1D1QA

Crystal structure of a yeast low molecular weight protein tyrosine phosphatase (ltp1) complexed with the substrate pnpp
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
159
structure length
159
Chain Sequence
IEKPKISVAFIALGNFCRSPMAEAIFKHEVEKANLENRFNKIDSFGTSNYHVGESPDHRTVSICKQHGVKINHKGKQIKTKHFDEYDYIIGMDESNINNLKKIQPEGSKAKVCLFGDWNTNDGTVQTIIEDPWYGDIQDFEYNFKQITYFSKQFLKKEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of a low-molecular weight protein tyrosine phosphatase from Saccharomyces cerevisiae and its complex with the substrate p-nitrophenyl phosphate.
pubmed doi rcsb
molecule keywords TYROSINE PHOSPHATASE (E.C.3.1.3.48)
molecule tags Hydrolase
source organism Saccharomyces cerevisiae
total genus 60
structure length 159
sequence length 159
chains with identical sequence B
ec nomenclature ec 3.1.3.2: Acid phosphatase.
pdb deposition date 1999-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1d1qA00
2J48A 1FFSA 3E61A 1KRXA 3O75A 3OLWA 1KGSA 1QNLA 4FE4A 4YCSA 2PUDA 1U04A 4D74A 1Z26A 2FLWA 3H1FA 3N75A 3QLUC 4MS1A 1DBPA 5TE9A 3NBMA 4JOQA 4MS3B 4NQRA 3Q9SA 2GI4A 3QEMA 2WB4A 3C3MA 5IEJA 1YMVA 4QICA 1MB0A 3RVMA 5JNRA 1JFTA 3HCWA 4QPJC 4MAAA 4WT7A 1XHFA 1DBWA 4N03A 6CHYA 3EGCA 3M6MD 4O1HA 3RVKA 4WXMA 5KQMA 3GL9A 3C3KA 4HNQA 2PUAA 1VRVA 3EQZA 5JS1A 3S99A 3SM9A 3CKMA 3O2QB 1ZN2A 5JNUA 4S04A 2HJ9A 4RK7A 3QX9A 2E4VA 2CHEA 1A0OA 1C4WA 2B4AA 2NUBA 4ZMSA 1LBIA 1SD5A 2PAFA 1KRWA 3NHMA 3H5IA 4OATA 1P6QA 3JY6A 4MS4A 3O2JA 4Z4FA 4MR9B 3CLKA 3L6UA 5C5EA 2VYCA 1QP0A 2MYPA 2WRZA 4ZPJA 4W5NA 1M5UA 4JB2A 1NTRA 2L2QA 4H3KB 3IDOA 5B3JC 1PNTA 3IPAA 4PEVA 5B3JA 4Z4IA 1GCAA 4O5AA 3IP5A 2LP4Y 4WUTA 2WJWA 4Y9TA 2A9QA 2IPLA 4CBVA 2MYNA 1PUXA 1NXSA 4KK4A 5KWSA 1RNLA 5TQ0B 4EGSA 2PL1A 2NT3A 3OO1A 2PE5A 4E7PA 1Z18A 2QVGA 3BRQA 4IMJB 1JHZA 3RVPA 3SG0A 1JWLA 1CEYA 4DQDA 4H60A 5F64A 3UKJA 2FMHA 3KLNA 4RXMA 4L85A 2ID9A 1JX6A 4MQFB 3URMA 3KYIB 1QP4A 2P9HA 3LUGA 3UUGA 3JS5A 3D02A 4RZSA 4F8JA 1NXTA 4KQCA 1NY5A 1RXEA 2IPAB 1ZH4A 3H1EA 1SXHA 3F7NA 2TMYA 5TPWA 1TJYA 1U8TA 1E6LA 2E4XA 4MQEB 3HDGA 2AYXA 2IPNA 3JPYA 5CNIA 2X7XA 4G0QA 3HDVA 5EWJB 4RXTA 4MR7A 5JNWA 4YWHA 3MMNA 3KHTA 4LDAA 4OLBA 3H5LA 1DC7A 2QW1A 4FB4A 2PMCA 4G0ZA 4IGAA 2IOYA 4EYKA 4M88A 2M98A 2P4UA 4KVFA 1J56A 3FFXA 2MSKA 3HUTA 4HNRA 1NXWA 4PYRA 3OQMA 1PNRA 2JRLA 1TM2A 4ETNA 4ZJPA 4Z9BA 3N8IA 4TLLB 2AYZA 3OLXA 3NNSA 1EWTA 1YK1A 1W25A 1P8AA 1DRJA 5FBHA 2PUEA 4W5QA 4IMIB 4Z99A 3HJFA 3OM1A 4IILA 4YS6A 1A04A 3H6GA 4OG2A 4WXEA 3VNAA 2MYUA 3TMYA 1YMUA 3CFYA 4KNYA 3LKVA 1RXIA 1LJUA 3C97A 3T38A 1E6MA 3LUAA 4G0PA 4IRXA 4RV5A 5CNKA 5DCLA 3KKEA 2W42A 1NATA 3HSYA 9ABPA 3ILYA 4D6YA 1VLZA 5FWYA 1URPA 4MLCA 1C0EA 3MF4A 3O2SB 2JBAB 4MR8B 3A0UA 2OENG 1E6KA 1IIBA 2FEPA 2FLKA 1LJLA 1QKKA 2JVJA 4MRMB 3EODA 1YS6A 3C3WA 3CHYA 3QLUA 3GRCA 4P1ZA 4JAVC 3EJWA 2RJNA 4MYRA 4Z9AA 2YHAA 2H3HA 1SRRA 3O21A 5EWMB 4XARA 1USGA 4RSMA 2ZAYA 5GQSA 4W5OA 1OXBB 2QVCA 2NZUG 3HUUA 5GOTA 1ZESA 2GKGA 2FQWA 2LIVA 3NNDA 4DADA 1YK0A 4N0QA 3HVRA 3FFWA 4NV3A 2Q5CA 4UHKA 5IX8A 3QK7A 1H9CA 4YRZA 4KMRA 4RY9A 2XDYA 1JF8A 5D2CA 4F3TA 1DC8A 1GUBA 1JDPA 3NNNA 4NICA 1EWVA 4Q6BA 3KLOA 1ZVVA 1ABEA 3LTEA 3P9YA 3OM0A 2L19A 2NT4A 5KQGA 3GT7A 1BDJA 1WETA 5IEBA 3UK0A 2FMKA 2JB9A 3GBPA 3LOPA 1JH9A 1ZAYA 2IKSA 5CNMA 4MR9A 2WMYA 4LZLA 1NXOA 3FGZA 4LDZA 4ETIA 4H3HB 4YO7A 1W9HA 1L5YA 1D4ZA 3N0XA 4E7OA 3Q7RA 3EQ2A 2N9UA 2QSJA 3RH0A 3MQ4A 5CHYA 2HSGA 3QLVC 5FWXB 5HSGA 1QP7A 3OLVA 1DP4A 2QR3A 3MA0A 4EYGA 1DRKA 3CZCA 4G0YA 4MS4B 5TQ0A 1DJMA 4EY3A 5T3YA 1Z17A 3CS3A 5BQ3A 3ROTA 2PLNA 2FMFA 4LE0A 3SY8A 2PUGA 2MSLA 3LKBA 3MIZA 4XASA 5ABPA 3LUFA 4DN6A 2E4ZA 3BBLA 4KQ9A 3SNKA 4F11A 2IDMA 3GV0A 3G85A 4EVQA 2FMIA 2LPMA 1UDRA 2L18A 1CHNA 2QZJA 3LMKA 5EWLA 4Z4CA 1BAPA 1MIHA 3H5TA 3L49A 4D6XA 4Z4EA 2WY2D 3TD9A 4LRQA 5PNTA 2L17A 1QPZA 5IUKC 1BVHA 2RDMA 1K66A 4F06A 3EAFA 4N47A 5JS2A 1JYEA 3H1GA 4F12A 4NCAA 3RVQA 2MSWA 1A2OA 1DZ3A 3O1JC 4G0XA 3OMXA 4TMYA 3DZDA 1XHEA 3Q15C 4UHJA 1RZRA 2R48A 3H5WA 3Q7TA 1GLGA 1D5WA 3HXMA 5TPWB 2CD7A 3RVSA 4MLDA 4PZ0A 3BILA 4PICA 4RU1A 1JFVA 4YV7A 1YIOA 5TQ2B 7ABPA 5T7BA 2VUIB 1USIA 3R0JA 1QQAA 4LE2A 3JPWA 4WWHA 2H0AA 1ABFA 2O20A 1ZITA 5IULC 1BDIA 2NZVG 2PUFA 3T6KA 5KI6A 3RVJA 2FKAA 5FBKA 2FN8A 1VKRA 3QELB 5JNSA 3T8YA 1YS7A 2QU7A 4QYWA 4RDCA 2IYNA 3CZ5A 3JVIA 4PE5B 1TVMA 4N0PA 4S05A 3IP7A 2WJAA 3A3KA 1U0SY 4OBBA 3F6CA 4W5RA 4NCBA 2IPMA 5IC5A 3OQNA 1JFSA 2HQRA 1DCMA 2F8SA 5HKOA 4KK3A 4RY0A 4EYOA 3GBVA 3LUCA 2PUCA 2FEWB 1EWKA 3B2NA 3D8UA 2I6FA 4YLEA 5BR1A 1CYEA 4OTZA 1R8JA 2RJOA 4WZZA 1MB3A 4RKRA 3LFTA 1APBA 1JYFA 2MYTA 1TLFA 2JBAA 3FFTA 1P6UA 2LUOA 5HM6A 2LBPA 4G0MA 2PL9A 2PKXA 2QV0A 4FE7A 4GPAA 4MRMA 3O1HB 4MS3A 1E2BA 3A0RB 4JASB 3OMWA 1PEAA 4EYQA 3KSMA 1S8NA 2E4UA 4L4UA 4RY8A 5EWMA 1YTUA 3HV2A 1M5TA 1Z13A 2FN9A 1ZY2A 5BRJA 4HYEA 1QO0A 4JB0A 1YVUA 3GA5A 5FWYB 1LBHA 3BREA 3H75A 2E4YA 4G0OA 4GNRA 4YP9A 4XLTA 3GYBA 3LUJA 3N6VA 4QYMA 2FVYA 3SAJA 5ED4A 4W5TA 1RZRD 1HEYA 2HQOA 2ZWMA 4MS1B 4EUKA 5IUNC 5IBQA 5I4CA 1DG9A 3DLBA 3QEMB 2E4WA 3C6QA 1PHRA 1M2EA 4ML3A 3M9XA 4RK5A 2WWVD 3M9WA 4KPYA 3FMVA 