1D1QA

Crystal structure of a yeast low molecular weight protein tyrosine phosphatase (ltp1) complexed with the substrate pnpp
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
159
structure length
159
Chain Sequence
IEKPKISVAFIALGNFCRSPMAEAIFKHEVEKANLENRFNKIDSFGTSNYHVGESPDHRTVSICKQHGVKINHKGKQIKTKHFDEYDYIIGMDESNINNLKKIQPEGSKAKVCLFGDWNTNDGTVQTIIEDPWYGDIQDFEYNFKQITYFSKQFLKKEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TYROSINE PHOSPHATASE (E.C.3.1.3.48)
publication title Crystal structures of a low-molecular weight protein tyrosine phosphatase from Saccharomyces cerevisiae and its complex with the substrate p-nitrophenyl phosphate.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
total genus 60
structure length 159
sequence length 159
chains with identical sequence B
ec nomenclature ec 3.1.3.2: Acid phosphatase.
pdb deposition date 1999-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1d1qA00
2ID9A 2YHAA 3CHYA 1NY5A 2MYNA 4LE2A 2XDYA 5I4CA 2FQWA 2JVJA 1Z17A 4S05A 3Q15C 2OQRA 3IP9A 4MR7B 4MR7A 4YS6A 3OO0A 1YK0A 3JPWA 2FQXA 1DBPA 4OATA 5KQGA 1QQAA 3KLOA 1ZVVA 1KRXA 5F64A 5BRAA 1BDHA 3G85A 3RH0A 1NATA 1YMVA 1U8TA 1TVMA 3Q7RA 1MB0A 2GWRA 4UHJA 1F51E 1E2BA 1GUBA 3CTPA 3EGCA 5E3JA 6ABPA 4XXHA 3HEBA 1YS6A 2WJWA 4QYWA 3SAJA 3RVKA 2CHEA 4KMRA 2O20A 3ILHA 4G0ZA 3TB6A 4EUKA 2MSWA 5IULC 3SG0A 3QX8A 4F8JA 4MR8A 1JHZA 4MR8B 5JNRA 3FFXA 1Y1LA 3CNBA 1YS7A 4H3KB 3F6PA 2FEWB 2IPLA 3JVDA 4KNYA 2F8SA 1Z13A 1ZITA 1SRRA 1U2QA 4MS4B 4MS4A 4QPJC 5B3JA 1FFGA 2QVCA 4HNQA 3VNBA 5B3JC 2A9PA 1L5ZA 1R8JA 4O5AA 1M2EA 3HXMA 4F3TA 1FFWA 3QX9A 2B1JA 1VPWA 1XHEA 4IMJB 3KSMA 4O1HA 3LTEA 4PZ0A 1FSPA 4N03A 4QICA 1VKRA 2QR3A 3LMKA 4ETNA 3M6MD 5C5CA 4KPYA 2JCGA 3LKBA 4P1ZA 4OLAA 3HZHA 3GBVA 1LJLA 1JX6A 1DBWA 4G0QA 2FQYA 3RVNA 2PLNA 3EJWA 5GQSA 2X7XA 1ZN2A 3QLUC 4EYKA 1KRWA 3QLUA 2FMHA 4WXEA 4FE7A 1FFSA 4F06A 3L6UA 4TLLB 5KWSA 1YMUA 3T38A 4KRFA 5CNIA 3HUTA 1BDIA 3IPAA 1JFTA 4N0PA 3UUGA 4Z4HA 1E6LA 4RY8A 1PNTA 5T7BA 3CU5A 1DP4A 2JRLA 4F12A 3I5AA 2QVGA 2FMFA 1JYEA 2M98A 2QV0A 4ML3A 3QEKA 3EAFA 1Z25A 3ROFA 4GPAA 3O1IC 1ISSA 2J48A 3O2QB 1QNLA 5KQMA 1RPJA 3KYJB 1U04A 1JDNA 4LDAA 4LE1A 2E4UA 5TQ2A 5TQ2B 3SQNA 4ZJPA 3N0XA 2FLWA 2FEPA 3MM4A 1TJYA 1GCAA 1Z26A 2FMIA 1YK1A 1BDJA 5EWMA 4RXMA 4E7PA 4MRMA 4MRMB 4RV5A 2P9HA 3LOPA 3NNNA 1EWVA 3LFTA 1PNRA 1RXEA 3MMNA 1QP7A 2A9RA 3T95A 2JVIA 4DADA 1JFSA 4IGAA 4XAQA 1E6MA 1C4WA 1QKKA 2WRZA 3UKJA 1Z15A 2IPNA 1C0EA 1DCMA 2WJAA 4RK1A 4ZMRA 1JF8A 1Z2DA 1LBHA 1TLFA 3OQNA 4RKQA 1QQBA 4D74A 5KC8A 3LUDA 3GRCA 2H3HA 3EDCA 4LE0A 3LUGA 5JNVA 2NZVG 3KTOA 3VNAA 3A3KA 4YR7A 3IP6A 5EWLA 3C3MA 5CNJA 1B00A 5EWLB 1QP4A 3JS5A 2L17A 3KJXA 3OQOA 2RJNA 2BGGA 1MVOA 1CEYA 5JNSA 3ROTA 3SM9A 2WB4A 2CWDA 1ABFA 3H1FA 3N8IA 1RZRD 1JYFA 3FMVA 4L85A 3EODA 4YLEA 2AYZA 1NXVA 4KREA 4G97A 5DGCA 3OLZA 3DLHA 1DG9A 3H5LA 4IILA 1Z12A 4MQEB 6CHYA 3Q7TA 3JY6A 5FWXA 4N0QA 4XASA 2FW0A 5CNKA 1USGA 3T6KA 3MIZA 3OMWA 3NNDA 3OO1A 2E4VA 4MS3A 1ZY2A 4MS3B 1NXOA 2M1ZA 4HNRA 1PEYA 1F4VA 5C5EA 2VUIB 1NXSA 3K4HA 4Q6WA 3CZCA 4KK3A 1D2AA 2TMYA 1YIOA 2QSJA 4Z4CA 1Z2EA 3JPYA 4WUTA 1JWLA 2W42A 1S8NA 1Z16A 4D6XA 2MSKA 3KYIB 3UK0A 2R47A 3EQZA 1LJUA 5ABPA 4MQFA 4MQFB 5IBQA 4RKRA 5TPZD 4W5OA 3HJFA 2KYRA 2WY2D 1TM2A 4MLCA 1T34A 2RDMA 3RVMA 4NV3A 4HYEA 3H1GA 1XHFA 3D02A 2JVKA 1EAYA 4H3HB 3EULA 2FSPA 1DZ3A 3R0JA 4IMIB 3LUCA 2PUFA 3HV2A 4MAAA 4JAVC 4TMYA 1NXTA 2ID7A 2IKSA 3GL9A 5CNMA 1KMIY 1AB6A 1P6QA 4N76A 3RVOA 2L2QA 3C6QA 3CG0A 2CD7A 2PL1A 3MA0A 2L18A 1ZGGA 3IP7A 3M9WA 1DCKA 4Z4FA 5DTEA 1RZRA 3H5OA 2MSLA 3O1JC 4WZZA 1QO0D 4RY9A 1ISRA 3F73A 1WETA 3CRNA 3GT7A 4ZYLA 2OENG 5TPWA 2IDMA 4UHKA 5TPWB 4PICA 3C97A 4ETIA 1VLZA 5HKOA 1ZHHA 3HSYA 1FQWA 4OLBA 2JK1A 1BAPA 1BA2A 3HCWA 4G0YA 1ZGZA 1U2PA 1LK0A 3K9CA 4W5TA 4D6YA 3HDGA 1RNLA 3QLTA 3BREA 3Q9SA 4KQ9A 3QK7A 4KQCA 5ED4A 2NT4A 1W25A 1W9HA 1P8AA 3SNKA 1D1PA 1MIHA 2PUAA 1A04A 4FB4A 1EHCA 2HQBA 2PKXA 3CZ5A 3O1HB 3N0WA 4ETMA 2LUOA 2B4AA 4MR9A 1GCGA 4MR9B 4TLMB 3HM9A 2PUDA 2Q5CA 1APBA 1RXIA 4QYMA 3H5IA 2R4QA 3FFWA 3OM0A 3RQIA 5IUJC 3N53A 3NHMA 3SY8A 5IUNC 3O75A 4YO7A 4MLDA 4OTZA 5DLEA 2V0NA 5EWMB 4MGEA 4RU1A 3BILA 4EVRA 3CLKA 4EYOA 3H6HA 3FDFA 3BBLA 5T3YA 3A0UA 3N0RA 2HSGA 3A0RB 3NHZA 5JS2A 3O2JA 1USIA 4JASB 5CHYA 3N75A 1P6UA 2MYUA 4TN5A 4Y9TA 4OBBA 3KCNA 5HM6A 1ZDMA 2FVYA 3RVJA 1SXGA 2LIVA 2MYPA 4JP1A 3HO1A 4S04A 1TMYA 5IUKC 3IDOA 2L19A 4JB0A 1JL3A 4MS1B 4MS1A 3TO5A 3DLBA 1MAVA 3MYYA 5JNTA 5KQPA 2JBAA 4JB2A 2JBAB 2E4XA 4RK7A 4KFCA 1NXWA 3DGEC 4JA2A 4XARA 4G0XA 1KGSA 5DKFA 2RJOA 5DCLA 1I3CA 3Q7SA 1QO0A 5TQ0A 3T8YA 5TQ0B 2VYCA 3FGZA 3HS3A 5EWJA 5EWJB 4YP9A 1QMPA 2PE5A 2WMYA 4ZMSA 3E3MA 3LUFA 3H5WA 2PMCA 4B09A 3C3WA 4KVFA 3MQ4A 5HQJA 1A2OA 5HSGA 3H6GA 1JBEA 2R48A 1NXPA 3TX6A 5IEJA 1K66A 4G86A 4RK6A 5FWYA 2NT3A 5FWYB 2H0AA 1GLGA 3RVRA 5FWXB 4KV7A 2NUBA 4NQRA 1IIBA 3D8UA 4RK5A 4KZKA 4LZLA 2HQOA 3QELA 4JOQA 1UDRA 3DBIA 3QELB 1H9CA 4HNSA 1NTRA 2CHFA 1DCFA 1SXIA 3A10A 3RVPA 1QP0A 1K68A 2ZWMA 2FLKA 2ZAYA 3KHTA 2LP4Y 4EYQA 1DC7A 2A9QA 1ZH4A 2E4ZA 2LPMA 3OLYA 4Q7EA 5TQJA 1XWWA 2QXYA 1PUXA 4Z4EA 3TD9A 