2N42A

Ec-nmr structure of human h-rast35s mutant protein determined by combining evolutionary couplings (ec) and sparse nmr data
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
166
structure length
166
Chain Sequence
b'MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPSIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase HRas
molecule tags Signaling protein
source organism Homo sapiens
publication title Protein structure determination by combining sparse NMR data with evolutionary couplings.
pubmed doi rcsb
total genus 54
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2015-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2n42A00
2JLSA 1OKKA 3KFVA 1VIYA 4QBFA 2W2VA 3WBKA 4KI0A 3SU8A 3FMOB 3HWSA 1DTSA 3JZAA 4C7OA 1XEWX 3LBHA 2O0KA 2VHQA 2VF8A 1DG1G 3A58B 4V02A 2F43A 1W49A 3I8SA 4Z8XA 2J41A 2OO7A 1OFHA 1ELOA 3DMDA 2PCLA 4IFBA 1G7SA 2O0JA 4OJKA 3SQXA 2GDJA 3TUJC 2YYZA 1Q1QA 1HH4A 1BKDR 1Z07A 4HDOB 1N6HA 2VA8A 4RD2A 3WP0A 3IUYA 4II7A 5JECA 4TZ0A 2EFHB 3KJGA 4OYHA 2FPKA 2ZE8A 4DLWA 4TZ6A 2P0EA 4HLQB 4WW0A 1W0JD 3RNLA 3U3RA 1EFRA 4M1MA 4NONA 4KXFB 1T8TA 2UZ3A 4LHXA 2QSYA 2YOGA 3UATA 1YZTA 4LJ5A 4DLSA 3LXRA 3LX5A 2WV9A 1Y3AA 3MD0A 2QZ4A 3DHWC 2R8RA 1XXHB 3PUVA 4Q9IA 5A4JA 2KBFA 3H4MA 4IOLA 3EXAA 3F8TA 1FP6A 1XBTA 1N6PA 3E70C 3AKYA 3D3QA 4LHYA 2V8OA 5JJKA 4LBYA 3ICEA 3RAPR 2OM2A 3GLGE 1N5KA 1FL9A 1OLOA 5EXSA 4IOMA 4YQFA 1RYHA 2P2LA 4GDFA 4UJ5A 621PA 3QEOA 1PLKA 2CNWA 1N25A 2FMXA 3AVQA 1C9KA 1K5DA 4Q66C 4MA4A 2FFAA 4WBSA 4G5SA 3TRFA 3WYGA 4DEXA 3B1VA 3FFBA 4I4LA 2ERYA 2CHVA 3U2QA 4MDFA 3CLVA 4BFYA 2W58A 1WBDA 1D2NA 2QMUA 1H8ED 2EWWA 1M74A 1W47A 5FUVA 5KNDA 4Q03A 5ANRB 5FOUA 3DEFA 2V1UA 1N5LA 4MUBA 1AZSC 1OIXA 3O47A 4P4SB 4Q00A 2IYSA 2JJ1A 2W2TA 4X8MA 2OXCA 1WMSA 3ZGXA 2NIPA 2RB4A 2XTZA 1DAFA 3NH6A 3ZQJA 3T5DA 3GJXC 3VKGA 2YJTD 1MO4A 4D26A 1OKKD 1IN5A 3IPXA 1OSNA 4KFSA 1EG7A 2DBYA 2XSZD 3KXLA 1U90A 2WWYA 1EFTA 4R7ZA 4EUNA 1XX6A 3EWSA 2LKCA 3LX8A 3RLFA 3FPAA 1FX0A 1RRPA 4MRPA 1DAHA 3QXCA 4AKEA 3UPUA 2P6UA 2QENA 4TSFA 2ZVQX 1UKEA 4B2IA 1B0UA 4DT1B 2ZRCA 3E1SA 4FCVA 1IOZA 2BJVA 2A5JA 4OL0A 4UNQA 4BE7B 5L3SA 5DE3A 4BWYA 2ZRKA 4YDHB 5DLQC 1Q0UA 5AJYA 1BMFD 1NIPA 3ADKA 4L9WA 1S4QA 1LNZA 4AD8A 1DEKA 1L7VC 2MSEB 5JS8A 1BH2A 1NVXQ 2AWNA 3CZQA 5H68A 4R98A 3IBYA 1EFRD 5FOVA 3X1ZA 3I8XA 3ZVMA 3ND9A 1G41A 1R2QA 1G3QA 2IW3A 4ACAA 1M7BA 2X19A 4ITRC 2GCNA 3ZVRA 5L3RA 1J99A 1ZRHA 1CJKC 3AQ4A 1NSFA 5BXQC 2I1QA 3NDPA 5FUYA 3QVUA 3T1OA 3OAAA 1SVIA 4HLUA 4JMPA 4FMDB 4NZYA 3B13B 1E2KA 2GAAA 1E2EA 4M2LA 1U99A 4M8NE 3GLGA 821PA 1KSGA 1P73A 1M34E 2B7CA 3CONA 4DUGA 3DKVA 3HR8A 2CHQA 5DN6D 4JLJA 2QQ0A 2BM0A 1G8YA 1IQPA 3CO5A 2G9NA 2JJ8A 2ONJA 1W5SA 2BMFA 1GDDA 1E9CA 5L3QB 4EPVA 3C16C 3K09C 5JI3E 3U6BA 2HUPA 1IONA 2J7PD 3A1VA 2ZQ5A 1IJEA 2NMVA 2VP4A 1SKYE 1E94E 4A0GA 2JA1A 3QXJA 1E9FA 2QPTA 2CL7X 1DAMA 1KJWA 4V0NA 3GLHB 4JT2A 4TYQA 1NJFA 4A6PA 4IEIA 4XVQA 1W5TA 4DSTA 4A8JA 1E9RA 5L3VA 3VNUA 1R0YA 2GESA 4G3XA 2QPOA 2YVUA 1CJTC 2HF9A 4M22A 1MT0A 1NJGA 4ZDKA 4DLUA 2BBTA 1RVDA 4OK3A 1Q3TA 2QL6A 2C04A 3SHWA 5JCPA 2YWHA 1COWA 2PBRA 4GSYA 4BFWA 4G5GA 5CLQA 1Q3HA 1XTQA 3DKPA 2GZHA 3OEHD 3WYFA 1E2DA 4ZI3A 3ZIAD 1NL3A 1F6BA 3O8CA 4MQBA 4M1WA 4JIMA 3QUSA 1US8A 1QVAA 3CPEA 1W36B 3GJ3A 1JJVA 4M53A 2B7BA 1GZSA 4B71A 4BLOA 3QOFA 2Q3FA 2XB4A 2P67A 4KBGA 2O8CA 1KDPA 4IDNA 4O0MA 4F91B 2ZITA 4FW9A 2ATVA 4L5BA 3AGPA 4Q02A 3I3SR 4C2UA 1G1MA 4OJQA 2H92A 1BYIA 2QU8A 4IKEA 3UANA 1DVRA 2GXAA 4DLTA 1JAIA 4JLVA 3RABA 1MKYA 2DCUA 4WIAA 4Q9KA 3K0SA 4DLVA 1ZYUA 1HTWA 2RGGA 4QBGB 5KDDA 2XSZA 1QHIA 1ZW6A 1HV8A 4HYYA 2GJSA 4LBVA 4MKFA 4Q48A 3FB4A 2D62A 3IEVA 3DZ8A 5CLLA 3KUCA 4V0LA 1TUIA 2OCPA 2OUKA 4Q1DA 4EKDA 4PC1A 2G1JA 2JAQA 4HATA 2AXNA 3K70C 2IK8A 4HAVA 1P72A 6Q21A 3U7GA 1LF5A 1FOEB 1OFUX 1Z06A 5B58C 1DS6A 1IN7A 4CGZA 2DR3A 2O8BB 5JHGB 4B44A 4TMZA 2HJGA 1SVKA 1NVWQ 2RGEA 1SXJD 1ZINA 4IXNA 1KDTA 4KODA 5FPYA 3TGPA 3REGA 4BFTA 2DFKB 2QSZA 3FKSD 3H86A 4HZUA 3OZXA 4W5HA 1GTVA 5TY0A 1MO6A 2ZR0A 1Q1BA 1KY2A 2ZPTX 2OAP1 3NXSA 1TADA 5J4YA 4FWTA 4KCGA 3BRWD 4AKIA 2R6GA 4TMXA 3VMFA 1T4GA 3HP1A 3M1IA 1D9XA 4P4UA 1G7TA 5JBQA 2J46A 4B3DA 5EZ6B 3GPLA 2JASA 2AFHE 2GBLA 3EZ9A 3PEUA 1S3GA 2CHGA 2ZJBA 4B3XA 4DC9A 2OCBA 1N6KA 1ONBA 4KAXA 4IVQA 2RMKA 2NOAA 4QHSA 4BFSA 1G20E 3FMFA 4Q7KA 1J70A 1G18A 1DARA 3IEUA 1WA5A 5TDHA 4XTCS 5HE8A 5E7JA 3GLFE 2HT1A 4DB2A 3K0FA 4LYAA 1QVRA 2W83A 1RRCA 1MH1A 1VKJA 3AF1A 4Q4AA 1JPJA 5J40A 1RC8A 4E5UA 4LJ9A 3P26A 2FJUA 1KNQA 2J87A 1P4SA 4Q7MB 5AR1A 2QMHA 4DZZA 3ND8A 1KI6B 1G5TA 4EPXA 2ZVPX 3GFOA 2B8TA 3PEYA 1BS1A 1G291 2F1RA 2IX3A 2A5DA 4G5RA 3K09A 3QKUA 4C3ZA 3GJ0A 4RD3A 5FI0B 1DAEA 1RYFA 1CULC 5FPSA 1O3YA 3DM5A 1BOFA 1YR9A 1KZ7B 5KYKA 2GEUA 4NE2A 4V0ME 3FDIA 2ZRDA 4QBHA 2GCPA 5DISB 1FMLA 1JR3E 4P32A 1A2KC 4B32A 2ZETA 2G6BA 1J90A 3ZVLA 5AUPB 8OHMA 3U3KA 1A82A 1F5NA 3QF4A 1ZM3A 1JEDA 3CRMA 3IDQA 1XNJA 5KSOA 2KJQA 3CB4A 2D7CA 5FTJA 4K8OA 4BFUA 4BEBA 4OK6A 2W6ID 3EZ6A 5K8UA 2HV8A 1HT2E 4Q9HA 1NG1A 2A5FA 2WJHA 1VMAA 4XTRA 1E4VA 2C03A 4PSKA 3SHFA 1KYIA 4ERNA 1HY3A 4Q4HB 3SI7A 