3KCNA 1OXKB 1ISRA 2R25B 3GWGA 3N0WA 1GUDA 3H5OA 1GCGA 1DCKA 4KV7A 2QXYA 1SXIA 3NHZA 3H6HA 1ZDMA 1NXPA 4LE1A 4RK6A 5HQJA 3ILHA 1MAVA 1U2QA 4ETMA 1F51E 1Z2EA 4RK1A 4ZYLA 3BRSA 5FWXA 2GBPA 4Q7EA 6ABPA 2DRIA 3QLVA 5KQPA 2FSPA 1AB6A 1EAYA 1XWWA 4RWEA 3TO5A 3RVRA 3F6PA 3KJXA 1F4VA 1Y1LA 3LUKA 3N53A 8ABPA 4Z4GA 3LUDA 4JP1A 1Z15A 1FFWA 3HZHA 4TLMB 3KG2A 3HM9A 1NXVA 2ID7A 2R47A 5C5CA 4MQFA 1EHCA 1SXGA 5JNTA 4RKQA 2B1JA 1RPJA 2JK1A 3Q7SA 1FQWA 1DCFA 4KZKA 4O1IA 3EULA 4EVSA 3I5AA 2VUHB 4HNSA 3KS9A 5TQJA 3W9SA 4JA2A 5E3JA 1JDNA 4MGEA 3CRNA 1EFAA 4RXUA 2YHBA 3FDFA 3IP9A 4MQEA 3QEKA 5CNJA 5TPZD 1QO0D 2CWDA 2FQYA 4KFCA 3HO1A 5KC9A 2VK2A 3N0RA 2OQRA 3K4HA 4XFKA 5DGCA 1NXXA 1B00A 3K9CA 1TMYA 5TPZA 4YR7A 3KTOA 1ZGZA 3RVLA 5BRAA 5EWJA 3QX8A 4RK4A 2A9PA 4Z0NA 1L5ZA 3DGEC 3MM4A 2PUBA 1Z2DA 2GX6A 1ZHHA 4RK0A 2FTKE 1JBEA 5KC8A 3OQOA 3RVOA 1KMIY 3CU5A 5EWLB 1D1PA 1BDHA 4N41A 5IUJC 1VPWA 4OLAA 4IF4A 2FEKA 3CNBA 4Q6WA 2RGYA 3E3MA 3OLYA 3TB6A 1T34A 2A9RA 5TQ2A 1BA2A 1P2FA 4P98A 2KYRA 4MR7B 4N76A 1DBQA 3A10A 2JVIA 1U2PA 1Z16A 3HS3A 1AB5A 4LX8A 4G86A 2BGGA 1PEYA 3HEBA 4G97A 3IP6A 3RQIA 3DLHA 1D1QA 3H5VA 1I3CA 3QELA 1Z25A 2FQXA 3I09A 1D2AA 1ZGGA 4YGXB 4ZMRA 3OLZA 3CG4A 3HK2A 1MVOA 3ROFA 1M2FA 3O1IC 5DTEA 2M1ZA 2F8TA 2CHFA 4B09A 2V0NA 3MYYA 1JLKA 3DBIA 2FXIA 3IPCA 4KRFA 1FSPA 2GWRA 1USKA 3O74A 3OO0A 3KYJB 3T95A 3JVDA 1Z12A 2JVKA 4XAQA 2HPHA 4RS3A 3CTPA 3I45A 4EVRA 2HQBA 3JTEA 4MR8A 1LK0A 2FW0A 4MPTA 5KQLA 5DLEA 1K68A 4TN5A 1ISSA 4Z4HA 5DKFA 3RVNA 1ZH2A 3SQNA 1QQBA 2JCGA 1FFGA 1JL3A 4KREA 3LUHA 3Q41A 3DGFC 3TX6A 1QMPA 2R4QA 5JNVA 3F73A 3CG0A 3EDCA 3I42A 4XXHA 3VNBA 2A9OA 3G1WA 2PJUA 3QLTA
chains in the Genus database with same CATH superfamily
3DMPA 1WXDA 4DPKA 2DT8A 3DT8A 4CG1A 5KIAA 3K31A 1PG2A 1GSIA 1UR5A 3DHYA 1Z7BA 4GUDA 1E2PA 1U04A 2PUDA 1U0OC 5JC8A 2UUOA 1XZLA 2NNWB 3JATB 3SD7A 3D9QX 1U1CA 4PGFA 1KBOA 3GGPA 4FGSA 2ETXA 1AGRA 4LDJA 4MS3B 1Z22A 4F6LA 3TSZA 4L9RA 3HWRA 4P34A 1FUIA 2VNIA 2IGTA 5TGZA 2QG6A 3KVRA 1RZUA 3CPSA 4JI6B 1CF9A 3WLHA 5AM3A 1O6GA 3M6MD 2CL0X 2AXNA 5FL3A 3T7IA 4KN5A 2G77B 1Q1AA 4MLPA 5FFFA 1R6DA 1Y8QA 3PUZA 1W34A 4EW1A 1OV6A 1Z2AA 1PFKA 2J0VA 5BW6B 3QX9A 2C2OA 3A4YA 5HX7A 3LGSA 4Y2XA 2V5UA 4HZUB 1T5LA 4JOBA 2IUYA 1S8AA 4GR9A 2HMSA 3SS9X 3AF6A 1KVTA 4LW8A 1M8GA 1FDIA 1WBBA 2FWPA 2G17A 1EWQA 3T52A 4ERNA 3KZOA 3UMMA 1NZDA 4KUHA 4RJKA 1NNI1 2BF4A 1N1EA 4FI3C 5AIBA 1T3LA 3EUEA 5JZ9A 3EMKA 4RETA 1PGJA 1Z0IA 3R23A 4B17A 1CVLA 1SCNE 3LPMA 4ZPJA 1PO7A 3RS0A 4AYTA 1NTRA 3EXHC 4B6PA 3IQEA 2EGUA 3PKIA 4RPHA 3W5DA 5B3JC 1JEDA 5ITZB 1AMUA 5A6SA 1T2AA 1XTIA 3DTVA 2ZBEA 4Q3AA 3C3AA 3GJYA 4U7PB 1NBIA 2PWPA 1H2RS 5SYAA 4TMFA 1I7DA 3RARA 2NSLA 1BSVA 4XPIB 5KWSA 1VE7A 1OX6A 5KOHA 2X1VA 4HNUA 5IASA 4BNWA 4BB6A 1PX2A 2AC7A 3CNLA 2BM8A 3EISA 1I4LD 3OEED 1ORIA 1TD9A 4NAHA 5EZ5A 1OFVA 2RGBA 1D1SA 1SUBA 1NAIA 3MAAC 4KIWA 5JHHB 5LD2C 1FBNA 2QK4A 5C1IA 3BJMA 4JJAA 3ZLTA 4NZPA 3OIWA 3L7BA 2A1IA 5IC6A 5LZ8A 1P0FA 2GOYA 4NLLA 4UOZA 5M2QA 1Z3IX 3ZJYA 3FLEA 1GA6A 1KP3A 1RXYA 3R20A 4RZQA 1RXEA 4GX0A 5HMLA 1Q92A 2DE0X 4CM9D 4DA7A 1GARA 5J4HA 2VNAA 3AUYA 4WLVA 1SQFA 3IS3A 2E5FA 2OQ2A 3PUXA 2OP1A 1BKSB 2DB3A 5CDSA 2V6JA 3PC8C 2EF0A 2V0GA 4PANA 3FSJX 4GRIA 3A9RA 3FYDA 1CQZA 1UFVA 1UFOA 3DKKA 4IH4A 4MUKA 4F4FA 5L40A 3K71B 3ZCQA 4JUIA 2APJA 4R7GA 3BB4A 3WK8A 1GKUB 4JGBA 1L7AA 1X7YB 2QW1A 2C2WA 3FAZA 4XWOA 3MN1A 4YONB 4HADA 3ZY4A 1E2UA 4F6RB 4FWTA 3GRUA 2QQFA 1WW8A 5L4NA 2EG5A 3VR5D 2VWPA 1ZM9A 3NALA 1JZTA 1SBCA 2AYYA 2FR8A 3DVSX 3HUTA 2IHVA 4PYRA 1YFZA 1R0YA 4S12A 4BVAA 1ZJWA 2V7WA 2MJLA 1AZWA 2D1QA 5L9AA 5EVCA 4A6XA 2P0AA 2WT4A 1VCNA 3N8IA 3HXTA 1MCZA 3WICA 1DRVA 3R5FA 2VR1A 3H11A 1H22A 3LJKA 5IZCC 4UJ5A 2WJIA 3MUOA 4Z7QB 5K0LA 1OXVA 3RQSA 3RUHA 2D5IA 3N2IA 3PD1A 4G81A 3EVTA 1T4MA 2FXVA 3GNSA 2FSGA 3KT3A 3HZOA 3WLOA 1KDRA 4B7AA 4AC9A 3WTBA 2UZ4A 2HRZA 3I0ZA 4NCNA 1KJNA 1F38A 3VZDA 4JLNA 5LOVB 5KCZA 1NT2A 4LBYA 2WVAA 1EHYA 2YVUA 1T9DA 4HN4B 4UUQA 4KFUA 1GPWB 1H8ED 3PNOA 5FFNA 5JY6A 3UJNA 4RHTA 4TYWA 4QDTA 1BE6A 2EWWA 3NVMB 4O25A 1BE8A 2PS0A 2PS1A 4MB6A 1OR8A 1WU8A 1GZVA 1VYUA 5D86A 2NZWA 3QNMA 2J7KA 2N46A 3BD9A 3OE5A 2IOFA 2JKZA 4HH3C 5HK9A 4CEJA 3LZCA 1HDRA 2ZAIA 3VKWA 2O4UX 3EPJA 2WK1A 3LRXA 3RM3A 2OKCA 5JSFA 3OD1A 6Q21A 1BD3A 5A4KA 3MUFA 2ZW9A 3CE6A 2QMEA 5A3QA 1TF2A 4J4BA 1EQAA 3WMFA 1YOBA 3BXGA 2DPLA 1RHMA 1L5VA 2X8LA 2XA1A 3AJDA 2NVBA 1VJTA 4IIXA 1HNWB 2WE8A 3ANYB 5KVCA 4UM9D 5CVVA 3EGXB 2J33A 2IHZA 3W2FA 5J43A 2HMYB 1OUMA 2J87A 2ZWAA 5FOWA 2P90A 3AR7A 2Y0BA 2G36A 4UHKA 5IJ9B 2XRMA 2ZULA 3ON5A 1FMCA 4MWOA 5KYYA 4NXNB 1YI1A 4CIXA 5LSAA 1HKUA 4ENQA 2ZB2A 3N2GB 3E4CA 2BOVA 3VH1A 2V3WA 4GS5A 1IL0A 1OTHA 1XQVA 3B38A 3GT7A 3RHFA 5IEBA 5FADA 2HCJB 4TM8A 1ZRSA 2WAYA 2IKSA 1I36A 4YRCA 1EZZA 4OAQA 4PLZA 4CODB 2VO1A 3A7EA 3I6BA 2BFAA 2WKQA 4YI5A 3FPAA 4CQMB 3A6PC 2ARKA 3VC1A 1ONPA 3EXHA 4OD0A 5DHTA 1ISJA 2ZVJA 1B8VA 2ACKA 2OOKA 4RKWA 2XCOA 1W94A 3AF2A 1C8KA 5BOVA 1D8AA 3GYGA 4F84A 3GC6A 2N9UA 3L4BA 4LOJA 4YJFB 2BEWA 4WGGA 4BU0A 5HSGA 1TPYA 1ULAA 1ULSA 4M83A 4A2CA 5CCXA 3F3YA 2C9CA 2QXTA 4ZYTA 4HGRA 4HWPA 3GJSA 5E0KB 1QTQA 1YL7A 