1JNXX

Crystal structure of the brct repeat region from the breast cancer associated protein, brca1
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
211
structure length
207
Chain Sequence
RMSMVVSGLTPEEFMLVYKFARKHHITLTNLITEETTHVVMKTDAFVCERTLKYFLGIAGGKWVVSYFWVTQSIKERKMLNEHDFEVRGDVVNGRNHQGPKRARESQDRKIFRGLEICCYGPFTNMPTDQLEWMVQLCGASVVKELSSFTLGTGVHPIVVVQPDAWTGFHAIGQMCEAPVVTREWVLDSVALYQCQELDTYLIPQIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Gene regulation
molecule keywords BREAST CANCER TYPE 1 SUSCEPTIBILITY PROTEIN
publication title Crystal structure of the BRCT repeat region from the breast cancer-associated protein BRCA1.
pubmed doi rcsb
source organism Homo sapiens
total genus 58
structure length 207
sequence length 211
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2001-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00533 BRCT BRCA1 C Terminus (BRCT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 1jnxX02
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 1jnxX01
1OQAA 2NTEA 3PC8C 2EBWA 2COEA 3K0HA 3HUFA 4IGKA 3PC7A 3KTFA 2EBUA 3PXDA 4XQ0A 3UENA 4BMCA 3FA2A 3K16A 4ID3A 2M2IA 2XNHA 1WF6A 3II6X 4N40A 3QVGA 2L42A 2K7FA 3HUEA 4IFIA 4JLUA 1IN1A 2DUNA 5ECGC 3PXBA 2K6GA 3SHVA 1L0BA 3L41A 3SQDA 3I0NA 3K05A 1T2UA 3JVEA 2VXCA 3AL3A 3T7JA 1Y98A 3PA6A 2COKA 2D8MA 2R1ZA 4Y2GA 4BU0A 2AZMA 4BU1A 3SHTA 3L40A 3COJA 4Y18A 3PXCX 1KZYC 1GZHB 1N5OX 3QVGB 2INGX 2XNKA 1T15A 3PXAA 3I0MA 4U4AA 1L7BA 2E2WA 3EF0A 2WT8A 1Z56C 3SZMA 2VXBA 3AL2A 2JW5A 1JNXX 3K0KA 3PC8A 1T2VA 3T1NA 3K15A 1CDZA 3U3ZA 2LE0A 1IMOA 2COUA 2HTFA 3PXEA 3UEOA 3T7KA 1T29A 3T7IA 2ADOA 3L46A 2ETXA 4BMDA 3EF1A 4XPZA 3PC6A 4OFBA 3PD7A 2EP8A 3OLCX
chains in the Genus database with same CATH superfamily
1NY6A 1KDVA 1U8AA 1KOLA 3SX4A 2XKBA 3WOHA 1L7PA 1NT4A 2BMJA 4D9GA 5BN4A 3X1YA 3IAM1 1INLA 1N6KA 1V2GA 2PBRA 3K0AA 4GLOA 4ZQGA 3ZQ4A 2NVBA 4PR0A 5DYYA 2OO5A 4DVJA 2IDZA 5TS2A 3T1YB 4BCDA 1C29B 2BUBA 1VJ0A 4BZZA 2R8ZA 4FHGA 4CL2A 1W5BA 1NL3A 4Q3CA 5GJWC 1P9LA 2IT1A 1OAKA 2GCOA 1KJJA 3PDCA 3GGCA 2R65A 2IPMA 2XKKA 2GI4A 1C4WA 2IPLA 3LPMA 1U2SA 4MKFA 1HDXA 5A04A 5IJ0B 1TM5E 1QP7A 3AW8A 1KAOA 2OV4A 1VXOA 2VPQA 4Z4EA 3ANTA 3CPSA 3TTVA 4EFKA 4JJIA 1RWOA 4F4CA 4I5DA 4PAWA 2O2EA 1PN3A 1S9HA 3RBAA 3SHVA 3G5LA 1X7XA 5JU6A 3CN9A 4F4UA 1U3FA 2PS1A 2QQGA 5BUQA 2QLMA 2G5TA 1L5LA 4A0GA 2F9FA 4CETA 5H0IA 4QUDA 3DGFC 1UDBA 1NR5A 1PDOA 3HCRA 3IEXA 4TTQA 1AUQA 3HB1A 4F38A 2QLBA 1FB5A 1J1IA 1O94D 2X5NA 1XR3A 3HXLA 3NBUA 4D81A 2G1UA 1E3IA 5LP1A 2J8ZA 4RQTA 3SM3A 2GKOA 1J42A 1F0KA 2C97A 5JQWA 1EFAA 2PANA 2VDLB 1LTKA 2WSLA 3ZKWB 4ZREA 1T8TA 1TX4B 2D4HA 3ROXA 5CB8A 3GA7A 3ZVNA 1U9JA 1YS4A 1VJDA 3AG6A 3BHJA 3UC5A 2QRNA 4F71A 2HQRA 2P4SA 4ER7A 4NX2A 4LS3A 5J2UB 3PQ6A 1MPTA 1ZD4A 3X1KA 4J0EA 3DFIA 2JHGA 2B5VA 1ZHHA 2HWXA 3PC3A 1DAGA 3IKLA 4NESA 4P0QB 1SOWA 1NBAA 1DKLA 1SMKA 4Z8YA 3U44A 2GK7A 4KYUA 3UZUA 4AJIA 3WGUA 5G4KA 4D97A 2OKCA 3C1OA 3UYKA 5FFNA 1W9HA 3FZQA 2AFIE 1R5JA 1TFUA 3GIWA 5H4HA 2BGGA 3YASA 4P4SB 5F4BA 3HMQA 3U62A 4CG2A 1B6RA 2XQVA 4CM7A 4RBNA 3GNSA 3V46A 5IC4A 2XB4A 2JFWA 3FYCA 5IARA 4DDWA 2XXAB 3FMFA 4NK5A 5KYXA 2VT7A 2O0MA 2X3UA 1HF3A 2PSDA 3FFWA 3OEEA 4YRLA 5IC6A 1E2PA 1G98A 3O91A 4C4OA 1IHXA 2OBMA 1KP9A 2J3QA 3S68A 3TEFA 4ZDWA 1ZRNA 4KX5A 2WOJA 3T52A 4OJNA 1R8SA 4OBBA 3FWHA 1F0YA 2HJWA 3QOFA 5T4BA 3PEYA 2O48X 1JP7A 3HM2A 4BLUA 3WGVA 1PT7A 4BNHA 1YVDA 5KPDA 4DS3A 3PHBE 3H2HA 1SBZA 2OXRA 2WR8A 2UZIR 3LXUX 1TO1E 1W0KA 1WDTA 1CG6A 5KHAA 1WCIB 1KI7A 2F4NA 4I4CA 1YZGA 2HXYA 5JFGA 3C3WA 4QECA 1XL0A 5FNVF 2ISCA 2JLSA 3FPGA 1GZ4A 1UC8A 1X0VA 3QJYA 4P5PA 2G0TA 5I7UA 2WHQA 4G41A 4PC7A 4A1FA 2BKUA 1IB0A 3KEFA 3R5TA 4RHTA 2WY2D 1A98A 3GFTA 3HABA 2VQSA 4MS1A 3ZDAA 3F5FA 3K1YA 5FPPA 3RTBA 1WXWA 1V8ZA 3TIXB 1QGOA 1ULBA 5H70A 3C7AA 2OR3A 3GRVA 1LFAA 5CX1A 2HDHA 3B6IA 3GUCA 5E4TA 3TXAA 2JCVA 4XJVA 3W5IA 5H7XA 4I4TF 3CT4A 4PQFA 1IWPB 2FW6A 5K3SA 2D3WA 4QBFA 4TWZA 3FGNA 4QJ3A 4QU9A 1WUIS 3AM3A 4E07A 2Q9UA 3BWEA 5TEWA 1PUIA 7YASA 3A4MA 4RF3A 3HKBA 2FN7A 4N5HX 2JGRA 3SHFA 3WR5A 4U2BA 3EDRA 421PA 2M1XA 1G8PA 1Z88A 3O21A 2ZULA 4RHYA 2DKOA 2OESA 3I9OA 4OGLA 2E87A 4ZJPA 6GPBA 4WNYA 5KJCA 3T61A 2AG0A 1BQ3A 1XZKA 1QRDA 2NXEA 1BN7A 1NHGA 4R0NA 3WA7A 4URUR 1ZOIA 1VB3A 2VZLA 5D00A 1QTIA 2G0AA 3UFBA 3LHFA 3FGOA 4G1CA 5ICSA 1JDNA 1ZH8A 2RCYA 1G3IA 3JD3A 3I2JA 1OAAA 2XVMA 3GLQA 4G9BA 3IR5A 3VDXA 2V3VA 4PHTA 3H04A 3KRTA 4ZEOA 2IEZA 5BR4A 5CVJA 1QQ5A 1KQOA 3IEKA 3KZCA 3P52A 4W1PA 3UWDA 4DIDA 2JLWA 3TEMA 3H1AA 1I5EA 1X8XA 1IQPA 1K5PA 3JD1A 5L3QA 4JSYA 3SYLA 2GAJA 4KN9S 4ZZ2A 1NXQA 3DBHA 1BSVA 2O8NA 3EFBA 2VSFA 3FI0A 1PZGA 2PBFA 3DUFA 3B9RA 4HNGA 5JVDB 1J09A 3AIMA 3N8IA 1PGPA 5E7QA 1K5HA 5D7BA 4N5NA 1V7CA 4B3GA 1J0DA 3AKDA 4G5XA 5AIBA 2A1TS 1F17A 2HSEA 3TDNA 4ZGBA 4RLQA 1LZLA 4DLTA 2I1WA 4HWOA 3RJMA 1SH7A 3MVEA 3WL7A 1BEZA 3MWFA 4X62B 4DKJA 2BI4A 4MR8A 5EJMA 1UBOS 4WIAA 5TQ0B 4D5EA 1A72A 2NG1A 3RM3A 4ZCMA 1ZJJA 1KI6B 1K97A 1A9TA 2Q5HA 1TU3A 3E9DA 1XMQB 3KQVA 4QNMA 5AKGA 1I6LA 3M0EA 4FZVA 3UMJA 4K03A 3SC2A 3DFZA 4OGGA 1BWSA 1FUYB 2LIVA 2XEXA 1CDZA 3N0RA 2ZJYA 5A9SA 5FOWA 