2D5IA

The crystal structure of azor (azo reductase) from escherichia coli
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
200
structure length
200
Chain Sequence
SKVLVLKSSILAGYSQSNQLSDYFVEQWREKHSADEITVRDLAANPIPVLDGELVGALRPSDAPLTPRQQEALALSDELIAELKAHDVIVIAAPMYNFNISTQLKNYFDLVARAGVTFRYTENGPEGLVTGKKAIVITSRGGIHKDGPTDLVTPYLSTFLGFIGITDVKFVFAEGIAYGPEMAAKAQSDAKAAIDSIVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Azo Reductase
publication title Three-dimensional structure of AzoR from Escherichia coli. An oxidereductase conserved in microorganisms
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 72
structure length 200
sequence length 200
ec nomenclature ec 1.7.1.6: Azobenzene reductase.
pdb deposition date 2005-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02525 Flavodoxin_2 Flavodoxin-like fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2d5iA00
4FGJA 1QRDA 5LJLA 4YAOA 4QOFA 1FX1A 4YAUA 1JA1A 3U7IA 1CZHA 2KQUA 1BU5A 3L9XA 1YCHA 3ESZA 2QX4A 2OHIA 1H69A 2Z98A 2QX8A 3HA2A 2RG1A 3B6IA 3S2YA 3W7AA 2QX9A 4N82A 1ZX1A 2FOXA 4YAFA 3QFRA 3GFQA 1J9ZA 1J9EA 1FTGA 1NNI1 4FGLA 3O73A 5LLDA 4LAFA 3F90A 1B1CA 4H6PA 3LCMA 1XYVA 5NULA 1XT6A 1D4AA 3GFSA 1FLNA 3W79A 5FA6A 4CETA 1SQSA 4ZVMA 2QR2A 3RPEA 2Z9BA 2ARKA 1CZLA 2BMVA 3NHYA 2GSWA 5F4BA 1ZWKA 5LVAA 3OWHA 1CZUA 4NLLA 1J8QA 3UXEA 3SVLA 3D7NA 3NLLA 1CZKA 1QBGA 4U7HA 3EDOA 4ICIA 2FZVA 3F2VA 5F51A 4LTNA 5EAIA 4DIKA 4QODA 1T5BA 3OX2A 4CF6A 3K1YA 4YALA 3FVWA 5BUCA 2FDXA 3NHRA 1FLDA 2Q62A 1KBQA 3JSXA 1XYYA 3OX1A 1C7FA 4R81A 1F4PA 2BF4A 5NLLA 4LTMA 3TEMA 2A5LA 1FLAA 2XODA 4ESEA 2B3DA 2BN4A 1CZNA 3KAPA 5ULLA 4C0XA 3TE7A 2MOKA 1D03A 3U7RA 1YOBA 4ZVKA 1OBVA 1FLVA 2M6SA 3ZHOA 1RLIA 3NHLA 1KBOA 1AMOA 2OHHA 1AKTA 2FCRA 4PTZA 1D04A 1FUEA 1YCGA 3B6JA 2QMZA 4DY4A 3NHJA 3NHKA 3N3AC 5JROA 1YDGA 5LJIA 3NFRA 1WSWA 4HS4A 4C76A 3K20A 1SG0A 3N39C 1H66A 3GFRA 3ESYA 4S24A 1QR2A 4OXXA 3FX2A 1YRHA 1AHNA 3KLBA 3OJWA 2FAXA 2WC1A 4GR9A 2OYSA 4QOIA 4LA4A 4XDGA 1GG5A 4Y9UA 1I1OA 1QHEA 1DXOA 3HR4A 1YCFA 4QOHA 2D5IA 1ZWLA 2BPOA 3L9WA 2X2OA 2V5UA 4Y7CA 1DXQA 1BVYF 5TGZA 4FGKA 2V9CA 1CZOA 3FW1A 3TZBA 3FJOA 1RCFA 4DILA 4YAWA 1X77A 3ESXA 3KAQA 1RLJA 4YQEA 5LBTA 1TIKA 1AZLA 4QOGA 4ZVNA 2X2PA 3ES9A 5F12A 1FVXA 4ZVLA 2QX6A 4HEQA 2FLVA 1TLLA 1YKGA 3QFCA 2OHJA 3GAMA 4GQIA 2FVXA 3OX3A 2HNBA 1T0IA 4F8YA 1AKVA 3NHSA 3NHUA 3N3BC 3OJXA 5LMCA 1OBOA 3NHWA 5EA2A 4XDHA 1AKQA 3LT5A 5FX2A 4J8PA 2Z9CA 4Y9RA 2Q9UA 1XI2A 4PU0A 5B3KA 5FUQA 2V5VA 1VMEA 3NHFA 2FX2A 3EYWA 4QOJA 3HLYA 4C0WA 4BMPB 3W77A 3OWXA 1CZRA 2N1MA 2Z9DA 1DX9A 2F1OA 1AKWA 2ZKIA 4FX2A 2HPVA 2XOEA 3QE2A 2HNAA 4C14A 1AKUA 4N65A 2QWXA 2W5UA 4U7GA 3W78A 3F6RA 3UXHA 2MWMA 4LTDA 1AKRA 5A4KA 5EMNA 2M6RA 1JA0A 4M0CA 4QOEA 4NULA 3G5MA 4GI5A 2AMJA 2BZSA 4BMOB 1WSBA 3B6KA 4D02A 1V4BA 3O2NA 4H2DA 3KEGA 3F6SA 3OVMA 3B6MA 1J9GA 2MTBA 2MT9A 4N9QA 4PTYA 3FNIA 3P0RA 1C7EA 2R97A 1AG9A 3R6WA 6NULA 1RTTA 1E5DA 3NHPA 2QMYA 1OFVA 5LBUA 2R96A 4U7FA 5B3LA 2FZ5A 2KLBA
chains in the Genus database with same CATH superfamily
4XQ0A 5DHFA 4JJIA 1TUBB 3WGHA 3WGQA 4HNHA 2H5JA 5FLXA 2ZUUA 1TCUA 3GJQA 3INGA 1PDOA 2V7WA 3KOUA 3NALA 4HGOA 4QRIA 2I4TA 4RHTA 4UULA 4DJAA 5L7TA 2HOQA 3AHIA 3SZUA 4RAOA 5BSEA 4U2BA 3D8SA 4DC0A 3QEBZ 2ZYUX 2G5CA 3O9VA 5E0OA 2BFOA 1IEXA 3EIXA 3FYHA 3R0JA 4M0UA 3BE4A 3A2LA 3HU1A 2ZWIA 1R74A 3PNOA 4RLSA 2RARA 2H7XA 3GMDA 4Z9BA 2Y1OA 4E1AA 2B5WA 3SX2A 1JNYA 2G88A 2HDHA 2G9QA 1PCXA 3IPCA 2W8BB 5KIAA 4U0JA 1JIJA 3EWNA 2P6UA 3AESA 3UV3A 4QGFA 3BJEA 3FOZA 2WT4A 2JFNA 5LB4A 1VPLA 3T5MA 4OLBA 1W87A 3I30X 4OJYA 3S2YA 3QVUA 4G24A 5T4FA 3QFTA 1M6VB 5A9SB 4COKA 3PUJA 1CNMA 1TQDA 3PFNA 2G67A 3LWBA 2RGRA 1GT6A 1ZK3A 4Z1MA 1BHQ1 1SULA 4LX8A 1H2XA 1T4CB 2JHGA 3R09A 1U3CA 1X7HA 2CNWD 2QYSA 1ZX1A 2VHZA 3SEFA 4TTJA 1NW8A 2F90A 1N5JA 4F4CA 5A0FA 1LW6E 5D01A 1FEZA 3QV2A 3M9WA 3ZHBA 1Z4KA 1ZD8A 2R8PA 1YZNA 3RTBA 4IHJF 2UXCB 1PLKA 3DBHB 3EDMA 4H1WA 1FRFS 3ORQA 2J07A 1ZISA 4JA0A 4CTNA 1UC5B 4K8OA 2PGAA 3Q2OA 1VOTA 1Z88A 4HDNB 1QM5A 4R4JA 4WZAE 1T0JB 3H2BA 4JI3B 4AJJA 5ARBA 3N1UA 3F90A 5DXFA 3VH2A 2B8TA 2IEYA 4MHTA 3IUEA 1Y5NA 3A6KA 1OX4B 3LC1O 5DWDA 4FJ1A 2HGSA 2NO5A 1C1HA 4KPEC 2AF4C 2V4UA 3MRVA 3ECCA 4RYDA 3KKEA 3L6BA 3WAJA 3RTDA 1XDBA 3CLRD 3PEFA 1XL0A 1UM9A 3GFSA 4YV1A 5C1PA 4L9AA 4ZVSA 4IRXA 2Q2NA 4X63A 1EGVB 2J85A 2PO7A 3GK3A 4HLQB 1MA0A 2HF9A 3W79A 1AV7A 1AUXA 1ZKMA 3ENNA 2B94A 4UE3S 5HIMA 2CVFA 3B36A 4FCCA 4IDQA 3KQHA 4PRYA 3KYCB 3T06B 5FKJA 1NXXA 2Z8YM 2BP7B 4WKNA 2X3YA 3PTAA 3RVLA 1QVVA 4KK4A 3G8DA 4HYTA 3VI4B 4DLSA 2C3PA 4L78A 4OQXA 1O95A 3IAAA 3LLUA 4QUJA 4BO8A 2XUQA 3D7MA 4LDAA 3V4ZA 4B84A 2FPKA 2ZI7A 5SZHB 4F8EA 5BW8A 1YVDA 1HEUA 3E4DA 4ND1A 4FC7A 1KFBB 2BUCA 1TW2A 2X1LA 2M6KA 3W5JA 3MC1A 4DMGA 1GGEA 2M1XA 3IT2A 4O1IA 4PBSA 3SBDA 2PRYA 2Q7OE 3R23A 3COSA 2ILVA 3SE7A 4JV5B 5E0KB 1E69A 4RENA 3UJDA 2IYFA 1WLYA 4BVGA 5H4GA 1T9GR 4GOOD 1GKYA 4M76B 5FB3A 3IL2A 4OJTA 2PXAA 1EM8A 3MK31 4F4JA 1BGWA 3D6AA 3G0BA 1OHHD 1X7ZA 1O2DA 1GCOA 2E21A 4ARAA 1H6DA 2OORC 4FHEA 1SHTX 4L9SA 1GIAA 4PRLA 4W1SA 3N7UA 3H6HA 4RHCA 1DJPA 1TRKA 1W2WB 4KQ2A 