1G2PA 3IKJA 3AC0A 2XMSA 3DKRA 4TL8A 4JI3B 1MC1A 1MKYA 1UCFA 2XQFA 3W3AA 4F56A 4CT5A 4EFKA 3HU1A 3C0KA 3OTOB 1JDBB 1FUKA 3RHTA 5A5FA 3BBLA 4Q7KA 4FGLA 1JJVA 1POWA 2D62A 1VFPA 1QFSA 3EASA 4MVCA 2OZEA 3I2YX 3HXOA 3PSAA 1AU9A 3UMCA 3DDNA 4LWOA 4Y2QA 3TIGA 2WYIA 1CJCA 3BMQB 3CH7A 2IZZA 3D4PA 5C9ZA 1W1UA 2GZ1A 3GJ5A 5K99A 4HNVA 3GCDA 3UMYA 3HB0A 2O5EA 2XB9A 1VL6A 1ZGAA 1L5WA 4F3CA 3DAHA 1DADA 2W83A 4C07A 3HNRA 4IZIA 1BVHA 1L4FA 1E3WB 1T5DX 1VIYA 1CLEA 2QEQA 3DVQX 3QFSA 3OFND 3PC8A 3PPVA 4WBSA 5B53A 2J0UA 5EJ5A 2NUPB 4DRXA 4O8CA 5JPIA 3PHLA 5IHXA 1Y81A 2R6R1 2Z95A 3FR8A 2WMDA 2H4HA 4NHEA 4DNOA 5B36A 4K9KA 4BNXA 1I5RA 3A3YA 1KBQA 1NBEA 2A0UA 1M73E 4BJ3A 2ZK7A 2OQVA 3UWKA 3R24A 3B2QA 4IHJF 3SHVA 1PGNA 1PJSA 3TNLA 1X2BA 3AP3A 4P5DA 4UFNA 4AX8A 4PZ0A 4N5LA 5EC8A 5E7QA 1QCZA 4C5CA 3PQ3A 1UIMA 4OH1A 3X44A 4ZICA 1VCHA 1JFVA 2FRDC 2ZUVA 5KVQA 3SEQA 1Y6GA 3L77A 4WKPA 2BYTA 1LI5A 1Y42X 3IEKA 2DU8A 2WPDA 4XVCA 4JQYA 2PX0A 4XI9A 4OHWA 3BL6A 1H1LB 4MKFA 4XFJA 3TL2A 3T12A 3WGLA 1A96A 1SKYB 2FUCA 3QELB 2ISSD 1QH8A 2VRWA 3ZD9A 1I2CA 3MTGA 3Q1KA 4FQ8A 1DXOA 1PZGA 4UULA 2EKLA 5L7YA 3RSZA 1XTTA 5GM1A 1ODKA 1M1YA 1WXHA 3L40A 2ZITA 4X00A 5AO9A 5MFZA 3BZUA 1G6Q1 4DV7B 5H3LA 2H8KA 1COWD 3VPSA 1OVGA 1FQKA 1OMOA 2NV2B 4FS8A 2W58A 4MDHA 3O8RA 2FWIA 2VN8A 2JKVA 1LDYA 2GFHA 4QXAA 3IOMA 1JG2A 3GCWA 3AL3A 4ZAXA 5IVIA 4K28A 2XQGA 4WCFA 3LFTA 5ELXA 2I6UA 2WFLB 3VR0A 3FG9A 4R7ZA 4HAYA 2BONA 1SR8A 3GO4A 2LBPA 4G0MA 5AIAA 1OI3A 2I29A 5KQRA 1QB7A 1UBTS 1WB4A 5EKUA 4X24A 2FZ4A 2F3UA 4M4SA 2UAGA 2X8JA 3HM2A 3LNTA 3ZLBA 4RVFA 4JV5B 3FPFA 2XYQA 5KTSA 1Z6YA 1GFSA 4UFPA 2BUCA 1NF9A 4QLAA 3PLRA 2AEMA 1FP6A 1YVDA 4NJOA 4C4YA 2RKOA 2NZYA 3NT2A 5A1TA 1E2HA 1KYYA 1GRRA 2WM2A 5ENVA 4O2BA 5F35A 5TX7A 1A77A 3L04A 4GNRA 3ZPXA 5B12A 5K3DA 3N6VA 1JI3A 2CK3D 3EPLA 2ZT7A 3SE0A 5KO2A 1K7YA 3I1FA 1FW6A 5FFMA 3IDQA 4L57A 4Y67A 1PJRA 4ZDJA 4PXAA 1ISRA 1RWWA 2R25B 3DB1A 1GUDA 4WK4B 1ZM4A 5GP1A 5TT1A 5BVHB 3ER9A 1CQXA 1Y9EA 1J39A 1WDMA 4YRKA 1KH1A 3OHMA 2QVZX 1T9KA 2X9GA 1SCIA 2IEBA 5P21A 2HZBA 4YRJA 5EKXA 1WDTA 3V97A 3VPAA 3OQIB 2PJZA 3LWDA 4KEAA 1U2QA 3AQ4A 1QE3A 2DQSA 1EJ6A 1X86B 2ZIXB 3VYVA 4BIIA 1C4XA 4DEYA 3ZKWB 2G3YA 4X1KB 2WDZA 4UUAA 5CX4A 4BKOA 2HQSA 6ABPA 1N2EA 2DRIA 4LGMA 3DYVA 3DBHB 2VZ8A 1P2VA 1YRWA 1Y3IA 1BU5A 2FX2A 2UUPA 1E7WA 1RYDA 5B1SA 3WK9A 5JD4A 1DV2A 2W4QA 5AW2A 1PDOA 4KMMA 1RBQA 2IYPA 4M36A 3BFVA 3ICCA 5ECWA 3H1PA 1Z15A 5BQ5A 4ID9A 1XU7A 2A57A 1JT2A 1BE0A 3HBLA 3TG8A 4ZJYA 3HZZA 4P7JA 1VMEA 2GERA 3CSUA 4J0FA 3UWMA 3CEPB 2GPJA 4H1TA 4CM4B 4DLAA 3G9TA 5JNTA 3S2SA 4F5YA 3GEDA 1SVMA 2WKPA 5CVJA 5LA6F 5LDHA 2G09A 3PIDA 5L95A 1CF4A 4YN3A 3ZOZA 1R0SA 4QGAA 5CLFA 2GZSA 2VF4X 2H08A 3VAZA 1VJDA 3VOTA 4OFWA 2GN0A 2ZAGA 2QG9A 2P9JA 3FOZA 4FDAA 1Q5PA 1QYIA 4L0QA 1V0JA 2RBGA 1YJ8A 4ZYXA 2QN7A 1WO8A 3GLTA 5TPZD 3ZW7A 3BQMB 3QKTA 2JJYA 4QPDA 4DIKA 1ID1A 1Z74A 3N0RA 4HDKB 3H6KA 5JZBA 1YQWA 3PC2A 3ZE0B 3K6JA 3K9LA 3U1BA 5D5PA 2LE0A 3MXTA 3AJ8A 4J0QA 3TQTA 1A9TA 4J4HA 4MQUA 2HK6A 3QX7A 4RADA 3HY6A 4J29A 4OHBA 5B30A 3T9BA 1N8SA 2Y92A 1UEIA 5JASA 2X7HA 5JI3E 1FBTA 3UKJA 4ZD6A 1WXWA 2JK0A 2COEA 4JVOA 2D5AA 2VP5A 4Q1VA 1UM8A 5HE8A 5A71A 2P30A 1VPWA 3R3SA 1Y4ZA 3CNBA 1H5UA 2RGYA 4IV0A 3A3NA 1JU3A 1E1QD 3INNA 3UXYA 3ZWBA 4BBPA 2BSAA 1N5DA 4YCJA 1VGRA 3VR2D 3FIUA 3SDZA 3THOA 1Z16A 1WSDA 4G01B 1F7UA 2PX6A 2IBSA 3U56A 4PX2A 4RWZA 1J0XO 3RQIA 3GOHA 3GUYA 4W1SA 5DM1A 1YJXA 4XJSA 4LQDA 5KPJA 1TKRA 1JEQA 3COZA 3DD1A 1Z25A 1U28C 2EBHX 2FQXA 4GAEA 2XCIA 4H9GA 4EO7A 3ACBA 3AXTA 3RRFA 3W6OA 2O54A 1L1EA 4ILKA 2GN9A 1JFFA 4NBVA 4LCEA 4HWOA 3UMJA 5CDFE 4AZVA 4PYKA 5C3MA 1KO8A 1ZHFA 2I4RA 4KJXA 5IJWA 3IPCA 5KTRA 4JI1B 1PJBA 1Q7BA 3H86A 1Q2UA 2PUWA 1IB6A 2XTJA 2QTLA 1TZMA 1BZYA 3HU3A 3E48A 1GUAA 3KB8A 2GZAA 4FYMA 4HNAA 4CG0A 3CTPA 1OHHD 4XWAA 2Z4TA 3L3BA 3T1YB 3PPXA 2JGEA 4X61A 2C00A 1XR3A 4HX9A 1SCBA 3OPVA 4TLDA 4RIGA 5ELMA 2IEIA 1IZ8A 2EKPA 3UTCA 3G2IA 5KQSA 1TOAA 1KMMA 4LXIA 1Y6FA 1FFGA 1P5ZB 1UBNA 1L3BA 2A9JA 3EVDA 4HSEA 4B6JA 1KY3A 2OLEA 2ODWA 3TTXA 4YT4A 2ACWA 3E81A 4E5MA 4OSEA 2OBBA 3EY9A 1DAKA 3K9BA 4GBGA 5CITA 5IDXA 1Q19A 3N75A 1V1RB 4EGJA 4BO1A 2J48A 2O2JA 3PFKA 2W8BB 1EUZA 1PYGA 1TMKA 1XKTA 3B2EA 4KXNA 4I4NA 4PHGA 4PQYA 4TN1A 1AXEA 2XWJI 2GD6A 2E82A 1B43A 1Z26A 3WDSA 1D2GA 5JS8A 1M34A 2YFQA 4YXWD 2NWQA 3KQSA 3KDPA 4NG5A 3OU7A 4NQRA 3Q9SA 3IJ5A 3USCS 2EKQA 1XNJA 2P62A 3NATA 1YMVA 4PZZA 3STWA 4JYZA 3F4KA 3B6EA 4PAOA 1LWNA 1Z2OX 3H2JA 2AUNA 1Q3TA 3IOBA 4FCWA 2FRVA 4W7SA 4PIMA 4DG5A 2FE1A 1OH8A 1Q44A 4G63A 2EEPA 1U8FO 1Z4PX 2ZR7A 1BG6A 3V2IA 4EPVA 3D7NA 3L8CA 4RK7A 3A3OA 1UP7A 2JPDA 2ZATA 4QTZA 3GRFA 3QVSA 1T8TA 1W0KD 2JGDA 1TK9A 1B2LA 1G4AE 4HB2A 5G0UA 4RA9B 4Y6SA 5TT0A 3MJDA 4V03A 3MRTA 1XLVA 1L5HA 3SDSA 2P91A 2H2IA 3TTTA 2XBUA 4IQ4A 1E3QA 3EEFA 3PTAA 1QF6A 1T25A 1TFRA 3CLKA 3R2JA 3PFHA 2VYCA 2D0PB 3GFBA 4TWIA 2VF8A 3QPDA 2PPVA 5SZKB 3U9TA 3KSAC 1Z39A 2FNAA 4IF6A 5GONB 4CTJA 4XSVA 4W5WA 3P71T 1R4MB 4HP8A 4KR9A 2EAUA 2C99A 1YS2X 5E1BA 2G5CA 3CLUC 4EHLA 3JWEA 1OWPA 2IHJA 4KUEA 2F48A 2J9XB 1FP7A 4G65A 1BHJA 4IDEA 2OZVA 3DMTA 2GZMA 2FZGA 4MO9A 3ZN2A 