2N42A

Ec-nmr structure of human h-rast35s mutant protein determined by combining evolutionary couplings (ec) and sparse nmr data
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPSIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase HRas
publication title Protein structure determination by combining sparse NMR data with evolutionary couplings.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 54
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2015-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2n42A00
4GFDA 3IGFA 4WZAE 1UKEA 1LF0A 4QBHA 4NE2A 3UG6A 2BMEA 1QHNA 5AUNB 1BMFD 1A5TA 2CBZA 5A4JA 4PPQA 1F60A 3TBKA 3Q3JB 1SVKA 1NN5A 3SFVA 1VMAA 2GETA 3PJRA 3VX3A 1XX6A 3RSOA 4PSVA 1W0KD 4HLDA 2ZJZA 3LBHA 3AP2A 4Q4HB 1EK0A 4Q4AA 4DZZA 2P6RA 1OPXA 1NVVQ 4KXFB 2WBLC 3WMEA 3EXAA 2OESA 2OZEA 4XTRA 2V1UA 2CCJA 2A5DA 1JAHA 1FQKA 2GCOB 3BFKA 3CR8A 4NHOA 4PPNA 2AN9A 3G82C 4TTQA 3T5GA 2CK3A 2V4ZA 5E95A 1SHZA 5KTYA 1T3LA 1LY1A 2AD1A 1ZNYA 2ANCA 5FBQB 2WSSA 2WWGA 4JJKA 5DISB 3IEUA 4A0FA 2ONKA 3FTQA 3RDPA 1NMYA 3ZIAA 4Z1MA 2P5TB 3BJIC 1CTQA 1Q57A 2WICA 2QAGC 4AY2A 5EE3A 2PJZA 5DHFA 2HV8A 4BEBA 1XCPA 1E1QA 2YC4C 2CNWD 1GRNA 1RFLA 2QUZA 3K09A 2CK3D 1XU4A 5G40A 3VX4A 1R10A 2WWWA 3UG7A 4Z8XA 4TLAA 3SYLA 2CL6X 2BMDA 2XZLA 3FYHA 4ZDWA 1J7KA 5EUMA 1DAEA 2ZRKA 3W8RA 4RD2A 1LNZA 1ZD9A 2GBLC 2RGBA 4N1AA 5HE8A 1E2DA 1F2UB 2IYRA 3FKSA 5B30A 1U81A 2DWQA 1TNDA 2ZRDA 2A78A 2QL6A 2XX3A 5F98A 1U8AA 3LQQA 4WXRA 1EG7A 4TT3D 1X6VA 4AYWA 2JJ1A 1YR6A 3JVUA 1GSIA 1XNJA 2K5UA 4Q9IA 1E0JA 5L3SA 1BO6A 2W0SA 3PEUA 2FOLA 4QGHA 2ZSAA 2WJGA 4R2HA 3GLFE 1CP2A 2ZIAA 3T06B 4TMTA 5AJZA 1OB2A 5HZKA 2WWIA 3CPHA 1MR3F 2CMKA 3FKQA 2FV8A 4J0QA 3T12A 3UK6A 2RH5A 2RGNA 2EVWX 2W6IA 4HZIA 5DNYB 3GP8A 4Q9LA 2ERYA 1E6CA 1V5WA 3ONWA 4BFYA 2IYVA 3AUYA 1XRJA 2JJ1D 2GXUA 1CR4A 1T8UA 2VSFA 3AUXA 2GK6A 3B13B 4HLQB 1VKJA 3UMRA 3VR2A 3W3ZB 4ZIRA 2DFKB 2GAOA 3KQKA 1E0SA 2CJWB 2JJ2A 2O8EB 5D3MA 2H16A 1L4UA 3GJXC 5KNDA 3QXCA 2ZAMA 3ZH9B 4OI2A 4DSUA 5K8LA 2IX3A 1IXZA 3D7MA 1XZPA 1P72A 2VSOA 4DJTA 3AVWA 1QRAA 1R7RA 4G5GA 3T34A 2ZI9A 2QP9X 1ZUNB 2GZHA 1XXHE 3LLMA 4JLPA 1FMLA 4IXMA 1C9KA 1NIJA 2ODNA 2JJ2D 4BFSA 3ZVRA 1JPNA 4RD1A 3W90A 2B8TA 3AKYA 5JI3E 1WRBA 2A5GA 2OCYC 2WWFA 4BZXA 2QM8A 5HPYB 1TUIA 1Z83A 4QJ4A 1XTJA 2CLSA 2CLCX 3C7KA 1GNQA 6Q21A 1R0YA 2OILA 1CRQA 4DUGA 2O5VA 1N0UA 2WWHA 3QF4A 2NZ8A 1E94E 4QGFA 3WYGA 4BECA 2WAXA 1YZUA 1I4LD 2ODWA 3QBTA 4YDSA 4BLPA 1WCV1 1CBUA 4DRZA 1M7BA 3LBNA 1GZSA 3KL4A 1PVOA 3RRZA 1JQLB 4LV5B 3W6PA 5FL7D 1AGPA 3FFBA 4NPHA 4F4IA 5CK4A 4HAUA 4MDEA 1GTVA 4UKDA 3D6TB 1O87A 2ZRLA 4LPKA 1NI3A 1RPZA 1AS0A 2FFHA 3PVSA 4X8OA 1ODFA 3BFXA 3KQUA 2NO9A 1P5ZB 3PUZA 1HYQA 2RHMA 5FR1A 3TSZA 4BQSA 4EIWA 3ADCA 3RYTC 3V4RA 1OYYA 3QIAA 2IXEA 1COWA 1SGWA 3SJAA 2HT1A 4XJXA 1JJ7A 4JYBA 4KCGA 5EXTA 1EGAA 4URXR 4IVPA 5KDLA 3TUZC 2JLSA 4HZUB 3OESA 3NDBB 1JXMA 4PO8A 4LBYA 1E2JA 1G17A 3QKSB 4TWZA 3SC3A 4B74A 2GJSA 1XEXA 1TMKA 3LW7A 2VP0A 1Z29A 3U3JA 3GFTA 3LWNA 3SBEA 1RYFA 3AGPA 3K70D 3A6PC 4MDFA 1E2FA 4E03A 2H17A 1E1RA 3FOZA 2Z4RA 1WXQA 3W6NA 3GCGA 1KKMA 4PAQA 3SI7A 3U60B 1R5BA 4I1VA 1DAHA 1HQYE 1G3UA 2QROA 2W00A 3NBXX 3X1XA 3A4MA 4EPXA 3O8DA 3O8CA 3KZ1E 4JBXA 4JKIA 3ZGXA 4D6PA 1EX7A 3EPLA 3RHFA 1YHNA 3EWSA 3AKDA 2IWHA 1A2KC 2YZ2A 1BYUA 3P1JA 421PA 4B2PA 1JJVA 4JMPA 1G1MA 4QJ3A 3CBQA 4YLGA 4B73A 2VP4A 1E4VA 3LA6A 1X3SA 1WA5A 1IJFA 1K5GA 2B92A 4CEJA 1Z3IX 4KI0A 2DWOA 5TDHA 4A92A 3IHWA 5EE0A 1F3OA 3FE2A 4LC1A 4B76A 1OH5A 4TYWA 2RKOA 5HCNA 1NY6A 2FPMA 4CW7A 1C4OA 4BLSA 3K0AA 2V8OA 3EZ6A 4D2IA 1VYVA 1XP8A 4KU4A 4NCKA 1RRCA 3EW9A 2ECKA 3W5IA 4C0JA 1RC8A 2Q3HA 3DZ8A 2ZRFA 4V02A 2N46A 4I1SA 4TMKA 1OH7A 2BJWA 1II8B 2C95A 2DHRA 2JDID 3C8UA 2AL7A 1U94A 4W5WA 1XPRA 4DWJA 4V03A 2QTHA 3KUCA 4LJYA 3TW8B 3JZMA 1VCNA 4MRNA 2BOVA 1N25A 3N70A 3A37A 3CH4B 2HLDA 4G5QA 4EJSB 1M7GA 3BAFA 1XJCA 3T61A 5CDFE 4NONA 1Q3TA 3SOPA 4URZR 1G3QA 2PCLA 3VKGA 1RRPA 2V1XA 2WJIA 1EWQA 2CHVA 3VNUA 1KIMA 4M1WA 4AIIA 2WAYA 2QAJA 4N0EA 5FTKA 1O3YA 4NYJR 3FMOB 4QRHA 3LBIA 3U4QA 4JYCA 2J0QA 1W1WA 2BBWA 2QP3A 3UWKA 4JIMA 1L8QA 2EFDB 2X1VA 4EPWA 3MUFA 4M9SA 1SXJB 5AJYA 1DELA 3BD9A 4Q4JB 4A2PA 4OQMA 1G4AE 1YZKA 1RE0A 3ASYA 3MFYA 3CKLA 5DGXA 3VR3A 3NBFA 2GCNA 2IXFA 5L8VA 1IAQA 2BKEA 1KI8A 3ZS8A 1ZM4A 1UEIA 2QE7D 1FL9A 1KK1A 2DPXA 2YOHA 1ZC4A 1L4YA 5B58C 4D4MA 1AZTA 4UNNA 5H1YA 4PHHA 4NCHA 2D7CA 4Q9KA 1E9CA 3RRYA 2HYDA 2ZSEA 1F2TB 4ZKEA 3TR0A 4PTLA 4E22A 1R2QA 1NF3A 3L82B 3QKSA 3NEYA 3R7WB 4OHYA 1B0UA 3T1QA 3NWJA 2D62A 2AWOA 1IXRC 3HU2A 3P20A 2OG2A 3LXXA 4IVRA 1II0A 4JLVA 3P27A 4W5HA 2JLVA 3A4NA 3FMIA 4LGMA 1U99A 4PR0A 2OV2A 2H1LA 1FZQA 1SKQA 2KWIA 2EFCB 1CR0A 1Z6YA 4L4UA 2BWJA 4PZZA 5EE5B 2ZSBA 1VG0B 1ZD8A 3B7GA 2FFQA 1E9FA 3NTUA 1W0JA 2HXSA 3CRW1 2F6RA 3DVLA 1NN3A 5EP2A 2GK7A 5FPTA 5SZIA 5H68A 3W5JA 3KQLA 2IYUA 2ZS8A 3MMPA 1FUUA 4KSBA 3AF3A 2EWWA 1W44A 1WBDA 3HPQA 4FI3C 4RFSA 4PANA 1E9BA 3NEJA 3B1YA 2O8CB 2NPIA 2WJVA 5LD2B 1NBMA 2IYQA 1UKZA 5AK0A 3CLVA 2WJYA 1RZ3A 3N2EA 3THYB 1P2UA 2V7QA 4NH0A 5FOSA 4IRUB 3IPXA 3OF5A 1NVUQ 