1E2GA

Human thymidylate kinase complexed with adp, tdp and a magnesium-ion
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
209
structure length
205
Chain Sequence
RRGALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTEIGKLLSSYLQKKSDVEDHSVHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAKRGERYENGAFQERALRCFHQLMKDTTLNWKMVDASKSIEAVHEDIRVLSEDAIATATEKPLGELWK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights Into the Phosphoryltransfer Mechanism of Human Thymidylate Kinase Gained from Crystal Structures of Enzyme Complexes Along the Reaction Coordinate
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords THYMIDYLATE KINASE
total genus 89
structure length 205
sequence length 209
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2000-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1e2gA00
4G5RA 2ZRAA 1AN0A 3SZRA 5HZHA 1SVOA 1JPJA 4LPSA 1Z8FA 3K0CA 4M9QA 5KSPA 3X2SA 1VG8A 3DOFA 1G7CA 3PQCA 4NYJR 5B30A 4RCZA 3VR1A 2QBYA 1TNDA 3MFYA 2C03A 4WA7A 1MOZA 3LLUA 2BBSA 3R8CA 3T1QA 1MKYA 1OV4A 1ZNZA 2YINC 4FN5A 1KOFA 2QM8A 2NO0A 5BYKA 3GLIB 2WWYA 2F1JA 3J81k 2V55B 2WJVA 3C8UA 4WW0A 1KKMA 4TTPA 1I4DD 1A7JA 3V00A 1AS0A 2FH5B 1TMKA 4PHGA 3R9IA 1GVNB 1QHHB 3HPQA 3WNCA 2H17A 1IJEA 3TKLA 1CXZA 1NMXA 4RZXA 5AJZA 4G3XA 1JR3E 1BO6A 2OEPA 4FXPA 4AD8A 5HKKA 4OI2A 2F1IA 2ZS8A 2VF8A 3WP0A 3P1JA 1T3HA 4Q03A 1HQYE 3TNFA 3ZIAD 4BFZA 2FPLA 1FNMA 3AKDA 3WHKA 4O25A 3MWLA 4A15A 4C2TA 5HKKD 2UKDA 4JSYA 1GDDA 3CO5A 1SXJD 1KY2A 2A5FA 3EPJA 1DTSA 1R0WA 1BS1A 3TIFA 3KXKA 1VG1A 2AWNA 3H84A 4C7OB 2QQEA 1G5PA 4NKRA 2DPXA 2DWOA 2J46A 4JYCA 4E22A 1MRNA 1XEFA 3A6PC 1E9RA 5FBQB 3EX7C 2LWIA 4HSEA 2CHVA 4LGMA 2B8WA 5TB5A 2P6UA 4PSVA 1SHZA 1A2KC 5L3RA 4GOXA 5TARA 2JJ1A 3BB4A 3LW7A 