5KOYA 1YZQA 1SXJA 2WVJA 5CYOA 2O8FB 3FMIA 4NPHA 4M1TA 3LY5A 3GLIE 1S3SA 2YHSA 2UVQA 1FQJA 4FINA 4XIGS 4RY2A 4GBMA 1Z5ZA 3CM0A 1TNDA 3JVUA 1E3MA 1E2MA 5EE9A 3P27A 2ZIAA 4MGKR 3W5JA 5JEEA 2V6JA 1XCMA 1T0JB 4TMKA 2HXSA 4E09A 3H2YA 1G8HA 2ZS8A 4QGGA 2P5TB 3U4QB 1ZNXA 3WBJA 1WF3A 5B30A 2Q6TA 1ZIPA 2CCJA 2RKOA 3L8ZA 4RFVA 3OIYA 5CB8A 1XMJA 2QNRA 4L4UA 3TQCA 4QOSA 3PV0A 2HT6A 2F43B 2ZRBA 4UKDA 2GETA 2BKEA 4A2PA 3FKSA 4LBWA 4P33A 3KB2A 4PXAA 5GJVC 3NC1C 1CR1A 5TMPA 2GXSA 4RD4A 1XD8A 1VYTA 3I73A 4CRWB 5LPNA 2IHYA 2BCJQ 3CRRA 4TLBA 2WJVA 5AUNB 2CL0X 2FNAA 1FMJA 5BN5A 2O5VA 1JI0A 5E7MA 2IBMA 2QM8A 5LBIA 3MFYA 5EE1A 3K9HA 5FOSA 2ZRPA 1GVNB 1IBRA 2BIFA 4URUR 4ZDJA 3FHTA 1ANKA 1XEXA 3KQLA 5FOTA 2R2AA 4DCUA 3FHOA 2QN6A 4H9GA 4M1KA 5D3MA 1EX6A 1N6NA 4W7SA 1X8LA 2OBMA 4PPFA 2N1BA 2WOOA 3M4YA 1UEIA 1SQ5A 3RSLA 1NLZA 2VSOA 4OHXA 1EK0A 4NYIR 2QRNA 1DBSA 2EWVA 2A7QA 1KO4A 2C5LA 4XH9B 2VF7A 3R20A 3PQCA 4TTRA 2J5XA 4LGMA 4QXAA 3PUXA 3IBGA 4Z54A 4TLDA 1JALA 3KTAA 1OH8A 3T61A 1XXHA 1T3LA 2ORWA 4KO8A 1C4OA 3WMGA 1M1YE 2ZJZA 4DSOA 4TQAA 4BLRA 1E0JA 2I4IA 1R5BA 4KSBA 3FYHA 4ZKDA 4US2R 1UBEA 3AH8A 1KI2A 2JLXA 2B8WA 3SJZA 1OYWA 3GJ5A 2R65A 3QF4B 3AM1A 3CIOA 1KK3A 1CS4C 1R7RA 3NHAA 3R9XA 4PZLA 3EPKA 3LFUA 3SC3A 3RS4A 1XMSA 4KFUA 2PJRA 2ZRLA 1PJRA 4NHOA 1S8FA 4E22A 2CE2X 1N2CE 4A0FA 1AS0A 3QXHA 2BEJA 4CEHA 2BMEA 3SFVA 1E96A 2EFEB 4L9SA 2QE7A 3ZQ6A 1P6XA 4Q1CA 2IXGA 2Z0MA 3VX3A 5CDFE 2ZRFA 2H1LA 5G41A 4RKFA 1FTSA 2D06A 2ZAMA 2ZUCA 4Q5IA 4NYMR 3ZZUA 5FL3A 2XXAB 3NEYA 2C9YA 4YXWA 3BFVA 3TVTA 4B48A 5DH9A 4FMDF 2XNDD 1WB9A 1R8SA 4XVUA 4JVNA 2FFHA 4GRAA 4B35A 3KKOA 2VPPA 4A9AA 1ZD9A 4F7WA 3UKDA 1YRBA 1ZJ6A 1AS2A 1ZAKA 4AIIA 2O52A 1JXMA 4QRHA 2J7PA 5CM8B 1Q1EA 2NQ2C 4XSGA 4JSTA 2CLCX 4LYJA 2OBNA 5B57C 5HZKA 3ONWA 1D6JA 4IHQA 1PLLA 1XEWY 1Z0JA 3BB4A 3PENA 3R8CA 1CRPA 2B21A 3K9NA 2EYQA 1OPXA 2VO1A 5JRJA 2ZXUA 4A0HA 1KO5A 3MLEA 4EFLA 2FGJA 3GFTA 5FPKA 5KNBA 1K6MA 1G19A 1UFQA 1SVWA 2J0UA 4Q7JB 1G5PA 4URVR 2QEQA 1UDWA 4TT3D 3KQNA 4PAOA 1KTVA 2FEOA 2QUZA 5JSZB 2YV5A 1Q21A 1COWD 2C77A 3D8BA 3EASA 1OJLA 4LJAA 2AKYA 3Q9LA 2WWXA 3X1DA 4LC1A 3SYLA 3ZH9B 4IEEA 3EZ2A 3ZIAA 5F9FA 3RS7A 2GF0A 3M0EA 2R6CA 5DGXA 2IT1A 4AKHA 5JI2E 3OFND 5H70A 5HTKA 4QHYA 2YOHA 4HB4A 3TK1A 2F1IA 3FHCB 5L8VA 4BLTA 1AM4D 2ANBA 5FL7A 3TLXA 4X8LA 3N2EA 2AWOA 3J81k 4DT1A 1WDTA 3CNNA 3A4MA 3BC1A 4PO1A 1XJQA 2GK7A 1IJFA 1TF5A 3BB1A 1F2TB 2EYUA 2O0HA 3E5HA 3QENA 5CM9C 4BECA 4D4MA 3U61B 1QHXA 3Q3JB 2JLUA 1XMIA 4MYUA 3QNUA 2CVFA 2JCSA 4RD1A 3RDPA 4LDJA 5DYGA 2NZ8A 1KDRA 2ZS9A 1II8A 2IF2A 1KSFX 1ZM9A 4NCIA 121PA 5IDVA 3B1WA 2X1VA 3BB3A 1WQ1R 3C41J 4KVGA 3B78A 3IKJA 2H57A 5FI1B 3QXXA 1NI3A 1LY1A 4M1OA 3TIFA 4LJ7A 2O8DA 4DWJA 1ZMXA 3I61A 1S2MA 1OXSC 3BE4A 4HLUC 2XZOA 5DIFA 2N42A 4F93B 4DIEA 2FPMA 3AP1A 3GEIA 3FVQA 2O8BA 4B47A 5FUXA 2QTHA 5TB5A 3SE0A 5JFGA 1Z6XA 5AUOB 1IAQA 2GCOB 3T1QA 4JVLA 3U7FB 4PZZA 3H0KA 1F2UB 4TLEA 2VHCA 2F1JA 4MH0R 1E2JA 3W3ZB 3PFIA 3GQBA 4OI0A 1KI7A 4I1UA 1NVVR 4R2IA 1E9SA 1DOAA 4EDHA 2P65A 4BZQA 4US0R 4B6FA 1NN5A 3RRYA 2QBYA 5JRZA 3QQ5A 4HDQB 4WZBE 2IUTA 3F3YA 3I62A 2R44A 3K70D 4AURA 1W4CA 3U7HB 1SHZA 1KY3A 4JLNA 5G3YA 3WMFA 1G9XA 4D81A 1UBCA 2Q9CA 2VHUA 2QP9X 2VLIA 4Y0AA 4CIDA 4ZCIA 5HR5A 3K8YA 3TR0A 3BAFA 2LKDA 4D2IA 5KSPA 2PT7A 4I99A 4UXJA 2PLRA 3T06B 2GJ9A 2ZRMA 3BJIC 4IDHA 1KMHB 4QBIA 3LO5A 2OV2A 2WJIA 4Q4HA 4FMBB 1R0XA 2GWHA 4Q18A 1JXOA 4UXHA 1XTIA 2O8EB 4YMUA 1TEXA 3SQWA 4A2QA 3VU9B 4B2PA 2JDID 3K1JA 3W6NA 1S96A 5FTMA 2XJ9A 4Q9LA 3THYB 1W7AA 3NBFA 3OHMA 1GL6A 2OCAA 3RWMB 1UBGA 2OZEA 1ZIOA 3X1WA 2O8EA 2D3WA 3U60B 3DOEA 3H84A 2J0QA 1IXSB 1XPOA 5JWHA 5TXGA 2OFWA 1G8PA 4N0DA 4HEJA 4UQOA 3UG6A 4IJMA 5G53C 3WHLA 1G16A 4FXPA 2DWOA 2WKPA 2ZJOA 5J47A 3CPJB 1XB2A 1R4AA 3UMFA 3F5FA 4DLZA 4OQLA 3L0SA 2Q3MA 2PEYA 3IILA 4A2WA 1P5ZB 4DCNA 2QGZA 3KJHA 1U98A 1DPFA 1NKTA 4KBFA 1WRBA 2VHTA 2C96A 4HSEA 4LCBA 1D5CA 3MJHA 4QL3A 5KTYA 1JR6A 2RGBA 3S1AA 5JEDA 4DKXA 1GRNA 1UDXA 1VTKA 3L8YA 2DFLA 4MYTA 5EXTA 1PZNA 1ZCBA 3N5CA 1CR0A 4JVSB 2WKQA 3KQKA 4KHZA 3TKLA 1NSTA 1GILA 3KZ1E 2P3SA 1W0KD 1SXJC 5GJWC 3O8RA 3V00A 1W4BA 3NWJA 5HCNA 4XWAA 3IIJA 1XP8A 4AYWA 5IHPA 4PC2A 1HQYE 1NBMA 3V4FA 4GZMA 4JSYA 2F9LA 1UKZA 2IYVA 2QAGA 4PR0A 2XNDA 5IRCD 1SKYB 2BC9A 1ZBDA 1D8TA 1DO2A 2D4HA 3EG5A 3GEEA 1TL7C 2GZAA 1ZC4A 4MGIR 5GVRA 2GF9A 1ZNYA 2IUUA 2ZROA 1II9A 4M21A 3ZLJA 2VYFA 4KLZA 4JKIA 1TAGA 2RGNA 4LJ4A 4B3CA 1JNYA 3CWZA 4PHHA 5C18A 1KMQA 4LRWA 4PC6A 3SYNA 2NGRA 2ZSFA 5TARA 3C5CA 4A4DA 2W6JA 2BM1A 4F4JA 2BMJA 5CDFA 1IY0A 1KZGB 1I2MA 3D7MA 2FU5C 1NF3A 1FP7A 4EIWA 1Z3IX 3RC3A 1ZD8A 1AS3A 1RJ9B 3HR7A 2JLYA 4C0BA 4RSGA 4URXR 1LV7A 3K70B 1GKUB 1JQLB 3O8BA 4CW7A 1P9WA 2WHXA 1O87A 4XJXA 2FX3A 4C0JA 1MABA 2YOFA 1S0UA 3AVXA 3RYTC 2QTVB 2XJ4A 3AKDA 3OESA 1CR4A 2N46A 1N0UA 1Z08A 2OCYC 3DVLA 4F92B 4WOPA 4KV9A 2JDIA 3CNOA 1J2JA 1RRGA 2BV3A 3TBKA 2BCGY 1LB1B 2VHJA 4MYHA 1VCIA 1GNRA 1Q1ZA 4LBZA 3LWNA 4M9SA 2W2XA 5HPYB 1A2BA 1E9EA 3B9PA 1EWRA 2JATA 1OXXK 3MWKA 2NO9A 1KO7A 4X8HA 4JL8A 5HE9A 4BLSA 1E9AA 1NLYA 2QP3A 4RZUA 1NY6A 4C0AC 2DYKA 3BIFA 3CUEF 1U8YA 