4BLUA 4EGSA 2FWJA 4RD6A 1N3IA 3FKJA 3JQ8B 1VKOA 2RG7A 3ZU6A 4OU4A 3GJ7A 5FPKA 3L82B 2QVGA 2XUAA 3RTCA 1FUEA 4IMJB 3N39C 1G3IA 3M3DA 3PD0A 4D5EA 4DQDA 5IWCA 1TK3A 3LT5A 1U7XA 5EOVA 3SX2A 5C1BA 3EPHA 1X7HA 3WWEA 1IPFA 2ID9A 3AGQA 1GGEA 1ZOPA 2X42A 5C34B 3K09C 1U2EA 4DDHA 2F1IA 3O3CA 3KJHA 3AVWA 1V8BA 3I9OA 5E9JA 1R9JA 3IIJA 2ZTLA 4I9UA 2ZTMA 1XPOA 3CMCO 1OXSC 3GPDG 4TMZA 4H7PA 1JA0A 2E2WA 3Q0TA 4XE5A 3SX4A 2JGKA 2OFXA 3D4BA 3N5CA 3RBVA 3VPFA 3D81A 3AHIA 4WDRA 2WLSA 3HDGA 4V2UA 1PS8A 3Q3IA 5K01A 4W9MC 1T9CA 3GGDA 4GI7A 1Z2PX 2ZU6A 2H63A 4CQMD 2X41A 3L7JA 4TS1A 5KTMA 3RWBA 1HNZB 2IUTA 2O57A 3OCVA 4R9NA 2CJFA 3M6FA 4MW2A 1PVDA 3F6BX 1U5CA 4BGDA 3H5LA 2B30A 1VOTA 4Q16A 4QG7A 4U9HS 1JHOA 3U49A 2O50A 1Z8FA 4FCVA 3VYTB 1JHYA 3EARA 1U1IA 5IANA 1BVRA 2QUBA 4M88A 2NVUA 4UC0A 3HSSA 2UUBB 4UASA 2M98A 3DBRB 3ZHSA 5FXMA 2EP5A 1J56A 3NGMA 4RNDB 1O3YA 1YU6A 5JWOA 4HNRA 1MH9A 4O4LA 4GWKA 1BXGA 2XTMA 2HIMA 1C1DA 1OSNA 3I2FA 3Q5EA 5LP6C 3ZGYA 5CM2Z 4EG8A 3R1IA 1D8TA 2XXBA 4LF5B 4H16A 3GDWA 3EWIA 4OREX 2AZ4A 1KP9A 5BMOA 1SA0A 4QULA 2SKDA 5FBWB 4L6IA 2KE5A 3CUKA 4HDSA 1M1NA 4RHEA 2FZ5A 1UDWA 2IDJA 4PTZA 4US0R 3LQ1A 1FTSA 2OY0A 1NNLA 3A6KA 1G1AA 4BNVA 3OA0A 2RGGA 3TLJA 1FQJA 1U2RA 1SRQA 2CFOA 5CNKA 2YWXA 1UBFA 3JW8A 1A2QA 1QHIA 1D6MA 1OT5A 1QTIA 1O1YA 1ZJ6A 2WT8A 5FBRB 4M0FA 4ZI3A 1KHHA 4COOA 4KHPB 1RRKA 4LA4A 2HLDA 2VKQA 1IN8A 4BKPA 5B3AA 4QZVA 1SQSA 1BO6A 4QOHA 4UDNA 5CYOA 1LI7A 5M7EA 3QKUA 4G85A 1J0DA 1ICEA 2G9VA 2YW9A 1R6XA 5DH9A 2A0WA 2RJNA 3TZHA 3ZCUA 4DLWA 4P80A 1OU0A 3V1TC 3GAZA 2DUMA 3PNQA 3CN7A 4DMCA 4EP1A 1T5SA 4G5HA 3I8SA 4OK5A 1GQSA 4JSYA 3TDNA 3OEHD 3IERA 1DV1A 1S89A 3N6RA 1TAHA 3RSQA 4BKQA 5LDGA 4ZOLB 2X2PA 3GZNA 5F3DA 3M6AA 2XAUA 3LZ6A 1XPRA 4KXFB 2NUTA 4ZVTA 2FFJA 5A0FA 4B2PA 1GRNA 4DWWA 3ZU4A 3F74A 4X7PA 2YRWA 2R6JA 3FIJA 1JQAA 1J8MF 3G9UA 4N8DA 1G66A 2W6QA 5HF9A 5JATA 5FTKA 1M7GA 2JGRA 1QIMA 3F6SA 3QG1A 1WUHS 3J7TA 1QHGA 2IV3A 5KYWA 2OXRA 3L7LA 1II8B 2QNIA 3UK0A 2AI2A 1GPBA 3OVMA 2AMVA 1AY0A 1PQ4A 4LISA 4NS4A 4I5GA 1KAOA 3X0DA 4QHYA 4FFSA 2NP7A 5J4YA 2CEAA 2I3GA 2IY8A 2QE6A 4KXQA 1W4LA 4BO7A 4ZGBA 3ZJVA 1XTJA 4DL9A 5H3CA 3D0KA 4M1SA 2ZRIA 5B37A 5FH9A 1GAQA 1XI2A 4BLQA 2CC2A 1VHJA 1M1UA 3Q7RA 3EQ2A 2HWUA 1NR5A 4CIAA 4QBIA 2P6MA 1NJ8A 2WWIA 3IX7A 1KU6A 2B35A 4UBOA 1KOLA 2CFTA 1MEEA 1FK8A 4O4IF 2XYPA 3K1TA 4DDVA 4Q3BA 1Z17A 1M8KA 3C7TA 4EPRA 4TKUB 4DLRA 1DAOA 2J3DA 3ZWAA 3M5PA 4QUJA 1A2KC 2ZJ2A 1OFUX 4DSNA 2QSUA 5ADHA 4BFCA 1BN6A 3ZGOA 2I6QA 2IWHA 4LC9A 2YV5A 3THWA 3ULKA 3K09A 3X1XA 2FMIA 1XXHE 3A9UA 4BB5A 3FPEA 2WIKA 4EYEA 1SC3A 4HDQB 1JVNA 1YZHA 4QXQA 5HS6A 4BDTA 4CL0A 1E0SA 1CLUA 4LSGA 3K0FA 3RFVA 2XE8A 2O3SA 4PPNA 4O02B 1E1RD 4O4LF 1GPNA 4FD2A 1L5OA 4I9FA 4OQDA 1OWMA 4KO2S 2H9YA 3B82A 3U3XA 1HKHA 5H3HA 1SKBA 1ESZA 2YZGA 4IS3A 4YPVA 3N9IA 1L4MA 4YAIA 3TNDA 4MV0A 4NX2A 3W9SA 1KJ8A 3PRKE 5K5EA 2BGMA 3DCJA 3ONWA 4RKEA 4EQ6B 2V7BA 2VJDA 2WHRA 3DP9A 3OP1A 1H1TA 1W5FA 3EXG1 5KCMA 5LYJA 5IP5A 1RZRA 1VP9A 3I76A 4YDSA 3T5PA 3G0OA 5ECDA 1PD1A 1NJ2A 4QXMA 1S3SA 5F1OA 4A92A 1FS6A 1GLVA 1WW3A 2OL4A 3HV0A 3QE4A 1IQPA 2VJCA 2HJRA 3HU2A 3IJPA 1FSFA 4M0PA 4A16A 2G72A 3F0TA 1ZYUA 4YV7A 5JIBA 1CJKC 3IAS6 2H31A 2XKAA 3FRHA 3WR5A 3ENNA 1QQAA 2ZTSA 4ZYZA 4HQKA 4G5OA 5L3ZA 1NT4A 1C4OA 1ZU5A 2ZJ0A 3C7CB 3FGPA 3K0HA 5BOSA 3T6KA 4RKFA 3GJTA 3RROA 2E1PA 1L7BA 4MEBA 2WFAA 3T8YA 2YY5A 3Q8KA 2PSSA 1EG7A 4JROA 3MWJA 5EJIA 3RRYA 4BLPA 4PE5B 1N2BA 4IINA 2G0AA 1LBTA 3GVPA 4J76A 4S05A 3UT5B 2F00A 1PKEA 1PL6A 2QRLA 5FUQA 3DBOB 4DSOA 2Q3EA 1XDSA 1S8OA 3SKYA 1YQGA 4HDNB 4RENA 1DCMA 3A37A 1NW9B 1N2CB 1ZAKA 1DFGA 1E4EB 3KXLA 4JL5A 5HKOA 2R0QC 1M3SA 1MA0A 4Z2AA 1XTVA 1LPNA 2XTZA 3BGWA 5J1TB 2XCRB 2YXDA 4JP5A 4BO6A 1K4KA 1MB3A 3TOSA 3QIVA 3B3FA 2P78A 4L0MA 4UZEA 2PMFA 2DC1A 1JMKC 3PJFA 4M9QA 3L7CA 5DK6A 4M8LA 3COJA 3BFKA 3BULA 3FHLA 4MMXB 2PT5A 4MYHA 1QORA 3X1WA 1EGQA 3BK7A 4FE7A 4XX0A 4QODA 1NFRA 1WB9A 2WAOA 1XUOA 5AHRA 4BBZA 1RCUA 3VAAA 3QP9A 3ZVLA 1P0QA 2IFTA 3LXMA 1DAFA 5FNVF 4CCAA 2I22A 4B2LA 2QSYA 1M5TA 3UG7A 4BB9A 3ETCA 3VQTA 1ZN8A 5A9TA 3X43A 1U0BB 1GGVA 1X6VA 4YP9A 5JALA 2EQ5A 3IRUA 4YACA 3F49S 2AOTA 3FZQA 1TYEB 4NNPA 4Q9HA 3OKFA 4B3CA 4D0NA 2J5XA 3N28A 2HU8A 1GZ4A 3QVVA 1T2UA 1PT7A 4L7VA 5HDQA 1HEYA 2O05A 5CDFA 2HQOA 4J7UA 2ZSKA 1GQQA 1E2QA 1D0VA 5CTAA 3V3KA 3PRJA 4U2BA 4C78A 4WCDA 1R3UA 2XPCA 3M89A 5KYTA 3FKQA 3LCJA 1OXKB 4JVMA 3RSOA 3HJNA 1B7GO 1SUSA 2D2EA 2GYUA 3HMQA 4GP9A 3FAKA 3HACA 1B0PA 2CJWB 2OHFA 2D0DA 5GMOA 4A8HA 1A71A 3ORHA 2V0CA 1KIAA 1ZDMA 4BNUA 1Q1QA 3UAXA 3BGDA 1A8HA 2PDAA 2DFTA 4GOOD 3THSA 3FKSD 1Y3AA 4EY6A 1JSCA 3B9QA 1U2SA 1VYVA 1Z2EA 3O3OB 4JSTA 1SIOA 2IYUA 2DVMA 3O94A 2Q3MA 3QU7A 3UV6A 2VTBA 2XCUA 3NHWA 4F4UA 4NFLA 1DJPA 2VDUE 4ZVPA 1PNQA 3G2QA 3ZZUA 5H16A 4X45A 3VO1A 2WKWA 2CLSA 1WXGA 2DAPA 3EA0A 2UXDB 3N53A 3ZR4B 4GI5A 5CDHA 1H0KA 3KEGA 1FSGA 2GAAA 1P0MA 3F2IA 3TOVA 1GO2A 2B61A 1ZOOA 2OFWA 2R3SA 3NAMA 4MVWA 4FFVA 1G8HA 4ALNA 4BX9A 1SXGA 3PI7A 5AI9A 2A8YA 4HV4A 3DB2A 2PX2A 4V0NA 2GAJA 1CIVA 1FXUA 3NQ41 2VUHB 4I4IA 3WBBA 4ZU3A 1MG0A 3CURA 2Q29A 3NHRA 3PDHA 4N39A 5DXFA 4QTTB 3QOWA 3CW9A 5I9MA 