2D5IA

The crystal structure of azor (azo reductase) from escherichia coli
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
200
structure length
200
Chain Sequence
SKVLVLKSSILAGYSQSNQLSDYFVEQWREKHSADEITVRDLAANPIPVLDGELVGALRPSDAPLTPRQQEALALSDELIAELKAHDVIVIAAPMYNFNISTQLKNYFDLVARAGVTFRYTENGPEGLVTGKKAIVITSRGGIHKDGPTDLVTPYLSTFLGFIGITDVKFVFAEGIAYGPEMAAKAQSDAKAAIDSIVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Azo Reductase
publication title Three-dimensional structure of AzoR from Escherichia coli. An oxidereductase conserved in microorganisms
pubmed doi rcsb
source organism Escherichia coli
total genus 72
structure length 200
sequence length 200
ec nomenclature ec 1.7.1.6: Azobenzene reductase.
pdb deposition date 2005-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02525 Flavodoxin_2 Flavodoxin-like fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2d5iA00
3GFRA 3FNIA 5NLLA 4D02A 3FX2A 3F6RA 2V5VA 2FZVA 3L9WA 1FLVA 1D4AA 5B3KA 5LLDA 2V5UA 1YRHA 1VMEA 1V4BA 5LBUA 2R97A 2AMJA 1RTTA 3GFQA 5FUQA 1JA1A 4DILA 2HNBA 6NULA 2KLBA 3UXHA 2QWXA 2FLVA 2FX2A 2QMYA 5A4KA 3P0RA 2X2PA 1FLDA 1XYVA 1AMOA 1CZRA 3NHWA 4LTNA 3KAQA 2MOKA 3NHRA 3FVWA 5EA2A 1FTGA 4FGJA 1SQSA 2M6RA 2BMVA 2WC1A 4DIKA 1YCGA 1TIKA 3W79A 1DXQA 5TGZA 1BVYF 4QOFA 1YCFA 4H2DA 2FAXA 1AKVA 5F12A 5LJIA 1CZOA 4QOHA 3EYWA 1YCHA 2HNAA 4DY4A 2FCRA 3S2YA 4XDGA 3F2VA 4J8PA 2HPVA 3EDOA 5FA6A 3OX3A 2R96A 2XOEA 4YALA 3NHYA 2Z98A 2B3DA 2BZSA 2MWMA 1AHNA 1D03A 1OBOA 4ZVNA 2V9CA 1RLJA 3OWXA 4GR9A 3GAMA 2A5LA 2QMZA 1RLIA 1GG5A 2MTBA 3GFSA 1QHEA 2GSWA 1TLLA 4LA4A 4F8YA 3KEGA 1J9EA 5FX2A 4GQIA 1OFVA 3NHSA 5LMCA 4BMOB 4PTZA 4FGKA 1F4PA 2QX9A 3JSXA 1C7FA 3R6WA 4QOEA 4ZVLA 3QFCA 4U7HA 3QFRA 2M6SA 3L9XA 3B6KA 1ZWLA 4H6PA 3NFRA 1CZNA 4U7GA 2FZ5A 1CZLA 1KBOA 3ESYA 5JROA 3HR4A 3NHPA 5LVAA 1C7EA 3KLBA 5LBTA 4ZVKA 3K1YA 2Q62A 4ESEA 2BPOA 5EMNA 3NHLA 4FGLA 1J9ZA 3O73A 3NHJA 2OHJA 3TE7A 2XODA 3D7NA 3FW1A 3KAPA 2X2OA 3QE2A 1QBGA 1RCFA 4NLLA 5F4BA 4YAWA 4YQEA 3OJXA 4YAUA 4QOJA 5EAIA 2KQUA 4LTMA 1CZHA 3ZHOA 2Q9UA 1FLNA 1CZUA 2BF4A 2FVXA 1NNI1 4QOGA 4HS4A 3N3BC 1AKWA 2Z9DA 1WSBA 1FVXA 2F1OA 4Y9UA 3NHUA 5NULA 4R81A 1FX1A 3LT5A 1X77A 3U7IA 1AKTA 1AZLA 5ULLA 1D04A 3F90A 4LAFA 1XT6A 5BUCA 2OHHA 3NHKA 1AKUA 3B6MA 3W78A 3N39C 1WSWA 1YKGA 4YAFA 1XYYA 3OVMA 2Z9CA 1I1OA 4LTDA 4N9QA 3FJOA 1QRDA 1E5DA 4Y9RA 5LJLA 3OX2A 3SVLA 1ZX1A 2BN4A 4BMPB 4CETA 1OBVA 3NHFA 4C0XA 4ZVMA 2FDXA 3TEMA 1YDGA 2ZKIA 1XI2A 3OX1A 1DX9A 2FOXA 4NULA 2RG1A 3B6IA 3LCMA 4QODA 1AKRA 3ESZA 4C0WA 1ZWKA 1CZKA 3G5MA 3W77A 1T0IA 4PTYA 1H69A 2W5UA 1J8QA 2MT9A 3RPEA 4Y7CA 3O2NA 4N65A 1J9GA 1FLAA 2N1MA 3HA2A 2QX4A 3B6JA 4C14A 3NLLA 4C76A 2QR2A 3ES9A 2Z9BA 1T5BA 3U7RA 1QR2A 4QOIA 1SG0A 4CF6A 1H66A 4OXXA 5B3LA 1BU5A 3UXEA 4S24A 3OWHA 1AG9A 3HLYA 1YOBA 2QX6A 1DXOA 2OYSA 1B1CA 2ARKA 2OHIA 4N82A 1FUEA 3OJWA 3TZBA 3K20A 3N3AC 4M0CA 4GI5A 4PU0A 1JA0A 4U7FA 4XDHA 2QX8A 1AKQA 3W7AA 4YAOA 4FX2A 2D5IA 1KBQA 4ICIA 4HEQA 3F6SA 3ESXA 5F51A
chains in the Genus database with same CATH superfamily
2XZPA 2CVPA 5DK4A 2H3HA 3NUQA 2H1LA 5K51A 3BF8A 4QULA 1EB8A 4I1SA 3OICA 4I6GA 5BOSB 3PLAE 4RA6A 1XMQB 3Q7SA 1JDBB 2IHVA 3ED5A 4BNMA 1NM5A 2HA6A 1N6OA 1TRHA 3GLHB 3U7QB 1ZD8A 1DKMA 1FNSA 2P9TA 3DKPA 3JYQA 4I5GA 4TTSA 4BKOA 3ZJ5A 3A9RA 3REGA 1EXDA 3UZUA 1J42A 1TMGE 3BMQB 4GF5A 2W6IA 4HK4A 2IL1A 4DR6B 2ZR0A 3TGPA 4GKVA 2ZJYA 1XA0A 4TM8A 4YDRA 4XXHA 2BRUA 1Q3TA 4XWWA 1GZ5A 2JDID 2QN6A 4EATA 3FCSB 1TO6A 1V4BA 1A98A 2A88A 2OG1A 1UKBA 3HKEA 1SRRA 4NJMA 4RHYA 1A7KA 3KZ1E 4L15A 5JAMA 1NVDA 1L7AA 2PANA 1RAEA 1W6UA 4UREA 1E3IA 1JFVA 4REMA 2IPNA 1SB8A 1LFDB 4MJ3A 2ASEA 5EZQA 3F6CA 4PRLA 2CEAA 4N6OA 1AGPA 1HRKA 1MTOA 2AUMA 3M1IA 1NWHA 4AZWA 5JQGA 5GM2A 3IE1A 5K8VA 2VJLA 3BUSA 2A33A 3N75A 1HTWA 4F6RA 3OCXA 1QZTA 2GNOA 4A5OA 2QMYA 1UBKS 4DIUA 1GZ6A 2LDXA 4E31A 1J0XO 3CKKA 3SI7A 5CNKA 5AHRA 1PWZA 4M1ZA 5LPNA 1D5CA 1IOZA 5DMXA 1E0JA 5CYGA 3TTXA 4L7VA 3BICA 2QPTA 1UKCA 2D0PB 2UAGA 2TS1A 3HB9A 3KAQA 3LUPA 3IOYA 4Z3DA 5LQJA 3KLNA 3EPJA 1ABEA 3SHFA 4IQGA 4EX7A 3HXKA 1IEQA 3VM6A 3BFPA 3OE4A 3WMEA 4XX0B 4EFMA 3CX6A 4LOLA 1XNRB 4A9AA 3L1VA 2H57A 5REQA 3AV0B 2NOAA 3EC2A 1RYEA 1XZNA 2CVFA 4EMUA 4P5EA 3KKMA 2P5TB 2VBFA 1E5XA 2R751 2YWBA 3H2GA 1UBMS 3TRIA 4C0HA 1N77A 2X8BA 4CM3A 1WKBA 4U2DA 1NMZA 4JB8A 3CVXA 3IX7A 3FPHA 3ZV5A 2XH8A 1UFRA 4N6GA 1P9WA 5CIYA 5CB0A 5LIRA 3L04A 1XTBA 3BAFA 3WXMA 3ZD6A 4M8NE 1YCFA 1I24A 4H2DA 4LCEA 3A6KA 2ZRDA 4JBXA 2BSQA 3D54D 1M34B 3HKCA 2QZJA 4YUXA 4Z8YA 2ZS8A 3PQ6A 3JQ9A 3BWYA 3EAQA 4Z7QB 4DV5B 2J1LA 1AQYA 3KXPA 2PY6A 4HNUA 1XYGA 1YRLA 1E2BA 1NN0A 2M1XA 2QE7A 2AE1A 1AHPA 1JDJA 3AWIA 1OC4A 2AQIA 2FMIA 4TV9F 2UYQA 4MGIR 3F2VA 1VLMA 1F0NA 1IU9A 3EVDA 3F7OA 3EZ6A 1EU1A 3N2EA 3O82A 2XVAA 3C0KA 1FP1D 3DVAB 1DZIA 2GZHA 2PSSA 4NY1A 2CV0A 3NWPA 2AK2A 3HSKA 3RTAA 2DCUA 1RU3A 2CDBA 1U1FA 3HJTA 3NBAA 1OZFA 4ISCA 3IEVA 2HHAA 3EVCA 5LB4A 2Z57A 1TLFA 3IT0A 1PJTA 2AC4A 2WB4A 4FEYA 1A5SB 1WB4A 2Q6TA 1YS6A 3FPEA 4QQ8A 4UCQA 1JQEA 4X71A 3W1WA 1NI5A 4W5WA 4EUSA 3TWOA 1X14A 4JI3B 1DU4A 1K4KA 2VZ8A 1DOAA 2RONA 3PJEA 1QYIA 