3TSCA 1IHOA 3FVWA 3HZHA 3LCUA 3OKPA 4N03A 2AV6A 4X61A 4MPPA 1M2JA 1XZNA 1L7QA 2BDTA 3EQ8A 4U00A 5TMPA 2L2QA 3RIHA 1KDTA 2ALJA 2IA5A 3GEPA 2C2WA 4NVRA 4FI3C 4BNDB 5JRZA 2CYAA 5EXTA 5K4GA 3AIOA 1K06A 1GILA 3GLHA 3A9UA 1QO9A 4LJ8A 1WD5A 1W9MA 4AICA 4OXYA 1D4ZA 1TUGA 1HL7A 4G67A 3RVSA 4KE8A 3WWEA 1BJKA 1MXHA 3D2BA 2IF0A 5CT6A 3WGGA 1IBKB 2FPIA 1ZW1A 3EAQA 4GPBA 2D5IA 3RRFA 3ZS9A 4HR7A 2FVXA 4FE4A 2B3DA 2EP8A 1Y6GA 4JJGA 3A05A 2H4YA 4UEOA 3TW4A 1SG6A 3ZIAA 2BMDA 2QW1A 3TM4A 5LLDA 5HCUA 1P2UA 4YRIA 3L8YA 3P71T 5CTJA 1O6FA 5CH3A 2A14A 2E4UA 2IIBA 3CUEF 4G63A 4IX1A 4KQGA 1UBCA 3WHLA 4NZOA 2BGJA 2MR5A 4CQMD 5EIXA 3B3AA 2YYYA 4OA8A 4UCWA 1GKYA 4DKXA 3X1XA 4OHCA 5UKDA 1YR8A 4JI1B 5CB4F 1OASA 1SOVA 4YALA 1OROA 1W1UA 2WUGA 1ZSYA 1JIJA 5DU2A 1VLJA 3WRYA 4CTNA 1ZMRA 2GBPA 1SFRA 5E6UA 5LP6F 1RZUA 4ZT5A 1M0WA 3DHYA 1EAYA 4PCUA 1S3SA 1ISHA 2QT1A 5E7MA 3REQA 1BO6A 3WOVA 1GQQA 3FIJA 3OWHA 2CNKA 2I2BA 4XUDA 4RKFA 1N0WA 2GZAA 4YMLA 3FHTA 4BNNA 2G1AA 2X1LA 2YIVX 4GMKA 1E6EA 4GICA 5LNK6 2GBIA 4D6YA 3NWPA 3UXYA 4OHKA 3U17A 4YB8A 2G5GX 2UVDA 4BTVA 6REQB 2V7PA 1GA1A 2HK9A 3C5EA 1L8QA 3MQ4A 3P2MA 5JO9A 4WT7A 3V9PA 4G1MB 2ZRJA 3C70A 3WGIA 2AN5A 1Q2XA 2OPBA 3K31A 4JMLA 1VGQA 2UXBB 3Q3GE 4QTUB 4EI9A 4HZGA 1VFPA 4IILA 4RKRA 3W7BA 4QTZA 4ZI7A 3B78A 1CQXA 4GVXA 5FUVA 4CVNA 4EFLA 1E8DA 4E31A 1RRGA 1PFKA 1EGVB 4GX0A 4KOAA 2TMKA 1VA5A 2HA4A 3QLEA 1NDUA 1NUAA 1R16A 2C4UA 3BWDD 2JFVA 3NYRA 2WU0A 3PC4A 1SBTA 4HDOB 5I7RA 5KPJA 1ZCJA 2YBEA 4GXTA 4L75A 1WMSA 4UU1A 2H4ZA 2WAMA 1KH1A 3AKCA 3QX7A 1FJ2A 4GF5A 4HYEA 4GX2A 4LC1A 4P9NA 2ECFA 3MGGA 5GZ6A 1WKCA 2CDBA 4R1PA 2G08A 1J5EB 3HXTA 3N5KA 1KO8A 2QAGC 1KJ8A 4YTEA 5HE8A 2C95A 4OHXA 4EG8A 2DU8A 3K5IA 3F5MA 1MX5A 3TOZA 1TM1E 1N3IA 1YBVA 4PZYA 1R4ZA 2X2EA 2J67A 4AUNA 2JS7A 4TX1A 4F7WA 2RGNA 3SKYA 4ALMA 5MHTA 1SVSA 2OP1A 2QLTA 2VF5X 1B2RA 1PZNA 4MVJP 5EKTA 4K6FA 4MV9A 2BGKA 3VR5H 1TAGA 1G8MA 5JYEA 3KOWA 1I14A 1PZXA 4U2KA 1GGFA 2PQ2A 4B3HA 2EFYA 4CW7A 1H4VB 4XVQA 1WMAA 4S35A 2XRZA 2HA6A 2ZYGA 4CG1A 3COWA 1P0QA 3C3BA 1PJBA 3MTDA 1D5CA 4OQQA 1GJRA 4JKIA 3P19A 4BNJA 3MK31 4CCWA 1TQ8A 1Z2PX 3OQOA 2XE8A 1JG6A 4YMUA 3M3HA 1E1KA 1TYBE 5C53B 3BH6A 1NFQA 3JV7A 1KEPA 1V5FA 1VSTA 1C8LA 1DV1A 2H17A 2W2LA 3KQTA 1T2EA 3QOXA 2G9RA 3T1QA 2A88A 1OE0A 2Q6KA 2E6UX 4HB0A 2RGWA 5IASA 2WTMA 3LW8A 5CM2Z 4TTRA 4ZHQB 2POCA 1XVAA 3ZWOA 4GXNA 1MOQA 5BWBA 5FA5A 4M1WA 1Y34E 2NSJA 3H1TA 1UXGA 1RQLA 3F3YA 5F7JA 5KQSA 2NUPB 2QSUA 3MTGA 3K8ZA 2LIPA 2ASVA 1PLKA 1RYYA 2COEA 5A0FA 4GKJB 1N8TA 1QHXA 4MP8A 4ANFA 5FYDA 1LVGA 3KSZO 2NZJA 3TLXA 3CXRA 4M88A 4L4YA 4C7JA 1UPUA 4IDDA 5D3ZA 3ADBA 1EUDB 3KWMA 1VL8A 1KTIA 2CFTA 4ZODA 3E5MA 1TCCA 2NZXA 2ZTHA 2UYOA 2WOOA 4FMDB 5ULLA 4CTKA 4ZDKA 3BIJA 2TYSB 1XO1A 2ZRDA 5JSYA 4D3YA 4G85A 3JWGA 4D6XA 4TQUS 3SFVA 2P7IA 1G20B 2WTBA 3DMTC 4BVAA 1DXQA 1Q0SA 3ZI7A 1P1FA 3OTGA 4QLOA 4HBGA 3ZTYA 4D7AA 5AM2A 3NMUF 2YVKA 1NYTA 3BD7A 4OHRA 1RWNA 3GLIA 3KKZA 2D1TA 3QI2A 5LZ7A 4XASA 1QK4A 2IEBA 2H4JA 2P3OA 4O4HF 5I9IA 4JCOA 1ZL0A 5BNIA 2W2NA 4DR6B 1R8XA 3V8QA 5IZ4A 1FUIA 3L5KA 1J9ZA 1RAHA 4RLFA 2IPAB 1NXTA 2ZK7A 2ZSUA 5K0GA 5LVAA 1PWHA 4R3NA 2FRDA 3VJLA 1NJ1A 3ND6A 1EE2A 1G8AA 2CCGA 2B83A 4DA7A 4TSFD 5GIOE 3P9SA 4JLBA 4REMA 1Y81A 1U0BB 2HU2A 1BHSA 4UUQA 1N1MA 2JIQA 2P9YA 4QJBA 3T5MA 1FMCA 4CT0A 2PRSA 1WHSA 3OQIB 3FZEA 3KL2A 4Z7QB 4RX1A 5JTUA 4ABTA 3LI2A 3EEYA 4YJ2B 2DVMA 1GAXA 1DKMA 1Z4LA 4EHKA 2IUSA 2BFMA 3KAPA 1M2OA 4QX6A 2GD0A 1CXZA 1W94A 4UNRA 3TOXA 4L4XA 5AVTA 2CV2A 4B3RB 4NJEB 1L7BA 3O3NB 3PT5A 1NAIA 1X3SA 2I7DA 4GG1A 4JEHA 1NJ2A 1Q7RA 1BKDR 1Y6ZA 2WAXA 3KHTA 4Y1EA 4M38A 1OZ0A 2FVYA 3Q10A 2O4CA 4F3KA 5SZHB 3BMCA 3BXGA 3IIMA 3EYWA 1LY1A 1GLNA 1MNQA 4ZYWA 5DGHA 1CY6A 2D0OB 2ZROA 2CJXA 1IXYA 3NATA 5C5CA 1VMIA 2CLFB 3BHNA 2RAPA 3SNHA 1V5IA 1XVVA 3JSXA 5SYMA 5IT9A 1YBFA 3U26A 1QAQA 1XTIA 4A2WA 3BL6A 2IZ0A 1L8AA 2V0CA 2YZ2A 3AT1A 1CNMA 3RRJA 5DHAA 3C7DB 4YUAA 5ALLA 4HQKA 3JTMA 1GQFA 2REXB 1XG5A 1L5GB 1P7WA 3WK4A 1XQXA 1C9EA 3SE7A 3K9HA 3QY9A 1EINA 4FJ0A 4U2EA 5EOVA 3HBFA 3NHZA 4KNVA 4KWCA 1V9CA 2RH5A 2WF9A 2OBFA 4LDJA 4W1RA 4OG2A 1PJZA 3HGMA 1IM5A 4R2WA 2RJOA 3BS4A 3H2JA 1M2EA 1KEUA 4DV1B 2WIBA 2WU4A 4Q4HB 2BCJQ 1RKUA 3D0KA 2NYUA 4CUZA 2X7HA 5B53A 3ZEIA 4AWAA 1DEKA 5CR9A 8MHTA 2BJHA 2GN2A 3DR3A 3EC1A 4H6WA 4NBTA 2NTEA 1J07A 2BP7A 3B53X 2JG3A 1X8KA 3NC4A 2UUAB 3GVHA 1GPKA 4L57A 3GJ7A 3JQBA 4MVCA 1WW2A 3B1KA 3PWZA 4PZUA 3ZCUA 4PLYA 3NGLA 4LEIA 4WKPA 4Z1OA 4OHMA 5JS1A 2UZ3A 1DQSA 1ZD2P 3A1VA 1HT3A 1RP7A 4JBXA 5JWOA 4MITA 2GZRA 2XCSB 1G4HA 2FEWB 1GUAA 1KYYA 2MWMA 5LQSA 1DXYA 2LNDA 2PJUA 2FPOA 1IZ0A 4FLFA 4LI0A 4RS3A 1FYFA 3GJSA 1QUFA 4X24A 1K7XB 2V9CA 4X1KA 2QMEA 3J81A 1NR1A 2B6HA 2ZU0C 5F51A 3H3JA 4INZA 1YC2A 1XK6A 1Z5PA 1NVBA 3LYLA 3EDOA 1P77A 3MS4A 4P1ZA 3EPLA 2V54A 1AGYA 1TU0A 1LBIA 3GO4A 3VH4A 3T0GA 2B2CA 5DHSA 5CDSA 4L51A 4WNAB 1IXSB 3RJ9A 4TM8A 1E92A 2FJ0A 5A3RA 4KRYA 3N2KB 3QVTA 4BO8A 2PVSA 4QTTB 5BNZA 1Z7GA 3ASYA 4IVPA 3V2HA 2AC2A 2VS1A 5K5EA 3BIFA 2IGBA 3IQHX 3IPCA 4Z9XA 4DJFC 1R2QA 1BWQA 2LCIA 3DG9A 1DWQA 1MABB 2PT9A 2ZIWB 4QQFA 4ZVQA 3SM9A 2Q28A 3M2TA 3QVUA 4YRQA 1VL1A 2DH6A 1NYLA 3HMKA 4K81B 1DRWA 