1JEYA 1OBFO 3CRRA 2R1TA 3F2VA 5EP1A 3K92A 3ADDA 3LAWA 1K08A 2CUKA 3DD5A 4B47A 3L7MA 4R2XA 4IYJA 2G5TA 2RGWA 3IEMA 1DIBA 7REQB 1N1EA 2FWRA 4GPEA 2CXOA 4NMMA 5CT6A 1IEVA 3F78A 3OX2A 4WOPA 4AF6A 1N0HA 5DM1A 1YDMA 4NZYA 3BAZA 3RGGA 1VZ2A 1XLTC 2FMKA 3I39X 4LF6B 2FDXA 2QW0X 2W2TA 2QRZA 2IUFA 1QGYA 4RVSA 4OQPA 3JD2A 3O8QB 4Q4LA 4QGBA 1QCYA 5JD5A 5TNXA 3IP7A 4RL6A 3ZLVA 3FPFA 4S1VA 3HYNA 2LR0A 4JP1A 3RKSA 4G89A 5FRDA 5IC4A 3H6GA 3VYWA 3ZWVA 2WAAA 1MC5A 2W6OA 1FRZA 1Z2NX 3L79A 4P7KA 3KO8A 4TUYF 1D2HA 3HB7A 4LYJA 4TRRA 4Y7DA 3UUWA 4KXNA 4CM4B 1USIA 2VDNB 1I3OA 2WSSD 3QOXA 3H5AA 8ADHA 5DTRA 2XWQA 1DO0A 3ZBPA 5GJBA 1MDBA 3KL2A 2NTJA 5HHTA 1QKJA 1Q95A 4G84A 4I55B 4RF5A 4FR2A 2C9YA 2ZB8A 3KK0A 1Y3DE 2C31A 4YUZA 3ZQUA 4WXYB 1Y80A 4X7MA 4DV5B 4NJMB 1UANA 1QOPB 2GF0A 4KBGA 2KM1A 1VL6A 2VHVA 4IQ0A 5EZSA 1W2GA 3H4IA 1R4NB 4C7BA 4RTMA 3NC0C 1V96A 1XVVA 4WGGA 4I3FA 5C53B 4GWGA 1W96A 3E3LA 2EP8A 4HBZA 5GGXA 5B6IA 3VKHA 1HDGO 1MOZA 3ONDA 4QNRA 4IOJA 2QTNA 4Q3KA 5EE1A 3IQGX 5EESA 2BI8A 1ACJA 2QLNA 2XE8A 3T34A 4EEXA 2VBCA 1Z18A 3CLUD 3MWKA 4Q3OA 3D43A 1KI4A 5J2UA 2AEJA 4DEVA 1NW6A 4AKSA 1SXJC 3CUKA 3L1KA 2JKYA 2I66A 3EGWA 3W2EA 2ISQA 1AKTA 5LIRA 3IYLW 3KUKA 2IYAA 2YZ7A 1JLLB 1U0RA 4WFQA 1RWNA 1FUEA 3OKAA 4LJKA 4TOIA 4L4RA 4ZQBA 4IFBA 3BD7A 3ZY3A 5C7IO 5JS7A 1RBMA 3C97A 3ILVA 4CEHA 3MJ4A 1XEAA 2QMZA 3MQFA 3JQQA 3GELA 3C1AA 3I62A 4B7UA 4O0LA 4YUYA 3KOZA 5HJ2A 3BCSA 1JHZA 2E1RA 4KQEA 1ADGA 1YR6A 4DMMA 3N2GA 5D3QA 4XDZA 1US8A 1VC2A 2JPDA 4MP6A 5ALZA 5DM2A 3LGSA 4LWQA 1RJWA 3QUBA 3B13B 2D62A 3MILA 4Q48A 3A32A 1DWUA 3C1OA 1JWBB 3RFXA 4TZTA 2BD0A 3ZIDA 1W0JA 3HKDB 3DE3X 2F1JA 4AP6A 4FMPA 1NHGA 4UTZA 4XH9B 4PGFA 3GY0A 2A9FA 4RY2A 2YHSA 5K0LA 3HL4A 1KAOA 5CD9A 4RTQA 3E48A 2DQ4A 3B1KA 2RHTA 3HYCA 3CC8A 3OE4A 3C8ZA 4ZVRA 4JNCA 4URXR 1NLFA 7MHTA 1P1IA 4LBZA 4HXYA 1GQYA 3DW1X 2RGNA 5G3YA 5CA0A 5D7BA 4W1RA 5LP6B 1S2DA 4XDYA 1X8XA 3GQBB 1EWRA 3Q9NA 1OKKD 4GKKB 3VR3A 2O7SA 2GPSA 3Q8WA 2GAFA 4ERNA 2TYSB 2X0IA 3A1CA 3ASYA 5IBCA 1PGJA 4WASA 2FGJA 2AKYA 3DZFA 2XA1A 3SZGA 3IAS1 1Z17A 4KU4A 5G1OA 1F12A 5G4LA 1IUKA 1GGMA 3NCTA 4WXPA 3STXA 1EXDA 1GNQA 4E33A 3SG0A 4KRYA 1GV0A 4G6ZA 4MA4A 4E08A 1ND6A 1TF2A 4IXMA 1M5UA 4Q16A 4QFMA 3R20A 1ACLA 4JBWA 3LHKA 5EXDA 5JTUA 1F7UA 4NMWA 4Y7CA 1T3SA 2JLBA 3VO8A 2G3YA 1DTWB 2FYTA 2XTAA 1BVYF 4OHXA 2C9CA 1SC1A 1DIGA 3HWSA 1MNQA 5DEIA 4HFJA 3CKKA 1YI1A 4ZHQA 4LG1A 3VR6A 4NOMA 1X80B 4Q4AA 2XUKA 4NFSA 4UMDA 2OV8A 2ZSJA 3C6ZA 1GAXA 3CJTA 3U1BA 3DKRA 3IR6A 5A7FA 2FR1A 3PNLA 5EPEA 3I58A 4LF9B 4EPXA 5CCDA 1ZYUA 1UJ4A 5E7IA 3TR6A 4ZVNA 2HWXA 3HRHA 4H6XA 3VPGA 1BOOA 2FEOA 2NU6A 2WJ4A 2XDQA 3DQZA 1LRJA 5IF9A 4OJNA 4WJLA 2HZ7A 3VX4A 4ASUD 4ZCQA 1VKJA 1GHTA 2BJHA 3ES9A 1UMBA 2OECA 4GI1A 1AGNA 1D9ZA 1SA0B 2CL6X 3QE4A 2XH8A 3CJRA 1YMVA 3CVJA 3M1YA 4EYQA 4XZ3A 4RWEA 2WAOA 3U7HB 3OZBA 4C87A 2G8LA 4LDRA 3WV5A 4C89A 4ND7A 4HXEB 1FDWA 2BMJA 1M5RA 3PR1A 3IPRA 1HYBA 3GAMA 4KSBA 2FVXA 4O5OA 4CU5A 4L4XA 4UQOA 1E2MA 1R0SA 1V3TA 4Y9DA 1SU4A 4RMHA 4C3VA 1L4LA 4YACA 5HZHA 2Y4OA 3OQNA 1XG5A 1T5DX 1HT0A 2WJWA 1YR7A 1E4EB 3P2KA 4DJEC 5J5AA 1XDDA 5EVJA 1AHHA 3QELA 5EOVA 5IASA 1G8KA 3HFRA 1YRWA 1FMJA 3TBKA 2Z30A 4U2KA 1DJMA 1S3SA 1N6KA 1JT9A 1BO6A 3EGDA 4BNKA 4YT8A 1P3DA 4MDEA 4ZAXA 1QS0A 4RY0A 2WZDA 3VSCA 1K7XB 4E12A 1M8KA 3N70A 1RRKA 1LI5A 2X8WA 1QRRA 4IR7A 3AR4A 3AJEA 4TS1A 3L7LA 4GUAA 2YW2A 4QVKA 4K6HA 3HBNA 1EXWA 1U0EA 2WKQA 5ALQA 2XJ4A 5JMTA 1SIOA 4B6EA 4PYLA 5AHKA 4KRGA 3W77A 1P2UA 3CUSA 4HYYA 3FPBA 4EG6A 2JAQA 4AMVA 3D31A 1CZRA 3OEWA 3GHYA 4B7CA 2G1UA 1WHSB 5REQB 3SHWA 1JL3A 4EB6B 2BYTA 5ED4A 4FFSA 3DKKA 5ALFA 3VZRA 2QLFA 1F2UB 3K0KA 4TTRA 3NDBB 4LJ4A 3DXYA 4Y2PA 1U6KA 4Q1EA 2EG9A 4M9CA 3VU8A 3MBIA 3IP9A 2HU2A 1KMCA 4RMIA 2HHJA 4XTCS 4ZRNA 5C8YA 3O0TA 5DYGA 3PITA 2RAFA 4C04A 2LBPA 2Z5FA 4C88A 1FSPA 4DA4A 4G9GA 3I6QA 1HH4A 2WUWE 3S28A 4OMFG 3HSYA 1OI4A 2DHEA 4U2CA 1UAYA 2WA1A 2EHDA 4G1VA 3EE6A 1UC9A 4N41A 1FNBA 2OAQ1 7MDHA 5AW4A 3R6TA 3PXCX 4G0PA 4F8JA 3HJHA 1ULUA 3OEYA 3U44A 3D6JA 1U0OC 3M83A 4XD7A 1SBNE 5E2AA 4M8LA 1ECGA 4YRRA 3ZZUA 1DCMA 3A4MA 3ZKWA 4KIJA 3UJ8A 4EY8A 3WZ2A 4LY9A 1E3JA 3MT0A 3AINA 2JHFA 1QO0D 3QU2A 4J3JA 3NBQA 3BRQA 3WFJA 2GZMA 1MABB 4NX2A 2JFWA 2Q07A 4ZEXA 3ECAA 1INLA 3CEHA 4O29A 2QP9X 1NIJA 2FPIA 5E95A 3WO0A 2PE5A 1GA4A 1RWPA 2AFIA 4PXSA 4TMTA 4E6PA 2FPUA 3IC5A 1U0JA 2Q3LA 1P80A 5JZMA 2H31A 4MKXA 5CBPA 2C29D 4JQZA 4NPHA 5FBZA 4DJTA 4M7RA 3ZYCA 2F3QA 1WABA 3BSSA 4TROA 2PSEA 1JNXX 2Y2VA 3A25A 2B82A 3RHTA 4J90A 4GZ5A 3GYGA 4XGIA 2VPYA 1ZGCA 3GGPA 3PQ4A 1QIFA 3ROEA 2ZI4A 4HAOA 4B6OA 2JFOA 3CX4A 1EKXA 4QEDA 2IHBA 4KQKA 3RUCA 2D7JA 3W90A 2DHCA 4HMPA 2JH3A 3U3JA 1OH5A 2J6IA 3EG5A 1YC5A 4ARIA 1CEEA 1A9QA 1J9GA 3RUDA 1DC5A 2GBPA 2A0KA 4QECA 4CTOA 4M1ZA 3D7SA 3DLBA 4LIPD 2OZEA 2B4AA 5ANRB 3Q7EA 4AJHA 4AP9A 3OFVA 4LBYA 3PX3A 5LZ5A 1B0PA 1S8AA 2VEOA 3AIOA 4LXHA 1JIVA 4L0MA 4AZWA 5JAPA 2VT6A 4NMLA 3RADC 1Y8CA 1T5TA 3EF1A 4Y2YA 3M5PA 1Z2EA 3GRAA 4K86A 4CLXA 1NJ2A 821PA 3G2HA 2HA3A 2GTHA 2Q5HA 3IAS6 2RJOA 2JIRA 3WXMA 1ID8A 1BXRB 4DQUA 1M7GA 1T3GA 1D6NA 2JGRA 2SCUA 3O1IC 3CZ4A 4BVEA 3QSYA 3KNZA 1G4UR 