2RGDA 2DYKA 3FHCB 2FDCA 1G16A 3AVPA 3OFND 2NG1A 3EIHA 4QGGA 1ESMA 2G1KA 1T0JB 2ZJBA 4RZXA 4ARZA 1HQCA 3Q7QA 4DXAA 4Z51A 1AS2A 1XJ0A 2VSXA 4US0R 4AWXA 1JPJA 1XD9A 2GVDC 1AN0A 3QJYA 4TSFD 3SU8A 2ZE8A 1MRNA 4OI1A 2O52A 3PV0A 1LV7A 1MABB 1M74A 2QZ4A 4TL7A 1EX6A 1US8B 2J3EA 2V7QD 2QMUA 4I1OA 3VQTA 4BEJA 4QNMA 4DKXA 3FGNA 2FZ4A 1G19A 2E9SA 2YINC 3K0FA 5FUWA 2A7QA 4MRSA 3GLIB 1KZ7B 4GP6A 3W6OA 2ZE7A 1Q44A 4NYJQ 2FPKA 2ZREA 4TQAA 1LF5A 3TIFA 1AZSC 1FP7A 2G3YA 2Q0HA 2QA5A 4A4DA 1KI9A 2HUPA 4HATA 1YR8A 4Q7KA 3I5YA 1TTTA 4L9WA 3CZPA 5LB4A 3AVYA 2WPDD 3K9LA 2Y8EA 5CYPA 3SR0A 3RVBA 2VP5A 2OSBA 3K53A 2P65A 1VG8A 4IDPA 4QM7A 4JT4A 1A2BA 3B78A 1X8LA 3I62A 2VPPA 2O8DB 2OAQ1 1HY3A 2FG5A 3DZDA 4NL4H 5DIFA 4DLYA 1DG1G 5EE9A 4HB0A 3C16C 4OJKA 1GL7A 3KKNA 4BFTA 4DB4A 4OI0A 1T0HB 4L9SA 3KKQA 2J59A 2D74A 1OF1A 1Q1ZA 4NP6A 2YC2C 1P61B 4L5BA 4KVGA 1NNEA 2OFWA 4GP7A 3FMFA 1E98A 4GOKA 2F7SA 4ZO4A 2BMFA 4JLBA 4FXPA 2SHKA 3TSWA 4PQYA 1CULC 1SVMA 2HCJB 1XFAA 2FF7A 2PL3A 2ZRGA 4KV9A 5E3HA 4BUJA 4CEIB 3IQWA 5JS8A 2JLXA 2NTYC 3SJBA 3K0CC 2I1VB 3NH9A 3QEJA 4UQOA 4PPGA 2BDTA 3KXLA 2AKYA 4QBGB 3A8TA 3EA0A 4MA4A 4UJ3A 2WM9B 3ZQJA 2OM2A 1L2TA 3QVVA 1LFDB 2IF0A 2GA8A 3LXRA 5JMTA 3B2EA 5BN4A 1PUJA 1KI6A 2CEAA 4O0MA 4X8LA 3DKVA 3REGA 3O8RA 2AR7A 2O8FB 4EPRA 4KAXA 1Q1EA 4M8NE 4V0NA 2IUUA 1R4AA 2VYFA 4C30A 4F7WA 4URVR 3KQNA 4C0KA 3L0PA 4NMMA 3GLGE 4B75A 4NDZA 4A9AA 3E70C 4LBWA 2RGGA 4LYHA 1N2CE 5EP3A 4G5SA 2D2EA 4URYR 2G83A 4MUBA 4XOIA 3AV0B 1D5CA 3RS7A 2BBOA 5LDDC 3WBJA 2N1BA 4XH9B 1EFCA 1E9DA 1ZAKA 4HB4A 2QP4A 2JGNA 4D0LB 1W4BA 3LVQE 3GJ5A 1UBEA 1E2HA 2J5XA 3WMGA 4CDGA 1N6NA 1GKUB 1LW7A 3PUYA 3SQXA 4TZ0A 2GXAA 4NKRA 3CRVA 4HLUA 2IEZA 3SYKA 2V6JA 1F48A 3W8NA 4Q4AB 1I4TD 1GL9B 2F3RA 4BFZA 2VF8A 4HI0E 4K8OA 1PLJA 4C0AC 3AP1A 1KKLA 2WZQA 1MKYA 1OXSC 1GNPA 5C46F 3VAAA 2GF0A 2OFXA 2W0MA 4LK2A 2F1RA 1RRFA 2ATVA 1DG3A 1NSTA 2BKUA 3LD9A 5HTKA 1G7SA 3VR6A 5BYKA 4EPYA 4YXWD 3DDCA 2CCGA 2R6FA 2GHIA 3SJZA 1T5LA 5HKKD 1M8PA 3BH7A 5GADl 2GXSA 3FMPB 3EARA 1HURA 3PITA 3VU9B 5KDOA 1G9XA 4IVQA 1RKBA 4IDNA 1Z8FA 4C0SA 4XWAA 2O8DA 1ELOA 2AD5A 4BGDA 2RAPA 2PT5A 3WYFA 3GEEA 1SVLA 4GOXA 3J81k 1NMXA 2PMKA 4OK3A 5KUTA 3UMSA 5F9FA 1HA3A 4B48A 2QBYB 2XZPA 3NHAA 3CM0A 4K46A 1N5IA 3SBDA 3B5JA 2W2XA 3ND9A 2V6IA 4MKHA 1MV5A 5C4MA 5KDDA 1FTSA 2BBTA 2Z5FA 1ZCAA 3MJRA 2J0SA 1Y63A 4JL5A 3MJHA 4WXPA 1GFIA 4B2IA 4KFUA 2LKCA 3M0EA 1W46A 5CJ2A 4EAQA 1A4RA 5J4YA 1N0VC 2ZXUA 5GJVC 2ZETA 4MKFA 5DN6D 1KGDA 4I99A 1DOAA 1DEKA 4MUAA 1XF9A 4RD3A 5HR5A 4PHFA 2XSZD 3WRYC 4O2LA 1D9XA 2G1JA 3NVAA 2NO6A 3JZAA 4LBZA 5P21A 1FOEB 5DSZA 3CONA 2QMOA 3Q7PA 2E1RA 2A30A 2OHFA 3CPJB 3F3YA 1ZVQA 4ZIRB 3CH5A 4RKFA 2WMOB 4PC6A 2PBRA 1VIAA 2ONJA 1KDTA 5D3MB 2ZITA 2IYWA 4Q02A 2ZRJA 3W3AA 1BMFA 4JLOA 1FTNA 2PMDA 1W49A 2G0TA 1HH4A 1Z6GA 2XZOA 4R9UC 4NZYA 4GPTA 3VR5A 1AA9A 3BH0A 3TLXA 1W36D 1R0XA 1W0KA 1JR3E 4C4PA 2IK8A 3GJ3A 1W47A 4M4SA 3KJEA 5JLJA 2BVNA 2VO1A 2Z43A 4HYYA 1GM5A 1Z5ZA 4L16A 3EZ9A 4GBMA 2NPFA 1GWNA 2I4IA 2QENA 3CWQA 1GRQA 4Q21A 1JQJC 3RNLA 1NMZA 3IDQA 4HLCA 4B43A 4M1YA 1KO5A 2ORIA 3HDTA 3TUJC 4Q1CA 4F91B 3EZFA 1XEWY 5LBIA 2GZAA 4DSNA 1QHSA 1XEWX 2YOFA 3TH5A 4CEHA 3LY5A 5FOXA 3I5XA 3QF4B 4ZCLA 3K9NA 1KSJA 2ZS9A 1TQDA 1SVSA 5KSPA 2QTVB 1OFTA 2W6JA 2WMNB 4TLCA 1RYHA 3GMTA 4LJ4A 4ZKDA 3QY0A 4I4LA 3EPHA 3Q9LA 1R6BX 3I8SA 4HB2A 4Q1AA 1NLFA 1PV4A 1E69A 2CNWA 2I3BA 1KY2A 4MGZR 4DLRA 5IRCD 2GXQA 3ZZTA 3LNCA 1W4AA 1KK2A 4M1MA 4EQ6A 1SULA 2GKSA 3ZJYA 2JLUA 2A5JA 1AJEA 1P73A 1N0WA 1S8FA 3PUXA 2ODBA 1ETUA 3PENA 1E9AA 2F9LA 4P4UA 3K70B 1CXZA 1XZQA 3TSOA 2YWGA 2W6JD 4KYUA 2H57A 2OCPA 2ZRMA 1AKYA 1H8EA 2FWRA 3T15A 3SFZA 4Q1FA 5FOTA 2VP9A 3VU9A 1KHTA 4TT3A 3GJ4A 1IOZA 4KFRA 2DFTA 1EFTA 2NOAA 2R9VA 1UEJA 1U90A 4H1VA 4U00A 4UXJA 3WXMA 4DVGA 3AM1A 2OBMA 1QHGA 1YZGA 4LDJA 2UZIR 2GCPA 1XEXB 2HYIC 1S3SA 4RY2A 4PO9A 3WHKA 3RS2A 2XNDA 1Q21A 2QBYA 1OHHD 2J0VA 3WP1B 2ZYWX 3AQ4A 121PA 1KZGB 5J4VA 2FZLA 1Z47A 3C4JA 3LFUA 1DAMA 2VP6A 2YOGA 4TMWA 1VPLA 3D3QA 4IOKA 3B60A 1H8ED 4N0DA 5IT5A 1NP6A 4RKEA 5KSZA 2IYXA 3PG5A 5F3WB 3KFXA 5BN5A 2X2FA 4ITRC 2ZAOA 4M21A 3RWOA 2ERXA 1UADA 2C5LA 2IYTA 2YNMA 1CJMA 1RJ9A 1G5PA 3CIOA 2GEUA 2HCBA 1R8SA 1FQJA 1WDTA 2HF9A 2FGKA 4HUQA 4UJ5A 4PC7A 2XNDD 1EESA 4Q4LA 4Q47A 2DCUA 2BC9A 1ZUHA 3PEWA 4ACAA 2KBEA 1VYTA 3X2SA 3GLHB 3C5HA 1J70A 3IIMA 3QENA 1OB5A 2Q3MA 4AURA 4LHXA 4CEJB 3GLFA 3A1TA 1JECA 4B6EA 2ZU6A 4FIDA 3KQHA 5BW8A 4IDHA 4RZUA 3ICQB 1TF2A 3GEIA 3L2OB 1CIPA 3QXXA 4HDQB 3K0AB 1S9DA 1AQYA 2G77B 3AEZA 1YZNA 3IKJA 1G3IA 1E3MA 2ZJAA 1TQ2A 1SKYE 4I1UA 4KODA 1P2TA 2OBNA 2V3CC 4K81B 2HF8A 4QHSA 3SHWA 3K0EA 5GJCA 2RGCA 1PLLA 2DFNA 3C14C 3GFPA 4PSAA 5KPJA 4R98A 3M1IA 3OEHD 3TE6A 1U0HC 3I92A 1D8TA 4BZPA 5CIQA 5FL7A 1J90A 2DFLA 2P0EA 3V9PA 5FBLB 1KI4A 4OKSA 1M6NA 5TY0A 5CB8A 2C9CA 4FMCF 1XXHA 4CT4B 4MKGA 1YR9A 5DYIA 4D81A 3KUDA 1G64A 4GSYA 2V54A 4KYIB 2QU8A 2NQ2C 3B1WA 3VR1A 5JZVA 4OL0A 1MOZA 4G0NA 4XD7A 4CRWB 3QG1A 1S3GA 1N6OA 4FINA 2A5FA 5KNBA 3AF0A 4JVLA 1TL7C 4LYFA 1E2LA 1OLOA 1NJGA 1DS6A 2PZGA 3H2YA 5AUPB 3U4QB 4C2TA 1G7TA 