4CDMA 2GJ8A 3BFXA 1MC5A 1WOYA 2ZYTX 4IGFA 3HSYA 4V1CI 3ZW8A 4M7OA 1XRLA 2IYOA 2O2XA 3NAMA 1I8TA 1L7OA 1I0ZA 1GDDA 2CNWD 1GR1A 1MQ8B 2DBRA 3RUCA 4EJFA 3HZOA 3ZHZA 3GY0A 3LWDA 3UJ6A 1LFDB 5LBUA 1Q0TA 2FZWA 1XEWX 1NF3A 1ID1A 1LPSA 1PS8A 1L7VC 1OHHD 1FYDA 5DULA 4PAOA 2RG1A 4B3JA 2X4DA 4DUYB 1AF4A 3L7LA 1D2RA 4ZQFA 2HU5A 1EUCA 1VMKA 5D5HA 3MSXA 4RVNA 4F1KA 4OGKA 3JZDA 4I36A 2DUJA 1EVKA 4DIEA 1YJ8A 4PWZA 4DW8A 1XHLA 3ISJA 4HFNA 1PV2A 4RXUA 1DINA 2JFOA 4NOKA 1ADCA 3K70D 1L5OA 1GKIA 4FDMA 4DABA 2C04A 5CDFA 4XVCA 2WIJA 4D41A 3FNBA 3RSLA 2ZW9A 2IP2A 4BUZA 4G1BA 3N58A 2B1GA 4GECA 4CDRA 4KYTA 3L0CA 3N9IA 2C9MA 3C8MA 3E58A 3R5KA 5DO9A 5A4FS 1GNRA 3U4CA 5KTOA 3URKA 1QC5A 3T5GA 3SKVA 1ZSNA 1R6AA 3QSGA 2G17A 3QLUA 1B7GO 5AI4A 1MNAA 3BFKA 1SC6A 3JWHA 3KKPA 4L1KA 2QB5A 4MVJD 4EECA 3ICOA 2P11A 3Q41A 4TMTA 5JSFA 3PRKE 4G1UC 1E1QA 3Q6MA 1VPEA 3D5QA 4CKCB 1KP3A 3VR0A 2HI0A 2GN4A 2TS1A 5BW8A 4FHZA 2P5UA 3LT1A 3L84A 3H5IA 4QULA 3EVDA 4A2CA 4MUGA 5BSHA 4ARCA 1PJ3A 4IJWA 1J8MF 4XPZA 1SIBE 2Z9CA 3RAPR 2JEZA 5A1TA 5TMBA 4GDFA 4U0JA 5T5QA 4HQ0A 1ZM2A 3V7YA 1C7EA 4JLPA 3EGCA 4CV3A 4CF7A 4QU5A 1UJ2A 2LD4A 4HMPA 4Q3OA 4ZDJA 3CRNA 2ZYHA 3RS5A 5H83A 2PUJA 4D4IA 4IUDS 3OD1A 3KXKA 1RWXA 3WWCA 3R3UA 3FCSB 1KERA 4XYGA 3D8SA 1U63A 4CKXA 1A95A 1RNLA 5D01A 1ONPA 2FWAA 4C43A 4LRUA 4F1WA 4LJRA 4QU8A 3P96A 4BMOB 1SZCA 4HH4A 4XKJA 1BCRA 1BN6A 4JT4A 4H27A 4IX9A 3M5PA 2A94A 3KVRA 3AUTA 3U4QA 1LSUA 1T5HX 2WVJA 2ZIUB 5AICA 2WMYA 1RU3A 4IYRA 2FW0A 4WFQA 1KR2A 1EMDA 3VZDA 1J1UA 4BZPA 1ZJ5A 1CFZA 3EX7C 1FQOA 5A4IS 3IERA 5LQDA 2PWZA 1H0KA 1NUPA 2YRWA 3DL2A 4CIXA 5I5EA 4AZTA 2B4AA 5F5NA 5DH9A 2F8SA 2KYRA 3K32A 3B9QA 3ON5A 2C2YA 1RXWA 3HXPA 4IQ0A 1G42A 1Y9EA 1EHIA 4P82A 1OAOC 2YBDA 4FGJA 2F43A 5LPNA 2FG7C 4BXOA 1ZNYA 4I9NA 1QQAA 2ASEA 2OLKA 2Q6OA 4MIYA 1QGUA 1DAOA 1XI2A 2JB9A 3IMGA 1XQ9A 4J1NA 2YIJA 4EGJA 3KALA 1AS3A 1C81A 2QM3A 2ONJA 1TB4A 1XA3A 3AR5A 1J7KA 1V4VA 3GELA 4NABA 4X3CA 2W2KB 5IJ9B 2HUNA 1D2GA 1TZMA 1LQ2A 2Y1DA 1IIRA 1T4CB 1WXEA 4C6RA 4FFVA 4BNVA 4ZVVA 3D6UA 4NBUA 5FLKA 3A6PC 1SWWA 5DHTA 2ACKA 3ZY6A 3N7TA 1W5AA 4PLHA 4QUIA 2GDJA 2XAAA 1I7SB 2BMEA 3LPLA 3O8QA 3VNSA 2ZWAA 3K8YA 1EFPA 1NUTA 4NFLA 1JU3A 1JAYA 4TV9F 4BIMA 2NOAA 3Q8XB 1THZA 1PJ8A 3FVQA 1KMHB 2A9QA 2CMHA 3OIVA 3OTWA 3BCUA 2BEJA 3BX1A 4W6QA 5DJ5A 1N3BA 1O5IA 4OUDA 3UFXA 1UC4B 621PA 1ZYUA 3D59A 4MI9A 2AVDA 3CU5A 4OHUA 2VPZA 4Z4CA 2DG2A 4ESHA 1GEEA 2ZWVA 2PFGA 3H5TA 4S05A 4Z6KA 4D6PA 1PJ2A 3KZOA 4NE7A 1Q3HA 2CZCA 2OXTA 3ZOKA 5AHXA 3TKAA 2EC5A 2JRCA 1TEHA 4G0YA 3F7OA 1IBCA 1M1NB 5KX5F 3F97A 1FXSA 1YS1X 1P17A 2EQ5A 2YHSA 4C89A 1TJ4A 4H08A 5CDUA 2A9KA 2G76A 2XWQA 1Y4ZA 3RVLA 1QGDA 1YCDA 2PWAA 3HZZA 4KPGA 3VR4H 1YBHA 1TQ6A 2J0VA 4V02A 4XQCA 3G0GA 2I91A 3DFMA 2VG8A 2FUNB 4ENRA 1PR2A 1USWA 1KRHA 1SOMA 4WBNF 1KQPA 4OATA 1EK0A 4GLBA 5CH8A 3ID6C 1LWOA 2BFDA 3GJ0A 3O26A 4GUAA 4EG1A 1EM8A 3UPTA 3ZW7A 3TLJA 2HSGA 3TH5A 4Z49A 5HQTA 2FFAA 3F67A 4HWGA 3NHAA 2Z4RA 1JT2A 4JXZA 4H3SA 1UK6A 4R8RA 5ARBA 1CUDA 3PNQA 1SBNE 2HPAA 3WVNA 5C4MA 2WFLB 1XZEA 1QAOA 2HFKA 2V58A 2ZS9A 3ZBPA 4JQSA 3ZY4A 2G1PA 4BV8A 1JIQA 3OJWA 4PGMA 2NAPA 4UNIA 5C3UA 3ITDA 4KL8S 4YAGA 1QJ4A 3V4ZA 5L3ZA 1NVTA 3KOXA 4LV6A 2AN3A 3NHSA 2XT9A 1LGYA 2HTEA 3I9V6 3MT9A 4WKNA 4GVLA 2Y6VA 3CO5A 2DTEA 1TUEA 3OM0A 4ZEVA 5JSUA 1CUCA 3WBKA 1I5OA 3CXUA 4NBLA 4X8MA 3WAJA 1DDOA 1KTVA 4CI9A 2Q1XA 2NO7A 1OYVA 3U56A 2HIHA 2EDCA 2A0WA 2AG6A 2BSAA 3EGVA 3QV2A 1YBAA 4Y2TA 2B1JA 5CDTA 2VH2A 5KJEA 4BX8A 4QQNA 4AJOA 4G5SA 4N7BA 4BJ3A 4Q9IA 2PZGA 4QBGB 3WB0A 4B46A 3GLGB 2CFRA 3EGEA 4QGBA 4YP7A 4N6OA 2PV7A 1Z2DA 3A58B 2ZUUA 3ND5A 1KAQA 4ITRC 4WOCA 5EAIA 3ZS8A 5F5XA 4FWBA 5CIQA 3NJ8A 2GBCA 5ERXA 1YB2A 5EJEA 1LX6A 3AV0B 2WVAA 3HS3A 4HDSB 5IFKA 1T1GA 3MN1A 2O0HA 1WSDA 121PA 2TSYB 3H2KA 4X20A 1W36B 1QYCA 2P1ZA 4TKVA 3NC0C 1AN9A 4NATA 1ZINA 1UJNA 4L0CA 3H0EA 2GLUA 4G0ZA 1ATZA 1VG8A 1VLQA 5KINB 4R0VA 3RUAA 4HN2A 4EGFA 4MKZA 3O6VA 4K5QA 5CGQB 1CJCA 1OCEA 2PLAA 1CERA 2Q4TA 2JFFA 3D6HA 5FIUA 3TNFA 3T12A 4MUXA 4Y9RA 3CPEA 3TRHA 4J0QA 5CBPA 5CG2A 1TAUA 4CKWB 4MRMA 2H1VA 3UMCA 1YQWA 4P3PA 2XNKA 3FCOA 4Y6LA 2QAGB 3VR6A 4V1CA 2DR3A 5FUWA 2QTWB 3H8WA 3TIGA 4YV0A 2ESRA 1Y4SA 3UKOA 4X8LA 1CY1A 2RMKA 1H85A 4NV0A 3RUEA 1XTQA 3FFBA 5J4VA 4BMZA 2RC5A 3AR3A 1FDUA 3VH1A 4HYYA 1UC9A 2ZM5A 1EG7A 1RRCA 1SVKA 3GFOA 1BWPA 3M6WA 2HWYA 3NT5A 3BMXA 3PG5A 4QBTA 1TKRA 3EASA 3T4PA 4CT4B 3M82A 3CEAA 3LBIA 2A78A 3N74A 4JC4A 4KHZA 4ZANA 5AM0A 3ZUPA 2I8LA 5IHXA 7MHTA 4H77A 1Y7HA 2PEZA 4BNLA 3G2HA 3ZD6A 3LWNA 1TMKA 3HG7A 3Q3CA 1FTQA 5AO9A 4MLPA 4MW0A 5CLQA 3S28A 1T36B 2QVLA 3O9MA 2SCUB 2HRCA 5G2OA 4J0GA 5HQ3A 1R64A 3BXPA 4AJEA 2GLXA 2G72A 4LMAA 5C1PA 5JPDA 2REBA 1DC4A 3EUEA 3QWBA 3DDZX 1OLXA 1J99A 3DEKA 2QF7A 3AHCA 3A1DA 5DBFA 1TYCA 2OBYA 4TQGA 1TVKB 4K0KB 4KR3A 1QK5A 5LXTF 5CH5A 4DHEA 2ZVPX 3NUQA 1QZZA 1VMAA 1NNUA 5TV2A 4Z4FA 1M6YA 2LDXA 1FMTA 2Q5QA 3BT7A 4FD3A 1OQAA 4CHTA 1ND6A 2W0MA 3GHYA 5CFNA 1C9DB 1X9HA 3V32A 3KJFA 5AKXA 1DU4A 2E6KA 4H31A 3QHAA 3M9WA 1I10A 3S2FA 1F8GA 1GCAA 1OD6A 1WQ3A 2CNDA 5EWLB 4JJ4A 4M21A 2HIGA 5JOQA 2H1OA 2BOVA 2P41A 4Q1CA 4LYEA 3VH3A 5LWQA 1E9BA 2GRAA 3KTFA 4QELA 