4M88A 3GWGA 2FXIA 3FFTA 3TMYA 4NCBA 4Z4GA 3EQ2A 5FBKA 1ZAYA 1CYEA 4L4UA 4RWEA 1EWTA 3RVQA 1SXHA 3HDVA 4EVSA 1ZESA 5D2CA 2IPAB 3LUKA 2JB9A 1CHNA 2QU7A 3E61A 2N9UA 3ILYA 1ABEA 5JNUA 4CBVA 3LKVA 4W5QA 3O21A 4RS3A 4WT7A 1URPA 4YGXB 1DRKA 5KQLA 4YCSA 4RY0A 4RDCA 2MYTA 3HK2A 5IX8A 2R25B 2PUGA 3I42A 1GUDA 3HUUA 4G0MA 4NCAA 2GI4A 4RXTA 2FN8A 1USKA 5FBHA 2DRIA 4XFKA 9ABPA 2QW1A 3GBPA 1HEYA 3IPCA 4WWHA 3MF4A 1JLKA 1MB3A 3H1EA 4DN6A 2VUHB 4EVQA 3B2NA 3CKMA 3H5TA 4Z9AA 4PE5B 2PUBA 4W5NA 1QPZA 1JDPA 4YV7A 3OLWA 2E4YA 3O2SB 3DZDA 1M2FA 3LUAA 5KC9A 1P2FA 3N6VA 3NNSA 4LRQA 3GA5A 4DQDA 1M5UA 4PEVA 4N47A 2P4UA 4EYGA 1AB5A 2FMKA 4IRXA 4Z4IA 3H75A 4MYRA 3L49A 1ZH2A 4EY3A 2IYNA 2A9OA 3DGFC 1SD5A 2QZJA 3I45A 4WXMA 4EGSA 3CG4A 3GYBA 4RK0A 3OQMA 1DC8A 1E6KA 4F11A 4PYRA 4ZPJA 5GOTA 3URMA 5TPZA 1OXKB 5TE9A 3KG2A 5BQ3A 3KS9A 1PEAA 4RXUA 8ABPA 3OLXA 4H60A 1Z18A 2I6FA 1BVHA 5IC5A 4Z9BA 3BRQA 2PUEA 1DRJA 2YHBA 1EFAA 1LBIA 2FN9A 3F6CA 3RVSA 4O1IA 3JTEA 5KI6A 3KLNA 1JH9A 1A0OA 3H5VA 4IF4A 4GNRA 4RK4A 4OG2A 2LBPA 3IP5A 2FTKE 2HJ9A 2VK2A 3BRSA 5IEBA 2WWVD 4E7OA 4YWHA 1YVUA 3G1WA 2E4WA 3OLVA 2HPHA 1L5YA 3LUJA 1D4ZA 4P98A 4XLTA 3CS3A 4Z0NA 1OXBB 3Q41A 4RZSA 3RVLA 7ABPA 5PNTA 3M9XA 5BR1A 3I09A 2GKGA 2GX6A 2FEKA 3O74A 2IOYA 2F8TA 1J56A 1DJMA 5JNWA 2PAFA 3OM1A 1U0SY 2PUCA 1JFVA 4KK4A 3OMXA 2NZUG 1D1QA 3F7NA 1VRVA 4FE4A 4N41A 1NXXA 3GV0A 3S99A 4YRZA 3QEMA 2PL9A 3QEMB 3C3KA 4MPTA 2PJUA 3LUHA 1PHRA 1D5WA 4LX8A 5JS1A 2RGYA 2GBPA 1YTUA 2FKAA 2AYXA 3W9SA 4RSMA 3CFYA 1EWKA 1M5TA 3NBMA 3QLVC 3QLVA 4G0OA 4G0PA 1DBQA 5BRJA 4Z99A 3HVRA 4Q6BA 2IPMA 4W5RA 4MQEA 3P9YA 2HQRA 3KKEA 4LDZA 3JVIA 4NICA
chains in the Genus database with same CATH superfamily
2IEYA 3M83A 1U7PA 5KWVA 3GLUA 1MX1A 1JJAA 2JVJA 3ZN2A 3IEXA 4HN4B 1E8DA 3R6WA 4MR7B 5DNVA 3D6JA 2II6A 3DZCA 2CYCA 3C3YA 4OYHA 4OBXA 3W4IA 1QQAA 2YVKA 5KUTA 3IAM6 3G85A 4EWLA 2EWMA 1KRHA 3X1XA 1N2GA 1UBCA 1Y4UA 3DE5X 1V3UA 3WB2A 4KQEA 4N8EA 1Z68A 1AXEA 1PFVA 2IEAA 1KMMA 1T4CA 2OXTA 4F3CA 3IDFA 1S2IA 4D44A 1QIKA 5ESDA 3GY0A 4CM6A 5KDOA 2GPTA 1TZMA 4OH1A 5CH3A 4K5QA 3ETCA 5KCMA 5GOZA 5DT9A 3LH5A 3ESXA 3VH2A 1FMJA 1AO3A 2GETA 4LJ6A 1T8WA 2VCEA 4R8VA 2OK7A 2PWPA 1T0PA 2WKQA 2WUGA 4N7RA 1QHXA 3AVXA 2VG8A 1FYWA 3BE5A 3OY7A 1N1MA 3ZGLA 2JGMA 1SKAA 3WDKA 3EWAA 2O52A 2P9GA 1PR6A 4JWTA 4OMUA 2CLSA 1PVDA 1L7RA 1R8JA 3AM4A 2GTIA 4M4SA 4EW1A 3D5QA 1ZK0A 3DVAB 1G66A 3AHEA 1RKVA 4N03A 5KOJB 1K63A 4ETNA 1QE0A 4YDHB 1NKSA 4B79A 5L4LA 4DMUB 1JLHA 4P1ZA 4TTPA 4Q7QA 2X13A 2O0JA 3C3XA 2E6KA 5CVUA 3U4DA 3QBVA 4N7MA 2PDAA 4QFMA 3IAS6 2C2KA 1DBWA 1V25A 1ZRMA 2WF5A 3P0EA 3RVNA 1T9CA 4I81A 4A92A 5KJ6A 1R0WA 3NIDB 3QLUC 1QRUA 1CWUA 4I46A 2FMHA 4OUDA 2MOKA 4LDNA 1MTZA 2D13A 2PNFA 1ZJWA 1BDIA 3T61A 4AJPA 4M38A 1Q83A 4MIKA 2QN1A 3MJ4A 2RGUA 4RZQA 3OEYA 1NF2A 4TWRA 5FF9A 3UMJA 4QAQA 4FGSA 2FWMX 3L40A 4J16C 3WBJA 4BCDA 5AVQA 2WK1A 4HFNA 2G9NA 1JKJA 5KVSA 2FMFA 1JG1A 4M0CA 2NUAA 1VG1A 3O2NA 1KR5A 1VZ3A 2P2GA 3KYDB 2WHEA 1OZ0A 4NRDA 2D8AA 2ECPA 2IHYA 2WKWA 2O1SA 5FPTA 1G1MA 3D3JA 3E0QA 3KOZA 4XLZA 3VI3B 4F45A 1BEEA 4MW0A 1AUPA 2B21A 2J3JA 4QTZA 1V96A 2PZBA 4ZVTA 3URKA 1Z75A 1LB1B 3LYLA 4HMOA 1SCKA 5K0LA 1BIFA 5DGTA 5EHGA 3Q9NA 1WXEA 1SXJC 1SVIA 1SU4A 2P3SA 2RHRA 3ONNA 2LE0A 3CYFA 4PYNA 3GP8A 4IUCS 1FYEA 4A0RA 1NJ1A 4BKOA 3RSOA 1P7PA 3KJHA 3HU1A 1N6LA 3VC2A 1KQFA 1H42A 3TTVA 2AC7A 2N47A 3LO5A 3WYBA 3KSZO 4L3WA 5I8PA 1Z5WA 3OFKA 4GMFA 5HVNA 1CU1A 3BHNA 4BC0A 2WTUA 3OP4A 3Q6NA 1Y8RA 4ZMRA 1JF8A 2XZDA 5HQ3A 1JQLB 2C04A 1E7WA 1Z2DA 4G5YA 4FYIA 3S2IA 2M6KA 4HDCA 1IEXA 1PNQA 1XTJA 2CFCA 1ZIPA 2BFDB 2P6OA 2BKAA 3CRRA 2ZBEA 3F9IA 4BFUA 5DM1A 1AV7A 1NBOA 2AMFA 2Y1LA 4KACA 5A5VA 2AW5A 1Y6FA 2EF0A 1CDDA 1CEXA 1VHLA 3QEJA 4J75A 2IYAA 2ACWA 3IUYA 5ULLA 1CEYA 3DNMA 1F8FA 2Y3IA 3KLMX 1IPHA 3QHAA 3QE4A 3SM9A 4D9EA 2BGLA 2QB5A 2B0CA 1DUIA 2O1EA 2C5SA 2VP6A 4K6MA 2YFQA 2W90A 4J7CA 2O2EA 2WTXA 4YP1A 4D81A 1TD9A 3Q5GA 1RAGA 3NIWA 4JUFA 4I50A 2VPWA 1AKUA 4I3GA 5HR5A 1N6NA 1X2BA 1FRVA 1YQDA 2X6RA 3K6KA 4K87A 4RNCA 1D2RA 2B7BA 4BNXA 2CB9A 4JJ4A 2VDPB 2A78A 4BFTA 4B35A 4CE6A 3RV4A 2J8ZA 3T9AA 1HDYA 1TE2A 2Q6VA 4G81A 2C88A 3G2OA 4Q02A 3H1TA 1I2AA 1ISGA 1J07A 2FP3A 2V55B 1R7RA 2AKYA 1W75A 5CUQA 3QE3A 3CEPB 5DH9A 1F2VA 4Y18A 2FSUA 1RPZA 1A9ZA 5BNWA 2ZB4A 3RT9A 5G0TA 2C4MA 3BWEA 1FDOA 1ZNWA 2H1FA 2XOKA 1Q1QA 3ZE8A 3FDXA 1ZNQO 1U8FO 3V1YA 1GLVA 4I55A 1VL6A 2DY0A 4AULA 4EG4A 1AHPA 2D1FA 1HZZC 5AXCA 3IFSA 3KYIB 1ZMBA 2R11A 3COSA 2QM3A 3QBEA 2PZLA 3ITNA 5IAEA 3MWLA 1X9GA 4NL4H 4F4CA 1E5VA 2IY8A 5JBIA 4WCFB 1TXGA 5FBWB 5IYZF 4M22A 1WRBA 3UBTA 3EMKA 4LDPA 3G6WA 4Z53A 5FEUA 1ZK1A 3D02A 1N4AA 3C24A 1VRWA 3S2GA 4RULA 2R1UA 3KSBC 2JAOA 1Q1EA 3F8SA 2CVFA 2H1WA 3ZDXB 4DOMA 2V97A 2WIBA 1BSVA 4Z54A 4EJSC 3HJBA 1AUXA 3K8OE 3PLNA 4K9NA 4QU9A 4R40A 5GWXA 3C6ZA 2YYSA 2YJ4A 4UZFA 3PGVA 4IDEA 2HMYB 3GLIE 2BR3A 1KVSA 2GYVA 4TMZA 4JLOA 4C6RA 2F55A 2GK7A 5FOUA 4BGUA 3GLGB 1J8FA 1SHTX 4U9UA 1HQDA 4NV0A 1WW2A 2PIDA 3HXPA 2MSLA 5FDFA 5HPYB 3PTAA 4LYDA 1QO0D 4JUDX 2XPCA 4MVJH 3CRNA 2A0FA 4KUEA 2ZUUA 5C81A 3TNFA 4ZHSA 3IDZA 3AOGA 1QIMA 2P9YA 3E22A 1V48A 2H5JA 3UXEA 