2N42A

Ec-nmr structure of human h-rast35s mutant protein determined by combining evolutionary couplings (ec) and sparse nmr data
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPSIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords GTPase HRas
publication title Protein structure determination by combining sparse NMR data with evolutionary couplings.
pubmed doi rcsb
source organism Homo sapiens
total genus 54
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2015-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2n42A00
4LPSA 4C0JA 1A82A 1U94A 3AH8A 5EZ6B 3SYLA 1W7AA 4EFMA 2WAYA 5DYGA 2A2ZA 3UMRA 4N3NA 3EG5A 4MYUA 4OHVA 2GCOA 2J7PD 2ZR0A 1U8YA 2CHVA 2IYLD 1IN5A 1Z08A 4QGGA 4BFYA 1OXXK 1T3HA 3MRSA 4MKIA 5AWFC 5BW8A 2CCJA 1CJTC 4NH0A 3EC1A 3LBHA 5CITA 3LBNA 2GF0A 1E9CA 3W3AA 1MV5A 4DZZA 4ZIRB 3OHMA 3EARA 2XXAB 4KV9A 1M7GA 4B32A 2ATXA 5FOUA 3A8TA 4BQSA 2FSHA 2YKGA 2JLQA 3K0FA 3REFA 3I8SA 4A15A 2ZREA 4O3MA 2PMDA 2CJWB 2V1UA 3TSWA 3KUCA 1M74A 2QTHA 1OH7A 2VSXA 2KBFA 4DXAA 4L16A 2C78A 4R7ZA 4ZO4A 3ZZUA 4GNKA 2GILA 2XNDD 2WSSD 1W4CA 4M1WA 4AYTA 4XOIA 5FBWB 2CXXA 2GHIA 1MABA 3VR2A 1KOFA 2F1IA 1G18A 4LYFA 1E1QD 3LX8A 3NEYA 3WYAA 2BIFA 2MSDB 4JBWA 1PV4A 1OH5A 3T15A 2JCSA 4OHWA 1P9WA 1CEEA 1E0KA 2HDNB 1CR2A 4AKHA 2CVHA 2GWHA 3TIFA 3EWSA 3UANA 5KSOA 2QM7A 2ZR7A 4C2UA 1XTSA 1KI7A 2BKUA 3TRFA 4CVNA 4DCUA 2EFDB 2AL7A 4W7SA 1R0ZA 3ZS9A 2FV8A 2QQ0A 2O8FB 2IYXA 5E3HA 3GJ8A 4ZI2A 3D7MA 5KOYA 2ZXUA 4D80A 5G40A 3SC3A 5LB4A 3U7EB 1XFAA 3CNNA 4B3GA 4PC3A 2DB3A 3IDQA 1WP9A 3DM5A 1Q22A 1YJ5A 1NBMD 2ZEJA 5KPJA 4ZCMA 1G19A 2JJ1A 4Z1MA 1QRAA 1TQDA 2JGNA 1E9SA 3P27A 3M0EA 1E9RA 2QP3A 1XBTA 4DLUA 4G5GA 4UXJA 1CIPA 3GJ6A 2OE2A 1S3GA 4EUNA 5TY0A 1S1MA 4RZUA 5FR2A 2VLIA 3HR7A 2E9SA 521PA 5TV2A 1I2DA 2DWQA 4FMCF 1G21E 1KY3A 5G3ZA 1L2TA 4IW3B 3DMNA 2ZS8A 3ZQ6A 2E87A 2VF7A 3LLUA 2DPXA 2F1HA 1Z07A 2GJSA 4B6FA 2CVFA 2VP4A 4GOJA 4DCTA 3CF2A 4A2PA 4X8HA 3RC3A 4DLRA 1HV8A 1W5TA 2CLCX 4GZMA 3C14C 2OAP1 3C5CA 3UKDA 4RCYA 1C4OA 1VG9B 2GETA 3SQWA 3B7GA 3O8RA 1W36B 4HUQA 3DOFA 1IN4A 1SXJC 5HTKA 2B7BA 4GMDA 4V0KA 4ASUD 1JAHA 1XEWY 2FGJA 1LF5A 1Z6TA 621PA 3VU9B 4TQUS 3LDAA 3CR7A 1VHLA 1KJWA 1QHHB 3L2OB 2ZE8A 2VHJA 1R5OA 3NEJA 4QM6A 1P3JA 3A4LA 1J70A 2J41A 4FIDA 3CH4B 4JVNA 1GWNA 3MUFA 4BZPA 2O5VA 2W00A 5KSYA 1FL9A 2GBLC 3BB3A 4A6XA 4C0AC 2FPKA 5JHHB 2GTPA 4H1VA 3EPJA 1Z0DA 2VF8A 1ZNZA 5CM9C 3AVVA 3OAAD 2KI5A 1S9HA 4D25A 1MH1A 3QKRA 3GFTA 3EX7C 1X8JA 1FFHA 1U0HC 4PPGA 2IS2A 4HLQB 1UM8A 3LNCA 4S2EA 5B58C 5J47A 5HPYB 2FSFA 2O0KA 1GFIA 4JJZA 2V1XA 5DLQC 3QPWA 3IIJA 5BYJA 2IYQA 5J40A 3GMTA 1FMLA 2RGNA 4JBYA 1KI1A 1Z6GA 3T1OA 5LPNA 3CNOA 3P1JA 1EFRA 2QMUA 3TAHA 1GITA 1CXZA 5B2ZA 2IYUA 3CWZA 1OXUA 2CL0X 1P60A 3FGNA 3EIEA 3RWMB 4ZDKA 5TMPA 4AYXA 5FOWA 5L3QA 2JIZD 1D2NA 2CE7A 1G1MA 4EKDA 4FMDF 4XTRA 5DHFA 1E2EA 1KDTA 3EPLA 2P2LA 1XXHE 3C7KA 1QDEA 4IVQA 1TQ6A 3A37A 2W2TA 3UMFA 2OBMA 3U7HB 4KU4A 2WTUA 3JVUA 1B0UA 1KKLA 3W6OA 2ZETA 4GPTA 4P31A 2YOHA 4MDEA 4M1TA 4NCHA 3PEWA 4UQOA 2WMNB 4M22A 2C99A 1KO7A 1G8HA 3BXZA 4D0NA 4ARZB 1HQYE 4GOKA 1FUUA 1QF9A 1QVRA 5EP1A 5AUOB 1DAIA 2R6FA 2GXSA 3IKJA 4L8GA 1XEXB 4PO8A 4A0GA 2O8BB 2NZJA 4OI2A 3AF1A 4IRUB 1E98A 4KSCA 1T4GA 2BBSA 2QY9A 3ZZTA 4Q9HA 4WXRA 4V0OA 1WF3A 4U00A 3K53A 1G7SA 2ZS9A 4AWXA 4BFWA 1ZD8A 5FL3A 1GL9B 4ABYA 4DT1B 1P2TA 2I4IA 2NO0A 5KDOA 5GVSA 1G3UA 3AVWA 2FGKA 2J7PA 4IOKA 3REGA 5FOTA 4B48A 2SHKA 4YMSA 1AJEA 2XZOA 5DH9A 3U3KA 4DLTA 2MSCB 1GL6A 2Q0HA 3GLHA 3WMGA 2G77B 1P75A 1GVNB 1KZGB 2ZJZA 1QHYA 3DZ8A 2DFTA 3SFZA 3QNUA 4LJAA 3W8NA 2ZAOA 2C5LA 3C8UA 2KE5A 1X1RA 5SZHB 4LC1A 1P62B 2C03A 4Q4HB 1R2QA 3WHKA 4URVR 3BWDD 3X1WA 1MO3A 3LLMA 3ZGXA 2WJGA 1E2NA 4QJ5A 2WKPA 2YOFA 4A0RA 4C0KA 1R0XA 4W5JA 3AP3A 3KKQA 2EW1A 4DRZA 2ZI6A 2QTVB 3DMDA 4PC1A 1HYQA 2A30A 2PZGA 4TYQA 2JLRA 5CB6A 2XNDA 5EE1A 4JLOA 4Q7MB 3EIQA 2VHQA 1CR4A 1Q20A 4QGAA 3H86A 3Q8XB 4CGZA 2F3RA 2IYTA 3QF4B 4CEJA 1KO8A 1SVIA 3F3YA 4LPKA 1E1QA 3WNBA 2BBTA 2ZU6A 5TDHA 1Q21A 3A1UA 1XNJA 1ZVQA 3KX2A 1CR1A 2VQSA 2QSZA 1ZU5A 3DVLA 4LYJA 1K5GA 2GAAA 4A92A 3ZS8A 2YWHA 3I3SR 4JLKA 1LNZA 2D2EA 3SBEA 1XPOA 3FHOA 3EWAA 1IHUA 1Y3AA 2DYKA 4UKDA 1PUJA 1Q1BA 5K8IA 1NVVR 1T0HB 1GIAA 2BMJA 4PHTA 2A3RA 1J2JA 1GOTA 4EJSB 2O8EB 3AUXA 4GOXA 3GPLA 2CHGA 1RFLA 1Z6XA 4EPYA 5DI3B 4D4KA 4C7OA 1F2TA 3JVVA 2F7SA 3U60B 1N2CE 4AG5A 3I4LA 1E3MA 5JZVA 4H9GA 2ZYUX 1GTVA 3KTAA 4QOSA 4PC6A 1JXOA 4IOJA 2JLVA 5DGXA 2IYZA 2WVJA 1E2GA 1WMSA 5BN5A 4P3YA 4ZKEA 1E0SA 2IUSA 4TL7A 3TUJC 4EPXA 3K70D 4AY2A 1U0LA 1DG1G 1KY2A 1QHSA 4A82A 4TYNA 3A36A 1IN8A 3AP1A 4O2LA 2ZYTX 2QT0A 2VP6A 2FMXA 5E7MA 2ZRLA 4B33A 4D81A 4TMZA 4HAZA 4TMTA 4DDWA 1T8UA 3GLGA 4CT5A 1ZCBA 1T6NA 4XD7D 1ZIOA 4D4MA 1NNEA 2IEYA 1JECA 3EZ9A 2ZU0C 1CS4C 3GCGA 3PEYA 3BS4A 2H16A 4OQLA 3CX6A 4TQ9A 1UBCA 4DC9A 5B64A 5IRCD 4Q1CA 1VG8A 1ESMA 1KZ7B 1ZW6A 3LX5A 2H18A 4JSTA 3WBKA 4ASUA 1H65A 4NYIR 2C77A 4TYWA 3RS7A 2RGDA 2IWHA 4AD8A 4KLZA 1NG1A 1A2BA 4QJ4A 4CF7A 1G7CA 2ZI5A 2FF7A 3SJZA 3UWOA 4JKYA 1XCPA 2HLDD 1UDXA 2F43B 4LBYA 2Z5FA 1YRBA 3AQ4A 3CPJB 1M7BA 