4EPWA 3AHFA 5E6RA 1XROA 3TXYA 2YMQA 2I67A 2HK7A 4RJ2A 4Q9HA 1RPJA 1QFYA 2QQEA 4QNNA 4PYKA 5FNVA 4NFHA 2BTQB 3C8ZA 3L1KA 4MH0R 3LKBA 1KYXA 3QKRA 2OHHA 4G4SO 4IJ5A 1R0BA 2MDTA 1SM4A 2O7VA 1LVHA 1RHQA 4IINA 3RBZA 3R75A 2B20A 5BW6B 2PMFA 2V7QA 2MR6A 5IJWA 4CKYA 1YR2A 4WUVA 5T8KC 4M6WB 3S1LA 4KQEA 5ALRA 4RKWA 3RC7A 1SIUA 1V45E 3W8RA 1SELA 4HVCA 1DIBA 1E9AA 2OORA 4RU1A 3OZXA 1Y9DA 4TSRA 4ZVRA 5JYCA 1NN3A 4M1SA 4L8YA 5AMXA 3QE0A 1WW3A 1YJXA 4I4TA 4MUBA 3UG7A 1ZNZA 2IHUA 4A15A 1EFVB 3QWHA 4WCDA 5A05A 3LT4A 3OZAA 1BVUA 2VYQA 3IT1A 4V0KA 4EHAA 1JSLA 4B09A 4AJHA 4RTRA 3IIEA 1OLSB 2JH9A 3UN1A 4JLKA 2Y0PA 4X6UA 4KV7A 2OAQ1 2QTLA 3DCYA 4TLAA 3JAWA 1E9DA 3OOJA 3ZXIA 4NCXA 4XWGA 4KC0A 4DGSA 5ITVA 3DLBA 4MVJF 2GS9A 5I9BA 2HZBA 5HJ2A 4A2PA 4TVSA 4HUQB 3ICWA 2VSNA 1H5QA 3KYCB 2CK3D 1KC1A 3D81A 4LY6A 4JENA 3H83A 2JI9A 3SK0A 3ZJTA 3JATA 1FX1A 4XRRA 3SMQA 3U7RA 2QR3A 2CZGA 4UDYX 1C0PA 5D3QA 1MG5A 3U4DA 2CN1A 2FMHA 3MEQA 3OEYA 5K8VA 4RK0A 4JA2A 1DZIA 2IH5A 2OCPA 3C87A 1J6UA 2HAEA 3ET5A 4GU5A 2QD3A 3OZGA 3E8SA 3NDPA 1NF8A 2OCLA 1SBIA 4JJZA 3QX8A 4LTDA 4DY4A 2YW9A 5AJUA 1J5PA 3RU2A 4JHLA 4DA0A 4AKHA 4IDQA 4BVBA 2CL6X 2ZCJA 1B6SA 3KT6A 2E4AA 2GPSA 5CBKA 1DVRA 1CP2A 1UJ6A 1WCV1 3V1NA 1ZVMA 4FYXA 3U4IA 2FW9A 3PUJA 4MZDA 1LDEA 4C29A 4DRXA 3DC2A 3LF1A 3U7GA 1QIDA 4EHLA 2X0IA 1W581 4J0FA 1Q84A 4NTZA 4U7WA 2ADOA 4MGEA 5IKOA 3UOAB 4WLNA 1VJGA 2ZRIA 4NV3A 4PICA 4X3OA 4BFXA 1L1QA 2JBAA 5KMGB 1QWSA 4B32A 3ZLTA 4X45A 1T1RA 4E32A 2X6RA 2VZ8A 1CB0A 3VTKA 2X1VA 1K86A 4QOIA 1EXDA 4KIWA 3OQHA 2GEKA 3L93A 2G80A 5I9TA 5AM4A 2H6EA 1PJCA 1AT1A 4KUEA 2GAFA 1Z3IX 2JGJA 3CR8A 1ZHFA 1FFBA 4GR4A 4MULA 4REQB 4Y6GB 2KI5A 1QTQA 3QW2A 5BPHA 4PC1A 2X3FA 4DC9A 2ZE6A 4DFDA 2ZSHA 2V7XA 2AE2A 1SPBS 2IP1A 2XCUA 4Q03A 2YFHA 3IDSA 1A9PA 1CUEA 1M2VB 4C06A 1KPGA 3EXFB 2CHGA 1GRCA 2ECKA 2V65A 1QLHA 3A6KA 3L7DA 2EQAA 3B1JA 5HRCA 3FWKA 4B7AA 1VGRA 4C1NA 2HJ9A 3VNAA 4CCAA 4O6VA 4TRNA 3H05A 4U6QA 4ECEA 5A5DA 2GBGA 2Z1MA 3SYMA 4I55F 3D6MA 2C7QA 3DZGA 3GPDG 1ZUHA 5JNUA 2NU7A 9GPBA 4TTTS 1QMPA 2ZP1A 4QOJA 4RA6B 3RLFA 4RJLA 1NI5A 1C41A 1E1RA 1WHTB 3R7FA 3TLGA 5B2EA 2G63A 4QYXA 1AKEA 4A73A 3ES9A 3GU3A 5A5FA 4JUCA 4KWTA 4QE3A 4J4TA 3AV3A 5AHKA 3IBCA 4J3NA 4EEKA 2G28A 4JLVA 2GJAA 4AN4A 1VG1A 4Z86A 4KDRA 2A84A 2ENWA 4M7RA 3U37A 5LP6A 3M1AA 4XWAA 3SSAA 4UUMA 3CLRD 1WCYA 2H1WA 3D8HA 3FB1A 4X1OA 4RVCA 2OGUA 4NNOA 2J9XB 3FNQA 2BWJA 1PAUA 1QYIA 2JHPA 4WAUA 4E2WA 2X77A 2WPDA 5JSZA 4RTSA 4YI3A 2F1RA 2J0QA 1U11A 1NW3A 2PX0A 3K0EA 1UP4A 3FKQA 3EAFA 4FR2A 4AKTA 1OTXA 4N7MA 1HE1C 3WX0A 1Z6PA 3I4LA 1HL3A 3SHWA 3NH9A 1MD9A 1NBMD 3SXUA 1J06A 3TE6A 7GPBA 2P4QA 3K6SA 1TKCA 3DTVA 3RVOA 5BVGA 5C1OA 2GAAA 2CXPA 2AD1A 1VCOA 2D0PB 4IIJF 4HDMA 4ITUA 1RXCA 5IJAA 4GM0A 1N0VC 2VJKA 4S12A 5AKKA 4LXUA 1UZLA 4GBGA 4N49A 4M9SA 2AFIA 1Z2AA 4PTYA 3MWJA 4GGMX 4QHYA 5LZ8A 3GJTA 2ZIXA 1Y63A 2OC4A 2GVNA 3I64A 2A92A 5EA2A 3RBXA 4DV0B 1LA2A 4ETMA 5ALNA 4KRFA 2CYBA 4FONA 5K0NA 2YNMD 1R4MA 3KOOA 5CM9C 3WGLA 5IAGA 4YP1A 4DJJA 5C4GB 3FHLA 3EZFA 4I1SA 1YCFA 3EH1A 4LYJA 4AMZA 4CMEC 1H3NA 2H51A 4E6EA 4MSUA 3AEUA 3PXEA 4FS8A 1NP7A 4GOLD 2V0GA 4IP0A 3H2GA 4U3JB 3TN7A 3S2SA 1AKQA 4WOBA 5CYOA 3BPSA 4RJKA 4X6XA 2CLDX 4J90A 2KBEA 2G40A 4NBWA 4LZZA 4RD4A 4MNTA 1Y37A 2IF2A 4IDCA 4MUEA 1TAHA 2GVZC 2IHBA 2X23A 3MBKA 4LHZA 3WGKA 2PUAA 4WMLA 5L4LA 1RPNA 4GI2A 1EJ2A 4G0MA 3U7HB 3DC7A 4X54A 3T54A 3WSTA 2MMCA 2RSLA 4D1YA 3F46A 5LC1A 4EBBA 5JZ9A 3E05A 2CDNA 2BHTA 2NACA 5JR3A 4OU4A 2IYXA 1FP4A 4PZPA 2QN6A 3I1JA 3W1VA 4EI7A 3BE8A 4RM2A 5JMTA 4A27A 4Q5IA 2G3YA 3S4YA 1KH2A 2AZTA 4MWZA 1GG9A 3Q7PA 1D2CA 4C5BA 2CT8A 5IBQA 3JWEA 3LT0A 3W8NA 3PXDA 3O8OA 4QJIA 5K3EA 5AJXA 4TYYA 3HH8A 2JGEA 3NBKA 5JNWA 4C7BA 1HDZA 3EWNA 1P4SA 2EKPA 5HF8A 4F3RA 1HI9A 3ZWBA 2ILVA 1FSZA 2CL0X 2H4WA 2IHTA 5EG5A 5JJCA 1OX4B 1QV6A 4XB1A 2Q3MA 4C4TA 3N6RA 2VTVA 3I9NA 3PI7A 3DXYA 1V8DA 4JUAA 2P6MA 2VCHA 5DNDA 5JS7A 1O94A 1NUSA 3HUEA 3VU9B 3P8ZA 3C6YA 4HDNA 1CUVA 2GASA 3L7BA 1GTSA 3PXBA 2ZTUA 3JRNA 1Y8AA 3I5UA 1RRKA 3TD9A 1XRNA 2JPDA 4KFRA 3LY8A 4MVWA 1L4HA 1Q20A 3O5AA 3PDUA 2XDQA 4YY3B 2AR9A 1F6WA 2FLVA 3ESBA 2GZ1A 3AY3A 3E9QA 3LX5A 1H2FA 3KUCA 1L4EA 5BYKA 3BWCA 3F0TA 1NLUA 4MQEA 5JT1A 4PLTA 3WP0A 1HQDA 3AVOA 1E18A 4R41A 5HMMA 2JK1A 1WJGA 1YQ9A 5G1OA 5BYAA 1N2CE 2P4HX 2UVPB 3C6XA 3COJA 5F76A 2C7RA 4P0PB 4CF4A 3GEDA 3OZUA 4FOOA 1HYEA 3DB2A 3KD3A 4IDHA 4EITA 4OFXA 3WJ1A 4OA5A 2DPYA 1AUPA 2YQ4A 2W2TA 4U8GA 2X7JA 2WHPB 2CLEB 2QUHA 3F90A 4QBKA 1G4AE 4QFDA 4ZPXA 4OF4A 1C3XA 3GNQA 2JGLA 4IDFA 4DM7A 3L77A 1HFKA 1EFCA 1KVUA 2YASA 3D8NA 3Q4GA 4HX9A 4U2DA 3EZNA 3STYA 4BZQA 3IAXA 2DCUA 3TLCA 3FOZA 1TIKA 5LMUB 2WSMA 3RFTA 5CXSA 3W05A 3LY5A 1GG8A 2P3QA 1DAEA 4CIVA 4AJNA 4DUPA 2DB3A 3KZMA 3BAZA 3P0JA 5F3WB 5DXJA 4N18A 3B36A 3NS7A 4QXQA 3VVMA 4NYIR 4LF8B 2FZLA 1YH3A 1CS0A 1O5TA 1S96A 4ME6A 3V2UA 5CFOA 4BO5A 3I6MA 2ODNA 3I6YA 4ZAWA 3M9LA 3UK7A 1C7RA 1U2EA 4W9NA 3P9CA 4ALNA 2HRRA 3P0HA 1BX0A 1PR0A 1WMBA 1XCGB 3DHNA 3DT8A 4KE6A 4NG4A 3I72A 1XLTC 1YZHA 4FDTA 1BHJA 1ZWKA 4KRGA 4DC1A 4LKRA 1MTOA 2Y8EA 1IJKA 1GVNB 1P9RA 4R16A 2YWRA 5EJ2A 3MGKA 2XDWA 9MHTA 5AQEA 3GFGA 4HLQB 4CJXA 4IZHA 