4QDXA 1DMSA 1EE9A 4ARSA 2ES4A 2F7SA 1G2QA 4LJKA 1TJYA 1Z8FA 1H2EA 2HPAA 3U2QA 1RXIA 4YS6A 3TVTA 4AWXA 4BB0A 1J8FA 3BWEA 4K6KA 2NN3C 1FTWA 2C2HA 3U4DA 4D98A 3STXA 4D1YA 4OHRA 3AESA 1IPFA 2QV7A 1HYBA 3AZQA 3DE5X 1BS1A 4IUDS 2G9ZA 5FR1A 5EIWA 3VO2A 1UBTS 4YRSA 5DHAA 3RRZA 1B43A 3LDUA 2O19A 4P0QB 1M83A 4QT0A 3NC1C 2JI6A 1I94B 1DE0A 1I2ZA 3V7FA 1HWYA 3Q8LA 4NCBA 1REQA 4HYTA 4KN9S 1QGYA 1DOZA 1HT0A 5K45A 1Z5PA 3W6ZA 3NM5A 1T9BA 1EP9A 3DXZA 4IHAA 3SAJA 4L8WB 2FQWA 1QHEA 1GZ3A 1T4BA 2ZYUX 1K7EB 2YY5A 4LA4A 4LXIA 1TUIA 1HXHA 4QHSA 1W36B 3S1AB 4Q7JB 1KK0A 1R16A 3IELA 1XR3A 2FSIA 2O0JA 3GR6A 4N9WA 2X5NA 4K9PA 1ZCBA 3GUHA 4PFKA 4UBMA 2J9ZB 3VZPA 4DJFC 4DNQA 2VPZA 2JKVA 3FRIA 3QA9A 4DJAA 4M46A 5BXQC 2F2TA 1KFCB 3FM9A 4PFSA 3SD7A 5IJWA 2P6UA 1CS0A 2Z2YA 1V37A 1U9CA 3I5YA 4MZXA 4ILKA 3CUSA 1JDSA 3JSXA 5MFZA 4D99A 1U04A 1LDMA 1Q1BA 3TRFA 1S4QA 1MB0A 1TA4A 2V7BA 3CX8A 4KP7A 4NXMB 3WWOA 2KW5A 2LKDA 3MCWA 1H5NA 4G8DA 4PNPA 1G3UA 4P83A 2O0HA 5DJ5A 2XGJA 1Z4IA 2BELA 2X6TA 4JS0A 1GZVA 3DLTA 3OU7A 1A9SA 2C2WA 3L8FA 1A8UA 1NUHA 5JJLA 3KVOA 3RRMA 3KZOA 5BUQA 3DMDA 3MINA 3DMPA 4ZOLA 1E64A 4G4JA 1BQEA 2G4VA 1WTAA 3HDJA 3QRWA 5K3SA 4A3SA 1S2DA 1BJKA 1E9SA 2E7ZA 4H4EA 3RNLA 5B7NA 4UVEA 1BOFA 1Z0UA 4INAA 5FBHA 4URXR 4H6PA 2NPIA 3GRYA 4IIYA 5GONF 2JIPA 3BMOA 3F5QA 2JJ2A 1KYVA 5KMGA 4ND6A 1JKFA 2YIMA 3WHPA 1ZH8A 4JQYA 1WUTA 1YQDA 4BO9A 4HGNA 4IKOA 4CGYA 5IM4F 1M2EA 1KBOA 2IZ7A 3R8CA 4BV8A 4PC6A 2HA3A 3PIRA 3CWCA 4QAJA 3ESYA 2JATA 2YDXA 1D2MA 3LTEA 2ZYSA 3L6OO 4PG8A 1W19A 1H0HA 3CJQA 3U44A 3ADPA 3VRHA 5T5QA 5EG5A 2O07A 4PGFA 3RS3A 3WR5A 3ENVA 3JWIA 1Z37A 3JATA 3KTOA 3M82A 4ARUA 1V8FA 3OMLA 4RD6A 1ZQ9A 3LZ6A 1NVUQ 1FUYB 5KYGA 1ZVMA 2BPOA 5FPSA 5FT9A 2Q29A 4OQYA 1HNXB 4CLDA 1RIIA 2PWAA 4N48A 1MAUA 4ENVA 4HXGA 1ZW1A 3T4XA 2QRQA 1U3CA 1Z2NX 4I7EA 4RZIA 4HQLA 2QGZA 3E61A 4WXEA 3PXGA 1F3LA 4YJFA 2OSVA 5IAGA 4Z9AA 4ZJYA 1ZJJA 1Q3KA 4EITA 2J6HA 5IJZA 3GAFA 4NYMQ 4RY8A 3HUEA 3TQTA 4R51A 1JDTA 4ETMA 2IYAA 3WGJA 1NASA 4YAWA 4K2HA 3RNOA 5ALFA 2J6BA 1Y5MA 2C2KA 1R88A 5F9HA 2OAEA 3PSAA 4BNIA 1OH7A 4URHA 3SM3A 3PZBA 2X86A 3IKVA 1N7HA 4RF4A 2PVSA 3U62A 4ID3A 5FUQA 4HN4B 1EWVA 1JR3E 4LTMA 4BLUA 3SKXA 2R84A 2QUHA 3GN2A 2PS0A 3V1LA 2ATCA 3IKTA 4AP5A 1TFRA 1M1YB 5K6AC 5KOHB 3A2KA 1DV1A 1SURA 5IJ0A 3KUUA 5CTJA 2YOHA 3RJMA 3QF4A 5IC4A 3QKRA 1BCRA 5A3JA 1BHJA 3L6BA 4YP5A 4M9UA 4XGRA 4ZU6X 1TQHA 2R7KA 1ZSNA 3ZKAA 4ZPJA 5JY6A 1OY1A 2X15A 1T13A 4TTTS 5G0UA 5JHHB 2UZAA 5ALTA 1EVEA 1GPLA 1ODSA 2VPTA 3WGZA 3BIXA 1LKZA 1T5SA 1CEXA 1H8HA 3L7BA 3W1VA 4FKBA 1U0NA 1ODIA 2B8TA 2IYLD 4M2LA 5TPWA 3S29A 2WVHA 1YBAA 3ENZA 3U7IA 3K0SA 2Q3HA 1FPMA 1G4UR 1N1DA 3KQSA 4OHCA 3SYLA 1D04A 5C35A 4ESVA 1B14A 1D2AA 4Q39A 5HBGA 5C8DA 2PMFA 1RYMA 1CJCA 4L08A 1ESCA 1ZISA 1J07A 4MV8A 3V6LA 1U9JA 2VCEA 3AEQB 4PAQA 4C0LA 5JZSA 5HRCA 1M1NA 3H2SA 1CP3A 2QT1A 1V6CA 2TMDA 1DIAA 2E18A 4GM0A 3W7VA 3WMFA 3DW1X 1OXMA 4Z9FA 1XLTA 3K1AA 2EJBA 4JH0A 2WYWA 4R8MA 2ZSDA 4RTOA 3W78A 1NQAO 1X3LA 5IKOA 2ZYHA 3KJXA 3ZE1B 3EVBA 3W5DA 2IS6A 1RQXA 2VHUA 3ROTA 4A8JC 4EO7A 3HGMA 2OBFA 4JUAA 3U48A 3ZY6A 3EMDA 4C4TA 2JASA 1FJGB 3GEGA 1UWVA 3CHYA 5DWDA 1QFSA 4OEHA 5BRAA 2AC7A 3EXIB 1KGDA 1U6JA 4D8WA 1GCIA 2ISCA 2AHOA 3WLLA 1JR3D 4ADSG 3IP9A 4PAMA 4EQZA 2JBAA 2JFQA 5DN9A 4N3CA 2QNIA 2P8JA 4KQKA 2ZR9A 3P0IA 1X7XB 2OV1A 2VDRB 4RZ2A 4D57A 2QRGA 5EVJA 2OK8A 5LP6A 3WYGA 1HQDA 4BYMA 4QQKA 4UU0A 4HNSA 4N8EA 3QOYA 2XBMA 2FP4B 4XLZA 3MWLA 4LXHA 2HH9A 4FP9A 3E84A 1GN8A 4J1TC 3DJFA 5J4HA 4LZPA 4L75A 2PD6A 1MAAA 1R6DA 3C87A 4DGQA 4QM6A 5H0IA 2XQKA 1YOVB 1SG6A 2GN1A 4UTVA 5CFOA 1X7WA 1TKRA 3NWOA 3RWOA 1UWLA 2A7XA 1PFQA 4BKPA 2FDXA 4EHKA 1YDGA 4PBRA 2WYIA 5FFMA 1K7YA 1NKVA 2W4MA 4DQUA 4DR1B 2WTMA 1A9QA 3L4BC 3Q3VA 2OFOA 4GICA 4L9SA 4MRRA 3VKGA 2GAIA 2FPIA 2QRVA 1IONA 1Y5IA 5AVXA 4MKFA 4WLOA 3P32A 4FFWA 1ESMA 2QAGB 4DSZA 1PG0A 3B6IA 1QG6A 1UBUS 2EKDA 2JS7A 4ENPA 1X1AA 4QPDA 1P2FA 1MJ5A 4BOYA 1QWSA 4K1XA 3EBLA 1F8FA 3RTDA 1PG2A 3FIUA 4BX9A 2RAVA 5AMXA 2BUAA 1M74A 2BY4A 1BNCA 4M9RA 4QVKA 4H77A 3ZXYA 1YUBA 2QRZA 4E51A 2C0QA 4RETA 1E5TA 3G5LA 4UEOA 2MT9A 1Y1LA 3LU1A 4M7RA 1NJ6A 3ANYB 5L7WA 3SVTA 1XQ1A 1X8XA 3IKLA 3QVVA 1GDTA 1U2RA 3VYTB 4Q47A 3N28A 3I28A 4JKYA 2WZCA 5BW8A 1JU4A 3FKSD 5E6SB 2B5VA 4DLTA 5BN1A 5J1SB 2QW8A 3SSNA 3EIWA 4ND3A 3NT2A 3T3PB 4D44A 1OU0A 1WKVA 4N5NA 3RTEA 2CJFA 2DR2A 3DNFA 4QO7A 3L0PA 2FEMA 3RRFA 4UTNA 3BGOS 1E9FA 1Q0TA 3OEHA 4MGYR 5I3ZA 2BZGA 3FOBA 3UPDA 4JYZA 1ZVVA 2W6QA 1SQ0A 1E18A 2CXHA 1ULHA 5K7SA 3ZE0B 1AJEA 1GP2A 4RD0A 3MTDA 4D8XA 4FC7A 4WUVA 2QTHA 5JAPA 5IWAB 2BFNA 4E5NA 3DEJA 4OU5A 5LDHA 4YRRA 4PNZA 1E94E 4AD8A 3G6WA 1RMYA 1UDXA 3ASYA 1TB4A 3HRHA 3UUEA 5JEDA 2PFKA 4NSNA 3R6DA 3BIJA 5B3LA 2QSYA 3GDGA 4YCCA 3BCSA 2C7RA 2X4IA 2QM0A 2BKVA 4DJJA 2IDKA 2XWPA 5HA5A 3INTA 4CVNA 3NC4A 4ZP1A 4E1VA 3EZGA 2PWPA 3WKBA 1XROA 3MSCA 3F71A 4LWOA 4EKNB 2ECPA 1H85A 1I6LA 2D74A 2G9RA 4LGVA 1ZA1A 1C7IA 4R8RA 5EE9A 1RBZA 4KKXB 4BXOA 4NCJA 3Q2IA 3QJGA 3RGGA 2OHIA 4C07A 5JH7F 1KDPA 5IBQA 3S8YA 3TQFA 1PU2A 1W25A 1T9CA 1KJNA 1TMKA 1WS6A 3VHLB 2QZ4A 3OPQA 4UBNA 4EL0A 3OTOB 1HFWA 5DH9A 1NXXA 2GHRA 