4U7FA 3JAKB 1RE0A 2G0AA 3BKXA 3JD3A 1EWYA 4CMJA 3PD0A 3NHMA 8GPBA 2C2MA 2CXNA 2VBGA 3FYUC 3U7JA 3TTXA 3H6KA 1JR2A 1YJ8A 4J0IA 5AKZA 4MHSA 2H11A 3MXOA 1BXGB 4RJ2A 1WCV1 4PIPA 4QOFA 4CM6A 1NP6A 3CPEA 1TCBA 3V7WA 2CWWA 1CQZA 3PGKA 3HRIA 1AQIA 4W8HA 2NZUG 1Q0RA 5IG2A 2O8EA 1M8GA 4MHOA 5F21A 1YCHA 1CQPA 2HHCA 3ESZA 3C5VA 1IE3A 4MGKR 3ROMA 4BU1A 3ZUGA 1ORVA 2RB5A 1S8FA 5ESXA 3TD2A 1T5OA 2JGJA 5EJ2A 1YU9A 4ZDIA 4M3NA 4Q66C 2K2WA 4PSKA 1DI0A 1KJNA 3AIMA 3R3ZA 4MP8A 3RREA 2B6HA 5C32A 1P77A 3IODA 1RXCA 5HYVA 4E5MA 3SLGA 4LEIA 1GGVA 1JAIA 3P4YA 2P40A 4ZMBA 3FHCB 4RTNA 3CXRA 2FCAA 4IPTA 4L8FA 3L06A 3BMCA 3ETLA 1CUVA 1PF7E 1M83A 2BMFA 2EGGA 3EASA 5GONB 4P7JA 3M33A 3AT1A 2XKAA 1B43A 3H1BA 3UJ7A 3ENVA 2QDXA 2XZDA 4LKRA 1G41A 4BYMA 3MTGA 1TK9A 1Q21A 5JCOA 5F5XA 1ZN7A 5KYGA 1NVAA 4FWBA 3QFRA 3VVBA 4AO7A 3IA2A 2XT0A 3MWFA 4LNAA 2CN1A 5KOHB 1KEUA 1AXGA 2X41A 1AURA 1M3SA 2Q8NA 5DYNA 1YJBA 4NJEA 3W7VA 1NI5A 1ECLA 1REQA 1Y5IA 3LK6A 4P3YA 4P86A 3BZUA 1KYWA 4EHHA 4KLAA 3GJSA 2VXYA 4X7PA 1EEHA 4QQ8A 4IHAA 1SWWA 3FMFA 2D0DA 4H6PA 4WY8A 4GIBA 4X66B 1XYVA 2PRIA 2V7EA 1C81A 4JAVC 4W9RA 2C2WA 3RC8A 3DAOA 5I8WA 1J39A 2R60A 3RYFB 2CF6A 2VQDA 1XQ6A 2YNMD 3FFWA 3T12A 1UBSB 1GR0A 2J9FA 2IV2X 5M2QA 5DMHA 3QW2A 3BRWA 4PGMA 1XQYA 4UTXA 4QNNA 1ZJ4A 3FMOB 2PXXA 4KSYA 3UXMA 3T4EA 3MOGA 5LYYA 2GEBA 3FSGD 4D9KA 1MCZA 4IG9A 5DBGA 2H2FA 1PN3A 1FCJA 3GCZA 4BKPA 1UXGA 3GLUA 2DX7A 2QAGC 4KP7A 2BIFA 1CWUA 1A96A 1T9KA 2O8NA 1JH9A 1TJ5A 1MAUA 3PEVA 3FTFA 5G41A 2O54A 3Q7IA 2A88A 2JAUA 4K9KA 3PHLA 3KCQA 4I4TA 1PW5A 4MVJE 5TB5A 4DV2B 3EEFA 4PCUA 1JDJA 4RK0A 1V1JA 4PSUA 1V7CA 1JJVA 2HFJA 4LC1A 3V1TC 3AVUA 3B1FA 2GFIA 3A6ZA 4M7PA 2ZIVB 2Y3IA 2IIPA 1L4MA 1ADFA 2WF6A 3P0IA 1NMEA 1PFVA 4MCJA 5MN4A 1XQ9A 3VPDA 3L0BA 1YL5A 1WUIS 5K8CA 1KEKA 2WLTA 1YIDA 2XUZA 3LCVB 1CD5A 1GPYA 3QHPA 4PX5A 5ALSA 5AKKA 5CMLA 1CVIA 1QBGA 3KQQA 1SO8A 3KT6A 4PZAA 3RVMA 3WQQA 3AF4A 1G6OA 2OGSA 3H2KA 4XQ9A 4Y2VA 2AN9A 4LMBA 3UWMA 2H6EA 4A2QA 1X87A 1S2OA 3HCRA 1NV8A 1NULA 2BGMA 4Y2RA 4PGHA 3FFTA 4KWTA 3RT9A 3B3FA 1DCFA 1U2EA 3JZAA 4G26A 1F8XA 1YUNA 3S81A 1WHTA 4CV2A 1E2NA 2AOWA 4XQCA 3B1XA 1W36B 2P9EA 3PTLA 1HYHA 2OKCA 2HU8A 3A4IA 3DMPA 4MUYA 3SICE 4N03A 8ATCA 3DDWA 2Y8EA 1ZM7A 3DC7A 3UAVA 2QUZA 3FUTA 3KWLA 2RONA 2Q4EA 1Y1PA 2VDWA 3FNHA 4Q93A 5EZYB 2Q6IA 4FWTA 2JLXA 2ZRMA 4OK6A 1CQJA 1GQOA 3LYHA 3UHOA 1QO9A 4P3XA 1C7FA 3UWPA 1Y3FE 1TM4E 5DHQA 1RE1A 3R40A 5AH0A 3IKLA 1CJMA 4GWKA 2PH1A 2YOGA 4WLUA 5B55A 1KZGB 2Q2QA 4PRZA 3O3MB 1ISGA 1EX1A 1C9YA 3BIJA 4RMNA 3WYBA 3JQ9C 1Z4JA 1PWYE 1A8SA 2VT7A 1XTIA 2VP6A 2JI4A 3PPVA 1OIWA 1VCOA 1C8KA 1JWAB 1FUKA 2FX3A 4CIWA 1CRPA 3FE2A 3VOSA 1KI7A 2IW1A 3IMGA 3TE7A 5P8WA 4Y6PA 3AP2A 5A71A 4TSFD 4PN3A 1AU9A 5C7YA 4PYIA 1HLFA 2HJGA 5CYFA 2FFRA 5FYDA 1GNLA 1KMHB 2OCIA 2HIHA 1UJ6A 1V7ZA 3I09A 4FLFA 2ZJYA 3WLAA 1T3ZA 4MTLA 3QKRB 1C8VB 2OAEA 4X71A 2VQEB 1M73E 3LWZA 4MUHA 2J59A 4UOZA 3HDYA 2M6SA 1W59A 2Q2WA 4K9NA 2Z8YA 3G88A 4IG4A 3ZHOA 4C03A 4C30A 3ER8A 2EV9A 3FYCA 1KY3A 1SG9A 1XFDA 1XTRA 3HKBA 4MPPA 4JH0A 2R0QC 1UT8A 3IHLA 1IM2A 4G41A 2DBYA 2REQA 3PNKA 3H16A 4L73A 4ZOBA 4YCCA 4FM9A 1NN0A 2A1IA 4O2BA 2FPMA 3MOSA 3L2OB 3RIMA 2VSXA 1NKTA 1O9GA 4UNPA 1IHDA 3WX0A 1WZNA 5FA5A 1NQOA 2PZEA 1T8RA 2Z6VA 4REQB 4DCOA 4BDTA 4D9CA 4BE7B 1D0IA 4QJBA 3SLKA 5ALEA 3JQPA 2O4UX 3HBFA 1ZMXA 3AV3A 3NDPA 3DMTA 3VM6A 3LLSA 5BMVF 3RYIB 1VMKA 5AVYA 1B0AA 2CK3A 2LRHA 2GZRA 3KKMA 1C4KA 3NC4A 4OQDA 3JVIA 3NBYC 4XGNA 2OGTA 2W2KB 1FU4A 3G9ZA 2HIAA 2PKWA 1Z38A 2XB8A 3ICVA 2GAJA 4XWOA 4LSZA 4AY2A 4H0NA 4JVMA 4NENA 1H3NA 2CMFA 5DK6A 4B35A 4AF8A 1KFEB 3I4CA 4JWTA 4X64B 2VWPA 2O3QA 3PXDA 1H2YA 2JJMA 4QGHA 1CJKC 3T9FA 1Z4IA 2J9XB 4QU5A 3MJSA 1BN7A 2J6BA 1YB4A 1LWNA 2CB0A 5HM8A 1MFPA 2PUCA 3WFIA 4OFBA 3ZNOA 2AF3C 3HJGA 3OG9A 4G8DA 2PTGA 4PO1A 4B4DA 4P58A 4PRKA 4EVIA 3CINA 3KVVA 3TQTA 1RYHA 3CEJA 3L6UA 4ZCSA 4GR9A 4KFSA 4JUIA 2QP3A 4OQLA 1H6CA 1BS9A 1AGXA 1YQDA 4DADA 1JVSA 3ITKA 4A0QA 5FQOA 1WY5A 5BN1A 3OIGA 4F11A 1QHEA 1RWBA 2QV7A 3ZZTA 5JDIC 1JHQA 1WPXA 5TC4A 1RP7A 2WPDD 3QV1A 1VHTA 1JDZA 1M1NA 4XB2A 1FSZA 4EX6A 4PLVA 5K0FA 2ID8A 4TTTS 1W46A 3NXSA 4KE7A 1JQ3A 2R4TA 1QIMA 1BRMA 1SEPA 4MKZA 2WYIA 1LDEA 2YJNA 3QPAA 3DTVD 3FF1A 5C80A 1PR5A 4AUKA 4PSDA 1GDDA 4LFCB 1VRCA 2IYSA 2PO5A 1LNQA 5TRTA 2RKBA 3LZDA 3MM4A 1QV7A 4HQKA 4F2HA 4FGKA 2CV2A 2CYAA 4NONA 5ECGC 3S55A 3TJRA 3ZQKA 1B15A 4KUGA 2HY7A 4W8GA 1K86A 1M0TA 4Q1VA 2EBHX 2XQVA 3ND8A 4XR9A 4YTEA 5MN5A 3K4QA 1EZ4A 1IRXA 1CP3A 4M6WB 2AI3A 1VE3A 2YYYA 5JBQA 4AY5A 2ZSHA 3VNAA 4MW5A 3BMQA 2QVCA 3FA2A 621PA 1SU8A 2BFDB 1X86B 2WQ7A 6REQB 1XMPA 4AY4A 2ZIXB 3KXPA 4KACA 3UXYA 2DTXA 3LDHA 3HXMA 1R12A 3AEKA 4WIAA 3UC9A 3LP8A 3EGXB 1G5FA 3BJRA 3M6WA 4M8IA 1D4ZA 1TCVA 4MW2A 2O2CA 2HMSA 1IWPB 1VE9A 1Z7EA 3OF3A 3C45A 4AYWA 4BJ1A 4EHDA 2PU5A 4PY2A 3TAXA 2DPLA 4ITVA 1OGIA 3K5PA 1L4YA 3AUTA 2ZJ5A 3PDHA 3DZ8A 2J3IA 1XRSB 1I33A 3OZWA 4XB1A 1LNSA 3ILSA 3LF2A 2IEGA 3L0DA 3WL8A 3DEJA 5DTEA 1PR4A 3KAJA 3W0LB 2ZSIA 2WIBA 1NF3A 1KOLA 4MQEA 5I5EA 3HJTA 4M0KA 4X1IA 4JLVA 4EECA 4LBWA 4MXDA 2JFHA 3K1JA 1IQUA 2C1XA 2COUA 2M98A 4EELA 5J58A 1OVGA 1WDTA 