3TE6A 4ZO4A 2XTNA 3AUXA 1HQCA 3RC8A 4FMCF 1RRFA 4QNMA 2WM9B 3FMPB 4FWIB 5FTNA 2KB0A 5J5CA 5KO2A 1PV4A 1KI9A 3LW8A 4EQ6B 2REXB 3AF2A 1Z0IA 1EXMA 1P2SA 3UWKA 2BMDA 2OFOA 2DWQA 2IYRA 1JR3A 2JJ2A 4U5XA 1GAJA 1GL7A 3TH5A 2WIAA 1XFAA 1Z0KA 1GM5A 1LF0A 4BASA 1W4RA 3B9QA 1T5LA 1WP9A 2CNWD 2IA5A 4FI3C 1E2FA 4FD2A 5DHAA 4ZV4A 2AX4A 1TUEA 1NBMD 1QG4A 3OE7A 1XTJA 5FPHA 1MRNA 4Q4JB 1SKQA 3C14C 1CXZA 1VPLA 1US8B 4Q7LA 1VHLA 1WCV1 2Y8EA 1R8QA 2AK3A 2PCJA 4JYCA 1GKIA 4K81B 4QHTA 4NTZA 4YXWD 3VU9A 2BBWA 3P1JA 2WWGA 5D3QA 1ZP6A 4A6XA 5G40A 3KKNA 3AKCA 3SBEA 2ZI4A 3P20A 1JJ7A 3EIEA 3RRMA 1OW3B 2GILA 4IVPA 2C78A 4LC0A 5B2ZA 3QPWA 2Z5FA 1NN1A 1F48A 2KWIA 5KPDA 5AUQA 1UKYA 4IXMA 2ZI6A 1TQDA 1HT1E 3VX4A 2ZM5A 3B5JA 1NMYA 1X8JA 2BDTA 4BZXA 3FFAA 3I32A 1L8QA 3T12A 1ZNZA 4B3FX 3QPVA 5IT5A 2AHOA 1M2OB 1FFHA 4OI4A 3CPHA 1XEXB 4AK9A 2YZ2A 4TN1A 3VR3A 3P4XA 4OHWA 4V0MA 3KKMA 2J0VA 2MMGA 2V9PA 3VQTA 4C4PA 4DBLC 2QGNA 4PPQA 1W2HA 4TL9A 2CLSA 1YRAA 1JQJC 5KSZA 1QG2A 4J0QA 3QPUA 1E32A 1U9IA 1II0A 3SZRA 2ZRIA 4MDEA 3U44A 5CITA 1L4YA 1E9BA 4I1OA 1N0VC 4A36A 4M4SA 2NPIA 2REBA 3GFPA 2IYLD 5AJZA 1Z8FA 2R62A 5HKKA 1X3SA 4D0GA 4TYPA 3FTQA 1T0HB 2WPDA 3ETLA 1LTQA 3K9LA 3Q5EA 4S35A 2ZTSA 3K0CC 2CL6X 1ZD1A 3LBIA 1VIAA 2XNSA 4B3BA 1NG9A 3ASYA 2DY1A 1P2TA 2D7DA 4WVFA 2IS4A 2Q3HA 1Z2AA 2QROA 1CIPA 2FPLA 2H7VA 1KNXA 2J3EA 1Z22A 4LWZA 1D2MA 5BWMA 2RHMA 1OH6A 1XF9A 3WY9A 4CZ2A 2MMCA 3QKRA 3LAWA 1E1QA 3HYTA 1KSHA 5G3ZA 4B6EA 1UPTA 1HUQA 3HJNA 2NO1A 5HZHA 1A5TA 5K8TA 4C0LA 1YU9A 2FGKA 2QG6A 2QT1A 2GJKA 4TQ9A 5UKDA 4D25A 2OSBA 4EFNA 4PTLA 3MWJA 3IIMA 4GI7A 3U7EB 5JJIA 4QGFA 1JB1A 2IS1A 4TMTA 3G82C 2FSIA 4A1FA 1RZ3A 2OG2A 3OE7D 1NBME 4IOKA 5LDDC 5FPTA 2C9OA 4HAXA 4Q1FA 5LB2A 2AN9A 1G8GA 5K8LA 1YZNA 1DAIA 2GKSA 2RHDA 2AXPA 1P61B 2RH5A 3AF0A 4LOAA 2VIIA 3U5ZB 2REOA 1ESNA 3EARA 5SZKB 1GL9B 4NYJQ 4P3YA 4DJTA 5JWRA 5SZJA 1YKSA 3RS3A 2J9RA 3OEHA 1N5IA 2ZAOA 1IN8A 3GCGA 4RKEA 4MKIA 3PG5A 1I2DA 3Q7PA 4CT5A 4ZDIA 1D9ZA 1S1MA 4HAYA 2XOKD 1LS1A 2C9CA 4LK2A 2WAYA 4OBEA 4IVRA 4EAQA 5GADl 1CKEA 4G1UC 4NCJA 3VR1A 2A5YB 4LV5B 4N0EA 4HAUA 4AWXA 3DMNA 5JS7A 3IQXA 3FKQA 1G6HA 4FIDA 3SBDA 1EWQA 1YR6A 1KI4A 4RD0A 1TMKA 4KVAA 4LZZA 1D2EA 3I1FA 4ILEA 3LLMA 2FE4A 1W36C 1QHNA 3LDAA 2G0TA 3NHBA 4AG6A 5EP1A 2IS6A 4TYNA 2WWHA 4DCTA 2C8VA 1XU4A 3RANA 2Q21A 1Z6GA 1U0LA 3CR7A 1EX7A 3KB1A 1AZTA 4MGYR 3MWYW 3CRW1 4LUCA 2JGNA 3DZDA 3D6TB 3K53A 1NRJB 2PZFA 4OK5A 2X77A 1N6IA 3QG1A 3CX8A 4TMVA 1E2IA 1YZUA 5JCZA 2HXYA 2ZS7A 2XGJA 3HYRA 4BFZA 5KSYA 4BLPA 4RZ3A 1FQKA 2IUSA 4C0QC 3GLIA 2NPFA 4HUQB 1CU1A 3AEZA 1AGPA 4O25A 3K9GA 1AA9A 1G4AE 2WMOB 5GJBA 2FEMA 4A8JC 3NVAA 2I3BA 4GP7A 1RIFA 3QBTA 4URWR 2CE7A 2XX3A 4ESVA 3U44B 4BFXA 1OYYA 3AB3A 3LNCA 5C46F 2IYWA 1SVLA 1Z47A 2YC4C 1NP6A 1XJCA 2JEOA 2VP5A 5KNCA 4EPWA 5JHHB 3QKRB 4Q1AA 3NIBA 2XB2A 3W34A 3WNDA 1E1QD 2X2FA 2VTKA 1UJ2A 3PR1A 2VSFA 3F0TA 1FTNA 1OIVA 2A2ZA 4EPYA 4M9QA 1X8KA 4TMWA 2PZGA 1XEFA 2YINC 1MOZA 5IK2D 5LD2B 5E7IA 2A3RA 1OH5A 1Z29A 3AUYA 3R8FA 4CT4B 3PITA 1XPRA 3PEWA 3NDBB 5J4LA 3UMRA 1E0KA 1F60A 3B7GA 3HU1A 5K8IA 2F9MA 3GLHE 4E03A 1F2TA 5FBRB 2BJWA 1P2VA 4DDWA 2F55A 3U3MA 3AVVA 4JLAA 1E4YA 2V4ZA 3GJ7A 5DO9A 2CVHA 2ZJ8A 2PX0A 4B74A 1KAGA 4DIDA 2QRZA 2GJ8A 2GHIA 3K0AA 1BO6A 3EIHA 1S9DA 2J0SA 5SZHB 4QFMA 3ZJYA 2LWIA 4JL6A 5EE5B 4OHYA 1M8PA 2DHRA 3CX7A 2QBYB 3GLIB 3EZ7A 2JLVA 1QBKC 1Z83A 4DEYA 3UK6A 5EZ5A 4OHZA 2ZEJA 2IYYA 2WKRA 2I1VB 2OBLA 3SOPA 1Q20A 4PC7A 2H16A 2TMKA 3ZYCA 2MSDB 3E2IA 1HA3A 2VEDA 4HZUB 1EFUA 4TL7A 3AVTA 3KTAB 1E6CA 1S1CA 3NBZC 1KGDA 1ZU5A 1E2QA 1N0WA 2W0SA 1RJ9A 1K5GA 1R0WA 2ZSEA 4IDOA 4A92A 1KK2A 1IN4A 2W0MA 1XMVA 2EFGA 3NBXX 4NCNA 3VFDA 2J7KA 1E2NA 2ZJAA 3ECCA 2A78A 3WRXC 3AVOA 3CKLA 2ZJYA 3TW8B 1QHHB 3K0CA 4HAZA 1OFTA 2ZREA 2G1KA 2VRWA 5AK0A 1Q12A 1NLFA 2P6NA 5LB4A 2V7QA 2FZ4A 3OEED 4D82A 2RGCA 3THWA 2R6DA 1F3OA 3LVQE 4PSVA 3ADCA 3C4JA 1ESMA 721PA 3NH9A 3X2SA 3PUYA 1QHHA 2KBEA 2NO0A 2FV8A 2HCJB 3MAAC 3THOA 4BPBA 1T5IA 3TJZA 2FSGA 3CX6A 1W44A 1ZUHA 1FUKA 3PUWA 1U9IC 5EP3A 4QGAA 2PLFA 4YMTA 1DAKA 4M0LA 3CW2A 4TLCA 1NKSA 1HE8B 3NG1A 2XZPA 4YMVA 1ZVQA 1FPMA 2CMKA 2G88A 2HDNB 4LI0A 2O8FA 2A30A 4FCWA 1KSJA 5KDOA 2D2EA 2XTMA 5IK2A 3QKTA 4PAQA 1K8RA 5CIQA 1P7CA 3TSWA 1XCPA 4XWKA 4B75A 5JLJA 2C99A 2OXRA 4ARZB 3WRYC 2CK3D 5EP2A 2KE5A 3TVDA 1OV4A 3WP1B 2IWHA 3S1AB 4URZR 4MUAA 1DAGA 1KO8A 2RGDA 2HCBA 4V03A 1GG2A 1VG1A 3BOSA 1RE0A 2WZQA 4F4CA 4MGZR 4W9MC 4ZDWA 2ZI3A 2OLJA 4YC7A 4HAWA 4LSGA 1G5RA 1KI1A 4JVMA 4RFSA 3T35A 1P62B 3X1YA 3EPLA 2XZLA 1YR7A 1VYVA 5TVKA 5FOWA 2X2EA 5A5GA 1KI3A 3Q7QA 4PO8A 4V0OA 4HDCA 2VQSA 2O8DB 4L15A 1SVOA 3DOFA 4O2LA 4IRUB 1BIFA 2IWRA 1OHHA 1QZXA 3LLUA 4OI1A 2ZSAA 3SYKA 1OXVA 4EQ6A 3GLFA 4CEIA 2DFNA 2P5SA 3R7WB 3I72A 1U8AA 4D4LA 1NVVQ 4IW3B 4MKGA 4H1UA 2C98A 2VH5R 4MRNA 2V3CC 3CF0A 4DVGA 3AVUA 2BBSA 5CB6A 3B8HA 3PIRA 2NO6A 2Q0HA 3LQRA 4MITA 3EPJA 1G8FA 3RHFA 2IXFA 2F3TA 2J1LA 2PL3A 5EXXA 3CH5A 4LV8B 4MRRA 1JBKA 4CYMA 2AR7A 2AFIE 4P4SA 1G7RA 2WSMA 4RZ2A 4JJKA 3QKSB 1OB2A 4TYWA 4HI0E 3REFA 4GL2A 1AKYA 2G77B 2G3YA 4QJ5A 3ADBA 4QJ4A 1OF1A 1WE2A 2ZYVX 