1PV2A 2IY7A 1SU4A 3WLNA 4AJNA 2OV2A 1T9KA 3F5SA 1G38A 4MQEB 3EIUA 3SXUB 2ZUBA 3R0XA 2XT9A 1NYTA 5CK5A 4L8GA 2DVMA 2TMGA 3V8QA 2JIZA 4C0BA 3DBRB 3LUKA 4C9BA 4XYLA 1KFKB 1MG5A 3MGKA 5A9SB 5A04A 3CVUA 1X3SA 1G16A 4TZTA 1WSDA 1EM8A 3PU6A 5ED0A 3TOVA 2H5JA 3VPSA 4GPBA 1QR6A 3S0JA 5DTEA 1Y82A 2NQ2C 1FSSA 1VHDA 1YAJA 3PTAA 5KTKA 3A9VA 1AGRA 1IY0A 1SU8A 2BJWA 2VH1A 1L3IA 2C95A 2X0IA 4NQZA 5F51A 3USCS 1XZFA 4HO1X 5AKHA 3ZCUA 1HYGA 3MK31 3ZS8A 3W9UA 4CQLB 4URVR 1BFDA 2OWDA 5JPIA 3P9SA 2YWEA 2ZJFA 3C41J 1XOIA 3I0NA 4FFPA 4LYHA 3DV2A 1NBAA 5AWFC 3WIOA 4XD7A 2QUAA 2WTAA 1WCWA 3HR7A 3MRTA 4YRPA 1TZJA 4DFDA 1XHFA 4R1QA 3ISTA 3VC3A 2G9UA 1AQLA 1T9GS 1YBVA 2DJ5A 2G1UA 3DGEC 1DKPA 2V9ZA 2PO5A 4AS2A 2VT2A 3TIGA 4RXTA 4UBLA 2WJGA 1DAHA 2W48A 1LX7A 4S1VA 1UBJS 1GPWB 4DHWA 2QD3A 4ZFNA 4D9EA 3OE7D 3PJRA 5IDQA 2QRHA 3ZBPA 2FFHA 4OP3A 5LBUA 4Y30A 2Z83A 4B34A 3JQ7B 2Z5FA 2WICA 5J47A 2P0AA 5LMNB 5CPFA 5EUCA 2Q46A 1ZBQA 3W5IA 4GPD1 2I3ZA 3T9AA 4YRDA 4OQPA 3LY8A 4YJGB 4D92A 2NO0A 1XKXA 2FHPA 2L42A 3V2UA 2QWXA 3ADOA 2BUBA 2ISSD 3ICOA 5G3YA 4ZTUB 4CV3A 2X1MA 4LHWA 4HYEA 1EFAA 1WY5A 2AE2A 3AI1A 3MWDA 3QIAA 4YAJA 4BRWA 4ZJZA 2R7LA 2O8EA 4DREA 3RT1A 4E5MA 1JE0A 5EUMA 1K8QA 4H1HA 3KD2A 1EXVA 1T9AA 3OPYB 1M2KA 3A14A 3P19A 1Z4QA 3BYZA 4B35A 3C3YA 1M6EX 4ZHQF 2WKWA 2VBGA 1RE0A 2VZEA 5J2UB 4EA7A 3LWDA 1SVMA 3PQ5A 4I50B 2PAAA 4B17A 3C3AA 2OXIA 4F45A 1N7JA 2C7PA 3DMRA 4DDTA 2FX5A 5JO0A 1C4WA 3FVWA 5EKUA 4RPHA 1PL7A 4OK3A 3RANA 2CBXA 3T9DA 4ARBA 1WA5A 1VLZA 2BI8A 4TMYA 3QWBA 4X7RA 1RWOA 4FGJA 4EJSC 3BA1A 3G1TA 3U3XA 2O0MA 3GFFA 3HNRA 2VUUA 3L0OA 2C7VA 2PVPA 2I6GA 4UKDA 1DBWA 1M8JA 3DZKA 4XYGA 3ORHA 2R8OA 2IWHA 1DXQA 2C77A 2AEMA 2PXCA 2Z5GA 4TS9A 1Z5VA 1Z39A 3GDHA 3FOAA 3GFOA 1FJHA 3I5MA 4OHMA 1CDOA 5TRTA 3NANA 4CMKA 1UWKA 2PX2A 5E6UA 3AEUB 4MDHA 3H5VA 5TX7A 2RCNA 4JASB 3ZN2A 2C1XA 1A5TA 5IN5A 4RVDA 5JAUA 1OPXA 3A1FA 1TUGA 3AJ9A 3HCDA 3KIPA 5EYPA 1MOPA 1P4RA 3PGXA 4A91A 5JCJA 2Q2WA 2LDBA 5IJ9B 1WOYA 2PYZA 5CD1A 3ADBA 5AFSA 4U2BA 1VYHA 3QFSA 5LNK1 1YH3A 3AF4A 4ZC8A 3NCTA 3ZU4A 2SKCA 1GZ4A 2G6BA 4K1LA 4JUDX 4DT1B 3MLBA 3R9IA 4HEJA 4BEBA 4IV0A 4G0NA 2EKLA 4BVEA 5TB5A 3K0KA 4YB8A 3L0ZA 1GA1A 4CF3A 1ZRNA 3ICEA 4L72A 4DMLA 1NLYA 5DTJA 1NW5A 3AHJA 1RWMA 2HPVA 3VR6H 1MOZA 2JLCA 5FA6A 1NW6A 3K5WA 3F5FA 4DWOA 2VWGA 1KEEB 2FGJA 1SPBS 3HACA 4AYWA 1OH8A 3K5PA 3C3CA 1JFTA 4BLPA 4ZQCB 1YS9A 2XEXA 2DWQA 4LZAA 2ZREA 1SCKA 2GFIA 2MYUA 3WYBA 5JT1A 2JAUA 2WSIA 3I9V6 4Y67A 4YY3B 2NNLD 4IWXA 1B0AA 1ST3A 4X8MA 3H11B 4QUBA 4DE5A 2GHIA 1LB1B 2PX8A 3SMVA 5A5GA 1QZUA 5GVSA 3FIJA 3L1UA 4I1RA 1OF1A 4QWWA 4Q3AA 4GNKA 1N3YA 2X0KA 3DL0A 4PO9A 5IUKC 2H07A 3LFHA 3LY9A 3R6LA 4X1KB 3VYRB 3M5CA 5I9NA 3OFSA 5J43A 4N18A 1WCXA 2XSZD 1T5HX 3GFVA 3H75A 1QX3A 3OZCA 3KU4A 4K9OA 3EGOA 3MWEB 3C6XA 3L0BA 2P6RA 1C9DB 1M0TA 3JPWA 2LVBA 5KO2A 3BD7A 2B78A 4JBWA 3GAMA 4JKOA 4JYAB 1GGMA 2XYGA 3BPSA 3U49A 1XXHA 4OSEA 4PGMA 1GAJA 4JI8B 2QGNA 3OQIA 3NKLA 2QTZA 4AJPA 3V80A 4UTOA 4DMGA 1MB3A 2YHBA 5A1TA 1AXRA 2LUOA 3B2EA 2WEKA 2W6JA 3ZI0A 1T4CB 2BBTA 2O7RA 5LZ4A 3O4RA 1RQGA 5FL3A 3JAKA 4LHYA 5HKLA 3W5SA 1J8VA 3H8SA 5LWHA 3SBEA 3NHSA 1GA4A 1FXWF 2C1EA 1HQYE 2QNRA 2GA8A 1E7QA 3DMFA 1KDRA 4IIJF 4UHCA 2LIPA 2JW5A 5IU6A 3JALA 5HQTA 1SCJA 1CP2A 1JNXX 2HK8A 4HDSA 4S3MA 4C4SA 2D5AA 3FHJA 1NRWA 2OO3A 2B30A 3I8OA 1PYGA 1M67A 1U4SA 4JOCA 4O4HF 3V8VA 3M5WA 2OHGA 4W1QA 4ZKEA 5AVRA 5JNSA 4JI4B 3TINA 4ESOA 1Z0JA 4UNNA 4MS3B 1SBZA 2I2DA 3OKPA 1KZ1A 2ZRHA 4YBZA 3K9LA 2CVOA 5EEGA 3SM9A 1DKLA 3K16A 3NJ4A 3I5XA 4J16A 4ZALA 3R77A 4D9GA 3IVXA 4LHZA 3OQPA 5CGQB 4WKGA 4KPEC 4ECAA 3PC7A 2HRDA 4CPDA 2FSFA 2AFIB 3GQBB 3GLKA 3EFEA 4RHXA 4XA8A 5LYJA 5JQWA 3P2YA 3GT3A 4YDHB 3CURA 3Q4GA 4HATA 2QTWB 2WD9A 4OI4A 5IEBA 1UKAA 5JBNA 1XL0A 4XB6B 1M6NA 4L2IB 5BUZA 3SSOA 5JU6A 2CJPA 3LPLA 3FPBA 3V1KA 2XE8A 1A72A 3Q6MA 2YOFA 4HN9A 4C7MA 2XKJE 3JARA 4AJ9A 3JQ9C 4GUDA 1VKRA 2P9EA 2QYHA 1D1TA 2Y1DA 1Q20A 5TPZA 5C3MA 3H5WA 5JJBA 3ZU5A 3C1AA 2XMPA 4PTLA 2PE5A 3A0RB 4CMIA 2HI0A 1D8AA 4X8OA 2JL1A 1CUDA 2PS1A 1I3NA 1YO6A 1CIJA 1AE1A 2EXXA 5EKTA 5CVVA 5ICSA 3WTBA 1MW8X 3AVYA 3N7TA 5CMLA 3HV2A 3HZOA 3L05A 3CRNA 3QGMA 2V7UA 4HNAB 4F2GA 2PUFA 4R3WA 5HCNA 3TE7A 4NJMB 3HKEB 4OHVA 3ZCRA 4F7WA 3KYJB 4DLAA 2QYTA 2CHFA 3FTFA 4JLPA 1YJQA 3B1JA 3C6KA 3SC2A 3KPJA 2IWRA 4M8KA 1CE8A 3M0EA 1ST2A 4QUJA 3DMTA 1U8XX 1CU1A 5ALWA 2LWIA 2CD9A 3OQ1A 1LVUA 2G25A 3I6QA 5ECWA 5JTUA 3HH8A 1D09A 5EAIA 3O4IA 1RHKA 1E3SA 2HLNA 3CIFA 2ZAYA 1OWLA 3S28A 3JD1A 3D1VA 1CZUA 3JCZA 3LVBA 3ZWQA 3HYRA 1VE9A 3LY5A 4PVCA 4MQLA 3IT3A 4PGGA 2J07A 3DNPA 3I2KA 1MX9A 1FS5A 2OM6A 4LMBA 1WXHA 4MS4A 4QASA 5CH8A 3RVDA 3VZBA 4E3ZA 1G98A 5ARBA 5JNUA 1EUYA 4FHGA 2PCLA 3BXZA 3H8JA 3IAFA 2ZVDA 3IQDB 3QBVA 4ZOCA 5AKYA 4O8ZA 4QEZA 5FWXA 2VHQA 3ASVA 4C1BA 1LRLA 4L7QA 4FMBB 3RVMA 1W0KD 5EY5B 3L1JA 1W1WA 1NV9A 2W00A 4AB1A 3HPQA 4N6NA 2DPHA 1JLMA 3C3PA 3KV1A 1AZLA 1R6XA 2JI7A 3CA8A 3OJFA 1H05A 1N92A 2HA5A 4TT8A 4B4UA 4P7GA 4P84A 2D06A 1QK3A 2HPHA 2JLAA 2OTCA 4UU1A 2AEFA 3LV8A 3IMGA 2Z3VA 3ZU2A 1TK3A 3CCCA 4II7A 4NE2A 3Q7IA 5GIPE 3MB5A 4DYVA 3R7FA 1VE1A 2HF8A 1OOEA 3IDZA 3P5BA 4FMDB 