2HFKA 1PK7A 2GA9A 3BHMA 3PA6A 4YCSA 4LRUA 3L4JA 2O7SA 1PGPA 1QO0D 3NCHA 4RD4A 2OCBA 1QHEA 2O2ZA 3AZOA 1R7RA 3M33A 1VMIA 4RMNA 3GCZA 4C89A 1P1KA 3AH8A 4UM7A 5DYNA 5HFAA 3L8ZA 5DOZA 1FU8A 1OYVA 5GJCA 1DFHA 3DR5A 2A9PA 4B46A 2JAUA 3M4YA 4M7WA 1RS0A 1G19A 1Y8RA 1IIRA 1YCHA 1N5KA 4GIBA 2Z2JA 3T1OA 3DDUA 4PFKA 5K6RA 2NYAA 3RDPA 5I48A 3OQOA 2J4FA 3RVOA 1NULA 2OAQ1 3V4SA 4I50F 4A4DA 3ZZ1A 3KAQA 3QBDA 2ZAMA 3HWSA 4ER7A 4HAXA 1YOVB 2WSBA 4OLAA 5HZHA 3UPUA 1FZTA 5DJ5A 2IYTA 3W1EA 1JLLB 1H4QA 2VF5X 3M34A 3ZLUA 2V3VA 4KAXA 1Y0BA 1HT3A 5T4EA 4DBLE 4E1AA 4K26A 1PZFA 1VPEA 2ZKLA 4FHFA 1T4CA 3NI2A 3HS3A 3P9QA 4RZXA 1XQ1A 5HG0A 4ABTA 2QY6A 2O8BA 1YQDA 1RRPA 3GIWA 4AG5A 3DLHA 2C8LA 5HQTA 3DZCA 3RFFA 2ZB3A 2OWDA 3R0VA 1OC2A 4G9EA 4W7HA 5AUOB 3NT4A 1D2AA 1UK9A 4HB3A 1SCUA 1UXJA 4OGLA 2G67A 4XVHA 1T36A 1J24A 3CF0A 5K7SA 3S2YA 3B9RA 1AN0A 3MT7A 5BRNA 3OICA 2PJDA 4DCMA 1FX0A 1FDTA 2CHFA 1JHXA 1OZFA 5EPOA 4EKNB 5ALQA 3U37A 2FYTA 2GWRA 3G5AA 4TKLA 1Z6XA 2QRVB 2AC2A 3KQUA 4TKVB 1VHLA 2GRUA 3KPWA 3E7DA 3ZBPA 2GO1A 4HDRB 2VBIA 1YE3A 1RI1A 1QSGA 2ZWPA 2C5AA 1TJ5A 1WB6A 1G42A 2WYOA 3N6XA 5BQOA 2CLMB 1EWRA 2ATIA 1U7OA 1W88B 3K16A 1Z8HA 2K2QB 3K7EA 1V11A 2ECFA 4WFJA 4MKXA 1M72A 2H1HA 3TBKA 3CKLA 2O5RA 4YROA 2JAWA 5IKXA 3PGKA 4G8JA 5C7YA 1K6MA 4MX8A 5KHLB 3K9FC 4OHZA 4RLSA 1ZZEA 4JLWA 2Y4OA 4BQOA 1JXOA 4J49A 1NE7A 5KAMA 3QLTA 4AY6A 3ILXA 4NOKA 3E61A 1E0KA 2WC1A 2ZUWA 3HCNA 5C4MA 4RTOA 1ZFNA 4MQLA 2Z4RA 4ZT7A 2EZ4A 1BHQ1 2OSBA 1RRFA 4WFQA 2PG3A 3OD5A 1FJHA 1W47A 5CBPB 4EKYA 5LDDC 1F0NA 3LKDA 3RTEA 4WRRA 1Z5GA 4U00A 3VSEA 4AJ4A 1ZCBA 1SEVA 1CJTC 3HBJA 1KERA 4WT7A 1E79A 4AUKA 1YMQA 1KY5A 2ZRGA 1V5GA 2CFIA 4H3SA 4YFYA 3SN6A 3U4MA 4IW3B 4JIMA 2ZZMA 1M8FA 3O7WA 1QUEA 3G7UA 3O2QB 1UZNA 4OXIA 2CV1A 3I8XA 2XQKA 4BQIA 2PHZA 1Q7EA 1ZD5A 1V26A 3ZIUA 4DMUB 2BR5A 2UZIR 1OGJA 2IH4A 2WHPB 1ENOA 2FI1A 2ZI7A 3DQZA 2F90A 3CO0S 4JQOA 3PWSA 2P8JA 2Q3HA 3A9VA 1NNUA 4X6YA 5ALKA 2FQQA 4HFRA 3NYQA 4TXHA 3KQQA 3EQ9A 4FXPA 4D9GA 3AUUA 1EXVA 2PKQO 4J2TA 5FL7D 1PJ2A 4IIJF 4TSKA 1R6VA 2IV2X 5A2GA 4OH7A 3HKBA 2GZ3A 3IQIX 4UMVA 2QMQA 4YP1A 4B73A 2IX3A 3PWTA 5B7GA 4C2AA 1G20A 1OLXA 3NEJA 3EJ6A 4ARZA 3NR2A 3CT4A 4IX1A 3WL8A 3BQNB 3PT5A 1ZNZA 3NOOA 4DMKA 3IPAA 2IYWA 1WP4A 2RKWA 2WWRA 4QELA 1TCVA 1UEXC 2YOFA 3GT0A 3IP5A 3JX9A 4OMFG 3HGMA 2SCUB 1Y8ZA 4UKDA 4PC1A 2IKQA 3MD0A 5TDHA 3M1IA 1PVOA 2G7ZA 3L84A 3D6NB 1WXEA 4O3FA 4QECA 1DQYA 4LOIA 1NWHA 3F3MA 4RJ2A 4TRRA 2ZRLA 4X3OA 4CF5A 4M87A 4CLOA 2JH8A 4J0HA 4PGGA 4PZLA 3E58A 5I51A 3PXBA 1JHZA 1SVIA 3OLCX 5DM4A 3SKXA 4ALMA 3HL4A 1X7ZA 1NVKA 4YMVA 2VH2A 3K94A 3FPGA 4FC6A 3KLNA 1KOGA 4OBEA 2GARA 3ZEIA 1AVTA 3FSGD 1GTVA 4IFBA 4IIHA 4M55A 3IP1A 4MARA 4P53A 4RAOA 4HMQA 5L51A 1NA5A 3JS5A 2C2GA 3LP6A 5CT4A 3VR5H 1W1WA 3D02A 3DFIA 1LTHR 1LNQA 3FWKA 4ARUA 2A7XA 3DBLA 1FYDA 2I4NA 2ZI3A 3AIOA 4ARSA 3ZCTA 4LFBB 4TV9F 3MTDA 4DV3B 4QARA 5FPTA 4FW8A 2VA9A 2JNWA 4KJZA 4WXHA 3S6JA 1WL8A 2W2MA 4GVPA 4NV1A 1U8TA 1RXCA 2V5AA 2AF3C 3JZIA 4I4TB 4Y6GB 4ZAGA 2FPOA 2N1BA 4ZTBA 3T3HA 3REOA 2AYXA 4MV8A 4Z1MA 3R09A 4JODA 3UICA 4F5WA 4DWVA 3OE1A 4G8DA 1DL5A 1QGUA 3ZHBA 5HE9A 5B55A 4RXTA 1CTQA 4YLYA 1MVLA 4Q4AB 3OESA 3WL5A 4DUPA 421PA 2I8LA 1E8MA 2WU1A 3ZBUA 2XBLA 2VI5A 2ICAA 3JZFA 4OQLA 2X9NA 3L1UA 3TR0A 4IJWA 1JU9A 2AHOA 2Y05A 4RPKA 2HWXA 4YI3A 4K7JA 4CT0A 1VLLA 5HA5A 1LSSA 1C30B 1ZNQO 3W6PA 3EPKA 4LTDA 1RP7A 1EFKA 4KTVE 3ZZMA 3FBTA 1LDMA 2FHSA 1R5NA 2QRJA 4KFRA 3KZKA 4WLUA 2OCDA 1AE1A 4ZI7A 1GSOA 1RAFA 4MGZR 1CRPA 3N07A 2JIZA 3HCPA 4P7KA 1P2BA 3K73O 3KEQA 5CIQA 5DB4A 3KLBA 3WNDA 1EWTA 4YHHB 1A7UA 1E3IA 4ZANA 4LJAA 3WBFA 4NEHB 3UH0A 2AN3A 3PEWA 1NZFA 1PR6A 3UG6A 1XGKA 2XB4A 3GAFA 1DARA 1FE8A 1K6EA 1QG2A 4MW1A 3TR6A 3VNAA 2OHOA 5E1DA 2GNAA 3WHPA 3E6AA 5ISMA 4B83A 1WG8A 2GZ2A 4KPUA 1T1RA 5CURA 3OCCA 1H6CA 3PENA 3AKCA 4FYJA 5DTIA 5C3UA 1NVAA 4R40A 5DBFA 3V7YA 3QV1A 3VDQA 4CMAA 1J2UA 1E9SA 1F06A 1PQYA 2AR9A 4Q3NA 4B81A 4BCDA 4PO3X 5LZ9A 5IVKA 1AKRA 3PVSA 1G5PA 2X3UA 5LQSA 1TVEA 3FYUC 3KEMA 4IEFB 4N9WA 2VPTA 4RMIA 3JZMA 5C1OA 3GJ3A 1R4ZA 2QD3A 4DOMA 3FCUB 2WU0A 3C3WA 3CHYA 1AGNA 3PQCA 3I01A 3RYFB 2HY7A 1H2BA 5BT9A 2H3HA 5B1HA 2P6NA 3JQPA 1B74A 4OYHA 1ZNWA 3VISA 3AY3A 2ZAYA 1JIQA 3GLGE 5BN4B 4R0MA 1USWA 1GT6A 2FQWA 2IEGA 2PBFA 2W2OA 2X8WA 3C6ZA 3L0OA 3LPAA 4IXTA 1XNQB 1H2XA 1XRQA 4PG8A 4P7GA 1TPZA 3V3TA 2GCGA 1G60A 4JENA 2EFYA 1KAMA 3FPHA 2QQ0A 2J7PA 1WQ3A 2WVHA 3QUBA 4RY9A 5CEEA 1JF8A 1BMQA 1YVEI 2V6BA 5AJTA 4P86A 1U4SA 2QTTA 1LDEA 4RDXA 5C31A 2H18A 4Q6BA 2Y8EA 3AWIA 3E84A 5JFGA 3ZVKA 4CEIA 4EY7A 1JGTA 3V8VA 4CLRA 3BS4A 1UBSB 4UU7A 2C2HA 2YXPX 2CLHB 5CDGA 1KMCA 1GXSA 1QZTA 3VHLB 1JH9A 1AK2A 3F5DA 3NFRA 5CRIA 3DNPA 1XALA 4OB8A 1Y8QB 3T3DA 1MHTA 3G9XA 3TM4A 2JFWA 3WNQA 4P8RA 2HTEA 3SQMA 3V6LA 1IOLA 4DJJA 1Z6QA 4ECEA 3V42A 1VRCA 2R79A 4KCGA 2GM3A 5JROA 3DTTA 2YWEA 2GCOB 4N12A 3OZWA 3AB8A 3RYHA 3U0VA 1DCTA 4D81A 4D0SA 3UHJA 3QY9A 4DSUA 4Y2TA 2EW2A 1TYAE 3WDMA 5LYJF 2A6PA 3CZCA 3ELYA 4B4VA 3U5ZB 2HO5A 1HDYA 2Y93A 4G37A 3VDRA 1BOFA 1IXRC 3CS3A 3JYLA 4RC9A 5GAJA 1L1RA 4UNIA 4LE0A 2IBTA 1I2BA 3IUJA 3R7BA 4Z3DA 1E2MA 3BTOA 4LZWA 3IAAA 3S27A 