1SVSA 3WMEA 5JSZA 4O25A 1MO6A 5EXXA 3OAAA 2WICA 3K9NA 3MSXA 3PV0A 4PPQA 3TNFA 3DL0A 2KSQA 2O8CA 4Q19A 1COWD 3ADDA 1E2HA 2R6GA 4PXAA 2CBZA 4JLNA 3QBTA 4HAVA 4XVRA 1LS1A 3QIAA 1AK2A 4ZPXA 4BE7B 1KI8A 1NVXQ 1JR6A 4TMKA 2OFWA 1MOZA 5KO2A 3NWJA 4TWZA 1P2VA 4HAXA 4P4UA 1QHXA 2LKDA 2WMOB 4JJKA 1NMYA 2VA8A 2IS6A 3I61A 3CNLA 3U3MA 1R4AA 4DUGD 1CJUC 1NSTA 4DLZA 1N5JA 2ZRKA 4URYR 1IAQA 2CLDX 1JPNA 3WYFA 4US0R 2JIZA 2D7DA 1G3MA 2B92A 1BYUA 1AZSC 4WA7A 3Q5EA 1ZBDA 4DCNA 1KK1A 4OYHA 4G1UC 1F2UA 3K0AA 4K81B 2WWFA 1D9ZA 1KI4A 3AVTA 3Q9LA 2GJKA 1Z0FA 1TQ2A 3R8FA 3K0SA 4QL3A 3KQUA 3SQXA 3BK7A 2Q9AA 5IK2D 2RHMA 3QJYA 4NCKA 1IN6A 4HLCA 1G20E 4JYBA 4L15A 2RCNA 3R9WA 4NZYA 1KAOA 2GVZC 4LGMA 4FCTA 1UJ2A 1NVWQ 1N0VC 1Z3IX 3OE7D 4P4TA 1J7KA 4DLXA 2QPAA 3GFPA 5EE0A 3UG7A 1XXHA 2C98A 2GXAA 2Z83A 2D3WA 1S4QA 3HYRA 4PHHA 3WP1B 4TYYA 5JJKA 2D06A 2W6JD 1FP6A 1Z22A 5TB5A 4QHSA 4V0LA 1U98A 1E2PA 2DFLA 1Z5ZA 5JI2E 1UEIA 1M6NA 1CTQA 3BORA 1GUAA 2DWPA 2I1VB 2ONJA 1Z83A 4A2WA 3CBQA 3B13B 5AJVB 4DBLC 2V55B 3GEIA 4MRNA 1WBBA 1U2RA 4QRHA 5HKKA 1AKEA 3PENA 4WOPA 1XEFA 1CRPA 2C2HA 2WWIA 2N42A 1KHTA 3K1JA 2W2VA 4PSVA 1XD2B 1P4SA 1SKYB 4KFTA 2CLSA 5L8VA 3BIFA 4NHOA 3P32A 4URZR 3QXXA 3UIEA 2VP2A 2IK8A 2REXB 4KHZA 3FTQA 4LV6A 4M53A 1Q1ZA 2H5EA 3A4NA 3U3OA 4PSAA 1C1YA 4B6EA 1XPRA 3OZXA 3U4QA 1LV7A 4DDUA 4KODA 1NN0A 5FPHA 1OIWA 1W4BA 4B74A 3K8YA 4CZ2A 3PIRA 3HPRA 4EPVA 1EESA 2DY1A 4NYMR 1G9XA 3QVUA 1XRJA 3U3JA 4UXHA 3VNUA 2FU5C 1ZRHA 1J99A 1DELA 1AM4D 3IBGA 2BJWA 4DCVA 1NMXA 1G7RA 1HTWA 1T3LA 3PUYA 5JCPA 1SVKA 3C15C 1K8RA 1JALA 2FN4A 2QTFA 3VAAA 5GJCA 3M1IA 2FG5A 3H84A 1FOEB 1W46A 2ZI3A 5HR5A 2CL7X 3QSYA 1DPFA 3QQ5A 2YWGA 1UKEA 1Q44A 2BBOA 2XITA 3QKSA 4D6PA 4F91B 3GJXC 3LAWA 3LWNA 1XD8A 3Q72A 2ORWA 3KJIA 3L0OA 1FTNA 2YOGA 1ESNA 1KMHB 2V4ZA 3RVBA 4NKRA 3N5CA 4EPWA 1G3QA 1G6HA 3IIMA 1DO0A 4WXPA 4BFVA 4XSGA 2V9PA 4JL8A 5CM8B 4MGIR 4UJ5A 3U7FB 2QROA 1ZNYA 2DFKB 2CCKA 4XVUA 2BCGY 3S1AB 1OIVA 1PUIA 5EP2A 3KL4A 4Q4AB 2ZRFA 3AVPA 4OQFA 3LXRA 3WRXC 2WWWA 2R9VA 5A0FA 4NU0A 1GNPA 1GG2A 3X1ZA 4KVGA 1D9XA 2EYQA 1Z0AA 4TYPA 1T8TA 5AJWA 1DOAA 1N6KA 1ZMXA 2Q9BA 1Z06A 1XWIA 5J4YA 4PAMA 3K0EA 3C41J 4NYJR 5CIWA 2J9RA 1W36D 1W0KD 1LB1B 1RE0A 3N2IA 4QFMA 3THWA 4K46A 1DE0A 5FPTA 3U7GA 1E9EA 1RW4A 2RGNC 5J4HA 3GLIA 2JA1A 1E9DA 1XMVA 1OJLA 4N0EA 4TL6A 2JLYA 1NKTA 3SI7A 3TAUA 4FD2A 4PZYA 2JJ2A 3QEJA 3NBXX 3DM9B 1KK3A 4LHWA 1E79D 3NH6A 5JMTA 4JIMA 3AEZA 1NY5A 3KXLA 3SJCA 1MR3F 3WHLA 4DDVA 3ZLJA 1WBDA 2XSZD 2GK6A 1FMJA 1DS6A 4DHEA 1ZP6A 4YMTA 2GKSA 1N6OA 1NVVQ 3TVDA 4W5WA 2F9MA 2QAGB 1S3SA 1G8YA 1E2KA 2WPDD 4TQAA 1DAMA 5FBQB 3BH7A 3G82C 4OHZA 1QVAA 4M21A 5JHGB 4LI0A 5EUMA 2D62A 2HLDA 2BWJA 2PX3A 3A1VA 3B9PA 4G3XA 4Q48A 3L8ZA 3NBYC 5G53C 3JZAA 4FWIB 2NO6A 1RJ9A 4Q00A 5C1BA 1N6NA 1R5NA 3IO3A 1BIFA 2FDCA 1OHHD 2W58A 3Q85A 2HEIA 2ZTSA 2J46A 4KITB 1COWA 5KNCA 3W3ZB 4YDHB 1JEEA 1UKYA 4A1FA 2F55A 1ELOA 4A0FA 2OBNA 1TUEA 4JT2A 3SJBA 1HT1E 4LJ7A 2ZVPX 3CR8A 1XPUA 4B73A 1KO4A 3CZPA 4UNSA 2W2XA 1FTSA 4YDSA 5FPSA 3L0IB 4PR0A 4GFDA 4TZ0A 2GCNA 3GLFE 2I1QA 2XTMA 1U0JA 3A1TA 4GP7A 5JRJA 4M1SA 1XJCA 1S0UA 3K0FB 5G41A 5FH9A 3H2YA 1NJFA 3LBIA 1ZC3A 2WWGA 2XX3A 3B6EA 1ZM2A 3QENA 4CEHB 4NYIQ 1YZLA 2ZRGA 4M1OA 3ASZA 2GZDA 4A8JA 1C9KA 5FL7D 2EVWX 2OG2A 1A7JA 1FUKA 5IK2A 1DTSA 1MRNA 2H8KA 3ZDQA 1YR8A 3TUIC 3GFOA 4B34A 4QGHA 1J90A 6Q21A 3OIVA 4RD3A 2J59A 2FFAA 1P2UA 3DKVA 2EFCB 1R8SA 2BC9A 1NP6A 1RRPA 4QHYA 4OBEA 1Z0KA 4M9QA 3NDPA 5EQTA 4B43A 3OESA 1N3BA 4MRPA 1FNNA 1M7HA 4B3BA 2W6JA 2QZ4A 1YQTA 2OESA 4HB3A 2AFHE 2XXAA 1KO5A 1SKQA 3RHFA 1IXSB 1NBME 3NHBA 4G0NA 2AWNA 2GK7A 4H1UA 4L5BA 3SN6A 3KUDA 5E4FA 2A5YB 3MD0A 4FWTA 4LX0A 4CW7A 4ZKDA 4AI6A 4C0BA 4EPRA 3SBDA 4EFNA 2UKDA 4IEEA 2ZJ2A 1VCNA 2CJWA 5CLQA 5TARA 4BZQA 8OHMA 3C5HA 1I4LD 2A78A 2OCBA 5JLJA 1WB9A 2G9NA 2B8TA 2ZUBA 1TEXA 4RKEA 2B7CA 3VR4A 5LDDC 3GLGE 2IT1A 2Y8EA 4M9SA 2EWVA 4RD0A 1SGWA 3FYHA 3SZRA 1G41A 4F93B 4KBGA 1Q0UA 4NCNA 1RYFA 1VYVA 1LW7A 2ZSDA 4KYUA 2HV8A 121PA 2FOLA 5EE9A 2FZLA 3KB1A 3TW8B 4F4CA 1WRBA 5CK4A 4EAQA 2VSFA 4DSNA 1FNMA 4TSFD 5C2JB 1OE0A 1XZQA 3ND8A 1YE8A 1HT2E 4A9AA 3VHLB 3U6KA 4HI0E 1N25A 3NKVA 4O0MA 3BH0A 3AKYA 2JDID 1YZNA 3I72A 2O8FA 4DSUA 3W90A 4QGFA 1LS6A 5JEEA 1E2IA 2FA9A 4EQ6B 1VDZA 1Q1QA 1OFIA 3X1YA 2XZLA 3IEUA 4YMVA 3ADKA 4A4DA 1KJYA 3W8RA 4D26A 2ZRNA 2O8DA 2HXSA 3RLFA 3VR6A 2FFHA 2V54A 5GVRA 1YHNA 4Q66C 3T35A 1QHGA 3VX4A 3R9IA 1J8MF 3ZJYA 2FH5B 2PT7A 3Q7PA 1A4RA 2EFEB 2OFXA 3C4JA 1VECA 1TU4A 4DLWA 3OIWA 4PQYA 4DB2A 1UPTA 2R65A 3V4RA 3B82A 4AIIA 2AN9A 4B47A 2HF9A 1N6PA 4Z51A 1DO2A 4KVAA 4YQFA 3IQWA 3ICEA 1I4DD 4NP6A 1LY1A 5AJXA 5FI1B 3KKPA 1NLYA 2BHRA 4HDOB 4RCZA 1KDOA 2ZSEA 2F1RA 2WBLC 4RFVA 1DADA 5LB2A 1JI0A 1ONBA 3L0PA 4Q1DA 5M04A 2G6BA 3BAFA 2H7VA 1IBRA 1W0KA 4J0QA 1KDRA 1TEVA 5FPKA 2RAPA 1FX0A 1KNXA 4MKGA 3VU9A 2IYSA 5CYOA 3RRNA 4ZDIA 4D0LB 2WJHA 1QHHA 2REOA 1CBUA 1EWQA 1HA3A 2NO9A 4L9WA 2DR3A 5DN6D 1XMIA 1E79A 1Q57A 4D4JA 3SFVA 4TLEA 1NLFA 5GJWC 4LYAA 1XX6A 4B44A 2UZIR 4RZ2A 4QHTA 2AFIE 4LJ6A 2EYUA 3C16C 4ACAA 2TMKA 2ZI4A 2PMKA 2QMHA 