2QQEA 2JASA 3ZQ6A 3DKPA 1QG4A 5L3VA 3MD0A 1AQUA 1Y3AA 3GJ8A 1XD2A 5IK2A 5BXQC 1I4DD 3T1VA 4OK5A 1XJQA 2HEIA 1EFUA 3H1TA 1OXXK 3JVVA 1VTKA 5EP1A 4TZ6A 4US2R 3D8BA 2OEPA 4XD7D 4W5JA 3EASA 5E7JA 3EC1A 1QF9A 1W36C 3X1DA 4BE7B 4DCTA 2DWPA 3HYTA 2J87A 4UNSA 4S2EA 1UAAA 1YR7A 4B6FA 2Q6TA 4LZZA 5E4FA 3KKMA 3KJHA 5IK2D 4RD0A 1GITA 1XPOA 1KO8A 3UIEA 4DLXA 3BB4A 3BRWD 4LJAA 3ADDA 4BLQA 4EUNA 2Q9CA 4L15A 1XTIA 4OJQA 4ZDKA 1XTSA 4V0ME 1YE8A 3SEAA 3KB2A 4C0LA 1W2HA 3I32A 5B57C 1HEIA 4FMBB 4ESVA 1ZBDA 3NG1A 4NCJA 4PO1A 3X1ZA 4MRRA 2RB4A 4TTPA 2BEKA 1SQ5A 1U9IA 1NN0A 5J5CA 4OYHA 3W34A 2ZI4A 3U6BA 4TN1A 1Z2AA 4CYMA 4OQNA 5GJBA 4PPFA 1P62B 4LI0A 4GOJA 3GLHA 4RFSB 1W5TA 4XSGA 1Z63A 2F9MA 4MRVA 3FWYA 2FJUA 1DO2A 4UNQA 2Z6VA 5EUQB 4PC1A 2JDIA 5CB6A 1QHXA 2IYYA 2ZSDA 1KOFA 4C3ZA 1G7RA 1E2EA 1G20E 1QVAA 2W83A 3DHWC 5CYOA 3AVXA 4DSOA 3B9QA 1CR1A 2B7BA 4BFWA 1G8YA 4ARZB 2J7PA 2G88A 3QKRA 3Q5DA 2R6CA 5JJIA 3ICEA 2G6BA 2NIPA 2O0HA 5G41A 1AGRA 4M1KA 1XBTA 2YYZA 4ZI3A 4DT1A 1YKSA 4HSEA 4Z8YA 2YHSA 4PHTA 4ASUD 1BYIA 2KJQA 2C9OA 5TXGA 3K0FB 1HV8A 1CLUA 1P2SA 2VHJA 1UJ2A 2WWXA 2JJ8A 3C5CA 1QHHA 1DVRA 4JSTA 1UFQA 1SVWA 2GEDA 2J7PD 5JEEA 3BH6A 3BS4A 2GWHA 5JSZB 2GZDA 5DYGA 4ZCIA 4JSYA 4AG6A 5KHOC 2AWNA 1IN6A 3CB4A 2EWVA 1IN4A 1Q20A 2QE7A 4FW9A 3ASZA 4R71A 1KAOA 2FFBA 2R65A 3EZ2A 4KBGA 1KSGA 3LV8A 4HAVA 1G6HA 4DLZA 5CDFA 2FSGA 3K09C 4Q9JA 4M1OA 1X8KA 1KSHA 1J99A 4P4SB 5JECA 2WIAA 1UKYA 3GQBA 1GDDA 1IN7A 3IO5A 3P26A 1OXVA 2GJ9A 2CL7X 2BIFA 5JJLA 521PA 2CDNA 3H0KA 4A8JA 3KKOA 4QKQA 2XOKA 3U3RA 5EXPA 3AF4A 5EQTA 1G5TA 4XTCS 2WTUA 1DE0A 5FI0B 1UBGA 4Y0VA 2QT1A 1E99A 4Q1DA 2QGZA 3IUYA 3EC2A 3BWDD 3U7EB 2VLIA 5FPYA 4B71A 4D82A 3UATA 3VMFA 2JIZA 5TV2A 3TW4A 2F1JA 2Q9BA 3NC0C 3K0SA 3ZLJA 1S4QA 2ZYVX 3Q8XB 2WWYA 5H70A 4JKYA 3A36A 1V43A 2V9PA 2XOKD 5JRZA 1YQTA 2ANBA 1E0KA 2QAGB 2BHRA 1GUAA 1MRSA 1E2PA 2QTFA 2RGNC 3S1AA 1D6JA 1DTSA 1G18A 4A2WA 2CHQA 2J45A 2QEQA 3UXMA 1TF5A 4S35A 3AH8A 4IDQA 4CGZA 2X77A 2AFHE 3QQ5A 4DSTA 2JIZD 2R6AA 1KI6B 1P75A 2BM1A 3OFNA 1T6NA 5TARA 2XITA 4G3XA 2NZJA 5SZJA 4A6PA 4YMWA 1U98A 2C03A 1YZTA 3HWSA 4DCSA 1X86B 4ERNA 1Z0FA 3TQFA 4NYMR 3CO5A 3CNLA 3SQWA 3NH6A 3QG5A 4TSFA 3P4XA 4BFXA 1GILA 1E2NA 1N6RA 1Z07A 3MG9A 3SZRA 3BFVA 1R5NA 2J7KA 1JI0A 4IFEA 1Z0AA 1Z6TA 2UVQA 3R8CA 4RCYA 1M7HA 3T1OA 1T4GA 3E5HA 3LAWA 1N6IA 1ZW6A 3AVQA 3B82A 1IONA 2W2TA 3TKLA 3CRRA 3AVUA 4OI4A 3PQCA 4RCZA 4D80A 1K6MA 3MAAC 3WNBA 1OE0A 1HT2E 1CU1A 2RCNA 1ESNA 2PCJA 4IOJA 4Q5IA 2XB2A 4D4JA 1G8HA 1NVWQ 2Q9AA 4IJMA 1Z6XA 3KXKA 3TK1A 1BKDR 2WPDA 4OHXA 1G6OA 2ODEA 3I72A 3QXHA 4JL8A 2BM0A 4WVFA 3EX7C 2CE7A 5KPDA 2MSDB 821PA 3E2IA 3BGWA 4PQRA 5F9HA 3WP0A 5JSZA 1LVGA 2AK3A 1Z0KA 3A1VA 4FMDF 2IUSA 2WIBA 4AK9A 1S9HA 5J4KA 5DI9A 4AD8A 2B21A 1M34E 3BERA 4M53A 2HJGA 2VF7A 4ZDJA 4PAOA 2BV3A 1ZCBA 2LWIA 3FFAA 2C99A 4TL8A 1A82A 2RGAA 3AF1A 3EA5A 3MWLA 3R9IA 2FH5B 4HAWA 5KSOA 2JLZA 1CF4A 4A0RA 1MT0A 1HE8B 4P4SA 4JLKA 1UPTA 3EAQA 3KJGA 2PX3A 2ZS7A 2RHDA 4KLNA 1PLKA 3VHLB 1Z0JA 2IC5A 2QN6A 2WOJA 3Q5EA 3RSLA 3THOA 4QFMA 4QBFA 4BASA 3B1XA 2BCGY 2HDNB 2JEOA 3L8ZA 4TL9A 1SXJE 3LDAA 3OE7D 1N5JA 4YMTA 4FCVA 1P6XA 1VIYA 1P7CA 5L3QA 2C77A 4Q19A 4QC2A 4HUTA 3I3SR 3IILA 4TYYA 2QMEA 2LCFA 2HJVA 2D06A 1KYIA 3CF6R 4RSGA 4JT2A 1TEXA 2JCSA 1TU3A 4BRUA 1AKEA 2ZRNA 3OIVA 4MYHA 3WRXC 2A5YB 1IY0A 3EPKA 1KTVA 2QAGA 3NHBA 4DLTA 3Q85A 5FPHA 1XB2A 2PH1A 1OW3B 4TLDA 3T35A 5DI3B 3P4YA 1RIFA 1WQ1R 2FGJA 4Y0AA 5KYKA 3DOEA 4BZQA 1EFRD 2CCKA 4KITB 3U61B 5JI2E 1ZU5A 1CJTC 4JLMA 3KTAA 3U7FB 4LJ8A 4NYMQ 1SXJD 3BK7A 1Q0UA 4YQFA 4QHYA 2GBLA 1EWRA 4OK6A 4D25A 2HXYA 2V55B 4LHZA 4QL3A 3RAPR 4B47A 3ZZUA 1XMVA 3AVVA 1BIFA 3RLFA 5M04A 4Q18A 4UNRA 1MO3A 4FCTA 1Q1QA 4YMVA 3BBPA 2IL1A 3G0HA 2H18A 1VG9B 2JLWA 3CUEF 3FVQA 2OLJA 1U2RA 1P4SA 3CPEA 4KFTA 4A6XA 2ZR7A 3GLGA 4URWR 2IW3A 1UBFA 5CITA 1UDXA 5EXSA 1YZLA 2GF9A 1CEEA 2P2LA 4CZ2A 4CEHB 2OXCA 4UXHA 4YXWA 4D0GA 5IF9A 4Q03A 5BWMA 4QXAA 1VDZA 2W58A 5FPSA 1NG9A 1M1YE 5FTLA 4EFNA 2NMVA 5KSYA 3OIWA 3FPAA 5HKKA 1UBCA 3AP3A 3TR5A 3U7GA 4EDHA 2GJKA 1BH2A 2PLFA 1LS6A 1GKIA 5JBQA 1YU9A 1ZJ6A 2FPLA 2D4HA 2XXAB 4NU0A 2REXB 4EQ6B 1TF7A 3LLUA 1G3RA 3BE4A 4II7A 4WW0A 4IOLA 1YVDA 1UF9A 4KO8A 3PCRB 2QGNA 4OBEA 4JVMA 3CRQA 3GLIE 1I2MA 1S2MA 4Q7LA 3A1WA 1XTKA 3NDPA 4WIAA 1GRRA 4GDFA 5DHAA 3IQXA 4KVAA 3O8BA 3QXJA 1NIPA 2J9RA 1KMHB 2MSEB 1GNRA 1ZYUA 1WMSA 1G3MA 4IW3B 1ZU4A 4MRPA 4RVCA 3SE0A 1VECA 1Z0DA 2R6DA 2CXXA 5DN6A 1KO4A 4IKEA 3EG5A 4A0HA 2OO7A 4BLTA 2R8RA 4DDVA 1ONBA 2FE4A 2FFAA 2XSZA 3FHOA 4TLBA 5E7IA 4AG5A 4BRWA 1GIAA 5TMPA 4B34A 2WKQA 3LX8A 2KB0A 4LRWA 2RGXA 3IIKA 1DARA 4RZ2A 4PQFA 2ZI6A 5FBWB 3TMKA 3WBKA 4JLJA 5K8IA 4NCNA 4XSHA 4NCIA 2TMKA 1OYWA 5GVSA 3HP1A 1RJ9B 3TVDA 1T3HA 4WZBE 2WKRA 3B1ZA 3N2IA 4XIGS 2ZUCA 4HUQB 3PXGA 1NG1A 2H92A 2ZVQX 2IXGA 3MCAA 1W7AA 3HU3A 5K8UA 2J46A 2WJHA 2F1IA 4URUR 4LJ5A 5DI3A 5FOVA 3BIFA 2EYUA 1N6HA 3F0TA 1P9NA 4LC0A 4DIEA 2PEZA 3KKPA 1T5IA 2OAP1 2IS4A 3GLFB 4FD2A 1TU4A 5KU1A 1U8ZA 3ETLA 3SYNA 1IHUA 5AJVB 1N6LA 3QF7A 2PLRA 4P33A 4V0KA 4B3BA 3PFIA 2ZRPA 5FUXA 5E7MA 4YMUA 