2JLSA 3GPCA 3RC7A 4MVCA 4YAFA 2O2IA 4NCIA 1GG9A 3MUEA 1S0UA 2H4FA 4FFDA 4EOGA 2OO7A 1PW5A 3OKCA 4DZRA 4MA0A 2Y67A 3I58A 3QVGA 1KQNA 2R3SA 3KG2A 4N9QA 2DM6A 4Q9LA 4OQMA 3GRUA 4OBEA 2V6JA 5A3VA 1JBEA 2NT4A 3H84A 2QRMA 4KTVE 4X0EA 5CNIA 2IXBA 4O5AA 1ID8A 1Z5GA 4QLAA 3SOPA 4ZHSA 2WFZA 3QIVA 2UZIR 4IQ4A 5H7XA 4IRXA 3TQSA 4PO1A 1W46A 2NU6A 1U9YA 4IF6A 5CH5A 2BH2A 5H80A 2VDWA 3F4BA 4KFTA 5KPJA 2BN4A 3R5SA 1TUBA 3H04A 1P8AA 2DFTA 2DHEA 1OH6A 1Z28A 4OGKA 1LS1A 3OP1A 4YLGA 1CUSA 1E2PA 4TL8A 4DQXA 1ZOSA 1ONSA 3RAJA 4BVKA 3WADA 2H5LA 3MBIA 1ABFA 4BGVA 1I13A 1H65A 1G3QA 4RK7A 4NX2A 1EVYA 4IHJA 2FK7A 3AVTA 4BKMA 3ZGOA 1CUFA 3EXFA 4O4LA 3TEMA 3IFSA 3VU8A 1FW8A 1SEPA 2G28A 4Z49A 4P8RA 1RM3A 2AT1A 2JLVA 3K2IA 3IBSA 5ALPA 4P3XA 5FTMA 3HRIA 2XKBA 3W3AA 4LDAA 1CERA 1Z6YA 1ZGHA 3OZWA 5D2CA 4BNNA 1REQB 4DXDA 1JHMA 2PR7A 1L5QA 1PL6A 5HFAA 5ALIA 2BBOA 1TTQB 1H1TA 3C3KA 4FK8A 3DCIA 5CHEA 3G0OA 2FW6A 3C5VA 3KJQA 1GZSA 3UJAA 1UPAA 4F9FA 1DC4A 1YIOA 3S40A 1H69A 1P1CA 3V1YA 3L7JA 3RPEA 5LB2A 4G4SO 4MIEA 4Y7CA 4EG7A 2NO5A 3LI2A 3DBLB 2HCFA 4XR4A 5J23A 1VSUA 5I45A 1IXZA 2WF7A 1N0VC 2P67A 2VT6A 5K0FA 2Q4EA 5C52B 4QU9A 3LO8A 2FSHA 4NV3A 5ALQA 1CS0B 3E9DA 3NZEA 4MQFA 1KVTA 1HETA 1Y5LA 3G23A 3GRAA 4LXXA 4N12A 5DM0A 2NO7A 4OJQA 4M0EA 4E14A 2RHGB 3ZH9B 1HEYA 4ZYWA 1N9GA 4B3CA 3H1FA 4C4XA 3OHSX 4RZ3A 1N1MA 4V0NA 5DCYA 1CDDA 3RHSA 2E87A 3MINB 4MVJA 4O59O 4ZOLB 1ZK2A 2Y1CA 4HB2A 4NCAA 3WLRA 1FJXA 1ZMOA 4CF6A 1OA0A 3FSRA 2JFYA 3T06B 1HE5A 4F85A 1OU4A 4WLUA 3ORYA 1NUPA 2JRLA 4HAIA 4RVFA 5BWBA 1JBKA 5C9ZA 2Z4SA 1LVHA 3L01A 4MB6A 5KMGB 3TOSA 3CMCO 2JLZA 1SA0A 3H6GA 4BIMA 4HOYA 2X3UA 1B4DA 2EX1A 2QX6A 3D6HA 4WHMA 3T7KA 1WULS 1BVUA 3CZQA 1TEHA 2IV3A 1EFUA 1T36A 2JI8A 4I1UA 4U7PB 4UUNA 2EWWA 3UW3A 3ZTYA 1Z3IX 4LX0A 2BEVA 4DMKA 2W6NA 4I8IA 5L45A 1XNJA 4R41A 4GAEA 3JATB 3VR5A 3NONA 2WHXA 5DGXA 3V8EA 3DMGA 3LF2A 3ZR4B 4YROA 4P7FA 3U80A 4M0CA 4I3GA 3AHFA 4LYEA 2PH3A 3AM1A 2BFFA 2WTNA 4QARA 2XB6A 4YACA 2ZR8A 5ALGA 2Q1SA 4CM1A 1FFYA 4UJ5A 1KQPA 4KMMA 3RUCA 5FWNA 4MLPA 1Y7IA 3VAZA 1GCOA 1SXJE 2G72A 5HMLA 2HYIC 4RL6A 3W90A 1QQBA 2BR4A 3MJTA 2PGNA 3MJEA 4R0NA 1CR2A 3VKWA 1DQZA 4QPCA 5CLFA 1SELA 2H1VA 3DP7A 1QB7A 3NNNA 3OM1A 4I19A 1A9ZA 1X9IA 1VG9B 2VRCA 4PYQA 5H1YA 5JLAA 4CCYA 4U8GA 2R44A 3NMUF 1QYDA 4PGHA 3H3XA 4KQMA 4M0DA 2VC2B 4ZICA 2DE0X 1UT5A 2H4ZA 3DW3X 1NE2A 5EIBD 3P71T 3WGVA 3GFRA 4HHEA 4BMCA 1NJGA 4F4JA 1RJFA 3NP9A 1VZ2A 1R6UA 1HA3A 5J2TB 2OLJA 1I4TD 1W8DA 2C1ZA 3DQQA 3EZ2A 5I4BA 3HXPA 4IDHA 1VL8A 3DHWC 4CMGA 2G1KA 5IJ0B 3BG5A 1ZNYA 4F0JA 4O4JA 3QF4B 5B55A 3TEJA 3FVQA 2Q8NA 3ELBA 1JLHA 4KWTA 4NI5A 5HW0A 1UPTA 4HWKA 2KX7A 3MHTA 4B32A 1KHTA 3SX4A 1JEYB 4QICA 4Z4EA 3BJIC 3EQ7A 4CBVA 1KRHA 2FSGA 5EP1A 1L4EA 1E1RD 1T2UA 2FPXA 3BXFA 3ROFA 3AYXB 4L27A 1PWEA 3M3PA 2AMJA 4TMZA 5DHRA 2V7VA 1VJDA 2XOKA 4HMPA 1Y3AA 1DLIA 2APJA 4PAWA 4Q1CA 4D6YA 4L95C 4Z7NB 1PDWA 1DTWA 3HBJA 4C2BA 4CQNA 4N7RA 1MH9A 1IVYA 2J7PD 5JZBA 3R5KA 4FSXA 4ND7A 1V48A 4HDMB 4B45A 5EZYB 5KNDA 5BWCA 2IZ5A 4A0SA 1V7ZA 1RAFA 1C0IA 1U7UA 1Z26A 1RJ9A 2G0NA 3QA3E 2E1PA 3QKIA 2EFCB 5EXEA 1FTSA 3K1AB 5BQOA 5B64A 5KTOA 1G1AA 2UVPA 2EBUA 2ACKA 1KS9A 3DWGA 3LLCA 4QBFA 2JVIA 3IP5A 1GT91 2FVYA 2G4CA 3G68A 3MA0A 3PC6A 3LH5A 2C54A 2B4AA 4MW1A 1BGXT 4XVHA 3LX4A 4LTNA 2IYZA 4W9NC 3GRZA 3FD8A 1O0SA 4PRKA 5FO1A 2YVLA 3TTUA 5ESDA 1Q1NA 3GHHA 3U61B 4DUYB 1QIFA 2PUHA 3B9QA 1U3FA 4C20A 1WAMA 3HU2A 1Z16A 2A84A 3OAAD 3VOTA 1N5DA 3ZK9A 2NU7A 4G63A 3KYCA 3I8XA 4DUPA 2M6RA 1U0HC 2WUVA 3WLAA 5LP6B 2I80A 3IQWA 2DPYA 3MS7A 2A0FA 5DW0A 4DJTA 3ZDQA 1PCXA 4E88A 1AUQA 2AL7A 3QOWA 4XI9A 4FLFA 3M3HA 1GCAA 4AVYA 5KWJA 2XYQA 2OB1A 2W2TA 4QECA 1KAGA 2QZZA 1W96A 2H0RA 4R4JA 4ZQGA 1TIKA 5DXJA 4KV9A 5ESXA 5KYNA 2VUIB 2X5XA 1QC5A 1E1QD 2XMZA 3HRKA 3KR1A 1U28A 5CIQA 1G42A 3OSZA 5BSTA 3VTFA 6REQB 1MA3A 2O8NA 2I1VB 4M1EA 1RQ7A 3D3WA 3D8RA 4L4ZA 3IV7A 2OESA 1N0UA 4OB7A 3DNMA 3HB4X 4QXPA 3RROA 2HJVA 3BMCA 2RARA 4GP9A 3E1GA 1C50A 2KI5A 4ZEOA 5HK8A 4RF2A 3WICA 2P1RA 3LAWA 3E3NA 4BNFA 1YF3A 1CZOA 1GTSA 3OD1A 2XEDA 2GBCA 4OY3A 1YAHA 2FPIB 1N2JA 2QRVB 1SWWA 3M6IA 4Y18A 3EOBI 4BNTA 2NYRA 4NOMA 3D3NA 1RWBA 2DR0A 2W2LA 4GMXA 3VR4A 2AKAB 4BFZA 3PHGA 3EHDA 4BN0A 4XDGA 4CMEC 2EGHA 3N2LA 3PXXA 2QMOA 3IKJA 3B89A 2C78A 2V7QD 4L73A 3ODPA 1F9EA 1W29A 1M2FA 1GRRA 2ZYIA 1KDZA 2E82A 3OEEA 1BRTA 1RWXA 1XCMA 2NZXA 3PEWA 3B82A 5BSVA 4PPYA 3K31A 2ZIFA 2FN3A 2XCOA 3K0HA 5JAZA 4F4CA 3GBSA 3NRJA 4OHOA 2JLWA 1Z68A 3BSWA 4NAVA 1Z0KA 4QNMA 2J5RA 5FV4A 1QLWA 2ZIGA 3GEPA 1WKCA 2MSNA 2ZG6A 3CX7A 4CIBA 1JEQA 2C3MA 2WJ3A 3A1EA 4YR7A 1OMOA 1DELA 2XI4A 3M6WA 1NF3A 4JJKA 4PC2A 4US0R 4RESA 2ZSKA 1JAHA 4IIEA 4DLYA 1GSOA 4ZVRA 3THSA 4GKKB 3AQ4A 1R9JA 1T2EA 5K4AA 2H1IA 3T1OA 1L4MA 4PCLA 4N47A 5TQ0A 4J2OA 3Q8MA 4H27A 3PUIA 3KC2A 1AHNA 3PF8A 4XGIA 2JAQA 3QYPA 4F3TA 1DBRA 4CKEB 3UK7A 1ORWA 4OXIA 3HEBA 1Y1KE 2C82A 3WKDA 3HDVA 3LY7A 1HI9A 1M10A 1K9VF 2X8JA 3ZHVA 1EWRA 1T8RA 5A0VA 3N2IA 1ULUA 3M9XA 2X9VA 4YIKA 3ZJTA 4FSDA 2NMVA 1K6MA 4NV1A 2GJ4A 5I7VA 3H99A 2C88A 4K46A 2R87A 5GJWC 5ICFA 1XG5A 1J9EA 2Y8EA 2PZGA 3KJIA 4FCTA 3QVJA 4HPXB 2C4UA 4MR9A 5D5QA 