4JL6A 3EA5A 2IBMA 5D3QA 4KFTA 4A82A 2RCNA 3AGPA 3IEVA 2FFAA 3LNCA 4B2LA 1ESNA 3UMRA 2W6IA 2J0VA 1ESMA 2VP6A 2JJ1D 2YWGA 4Q47A 1CR1A 1UFQA 4R2IA 3CZQA 2R6FA 1VYUA 3GJ5A 3WY9A 1KJZA 1B0UA 1OFHA 4D6PA 4Q4AA 5LPNA 3PXGA 1DPFA 2REXB 3K0AA 1GL7A 1S3SA 3RS7A 1KYIA 4B3XA 1CP2A 3SJBA 1NVVQ 3TMKA 3PENA 5AR1A 4RJLA 4P4TA 3RRYA 4QRHA 3NBYC 1XXHB 5EUMA 3AVOA 3KQLA 1XTSA 2WSSD 5JS7A 4Q7KA 3UK6A 4A6PA 3KQHA 3K9NA 1E9AA 4W5JA 2IS4A 2VP5A 4RZUA 5EP1A 5TDHA 4IRUB 3TRFA 4AC9A 1Q1BA 1E4YA 3B1VA 3IIKA 4URUR 1Z0AA 2P5TB 2ZI4A 3KKMA 4OJKA 1HH4A 1KSGA 5FR2A 2D2FA 4NDZA 8OHMA 3A4LA 1LS6A 1US8A 1OFTA 3CM0A 3VX4A 3QENA 4LJ4A 2IYVA 3THWB 3VKGA 1LFDB 2ZRGA 4XTCS 5F3WB 1GRNA 1C9KA 4G5SA 5TY0A 4LJYA 3H86A 3KJHA 4JJZA 4N0DA 3MWKA 3EPHA 1DAMA 1FPMA 3B9PA 1AS2A 2Z6VA 3I72A 3FPAA 4JMPA 2NO1A 1PZNA 4OHZA 4FI3C 3LD9A 2QN6A 3FTQA 5EE9A 1W5SA 2ZE7A 3MMPA 3VKHA 4E07A 4LYFA 4TSFD 3AEZA 4Z54A 1ANKA 2KSQA 1P2UA 2GXSA 2RGCA 3ZS9A 4B6EA 4D82A 1NNEA 5GADl 3OHMA 2ODEA 4B47A 3GFOA 5DLQC 3OEED 2WIBA 4MRSA 2OCPA 1N5IA 3PEYA 4M1SA 1KDRA 4DCSA 2VLIA 5B57C 4XD7D 5IRCD 3B78A 4WZBE 1OE0A 2DFTA 4US1R 1L7VC 2REOA 4M1YA 4NCNA 1KSHA 3GJ8A 2PBRA 5DSZA 5G3ZA 4Q1DA 5A5GA 1MRSA 2F1HA 2QE7D 2JAQA 1UM8A 3X1YA 4DKXA 4EJSA 4N1AA 5KSYA 5DNYB 4PHFA 2WKQA 2ZI6A 4JBWA 4LBWA 5EE3A 4PC1A 5FOSA 1Q1EA 5FL3A 3P32A 3HDTA 4JSTA 1GZSA 1VIAA 1IN6A 5D3MA 1CBUA 4YQFA 4TL8A 4WZAE 2C77A 3A1WA 4JBYA 2PZEA 3QXCA 4I1SA 4NCIA 3IKJA 2VHUA 4TQ9A 3W6PA 3SDZA 1Z07A 2CJWA 4XVQA 3UMSA 4XOIA 4E09A 1S0UA 4LBZA 4DEYA 3O8BA 4KO8A 3AVTA 1A4RA 3I5XA 5EXXA 1Z29A 4XWOA 4JVNA 4LHZA 4XSGA 5AK0A 2RGXA 1EX7A 3D7MA 2QT1A 3A58B 2MMGA 4RY2A 2JLYA 1OH6A 2ATVA 3H2YA 2D7DA 4FMBB 4TMZA 3WYAA 4ASUA 4KU4A 1QHIA 1E3MA 4B6FA 2WZQA 1JALA 5AJVB 3THXB 5FTJA 2R8RA 2WKRA 3G0HA 1IONA 1KO4A 