2D5IA

The crystal structure of azor (azo reductase) from escherichia coli
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
200
structure length
200
Chain Sequence
SKVLVLKSSILAGYSQSNQLSDYFVEQWREKHSADEITVRDLAANPIPVLDGELVGALRPSDAPLTPRQQEALALSDELIAELKAHDVIVIAAPMYNFNISTQLKNYFDLVARAGVTFRYTENGPEGLVTGKKAIVITSRGGIHKDGPTDLVTPYLSTFLGFIGITDVKFVFAEGIAYGPEMAAKAQSDAKAAIDSIVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Azo Reductase
publication title Three-dimensional structure of AzoR from Escherichia coli. An oxidereductase conserved in microorganisms
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 72
structure length 200
sequence length 200
ec nomenclature ec 1.7.1.6: Azobenzene reductase.
pdb deposition date 2005-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02525 Flavodoxin_2 Flavodoxin-like fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2d5iA00
3K20A 3JSXA 2QMYA 4QOJA 1ZX1A 1AKRA 1YDGA 4HS4A 3S2YA 1E5DA 2QMZA 3NFRA 4QOEA 3TE7A 4LTMA 2FZVA 1SG0A 1J9GA 3NHRA 4LAFA 1RLIA 1XYVA 3ZHOA 1ZWKA 4GQIA 2X2PA 4PU0A 2OHJA 5FX2A 1AKUA 2D5IA 3ES9A 1TIKA 4U7HA 4GR9A 5LBTA 2XOEA 3GAMA 3NLLA 5LMCA 2MTBA 3W77A 3B6JA 3OJXA 4BMOB 4ZVKA 1T5BA 3W79A 2RG1A 5B3LA 3O2NA 5EAIA 2W5UA 2Q9UA 1WSWA 4CETA 1J8QA 2FCRA 4N82A 4OXXA 4R81A 3KAPA 1TLLA 4FGJA 1FUEA 1T0IA 1DX9A 4ESEA 3L9WA 5B3KA 1VMEA 3OX3A 1OBVA 3NHPA 2HNBA 5NULA 4Y9RA 1YKGA 4NLLA 1XYYA 1WSBA 1DXOA 2Z98A 4YAUA 1AMOA 3SVLA 1FLDA 3U7RA 1AKTA 4C0WA 1QBGA 1J9ZA 3ESYA 2BMVA 4ICIA 2OYSA 5JROA 1AG9A 2FAXA 1FX1A 3F6RA 2FDXA 1ZWLA 4NULA 3N39C 3W78A 3RPEA 2V9CA 1YCGA 3NHJA 2MT9A 4N65A 1KBQA 2OHIA 3HLYA 3KLBA 3TZBA 2N1MA 1CZLA 3D7NA 1JA0A 2F1OA 1BU5A 1CZUA 4Y9UA 2QX4A 2MOKA 1YCFA 3OX1A 4QOGA 4J8PA 1QRDA 5FUQA 5LJIA 1AZLA 1D4AA 3L9XA 3HR4A 2QX6A 4F8YA 3OWHA 5F51A 4YAWA 4XDHA 4LTNA 3TEMA 2M6RA 4YQEA 3R6WA 3GFSA 4GI5A 1CZOA 3NHSA 1AHNA 4DY4A 3B6IA 3NHFA 4LTDA 1QR2A 1RCFA 3GFQA 1H66A 1J9EA 5F4BA 2ZKIA 2HNAA 3O73A 4DILA 3F6SA 2Z9BA 2XODA 3KEGA 3QE2A 3ESZA 3B6KA 3LT5A 2QX8A 2BN4A 3FJOA 3NHLA 1OFVA 4ZVNA 2QWXA 3B6MA 1NNI1 4QOIA 3N3AC 2QR2A 2KLBA 2HPVA 4Y7CA 3GFRA 1CZNA 2FVXA 4LA4A 4PTZA 1CZKA 2FZ5A 1I1OA 2KQUA 3EYWA 2M6SA 4BMPB 3F90A 4N9QA 2FOXA 6NULA 2MWMA 4ZVLA 3OWXA 2Q62A 1FLAA 5EMNA 1KBOA 1F4PA 1JA1A 2R96A 5NLLA 3FVWA 2BF4A 1QHEA 3HA2A 1C7EA 4YAOA 4C14A 4U7GA 3UXHA 1CZHA 3QFRA 4C0XA 1AKQA 3EDOA 3LCMA 2FLVA 1XI2A 5ULLA 1AKVA 1SQSA 2FX2A 5LJLA 4U7FA 4HEQA 3F2VA 2WC1A 3K1YA 3ESXA 1RTTA 1YOBA 2AMJA 1YCHA 2V5UA 3FX2A 1XT6A 2GSWA 1X77A 4FGKA 1RLJA 4D02A 3OJWA 4H2DA 1OBOA 1C7FA 4CF6A 1D03A 3W7AA 5LVAA 3NHKA 4QOFA 4YAFA 3FW1A 1AKWA 1YRHA 1B1CA 5BUCA 5FA6A 1DXQA 3P0RA 4S24A 1V4BA 3OVMA 4DIKA 3NHYA 3N3BC 4PTYA 2A5LA 3OX2A 4XDGA 4YALA 2X2OA 4QODA 4QOHA 3NHUA 1FTGA 2ARKA 1GG5A 5LBUA 2V5VA 3G5MA 5EA2A 3NHWA 2BPOA 2B3DA 4FX2A 1FVXA 2R97A 5A4KA 1CZRA 4H6PA 4ZVMA 3U7IA 1BVYF 2Z9CA 5F12A 5TGZA 3KAQA 4FGLA 4C76A 5LLDA 1FLNA 1FLVA 2QX9A 3QFCA 3UXEA 2BZSA 1D04A 1H69A 3FNIA 2OHHA 2Z9DA 4M0CA
chains in the Genus database with same CATH superfamily
1U2EA 4K40A 5D3KA 4OB8A 2AYYA 3HEBA 4R1OA 4KE7A 1CRLA 4MUJA 1Y98A 2MSDB 4IV0A 4ENVA 1UBTS 2ZAYA 2B1IA 2NGRA 4FILA 1Z5NA 1SU4A 3GW8A 3DEIA 1MW8X 3HY3A 5K0EA 2C4HA 5TE9A 3HJCA 1RIIA 5KTNA 2FX3A 4ZO6A 3GO4A 3VR2A 1QV6A 4C7KA 4F2PA 4LVNA 1JR4A 4L22A 3ZVNA 2VHYA 1NPTO 5BQOA 3WOVA 3TTWA 3M81A 1KY2A 4MVYA 4KBGA 4RCVA 3T38A 2CCGA 1P4GA 2WP8J 2CJWA 4RNCA 5ETJA 5JJIA 2B92A 2L18A 4ND7A 5J58A 1IDOA 1H9BA 2IEIA 4GKVA 4I50A 4RMNA 2QG6A 2R4QA 1UM9A 1YONA 3OU6A 1J8YF 2ZETA 3QVJA 4R16A 1T3GA 1Y1PA 4RLHA 1NJ2A 3N05A 4XCXA 1SPXA 3RS2A 4FC6A 2JC3A 5FTJA 3I4CA 3CONA 3CA8A 4EY5A 4YPOA 1L6RA 3I3OA 5HS6A 1FFHA 3I61A 4B3TB 4HAZA 4OF4A 3PUHA 1O9BA 1QG6A 3PR3A 1C7QA 3Q9NA 4Z3OA 1OAOA 1T29A 1EP9A 1U2GA 2VSQA 3OQJA 4LHSA 1T15A 4ZAZA 3X1WA 5BT8A 4ZV4A 3FNEA 4YLYA 3OAAD 2GNOA 1GADO 3C24A 1EWKA 1VKOA 3FVQA 3IDFA 3MTQA 4N3BA 4DJTA 2GBLA 1Y89A 4RDIA 3UA4A 1EUQA 4TRRA 3C3EA 3QLUA 3D6NB 3LHDA 3AM5A 1QGOA 3TW6A 3QEKA 1CQZA 1HSZA 3O3MB 1BCRB 3QX7A 3DL4A 5EC8A 1RQ2A 1VGQA 2AEJA 3RU7A 2VRBA 1LF0A 3BMCA 4LOKA 1A1SA 1L4YA 1ORHA 4TMFA 3ZK9A 4D3XA 5IUJC 2C2KA 4EYQA 2H07A 1DUSA 3RRMA 3WWPA 4EITA 4YJ2A 2O8EB 3JCZA 2BSXA 2WAMA 2Z5VA 3A1CA 4XRRA 2I2AA 5LBTA 3FUUA 5GPBA 3WL6A 3GAMA 4TYMA 1G19A 3DFKA 4BFVA 4EA7A 4TKZA 2YXPX 1N78A 3DTVA 3S8YA 3ZHSA 5KVVA 2NV6A 4CIDA 1L5YA 1REQB 3IYLW 4JYAB 4ZCMA 2DHRA 3UB3A 3K1JA 3EVFA 5G53C 1VA4A 3B6JA 4QRHA 4ZGGA 4BMOB 1UPXA 2ZYWX 3K73O 5CEJA 5IBCA 2ZDHA 3QEMB 4LE2A 5C0OE 4BEJA 4EI2A 3KTFA 4REOA 3HYRA 3VYTB 4RPJA 1VE5A 4IO1A 1PFUA 4WLOA 4DV5B 3LKDA 4G1BA 3ZQKA 3LI2A 1TO1E 3ZHBA 1JALA 1TYAE 1VJCA 4K9QA 4IFTA 2XMQA 4KTTE 5A3VA 2FH5B 2OCDA 3Q88A 3OIYA 4XB6B 1X9GA 5A5EA 3TVDA 1DP4A 5A3JA 2C4UA 2FCRA 1JIJA 3ZHCA 5KHLB 3HU5A 2BF7A 5JCJD 1Q91A 2FUEA 1HWYA 2YFQA 3BXXA 4NYMQ 3T5CA 2WYWA 3VU0A 3D0RA 4HYEA 4JLSA 3V1UA 4K1XA 4I5GA 2DAPA 3KQSA 2BR5A 4RIGA 2RKBA 4UHCA 4BFUA 5C9ZA 2GCOB 3EQ2A 1DAGA 1Z4JA 1Z6QA 4KLCA 3QNWA 4R8RA 4V0KA 4EKNB 1TI7A 1R0XA 4JBNA 3B1FA 3QKRB 2DTXA 3P9CA 5ITSA 1OASA 2X19A 4IIYA 5J1TB 4G5FA 1FSPA 1XE3A 3B9RA 3RSOA 