4KV9A 3SQNA 3KEQA 1KO4A 1OT3A 2WKWA 5DTEA 1AGNA 3TNYA 5JQGB 1OYYA 2DY1A 3GQBA 3KPWA 4TGLA 2W6ID 2IX9A 3LCVB 2AG5A 1I30A 2OV1A 3H5WA 1WTAA 2JI8A 3Q3JB 2X9GA 1NPTO 2ECPA 4IEFB 3E18A 2UVQA 2RKWA 2P6UA 2ZVQX 1GAEO 1H2RS 4KW7A 1Z0IA 1MX1A 2BTOA 1NMSA 2R6CA 1JTFA 3PWSA 4G4IA 2H7CA 3C0KA 1XV5A 2ZKLA 4HN4B 1Q0RA 4TPKA 4PEVA 2QM0A 2ZSBA 5KKCA 2I66A 1S2IA 5IVKA 1NULA 4XB6B 2I3AA 4YA6A 5ENVA 3B7GA 1G4UR 3SOZA 4KAXA 3U39A 3ZDZB 4KPEC 1SY7A 2QTBA 2VDWB 2W43A 2AXQA 4Y2UA 3FDZB 4X95A 3OSZA 4CTOA 4EIWA 4AN0A 4MUJA 1DWUA 4JJAA 2FSVC 1DTWB 4ZDIA 2Y1XA 3H3XA 1NKTA 1P2TA 3S3TA 1DJMA 3H0KA 4FX2A 1IRXA 3ISVA 2C2ZA 5J63A 1K5DA 3KELA 1AGPA 4ZGWA 4ZZ0A 1GUBA 4LBWA 4D25A 3RVQA 3SMVA 4QOGA 3T3EA 1MB4A 1YU9A 3CHYA 3LX4A 4NBNA 4Q7MB 4YRRA 4NNPA 3I34X 5L53A 1EJBA 6AT1A 3DVLA 4ZCSA 1HZZC 3FOAA 2ZBRA 3I0NA 2C98A 1VA4A 1QRRA 3O2NA 5LSAA 5C8DA 3JWIA 1G1AA 4NULA 1NF9A 5WRFA 2AW3A 4QXAA 1GNSA 1VKNA 1CE8B 2EFCB 1VSQA 1D2AA 3GH3A 3V4FA 4TM7A 1Z2EA 2EVWX 3AWIA 4LXYA 2OUIA 2R2AA 3ER9A 3OA0A 3RGWS 2CHVA 3H5VA 4HEJA 2HGSA 1XFAA 5TQJA 1JDPA 3H1GA 1JEDA 3SJ7A 4DMKA 1G6KA 1L4YA 2XTNA 3PE6A 4KAAA 5KHOC 2IOFK 4P38A 1HYHA 1V16B 2Y1GA 3OX1A 2VZEA 5G0WA 4JJEA 4KPUB 4Y3UA 3Q5GA 1L7MA 1Z5GA 1I9CA 2WYUA 3A4NA 4WJLA 5J3JA 1CQJA 4POOA 4R3WA 2CF5A 1K8QA 4M9QA 3SICE 2UDPA 4HF7A 2HHJA 3RUPA 2J3LA 3GGSA 1OIWA 4AFNA 1Z13A 3FNIA 3DR5A 4J9VA 2BFBA 3DO8A 4WH0A 5CNKA 4IHJA 5DLPA 1AV7A 3RR2A 5AI8A 3O95A 4BPBA 5DK6A 5E4YA 1WXFA 1ZVKA 2RHTA 4FYWA 3G5AA 3EVGA 4D4HA 2V3WA 3V4OA 1ZVVA 4N48A 1EK2A 4S3MA 3WYCA 3OF2A 3SJBA 1ACMA 3RF7A 4EY8A 1C9JA 3PRHA 2GEJA 3KP1A 4AZ3B 3LCJA 4PYLA 1W30A 3LKDA 2MU1A 4EBFA 4A6PA 1OZAA 2QUKA 3ASZA 4BX2A 1HNZB 2EX1A 3AIIA 1AKWA 1Z68A 1H1LA 3ANNA 4NE9A 5JLAA 5DHQA 3NKFA 4ZAXA 4W5JA 2FG5A 1T43A 1XQ6A 2P7HA 4FQ5A 3T7KA 1W7AA 3NDIA 2Q62A 1BS9A 4XD7D 3RB8A 1YQGA 4N8SA 2AG1A 3LP8A 4ZK6A 3E6AA 3ZZNA 4US2R 5DI9A 1I2CA 1REQB 1R1DA 2VAMA 3ZE7A 5IJZA 2JBWA 2ZJAA 3OUZA 1MKYA 2ZUSA 4LZNA 1ZI6A 3L6CA 3RJZA 1B0UA 4UU0A 1MO4A 4HWTA 4TT3D 4IIFA 4CQMA 5KDLA 3H5LA 1OGYA 2NAFA 2YYSA 5IBCA 5D85A 4W5RA 2DHRA 2V3CC 4EA7A 4D92A 2QZZA 4F04A 3ANLA 2DUMA 5KCZA 4B9AA 1MC8A 1THGA 1A7UA 4KOEC 1BGXT 1C7JA 3G2LA 4RY0A 5CT5A 1W4AA 4Y8VA 4JKYA 1ZJ6A 2IHYA 4W82A 4P92A 2VP3A 3SDSA 4D99A 1IY9A 3F98A 2Q5IA 4O4LB 1WOMA 3ULKA 1GPJA 4JC5A 1HRKA 2QT0A 4WEQA 1KMQA 4B4VA 5T64A 4XB2A 3R5JA 1F2TB 3QWIA 2ON6A 4DMGA 3UWPA 1LBTA 4IFBA 4L28A 1C0IA 1ENOA 2HADA 2XNHA 4JWKA 3RVPA 4ZHSA 4ZI2A 3KBBA 4M0DA 5LWHA 2IBSA 3QVGA 1UK8A 3LKZA 4FKZA 4B8ZA 2KBFA 2OM2A 4RTNA 3U09A 1GN9A 1Y89A 1AQJA 3CMMA 1H2WA 4AKGA 2ID8A 5ECGC 2L17A 1KDRA 3CIOA 1OWNA 2HEGA 3UJPA 5D3MB 3V1YA 1P6UA 1EP2B 3TPZA 1N2EA 1SHJA 1XQ1A 2G71A 1CJVC 2WD7A 4B3CA 3I37X 5FUQA 4POAA 1XBTA 2UYGA 2AMLA 3G5UA 3UHAA 1KS2A 4HUJA 4LXHA 4RPHA 2C0PA 4CLDA 1E89A 2ATVA 4HDRB 2Z2ZA 4M98A 1J2UA 1F1BA 3G5TA 4ZEWA 2I62A 4S1VA 5H68A 3TR5A 1VL6A 3KPUA 5JCOC 3TI7A 2WU3A 4S0XA 4DA8A 4FYMA 1ZBQA 1JTVA 4EJSC 1Q50A 5G0SA 4IF6A 1QKKA 1KL7A 3AZPA 3HSKA 3CLUD 4BUJA 1N5OX 2W8BB 1HQYE 3QPBA 4IR7A 2IZZA 2FDCA 1CQIB 1EWKA 3ZW9A 2O3UA 3B51X 3ESRA 2PXXA 3QNMA 2WYVA 4MVJI 4WZAB 3P32A 3ZU5A 4R6XA 5B7GA 1XKLA 3PBKA 4B5LA 2FTKE 2ZVJA 3AEKB 3D5TA 2O3TA 1P9NA 4MPJA 4KZPA 2IV2X 5EIBC 4WSOA 1Z6XA 2DQ4A 4OK3A 1V0JA 1UFOA 3CNLA 5TQ2B 3QPCA 4TVOA 1I13A 4R9NA 4Y9UA 4D0SA 5M29A 5I7VA 4KDCA 4B8WA 3LV8A 1QM5A 2IDJA 3ZIUA 4MW7A 2EF1A 3DKRA 2CLMB 3WTBA 4BLTA 5FO0A 1YUMA 2D7CA 2DHQA 2XECA 3RC3A 2YN4A 1RRVA 4UBLA 3ZLUA 5JNLA 3E84A 3OMXA 3P5SA 3RFFA 5TXGA 3HLKA 1T0HB 5B37A 1RYZA 3GLRA 4IIXA 2WF7A 4BP1A 4X84A 5B55A 1CJMA 2JJMA 1X80B 2Y27A 1LK0A 5GWXA 4XEUA 4TV9A 2M1ZA 1RQGA 1QIHA 1VG9B 2A1IA 3K9QO 4P4LA 5DM60 3R3VA 3T7CA 3T5AA 4YCJA 3S81A 3GLFE 3OLVA 4KLNA 5J5CA 4NYMQ 1HK7A 4H7PA 3JX9A 4MRPA 3FKJA 5BSMA 1E6WA 1W4LA 1D4OA 1JDTA 1IZ8A 1E0AA 1KYVA 4QUBA 4ZQEA 4BMDA 3IV7A 3D3JA 4BE7B 1GU7A 5KX5A 1NY5A 5DFAA 3DE2X 3DP7A 4F3NA 1C4KA 4Z5XA 3I6ZA 5JW6A 2FZ4A 2QTVB 2P2ZA 1OOEA 3LF2A 4QFCA 1VZ3A 1ZK1A 1JMVA 2H2HA 3KAJA 4MPTA 3WGZA 1UODA 4TTIA 5HYVA 4L5AA 3UUEA 4CLHA 5KVQA 2HA3A 3CW2A 5AI0A 2G88A 1N6HA 4HGRA 1JKXA 1WXHA 3R9WA 4DLAA 2AMVA 4C1BA 1GYRA 2AWOA 3IO5A 4WBNA 1BD4A 3THSA 4Q12A 4CL8A 1X1EA 2NNWB 3L0OA 1ILWA 5AT1A 1O1YA 4UHHA 4ZJUA 1N5KA 1Q74A 3ELDA 1XZIA 1JDUA 4EKIA 2QTAA 1JFLA 1MJGA 4BLSA 2GHRA 1BEEA 3U1TA 1BMQA 1YKSA 2PYDA 2R0QC 1ECCA 2DWPA 3RVJA 1IPHA 3WLLA 4ZCTA 4KR2A 4FFMA 1Y7LA 1Z12A 2AFVA 2F90A 2OZLB 3D54D 2ES4A 2RARA 3O1HB 4MJ3A 1XDGA 1GPYA 1QIKA 1WPRA 1XRQA 1XZDA 3D1LA 3FR7A 4FQ7A 1SXIA 2MYUA 3STUA 1UWCA 2C1ZA 4BO2A 1YQQA 5DBHX 3SJZA 4TSFA 4RPCA 5DHUA 2R751 2PLWA 1E1CA 4UM5A 1YACA 1ESEA 1TTTA 1A1SA 4C0SA 1FXWF 3WRXC 1G0NA 1ZUNB 3IIKA 1PS0A 4PXSA 3DDNA 2FB9A 2FRXA 2BMVA 5C7LO 4BUCA 2MSEB 2WJJA 4BBAA 2IH2A 4R01A 1LSOA 1YIOA 4K40A 3SSNA 3KKEA 4DWJA 5AW1A 3MQFA 3P20A 3RSQA 1ZESA 2PGXA 1JMYA 4AJKA 1UFKA 1FU8A 1LK7A 4PLVA 5AP9A 4ZN6A 1TC2A 4DLLA 2YWCA 2YWHA 3FBWA 1XCPA 1G7RA 4PVCA 4BQPA 5D84A 4CM5A 5CPFA 1OVMA 3K1AA 4BWGA 3RCBA 1S02A 1YZTA 5C2JB 4OHPA 1CULC 3GDWA 3DE0X 4L4SA 5LYYA 1P72A 4Q3DA 1EGMB 1LPPA 4D8XA 7ABPA 1KXZA 1QYWA 1BRMA 4D0GA 4D4KA 4MUHA 4MW5A 2H08A 3T1HB 1NM5C 1U5CA 4DUGD 