3I2YX 4GOKA 5IN5A 4CL2A 2VHYA 4GYWA 4BNZA 4CZ2A 4YAJA 1OR8A 4G0UA 1XXHB 4WCDA 2AK2A 2CVZA 1XQVA 4RCYA 1ZNXA 1L8OA 5FX2A 1ODFA 4X9XA 4Y9RA 1O6ZA 4K9SA 5E9AA 3E03A 2HBZA 4EAQA 3QLVA 1A9RA 5FUQA 1C3LA 4UPVA 4C08A 4G0ZA 1P9NA 2GT1A 5K3DA 2VHXA 2VK2A 3H4VA 1A2KC 5LKRA 3KHKA 4KE6A 4DB2A 5CLFA 4MRMB 2GH1A 3IQFA 1E3TA 2IZZA 1N2CA 3RTEA 3RIYA 1W47A 2VBIA 1YA4A 5L4LA 3GT3A 3EGCA 2J0SA 3EMBA 2M2IA 3W3AD 3CURA 5LUBA 4D4JA 2RBEA 3FNBA 1EVLA 1QIJA 1CX9B 3KYJB 3VYTB 1F4LA 1KYTA 4MR9A 5GAJA 2XXJA 3K2BA 4CG3A 1II8A 1OA1A 2ODTX 2SBTA 3BWXA 3ER6A 1GILA 2AH5A 1Z6AA 2BMAA 3D6FA 5HWSA 3AVWA 2QAJA 2C99A 2OWEA 1DTSA 4HAUA 1VQ1A 1P4SA 1A9XA 1QPGA 1QJCA 2B7CA 4AJ2A 1Q1QA 3CKLA 4PW0A 2OB1A 2GN2A 4L4SA 1JXAA 1QONA 3GZJA 4HRYA 1USWA 4O6VA 4EFDA 4UOEA 3CVXA 1T2CA 2X0DA 2QM3A 1GP2A 2Y71A 3GVHA 3EPKA 3FCXA 2JFVA 1QG6A 3CWCA 5JV5A 2EHJA 2BEUA 2QM7A 1G7CA 3FKSA 1OH8A 3D4NA 3KQOA 4EUEA 1SU6A 2W83A 2GASA 3K4HA 4FNMA 3N28A 3B5JA 3BFJA 4G5YA 1WCIB 3PI6A 4R1NA 2Z1DA 3SKXA 3TECE 4EY5A 2O1WA 1OWOA 2YV4A 4Q6WA 5AW7A 3L92A 3SKYA 2PGOA 1QX3A 4IGAA 4JUAA 2DY0A 3JRWA 5I7VA 1ORRA 3IOYA 1R4MB 3V3TA 4ZPJA 1P73A 5DBIA 1UMCB 3RF6A 5J2TF 4G1MB 1U8TA 3LQ4A 2VDQB 2Z2YA 4QGAA 4TT8A 2C9OA 4C3UA 1GTSA 3DE4X 1FXWA 4AWBA 1YC2A 4B5LA 2YWCA 1OI3A 1TEXA 3PA6A 1CHDA 4WA7A 5CTJA 3U7QA 2F2TA 4R8KA 3OLXA 3PYLA 1KDTA 2V6BA 2YMPA 1EINA 1AOXA 2ZULA 4UVDA 2BFWA 3SYTA 1SHUX 2VNHA 4D43A 2J30A 4OOEA 4XXHA 1XLUA 1G3IA 2ZJFA 1YRLA 1Y7PA 4US0R 1TFUA 4HH3C 5DCLA 1DAPA 1F7VA 3O8BA 4FMCF 1WVIA 2EF0A 4F3NA 2V4MA 4R1MA 4EG5A 4Z2AA 5FTLA 1NTRA 4HQ0A 1GDHA 4G8CA 4GLJA 4A8PA 5CFMA 4PZUA 1TM3E 4X20A 2BLLA 3C4JA 3GGGA 5B57C 3UK2A 1VKOA 5ER9A 3AHHA 3AY6A 4A5SA 1QP7A 4B3HA 1CUWA 3K1AB 2ZBPA 3FWNA 5ECDA 2XWBF 3JATB 4XVUA 3E7XA 1M1YE 3DSRA 5C3UA 3F49S 3OU6A 4LS3A 1V5GA 2VDMB 1B3RA 1E1LA 3T5GA 1T9CA 3LYAA 3EDRA 1KS9A 3ETNA 4TZ6A 1N33B 2DJ5A 4IKEA 1F60A 3NIWA 3GJXC 3BHJA 2P5SA 3CNQS 4OH7A 2Y2UA 3TBHA 4BWYA 2QB5A 1B73A 1Z6XA 2CYCA 3MHPA 3QVMA 1GN8A 1SHKA 2VXBA 2WAXA 1WSDA 5JSYA 1CSEE 2D2VA 4ZOLF 3T9CA 2O2EA 5JJ5A 2LDXA 2ZU0C 3DAGA 3WSWA 3TG2A 2UZ3A 1E9DA 1ULHA 3EVDA 4KB5A 5KOJB 5B3LA 3HRKA 4UUMA 1YHNA 3AF2A 3KJQA 5CD1A 4BFSA 1O0CA 1AJEA 2TRSB 3NEJA 3GDWA 2EKZA 2JIQA 3AU9A 4BVBA 5I6DA 5JNWA 1ZD9A 2KYRA 2QTHA 1M2NA 1TLTA 4LFAB 4I50A 1AD2A 1GL9B 3FCUB 3G5LA 3T9AA 4HGYA 1NF9A 3BSYA 4HNRA 2OO5C 2BRUA 3UO8B 3ZK9A 4IBOA 4ENWA 4ZA2A 1DADA 5FWYA 1E9VA 1QQ6A 1JDTA 4IDEA 4M55A 2NU7B 4CIBA 5ITVA 3KLOA 3QF7A 4OOFA 3J81k 3HXKA 3OO1A 3HP4A 4QT4A 3FWHA 4QUAA 4YFVA 1XZCA 3ROQA 3O75A 2WIDA 2XUGA 3G0IA 3LLCA 3X1XA 2ZDHA 1NY5A 5JWRA 1BKDR 2I6GA 4NU5A 1YR3A 1E6EA 1Z4QA 2W0MA 3EW7A 1DAEA 2HPZA 4YJHB 1IBLB 3DTYA 4MJLA 3K0FA 3RFTA 2P75A 4LRQA 4KQ9A 5CFLA 5K6TA 4F9FA 1ZOIA 1U3FA 2Y1KA 4FEYA 4B1FA 5JFTA 3TNLA 4N9WA 1JLHA 3QK7A 3DMHA 1LPAB 1XNHA 1CUBA 1ZVMA 2YHIB 4GX5A 5B12A 4RQBA 2VJPA 3TJMA 2FW9A 3UGQA 1XMSA 4X60A 1R64A 1SH7A 3M9XA 4DARA 3KZCA 1D1SA 3ESRA 3GCDA 2PQ6A 3CLSC 3EUAA 4JBYA 4MUJA 4EB0A 4P7BA 5T64A 3W5UA 4J3NA 3U61B 1AUPA 3EY9A 4HAWA 5BXQC 1Y3BE 1Z0IA 3C4QA 3EZ2A 1WWKA 4C0SA 3ZV4A 5D6OA 1NYLA 1T0PA 2IOHA 2P2DA 2CJXA 4RH1A 3UY4A 4D6YA 1C9NA 4BCCA 1KRWA 2IXFA 1E9CA 2A57A 4LDQA 2BY4A 1OYVA 4N0EA 1UPTA 4P4SB 1XHEA 2D1YA 4WBXC 4G0YA 3RTCA 3O9MA 3PDWA 4GICA 4MW0A 4WNCA 3V8QA 4ZYVA 5JU6A 1DWOA 1YBMA 2Q45A 2LIPA 4TQGA 2IBSA 2LXNA 1HE2A 3OFSA 4DYHA 4WAUA 5AVOA 2VYVA 4MITA 4XOUA 3IMKA 3OURA 4E31A 5JYDA 3JAMA 3NU1A 4K9OA 5SYNA 3DDOA 3TDNA 4HXGA 1L5RA 4PZLA 1Y8AA 3P9RA 4R2MA 2I7CA 1TCAA 3HUTA 1O1YA 1X14A 2IZ0A 1Z2PX 1WW3A 2WE7A 3BQNB 4AVYA 5A06A 3OD5A 4NS1A 2HDWA 3QVGA 1BIFA 4PHGA 1BE8A 4XLZA 5KYXA 3LW7A 2TSYB 5D7NA 4CT4B 2XGGA 3PWZA 4D9GA 5KKNB 5I7UA 4QSMA 1PEKE 2XRYA 4I5IA 1KBZA 3K9GA 2VAVA 2GZ2A 4WZBB 2Y1GA 3WIEA 3IUSA 1SCIA 1VL0A 4FYPA 2EYQA 1U2RA 1NI4A 3CNOA 4P7FA 3RPEA 5A5DA 1Y4DE 2EFHB 4Z1MD 3DE5X 5D3MA 1NL3A 3C8HA 4Q7QA 3E9DA 1WNFA 2YJ5A 4ZGGA 2HLDA 3PQFA 5F7XA 4JYBA 4Q9AA 2V7BA 3MWEA 3TB4A 2GCOA 4DIMA 5HKOA 3UJHA 4LMPA 4M0EA 4G65A 3ZBUA 1G8HA 2PK3A 2PZMA 3A2NA 3LX8A 4P92A 4UMEA 4WFKA 4KL8S 4A23A 4RHYA 3C15C 2OL4A 3VZPA 1YWGO 3UCXA 3CONA 2KSQA 4CMIA 3I4LA 3G6KA 1KYXA 4RGVA 1IK4A 5B2ZA 3R6GA 3UXEA 3WDMA 3IAFA 4A0HA 5A6SA 5DTIA 1HYEA 1ZMRA 5JMWA 2I2BA 3DEZA 3DOJA 4EY4A 1Z62A 3JQ8A 4B4WA 3JR7A 4DQ0A 2FZVA 3HZRA 1I5OA 4JQYA 3IIKA 1MRNA 3WIVA 3LQQA 1ETHA 2QW1A 3VC2A 3PUKA 4B71A 4BNDB 3RRZA 2JW5A 3MFYA 4E4TA 1ZMOA 3G0DA 4MO2A 5DHAA 1KI6A 1J5XA 4KFRA 3PX7A 4GSKA 5AP9A 1TT5B 3OC0A 3CMMA 1C3OA 2V3VA 3MFQA 4KE8A 3VTZA 3UCFA 3ZDYB 5TVGA 4FDUA 4J43A 3EW9A 4KYVA 4LUCA 5BUCA 1NBWB 4NCNA 2FRDA 3GN2A 1G21A 3NYWA 1RDFA 4KJZA 1FJGB 2AZTA 2FSVA 2X0FA 2XD4A 4LJLA 1O95D 4LZWA 4TTQA 1PDVA 5TF0A 2VWGA 1XHLA 3ZI0A 3IP6A 1ZKDA 1UKVY 2GO1A 2WNSA 1I0LA 4P4LA 4RUKA 1E92A 3UKOA 1E3QA 2YV5A 1X7DA 3TGWA 1A7KA 3TR0A 2FHSA 2WABA 3OCWA 5B53A 1ECBA 1HE4A 2C42A 1NQUA 4M60A 1SOAA 3TEMA 3NNSA 1DC6A 2ODNA 3EN0A 3KKQA 4Y2TA 3F47A 5HMLA 2FSFA 3T1HB 1GNRA 3GA0A 1ZHOA 4QFBA 2QE7D 2QZJA 5DHUA 4MPTA 1UWCA 3EARA 3P32A 1AB5A 3WGTA 2X5OA 1JIUA 2YZ2A 3FTNA 1LPMA 1PQWA 5CNKA 1YMQA 1MJFA 4H4DA 1VMAA 2W43A 2XCQA 4HJRA 3N8NA 1AB6A 