4F3NA 5DN6A 2PKWA 1EE2A 1CQIA 1QBKC 2BE7A 4JJEA 1LPPA 3D43A 4ZO9A 1JA9A 1FFXA 3KOYA 1ESDA 3NVMB 4DAOA 4IO1A 2XGMA 1PJRA 4US2R 3FUXA 4CUKA 2QAJA 2QPAA 2YASA 4H7EA 1XLVA 3COJA 3O8RA 1XDUA 1E9EA 3KVRA 2RH5A 4MQMA 4BXOB 1RPZA 4Q0MA 2D4AA 2XNCA 1KY4A 1F4PA 5I5GA 2CK3D 3NBMA 5CLHA 2PMWB 3AILA 1SVUA 1I4OA 4MYCA 3G9QA 3NOXA 3PEFA 2IA5A 3UMFA 1VGVA 4P34A 2HF9A 1ORRA 4CYMA 1DGQA 1G8JA 3SYNA 1J97A 1Z0AA 2AUTA 2Q4TA 3CX4A 4ZVUA 3FLBA 1BMTA 3BTUA 4KNYA 1NWCA 1BA3A 3DF7A 5JDCA 1YZYA 3LC0A 1FFEA 2H4YA 4NE7A 1ZW6A 2YVQA 4OYRA 3VR2A 2AMFA 2EBFX 4L76A 1LZKA 4W1PA 2OHOA 3WFJA 3NASA 4RJTA 4KR2A 2QP3A 2EFYA 3I42A 1EM8B 3W6PA 3QMPA 4QUKA 4JQZA 2FZ4A 2H7XA 4TMXA 1I51A 4K81B 3LSTA 1KORA 1CZNA 2IP2A 1ZGAA 3OUTA 2ZEJA 4P4SB 2R8ZA 1WMEA 2HJWA 2IT1A 2VH5R 4NMXB 1IEXA 5FEMA 3TKLA 4TLLB 4KSYA 1CR0A 1QU3A 4IFBA 2QTTA 1N0HA 4FHEA 3NHPA 3R6GA 4Y1FA 3G88A 4OSPA 2AN9A 4FYYA 3W2GA 4NR0A 1D6JA 1NV8A 2GVNA 1BXRB 2Q3LA 2ZUWA 3NIFB 1LV7A 4LEIA 1BEUB 1JHAA 1YR7A 4QUIA 5C34B 4BJ3A 2ZUFA 1WIWA 2IYWA 4EO9A 4BE9A 1X7ZA 1Z0DA 4GI1A 2GRJA 3OLQA 5IXYA 1D8TA 3HP7A 3UVEA 4A26A 4BLOA 5C5IA 1UXGA 1QGAA 2ZBEA 2IIQA 5GGYA 2J0VA 1Y5RA 1Z3CA 1BKDR 3FCAA 1JX6A 4IAOA 4FGZA 4LBYA 1S2MA 1AQNA 3SEQA 2XQJA 3OTHA 1QYCA 4BNXA 4CNQA 1NDUA 1U2QA 2NYVA 4GLLA 4EZIA 4ZI7F 1NFQA 4JLNA 3O7WA 3RSLA 4P3OA 5DISB 4HBGA 2DRIA 4YCLA 5EHXA 4DR4B 3EISA 2RGNA 4UVGA 2IXEA 3QVXA 2JZOA 1N5IA 2GXSA 2XTAA 3MWDB 1Y89A 2JAXA 4PBTA 4AZ0A 5HRAA 4WL0A 1VTKA 3UFXA 5T7BA 1BMDA 2VDNB 2XUDA 4XVQA 4A0GA 2O2YA 2VZ9A 1LK5A 4M86A 2VQEB 3NM6B 4ACBA 2XVXA 2XRZA 3CR7A 1QIKA 4Q00A 4A8TA 1C9KA 4HAUA 1E98A 5THQA 3KSAC 5IH3A 3H16A 2HUNA 3C3MA 3AW9A 4YCSA 3UHJA 5KTSA 2PUCA 4OHYA 421PA 1RLOA 4TSKA 4JR0A 4ZCLA 3MAGA 4A6PA 4J7XA 4FMCF 4YRBA 1U7PA 1TW2A 4O2BF 3NI2A 4E5SA 2GXQA 3LX6A 3ZWCA 2I8CA 3UGKA 1J90A 3C5EA 1WR8A 1OILA 2QR3A 2EG5A 2I4IA 3HXOA 5JSUA 3N6VA 2JAOA 2OKGA 3FLMA 2JGMA 4WVFA 2Y0PA 3HO1A 2E4UA 4AKIA 2FWNA 2NSYA 1IBMB 2C2ZA 2O6LA 3FGNA 3FYUC 4WH0A 3V48A 4FQ8A 3MAAC 2XNKA 1JHPA 1UJNA 3CZMA 3LRXA 1KMCA 3PT5A 4V0ME 3G3EA 4WKOA 3CONA 5E6UB 3PNKA 1X87A 4B48A 4UQPA 2HX1A 4JYBA 3ZWOA 2UV8A 3KQMA 3WXBA 3MGAA 3P27A 2I9PA 3WS7A 5CA1A 5EYPB 1DXYA 5EHGA 4FI3C 2QD5A 1I0LA 3GJ6A 3RHTA 4JLUA 2JFPA 4EG6A 4WZBE 3PIIA 3G8AA 2BONA 3LD9A 4GVLA 4J16C 2Z9CA 2FWBA 4BE4A 5BSGA 4GPEA 4PLPA 1Z5UA 3GLHE 3S70A 3C3JA 4ARCA 3AV3A 4GUAA 4ERNA 3VZRA 3K35A 4K5QA 1NN1A 2ODNA 4I81A 3EW7A 1U31A 4KFSA 2ZI5A 3VNQA 4AKSA 1VPWA 4G0MA 4YUWA 1H5UA 1LFAA 4XSGA 3V8MA 4DLZA 2O1SA 3K92A 1DXHA 2EGUA 4BX8A 5FJJA 2WLSA 3RSOA 5HX7A 1XWFA 2JGDA 3PGA1 5BPFA 3J81A 4YA6A 4V24A 1XTUA 2OGZA 2VEDA 1BYUA 1J0AA 1WVIA 4GWGA 4RGQA 1M6YA 2E4WA 4Z0HO 4BNYA 2KB0A 1RQ2A 4JWKA 4K6CA 3U37A 2HEGA 4NBRA 4PVDA 1GQSA 1XEFA 3A6FA 3DUWA 3Q6NA 1EVZA 4JUBA 4DM4A 4FZJA 3RUPA 5C7IO 3JQAD 4PE5B 1P9NA 3PL5A 3L0CA 3NYQA 5IYZF 1TLTA 3KOWA 4TWIA 3O8QB 1P73A 3EG5A 2WMDA 2XYHA 3E27A 3HEMA 4URZR 4OX9Y 2ID9A 1SEVA 2OG2A 4GYYA 5L3SA 4F06A 4DPLA 1Y4ZA 2PPVA 1A82A 3QEKA 3FMFA 4H7DA 2C4HA 1BEZA 4JEHA 5DIZA 3SY8A 4HZUA 3UV7A 1JTVA 2I62A 1P77A 4NULA 2CZCA 4EPYA 4L8FA 5LQDA 2NYAA 3P9QA 1XXHB 3N7UA 4JITA 3OQIB 3AL2A 2YWHA 4BQFA 1GT6A 1KO4A 1NBOA 3D8NA 4MZDA 3HMKA 3F7NA 5B2ZA 2VRNA 4C04A 1JHUA 3HA5A 3R09A 3VU9A 3RBAA 3DMTC 3HZZA 1ZH6A 3GYGA 1HDRA 2JARA 2W5UA 5HZMA 3FFTA 2XXBA 2OEPA 3JAKB 3DYVA 1USGA 4REQB 5AJTA 1CT9A 1SVKA 4PZ0A 1NJ5A 4U7WA 1JXQA 3K9GA 5JZOA 2I7VA 5JFTA 3VPCA 1LVGA 3HB1A 1K4YA 1P2BA 2JJ1A 2MR6A 5IHXA 3JALB 3ZG6A 1Z36A 2XLBA 5A3RA 4HDSB 4RTKA 2C2YA 4QBGB 1WUIS 4EJMA 3M1AA 4KK4A 3G9ZA 4XYEA 2WNHA 5FWYA 5AVOA 1ZFNA 1A9YA 4HAWA 4PAOA 4XQ0A 1AF7A 5AOCA 4C14A 4YWHA 1XZ8A 5IANA 4J03A 2ZDQA 4RV5A 1YR6A 4Y6GB 3F8TA 1CR6A 3ORSA 4KYIB 4FC6A 1M34E 4DLKA 4LE0A 1OX4A 2BMEA 3PWZA 5TY0A 5SYMA 1T6YA 3NOVA 4P4UA 4H1TA 4WSOA 3WMXA 4NK5A 2I1QA 3SG0A 1EFRD 1QR2A 4AO6A 4OJMX 2NO1A 5CM2Z 1J7KA 2ZPAA 1XMXA 2Q1UA 3UXEA 3UH1A 4B74A 3B3GA 1IZYA 2BD0A 3LK7A 1Z38A 3N8KA 2Y1GA 1IRXA 3MS4A 4PCAA 2AZXA 3I8SA 3X44A 2I99A 3G5AA 1IBRA 2XRFA 2PWZA 2ZM6B 3FMIA 1R0RE 1W87A 1O97D 3PNVA 3L1KA 4YVFA 2O8BB 1A9TA 3JARB 1NQOA 1XPOA 3QVWA 1YRYE 4CR8A 3PK0A 1HOXA 3RR2A 1X1QA 4NU5A 1NG1A 4JN6B 3ZX4A 2EJVA 2AB0A 2K2QB 4BC0A 4BHTA 3RBXA 5KZMB 1FYXA 3LHSA 1KK1A 3EJWA 2WY2D 1RT9A 5KYKA 4CMIB 4LSGA 4PAGA 4XGQA 3UJCA 4BNGA 1Z8DA 4HZGA 2O9JA 3CRMA 3E8SA 2A14A 2FR1A 2XNHA 3ETDA 2WM8A 3KJHA 3NDRA 1E2KA 1DKUA 1U1EA 4IHKA 5IF9A 2VQ6A 4PU0A 2XKKA 1G2IA 2HK6A 4DCNA 4DIBA 4JLDA 2ZRQA 2EWMA 1BXGA 2WAYA 4EJ0A 3JTMA 1YS1X 4H7KA 1PRYA 2PXXA 4XSVA 2IV7A 5CXUA 1GGVA 5JAHA 2VP5A 4QG7A 1AGYA 1JECA 3L7NA 5HFJA 1V2GA 2QVLA 2WK1A 4LIPD 2ZSEA 4LYJA 4R8KA 3SC2B 3SICE 1I10A 3FPAA 3WA7A 5BNTA 3QTBA 1AUPA 4EBFA 1CQWA 4H3VA 3HZHA 1R00A 4R01A 5IWCA 3U31A 4YT2A 1Q0UA 2EKBA 2I6XA 2W93A 2YQ5A 4UNRA 3AIOA 5ECGC 3BVPA 1Z56C 3LWBA 4XD2A 5T4HA 5BWMA 1Y9JA 5HMMA 4QYMA 2GETA 2DBYA 1JPJA 2W0SA 2QTLA 2V6IA 3LXXA 2GN2A 5AW6A 1SBNE 1GNLA 3T5MA 1SO8A 2KSQA 3HY4A 1EP1B 2W2PA 3I3OA 5FL7D 3RVNA 2FPUA 4OAOA 3GAAA 4UQLA 1WO8A 2X4DA 4CFSA 1WBBA 5HGJA 3WGNA 1X7GA 1Y9AA 2PSDA 3KR2A 5H82A 3SQLA 1X80B 4MDYA 1Q21A 3D6FA 3EUAA 4NBTA 2E6KA 3K8QA 