2Z04A 1BU5A 4CI0B 4YAOA 1ADGA 1RYBA 3BRWD 2Z43A 2LRHA 2FSPA 4GMHA 2HB6A 5K6AC 2O8BB 4I4LA 1KNXA 2AR0A 4TLLB 4EOGA 1FFCA 2BR4A 1JU4A 3H16A 1U28C 1GA6A 1QLWA 1TO6A 2LDBA 3VAYA 1X6VA 1U7XA 2C58A 4EDFA 4AZ0B 1Z5ZA 3R5HA 3UGQA 1GU1A 3V8VA 3PXXA 4YIHA 1LJ8A 4I1PA 4P33A 1PHRA 5CPBA 1A5TA 4B4DA 3HZRA 3MIIA 3UWOA 4ZYTA 1ZO8A 2DY0A 3E9MA 1UMCA 5TNXA 1M9NA 3G8BA 4UTXA 2QN3A 2ZSAA 3QH4A 3QVSA 4HSEA 4K1XA 5CX4A 5AD1A 1AZTA 3ZU3A 3SVZA 2NTVA 5CLJA 2YUIA 1U94A 4RELA 1L9XA 1MAHA 1S8OA 4HNRA 4KHPB 1Z4QA 4OX9Y 4G0QA 1LLCA 3IUPA 3LSYA 3MTEA 1GSOA 4WA7A 2CMDA 1NJFA 1E9CA 2HHAA 1X7WB 2RH8A 3OVMA 1ZN7A 3AQ4A 4P35A 3OLCX 5FF9A 3NOXA 1UZNA 3ZX5A 1MRZA 4P4UA 2QD1A 1RLIA 2NPIA 4QATA 3PJRA 4HQNA 2O05A 3G5MA 4P0TA 3NDRA 2GN8A 2QXYA 1I36A 3BTUA 3RRYA 1QGED 1EIWA 2HY7A 3DV2A 2R97A 3AH8A 3EFOB 3PC7A 4U02A 3OPQA 2AZ4A 4V0MA 6PFKA 3CH4B 4F4DA 4BMCA 2C0QA 5LXTA 3IP8A 3RIGA 3H84A 4N5MA 2CVZA 4RVOA 2HPHA 1R15A 2BGTA 5B7PA 5IDXA 1FX0B 1G3RA 2EHJA 3KD2A 3R8CA 1Z6GA 3K2EA 1W59A 2WINI 4JVMA 1YB5A 3BMQB 4V0QA 5JEDA 3EQ7A 1T0JB 3JYLA 4NKRA 1GNQA 1XTVA 1M2KA 5DX0A 4NNJA 4I5GA 5CEJA 3HDJA 1PNTA 3NEAA 2WWTA 4FBLA 4P83A 4WZ6A 4YECA 3M34A 3ZVKA 5L45A 2CNWA 1UM9B 4Q16A 5AK3A 4R54A 4YRTA 2P27A 1KY4A 3NPAA 4MUYA 3FNFA 5IAOA 5E9JA 4KE7A 3OLQA 5AKZA 2DKNA 1UR5A 1OHHA 5EQFA 1FLAA 4KB5A 2XGMA 3CTMA 1ZBDA 4OI1A 1ZD1A 2JLVA 1DAIA 2CEKA 2R87A 3BWBA 4RH1A 2J07A 1Y3FE 2J5RA 1JB9A 4RIIA 2ATXA 2OFXA 3T38A 2B0JA 1SG9A 1A88A 1EA7A 1HNNA 1K0FA 1XLVA 2EZ9A 4HZUB 3BZBA 4UU7A 4EB0A 5FPQA 1I2MA 4YRPA 1U02A 2GF2A 3QYJA 3PXAA 4IWXA 3EVAA 4TTAA 3EODA 4DCSA 2ONZA 4E2FA 5B1YA 3OQNA 4ND7A 1PKEA 3E61A 2YYAA 2RIPA 1ISPA 3AFMA 3CF0A 2DTXA 3MA0A 4I7EA 1H4TA 1HWYA 3H5OA 3DCJA 1P44A 3FWNA 2EKZA 5CVUA 3OE7D 1CVIA 3FAKA 5AUQA 3CLVA 2ACEA 2OBBA 2CL7X 3OLWA 5KO2A 2OFFA 1K4YA 4MVJA 5BW5A 4BO4A 4HSGA 3LHSA 4BQQA 3UKDA 3G88A 1EE9A 2QTZA 2A6PA 4KO2S 1KFJB 1U90A 2GZ3A 1O95D 2QZ4A 4MO2A 4TV8B 2NYRA 3H7IA 5FBKA 3S1AB 4IJQA 3R0IA 4FLEA 4F9FA 5K09A 5JXGA 1HLGA 1FP2A 4DDHA 3VAZA 3UAOA 3DE6X 2M6RA 3IMCA 2I3ZA 3KLOA 4DJEC 4BJ6A 4DLBA 3UM9A 1V41E 2AHOA 3A1FA 4AXXA 2BKXA 1Z4OA 3PUXA 4IXNA 4OI2A 4XAQA 2FPPA 4WZBA 5EJ8A 2YVLA 3L49A 5SZJA 1IE3A 1M7HA 2YXPX 1RM0A 1YT5A 4R84A 1RQ2A 2GMWA 1Z63A 4B7ZA 3LHDA 2VP9A 3NCHA 4D8UA 3WQBA 1JPVA 1O4WA 5KVVA 3TTTA 5HIMA 2PKXA 3BDAA 3Q7IA 4FC7A 1FTSA 4TRJA 4AW9A 5ADHA 2QRHA 3PNKA 3UO8B 5HIAA 4Q3AA 2Q5LA 4TL9A 4RLSA 4IH4A 1YK0A 1DT5A 4LHVA 3UANA 4BY9E 4FILA 2OXFA 1JSRA 4NCJA 5FX2A 5TEVA 1RAGA 3ESZA 1JEYB 2FUCA 2HBRA 4WTOA 3WMRA 1NMXA 3KT0A 4IGKA 2R1TA 2SECE 3W78A 3JAMA 1QP0A 4M83A 2MMGA 5G53C 1DZ3A 4YFVA 2Q0SA 3WL4A 4HT3B 4YASA 1RQ7A 2VDRB 3PDIA 1SG0A 3U0VA 1RQRA 1D09A 1HRDA 1PGOA 4IV5A 2PU5A 4QYWA 1YRLA 1TYZA 3SR4A 1JHRA 1SUEA 4FDAA 3VHLB 1L5RA 3C98A 3K9GA 3LUDA 4JBNA 3WLKX 1C4XA 5CYPA 1YR7A 1ZOSA 3GDOA 2WB2A 1X38A 1K7CA 3DBLB 4GQBA 1H6DA 1TCUA 2QAIA 1XX6A 1GA4A 1A4XA 4HY3A 2XE7A 4AQYB 3K5WA 3D31A 3UH0A 2CHQA 2SKDA 1G21A 1NQXA 3OAAD 4RW0A 3SN6A 3VZCA 4UUPA 2B2NA 4CKEA 4BBPA 4U63A 3CTPA 1ZCBA 1SB8A 4CXMA 1ZK0A 1YOVB 3VR3A 4CDNA 1E9FA 1WL8A 3QE3A 4INAA 4MHTA 4JUFA 2VC2B 1Y1PA 3QG5A 3IEUA 5DT9A 5F23A 3LQKA 1NVFA 1VRVA 3ZWWA 5AQ1A 2QX6A 4PG6A 5HZHA 3O82A 1Y5IA 3U7IA 2IS4A 2HMYB 2IUYA 1RLMA 3TLAA 3ZV7A 4BLRA 1O5OA 2WLSA 2I78A 2XMCA 1I3MA 3K71B 1P5FA 3ADPA 3O8DA 3T35A 2DFTA 1PVDA 4G25A 3E5RA 3C74A 1G2OA 3NWJA 2FA9A 3GP5A 1HEYA 1L3IA 2RH9B 2Z8YM 1A5ZA 3PFHA 4JI8B 5DT2A 1VKHA 3G7NA 3TQOA 1CRZA 2ERCA 4IUBS 1XAIA 3DTNA 4DXDA 4QYMA 4DV4B 1ORTA 3KT8A 5DCWA 3RH0A 1JUDA 2IBMA 4ERNA 4E4TA 3HCCA 4NICA 2ABWA 4GZ6A 2CJPA 1GTG1 1K7EB 2DC1A 3HA2A 4RE6A 2V6BA 2JD1A 3O2QB 4XJSA 3T5TA 5KQMA 3U5ZB 1OH8A 3HJNA 2KB0A 4NOMA 3BULA 2VNSA 1MCZA 4ACAA 3U3ZA 1R00A 4B87A 2I65A 3PIRA 4LHXA 4FU0A 1B26A 2APJA 2GM3A 3FMPB 1MENA 4K05A 2V9ZA 1CRQA 3MFQA 4IIJA 3EWSA 3T3PB 3WRWA 4CV0A 1E6CA 2WP8J 2XKJE 2Z2IA 1J8FA 3CLTC 4XGQA 3W4KA 5BSRA 3B5IA 3ZHOA 3I2YX 3WMGA 2GPAA 3O4HA 2H1CA 4QZVA 1DOHA 3QJ5A 2IIQA 3EGXB 3K3PA 5C31A 5IEJA 3IELA 4WADA 4WXEA 1XQYA 2BFPA 3QU9A 2AFHB 5KTKA 3RS4A 1ILEA 2LPMA 1K7FB 1VPWA 1U8FO 3L07A 1XLUA 1GO2A 1NU6A 3RLIA 3T15A 4D3SA 4OKNA 2WP0A 5FOSA 3GUZA 1KZ4A 3UJNA 5ALHA 4Q02A 5FH9A 2WU1A 3JXEA 4HG2A 5IDYA 2I6SA 4S04A 2NQ2C 2PD6A 2A8YA 3LQ1A 2J0SA 2QKYA 2OOSA 3LYAA 1LI7A 2GAIA 2NQ8A 1A8HA 4ID9A 4NZMA 5I4KA 3E2IA 1L5FA 1WX1A 3DYIA 1RYNA 1Z0SA 3F7MA 3R76A 3CPJB 4RK5A 3K0CC 1RKQA 2J5XA 3K16A 1KO7A 4MV3A 9LDBA 1YL5A 4V0OA 3T0FA 1R0RE 4E12A 4MQBA 2VDNB 4MR9A 4OI0A 4XFDA 3ZCTA 5CAEA 3S7TA 5HUJA 1E5VA 4NHEA 5HILA 4Q0MA 2AJTA 3IKMB 4QSHA 3FLBA 3GAMA 2NUTA 1A97A 4MWTA 1KMNA 2JFYA 2I76A 2WE8A 1SUCA 1EGQA 3GJ6A 2NZ2A 2XMRA 4GMDA 4MS4A 4FOPA 3LSTA 3STWA 2QYSA 3OBBA 1DAFA 1B15A 1ADBA 2HDWA 2WW8A 2VVTA 4IIEA 1F4PA 4YUZA 4ESVA 1UJBA 1YB4A 2PWYA 1IU9A 4JLMA 5I8ZA 4FGUA 4C30A 4EPXA 4BNKA 1U3TA 5ALJA 5COQA 5THKA 4EJSB 3L40A 1AQYA 3D9QX 1JIVA 3M6VA 1CRLA 4IO1A 5D1HA 1ONBA 3B3QA 1RMYA 1B00A 2BEVB 3FKSD 3RVDA 2E4XA 1QYRA 4PINA 3IC5A 1YONA 1DJPA 2IELA 2B8JA 5HKLA 4CIBA 3WLOA 3LXMA 5EHGA 3IVGA 3WO0A 2WDPA 3QEJA 2X41A 1X70A 4IDOA 4OMCA 2AMYA 1DI0A 1Z25A 1SD1A 4U4AA 3RABA 1PGQA 2EBHX 1VTKA 5BT8A 1UEJA 