4XB6B 3KIPA 4L9WA 4RMJA 2JHAA 2E37A 3DTVB 4LYAA 1KY4A 3CNHA 2AB0A 4I1SA 1LA2A 1DT3A 2W6OA 5FBVB 5IRCD 1HO3A 2HLHA 1W36C 3DZJA 2HA7A 3WQBA 3KKQA 3E35A 5BWNA 5KOHB 1H94A 3S8MA 2AN9A 1F0YA 4Y1FA 1B0UA 2P6OA 2CCKA 2VPWA 3LQFA 1Z0JA 3VSBA 3MJTA 3UFXA 4FKBA 5GTDA 1M2GA 2F3SA 2O8DA 4PC3A 4AP9A 4ZI7F 4UU0A 4XD2A 3E8MA 4DNQA 5BNTA 1KFKB 3FWZA 1SU8A 2E0IA 3B3QA 1V4BA 3DOFA 3U7IA 4DQXA 3W79A 4DR3B 1MIOB 2LZ0A 1JYEA 1K06A 2O6LA 2OZKA 4HGYA 1DB3A 2RHBA 1RU3A 1VHQA 2P1ZA 3WQSB 1DTWA 3ZDEA 1A2OA 1H3EA 2DQYA 3DJFA 3CB2A 3OMXA 1QTNA 2GNPA 2H00A 2HDOA 3EHEA 4OFBA 4PG4A 4TMYA 2OHGA 1NIPA 1DC3A 2F4VB 1AUXA 1TJPB 3BILA 4LRTB 2WM9B 4D9KA 4ZV7A 7REQB 2B4KA 1AQ6A 4F7DA 1QLJA 2Y1GA 4WASA 5TQ2B 1MPTA 3AUXA 3FDIA 1W48A 4HQOA 1OC4A 4HFNA 3WO1A 2AMLA 1ABFA 3M83A 2O20A 3A32A 5THQA 2BTEA 1NQUA 3D6JA 3BH7A 1E2KA 3JD1A 5JNSA 4OOFA 1RM5A 2OCPA 3F7TA 4W1QA 3L0DA 4HNGA 1UXHA 4TSFA 1RXWA 1P17A 1VSVA 2XADA 4FOPA 2Z09A 4HZGA 4JUCA 1Q3HA 1JPNA 1X80B 3UWDA 4B3XA 1QH9A 4TL6A 4XCXA 5CJ2A 5CR9A 1WNTA 4UAGA 4NCBA 4GECA 4FLFA 1SBHA 1OZAA 4JK3A 4MJXA 2GBCA 3DOEA 4KK3A 2C5EA 4PX5A 2FEWB 4NYIQ 1I3OA 3UB4A 4Z0TA 1IG3A 1ND6A 1QZUA 3ILSA 3W5BA 1Y1QA 4WXPA 2VJQA 3CISA 3GZ4A 4LMPA 1YGYA 4P4GA 1A82A 2EFEB 1SO8A 2HXSA 2V7XA 3ERCA 1JYFA 3ZDFA 1P6UA 1VG9B 1XZAA 2G70A 3CJRA 3UATA 3FYUA 1HEIA 3FUWA 5DN9A 4W1PA 1OX4A 1M0SA 4YAEA 4J0GA 4ZVKA 4MWEA 2GPAA 4BPRA 1E2BA 1C5KA 2QL9A 2VQDA 3WHIA 1G18A 4B3IA 1RI4A 5AK5A 3QVJA 2EJVA 3FM9A 3LPCA 3KSDO 4P4TA 2IVZA 1J09A 4EH1A 1N0WA 4CU2A 1FFYA 2VRCA 5JBIA 1LXCA 4HYEA 1EXNA 5JPCA 1G4UR 2D00A 3QMMA 3L7AA 3B8EA 5AI8A 5C5DA 2O23A 3NDRA 4QGFA 4KPFC 1KO1A 3AUTA 4JJ8A 4CEJB 1P7YA 3C3PA 2P75A 4WNCA 4GYKA 5BSRA 4WFKA 5HIKA 5BSEA 4DIUA 2WMNB 1DDOA 1V5WA 2YWRA 1AHPA 2GSWA 4LBZA 4CN9A 4G0WA 1FLDA 3QFFA 2WWVD 4CM3A 1BDMA 1DPFA 4HD8A 1JAHA 4JMLA 1Z75A 4TLCA 4AMZA 2LCFA 1RYNA 4S0ZA 5EZYA 1YUNA 1GTJ1 3P97A 4RO0A 5J9FA 3SBXA 3X1DA 5A5DA 1FRZA 5AHXA 4RZ2A 1T24A 1N0IA 3GMIA 4Z7OB 4IV5A 4RCYA 1P91A 2AWNA 2GHQA 2QXYA 4QPZA 3UXMA 3IO5A 4AD8A 3BFJA 2WABA 3BIOA 3T7RA 2V6IA 2HWKA 4ZJZA 3WDKA 4ZPXA 4ZHQF 5JH7A 1HYQA 3FMOB 5AOBA 3AEUA 5KNDA 1XFDA 4YRQA 4YMHA 2ZPTX 4J0CA 5HW0A 1E64A 1RI3A 4L9AA 2CE2X 1Z4LA 4MKHA 4EW2A 3ICQB 4A73A 1QO7A 3QRWA 2UVPB 5FPSA 2OGWA 1K7XB 2UZ0A 3NDJA 5AT1A 3PIRA 4NJMB 1CNEA 4JT9A 4JDUA 2CNWD 4CQLA 2PQ0A 1VTKA 4N6GA 4N7JA 1ATZA 1PJQA 3QW2A 1BVUA 4M9RA 2G63A 3I72A 4JLOA 1TM7E 3NTQA 4I8DA 1AZLA 3EXHB 3O9VA 4PLVA 3ZDRA 4F4DA 3W8NA 1Z83A 4LZPA 3QBJA 3BAFA 4B87A 2J6BA 3BT7A 2VQFB 2BEWB 4ND1A 3I1YA 1FPMA 2CMFA 5ALMA 2XNDA 3W4IA 5LL6P 2I4TA 4ND4A 4ZZ2A 5DX0A 2O19A 4RAQA 1CE8A 2F1KA 3S7TA 1C9MA 2HK7A 3QVXA 5JWHA 1IQ0A 4NYJR 2MR6A 3IGFA 2DYKA 4PFJA 3HO1A 2GUWA 4NYMR 1C9YA 5G4KA 2R8BA 3A2NA 5LD2B 3FVWA 3PPYA 3CVYA 3NGLA 2ECKA 4M89A 1CFZA 1OFGA 4MWZA 3QX8A 3CR3C 3P4YA 4ZN6A 5ES4B 5HKBA 3I3SR 1QHSA 2JGLA 4JUAA 2P2NA 3ESAA 4HQFA 4KUGA 4RLFA 3R4VA 4MUHA 1GZ6A 4XGIA 1YRBA 5DNEA 1W87A 4NCJA 4ZZ0A 3ZTTA 4LX0A 1OBFO 1Q1ZA 1F20A 4N41A 1OZGA 4FCCA 1ZMRA 5AJHA 4DIBA 1G7TA 2V7QA 1G2QA 2FEKA 4XYEA 5FCDA 1WMDA 3ZY6A 2BSQA 2GXAA 1JQEA 2EV9A 1DWOA 2LIPA 3GRZA 1Y1RA 1WWKA 1WBJB 4PWYA 4IGFA 5KZMB 4XIGS 3S81A 1O94D 3ZI4A 2J0UB 4KKVA 4DRXB 4JKIA 2H7YA 3TVDA 4CLEA 1DIAA 1MBZA 2DUUA 1SVWA 2QN1A 2B69A 1VE9A 3F6YA 4XDHA 2RARA 2XA2A 3AUJB 4KWHA 2C04A 2CKMA 1QV7A 2IDKA 2P0YA 2EZ8A 1F5SA 1VB3A 5BMVB 3NO4A 3JRWA 1TADA 2IUUA 4FGZA 1CS4C 4Z9XA 4X95A 3NOXA 1GPUA 1P5JA 2JFVA 2QX4A 1NW6A 2VPYA 1M2FA 3EFHA 4IDFA 3VI4B 1CY2A 4BO9A 3ME5A 3ZWPA 5LKRA 1TTHA 2PH5A 3HB5X 2V0NA 3MYYA 3EEQA 2H1VA 1IK6A 3H9UA 2YC4C 5LJIA 1EB8A 2IBMA 3IULA 4URUR 5EJ8A 1DOZA 1ZWKA 1RRMA 1GVHA 4QEKA 2IS2A 1C3OA 1CUHA 3QU5A 3ZUGA 4ZARA 4LOAA 4EVRA 1JPUA 3LLCA 5IBCA 1S2GA 3JR3A 5KQLA 1KSFX 5CH8A 4D82A 3SVLA 1RYZA 1XP5A 4AWBA 1RHRA 1M1YB 1UXOA 5AK4A 4YYEA 1NRIA 3MJVA 4FDLA 4BC1A 1K7EB 3ROKA 3TX6A 4GOLD 1HT1E 2QZZA 4LSMA 1QK5A 4DCNA 5EZYF 1KO4A 4BMXA 4KQXA 4R1TA 5E95A 5IJ0A 3G1WA 1QJCA 5ICCA 5MN5A 1NE2A 4GMFA 1O57A 4GM4A 2R8XA 4QWMA 5IS2A 1FFSA 2HF2A 5ICEA 4LTMA 1TZBA 3JAKA 3OLWA 1E0DA 4MIKA 2OV4A 3BORA 3BEOA 4MRAA 4N54A 2F9MA 4C0AC 2C61A 3OQ6A 1VE3A 3MNFA 1VLHA 2Z2IA 2Y6VA 4RGVA 1CDDA 1QVVA 3DWFA 2GI4A 2X8JB 4IFIA 4JCOA 3K9WA 4A8JC 4JZYA 1SCKA 2QDXA 2WKRA 4JX8A 4H1HA 2HBQA 2OCYC 1KQ3A 2ZSJA 1JQBA 2NTYC 1SD2A 3EBPA 4MTLA 5B58C 1U81A 4FEAA 2F64A 2NXWA 4O2BB 4TT3D 2ZUFA 4ZVUA 3CKMA 1SU7A 4GEGA 2XKJE 4AVYA 4FGWA 4UXJA 4TWBA 1LX6A 2PZMA 2CW5A 3HVIA 4KQJA 3PHJA 4XYGA 5FR2A 4A0HA 4B2IA 2H06A 1D4OA 4K6HA 4DUGA 1CW2B 4WNAA 4R71A 1SOAA 2NUBA 3SJ7A 1MB9A 2CZCA 3PG5A 2OV2A 1JFRA 5DIZA 4FEYA 1J7JA 4CIDA 5LZ4A 1AMNA 3NHMA 2PD6A 3H5IA 3JALA 3E7PA 1KK1A 2GBIA 4R69A 3MTJA 3AFIA 2Q3DA 1QRUA 1YB4A 3ISTA 5IFLA 2CVFA 2CDRA 2AR0A 1BJRE 4EF6A 5IZCA 5AVQA 2VSFA 1VKHA 3IDOA 1X70A 3TE7A 1NNEA 4UEOA 5DBEX 1B41A 3BSSA 3M4NA 3MMSA 3ZS9A 4F2PA 4O5AA 4PSUA 3R8CA 2HYIC 1FCJA 1QHNA 4FT4A 1PUXA 3CX8A 4R51A 4I3HA 4P0QB 5GVSA 4BKRA 2W5UA 2PZJA 5B6IA 1RNLA 5EJEA 1FU7A 2GN8A 2IXAA 3QXHA 3R7DA 3GP3A 4L5JA 3IEUA 3ZWVA 3ZNNA 3LD9A 5YASA 2IWRA 2FOXA 1N0HA 3S8YA 5FWAA 1XD2A 1FP1D 3MLEA 3HXLA 4H60A 4JUDX 1KJJA 