4I8DA 2BGUA 4RMHA 3D7KA 2GESA 4QYSA 4R3UC 1CUZA 3HUFA 2RI0A 4MS4B 4H59A 1PT8A 3FWZA 4PNHA 1SVLA 1ZM7A 2WPDA 1GNVA 4BNZA 1YRHA 3C45A 1TQ4A 4PEVA 1WL8A 3OG9A 4JI1B 3R0VA 2R7AA 1PGPA 2VR1A 2DWUA 3KOZA 2HYDA 2QLBA 3EG9A 1PK8A 2WWRA 2H1SA 2Q1WA 4AYTA 1E4EA 1V5FA 4F96A 3KB1A 1R8JA 3U4MA 4PG4A 3QLVA 2OBLA 4MNTA 3O31A 4Q1VA 4RJJA 2BC9A 2OAQ1 5FPYA 3RV4A 1WXGA 3N59A 4LV5B 3LBYA 4N0DA 4DMFA 4DEYA 4I55F 4W5HA 7REQA 2YC4C 3N70A 3NVAA 4BPRA 5CDSA 5BV0A 1HL7A 2PPLA 4JGIA 2MJLA 2UVDA 3H9UA 3ZWPA 5LOVF 3LKBA 5CG1A 2HSJA 2ZRBA 4GNRA 4U00A 4NWIA 4CU2A 2WOOA 2C2OA 5EE5B 1BKYA 4B3RB 2VAPA 3FLEA 2GT1A 5DDIP 4BB9A 2Q1TA 2XMRA 3VNVA 2JCYA 5JMOA 5JI2E 4R5HA 3U7HB 3GAZA 1R0WA 1E8MA 1OCEA 2PNFA 1MRZA 3PS9A 4AJ1A 1OXKB 5ICGA 1GIAA 1XMJA 3HVJA 3EMBA 3PX7A 2G9VA 1KZ4A 1MV8A 1XAJA 3CC8A 1W36D 2GI4A 3IP8A 3NHRA 4EVRA 3CSDA 4WXMA 1RQPA 3UB4A 4BQEA 5KDOA 2Q9CA 3IQHX 2PX0A 5B53A 3RS0A 2PBRA 3VKFA 2WTEA 2NU6B 2ZE6A 3PTZA 4WCDA 5D3MA 3HN6A 5LQSA 2F59A 3V3KA 3NEYA 1TUBB 1X1RA 4FOLA 3V3TA 1LRKA 4L5IA 4WEQA 3UA3A 2QTVB 1D07A 3BB3A 5EQTA 4AF7A 4QNNA 2BKUA 4FEEA 4DAEA 5BV7A 1BCSB 2IQIA 2JKZA 2QL7A 2V7GA 3MCVA 4FDLA 1NW3A 3T12A 1RQNA 4JB2A 1E2IA 4INPA 4QHTA 5CFZA 3ABOB 1SMKA 5HE9A 4EDHA 5FV7A 3PPWA 5FUYA 5I7OA 2O6HA 4IHJB 1FUUA 5TMPA 1K5GA 2XD9A 3B5EA 1KMNA 3QHQA 3VNAA 3EXFB 4EMTA 4D74A 4Q24A 1Q0QA 1X6VA 1JZTA 3QVLA 3EGDA 4PSVA 4IJUA 2HMAA 5GINE 5SV2A 5KSYA 3W5BA 3JQRA 4L74A 3NEAA 4YT5A 4ZMSA 2QSJA 3FYCA 3HA3A 1IN4A 1FFAA 3CGGA 1M1YE 1NE7A 4R1TA 1JWBB 2BDTA 4XQ9A 2ZP1A 1Q7BA 1QSGA 2TMYA 3PL1A 4OTZA 5IS2A 3GT4A 2PCJA 5CLGA 4GL2A 3JRWA 2YWFA 4MV7A 2RKWA 4LDQA 4WBSA 1XMVA 3FB4A 2GVZC 3BRCA 3B3JA 1R9MA 3PWTA 2C57A 4BP8A 2BF7A 2XOEA 2Q5CA 3K53A 4QSHA 3IBTA 5B7GA 4IH9A 1FF9A 5CU7A 4OPMA 5EP2A 1NUTA 2E4ZA 1L5MA 3KD3A 1B23P 1INLA 4N5IX 4OK5A 2ZUTA 1F4VA 2GK6A 2P5UA 4B6QA 1C80A 3X1DA 1PUXA 2PUTA 4Q1DA 5AJYA 4JXZA 3QVOA 1H42A 1YUNA 7ABPA 5IG2A 3OQMA 3DCJA 4EG4A 1YR9A 4Z99A 4KIGA 5LA6B 3V1NA 1EDEA 4XWGA 5I9BA 3FRJA 3EARA 1THMA 2CFOA 1MG0A 1N9GB 1SK8A 1PEKE 2H2DA 2MIIA 3ENNA 4YP7A 5JG7A 3JWEA 1HNZB 2OL4A 3PKJA 3SHVA 2J6CA 4ZTBA 5LD2C 2VYFA 2BFDA 1A2BA 4GR9A 4KQ9A 2VOEA 4X1YA 4R8VA 1ZM4A 3SJAA 1ZHHA 3AKCA 3PNMA 5AD1A 4OMFG 1RRMA 5TC4A 1T8TA 3DTVD 2UZ4A 4Z53A 1A9OA 4H0FA 1WB9A 1UMDA 2HN9A 3ZWBA 4AI6A 3JAWA 3WBFA 1SQFA 1WCIA 3R20A 3W9YA 3DPSA 5GJVC 3G0GA 1SA0B 3CSUA 5DT9A 3HE3A 3KAKA 1U9ZA 4BGIA 3IHKA 3Q15C 4MRNA 2MSWA 3U9TA 2W2OA 4EP1A 1P5RA 2VPYA 1QFZA 4V03A 1TVKA 3IIMA 2BEVB 3LP5A 3T3GA 2D2EA 3TL3A 2B25A 1XCPA 1G5FA 4OI0A 1VKZA 1X19A 2CGEA 2EZ9A 3B5IA 1P4SA 4DBLC 5D3KA 4ERXA 4RVOA 3UCEA 3I9OA 1F0KA 1HBJA 1F8YA 4LZOA 4A36A 2AJBA 1WF6A 1QU2A 1W1IA 3UG6A 3FNHA 3ZY2A 1JSZA 2BFFB 4TXJA 1TZKA 4D45A 3NIDB 2X1LA 4MIKA 5JZMA 1O6CA 2QV0A 2WJAA 1NU6A 4XWKA 1MOQA 1VYTA 2O05A 2YCLA 3EQ8A 5BOVA 2DQKA 3BHIA 2CNKA 5K3DA 1YNSA 2FKNA 1XQ9A 3R3SA 5L9AA 3WGTA 1Z6GA 5KTPA 4LF6B 1UJ5A 2QQEA 4D4KA 4DTIA 3AEKB 4H1WA 1YHYA 1TEXA 4BLTA 3THXA 1C0KA 1JKIA 3OZFA 1QIHA 1Z33A 5JSZB 1DEOA 3MJHA 1U28C 3RFXA 2UZ1A 2AOVA 5ELMA 3B8EA 1T9HA 4YDQA 2GNAA 1TO1E 2YYYA 4YH1A 1B93A 3TLKA 1SHKA 1TM4E 4D46A 1IVSA 2Z2JA 5HIJA 4JJ8A 4LY6A 3AU9A 3HDTA 3ND6A 3C1TA 1G7SA 2HAEA 2Y3IA 3EAGA 3PVSA 4L9WA 2CNNA 3KFVA 5FXMA 3TTWA 4GP6A 4TM7A 4LXTA 5C8VA 3IE0A 2NU8A 3ZNOA 5LVAA 1ZUIA 2JLQA 4S35A 4X65B 3L4EA 4IGFA 2Y1WA 1ISRA 4TTRA 2ODEA 2ZRJA 1X8LA 3EZ9A 3NIWA 2FEKA 1H8EA 2ANBA 4HH3C 2C2XA 3QOFA 4HLQB 4O4JB 4FXPA 5BURA 3CZ9A 4DR7B 4ZVQA 4A8JB 4ZAYA 2YN4A 2QY6A 3GLTA 1OI2A 3OE7A 1R66A 4QDKA 2MSKA 3QKWA 1TD1A 5DLDA 4ZWNA 2HJSA 1RYFA 2YY6A 4CQJA 4RTPA 3HXQA 3DFFA 3JASB 2DTEA 2FPGB 2J3MA 2VLBA 4OP1A 3RUDA 3SS8A 5D5PA 4NS4A 3U5ZB 4NFHA 3A3OA 4TRNA 1C9NA 1G4HA 1V8BA 2X2OA 2J5QA 2X41A 3BB1A 3I2HA 1ISFA 2XJ4A 3D5EA 3PNBA 1FMCA 3EWAA 4HQNA 3IUPA 1E2EA 1QDEA 3UFBA 1T8PA 3B20A 2WJPA 3BJZA 1YRBA 1TL7C 1S7GA 3ABRB 5FULA 1GNPA 2ZAOA 5IABA 3FG9A 2P0EA 4RD4A 1P6QA 5ECYA 2CXTA 3THOA 3D3JA 4KUHA 4L0MA 5H8WA 2UVPB 4F1WA 4OOFA 1EQAA 1XQWA 2BOVA 3ND9A 4M0MA 5BSFA 5KSZA 1DQYA 1Z4OA 2XCQA 2JD1A 2O23A 2P3SA 3DOIA 4I0WB 1T3LA 2LW7A 2BF4A 4ZQEA 4D97A 5KQGA 4KQEA 4B2YA 4V1CA 1E3EA 4GWLA 5CVUA 4YI5A 2JLXA 2G80A 1P81A 1C81A 4TSFD 2QL5A 1VOTA 2A59A 3T5BA 3GNTA 1W59A 1AZWA 2F3PA 2NSDA 2OFXA 5CGZA 3UANA 1CG6A 1SKQA 4JEUA 4QL3A 4BP9A 1OFIA 2WSSD 5EJMA 4L57A 4GXQA 1GPKA 2D3WA 2VP4A 2VS1A 5F1KA 4BRSA 4F6CA 1M75A 4X1IA 2G5TA 1XEWX 3IPLA 1WNFA 4ZVMA 3VSBA 1E7RA 3IOEA 3GJ8A 4RL4A 5I5EA 5IHPA 4E32A 1TZCA 3VR6D 1HE2A 4XE5A 3W3AH 2CWDA 4HT3B 2OZKA 1QC5B 5GIOE 4HXEB 1LDBA 1YB4A 3D3WB 4GYWA 5F5NA 4GLBA 3QTTA 1FSFA 4BLWA 1SOWA 4MKHA 1NQXA 2BHTA 1DQNA 3BMCB 3TJZA 5EGNA 1R8SA 1ZGBA 4OLJA 5JNRA 1GQOA 1UC4B 3HYNA 1IN5A 1LK0A 4KDEA 1WSWA 1UQUA 3RCBA 3MELA 3O9ZA 4LECA 2UUBB 5AXAA 1VCMA 3I01M 4PM4A 4DQKA 1PNVA 5ER9A 5I6DA 1ELOA 1Q7EA 4EEKA 1I6MA 1JU3A 4PLCA 2B2CA 2C20A 1KYQA 4XWYA 2YNMC 3D8HA 1QTRA 4IDQA 5EMHA 4IYJA 3TR5A 3W8EA 4D5GA 5C8YB 4OX9B 1CHNA 1HTTA 2HFKA 2TRSB 4ARAA 1OWNA 4HWTA 1F7VA 2Y0BA 3VZDA 4ALIA 3IAUA 1P2GA 3BXGA 4Q7EA 3TH5A 2EDAA 1WUYA 4EECA 1QGUA 1ZX1A 4H31A 4F4UA 2HWKA 5KX5F 3VNUA 4UEJA 1SAYA 2O2JA 3IJ5A 1UIMA 