1P1BA 1DQRA 1N6HA 4B6EA 3THYB 4KXVA 2XIQA 3J7TA 3QA3E 1WXIA 5KSZA 4J1NA 4DQXA 4RFLA 1MABB 3LL4A 1MORA 1A7UA 1Z0SA 5B55A 3CXRA 4QT4A 4UBNA 4R51A 1P7YA 1TKRA 5DNWA 1IPHA 3U3DA 1KFKB 3OZBA 1AMOA 3PA8A 1JHMA 1WSAA 4UBJA 4DDUA 4ND2A 2GD0A 1L5HA 5JTUA 3QVUA 4JC4A 1NQXA 1M6HA 4J90A 4M8LA 2PLAA 4IDHA 5I47A 1XHLA 2UUPA 4MLDA 5DM70 1GDTA 1L5RA 1N1MA 3K0BA 1WCWA 1YB4A 3IR5A 4WVLA 4IDGA 3GLGE 1H6BA 4CIXA 1EJ2A 2I4LA 4K9MA 2HX1A 2H4XA 2ID8A 1NOKA 1VIYA 4HATA 4XASA 4DC1A 2DBVO 4W6ZA 2PN1A 4LX8A 1BX0A 4EPXA 3PKZA 3ZS9A 2FSHA 4POOA 3KLMX 1LY1A 1MDFA 1F48A 2FDXA 5JWOA 1E3DA 2C07A 1HORA 2G0AA 3HWX1 3MWEB 4NULA 2O59A 2RGUA 1CYEA 2V9CA 2NSHA 3UAOA 4AUMA 3EFOA 1X1EA 3IRUA 5FL7D 2VQSA 3MWLA 3LT1A 5AXAA 2XKKA 1E61A 5JHGB 1RPZA 4D0SA 3GROA 5BSHA 2ZIUB 4JC5A 1CJUC 5D86A 3KPVA 4EFDA 2JAUA 4KO2S 1LBEA 1O8BA 3H8VA 3X1YA 4WBNF 2AEEA 4C6HA 3CWCA 1VLVA 4V02A 3RROA 5KYXA 4ANFA 3I01A 1ADBA 2AWNA 5CX4A 4MX8A 3PR2B 2JG3A 1P0CA 5KVQA 1JDZA 2W93A 1MNAA 2NX2A 3UPDA 1K89A 1SKUA 4YACA 3DXZA 1G7TA 1BWRA 1OE0A 1UKYA 2TRSB 3KOOA 5ALPA 5B37A 4J07A 4GW3A 5ENDA 4M8SA 1OA0A 3M49A 3FPGA 4I1PA 3KR9A 2AR7A 4YJ3A 1R4ZA 2I7DA 2C4WA 1U0RA 2MJLA 1B6SA 5DLYA 4E2ZA 1W36B 4NMLA 3SN6A 1NR1A 1JZTA 1UMKA 2H3EA 3NT2A 4XPIB 3RR2A 3DE7X 1ZCZA 2QQEA 2HU7A 2VLIA 3M6VA 5MN5A 1Z7YA 3KWLA 3PHLA 2HU8A 1I10A 3M1IA 4KG7A 4QYSA 2O1XA 4F6CA 1M6VB 1JLLB 4ZMSA 5CEFA 3D3NA 4ONEA 3ZIAD 1O96A 1FMFA 1ZI8A 5EJ8A 5KREA 2IDJA 3AHHA 5LWQA 1SKAA 1RI2A 2AI1A 2IZ7A 4ZT4A 1Y5LA 2NO6A 2G4CA 3PUIA 2V97A 5EXDA 1FTNA 2CHVA 1BVRA 1ZGGA 3H2GA 4BEBA 4XWTA 3R5KA 4ZT7A 2OCLA 1OXTA 4HAVA 5TQ2A 3H1BA 1OWLA 3IVGA 4MVJF 5DMXA 5DW0A 3T7SA 3W04A 2O8FB 3E9EA 1HDXA 2Q9CA 4RLFA 4I5DA 2XPCA 2ZRKA 2BKXA 3EGXB 4INOA 1JZQA 3H97A 3IA7A 3MWKA 1R8YA 3SJUA 1H2YA 4DLRA 1O6GA 3R6WA 5KOIA 2CYAA 2I6SA 2QLMA 3CRNA 1Q3HA 1J8MF 5MFPA 2O2SA 2ZU6A 3RVRA 3OUZA 1E0SA 1J90A 5HRCA 1UMBA 4MULA 3C48A 2O8CB 3NT4A 3OD1A 1E9EA 4NMXB 5CNJA 5F1OA 1DJNA 2VNHA 3WSTA 4E5NA 4BJ3A 4P7BA 3HGQA 3PT5A 4PFKA 6GPBA 4GMKA 3F6SA 3K6JA 4L7VA 2YVQA 4RIHA 2OAGA 1NSTA 3IVCA 5KWVA 1G38A 3UATA 4PCVA 4YP5A 1E2UA 2AXEA 2GKGA 1FA9A 2BFFA 3PHHA 3PTZA 1A8SA 2P67A 4IM7A 4O02B 4Q48A 4UD6A 4UTOA 1RYBA 1QCDA 4BL5A 2YIJA 4J0DA 2O8CA 4OK5A 3ZS8A 5FR2A 4LQLA 4EECA 1NNI1 1U1CA 5HHTA 4X1KA 4IHJF 4J4TA 4OKNA 3D4BA 5I7OA 4UZEA 2PZGA 3H5AA 3MNFA 1QHSA 3GCWA 4V03A 5FJIA 4GNRA 3EHDA 1WULS 3C5EA 3GLHB 4KYVA 3VPCA 3ROEA 1CDZA 1KMNA 4B6GA 3DFIA 2FVXA 3IAM1 3CVWA 1KNXA 1DMSA 4E46A 2OM6A 2Q5CA 5EQFA 3PWKA 5DIZA 4R2XA 3SZOA 1K6JA 4B4WA 3STHA 1LZLA 1OXXK 3MBOA 1G3RA 5JZSA 3T9BA 1CVIA 5E1DA 2R87A 1N9KA 4JI1B 5G1NA 1INLA 5F2EA 5DBOA 5BPFA 5FOQA 2GCGA 3G1WA 1ZG3A 4JI0B 3WRWA 1JSCA 4QUDA 1VKJA 3TNYA 4RTLA 4RSHA 3ZX4A 1DINA 1ZA2A 2H2FA 3P4UA 3ZCXA 3RUDA 7MHTA 2EYQA 4X8HA 4DM7A 4N03A 3GRPA 4A8JB 5T6BA 3WG9A 3CSSA 5UKDA 3QE9Y 6AT1A 4MVJP 1WU8A 1WZ2A 1KGDA 4AP9A 4N6NA 4BZZA 4I9FA 1J0DA 4US1R 4UHKA 4B33A 5JHHB 1JG2A 2G67A 3EASA 3P2MA 4OB7A 2X0DA 4C43A 4CQLA 5JNSA 3JWEA 4P83A 1HDEA 4LFCB 3V1MA 2IOFA 3ONFA 4FR5A 2VT2A 1RLOA 2B99A 5HE9A 4A8JA 4CT4B 4LHZA 2QL9A 4K6OA 2YW9A 3W4IA 1EA5A 4NABA 4R0VA 2FN7A 2ZAMA 5FUYA 4QHSA 4GZMA 1XAGA 1NI4B 1XPUA 5E8JA 1NF2A 5ERYA 1KAEA 1M1YB 5KC8A 3WZLA 1NTOA 3UK1A 1CQJB 3DV0A 3EXFA 1PT7A 2N1BA 2R8XA 4RK5A 1XP8A 4NI5A 1OAKA 2ONKA 1WUJS 3A11A 5KWJA 4ILEA 3PEWA 3JWIA 3JQ7B 3QFRA 5G0WA 3NJ8A 3TL6A 4IOLA 4FLFA 5CHYA 3ZK7A 2WD7A 3DNFA 1DEHA 5EJFA 2P9JA 3W5HA 4C0XA 1P3DA 2I55A 3FZEA 5CDFE 2VYNA 3P26A 4A0SA 1IMJA 3WO1A 2JIBA 4R6XA 1Q7BA 2FN8A 3S7ZA 1TKAA 1ECPA 3FWNA 3KPWA 4LVCA 3MAJA 3QLJA 4NU8X 4TUYA 3W5VA 4A2WA 3Q3JB 4N0QA 5IHXA 1F9AA 4L0QA 2XGMA 4WLFA 4BN4A 4BX2A 3IP3A 4N7JA 4F2WA 4XAQA 1QLJA 1UJ4A 1D4FA 4ENWA 4R54A 1MRZA 2QQ5A 4MUBA 3MPOA 4MRAA 3TUJC 3FOFC 1NY5A 1Z2DA 1JDVA 3IQWA 4N6GA 4C6RA 1PFVA 4IDCA 1ST3A 4OHMA 1UJNA 1W73A 3EHEA 1JVNA 1NW6A 2NW6A 2PU7A 4GI2A 4GP7A 4QUBA 4R05A 4XKJA 3U0BA 4AXXA 2EV9A 2AN1A 4PC1A 1CUAA 2NV2B 5D2CA 3SM9A 5DM4A 4M86A 1H4VB 3AKZA 4IIEA 2WM2A 2DG2A 1A4UA 2EKLA 1Y81A 3DT9A 2O7QA 1N8KA 4Z7NB 4KACA 3MC1A 1T0BA 1XT6A 2GSWA 1Z45A 2VF8A 3OZCA 5DM1A 3SC6A 1FU8A 3ZU2A 5C81A 3V4RA 2HIMA 5H80A 1PJ8A 1QP8A 4MGHA 3VPXA 1E60A 1MA3A 3PITA 1OBOA 4RHEA 5JISA 2PY6A 2HREA 3AUFA 3KU4A 4M1KA 1HDCA 1GO2A 2BR4A 3A3PA 4KXFB 4D3SA 2J9YB 3SYRA 4G24A 1DDOA 1AKWA 5CM9C 1K5HA 2IXTA 1LK5A 2OFOA 4OUDB 3OCXA 3VKFA 2Q3DA 2RB4A 1WV0A 2FK8A 2C03A 5FA6A 1QNLA 1ZM9A 1I2DA 3WLEA 3FYDA 3K09C 1KOLA 1KJJA 2VG8A 5GZ1A 2VHVA 5K0NA 3SLKA 1GAQA 4HT3B 3U5TA 3EGIA 5FEMA 3C8HA 5BO5A 4YRNA 1TA4A 3WLKX 2I3GA 1IPFA 3BGSA 2ZDQA 4N8SA 4JI2B 4HK4A 1QC5A 1VRCA 5FORA 3OLXA 5LIRA 3R7AA 1II0A 4QAQA 3DMPA 4TXNA 2FEMA 2PGJA 4YJHA 5EIXA 2PDAA 3OEEA 5HS4A 5CFQA 1M2JA 2JFOA 1Z6GA 1T35A 3H13A 4YRTA 3TZQA 5I9MA 4EUHA 3K0HA 2QIPA 4YJDA 1SR8A 1T24A 2XQJA 2ZRMA 4WLUA 3TLKA 3CPJB 3ZDYB 3GDHA 4OP1A 3Q9UA 3ZDQA 4AP6A 2MYPA 2Q5QA 1GILA 3WLPA 4MCAA 4YAJA 1QHGA 2HH9A 4H7IA 2IBTA 1AKMA 1B6GA 2D2VA 2Y9PB 4YUYA 1JJVA 1YS2X 3MRXA 4NXMB 3MUEA 1QCZA 2JS7A 1EA7A 5DWQA 3AEKA 4FX2A 4YQYA 3F96A 3GUUA 4FKMA 3QE3A 1OY1A 4F0JA 4QG7A 1XDWA 1JEQA 1IN6A 2P2CA 4J2TA 4ARZA 3BH6A 3P2YA 