1AM4D 1QZXA 1SVWA 3REFA 1D5CA 4O3MA 3T15A 4LBVA 1OYWA 1H8EA 4B76A 4Q19A 2F1RA 2GWHA 1XEWY 4NZYA 3ZD6A 1IN7A 1WP9A 1MO6A 1IXSB 1F2TA 5C4GB 5B64A 2EFCB 3THYA 5JI2E 3U7GA 5EQTA 121PA 4NTZA 1P9WA 4AYWA 2RGAA 1IXRC 2IYQA 2IK8A 2ZYUX 4YC7A 1BIFA 2PLFA 4KSBA 2ZSFA 2JGNA 1PUIA 5KUTA 4AKGA 1TQDA 3RYTC 5IDVA 4CGZA 2QG6A 1B23P 1OPXA 3P26A 3P27A 2O8DA 4HB0A 1NBMA 1G16A 2NZJA 2BBTA 3QXHA 1EWQA 2O0JA 2YKGA 1II0A 1Z63A 1BH2A 1DVRA 4CEJA 3CRMA 3BB3A 1Z2CA 2E87A 5CJ2A 5E7MA 4JLOA 2GAOA 2O8CA 1N6NA 2IHYA 5G40A 1W0JD 2GNOA 1HV8A 4B34A 3GJ0A 1MT0A 2BJVA 3GD7A 3DL0A 4TMTA 1OH8A 1Q0UA 4PAMA 4S35A 4IEEA 2YZ2A 1G8GA 1N5KA 1S4QA 1CJMA 2C04A 1CTQA 3Q8XB 4FIDA 1HT2E 1NG1A 2WIAA 3W6OA 2XB4A 2RGEA 2ZRDA 4GZMA 3SEAA 3WXMA 2BMDA 5JMTA 3RVBA 2R6GA 4LWZA 1ZD8A 2ZUDA 4R98A 4OI0A 2X2FA 1GITA 3UANA 2WPDA 1NIPA 2HJGA 5BN3A 2WJGA 1N6PA 2A30A 3BC1A 1GNPA 2QTFA 1FX0A 5FPTA 2F9MA 2Z4SA 4TT3A 4BFUA 1NMZA 2GXQA 4OI4A 2CVFA 3THXA 4DT1B 3AVYA 3WYFA 2GILA 1CR2A 2J41A 4CEIA 1IN5A 5AJWA 4UXJA 1EWRA 2B7CA 2CCJA 4TT3D 2GJKA 4BQSA 2E9SA 3DMDA 3FMPB 1N0VC 4DWJA 1FTSA 1VIYA 1XJ0A 3PITA 4DIDA 3PFIA 4PAQA 3EAQA 4QM7A 4RD1A 4LBYA 2ZM5A 2JASA 2JLZA 5LD2B 1CJKC 1KDTA 5EP4A 4CEHA 1BMFA 1FL9A 1ZAKA 4I1UA 1W47A 2RGNA 4V0KA 1DS6A 4PAOA 2OLJA 3TUZC 3W90A 2B21A 3RSOA 5HZKA 5UKDA 2QAGB 2FU5C 1J8YF 1KI4A 4OL0A 4US0R 4CT5A 4F38A 1JJ7A 3A1TA 4WIAA 1IQPA 2NPIA 1JPNA 1WBBA 1TF2A 4MRVA 2PX0A 3EZFA 1YZKA 1R6BX 3AQ4A 4IJMA 3CH4B 3L8YA 2EW1A 5E7JA 621PA 1XEXB 4P4SB 4QNRA 1ZYUA 3CKLA 3FYHA 4W5HA 4XH9B 3NBFA 4DJTA 1T3LA 2OXRA 1RZ3A 4DT1A 2W58A 2CL0X 2XITA 3TQFA 5EJEA 5KDDA 3CWZA 1ZBDA 1X8KA 2C96A 1DELA 1CRQA 3ZGXA 1TADA 4PSKA 5SZHB 3SJAA 5FOVA 1GKIA 5LB2A 4MQBA 4HLCA 2OV2A 3PUYA 4P3YA 1ZP6A 4D0LB 4GZLA 3IO3A 5JSZB 1GL9B 3LVRE 4TMXA 3C16C 1Z83A 