2BHRA 1MV5A 2WWIA 1E98A 3KQUA 2ZU0C 1T3SA 3EW9A 4UJ3A 4UXIA 3A4NA 4EJSC 2UZIR 4PQFA 4POAA 1I4DD 3BWDD 1XRJA 1H8HD 4ASUA 4FMCB 1KKLA 1X6VA 2PX3A 4KLNA 1AIPA 3CF6R 4LHVA 2ZSBA 3BFKA 5DI9A 1R0ZA 5E3HA 2GA8A 2JLQA 1TU3A 3W8RA 5F98A 3LD9A 5FH9A 1ETUA 4OQNA 4NBSA 1T3HA 3LH5A 3ZZTA 1YHNA 3L0OA 1Q57A 2ANCA 1DE0A 4GPTA 2GBLC 2OHFA 3H1TA 5DHFA 3ZS9A 2YWGA 1M7GA 2F7SA 4ZCLA 5EE0A 3BFXA 2E87A 2Z6VA 1E69A 1WXQA 3GLHA 3IHWA 5FL7D 4HLDA 2EQBA 4CF7A 1S9HA 4TLAA 2D2FA 2JJ1D 3CZPA 4RCYA 4JS0A 4XSHA 4QC2A 4BQSA 2GXUA 4BUJA 4QGHA 2MSCB 3EIQA 3KJEA 4P0TA 3TAUA 1P60A 2HJVA 1YE8A 2JLZA 1KAOA 2VL7A 1P3JA 4Q21A 4Y0VA 1W48A 2WJJA 1NMXA 1EFCA 4DLRA 3AVWA 2ATXA 1GRQA 2OILA 5JWOA 5AWFC 4XD7D 1A1VA 1KDOA 2Z43A 3JVVA 1IY1A 4Z8YA 1YZKA 2NZJA 5A0FA 4EJSB 1SZPA 1OHHD 1NMZA 1XD2A 3IGFA 4KYIB 4E07A 2JLRA 1J8YF 1L2TA 3EC2A 5KHOC 3TW4A 3BK7A 4JKYA 3CWQA 1X1RA 3EWAA 4ZPXA 3CF2A 4L16A 3NKVA 2YNMA 1X1SA 4N3NA 4GNKA 4DXAA 1OT3A 1CEEA 1NY5A 3GJ6A 5JSZA 2V54A 4N1AA 4HZIA 3AKEA 5KU1A 2XOKA 1Z6AA 3GD7A 4PHFA 5AJVB 2G0NA 5CK4A 1W36D 3R9WA 4WZ6A 2OEPA 3K0EA 3I4LA 4NCHA 2ORIA 3Q5DA 4KITB 3OIWA 1RFLA 4BRWA 5CYPA 3BERA 2GNOA 4FN5A 3NTUA 4C9BA 2A5GA 2EFDB 3C8UA 5BN4A 1VECA 3IO5A 2GJAA 4EFMA 3A1WA 1E9DA 4JLPA 3G5UA 5B64A 1A4RA 4W5JA 4AYTA 1LS6A 4KJZA 1JEEA 4DDTA 3THWB 1GNQA 1CTQA 2PMKA 1KOFA 2IYXA 1E2PA 2VP6A 4IDQA 2ZE5A 4PO9A 4TSFD 1W0KA 3BH0A 1NN0A 2CEAA 1KKMA 5CJ2A 3SDZA 4C0SA 2ZR9A 1NVUQ 3A8TA 1YQTA 2ZJ5A 1KMHA 1AQYA 521PA 4B3GA 3P4YA 2WOJA 2RCNA 2QORA 3MMPA 1NIJA 1VG0B 2ZUBA 3C7KA 1J7KA 2QM7A 3CRVA 4KYUA 1U94A 3DL0A 2H5EA 4G5OA 2QT0A 4OKSA 1OFIA 4JLBA 4ACBA 3B1XA 3GJ8A 1AN0A 3CNLA 2QY9A 3PVSA 2ZJ2A 1QRAA 1FX0B 3V4RA 4L8GA 4NL4H 4DUGD 4X8OA 3L0PA 3I5YA 4MRSA 1C1YA 1FZQA 1G3UA 2DFTA 2ORVA 3QI2A 3SJCA 4PZYA 3W8NA 2HYIC 3A6PC 1J8MF 1N5JA 3PXGA 4YLGA 4GMXA 4P4TA 1GOTA 1ZM7A 3KKPA 4TL8A 5J4KA 3EPHA 3VHXA 3R7WA 3W3AA 1Y63A 2WTUA 1HEIA 4O2RA 3WXMA 4CDGA 2FF7A 4XWOA 2AL7A 2ZSDA 5E4FA 2J45A 1ZM2A 5DN6A 2FFBA 2AD5A 3AP2A 5JMTA 1E0SA 2YKGA 1VHTA 2FH5B 4AC9A 5M04A 4C0KA 3MRSA 2ODEA 1OXUA 5EP4A 1XPUA 3ADDA 5J4VA 2OFXA 2EW1A 4QJ3A 2A9KA 5FBWB 2J59A 1FW6A 1Z63A 1M7HA 3RVBA 2ZRJA 2H8KA 3GLGB 5EQTA 2ODBA 2GRJA 2ZE6A 2ZRAA 3B1ZA 1H8HA 2R9VA 4ASUD 2VP2A 5EXPA 3B2EA 5C1BA 3IHLA 3IIKA 3C15C 4Q9JA 3A4LA 3SEAA 5FBQB 4BEJA 1ZC3A 2K5UA 4M1SA 4PSAA 4A0RA 1T6NA 2C2HA 1IN6A 1HURA 4M1YA 3W9YA 1U0JA 4Q4JA 2XXAA 2QP4A 3AVPA 1G7CA 5AJXA 3KXIA 4OHVA 4JLDA 4JZKA 4PHGA 4DSNA 1E2GA 1JAHA 1W1WA 2BEKA 1IM2A 3QVVA 4Q1EA 5P21A 3QKSA 3N2IA 4GP6A 1CJUC 4UNRA 2GTPA 5J4HA 5ELXA 4C7OB 4AYXA 3IPYA 1AQUA 4DHEA 1P9RA 1G3RA 2GAOA 2RGNC 4OQXA 4D4KA 1E0AA 3VNVA 2H17A 4GMDA 2KSQA 2W6JD 5FOXA 3HPQA 3VR2A 1ZCAA 2Q9AA 5H1YA 1A7JA 1TQ2A 3ZVNA 1NN3A 4ZIRA 1SGWA 2R6FA 2ODNA 4LYHA 4B73A 3NC0C 2ZYUX 1EESA 4RCZA 1RKBA 2PEZA 3WHKA 3SJBA 5KPJA 1HE1C 1Z2CA 2NTYC 3P32A 1OXTA 1YZLA 2WMNB 2P6RA 2HYDA 1QHYA 2Z83A 4IFEA 4DDVA 3DO6A 4AKGA 3WMEA 2Z4SA 4UNNA 1YR8A 1GIAA 1BYUA 4DCVA 2IL1A 4UNSA 2IYUA 1KHTA 1SXJB 2FFQA 3KL4A 3MCAA 2FSFA 4YMSA 3CBQA 5GJCA 4DCSA 2VSXA 3KQHA 3SN6A 4CEJA 1CJMA 1KIMA 4YMWA 2PH1A 1IXZA 1YJ5A 4HUQA 5D3MB 4BLQA 2XAUA 1TQ6A 4JLMA 3W6OA 4NU0A 4B43A 1CR2A 4IDPA 2WICA 4D80A 1E2LA 3UXMA 2IXEA 3EA0A 2AKAB 2VBCA 1JR3D 3VTKA 4YDSA 1QF9A 3T1TA 2LCFA 3B1YA 1E79D 5EUQB 3QY0A 2CJWA 4LJYA 3O8DA 3MG9A 2PMDA 3QG5A 3WYAA 1LVGA 4TWZA 3UIEA 1ZUNB 5BQ5A 3HPRA 4EJSA 3KXKA 2BVNA 3OIUA 1XWIA 2IHBA 2RAPA 3CR8A 2JIZA 5SZIA 3W90A 1KO1A 2YC2C 1TX4B 4LPSA 5CIWA 3RSOA 4UNPA 2FA9A 4WAUA 4XOIA 4JYBA 4G0NA 3ZS8A 4PX9A 4LX0A 3VR6A 4D0LB 3UG7A 3QEJA 3THXB 1OIWA 1Z0DA 1UKVY 2R6AA 1DELA 2QA5A 3TSOA 3KJIA 3EC1A 3IQWA 3HU2A 4HUTA 4BZPA 4S2EA 2QPAA 3THYA 3JZMA 1II8B 3LQQA 2CCGA 4G5QA 5C4GB 1ZU4A 3C5HA 1DADA 3SNHA 3L82B 2AK2A 2ZI9A 3QIAA 4FCTA 4BFVA 2DPXA 3GLFB 221PA 3OFNA 3FOZA 1U81A 2CLDX 4EPTA 2BOVA 2ZYWX 1YVDA 2CXXA 5BYKA 1IY2A 1L4UA 1KI8A 4Q01A 5FBLB 3SR0A 3W5IA 4KFRA 3RS2A 1XZQA 4Q47A 2QTFA 4ZKEA 2RGAA 2FN4A 3MUFA 3PCRB 2F3RA 1RPZA 1G17A 1GFIA 2ZUDA 1N3BA 3TUIC 5BN3A 3RS0A 1CBUA 1KK1A 5IF9A 2W6IA 2FDCA 5EUMA 1GWNA 4B76A 3MGCA 1M6NA 3SJAA 1P75A 2WSSA 3KFXA 3AP3A 3LBNA 1DG3A 2IEZA 4QM7A 3WNCA 1P9NA 4HB0A 1GNPA 3BH7A 3QSYA 1G3IA 2IF0A 2IYZA 3CH4B 3HU3A 1V43A 1GRRA 1XTSA 3BORA 4NYIQ 4RVCA 2GEVA 3TAHA 3B85A 3Q72A 1Q44A 3VAAA 2WPDD 3GMTA 1OH7A 5FUWA 4JL5A 3BXZA 1PVOA 2PJZA 2QMEA 4RD6A 1GSIA 1FNNA 5BYJA 1KJYA 3KKQA 4DDUA 1G3MA 4RZXA 4WA7A 3T1VA 4WZAE 1XDBA 1E1RA 1Z0AA 4M9XA 4F4IA 3FWYA 3QJYA 1MRSA 4BRUA 2W00A 3THXA 2V55B 1VYUA 4MKHA 1VG8A 4LPKA 3W6PA 4I81A 2HEIA 2PZEA 2E9SA 2KI5A 1E79A 5DNYB 3PEVA 3L0IB 2BWJA 2GZDA 4R2HA 2FWRA 4GOXA 4US1R 4JT4A 2GK6A 3GP8A 1CF4A 3IO3A 5F2EA 3ICQB 1ZUIA 3AVYA 3MWLA 1PLJA 3Q85A 2XEXA 1OB5A 3Q8XB 1UM8A 3OF5A 1ZM4A 2IS2A 3SS8A 1XTKA 1T9HA 2B6HA 1AKEA 3OIVA 3B60A 2QAJA 4GOJA 3ZDQA 1AK2A 5C4MA 3A1SA 3NBYC 4LHZA 1GITA 4A82A 4Q1BA 1I4LD 2VP9A 1TF7A 4PFSA 3UMSA 1G64A 4JLOA 1R10A 3AGQA 5JJLA 1Z28A 3VHLB 1TF2A 1MO5A 4GZLA 4R9UC 2E1RA 2NG1A 3QE0A 5FTKA 4Z1MA 3LV8A 4YONB 1TPZA 4HB2A 3FGNA 5HCIA 3L2OB 5FTLA 2ZRGA 5F9HA 3LXXA 1SVSA 1R6BX 2IC5A 2OE2A 5AJWA 4B2LA 