2ZFUA 5LFAA 4HAOA 4AY4A 4DR7B 3WIDA 1X38A 1PJ8A 1ZD9A 4AD8A 5K6AC 1D1PA 2CHQA 1XZHA 2C00A 1SURA 1G20A 4P83A 2Z5FA 1OCEA 4I8DA 1HLGA 1NSTA 1G55A 2I6SA 3IDQA 3L8CA 3P2MA 1VI5A 4KX3A 3T0IA 2H1RA 2V9ZA 1PT7A 3KDAA 4FFMA 4XM0A 4ZOEA 1U9JA 3MJVA 4Q9KA 1XVAA 4J7XA 1SH7A 5DK6A 5A1TA 2R8PA 1TIPA 1WOMA 2HB6A 5K05A 1QGYA 1O8CA 2H54A 4HLQB 1ADBA 1LZKA 3B6EA 4HPWA 3WFJA 1B0AA 8LDHA 4NZZA 4EUNA 3M5DA 2W6PA 5HF9A 3YASA 5IVKA 2Y71A 3FKSD 1XLVA 4GQAA 4HSGA 2IF0A 3JAWA 3LZCA 1GO2A 4WBSA 5FUQA 1XPOA 2ID8A 3IT3A 4YREA 4K9OA 5J5VA 4WOKA 1UZUA 2W6ID 3AI1A 3F90A 4WZAE 5D3KA 3EQ9A 3FMFA 3EBLA 4Q82A 1O4VA 4GQBA 1QQ7A 4TV9A 5KYXA 3RVJA 1CY7A 4X1KA 2JGLA 2HTEA 1ZR4A 4B80A 3WFZA 1KPGA 4JQCA 1Z0SA 1CR4A 3G2QA 5C8DA 1HT3A 3TQSA 3VAAA 4YHBA 2N3ZA 4G26A 1TC1A 1ZH0A 4ZQCB 4CT0A 3ONEA 1NURA 4KN8A 4RHEA 3PPIA 2DLNA 1S0UA 1VJ1A 3PPXA 1BHO1 5DCLA 1A96A 1BVYF 2HUPA 3FNBA 1VMKA 3AUSA 2IFTA 1Z5GA 3C3DA 3E3LA 3KQQA 3Q7SA 3U2QA 3EIUA 3A4TA 5JBNA 5B58C 2CNWD 3QNUA 5ECDA 3ITKA 5DYWA 1QR2A 1HLFA 3LK7A 3CGGA 4HWOA 2JAHA 1VBKA 3VXKA 5JTTA 2BFEB 3FETA 4LYJA 2CZCA 2ECQA 2NVBA 3BEDA 5KPDA 5EESA 5GADl 5K7SA 1H6CA 1U3TA 4HX5A 5JJLA 3U56A 1AKTA 4HTAA 1NGSA 3SFTA 1ZCJA 4KV7A 4YUVA 3GEBA 3JQGA 3WAKA 1ZGJA 5LUAA 2ZSHA 2O5EA 3D8UA 2HEGA 1G98A 5EUMA 1HI9A 1NI3A 1CQIB 1AGPA 1TQHA 2EW8A 3ZI7A 2F17A 1MORA 3EIWA 1DB3A 1KI6A 3DBIA 4F9EA 2E48A 3S2ZA 1U28A 1YXMA 4IQGA 4MITA 2J5BA 4DY4A 1NW6A 1ZOPA 2EIXA 4YAUA 4LQ4A 3UT0A 1JG3A 1M74A 1I2BA 1EPUA 1E6UA 1SOMA 2EX1A 3HZZA 5ILGA 2DR2A 3GQVA 3NQ41 4EX6A 2C7BA 4AUKA 3R44A 4AKTA 1FF9A 2D8MA 4JDPA 2I4LA 1QYXA 4G07A 4C43A 5JZ9A 3QPAA 4BU1A 3LV8A 3W2EA 2ZR0A 5A4MS 1WM1A 4RPHA 3LUPA 4M88A 4Q12A 4E22A 3Q0EA 5ERGB 3O94A 4Z3OA 3MBOA 5U4QA 4MXDA 1UK9A 1PJLA 5F1OA 5K0SA 3AVWA 4S1OA 3V9AA 3IVGA 5K45A 3OOJA 3RC1A 3WO0A 3QG5A 2YJGA 3LFHA 5J1TB 4IIEA 5J2TB 3UJ9A 3GCDA 2IL1A 3ZR4B 1Q3KA 2CLDX 2GF0A 2VSQA 3O8DA 3IQXA 2WBLC 2YWCA 3BPSA 3NOXA 3M6VA 1U7UA 3UF0A 1BE1A 3L7NA 1Q74A 1MW9X 4HUTA 1B15A 1OXUA 2GFIA 3FRJA 4LXQA 4E3ZA 3JQBA 4EVIA 2NO9A 1RYMA 2WVJA 1NXQA 2X40A 4H08A 4IZIA 1IFXA 1TEVA 2H63A 3ZWQA 2C5LA 1QGUA 2EQBA 2VP5A 4IJKA 2HIGA 5TVGA 5IT5A 2QTAA 4J91A 4B84A 3GC6A 3W77A 3LT4A 3M1IA 1E0DA 3UAZA 1NQXA 5CDFA 2WWGA 2XQGA 4AKGA 1CUZA 2AL7A 2FFJA 1SUAA 4WXHA 5JVDF 1NLFA 1XMVA 2QI9C 1F2TB 3CNQS 3U0VA 2BTQB 1B4DA 1I80A 2XMBA 3SVZA 4NJOA 3O5AA 4HWTA 1P18A 1QE3A 3ECSA 3UFBA 1M5UA 1KH2A 1KO8A 2P4UA 2XRMA 4NYJR 4EAAA 1HPLA 5JXGA 1SOVA 4Y1RB 3JQFC 3N8DA 3QKRB 3PXCX 4P80A 2IYNA 2ZPUA 3DZ8A 5E8JA 3LM8A 1TNDA 2QZJA 3GEDA 2PGXA 1RPTA 2LCFA 3NBUA 4WNIA 5BN4A 3QKTA 3H19A 4ZARA 1P4GA 4TSRA 1NW3A 5FJIA 1LSJA 5FKJA 1W36D 1R4MB 5B1HA 4BO7A 1GL9B 1UDAA 4M0LA 1L4MA 1G8GA 4NVRA 1Z18A 1YL5A 2I6FA 3RUEA 1FU8A 1PAUA 4IICA 4OMFG 3WKDA 2EGHA 2PSSA 3SC2A 3TR5A 3NHWA 2YHBA 4PYMA 3RUAA 4BZXA 1LBIA 2GNOA 4TXJA 4P0QB 1E60A 4YIKA 3MT9A 3W78A 2ICAA 1BYUA 2R8ZA 2VF5X 2VZLA 3FUCA 3FPCA 3R0XA 4V3BA 5EMMA 4K8OA 5KVQA 5JS8A 2HA7A 4BO5A 2HJ9A 3H0EA 4D98A 3CUEF 3CB2A 4EF5A 3V2GA 1Y42X 1QCYA 3HVIA 2IOQA 4MP6A 2QMZA 3C8ZA 1LI4A 4TYQA 4WERA 5E4FA 4RAOA 2ZSAA 1Z0IA 5JAQA 1XD8A 4X85A 2GBLA 2GR9A 1L8XA 1N0WA 4RCYA 3F1KA 5CVDA 4DEVA 5C4IA 1X1TA 3ZLUA 1THGA 3GJ3A 2WZQA 1IY9A 4ZEWA 3PFHA 1RQNA 5AKYA 2WOOA 1MXHA 1VDZA 3BJZA 2Z9CA 1BKSB 3MAAC 5TGTA 4KIFA 3PXEA 1BWPA 1E79D 5DM0A 2H2WA 2R5NA 3HV0A 3QVLA 4NDZA 4PSUA 2HLNA 4AJLA 2B8NA 1PIWA 2WIJA 4CIWA 1A9YA 3AEZA 2ID4A 3RIXA 1DFHA 4JK3A 4D8YA 1VLLA 2CXHA 2AXPA 3TZ6A 4D3XA 5LWHA 1WCV1 3F0TA 5EIOA 3FPFA 4PBRA 3PPVA 2HF2A 5FNVA 1UT5A 2GZRA 4KMOA 4BMSA 4CPDA 1WPGA 4LPSA 2HA2A 4LXTA 1RM4A 1XZCA 4BP8A 3WYDA 1LDMA 4MEBA 5EI5A 1IHPA 3FHJA 4UDYX 3T5GA 4D8VA 5EEHA 1FNSA 2GEJA 4WA7A 4XDZA 3N76A 4UNSA 4UVIA 1NLYA 4ZVOA 1JSZA 4RD4A 2ZSFA 3VR3A 1V39A 5LR6A 4QNRA 4ZOBA 1GNPA 3FMPB 3L6OO 3H1PA 3EOBI 2NTEA 2OZKA 4YYZA 1X7XA 3QEBZ 4B87A 1JLMA 3EZFA 2XVAA 3C3CA 3GMTA 3KKNA 4PC3A 5SYMA 3ZE7A 5I4CA 3TSCA 1J9ZA 1YHYA 3HACA 5JZMA 5CYGA 4OQYA 2PO7A 1Y98A 1NQVA 1TZKA 1IXYA 1M8GA 2DCMA 4OATA 5TC4A 3X2EA 3DXXA 3PQEA 1ZVVA 1QVWA 4KSCA 4ALLA 4D9JA 3ZLTA 2YOHA 3PX2A 2ZBRA 3UJBA 2GT1A 1I33A 3ED5A 1S4QA 1LDYA 4E51A 3STHA 1F51E 1UJ2A 2WM9B 2ZJYA 3KXDA 5ADUS 3U61B 1ZLYA 3C7TA 5FPQA 4EB6B 4DDUA 3T4EA 2UZ1A 2HTFA 5LOVA 2O2GA 1JEJA 2LRHA 4ZRMA 3COZA 4KMRA 3V2IA 2AN1A 1OXXK 2Q0QA 2V03A 1YI0A 2IYTA 3DO6A 3I39X 3P4XA 1V7ZA 2OCYC 1RQXA 3ANNA 2F43B 5F4BA 3TNJA 4HDMB 4C04A 2OOSA 1M72A 2K87A 2DFNA 1X3SA 4N5DA 4CVNA 3K0CA 3FTQA 1GOTA 1YS7A 2J7KA 4Z2YA 1WXDA 2J08A 3VI4B 1K4MA 5LA6A 4YDQA 3SQWA 1F6WA 3NUQA 3KT6A 4MDEA 3E2PA 2ZANA 2HADA 1EDBA 1OAKA 1OX6A 2EFGA 2BHNA 3OJEA 4QXPA 4MDFA 2CXTA 3ENVA 4WNAA 3HWRA 3NWBA 3HEMA 1ZUHA 1ZD8A 1P1JA 1P80A 1QUFA 2B1JA 2QN8A 2OP0A 1S96A 4YAEA 3TCKA 4B3TB 3NBAA 2EQ5A 2UUPA 1Q7CA 1CPYA 1NYQA 2H18A 2FUNB 2JH9A 3FYUA 1R0KA 2GJAA 2ZETA 2M9MA 4MMYB 3UXYA 3J81A 3AF5A 4MYUA 4Q5IA 3BE4A 1QLJA 4HXFB 4WDQA 5K3CA 1ZN2A 2P75A 2WOJA 3U3ZA 5F2NA 3PC2A 2CLCX 4OVKA 1T0BA 3MGAA 2YV1A 5G41A 2BN4A 4LF8B 1ZGBA 5FA5A 3IPAA 3KDSE 3NWPA 4KPUB 2EKPA 5DDIP 5E2AA 3TLGA 2F9MA 3WNZA 1BQEA 1AGRA 2O59A 5EUQB 2BFWA 2ZTHA 4XCVA 4ZRDA 4YJ2F 4DRYA 2W4MA 1RRGA 