1OYWA 3TKLA 2WPDA 4LJYA 5C4MA 2NOAA 2QGNA 2F3TA 2P5SA 3IO5A 4Q4JB 3B85A 1M8PA 3L0SA 4IVPA 2JLUA 1LF0A 5H70A 2XGJA 1KI6B 1G8FA 1H8EA 1E0AA 4OQXA 3VR3A 4PANA 3K9LA 5SZIA 1E1RD 4R2HA 1RC8A 4A6PA 2H92A 1VHTA 2MMGA 4LHYA 1E32A 3BBPA 2GEUA 4PO9A 5JJIA 3WNCA 1JQJC 3UPUA 2RB4A 2FEMA 1OW3B 3GLHB 4PTLA 2WSMA 4KI0A 1J8YF 2ZJ5A 1N5LA 2QNRA 2X2FA 5GJVC 4B2PA 5JFGA 5ELXA 2ODEA 2BDTA 3R20A 2K5UA 3GEEA 4I1UA 4IFBA 2A5DA 5CB8A 3THYA 1II0A 1W1WA 2FPLA 2OV2A 3CF0A 2NPFA 4DCSA 4JLPA 2YC2C 1N5IA 2ZI9A 5F98A 5DISB 4FI3C 4B2LA 1W0JD 4ARZA 1G3IA 3B1ZA 1OSNA 3MJRA 4C0QC 5K8UA 3KKNA 4Q1BA 2O8BA 2YV5A 5AJZA 2PZEA 2QUZA 1E4YA 5JWHA 3T34A 1BYIA 4G5OA 1G4AE 1SKYE 3DZDA 3I5YA 1FQKA 1PZNA 1S8FA 5FL7A 1S96A 4ERNA 2YINC 5KUTA 4NE2A 2YZ2A 2IXGA 2VH5R 5FFMA 4DT1A 3GLFA 2EFHB 2ZSBA 1N6RA 1R0WA 1W47A 4GMXA 3RDPA 2W83A 4TT3D 2OILA 3A1WA 2AHOA 4UNRA 2F1JA 1TADA 2WSSA 1H8HD 5EXTA 1ZNWA 2FEOA 1VKJA 2HYDA 3AGQA 2ECKA 2FWRA 3ZVNA 2PCLA 3CLVA 4RSGA 1JEDA 2YHSA 4AK9A 4DLYA 2ZYWX 4QBHA 2IUTA 3KKMA 4MDFA 1N0UA 2GNOA 4JLMA 4Q9JA 1IXZA 3KQLA 1BKDR 1R10A 2ZPTX 4KSBA 2MMCA 4TL8A 4C9BA 1F2TB 4QG7A 4XIGS 5FOSA 2QBYB 3PJRA 4Q4HA 2BMEA 3EW9A 3DDCA 2YWEA 1E69A 3PUWA 1DAKA 2HT1A 1DEKA 2DCUA 4NMMA 1IY0A 1XTRA 4US2R 2Z6VA 4DB4A 4MGKR 1AKYA 3P4YA 5H1YA 5F3WB 3V00A 2Z4SA 1UFQA 3PEUA 1YRAA 2CMKA 1CJVC 3GLIE 2ZRDA 3NDBB 4LBVA 1W5SA 3QF4A 1EXMA 1NBMA 2WM9B 1XJQA 2GF9A 2QRNA 3K70C 1QHNA 3CRW1 4QBIA 2VEDA 3WMFA 3FMOB 4UXIA 2QMEA 2D7CA 4EPTA 4IFEA 3Q3JB 5HCNA 5KDDA 421PA 2BVNA 2GA8A 1TUIA 4F4JA 1DARA 2QGZA 3T1TA 3VR1A 3OEHD 4TSFA 2HT6A 2WJJA 3AF0A 4BLOA 2IBMA 2ZQ5A 3CUEF 1MO5A 4PAQA 1SZPA 4JSYA 4EJSA 3U44A 2O8EA 3CPEA 2C9CA 2CE2X 5FTMA 5UKDA 2JDIA 3EASA 2N1BA 3P4XA 4CEIB 2OCAA 2Z0MA 3SYKA 1IQPA 1SXJB 3MGCA 3B1XA 3I32A 4PO1A 2R62A 3TQFA 4F4IA 1VCOA 2R44A 1W2HA 1E94E 1UADA 3FMPB 1Z28A 3L43A 1TTTA 4LY6A 5FUVA 3FHTA 5K8LA 4B71A 4RZ3A 5FUWA 4URXR 2GJ9A 3QPVA 5FOXA 2WOOA 3P26A 1HUQA 2C04A 1GKYA 3KFVA 3ZH9B 1TMKA 3TLXA 3OEED 2HUPA 2XOKD 5AK0A 2GESA 4OI4A 1EFCA 1PLJA 1SQ5A 3FE2A 3AB3A 4OHXA 1N6IA 3THOA 1WCV1 5L3VA 3EPKA 2WWHA 3I5XA 1IY2A 1XCMA 3THXB 1VG0B 1UBGA 1VTKA 3FKQA 4AC9A 2OFOA 1W2GA 4LBWA 4RD4A 4BLPA 4AG6A 2E1RA 4CDGA 1XDBA 4LJ5A 3OF5A 4QXAA 4RFSB 5CLLA 3X1XA 4EDHA 2RGGA 1RPZA 1VYUA 4E07A 4G5QA 4GBMA 3E2IA 4FMCB 1NKSA 2ZM5A 1GKIA 4AURA 1Z29A 5H8WA 1SVLA 5JS7A 1GNRA 1EG7A 2ZRJA 1F60A 2YVUA 1W49A 3P20A 3BE4A 3K09A 4KFUA 3TUZC 1ZIPA 5JECA 3QXCA 4IOLA 4CIDA 2W0SA 3WYGA 3LW8A 2C9OA 2VP0A 2WZQA 3K0AB 1G17A 2F43A 1ETUA 5LD2C 5EJEA 2PH1A 4MGZR 4QBGB 1GRQA 4KO8A 3OFND 2B8WA 3SEAA 1T91A 1ZM4A 4HDCA 1YZTA 4JL5A 4HDQB 4OL0A 4PHFA 3VKWA 4PPFA 1QBKC 1P73A 3B1WA 3GJ7A 5SZJA 5L3SB 3CWQA 4F92B 4JT4A 1FW6A 4A8JC 1OIXA 4JMPA 3HR8A 3MWKA 4F7WA 2NO1A 1RIFA 3IQXA 1YZQA 4IDOA 3AKCA 4TTPA 2CL6X 4QC2A 3KJHA 5JS8A 2FE4A 3B1YA 1JXMA 1BS1A 2VO1A 4BGDA 2X2EA 1Z2CA 5HE9A 4MUBA 1AGRA 2VPPA 1W4RA 2OBLA 4FMBB 1OH6A 4ZCIA 3CZQA 2ASEA 2EWWA 3I62A 1HEIA 4QKQA 1II8B 1DG3A 2QT1A 3R9XA 2QP9X 3FWYA 3TMKA 3AVYA 2A9KA 3QXSA 3R7WB 4FXPA 3HP1A 1P72A 2GRJA 3T5DA 3NVAA 1YKSA 1FZQA 4HZUB 1NSFA 1XEWX 4DWJA 3B78A 4HUTA 3RANA 5J4KA 3LH5A 1G6OA 1KK2A 5K8TA 4PFSA 2R2AA 3CPHA 5CDFA 3RS0A 1SVWA 3MFYA 2OLJA 3GJ5A 2H17A 2J5XA 3DEFA 2ZUCA 1T5LA 4URUR 2OLKA 2I3BA 3LD9A 4OJQA 1MKYA 1W0JA 3IEVA 2QL6A 4W5HA 4IDNA 4V0ME 3TBKA 1SULA 4Q9LA 2ZSFA 4JYCA 2RGAA 1OXVA 4KCGA 3SOPA 4MYHA 5AUNB 2X1VA 3W6NA 4BLTA 2VIIA 3FMIA 4RD6A 1W48A 3CH5A 3D3QA 2CHQA 2ZUDA 3FPAA 2XJ4A 2LCFA 4Q4LA 4GDFA 1E96A 2ERYA 1ZD1A 5IT5A 4TT3A 1CU1A 1SVOA 1G291 1AZTA 3DPUA 5TVKA 1H8HA 3FKSD 2VBCA 3GJ4A 5DO9A 2OT3B 4FCWA 4MH0R 4I1SA 4BFTA 3J81k 5JRZA 5KNDA 1DAFA 2JJ1D 3E5HA 3EAQA 5KSPA 1XD2A 5FUYA 1YZGA 3BB1A 3HYTA 2PLFA 721PA 3CX7A 2MSEB 1W4AA 3F8TA 1GDDA 5KYKA 1E2DA 2V7QD 2YC4C 2J0UB 2QMOA 4IVRA 5D3MB 2YYZA 3TW4A 3ZZ0A 2HCBA 4HB2A 1GKUB 2ZJYA 3EZFA 4CT4B 3HU2A 4NCJA 3ZD6A 1KAGA 3HJNA 4M2LA 4WZ6A 4AKIA 1CF4A 3CKLA 5DHAA 2QAJA 3LQRA 3SHWA 1U8ZA 1US8B 3RS5A 1GL7A 1TAGA 2NIPA 2PBRA 3R8CA 3W9YA 4LWZA 1V43A 2DFNA 2ATVA 3IBYA 4FINA 1XD9A 2FSGA 2KBEA 1DAEA 3HPQA 1V5WA 4HB0A 1W36C 1VMAA 2AXNA 5FPYA 1EFTA 4DVGA 4LV5B 4TTRA 1GAJA 1SHZA 3OEHA 3CB4A 1KMHA 4XD7A 4A36A 4JLDA 3CRRA 1WE2A 4BRUA 1ZM7A 2DHRA 3BRWD 4C3ZA 2V6JA 3PFIA 1LVGA 1I4TD 2AD1A 3JZMA 2B21A 4X8MA 4BECA 1OLOA 2L0XA 4C2TA 1BMFD 4P4SB 1AN0A 1CJMA 3SR0A 4Q4AA 4GT1A 2XJ9A 2ZJOA 5DI9A 2HYIC 4JVMA 3D6TB 5L3RA 2AK3A 3TVTA 2BBWA 2NMVA 2WKQA 4II7A 4P33A 3E70C 2G1KA 3RRYA 3HWSA 4ZV4A 4MUAA 1IY1A 1RJ9B 1XTJA 1E99A 2XTZA 4DSOA 1NJGA 3K9GA 4PQRA 1M34E 2XOKA 2OCYC 1RRCA 3RC8A 3BH6A 2ZITA 3AM1A 1U9IC 3SU8A 3WNDA 1PJRA 3LVRE 5EXPA 4XWOA 5BN4A 4KAXA 2ODNA 5GJBA 4EIWA 2G83A 3I92A 4R2IA 4B3CA 4N1AA 3BFVA 3NBFA 2J0VA 2UVQA 5FR1A 2PCJA 2G0TA 3KQHA 2J0SA 1XB2A 1GP2A 3GJ0A 4U02A 2GCOB 5J4VA 1T0JB 1OF1A 1EWRA 2EQBA 2PLRA 4WIAA 5FTLA 2ANBA 5GADl 3BD9A 3X2SA 1U81A 2YNMA 821PA 2PX0A 3MWJA 4MYTA 1XZPA 3Q5DA 3TR0A 3DHWC 2X77A 4M1MA 5H68A 1ZJ6A 2QAGA 2BEJA 1E6CA 3TR5A 4D4LA 1E9FA 4DUGA 1R8QA 1VIAA 3F5FA 3UXMA 1NMZA 2IC5A 4DDTA 1QG2A 3SYNA 1OB5A 2CEAA 3OFNA 2VSOA 1TF5A 