2IS1A 2AFHE 1NP6A 5IT5A 3SQXA 3EARA 4LYJA 1G8YA 5CLQA 2WSMA 2HEIA 3MWJA 4U5XA 2Y8EA 2RH5A 1Y63A 4IOMA 3U3JA 3GLGE 3AF0A 4HAZA 1RVDA 1PLJA 3ICQB 2R2AA 2V7QA 2WMNB 1OW3B 3B1XA 4OQLA 2CEAA 5J4HA 1KMHA 2GETA 1M74A 3NH6A 4Q4HA 5BN4A 2ORVA 1F2UA 3KZ1E 3AF2A 4MYHA 2R44A 3QSYA 4P4UA 1G7RA 5D3MB 3OZXA 3BGWA 4IHQA 4FD2A 2FV8A 3A1VA 2X2EA 4KFSA 4A0RA 1E2IA 2BKEA 4X8HA 2QGNA 4Q48A 5BXQC 2F7SA 3B8HA 3U4QA 2BWJA 4EJSC 3W3AA 2ZETA 1G64A 1R7RA 4Q7JB 3TSOA 4BFVA 3DEFA 2CHQA 4GI7A 4Z8XA 1GL6A 1W2HA 3QOFA 3R7WB 4QGHA 5CLLA 3C41J 4QJ5A 3AVUA 1XJCA 4W5WA 2BM1A 2ZE8A 2OZEA 2VYFA 4TYYA 2ZRBA 3SFZA 1COWA 1QHHA 2FF7A 1J8MF 1OXTA 1U81A 1HE1C 4HLUA 1XB2A 4MGYR 1XZQA 5AUQA 2Z4RA 4M1TA 1O3YA 2AX4A 4DLWA 4ACAA 4FWTA 3B13B 3ZJYA 5CB8A 5DI3A 1NY6A 4EFLA 2CMKA 3SHWA 1LF5A 1G3UA 5FBVB 1UEJA 2PEZA 4HLUC 3I5YA 5CYPA 1U2RA 2FEOA 4OQXA 3V9PA 1IM2A 2QP4A 1AJEA 3GJ4A 3EWAA 3EIQA 1KO7A 5LD2C 221PA 4MGKR 2FSIA 5K8LA 4MKFA 1US8B 4ZI3A 1E99A 3LXXA 1SGWA 4C7OA 3BH7A 1W46A 3C15C 1E2LA 1KJWA 2XXAA 4QJ3A 2P65A 1U90A 1SVIA 4EPWA 4OKSA 1M1YE 3RRMA 5L3SA 4Q1BA 3KKQA 1R8QA 2IS6A 4Q1EA 1Q44A 3BIFA 4QC2A 3H4MA 1OIXA 4ABYA 4O0MA 3ZZUA 5IK2A 3QBTA 2G77B 2FSHA 3TQCA 5KSZA 2OAP1 2O8CB 5TXGA 3X1XA 1NY5A 2JEOA 4DDTA 1XJQA 2ZJBA 4QGGA 3I8SA 1VHTA 2VBCA 5ANRB 3T06B 3AF3A 1R0YA 3L43A 2XSZD 4YXWA 1HTWA 4V0NA 3WP1B 4PQYA 1ZIOA 4PPGA 2WMOB 1H65A 2ZROA 4M1MA 1Z0DA 3QJYA 3W8RA 3UMFA 1P7CA 2H18A 2IEZA 1OXSC 3K70B 1RE0A 4JLVA 4DCTA 1G8FA 1W36D 3A37A 3LQQA 3ZZ0A 3VR4A 3VNUA 1DAGA 4C2UA 4ZCMA 2OT3B 3BFXA 3EASA 3IHLA 3NBXX 1TU3A 3T5DA 2JLWA 3I8XA 4BRWA 1ZC3A 4FMCB 5SZKB 2FWRA 4LYHA 2A9KA 4LV8B 3TW4A 1K5DA 2Q9CA 4BZQA 1ELOA 1GRQA 2QSZA 3IBYA 2VPPA 1XXHE 2YWHA 4WXPA 4PC3A 4BWYA 5GVSA 5JSZA 1LVGA 2FE4A 1QG4A 3IEUA 2ZU0C 1XRJA 4CDGA 3HR8A 2FDCA 