1E4VA 4TTVA 1E1YA 4O2AA 4UE2A 1O4WA 1T3ZA 5MN5A 1NMXA 3DE4X 2I4OA 3JYNA 5JS7A 3QELB 3R3WA 4MVJH 3BXOA 2CNWD 2WP0A 3N2ZB 4RCYA 3RQIA 2JZNA 3LS2A 1J1UA 4DPKA 3MWGA 4DW8A 1A2OA 2CNDA 3M33A 1VCOA 2J0UB 1EUZA 1BOOA 1NY6A 3IRUA 2GN6A 4QJ5A 1YQQA 3RYFA 3PHJA 1EUDA 3T5DA 1TM5E 1QOPB 1W34A 4G5FA 1T1EA 3RJ5A 4H60A 3CH5A 6REQA 3H4IA 2UUOA 4DSUA 1XLWA 2XOXA 5DRTA 1OWPA 3T5PA 3THYA 1AU9A 3V33A 4RCZA 1IXYA 4D80A 3VPFA 5KQLA 2HM7A 4UUBA 1P7CA 3MT8A 1L8QA 1DDOA 3KE9A 5LMZA 4AZTA 1ZYUA 2RG1A 2Y9PB 1KPGA 3HS3A 1TKCA 1K98A 1I3KA 1XQ6A 1MB4A 2WU0A 3HUUA 2PGOA 4MKXA 4KFUA 2IJGX 3H9EO 2AW5A 3W9SA 2CBGA 4I4TA 4OHUA 3JZAA 3L77A 3P0FA 1P5FA 4IV5A 4YJKA 3VR5H 1PT7A 3I1FA 1ZJYA 3TIVA 4DCJA 4G1BA 1ENYA 1FL9A 2NVBA 4J3FA 1TF2A 2OY0A 4PTYA 4AMUA 4UOZA 4MR9B 4D4HA 1KAEA 1Z5WA 4PLWA 3O74A 4U7JA 3TDNA 5KIAA 3N8NA 1M8PA 3NBXX 1RYBA 2H5IA 3I6YA 5DBOA 4S12A 1I01A 1D2GA 1L9XA 1Y7LA 2IVZA 1WABA 2Q4RA 3NALA 1IY9A 5FNVF 4N65A 1RHMA 3S27A 3TECE 1FLAA 1GL6A 1RLTA 1SZPA 3BULA 1BDBA 1FP7A 1P7PA 2LE0A 4NCHA 4FYXA 5FOWA 4GU5A 1N4DA 1OB2A 1VLVA 1N6LA 4L5YA 4P81A 4YJ2F 5A7GA 3VUEA 1AQUA 1E3TA 1V0JA 4MPRA 2GGSA 3E82A 1E3DA 1NI3A 2IY9A 1ZN9A 2OOKA 3L84A 5KNCA 1HE3A 1D4OA 2D1TA 3MGGA 1XN1A 1OT5A 3VAAA 3BF7A 3P2MA 5DBIA 4UCFA 1CX9B 3H4VA 2ECKA 1NPYA 4OM7A 4KV7A 2VT7A 1LLFA 2B8EA 2INGX 2O3SA 5CNMA 5DI3A 3TSYA 5HIKA 3EFHA 1YVPA 3CEAA 2QVBA 4IKEA 1SG0A 5AM0A 3OSUA 3WGHA 2RJOA 3WLHA 3L6CA 4RABA 3H7AA 1F7UA 4S24A 1Y8AA 1KOJA 4EHFA 2IUSA 4UARA 3LQQA 4HDNB 5L4NA 3W0LB 3RS4A 4EX6A 4OYLA 4HB0A 1GPJA 1FZQA 4LNHA 2IYVA 1C1HA 4P80A 5BVGA 3RTGA 2DBRA 1H3FA 4GHWA 1OROA 1KMHA 3M1YA 4FZ5A 4MRMA 1F4LA 1MABA 3UTDA 1W2HA 3U7GA 3N0VA 5G0WA 1EJBA 1N5KA 5GWXA 4DA8A 2J6IA 1OJLA 1CFZA 4PN3A 4N82A 2QUZA 3B13B 3BE6A 2Q6VA 4P4GA 1KR2A 1OAOA 1X7ZB 3KR0A 5LUAA 5CEFA 5KNDH 4ND8A 3CV3A 4U7TB 1S8AA 4I5DA 3EEOA 3TLYA 1L7QA 4JLVA 4FBMA 1LWOA 2FRVA 2D2VA 3IVGA 3CX3A 4J94A 3N0RA 4JR2A 5FRDA 1AKQA 5CYPA 4HQKA 2ECOA 2XPCA 1GZDA 2HU8A 4BLQA 3GEEA 3LC7O 2GASA 1N1GA 4CFYA 2WT4A 1ATIA 3HFGA 1H4QA 1KBQA 2E4YA 2PL1A 2B6NA 2PV0A 3AF0A 4EJSB 1AXEA 1JLKA 2HLDA 1M2NA 1SB9A 3IUNA 5D86A 1YZ3A 2R2AA 1ZI8A 3ICQB 1NYQA 4JU8A 3H17A 3LCCA 2F3TA 4ZT3A 3QJ5A 2FB9A 2GTPA 5KTNA 1U1DA 1J24A 2CUNA 2YL2A 3A4LA 1K5DA 3AHHA 3EZ7A 2OCLA 3PDJA 1EK6A 3KWLA 1E9CA 1O95D 1UK9A 2HMTA 4NONA 4RY2A 4AZ0B 3S8EA 4TZ0A 3UFXB 3HLTA 2P90A 4LSZA 5EERA 1C3JA 4V39A 1O94A 2L19A 3EDQA 4LZNA 1D2HA 1BDJA 1PJZA 2D0IA 4MWSA 2XB8A 3DE1X 3AXTA 3DAYA 1C0PA 3GUYA 3NJ8A 4R1MA 4EKGA 5HRUA 1FFDA 2P2GA 3E05A 4IILA 1P1KA 1FLVA 4UHFA 2IYSA 1F1BA 4S0XA 1Q92A 2X19A 4EPWA 5ELLA 4ZYLA 3ADCA 3DD1A 4M9QA 3SDBA 5M04A 1II9A 2ERCA 4H7JA 1M2WA 4W8GA 1BE1A 2PUGA 1D4AA 3UAGA 1ODCA 5ECDA 1SJ9A 1B8OA 3ELUA 3C1UA 1WXXA 4TQ9A 4UNPA 3SHQA 5LLDA 2O2DA 3CO0S 4MUJA 2IUTA 5DHQA 5B4UA 2OECA 3EGCA 3NEPX 2CE2X 1QVWA 3KZMA 2R97A 3QKTA 1Z9BA 1W0KA 4KXUA 1XL1A 4N8DA 1OBHA 1JAYA 2B7LA 4WLEA 5BN4A 1JA1A 1SCNE 3IAXA 3MMZA 2FV8A 3B7GA 2JIMA 4JP2A 1DAGA 1DIRA 1G4AE 3IA7A 1XVVA 2AFIE 3BL8A 1U2SA 3G89A 4HEA6 5FA5A 5HDQA 2VJCA 3VR4H 3WK9A 4KR6A 2DLNA 5HUHA 2B3TA 2RGEA 3QXGA 3A1NA 3UO8B 1K1EA 1ZUWA 1KI6A 3V1UA 4EBBA 1K4MA 4CLEA 5CA1B 1YZKA 3KL2A 5TJ9A 3SZMA 4AQ7A 4JMPA 4M3NA 2UYOA 2RBEA 3MVEA 4RMGA 1DAKA 2XMQA 5T8KA 3ZV4A 1D2NA 3FTPA 4OKIA 2X2PA 2R7MA 2IH5A 4R5MA 2GPNA 3GEBA 3HJBA 3GT7A 2BKEA 1U2GC 3C8DA 3TRJA 2DSTA 2ZJBA 1UPCA 1EHIA 4QQNA 2O8FA 3EVAA 2QP9X 3FLAA 4X24A 4IRMA 2DUWA 5ALXA 3QUSA 4MRVA 2VP2A 3QLTA 1Y3BE 1T5TA 2H9AA 4WERA 3TB4A 5ES4B 3FOFC 1F60A 2ORYA 3P0HA 1V9SA 3COYA 3MOIA 1C3VA 1R5OA 1EJ2A 2BI4A 2H48A 4GBJA 4F56A 1YZHA 3TTYA 3WFZA 3N2KA 5EVCA 3D8TA 3NTVA 2Z8YA 3OCUA 3WL4A 4B4DA 4G09A 1Z7GA 3LUGA 3T4PA 5D01A 3V7WA 3WL3A 4JL8A 2BHNA 4YWJA 3AOEA 3ZGYA 4AJHA 4BECA 1T5IA 4B81A 1PNTA 1ESEA 3EA5A 2YMLA 1ZEMA 3WGUA 5GONB 5TGZA 5DM60 1BVYF 4DDVA 3KELA 2WE8A 2V3WA 1P0FA 2RHHA 2XMGA 4KWHA 4RS4A 3VZSA 2CFSA 1C3EA 4W8OA 4HVCA 3JD0A 2YJNA 1G8PA 1E58A 2GDJA 3Q40A 5L3SB 3IDSA 4LYYA 5I7WA 2Q5HA 2FAXA 4BUZA 1NNEA 5CT6A 2XTZA 3O8NA 4HZUB 4BL5A 2NTNA 1KQFA 4Y2JA 3V4LA 4QXOA 4KFCA 4WBNA 1D0IA 3Q2KA 5H5JA 2DWPA 2NXCA 4OKNA 4RZQA 3BWCA 2CYAA 1RXUA 1X7YB 3A9WA 4JVMA 4PYKA 3AGPA 4B2PA 2I3AA 1KA9H 4D9HA 3WMWA 3PHBE 2B34A 3NNSA 3WRYA 1EFVB 1T34A 1VJGA 5HIAA 1XZKA 4DXHA 4BIIA 3K1TA 4D4LA 3K70B 2Z08A 2NU9A 4K9DA 3A31A 3WA6A 4LJAA 4YP1A 2I7DA 1XIVA 2C31A 2PL3A 4Q05A 3GVCA 1LEHA 2I4NA 2DULA 1N75A 3ER9A 3G2MA 4C2TA 3M5PA 4G0WA 1XXLA 2ZZMA 4WNIA 1H6AA 3UYKA 2J09A 4Y2XA 4JL6A 1LH0A 3MGBA 2W6ID 3QKSA 4ZQFA 1N6NA 4B6GA 2Q3FA 4WA8A 1LTQA 2H8GA 3C70A 3MNFA 4CM4A 1VYVA 1XKQA 1IJBA 4Z6KA 1WE2A 1ZH2A 1TJNA 3PG5A 1A8QA 1A76A 3H1GA 3LKDA 2ZQYA 4KOEC 1DZ3A 3LT4A 4GRAA 3L7OA 4UAUA 2WB2A 3PITA 1QNFA 1Q12A 2ZRFA 2MINA 2Y93A 3CEJA 3HPRA 4PBSA 3HY6A 2IH4A 1CB7A 4MAAA 4CHTA 9ATCA 5FBQB 4XDYA 5T3UA 2NO9A 4ETNA 1SULA 1H23A 1VI2A 3NDJA 3WKCA 1A1SA 4DIEA 5AQ1A 1QH8A 1YZLA 3KJEA 2XECA 4FPXA 2QW1A 5BW5A 2OR3A 3EEFA 3EOAI 4RX1A 2JIQA 3QLVC 4KXXA 4OB8A 4RD3A 3C4VA 4BZQA 2IXTA 1LSUA 1KFBB 1KI8A 4ZREA 1V5WA 3LIPA 4LNAA 1PZEA 1WRBA 2VNHA 1RZRA 3MJRA 2IP1A 3C6MA 3FHTA 2DPXA 5HWSA 4UMDA 4TL6A 4BV2A 3IT2A 