4D4JA 4QM6A 4JLKA 4LY6A 1FNMA 3LA6A 4D6PA 1LW7A 3LRPA 3L43A 3VR5A 5L3QA 3A36A 5EJEA 2ZE7A 1TEVA 4JBXA 2FG5A 1XD9A 2FSHA 1UADA 4NH0A 2ZANA 2RGXA 3K0FB 2WSSD 2ZU6A 1R5NA 4NMMA 2QI9C 2QE7D 5FBVB 1GUAA 1Z6YA 5CK5A 3TR5A 1W46A 4CEHB 3T5GA 1E2HA 4LJ8A 1GP2A 4I1SA 1UBFA 4ZI2A 4OQMA 2QAGC 3AF3A 4NP6A 2VP0A 1ODFA 2DWPA 4C30A 1YZGA 2ASEA 4H1VA 3QBVA 4TTPA 4QKQA 2WJGA 1FUUA 1GKYA 2H18A 1B23P 1EGAA 2SHKA 1V5WA 1G21E 1UEJA 3VKHA 1NNEA 2F6RA 4QNRA 4PC3A 5DYIA 3LVRE 1EFHA 2WJYA 1TTTA 3B6EA 2OLKA 3BD9A 4WXPA 1XTRA 4NKRA 2DB3A 2YWEA 3BS4A 1DO0A 4PANA 4V0KA 3BBPA 1OE0A 3T15A 1XZPA 4CEIB 4MRVA 2PT5A 2WWWA 4Q4AB 2QMOA 2X8AA 3DDCA 3TSZA 5DI3A 4CEJB 4Q4LA 3N70A 3WNBA 2G83A 4ZCMA 3QXSA 2HF8A 2WIBA 3EA5A 4C0HA 1R5OA 4TQUS 4Q19A 3B82A 5L3SB 4LYFA 4PHTA 2JJ2D 4XVRA 2QQEA 3U6KA 4D0NA 3ASZA 3A1UA 4XD7A 2WAXA 2WBLC 4NCKA 4TTQA 1X86B 3RS5A 1AGRA 4Z51A 4EPRA 4PQRA 4DB4A 3FE2A 1MR3F 3GEHA 5E95A 4TYYA 1E99A 1Z0FA 5CJPA 2V6IA 4B33A 1XJ0A 2YWFA 1HYQA 2XITA 1U8ZA 1XCGB 4NDZA 4TT3A 4DRZA 4OI2A 2ZI7A 1MABB 4IOJA 2Z4RA 4A15A 1VCOA 2CCKA 4PAMA 5H8WA 2QAGB 5KUTA 2CBZA 1SULA 2BKUA 2UKDA 1XD2B 1G6OA 1TQ4A 1W2GA 5FR1A 3A1TA 3MSXA 1H8EA 4ON9A 4W5WA 4RFSB 2C95A 2ERXA 1IXRC 2GEDA 2HLDD 1QDEA 2NO7A 1AJEA 1JECA 1N6OA 2OT3B 3RRNA 2IEYA 2EU8A 4GFDA 5F3WB 3UWOA 4LHWA 4G01B 4QG7A 3DM9B 4U7DA 3U4QA 4TL6A 3RRZA 4RJLA 3HDTA 2F1HA 2ONKA 1T91A 3SFZA 3QF7A 2J0UB 2OAQ1 1W0JA 1CLUA 1MO3A 1CJVC 4PPGA 3LW7A 3ZD7A 1KK0A 3PJRA 1N6RA 4CVNA 2FZLA 3G0HA 1XXHE 1VDZA 2L0XA 4A8JB 3EAQA 1H65A 3KX2A 4PQYA 4BGDA 3I5XA 4HLCA 2ZRHA 4GOKA 1CP2A 2O8CB 3RWOA 2V7QD 2ZYTX 5DI3B 1E1RD 3DPUA 4LV6A 1UAAA 1RW4A 3BGWA 3I92A 1U0HC 1VG9B 4F38A 1SVMA 5GVSA 4NYMQ 4R71A 4ZIRB 3BH6A 4WXRA 2FOLA 2EFCB 1VCMA 2IYQA 4URYR 3EX7C 2BBOA 1TU4A 4U02A 5LD2C 1PUJA 4MYCA 4OQFA 4P31A 4ARZA 4GT1A 3U3OA 5FFMA 5JZVA 1F2UA 4AY2A 5KDLA 2GVDC 2GCOA 4B34A 2GVZC 4AG5A 4C2TA 2EVWX 2JLWA 3PUZA 4JBWA 3OAAD 1UF9A 1PUIA 3MJRA 4KFTA 5EE3A 3TQFA 3EZFA 5C2JB 2Q9BA 3TNFA 1SHKA 2ODWA 5TV2A 2CJWB 5FR2A 4ESHA 4I1VA 5DSZA 1I4TD 2ZR7A 3AF4A 1Q22A 2D74A 4U00A 1KI6A 4O3MA 2OESA 4HB3A 5BW8A 4PPNA 1WBBA 4JBYA 1LFDB 2AD1A 3M6AA 3TUZC 4M9ZA 3D31A 1KJZA 1W4AA 2B92A 4K46A 2V1XA 2CDNA 1CRQA 1U2RA 3VKWA 4DLXA 2WWFA 4DSUA 3U3JA 3K0AB 1P2UA 1Z6TA 3KUDA 3T34A 3GJ4A 2ECKA 4Z1MD 4AI6A 4KU4A 1IHUA 1N6LA 4NYJR 1ZNWA 2HLDA 4KSCA 2GXQA 5HKKD 3R9IA 3CRQA 3NEJA 1VCNA 3AV0B 2CK3A 3A37A 3VR4A 421PA 2JIZD 2ZRNA 4ABYA 3OEEA 1SXJE 1JPNA 4JJZA 4DLYA 3TMKA 2IYTA 1BMFA 4LJ6A 1QHSA 3KDSE 1QHGA 1G4UR 1T8UA 3X1XA 3ZZ0A 2ZI5A 3ZD6A 3V9PA
chains in the Genus database with same CATH superfamily
1J49A 2A9PA 1MJNA 2JFHA 4XQGA 3ZCQA 5E6RB 4IHJA 3WBKA 1IZZA 2CXPA 3FMOB 3V1UA 4JUAA 1JEJA 3JZAA 4L95C 3ZJ5A 1D0IA 2XH8A 1C3LA 3FLAA 1J9EA 2BEVB 4J3JA 3CV3A 1D07A 2RKWA 5FX2A 1ZOPA 1GN9A 4V02A 3L4EA 5I7FA 1IN1A 3RFUA 3V7YA 2LV8A 2AT1A 1ZCZA 1NDQA 3C4VA 3DMDA 3FNQA 3SQXA 3KSAC 1RBZA 4TSRA 3TUJC 2YYZA 3OJEA 1Q1QA 2HFKA 3TNJA 4HDOB 1GCAA 4RD2A 2RD2A 4TZ0A 3KVYA 1ZN8A 1FA9A 1ZSYA 2AR9A 1IVNA 3LA8A 2A0KA 4MVYA 5ALRA 4TZ6A 1NOJA 3PNPA 4HLQB 2APJA 2X41A 4M38A 3RNLA 1EFRA 1CUBA 4BJ3A 4NONA 3L4KA 1K7XB 1YQDA 5EUCA 2QSYA 4AMUA 1ULTA 2N3ZA 4CETA 4DLSA 3LXRA 1JQDA 2FUG1 4LFCB 4G4GA 3DHWC 2O5EA 3ABOB 2KBFA 2A0FA 2X42A 3BXFA 5DHQA 3FUUA 3AFGA 2PUEA 3WYFA 2GH1A 4X45A 4LVUA 5SY4A 1JWLA 4JP2A 3QU4A 4DM7A 1X0VA 5F1KA 2OQIA 1C7IA 4LHYA 5IXYA 4GXRA 4NAUA 1QZ3A 4FEGA 4WZAA 5K6AA 1N9GB 1YC5A 4IO0A 2WA2A 1NVFA 4LBYA 3VNQA 3NIWA 1JDPA 4O6VA 2RG7A 1FL9A 1OLOA 2G76A 5K0EA 3GRAA 3KD3A 2GCIA 2P2LA 3QVTA 4IOMA 1FPQA 3HACA 4N5IX 4UJ5A 2WQZA 1VCHA 4HH3C 1N25A 3AVQA 1C9KA 1K5DA 4ND1A 5AI4A 5JDCA 2EKQA 5BWLA 3OOWA 4RA9A 3ZY6A 3GK3A 4ZYZA 1P0MA 3C87A 4UTZA 4EYGA 3WYBA 1AMOA 4MQEA 4EVQA 3OOYA 3RUIA 2KX7A 3B53X 4BFYA 1WBDA 5DGIA 2ZUEA 1D2NA 2VYND 5LJLA 3MELA 4IJKA 4BIIA 1URPA 3DCYA 1YACA 3F6BX 1CEYA 4GR4A 1BS9A 5KNDA 2QQFA 2DBRA 5ANRB 4ZMSA 3H1BA 1U8TA 1N5LA 3A1EA 4UHKA 2V1UA 2XUGA 1AH2A 3ORQA 2IYSA 5GV7A 3H19A 3I9FA 4M6WA 2CXNA 2VXCA 3TO5A 1C30B 2W2TA 1E5DA 4X8MA 3OO1A 4BN0A 1EIWA 1WMSA 3ZGXA 2NIPA 2XTZA 3UMYA 2PZLA 2QUJA 3ISVA 3Q41A 4BQRA 3ZCTA 3HCEA 3WYDA 1EUCB 3JRNA 5TMDA 3R7BA 1WZCA 3KR9A 1TMYA 1OKKD 3UMVA 2BZ1A 5H16A 1PT8A 3ZUGA 5FQOA 4EI7A 4KFSA 3Q8LA 4G0OA 1H2WA 2HI0A 2A58A 1QQTA 2P5UA 1PZEA 4MUJA 4R7ZA 3UK7A 3H2GA 3PNOA 5GP1A 1JDUA 2A9FA 4HDRB 3TKAA 2LKCA 1VC2A 1X9GA 2VCYA 3AI2A 3GDHA 1ADYA 4RE6A 3RLFA 3RARA 1AE1A 1RRPA 3TECE 3QXCA 3UPUA 1QVVA 3OLZA 4TSFA 2HBYA 3WIBA 4KDEA 3BGSA 1A4UA 1B0UA 4NJEB 3CCBA 3E1SA 2VNSA 4GR5A 4WY2A 4B2IA 4GMGA 4BE7B 5DE3A 3VPSA 4BWYA 3LCVB 1ST3A 2B61A 2JHCA 1FDWA 1Q0UA 3I58A 3PICA 1NIPA 1J09A 1XE3A 2WR8A 3NRBA 4ZODA 3M5DA 3JV7A 1EM8B 1F3LA 1LSSA 1KFEB 2VDUE 1M2EA 3BE8A 1NQ5A 4L9WA 1SN7A 2MSEB 1BH2A 4AJLA 3N1UA 4BC1A 4UDYX 3I8XA 3X1ZA 1G41A 3AR4A 1R2QA 1G3QA 3H1AA 2POCA 3EGDB 3G17A 4ACAA 3LUKA 1M7BA 2WHQA 2X19A 3N6XA 1QK5A 4ITRC 2GCNA 4RZQA 4KFCA 1JDBB 4EEZA 3VSDA 2Q8QA 4B6OA 1NSFA 4CG0A 4R3NA 1D6NA 4BYGA 2HU8A 5DTJA 5E4TA 2ST1A 1SHLA 1B4DA 3B13B 4TTJA 3PPVA 5B7QA 5BN4B 4PZEA 3LFTA 4X00A 2W6PA 3ROKA 1P73A 1RXUA 