2P3SA 3UJHA 4EW6A 3AZQA 4WZAA 4F4HA 5DB4A 3OZFA 2Q46A 3IKVA 1GGFA 1UDWA 2AC2A 5CM2Z 5MGNA 4NAVA 1FLVA 3G9QA 3K9GA 4LBVA 4RZ3A 3A6GA 1GPAA 3H75A 3JTMA 1T9AA 2HK8A 5H81A 1L3IA 4Q6BA 5A5GA 1RZUA 5JXHA 5KQPA 4QWWA 2Z1MA 3CHYA 4W6QA 3T9EA 5T4FA 2PXXA 1MG0A 2GA9A 2TMYA 4WEOA 5CYPA 3T4PA 3VC1A 5DM60 4DA6A 3RTBA 2NUAB 2XR1A 1Z0IA 1U3CA 3FYCA 3KR0A 4QARA 2O2HA 4QYWA 5DT2A 5TV2A 1JG3A 3W2HA 1MOSA 4FW9A 3CURA 4AKSA 5IKEA 3D9QX 1YB1A 2VOJA 3QX3A 4MI6A 4MOWA 3CNQS 3O90A 5EXEA 3JVDA 3OJLA 4IXMA 4QOJA 4AJHA 1ZD3A 5BN3B 3HXQA 3VPHA 3MJVA 3HKBB 4RKFA 4K8OA 1UKZA 3A1EA 3IPRA 2NUAA 3NHBA 3IEKA 1OZGA 3HNPA 2XXAA 5HUJA 4EK9A 1NZFA 1Z5OA 3RTDA 5DCYA 4ZYVA 1Z12A 1Q95A 1XQWA 1T1RA 2E6UX 5A3SA 3U44B 3CZMA 4PVDA 4DG5A 2IU6A 5A5FA 2JNWA 2QHXA 3VZPA 4XYMA 1I0IA 2VSFA 5L3QB 5EFZA 2Q1WA 2WABA 2BFEA 4FMBB 1GNPA 3R6TA 3Q5GA 4WXPA 1RWKA 1HPLA 5H5JA 2R11A 1G2IA 1RLIA 1V8BA 1J2JA 4UVGA 1GA4A 2HV9A 4CL2A 3EXHB 1P44A 2PUWA 1WMAA 3H6GA 4GPEA 3ZNPA 4RWZA 1E3EA 2OC4A 2E1PA 1BD4A 1O0SA 4BMCA 2CLDX 4F46A 4F3TA 1HYEA 2Z58A 4XX0A 4ZOLB 3LT2A 721PA 3QU9A 4DWOA 1LUAA 3PQDA 4WCDA 1A2QA 3JD0A 1E6KA 3PQ7A 5LMUB 3OJ0A 4KEAA 2IKQA 1QWOA 3PEFA 5H0IA 1WEHA 2PRZA 1G5FA 3GRCA 4TYPA 3THWA 2A5GA 1XZMA 2P27A 2H1VA 2G5PA 5BW8A 4UQOA 4JKYA 1SOWA 5K3CA 3TCXB 4WACA 2FPOA 2ST1A 1KZYC 4O0LA 5L4SA 4LVUA 2IZ1A 1R5JA 4PX5A 4Y2HA 3A6ZA 1A82A 2CZGA 2IX9A 3KQTA 4FDAA 3VDNB 4KR9A 2C3UA 1CIPA 2VR1A 3NBZC 4EELA 1I1NA 1XNQB 1S7GA 5JRZA 4RFSB 3W1EA 1ORVA 1NYTA 3K94A 4V1CI 3LLMA 4ZEVA 1GKUB 1P29A 4CMCA 1S2GA 2B30A 1S8FA 2GJ9A 5HNKA 4DXAA 2O48X 2G4LA 2JEZA 3DW3X 4RTPA 2PRJA 4KX5A 3ZDAA 4EHIA 2VBCA 1KGSA 5FI3A 3T34A 3I30X 3VHXA 1AU9A 4MI3A 1G18A 1ISMA 2FPIA 1T9BA 2GN2A 2LXNA 3PQ6A 5DHTA 2ZKLA 1QRTA 2R2GA 10MHA 4EG7A 2DPLA 2RHBA 1EFLA 2Z3ZA 3KD3A 3SHTA 5ECDA 1B6RA 2ZYTX 2J7KA 1JAYA 2XMRA 4FCVA 1HTTA 5ER9A 2IYFA 5IH3A 1C2YA 2OILA 2C9OA 2PV7A 2WWXA 5K0SA 1NN0A 5K0JA 2GS9A 2OORC 1O94A 1GSAA 4Q47A 2BY4A 2OBBA 5C7OO 1ORIA 4OK3A 4EWLA 2ERYA 3I5MA 5JD4A 3N2GA 1QYRA 2E55A 2HU2A 3L4KA 1T8RA 2ZUVA 2JKYA 2XGSA 2CXPA 1V41E 3PVSA 1O5TA 2D7JA 3OX3A 1SUBA 2LW7A 3GVXA 4HFMA 3LLSA 3FGPA 5ICMA 1WCIB 4UVHA 3N0XA 3WP1B 1CG6A 1N6NA 3PE4A 1CVLA 1TNDA 4G5YA 5D3ZA 5G0UA 4B6QA 4LMPA 1Q50A 1K6IA 1QYIA 4GLOA 2YS6A 1RBYA 2ZE6A 4N12A 4PLYA 4TSFA 4C3UA 4GKKB 3DUWA 1Q7TA 5JXGA 2QLJA 1ZMTA 3VPSA 4MTLA 4MVJI 2CVFA 5DNAA 2BGWA 3EUWA 1BFDA 2B2CA 5BR4A 3AVWA 1F4VA 1JIKA 1QX3A 2ZVQX 2IGBA 4RQTA 4EH1A 4UHEA 4C0WA 1P2UA 2ZSEA 4MWOA 1KE1A 4YIHA 2PR2A 4E6PA 3CRW1 4MEJA 4NHOA 1POWA 3AK4A 1JTEA 2DHCA 3KQHA 1I7PA 1PAUA 1QOQB 2HPAA 1Z4PX 4M8KA 5IZCC 4WOPA 3CPEA 4D8XA 2NXEA 3B6EA 3OH8A 5BORA 4IIJA 5FBRB 1WB4A 5EJEA 1M54A 3EA4A 4PZCA 1IEVA 3AUYA 3FHJA 3KJGA 3IAS6 1QGAA 4G0MA 3TNDA 4BNLA 2AZTA 4DC0A 1VJ5A 4ETMA 2C54A 3OICA 4A8PA 3ESDA 3RUAA 3UYLA 4IS2A 1WTCA 4KWEA 4FOSA 2E4WA 3CUWA 3E5RA 1DS6A 3WLLA 3MHPA 1H3EA 2MYTA 2O1WA 1VRVA 5SYNA 4RABA 2B4KA 2Z2ZA 3ZXUB 3F97A 3P97A 4DLXA 4LOLA 4NHEA 2YOGA 2C7VA 2A4MA 4FBGA 1WHSB 1JX6A 2I8AA 3ETCA 1Z5GA 1EWYA 2CV1A 4TZ6A 2QY6A 4XUDA 1P6UA 3DM5A 3HUFA 3ZEAA 3QH4A 2R7LA 3E58A 1NONA 3Q0TA 4GPD1 2N1MA 3OCJA 1R12A 1ZINA 2JJMA 1P2BA 5EN4A 3MJHA 2GCIA 3GNQA 3HNOA 3JD2A 5BN4B 3RIMA 4J76A 4QU0A 3WYGA 3ZHRA 3NC1C 2WZCA 3KLNA 1I3CA 2L69A 3O3CA 4M9RA 4NOKA 4P36A 3RLIA 4ASUA 4WINA 3TGLA 2LV8A 2C3PA 1UBNA 1VLQA 2BL4A 3UMGA 4FX5A 4CM3A 2UYHA 1UJBA 1TRKA 2BTQB 5FPSA 3SFTA 1B14A 1DBPA 2I0FA 1HNZB 2QT1A 4ER0A 2PA3A 2VSNA 3FR7A 2W48A 5IJZA 3L9XA 3T1TA 4UJ5A 4XOUA 3IH5A 3LTNC 2ZEJA 4ENTA 1A7KA 4F5YA 4MQFB 3FTFA 1HL3A 1NUHA 1YB2A 3PU6A 5F51A 3MVEA 2G6BA 5C5DA 5H4GA 1G4AE 1XK6A 4JMLA 4NAHA 3TRHA 3NVAA 3V8PA 3GJ8A 3GT3A 1W9MA 3OCVA 2AFIB 3O26A 5D00A 2TMGA 3GEIA 5A9TA 5ALNA 1P4RA 3GLHE 1DC8A 4DMGA 1XD8A 1C7IA 4HH4A 5BSRA 2QRPA 2CFRA 2FVYA 4A91A 5HRAA 2A7QA 3LUHA 4CBVA 5MF6A 4PINA 4QYIA 2R8EA 2HMSA 5KYVA 1NNLA 1SPBS 1U2DA 5G4KA 2L42A 1EUYA 2BGJA 2RI6A 4NBWA 2X8JB 1V11A 4ZI7A 5IN4A 3ILSA 2DTEA 2FA9A 4OJMX 3UV6A 1LRLA 3D2BA 4E2XA 4F71A 4C0HA 4DTIA 4LZPA 4D3FA 2XLCA 4U2BA 3KEGA 4EKEA 1NU6A 4FQ7A 2IUUA 4AUKA 4OQQA 5CLIA 3TCKA 5K0BA 2BM1A 1L4BA 1FJGB 4ZARA 5AI9A 3GVHA 4G2TA 3UWKA 2ECQA 4QATA 3R3UA 5T8KA 1P5ZB 2BRUA 2DLNA 2ZI7A 1YZUA 2ZU0C 4E30A 2V1XA 3VZBA 1BQ4A 2QTRA 3DHWC 3HZRA 1U0LA 2Z43A 4HL6A 4PNZA 3B3FA 1GL6A 2GZ3A 3VZDA 3WLRA 4BS9A 4DDHA 1C80A 1KPIA 2DKFA 3UK0A 3GLSA 5I7UA 3TGPA 1EFRA 3TFWA 4YR7A 4DW8A 1TYZA 2OBFA 4TMYA 3P9QA 1G98A 2P9GA 3GGOA 4HLQB 3VPAA 2PXHA 5CPBA 5K5EA 3KALA 5MDHA 1SQ5A 3BMQB 1PP4A 4IHAA 4AG5A 4CMAA 3GPIA 4PWZA 5DASA 4PTZA 3ZV4A 3T5TA 3DMTA 1Q0ZA 4QT0A 3DL0A 4YDHB 2WTBA 1YZGA 1ZGHA 3GDOA 2ZG6A 3HEAA 1SVLA 4ZYLA 3OZVA 1QRUA 1LEHA 2O4CA 4N3GA 2V7EA 4PGAA 4GSLA 4OQYA 3BF8A 3CVJA 5DI3A 1JKIA 1KY5A 1TM4E 4ZQCB 5ALLA 1FXWF 3KNZA 4R1MA 4HKTA 1P2DA 3H5NA 4BRSA 3PBKA 4KGZA 4AX8A 3DPIA 4UFPA 3OIWA 3ZN2A 3GVCA 7MDHA 3D7MA 2GPAA 1JVBA 1T2FA 4KKVA 5CGZA 2OESA 1CSEE 4RUKA 1C1XA 2MWMA 3L6DA 5C3UA 1D7OA 2ZUDA 3IDOA 4NE7A 1E1YA 1N5RA 4DIOA 1DEAA 3C6KA 4YV7A 5ADHA 5KUTA 1ONOA 4FKBA 5EP3A 1RLUA 2P6RA 3LBYA 5KPDA 2BGUA 4PSKA 2ASEA 3BCSA 4BYMA 4I2NA 4G97A 3ZLBA 1VHJA 5TXGA 1YZVA 