1OKKD 1N6KA 1OT3A 1PUIA 4I81A 3TGPA 3IO3A 2D2FA 1RVDA 2ZR9A 4ILEA 4JL6A 4JS0A 1CR2A 3SJCA 1G5RA 1XMSA 3HU1A 1X1RA 5AR1A 4TQ9A 4LYJA 3BB1A 3VR4A 2ORWA 2EYQA 4DDUA 3ZD6A 2C04A 4C0BA 3E1SA 2VHTA 5CK5A 1ZM2A 1KJZA 4IEEA 2C96A 3VKWA 1AS3A 2P3SA 4X8MA 1E9RA 3WNDA 4H9GA 5FOWA 1EXMA 1P9RA 2FU5C 1JR3A 4EJSC 2ZANA 1XXHB 2Q3FA 3U5ZB 4A2QA 2KE5A 1OFUX 2JLQA 1H8HD 4PX9A 4FN5A 1C1YA 1XWIA 3DL0A 1L7VC 1NLZA 2GJAA 2WHXA 4KFSA 2OE2A 1MO4A 2R2AA 3NBYC 5FUVA 1Z6AA 2DBYA 4ZPXA 2N42A 2XXAA 2F3TA 1H65A 2O0KA 1W5SA 4PFSA 5C18A 3BB3A 1JR3D 1AK2A 1SXJC 2IYSA 2ZTSA 4EFMA 4RZ3A 1XD2B 2IYLD 3THXA 1OHHA 1TADA 3X1YA 1Q12A 3OEED 1KO7A 4D26A 3AKCA 3DEFA 1MH1A 1KMHA 3ZYCA 4AKEA 2YJTD 5JS7A 4MYTA 2IA5A 1DAIA 1KK0A 1E2GA 2ZROA 2VHCA 4ZCMA 1F5NA 3GPLA 1R5OA 4CIDA 3RS5A 3B1VA 5FFMA 4DLWA 3QI2A 2J0UB 3WMFA 4LCBA 3VKHA 1RRGA 3PEYA 4DCUA 2PX0A 3R20A 2QRNA 4DEYA 3LRPA 3QPVA 1GP2A 4E5UA 1NLYA 4QJ5A 2LKDA 2P6UA 2GNOA 2QM7A 4O25A 4DEXA 4JVSB 4IDOA 1KJYA 5DO9A 2REBA 1DADA 1LB1B 2NO0A 1TQ6A 3T5DA 1ZD1A 3FDIA 2KSQA 3CX7A 2ZRHA 4NYIQ 4Q7JB 2C78A 3CW2A 1CJKC 1OJLA 2FA9A 1KAGA 4G01B 3U3OA 4IOMA 1NN1A 3KDSE 5FOUA 2R6GA 5DH9A 2IS2A 1G4UR 2WSSD 4BWYA 1N5LA 3DM5A 2XTZA 2VH5R 2CL0X 2FEMA 1KY3A 4MYCA 3V4FA 3A58B 3ZIAD 4QOSA 4Z1MD 3HR8A 2G9NA 1CKEA 4P3YA 4FWTA 1FNNA 1FNMA 4A0GA 2P67A 1UM8A 2NO1A 4E07A 2ZI5A 4BFUA 1JAIA 3ZVMA 2O8BA 2H7VA 1XDBA 4B32A 1E1QD 3G5UA 5FBRB 5LPNA 5LD2C 3KB1A 5DLQC 1YRAA 4MGYR 2ZI7A 4LHYA 4M22A 2VRWA 3MRSA 2ZE6A 3UKDA 2CVHA 1ZRHA 4F4CA 2YKGA 1FP6A 1QVRA 4TYNA 3OEHA 4PSKA 3L8YA 3H86A 4Q66C 1G21E 3EIEA 4DDWA 2X2EA 3AB3A 3LO5A 4ACBA 4HEJA 4PZLA 3CRMA 3AGQA 1TUEA 3B9PA 3FKSD 3NC1C 4HDOB 4OHZA 3CX6A 3QKRB 4GMXA 3CNOA 2Q21A 1WBBA 1MO6A 4Q00A 4YONB 1ANKA 1BOFA 2FSIA 4HLUC 5FBVB 2JLYA 4HAXA 2RMKA 4F92B 2QPOA 2G0NA 2ZYUX 1N5KA 3K9GA 3RS3A 4DT1B 1JALA 1X8JA 4ESHA 5C1BA 4A36A 4JJZA 2YWFA 3WYAA 4G5RA 4V0OA 3FHTA 2QSZA 3RC8A 1ZNZA 1FX0A 5G3ZA 1QHHB 5KO2A 3T1TA 3IEVA 3N5CA 4Z54A 2DY1A 2GAAA 4NTZA 1KNXA 2QQ0A 4RFVA 4WZ6A 3WNCA 4X8HA 5EZ5A 3QKTA 2W6ID 1JBKA 1VG1A 4N3NA 1KDOA 5EXXA 4PC2A 3HJNA 2VHUA 4W9MC 1OFIA 1ZUIA 2A2ZA 2VBCA 2OXRA 4UXIA 1VHLA 2ZJYA 4QHTA 4WA7A 3L0OA 1Z06A 4ON9A 2HT6A 3QPWA 1WP9A 3DMDA 1IN5A 4C0HA 1G41A 1UKVY 4CF7A 1QHIA 4AYXA 1NSFA 2PEYA 3H4MA 4GMDA 1IBRA 5TVKA 3THWB 4A8JB 4DLUA 5CLQA 2WSMA 1U8YA 4Q4HA 2ZM5A 4PZYA 4GZMA 3BOSA 3RRNA 4EFLA 1SVIA 2C9YA 1XTQA 3EPJA 4PAMA 2W2VA 2GCOA 2ZE5A 2ZEJA 4KBFA 1K8RA 2PZEA 4NBSA 4DC9A 4AI6A 1OIXA 4P31A 4TL6A 1BS1A 3AVTA 1JEEA 2J0UA 2GILA 1J2JA 2CE2X 2GJ8A 3AKEA 3I4LA 4JBYA 4DUGD 4KSCA 1KI2A 1GL6A 2JA1A 2XTMA 2F43B 1I2DA 1NY5A 4BPBA 1GKYA 2ZRIA 2H5EA 1D9ZA 2AFIE 2AHOA 2VEDA 1E0AA 4TMZA 3S1AB 4TMVA 5DE3A 1KI7A 1P2VA 1KJWA 1J8YF 1LTQA 2XNSA 2O0JA 5LB2A 5JEDA 2Z0MA 3D31A 4DIDA 4AKHA 2IBMA 4LBVA 4D4LA 1CRPA 3I8XA 2XB4A 4ZDIA 2REOA 1F2UA 1ZINA 3WY9A 1XCMA 5K8TA 2IYZA 4D0NA 4YMSA 2B6HA 4V0MA 1COWD 3MWYW 5JHGB 1YZQA 1CJVC 3ZS9A 5KNCA 1IY1A 1TPZA 4M1SA 4DCVA 4YDHB 5EZ6B 5AUQA 1ZNWA 3RC3A 4A15A 1FPMA 3P32A 4HB3A 5TB5A 3GLHE 4E09A 4ASUA 3KXIA 2IWRA 3UWOA 2WOOA 5FPKA 4GL2A 3HR7A 4POAA 5ELXA 3BXZA 4B3FX 3GJ6A 5BQ5A 1SVOA 3RABA 3QEOA 2ATXA 3K0CA 4GT1A 1AIPA 5GVRA 1E1RD 1E2IA 2ORVA 4D4KA 3MSXA 2GDJA 1LS1A 4C2UA 4FMDB 4C9BA 4TTRA 2EW1A 4CT5A 2GVZC 1QZXA 3QE0A 4DB2A 3L0SA 3PEVA 3I1FA 4MYUA 3U3MA 4FWIB 2I1QA 2O8EA 2CJWA 3CNNA 3W9YA 4PC3A 2FSFA 721PA 2ZRAA 4WBSA 2P6NA 1Z2CA 3C15C 3DPUA 2CHGA 1W2GA 4B2LA 1D2NA 2XJ4A 1NRJB 3CZQA 4MH0R 4IXNA 1D2MA 2FEOA 4ABYA 5JFGA 3U44B 4XWOA 3GEHA 5HCIA 3SDZA 1WB9A 2IS6A 4C7OB 1T9HA 4Q7MB 5JWRA 1U0LA 4C0QC 4Q48A 4LV8B 2XAUA 2J1LA 1ZM9A 3FB4A 3KJIA 2IF2A 1NKTA 5UKDA 3TVTA 1DAKA 3THWA 8OHMA 4WOPA 1FUKA 2ASEA 2JATA 4LSGA 4MITA 3QKUA 5FR2A 3QSYA 5L3QB 1IM2A 1KI1A 4F4JA 1E32A 1ZNXA 5C2JB 1S1CA 3SN6A 3LVRE 4Q1BA 2CVFA 2QPTA 2QT0A 3U3KA 4DHEA 2HLDD 2Z4SA 2XGJA 2IEYA 1OIWA 3CF2A 2DR3A 3F8TA 1Q22A 1Z0IA 1Q1BA 1TX4B 2J41A 2ZUDA 4JLAA 4JVNA 1OXTA 2F43A 2AK2A 5CJPA 3TUIC 5B2ZA 4A82A 4G5OA 1FMJA 3B8HA 4XVRA 1KSFX 3TAUA 2FMXA 1X1SA 2ZI3A 3GFOA 1R0WA 2BMJA 3PIRA 2IS1A 4ZI2A 1R8QA 4HZUA 5FTMA 2GESA 3CF0A 4MGIR 2CLDX 3KTAB 2QY9A 3OIYA 1VHTA 2ZJOA 5H8WA 4P4TA 1ZIPA 5JRJA 4IEIA 2F55A 1OV4A 1Z28A 4US1R 3REFA 3TAHA 2VTKA 2OCBA 3EIQA 1Q3HA 1QDEA 3MGCA 4OQXA 3M6AA 4LX0A 2QG6A 1OSNA 2QMHA 2JLRA 5EP4A 2QI9C 3GLGB 1NBME 2NGRA 2EFHB 1DBSA 5G3YA 3BORA 1IJEA 1XPUA 4XWKA 1A7JA 4GNKA 3AVOA 4JLDA 3PUVA 3VFDA 4G1UC 4LY6A 4LOAA 5HE9A 1OIVA 5FTJA 5FH9A 2C2HA 1S1MA 5FL3A 2VIIA 2ZJ8A 1CJUC 4IFBA 5FUYA 4LJ6A 1HUQA 1QG2A 5HZHA 4AYTA 2IUTA 4M2LA 4UNPA 1KI3A 2ZU0C 3VHXA 2WJJA 1W0JD 3ZZ0A 2NO7A 4AC9A 3TQCA 2GEVA 4KLZA 5IHPA 3A1SA 3LX5A 3L43A 1KO1A 1TEVA 1ZM7A 3QBVA 4JLNA 4RJLA 3IBYA 4BLRA 3NBZC 1KNQA 2BJVA 1P9WA 5A0FA 1ZIOA 2ZVPX 4GRAA 1IY2A 2OUKA 3U44A 2IHBA 2OBLA 4RD6A 5J47A 3K70C 1NBMD 2UZ3A 2OFOA 5FTNA 2R62A 3OE7A 3IPYA 1II8A 3KX2A 3RWMB 3PR1A 2VA8A 3I73A 1M2OB 3QXSA 3ECCA 3UANA 5BYJA 2OCAA 1DO0A 4C7OA 3DO6A 4HDCA 1OH8A 3QOFA 2IT1A 4EJSA 4LJ7A 2KBFA 4DBLC 4O3MA 4B3XA 3L0IB 3OAAA 2KI5A 1SHKA 1E96A 1GVNB 2GRJA 1QBKC 1NKSA 1E9SA 2EQBA 1UDWA 1JEDA 