1T6ZA 2FUG1 2WWGA 3R3XA 3FWKA 3N8DA 3VX4A 4EKIA 3DB2A 4LHVA 1EPUA 2ACWA 3Q9SA 4DRXB 1ADBA 1U4NA 3IR5A 1AB5A 4MVYA 5IMSA 2A0WA 3V2HA 4LDRA 2ZJ6A 4FGKA 4RTRA 1M73E 1USWA 3NCHA 4FDUA 4MLCA 4D0LB 1UKZA 4CTJA 4Z3OA 3PXAA 4EG3A 1LNZA 1JNYA 1VCIA 5IMBA 1XP8A 2H1RA 2X8AA 3EIFA 2ZWAA 1H6CA 4D5EA 2XIJA 3C39A 1BXGB 2R6DA 3H0EA 4GEKA 4KOAA 5E9QA 3TIIA 2KJQA 2ENWA 4XYBA 3K2EA 3TJMA 4BFTA 3GIWA 5DOZA 2VJAA 3I64A 1J49A 2C83A 3EB9A 3QU9A 4R3NA 1L7NA 5JS8A 1KL7A 2XT6A 5ALRA 3UM9A 5BPHA 4UM9B 2X1VA 4RVGA 2IPXA 1MV5A 3LT1A 3QMWA 5E9JA 2H31A 3BRQA 3QITA 1XTPA 4HJXA 1Z12A 4D0RA 1GFZA 3H97A 1C9JA 5HZHA 1I30A 2F1RA 3I6MA 5B1EA 3EK2A 3HBMA 2D4HA 5COAA 1KRWA 5DYYA 2A30A 2NAPA 5H3LA 5LQCA 2O2GA 2QE7D 1ONPA 1U3UA 4NH0A 4IQ8A 4N1AA 4UW9A 5FQOA 4YN3A 2AX4A 2V6FA 3HJUA 5F76A 3VNRA 5LBTA 2X2EA 3MGCA 3ODGA 2H63A 2E3JA 5G0VA 5TMBA 3ZKWA 3LZCA 2QVGA 3ACCA 1HKHA 1ZMBA 3NYWA 1QRRA 3NAZA 3QLJA 4YPVA 1SOAA 2Q62A 2KLHA 3V6MA 2Y1FA 1O2DA 4F9EA 2YIVX 3HO6A 1YJCA 1J9ZA 3ZE7A 3I2FA 3M49A 1T0PA 4G37A 4H9GA 4YQFA 2RGXA 1E4OA 1JE1A 2GEDA 1SC9A 2D62A 2V5AA 3C74A 2IITA 3EG9B 1OTHA 2B4RO 3DT6A 3RRNA 2R9VA 1J2JA 4KNWA 4QTXA 1E4EB 1DIHA 3AHCA 4TN5A 4J0QA 3QBJA 4U9HS 1Z17A 3EPPA 4IEEA 2HWUA 1ETHA 2AOTA 4BFXA 2VDJA 1SUWA 1WVMA 4JFAA 1FRFS 2OVBA 5FLKA 3X0DA 3PFHA 4AIRA 7REQB 5AHWA 1KFJB 4YAUA 3K30A 4TSRA 4UFNA 1ZCAA 3EPHA 1UMKA 1OZ0A 3OE5A 4WTOA 1S3IA 1WP9A 1SXJA 2OYRA 3ZIDA 5E4FA 1J00A 3BH7A 4H16A 2V6GA 1P91A 2W71A 4RBNA 1GAQA 2CCGA 3OZ7A 3PUZA 4Q1EA 2ZM5A 1FLNA 1PFWA 3CQ9A 3PFNA 3L7MA 4HVAA 5JY1A 2G3YA 4R7ZA 3HJHA 1ZNWA 5JIBA 4CL3A 2Q4OA 4MVJP 2EQBA 4HS4A 4M1SA 5FUBA 1PEAA 2YQ4A 3WO0A 2SICE 4RM2A 2I91A 2C07A 2FJPA 1W0JA 1VRCA 4EGAA 3CJRA 3K0BA 4L85A 3WLQA 1KO1A 1LLDA 1I6WA 3AUXA 3CWZA 3OAAA 3WX0A 1XKLA 3HDQA 4GOOD 1UOEA 1I3MA 3EDRA 5AW9A 4AZVA 2RHBA 3H6KA 3M7IA 4MR8A 1GNTA 4GBGA 2IYPA 2GLXA 5LL6P 4RAQA 2DOKA 2WE7A 2JIRA 3IUQA 4X20A 5T4EA 1J0DA 2JLRA 3FF4A 4EMBA 1IBKB 1GDDA 3T9EA 2QGFA 2RGRA 1ADYA 3AIIA 1M1ZA 3ITDA 4FE7A 5DYIA 3GVHA 3QV2A 2AI2A 4QBKA 5TQ2A 3RS8A 1IATA 4A73A 4CLRB 3W5UA 4DDMA 1GYPA 5KYYA 5D7NA 2HU7A 4KDRA 4BQOA 1W4LA 3HABA 4HPJB 1K7CA 5BUCA 4ZOQI 2WF8A 4ZVVA 3L3BA 4HWOA 2BAGA 3Q88A 1ZCZA 4G1VA 2O50A 4ZDJA 4CLHA 2GZSA 5ALDA 4A0QA 1ONNA 4DNPA 2O7VA 4FWIB 1ENPA 4BDTA 2DKOA 1D1PA 2M98A 3DDHA 5F1YA 3PDIB 2HCJB 3WZLA 5C7OO 4WCFA 5B7PA 3UXYA 1NNUA 3A1TA 1QAMA 5JH7B 1EWTA 2FN8A 1IZ9A 1G6Q1 4O5OA 5DCLA 1JXMA 1IIBA 1K06A 2V7WA 4IKPA 2ALJA 4AN1A 2C7OA 3SCZA 1IFXA 1O4VA 2WD7B 2JJ2D 2YWRA 3P0JA 4X44A 4D9MA 2WHPA 5ESWA 2ET6A 2XUIA 1K3UB 1RZ3A 3QF7A 4IMRA 3D8UA 3TNFA 1M9NA 2FMHA 5KYWB 5F2EA 1JW9B 1KI3A 2ICAA 1AC5A 3AERA 4JKIA 2NUPA 3KP1A 3RRXA 4BLRA 2AK3A 4KQ6A 4L4SA 2WKPA 4LKRA 2RAFA 1XZDA 1EK0A 5K0TA 1YA6A 4TT3A 2H2HA 3GLRA 5J5VA 3ZE8A 3DKIA 4RU1A 4BX0A 4C4OA 4BCBA 1N2OA 3DHNA 5CLLA 5EQDA 5GOZA 3RYCA 2QTRA 2YXLA 2B0JA 2ZOSA 4IIUA 4Y2GA 2ZSBA 3HQ4O 3ZX5A 1TJPB 2B5WA 3ED1A 1P0MA 4XM2A 2P79A 5AJZA 2FJ0A 3QYAA 3VPXA 2GRAA 5JVDF 1LDNA 1SHZA 4AG3A 5IVPA 1X15A 2ABWA 2OV8A 2QI9C 2TSYB 2VHVA 2VIIA 4H7IA 3WRWA 1P39A 4GP7A 1T8WA 3RASA 5B30A 2JHAA 3ND5A 1E4YA 1UJ4A 2EWVA 2REOA 3RFFA 4GX1A 2BFDB 3CZAA 2C9OA 4X1YB 3DE2X 2AS0A 4WZAE 4UXIA 2QJTA 3EA0A 3LT2A 1M1XB 1AV7A 3C3EA 3P96A 3BN3A 1NP3A 1MX3A 1P2VA 3ZCVA 4CUZA 1Y33E 4M83A 1Y8QB 2PUWA 3PNSA 1MZPA 1UMDB 1H2RS 3JAWB 3KXIA 4LOJA 3IPXA 1WCIB 1YD7A 3SQNA 1RAAA 3ZH2A 3W77A 4ZO4A 2ZKLA 3TG2A 4ZAFA 1YFKA 4Q3BA 2VP3A 1V16A 5I8PA 3F3KA 2GAFA 4P92A 1GPAA 4KLAA 3IEXA 3KEFA 1LC0A 3ND7A 3O2NA 2YYAA 3HC7A 3OFVA 4JL5A 1O9GA 3EW9A 5LZ5A 4CRWB 2FPSA 4U2GA 4D8VA 3VSDA 2R60A 4QAQA 4MMYB 1YFJA 1CUYA 3FUCA 1OLOA 4M0UA 4NZOA 1RKQA 3EF0A 5JLJA 1V4VA 2GQ0A 1SHLA 4IEIA 1NULA 1CJKC 4TXMA 1FU4A 4G1EB 2LR0A 2YJZA 2W4IA 4HZIA 1OV6A 1P45A 3G02A 3H9BA 1MMFB 1NOIA 1S96A 3N0WA 1X1TA 2MMCA 1Z15A 4PZZA 4F72A 2QLMA 5KUTA 3ES9A 8ADHA 3ZY5A 1WY7A 3GRKA 2FUCA 2Z9BA 1AUVA 3I04A 3FZNA 3MD9A 5LQAA 4U7DA 3GLIE 2Q3BA 3CU5A 2ZIEA 3TTVA 3DC2A 3GVIA 1SUDA 2XV1A 4J7UA 4Z3KA 3THXB 2JGEA 1TOAA 3WHIA 1ZD4A 3AXSA 5EN4A 4RVNA 3ZQ4A 3LL4A 1M6VB 5FAKA 1RRCA 1BU5A 2P2LA 4XIGS 1OI3A 2PYDA 2YV3A 2V6BA 1FTNA 5K8JB 3LBNA 2Q3CA 3QUTA 2X9GA 3V4PB 1RKBA 5HF8A 1TEVA 3RQSA 1ULBA 1PX2A 2GDZA 3N87A 4ABYA 5EZ6B 2OYSA 3Q7QA 3EMKA 1VL1A 4WK0B 2JFUA 2O2EA 2NU8B 2QG6A 2XGGA 1EYZA 2CSUA 3DV0A 3O5AA 5H59A 5CXQA 3U5TA 1W7AA 2ARKA 3FGPA 3O84A 4BNKA 1PQYA 5KREA 1BN6A 4UM7A 5DYTA 2QUKA 5F73A 4FFVA 4MCJA 4BWGA 1QB8A 4MVXA 1DQRA 1H0SA 2ORIA 2CXNA 3ACBA 3H1PA 3JQFC 1OPRA 4MYRA 4XJSA 5FBRB 4C05A 3A05A 3UMSA 2Y76A 4KREA 2BT4A 3OM8A 3PGVA 4HKTA 3ZV3A 2QRUA 1V7PC 3KTFA 2BP7A 4Q7MB 4CMBA 1QIEA 2FWPA 4ENQA 9MHTA 1IOLA 2PIDA 5E1DA 3FGZA 1QGDA 5DFAA 2FMFA 2FRDC 4NL4H 3ZK7A 4BP3A 3BB4A 3EPKA 4J2TA 2D5IA 5HM6A 3IILA 4NBSA 4RMNA 4K9KA 1UKYA 4TGLA 3K09C 1PZMA 721PA 4CKWA 4O8CA 5BQ5A 1KAHA 3AVPA 2H9IA 2NAFA 5IBRA 1M6WA 1A77A 3OTQA 5F7JA 2PXAA 2HDWA 4J0DA 3L0IB 3U4QA 4LN1A 2WIFA 1XX6A 1GPH1 3B2NA 4KWCA 3ZE2B 1G64A 2ESRA 2R62A 3VTZA 5B1HA 1R0LA 4TKLA 3BGVA 2YCBA 4X3CA 2IF2A 2E4VA 4HWPA 4RWZA 2YWXA 2V5VA 3E7PA 2IE0A 1C3LA 2RIRA 3CLSD 3QBDA 3WLTA 1D7OA 2AC2A 2BKLA 1E1MA 2A1TS