2EEPA 5DCWA 4BO4A 4C5CA 1JNXX 1HFWA 4JJGA 4UNRA 1UJ6A 4YYZA 5K0TA 2RSLA 3L46A 1F4PA 1GPWB 3DDCA 3VI3B 3LOQA 3MT7A 4M0UA 2XKAA 3KYIB 1ISIA 1PFGA 1L3CA 1RYZA 3GRYA 1OI4A 2JBAA 1IUNA 4LZNA 3I76A 1XPOA 3UENA 1S4QA 1Z07A 3H8JA 3ORSA 4TROA 2ZOSA 1UWLA 3ISVA 3MGKA 1XCBA 3UXMA 1IG3A 2HM7A 1TC2A 2LTAA 3CS3A 4PRYA 3WV4A 5A6SA 2H9YA 3UJCA 5BMVA 5BV7A 4WSOA 4GBMA 1KEUA 2RHJA 2ZIGA 5JSHA 3FBWA 2PUBA 4WFIA 2IU0A 4OXRA 5JO9A 3WHLA 1TJPB 3IIJA 5CA0A 4EABA 1M76A 1XU9A 1L5LA 3B38A 2NTEA 1ZSYA 2BFCB 3I1IA 2DM6A 3TZEA 4UM9B 1FYXA 1O94D 3KTAA 3K1AB 4R84A 1WS6A 4KWTA 3ZWDA 3LDHA 1JSLA 4XX1A 3QXCA 1GQ2A 1NJ6A 2NM0A 3LYUA 2JA2A 2A67A 4UMFA 3KC2A 3KKZA 1Z13A 2AYXA 2BKAA 2P1ZA 2Q6VA 4HX5A 4Y6LA 4J9UE 3TQSA 1JBQA 3OIVA 4UPVA 3GFVA 1S9DA 1L4MA 2FN9A 3LQFA 4A5SA 2O8DB 4H7FA 1LPAB 1VHTA 3FMOB 1GT91 1IB0A 1OLUB 2H1IA 3H42B 3IDQA 4M1ZA 3A6HA 3VO1A 4DSAA 4RYDA 2BJVA 3KKMA 2FY8A 3ZLJA 4D2IA 3KKQA 5HK9A 4KC0A 3EZXA 3FPKA 2QJWA 3QY0A 4TSFD 3VTKA 3BMNA 5FI5A 3V7YA 1BJTA 1WW2A 4FK8A 2C00A 4FSDA 1QF7A 5DP1A 4EVIA 3I04M 4ZDKA 5ICEA 1PV1A 4LW8A 3V4LA 3HRIA 1HY3A 2JCSA 4H4EA 5AIAA 1TMGE 2AHOA 4BLRA 5AESA 5C7IO 3DTTA 5AKKA 4LGMA 2E4VA 5DK4A 5K0ZA 3ZCVA 4X1IB 3WLHA 4BMYA 1KC3A 1BD3A 2UYQA 4R6WA 3NGMA 3LWNA 1FTWA 1I3MA 4XIJA 4XZ3A 4XFJA 5AXDA 3IT2A 3QQ5A 3HKEB 4IDEA 2FZLA 2I3BA 3MK31 4E09A 4XLLA 1LDMA 2VOEA 4O4HA 1Z68A 5F7OA 4OL9A 1DE0A 1E3WB 1MIHA 1HFKA 1PGPA 1TT5B 2ODPA 4LDRA 5EKSA 3OCCA 3VYUB 3WL8A 2PQ0A 3BHMA 2C04A 4L8WB 1EQ2A 3W5DA 1L5MA 1LRJA 5JSUA 1I0ZA 3NEJA 1NXTA 1V4NA 2IDMA 2VWGA 5CFNA 2IC5A 4JQCA 1M9NA 4N3CA 3VGJA 3ZE6A 2W0MA 1BFKA 1UCFA 4MKFA 1A9PA 1BKDR 1KYTA 2ACVA 1OXKB 2CNWA 2WWTA 1FX0A 5FQNA 2DQYA 4P4SB 4I3HA 4DWJA 8LDHA 1W4AA 5CM8B 2CXXA 2PTHA 2WU4A 3H87A 1IEXA 1NVGA 2CXQA 2L19A 3FTDA 3S44A 3PDJA 3WGYA 1RXUA 4DDMA 2EL7A 1O4VA 2HDNB 4MR8B 5F3DA 5BVGA 5CB6A 4LBZA 2EIHA 3V97A 3GUZA 1WUKS 5J4YA 4MV5A 2FQWA 2KHZA 3W3AA 1CTQA 3OY2A 1GFSA 3KVNA 2NSYA 3HYNA 3FYUA 3R8XA 3WJ1A 2TMKA 1ZONA 3J81k 3GZNA 5DRTA 1BNCA 1Q16A 3WLTA 5A05A 4ASUD 2O19A 5AT1A 3G2QA 3L8HA 2ATXA 2PM8A 1N0VC 5BN5A 3AXSA 4NJOA 4LV5B 1QU2A 3THRA 1ZH6A 3FR8A 3R1IA 4Q3EA 5AK5A 4ZCTA 3EEFA 5JBIA 5BR8B 3INYA 1UBOS 3O95A 4EYEA 2BEUB 3N9IA 4I3GA 2R9VA 4Z1OA 4RY8A 1CF2O 2PJRA 2R7AA 3HDYA 1EIZA 4EW3A 2VPIA 4Y1GA 1ZHHA 4KXNA 3I9OA 4N01A 5CVEA 1PR0A 1T3ZA 4HEA6 4O5AA 3OE7A 3SI7A 1L5OA 3BB3A 3UTCA 3N7UA 1T4MA 5JFOA 4OYLA 1N2HA 3FLAA 4C08A 3AUKA 2XADA 4LHEA 3IP9A 2XRFA 1TDJA 4TVSA 2B9EA 3OFJA 1JYSA 1TVCA 2JA1A 2Q2QA 2XQKA 3I8SA 4J0CA 4LECA 4QLOA 3D7RA 2R7KA 4M1WA 4R8MA 4EMSA 4MW1A 4ZEMA 3OZGA 1N3BA 1ZVVA 4KVFA 4DS3A 3T5MA 1E94E 3RS8A 5JATA 2VJDA 1U1FA 4OSEA 4AN4A 3CY6A 4JI5B 3G0DA 1SXJC 4EY7A 3E05A 5JMPA 4PYJA 3A6DA 1B0AA 3BORA 4V39A 2H1OA 1NURA 3WBBA 2C5GA 3BWXA 2PKYX 3KYCB 3HB1A 2HSWA 3LRTA 4RDHA 5JQGF 1XLUA 2P4EA 1U3FA 1XKTA 2QXTA 3FYTA 4PV7A 3ADDA 3ZXYA 2GUWA 3NBQA 4ARCA 1W0JA 2WJ3A 3DGFC 3HHPA 4B3GA 5DP2A 1KH1A 3WNCA 2XWQA 2V7QA 3EQZA 3NFRA 4ZP1A 3WGTA 3QLUC 3NYRA 5AKEA 3JQ6A 2WKWA 4CI0B 3H6HA 3SZRA 1AS2A 2DXIA 1Y1RA 1VC2A 2VFAA 1EFRD 2E4ZA 2X0KA 3KT6A 3AVOA 3K05A 4Y2VA 2R25B 3UHFA 1LB1B 5ALJA 2FRVA 3R77A 4PZPA 4DSUA 2V96A 1QVAA 2Z1NA 3G5AA 4CDMA 3ELYA 1RFGE 2CL6X 2YH2A 3AQIA 3E7XA 4PZEA 5EZSA 3UW1A 2PH1A 1YL7A 1P5FA 4H9GA 2B82A 4JKIA 5CYFA 1E2PA 1N7IA 3KOZA 4BPBA 1EBUA 1OT5A 1D6SA 3MB8A 2IOFK 4HDMA 3BK1A 5TS3A 3B12A 4GQIA 2VHXA 1L9XA 2F3UA 4WKCA 3PV0A 3REGA 3HV0A 1LPNA 1VHQA 2PT6A 3FAKA 5FOUA 4UTZA 5JPCA 4ZDWA 4JI4B 1HLFA 3BK7A 3IAM6 2OHJA 1DQZA 1N0HA 1T36A 2MHCA 4IZIA 4B74A 4MVJM 1XPRA 1GDDA 1UC9A 1QM5A 3EF3A 4MUEA 2Y92A 4PBRA 4BN0A 4HGRA 1VLHA 1YRBA 1MOZA 2E7ZA 1QK3A 3GRVA 3PIIA 1QAQA 1G21A 1GRRA 4IYJA 1KH3A 2A78A 3A32A 1EDOA 5CVTA 2GN0A 1ONSA 3M5CA 3M9WA 4ZJPA 3A4NA 4NMWA 3QEOA 1C0IA 1L5WA 3FLBA 1WB9A 1SELA 2BFPA 5CB4B 2F1RA 1U94A 2NUTA 3ZWVA 4CV1A 3R3VA 1A50B 3AIKA 3NLLA 1QX4A 2OCAA 4DXHA 3F5MA 2R1VB 3QWAA 3QE0A 2ERCA 4K9OA 1ZRNA 4TVOA 5BW6B 3IPAA 1WF6A 1X0XA 2JAOA 1T2DA 4JLNA 3W77A 5A62A 3PWTA 4Y30A 2VQFB 2QP9X 3ADKA 4QBTA 3WLFA 1GOTA 4L02A 3VV3A 3FCYA 4M38A 3GQBB 4D26A 2IYWA 1CIJA 1OXVA 1PR1A 2B83A 3HDQA 3K9HA 1ZZEA 2ZK7A 3UKJA 2EIXA 1NIJA 3MJTA 3EIXA 3H7IA 7ABPA 4A15A 1WDTA 1E89A 2PVCA 4HN9A 1Y6QA 4QASA 1E6WA 5FPPA 4BX9A 2CL0X 3HB9A 4QTYA 3HLTA 4KDCA 4R9UC 3ICWA 2D7CA 1DX6A 1LV8A 4FQ5A 2H2GA 3FKSA 3HZHA 4IL5A 1G0NA 2ZR8A 3GIWA 3DMFA 3JQ8B 1TO2E 1ONNA 4U2KA 4GPTA 1IY9A 1RYNA 2XT6A 3Q85A 2ZYUX 2FETA 4P7JA 1Z74A 4TLCA 2QF7A 3MTEA 3RHZA 3PT9A 4PNEA 3AM1A 4BGIA 3TINA 2W6CX 2HUNA 5T4BA 4JENA 1KK0A 3IKMB 5CLJA 2IIBA 3S1AB 3N70A 3EC2A 1D07A 5EEHA 2BEVA 1YSCA 6PFKA 1VBMA 1WVMA 4EMBA 2YYYA 3LLVA 3V4VB 1NVUQ 3JQ8A 4KX3A 1DX9A 2X6RA 4H16A 2QVZX 4PYIA 3ZE2B 3LXMA 1E4EA 1OD6A 2HSJA 3OOYA 2XAUA 1UZUA 4QFDA 3GVPA 3BERA 3HKDB 3C3XA 1O9GA 2HNBA 2WD9A 3UJ7A 4X71A 3T41A 1LZKA 2XEXA 4AJJA 4XH9B 4M9QA 3MJCA 4ZQBA 4ILKA 1DRUA 1Z6YA 3ZY4A 1OLXA 1KAMA 1BOOA 1E5TA 3GG2A 3LYAA 1L4FA 1EB8A 2B7LA 3HUUA 3H16A 3LQ2A 4KUGA 3A6PC 2ZPTX 1IVSA 4XIFA 1I01A 3MJSA 2HQRA 4UXHA 4WJZA 3L1KA 5JDIC 1QAOA 4BQEA 2XCQA 4LYGA 5SZIA 4F9GA 3DE2X 1I1QB 2GN9A 3EEIA 3KS9A 5IHPA 4EJSA 3VR3A 