2XQGA 4P5PA 4UUBA 5CYGA 3D8SA 3ONFA 1CQWA 2P6MA 4RWEA 2XDAA 5F51A 2CHQA 4MV4A 4HQFA 4PWYA 5GY7A 4U4AA 1NE7A 3BFPA 1ORIA 2BM0A 4ZPJA 2JJ8A 2V6GA 1MF7A 1QYRA 3C8MA 1DIHA 3I1JA 4KV7A 5LZ7A 2ONJA 1F14A 1I9GA 1W5SA 2GZSA 1GDDA 1X87A 4RV4A 2CLOB 6REQB 1NGSA 3K09C 3U6BA 3KZCA 1CIVA 4AMVA 1L8OA 4DBVO 4MWEA 1X7ZB 4O0LA 1ZZGA 2XKBA 2TYSB 1E94E 5DCWA 2OGZA 3SSNA 4Z7OB 2AE2A 4RUKA 3ZU5A 1DEHA 1DAMA 1KJWA 1S2NA 2CL7X 2JF0A 3OM9A 1RQXA 5G1OA 5I9BA 3IVMA 1QO0A 5TC4A 2IRWA 1JAYA 2DG2A 4B0PA 1JL3A 2OV8A 2HHCA 3PNLA 4XVQA 2ZUTA 2AV6A 2HMUA 1W5TA 4OOFA 3H5WA 3KT8A 1E9RA 3NBUA 5DNEA 1EAMA 2BFWA 4A0SA 2GESA 4E15A 3RYFB 1FP2A 2W71A 2QPOA 4K6KA 2RI0A 2IFTA 3IUBA 4DLUA 4M86A 2BBTA 1RVDA 3V1YA 2CLKB 4WGFA 2QL6A 2YWHA 1COWA 3FZQA 3WK5A 4ALNA 4UEJA 1DMSA 4R01A 4PGFA 1JT9A 1CFJA 2NPOA 4H4DA 2XUZA 4U7WA 1E59A 4BFWA 5EWLB 3QVXA 4I50F 3HMKA 4O59O 4LNUA 1F6BA 4RTKA 2JI4A 4MQBA 1IVYA 1LLDA 1US8A 3QUSA 2HWUA 2R79A 4LOIA 4UCWA 3E8SA 1P31A 2JIPA 3GRRA 4UPEA 1JHVA 2ZK7A 5YASA 5K6AC 1GZSA 2G6TA 2XMQA 1QIMA 1XF1A 3V7NA 1E3DA 5DM0A 4B8YA 1VE5A 2O8CA 1KDPA 1SUCA 3DBRB 4IDNA 4CTOA 3L49A 3VDNB 1TM7E 1JG7A 1W0CA 4IFIA 4DCJA 4C76A 2QDKA 2FMKA 2X8WA 4IY1A 3I3SR 2I9PA 4RPCA 2D0OB 3B2NA 4K1LA 2QRHA 1G1MA 1F9EA 4IKEA 4RM2A 3UANA 3STYA 1WXGA 2Y93A 4ZT2A 4JLVA 4DLTA 4ETIA 3ML1A 4V2IA 4FB5A 1ZUD1 4C29A 4WIAA 4ND8A 1GSAA 3T5TA 1ZFNA 4Q9KA 4W5OA 3KJFA 2EHJA 3QVLA 4PF1A 4DLVA 1HTWA 2N1MA 4QBGB 2X6RA 2X2PA 4D4HA 3SQMA 5J2UF 3U4GA 2QRUA 4NOJA 1A9XA 5EIXA 3P94A 3E5MA 3S2SA 4Q48A 4ZT7A 2ZBQA 3IBTA 2UZAA 1LVHA 4UTNA 1DO8A 1U1IA 1VGRA 1TUIA 4RO0A 1NUSA 3F9CA 1XTBA 3NW9A 3O21A 4M8LA 4N49A 3NDRA 4KIGA 3WAJA 3GV0A 1SQGA 3L8DA 3OPQA 4JWTA 1WMBA 1XZKA 3DYIA 8ABPA 3HI4A 1ZK3A 4GI5A 2V7XA 1R74A 1LF5A 1FOEB 2HWXA 1Y5RA 1WVMA 3MMZA 2LCQA 2XMSA 4BNFA 3W2IA 4B44A 1TUBB 1OWOA 3DWGA 4C0XA 4JBNA 3PGLA 3PQ3A 3KETA 3DEZA 3H86A 4QO7A 3RHTA 2EGUA 2HRDA 1CUYA 2PMBA 2ZR0A 2HOQA 1QTQA 2OAP1 5L53A 3QVMA 2NTNA 3GIDA 4LRUA 5K5EA 4DG5A 2BTQA 2OL4A 5BPHA 4WKOA 2C7VA 3VMFA 3H6HA 1D9XA 1M3SA 3F1KA 3R0ZA 3SZUA 4PZ9A 3AR9A 4JYMA 1BSVA 4B3DA 1NUPA 5IBPA 1Y7LA 2GBLA 3IIEA 2CBXA 4KN6A 3ST7A 3UAXA 3X2EA 2WTMA 1J2TA 4M0KA 4LECA 4PN7A 1NNLA 1RBYA 2ZJBA 4B3XA 2H2AA 1JTEA 3MTAA 3SSAA 1P7ZA 4IVQA 4KAXA 4P4LA 2MT9A 2HJWA 1G20E 1I1OA 3KXPA 4GPD1 1BQ3A 1J70A 1DARA 1PO7A 3IEUA 3QOYA 2BMAA 4WACA 3SHVA 5JNVA 5BV2P 1JEQA 5E7JA 4AO6A 3GLFE 3PQ8A 1KOGA 1U7UA 4YLYA 2WTXA 3DL2A 3B51X 1AXEA 2W2QA 2C8LA 1BHSA 1V4BA 1IM8A 4EYKA 2FEKA 2PG3A 2XNHA 3MRXA 1CERA 1QZZA 3KJNA 2HIHA 4DREA 3QMMA 2G5TA 2WZDA 5K20A 1M34B 2PX6A 5EOVA 2QVGA 1KNQA 4ABTA 3GPBA 4BTEA 1P4SA 3M4JA 4DZZA 1Q7BA 5BNTA 5IM4F 3S3TA 3GBSA 2B8TA 2Q3JA 3KV1A 4KXWA 1PWXA 4Y2HA 1PR0A 5D3ZA 3R76A 3Q8MA 4I3GA 3U62A 3E8MA 5EJ8A 3FH0A 2YFQA 4R2LA 3PDUA 4TV8A 3STWA 4IIHA 1IPEA 1YCGA 3GLKA 4G37A 5EERA 2I2AA 3CEPB 4IUDS 1T6ZA 4BYMA 3K1AA 4TS3A 2P0YA 3FCEA 3RKUA 4KXVA 1RYFA 4CLHA 3C48A 1K75A 2VCHA 5JISA 1Z26A 3FN4A 2H06A 2HPVA 2X9GA 4XDGA 4NE2A 1PL0A 5ED4A 1NYRA 1AV7A 1PJTA 4KN5A 3FWHA 1NJ1A 2YY7A 1Q0RA 4IIJA 3WGZA 5KVVA 1M2HA 2JBAA 1HX7A 3DPSA 4FIZA 4B32A 4EUKA 4EWLA 1J90A 3SF8B 3ZVLA 3UMMA 3L5KA 4B6JA 8OHMA 1LV8A 1RD4A 1LWOA 3IR7A 3OLXA 1ZM3A 1UXGA 2WIJA 4B3JA 2XD4A 2NT4A 3MF4A 2FEPA 3HO8A 1PT6A 4J0FA 5FTJA 3UMJA 1JAZA 4OK6A 2ZM6B 4HDNB 2QT9A 1UANA 3GFRA 4D02A 1PKXA 1YUNA 1E4VA 2MYNA 1APBA 3QHPA 5ILQA 1KYIA 1CVRA 1LI4A 1JDBC 4ZOLF 3SI7A 2CNNA 3SHFA 3TEMA 1QGOA 3QMPA 1SXJA 4M9RA 4REOA 3MJ4A 3O82A 4DWWA 1RQGA 5HCUA 4O4LB 5BW4A 1NBOA 1C2TA 1PEKE 1S3SA 1QFSA 2FMIA 2YHSA 2YV4A 2UVQA 3EE6A 3LY5A 4Q9AA 4WCDA 4OSOA 4RY2A 4F96A 4YRGA 5FWNA 1E1MA 1Y9EA 5CPBA 2I6UA 1P77A 3RAFC 4BKQA 1E3MA 5D7NA 3QYAA 5EE9A 1ODKA 1XKLA 1C1DB 3W5JA 3KZKA 5E2BA 1HZZC 3VJRA 5L9AA 3E3NA 4LISA 5DJ5A 4BMZA 3H2YA 1IY9A 4R7TA 2ZS8A 4ER5A 4G09A 1ZNXA 2HJRA 3CISA 3A6FA 1YE5A 4J0HA 4KUEA 4AY5A 4X6LA 4EA7A 5B30A 1AMUA 1Y98A 2CCJA 2FWAA 2Z95A 4RFVA 3RU3A 3TXYA 1UBUS 3V1KA 2QNRA 1VL1A 1ENOA 3JSAA 3IT1A 3WFZA 4TRNA 2OBFA 1L5SA 2AN1A 3FMGA 3FSJX 3H17A 2HT6A 2F43B 4XCVA 3WBBA 4C1NA 1HK7A 4ECAA 3UJNA 4P33A 4FFBB 5DHRA 4J7AA 4RD4A 5ECGC 3WWZA 1DKOA 4DRXA 3FRJA 2IHYA 1JN0A 1RKQA 2B3DA 3OA2A 2XKJE 4KMMA 2WJVA 3A7EA 4XIIA 1J0XO 3AFNA 4P80A 2VDWB 1NUUA 2FNAA 5BN5A 4INJA 4R9RA 4HNAA 1YHYA 3K4HA 2JI8A 2PGAA 4AF6A 2GN0A 4ROTA 5C37A 2REQA 3T3NA 3TSAA 4EG3A 2PAFA 4HXGA 4ZDJA 3PE3A 3NS7A 1ZAYA 4XFJA 1PS9A 1SCIA 3KQLA 2A0YA 5FOTA 1UZLA 1XZNA 3WRXA 2R2AA 1DI0A 2BLLA 2NVUA 3T1HB 3RU7A 5BN3B 4IV5A 1UDAA 3UJHA 1X8LA 3EQ2A 2RAFA 5LZ4A 2HDOA 2WOOA 1SQ5A 3AY6A 2VWHA 2W7TA 3Q6NA 4KQ6A 1AA6A 1UWLA 2YY5A 4J0DA 4O4JF 2O48X 5ALOA 2VDKB 4OHXA 2VTBA 3BULA 4B0OA 4FFOA 3ZY4A 4RMJA 1L5QA 2FCRA 4HDKA 3O4VA 3U19A 1DBSA 1M75A 5B3KA 4GYYA 3D7SA 5CX1A 9ABPA 1P8JA 4GKAA 3PQCA 3FSEA 4DCOA 2WZCA 2NN3C 4QXAA 5BW6B 2IYAA 4BO6A 4Z54A 2UYHA 4NEHB 3EAGA 4KPEC 2AOUB 3ZDRA 3D3EA 1NUAA 3T61A 1ZJWA 4CGZA 3HRIA 5LA6B 2ORWA 1Z73A 5REQB 4DLPA 1M1YE 1YQEA 1VHJA 2X0RA 1ZITA 4BLRA 5ICFA 1YONA 2I4IA 4OMDA 2BY4A 4DSOA 3H5TA 4IIBA 3FYHA 3KFLA 4TS1A 3X1MA 1UBEA 3CZ5A 4IP0A 2P7IA 5JPIA 4K26A 1QRRA 3JQPA 1B43A 