQA 5BP7A 2P0EA 4DHWA 1YIAA 1XQ9A 2A9KA 2GN9A 3R0ZA 5DHAA 2R6HA 2G9UA 5MFPA 2RH8A 4NJMA 5LOVA 2FWJA 3SYKA 2PLAA 3VFDA 2P75A 1P9LA 1MAWA 3ZTYA 2BY4A 2PGOA 4AUEA 2GN1A 3MWLA 3E4DA 4F5DA 4H6XA 3AF2A 5BW8A 3ZQJA 4ZGGA 3B89A 4KFSA 1QVZA 3HLYA 1ZVMA 1N6IA 3TR6A 4BE4A 4E4TA 3QVJA 3OG9A 3KUXA 3ELYA 4LDRA 1JPNA 4L0DA 2VP3A 2WB4A 1I7QB 2A14A 4HNHA 4F86A 1IHYA 1NQWA 4ASUD 1SFRA 4L5BA 3IL2A 4FDVA 2X0RA 3K9WA 2Q1SA 4G0XA 3RI3A 3EVFA 5D3MB 1K5HA 2EQ5A 3JQ8A 2YNMD 3EUWA 4J9VA 1IEQA 1SBHA 1V71A 2WIKA 2FSPA 3BGOS 1CQIB 2ZXEA 3K6JA 5C31A 3SSAA 5ERGB 1GTJ1 2JB9A 4MV6A 2EAUA 3LY5A 2IYLD 2BMVA 5C1DA 1ZCFA 3P9CA 4WLEA 4G0MA 2GAIA 4X9XA 5EZYF 3BMNA 4MVYA 4CQLB 1P9RA 4Q4HA 4XD2A 2B7BA 3ECCA 3H5RA 4Q37A 1MH1A 4TT3D 3ZEAA 5ECGC 1YQGA 3LGAA 5KYVA 1T35A 3AUXA 4BBAA 3GGOA 4BO5A 2JK1A 1MJGM 3K4HA 4XASA 5KTPA 5CFOA 4QUBA 2P3LA 1ABFA 3JTEA 3PHHA 1L4EA 4NCXA 1EP9A 2M6LA 1EE9A 3JVIA 3PUKA 5IU6A 5MGBA 1T4MA 3TAXA 4BJ3A 2PBLA 4IKEA 4AJLA 2XNKA 3BJRA 2B4RO 4BQPA 3CSSA 1VJ0A 1RXWA 1RYHA 5CD1A 1NUHA 3OCXA