1GZ3A 1U1FA 2CDCA 2WU0A 3KL4A 3L8HA 3P96A 4L5IA 4MQ5A 3I5AA 1F3OA 2PD4A 2X3FA 3AUXA 4QDZA 2O8BB 2QV0A 3G0IA 4RABA 3T0FA 5DGHA 1PLLA 2YHSA 5FX2A 1XN1A 2I7TA 3ISTA 2MINB 3PL5A 2IKQA 1ISSA 4JJGA 2CL0X 2V6FA 2X2EA 5E95A 1TFRA 3HKDB 2Z6UA 4LE1A 1KP2A 4WASA 3T3IA 4HRAA 4Y2RA 5TQ2B 4BJ5A 5D3QA 5I6DA 3KQPA 2AFRA 4AJIA 1KIFA 2FRVA 5F2OA 1W73A 4AK9A 5HXAA 1PS9A 4IS3A 2CJFA 2OFXA 2XOKD 5FI3A 5LMNB 1A69A 3I6IA 1T1IA 2OO5C 5KQSA 4KCGA 3F5FA 1L5RA 4EMUA 3RAPR 4UTXA 4FGUA 5AVKA 13PKA 2P9FA 2PX5A 3BGIA 1KDRA 1L3IA 1T5OA 1WXGA 1XT6A 1F06A 2I62A 2Q1YA 3II6X 3P19A 2B4KA 2F3PA 1YA6A 1KC3A 3NCHA 3KKZA 2DWUA 2PLWA 4RHCA 1EFVB 4RLQA 2C9YA 4TROA 1VP3A 4EUEA 1NLZA 3DWEX 1BH2A 1K0UA 4GNKA 3HLTA 3RKUA 3TLGB 4BGEA 2Q4RA 3WQHA 4UARA 1JAZA 1RTKA 1T3GA 1B6GA 1ADFA 4XGKA 3EXFA 3FPAA 3AL2A 1FJHA 1LPBB 3FKQA 3F98A 4J7AA 4R2JA 2B1IA 3OLCX 3EG9A 4AAYA 1X1QA 4H7EA 5EFZA 2BBOA 3FKJA 1DJQA 2FK8A 3LCVB 3VNAA 1ECBA 3O3CA 2LVBA 1U1CA 2BM9A 4I4CA 4J07A 4WTOA 4G8CA 2F1KA 4MPRA 4X20A 4AJ1A 5ADVA 1FUYB 2O3JA 3WLAA 2H4FA 5TMEA 4ZOLA 2P41A 1D0SA 2EYQA 2JG3A 4QXMA 4WKBA 5IAKA 4CHGA 4EB8A 1GPYA 2X0NA 4QBFA 3B48A 3BSSA 3E5HA 5E2BA 3LVBA 3T4XA 3OJOA 2ZJFA 1V5EA 2FSVA 4G65A 5FQOA 2IK8A 3ZS8A 2NTNA 1K7EB 1L1FA 3SZLA 3V1MA 3EAGA 3BVPA 3I9KA 2RHJA 5CLIA 3EEBA 2NQ8A 2R44A 1GXSA 4WZBB 3B6ZA 3MOIA 5K6TA 4EGFA 2XLBA 1SUWA 4GIBA 1JEDA 1YE8A 2HPAA 1D9XA 3NDPA 5G4KB 1E4VA 5DX1A 5HJ7A 1PEYA 3CVXA 3RQSA 4KV9A 1QHHA 2EFJA 1NXSA 1U1DA 4I1YA 4PLPA 3OM9A 2ASVA 4P7FA 1UMCB 2HSWA 4OCZA 4Y2XA 4B76A 4EJ6A 2G17A 1WVMA 4H7JA 3ZD9A 5TVKA 2CBXA 1M7GA 3VFDA 3VNVA 3H11A 4M6WA 5AVJA 2R47A 5GJWC 1OBVA 4LSGA 5CVJA 4DSOA 3PT5A 4Q4HB 5SICE 4P4NA 2R1TA 4DIMA 4B3DA 3K15A 2CEKA 1O95C 1E77A 1CJKC 1KL7A 4UATA 4YBZA 5E1BA 4MLCA 4NMWA 1TQDA 3Q40A 1KDVA 4M7RA 5DM4A 4U2BA 2WVAA 3IBGA 1W35A 4FMCB 2FX3A 2VXYA 4ZVKA 2XOXA 4G36A 3REQA 5A6VA 1XMXA 3GLFB 1UINA 3PD1A 2REXB 2AMJA 2QRZA 2XMQA 5ALVA 2FPPA 5LXTF 3N2GA 3OCWA 4AP6A 3R41A 3HV2A 3PGA1 1OXMA 2RGCA 2Z3VA 4HLNA 4LWOA 3MUNA 1XZLA 5COAA 1GQFA 1T10A 1H1LA 3KKQA 2BMEA 4ESOA 3LDHA 4COKA 1FEZA 1WKVA 1N7HA 2O2XA 3KTAB 4NPHA 4N76A 2Z3ZA 4EHHA 3H4TA 4NZMA 2J3KA 2NW6A 3I01M 4LISA 4GKJB 2Q5EA 3LFUA 1K9VF 2VSXA 3DT9A 3TIGA 3AX6A 3CINA 2DPHA 5KNBA 4CQLB 1EB9A 3LPDA 2QYHA 4I9FA 5EY5B 1XCMA 4O2AA 1IE3A 3JQQA 4F4DA 5KB3A 1BTOA 2MDTA 2WVGA 4IH1A 1IWBB 3SIPA 5CG1A 1RWVA 2AWNA 4DLZA 1ZJ6A 1UPUA 2DJ5A 4HRVA 3PT9A 3W5HA 1RS0A 1K8XB 4QQKA 2M1XA 4A6EA 3MINB 3GJ7A 3LWDA 1LNQA 3NTQA 9LDTA 5JXHA 2B9EA 2ZQZA 2FZGA 2XRZA 3V8MA 3SX2A 2I76A 4EG5A 5AWFC 5LQKA 3FE2A 1W94A 4BZPA 4D99A 2VDVE 3O83A 4ZCRA 2BVNA 4GMXA 4WLUA 2E87A 3D2LA 5ICFA 5A03A 4GGOA 5K0TA 1T6ZA 5FYDA 3D1LA 3F7MA 3K9FC 1JI3A 2PAAA 1KE2A 2OEPA 1E1DA 1Q0RA 3N53A 4JYCA 4YJFB 1OIVA 2D54A 3W5IA 3G5LA 2Z8YM 1FB5A 3DVRX 4RZ3A 1CF4A 4UAGA 4FDUA 4Y9SA 5F1KA 3H5AA 5JLAA 4RFLA 3SFVA 4P3KA 4AJ9A 4EW2A 1TX4B 4LF9B 3ONVA 2OD2A 3WP1B 2Z4RA 4QD3A 2N46A 4I2VA 4HFRA 5BMOA 4QGHA 1ODKA 1RWKA 2HRBA 1L4FA 2IVZA 1HT0A 3W8DA 2QENA 1EXMA 3DE4X 4GLBA 3WXBA 3KM0A 4FCCA 3TM5A 3VPFA 2VK4A 2Z09A 4CM8B 4CR7A 2LGJA 1A7AA 2O8NA 4JOCA 1JUDA 1X7ZB 4LHSA 4HJXA 3IDOA 5FUMA 4CMEC 2BSXA 2HMSA 5CDSA 4XJSA 2HJSA 3RS3A 4E2WA 2J07A 1M1YB 3OIYA 5FOQA 4EJFA 5A4DA 1A1VA 1P3JA 5JYDA 3QVSA 3CURA 2Y2VA 4H7DA 4EELA 3IJEB 3EXHB 4DDVA 1UAAA 1Z6YA 2RJOA 3ACBA 1S01A 4FEYA 4J9UE 4ZV4A 1KIAA 2E85A 1JALA 4KQMA 5KNBH 2CLIB 3L7LA 5KEIA 4EZBA 4DSTA 4ZI2A 2YXDA 1DOAA 4YP9A 1XZMA 4B6RA 2A5GA 2AEFA 4RIIA 3GZNA 4EI8A 4Z7QB 9ATCA 1XPUA 3PBKA 1B8OA 3IDAA 1U2GA 1WHSA 1I0LA 2Y6UA 3H6GA 1G19A 4CEHA 1EBUA 1WMSA 3LHIA 2IF2A 1MO2A 1UFVA 3EZLA 3M4NA 821PA 1IN1A 1TEZA 1UM9A 1EVQA 1YB4A 3QXCA 1PJRA 4GZMA 1PSWA 3B13B 3PDJA 2YIJA 4G4JA 4LOIA 3K1AA 3R7FA 1FLDA 3CF2A 2ZYVX 4G0UA 1W87A 4OYRA 4EB3A 1G9XA 3HCNA 1ZNZA 3QVOA 2ECFA 4X93A 3TVDA 4QOGA 3U4HA 3G2PA 4LOAA 4JI0B 2VH2A 3M3PA 2B8JA 4LAFA 1Z2PX 3ETHA 4AP9A 1NHWA 1ZMOA 1G6OA 1G4AE 4IIGA 5EXTA 3M89A 2O1WA 5M5BA 4RMIA 4MI1A 5B57C 1TYBE 1UXIA 2QRUA 2XNDA 3N7UA 4UVGA 3UOGA 3AVUA 1DHRA 4G0NA 1DVRA 3VU3A 2X0FA 2V65A 4YJGA 1CNMA 4DCMA 2GD6A 4IQ4A 4O4JF 2XEDA 5JNLA 2FXIA 2Z8ZA 1FSSA 4ZHQA 1KQOA 4FGJA 3L0PA 1JHPA 2OGTA 4YRPA 4O4HA 4LHVA 3CA8A 3MCAA 3HA7A 4OXYA 3AJDA 2Y05A 2FPSA 2PPLA 1SXHA 1YFZA 4B7AA 1YF3A 1VKNA 2Y1KA 4RD0A 2QU7A 2ZAMA 2N9UA 1L4GA 3WGVA 5BY2A 4DV3B 3C5EA 4PZCA 4TWBA 4DA4A 2HWWA 3RVBA 4DHEA 3DEKA 1T3LA 3QJ5A 5JMOA 4AZ0A 3ICVA 4G5QA 4JKIA 2R25B 2BHLA 3CKKA 4NCAA 3A9TA 4X3CA 1V8PA 4J2HA 4X54A 3ADCA 4HGQA 4XFKA 4PZ9A 1Y7HA 4CMBA 4IIUA 3VPCA 3QXJA 5AT1A 2JIRA 3ILSA 4WWHA 2Q27A 1U0NA 4EVQA 1VMAA 2PX6A 3EGXA 1PW5A 2O2ZA 1ITZA 2RHHA 4H4CA 4WY5A 5AM4A 3I92A 1Q6ZA 4OLFA 4UHEA 4W5NA 1Z0KA 3LNCA 4R0VA 1JDZA 2WJ3A 5AD1A 5LIRA 2ZYDA 2AD5A 1EXVA 5F7ZA 4Y2SA 3FI0A 3IODA 1MENA 1ZOOA 1NJFA 4MRSA 2XXJA 5C2JB 5IJ9B 1E94E 3OE4A 5KC9A 1HOTA 3IP3A 1QFMA 1TYAE 3Q5EA 2AGVA 2I1VB 2VDOB 3HLYA 5JFGA 4PVDA 4GF5A 3TZKA 3U7HB 1DG3A 2FMKA 3DL7A 4HCJA 3N58A 1N2ZA 4DJ5X 4MYRA 2A0UA 4FLEA 4V38A 4QUAA 3CH7A 3F6SA 3K7EA 4FQ8A 4G67A 4XQ9A 4Y2YA 2V7QD 3AR6A 1ZZGA 2O5CA 3G5UA 4NC9A 4MV0A 2ECKA 4WZAB 4EW6A 3QWBA 3DSRA 4UFPA 1DRWA 1LFAA 