1RYNA 1B73A 1XZHA 2PA0A 2R65A 2VT6A 3GA0A 3QF4B 4LEIA 2HF2A 3H7AA 4C4SA 1P2DA 4U3JA 5CLJA 1WW3A 3NHAA 2EZ9A 2GI4A 4KO2S 4YCAA 4I3HA 4D4GA 1FTQA 4RDHA 4WCFC 5AM5A 5B1HA 3SZMA 3IA2A 3RS4A 2IZOA 1XMSA 4C5BA 4CU2A 3EEOA 1PSZA 1HQKA 3AERB 3OZWA 4BQPA 4IX1A 2CE2X 1AS0A 2WT8A 1TOAA 1BWSA 2BMEA 3SFVA 5IAOA 3AY3A 4MVJI 4R2KA 2EFEB 2QE7A 4GM4A 4RL4A 3MSCA 3ZQ6A 5CDFE 4W5RA 3I53A 5BMVF 2H1LA 1XC7A 4RELA 3T9FA 3Q4GA 1B6TA 1U2ZA 2H1WA 1KZHA 5LUAA 2C4UA 5GZ6A 3QW2A 5EMHA 1FYEA 4EG8A 1GZ7A 1PHPA 1QV7A 3H97A 1L7QA 2C9YA 1F8FA 5HFJA 1ABBA 5DH9A 1T5OA 4FT2A 1R8SA 1E6LA 3N2GA 4ZU6X 2BF4A 4XVUA 5BWOA 4GRAA 4ZU3A 3GEDA 4RESA 2OHJA 2AUNA 1V4VA 4LXTA 4DIBA 1T9GS 3UQZA 1JXMA 1RCTE 2J7PA 2XQVA 3OZDA 4JSTA 4Q37A 2OBNA 4N82A 3TOSA 2ROQA 4J2OA 3UA4A 2Y0CA 1D6JA 1VHWA 4RPHA 1V8ZA 3W2HA 3WKBA 4EG1A 3O83A 2FXVA 3HVRA 3BB4A 1Z0JA 1K3UB 2HA0A 2DLNA 3EIWA 4RJ2A 1XLWA 1GQQA 1IEVA 3GZNA 5KTMA 2BFAA 3HXTA 3TI7A 3E84A 4JI7B 5CCBA 1YDGA 3TCNA 1A4XA 3IHKA 4ZOBA 3AETB 1GGVA 3KAPA 5CAEB 3VYUB 4A0HA 4EFLA 3X44A 1G60A 3A9WA 4FILA 4GBJA 5CMLA 4YUWA 5LSAA 3WK4A 2AF3C 3KQNA 3HCRA 4N3CA 4PAOA 3OBBA 1BWQA 5JSZB 1JNXX 5IM4A 2C77A 1COWD 3GMDA 3NAGA 3UT5B 3EASA 4FONA 1WSDA 5B7PA 1NZFA 4XX0B 5DXJA 3X1DA 3SYLA 4IM7A 1DBQA 4RF2A 4BX0A 4YQFA 3L5OA 1PR3A 2J48A 3IDOA 2AOVA 5T3UA 2R6CA 3RFVA 1QKKA 4CF3A 5INTA 3E9CA 3F4BA 2IEDA 1GUYA 3NIFB 2AKEA 4HB4A 5JFOA 1YRWA 2F1IA 3CH6A 3HG7A 5L8VA 5FORA 4TTSA 4EG0A 2BMVA 5FL7A 2FHSA 4X8LA 4WEOA 4WK6A 5K45A 1Y89A 3CNNA 4LZWA 4HX9A 4NAVA 1S2LA 3A4MA 3ANXA 2OZVA 1TK2A 3TX6A 4DJEC 4UDNA 1TF5A 3E5HA 3P5BA 4R51A 3ZGLA 4ZI7A 3OD1A 3LY8A 3ZPXA 1GPBA 3NPAA 2JLUA 3ZDCA 2B4YA 2X0IA 1XMIA 3AEXA 5BV7A 3K6SB 16PKA 1WMEA 1HDXA 1YL6A 1Z4PX 1BNCA 1P6UA 5K3CA 2C9MA 2QDXA 2HMAA 3LBFA 3M1AA 3AJ9A 4G85A 3ROZA 4RH1A 4MHOA 3MYYA 3B6JA 2X1VA 2CYCA 1BN7A 1L7PA 1PNOA 1G2IA 4O08A 3WNZA 5K0JA 2WSBA 1UBTS 3L02A 5DF1A 6PFKA 2OHHA 1U7WA 2H57A 3PI6A 5LC1A 1NI3A 3NLLA 3U4HA 5A62A 5CGQB 4Y2TA 3QITA 1OXSC 3BE4A 2WJ4A 1H05A 1PFKA 4HLUC 5AKJA 4A03A 5DIFA 4B31A 4F93B 4EDFA 1MEJA 1QGDA 3QTLA 2C5HA 4GQBA 1LH0A 3EWIA 2NTJA 3LYUA 2QTHA 5FUXA 5TB5A 3VJKA 1BKSB 1MG0A 3NYWA 1ZQ9A 2R4UA 3CZ9A 3LDFA 1IAQA 3N7AA 3PF8A 4LOHA 3M5WA 3C85A 4TLMB 4WZBA 2YWCA 3UHJA 4I1IA 3U7FB 4NZNA 4TLEA 4ARCA 1RPAA 4NK4A 5JFTA 4MH0R 4PCAA 2E37A 5T4HA 1N1MA 1E2JA 4AN1A 3M34A 3ESDA 4WT7A 4EHJA 1MH9A 3T9BA 1VLZA 2ZZKA 1YZFA 4BZQA 2C7QA 4J90A 4E2XA 5JRZA 1JTFA 4FZ3A 4WZBE 4G89A 3K70D 5EEGA 1ND6A 1Y7HA 1W4CA 1V11B 1B2LA 1KY3A 5G3YA 1ZVVA 4GI3A 1G9XA 3OWXA 2VHUA 3CPSA 5HGJA 3R3SA 1DRUA 4DQ0A 3LOUA 1J8FA 1PKEA 2I8CA 2NAFA 2R5FA 3K8YA 1IEWA 5ERGB 1JFRA 3MWDB 3KJZA 4WA8A 5SYAA 4PONA 4D2IA 3AR8A 2UYCA 1HNNA 3T06B 1Y33E 3IUEA 3A1CA 1DBWA 3OT5A 2OV2A 4RHCA 2PGNA 4YBRA 4YXFA 4Q4HA 4Q18A 1JXOA 3FRHA 2CMDA 3VU1A 4AZ3B 2GZ1A 4E5MA 5ARBA 2HPAA 4YMUA 1OVGA 5CH8A 3VU9B 4B2PA 1G5IA 3BE6A 5CDYA 1JBEA 4BNNA 4O2BB 1ONSA 2ZWIA 3WLQA 4J2TA 4ND2A 7GPBA 2COEA 2I0FA 2XJ9A 2FPOA 3P71T 1WMAA 4NBRA 1D2CA 4UBNA 2IKSA 3UUEA 1Q5PA 4XUCA 1J0CA 1UBGA 1VB3A 2DULA 5BNFA 4ZQFA 1CZUA 2Q45A 5KS2A 1GD1O 2LDBA 4EKGA 1OBVA 1BMTA 4WUTA 1XPOA 5AHWA 4ALJA 2CXQA 2JFYA 2QTLA 3KEFA 3UYKA 4HL6A 5IPFA 1I36A 2OFWA 3RK1A 4H7FA 4IJMA 2WFMA 1G16A 1GCUA 1WSAA 4UDXX 4A1OA 1FDIA 4OF4A 1J21A 3BXPA 4DM4A 1EMDA 3DONA 3SBOA 4A2WA 2OK8A 3OLQA 2I2XB 4OYRA 1X9HA 4DCNA 2QGZA 3KJHA 2G67A 1IDN1 1N5OX 1U98A 2JZOA 4FFVA 2VF5X 3U7QA 3VKUA 2C96A 2O3RA 2JCXA 4P3XA 5L95A 3KSRA 4K7JA 3F2IA 3L07A 1HDOA 2JAPA 5DBHX 5KTYA 1V5IA 3NO4A 3UFXB 1GRNA 4M8KA 3WL3A 2H2DA 3K6RA 2QYOA 1I7LA 3WK8A 1ZCBA 3N5CA 1W25A 3KQKA 1IMOA 1CK4A 3DH0A 3KNZA 5GPBA 5K9ZA 3GAZA 2P3SA 1U7XA 3BN3A 5GJWC 4K9KA 5ALTA 2Q9UA 4XWAA 1T4BA 2BISA 3CE9A 2OGTA 3NOVA 3QV2A 1SUPA 2V03A 3RG2A 3WHPA 2BGKA 4HC4A 4GZMA 4MVJH 2IYVA 2JD0A 2AQKA 1CY0A 2IUUA 5IRCD 3EUWA 1SKYB 3KLMX 5IVPA 2BC9A 3Q3CA 4UCFA 1D8TA 3GEEA 1KYTA 3HA3A 3KWMA 1ZC4A 1G8JA 2V7UA 5AI5A 3SEFA 1ZGAA 4BAGA 3W1EA 1PD0A 1Y5NA 2VYFA 3INYA 1DDOA 4KLZA 1D4OA 5D5PA 5H9VA 2XUJA 5C18A 3SYNA 1KF0A 4LRWA 2BGTA 3KKZA 5TARA 1BAPA 1R3UA 4ZQGA 2D2IA 2JAUA 2W6JA 4A4DA 5EAIA 4DMRA 4F4JA 4YT2A 2R47A 2BMJA 3SXJA 2QX6A 1IY0A 2B4TO 4MWGA 4L57A 2HBRA 1AUVA 1N92A 1I2MA 2NXNA 4MKRA 1O54A 3WBFA 4YT4A 1U0FA 1FP7A 4EIWA 1GADO 3UBTA 3NONA 2R97A 3RYHB 1WXWA 3HR7A 4N7BA 4RDCA 4W99A 5EJ5A 5FUQA 2A5LA 4C0BA 3VTAA 4RSGA 4WK4B 1LV7A 3E15A 3OC6A 1JQLB 4S0XA 2WM8A 1JI3A 3OQHA 4Y7DA 5TQ0B 1QTRA 1E3SA 1AO3A 1DDGA 2BGNA 4XJXA 4CL0A 1I2AA 1I2ZA 4IV0A 4C0JA 1EDEA 2OYSA 3C7AA 1ESDA 2YOFA 5FADA 5B12A 3TD2A 2B4QA 5C31A 4WNIA 4LQDA 2N46A 2C92A 1JLKA 3ZGYA 4BATA 4CV3A 1N0UA 4UATA 3JQAA 1QRTA 5I7OA 1HFEL 3COZA 4L2IA 3HWX1 4G84A 4TTAA 4D6XA 2XAAA 1MB3A 1QH1A 1U5BB 1RHUA 1LB1B 1PJ8A 1JDVA 1UP7A 2B1RA 2VHJA 3ONVA 4TXHA 3U4MA 3AETA 3VR6H 1Q1ZA 2FWNA 2XMZA 2DVMA 4S04A 1OXBB 5ALKA 1O08A 5KB3A 3W8DA 5JSKA 1G66A 3KWFA 4K9QA 5BVHA 2I91A 1QS0A 1U28C 2UZ4A 2JATA 2GPNA 2GLUA 2HX1A 4IS3A 4BLSA 6ADHA 4AKSA 4RZUA 3FOWA 5EFOA 3OC0A 4Z4IA 4FC6A 2DYKA 3PUIA 1EDBA 1U8YA 4FJ1A 2HN9A 3BGVA 3AL3A 1YRQA 3K16A 3OM1A 1HQCA 2BI8A 3TE6A 2DC1A 4FMCF 5HZMA 5M34A 