4GI7A 4ACBA 1QZXA 2RKOA 2WJIA 2ZAMA 3NH9A 2HXYA 4PC7A 4HAYA 3VFDA 2ZRIA 2IF2A 4QNRA 2OXCA 1AQUA 5BQ5A 1P5ZB 1P6XA 1OB2A 1A2KC 2HCJB 4IDHA 5SZKB 4Q47A 2ZRPA 4YONB 2NO7A 5KNBA 1MABB 2X8AA 3IPYA 2ZSAA 5E7IA 2BEKA 3QVVA 3GD7A 4P32A 3PR1A 1GNQA 1RRGA 3T5GA 4BLRA 2BM0A 5FTJA 2C95A 2D74A 4LBZA 2P65A 1JPJA 1UDWA 1XJ0A 2LWIA 3OE7A 4OHYA 3O8DA 4TN1A 1E4VA 2BMDA 4BFXA 2V3CC 4UNNA 2A5GA 4BFSA 3EC2A 1NL3A 1ODFA 2ORIA 4ZIRA 3IHLA 1ZUHA 1JR3E 4Q02A 2D4HA 2P6UA 3HDTA 4UNPA 2AKYA 2C9YA 2BJVA 3U61B 3ZIAD 5JEDA 2PEYA 2AWOA 3OIUA 4Q1FA 5C4GB 4CEHA 2J7KA 3FFAA 1UKVY 3ZVLA 3AGPA 2RGCA 1EK0A 1KDPA 2XB4A 2ZVQX 4IXNA 2Q6TA 4D2IA 2CDNA 3T06B 4TLCA 3Q7QA 4A2QA 3KJEA 4IDPA 2GEVA 3ONWA 3H4MA 3PITA 4LK2A 4CRWB 5AR1A 4WBSA 3L8YA 2VL7A 4XSHA 4E22A 4HLUA 1JR3D 1KI2A 2A5FA 1EX6A 4LYHA 5FBLB 4HEJA 4BRWA 4POAA 3I1FA 3WP0A 2OM2A 3V4FA 4C0LA 1D6JA 3LRPA 4MRVA 3RS2A 1XCGB 1Z0JA 3WRYC 2IS1A 1T3SA 3FHCB 1KGDA 3MMPA 1Q12A 2XZPA 4EJSC 3FKSA 4QM7A 4V0MA 1E2FA 4MKFA 4OK6A 4E5UA 3FOZA 2ZRHA 2O8DB 2XTNA 4HUQB 3I73A 1WDTA 4JVLA 2G3YA 3BB4A 4KXFB 3LFUA 1CJKC 2QE7D 3ND9A 5IF9A 4TL9A 1Z2AA 2OZEA 1MO4A 2J3EA 3LY5A 4B2IA 1A5TA 4RVCA 3HU3A 4HAWA 4MRSA 2BV3A 3FDIA 4M4SA 2BMFA 1XU4A 5DE3A 4WZBE 4TLBA 1R7RA 1Q3HA 2P5TB 4JKIA 1G4UR 1SXJE 2UZ3A 2V7QA 4KYIB 4P0TA 3EZ2A 2P6RA 2ERXA 1TL7C 3QG5A 3VKHA 4JLAA 4TMWA 1ZC4A 4GP6A 2W6ID 4XWAA 1A1VA 1GRNA 2CCGA 4B3FX 4AYWA 4XH9B 5KDLA 1S9DA 1KMQA 4BLSA 3CX8A 2OXRA 4E03A 1NLZA 3KB2A 1NVUQ 1ZINA 3QE0A 2VHTA 2IHYA 2PL3A 4LC0A 3QKRB 2IL1A 1KK0A 1EX7A 3GEHA 1TF2A 3KXKA 1TX4B 2GCPA 2A7QA 4PSKA 2GZHA 2IYVA 4JLJA 2IHBA 4EQ6A 3KQNA 3LO5A 1JJVA 1SXJD 1FX0B 3QG1A 3KJGA 3B60A 3UG6A 3NC0C 4BEJA 3B8HA 2QI9C 1HURA 3G5UA 2VP9A 4RD2A 3O8BA 2JLZA 3EA5A 3AVOA 4NYMQ 3PXGA 4UJ3A 2H1LA 5D3QA 5KHOC 3K09C 4R9UC 4BFUA 5L3QB 1LFDB 1P9RA 2FFBA 1N0WA 2NZ8A 4RY2A 5FI0B 4C30A 1ZM3A 3GQBA 2OHFA 2GXQA 1YVDA 5F9FA 3G0HA 4Z8YA 3PCRB 2PJZA 1Z8FA 2OUKA 3M4YA 1CR0A 1WXQA 2N46A 1XMJA 2ZR9A 1N6LA 1BMFA 3EA0A 4NTZA 4C0HA 1II9A 4QBFA 4LRWA 3KQKA 1Z63A 5EZ5A 2P0EA 1OXSC 2AK2A 2XSZA 3D31A 1OFUX 1E9BA 5AJYA 3K0CA 3ZYCA 1S1CA 3A1SA 3T61A 4LV8B 5EUQB 4R71A 3GP8A 4ZCLA 3KXIA 1AS3A 5CIQA 4CYMA 4IDQA 4PHGA 4Z8XA 1CP2A 1G5PA 1T5IA 3M6AA 4B75A 1ZUIA 1E2JA 5CJ2A 4WAUA 4HATA 1E2MA 1P7CA 1U9IA 4NPHA 4JBXA 5CDFE 2VYFA 3UWKA 1G8PA 3BJIC 2KB0A 1X6VA 1OHHA 3PQCA 4L9SA 2PJRA 4Z54A 1KJZA 3RSOA 2RGEA 4KBFA 2IEZA 4V0NA 4TLDA 1F6BA 4OKSA 3THYB 2R8RA 1HY3A 4LJ8A 1N5KA 4YMUA 5JJLA 4NYJQ 1PLKA 1K5DA 4B3XA 4B76A 2JJ8A 1KI9A 1GILA 1VYTA 2IA5A 2RGBA 3I8XA 1KKMA 1U90A 4QJ3A 4Q9KA 3A58B 4Q5IA 3NHAA 1F5NA 3ZVRA 2EFGA 2FZ4A 2GDJA 5F2EA 5KSZA 5LBIA 4Q4JA 1U8AA 2F6RA 4PZZA 4TTQA 3B9QA 3ECCA 3RS3A 1KI6A 5FTNA 3BERA 3U2QA 1L4UA 3FVQA 4LHVA 4IXMA 2F9LA 1NN3A 1HE1C 4DLVA 1GZSA 1S2MA 2Q21A 1XEXA 1IJFA 5C18A 3GLFB 2EU8A 1D8TA 4OK5A 3T1VA 2Q3HA 2QORA 4ZI3A 2WHXA 3F0TA 4IOMA 5E95A 3WXMA 3QKTA 5DYIA 5EE5B 2ZS7A 1DAGA 1Q1EA 4FW9A 4PQFA 4ILEA 3BC1A 4OJKA 2LKCA 1OKKD 5P21A 2XB2A 4CEJB 5HKKD 1HE8B 4MQBA 1KIMA 4O2RA 1AA9A 1X8LA 4V03A 4JLVA 2WWYA 1O3YA 3ETLA 4FN5A 4NDZA 2J45A 3AP2A 4Q7LA 4I1OA 1Y63A 4OI1A 1EFUA 1FQJA 5JWOA 3SJAA 1PLLA 4X8OA 3KFXA 2BCJQ 4LCBA 5BYKA 3QPUA 2CNWD 4GZLA 1NI3A 3BGWA 2P6NA 4M1KA 2PZFA 2Z43A 3DO6A 4YXWD 2WV9A 2R6CA 4Y0AA 1ZD9A 1YZUA 2O0HA 3KKOA 2NG1A 3NIBA 3AVQA 3UK6A 1JNYA 2DWOA 4DSTA 3AVXA 1SVMA 4C0SA 5ANRB 4C7OB 4AKGA 3ZIAA 3NBZC 4HZIA 2WKRA 1CKEA 4NL4H 3AV0B 2PT5A 3W5IA 2QG6A 3VX3A 1NY6A 2REBA 3KTAB 4GL2A 4WVFA 3TJZA 2WWXA 4KFRA 1WQ1R 3EIHA 1OFHA 2X19A 2FPMA 4A0HA 3E1SA 3CONA 4IKEA 1XMSA 3LVQE 4N0DA 5DNYB 4MGYR 2RMKA 1VG1A 1IXRC 5BXQC 2ZRMA 1E2LA 4MYCA 4XWKA 4LHZA 1XTKA 1JR3A 3ZQJA 4KFSA 5KTYA 1RRFA 3A6PC 1ZCAA 3O8CA 1TQ4A 2OEPA 4UNQA 5HCIA 3GLGB 3AF2A 1R6BX 3U44B 4NONA 4RJLA 4NBSA 3VR5A 2ZRCA 1I2MA 4MKHA 3RS4A 1ZAKA 3HU1A 4LSGA 3RSLA 1EFHA 2QBYA 1NRJB 3SDZA 4AKEA 2Q9CA 4GRAA 1VIYA 2OCPA 1CLUA 3TK1A 1KSHA 1GM5A 4PC2A 2WIAA 3W5JA 1ZU4A 5DI3A 3MCAA 2DBYA 2G0NA 4Q18A 5KPDA 2ZYVX 1G16A 4Y0VA 1Q3TA 1YR6A 2QE7A 4YLGA 2WJYA 1OT3A 2GVDC 1IN7A 2HJVA 2Q3FA 3AKDA 2WJVA 3CF6R 3CRMA 4DIDA 2GXUA 1M2OB 5FBVB 2IW3A 2GEDA 1D5CA 2ZJ8A 1AQYA 4OQNA 2KWIA 4LOAA 1G5RA 2NQ2C 4LUCA 4S35A 2VHCA 2FFQA 1DVRA 5TXGA 2W6IA 4DEXA 3FMFA 1ZM9A 4OK3A 5JSZB 2G1JA 2FX3A 1UEJA 2IYYA 1E2QA 3PUZA 5AUPB 3AUYA 2WAXA 1JB1A 1TU3A 2NGRA 2QSYA 2ZJAA 1RVDA 3DOEA 4IEIA 2JJ2D 5EXSA 5FTKA 1NIJA 2RGXA 2O8CB 2KJQA 4Q7JB 4V02A 5B57C 1JJ7A 3N2EA 1KSFX 1T9HA 3MWYW 4M0LA 3ADCA 2GAOA 1HH4A 4RD1A 1IM2A 2XEXA 3AF4A 1D2MA 1P2SA 3CRQA 2R6DA 3H1TA 4KJZA 4BUJA 3QKUA 4CEIA 1OYYA 1SXJA 3KZ1E 4LZZA 3VKGA 1GRRA 3T12A 4DEYA 3VTKA 1G64A 1BOFA 4RZXA 4FCVA 2QM8A 1OFTA 2ONKA 2IF0A 4DLSA 2A5JA 4HYYA 4ITRC 4Q1AA 1YU9A 3NG1A 2CK3D 5CYPA 2J1LA 2IX3A 2Z4RA 2QAGC 3QY0A 4OI0A 2PEZA 2GBLA 3MJHA 1EGAA 3IUYA 2OO7A 3MLEA 4NCIA 1ZUNB 5DN6A 3LV8A 5JWRA 4U5XA 1F2UB 1F48A 1KYIA 4M8NE 5FUXA 1P9NA 4MITA 1K6MA 4QNMA 2P3SA 4C4PA 3LW7A 4JVSB 2BM1A 4BASA 3THXA 5DIFA 3CM0A 2W0MA 1DBSA 3SNHA 4I4LA 5HZHA 4TMVA 3IIKA 5BN3A 3EZ6A 3U5ZB 1KSGA 4RFSA 2QPTA 5A4JA 1XF9A 4JLBA 4WZAE 2AXPA 2ZRAA 1Z47A 2ODWA 4DJTA 