1L5NA 3VX3A 3WVNA 4R69A 1FP2A 3RAFC 4MPDA 4NZZA 2A6PA 1J21A 4R5HA 5ALTA 5AXCA 2LTAA 3EXEB 3NPMA 1FDSA 3T1OA 5KEIA 3KR1A 2G6TA 4ER6A 5DXJA 4W1PA 4YDQA 3PJFA 1DO2A 1UOEA 1GPLA 2WD9A 4B7ZA 1ZINA 2Q8PA 1LF5A 5F7JA 3UJ3X 4ENQA 3LY9A 1MJ5A 2C61A 1MEJA 2TECE 1W4ZA 3V9AA 2ZS8A 4DUPA 3BX1A 2ZBGA 4P31A 3W34A 5FR2A 2QTWB 4QJ3A 2R6FA 4LZAA 4DRXA 1PK8A 5F3RA 4HNAA 1CUSA 3LH5A 1II9A 1K92A 5EP3A 3BBPA 3H8SA 1J2YA 4EVQA 5A5GA 2KPOA 3RQIA 3I61A 4O2LA 1JHPA 1SCAA 3C7TA 3UHFA 4C9BA 4R0MA 2B21A 2HRCA 5CK5A 3GCXA 1AXRA 2PL9A 4QU9A 5BSFA 5ENDA 2QQ0A 4D5EA 3I8OA 4AK9A 1MHTA 1HV8A 1TM7E 5DFAA 1M9NA 2D1RA 3BSFA 3WQRA 3ED1A 4BNUA 4BHTA 3MTEA 1EK0A 1XZLA 2DUNA 2DWPA 5EE5B 5LJIA 2HRRA 5FV7A 1M34B 1QG4A 2DE0X 3CNNA 2W8BA 2Q4DA 1XPUA 1KGDA 1FIUA 5AHRA 3U4CA 5G4KA 1J2UA 3ZVMA 2PMFA 1Q1AA 1PJAA 3HCWA 4Q3CA 3RSSA 3J80A 2WSIA 3I2IA 3SQOA 1EBFA 2BZ0A 4ZQEA 3T99A 4BXOB 1M6VA 2Y1DA 4Z8XA 5AVRA 2XUHA 3ABSB 3PRYA 1T1EA 1Q12A 3ENQA 5LQRA 3D6UA 1EP1B 3TZ6A 2FAXA 1H2AS 2NUBA 2IYUA 2WLSA 4GPAA 1U02A 3SCZA 4M2LA 5DN6D 1AQNA 1S7GA 4W9MC 1W73A 2VCEA 3OQMA 3RS0A 4KJXA 3DLTA 4D7AA 3F98A 3WDLA 1QE3A 2LZ0A 4QGGA 3SX0A 1QZZA 5DBOA 2NTEA 4NZNA 4E1VA 2A67A 2DFVA 1XN1A 5H16A 1NJFA 3G8YA 2ZIUB 3NATA 4FNAA 4QXOA 4Q9LA 4G1EB 2KWIA 1H23A 3NKVA 1UKBA 1I32A 4EGJA 2BUBA 1K0FA 3HHEA 1OX4A 4M89A 3DKVA 4PR3A 3EXHB 5JBNA 1QHGA 4CT5A 3WL7A 3ZS9A 1H5NA 1L5HB 1NSFA 2EKLA 4ILKA 5E1OA 2LNDA 3CCFA 3IP8A 1SBZA 4JDUA 2D2FA 2VSFA 4MYUA 3ZZ1A 3K6SB 1DVRA 2H52A 2A5FA 3U4AA 4FKBA 1MC4A 5EC8A 3TZBA 1VPVA 2C04A 2RAUA 4TT3A 1LPOA 3UB3A 1IVYA 4LOJA 9LDTA 1ZUIA 5SZKB 2VJAA 3TMYA 2BP7A 3BWBA 5JRZA 4MWBA 1EJBA 3FMVA 2Z5GA 1MU0A 1W0JD 3H5IA 2I8CA 4FDLA 4KXLA 1KAHA 2XGSA 4OHCA 1ID1A 2BEVA 2WNIA 3ICCA 4CI9A 4EHNA 3TQSA 4J94A 1UFVA 1XD9A 6ABPA 2O8FA 1DDOA 3TSYA 5B7NA 3OQBA 4CQMB 5IVKA 5BW6B 1RJDA 1HR0B 2VYQA 4ONEA 3VUEA 4HSEA 2IXAA 5EPUA 5A1JA 1QNLA 2AR7A 1T2UA 2VHUA 4FEGA 1S96A 4JY7A 3A04A 3GDGA 1BH2A 1R2QA 1MQ8B 2C5SA 4HEHA 1EFUA 3BG5A 1AE1A 1W9HA 1OWMA 3FBGA 3LRXA 4LHXA 1SD5A 4I0WB 4M7WA 2J0QA 1N0UA 3VR3D 3IVGA 2VKQA 2YWJA 1ZJ6A 1IAQA 1KU0A 3ABOB 1U5BA 3QFCA 1NHWA 1E7WA 2NO4A 4OTZA 1DT3A 5G0SA 4ZZ2A 2X6RA 4QDXA 3OPNA 4RV9A 4RZIA 1RTKA 2ZI6A 3MEQA 1HT3A 3FPHA 2XDYA 3LO5A 2BKLA 4JGGA 4PGAA 5JD6A 1K9SA 3CW8X 2Q1SA 1ZA2A 3OUUA 2XSZA 3FSJX 1DAHA 3OJXA 1T2DA 5EFOA 3GLTA 4LMRA 2B34A 2PS3A 1SUDA 2QSZA 2FWMX 1H9BA 1TC1A 3ORRA 4MIKA 3WMWA 2CJWB 7REQA 2FEPA 1J1UA 1AKYA 2ZQZA 1MPXA 2C4VA 3QTTA 3LJKA 5EP2A 3TLKA 4N76A 3DGEC 3VR6D 2A4MA 1P1JA 4TTSA 3O8QA 2Z5LA 1T26A 3GJZA 4MKHA 2Z95A 4UQPA 1MO6A 2H4YA 4L8YA 1JZQA 3B89A 2WB4A 2YJTD 4IVRA 4XLTA 3S2GA 1W44A 4GXQA 3LKZA 4RA9B 1GKUB 4B3BA 5BNIA 1V1RB 4IMJB 3D1VA 5JRDS 5BNWA 4DHWA 3DKIA 1W4BA 4XPIB 2XWPA 3VISA 5AKEA 3W2TA 1JWLA 4A8JA 4E11A 4JZKA 1MFZA 2BKEA 4CM4A 4AZTA 3KSBC 1O8CA 2RD2A 3KJXA 3MAJA 3W5BA 4DV1B 1GZ5A 5EJ9A 3ZDBA 1OWLA 1ZD5A 3QE3A 4PZYA 2Z9DA 3AFMA 4QDOA 4QHYA 3OZ7A 2R5WA 4R8SA 3RTGA 5J4VA 2PUAA 3K9CA 1KOGA 1FRNA 3ON5A 2WSBA 5IHXA 3BXXA 4JC5A 1JSZA 4ILEA 1U2SA 3SOPA 3FLBA 1RVV1 3N8GA 1Z6PA 4NJMA 3JRNA 3KPVA 3ELBA 1N2HA 3AEUA 1ZRSA 4RYLA 2R86A 5FUWA 3O1LA 4J49A 2K87A 2FPLA 3D54D 3H5WA 1L5WA 3TZCA 4MDYA 5JCXA 4PYJA 3AVXA 2XCIA 4TMKA 1VGVA 1DDIA 3VU1A 3ANMA 4EATA 3HWX1 4OQZA 2ZVPX 4JXKA 3WWCA 1Q16A 1ZIOA 2R2GA 4YP5A 3COZA 5FR1A 2IUTA 4DSOA 4TX1A 1U5CA 1L5OA 2GETA 4HQNA 4CMHA 3IBFA 1ESNA 5CB4B 4C1NA 4GPIB 3N74A 4MWOA 4QG7A 1Q84A 3L46A 4XWAA 1CR0A 1IHUA 1R1DA 4E03A 4R05A 1H22A 4KR9A 1COZA 1V11B 5T57A 4U7PB 4RHFA 3WZMA 1ZESA 3L04A 1LDNA 2DUJA 4JJ7A 4TSRA 2RAVA 3OA0A 1K89A 5SZJA 2PAAA 2PZBA 1T6NA 3FRHA 1KDVA 4CIVA 2BEKA 2VUHB 5HKBA 2UAGA 1RPJA 2Z56A 4QHTA 5E9JA 3GLRA 5BRNA 5PNTA 3I8XA 4BOYA 3NANA 5E1DA 4TM8A 5LLSA 1C14A 5TXGA 3M6UA 3O3NB 3LLVA 3MXTA 2PBFA 2Q6KA 4UHBA 3U3OA 4BASA 5CDYA 1VCIA 4OYLA 5KBYA 2ADOA 3LBAA 1DNPA 2JLCA 3F2IA 3T7DA 2OAGA 1GGFA 1Y7LA 2JC3A 5IJ0B 2QIOA 1C0KA 3HKDA 2WOJA 3ITEA 2OZVA 2POCA 2O50A 4AY3A 3AEYA 2MSKA 4HDQB 3UWDA 1TKCA 5ALNA 4B75A 2CMDA 4LHVA 4NNPA 4HTFB 3IH5A 1GRQA 1X7GA 2ZRPA 3B6MA 3CLKA 1IBSA 3TSWA 3U3KA 3FN4A 1U31A 3GGOA 4TTVA 3NMUF 1EBUA 4OP3A 4NBRA 3DWEX 2C96A 4FMBB 4BP1A 5LP6A 2C3YA 2QRGA 3KSAC 4HJXA 1TJYA 3NV9A 4LY6A 4BN0A 2P4EA 3LP5A 4P38A 1JU4A 2FDCA 4XD7D 1EUZA 4BBZA 5KQLA 2RGUA 1FX0B 2NUPB 1G5IA 3N7AA 5BR1A 2JLQA 1E2GA 1RM5A 5AK0A 3RI3A 3CA8A 3F5FA 4DPLA 3VXKA 4W5TA 3E58A 2XXBA 3OY2A 3V4PB 2AHOA 1T2EA 1XDWA 1Q7GA 3RKRA 3LHSA 1D8TA 3N8DA 2VUIB 5HILA 4A6PA 5KKAA 3MYYA 1PUJA 1ZIXA 4ETNA 4M21A 4V1CB 4R84A 4F5DA 4FYIA 1DTWA 1Y1RA 2Z2KA 4QTUB 5AK4A 4B17A 3EFOB 1NJ8A 13PKA 3T7RA 1ZH2A 4ZOCA 1UEXC 3UMJA 4Q1BA 2XE6A 3FLEA 3SVTA 1UXKA 3PJDA 2CL5A 4EF4A 4YDSA 4WLFA 1H4VB 4GMDA 5BN4B 2ZSFA 2FN8A 3DZDA 4IDAA 3M2PA 2BFNA 1A5AB 2H2GA 4CQLA 3SIPA 2AR0A 2EJCA 4CM5A 3U7IA 2O07A 4L22A 1BWQA 2WWVD 1HL3A 4O59O 2G40A 1P6UA 1RLOA 4KK3A 3KQSA 1KORA 3MN1A 4BMCA 4J0HA 4FFPA 2JLZA 4YJ2F 3S2EA 3ZDFA 1AVTA 3CUTA 4IMIB 2W2PA 3FPJA 2VDUE 1DB3A 3OM8A 4M9RA 5CLIA 5IRCD 3HVJA 1PJCA 2OLKA 2RGAA 3OHSX 4Q21A 3V33A 3WWOA 5BW4A 4DPMA 2BLNA 2QTVA 4G36A 2UYHA 3C3AA 1A8UA 5DWVA 4XWKA 2EBUA 3V2GA 1E7QA 3CE9A 1HM5A 4N3AA 