2RGEA 4W7SA 2L0XA 4LHVA 4EPTA 1PJRA 4QGAA 1EFRA 2MMCA 1XCGB 2ZSFA 4Q01A 4JBWA 3U2QA 3VNVA 1F6BA 1SXJA 4LHWA 2ZPTX 4Q4JA 2QPAA 3NKVA 1YRBA 4YC7A 3VTKA 3RS0A 4OHVA 3DOFA 2ZYTX 3O47A 3OAAD 4B3CA 1U9IC 3ND8A 1TAGA 1HT1E 3ADBA 3LW8A 1E2MA 1SZPA 1T91A 4LWZA 3IIJA 3EZ7A 1W36B 3IBGA 1P3JA 2D7DA 2EFGA 2QNRA 2ZJ2A 2X19A 5AWFC 3H84A 2MSCB 2GTPA 2XJ9A 4M0LA 1F2TA 4DDTA 1NL3A 1IQPA 2XTNA 3LH5A 4GI7A 3R7WA 3AF2A 1E2KA 1VYUA 1GOTA 1OXUA 1KDRA 2R44A 5JJKA 4U02A 3C41J 2VP2A 2C8VA 3GJ0A 5A5GA 3U7HB 4MKIA 4O2RA 1FFHA 2VHQA 5FI1B 3IHLA 4DCNA 2YWHA 1D2EA 2C98A 4LV6A 2BCJQ 5EJEA 4DLSA 4H1UA 2YVUA 1MO5A 3UPUA 3BC1A 1KDPA 3B6EA 4KJZA 1N3BA 4Q1EA 2BEJA 1JR6A 5G53C 4PHGA 4AKIA 1T8TA 3RRMA 1VCOA 3HPRA 2Z83A 1NVXQ 2E87A 4DLVA 3OHMA 4B44A 2ZUBA 5F2EA 3CX8A 3R9XA 4B3GA 1NJFA 4KHZA 4OQFA 5CM8B 3MWJA 4M9XA 2O8CA 5C4GB 2X8AA 4PXAA 221PA 1VCIA 4TMXA 4XVQA 3THYA 4LJ9A 1JXOA 2H8KA 5AJWA 5J4HA 1ZMXA 1HTWA 4R2IA 3ZD7A 2QORA 4IHQA 2FNAA 3B85A 1HE1C 1WF3A 4EPVA 3NXSA 5D3QA 2MMGA 1CS4C 2P5SA 4F38A 1Z08A 3OZXA 2AKAB 3I61A 1JNYA 3THXB 2F1HA 1RW4A 3RANA 4A8JC 1XMJA 3SHFA 5J4LA 1A1VA 1VCMA 4JZKA 1OH6A 4B3DA 1KK3A 1MABA 4XVUA 3CR7A 5JCPA 1P60A 1US8A 5CM9C 2AX4A 2WVJA 4RD4A 5BN3A 4U5XA 2YV5A 621PA 2EFEB 3TNFA 3GLIA 4QNRA 1B23P 1ZP6A 3SS8A 2WKPA 5SZHB 1PZNA 1DPFA 1NVVR 4EKDA 2ZQ5A 1T3SA 3CWZA 3X1WA 1E79A 4B33A 1U0JA 1DAFA 3K1JA 1N6PA 4LYAA 1II9A 3QVUA 1W4CA 4BFVA 2PT7A 4U7DA 1G8GA 5JCZA 3SNHA 4L8GA 2QSYA 1WE2A 4QM6A 2YWEA 3ADKA 4QG7A 5J40A 4WAUA 1E4YA 5ANRB 5JWHA 5AUOB 3K9HA 3A1UA 2A3RA 2PZFA 3PUWA 4HAYA 2ZR0A 2IHYA 1OFHA 3QPUA 3KFVA 2VL7A 3ZVLA 4TYQA 1YJ5A 1QHYA 3TRFA 3ZDQA 4TYPA 1K5DA 3NIBA 3QUSA 1E79D 4MQBA 4NYIR 5EE1A 5GJWC 1FW6A 4OQLA 1ZC3A 3MWKA 1XMIA 5CLLA 1TQ4A 2XEXA 3HYRA 1OKKA 3TJZA 2A9KA 2PJRA 3V00A 1S96A 4TLEA 4P32A 4BLOA 2O8BB 2BBSA 5AJXA 4LUCA 1W4RA 2JAQA 3ZVNA 4F93B 4QBIA 5JHHB 2WV9A 1S0UA 1Z22A 3UMFA 5L3SB 3LQRA 1IN8A 3WHLA 3OIUA 1JB1A 4Q9HA 1XEFA 4OHWA 4CEIA 3R8FA 3K8YA 4MGKR 4R7ZA 4AKGA 1XTRA 1EFHA 1IXSB 2B7CA 3F5FA 1R0ZA 4M9QA 2AXPA 4FMCB 3A4LA 4CVNA 3DM9B 4A1FA 4M9ZA 2ZRCA 1GAJA 3R9WA 4GZLA 1H8HA 4M1TA 2FX3A 1G8FA 1W48A 2OT3B 2DB3A 4HAZA 4P0TA 5L3RA 3Q72A 3GJ7A 2EU8A 1SKYB 1FX0B 1KMQA 2ZRBA 2O8FA 2FN4A 5IDVA 2B8WA 2UKDA 1G8PA 2OLKA 4ZV4A 1AM4D 3EWAA 4FCWA 3RS4A 2AXNA 2QRZA 4B35A 1E2QA 5JWOA 5CIWA 3DMNA 3OEEA 2FSHA 3U6KA 1GG2A 4V0LA 3M4YA 1DAGA 3MLEA 5KOYA 5B64A 3QNUA 1XD8A 3GD7A 5SZKB 2D3WA 1G7CA 1E9EA 1G291 2ZJ5A 2VQSA 4TQUS 1ZM3A 4LPSA 1J8MF
chains in the Genus database with same CATH superfamily
3IGFA 3P2MA 1UKEA 3S2FA 5CXQA 1CYEA 2DBVO 1LF0A 4DOMA 3AHDA 3FZEA 1PBTA 5HIJA 4DABA 1F60A 2VPQA 1MX3A 1SXPA 3Q3JB 1IPFA 3BWMA 5A06A 1VMAA 3QSGA 3S40A 3PJRA 3AY0A 2NXEA 5EZSA 4D0RA 5JDIA 1A7UA 3WTBA 3SIXA 1W0KD 3MUOA 3DMRA 3KQYA 1YI8A 4IWYA 5LBTA 1NV8A 3EXAA 1D09A 2OESA 4N47A 2CCJA 5IDWA 1FQKA 4PPNA 2CF5A 3RF6A 3ECSA 5JNUA 4KZKA 2CK3A 2IX9A 1T6ZA 2D5CA 2HLNA 2VHVA 4N0PA 1SHZA 3WLNA 4CQLB 4XPIB 4ZIRA 5LMNB 1T3LA 4YRNA 1IK4A 2B5OA 1E7QA 1NJSA 2YICA 3RFXA 3T9BA 2L42A 2C0PA 3IEUA 3GJZA 2ESRA 2ZTMA 3FTQA 3M8KA 4PZEA 4HMOA 3RDPA 5LP6F 3ZIAA 1GG8A 2P5TB 3QVGB 4IXTA 4FR2A 3JVIA 4CHGA 1J1UA 4M46A 5LXTB 4IX1A 4WINA 2HV8A 4H27A 3J7TA 1XCPA 4Z4GA 2WFAA 2PRSA 3CEHA 4C08A 1RP1A 4D9NA 2OYRA 3QUBA 5LBUA 3CWCA 3BMCB 3LDHA 3MB5A 1YRWA 2IH5A 4D45A 1QE3A 1DIAA 3UG7A 3ZDXB 1X94A 5B3JA 3CSUA 2ZT8A 2CL6X 2BMDA 3AI3A 3LHIA 2XZLA 4X84A 1SCKA 1DAEA 4ENUA 4TS1A 1LNZA 1X2EA 3E9CA 3FPLA 1HLPA 3E2MA 3DQZA 1XRLA 2UZAA 1LLFA 5AFSA 4DCPA 4D3ZA 4RE5A 3UMGA 2C29D 1FXWF 2VRCD 1CDDA 3I4CA 4WXRA 1U5BA 1KVTA 3KQQA 3M34A 3I6ZA 2C61A 4FZJA 1FFWA 3GFSA 3OSZA 4YJ3A 3KOZA 1EUCB 1GSIA 4FFMA 4NCAA 1E0JA 1DSSG 2G9ZA 2DOKA 2F3UA 1WW2A 1EFKA 2XQVA 3FVTA 4QGHA 1J42A 1K6EA 5MDHA 3GLFE 1NPTO 2VJQA 2BFBA 3DBHB 3H2ZA 3OCUA 3BK1A 1CVLA 1KYWA 5BY2A 2VNHA 2WWIA 3A9RA 1Q77A 4J0QA 4UUNA 2RH5A 2CD9A 2EVWX 5EZYB 1XG5A 3HJGA 3ANLA 2ERYA 3NM5A 3ONWA 2PWAA 3PTAA 4K2HA 3AUYA 2XE7A 1CR4A 1T8UA 3PNMA 2E5LB 5F9MA 1VKJA 2LIPA 4Q7EA 1AT1A 1J22A 1EM8B 2YNMD 3BUSA 4KWCA 3UAXA 5A1TA 9LDTA 5JPCA 4DG9A 2B3DA 4ETIA 4O4IB 1TCVA 4JB0A 5FO1A 2CMDA 1NJ5A 3I52A 3GJXC 1WIWA 2PSFA 4IR7A 5KNDA 4QU5A 4A6EA 5L45A 4Z3KA 4OI2A 2NV0A 4QRDA 1XPJA 3VPCA 4JA0A 2IX3A 1IXZA 3VJRA 1XZPA 3FD8A 5DP2A 2ZKLA 2OFPA 3IEIA 1G0OA 4NOKA 2JLBA 3TTSA 1LDYA 1VL8A 3T34A 4YV7A 1QIKA 4GG1A 4G0YA 2GZHA 1R16A 2FQ1A 1U0NA 5ETJA 4B3JA 1GLGA 4UATA 2UVPB 3FSRA 3ZJ4A 2ODNA 3ANSA 4EB6B 5I9TA 1AO3A 2JJ2D 1YA6A 3CNQS 4EELA 1PFKA 5B1SA 1JPNA 3ZDCA 2VK2A 2OV6A 4GIBA 3R0XA 3MBIA 1OVGA 1WRBA 2WWFA 3UXYA 4INOA 4MI6A 1WS6A 2CLCX 1GNQA 1A9TA 2VYVA 3NEPX 5C7LO 6Q21A 3USES 4DUGA 4OYRA 1U28A 1ZJYA 2NZ8A 4J16C 4BP1A 1DTEA 3QTBA 1MC1A 4QGFA 3B3GA 3PQ8A 4BVEA 2YWXA 2QTVA 2WAXA 4BECA 5IFKA 2ODWA 2GYUA 4DRZA 2BP7A 4EG3A 1NULA 2YN2A 2Z56A 3KL4A 2Z04A 1PVOA 4X93A 3QYFA 5CR9A 4BYGA 3BZUA 3PZRA 1BD3A 2WK1A 2IV3A 4GPAA 5CK4A 4HAUA 4BV9A 4IM7A 2P78A 5DMHA 3AEUA 1Z37A 1AKQA 2F67A 4LPKA 4MZDA 2WM8A 4N5DA 1NI3A 1POXA 4GOOD 2FFHA 4HGPA 1ODFA 2YHIA 3K9CA 5LA6A 3D3JA 3ILYA 1P5ZB 4BQSA 2QTAA 3FUXA 1QZUA 1QH8B 