1WETA 5AVWA 4WDQA 1GFWA 1XFDA 1MJNA 5J4VA 3RAJA 4X24A 1W88B 2FW8A 3O4GA 4XM1A 2OQ2A 4G25A 2IUFA 3H17A 1QS0B 2DJ5A 4A2CA 4A23A 2AKEA 1KI3A 2FP4A 3PXEA 2WHRA 4P53A 1NC1A 3TK1A 4G89A 5FHQA 2QSUA 3I6IA 1AGNA 3K0AB 4KDEA 3F6RA 5E7JA 4BP9A 3ANNA 4BQNA 2Y68A 2QUKA 2ATCA 4IH4A 5IU6A 4OSOA 1H2WA 4JZYA 2DF8A 1TX4B 4LY9A 5LDDC 1N2SA 3C6MA 5BSWA 3AI3A 2FPSA 3W3AD 3R6DA 2DMRA 3B8HA 2O5VA 3W9UA 1V5WA 1E1NA 4Q7MB 3INTA 4YFVA 1PBNA 5ALOA 2G09A 4DCVA 5P8WA 2AFIE 2ZSHA 3C43A 3C3AA 1F0NA 1FQWA 3IPYA 1O5OA 2XWBF 3KLBA 3HLYA 3D7NA 2C5EA 3GD5A 3SJZA 1CLEA 2F1IA 2FSIA 2NYVA 1PX0A 2VKTA 1YRAA 2R1TB 5ECGC 2R4TA 3B1YA 2WJ4A 5DF1A 3WWEA 4Q9AA 1V47A 1ZM3A 4IJWA 2P7HA 5GONB 2I29A 4IJMA 1T9GS 1ZVMA 2BSQA 3IOYA 2AG6A 1ADFA 4MAFA 1EE1A 4ND6A 4KIJA 2QAGB 2M9MA 3W5CA 4TVKA 1GAEO 2OFFA 1IXYA 1NA5A 3A27A 3D3JA 3OE7D 2OWEA 5IKPA 2A0UA 2EWVA 1QFXA 1XCGB 2VJLA 3HVIA 1E9BA 1JMVA 4JLAA 4ND4A 1AZLA 2AG0A 1ITZA 4OFWA 1KDZA 5E6RA 5LQAA 3HPRA 3HWRA 2X77A 1W48A 1SXIA 1Z35A 3WVNA 1UZAA 5DSTA 1DSSG 1XDGA 1E79A 3VSCA 1GZDA 3TKYA 1DO0A 1W4LA 1WOMA 3WQHA 4EHHA 2OZLB 3GEDA 4FCWA 4UVDA 5BMOA 5LB4A 4AYWA 1Z6ZA 5FWNA 4NECA 2P6NA 1G8AA 2EGHA 4J94A 5K4AA 4ZHQB 3HO1A 3IHKA 3ANXA 1EFPB 3UJ8A 4GG1A 4BNDA 2GPWA 4I66A 3MT9A 3IPLA 4BMSA 4DL9A 5E7IA 3VKUA 4Y1RB 5AKZA 4MGEA 1JQBA 3TD6A 3QEAZ 3NHSA 3TECE 5FWAA 2OZLA 4NQZA 3JV7A 3NW9A 5F73A 4R0NA 3I6YA 1K8XB 2YXDA 3B52X 5HMMA 3U4GA 2OK7A 2MSWA 1FF9A 3GMSA 2YBEA 2ZWIA 1HDGO 4JS0A 1L4UA 4D1YA 2P5SA 2V7QD 4Y1RA 5T41A 1H4SA 4YCBA 1PJAA 3BAZA 3DC7A 1C8LA 3GEPA 5HQ3B 2R7MA 3D1JA 2CFSA 2PGLA 1G8SA 1ZN2A 2HWYA 3NR2A 5KJCA 3LT5A 3L18A 3TTSA 1UPAA 4OMCA 3ZLVA 3GELA 2BN4A 4ENSA 3NHLA 4UOEA 3K4HA 4RMGA 3ZLUA 4EVSA 5A7GA 1E2NA 5CLFA 4FDMA 5EYPA 1LGYA 2VRNA 1NFFA 3P1JA 2GAJA 2IP1A 5AW9A 4RACA 3RANA 2BI7A 3JQ9C 4CR7A 5DCUA 1I2ZA 3ZKAA 2WYVA 3BM5A 3T7IA 3NRJA 5K01A 3EVAA 5I9IA 1P9LA 2KPOA 3G88A 3LOUA 3PEEA 1SC1A 4BIMA 2R00C 2RH9B 2D4AA 5GOTA 3MS7A 5CK4A 5FOTA 1IXZA 4V1CB 1C29B 2E49A 1X9IA 1G55A 2H11A 1JG7A 2FFHA 5BOSB 5IJ0B 3THXB 1GHTA 1WKBA 2NYUA 2E21A 3BBPA 3C3DA 3M4NA 4QYXA 4BLTA 5A4AA 5BWBA 3K6SB 1RADA 3I58A 4O25A 4TWIA 5K0GA 1CRZA 2TS1A 4JODA 2QTBA 4QVIA 2J5QA 1BO6A 4NF2A 3O8QB 4RD2A 4J0JA 4UATA 4BKMA 5BOSA 3GH1A 4RZIA 1NX6A 1P2SA 2DUJA 4C5BA 2FSUA 3ROFA 4WBNB 1P7PA 5EIOA 4DPMA 4EPRA 4MWDA 2XMPA 3TLGA 4JJ4A 3REQB 2BE9A 2WVGA 4IQGA 3I2GA 3I6MA 4G5QA 3SXUB 1M75A 2CJXA 2JGRA 5BQXA 4PN3A 2XSZA 1DXYA 3VNRA 4Y9DA 4JQOA 1GTSA 4HNGA 3SYLA 1E1RA 1KZ6A 1J0EA 3HU3A 4IQ4A 3DW1X 1ECGA 1IL0A 1GQSA 3FUTA 4A92A 2HRZA 2G08A 2BFAA 1NLYA 3M6IA 4J1TA 2XKBA 3Q12A 5T57A 4WBNA 1PZXA 1NJFA 1WM1A 3CO5A 2HKIA 3EVZA 2GZ1A 4AZ0B 5I7RA 2R6CA 4IF6A 1FDIA 2DQZA 3GIDA 4RF4A 1BWQA 3HN6A 5ESWA 5CVVA 2J32A 1BS9A 3HJUA 1U0NA 5KJ6A 4NCBA 3KYDB 4HDQB 5GIOE 3NAQA 4PAOA 1XVIA 1PNTA 2R44A 3HUTA 4K5QA 1PZHA 1T5SA 3LCUA 3QYFA 5LQUA 3OBIA 3FKSD 2I9PA 3A3YA 2C84A 3LVQE 4NBRA 1EGVB 3FRHA 4MK4A 4NFSA 5CJJA 4Y2QA 1UPUA 3DEAA 3CPSA 1NAHA 4KDRA 5LZ7A 3O4VA 2FKNA 3K8YA 5JZOA 2VDWB 1RQLA 2G17A 4R9SA 4RULA 3UZUA 3PNYA 1QQBA 2XMGA 3N0VA 1I5OA 4HH1A 3V1YA 3WICA 4IX9A 1WPRA 4REMA 2J0QA 1DG9A 4HRXA 3BFJA 1O6CA 4MJ3A 3I45A 3L82B 5TS2A 1S8OA 3TNJA 4WK4B 5LWHA 5SY4A 5M29A 3P9XA 3SSNA 3COSA 2DHQA 4W1SA 3OPVA 1JHYA 2ZSDA 5E9QA 2F17A 3OC0A 4O2BF 1I80A 3I2FA 3T0FA 2VYQA 2FLVA 4OHUA 4M7RA 4OHKA 1PR6A 1MB3A 4CT0A 1TQDA 1TF5A 4FUQA 1D2EA 2XF8A 3V6MA 1Z8DA 3DDSA 4OQZA 1J22A 4HF7A 3WJ2A 4KIWA 4TMTA 1F5SA 5ULLA 1F51E 2R8PA 4O0MA 5LP1A 4MW7A 5IFLA 3FOEC 1VRWA 2OV2A 4YO7A 1JDBB 1MPXA 3NWEA 5JSZB 5TPWB 2I7VA 1JMKC 2CLOB 1ZJ4A 3F6BX 3GEBA 3R7NA 3VNAA 3L6BA 3RYFA 5CT9A 5LBIA 1JDNA 4BMVA 3AHDA 5CRIA 3VR3D 4EZEA 4LKRA 5HJ7A 421PA 2C8VA 4WD3A 3DPSA 3DEJA 1DTWA 5HCUA 4TMWA 1ZD9A 2Y0PA 3R0ZA 4IHJB 2J7PA 5FBWB 3U3ZA 4LXXA 3ZY5A 5JR3A 3UHAA 5JSZA 1T5TA 2ZRLA 5DYNA 1J20A 2IODA 4Q7QA 2ZPUA 4I1RA 4UZSA 4EIWA 2DECA 1AO0A 4KVAA 2PANA 2W6MA 2G3YA 4KJZA 4L6IA 1PF7E 1VIVA 5DRYA 5DNVA 3I3SR 4ESOA 4OHWA 4PXSA 3MUNA 2EFCB 3FVRA 5AI5A 3SLRA 2O23A 3GXBA 3DOUA 3PVZA 2ZVJA 3W7AA 4GBED 3FF1A 1CP2A 4DCUA 1LPPA 3KZXA 4J2HA 3QU4A 4PSCA 3W5JA 3FFAA 2AVDA 2YV5A 3I05A 3JAKB 3L6RA 1DXQA 4FHGA 4HG2A 5DU2A 2VJPA 1GTZA 4D99A 4Q66C 4UBOA 5KSYA 2XYHA 2I7TA 2H4YA 3PNVA 3GN2A 1IHDA 3IUNA 4LZAA 1NNEA 4YT5A 1EXDA 3UJ3X 1QVWA 1YGPA 4IOKA 2HA7A 2WB4A 2PL5A 1AK2A 1N3YA 3L0YA 4YMLA 4Y6PA 4XD7D 4LN1A 1XD2B 1XAIA 3FETA 4FFLA 2W2MA 4MW6A 4R5HA 3RVNA 3E2IA 1L7XA 5IKMA 1RYDA 3ZV3A 1KKUA 1WSDA 1J8VA 1AF7A 4QODA 1Y4AE 1YDMA 4JLUA 5BV2P 2FQYA 5C4MA 2VZEA 3INRA 5ENVA 4E2YA 2A9FA 4EY4A 4EY6A 1EDBA 2O0MA 3WYDA 2ISQA 1OUMA 4GR4A 1R15A 4L7QA 1JXOA 5FHRA 5KTRA 5KO2A 4I6JA 4U9IS 1BWSA 5AICA 4B6FA 4F2HA 5JXWA 1R50A 3HM9A 3QPWA 1DG1G 4DCPA 3R9IA 3C14C 4XWKA 1HDYA 4J4BA 1SCIA 2BMAA 3FHCB 3DAPA 5AM4A 4LCJA 5JDCC 1EGAA 2B3DA 3CTMA 1E9VA 1KI7A 1U0JA 3NANA 3ZW8A 4BTEA 2YX1A 2AOTA 2RHGB 1CDEA 3H2JA 4JH0A 1X42A 4IDOA 4P31A 5LYYA 2H16A 1LQUA 3U7IA 1C9JA 3E22A 1Z0KA 1YZYA 3IMKA 3PYLA 4OHPA 3IVAA 4D5GA 1MFPA 1JLMA 2WILA 1QIIA 1Y6JA 2FRDA 2WIGA 3RLFA 3M83A 2P5UA 1LDGA 2XUPA 4FEAA 4F3YA 5LLDA 5F78A 4QPDA 4HLDA 3L0DA 2AJ8A 1HDRA 4IRMA 4PYKA 4AUNA 