1XELA 1RJGA 2WVGA 1EX7A 5DHPA 2OV8A 2CNOA 5J5AA 5EQTA 3VVBA 1VE5A 3AZQA 2WZBA 3TEJA 4CIYA 5C53B 4GD3Q 5IBPA 2IHNA 3K5PA 5EY5B 1KK2A 2OEPA 4LYDA 5FYQA 5BORA 4NBKA 4M22A 4HDMB 4OKSA 4ZO6A 4OX9Y 1MDBA 1NXTA 5AOVA 1DJQA 1FX1A 4V0RA 3WGVA 1A7AA 1QMGA 3GQBB 4NOJA 4MKRA 1Z07A 1JKFA 1C50A 3SEAA 1GKLA 3A8TA 5I3ZA 3MJEA 3H3FA 3IAFA 3W06A 1T9AA 2JA2A 1SFRA 3HBAA 3NTRA 4N6NA 1ISIA 3VZPA 4QJ3A 1L1FA 2H5IA 3AERB 5DYGA 1JKJB 3PGJA 3QFTA 1AS2A 3AVYA 1NFQA 1UH5A 1VIAA 1N8KA 1YIDA 2FPWA 1JIKA 2IGBA 2UZAA 3UC5A 1LVUA 1ZI8A 1TM3E 2IOYA 4CHTA 4YTEA 1V5IA 1G2IA 3IT2A 3PDIA 4W6QA 3AFHA 1E32A 2LDBA 4JY7A 1GYPA 2BR3A 1PZXA 2FPPA 3AO0B 3FCOA 3SHWA 1Z5OA 3CBQA 4YJHA 3SLGA 1E5VA 4NU0A 5A6VA 3OQMA 5ALZA 3DHVA 3WK7A 2HA3A 3IDAA 1EMDA 3IPXA 4F2GA 1ZLYA 1ZX1A 1ZIYA 4BWYA 2WA1A 1FYEA 5THKA 1Y7LA 2BKVA 3FOFC 1J20A 2D6FA 1D4FA 1P0CA 2NO0A 4MCHA 4F9GA 3RU2A 3DTVD 4IDAA 4RANA 1DRJA 5FLYA 3C14C 3K4PA 4H7DA 1KRHA 4GLJA 3V4OA 2WF7A 4GR4A 1MJNA 4GXQA 4I3GA 4MWGA 5K51A 3T5GA 4ZIRA 4ZKDA 5JAIA 4WXEA 1LDBA 3F96A 5AOAA 5LQMA 1AA6A 1NVUQ 3TMYA 1L5FA 3K0EA 4INAA 1JFFB 3AR9A 1UOOA 3OCZA 4D6PA 4KNYA 3C97A 3NPAA 1JILA 4KV9A 3FR7A 1UOEA 4P38A 4Y9DA 1I9GA 4LY6A 3ZHQA 4RE5A 2VSXA 2OO5A 2FGKA 2FZLA 4JGIA 4M86A 4PC2A 3E3AA 4AS1A 1T8SA 3G5TA 2ZXFA 3ABOB 3EWNA 4D57A 4OU5A 3SIRA 4HNAB 3PDUA 1DO8A 4MVJP 2XGMA 4M9SA 5C51B 1R1DA 1O0CA 1RLIA 1VLZA 3O7MA 3O2SB 4J7XA 2D7JA 3KUCA 4P22A 1QDEA 2ECQA 2MMGA 2NP6A 3H9GA 2R65A 3HKCB 3SYKA 4LYHA 4OB7A 4LRYA 3WKEA 3EODA 5I5EA 1GGJA 1H65A 4OB6A 4BNGA 1TO1E 1IHDA 3CJTA 4GWLA 3FROA 5E0OA 1XF9A 4NABA 5IVPA 2O8EA 1V9CA 3MFQA 4HVLA 2ZIAA 1X7XA 4PX9A 4UVIA 3BJRA 4RABA 4S3MA 3NYIA 2EFHB 5JDIC 3GHHA 2Z1NA 1Q15A 2QS9A 3LIIA 1KO7A 4MW9A 1QR6A 1YK0A 4J03A 4R9SA 4DY6A 4LDRA 4FGUA 3TF5A 3RUCA 5F1YA 1RI5A 3CLRD 1GYQA 4QVIA 3HVRA 1CF2O 3IE1A 1QBKC 5IARA 3PEYA 2K7FA 4R5HA 1M34B 4D1YA 2E4AA 4F3TA 2IE8A 3NTVA 3MJ4A 3D0OA 1GUBA 5EFZA 1X7GA 1JZSA 1NKTA 3A27A 4HGZA 1V7CA 4AIRA 3LXUX 3D8BA 5ALJA 3E9ZA 4HG2A 4EO9A 4KXWA 3UK6A 1P1FA 4PPGA 4Z54A 6REQA 4C2UA 1HTWA 1VA4A 2JFZA 1KJQA 3CLVA 1OLUA 2FSUA 2H85A 5DEIA 3T7JA 1D3AA 4EJMA 1UUFA 1ZAYA 2I91A 4N5DA 5EYPA 3VJRA 4WKCA 4FHEA 3RS9A 3USES 4UE6A 5E6UA 2HF7A 2QB5A 4H3HB 3RJ5A 3VKUA 5JANA 4C9BA 1WZNA 1TQ6A 1DBRA 1SM4A 2CLKB 4MI1A 3WFZA 4Z53A 5CVCA 3N2LA 4KE8A 2JH3A 3M0EA 5IBRA 2Z6UA 3MWKA 3E5HA 3OLVA 4FNGA 1L5HB 3BH0A 4Y2SA 5C7IO 2FG5A 5E1OA 4R2JA 1BRMA 5F7OA 4LS3A 2WFMA 4WESA 4K9OA 3UHFA 1LKZA 3GAMA 2ZYVX 3EVBA 1USVA 4KXUA 1ZRNA 4U6SA 4N4AA 1MOSA 3O3NB 5HYVA 2YJ4A 4NP6A 5B2ZA 2E4ZA 2OSVA 2FPMA 2PN1A 3AP1A 3S29A 4F11A 1FTQA 3DOUA 1QRAA 2BZSA 3F71A 4AKTA 4HMOA 1KJ9A 4GOND 2ID4A 3EIXA 5AXDA 3QFCA 1C0PA 3J81A 1V35A 3BM5A 4DWJA 3LBIA 1G3RA 2Q0XA 2RBKA 4QT4A 1LRLA 3BJIC 4DYDA 5H81A 1RLTA 5AVZA 5CXQA 4R1MA 4UUBA 2QTGA 3FHTA 2HX1A 3NVDA 1Y6RA 2OBNA 3IEXA 3TXAA 2CVHA 1W4ZA 3K15A 2HHHB 1HDOA 2QRPA 3EAFA 3WGHA 5G1OA 3AR3A 2C59A 3E1GA 3BUSA 1KTVA 2C98A 2Z6QA 3CPEA 3C8UA 1YDWA 2ACVA 3H5WA 4BX2A 1KO5A 1NMSA 3Q7TA 4DR7B 1OFUA 4Q3KA 3ENQA 3QKWA 2NU6B 2ZTVA 2B7LA 5ALGA 4FDTA 4DCCA 1QYCA 4QRDA 2F55A 1BWQA 1WLYA 1RKXA 3PTLA 4UAJA 3RIXA 1Y4SA 1L4EA 3B1VA 3G5UA 5CYGA 7ABPA 2VUIB 3KPYA 3DMHA 3FVRA 5G0SA 2LV8A 3S55A 4XB2A 1WOYA 2C82A 4RIFA 3RREA 2J3EA 2AT1A 2RHTA 2RMKA 4JEMA 5KI6A 3CLSC 4D80A 4YMGA 2FN8A 2ZYIA 3EVFA 3T1VA 4EARA 4KR6A 2P35A 3L8YA 1HE5A 4RDCA 1FMTA 4FFBA 4ZVRA 1YR9A 2BHSA 2J30A 4LYYA 2NVUB 5D6OA 1VZ2A 3NH6A 3A3KA 4ADSG 1R4NA 2H29A 4Y6OA 3HEAA 4Q3EA 5DNCA 3ZLJA 4P84A 1C1DB 4L15A 4IFEA 3W3AD 1VHTA 4UEQA 3L0ZA 1L4BA 3AEQB 1WKVA 3B3GA 3D8UA 3EBOA 2I6FA 1U7PA 3N70A 7MHTA 2CMDA 4OTZA 2VPPA 3X1MA 3EVZA 2EHDA 2PO5A 2IU0A 2C4NA 4LWPA 4KQFA 1SA0B 1E92A 2D1YA 4U2FA 3DHNA 4O29A 5CGZA 1M1NB 2DBRA 2VDJA 3NAGA 1G2OA 4ND6A 4KGDA 4XDZA 3TBHA 1NKVA 3FFAA 4I1UA 1G8FA 1Z0AA 4AZ3A 5CLIA 2FH5B 4DIOA 5TIIA 1JIVA 1LX7A 3A0RB 4PVDA 4EJ0A 3E8SA 3SYMA 3V48A 3BXEA 4BB0A 4G24A 3TEFA 3ECAA 2E4UA 3R40A 5C46F 1BQ3A 2HSJA 1FFAA 3HVJA 1YT5A 3U0BA 2V97A 5JDIA 4DZRA 4BLWA 2CB9A 1C9KA 2OV1A 2NO1A 3D4OA 3HC7A 1NRXA 5AW4A 3ZD8A 2FPKA 5CXSA 2Q7DA 5ED4A 1TF7A 3RYTC 1E1CA 4MJ3A 4RVNA 5K8CA 2ZWMA 1PYDA 2J31A 2RGDA 4Q7QA 6GPBA 3DLBA 1BQ4A 3IELA 5E4JA 3PICA 1G6OA 1E94E 4WKGA 1QBGA 1XZJA 2G8NA 3M9XA 4P2BA 1U98A 4RTNA 1NYLA 3GJ0A 4AU1A 3GWGA 1HMYA 4YUVA 1IE3A 1E59A 1JHQA 4C3VA 4EATA 1YS9A 2IELA 4YT8A 4CEHB 2DR3A 2QDKA 2QUAA 3EZGA 4PQEA 4EGAA 2NUTB 2Q3BA 4DCPA 1HTTA 1OWNA 2FETA 4N5IX 3TVTA 5H70A 4JLAA 1YRHA 2JJQA 4JI8B 1GR0A 2ZJ7A 2H6EA 4KQKA 4DXAA 4YQYA 3O4GA 1ESNA 1PV1A 2WQ6A 5DTJA 4KIGA 4EKIA 2X2FA 1U0HC 3TO5A 2OA0A 1PJ4A 4FQ7A 3WIUA 3B20A 2J5KA 3QE3A 4XRGA 1YA4A 1E62A 3OZTA 1L5GB 2DWQA 2OUIA 1XMQB 5BYKA 4HC4A 1SC4A 1DAEA 1JDZA 1QKJA 5J2UA 4OKIA 4EMBA 3HM9A 1F2DA 4BZXA 3W5AA 4IGKA 1TTQB 1S0UA 2DPXA 1QHFA 3RC9A 1FTNA 1JJIA 1M6NA 1Z9BA 2JA1A 4INZA 5BUZA 4WLEA 1J8DA 1FLAA 1IDN1 1X8KA 3CUWA 3ZYCA 3FVQA 3ZGNA 1TIKA 2IXBA 1DDGA 1NJGA 1WPGA 5D3QA 1TLLA 5CLJA 1LTKA 2Y9MB 1A5TA 3NH9A 5TMPA 4RGBA 2I6TA 3OKAA 2B83A 3IP9A 4OSOA 1J9ZA 1I01A 2FQYA 3ELDA 3FBGA 3K4HA 1SQ0A 4H2DA 4HK4A 1W4CA 3TCKA 3HBFA 2J85A 1X1AA 2DJIA 3KVNA 3OI7A 3M4XA 2HDWA 