2JASA 4ZDJA 1X1SA 1KI3A 4D82A 2QU8A 3CIOA 3MWLA 1XTQA 1XXHB 2QENA 221PA 1JQLB 3SHFA 1RYHA 3H0KA 4JS0A 1E1RA 3LXXA 3QUSA 5DSZA 3EPHA 4BPBA 2ZANA 1RKBA 3RNLA 2AR7A 3QXJA 4WW0A 2JLWA 4E09A 4JL6A 4XTCS 2WOJA 2AD5A 3WBJA 4Q9IA 1OV4A 4URWR 4XVQA 4BFZA 3PUXA 1NN1A 3W6PA 3WY9A 4JZKA 1VCIA 3W34A 5EP3A 5L3SA 3ADBA 1Z6YA 1G5TA 1UBFA 4IHQA 1QHIA 2IXEA 2JAQA 5HE8A 3TH5A 3U3RA 1NG9A 3CRVA 2ZE5A 1CRQA 2QPOA 1GSIA 2JATA 4ON9A 4PAOA 4MRRA 2GJAA 3VNVA 3EZ7A 2RHDA 1YZKA 4L4UA 4TMXA 5F9HA 5CK5A 2V6IA 3LA6A 2IWRA 1BH2A 2XNSA 1HQCA 3U4QB 2AKAB 5EE3A 4HLUC 3IILA 4BZXA 1IOZA 1KNQA 4FMDB 1E9AA 3CO5A 3X1DA 5JCZA 1AGPA 5JBQA 1II8A 2FNAA 3LQQA 3CW2A 2P67A 1UBEA 1LTQA 1G7TA 1X86B 1XP8A 2NPIA 4MA4A 4EFLA 3R7WA 2R6AA 2QRZA 4I1VA 3BFXA 2GJ8A 2WIBA 1FPMA 2HJGA 2ZE6A 4IJMA 1OKKA 2ANCA 4HZUA 3RRMA 4LJ4A 2VP5A 1IONA 1VPLA 2G88A 5J4LA 3NC1C 1NIPA 5AUQA 2ORVA 1WA5A 3TQCA 2GZAA 3B1VA 3NXSA 2ZI7A 3FFBA 3QKSB 1NN5A 3DKPA 1NF3A 3QEOA 2CNWA 1W44A 3KDSE 4Z1MD 4LHXA 4YXWA 4Q7KA 4BWYA 3A4MA 2QP4A 4ESVA 1X3SA 1OPXA 2YJTD 2FSIA 4HAUA 4Q01A 2J0QA 4KLNA 4W9MC 2YWFA 3ASYA 3QBVA 2B6HA 1SHKA 1CULC 3L82B 5BWMA 4HLDA 3ZVMA 2JLSA 2D2FA 1TF7A 3NTUA 4I81A 2QA5A 3VMFA 3K70B 5IHPA 4R98A 2IYWA 3IPXA 4HSEA 4Q03A 5JI3E 1M1YE 2VRWA 3EXAA 1AIPA 1KSJA 1D2EA 4ZDWA 1AS0A 1MT0A 5CJPA 3T1QA 4TLAA 3AVUA 3THWB 4M9ZA 4US1R 1L7VC 1ANKA 1F3OA 1YR7A 1ZNXA 4F38A 1ZYUA 3B2EA 4HB4A 4ESHA 3GLIB 2ZJBA 4G5RA 1JBKA 1N6HA 1O87A 4Q1EA 1R0YA 4BLQA 1OH8A 4M9XA 3RYTC 1R5BA 3PUVA 1KTVA 5A5GA 1U99A 3N70A 4YC7A 2J0UA 5D3MA 1RZ3A 4LDJA 4Q21A 5EP4A 4PZLA 4M1YA 3QI2A 5KU1A 5IDVA 2ZIAA 4DKXA 2JLXA 4I99A 5E7JA 2IS4A 4G5SA 3VHXA 4G01B 3K9HA 2V8OA 3QXHA 3FB4A 2IYRA 4K8OA 4YMWA 3S1AA 1X8KA 2H57A 5J5CA 1US8A 3GJ3A 2C96A 3K0CC 3VQTA 4B35A 1VCMA 2BOVA 1UAAA 2BKEA 1G8GA 5FOVA 3TE6A 1DAHA 2QEQA 4PPNA 3ICQB 3TGPA 4DIEA 2IXFA 2FJUA 1L8QA 1Z0IA 1L4YA 4PX9A 1KO1A 3OEEA 2ODBA 2QN6A 1P61B 1FP7A 2ZE7A 1EFRD 2C8VA 3MG9A 1G3RA 2OAQ1 5FBRB 4OQMA 3QOFA 3QF7A 2HF8A 2XAUA 3RWOA 4TZ6A 1UKZA 2OSBA 2O0JA 3IHWA 1UF9A 3PEVA 1TNDA 3UATA 1IJEA 1AS2A 2IUUA 1BO6A 3AF3A 3SE0A 2QQEA 3OIYA 1TPZA 2VHUA 4LJ9A 3BFKA 1YR9A 4P4SA 3RAPR 3B5JA 4BEBA 3MAAC 1MRSA 2ZRBA 3PVSA 3RRZA 1OXTA 3IGFA 2VTKA 1QG4A 3AKEA 1XTIA 5B30A 5C46F 2CK3A 4X8LA 4XJXA 2ZROA 1Z6AA 2Q3MA 4D0GA 3SS8A 3O47A 3PG5A 1H8ED 5LD2B 3RABA 4B3DA 2AX4A 3GLHE 3U6BA 4RKFA 3D8BA 4U7DA 3V9PA 2NTYC 3BOSA 1B23P 4GSYA 2O52A 3TSOA 3UMSA 5HZKA 1PVOA 1JAIA 2J87A 1E0JA 2RH5A 5G3YA 4A8JB 2JEOA 3ZD7A 3TSZA
chains in the Genus database with same CATH superfamily
2E4VA 4CR6A 4RKWA 5G1PA 3MINB 5TGTA 1Y89A 5G4KA 3DEIA 2A2ZA 3ONVA 5BSUA 3UMRA 1PG2A 3M89A 4OHVA 4BAZA 2HWUA 2XT0A 4P7GA 3NM5A 2FZKA 1V7ZA 4U9UA 2IY9A 3NOVA 5L95A 3ESDA 3SF8B 4BKQA 1TO2E 3L0ZA 5LNK6 4MKIA 1QB8A 2FW1A 1H6DA 1K4YA 2RG7A 2CCJA 1CJTC 3O9VA 5CITA 1LUAA 1PZMA 3PGA1 1AZWA 2GF0A 1E9CA 1K2WA 2WUGA 2ZQYA 3UUEA 4DZZA 4CTOA 5IZCA 2Y0PA 2XXAB 3C3MA 3TL6A 1K5HA 3K16A 1N77A 2ATXA 3E5NA 4NJOA 5FOUA 3AKZA 4BQSA 3NMUF 2C2MA 3FGOA 4FEGA 2PX4A 1QYXA 3L6EA 5DTJA 5EN4A 3REFA 3TZHA 2WLSA 2HSGA 2VVTA 2PMDA 2PSEA 4XLLA 2HM7A 4NJMB 3VC1A 3VDQA 5AVRA 3HLTA 3KUCA 3M3HA 3SQMA 3FUXA 1NV8A 2G40A 3C7DB 4CL8A 2KBFA 4R7ZA 1PHRA 1PT8A 1TZCA 3OFSA 1R5JA 2XNDD 4ZEVA 3OPYB 1W4CA 4M1WA 3QYAA 4FGWA 5C8ZA 5FBWB 2O5EA 1IY8A 1VJGA 2C97A 2IP1A 3CW9A 3I52A 1Q6YA 2GHIA 4MW0A 3VR2A 4WJZA 1KOFA 2BE9A 1VSQA 2GPWA 2Y66A 5D5HA 1JHAA 1G18A 4DY4A 4LZPA 2WLTA 4LYFA 5BSEA 5AMXA 4BQQA 1E1QD 4NESA 3NEYA 1LWOA 5ALJA 3TD2A 1U3DA 3JTMA 1RBMA 3MMNA 4QXOA 3T15A 3TFQA 3NJ4A 2JCSA 2CMFA 4U4AA 5EJ9A 1CR2A 1ORRA 5DGTA 1FK8A 1PVVA 2CVHA 3MGGA 3KQQA 5JCXA 3DOUA 1XMPA 2VJMB 4WFKA 3DO5A 4R68A 5JYEA 3TRFA 1GVHA 1O9BA 2HLPA 2H8GA 4M9UA 3BIOA 2P4UA 1R0ZA 4LZLA 4MWTA 3JX9A 1JWBB 2WYUA 3WWOA 4F8YA 1N3YA 1R9NA 3E3MA 4L9RA 3TI9A 3SS9X 5K0ZA 5KOYA 5FLXA 1YRWA 1U8FO 2R3SA 3FDZB 2ZXUA 1I2CA 2OGZA 3BUSA 2Y0CA 1RABA 4UTXA 5FHRA 5E2BA 2P9TA 3AETB 1XFAA 3P9IA 4B3GA 2HSWA 1XQ1A 1L4GA 3UB2A 1R4MB 4B6SA 5JNWA 4EDFA 2AB0A 1PNVA 3HJBA 1QRAA 1T4BA 3M0EA 1E9RA 1NWCA 2WYOA 4X90A 4B81A 4UXJA 4YXFA 1CIPA 2VHZA 2B4AA 1S3GA 4CL0A 1X13A 4PU0A 1OI7A 2DPYA 2O20A 1N2XA 1U4OA 3HR7A 521PA 1L5KA 3CVYA 2DWQA 2E3JA 2J9FB 1L2TA 1JIXA 2VRCD 3DMNA 4IW3B 5K1ZA 3ZQ6A 2VF7A 4B7UA 2NPOA 2NV2B 4RK5A 3OPMA 4LQCA 1PEYA 4MLDA 3KUKA 4ETNA 1JF8A 1H22A 1BGXT 2ORED 3HKEB 4G1VA 1JDPA 4U2EA 2CVFA 1K68A 1IUPA 2H6EA 3O1LA 2OHJA 3FZYA 1A9ZA 2Q1TA 4NATA 4OXQA 2CLCX 2VAVA 4P6VF 4GZMA 3OPNA 3GUCA 4C76A 1ITZA 3ZCQA 2V3WA 3C14C 3HA5A 6GPBA 2C4KA 3H42B 1ZLXA 3S5UA 3UKDA 1HX7A 5FEUA 3QI7A 4P36A 4C7MA 3OA0A 4B9EA 4RCVA 3UYKA 3O8RA 5IP5A 1IN4A 1SXJC 1NYTA 1PJAA 2OHIA 4GMDA 5GONF 3UM9A 1GAWA 3V2IA 2LXNA 1H93A 4DCCA 3ETEA 1LF5A 4S3MA 1GGNA 1LPAB 1G5QA 4E51A 3LDAA 3CR7A 3ZX5A 2Z95A 1XCBA 3O8OB 3NEJA 4P35A 3U80A 4GXQA 1IWBB 4FIDA 4J4HA 1P1FA 4CT0A 1UZAA 1HDZA 1A5ZA 3FR7A 3OP4A 5I7HA 2W00A 2WG2A 4ZEMA 2FUNB 1FL9A 1QK3A 1X14A 1VL8A 3BB3A 1YQQA 2QVCA 5JHHB 2FPKA 4JQOA 3W79A 1S2DA 1X77A 2P0YA 3ESQA 5DT9A 4H1VA 4K9RA 3AEXA 1ZNZA 3GPIA 3KR1A 3AVVA 4KX5A 1JG3A 2CZGA 4D25A 3GO4A 1MH1A 