2P1RA 5C35A 4K6CA 2VAXA 1AUVA 3T0IA 2P3LA 3R5TA 5LXTB 1GGJA 2D62A 5JMTA 1QO0A 2MYNA 1ORRA 1DT3A 1RPAA 3BHIA 4CCAA 4IY1A 1EESA 3ZJVA 1IZ0A 2ORIA 1BHJA 1G21E 5ELMA 4Z8XA 1QZXA 4D4JA 1CDDA 1MO6A 1XXHA 3FY4A 4NU5A 1GXSB 4UAVA 3T7TA 4GOLD 3ZJ4A 1FS4A 3CW8X 2PVSA 3JYHA 3K0CA 2XB4A 2OSBA 3PNQA 3PFCA 3RVJA 3A4YA 2HU5A 3DCJA 2YWFA 1AKRA 1CUJA 2IHZA 5BW5A 3T5PA 3MM4A 4JT2A 5D7NA 4QM6A 4ZRNA 1YBAA 4EB6A 3EEBA 3UMJA 2QTAA 3H9CA 2Q2VA 2ZROA 3M4XA 3FWHA 4IXWA 1E5DA 2XQVA 5AKJA 3TF5A 1YZNA 3B2NA 3WL4A 4CF4A 2FEWB 5JYEA 4ZEXA 1T5LA 3M89A 4MKGA 1SG0A 1TUGA 2YFKA 3U7JA 4C7JA 5C5IA 1T3TA 3ED1A 3CIFA 4CHGA 2HI0A 2QUIA 2VPQA 3K0FA 3TKLA 4DQDA 3I73A 4KPUB 4XVHA 2BHSA 2DR3A 1DT5A 4POAA 5H59A 1V16B 3BA6A 4LJ4A 1ZN9A 3OKPA 1VG8A 2BFBB 2QN1A 3ZVRA 1R37A 2WFLB 2OV6A 3E0QA 4H3SA 2A0FA 2YZGA 4PR0A 1JLKA 1MXFA 1OXBB 4CM7A 1OTXA 1V7PC 2Z56A 3SEFA 5KQMA 1GNVA 2CKDA 3C7KA 4F92B 1Z16A 2GARA 2AHRA 2O06A 5H83A 2QN9A 1KMCA 3JQEA 1KO8A 5TGDA 1U6KA 1QK4A 2IW1A 2VK2A 1U3TA 2X2PA 5AXCA 4CVNA 1K5PA 2J0EA 3IBSA 1KARA 1N8NA 3PQ3A 1ABEA 1MO4A 4Y9SA 4BAUA 4JI7B 2XSZD 2AOWA 4PANA 1HDOA 1L5SA 2WJZB 3BB4A 1I4LD 1E1RD 3HO8A 3C6ZA 4GDMA 1QP7A 2AD5A 2DQSA 3BD9A 1P72A 1P9OA 2I87A 2VUUA 2YV1A 4G8CA 2GYYA 4CN9A 4Q9KA 3NBAA 3CKMA 3MELA 2OEPA 4HZIA 4ID9A 1A9SA 4WMLA 1Z37A 3BIJA 2EJCA 1SXQA 4UAJA 4PYLA 3I6BA 5A06A 4U2CA 3T0GA 4X62B 1SK8A 3QWIA 2F1JA 1FRZA 1GZ5A 2NU6B 3DBLA 4AC9A 3BSFA 1X7DA 1DJOA 3CBQA 3HFRA 3GLIB 1XF9A 5HR5A 3ZQ6A 5T7BA 2WHPA 1B4DA 3LUDA 1AA6A 3E7WA 4FGUA 4C20A 1FMLA 4NCKA 4Q1VA 3LPDA 5JARA 2C7PA 1RMYA 4P8RA 5I7AA 3QVVA 3OTOB 1NUSA 2OFXA 3HN2A 3V8VA 4QECA 2Z4RA 1QHFA 3E1SA 2A84A 2B6NA 2JFHA 2YOFA 1PJSA 1V48A 1FNNA 1KVRA 5EJGA 1TTHA 3R3ZA 1Y7TA 4NK5A 4CHTA 2WDZA 3SF0A 2NZXA 2DOKA 2WAYA 4HN4B 4NZMA 3J81A 2C96A 1NNSA 1TCUA 5TMBA 4GMGA 3EAGA 4JR2A 2QRZA 3B78A 1TTQB 5KOHB 3KJNA 3PD1A 1A2BA 5JALA 3LT4A 2IPAB 4N82A 2J0SA 1O89A 4LE0A 1JAXA 1Z8NA 1XUOA 2W8BA 4QE3A 3LWBA 4R1LA 2GHRA 1PQYA 3CR8A 1S0UA 3ODGA 4WNIA 1PL8A 3UMRA 3K6RA 1YB7A 5C1IA 1YFJA 2W2VA 4XJXA 3RYIA 3P2OA 3TPCA 3H11A 3R4VA 3SHFA 4G85A 3Q3VA 3DD5A 3ONDA 1QF9A 3UV3A 1X1DA 1SOUA 3ITKA 2RDMA 2PGXA 1RAAA 3ZGNA 3QITA 5KYGA 2QP4A 3ICPA 3EYAA 4GX2A 5AM1A 1NW4A 4NESA 1LPMA 4KWHA 2QTNA 1R1DA 4JB2A 3ANTA 5GM2A 1A72A 1Q77A 1KIMA 5LA6F 3PSAA 2QTMA 2ZJAA 2EKZA 4U63A 3DMGA 4OAQA 2QVGA 1YAHA 1T9KA 3SYMA 1D4ZA 4KW7A 5D5HA 4EKIA 2HBZA 5MHTA 3TD2A 2J7PD 1ST2A 2BZGA 2OK8A 3K15A 3QSGA 5LD2B 3OY7A 2DY1A 2Y71A 3QU5A 1LC3A 3IXQA 1NF9A 3MRVA 1YRWA 4L4ZA 5ALXA 1ZK1A 2YC4C 4RWEA 4TQUS 3VZQA 1QE0A 2W9XA 5HKOA 3EWSA 3HCEA 1NRWA 2XAAA 4RJJA 2C9MA 4L28A 1QBGA 1ZL2A 4RD1A 5IT5A 1J42A 2P6MA 1IC6A 2P69A 3AERB 3IBGA 3KJEA 1WD5A 1AC5A 5DM2A 4JXZA 2AZMA 2OWDA 3ESYA 1RFLA 2BMVA 2IZ5A 1QNFA 1XMIA 4G4JA 4MRMB 3WLSA 4AZTA 2ON6A 1P7WA 3Q3IA 4AJOA 2FX5A 3MMXA 2EBHX 4FXOA 2OV4A 3E4CA 3K4QA 4KPGA 4MUXA 2ZB3A 4YDRA 2X3FA 4Z54A 2JAWA 3N59A 1GQQA 3IIKA 4LC0A 4C89A 5KNDH 4D42A 4IDBA 3AEUB 3LP8A 1C3XA 2WSYB 5FH9A 3LWDA 4J7XA 1L5GB 3ZHXA 3E8MA 3EK2A 5H82A 1RCTE 2EDCA 5FB3A 5HDQA 4RY0A 1G7CA 3ISTA 4PHFA 4WFJA 3MB5A 1EZZA 1JVSA 1W36D 2C92A 3V4SA 5AI4A 2J4CA 5HF9A 5ED4A 4LOIA 1D2AA 4LUCA 4C4PA 2WMOB 2Y4NA 5FWYB 1QO9A 2O0HA 5FNVF 3T35A 4HDKB 1B2RA 1JEOA 2Q4RA 2ZYHA 2D8AA 1JKXA 3L8EA 1T10A 3AESB 3OEWA 2OPHA 4B2YA 8ABPA 2IEBA 3NBFA 3K70C 1R2QA 1JA0A 1CY7A 5I3CA 4TMXA 5FUVA 1EFTA 1YJ5A 1BU5A 4AF8A 1YR8A 2AW3A 1T9GR 2ODQA 3LDUA 1QV9A 1UL1X 3LWZA 4DC9A 4J0QA 1SULA 3T1YB 2ZRIA 1RHQA 3A4TA 3HGMA 4JFAA 1GZ3A 2RB5A 3KJFA 4PPQA 3PB3A 4J8PA 1ISPA 1QRDA 2BWJA 5TPZA 3HO6A 1DJMA 2PO7A 5FUQA 1VYHA 2J45A 2JI9A 4NATA 3Q40A 2H00A 4AMYA 1YVPA 4FJ1A 1JHVA 1RT9A 1NV9A 2CB9A 2ZT7A 4O33A 4OJQA 1YUNA 2QX6A 1VECA 1IVYA 4O4IF 4F8YA 2AN5A 3G2NA 4CQJA 1LTHR 6REQB 2C94A 4L15A 4QIHA 4NZPA 4X94A 4BO9A 1HC7A 1JHZA 4GLFA 1YWGO 1QO0D 2A1UA 5DYWA 1XG5A 3AHCA 4WTOA 1XKXA 3TJRA 1GRVA 3C45A 4P4UA 2AMVA 3GDGA 3MTJA 4FINA 3WXBA 1F2TA 3ZV5A 1TZCA 2VZ9A 1I7NA 4B85A 1DARA 1UPTA 1CT9A 2PYIA 4CLHA 5G3YA 2P30A 4R1SA 1NP7A 2W2OA 3RVPA 2WV7A 3OLZA 1NVFA 4HQKA 3PZBA 1CZOA 1XQXA 4GI5A 4XSGA 4YJGA 5HFAA 3TLEA 4DY4A 5IT9A 1E9SA 1TCBA 3P9ZA 1WXXA 4Y2JA 5HRUA 1QR2A 4UNQA 1ARZA 2FHPA 1SG6A 5EZYF 1T5OA 1EVEA 4I4TF 1EH5A 1H66A 1J9EA 3C5CA 5KNCD 5CIYA 5KYUB 1QKIA 5FLKA 3GLKA 4TN1A 2WB2A 3JWGA 3AP2A 3QMVA 3N7TA 1NTRA 5C52B 5T3YA 3VKVA 1NJGA 3IIEA 2ZB2A 3BSYA 4H15A 1E3TA 5G0VA 3ZWMA 4DARA 4KNVA 2ZFUA 4GYWA 4KGXA 1BDIA 1OX4A 4B3MB 3DMYA 2WYOA 5LKRA 1VE9A 2J9XB 2ZJBA 2OA0A 1KAOA 2IY8A 2QRNA 1IWOA 5KMGB 4RKYA 3GLFB 1ZNQO 5EIBC 1ODTC 3NTQA 3ZHZA 3DVAA 1TL7C 2VDRB 3RRBA 1ODIA 1SKBA 3IBCA 3LK7A 1TCCA 4INPA 1G7RA 4UTXA 2IZ6A 4MWBA 4D43A 4INJA 5AKGA 4B80A 1TMYA 1DCMA 1SHTX 4PF1A 3ZYZA 1XELA 5A1TA 2XWJI 1Z36A 3IAXA 1KL7A 3AFMA 4KB5A 4UCFA 5E9JA 4Y7CA 1FEZA 4GM4A 5U4QA 4BO8A 3ZTWA 3T7EA 4DNQA 2XJ4A 4OLHA 3ZZUA 2C2OA 2E0IA 3TRIA 1XN1A 2GWRA 2WU1A 1JQDA 3EAFA 4XEHA 5J47A 1W19A 2DP4E 5CVJA 1LSOA 1Y3FE 3QPUA 2ZJ6A 3BE6A 3SR0A 4CQNA 3DTNA 3DKIA 3RAFC 4WCFB 3PL1A 1KPHA 2B4TO 3QBDA 4JIMA 3COPA 3TWOA 1XZBA 4E5DA 3EYWA 2ZYAA 4M22A 4MVJE 5KYYA 3M8KA 1I7QB 2FB9A 2ZJZA 2O7SA 1WNTA 2WI8A 