1G20E 1IY1A 1GKUB 2CL6X 5JI3E 5CK4A 3X1ZA 2IWHA 4NHOA 3RS3A 4DLSA 1G291 3WYGA 1ZNYA 2OM2A 4Q02A 4YDHB 1OH5A 4URVR 2BIFA 3GMTA 5HE8A 1OXVA 5FBRB 1E0AA 1G4UR 2FFHA 1NN1A 1TF7A 5BWMA 3MG9A 5KNBA 3CX7A 1RYFA 3QF4A 4BUJA 4RSGA 2P0EA 2ZJ8A 3FHOA 1H8ED 3Q7QA 1ZM3A 5KNDA 2WSSA 3CNNA 1KZ7B 5CIWA 2RHMA 2HF9A 2ZJ5A 4F4CA 1F2TB 5CK5A 3W8NA 2BCJQ 3PG5A 3BERA 3GCGA 1M34E 4YMSA 4KHZA 1GTVA 4DEXA 1NLZA 5JWOA 1Z5ZA 2IUUA 5J4KA 4BLRA 4LHWA 2ZJ2A 4KLNA 4B71A 4CVNA 5FTLA 1CF4A 1XX6A 1U0HC 1GKYA 3PIRA 2G6BA 1VPLA 2ZR7A 4YMTA 2A3RA 2IYZA 3WBJA 3QG5A 4TZ0A 3PUWA 3UATA 4DB4A 3CRVA 1SKQA 3KJIA 4Q1AA 4B32A 4A36A 4AY2A 4DCNA 2XTNA 1E2GA 4A92A 1XPOA 1Z0KA 1G6OA 4DSTA 3ADDA 5EUQB 3BWDD 4B35A 2IC5A 2ORIA 5KDLA 2BKUA 1Q1QA 3L2OB 5DGXA 3T12A 4B48A 4GL2A 2EVWX 3ADKA 4UJ3A 3VFDA 4QHSA 4YMUA 2GESA 1EFHA 3NXSA 4LK2A 4UNRA 2AXPA 4BFYA 2C78A 3ONWA 1R10A 3AF4A 3X1WA 5EP2A 1W4BA 4DIEA 1T91A 2HV8A 4TYNA 2ZTSA 1SVLA 2W2XA 2QRNA 3GJ3A 4M8NE 3GP8A 2JLRA 2HJVA 5BN5A 4MKHA 3RS5A 3M0EA 4R71A 5K8TA 4G1UC 5L3QB 1HA3A 3BXZA 1OHHA 2WPDD 3PUVA 2GK7A 4Q4JA 3CLVA 2WOJA 2JIZD 1TAGA 3TAUA 2QSYA 3QVVA 2G9NA 4IVRA 4WBSA 1R0ZA 4G5QA 5FPYA 1KZGB 2O0KA 3M6AA 1DARA 1IOZA 3IBGA 1G3RA 4AYXA 4C0HA 2F6RA 5SZIA 2HYIC 5F2EA 3PCRB 4CT4B 2HXYA 1SVSA 2IF0A 1SULA 2ZVPX 5DHFA 1EFRD 4HAUA 3IILA 3I3SR 1L8QA 3T61A 1GG2A 4BLTA 1ZMXA 5AUPB 1J2JA 3KQNA 1R0XA 4EKDA 1TQ6A 1F5NA 2V6JA 3RNLA 3AUYA 3KXIA 2J5XA 3DDCA 3O47A 4TLEA 2GF9A 4GP6A 1WCV1 1TU4A 4FCWA 1JEDA 3T1OA 3K0FB 1SXJC 2ZE6A 4GFDA 3D31A 1M7BA 3GEEA 2A78A 2DBYA 4EQ6A 1MABB 5B58C 5IF9A 4P0TA 2DCUA 1HQCA 4EAQA 521PA 4A4DA 2JLQA 4X8LA 3X1DA 4B3BA 1Q20A 3U6BA 1JXOA 3DKPA 1KO5A 3VR6A 2YWFA 4BLSA 4DUGD 4JBXA 4QFMA 1SKYE 2N42A 1YRBA 4LRWA 1Z47A 2BV3A 5KPDA 2JCSA 2OFOA 3KUCA 4IDOA 2GF0A 1D9ZA 4PHTA 