3CA8A 4LX8A 3EEIA 3SLRA 3EX7C 2Z5LA 3AK4A 3S2UA 1U0HC 2C2BA 2QRGA 3L8FA 4PPGA 4BMYA 4XUEA 1EGQA 1UM8A 4GKKB 4KIUA 1MX3A 4W8GA 2IKQA 3FPKA 4IWNA 3WLNA 2FSFA 5HPYB 4QDUA 9ATCA 4JJZA 2V1XA 4WBXC 3Q3HA 3HXTA 1IN1A 1MEOA 3IIJA 1RACA 5D6NA 5BYJA 3O03A 4YCLA 5EG5A 4DG9A 1Z4NA 1KI1A 1SZDA 3P9NA 3T1OA 5JPCA 3LUFA 3N8IA 2NUPA 3CNOA 1P6QA 3TCXB 4MAAA 3FUCA 3STWA 5COBA 2HHHB 1S7CA 1PR6A 3TAHA 3K71B 1CXZA 3AY3A 3MIIA 2CL0X 4XD2A 2L82A 2XCOA 4ZDKA 3ZC3A 4QAQA 3L7AA 3OQPA 1JU4A 5ADVA 2N3ZA 5LSAA 1ISJA 2JIZD 2B6NA 2EX0A 3CEJA 3EWIA 3OM1A 2J9GA 3T7IA 1LSUA 2B1QA 2WF7A 3CBGA 4FMDF 3F6CA 1KDTA 3H6HA 3EPLA 2XIQA 3E7FA 3JWPA 4FHGA 3G0CA 2WWTA 3CYFA 1S5PA 3UMFA 3U7HB 4KU4A 1EP9A 2WTUA 3FSGA 2PM8A 1IHXA 4QEKA 4B3RB 3R5FA 4GPTA 2YOHA 1YOVB 2VQ3A 3O75A 4FS3A 3INTA 4L8YA 3ZOKA 3CU5A 1PW7A 4BX8A 3SX0A 4UQOA 4M22A 2DFPA 1KO7A 2IPNA 2UUOA 4R54A 1TC2A 1ICIA 4LY3A 1LDMA 1T2AA 1QVRA 4YYEA 4GUAA 1HRDA 2BGIA 2Z4TA 4M0MA 5JO9A 5J2UF 3OZUA 3B1JA 1T34A 4KSCA 5IDXA 3HBAA 3GP3A 2BBSA 3NNSA 1QHFA 1CV2A 1F0YA 1KBQA 1PJ4A 2O2YA 4LIPD 3ZZTA 4ZYTA 3EIFA 2AQ8A 3PZBA 4U00A 4HEQA 4MWDA 2VZLA 2HPHA 4P5DA 3T5MA 3W2TA 5KDOA 3G2IA 3CLUC 4JI6B 5JBIA 2EG9A 4HV4A 4IOKA 4PYQA 5FOTA 1AJEA 3S1LA 5LP6A 3OOSA 1ZH4A 4DLTA 1ABFA 4UE2A 1GL6A 2Q0HA 2I1LA 2WHPB 1GCOA 3BVPA 4RY9A 1VMKA 3KIPA 5FUMA 2VSQA 1GVNB 1LRLA 2GJ4A 1KZGB 1U2GC 2AN1A 1J07A 1FTGA 2XWBF 2ZJZA 4ZC1A 3UHAA 3T5PA 3W8NA 2XDWA 5AKLA 2CD9A 2QX7A 2EHDA 3ISJA 1CUDA 1I4OA 4X3PA 1X1RA 5SZHB 4TKVA 4GC5A 3O6VA 3PPYA 5CNKA 3CRZA 4RTMA 1KARA 5EFZA 3P9RA 2DX7A 2YWBA 3BGIA 3LLMA 2R97A 3ZGXA 2WJGA 3E7XA 1E2NA 5E6UA 1MAAA 3U81A 4DTIA 1EGVB 1DFGA 2CFTA 2DCMA 2VJOA 3HFSA 3ISTA 1Z4QA 3KKQA 5CTJA 4OMUA 1WF6A 4EG5A 4TWBA 5K3OA 1X1QA 1U0RA 1NF9A 2A30A 2CXRA 2DC1A 3GLQA 1D1SA 1SOAA 1DL5A 3ASVA 3OZBA 4B6RA 5CB6A 4D8TA 4DQLA 4FYIA 4U7GA 4I66A 4JLOA 4Q7MB 1CR4A 1Q20A 3CLTD 1RJGA 4CGZA 2BSXA 2F3RA 3JARA 4K9OA 4CEJA 1FFXB 1KO8A 1OROA 3W1EA 2FWBA 5JZMA 2DUMA 2BBTA 2Z1DA 3VJLA 4H7JA 3A1UA 4KZKA 5FAXA 1BWQA 3D4LA 2VQSA 4LYJA 1AXEA 2QSZA 2VT6A 2GUGA 3GVPA 2GAAA 5M34A 5JDIC 4B84A 3I3SR 2D2EA 2XWPA 1TT5A 3GJSA 3EWAA 1IHUA 2DYKA 3DHNA 4FYMA 2FPPB 4UKDA 1PUJA 1BX0A 3WLIA 3IA7A 1T0HB 1VE3A 2BMJA 1YCDA 2RBKA 3RVRA 2ZIGA 4JEHA 3MT0A 3AUXA 2R1ZA 3QY9A 2Z30A 3SVTA 1XZKA 3TF5A 3DONA 5DI3B 4I50F 1MDBA 1TECE 4IQFA 1OI4A 4C06A 3HL0A 1HLDA 2ACEA 1R18A 1YJ8A 1T8RA 2VG8A 3I4LA 2W71A 5JZVA 4BTEA 1GTVA 3KTAA 3KJQA 1JXOA 4ITUA 4IOJA 3U7JA 3KZNA 2WVJA 1LPNA 1E2GA 2P69A 4TTVA 2YX1A 1WMSA 4DR6B 5K0LA 5BSHA 3LVBA 3FCAA 1MB0A 3HM2A 2XODA 2FAXA 3H17A 4Q7QA 3AESB 1KY2A 1UMBA 1WCIB 3A36A 4MINA 2I3AA 4O2LA 4C20A 5KYXA 1QH8A 2ZYTX 4LS3A 4MTCA 3O2SB 1O95D 2WZBA 2QT0A 2VP6A 4KW7A 2FMXA 4HADA 5E7MA 4Y30A 3HWRA 3A10A 5M2QA 5BWBA 1WXHA 1JAXA 1LJUA 1T8UA 3ENVA 4NZMA 4KLRA 4TROA 2PKEA 5TJ9A 2HRBA 1ZIOA 1QYDA 1NNEA 4HAOA 3DAYA 3HKCA 1NJ6A 4G0ZA 4F4FA 1IK6A 1JYEA 3WKBA 4CTKA 2ZU0C 1SC1A 1PL8A 1CS4C 3GCGA 3KHUA 4U6QA 2UYGA 3BS4A 3GVXA 1KR2A 1ZJZA 5JD4A 4G2NA 3PS9A 4JXKA 5B64A 2DXIA 2V7VA 3VPGA 1KZ7B 2V9ZA 3J7TA 2M2IA 1E4EB 4P7FA 1Q19A 3GFBA 3WBKA 3RGWS 3O1HB 4ASUA 3LPDA 4OQPA 5FV4A 2JD1A 3FTDA 5DNYB 4PONA 3RS7A 3NT4A 2RGDA 1ZD2P 4AD8A 2CSUA 4RTSA 3AEKB 3IUBA 2ID8A 4GLOA 5KYNA 5DCUA 5BURA 1A2BA 3HI4A 3RSHA 3WWZA 3WNZA 4O4JA 1G7CA 3PCXA 4Y1EA 1FU8A 1C9JA 1ZD3A 2FF7A 2ATIA 3UWOA 4HPWA 4JKYA 4DS3A 3URMA 4GBED 4INZA 1IIBA 3AB8A 2E2WA 2F43B 1YR1A 4LRTB 4LBYA 2O23A 1YRBA 2Z5FA 3AQ4A 3CPJB 3TQSA 4IZOA 3WMEA 5AM3A 2H1RA 1XU9A 4GQAA 3IP7A 3L8GA 3CEHA 4LXTA 1MO6A 4O25A 5I7VA 4N8SA 2WICA 3QX9A 4EFDA 4PPQA 2O8CA 2KSQA 4HWSA 4Q19A 4TVBA 3OU6A 1K92A 4EF4A 2G4CA 1XA4A 2G9ZA 3DW3X 5JSQA 1TJNA 2CBZA 2FMTA 3GPDG 4IP0A 2MDTA 2CJXA 2ETXA 1R0SA 1RBQA 2BEVB 2GERA 3QBTA 4HAVA 3TDNA 5AOCA 4TWRA 1AK2A 4BE7B 1KI8A 1JR6A 2QRHA 4UFOA 2BW0A 5BMVF 1E3DA 4DPLA 4X44A 4B6PA 2ZGVA 2FVYA 2FJPA 1V16A 1LQ2A 5AXAA 1DMSA 3IQDB 1J33A 3U3MA 5F98A 4DUGD 1KQGA 4NLLA 4B3TB 2XNJA 2IDMA 2J5BA 4XDGA 3W9SA 2X0FA 1TJ5A 3PGLA 2XCUA 3LO8A 5AJUA 4YP1A 5IZCC 2WT8A 4O29A 4US0R 5ALNA 5K09A 3KSAC 2ZWPA 2SICE 2D7DA 1EFLA 2ZJ7A 2ZJFA 3SZMA 5BWCA 1QLHA 2PSSA 1ZBDA 4DCNA 2OKGA 3PHGA 1QVZA 2C4UA 3ZHZA 5A6VA 2WWFA 3R23A 3PGXA 4K9NA 2QLTA 4Q3LA 3Q9NA 4ECAA 1Z0FA 3R8FA 2GD2A 2P2DA 2J4FA 5T67A 1Z8DA 1KQOA 2DSNA 1OR8A 5IK2D 1NW7A 3ZHTA 1C7FA 1AUOA 4R8SA 2IBSA 1YQGA 2RH4A 4YCDA 2VBFA 3QWBA 3RH0A 5AW8A 5LC1A 3R9WA 3RYCA 1XZNA 4IY1A 3OKFA 3OZCA 3D9QX 4Y1FA 4E94A 4D1YA 4ZOAA 1CPYA 4JBLA 3D3NA 4Q93A 1NVWQ 1N0VC 2P35A 2WSIA 1UMCA 2AZTA 3EXEB 4OV6B 4P4TA 4RHEA 4RENA 4AZ3B 4BMOB 4DLXA 5K0CA 2QX4A 3RD5A 2NZUG 3UG7A 1XXHA 2C98A 1KQFA 4BNWA 2CEKA 4EA8A 2V4UA 2D3WA 3HYRA 4MWOA 5B4VA 5JJKA 5TB5A 1FP6A 1ND6A 1ZN7A 4YP6A 3UWMA 3OT5A 5BUCA 5I6DA 1U98A 3WMXA 3UGTA 3WYEA 5JI2E 1M6NA 3BORA 4S1VA 1L3CA 1W8IA 5K99A 1GUAA 1VBMA 2DWPA 5KU7A 3PQ5A 4F21A 1AQJA 4MKXA 4W1PA 4JA0A 5J2TA 5KTNA 3B13B 3P2JA 3CLSC 4DBLC 1WD5A 2V55B 3GEIA 4LY0A 5HKKA 3B6IA 2OBBA 1Q95A 2C7BA 2IOYA 3SBXA 3G2MA 3BICA 2C2HA 3HKBB 4PX2A 3X1MA 2P5YA 1X2EA 1P4SA 4RBNA 4Y1RB 1SBZA 3HCDA 5F21A 2XQIA 1CDOA 3M6LA 4NHOA 