3NRCA 3IDSA 3F67A 3I76A 4EGCB 1FQOA 4FOTA 1M2GA 2WV9A 1QF9A 4H77A 3EBLA 5LQKA 4H7DA 4GYYA 5IFKA 1FF9A 1FTYA 4HZGA 2FN4A 2WMOB 1PU2A 3Q85A 3QYPA 3I64A 3PE4A 4UMVA 1M54A 4K9PA 1FTGA 3EVFA 4X93A 2ZXUA 3TLZA 2XADA 1SBTA 1VLVA 1MTZA 3W6ZA 2RHDA 5E38A 3GJ0A 1QQ7A 3MJVA 3PZRA 3T5PA 1A1VA 1F0NA 4GMXA 4L5JA 1PGPA 5TS3A 2Q0HA 4RTOA 1GQRA 1TO2E 2OMKA 4J4BA 1J8FA 3GWGA 1R3UA 2YFHA 3QBTA 4ZO6A 5T4BA 3WTCA 5C9ZA 1DARA 2AWOA 5IZ4A 1HL7A 4J2HA 4XWYA 4GMFA 1JMKC 1SKUA 5AKHA 1GG9A 2GTPA 2PVCA 3GAZA 3OUZA 3SHFA 3VR4A 4PLYA 1I3MA 3LC7O 4YMVA 1P60A 2DETA 2PAFA 1J4AA 1C1XB 4OEHA 1M2VA 4LRTB 1DFIA 2QZPA 3IP5A 1Z4LA 8ABPA 4Q7EA 4JP3A 2X6QA 4L4UA 1W19A 1L4EA 1JHXA 2Q3EA 2WSYB 4OYHA 4V0KA 3USCS 2BCJQ 2QU8A 1IHYA 4KGDA 4Q4CA 5KTSA 1HPLA 3FZQA 2MJLA 4JHXA 5REQA 4LQDA 4EB6A 3V4LA 1QHHA 1AHPA 2QR2A 4I4NA 1G20E 2C9DA 3P2JA 5FLKA 1QBKC 2YOHA 2ZS9A 5KHAA 2ARKA 3ASZA 4A03A 5IT9A 4BCDA 3IAHA 3MS4A 4OLFA 4UU8A 4R3NA 4X0EA 3FNGA 3QUAA 3TEJA 3BE5A 3L3BA 5JFGA 3HY4A 4FGUA 1LGYA 2REBA 1G1AA 1PFWA 3AB7A 3IQXA 4E5NA 1NNUA 1JLMA 3TL2A 4Y6QA 2Q5EA 3LRPA 5KNBD 1U2QA 1BE0A 1NUSA 3ASVA 3OWHA 2E85A 2RIRA 3CEMA 4Y3UA 2YQ5A 1ZCBA 3DFZA 4N8DA 1JBKA 1XAIA 3U49A 1HOTA 3J7AC 3QPWA 4HDSB 4HDMB 1Q11A 2OBLA 4HFNA 4BJ5A 2IY9A 1R0XA 4QO7A 4QBFA 9ATCA 1GUAA 4LDPA 5AKJA 4KO1S 1RYBA 5FOTA 4W5OA 3I0MA 2YYSA 2P4HX 3TR5A 4B2YA 4HBGA 2DQKA 1HRDA 2OLJA 3CR8A 4LZZA 2ZB7A 1D7AA 4ZT5A 2IK8A 3N5KA 1WP4A 1EESA 4GPBA 3U9LA 1P44A 2EAUA 2PA0A 3ZZ0A 2X14A 4GQBA 2WJVA 4DIKA 5MFPA 4IX1A 1Z0FA 4NG5A 4GX1A 3ZHZA 4QUKA 3DOEA 4U39A 2EP7A 4TLEA 5A3SA 4CF6A 1KDZA 1EVZA 4ZFNA 3KPYA 3V1NA 4HS9A 1HT2E 3QTBA 2GVZC 5AM1A 5BV8A 2Q62A 3NM4A 4L5IA 4C1BA 3AZOA 2QMUA 2QRVA 4CVNA 3TUZC 1Z5GA 5BT9A 1JX6A 5DASA 4OAOA 1U2ZA 4IIJA 1N8TA 2NZYA 4MYHA 1B8NA 1XLTA 1E77A 3SHQA 3KQMA 3O8LA 4GWLA 2WKRA 4LXQA 4EYKA 3L4KA 5D3ZA 1EJ2A 1GT91 1NVDA 5C8VA 1BJKA 1D7OA 1J70A 2H5LA 2KI5A 1KAMA 4JVNA 4JLBA 2JBAB 1AH2A 5CIQA 3AONB 5D2CA 4XARA 5GQSA 1OREA 4EKIA 3SXUB 2GK3A 3L4EA 3WQBA 4A4DA 5E7QA 4D0RA 4L3OA 2V7PA 1ISJA 3LTEA 3BIWA 1DOAA 2HCTA 4AN4A 5G40A 2GZAA 1MQ9A 3SU8A 2V7QA 2FG6C 2C8LA 4KEAA 1VPEA 4XASA 5GOTA 5L3RA 3UCEA 4FUTA 5FH9A 4D45A 4UPDA 1CB7A 3QFHA 3BGSA 4GI7A 2GZSA 3G79A 1A2QA 3A3PA 3DMRA 1VBKA 4WVLA 5JZ9A 3SMVA 5F33A 3HUUA 4IYRA 4DA8A 1POXA 3R7WB 4A6DA 4YCLA 1F6WA 2PKRA 1FNCA 1YULA 2HA0A 3TW6A 3NPAA 5H81A 4QYSA 2BBTA 3KEMA 4KN9S 5ENZA 5FTWA 3ZWPA 2VAXA 2PS0A 5J3JA 2I03A 4BFUA 4E4YA 5JS6A 1CIPA 4NMXB 3H87A 3GYBA 4HGZA 3FWPA 3HCDA 3KD3A 3NTOA 3OFKA 4WCFC 4N5LA 1AMOA 1FA9A 5KDLA 3AP3A 1BXGA 3JZIA 1Z6QA 4PTZA 1OB5A 1N25A 4I99A 4XSHA 5HK8A 3I9MA 3WGZA 2CLCX 4XPZA 3DEHA 5C37A 4TSKA 4F0JA 2X1HA 3F8TA 2MSWA 1H8ED 4TZ0A 1NQAO 4Z3DA 1Z9BA 1SXJA 2EX0A 4DFDA 1FMLA 2FK7A 1YT5A 1P4RA 2FKAA 3DMDA 3GUYA 4FGWA 4CV1A 3AERA 4D4LA 4W5NA 3RQSA 1GGJA 4RFLA 3VAYA 1GYRA 1AKNA 5EG5A 5BWBA 1X1EA 4FXOA 5JUWA 5A04A 5ADHA 5IJWA 2WJYA 2Z1NA 4KH0A 5B3AA 2GPWA 4IQFA 1B0ZA 1GYQA 1GTL1 4LMAA 2V1UA 1GTMA 1PX0A 2A5GA 4PLGA 1S2NA 4FSHA 1YV9A 3G17A 4EA6A 4DWVA 3T54A 4MSUA 3L8CA 1MB4A 4QDZA 4U7TB 1EEXB 5GONA 2VAPA 2HQOA 3CPHA 4KQGA 5FNVF 2EZTA 1C7QA 3JWIA 3OJWA 3MWGA 4JGBA 2X5KO 3JYLA 5AYVA 4X7BA 1HTWA 4EBBA 2V6MA 5DM60 2O8DB 3TDKA 2R68A 3FETA 4HSGA 2G1PA 5KOHA 1I1OA 1W25A 1WBDA 1MT0A 3G2PA 1Y4UA 1N57A 3QYJA 4EJSC 1JR4A 4WE3A 1GR1A 4L15A 5DWQA 3RRFA 4M37A 5AW3A 3P9NA 2AGVA 4V0ME 3E9EA 1RPTA 2D74A 3ETDA 4TXHA 4YRNA 2DSNA 4QJ5A 4HLCA 4DBLE 3RT1A 2WM9B 3T1VA 2PDAA 2PD4A 1W5FA 2PL3A 4R7ZA 2HB6A 2E4ZA 4YMLA 2CVOA 1T9ZA 1XDSA 1POWA 2H3HA 3LVRE 4V24A 5HCNA 2BHNA 2CK3D 2DTEA 3V97A 2VIIA 3ZGNA 3N8HA 4WKGA 3H3FA 5C5IA 1W6RA 1TNDA 2OXIA 2V5UA 1TQHA 1RHJA 1WXFA 2AOTB 2Q50A 2VJYA 1QV6A 2QNRA 3ABZA 3BICA 4UEQA 4URFA 5ERYA 3M7IA 1TVCA 4YP7A 1TK2A 3RAJA 3VZSA 5HTOA 4G0VA 2XITA 1KHHA 2QD5A 1OSNA 3FJOA 2ZSEA 5BPFA 1LRLA 3PHCA 3GGCA 2GKOA 4NARA 1UMKA 1SK9A 5BWCA 1NNSA 3P2YA 1X77A 2VFAA 3P9ZA 4ZZIA 2B2CA 4NXMB 4EWLA 1DWPA 2Q46A 1NE7A 4TKVB 1FFGA 3KT3A 1XZAA 1B26A 1LTKA 1SVLA 3URKA 2HF2A 3RTAA 4YY3B 3J81A 2RI1A 1SKYE 2B1RA 3JR3A 1BXKA 2XQGA 3FHTA 1N2XA 5KNDH 1KH3A 1PUIA 2E6KA 3I1IA 4U2DA 4LY3A 3VH1A 5I9MA 2XKKA 1S8NA 3A4VA 5FPQA 3FBWA 2C7GA 1BQ3A 3OOEA 5AI8A 4KCGA 2J4DA 4ZJYA 2Z08A 1XRJA 1WW8A 3HVHA 3UMVA 5CFOA 4INZA 4YAIA 1T8YA 4IIEA 4LRWA 4LYAA 2DLNA 5CH5A 5GJVC 2NPIA 1FP4A 4K87A 2DXIA 2JLVA 2VJLA 1B8OA 2FB9A 3A6GA 5DRTA 1L6IA 3T7EA 4S1PA 3TRHA 2ZCJA 3GLGB 2AVDA 4RESA 3BXPA 1QNFA 4BRSA 2OZLB 3EOBI 5FFMA 3THXB 1BFUA 2HNBA 3GRVA 3OJCA 1KK2A 2QN2A 5KSOA 1MC8A 5BYJA 1PV4A 3LC2O 4LF4B 3V9PA 4E2ZA 4P0PB 2XHZA 3I9V6 3MAAC 4AJLA 5BXYA 3CF2A 4BNJA 1CDOA 2ZU6A 1G8FA 4JGIA 5EA2A 1EFCA 3P4XA 3RUAA 1ZVQA 4UBMA 4JELA 3KZNA 4QYTA 1O6FA 3HJFA 3EEBA 3JALB 4HDOB 4NICA 1E1NA 4MS4A 4J8PA 2GN1A 4HGPA 4L3VA 3WQHA 2Y4NA 2E0IA 1H2EA 2XV1A 3MTQA 4KPGA 4FCTA 1R5NA 3B51X 2XT9A 4ISBA 1K5DA 3DTVB 1OYOA 4LISA 3SYRA 2WF7A 2O7RA 5ECWA 4OB7A 4R16A 4JKOA 2UZ4A 1NXWA 2BBSA 1ARZA 4JQCA 4WESA 4FMDF 3TUJC 3W05A 4F2PA 1IATA 3AU8A 2GF9A 3IRUA 5D5HA 5DW0A 5HIAA 4ND8A 2WYVA 5DLYA 4LF5B 4JJFA 1U1CA 4PZPA 5FOUA 3HTXA 1F51E 1Y9JA 2G5GX 4DLLA 1FS4A 3I6YA 4X6LA 3KZOA 4G86A 