3JW8A 3DBOB 3JTEA 3OOSA 1N4AA 4LRSB 3ZY3A 4DBLE 3V4RA 2YV4A 1MX9A 1DWOA 5HUHA 2IDJA 2IXEA 2O14A 4FDAA 3WK6A 4KH1A 3ZI0A 4AJ2A 3MLBA 2E6UX 3MTJA 3HXTA 2BHNA 4HTFA 4QX6A 2PIDA 4RLHA 4EHLA 4KR7A 1NP7A 2UUPA 1R3UA 2H65A 3UF0A 2GYVA 4GU5A 3T1YB 1AB6A 4KQHA 4U2GA 4PO8A 4B74A 1E89A 4DIKA 4KPUA 3I28A 3R3YA 1XEXA 5JNSA 2JA2A 3FI0A 1X9IA 4JB2A 5DU2A 5FWXB 4FKBA 1W6RA 3GFTA 3IA7A 4LRUA 4OQZA 1RYFA 3AGPA 1FY2A 1I3NA 4ZO7A 4YRJA 4E03A 5JT1A 4OBXA 4AUEA 4RTKA 4MDFA 3A6PC 1EVZA 3OZEA 4MGHA 3U7QB 3SIPA 2FHPA 3GCGA 3W6NA 3EZYA 4IIJB 3TIGA 4RKWA 3ZIUA 2G1PA 1U5AA 2PFSA 2QROA 3RVMA 4Y2VA 5EIOA 3N07A 5ERGB 2H4JA 1JDNA 3O8DA 3ENVA 3KZ1E 4JBXA 4JKIA 3ZGXA 3I76A 4RYDA 1FBNA 1Z15A 2IWHA 1A2KC 1TZKA 2OR3A 2Q3CA 2QJRA 2X5NA 3HYNA 1V47A 3C2QA 4QYMA 4WRRA 2OFFA 1WMBA 1GUFA 421PA 4DMFA 1JJVA 4NLLA 2RGRA 1GG9A 4YCCA 1I80A 1ZGJA 1N4DA 1ATIA 3ROTA 4EF4A 2POCA 4FDLA 5JPDA 5H7XA 4AM8A 2VP4A 1E3IA 4B31A 2VDWB 3QU5A 1I0LA 2JL1A 2JAPA 1N32B 1Y5LA 3TQTA 4IFTA 1L5OA 3W2IA 4BX8A 1VE5A 5TDHA 1D7AA 4PYMA 3IHWA 1ZK0A 2W2OA 1F3OA 3FE2A 4LC1A 4MS3B 3QE3A 4PVCA 3B7PA 5CT8A 4IMJB 5EWMB 3EFBA 2ZBQA 3IP9A 2WWRA 3OH8A 1UPFA 3EZ6A 4DR6B 3VSBA 4D2IA 3R5SA 5G0SA 2VJMB 4FDUA 4UEWA 3FAZA 2W70A 4IIEA 3OZ7A 4HPWA 4M0UA 1ZY2A 3AFGA 4EW6A 3W5IA 2JAXA 4U2CA 1ZXXA 4JJ4A 5KKNB 2EDCA 2Q3HA 3N1UA 3Q6NA 1GADO 3V42A 5IABA 2WHYA 2HA5A 3GPIA 3OT5A 4I1SA 1I5RA 4AS1A 3ND7A 1OH7A 1JTEA 5IT0A 2ATEA 1PYDA 3T7SA 3C8UA 1IHYA 4QYIA 2Q5CA 3KUCA 2PL9A 4LJYA 3TW8B 4ES6A 4MRNA 4R1PA 2WABA 3DV0B 1N2GA 4YWJA 2PU5A 4N0QA 3ZY6A 5B7PA 3KO8A 1TK3A 1M7GA 1XJCA 4J7XA 3T3DA 3GEMA 5JZBA 2QZZA 5ALIA 4RLQA 1U2SA 2GJ4A 3Q88A 1EWQA 1KXZA 1O97D 2HSEA 1ZISA 1PL7A 5TS3A 1VJRA 1NMQA 3M9WA 1GUZA 2WAYA 3A31A 1DIOB 2UVDA 3O3CA 3PIIA 3R4CA 2CYCA 4HO1X 2XUAA 4QUIA 4CL3A 4D43A 1HF3A 5FTKA 4DF3A 2QD4A 3M6WA 3FMOB 3UHPA 1YS7A 4XX0B 3LNTA 4HH3C 2J9ZB 3LBIA 4JYCA 4CMBA 3UWKA 2YXDA 2EFDB 1CY2A 3IAS1 4QYSA 4AS3A 5T7BA 4FM9A 3BD9A 2FCAA 3ASYA 1DGQA 5DGXA 3NBFA 1PD1A 3IOYA 3LYUA 4AB1A 5CNIA 1L7AA 4UC0A 3VC2A 4A16A 3ZS8A 5TGZA 4DILA 1UJ5A 1WXFA 4YLYA 1FL9A 1KK1A 2DPXA 5DVZA 5B58C 4UNNA 5H1YA 1EYZA 2ZLBA 4ZAVA 4NCHA 2AW3A 2D7CA 2R1UA 5KQLA 3LZCA 3WISA 2RHTA 4UD2A 3T0IA 1V96A 4DA6A 2ZSEA 3M33A 4OHYA 1BGWA 1NF3A 3L82B 3NEYA 1E3EA 3QKSA 4MR8A 4GMFA 1R6AA 3BIOA 2DG2A 3NONA 1IXRC 2PZLA 3HU2A 2OG2A 4IVRA 4NJMB 1XTPA 2MSNA 4W5HA 2HJ9A 4OLBA 4BGUA 2XUPA 4EOGA 1NUSA 2VUIB 1MX5A 2QTRA 3CVJA 3FOBA 4LGMA 1WM1A 3SQMA 1ZK3A 2YUTA 1Z38A 2YJ4A 1BEEA 3IAUA 5AKLA 2KWIA 2EFCB 3F4KA 1VJTA 1WXGA 3ITDA 4E46A 1VLZA 5AESA 4ZEVA 4PZZA 1IUKA 2NTJA 3T41A 3CVXA 3QUQA 1EZ1A 1ZD8A 3G9ZA 2HQSA 1E9FA 3NTUA 3E2PA 3ELYA 4FYHA 1WXHA 3DVLA 2R2GA 1NN3A 4KGXA 5FPTA 2QX7A 2VVTA 4N9WA 5BWNA 1JI3A 1P0PA 2IYUA 3ZWCA 2WD9A 5I6DA 2P9TA 2ZQZA 3HV0A 1I4OA 1Y4UA 4G85A 4NMLA 2EWWA 4KSBA 1W44A 3TLGB 4LF8B 3VRHA 3CPSA 4GM0A 3OZDA 1MN6A 3ZV5A 3OOEA 4CM4B 3R9XB 4B7AA 1W19A 5AICA 5L53A 1GZ7A 3WK5A 2EJWA 3B1YA 2O8CB 3BVPA 4RVDA 1E1YA 4MOWA 3RBZA 3UUGA 3DFUA 4J0JA 5B1YA 3I2IA 1RQNA 2I7VA 3CLVA 1RZ3A 3A3PA 3N2EA 4ZOLB 3VXKA 4B6GA 5FOSA 4EGFA 5J2TA 3KUKA 1NVUQ 3Q9NA 3B53X 1JA1A 3W1VA 2PDAA 4W1SA 1Z0SA 4LMPA 2GBIA 3ND5A 5FO0A 4TKLA 3JASA 1TW2A 2PL1A 3MILA 4ARZA 1HQCA 5CURA 1BDBA 4CIAA 4Z51A 5I7SA 3WSVA 1AS2A 2J67A 1U02A 4GXNA 3JYNA 2G70A 4TSFD 3SU8A 2ZE8A 1L7EA 3QEMB 4PCAA 1MW8X 5JNTA 4AWBA 3PV0A 1UBKS 3LUHA 1LV7A 4JX9A 1CEYA 4Q3BA 2ATIA 3U16A 1C7QA 2V7QD 4JU8A 4DW8A 1U5CA 4BEJA 5GPBA 3FGNA 1NVBA 1FRZA 2CBGA 3LRXA 5DLEA 5EQFA 4HNUA 2C3OA 3U0BA 5CA1F 3PHHA 4MRSA 4W9RA 3RIGA 1KZ7B 4GP6A 4UVIA 3Q0IA 5KNLA 2VC2B 2VF5X 2ZE7A 1Q44A 4EGJA 4B4DA 2HY7A 2FPKA 4JYMA 3KE9A 1BEUB 2OY0A 4B7XA 4TQAA 3TIFA 1M3SA 1SY7A 4DJTA 1GZUA 3TIVA 1EMDA 1XMXA 2LE0A 4PXSA 5G0VA 2HUPA 4HATA 3E3MA 2WQ6A 1XLUA 1XRNA 3AZPA 2QUBA 3ZY2A 1FYVA 1GJRA 3K9LA 5CYPA 5BURA 2P9BA 4K9QA 4YACA 3F5MA 5ADUS 3OURA 2P65A 4IDPA 4MS1B 5JC8A 1XYYA 5EJ7A 2N3ZA 1F6DA 3DOOA 4JT4A 5KC9A 3ZHSA 1TYZA 1X1AA 5IANA 2CV2A 2VPPA 1OLSA 4NZZA 1DQYA 4GKBA 3NWPA 1QO0D 4GC5A 4TKUA 3WNZA 5I9LA 3QX3A 4FHEA 5EE9A 4HB0A 4OSPA 2WNIA 1HEUA 3C16C 1I2CA 2JFFA 1GZ5A 1NVKA 2C2WA 4UW9A 1GRCA 4BFTA 4C2BA 5C5DA 4OI0A 2PZ8A 2QT9A 1S2DA 4ZQGA 3IAAA 1AQJA 4JT9A 1NQTA 1FRVA 1BMQA 2YC2C 1P61B 5ELLA 2P75A 5B3AA 4YUAA 5CB4A 5T6BA 3RIHA 2C97A 1AN9A 1E98A 4WZBB 1SURA 4N6GA 5AKYA 2Q4BA 1IQ0A 4R0MA 1P0IA 1ZRNA 4ZO4A 2VSYA 2EV9A 5AH0A 5KOIA 2TSYB 3JQPA 2EX0A 2SHKA 1Y1TA 1SVMA 5K0TA 3DEZA 5E9QA 4FILA 5B2EA 4KV9A 2X42A 2QMZA 4B46A 5E3HA 1P1HA 4TXJA 4WY8A 4L1KA 4K9KA 3A9TA 4V1CB 3Q87B 5AKKA 2Y0CA 4YECA 3GIDA 4QELA 4RY9A 4O4LF 5I47A 1JLHA 5EVCA 1ST3A 2J3KA 3GEGA 5AKHA 4RPLA 1JDSA 3EA0A 3B6KA 4KDEA 2KLHA 1H2AS 1EFPB 3GLQA 3NTRA 4UCWA 4YS6A 1SOVA 4E2ZA 2AQ8A 3B2EA 3L7AA 3TGLA 1R4MB 3E58A 1VGVA 4B6OA 2JIPA 3GFQA 2FEXA 3DEJA 4YO8A 4DY4A 2CEAA 4RS3A 4BKRA 3DKVA 1XNHA 4MV1A 2AR7A 4RH0A 3V8VA 3O8RA 4PHCA 3H8JA 1C7RA 1R4AA 4F7WA 3DUWA 4NS1A 3ES9A 1F8UA 2R751 3SYTA 3L0PA 3WB1A 4EYSA 5C1OA 3GLGE 1NF2A 4A9AA 6CHYA 2QRKA 2RGGA 4U7WA 5JXWA 3K94A 1UBSB 2WIDA 4FOOA 2G83A 1V1MB 3L6CA 1PR3A 2XADA 2N1BA 4MCJA 