3ZI4A 3HRKA 1PGPA 1Z5PA 3M34A 4URZR 5AKEA 5K3DA 2FPSA 4YUVA 4D8VA 1B93A 1FXSA 2BFCA 2VP2A 2IK8A 3HRHA 5D6OA 3AILA 1QVWA 4OH1A 3LGXA 3UIEA 4RK7A 4Z49A 1DQNA 1ORWA 3AY7A 4UMEA 5IH3A 1Q1ZA 2FK8A 3A4NA 4RE6A 3U4QA 1AE1A 2NXEA 3GDHA 3N7TA 2BGTA 4KODA 4C21A 4NEGA 1O58A 2I7XA 1GTG1 4Q9AA 1NN0A 2F64A 1K7FB 4QFBA 1VSUA 2WJAA 3HPRA 1NPDA 3PIRA 2DY1A 4Q6BA 3VNUA 3D59A 4ENQA 4D3FA 1M1NB 5FTWA 2BJWA 1JXQA 4BO0A 2ECFA 3OFVA 1T3LA 3PUYA 5JCPA 5JAUA 4MV1A 2HOQA 3M4JA 4JUDX 3M1IA 4RNDB 1E7YA 5BMOA 3T7JA 5JRDS 5CFZA 1W46A 2ZI3A 3OFKA 1O0BA 1JSRA 1DPFA 4FYKA 2GO7A 4WASA 1ODTC 1SXGA 5K3AA 5I9TA 5K3BA 3ORRA 1BXKA 3FN4A 3FETA 3NCTA 1XD8A 2V7WA 3GY0A 5TC4A 1Y3FE 2QTNA 1FTNA 3OZVA 4HBZA 1KMHB 3RVBA 3PEEA 1G3QA 3IIMA 1UP7A 5HDBB 1DO0A 3UHPA 3E9NA 4BFVA 3L7IA 4CM3A 1MO2A 3KYJB 1LC3A 1TKBA 2V9PA 3R0XA 1Q92A 1QUFA 4UMFA 2PR7A 1AO0A 4Z3OA 3HCBA 4R1SA 2EGHA 2DFKB 3CC8A 4XVUA 3COSA 1D1TA 1PUIA 2ZRFA 3K73O 3OOWA 2EIXA 1F8FA 2R9VA 1EA7A 1GG2A 2HRDA 5IM5A 1VHQA 4EF5A 3GRUA 5BW4A 4KFCA 1NV9A 4ZQCB 4BYMA 1C81A 1Z0AA 4KWIA 1MIOB 2OTCA 5CG1A 1QLWA 1UK8A 1ZWLA 2W7TA 3MQFA 2AMVA 2RI6A 4IDAA 4TKUB 2YCLA 1CY2A 4RTOA 1Z06A 4RANA 1GQRA 4RA9A 3ZLVA 3LKZA 2YCBA 2PR2A 1CE8B 5IS2A 2FPGA 4G5FA 2W4IA 3UW1A 3WLAA 5CH8A 4CMJA 4QFMA 4YUWA 3THWA 1DCTA 4KHPB 1DE0A 3M6IA 1E9EA 1RW4A 3NM4A 4CLRA 4P5PA 3C6QA 3DAGA 1M5UA 1R4NB 3UUFA 3E9DA 3CUWA 3TAUA 3EQ7A 2NZYA 3QEJA 3KRTA 1U04A 2Z6UA 3IRUA 4MA5A 2GBIA 1E79D 5F3DA 2YWDA 3SJCA 4HN9A 3RROA 1SZJG 4I6JA 1MR3F 3TTVA 4LMBA 2XDYA 3WHLA 4DDVA 1XTBA 4INOA 1MMFB 1XWFA 2GGSA 3CN7A 3KSZO 3D3WB 4FKZA 4CLOB 1HTBA 2XSZD 1NRIA 2LIVA 3IERA 1FMJA 3V4PB 2GD1O 5K0NA 2IKSA 1GPYA 2Y1CA 4YMTA 3E9YA 1L7MA 2GKSA 3KC2A 3NTRA 4MW7A 3K5WA 1NVVQ 4AY5A 3TBFA 3ROXA 1YVRA 4KPEC 3TNYA 2X0JA 4TQAA 4CDNA 3M6VA 3NS7A 1WVIA 4H4DA 5FBQB 1A72A 2GZ3A 2Z2ZA 4J2OA 4M21A 1GPJA 5JHGB 2WYVA 5EUMA 1PQPA 1XLVA 2HLDA 3ANYB 3R3HA 5A1TA 5TMPA 3KYIB 4NJEB 4IL5A 4DQVA 2BUCA 2V0GA 3DBIA 4EUSA 3DG9A 4FWIB 3ZI7A 4D02A 5EIEA 2FEWB 1BIFA 3TNDA 3EDMA 2ZT7A 2ILVA 2H4FA 5FUQA 3QEMB 1OHHD 4WV3A 2HEIA 4KITB 1XRPA 1Z13A 2WABA 4YDHB 3ROPA 1JEEA 1FP2A 1VHDA 2R751 3IESA 4H18A 3VSCA 4YROA 4X97A 3GYGA 4ZQFA 4H08A 4UTRA 4ZU1X 4C6HA 1HT1E 1WMDA 4HDSA 3VH2A 2SBTA 1QYIA 3ZY6A 2ZVPX 2BR4A 2WJPA 2Q3JA 1KERA 2NYAA 3G2JA 4UZEA 5LP6C 1V1RA 4ED9A 1PX2A 3GRAA 3NU1A 1BTOA 2X8JA 4MMYB 3EG9B 3ZBUA 1M2VB 1NJ5A 1C1DA 2GN1A 3G8DA 5E4JA 3L6BA 3KUUA 3T0GA 5IJ0B 4W5NA 3D3JA 1ID8A 2I2AA 1YB5A 3BIJA 1LPMA 4ARCA 2IRWA 3A1EA 1CUYA 3OU2A 4BV8A 1AHNA 4GP7A 3WQQA 3AONB 1JG2A 3FMGA 1ESZA 2R85A 3A1NA 1IVYA 3MXTA 1XJCA 4HDMB 4MI1A 4A91A 1ODIA 5TT0A 3NC4A 3LBIA 1I6MA 1QJ4A 3TX6A 1ZC3A 3VGJA 1SCJA 4NXNB 4KR3A 2XX3A 3A4IA 3B6EA 5JPIA 4RTKA 3QVSA 1YVUA 3M1YA 1VP9A 3QENA 4Z0NA 4EGSA 2O4UX 4UBOA 3R9KA 4A8JA 5SY4A 2XGMA 4RTQA 1BJKA 2EVWX 3QVKA 1A7JA 4HDNB 3KKZA 1O1YA 2ZPUA 5AVQA 4CLXA 5HJ7A 3D7RA 1DPGA 4P53A 1RP1A 2FN7A 3B3FA 2PIAA 3ZDQA 5EJIA 6ADHA 4M98A 4YJ2A 4CU2A 4FC6A 2YIVX 2D0PB 3VH4A 4LCEA 4BB5A 1PJTA 2X1LA 3MBOA 4HFJA 4OJYA 3ZY5A 4BB0A 3N7UA 4TGLA 1EAYA 3OIVA 2ZSKA 1RXYA 5IXJA 2FFAA 5KYUB 1P2UA 2GPAA 2JH9A 2P2GA 3U56A 3U60B 1IHOA 2H4YA 1NP6A 4S2UA 3KQTA 4OBEA 1Z0KA 3GHHA 4HQNA 4M9QA 5EQTA 2E6KA 2AN4A 2XHEA 3OESA 3RJZA 4MRPA 3SS7X 1PR0A 2W6JA 1Z7WA 4F3RA 2WUVA 5KYYA 1M2EA 1YQTA 1Y8RA 2FTKE 1KFCB 4V2IA 3MBIA 3A4YA 2X6RA 1IXSB 2AWNA 4L5BA 5EKDA 5E4FA 1U2TA 4IGIA 3MD0A 1Y5LA 3PXEA 1EPUA 3HXKA 3PIIA 5DHQA 1RHUA 1T9BA 2PYZA 2PA0A 3TEFA 3V1LA 4QREA 4BZQA 2CJWA 4H0CA 2LTAA 4GH5A 1I4LD 1YO6A 1QIEA 2O2GA 3OZAA 4PLHA 3KQOA 3EIWA 2DQKA 1T9GS 2C8KA 3JD0A 3HY3A 5U4XA 2BHSA 5JLJA 2G9NA 3KAPA 3ST7A 5EPUA 4ZYUA 5LDDC 1V8FA 1YWGO 2ZTMA 4M9SA 4BEWA 1Y9DA 4RD0A 1JFFA 2FW0A 2ZRQA 1Z7BA 5CGQB 4EG6A 3NRCA 1G41A 1L5RA 3H2JA 3KEGA 4KO1S 4KYTA 4RDIA 1EVYA 1LW7A 1W59A 2GCEA 3H5IA 1Y3BE 4MV0A 5EE9A 3WK7A 2ON6A 3L7LA 3TB4A 4PIVA 1PD1A 1EEXB 4QX6A 2ZAGA 4Q4AB 2IV2X 4EKYA 4ZQBA 4DCPA 1PTJC 3P2IA 3RAJA 2JJQA 1B1AA 3KOUA 2WWVD 4EAQA 2XUPA 1ZIDA 2EWMA 1BE1A 1P1IA 3CX3A 1OE0A 3NTXA 4TSFD 1YE8A 2VDQB 3VHLB 1JSLA 3UUGA 3F7NA 5ALZA 2JDID 3NUGA 4DCOA 4DSUA 4QGFA 5EESA 1P8JA 2OP1A 1VPEA 1DBRA 2BZGA 3VSEA 1G8SA 1T6XA 3C7AA 1OFIA 4QQRA 4WN3A 4X20A 3X1YA 1T9ZA 3ADKA 4OFXA 2PFKA 4LE0A 3UWPA 4D26A 3IV6A 4BBPA 4HCJA 4ZRDA 2QQGA 4FJ0A 1MVOA 4TRMA 4C6SA 3VX4A 3ZJYA 1IIRA 4M83A 3VPXA 2PT7A 3Q7PA 1THZA 1A4RA 1V8DA 2OFXA 4D9CA 4EABA 1E77A 2JFUA 4X62B 2AQKA 4DEXA 2MYNA 8LDHA 1CYEA 4DLWA 1TO1E 2AOVA 5ILQA 2PUEA 4DB2A 2MYTA 2PAFA 3ELDA 5CM2Z 4KPUA 5DVZA 3HKDA 3B82A 3FSJX 4IO0A 1A95A 3WGGA 2YJ3A 4GZ3A 1WOYA 1DO2A 2Z98A 1IUKA 1OX4A 1RKXA 4QECA 1FBNA 3ZHSA 1MZPA 1UZLA 1J5PA 3WKCA 2COEA 3G1WA 2OAEA 1M72A 1U02A 3RK4A 3HZRA 2BHRA 1P33A 2FFRA 2HK6A 1NSYA 3PNSA 5FNZA 1NTRA 1Q0PA 2ZSIA 4ZHQF 5L7YA 2FPOA 2QN9A 4PXYA 3WK5A 3ZU5A 1FJGB 1DADA 1PFKA 2O9JA 2DQYA 3EMBA 2LCIA 3BAFA 2NUPB 2CVOA 2VHVA 2PDAA 1IBRA 1NW8A 2ZIXA 4J0QA 4NZPA 4NENA 3SFTA 4AJLA 1KDRA 7GPBA 1Z8HA 2RAPA 1FX0A 2VH1A 3NHUA 4KRYA 2ATCA 4LJKA 4MKGA 4IIUA 3VU9A 4X95A 3UPDA 3LCJA 5CYOA 1QHHA 2OWDA 1QPBA 2E4AA 2MSLA 2REOA 1CBUA 3D7SA 