2I7XA 3AB7A 3CRMA 5L8VA 3HR4A 3FWNA 4XQEA 3IYLW 2B37A 3KEMA 5FCDA 3VYWA 1F4PA 1Q50A 1PEAA 2NXCA 3OLXA 4PQRA 4Y9DA 3C5WP 1GFWA 3U37A 2HPVA 1X94A 2NNLD 2XXBA 3PLAE 3DMHA 4X1OA 5AM3A 3ED1A 4UFNA 4HP8A 4JEIA 4XB1A 1EJ2A 1JDVA 1JFFB 3DBLA 1VIMA 4JQSA 4DCJA 3OIGA 1XRLA 4HV4A 5JUWA 1OFUA 1MOSA 3KLNA 4GLJA 4A5SA 3I9V1 1A0OA 1PVOA 2ZE8A 2NQ2C 2ZIUB 1FXWF 3NAZA 4NTZA 2WWVD 3FPGA 4GU5A 3WLHA 2JZNA 2N0SA 5CDYA 1U65A 3BMNB 4NMMA 3QZUA 1KJIA 3DFIA 4LOLA 5JXIA 3QKIA 1DKRA 3KQWA 2XNHA 3PRKE 4REQB 3X43A 1MFZA 1OXBB 3Q41A 4PFKA 5JCOA 2C5EA 3PXXA 1MPXA 4IEIA 2ZW9A 3IRVA 4W1RA 3EQ6A 1H2HA 3D6UA 4OX9B 3A9WA 2JKVA 3RYFB 3JWPA 1QAQA 2IOYA 2B98A 1RBMA 4KVAA 1KI8A 4BLTA 1JLRA 1Q1BA 1FDVA 1U0SY 2A0XA 3B53X 4N3BA 3QKSB 3WWYA 1IHOA 4CG2A 2JLYA 5CA1F 1VHQA 1I4EB 4B3MB 4CW7A 2PX0A 2KHZA 2ZATA 4E5MA 5CJ2A 3ZD6A 2NQTA 3OQPA 4YACA 5BSKA 3G23A 1IXKA 2Q5HA 4OQLA 3EZ6A 3L5KA 3PXGA 3V1LA 1EI9A 4YO8A 3WHKA 2WSSA 3FWZA 2YL2A 4DDMA 3AQ4A 1V11B 3M3HA 2AEEA 2ZLBA 5JW6A 1PFUA 4DJTA 1K3TA 4BO3A 1L4YA 4F7DA 2A59A 2GXUA 4F5WA 4HSEA 1YQ9A 4WY2A 2BGUA 4LVNA 1VE3A 2BKXA 3HZRA 5IASA 1BS9A 2AFIB 2JBHA 2PXAA 3LZDA 4XPIA 1XMSA 4PY2A 3STUA 5F78A 2YXBA 4IGKA 4KOEC 1II8B 1PT5A 2ACKA 5H9VA 2QD2A 1V5IA 1XA3A 1YOBA 1ZI6A 3IHLA 1QHNA 4MR7A 3I9V6 3UCFA 3UMRA 3AXSA 1FBNA 2J1LA 3OZRA 3VTFA 2QMHA 4AJKA 4C0LA 1HFJA 5I9MA 3KLOA 4UAVA 4C4SA 3B1FA 1G8YA 3ZXYA 2HLHA 2P2ZA 2W6QA 5CIQA 2E6UX 1IXSB 4MOWA 2GYUA 3AW9A 1A8PA 1T9DA 4BB6A 5CB6A 4D79A 3C6BA 1G17A 1IJKA 3U1TA 1F0YA 3M6UA 1GD1O 1SBQA 4IJWA 1QFJA 2BELA 3KK0A 5J5CA 6ABPA 2X4GA 2CMFA 3EY9A 4DIOA 3UH0A 1KZ4A 2H3EA 3E27A 3PFBA 3DR3A 3CSUA 2NN3C 1OWPA 2AJCA 1YDHA 2MSWA 4KKXB 2PO5A 2FN3A 1PR2A 2IELA 3BSYA 2OFWA 3JQRA 5JCZA 1JVBA 1ZW6A 1P9LA 2DPXA 2VO1A 3ZS9A 2QL5A 1NPDA 2WICA 2XQKA 1WL8A 1J2UA 3PWTA 1A1SA 5F4ZA 2R87A 1Z13A 2FXVA 1SRRA 1DUVG 3H3JA 3KUKA 3UAGA 5BRAA 1AQYA 1ODTC 2HU7A 5FTNA 3WWEA 3GEPA 2GJKA 3DVAA 4EHBA 1FFWA 1IM5A 5TEWA 2R5FA 4UU1A 5KSZA 3AP1A 2NPIA 3IMGA 2YW9A 3L43A 1XTZA 3NHLA 5KOJA 3LUBA 3MTQA 3IUJA 5IANA 5T4FA 2B35A 4K03A 2AKEA 2QGFA 3EHDA 2M6LA 4W5WA 3RFFA 3TZLA 1SUSA 3NJRA 7REQB 1YZ3A 1VJ0A 3N2YA 1S9HA 2VWPA 4JY7A 3WNBA 3OCZA 1E3WB 1JPVA 2RC5A 4C2BA 4IFEA 4U2EA 1ZU4A 3SMVA 1I2DA 4DUGA 1HFEL 3CISA 2D0PB 2H16A 1VXRA 2IU3A 3K72B 3KJNA 3PGLA 1X1AA 4G8JA 3ZIUA 4EA7A 2AE2A 1ZCAA 2UXDB 3T9CA 2EYUA 3HYCA 2P7HA 1E9RA 4L75A 1U90A 1EXNA 4EKYA 2QYTA 3UGJA 3SZOA 3KYDA 2F1HA 4IO0A 2INGX 1F1JA 1B41A 4F6LA 1W6UA 5JAIA 1RPJA 2O8CB 1LA2A 4PX2A 1WABA 2IXDA 3SQNA 1CR0A 4EHIA 2B6HA 1ZX1A 1NVKA 1L7NA 4M1SA 1Y34E 4QYTA 3DM9B 5I7AA 3WGQA 3RYIB 3F6RA 2NSHA 1WSWA 1SEPA 3EUWA 3A1CA 2Q3BA 1E61A 1DQZA 3OJLA 4MRMB 3D9QX 2I55A 4JT4A 1HURA 5A3VA 2ST1A 4ZI5A 5BNZA 2I2FA 3FUWA 1FXSA 1HR0B 4O3FA 4QG3A 5INTA 4IGAA 1JYSA 1KR2A 2W00A 3EH2A 3G5AA 3WK7A 1SAYA 2EGUA 1G5FA 3KVOA 5AM1A 1IN7A 3KU1A 2HJVA 1PT6A 3ORSA 3QU4A 2WJAA 4NCIA 4Q4DA 4DA8A 3ZDCA 3KQMA 4QTXA 4DB2A 1XTUA 4I1PA 3OQNA 1F0KA 2R0QC 2NACA 1GKLA 1FX1A 2HDWA 3CF4A 4FINA 3VZQA 2OE2A 5B7PA 3PICA 1V9SA 1P9NA 1TF5A 2QP9X 3VHXB 4A8JC 2VRNA 1CZUA 3RRYA 1EDOA 4K28A 3WOVA 1WOYA 5CNJA 2HRZA 1MAHA 4XVCA 4HO1X 3U3MA 5JMWA 2VQEB 1TM7E 4Q9NA 2DECA 2HJWA 4WOJA 2P90A 1HDZA 2IS2A 2GAJA 2O5RA 2C4UA 3NGMA 5B3AA 4HN9A 2XBMA 3TOCA 2WYWA 1V7QA 3I4FA 3ICPA 3RAJA 3ABRB 3BXGA 1GKYA 2ADFA 3BWMA 1I6WA 1OLUB 1G2IA 2PFKA 3S7TA 3WGJA 3QVGB 4L85A 1TVKB 2XB6A 3UJPA 5LWQA 5JDCC 2V6MA 3WZMA 1V3TA 1DKUA 3HN7A 3ER8A 1NP6A 4H4DA 4URVR 4P08A 1USVA 4LGCA 1D2EA 1LRLA 1QAOA 5K5EA 1AS0A 1Z7EA 3CUKA 5KU7A 1QVVA 5CNKA 3TLZA 4BVFA 4LJKA 4W9NC 3WYCA 2D1SA 3MVEA 2H7VA 1G4HA 3MIZA 3R3XA 2QNIA 2Q49A 3LVQE 4IXDA 4ZCPA 3UMBA 1IAQA 3D8NA 3KSRA 5C53B 4Q3CA 4TXLA 2WDPA 5JWHA 3GUVA 2HMTA 4RA9B 2EZ8A 3NTOA 4PYKA 4JGIA 2H51A 5C1IA 3UB4A 3VR5D 4BTEA 3FOFC 4QOFA 1PL0A 2H7CA 4YRBA 1J06A 1J49A 1U11A 5ENVA 1GY8A 4BCBA 4KBYA 2ZRNA 1Z4IA 3UV6A 1AV6A 5E7IA 4IX1A 4EDHA 1W2GA 4G24A 1C1DA 4U0JA 1VYUA 3TZCA 5AKGA 4ZP1A 4RV4A 3EVDA 4HK4A 5HKAA 1LI5A 1U1GA 4R2LA 4WCFA 2CEAA 1R8QA 1TPYA 5MGNA 2PKRA 3JQ8A 4DR3B 3UW3A 3GVHA 3COJA 1MQ8B 4PZZA 3ZU3A 4PGMA 4WHMA 3I9LA 4KRGA 1DBVO 3FWHA 5DW0A 5E6SB 2PYZA 3E7FA 4LZWA 1CVRA 3HUEA 2O7VA 3LUCA 4N3CA 2G09A 1Y5LA 4Y2UA 4BC1A 4GM1A 2CHUA 5K0JA 3F6YA 1TD1A 3WQRA 1VSTA 2OL4A 4ESVA 2Q29A 4PQEA 4YRSA 2DBQA 1V7PC 2EKQA 2F3UA 3VU1A 3MS2A 4LY9A 5C32A 2NAFA 4PYOA 3K9GA 3R0VA 3WQSB 1P9RA 4ABYA 5KCZA 1X2EA 3R2JA 1HE4A 1ZICA 2RHMA 1Z6PA 3VTAA 4YECA 1F2UB 1CFZA 1RP1A 2J85A 4PZUA 4JI3B 5IK2A 1KJZA 2Q9BA 1N2SA 2V45A 4QL3A 1FQWA 3NG1A 2VHYA 3O7WA 2ZSUA 1BAPA 1PL7A 5TIIA 1RM3A 3I0MA 5EZQA 4AJ2A 4U02A 5KTTA 3PUIA 5CFQA 2I8LA 2ZYIA 1XEWY 2FSSA 3PRHA 4FZJA 4CCAA 2WU3A 2RI6A 5AKEA 3EGVA 4R0MA 1FDIA 3RD5A 3CM0A 3PV0A 4MP3A 4QLBA 3TPCA 1P7CA 4C6HA 5D5QA 3MMZA 2E1RA 1H66A 1JIQA 2ZS7A 1Y6RA 1Q1NA 5K03A 1YSCA 1E2MA 2CNKA 3AVVA 1ESEA 4RJTA 1NYLA 4KB5A 3WLOA 1Q91A 4I08A 4PU0A 3RREA 4CU2A 2YV2A 3TZQA 2ZBVA 3H65A 1PJQA 3WV5A 4R7ZA 3W8FA 5EKXA 3RE1A 3CPHA 1X1SA 4IV5A 3A36A 3SC4A 1NPYA 2VHEA 4YRTA 1X7GA 2XNDD 3MPUA 3MC1A 4OUKX 4OKIA 4D9FA 3L01A 4QUIA 4GPEA 1V4VA 2REOA 4F2GA 3M49A 3RRMA 4A26A 3TINA 3V7FA 2XI4A 4CN8A 