5DHQA 1RBZA 3WBJA 2C7QA 2GPJA 1LWNA 2P2CA 4YLEA 5EPEA 2X7JA 4HB4A 4ENWA 5AW7A 4D5EA 3PQ7A 4FDTA 2OENG 1U4SA 3FKJA 1ETHA 2QYOA 3GJ5A 3ZWAA 2GK3A 1P39A 1E2HA 1NURA 2J5XA 3C6BA 2R8ZA 3ZTWA 1N6NA 1Y7PA 3J80A 3SQXA 1AQLA 3HM9A 2NT4A 4WUVA 1SU4A 4N48A 5I3CA 5KYWB 4YRPA 5BUQA 4R01A 4R1UA 3W8NA 1EG2A 3F7NA 4CFZA 1GL9B 4ROTA 4U0KA 3EH1A 2VF8A 4HI0E 1KZ1A 1WTCA 2JG3A 3AP1A 1KKLA 1ND5A 1H9AA 1GQRA 2C4WA 1EGQA 5IC5A 2I54A 3MTQA 3ZCXA 2C3MA 1JLLA 3VAAA 2IODA 3GN1A 2F1RA 2ATVA 3KLNA 1DG3A 4NFHA 3LD9A 5HTKA 3VR6A 3LP5A 5CMLA 3IQDB 1YS2X 2ID8A 2MYNA 3Q40A 3EBLA 4HYTA 2W6ZA 4RACA 4NEHB 2ZB3A 3KHSA 3ZBQA 5HKKD 2OLEA 1Q0TA 3GA0A 3F9IA 3JSXA 3HN2A 4YMLA 3P2JA 4E14A 1BHQ1 3QLTA 1KQOA 4V3CA 3GFGA 3SY8A 3UM9A 1H2RS 4IVQA 1YMUA 4WFJA 1COZA 4MW4A 4C0SA 3A2NA 2R6R1 5LQCA 4HDNA 2O8DA 3O8QB 3ZWOA 2VQ6A 2IUFA 1OY1A 1IN1A 1GGHA 1GFSA 5TJHA 5AVYA 3FPHA 1SVLA 3J81k 3WJ2A 1EUDA 1NTOA 3NAQA 1QCYA 4TM8A 3I64A 4HWKA 3EXEB 4B48A 3HNRA 3WX0A 2PUFA 1LSSA 1QZZA 4RK6A 3SAJA 3SBDA 5KDDA 3OLWA 2V6IA 1UBJS 4ETNA 2C1EA 1L4FA 2CN1A 2Y3IA 5BUCA 1Y63A 4HHEA 3MJHA 4JP8A 1GFIA 4WXPA 1QFYA 2DUWA 2FLWA 3KKZA 5TPZD 3WE7A 4YRAA 1RLTA 2OC9A 3AIMA 2HL6A 4CE6A 2VDJA 4X1KB 4C5AA 3NRCA 3G0DA 3HLTA 2ZXUA 1JQ3A 4JP3A 5DN6D 4RXMA 2GN1A 3I45A 4MROA 2EP8A 4W82A 1A95A 4KVZA 1PN3A 2FUKA 1DJPA 2G09A 4RD3A 2OD9A 5HR5A 3R7DA 1AZLA 3B9BA 3K4HA 4O2LA 2G1JA 4YCJA 3NVAA 1ZEMA 4FLMA 4TTIA 5P21A 3HKEA 3F7TA 3GG9A 3ZXSA 1R9MA 4QFBA 1G21B 2E1RA 1ULAA 1YFKA 3CPJB 4XWWA 2VATA 4PC6A 4C20A 2OCKA 2GEJA 1VIAA 2PH5A 2UYYA 1JHUA 1GV0A 1HORA 1WVIA 2WV7A 3CCBA 2ONJA 3ZWXA 2E21A 1GGKA 4TTSA 3G85A 5HKOA 2IYWA 4EKIA 3DP7A 3PNLA 1Y6FA 1YS4A 3CLTC 4DA8A 3W3AA 3TLKA 2YV1A 1CZUA 1S2GA 5GAJA 2PMDA 1N1GA 4ZP1A 3D64A 3JCZA 5JMPA 2GKOA 4AF8A 3RVPA 2JKVA 2VRBA 1AA9A 1TVKB 3R3VA 5IUJC 1T24A 3FWHA 3DAOA 4WA8A 1QR2A 4C4PA 3AI7A 1RBQA 4GWGA 4XIFA 4ZVSA 2X0FA 3UV7A 4X00A 5LDGA 5MN5A 1GM5A 1OJ7A 2H31A 2R85A 1OYVA 4WECA 2FXIA 4EENA 4GBMA 4J1TC 4Q21A 2QENA 4ZVMA 3FOFC 1GRQA 5EN4A 1ZZGA 1C1XB 3IDQA 3MMSA 2X41A 2ORIA 5F7ZA 3A1FA 4Q1CA 5ALDA 4DEVA 3EZFA 5KCZA 2XUZA 4V24A 1IHPA 3I5XA 3NFRA 5EC8A 5FOXA 1M5RA 2Q99A 1BMDA 1AHHA 1E1CB 4HFJA 1XQ1A 5K0LA 3LQ2A 3GRRA 3F8WA 1L7NA 5KSPA 2W6JA 3ZDAA 3LZ6A 3GMTA 4ZCPA 4NF2A 5GM2A 3D6JA 1UC9A 3Q9LA 2VF2A 1U3FA 4HB2A 4R2LA 1PV4A 2I3BA 4MGZR 4X1YA 5K4HA 3COJA 4ZZ2A 1V8OA 2X22A 3DVAB 4EQ6A 1ESDA 4ZFNA 1QCZA 1IIBA 3LT0A 1P73A 3LCJA 4CTMA 4I55F 1RKVA 2AZXA 3PNVA 5A9SA 5KYGA 4JLSA 4KQJA 3MWEA 1NT2A 3CJQA 1RIIA 4N5HX 1GU1A 2C8JA 3K70B 4KNWA 3JD4A 3NHKA 2CV0A 1HQDA 2J9GA 4KYUA 1JG6A 2ZCVA 2H57A 2FWRA 1N0IA 4L51A 1ZD4A 2DTXA 2LIVA 3VU9A 4F3KA 1KHTA 2CJXA 4LQCA 3JAMA 3LCCA 3VJMA 1HDEA 1EFTA 1XA4A 2NOAA 4H1VA 3AM1A 4WFQA 1JJFA 4AIRA 2LV8A 1MV8A 2OBMA 3AL3A 1QHGA 2UZIR 4XYGA 3TQIA 3HE3A 3GEBA 3ZU4A 1SA0A 1NFRA 2I3DA 2QBYA 4TM7A 1SCUB 2ET6A 2ZYWX 3LKVA 121PA 1KZGB 2QRVB 2FZLA 4R3WA 2G0AA 5JSKA 1MB0A 3C4JA 4ADSG 3LFUA 1DAMA 4Z3DA 3MMNA 2WE8A 1DWQA 2HWWA 2YOGA 2YIDA 3NHYA 4KQ6A 3SXUA 1M10A 1H8ED 2X5JO 3B60A 5IT5A 2SCUB 5KSZA 4XE5A 2EG5A 4EW3A 1SKUA 3KFLA 5BN5A 4RY0A 1N78A 4M89A 4ITRC 2ZAOA 5CEJA 5JD4A 3UVEA 4IIFA 2C5LA 4NS4A 1G66A 2XKBA 1CJMA 4UUOA 3Q7TA 4FE7A 3VZPA 2GZ3A 2GEUA 3CIOA 3KQOA 1OAAA 3LDFA 2XNDD 2OQIA 1U3VA 1MO2A 3IERA 2P9EA 3RC2A 4Q47A 3HUTA 2ZUFA 2DCUA 2BC9A 2DUMA 2IVZA 3QLVC 1ZUHA 2FMKA 3CC8A 2P7HA 3C7TA 4BEVA 3DULA 2PE5A 1VYTA 2MIIA 3X2SA 3BHJA 3H8WA 3IIMA 4CM6A 2WNSA 4GX2A 5BW4A 3KJZA 1P8JA 2H4HA 3W8FA 1Y4SA 5CDHA 1JECA 3WSTA 3IB6A 1PZEA 4YRFA 4DIMA 4IDHA 5C5CA 2H1WA 5KBYA 4MO9A 3EVEA 3ICQB 2WKSA 3ZH2A 3M1YA 4AO6A 7MDHA 1I7DA 3FFXA 3T9FA 2IHTA 5JAHA 5JFTA 3MW8A 3ZU5A 3IPCA 1JLRA 3S5UA 1TAQA 1WUJS 2H5JA 3RIXA 2G77B 1MC8A 1YZNA 1G3IA 4RK7A 3BXPA 1FSZA 5KHAA 1SKYE 4UBKA 6ADHA 3QEAZ 4D57A 4FDMA 1NW5A 4K81B 2AUNA 2C84A 1WEHA 5TF0A 2IIQA 2NU9A 3ZXIA 5CAEB 3LQFA 4REQB 4D8XA 3IUBA 2C5AA 4R98A 1ISSA 2IZZA 1TM5E 4WBNA 4HQLA 1AUXA 1L7OA 2IZ6A 1G8JA 3VR4H 2P0EA 1Q15A 5DW0A 4I4NA 5FBLB 3TNDA 4OX9B 3L7IA 3UAYA 5K3DA 5CB8A 2Q28A 3EXG2 3GPDG 1JHPA 3JY6A 4CM9A 5B55A 3N7TA 3DE2X 4DLKA 1ISRA 2LXNA 4OYLA 1E8NA 4P81A 4GE3A 4L4YA 4CT4B 4YMIA 3RTDA 1DC4A 3IAM1 4D81A 4GSYA 1G64A 1ES9A 2V54A 3LBYA 3B1WA 5AVRA 4FFSA 4FOLA 3FH0A 4B17A 5BR7A 1B2LA 1KQPA 4UPVA 5IN4A 3QG1A 1LC0A 1N6OA 2QI9F 2A5FA 2HA0A 3AF0A 4LYFA 4RL6A 5BYBA 1TQ8A 3H2YA 5AUPB 3VGJA 2DF8A 5KJCA 4C2TA 1H3EA 1G7TA 4FEEA 1XOIA 2Q2WA 3L93A 4PE5B 4KKVA 1L7PA 4C6TA 3MD0A 1Y3AA 1TIPA 4R9RA 5E4JA 4RPJA 4PYRA 4OQEA 4MVJH 1EEXB 2NX2A 3OWHA 4GVPA 4I6JA 3H1TA 3JVVA 5FKJA 4GGMX 3ZHTA 5EP1A 4CV3A 2OEPA 3BRWA 2VWPA 4XD7D 3NJ8A 5EEHA 2BGUA 3EASA 3TFWA 5E7JA 3EC1A 4OIFA 1QF9A 4WV3A 4RULA 1HZJA 2QVXX 4R8RA 4YP6A 3QELA 1W36C 3BGIA 1GTG1 2GDZA 2I3GA 2ZDQA 3VDNB 1ISFA 1IDN1 1U2DC 3QWFA 4LZPA 3VAYA 5LLTA 2C2GA 1UAAA 1XZFA 2HMAA 3M1AA 4F7DA 3TLZA 2BTQA 2QRLA 5LQNA 1VMDA 4C7MA 3KKMA 1RYZA 3A4IA 3M3PA 4IJ6A 3V2IA 2AC7A 1ZOSA 5CCDA 1OWOA 2QRGA 2AG6A 2XYQA 1L5NA 3F6BX 1T9GS 2VCYA 4HJXA 1GA6A 1TZJA 3LQYA 4WKNA 2Q07A 1VYHA 5EKTA 4O4JB 3C6QA 3PJGA 5CFLA 1NQWA 4BLQA 4EUNA 1B43A 4KE9A 2P8SA 