3A14A 4IHKA 4RK0A 1AN9A 2WU3A 4GICA 4WWHA 5ICGA 3JQGB 2X0FA 3SK0A 4JOSA 3W2FA 2CDCA 1UXHA 5BWOA 1E1MA 3JZFA 2K87A 3KCQA 4L9WA 1MC8A 1E6LA 3HP7A 4HX2A 3PGMA 1G8YA 1RXEA 4FGZA 1GCOA 4WLNA 1IJFA 3OWXA 3WK5A 2YUIA 3WWDA 5KWSA 3HUEA 4MP3A 3LQRA 1R6AA 1J4AA 1KBOA 1ECCA 2ZUBA 3BICA 3JQGA 4G0QA 3UAVA 4AYXA 1U11A 2V03A 4R71A 4P4GA 1YFLA 4LJRA 1I7SB 3LE8A 1C30B 1E1CB 2GRAA 2JI7A 4OMDA 5KAMA 1ZAYA 3T3OA 1K7EB 3GJXC 3RWBA 4ETNA 3AR3A 4LJLA 5JU6A 4IQFA 5GQSA 5I7FA 1UBCA 2P6OA 2RGRA 2QSJA 4RSMA 2YJTD 2F6RA 5F2OA 3S68A 3TLCA 4DIBA 1TMOA 5BYAA 1GRCA 4MLZA 1YRQA 2WJIA 3HJRA 1Z88A 5HKKD 2WJVA 4FW8A 4E2FA 5AW3A 3VR4H 3ELDA 5JAIA 4JYPA 1EVZA 1JA9A 3UOWA 3EDOA 2JAQA 3TL2A 4EFLA 2YIVX 3Q11A 1BROA 2DBRA 3NO4A 2BT4A 3EWIA 4B71A 4NYIQ 3K71B 4YCJA 1YR1A 2AG1A 2ODBA 3OFNA 1I94B 1YTUA 2OAP1 4C4SA 4QGGA 3WNQA 5LQSA 2UZ4A 1XF1A 3NTVA 4OG2A 3QVSA 1WXGA 4LC1A 4YRJA 4BQQA 3RASA 4DG8A 2JI4A 3PC8A 1AKVA 5BVHA 5EJ2A 4N0DA 3RU2A 4LXGA 1Q1NA 3WGLA 1QO7A 4OEHA 2LVBA 1N7JA 4Q4JA 3X3HA 4R0MA 4EG1A 2HW8A 4P35A 3L0SA 2AQIA 5IZ4A 1K1EA 1FFDA 1EX1A 1Q0RA 1XA4A 4MRSA 2HCTA 4S1WA 2AR0A 1VCIA 1C2TA 4Z4GA 2JHFA 3UY4A 2PT9A 1KA9H 3PNMA 4OLBA 4C5AA 3QNMA 2WDPA 1WCYA 4KPEC 1GT6A 1KERA 1RM5A 4V0QA 1KAQA 1QVRA 1VL6A 4YP6A 2ILTA 4RCZA 1K6MA 3QXXA 5CFMA 1NVVR 4CIWA 4OB6A 4MROA 1LKZA 4HYQA 5K8VA 2P2ZA 2QZSA 3EE6A 1PNQA 2FPPA 3BILA 4PO9A 5IRCD 1LA2A 4N3AA 1D03A 1YS9A 3SFZA 1J09A 1NUTA 1RHMA 3N86A 1J21A 1E5VA 3QU2A 1YRHA 1OLSB 2JK1A 3S5JA 4D6YA 2I22A 1UINA 3SG0A 2X5OA 2GAFA 4KUHA 5F77A 4CMEA 3CKKA 2CBXA 3GAZA 1CULC 3CEHA 4MI9A 4Q7JB 3ZDEA 3FPCA 2FPRA 2ZRNA 3L93A 3IMFA 2Z8ZA 4HDCA 2ATIA 3DONA 4MAAA 3MINB 3SF8A 4EHLA 5CYGA 4JL6A 1AHIA 3WDMA 4GYKA 4AY2A 2YWDA 4LRQA 4TLAA 4WIAA 5BR1A 4CXMA 1EP1B 3AHFA 3WLQA 2Z8XA 3CLTC 3VSDA 4Q03A 2ILVA 2LKDA 4AG3A 1IB6A 3GYBA 3CZ5A 3OJEA 5CD1A 3KFXA 5IH7A 1YAJA 4KYUA 3QLEA 4HV4A 1TVKB 2P2NA 2IPXA 4A0FA 1M67A 4V0SA 5E6SB 2WIDA 3N2KA 2WSIA 4G5OA 5LPNA 3GUVA 4RD0A 4CM8A 5GTDA 3ZI0A 4W5HA 4NU0A 3CZRA 5K6RA 1DCFA 1ZMBA 4X91A 2ZIXA 1QH8B 1UXGA 3KBOA 3MQFA 1V4VA 4EO4A 4K0KB 3D8UA 5M5BA 4BE7B 3CO0S 3ZE9A 3TLAA 4KH0A 2ZRCA 4OIMA 5TPZD 1ZCAA 2IXGA 3ZBPA 2G0NA 2HF8A 3PRKE 4CMHA 4J3JA 1YI0A 2DUNA 3QG1A 4RF2A 5CNIA 5E6SA 1FSGA 4TWAA 4DYHA 4YAKA 2WPDA 5ELLA 1Y3IA 5JH7F 2Y1FA 1RHKA 4HWRA 2KMLA 4FI3F 5F12A 1TOAA 3TIVA 2ZBGA 3OFSA 3AJRA 3DBRB 3OJFA 5JAPA 2FUKA 4OKIA 1WZEA 3DBHA 3PHGA 2OUIA 1FW6A 4IVPA 4OFXA 1XVAA 4XR9A 1WKCA 4IKPA 5HBRA 3VNQA 5HPYB 2VJBA 4DRXB 3BKXA 5C5EA 4DUPA 4C01A 3I9KA 3ITDA 1RKQA 3FNIA 3BZBA 1VBFA 2NPOA 3EDYA 3SHOA 2JW5A 2QV7A 1EJBA 2P91A 1IQ0A 4Z49A 4EW1A 1QP0A 1V6CA 4BVLA 3JATA 2EZUA 3TXYA 1Z56C 4TV9F 2JKVA 2YWXA 1A2OA 4WN9B 4AI6A 1THGA 1BQ3A 1EM8B 1SBHA 5GZ6A 2YHIA 1QAMA 3PNOA 3GV0A 1S1CA 5HTOA 2P0AA 2ZM5A 4TKUA 2XVMA 1VJ0A 5DISB 5IVKA 4JUDX 3B53X 4YRQA 2WTAA 5EIFA 1S8NA 1HXHA 1TUBA 1PLJA 2IYTA 2EAUA 1JFLA 3D8NA 1TEZA 2NADA 4O4JF 4WKBA 4X84A 1TUEA 5H3HA 5B30A 3SX0A 1XRLA 5DLDA 3C98A 1UFRA 1W4BA 1TW2A 4ZC8A 4ARZB 4JV5B 3OECA 1O97D 5EZ6B 2WTEA 4X1YB 3NVKI 4N41A 1J9GA 4QAJA 4AIRA 5AK3A 1E4OA 3RS5A 1ECBA 2X9VA 3GLIE 3H7AA 5H9WA 5KTKA 1VXOA 2Q3FA 4JBXA 4UCXA 3T7KA 2WZDA 4L3OA 3VVBA 1KKLA 5BRJA 1F38A 1OSNA 4FSHA 5ARDA 2DHEA 5GJVC 2XHEA 1GUFA 1GZSA 3E3MA 3G2OA 4KREA 2YMLA 3G5TA 2H4JA 3GWZA 5TLSA 3FIUA 1U9IA 2Q3CA 3R2JA 5THXA 2IHYA 3Q7QA 2F8LA 4BO3A 3LL7A 4LGYA 3FMPB 1EUZA 1MOPA 3PI6A 1OWNA 4FNOA 5IJAA 4B09A 2WUVA 2ZVPX 1LF5A 1I6MA 2CLKB 1RZRA 1NYLA 1J07A 1PS0A 5K3FB 1DFIA 2FSSA 5FBVB 1ZIXA 3KE8A 3CZPA 2I91A 3TQTA 4C7BA 4D4HA 1FIUA 2QSYA 3LQ1A 4YQZA 4DV7B 1AUPA 3CZ9A 3G9XA 3L7NA 2OMEA 3QYJA 1ZW6A 3G7NA 3CF2A 2QN8A 3AVVA 3GLVA 1HZZC 1H4QA 1ISRA 2ANBA 2XDAA 3ABRB 3GCZA 2QTWB 2GLTA 3BDVA 3DO5A 1GNLA 3GFOA 2IPLA 3IQXA 3ORFA 4RHXA 3MJEA 4R1PA 5K3FA 2V9PA 5K45A 1CR4A 1ZJWA 3C3WA 4F1JA 4WW0A 3D4PA 4KL8S 5C5CA 1SD5A 1UT5A 1RJFA 1RBZA 1YCDA 5GM1A 3U31A 4U7TB 4J16A 2E89A 3CW9A 4ALLA 4TM8A 1QIKA 2BLLA 3EUEA 4QBKA 3VNSA 4BGVA 5AOAA 4J3FA 4YB8A 4A10A 3TNFA 1J2RA 3DA8A 4HXEB 3WGJA 3U1TA 4P6VF 2IV3A 1IXRC 4GNKA 3EA0A 3O2NA 1JEEA 1H2HA 1W5SA 2J08A 1F6WA 2Q4BA 1BX1A 1Z4NA 2QVBA 4ND8A 5CJ2A 5D7BA 5DIFA 2GFIA 3B3AA 3WC4A 3WMRA 5JVDF 5CB0A 1OV6A 2F90A 3QBEA 1Z4QA 4UUQA 5CH5A 2J5KA 1WKVA 4YEDA 1H5NA 1ZBQA 3WZMA 5SZJA 5BN1A 3RUCA 5JNTA 2C7QA 2QP3A 4KMRA 4L72A 4UBLA 2J0UB 3RW9A 1YJBA 1CF9A 1U0FA 2DFPA 2J31A 2Z2XA 4HAXA 4PQFA 3DZCA 4RAQA 1A9QA 4M1MA 2PWAA 4ME6A 1KFEB 3OFND 4S1TA 3GOHA 1K63A 5KHOC 2HWKA 5EWLB 1M1ZA 3CLHA 1KAHA 3PHIA 1KP2A 3IOCA 5FV7A 2MR5A 2OD9A 2IU4A 3IDZA 2B20A 4FYVA 5K6AA 1HM5A 1N8TA 3OZTA 4FMCB 4P3YA 5JQGB 3FUXA 4URXR 3KEMA 1ACMA 1UQRA 3M9LA 4NAUA 9ABPA 4QQ8A 1A96A 1OBVA 3NHPA 1SRQA 4KBFA 1EVIA 1FFXA 4JD5A 4PRLA 2XUDA 1J70A 1SU6A 5B36A 3GX1A 4GXTA 2G5CA 3A1WA 2M6KA 2B6HA 1FY2A 4Q19A 2J59A 4KIGA 4WUTA 5EZ5A 1EK5A 3QKIA 3TI7A 3K9CA 3ZGXA 3PFIA 3NG1A 1YHZA 3P0IA 2PUVA 1RM0A 4ZN6A 3M6WA 2DUMA 2DFNA 4FB4A 1L4GA 3FFXA 4E1BA 3B9PA 3HWSA 3WGUA 1HQCA 2D8MA 3H19A 4UM5A 3LW8A 5LZ8A 4BLOA 1XVLA 2GNPA 3E03A 1CRWG 3QVXA 1GEGA 2N75A 3PZRA 4H17A 3AEZA 3V8NA 3GZ4A 3JWPA 1K7XB 3WGOA 4AM8A 4DMKA 4DLSA 2PEYA 1TJYA 4HEJA 