2VJCA 4JMLA 4PFKA 1OTXA 1N8KA 3A6FA 4FFMA 4MLCA 3FPEA 2ONCA 4Z8YA 1NDUA 3TXXA 4CKEA 1E2KA 3IMFA 1U11A 2GLTA 2ZPTX 1D1QA 4FX2A 3AC0A 5KYYB 1AMNA 2C4UA 2JEYA 3GAFA 3H3JA 5CX1B 4ZQGA 3G0GA 1KMHA 5FYQA 1DLIA 3B78A 5CVDA 2GN9A 3QKRA 3PRHA 4C7OB 2WT9A 1O0BA 4URYR 2R4UA 1RLUA 3I9OA 2ZYRA 2BFCA 3D7RA 4JBLA 4WNIA 2CUNA 5B30A 5ICMA 2EFGA 5G0VA 4BQEA 1Z4OA 2BGIA 2NVOA 3SX4A 2IEZA 4IIGA 1VIDA 3LXUX 5K3FB 3VNQA 4XUDA 1MVLA 1N1MA 1I4EB 1DKOA 4NBNA 3TIXB 2G9ZA 3ZBTA 1KYIA 2O06A 2WWHA 2P62A 2D2IA 2IDJA 4MWSA 4YK7A 2QGNA 3HUDA 5F1OA 3CIOA 1W0KA 3HS3A 4WERA 4ZVQA 3HGQA 2EG5A 3QVWA 3TOSA 3JPYA 4DMLA 1Q44A 2H06A 3LT2A 5AJVB 4RD2A 3I6BA 4IKOA 2MWMA 1QCDA 2XA2A 5EUCA 1D2GA 1WE2A 1T1GA 4JR2A 5GJWC 3V2UA 5CG1A 3DB2A 1EIWA 3L5OA 2JLRA 4UHEA 2ZCVA 4G0QA 5DLDA 3OBIA 5ALVA 1ONNA 1MEEA 5BN5B 4B44A 1LW7A 1PJZA 1ULBA 1KIAA 2QUAA 2Z43A 3GRUA 3O47A 1Q0QA 1HLGA 3F4KA 2W2KA 1OLSB 3HNPA 4HX9A 4YMGA 1TTTA 5CYOA 3Q3CA 2X0RA 3EEQA 3MCVA 4UNQA 1XD2B 2IUYA 1XF9A 5AXDA 4BUJA 1W52X 3ANSA 4IDHA 5LQDA 4HAYA 1EDEA 3TVYA 4RKWA 1WSBA 1K6XA 3KR2A 4AYTA 4BMOB 2XYQA 1HFKA 1H2HA 3A1DA 4AB1A 3A3KA 4K88A 4OIMA 3OTWA 3NBXX 4Z9YA 2IE8A 5K0NA 2WYHA 3LU1A 4F04A 3ICOA 1U0HC 1RXUA 2BMWA 2C97A 2X4LA 4J7UA 1N2ZA 3E0XA 5D6NA 5EL0A 3ZQJA 1LLFA 4P6VF 2IX9A 2FEXA 3FKSD 3GRKA 2GD2A 4LV5B 4CYMA 2WJIA 5CFQA 4FHCA 4UVEA 4XW2A 4Z49A 1WB9A 1QGUA 2C5EA 2VTVA 3FB4A 1IC6A 1IY0A 4O4HF 2AS0A 4BMNA 4BWGA 2H1RA 3G3EA 3NG1A 1JQDA 1FP1D 1A7JA 2YBDA 3LT1A 3QM1A 4I5DA 4J1TA 4P80A 4R8LA 4KXWA 1NFQA 4KRFA 3A9WA 2ZPAA 2FSSA 3HBJA 4RF3A 2EIXA 3NHPA 1DAKA 4N0QA 2D5LA 4RD0A 3FNEA 4FT2A 1LDGA 3O90A 2Y05A 1ZVKA 3SR3A 1R8QA 3N0XA 2UZ0A 3F6EX 1K5GA 1VL2A 1XVTA 1ZI9A 2VAWA 3FDJA 3LQ1A 3OE5A 3R0IA 1YFLA 1X7WA 4TKLA 1A3CA 2QKYA 3HUEA 3QY9A 1ZM9A 2CNNA 4DT1B 1PGQA 1MXHA 4LDZA 4JT4A 1N6LA 3P2MA 4GSLA 5IPFA 4K03A 1SZDA 2JA2A 4CEJB 5K8LA 4F6CA 2IBMA 2X9VA 3TLBA 3K72B 4PPQA 3ZDZB 4B74A 3SIRA 2P6PA 3D64A 4G63A 4BGIA 1TF7A 2GEDA 4MOWA 1QRDA 3KYIB 2ZSUA 1H42A 1KPGA 1R6DA 1KP3A 1Z5PA 4HAIA 3OI7A 5AVUA 1X7XA 4DSAA 5KYTA 1E6KA 3FYUA 5A3QA 1NBME 3I12A 1DEOA 9LDBA 5BVGA 4LJSA 3P94A 2GXAA 1RZVA 1IG0A 1ZC3A 1X7YB 6REQA 1BS2A 3N07A 3PT5A 4JUDX 4Z51A 2ZIXA 2WFAA 2EJUA 2BELA 2QX4A 3C1TA 2VN8A 3IFSA 2ENWA 2H1SA 4QU8A 5C3MA 1HQYE 4KPUB 3OZDA 2PUVA 1XEWY 2MSCB 5BWMA 3VU9B 2X8LA 3SQMA 3IT1A 5L40A 4REMA 5EMMA 3U1TA 1KQFA 2CEAA 2RHGB 5TSDA 5IJZA 1OY1A 3D6TB 1Q1ZA 2GJ4A 1JHOA 2WYWA 1UBUS 1N2OA 3EODA 1CPYA 2PMKA 4OLJA 5CJJA 2C4MA 4YRJA 4HLNA 5B36A 5BVHA 2AG5A 4MVJP 5DNCA 3EGIA 3F46A 1O58A 1OFGA 3B3JA 3M1IA 1LTQA 3BYZA 4C4OA 4NABA 5BQ3A 1KEEB 4QQRA 1G16A 3JWEA 2FOXA 3U39A 3JYOA 4CCWA 2CLEB 2Z2JA 2X8JA 1B0UA 3I83A 3NBZC 5BSHA 1RKXA 1XA3A 2YL2A 1AO3A 1Q7RA 2P5UA 5HDBB 1TJPB 1CS0A 1XXHA 521PA 2OGZA 2QMOA 3EISA 4EUKA 1MPTA 3ETGA 3R3UA 1XMQB 9MHTA 2E4YA 2DPYA 2PD3A 1PEDA 4RK5A 4YJFB 4P0QB 4G1BA 2VA9A 4JIMA 2QY9A 4WBNA 5EQDA 2ODEA 5HZMA 4B2IA 3F7NA 3AO0B 2ZWOA 4DEYA 4MRMA 3TE6A 4DMUB 5K45A 1ZUHA 2X76A 1EUCB 4M1WA 2PT9A 1MX9A 2VCHA 4OQMA 4Y0AA 3F8SA 3RUEA 4AF7A 5J4LA 3EDCA 1Q20A 2VJMB 5IJ9B 3WMRA 3MJDA 4WNAB 3VHQA 4UEWA 1YL7A 3ZQ4A 1CIJA 4TL9A 4OBXA 3E9YA 2W90A 2B5VA 1I7LA 4IJUA 4IQGA 4I1VA 4I9HA 4JN6B 1ODJA 2ZJZA 3A1FA 4O4IF 2ONJA 3TIIA 4PQYA 2H4HA 4ZTBA 3PWSA 2B5OA 3AX6A 3JSAA 4J0KA 4TMVA 2MSNA 3TFWA 1KI3A 3R5XA 1BDBA 2BHLA 3UH1A 2IQIA 2JIOA 2RC6A 3VAAA 2GDZA 2P8JA 1I30A 4XWTA 1P4HA 1KZ1A 1WPQA 5HNKA 3KE9A 3ORHA 4DXDA 1OFHA 1RWOA 3H83A 2QAGA 5E9WA 4D92A 2ZJ2A 3D6NB 1VLQA 3IE0A 1JEAA 4IKPA 4R41A 4RPHA 4R68A 1JZSA 4RZHA 2EQBA 3CZQA 3Q8KA 2HCBA 1C0EA 1YBAA 3C3YA 2WJJA 2CDNA 2RK6A 2UV8A 4NESA 1TVKA 1TDJA 4RD4A 2OYCA 3V55A 3OT5A 2MSEB 5J47A 1ZJJA 2CYBA 2AKAB 1PBNA 2HIGA 2WJ6A 2QRUA 4TRJA 5FBVB 1UMCA 5EWLA 3K9LA 1RPAA 3DJFA 2QDKA 3AETB 3AHFA 3ZPXA 4YASA 5HE8A 3KXLA 5EUBA 3VR0A 4LTNA 2W42A 2GN6A 1V37A 1Y0BA 2BTOA 3Q3IA 3V4OA 2Y0PA 3QVLA 2CUTA 1QKIA 2PX2A 1NT4A 1T5BA 3OE7A 3WDKA 4A27A 1NR5A 3AMVA 3BT7A 4WCVA 1UZNA 1IOLA 1PJ3A 1XU9A 4G8BA 2AX3A 1ZLXA 2FR0A 3W3ZB 5SYAA 1E1RA 4GAEA 3SMQA 4BQIA 3DE6X 3BFKA 4HO1X 2GPTA 3OHMA 4BO3A 3F1KA 2NQ2C 2QRJA 4EUFA 1KQGA 3VRHA 1Q77A 2ZT6A 3LKVA 4BQFA 1GVNB 2ZYAA 3IQZA 4JA2A 3ZUPA 5LPNA 5IBQA 4PTLA 2I4IA 2SICE 2NPOA 4B4OA 1M8FA 2Q3BA 4G0WA 2BF4A 2JLAA 4NV1A 4RVDA 5DXAA 2HLDD 3L7NA 2CZQA 3I9LA 3LWDA 5EXEA 5LA6F 3CLRC 4WY2A 3K1AA 3MPUA 3C3BA 5A9RA 2P30A 3WRXA 1H2FA 2A5LA 1UDAA 4LW8A 3NWBA 4WN3A 3JATA 4MQLA 1U0SY 4Q9NA 2I6TA 1G2IA 5H1YA 4B3RB 4IJKA 3PNQA 5LQAA 2FMUA 4ZYUA 1S02A 3E9CA 2Y0DA 2ZOSA 4K46A 5FLYA 3ZWOA 3JQ9A 4K05A 3V34A 3GUUA 1QH9A 1IDOA 2YWRA 1V41E 4F9GA 1Z0AA 5H0IA 3UMYA 2EERA 5ALMA 1OIXA 1JBQA 2XX3A 3HV2A 1OIVA 2AVNA 3LFUA 4DSTA 3IUQA 4JBHA 2X8BA 5C8YF 2DP4E 1JEQB 3OQ6A 3SZ3A 2VF8A 5IDQA 3Q3HA 4N5DA 1BAPA 2WWTA 3NHLA 5G53C 2GUWA 1PD0A 2FSUA 3K2IA 3W3AH 5KOJA 1IHOA 1C7JA 5CH8A 2Q5FA 3W5DA 4MYRA 4F6LA 1TD9A 1Z83A 3EEYA 3ICPA 4X8LA 3RBVA 4RXTA 4R9RA 5LOVA 1JEJA 3KKZA 3JQBA 3PT9A 4FSXA 4QPCA 1SPBS 1X19A 2PSSA 5JCPA 4HWGA 3REQA 2SKDA 1SKBA 1E3EA 2PBRA 1NDHA 4BBJA 4KLZA 1H93A 1P62B 2PT5A 1UQRA 1E3SA 1M7BA 2NU7A 3NRJA 1GUZA 1AZSC 2H9IA 5TARA 1ODTC 5DP2A 1ZUNB 4ZYTA 