2VA9A 4L15A 1ZGGA 4KTVE 1UZUA 2DHDA 3THXB 3VPHA 4OJQA 3FRHA 3LT1A 2P9FA 4DRXA 4ZMSA 1A69A 3ID6C 5BSVA 5CPBA 4R7TA 1KJIA 4P7FA 2B34A 2B0CA 5E4TA 1IULA 1R12A 5B37A 1ZBDA 2I4LA 2V7PA 2JEZA 3H1FA 2FEWB 3NG1A 3GFVA 3SX0A 2BEKA 4ENRA 2H5LA 2HO4A 5J5CA 4BXOB 1VI2A 4CMJA 2JJYA 2ZI4A 3HEMA 3U6BA 5GJBA 3RBAA 3QUAA 5B5SA 2HHCA 1D4AA 4LI0A 1Z13A 3G2PA 4GOJA 1WSBA 2E4XA 3O3OB 2C58A 1W5TA 3DOHA 3IQGX 2YS6A 1KQNA 3VH1A 1RI4A 2F9MA 4G8CA 5KIAA 5J2UA 2BI7A 4UNQA 4GKJB 2Q1YA 2J0EA 3JQ7A 2J3IA 1CY7A 2IPOA 1EP2B 1A7KA 4AAYA 1GPUA 2IYYA 2ZSDA 4RF3A 3SC6A 4BO1A 2D1TA 3ED1A 4IEFB 3FR7A 3KYCB 2UV8A 4KO4S 1GNVA 5T4EA 1CR1A 5ALVA 4MINA 4NBWA 1G8YA 1G5IA 4HDKA 2J7PA 2I3ZA 4F6LA 4RMJA 3HCCA 4CM3A 1E7SA 5JZSA 3Q5DA 2R6CA 4IQ8A 1IBSA 2A9OA 3JWGA 5DBEX 1KAEA 2NIPA 1WLSA 1XDUA 5G41A 3T9DA 5JROA 2O9JA 2DY0A 4LXGA 4D7AA 4KXYA 5F1YA 4ZI3A 2RI6A 3DVRX 3WL8A 2K6GA 3H8VA 4PU0A 1PK9A 4HSEA 4Z8YA 3CUSA 4PHTA 3JATA 1BYIA 2KJQA 2DBQA 1T1RA 2WTMA 2JHPA 2C2XA 4PRYA 3D8UA 1CNMA 3VVMA 3EVGA 3ZW8A 4ESOA 3E15A 3HHEA 2OBYA 4UEOA 4W8GA 1P2SA 3TEMA 5EHQA 3V4LA 4Q3OA 1PJLA 1PZFA 1PT9A 5M34A 4W9NA 1HYHA 1MORA 1WD7A 3MWDA 1U1CA 4INPA 4JSYA 3E9RA 4ZCIA 2EKZA 3TQQA 1ZUD1 1IN4A 1NR1A 1T4DA 1YB2A 3BEDA 3IMEA 4GI2A 2CLFB 3R7SA 3S28A 5D87A 1E7MA 1XCOA 1HDXA 5FADA 2FFBA 3EZ2A 2R1ZA 4HDMA 2ZQYA 4MO2A 2HCRA 3REQA 4DAEA 3EG9A 5KWSA 2JD0A 3GT7A 3PHBE 5CDFA 13PKA 2HHLA 2QLJA 3U62A 3LKBA 1X8KA 3OY2A 4C6TB 3T4PA 2FN9A 2WIAA 2XNJA 4U9HS 4YCAA 3UTCA 3VR0A 4O08A 4LZLA 2XBUA 4ENQA 2V9CA 1OXVA 2CFRA 4MB2A 5GONB 4E11A 5HWSA 1R1DA 3E81A 5CX1A 5F7JA 3RVQA 5K3OA 4QKQA 2XOKA 4NG5A 3U3RA 3BRQA 1DDOA 2P1RA 3A4VA 3AF4A 4XTCS 3H9GA 5FI0B 5EYPB 2QT1A 1F20A 2N0SA 3EC2A 1RJDA 2XHEA 3BWDD 4QEZA 3ZLBA 4AFNA 3HXMA 4YFYA 4X63A 5FPYA 1KVQA 4CODB 1NUPA 3QUTA 4K6HA 4RTSA 2QRUA 4MUHA 1RLMA 1BXRB 5EAIA 3TW4A 1ACLA 3ETHA 3FCEA 2O5RA 2HRZA 8AT1A 4BEWA 3NMUF 3Q8XB 4HK4A 3UY4A 3W9UA 1UP7A 3F96A 3JD1A 3T4XA 2V9PA 3N76A 1ZLXA 2BFMA 3AHGA 3T7DA 2ANBA 5CGZA 5JRZA 2QAGB 2BHRA 1GUAA 5AP9A 2X8LA 1NLUA 4YQYA 2GOYA 1C9YA 3U7IA 2Q4DA 1I7PA 2X3FA 3LCUA 4MWEA 4GR9A 4E33A 1DTSA 1J7JA 1G18A 3NV9A 2HREA 4Y67A 1TF5A 5D3KA 2PK3A 4LDPA 1H66A 5JNVA 3R5JA 3IDZA 2AFHE 4ZK2A 2JIZD 2CNKA 2EZ8A 5BN4B 3PT9A 3QBEA 1P75A 2BM1A 5FNVF 1T6NA 1K5PA 1W85A 1KKUA 2EKDA 2QVGA 3AYXB 4ONEA 1NVFA 3LCVB 1YBHA 4S0XA 1DC5A 4EK9A 3OUTA 5E2IA 5BMVB 1KYZA 2VAVA 3H2BA 5K0JA 1DC3A 2C03A 2I65A 2ZWOA 4UVGA 5CYGA 3IOEA 1X86B 1M2FA 1XI2A 1G8KA 1TDJA 5ESDA 2YCLA 4FHZA 1MAVA 3QG5A 3EZGA 3SLRA 4CTKA 3VUEA 3VU1A 5K8VA 1QYWA 1M1NB 1T0UA 2J9FB 3QYPA 4IFEA 5ED4A 2J7KA 3KSDO 5LR6A 2PUEA 4ND6A 5B1IA 1Z0AA 2JANA 2UVQA 2MSLA 1SN7A 2V96A 3CUUA 3EXFA 3NXKA 3R8CA 3T1OA 3TZKA 2DETA 2WHQA 3G79A 4NV3A 1OBCA 1ML4A 3AUAA 3CRRA 3JWJA 3K1AA 5B7NA 3AVUA 2HRDA 4LYDA 3TD6A 4REMA 4RCZA 5DXJA 4D80A 2FSVA 2OXEA 3WNBA 3H4TA 1JU4A 4ZV9A 1CU1A 2FP3A 3DFIA 4MCIA 3H9QA 4U0JA 2FRVA 1QX3A 1U28C 2FX2A 2ZYSA 1G8HA 3GLSA 4ALLA 4C78A 1D0SA 1YOBA 2AJ8A 4PG5A 3V8BA 3AINA 4YI3A 4WLEA 4YT2A 2Q7XA 3GLKA 2WPDA 3WKBA 3GXBA 1G6OA 4XR9A 3IBSA 5C8VA 2MSWA 2P9ZA 2XUIA 2BM0A 1I1HA 1O94A 2P8JA 2FWAA 3B5EA 4PBSA 1ZGCA 4WVFA 5FLXA 2B25A 1XJ5A 1JDBC 3ZDRA 1KWKA 3K2IA 1FVXA 3SBOA 1IBLB 2H4FA 3E03A 3L02A 1XQVA 3MYRA 2PUTA 1M2NA 4PQRA 5IDXA 4FVTA 5ILGA 3ZCUA 1Z0KA 3A1VA 4FMDF 2IOFK 2LCIA 2R8XA 5JNRA 1RAFA 2WIBA 5C8YB 2AR9A 4OV6B 1M34E 1TXGA 3OTHA 1KEUA 4M53A 5BP7A 1L5RA 2HJGA 2VF7A 3NUZA 3DMGA 4HMPA 4LF9B 1M2VA 1A5AB 1VL1A 1ZX1A 2ZXFA 1IK6A 3MOIA 2G8LA 2RGAA 4J03A 3EA5A 4TL8A 1DKMA 3R9IA 2FH5B 1ZGHA 1M2JA 4KXLA 4DHWA 2VQ3A 4HAWA 3W0LB 1NXQA 3J7AC 4A0RA 5COQA 3MZ0A 1HDOA 1KPGA 1P3Y1 4JLKA 3CLTD 1UPTA 4JP2A 4P4SA 2ZCJA 1L4EA 2O06A 2ZS7A 5KOJA 1KAHA 3JQFA 1GU0A 4KLNA 3KQPA 1SOUA 3LDUA 2QN6A 3PQ2A 3QVWA 3OJCA 4MKRA 3RSLA 3GDWA 4DIBA 4KW7A 1K98A 1U9JA 2H9IA 4BASA 3B1XA 3GUUA 2JEOA 1SXJE 4RVHA 3OE7D 1ST2A 4HGYA 1VIYA 2DQKA 3AY6A 3I5AA 5CNJA 4ZU1X 4FGZA 4NVRA 3NBMA 3R8XA 5L3QA 2CLIB 2OHGA 2NPOA 3JQCA 2XE4A 3IILA 4FZ5A 4H18A 3WLHA 2F4NA 4GYJA 2PR7A 3EW7A 1MG0A 3N2LA 2KLBA 3H2KA 3HHPA 3CF6R 3DV9A 3EK2A 4OP3A 5ALYA 5BNZA 5AW2A 1DBPA 2JCSA 4DM7A 1TU3A 2PBFA 3PTLA 3OIVA 1PR6A 1SUCA 3PBKA 1CX9B 1IY0A 2I5PO 2CXHA 3CE6A 1HK7A 1TVCA 3AR8A 4M86A 5DHTA 3NHBA 4RMHA 2ZIGA 3NJRA 1KHHA 1FFSA 3UJ8A 1TFUA 4Y6LA 4RV4A 5AI9A 4IDDA 5AM2A 3DOEA 2HLHA 4KITB 3STHA 2P4SA 2IPXA 1ITZA 3AHCA 1ZGZA 3KJQA 5JZMA 1I36A 3A2KA 1CJTC 1KRXA 4JLMA 1GPWB 2D8MA 5C9ZA 1SXJD 2CXOA 3BK7A 5DX1A 5ELMA 4KLRA 1WU8A 4XJSA 1TT7A 4DXDA 4EY8A 1QVVA 3E1KA 1LH0A 3IKVA 4HX9A 1EWRA 4ENSA 1YMQA 4G4JA 2PTGA 2VHWA 3QV2A 4LHZA 5CVVA 3WIOA 4B47A 2GZRA 1E20A 4YB8A 1Z4LA 2A92A 4EX6A 4I5EA 2BGTA 1MO3A 4BO9A 1ECCA 3I2FA 4YMVA 4QGSA 2DMRA 2FTKE 4JJFA 4PLGA 3FYTA 1VG9B 3FVQA 1LX7A 1JKJB 2OLJA 2Y1OA 4FBGA 4INAA 3OQNA 2O7RA 4WXYB 3QVMA 1RXIA 4KG7A 3ZU6A 3STTA 4A6XA 1IWOA 1EP9A 2AJCA 3K30A 5K3EA 4GLLA 4KDFA 1UBFA 1UDXA 5DXAA 5F33A 2V6GA 5KX5B 1QYCA 3HDQA 2P2LA 5CDSA 5JQWA 3L49A 4UCQA 2I03A 1PFGA 3EVCA 3CMCO 4GAEA 4I4TF 1U7TA 4PYOA 5TR9A 1B15A 2CB0A 4L0CA 1MIHA 4NZPA 2W58A 3HZOA 5FPSA 3VO9A 3BF8A 1NG9A