5BWCA 2PD3A 1QQTA 3FSEA 4L9AA 3GVPA 4TN5A 5AKXA 5E4JA 3DHNA 2HHHB 5JCJD 1DAEA 1IBSA 3AEKB 3EDRA 4M54A 4QREA 4I7EA 2OCAA 4B1FA 4Z4QA 2ZRLA 3O03A 4KIUA 2ODBA 4PTLA 2AI2A 1SWVA 5DE3A 4LZNA 2OCKA 4MO2A 4DAOA 1J20A 1U8YA 2VHXA 4IY1A 5IAJA 4AT1A 4KFCA 5GVRA 1G9SA 4RESA 1XRJA 2Q6KA 4F3NA 4FHEA 1E5QA 2QL6A 3BKWA 4C30A 1BE8A 2V98A 3T1TA 2I1LA 5TS2A 2AC4A 3Q6IA 4LGYA 1R0CA 2D00A 3BWXA 1KK1A 4DUPA 3NXKA 1FMTA 1QIGA 3IPXA 2BGTA 2EKBA 2XUAA 4NYJQ 1ZINA 3U13A 3G2NA 2C2XA 2EWVA 3B1JA 3DDNA 4AB1A 4C4OA 1GR0A 3VUEA 3ZBTA 2BFEA 3QWIA 4R41A 2D5IA 2X8JB 2WM3A 3OD1A 2A0YA 4BUCA 3I73A 5IEJA 3DKIA 4LTMA 2QP4A 2JFQA 1BGVA 1UJNA 4J4BA 3DMYA 4QFBA 3RVRA 3CF0A 5K0CA 7MDHA 3M0EA 1JH8A 2AD1A 2BEWA 3KB6A 1CQIA 4LZLA 3WL8A 3KTFA 5JATA 2HQOA 1QGOA 3G9XA 1UDWA 3NTUA 1J97A 2AOTB 2IYFA 2X9VA 1GQQA 1C9EA 1JR4A 3ESRA 3EC2A 2CHFA 1U5CA 5SZKB 2QRJA 1JFLA 5ESXA 2ISCA 2IQIA 3SPXA 2GPWA 2LD4A 3I83A 4WK0B 4JR1A 3J7AC 1KH1A 2JZOA 4Y6RA 4TXNA 2R8OA 5IU6A 3TBFA 1P1CA 2VRBA 2PZMA 2VF8A 2ZR7A 4J0HA 5JY1A 1M2OB 2LPMA 5KTMA 4QQ8A 1AF4A 3LVRE 1R18A 1TEHA 5BT8A 1SHUX 3EE6A 3NEPX 2Y2UA 2HNKA 3ROGA 4H6WA 1YZFA 3HBFA 2CXQA 1H4SA 4NZYA 3S7ZA 2ZWIA 4HDQB 2RB5A 5M34A 2VT7A 1QZTA 2H2GA 3NVAA 5FR1A 1CRLA 3HDVA 3LF2A 3MCVA 3RF7A 4EVSA 3H4VA 1U9CA 3WMWA 4MW6A 5CLLA 5CG2A 4UBLA 4QGBA 5J2TA 1KY5A 3ACDA 1WJGA 2FRDA 3LCCA 3WK4A 4KR9A 2HUNA 1BMQA 1ENOA 1KBZA 2ZE7A 4RDCA 4CQMB 2E2WA 4MIEA 3ZK8A 3DDSA 2C2GA 1ECGA 4LZJA 4HGPA 1SBTA 3NT5A 1U6KA 4M7OA 4EKIA 3PF9A 1VCHA 5I4BA 1SB8A 2HK7A 4J1TC 4M1EA 4DIFA 1O1YA 5CB4F 1V4NA 1GZ5A 3JD0A 4UHFA 4DM3A 1OE0A 1GNRA 3JD1A 1XZEA 1JPNA 2YR0A 2OYRA 1P75A 5LBUA 2ODNA 2XSZA 3VR4A 2VUHB 1JKXA 5GM2A 4UCXA 4AJHA 1WS6A 1WB5A 3IKLA 3GIDA 1O6GA 2OZEA 3HGQA 3EXAA 4IJVA 2E7ZA 3EZ2A 4PG4A 3RSFA 1WAMA 1W0CA 3VM6A 5IZCC 2GZDA 1II9A 2C03A 3DA8A 5G0VA 2A6PA 1F8GA 1QF7A 4HNGA 4LRXA 1XXHE 3FLAA 1F2TA 2FUCA 4BVJA 3W5CA 1UK6A 2BTQA 4TL6A 3X2SA 2NV2B 1UCFA 3FJYA 3FYUC 3KQYA 1RBYA 4QQRA 1EX1A 5AW0A 1C1XB 2QRGA 2K4MA 4UTRA 4HVCA 4UOEA 4GUDA 4Y1RA 2ODTX 2B1GA 2WSSD 2IUSA 3G8AA 3HBNA 4ID9A 4ZZ3A 3QKRA 3HJGA 4MUEA 1BXZA 3TD2A 4MWZA 5JT1A 1MUUA 1CJVC 2AEJA 2GM5A 2QJWA 1SVOA 2WFZA 2VAMA 3AP3A 3HEAA 5BW4A 4XDYA 1ENZA 1XKTA 3EEQA 4ALJA 1MOQA 4B17A 1TA0A 4TZTA 2QW8A 1E32A 3EXEB 2XWPA 4UFOA 5THKA 2Y0BA 5LJIA 1DX4A 3OJFA 1DTSA 2I1QA 2I3GA 1R4MA 4CM9A 3RROA 5I9BA 2ZCUA 5JVDB 4OL0A 4TXHA 3PCXA 4FD3A 3WWCA 2BCJQ 3IB3A 4FFSA 2R4TA 4II2A 3N1UA 1E96A 4ZA2A 3U44B 1MX5A 1Z6GA 3GZ4A 2FW1A 3LNTA 2IEGA 4FKZA 3OWOA 4O2RA 4PINA 4J0JA 5LQNA 1QFZA 1KOGA 2KLHA 3K53A 1RLOA 1C7ZA 1KSFX 3FYHA 4YUXA 4HJRA 1ZK4A 3HP1A 4I4TF 4ZAVA 5B4VA 5K8UA 1M0TA 1ZBQA 4TKMA 1U3VA 1YZVA 2QBYB 5DRTA 1L5OA 4J03A 4JEUA 3S40A 2WMDA 4CT5A 3KHUA 2XBUA 1I2ZA 1YIDA 5KNDA 2Z57A 1YFKA 1FDUA 1XD9A 4R0NA 3BH0A 4NCXA 1BMFA 2IY9A 2CCJA 3DOHA 3TAUA 3H87A 1D8AA 1J8VA 2H1IA 2P9EA 4C22A 2D74A 2X2FA 3L02A 4U00A 1HY3A 1WE2A 5AMXA 2D1YA 5IC6A 2BM0A 3E15A 5PNTA 1HH4A 4XVUA 4BZWA 2IYYA 3VR4H 2R8YA 1M76A 3GGJA 1CJTC 1OFUX 3ZV5A 2F8TA 1RI4A 3MS4A 1XZNA 1R27A 4KI7A 5K1ZA 4L8FA 4WBNF 2FUG1 4RKWA 5K6RA 4Y6LA 1YJBA 2NZUG 1PDVA 2QVZX 5KTOA 5EPEA 3BULA 2BSQA 3VX4A 5FHRA 4FN4A 2HT1A 1ZQ1A 2YINC 3ONFA 1E2DA 4WN9B 4ROTA 4JLJA 5DP1A 2VDQB 2QX8A 3UA4A 1QZ3A 4M8IA 2AOUB 2O2CA 3OEEA 4A0GA 4AJJA 4ZZ1A 4W5HA 1BS2A 1EFKA 1VYTA 5D01A 1AZSC 1KEKA 1RRCA 3K0EA 4H3VA 4OXKA 4Q3KA 3RC3A 1EXDA 3QIAA 4JXXA 3NBMA 1QO9A 1BROA 3ZV3A 5BRJA 2BMAA 3MHTA 2FB9A 3LY9A 5ECYA 2J0SA 4XWTA 3ZEIA 3CNEA 4HQNA 1KYVA 1SVLA 3L1KA 1OLXB 2PZ8A 4IAOA 5F12A 3SJUA 1DAIA 2FFBA 3GPCA 4YFVA 4DUGD 3EYWA 4L3VA 2UUBB 3WK5A 1ZCZA 2FQWA 2C95A 2PLFA 5BORA 3S68A 3D43A 1O6CA 2Q4TA 1N5MA 4G8DA 5P21A 1R37A 5HZHA 3DTVB 1QWSA 1LK7A 3WAJA 2AHRA 3GRPA 2FQXA 5FTMA 2EBWA 2OKGA 3FSGD 1P0CA 3CZAA 2I6GA 1XEAA 1XYYA 4ARIA 3PSHA 4E5VA 3ZNPA 4AKIA 3N8GA 4EB6A 3FGPA 1T0UA 4MMZB 1ESCA 4DCSA 2JGKA 1LXCA 3AKDA 1C7EA 1P81A 3N2NA 4WLOA 5AW2A 2JLZA 2FETA 2Q2QA 4D9GA 1FFBA 3FOAA 2QDXA 1YQWA 1B23P 4RVDA 1Y7IA 2F43A 4PGGA 2RK4A 4RFVA 3BA1A 5A1JA 4RSGA 4WVLA 3A3YA 2DBZA 2FUG6 1SJ9A 1EVIA 1MDBA 1LRJA 5AHXA 3VV2A 3ND6A 1OGJA 4MDYA 5CGQB 3NVMB 2IPLA 2WA2A 3HPQA 4EJ2A 1BDHA 1ISMA 1MABB 1PBNA 5EN4A 4CG3A 5JJCA 4H7PA 1SCAA 3FRIA 5LQCA 2EG5A 3OQBA 2QRHA 4NWIA 1U0HC 3RHTA 1TOAA 3U3XA 2J3QA 2YMQA 3HA3A 4LVCA 4EA9A 3P0FA 3SS7X 2BUBA 5KSWB 5FYQA 1HDGO 4P84A 2ACEA 2HYDA 1CP3A 5HQTA 1FSPA 4KDEA 3Q3HA 4BMCA 3U49A 3ZLBA 5A0VA 2J41A 1HG0A 2R60A 1CZNA 2FZLA 4JC8A 4Y1EA 1GIAA 3PNVA 2B4QA 2GNPA 1KQGA 5C7LO 1LTQA 4P4TA 2ZTVA 2EERA 4TX1A 2OXCA 2RJ3A 1P4SA 1Z7YA 3EJWA 3ZZ0A 3SKXA 3WZ2A 1MAAA 1GTL1 2ZE5A 5IXJA 3GB9A 1VA5A 2XCIA 3L6UA 4J0EA 4Y2QA 3VUFA 3V2HA 3WVNA 3ZTTA 3ZW9A 4KPUA 2DKFA 4BEVA 1X42A 2ZJ6A 1PR4A 4MYSA 4PYLA 5FBLB 1R0ZA 1K4KA 2Q3JA 3L7IA 3E70C 2GAFA 4M9QA 2XWQA 2KB0A 4XIYA 4JGBA 4X6UA 4AYXA 2HJHA 5ARDA 5B12A 5IAGA 4L2IB 1PKXA 1FA9A 3PDWA 4IDAA 4MWSA 4BDSA 3QWHA 4QTYA 2Z2XA 3IVCA 4KAXA 7AT1A 1UT8A 2H9AA 3EAFA 1K5GA 2MINA 3Q3VA 1QJCA 1WMDA 1GTZA 4TVOA 4L08A 4U63A 4EO4A 2QWXA 3HKDA 2VRWA 1ACLA 1T36B 4IKPA 4NKRA 5TQ2A 3VR2A 4CDMA 1L7DA 3OBBA 2Q3LA 1HL3A 1RHMA 3SJAA 4MGKR 3QTLA 1PTKA 1OWNA 