1LBEA 5HBRA 2XDWA 3PX2A 5FTNA 2KB0A 2XKAA 5J5CA 2ODQA 4YVFA 2WJ3A 2I2DA 2QVXX 1IOWA 4P86A 4IJVA 2I87A 4QTTB 1W4LA 1P2SA 1P91A 2C0CA 4KRGA 3LUGA 1F8XA 1N2ZA 2YWJA 4X20B 4C07A 1T0PA 4BVEA 2PBFA 1Y8ZA 4ICIA 5AVTA 3B48A 5ADUS 1V7CA 4FNOA 1X1EA 4D8TA 3TRHA 1GL7A 1VE9A 1FXUA 3K30A 3GLUA 2VNJA 3C6BA 3SFZA 1Z0KA 1GA1A 2AVNA 2Z9CA 1W4RA 4HBGA 5ALYA 3I3OA 3UENA 1XFDA 5E9QA 1E58A 2VZ9A 3LVFO 4FI3C 1E2FA 4JIGA 4FD2A 3F7MA 5DHAA 4ZV4A 4S12A 3MB8A 4YUAA 2CMGA 1MVLA 2LR0A 3B6KA 4KWCA 1SKQA 1WD5A 1T8RA 2VAVA 1ECGA 1KE1A 2EJCA 3EQ9A 1K4MA 2HTEA 4YMLA 4ARBA 1CUIA 4Q7LA 1SCKA 2XZDA 2I3DA 2AK3A 1UBSB 2V6MA 4K81B 4QHTA 5DNWA 2XQJA 1YJXA 3VU9A 2BBWA 4YEDA 1Q84A 1MTZA 3KKNA 3G0BA 4UAVA 3LP5A 4EB6A 1Z5GA 3EIEA 1C7ZA 2PU5A 3RRMA 2E6KA 3VAYA 4ZGGA 1PG0A 1SQ6A 5BR1A 5ITWA 4KWIA 2WYIA 4LC0A 4X7RA 5B2ZA 1XZDA 3T94A 3QPWA 1GQRA 1RTTA 2Z5FA 4ZTUB 1F48A 4B40A 4XGQA 1UKYA 4I19A 4IXMA 3MJDA 4F72A 1PG5A 1OU0A 3M2TA 1JFVA 2YNMD 3R0JA 2WB2A 3J80A 4Q82A 1HT1E 3LQYA 1DQSA 2WW8A 3B5JA 3FBTA 2ZXEA 2DQZA 3E2MA 3NYQA 3QIVA 5CXSA 1O2DA 5HQTA 2HQSA 3DDUA 4BZXA 4D1YA 2ID4A 3I32A 2FJ0A 5ESXA 1ZNZA 1J56A 3BGIA 3IV9A 5GGYA 3ZX4A 4CKXA 5ITVA 5DM70 3DBOB 3CWCA 1FFHA 2OHIA 2AEFA 3KOUA 3PHHA 4NWIA 4H3SA 1NOKA 3F5QA 4KJXA 4Z2YA 2Q6LA 3K4QA 4FLMA 3SF8A 3TM5A 5C5IA 4KG7A 2J0VA 2MMGA 2VAXA 1DRVA 2Q0SA 2X76A 1P0IA 4C08A 3CR3C 1ECLA 2H6EA 4C78A 1PS0A 1JQJC 5CG2A 1PBTA 3UUGA 3D64A 3AR3A 4G6ZA 4NLLA 1U9IA 5MN6A 5AVJA 4R84A 1M1ZA 4QUEA 3VOAA 1II0A 3MTDA 1T0IA 2WKSA 3R6GA 4I8DA 4LZAA 4YWJA 4YT8A 4J8PA 3C24A 5CITA 2R84A 1O95C 1YDFA 4A36A 5AESA 2NPIA 1Q7TA 4TWBA 5AJZA 3GLSA 2IEGA 2BR4A 3QOXA 4QQNA 5HKKA 2I7XA 1I4EB 1U2DA 1X3SA 2VK8A 3T6KA 4M99A 3CS3A 1LTQA 3T52A 3Q5EA 3SE7A 3OQOA 2ZTSA 1TM5E 4N7MA 3VR4D 1EYZA 3BBLA 4R41A 1E4OA 2CL6X 2B0CA 1F0YA 2XXJA 1VMKA 3IE0A 3NDJA 5DTEA 1Y3BE 3QX3A 2J8ZA 2OAGA 1KFCB 3OJFA 1P2TA 2C97A 4WVFA 2IS4A 4KQKA 4RIFA 1Z2AA 3ZU3A 4OH1A 5M7EA 2FPLA 4YMIA 1KNXA 3GNQA 1NR7A 1Z22A 3A06A 5JD6A 1HL3A 1DKUA 2GHRA 2RHMA 4IX9A 2HLHA 2RHLA 3ENKA 4CZ2A 1WCIB 2MMCA 3LAWA 1KSHA 4FUQA 2OG1A 5G3ZA 4B6EA 5TMEA 1JQKA 4D3YA 4EHFA 4J75A 3JWPA 2FCAA 3GFGA 4PZDA 3BKXA 4QEKA 3O4RA 1DQRA 2QX4A 4OXIA 4C0LA 2J3JA 5K8TA 2DLDA 4GOLD 1GPNA 1POXA 5UKDA 1J0BA 1TZBA 2CHEA 2OSBA 3RROA 1KEWA 5JJIA 3CEJA 1OA0A 1BU5A 1WQ4A 3WAKA 5JQGA 3G79A 2PGJA 5ALZA 4C2BA 3DL4A 1PSDA 4YJ3B 3ZOKA 1H3EA 2JRCA 3PYXA 4MHSA 1Z45A 4BE4A 4CPDA 1ORTA 1RPJA 3ESCA 5IJAA 4EW3A 3DE3X 1M0EA 2IS1A 4EHBA 2ONZA 1RZ3A 3LWBA 3OI7A 4S1OA 1RM3A 5JAUA 5JV5A 1EUCA 4Z9YA 4RZSA 4C6HA 3KBOA 2AG1A 3QGMA 2Q4EA 4I46A 2XVZA 1FJGB 4NABA 5HF6A 1AZLA 2H7XA 1G42A 1O96B 3BZBA 4YQEA 1B8UA 2AXPA 1P61B 1TKBA 1J5EB 3BMOA 3AF0A 3O1IC 4B3MB 4URHA 4P4GA 3M6VA 1V4NA 3FJ1A 3JQBA 3VZSA 3LPDA 4NZOA 3FG9A 5AP9A 3S2EA 4YDQA 5C8YB 1GN8A 2J9RA 3PD7A 3HA2A 1L7EA 2DFDA 1PR5A 2ZAOA 1NE2A 3JASA 4N40A 1T2AA 4F2DA 3NHMA 1AO0A 3D9QX 8MHTA 1QK3A 4CT5A 4ZDIA 1F4LA 4EJ6A 3HB5X 1LS1A 2IY8A 3I5UA 3W8FA 1FEZA 2ZOSA 1DC4A 4IVRA 5GADl 3L7DA 3BL6A 4RSRA 1GPLA 1TJPB 3GGPA 4G1UC 4GPEA 5CLHA 5F2OA 3GGOA 1JSCA 1CNEA 3IQFA 5AOBA 4PAWA 4YUVA 5JS7A 1JT2A 5LQCA 1J5PA 2C88A 1QFYA 4ALKA 1BRMA 4O1MA 3I83A 5F5NA 1EWQA 3L7AA 1I24A 3WADA 3W79A 5KQLA 4XE5A 4DVJA 1Y8AA 4C4XA 2I80A 1QH8A 4RYLA 2NTVA 3LDAA 2G0TA 3G59A 4IWYA 3D1JA 3HLYA 2P9EA 1NP3A 1U0RA 1LTKA 2C8VA 3ZHRA 4EOGA 1OWMA 4OU5A 4FZ5A 2EEPA 3KB1A 3ZW9A 1AZTA 1YR2A 4OUDB 1O58A 1PR6A 3Q0TA 4KQ9A 4RDXA 3TLAA 4AO7A 1XRRA 3D6TB 3A10A 1K8QA 1MC4A 2PZFA 3K53A 3L7IA 3AJDA 4FE7A 2X0FA 3ZDBA 3KP1A 3MK31 4G23A 2XD9A 4OD0A 5KJ1A 4S1TA 3AX6A 3M9XA 2ZS7A 3DB1A 3OT1B 4X1YA 3WLJA 4LDAA 5KSYA 1QCZA 3VNSA 4RZ3A 4NG5A 4C3UA 3GLIA 3LWZA 4ZVKA 1MPTA 3JAKB 1JJAA 4W5QA 3TRDA 5GJBA 5IFLA 2FEMA 2H4FA 3BJEA 3FFTA 3NUQA 4YFVA 4MV8A 4YP6A 3QBTA 4KN9S 3U1BA 4DMHA 2WYOA 2P77A 4ZCRA 4ESVA 3QMWA 4B45A 4BFXA 4UPDA 4JQSA 4CNQA 5KYXA 3AB3A 3PB3A 4OO3A 3GNSA 2IYWA 3LP6A 4H16A 2J5RA 4OY3A 4D41A 1Z47A 7YASA 1DV1A 4HX5A 5KNCA 1SWVA 2GB4A 4E21A 4LFAB 1A2QA 2POQX 2XB2A 1PVVA 3DEJA 1YC2A 1PZFA 1Z6ZA 1YRHA 1ZH2A 2X2FA 3WNDA 3WB9A 1YZYA 1FTNA 1OIVA 5TGZA 5K0BA 2QLLA 3UY4A 1ZHOA 4M9QA 2ZBPA 4UOZA 3HKEB 3CA8A 1KKUA 1JQBA 5J5VA 5IK2D 5IJ0A 3R8FA 1PL8A 3LC2O 3PITA 4HLNA 1V35A 4LKRA 3U48A 1ZH8A 3K1ZA 5AKZA 3LUJA 5K8IA 1ODTC 1C1HA 3PNMA 3FJYA 4MRAA 4W8GA 3GLHE 3C3MA 4CR6A 2WAAA 3IQGX 4WOBA 4UHDA 4XM2A 2O0MA 4HP8A 2F55A 4D3FA 1Z4IA 4MZXA 3GJ7A 4GO1A 5DO9A 5KQGA 1GFSA 2CVHA 3MIZA 2ZJ8A 3CCFA 4QPCA 4F3RA 4DZRA 2XGGA 1QGED 3RR2A 1FRQA 2J0SA 1VL5A 1PL6A 4IZIA 4W1RA 3V1MA 4HTFB 5AVVA 5EQDA 3RREA 4YFYA 3PNBA 3EBLA 4FJ0A 4HYEA 4FZVA 1XHLA 5CNMA 2YVLA 5LNK1 3OUTA 3G0CA 2QBYB 1YSCA 1LI5A 1QBKC 3NC4A 4QFCA 1TK9A 2I71A 2NAPA 3VNAA 2XMDA 1H9AA 4IVNA 1D1SA 4OHZA 2IYYA 1YXMA 2WHRA 3KLPX 3RVJA 1EUZA 4EFKA 4Y0NA 1T4CA 3T95A 3SOPA 5DCLA 2E18A 3OCUA 2H16A 3L7BA 2M6LA 3DNFA 1HA3A 3PWTA 2FOIA 3L4SO 1EFUA 4TL7A 5BSEA 2Y68A 2VHVA 2IU0A 1ZU5A 4HYQA 1Q0HA 3W1VA 5ECWA 3AF5A 1IHOA 2I8LA 4A92A 2ZSEA 4P82A 3RADC 1XMVA 2R3SA 3NBXX 4NCNA 5IKPA 2ZYRA 1UK8A 5CT4A 2FFRA 4PV7A 2HIAA 2ZJYA 2DUNA 2IYOA 4KIJA 4UBMA 4HAZA 1OFTA 1T6XA 3LZ6A