1FLNA 2PL5A 3DBRB 3WMFA 3MT0A 5CT4A 4LNUA 4FUTA 4RSHA 2VHEA 3JQBC 3R9KA 2F7SA 3NQ41 1NI4A 4YAFA 4G8CA 4MARA 2QT9A 1C3LA 3AL2A 3JQ8B 1ZVJA 3O92A 3PIDA 5CHEA 5LDGA 1TLFA 1X7GA 2QENA 4R8KA 4EVSA 4CCYB 4NV1A 4G6ZA 4NLLA 4YI5A 4GC5A 3V5NA 4FZRA 1A0OA 1Q11A 2BZ0A 2PO5A 4JOSA 3QSYA 1R5NA 1STOA 4Z2AA 2Q8NA 4KVFA 1PQUA 4B44A 4H16A 3ZHXA 5CMLA 3OURA 1JLLA 4WCFA 4WNAA 4DG8A 2BH2A 2YS7A 2V59A 4GGPA 1MV5A 2XNCA 1XJQA 3E3NA 3QOWA 2QPTA 4RANA 4JXKA 5DI3B 5AVQA 2OQ2A 2A1UB 1FP6A 2FRVA 3ONFA 1G41A 1FVHA 2C31A 3HY4A 3IEIA 5K4AA 1T4MA 4HB4A 3AOEA 1TUBB 3UUFA 3L05A 4NU0A 4US0R 4EEXA 1N5LA 4BFTA 1EEXB 1LXCA 2WAYA 1LLDA 2WNIA 3E22A 3EQ6A 4GXRA 4OYHA 4DNFA 1OXMA 4E7PA 3T3NA 2PFKA 2X5JO 3CLSC 2NQTA 2GPTA 2PGOA 2VTKA 2HM7A 2GDZA 1CF9A 4Q7JB 4P84A 2VK1A 2QI9C 4PBTA 4QXOA 5F21A 3T7RA 1AMNA 3M6XA 4TTVA 3V1TC 5EWJB 2YJGA 2OCYC 2WIDA 3GWGA 3PNVA 3E8XA 4HWRA 4XI9A 4D3ZA 1SCBA 5CITA 5KTNA 3KJZA 1RZVA 5J2UF 4BASA 3BG5A 1NI3A 4OQLA 4OHYA 1CUGA 1V3QE 2ID7A 3ENKA 4UVEA 4Z4HA 4ZVNA 1RYHA 1Q15A 3I6QA 4GI5A 1EEHA 4WLVA 5IC5A 1IDN1 5JATA 1EFUA 2QX8A 3KUXA 4FMCB 1EZZA 4R71A 1DG9A 3G7SA 3Q7QA 1TF5A 2OEPA 4Q34A 2ZRNA 1Q17A 2YCLA 4HAUA 4IDBA 3JALB 4JY7A 3I58A 1YRYE 4LGYA 4FHCA 3TR6A 3VYSB 2WIAA 4ZTZB 5M3BA 1FOEB 1SHUX 2YZ7A 4BC1A 4FOLA 4MMZB 1NN0A 5L6LB 2EATA 4HEHA 5CCDA 1MAUA 4I9UA 1WXIA 1LB1B 1QZUA 3LD9A 4AQ7A 1PHPA 1V96A 2DUNA 3QVOA 1EFKA 3NBZC 4HPXB 4CM4A 3M49A 4ESEA 2MSNA 2XZOA 1E7RA 1C1XA 3KWJA 1DKOA 4EO9A 5IZCC 5DMHA 5KYKA 3CCBA 4QDXA 4UCFA 2EP5A 4PIVA 1PTJA 4GNKA 4TZKA 3EB9A 3CEJA 1N5DA 3G23A 1K75A 4NF2A 1ZR4A 3CSDA 3PEEA 3DZ8A 3BH0A 4PBRA 2QQ5A 1J2JA 2CK3A 5MGNA 3H42B 2RGDA 3LM8A 4YRFA 2J3HA 2BN4A 5JANA 3V3KA 5GVRA 3HN6A 3X44A 3ZKAA 4PN7A 5BUSA 5IT5A 3NM4A 1QPGA 3QYFA 3TG8A 2EEZA 2G7ZA 4WXPA 3WL8A 4C4RA 2VPTA 4LHWA 3GDHA 2IU6A 2OFOA 2Z5LA 2VCEA 1K8ZB 4A7PA 1Z16A 2QZJA 3H5AA 3OIGA 5FJIA 1PTKA 3KKKA 1E3TA 2VTEA 3HACA 5FR1A 2D00A 2FPXA 1JLRA 3MD0A 1X1TA 2YWBA 3HP4A 3H2IA 4C4ZA 2FAXA 4BNYA 1NJGA 2D2FA 4JCCA 4GKKB 4DCMA 4E5KA 3QZUA 2JARA 4FDVA 3N05A 4EMBA 1A8IA 2G4LA 3B1WA 3H65A 3Q9NA 4L5JA 4LVNA 3RRBA 1OU0A 1X9GA 1EQ2A 1JJVA 1GPH1 1W25A 4II3A 1GLGA 4N5DA 5DP2A 2RE8A 3CPHA 2ID4A 3KQQA 2P2SA 3NT2A 1JI0A 4RAOA 2OQVA 5LQUA 1CJTC 2C7BA 1PR4A 3KB6A 3AJEA 2ZI4A 4YROA 5KQGA 3EIWA 4NECA 1S1CA 4OQMA 4TWBA 3X0DA 2XIJA 1U2DC 3HKEA 3LAWA 2VPPA 1A04A 3NRCA 3O73A 2PR2A 3RUIA 3QEKA 1MXFA 3DAHA 3V8RA 1XEFA 1MJNA 3CX4A 4GL2A 2EG5A 2O52A 3TW6A 5KNBD 1UPBA 3HCPA 2TECE 3KTDA 4PO8A 1SBHA 4YAUA 2NZUG 4K88A 1RI3A 3QJGA 4LSGA 4B4KA 2GUWA 1VM6A 2J48A 1C9NA 1VI2A 2JATA 3HNOA 1HGXA 3B3FA 3JY6A 2PJRA 5DYTA 1YL7A 1NXVA 1SU7A 3BD8A 1EX1A 2H5JA 3AGQA 2OBLA 1E3DA 1DELA 2R1VA 3FN4A 3D6VA 3PSAA 4KGZA 4ZRDA 1WETA 4JC8A 1HQKA 3UMYA 4KWHA 3ADOA 2X0NA 3N8GA 3HCBA 3KEMA 3OE4A 2GZMA 3PUIA 5EXEA 5HKKD 2QW8A 1P5ZB 4QPNA 3SYNA 2ZTVA 3NU1A 4W8OA 4DPKA 4UMDA 3ZC3A 2QY9A 2W8ZA 2IS1A 2WWRA 3U7EB 2O20A 1GQYA 1VLZA 3BEOA 3R40A 5TPWA 2OFPA 5TGZA 5L3QB 1SXJD 4RZ3A 2IY7A 2IRWA 3PR3A 1P1JA 1S0UA 3K9NA 3OPVA 4MQ4A 3KQHA 1H5NA 2JHFA 3AONB 2O4UX 4XIIA 3DYBA 2Z1DA 3HRKA 2N42A 3AZQA 2QE7D 3EOBI 4I5EA 3FCCA 2G67A 3FA2A 1NVDA 3WK8A 4QWMA 5BN5B 3WLEA 1JFRA 3TMAA 3VUEA 1JPJA 1KFBB 1US8A 1GP2A 3ET4A 4JX9A 1ZGZA 5A6VA 3B8HA 4PSAA 3VM6A 2PRJA 1DJQA 2QMQA 4M8IA 4YHHB 3MAJA 2CL5A 5B3JA 4UBIA 4JLUA 2B9VA 1KK0A 1Z9BA 2Z2YA 2AKYA 3WMEA 2A2ZA 3TSWA 1QG2A 3GEBA 4P31A 1MX9A 1XRSB 2YFYA 3H4IA 1QZ3A 1EP3B 1W85B 3J80A 2QEQA 3TD6A 2H2GA 3DKIA 3F8WA 5JRJA 2VSOA 5HIIA 3U4AA 4Q4CA 1WRBA 5C81A 1VOTA 4NS1A 4R3UC 2O8DA 3WLMA 5AVXA 1CY2A 2ZRQA 1P4RA 5ALVA 2Y71A 1FMJA 4BOYA 1NBMA 2CMKA 3GGJA 3KWLA 3BIWA 5E9AA 1PDVA 2QN2A 1TL7C 1IBSA 4OHFA 3A6DA 3B52X 3OSUA 1Y1RA 1KEEB 1IXRC 5JUWA 1XRJA 4J2OA 2UZ1A 2XB6A 4N76A 2E0IA 2XBLA 5I7EA 1M2HA 2IOQA 2IEGA 2CSXA 1YVEI 2CXOA 3ZY3A 4MWDA 1N36B 3V6LA 1XTPA 1VC2A 1LJLA 1QHGA 3LNTA 4YRCA 3V4VB 3ZE1B 4PNEA 2VF4X 3OQMA 3NHLA 4E2XA 1Z08A 3HV2A 1X1QA 4IUYA 1QIIA 1M33A 3JVUA 3OJ0A 4LJ5A 4ON9A 4WV3A 5T4EA 4B48A 2XUQA 2H5IA 2RBEA 2YNMA 3E3AA 1OBOA 4D9MA 1GG2A 5B1DA 2GGSA 4FKBA 5EUCA 3OLYA 4WE3A 5GP1A 1X3LA 2DPGA 3AXSA 2JIOA 4LQCA 3MHPA 3G2MA 4YT5A 4X60A 4PZDA 5NLLA 4LPKA 3QEAZ 1K4MA 4QPZA 3OECA 3QMWA 2EGGA 4LDAA 3DE3X 3ZDFA 4F5WA 1SXQA 2EAUA 4C6TB 1NX9A 4OB6A 4C2AA 2EFEB 4RSMA 3MAAC 1Y1SA 3OU7A 4RDCA 4BEWA 2HCFA 2JI7A 5J4KA 3GMDA 4TN1A 1XVTA 1ID8A 3QPVA 3U48A 1BTOA 4D8VA 5HW0A 2B2XA 2NXWA 4WX2B 4OL9A 4K2AA 2NVUB 2BCEA 1ZZGA 4XWKA 3LYUA 3EE6A 1HOXA 4IFEA 1JGTA 1OA1A 2ZAOA 4MGZR 2PUVA 3PICA 3FXAA 2AOXA 1ZGHA 3GVIA 1WDKA 3GLKA 1DO0A 3N2GB 4LYFA 2IW3A 1THMA 4E09A 1AX9A 5AUNB 2BKAA 3F78A 5FWNA 1Q83A 2W48A 4IEIA 3VZRA 2ENUA 4A03A 1M10A 2F1KA 4QRDA 4JLNA 2QPOA 2WAOA 3DWFA 4Z3DA 1CUBA 1IC6A 1TJ5A 4YEDA 4MDHA 3TLKA 1ISMA 1E94E 1Z06A 3LUKA 3QEOA 4QUGA 2NU6B 4OLHA 3GJYA 2A9OA 4KLCA 4GBJA 1PR9A 1UC5B 1ZCAA 1Q1NA 1R50A 2HWUA 2WTNA 4P36A 1J56A 2AWNA 3ZGLA 5BN3A 3F4BA 2ID9A 1RJ9B 3OCXA 5DX8A 1PI3A 2L69A 1SHTX 1WKVA 1NMEA 2P0EA 2PGLA 4QDOA 4RL4A 1CUHA 5DW0A 5JE8A 3A14A 3SC6A 2BHRA 3EZ6A 1X7DA 2FJUA 2ZXFA 4UQOA 3O1JC 1MW8X 4IDEA 4NXMB 3EF3A 4C3OB 1VPVA 1V8BA 2QMUA 2C5SA 3BAFA 3CNBA 3IA7A 4D0LB 1CQPA 1TZJA 