2J3DA 1E60A 3NGMA 1WSWA 2EQAA 3O4GA 3AOEC 5EWJB 3SZMA 1B00A 4C7XA 2WG1A 2ZBQA 2YHAA 2W6NA 5DBEX 2FWAA 3CCBA 1NW5A 2AOXA 4JSYA 4BTVA 4OQQA 4C4XA 4NCAA 4TN5A 5LBIA 4A0FA 1G8YA 2Q5CA 1XNGA 2J9ZB 2G7MC 3LYLA 5BQXA 3MTBA 2OCLA 1GPJA 3AKEA 5AW1A 5BR8B 1RLMA 3LNCA 4WZBE 1B7GO 3QPBA 2OWDA 1RWWA 2YHIA 1LPSA 3ESYA 4J0DA 3TOVA 3ZHUA 4ENTA 3FPSA 4IHQA 5JQWA 2CNLA 2C20A 3RRJA 3FX2A 1GUYA 5G0UA 3KKNA 1Y9DA 4NFYA 4JNKA 5H9WA 5CEEA 3CRQA 1K06A 4QBIA 4OJQA 3OCVA 2GWHA 4DDKA 4EW3A 4YUAA 1AC5A 1ENYA 5JO0A 2RHBA 4YPFA 3BL5A 3DMYA 5H68A 2I54A 2B7BA 2PH7A 4W1QA 1X7ZB 1O0SA 3ITNA 3RSLA 3C5WP 4P35A 5L6MB 2QRLA 4KX3A 2JD0A 1FPMA 2G80A 3T3HA 2E5WA 1HMPA 4FKMA 2HBQA 2R1TB 1JEYB 1UKZA 4D2IA 2XQJA 5JW6A 5C52B 2B37A 2CDAA 1NNEA 3M6IA 5TQ2A 5CFPA 3SBOA 2XMDA 4QE3A 4ACBA 1VA4A 2GBCA 4P4TA 3V4SA 4AJKA 5JDIA 1IZ0A 1PJ4A 2FZ4A 3FHJA 3AM3A 2C2GA 5EE0A 1V3QE 3WGOA 1TZCA 3A3NA 4EKYA 2NT3A 4J03A 3SPXA 4AXXA 4MLDA 3D5TA 3FPAA 2DG2A 3IJEB 2EEZA 4WH0A 2HN9A 2JVKA 3FPLA 2NU8A 3WL4A 1RRCA 2P67A 1YU6A 3L8DA 3V1YA 4RC9A 3CLUC 2MDTA 4GPD1 5HKAA 4OYYA 2V9ZA 4RVFA 4XYGA 4Y1FA 3I05A 2CXRA 5GZ3A 2WUVA 1C41A 4PYOA 4EG0A 1T2FA 4LZJA 1PL8A 4A15A 1D9XA 2PD6A 3ESXA 4NV3A 3GNLA 4NZMA 3BREA 3IVCA 3BJZA 2WHPA 2UXBB 3BILA 2C4TA 2H0AA 4FW8A 4RZ2A 4IXTA 2BKXA 3TMAA 5AD1A 3VTAA 3CWZA 5LBTA 2NO7A 1RC1A 4IZHA 3TI7A 1RHMA 2W9XA 1TCCA 4WK6A 3TLEA 4FJ0A 3UAZA 4AUEA 4CM9A 5BWLA 3PGVA 1CUFA 3CE6A 3KFVA 1AUQA 1J20A 2UZ1A 1IJEA 3OSUA 5BOSA 1D07A 4HRXA 4LPKA 3IIMA 3ELYA 2YVAA 1RHKA 3OTGA 3RC2A 3P5BA 4LJRA 2ZB4A 3OLCX 3M8KA 4DMCA 1PEAA 2VSQA 4HEQA 4C5CA 5BSWA 3I5XA 1YDWA 2NV6A 2GZHA 2WMDA 3HPRA 5DNDA 3T3GA 5L9AA 2EW1A 3UMSA 5JY1A 2C2KA 5F35A 1AKMA 5BR7A 2WQ6A 5F98A 3OPQA 3U3ZA 4ENSA 2DUWA 1Z5UA 2J7PA 5KHLB 3BQ9A 1JFTA 3I3OA 5JPDA 3LPLA 1H2RS 1R27A 4R2WA 3S27A 5WRFA 3UFBA 3NXKA 4ARSA 4F8YA 3RRXA 1ZQ1A 7GPBA 3NHSA 5J2UB 4G5OA 1ZK0A 1Z26A 1CJSA 4ZAGA 3N3BC 3SJAA 3OZRA 4RPIA 1P6XA 5ER6A 3VGPA 2QTMA 4F5WA 4C0HA 4Y6LA 3CMCO 3OZSA 1TJ4A 5LZ7A 3IUYA 3MJFA 1TUEA 1N36B 4Z9FA 2CUZA 1GY8A 3ROPA 3FHOA 4TT3D 5DHRA 1K3FA 1PR9A 1LLUA 4K1XA 3WIOA 5FPHA 5ELXA 1G3QA 4M1SA 3NFYA 1EUDA 1GQQA 4CEHB 4PU0A 4L85A 3HKEB 4MZDA 5TJ9A 1ONSA 4HDKB 1SCJA 3AM5A 2GZDA 5TGDA 2MYNA 3P9XA 1T8UA 5GVRA 1Z12A 3EG9A 4KIWA 3BA1A 2AZ4A 4BN5A 1PR2A 1CV2A 1Z4PX 3D3EA 3LLMA 2VDKB 1L7OA 4WOKA 5JPCA 3K9FC 1L7PA 3ZX5A 3BGIA 4D5GA 4OXRA 3ICQB 2WWRA 5AM0A 5BMVB 5A4IS 1RYFA 3OWXA 3V8BA 3RK1A 1I1HA 3Q4GA 3ZWAA 1P31A 1EWKA 3KVRA 4EHFA 1XKQA 2P2LA 3L7JA 1M34E 1J2EA 2FHPA 2J33A 3OECA 4B83A 3O4VA 3G9TA 5JD3A 1S89A 3NUQA 4F7DA 2XTNA 4HRAA 4GLOA 4KHZA 2LV8A 4QATA 2ZYGA 3UUEA 1F0PA 3ZI4A 2WWYA 1MIOA 3A3YA 5E3JA 1SOMA 2Q1WA 1RVDA 2B69A 3NHAA 3GJ7A 3MT8A 3GV0A 4P5EA 2G1AA 5DGHA 4C6RA 4P2BA 5INTA 3MRSA 1HFJA 4LI0A 2XSZD 3T5AA 3TLXA 1HGXA 1IBRA 2XAAA 4CLOB 2I4RA 5IZCA 4NH4A 4BC0A 2GAIA 1P7YA 3AY0A 4J7AA 1FXSA 2O6HA 4OGKA 1JBEA 1T8TA 4TL7A 4MJ7A 4DDTA 1N3YA 2YIMA 2OPBA 3QX9A 1YNSA 3VDRA 1A95A 3ZWYA 4MUEA 3CGWA 3BB3A 3A6PC 1CF9A 3RU3A 2JG3A 1ZGAA 2WIJA 5F7ZA 3M4NA 4MWCA 3EQ8A 1ZJWA 5KJ1A 4CDMA 1V1MA 4OLAA 2APJA 1FFCA 3ZW9A 2IIQA 1GL7A 3HB5X 4KWCA 4CN8A 1CY8A 3AKYA 2XZOA 1UXHA 4ZU3A 4ZHQB 1Q0ZA 1RI4A 2QUHA 3MLEA 4D97A 1RWMA 4Q4AB 5KS2A 5GMOA 2PLRA 4KN8A 4JXXA 3WNVA 2Q9CA 3VUFA 1AK9A 1OUMA 4OREX 1UBJS 1UJNA 4PLHA 1JRLA 1BDMA 3QIAA 1URPA 2JATA 4UTOA 4CCSA 2QYOA 4JB2A 3ZLJA 2I6XA 2DBZA 4QBTA 4UEKA 3WNCA 2QVYX 4UFOA 3GLHA 2NU6B 1THGA 5JNTA 2EYUA 1HG1A 1NBHA 2FN9A 5J40A 4DDHA 4MRPA 4MRVA 2D5BA 1V4BA 1OILA 2QS9A 5EMHA 3JVEA 3RK0A 3SE0A 3OFNA 5JARA 4C2BA 2BDEA 3R1IA 4MVJF 1E2HA 1FUYB 4PYRA 2XNHA 2Y1EA 3DDSA 2D4AA 4G9BA 1O9BA 3KSRA 1GEEA 1QMPA 4ZZ3A 2AI1A 4RFVA 1N7GA 2RGYA 1Q14A 2IXBA 2ZTMA 1JYEA 1T15A 5LZ8A 2I29A 3WLKX 5FOXA 3UPTA 1ZRNA 1XCLA 3S99A 1G8AA 2X8AA 3IJRA 5AUNB 1PS9A 4C29A 3B2QA 5A3JA 1Z28A 1V8BA 2K2QB 5IC6A 3K0HA 5JY6A 1FYEA 3RG2A 1P5JA 5HUJA 3ODGA 4X95A 1HQDA 3GT7A 4A0RA 5G0TA 3AJRA 2QL7A 1GKLA 3GNQA 1F8UA 3QELB 2B99A 3DWFA 3QYAA 3T7JA 3PFFA 4TLAA 4TLLB 5AJUA 1G66A 5C35A 1JHMA 3G2IA 4JASB 4R8MA 3EQ9A 3G5TA 5FJJA 5U4QA 2YFKA 5JNVA 1PAUA 4C21A 2JDIA 4MCIA 3L0CA 1SIUA 1OTYA 4OPMA 2ZAOA 3RYHB 1O89A 2O3JA 4BMSA 4MV7A 1XRLA 1KU6A 4BUZA 5A05A 1UCFA 3H2HA 3FOEC 1SVUA 5E9QA 4AW9A 1FU8A 5LYJA 2XCSB 3SQLA 1I13A 4OU5A 1ZR4A 1JA1A 1C29B 3NGLA 4RE6A 2P4QA 5BUZA 4FS3A 3AXSA 4Q1AA 3RSOA 4JUCA 3USZA 2ZCUA 4E2XA 5LU8A 1IXSB 3KQNA 2ADFA 4EZBA 4M46A 4CQMA 3UT0A 2OAP1 1JPUA 4PF1A 2VEDA 2WD8A 3EDQA 4U2FA 3GG9A 3A26A 3K53A 3S5UA 4HVLA 1GNPA 2OO5A 5HW0A 4Q3AA 4Q34A 4UASA 2BEJA 1VG8A 2XF8A 3DLPX 4YVFA 3TCXB 2CV1A 4FD3A 4IHKA 3WJAA 4IGEA 1MP0A 2Y77A 3STHA 4NK5A 1YQTA 1VLJA 2XIQA 2ECKA 2AW3A 1LK0A 1ZOSA 2JFFA 2VP4A 4MDHA 2VNIA 4B32A 3L8MA 3LQYA 3QKSB 4UVGA 5FOQA 4ENPA 1DJOA 1M6EX 2FQWA 4IV0A 4D42A 5A4JA 3W8DA 3UICA 4HAVA 3TLMA 4GXTA 4J1NA 4M54A 5FP0A 5JSKA 2CHQA 3SXJA 3PK0A 1T3LA 2B4QA 2CL0X 4O8CA 4CNQA 1K0UA 1UBKS 2GK4A 5I7FA 1HUQA 5JS2A 2EIHA 1B74A 4H4EA 2PWYA 1Z2AA 2CJYA 2ECQA 4S12A 4BIMA 4E07A 2V0GA 3KSUA 4RIHA 1SCNE 1IOWA 3U44B 4N18A 2W8ZA 4YRAA 4G5GA 3E53A 3FTCA 4Y6RA 2HUNA 4PFQA 1NNI1 3C7AA 3RANA 4K9LA 3B1JA 1E1KA 3MLBA