4LVUA 3KCQA 5FI1B 4AFNA 3DFKA 3JQAB 4H7IA 4CKXA 2JGJA 1OWOA 4NS1A 3HDTA 3K1AB 1CC1S 1ZHHA 3BGVA 1SPBS 3FTQA 3TCXB 3SXUA 1ZWLA 2CXXA 4RE6A 5BSGA 1NDQA 1O96B 3V9AA 4J7AA 1EA7A 3TJRA 3ZHRA 1SK9A 3ZGZA 4BVJA 5ARBA 5HJ7A 3OLYA 4B75A 1XVAA 2BM0A 2ZQ5A 5DW0A 5ECGC 1IRIA 3GN2A 4UBLA 1S02A 2PWYA 4G2NA 1Z4JA 4G56A 4RVDA 3NWEA 1UQUA 1U2PA 3H99A 2VP2A 4TL7A 2YIMA 3GUUA 1U31A 4CL3A 3ROXA 4GPEA 4NATA 3I6MA 2G9RA 1G8YA 3ONFA 3RIMA 2AX4A 1G16A 3EZ2A 2J3HA 4E70A 3OX4A 3I0NA 1OCEA 3DQQA 1NBOA 1MVOA 4CMIB 4RJIA 4ZODA 3U3JA 1KI6A 3ZWQA 1V6CA 1RJEA 1YDMA 2C1EA 5FUWA 1C3EA 1OPRA 1PFGA 3TKAA 3USZA 4K5QA 3KQNA 1XO1A 4MJLA 5A5GA 3NUGA 2DTEA 5CUQA 1H2AS 1F1JA 1GPKA 5GGYA 3WLRA 5I7OA 1JSRA 1O58A 3WL6A 4DTCA 4G07A 4OF4A 4E2YA 2ZRPA 3IDFA 5T64A 1RWQA 2B9VA 2ZP1A 4S1WA 2NUAA 5ILQA 1ZBQA 2A30A 5DKFA 1IUPA 2YIDA 1CZLA 4E2XA 4B3FX 1IXKA 1P80A 1RIIA 2EOAA 2H4JA 3ZS8A 4OJMX 4IDGA 3V9PA 3IVGA 2V4ZA 3GLVA 4EPTA 4Q82A 4JA0A 3D6VA 2J3QA 2CXHA 2JC3A 2JFFA 1G55A 3AB3A 2A5FA 3G82C 5JQWA 4IVNA 3GHYA 1OXMA 2BT4A 3OC6A 1YUMA 4JH0A 1C7FA 1K89A 2QP9X 1A8PA 1MT3A 2COKA 2TSYB 3DG9A 3ET5A 3O91A 3L5KA 3NV9A 1RRCA 5DHUA 4K0KB 4L4SA 3CGWA 3KBOA 2GMWA 3K30A 3CNOA 3SXJA 4PHTA 2DKFA 3ZHZA 1XMJA 3GPLA 2YTZA 4WK0B 4B3GA 2DX7A 3MMZA 2ZJ6A 2CCGA 2W2PA 1N9GA 2VJMA 3MVEA 1MR3F 3N7UA 3QJGA 1FZQA 2QW0X 1XEFA 2ZQYA 1U63A 1NURA 1HR0B 1L4HA 3PXXA 4WXMA 5KQMA 1XL1A 2QTZA 4OUKX 3ET4A 5J2UF 2PUAA 4CGZA 4LHYA 1CUSA 4GX5A 1ZN2A 5B58T 1ORDA 4XUGB 1A3CA 2ONYA 4QFCA 2J41A 4UTPA 1GCUA 4XIIA 1AV7A 4WBXC 3E3LA 1N1GA 3GCGA 13PKA 3RW9A 4PZDA 1C7JA 4Y2PA 4B3SB 4V1CA 5D8DA 2PWBA 1GJRA 4I5EA 1AJEA 1B3BA 1OBCA 2PBZA 5MF6A 1WMAA 1W5SA 2WOJA 2Z2XA 1LQTA 2JJ1A 4L1KA 1PS0A 1FDOA 2ET6A 2L42A 1Z4MA 5JAZA 5JMWA 2IQ5A 4OJKA 4D4HA 2BMJA 4G2TA 3RI3A 1BEUB 1C3LA 4UHDA 3GK3A 4B0PA 1NHGA 1NBWB 4IOMA 3EZ6A 2ZYDA 3B12A 3GW8A 1UWLA 2K7ZA 4JJGA 4PEVA 1GCAA 5EUQB 3QKRA 5FI3A 3G1UA 2Q2OA 3OJEA 3SIXA 1RKBA 4PGAA 4PBSA 1ESMA 4LGVA 3WNCA 4KQGA 5AK3A 3DUFA 2JAQA 2YJ3A 2D74A 3H05A 1A4IA 3NIFB 1GZHB 1Y82A 4URVR 1BKYA 1NOJA 2QRGA 2O1EA 4JLPA 3ZHUA 1CEYA 3IHWA 5F64A 3P5SA 2UZ1A 1NVTA 1OTYA 1QQ7A 2VHCA 2CB0A 3LV8A 3AF3A 4K1LA 3V32A 3IC5A 3QSGA 3Q98A 3BXPA 3TIFA 1NVMB 2NQTA 2WAAA 3UHAA 3MWEA 4NJEB 1NG1A 2ZBPA 3LPNA 1V16B 5ESXA 5B3KA 2A58A 5JVDA 3KXPA 4WJLA 4DDTA 3E2PA 3E1SA 4F2DA 821PA 1O9HA 4MUGA 4WLOA 4QGSA 2IPAB 4YUZA 5IC4A 3FUCA 3P9CA 3QMVA 4CKZA 3VSCA 1UMBA 2YHUA 4KHZA 1WKCA 1KL7A 1U9ZA 2RHJA 2IYVA 3AI2A 2DM6A 4FSXA 5M5BA 4AS3A 4B82A 2HRBA 4RCZA 5LJLA 4R1LA 3AUAA 1GPJA 1YO6A 4C3OB 5C7OO 1TO2E 2A86A 4D7AA 1Y8RB 4DA9A 5EIXA 4LN1A 2AOXA 2CK3A 2XJ9A 3T3NA 2PGLA 2KW5A 2VP0A 4WN3A 5I7SA 1YJCA 3JQ7B 1ORRA 2XT9A 2BJWA 3AKZA 1T3ZA 1ECCA 1FJ2A 4NE2A 2GJ8A 4FNOA 4HAWA 4W5HA 1D9ZA 1PNRA 1GUFA 2B3TA 2J3LA 3TQOA 4DAEA 1UPAA 3FOWA 3ASVA 3GDOA 2ZT6A 4MXDA 2VT7A 1SHZA 4KOAA 5AKKA 4JI7B 3C8MA 1XZQA 4UUPA 4DG9A 3G79A 1BDBA 3G68A 5EZQA 3C70A 2AWOA 1XZBA 3H8JA 3LYLA 3V8EA 4F8YA 4ALKA 3VJMA 3ONDA 1W85A 1YCDA 4IJQA 3V2HA 3LZDA 2G88A 7MDHA 4ZQIA 4Z99A 3WAGA 3ICEA 3HE3A 4NZ9A 1SCUB 1RP1A 3AEYA 3LH5A 3SSNA 3ETEA 5A3SA 3KTFA 1RQ7A 3A9SA 2MYUA 4Y2GA 4P2GA 4TLEA 3V1KA 1K6JA 1PZHA 2BLNA 1FX0B 4MA0A 5IH7A 3AVUA 2HXYA 4K9PA 1D0IA 3T5CA 2P4EA 2JI6A 1PUIA 1L9KA 2AJ8A 3FYSA 4KLRA 2SECE 2Z0MA 1TVKB 3O8NA 2Y1EA 3HR8A 2FPUA 4EAQA 4DSZA 5K8IA 2CBZA 1QVRA 3HSYA 1MEOA 5DI3B 1ETHA 4IV8A 4D6YA 4DEVA 2FZKA 1FDVA 4B0OA 5E3IA 2ANCA 4OLFA 4J2OA 3EEIA 1AM4D 4B6GA 2O2SA 3KR1A 4JN6B 1PZEA 2I7VA 1L8QA 4QU5A 3JATA 3WO0A 1R0CA 1DJLA 2ZBUA 3EZNA 1QK3A 4KBYA 3LOUA 4QEDA 3GRCA 4G0UA 4JL8A 2VHZA 2HDHA 4D8YA 2GAOA 2FPLA 2JANA 3LWBA 3B9BA 3VPGA 4UCWA 1Y9ZA 2AOWA 2WQZA 2LIVA 4TKZA 3WYEA 3F47A 2G5PA 1E2FA 2A2ZA 3KUDA 2PQ2A 3VVLA 4IR7A 3CBGA 3PLAE 1AQYA 1DQPA 2Q21A 2QJFA 3C6YA 3VR6A 1JQJC 3IQGX 3BAZA 3I4FA 3OFKA 4LHEA 5I8PA 3V4RA 1V95A 5JV5A 5KDDA 2E49A 4ODIA 4UVDA 1JDPA 1IXSB 1VLVA 1EWVA 3IUPA 4OXKA 4YMSA 1ZVVA 1J2TA 2PGNA 5EL0A 3O8BA 2PA0A 3L1IA 3MWGA 1JLHA 2YINC 3MJHA 5FPYA 3D3EA 2C7BA 1WUYA 4UM8B 2J3KA 1YQXA 4ZAZA 1ZW1A 1ZHOA 2V65A 3A36A 1JB9A 3FCXA 3OTQA 1G6KA 4TM7A 2C5FA 3UANA 2KBEA 2ZVPX 4DC1A 1T5BA 3AI1A 4BNTA 2XH8A 5CU7A 4C7BA 4JC5A 1ESDA 2BL4A 4ZEMA 4CF7A 3AZPA 4ZYVA 2QSJA 5JVDF 4M8NE 1CHDA 2GASA 3HWX1 5SY6A 1SUDA 5BVGA 2ST1A 3FTDA 5K3FA 2QGNA 4G0YA 2FWRA 2IIBA 5BN3B 3NHJA 4OHCA 5T3YA 1RC0A 3HKBB 1IEVA 2G1AA 5IT0A 2IQIA 3ROTA 3LC0A 5BQ3A 2FSVC 4P7BA 2WSYB 2EJTA 2ZIEA 3RSLA 3ZVMA 1G20B 4ZV9A 5A02A 2HLDD 2OD2A 1CT9A 2INGX 4MUAA 2VAMA 4NK5A 4ARZB 3WGOA 1XA0A 3DM9B 4E21A 4ZWNA 5JXJA 4KREA 2PFGA 4RDHA 1HDIA 3GV0A 4LNUB 1MU0A 5HBGA 1EJBA 4FT2A 5LB2A 2XRZA 2UYHA 3A9WA 1BU8A 2H92A 3GA7A 2XVYA 2GCNA 4D4KA 3FZGA 1NXQA 1W5AA 4ILEA 4P82A 3EC2A 3K6KA 5JJ5A 4Y2VA 4MUMA 4YQEA 2GEVA 3QVLA 2EW1A 2WAXA 4MUNA 2YASA 3GEGA 4IS2A 5JD3A 4E1VA 3C7DB 3AVXA 5EI5A 5IAJA 4B4KA 5IXSA 2GLTA 2L17A 3IAEA 4PGMA 1DKPA 4IZHA 5GJBA 5KKCA 2RDMA 5HILA 1G291 3JQFA 3BE6A 3EH2A 3H65A 4E09A 3RVQA 1NMXA 5HXAA 3DBLB 3O1JC 1X7YA 1UKVY 1ZH0A 2UVQA 2WJGA 1XDDA 2WTAA 2ZIUB 3C85A 3H9EO 3LBNA 4IIUA 3SBDA 1JPVA 3HJAA 3OMLA 4RQTA 3HXMA 3OCUA 1W2HA 3CUEF 3D5TA 1AA9A 3I8OA 4L72A 3RVSA