3TOVA 3GUZA 4EUKA 4L9WA 4CV0A 2GO1A 4PY2A 3QHQA 2XNKA 2W6CX 1XMIA 2FSVA 1D1QA 1EVJA 4IIHA 4AU1A 1RKVA 4KN5A 2HSJA 4FX2A 2Q5CA 3SOZA 1NLFA 2QTCA 3PDHA 1OZFA 4RSMA 4LYAA 1L3IA 1EVQA 1FPQA 4B44A 3CNEA 5LMNB 2UZIR 5EJ4A 4RDXA 3D4OA 4RF3A 1EK5A 3C16C 2I2CA 1UIMA 2I4RA 2PMKA 2ZI4A 1OYWA 4GMFA 2X86A 4LJYA 2PTHA 2NOAA 3WLFA 4D57A 1SC4A 3L92A 2F3TA 5L53A 3IO5A 4IVPA 5D3ZA 3L0SA 4X0EA 3CW8X 1M2JA 1ZK2A 5JAOA 1BZYA 1RZVA 4C29A 1WAMA 1TUBB 2H2HA 5EZYA 5B7QA 3KVOA 3QWIA 4OQXA 4PANA 3K9LA 4BVHA 2Z57A 3LUAA 1E0AA 3T5TA 3W8FA 1H4QA 3EVDA 5C1IA 1KVSA 2HMSA 1VHTA 1MG5A 4DM3A 1Z7YA 2CV2A 1E32A 2JCBA 2GEUA 2IHJA 4PO9A 4D9BA 1BCRA 1O03A 1YOBA 3I01A 1J42A 1A9XA 4EFKA 1SWWA 1M34A 5IJXA 4NMXB 3FRHA 4AY3A 1ZK3A 3K30A 4PTLA 3OZGA 3RVKA 5MFPA 3RSQA 5ELXA 2EFYA 2ODEA 2BDTA 3D6HA 3WIUA 2C3OA 4DBZA 2K5UA 3GEEA 4YRPA 1EM8A 4JDUA 5HX7A 1D6SA 3R6WA 1XAGA 2CXPA 3K1TA 1EDDA 1II0A 3RJMA 2DE0X 3B70A 2FCAA 5DLPA 5F1OA 2PUHA 1W0JD 2JGRA 1G3IA 4C0QC 1DIOB 5E6UB 4R0VA 1O54A 2MU1A 3KKNA 3D7KA 3PHBE 2O8BA 3ZUPA 4M0FA 5DM0A 5AJZA 2D1TA 2UUCB 3EEQA 3DE4X 3OCXA 1CZUA 1KYVA 1G4AE 2C1XA 3DZDA 4WK2B 3H4TA 4B4DA 2W6OA 4BB9A 5H59A 4DDKA 1FYFA 4XKJA 2R8PA 1UZNA 2R48A 3JARB 1C1XB 4NE2A 4KGZA 2WUFA 1EFPB 2CXTA 1W47A 1U1FA 2ZSBA 4NNJA 3RDPA 4WLNA 4UNRA 2JCVA 4IKPA 2QMZA 4PHCA 4J3NA 4JYAB 4MR9B 3JASA 3MGBA 3NIFB 1ZNWA 3V32A 5FV7A 3SLKA 5KC9A 5BRNA 2PUBA 4RK0A 5EYPA 2AS0A 3U1VA 5JBNA 4NZ9A 3JVEA 2H7CA 4MVJP 4EOGA 2PCLA 1ZSNA 3CLVA 3JU3A 3EK2A 4AK9A 1O7JA 4OA5A 1MORA 3OCCA 4RPIA 4F2GA 1RWPA 2ZYWX 1M83A 2E18A 5KTRA 1X38A 2IUTA 1RJEA 2WYIA 3ZE0B 3A05A 4YI5A 3TSAA 1XOIA 2NYVA 2Q4BA 2IE0A 3N9IA 1V3QE 2CXHA 1BKDR 4EB6B 4DUZB 4C4RA 3C6YA 1M76A 4D3ZA 1XUOA 3PJRA 2IVFA 2QBYB 4Z9XA 3DL4A 4CUKA 2JLYA 4EW2A 1E92A 2YWEA 3AJRA 3PUWA 4YBRA 1H2BA 1IY9A 3I28A 1AQ6A 1SOUA 1LLUA 2I6XA 2BDUA 3HEMA 2Z6VA 5C9ZA 4EW3A 1GDTA 4E1BA 5LQCA 3PKZA 1R6DA 2NN3C 5H1YA 2QTVA 2ZM6B 1N1GA 3DGFC 3BEOA 1MTOA 3V80A 1GGHA 3H6GA 2A33A 4QUEA 1NVMB 2W2NA 5I7RA 2OOSA 3EC7A 2I4LA 3H1GA 3SY8A 3Q8MA 4NIMA 5GP1A 3VVLA 4PCLA 2CMKA 3FX2A 4G0XA 3GLIE 1M6HA 2ZRDA 1R0LA 1H1LA 4GVXA 1C4XA 1QM5A 1W5SA 4GWLA 1H42A 4M0CA 4WMLA 5EI5A 3QF4A 2JB9A 3O84A 4DTCA 4DM7A 1H3EA 2Y2VA 4QXQA 4NOLA 4LF5B 2C00A 3RHTA 3HBMA 3CH6A 2DBQA 5EIOA 3PB3A 3WMFA 3FMOB 1BCSA 3UK0A 4C7VA 1I4WA 4K8RB 4UXIA 2R8OA 3RIYA 1UK9A 2C9MA 2XRMA 4WK6A 4CIAA 4KR7A 4EWLA 2P2CA 1GPNA 3E3AA 1ZEMA 2HXGA 5LOVF 5ARDA 4GU5A 2GA8A 2LDXA 1UP6A 1CUJA 5BR4A 4PYIA 4FFMA 3VR1A 3T1TA 2EZUA 3EVBA 2VZ8A 3AF0A 1ZGZA 2ZQ5A 2PKCA 3BWVA 3CUEF 4MR8A 1QXSA 1SZPA 2BEUA 2IYFA 3P2EA 3TN7A 1N9KA 1D0SA 1KRHA 4YV7A 3EASA 1ECJA 3U40A 3WS7A 5KWEA 1U8EA 3RSSA 1TFRA 1W96A 2OCGA 3OJFA 2Z0MA 5BNZA 2H7YA 2I7TA 3FHLA 4I9NA 4CMGA 3MGCA 1OBCA 1RAFA 3KZVA 5HJ5A 4FBGA 2QTLA 3MTEA 3P9XA 4WLFA 1RU3A 1UMDB 3A9SA 5CDYA 3N8NA 4RF2A 4GMGA 4LY6A 1RC0A 2C5SA 3F3SA 2QLLA 4P81A 1UBKS 2X3UA 1KU0A 2RHRA 3SEZA 4B4VA 9LDTA 4Q24A 4KE9A 5FOXA 2FHPA 4YREA 2C04A 1GKYA 3KFVA 1TMKA 3PC4A 2Y1DA 3PNBA 4O5AA 5SYMA 1QGAA 1Z16A 4UUNA 1VKHA 2XYPA 4UM5A 2QQ5A 3MWFA 4EB0A 3UBMA 1FYVA 1Q1AA 2P1ZA 4KXLA 3THOA 3EPKA 1Y1LA 4WA8A 3ODGA 1QZTA 4NZOA 4QO7A 5ALGA 3Q1LA 1Z5OA 1UDCA 2QV7A 3EYAA 2EL9A 5A2QA 1NE2A 3RTCA 4RD4A 1HG1A 2E1RA 4PYLA 4HWOA 1XDBA 1ZD4A 1NASA 2HY7A 3NTVA 3HJRA 1ICEA 4RTNA 5IVPA 4JLWA 5IN4A 1V16B 2I9PA 2RGGA 4I5IA 3I5YA 1RPZA 4JOBA 4EA7A 3C3JA 3DE7X 3FZEA 2R2GA 4L4YA 4P9NA 4UBKA 3VJKA 3CR3C 4TS1A 1QORA 3KBBA 3L02A 4MIEA 4PAGA 5HS6A 3WZ2A 1GKIA 4BU1A 5TGZA 4TLMB 4UOZA 5CFPA 5JS7A 3PK0A 4KQHA 3A3PA 2MYPA 4J49A 1B3BA 3D1JA 3K2QA 3BE4A 4CGYA 1IM5A 4PV7A 1QFXA 1YXMA 1ULHA 4Z7QB 3PNYA 1I3LA 2WZQA 2ODAA 1D04A 2XKKA 2B35A 3DC2A 1HDEA 4HL6A 4PG4A 3DEKA 1DQZA 3VJMA 1QH0A 3DQPA 4QBGB 2O54A 3OFND 2D0IA 4MHSA 4EJ2A 4HDCA 5IDWA 4PHFA 3ZH2A 2QUBA 5SZJA 2AFRA 2F3QA 1Z6QA 4CHGA 1EMDA 5K2OA 5IMSA 4D9FA 4A8JC 1FX1A 2ZBGA 1Y6JA 3A31A 4UHCA 4JJAA 4KXWA 5IPFA 2W8ZA 4U5QA 4L0QA 3KJHA 4QC2A 2R66A 1KE2A 2B61A 4LOKA 5DBFA 1BS1A 3B5IA 2VO1A 1PKXA 3WLJA 1F9EA 1RPNA 4DV3B 2H63A 3H9QA 4TM7A 3KT3A 2A0UA 4MUBA 1V1JA 1WVMA 5EGNA 4X1KB 3WADA 4FMBB 1WXEA 1OH6A 4JBIA 1NDQA 3CZQA 1PDVA 2TS1A 1UJ5A 5LUAA 2DTEA 3STVA 4JB0A 4OMCA 2QT1A 3WWDA 3R9XA 2QP9X 4MUHA 4I55A 2QMYA 3AVYA 4F5ZA 1BMDA 1OASA 4GOOD 3SPXA 2FY8A 4FXPA 5J2TB 2GEJA 1M10A 4A10A 2GK3A 3NVAA 3V7WA 3EB9A 1NQXA 4HZUB 4LJSA 2FN8A 1ZJYA 3ZWQA 3W5SA 1X9HA 2Z56A 3RANA 4Y18A 1G6OA 1MQSA 1SCKA 2OZLB 1DX4A 1VE5A 3PNMA 2R2AA 4WWHA 3HADA 1T1EA 5CDFA 1EB9A 3RS0A 5HS4A 1SVWA 2P9FA 3O4VA 4QOJA 3GJ5A 4FX5A 1GRCA 1H5NA 2ZK7A 4ZT4A 4II3A 3V7NA 1CUVA 3C4QA 4L5IA 2P6PA 3I9FA 2PA3A 1IMJA 1OREA 1JG1A 2SCUA 5F73A 5AXCA 4V0ME 4AF7A 2YV4A 1ODSA 2B5WA 1PSDA 3H97A 3IV7A 3OD5A 4JYCA 2BH9A 2PXXA 3P94A 4P58A 4PLTA 4KN8A 5IEBA 1Y4DE 3L06A 3VKUA 5I8WA 4BTVA 5AUNB 3QVXA 2X1VA 4XGKA 2PMEA 3T38A 2OMKA 4N5NA 1J6UA 2VXYA 1AK9A 3AR6A 3ER6A 4HQKA 1KVQA 1U9JA 2WNHA 3CH5A 2CHQA 3D1LA 4JQCA 5H3HA 4ITVA 4NEQA 4GDFA 3CKMA 3GDGA 3IQZA 2IYEA 1E96A 4P83A 3RVPA 3QU7A 3OTQA 3STHA 1RC1A 2KW5A 4UEJA 1SEVA 2AQIA 1DKRA 5ALHA 3KD3A 4KNWA 1ILWA 1AZTA 1C9YA 4LISA 4U7JA