4PAGA 2R84A 2XGOA 3PPIA 5TB5A 4KO4S 4ETIA 3ZZUA 2XPCA 3LG2A 4QC2A 1NRIA 4H3KB 1SQSA 2NADA 4RFSB 4R1QA 2PZLA 2RAUA 1PDWA 4DMMA 5HFAA 2AEEA 2UUBB 1AZSC 2AX3A 3D7NA 2GCEA 3JASB 3L8EA 4GWGA 3UCXA 4ZVLA 3ZWNA 4U8HA 4EHFA 1II8A 1T5OA 5BRAA 1U5AA 3OT1B 2ANBA 1NONA 4V03A 4ZAYA 1Y82A 3BIXA 3HE3A 1SK8A 1FZTA 3TF5A 3R6WA 1C8BA 3OZ7A 2BEUA 4BDSA 1IFXA 3EZ7A 4KNYA 3I01A 5TMDA 3IKJA 4K9MA 4BB5A 1NXWA 4P7BA 1NLYA 3CJRA 3IIJA 3LP5A 4HK4A 4AJ9A 1KXJA 4DSAA 4HV4A 5BWOA 3KKMA 3WV5A 3O4GA 3TZEA 5EHZA 3IKTA 1VE5A 1FFXA 3NJ4A 3RYIA 4AMGA 4IWYA 4RETA 2XMGA 1Z0UA 3D0QA 3AOGA 3BE4A 5DYIA 1TE2A 4KODA 5EY5B 2ZT5A 1KJ9A 3BJMA 4ZHQF 5J1TB 3SBXA 4QTYA 3CNHA 4IS2A 5H3LA 3M4NA 4XM1A 2PYZA 2VPXA 5AVVA 1FXWA 4JQZA 4OD0A 1DBRA 1U5BA 4FUQA 4NH4A 5FBZA 1Q1GA 5AXAA 3HA3A 1SUDA 2O3RA 4WFJA 4DQDA 2GQ0A 1LF5A 2GNOA 4LOHA 2VH1A 4NDNE 5E1BA 4MA0A 4X1YA 3A0RB 2O59A 3SZGA 1FLVA 5ALTA 5HK8A 1DKQA 5B1EA 4O8CA 5HZGA 2FEOA 1XWIA 1WB6A 1CT9A 1YFZA 1NSFA 4PCLA 1SIWA 2GWHA 4BYGA 5KOJB 2XH8A 4O2AB 1XD2A 2JW5A 3A3NA 3TVDA 4Q4AB 2FMUA 2Q7DA 1JR3D 5I9NA 1TA9A 1JSXA 3NEPX 1JNYA 3ROKA 4EZIA 1E6KA 2CFCA 5FWXA 2CLOB 4GE3A 4HH0A 1J24A 2HTFA 5K3FA 2V4MA 5DM2A 4N39A 5HGJA 5JWHA 3ED5A 5CCBA 4YJGB 4BMYA 2J9FB 1YE8A 2W6IA 2FLWA 3CCFA 4UAVA 1ZMXA 2HR1A 1ZL2A 3IDAA 2AXEA 3EA5A 2FPUA 3OM8A 4R83A 1XJWA 4C4SA 1L6RA 2VRCD 2O8EB 2HDOA 2XDAA 5D6OA 1JB1A 4P08A 4JOCA 3CKLA 1XTRA 1RM3A 5CVTA 2FPKA 1E4EB 3K7EA 4OVKA 3A9VA 5KSWB 3VBEA 4DLYA 4J1QA 4FB5A 2HSZA 1IVYA 3CZRA 3GH1A 5DK4A 2V6GA 1C30B 1JHVA 1OY1A 4NPAA 5G40A 4ND2A 1TIBA 2EF0A 2H4XA 4YPVA 3T94A 2VJLA 2VDQB 3EMVA 3N8DA 4CU2A 4ZYXA 5FDFA 1FNMA 1R0ZA 2PSSA 3EG5A 4IAOA 4I50F 2G8LA 2JI6A 2CLHB 2JLBA 3NM6B 4IHAA 4YJ2F 3KTAA 1JAHA 1GZ3A 3OQVA 3RTDA 2O2CA 2EBWA 3FNRA 5JCXA 1RWPA 4F11A 4PYNA 4LOAA 2JJQA 2BF7A 2ZYSA 1G5TA 2ANCA 1QQ6A 2BIFA 4B6QA 4EQ6A 4JT8A 4ZPJA 5CA1B 1ZJ4A 2XZLA 1Z62A 2IYAA 3D3KA 3ENVA 2FPSA 3ZV6A 4KITB 3FJ1A 4EABA 5KYWA 1LKZA 2PHZA 1E5QA 4FGKA 1HFEL 1QIFA 1Z5VA 2IYTA 2QVBA 1ENZA 3PL5A 4IKEA 2I55A 3AHDA 4HEA1 4NU6A 2CB9A 4ZA2A 4KMRA 3ZH9B 4CR7A 4OQFA 4C0AC 4EX7A 1LBEA 1SQ0A 2HREA 2AC7A 4XSHA 4JYAB 4CLXA 3K30A 1W36D 1C3VA 4MRAA 2C7VA 1CJSA 1DFIA 3DMDA 1K6JA 1FF9A 3COPA 2Z08A 3UQYS 1UFVA 2XUFA 2GOYA 3C39A 1CZHA 4C7KA 1QH1B 4YV1A 3N75A 4BFVA 5EE3A 5KTYA 1WLSA 2AC4A 2I2XB 2NIPA 3HPQA 5EYPA 3RC8A 2WJVA 5C8YB 3L4BC 4GFDA 4LNHA 2JVIA 3ITNA 3G49A 4L85A 2BRUC 4ZAVA 2AUMA 4OHBA 1K7SN 1M1YE 3QF4A 2VTDA 4B83A 2I34A 1EXVA 2XADA 1SUAA 3T34A 5JBQA 3PFKA 5JDCC 3SHTA 4EJMA 1O0BA 1T5SA 2JLQA 3H7AA 3GT0A 2VAPA 3OIFA 5IABA 3DL0A 2PZ8A 3RIMA 4OB8A 4X64B 4LMRA 4NOJA 4QQKA 4D9FA 3S55A 5ED4A 3A10A 2WK1A 4KR9A 2ZUVA 3L06A 3OIUA 3A4YA 1GL3A 1LPOA 3DOEA 2QLFA 1ZWLA 4M53A 3SSOA 4LDNA 1D7OA 3BB3A 3I1IA 1NQWA 1R8QA 3KCQA 1UPXA 2CFIA 1OXUA 1JR3E 521PA 4AD8A 3WGTA 4D9HA 1AMOA 2GPJA 2WV7A 2DT5A 3EZ9A 4EYKA 2JFNA 3ST7A 3THWA 3D7MA 1Z47A 3G9QA 1XA0A 3GEEA 4U2CA 4XTCS 4EF6A 3FMGA 1YIDA 4J29A 2W37A 4G5YA 1QH8A 5AXCA 4CKZA 4GYKA 5JAQA 4TWJA 4EY5A 2QL7A 4IRMA 4ZQHA 1FL9A 3RIXA 3W5UA 1X7ZA 2OT3B 1SKQA 2IZ5A 3A7DA 4XD7A 4MKRA 3BXXA 3W34A 2ORYA 4A8TA 2R8BA 3BOSA 2ZYAA 2FUKA 3SJAA 2YV3A 1TA0A 3T1NA 1EFHA 2QTFA 3AEQA 4HQRA 1E2GA 2QRUA 4MROA 2I1QA 5BT9A 4ARSA 3I2GA 5E6SA 5JAZA 3OKAA 4ZOCA 2JDID 4F0JA 2M32A 4MQFB 4TT3A 5JY1A 1QG6A 4LY9A 1AQNA 4I9FA 3KQMA 2HJVA 1QS0B 3K09A 3BFJA 3KKOA 1U6KA 2JASA 3P5BA 4IHQA 2ZWOA 4E0BA 2HPVA 1L8XA 5BSTA 1ZVQA 3KJHA 5IPFA 3KQWA 1XK7A 2RC6A 1P33A 3QWFA 1VKOA 4CGZA 1Z8HA 3GYBA 1AA9A 1LK5A 1QO7A 2J41A 4Q1DA 4RD2A 2PGIA 4CEHB 5KNCD 1VBMA 3DHWC 1BW9A 2WAAA 1VI5A 4JP2A 2K5UA 1JG7A 5IM5A 1GNLA 5IN5A 1DSSG 5L8VA 5H59A 2NPOA 3IS3A 2ZT6A 4GQAA 2ZBQA 5BNTA 5KSYA 5U4QA 2Z8ZA 3CA8A 2VYVD 1E7MA 3EN0A 2W2QA 1PG2A 3R6TA 1G8FA 3HEMA 1JJIA 2IE8A 2HSDA 2VJPA 2VP5A 3QVMA 4KACA 4R9RA 4WXMA 3RW9A 4YMGA 5HZKA 1U1CA 1BCSB 1QX4A 4FSDA 2ZJOA 3EG9B 5AYVA 1JECA 4X7PA 1I4LD 3NYQA 5EIHA 5A1JA 3QA9A 4DV5B 3UJDA 2ZJ2A 1V8PA 1BMTA 3C1AA 3M6AA 1USVA 2V7VA 1UBLS 2CE2X 1UBGA 3UAVA 2REOA 2K7ZA 2XW6A 1VRWA 1LSJA 3OZFA 3U80A 1E6MA 3IJPA 2VQDA 4I6GA 1W35A 1Q0ZA 2EJBA 2PX8A 2UKDA 1ZK4A 4JLSA 4HO1X 4IOMA 3UJBA 4YCSA 2CNBA 3UNXA 3ZWCA 3OJCA 4GSLA 1GFWA 4JBLA 3MILA 2GRUA 2HMUA 1POWA 3T5BA 1U04A 1U3GA 3DJYA 3ZDQA 2R4QA 3IVAA 3LGSA 2AOUB 4KXUA 1L5HB 2H48A 2HZ7A 1AD2A 3L02A 2ZPTX 1L7NA 2V03A 2ZREA 3IH5A 2YMPA 4L15A 5AK0A 5BQOA 4OJKA 1XIVA 4H7JA 1DS6A 1T2FA 2FP4A 4PFSA 4JNCA 1P3DA 3VYUB 2OAGA 3KFXA 3ESAA 1V1MA 3EQZA 1MOSA 4RIFA 3LCCA 3RSCA 4Z0HO 1FRFS 1QB8A 3NTVA 2VF2A 1FTNA 5DVZA 2JH3A 1GCOA 4NZZA 1C5KA 4L72A 3MFYA 4MRVA 4C0JA 5BPFA 3DSRA 1ZGBA 2CXSA 2CFSA 4QAQA 2NPFA 3EVNA 2GBLC 2WWGA 5DMXA 2QMHA 1QDLB 3BSSA 3K9WA 2WSSA 3TQIA 8OHMA 1WIWA 3RFCA 2QU8A 4GKBA 4KJXA 1YK1A 4TROA 1V47A 3NAGA 3SZOA 4EO4A 1YVPA 3PE3A 3SJUA 1MH1A 1UBMS 2OXEA 2X4LA 2BKLA 4NJMA 1J7JA 2VI5A 1GDTA 1LH0A 4B7XA 1TJPB 2BFFB 1VJ1A 3EEBA 4AMVA 3SF8B 4BRZA 4L5YA 4L02A 5HOQA 5K01A 4X66B 4TN5A 1HE4A 1MH9A 1M6VA 1SCUA 4PQGA 1PWZA 1R6VA 2X8JB 5L4SA 2GEBA 3A1SA 4EB3A 2H1HA 4UBKA 3BGWA 2XQJA 1DTEA 1JDBC 1UADA 1XN1A 3KXLA 3LIIA 3MC1A 4PHHA 4LFAB 1SQGA 4PIMA 3GUVA 1H8HD 2ZJ5A 4L9RA 1EKXA 1JQDA 2WU8A 5CURA