3ELUA 5EWMA 5DN6A 3QVVA 3J81k 3PNSA 5HF8A 1SXJB 1WBDA 3H8SA 1Z5VA 4XX0B 3IQFA 4ER3A 2JHPA 1RXEA 4UZSA 1Y7TA 4FVTA 4BIIA 2ZUFA 1AU9A 2H48A 1KK2A 5I7VA 1Q15A 1OXTA 3LPAA 2E0IA 4A2QA 1GUFA 4TS9A 5BSHA 2Y1EA 1XMOB 2O8EB 3ISJA 1EFVA 4MVCA 4MUYA 4S35A 3A6HA 1GNTA 3GEEA 4RK1A 2IZ6A 2DYKA 1FP4B 2ANCA 1AHHA 2Q3HA 1CQZA 1DPGA 1MBZA 2QNRA 2XYRA 1DO8A 1DXOA 3BH7A 5J4YA 3IL2A 1XBTA 2QTMA 2VHQA 2HLPA 3FTPA 3ZHXA 4DV7B 2IH2A 4CQNA 2B30A 1OZHA 4ZGWA 2YDYA 3E4DA 2Q6LA 5DM70 3BA6A 1PT8A 1VJTA 3KTOA 4UVDA 4EENA 4WJLA 3AHHA 1F9AA 3H7IA 4ZXPA 4B8WA 1ZRNA 1CDOA 4C7BA 2NXNA 1TT5B 4RDIA 2ZQYA 3ORYA 1A95A 3GARA 3MTIA 1G8FA 3A4YA 4GT1A 4AN0A 3PTZA 1UKCA 2IQ5A 4I1IA 3ROTA 1J24A 1IZYA 1Q7BA 3R6LA 3DP9A 4DIBA 3SIRA 3A32A 3DOUA 3E81A 3FTEA 3H3XA 1WMEA 4AU1A 3HNRA 3WLRA 4L4ZA 4RPKA 4DC0A 1MQ9A 5IK2D 2QOEA 1EH5A 5IAAA 1Z8FA 1EK2A 1HUQA 1SVSA 2PX3A 1MAUA 1QHEA 1PT9A 4P3NA 5JO9A 4D9KA 2JASA 2QUIA 1IU9A 1R88A 3BE6A 1OFVA 2FFQA 2I7VA 4GOMD 3IBCA 3HJHA 4HH3C 4KFSA 2Q2NA 4ND6A 4DSNA 2QMUA 1GDDA 1C3OB 4DQKA 3VA7A 2DSNA 4WZBA 2YFYA 1HOXA 5EJFA 2JCYA 2W7TA 4NJMB 5F2EA 1YZTA 1N78A 3K5IA 5G4KA 3MT8A 4OB6A 3TIVA 1UJBA 5EIWA 1RYHA 4PNEA 4ZI7F 1JIJA 1ORDA 1WZUA 3A9UA 5C5EA 2ZXUA 5K0NA 1UMCA 5T4HA 3QKWA 2C8KA 1D2AA 3GFPA 1DHTA 3DZJA 3ZWVA 3N39C 1AS3A 1SU8A 2XDWA 3MFYA 5GIPE 5E38A 1IXRC 2UYCA 1K2VN 4GGMX 1ZUIA 3AERB 4B85A 1RJWA 4IRMA 1FUIA 1MLDA 4Q4HA 3GRUA 1KH3A 4CLHA 1W93A 1Z07A 2RHLA 2WAYA 5LM3A 2WNIA 4P22A 1H94A 3L1HA 4CUZA 4JYZA 1FVOA 3LI2A 1QLWA 5A04A 5NULA 3KB1A 3M2PA 1MG0A 2ZI3A 3GLFA 2JFFA 4EHAA 4HDAA 2GZMA 3N70A 4EX7A 1GAXA 2AVDA 3KOUA 2IYPA 1QG6A 5B1IA 3F6BX 1LC0A 5AUOB 3AV3A 1CK4A 1ZBDA 3THWB 3NM4A 4B75A 5LJLA 4EJSB 2GNAA 4X7BA 5BYJA 3LQRA 8AT1A 3AFIA 4PYQA 3EB9A 3C43A 3A4MA 1ETUA 4L6IA 1E3IA 1BXRB 2OORA 3IP7A 3MJFA 4CQLA 3VZBA 3SQXA 1JW9B 4U8GA 3B20A 5DTEA 1XFDA 1G3RA 3UEOA 2P6UA 4HFMA 5C4GB 3UAWA 1R4NB 2R1VB 4KFRA 3ZWDA 1PQPA 3HDTA 2YWBA 1CX9B 1BGWA 1RWPA 4BB9A 5ENZA 4TUYB 4UHHA 3O8RA 2QLBA 1L4HA 2QJOA 3K8YA 2HRCA 1P5FA 3QI2A 2GPNA 1ZGZA 3MINA 1I6LA 5LXTB 1FP2A 4W5TA 5IXSA 1KP9A 4IJMA 1MHPA 4KQ9A 4XGQA 5BR7A 3K0FB 4XUEA 2CL6X 2Q6OA 1CY8A 3EY4A 2TS1A 3FGOA 2XWSA 4M7PA 4HB3A 4X8HA 3RRFA 1VL2A 1KWKA 2DXIA 1HSZA 3T1NA 2I4NA 4GQIA 4TVKA 3ZZUA 2LKCA 2W5UA 3CLRD 3EVBA 4QUGA 1SZDA 4ETMA 4ZMBA 3QX7A 5ALMA 3QJYA 4TZKA 1A7KA 4JVOA 3H5IA 1ML4A 5A6SA 3OM0A 4XB6B 4HAVA 1AKYA 3DPUA 4KN5A 4OIFA 4YJFA 4FOOA 4JJFA 5ALSA 5F77A 4BBPA 1O6FA 5I4IA 4UM8B 3GRYA 3EMVA 3LDAA 2HCRA 3B1WA 4GOXA 4DLXA 1JU3A 4BFZA 2CBZA 4TYWA 1Y8CA 1D09A 1XZBA 3K6JA 1UBGA 2D62A 5B6PA 1NJGA 1QYRA 1R10A 3T7KA 4CTOA 3NHZA 4P0PB 2I99A 5FA6A 3SF8A 4JASB 1O96B 3CBGA 2RGAA 3E8XA 2PKCA 3VO8A 4K6CA 2NVWA 2FVYA 4IOJA 4CM8A 1K98A 1S2MA 1Z33A 3ROZA 2HKIA 1X7ZA 2HLDD 1Z0AA 2QAJA 2Q3FA 3AIIA 3QLJA 3ADDA 2CLLB 4MB0A 3DLBA 4TGLA 1TECE 5CK5A 2DR3A 4D45A 4RTPA 1M1YA 1E1YA 2E4XA 1W0JD 4BATA 3UPTA 3PRJA 2ZKIA 2FSFA 2JNWA 3IMFA 3DMPA 1ZM9A 2PRYA 3EXHA 2GH1A 4L0CA 5DKFA 2WWIA 3M6WA 1O6BA 1U0OC 1VMEA 3QYAA 4F71A 3O26A 4YHHB 5MF6A 2IDZA 5DF1A 3ZCTA 1N1DA 2CN1A 4YAIA 3IT0A 4PCLA 2F00A 3BF8A 3Q9UA 4UDOA 2I8CA 3UH1A 4AMGA 4MPPA 3B9RA 3C3WA 1TO2E 5ARCA 5HA5A 3RWBA 3ZV6A 3WA7A 1RJFA 2AF4C 2XSZD 3CVOA 3PGKA 2R48A 4H59A 3UJCA 3LY8A 4Z9YA 5KVAA 5EIAA 4K2AA 4P9NA 1T5HX 2EVWX 4NECA 3THSA 3WRXA 3NH6A 4YMGA 2PTHA 2J32A 2Q9CA 3R20A 3AF4A 4DWVA 4KO2S 4FR2A 3TKLA 4OAOA 2ZRAA 4LY6A 5AVSA 5AJUA 1XNJA 1JPUA 1H9CA 4A2PA 1N6KA 2PGDA 4AX4A 2VTEA 1GTVA 1C30B 2G1PA 2XA9A 3LDGA 3P94A 4PW0A 3SZ3A 3PIDA 1B0ZA 5AIBA 1FL9A 5ALEA 1C8LA 2QTGA 1NR7A 1R0XA 3DWGA 5A05A 1R6AA 5A9RA 1YC5A 1AKMA 3K73O 5E6RB 2ZAGA 4ZVNA 2OCBA 2A9QA 3OWXA 3SYNA 1N33B 4MK4A 4G84A 4DCTA 2QZZA 5E7MA 2YV5A 4MVJE 3EVEA 2C7QA 1IQPA 1LV7A 2FZVA 4LXXA 1WXIA 2WG1A 1VL5A 5K01A 4DIEA 1DTWB 3EQ2A 3B36A 3F5QA 1DC5A 3PUYA 4BFCA 2NXJA 4MLPA 4C0HA 4GOOD 5FORA 4UOZA 5EIXA 4GDMA 3IE1A 3E9EA 1FNBA 4AJ4A 3VR6A 3IOBA 1IUOA 2ZRDA 3N74A 4ZK2A 3U4CA 1M7HA 1OYOA 1Y4AE 4R2IA 5B1SA 3B1KA 1XPRA 1OZAA 1LF0A 1ZH6A 3H4IA 2W98A 4IGFA 4YCSA 2C94A 4LJ5A 3T41A 2NX2A 2VLBA 2XVYA 4Q4JB 1G38A 2CUNA 3QV1A 1OYWA 2Q99A 1SOAA 1YKGA 4YXWA 2PH7A 3LC2O 5KNDD 1WMAA 4RVGA 1U94A 3DKVA 1USKA 4MROA 1ORIA 1W76A 3NGLA 4UJ3A 4CM7A 2AR7A 3DMGA 1PJTA 4AN4A 3IPCA 1EE2A 1FYVA 3SXPA 5F21A 1OREA 1TC2A 4OQNA 3VVLA 2C9ZA 5CM2Z 1UOEA 1WKBA 2DY1A 4DIDA 1Y3BE 1BJTA 3ZQ6A 1JSRA 4YNBA 4D9MA 4D9NA 5KYNA 4WD3A 4M7WA 2FR8A 3ESDA 3IMEA 2W9XA 5FHQA 4AMUA 4CR6A 5IJ9A 2Q2VA 3LUAA 4XGRA 1MVLA 3AH8A 1DDIA 3DOOA 3OAAA 3QUSA 2QEQA 3G2KA 4N65A 5CITA 1JMKC 2JEYA 3BDVA 1UF9A 2VHCA 4Z3KA 2QTBA 1RRFA 1EGVB 2ORYA 3KEGA 4PEVA 3IXMA 4QUBA 1LBEA 2GHIA 2QJFA 2YWJA 3AVOA 4HLUA 4P4SB 3A1SA 4EHLA 1W30A 1H5NA 4ZFNA 4FX2A 3NDRA 5BNFA 2Y6VA 1YBFA 4JLBA 4ZRNA 5EP3A 2FEAA 1WG8A 1TJ3A 4EBBA 1T9HA 3EZNA 2GQ0A 1FS6A 4WZAA 3W4JA 4RK0A 1GTJ1 4RTLA 1DC8A 4B34A 2YKGA 2CW5A 4L4YA 2E5FA 3KPVA 1K8YB 1DAHA 3LBIA 3OCVA 3RS9A 1OXKB 5I3ZA 2O3RA 1WUJS 2XB2A 1L0BA 4Z86A 5EIFA 4FSDA 1DRVA 2Q07A 1BVHA 1G5TA 3I6MA 2JHGA 5DNYB 3LA8A 3JASB 4UJ5A 2FW7A 3C1OA 1JAIA 1JFFA 2J46A 3PJEA 4KXVA 4CODB 1ZXXA 3R8FA 3HTXA 1OAAA 5DHPA 4IDQA 4ER6A 2CZQA 1XNRB 