2WF7A 5TF0A 2HPZA 1TQHA 2WP0A 3DLIA 3ZK8A 4PQRA 4C7OB 1HA3A 1W8DA 1VJDA 2PS1A 4D9HA 4LYDA 3KTOA 1E0AA 1Z6PA 3KSUA 3U37A 3D54D 3MF4A 4QGHA 2VK4A 4BJ1A 3VH2A 3IIIA 3P32A 2NVWA 2GA8A 3RUFA 4Y2RA 1SIOA 4X8MA 2AH5A 4YECA 5G4LA 5FF9A 4M6WB 2JH9A 3VX4A 2QL6A 3PXBA 5EJMA 4C03A 4DBLC 5CBPA 5L40A 4A1FA 3BTUA 4WL0A 1FUUA 2AD1A 2AN9A 2B1JA 4RJTA 4E3WA 1ZJ6A 1JXAA 5DXAA 1F17A 4C7XA 5FUBA 2D0PB 2QTLA 4GI7A 4R8SA 4BZXA 1I3OA 3AW8A 1A5BB 1DQYA 3AEYA 3IVRA 1EXNA 1RKXA 1CUZA 4QPZA 5CMLA 2COUA 2QA5A 3EMDA 3M9XA 4C9BA 2JDIA 4QD3A 4B6JA 4XYEA 3CVOA 3L41A 5HKAA 4BO5A 1JJIA 3VHLB 3IP5A 2W6IA 1TVEA 3EGDB 4MUFA 4RXTA 1H1LA 2QN3A 5JNLA 1E5LA 4LF9B 2FZEA 3NOVA 2PRIA 5JC8A 3X2EA 4MUIA 1NBMA 2EG5A 1PSWA 2FFAA 3I52A 1KVQA 1NYRA 3GRRA 3H0KA 4QJIA 2J33A 2MOKA 4BGEA 1EK0A 1NW7A 1S01A 2CN1A 4CTJA 5I7WA 4MS1A 2EGGA 4LC9A 4XFKA 1NLMA 1V9CA 2XMZA 2XUIA 3DE0X 3LBNA 4KODA 1Z5VA 4Q7KA 4KQJA 2X0EA 1GUAA 3EDQA 4MWZA 1CY1A 5FFNA 4B82A 1Y48E 1XOIA 2VWHA 5BV8A 3U7HB 3M6LA 3H0CA 4WHMA 3NFYA 1AS0A 2FXVA 4ZOEA 4I50F 4AF6A 3ZLTA 2O2ZA 1P18A 3H1PA 3FWYA 4H7KA 4JSRA 2Q8PA 4DCGA 4DVJA 1NVTA 1C7JA 2ORVA 4RTOA 2P4UA 2WKRA 4DANA 4Q3OA 2B5OA 3CG4A 3IJ5A 3CISA 1ID8A 4V0RA 4B3CA 2DH6A 4BBJA 2VZLA 2HBRA 4ZPJA 1DPFA 4CQMA 1HUQA 1AHNA 4L9AA 3B70A 4BFXA 4BKRA 3KL2A 3K9FC 2F3TA 3B6IA 3NHFA 1PWEA 4LTDA 2JEYA 3BE5A 3IOEA 4EPYA 5HZHA 1N2EA 4G0YA 3HH8A 1U1GA 1R0KA 3WMGA 4WZBA 1RABA 1W59A 2FWBA 2VJMA 2W8ZA 3N2LA 4FFSA 3W3ZB 3JALB 5FTLA 1N7GA 3G9TA 2HJWA 1GAWA 4TMZA 5DWVA 3MGCA 1EFVB 2Q2OA 3S2IA 4N3NA 4EYSA 3BEDA 4YJ2F 2BYTA 2Q3MA 3GFPA 4KIFA 4R69A 4HWGA 1NT4A 3FFWA 3OQVA 4NPCA 3EVTA 3L5KA 4FFRA 4BO6A 1N6RA 3RBVA 4B2LA 2WQ7A 2OZKA 2FEXA 3D6FA 1JG1A 4RHTA 5IANA 1WDKA 3PF9A 3WAGA 5JFTA 1KHTA 1UKBA 2LD4A 4F3CA 4YRAA 3L04A 5TB5A 2A9OA 2GF9A 4IGKA 3WQQA 1M8JA 4AJPA 5B4UA 1WUIS 2MSEB 1HX7A 1QGUA 3RYHA 2XBMA 1V8PA 2OGWA 1WQ1R 2B94A 2VP9A 1Y63A 3GFRA 4J1TC 1L5KA 4G0WA 3BHNA 4KRFA 5CAEA 2KX7A 1RJGA 1GKYA 1RZRD 5BURA 1CFZA 2ADMA 3EBOA 3NGXA 4EBFA 4EPVA 3KIPA 5D85A 3VX3A 4EKDA 1P77A 1PQWA 2PYZA 2ZPAA 1ID1A 4H7DA 1GR1A 2H92A 3JQFC 1UJMA 1E9RA 2VCYA 1L7RA 3H1AA 4FJ0A 4ZCPA 3RQIA 3ANMA 4LG1A 2JEOA 3BS4A 1AURA 1N6PA 3Q6IA 3COZA 1WB5A 4JBYA 4FLEA 5JSQA 1UAYA 3NUQA 2QRLA 3D0KA 1HNWB 3WV5A 2GERA 4MITA 4TTIA 3RK1A 3U4QB 1PJ2A 4ETIA 1FJXA 1AE1A 4MKIA 3RC1A 1P5JA 1L7QA 2QU7A 4ADSG 1TYEB 2WWFA 3WJ7A 5KNBA 4CW7A 1EKXA 4FNMA 5L3SA 4Q24A 4IQ0A 4KXXA 3T5BA 3VBEA 4C2BA 3KQLA 2YNMC 1H8HA 3C1TA 2HK7A 1OF1A 3H9UA 4Z51A 1NJ8A 4G8BA 4NJEA 2OY0A 4Q6WA 2Z1DA 1GZVA 1NF3A 2Q62A 2IHKA 3DYIA 3PGJA 1DWQA 2VUTA 2QXYA 3WLAA 5B1YA 2JGFA 3NJRA 5J2TF 4QWMA 5I8WA 4CEIB 2EKPA 1CE8A 5C8YA 1HNNA 5CDUA 4C29A 4LS3A 1ULBA 2V7XA 5FO1A 2PQMA 3N75A 1DAIA 3CMMA 1WU7A 2JFWA 1V5GA 3HA2A 4CE6A 2IT1A 1UXJA 4NK4A 5CFLA 4PS0A 2X8WA 1BHO1 2HRCA 3WKEA 4L5AA 1XLTC 3EIOA 1DDGA 2BIFA 1CUXA 1SCUB 3I23A 4CM1A 5AO9A 2FMXA 2IYAA 3HK2A 2PBLA 3EDRA 4ZO4A 4U7PB 2O1EA 1BXKA 4X65B 1VLMA 1XMQB 2A9QA 3EPRA 5ADUS 1G8HA 1U5AA 2IJGX 2WK1A 2Z6QA 1JTVA 2I6XA 2NUPB 2W2TA 3IOBA 2HXYA 5KDDA 2AUTA 4W8OA 3ICOA 4MV4A 2VHJA 1ECJA 1N5MA 4QJBA 4V3CA 4Q3LA 3TEJA 4COOA 4RA6B 2DTDA 2CEKA 5CA1F 4H1WA 3D0OA 1YL6A 1X6VA 3QJGA 3LD9A 1KQGA 4PPGA 5KYWA 2X5JO 2WYUA 3FRJA 3OIGA 4FQ8A 4ZZ3A 3PFKA 5I9NA 1ZK4A 2P68A 1YFZA 2WWRA 4DMRA 2EJTA 5K2OA 1VJ1A 2CUNA 3UW3A 2BGMA 2X42A 1ZNZA 3K30A 3P9PA 5E3HA 2POCA 4OUKX 1JR3A 5JPDA 1EMDA 4UTPA 4L5BA 3R6LA 1Y80A 2SHKA 1TU4A 3AKYA 4E32A 4K3VA 1M34B 3O5AA 3FPSA 1DBVO 4U7FA 3BSWA 1FSSA 3N2EA 4QBIA 3UAGA 5I7EA 1XO1A 3H18A 4OY3A 4JCCA 4ZQIA 3WGGA 3ZHQA 5ITZB 3BSSA 4MAMA 1CR0A 1E3JA 2ZBRA 4Q1FA 5D6OA 3OTHA 5AW8A 3WIUA 1II9A 1KXZA 4L9RA 1LVHA 2BMWA 2GPBA 2R47A 2R8RA 3H0EA 5J4HA 1V6SA 2BZ1A 4JY7A 4EKYA 1K27A 2Z8YA 3R5JA 2WM9B 4LV8B 3QJYA 2RGWA 3ICQB 3Q6MA 1AQLA 2W00A 4YJ3F 2ODWA 3TLMA 3QVWA 7REQB 5I4CA 1DC3A 3R0IA 1HH4A 2D00A 1JSXA 3U48A 2AOUB 3CN9A 5BRAA 5LIPA 4EB8A 3ZZ1A 1DVRA 4I5EA 4ZAVA 1IBCA 3MTBA 3NYQA 2OQVA 2IDZA 521PA 1NKTA 1HV8A 4MIOA 2GK6A 4MB6A 4TZTA 5F7ZA 4AS3A 4AU1A 4RW0A 2PLWA 3ZH2A 4MGIR 1KU6A 3TNLA 2V4ZA 3R40A 1BKSB 1JQKA 4RVCA 2I6TA 1A8QA 4UEKA 2C2GA 1J33A 4C6TB 2C9ZA 1RHRA 2D1TA 3VOBA 2P4HX 2PMCA 3W2EA 2QRGA 3F7MA 2JDID 2IIQA 3L0ZA 4F60A 8GPBA 2LCFA 3B1WA 3JS5A 1ZGZA 1CHDA 3THOA 2WYIA 1TM2A 4MW5A 1NQVA 1OFHA 1YR9A 3TS1A 1K7SN 4UPEA 1K9VF 5EXTA 2W6ID 3RODA 1E1LA 4URFA 1P8AA 4EHKA 3A2KA 5EKXA 5CCDA 4JR1A 2E4UA 1IWBB 1QKKA 3WI7A 2BCGY 5KX5A 1WD7A 4PLVA 4UHDA 2Q3BA 3E5NA 3HDGA 1IN8A 2C0QA 4FFVA 5FPYA 2NZYA 1BH2A 1GG5A 5LQCA 3W1VA 4KPYA 4MDFA 2V3CC 4F85A 3GG9A 2G36A 2WU0A 4OV6B 2Q0HA 1LWOA 1B8NA 4PG5A 1Z2OX 4B40A 3AETB 3M5WA 3DAGA 4U9HS 5E4YA 1C4WA 4RKQA 2MR6A 4YREA 1SVNA 3SR3A 3IB6A 3MGAA 5JYDA 2GPJA 2ID9A 4QRIA 3OPNA 1SCBA 2JFGA 2KM1A 2Z3WA 3R3JA 2Z9CA 5TGZA 1VIDA 1MO5A 4R68A 4CM9A 1HLDA 1HLPA 1THTA 1YI1A 2C42A 2RGNC 2J6CA 2XMCA 1CR1A 2GZDA 3D3WB 3HXKA 1E63A 5A0TA 3K72B 2FUG6 2IEYA 1DBSA 3HYTA 5HP4A 5JZVA 4HWPA 1A4XA 5A71A 3L43A 1SCDA 1UBKS 1LJLA 2AJBA 3OZIA 3PA6A 2HMUA 4LRUA 5E2IA 4PAGA 2EL9A 4PIVA 5JCXA 1RD4A 2JBWA 3KQVA 3O6VA 2CGEA 4O2BB 4PPFA 4QQNA 5H7XA 1VJGA 2VHEA 1KZGB 1OU4A 3RJ9A 4RHCA