4DUZB 4K0KB 4BO9A 1J7KA 4FCWA 4D3DA 4LECA 4HQFA 3VVCA 1RQGA 4LMBA 3BMNA 1X8LA 2WE8A 1E0KA 5B1EA 4FFRA 2YFKA 5H80A 3A1WA 5CLGA 4KR3A 3ESCA 3CR3C 4REQA 4GP6A 4LY3A 2ES4A 1GQOA 1MJGA 4TS1A 4GZLA 2BKVA 3PEUA 4PO9A 2ZU0C 5KOHB 4P7BA 4KFUA 1EWQA 2R6AA 3RBAA 3TPFA 3LPCA 2I0FA 4Q4AB 2GKGA 3EGEA 3G0CA 4YCMA 1BMTA 4I1UA 3UUFA 4ACAA 4ARVA 3OM1A 2L0XA 1YBMA 5K0EA 2OBFA 3QKSA 4A8TA 3MJRA 2FF7A 3P2EA 4HPXB 3OMXA 2P5UA 3I2KA 4ZZ0A 2RONA 4JS0A 3FCXA 5FLYA 2ZTUA 1MH1A 1VPLA 4Q66C 2A33A 3N5KA 3GJYA 2O14A 2PL9A 5FL7D 2F8LA 4RORA 2JH3A 4XIJA 3DBOB 4PPQA 1V11A 4OHCA 1NLMA 3UK7A 1F12A 2PYDA 3H5NA 4MB2A 4RSMA 4ZCTA 3PFIA 1W5AA 1U7XA 4NIMA 2YWDA 5CAEB 4LC1A 1T2AA 3ZWPA 3IMCA 5IH3A 2B20A 5H4GA 4R3UC 4HQ6A 4MQEA 5FOTA 1IB6A 2W2PA 4MW9A 5IFKA 4K6FA 4LDZA 1KVRA 1II8A 2PH5A 4L73A 5ITVA 5CA1B 2G25A 3IQIX 4Q47A 1M8KA 2DT8A 3D8BA 3O91A 5BUSA 4ZO7A 2VT6A 3S1AB 3UYKA 3A70A 3ZY4A 3EHEA 2FDCA 4QUEA 2QN6A 3PNQA 1P17A 4DTIA 4F1KA 5BRNA 1H6AA 1ZXLA 2ILVA 3ZHOA 4EKDA 5HJ2A 2GZHA 3RK1A 4B33A 3KQKA 2GPJA 1DKLA 4CV3A 2VYNA 3E4CA 1DBRA 1ZIYA 1H85A 3I2IA 3T4PA 1NR5A 3VR2D 2F90A 3WQBA 4B5LA 4BVGA 3MB8A 3U09A 2HL6A 1KJQA 1O6ZA 4GMHA 3UHOA 3UT5B 4Q1AA 3KOXA 2X0IA 4GI3A 3WIBA 3L7DA 5DN6D 4L9WA 4YMWA 4AY6A 2G9QA 4MWBA 1Q0UA 2VBCA 4QU5A 3GI1A 2QGNA 4RGYA 2WYOA 3W6NA 2VJMB 1CD5A 1E1MA 1JHZA 1W8IA 4RD2A 2B94A 5SZHB 1BCSB 2IH4A 1FVHA 2XUQA 3L1VA 4D3YA 4LPKA 3AGPA 4PXYA 4DJAA 1TF2A 1XXHB 4LDJA 5BPFA 3JVDA 1RFLA 1K6XA 1G8KA 1F60A 2QQFA 5L9AA 1ULTA 4R2WA 4HNQA 4I5FA 2DPLA 3ZHSA 1NRXA 1LLDA 1EDDA 5CMLA 3ZCVA 1L5ZA 1PWEA 1YQXA 1R12A 4O5AA 4GXQA 1QU2A 3CNNA 3NTRA 4QDUA 4R1MA 4YMIA 3JQAD 2ZYWX 5J23A 3KSMA 2GK3A 4CV0A 3LMKA 4JI5B 4JHLA 4TMKA 3LKBA 2PJDA 2RGNA 3GFQA 4G5HA 1V8DA 1V8FA 3D6HA 3ZDEA 2EX4A 4RVHA 2H85A 5C51B 3VSBA 7REQA 1IG0A 4KUGA 2N1BA 5GQSA 1KFBB 4DMCA 2C92A 2VPYA 3Q12A 4M21A 5DBIA 5DSTA 3TJMA 3CEJA 1GYQA 1I3MA 3JYPA 3GGCA 3V8EA 1Y4ZA 3HYTA 1S2NA 2YV4A 1JFTA 1U6JA 2ZZNA 4QGSA 4RY8A 2Y4OA 1SOUA 4CEIB 1YVEI 1NWHA 4RHTA 1Y5RA 421PA 2XE4A 2ZIZA 4D2IA 3I64A 4D4IA 2FGKA 1D0IA 2O6HA 3WJ2A 2QVGA 3FBGA 4MKHA 3KE8A 1ZC4A 5IP5A 4RA6B 4XWYA 3D7KA 3ZTYA 4AXBA 2IUTA 4EHFA 4LZAA 5CDFE 2ONKA 2ZI4A 2EHJA 2QRMA 1VG0B 2CBGA 3O1IC 4M0PA 5ALKA 4IHJB 3SQDA 1U04A 1JDNA 2XY4A 1IXZA 3SFZA 2PT6A 4Z0TA 2FEPA 1TJYA 3LBFA 4L51A 5BV8A 4ZAGA 3RYIA 4RXMA 4MRMA 4E1VA 3ADOA 2JI6A 1E4YA 1VL1A 3UPUA 1FOEB 1C9MA 1PNRA 3HKBB 1EK1A 2O48X 1E7SA 4GX2A 1EBBA 2PM8A 2V6IA 4I9HA 2C2YA 3L8DA 1YMQA 5EXEA 2NZYA 3UIEA 2QX7A 3WWDA 5JCXA 1OC4A 5I9IA 3DZKA 4JIMA 3PNOA 4P7KA 1X7WB 3G9QA 1K4YA 4X6LA 2IPNA 4D4LA 2QD1A 2AE1A 2D0OB 3H97A 4MINA 2W11A 1YC2A 1JJVA 3FZEA 2XCSB 2PSHA 1N92A 2AKAB 1H0KA 1R66A 4JLUA 5F5XA 5HZMA 4NEHB 4DV1B 3ZCPA 4KHPB 1LV8A 3NYIA 1NQOA 2ZIGA 1KAGA 3UY4A 3VHXA 4BEBA 1KJYA 5JNVA 5IKXA 2EJUA 1IN6A 1AZTA 2ONZA 3SR4A 3AO0B 1B00A 2CMDA 4JEMA 3GEGA 4LBWA 5MN4A 1JHXA 4ALMA 2J6CA 3OQOA 1CSEE 1C7RA 4B4VA 4E0BA 2PX4A 4TWJA 1UKZA 2IOFA 2CWDA 3LGAA 4B31A 3JQ9A 4FEGA 1J42A 1OLUA 3QVGA 2J5QA 3AXTA 4RACA 1TVKA 5ALLA 2YV3A 4KREA 1TCAA 2JF0A 3ROPA 3VRHA 3FR7A 3UYLA 2APJA 1HV8A 2YVQA 1W36C 1U7OA 3Q7TA 4FFNA 5CURA 3MTEA 4WGGA 4B6FA 4M37A 1AQ6A 3JY6A 2XITA 2VEDA 4ZVSA 1AT1A 1Q21A 3L6EA 4UUBA 1HTTA 1USGA 4FWIB 4BAGA 3BJRA 4LKRA 5IVHA 1KMHB 1G3UA 1ICIA 2QLJA 1MKYA 4CNQA 4RA9A 3Q8LA 3KE9A 1NUTA 5JSQA 4N0EA 2D2VA 1V7CA 2CVHA 5DBHX 2GKSA 3NFRA 1Z4JA 4L3OA 1ZUD1 2XX3A 2XOEA 3CH6A 4PGFA 3V1TC 4U6NA 5C4MA 1BEUB 3C4JA 3CF4G 3BERA 1L1RA 2OBNA 1JAXA 3KUDA 3GNLA 4JH0A 5GPBA 5TQVA 3SOZA 4B3IA 2VA8A 4DF3A 1PU2A 4ACBA 4G1BA 4RZIA 4HDNB 5LP6B 1CIVA 3O82A 2WKRA 1XMIA 1AQNA 4G1VA 3GAFA 1PG0A 3HJFA 1TM2A 3C6MA 4FDMA 1VMIA 3ZNNA 4HYEA 4AM8A 4CGYA 5C7OO 4N01A 2QMOA 3ECCA 5E6SA 3T5AA 1Z6AA 2D4HA 3UA3A 2QTWB 4D57A 3OICA 1TQ6A 2BMVA 1YT5A 2Y1GA 3UJ8A 3ASUA 2IZ7A 4HNTA 4UU8A 4JLPA 1ACJA 3R7WB 5GIOE 2BZGA 5IT9A 5AXAA 3AR2A 2W8BB 2HCFA 3SR0A 4C3UA 1Y63A 3DKKA 1T4MA 2ZM6B 2I29A 1SVNA 1Q92A 2VVTA 1DWOA 4FHCA 1F2UA 4OPMA 5GJVC 3O1JC 4DSAA 1QGAA 4MQMA 2OENG 4S1TA 3UK1A 4C0AC 4QPCA 3JWIA 4PICA 3OFJA 4BNDB 2XZLA 3HSYA 1WSBA 2JCXA 4YRDA 4NP6A 2IHNA 1MP0A 5CBPB 1Z0JA 1LK0A 3GXBA 3K9CA 3W79A 4RKYA 4LNAA 1EGHA 1FQKA 1ZUNB 5DBEX 5ED4A 1L7OA 4CI0B 4PQGA 5EQJB 1W25A 4ENQA 3SNKA 1SIUA 3U39A 3X1YA 5AW1A 3H9EO 3S8YA 2FE1A 3MUFA 3W9UA 3OPVA 2NMVA 2XR1A 4Y2GA 1G2PA 2LUOA 1WBBA 4WLFA 1J0AA 3H13A 4QDJA 3BIXA 3PIRA 1THTA 1G6HA 4TT3A 1U9IA 4DLUA 1YH3A 3OHPA 2RH9B 2VP4A 5C80A 3LCJA 3SEZA 3U3OA 3PKJA 2H2DA 4DSZA 3P52A 3BE8A 4ECAA 4S12A 4R5MA 3N5CA 4BE7B 4OK3A 2WWWA 4H16A 3PUJA 1Z3CA 4G01B 3LIPA 4K9KA 4K46A 4FFLA 1QTNA 5FTWA 2F4NA 2P3OA 2O8VA 3S5UA 1XZJA 5FWNA 3AKEA 3WKAA 4UQPA 2PBRA 2CKDA 1K5HA 1OTHA 1I7PA 5CD9A 4B6EA 2A7XA 3BHMA 4C88A 2EF1A 3AEKA 3QXSA 4KQFA 4OLHA 1LY1A 4WKCA 2Q3DA 2QN7A 3HO1A 5AM0A 1TMYA 4OHXA 1I4OA 2XNSA 5FUBA 3VR6D 2JLAA 3LL7A 3MYYA 2QORA 5FOSA 1YRAA 1EGMB 3I53A 4DJFC 3NT4A 3CEHA 1ZN8A 5EZYF 4F2HA 3U16A 5B37A 1JQDA 1C80A 2NZ2A 3UAOA 2J31A 4UDNA 1UOOA 1KK3A 4K88A 5K9ZA 2GWHA 2VYCA 3HE3A 4GP9A 3OKAA 2G7ZA 3CWCA 1ADCA 1CUYA 4LSMA 2PGJA 1RQRA 3PEEA 2DF8A 4BLOA 5TDHA 4EUHA 3H5WA 1D5CA 1XZAA 4OFBA 1J5XA 1YL6