3EZ6A 1N6RA 4G5GA 3WMGA 4URZR 3VR5A 3R9WA 1Z0FA 3K9HA 3NKVA 4TTRA 2DB3A 2RHDA 1AGPA 2YOFA 4NE2A 3CONA 1HY3A 2W2TA 2GK6A 4JL5A 3TSWA 3TUIC 4AI6A 1NVWQ 5CYOA 1U8AA 3O8CA 4HLQB 4M0LA 2EQBA 3AKCA 4MYTA 2W00A 2OO7A 3CBQA 3HU2A 5KO2A 2EFHB 3T35A 3LFUA 4LYAA 4MRNA 3SBEA 1NKTA 1R5OA 1JECA 1X8LA 2PT5A 4DLRA 2N1BA 1XBTA 2HF8A 2AKYA 4MGZR 2N46A 1ZD1A 1Q22A 4R2HA 4PPNA 1KGDA 3UWOA 1EFUA 1RJ9A 3AVPA 4S2EA 2V54A 1AK2A 4XWKA 1LNZA 5H70A 1HE8B 1U9IC 4TMKA 3AKYA 1W0JA 1OFIA 4TMWA 1X3SA 3MCAA 3LDAA 1EG7A 2WM9B 4PPQA 1TQ4A 4PO9A 2VA8A 3NG1A 5E95A 5JEDA 4DLUA 2CL7X 4Q00A 821PA 1JEEA 1OB2A 3A1SA 4QG7A 3THOA 4TQUS 3MGCA 3TBKA 1IJFA 1IY2A 3MAAC 2ZI5A 1OSNA 3IIMA 1JB1A 2FGKA 4DSOA 2WJIA 2VO1A 4ESVA 2EWVA 5G41A 1CRPA 1Q12A 3CW2A 2UVQA 1AIPA 1N25A 3EC2A 4AWXA 5CJPA 2ZJOA 1DAKA 4KYUA 4Z51A 4MITA 1T0HB 1G18A 4MGIR 4XWAA 4BEJA 2QQ0A 4A0FA 4Z1MA 3MSXA 3WRYC 1TX4B 721PA 1JBKA 4Q4JB 2GCOB 1YVDA 1DG1G 2WWGA 2O8DB 1UKVY 4JT4A 1VG0B 1OYYA 2FA9A 4D4LA 3RHFA 1W7AA 1IN8A 5DE3A 2QTVB 5AUOB 1DAIA 1YU9A 1KO8A 2IUTA 2YVUA 3QEJA 4KCGA 4N3NA 4MUAA 4ZDKA 1VKJA 2FFQA 4DSNA 2KBFA 4JLAA 4Q21A 1NVVR 1ONBA 3K0SA 2GJ9A 2I1VB 3I1FA 1KDPA 2FJUA 2NZ8A 5EXPA 1CIPA 2J9RA 1KK2A 1Z6YA 1E1QA 3Q5DA 1D9XA 1ZUHA 5AJXA 3ZS8A 1KNQA 1E6CA 2PL3A 3FFBA 3GLIE 2E1RA 4PR0A 2F43A 4UXHA 2GVZC 2A5GA 1W4RA 3C5CA 1DBSA 3EWSA 2IA5A 1P4SA 2QORA 1WB9A 1A82A 2QUZA 1QHYA 3K9LA 4LV5B 1NL3A 1RFLA 4TYWA 3ZLJA 5FUYA 1DG3A 5K8UA 2V1UA 3NDPA 4EPXA 1G4AE 2PJZA 2VH5R 1ZVQA 4M53A 3LBHA 4IXNA 4L15A 2WKPA 2ZSDA 4ZKDA 3R7WA 4LZZA 4HYYA 4EPTA 3LY5A 1XFAA 2OE2A 4LHYA 1YZTA 3KTAA 4QL3A 2C8VA 2SHKA 3SC3A 1E9BA 3I62A 5JEEA 5JLJA 1WMSA 1E2JA 2FMXA 3Q72A 3TVDA 2RGGA 1K5GA 5KPJA 2O8BA 2QROA 1R2QA 1TPZA 2B92A 4DC9A 4PHHA 3VR2A 3ICEA 3GLFA 3DPUA 2ERYA 3SHFA 2I4IA 2F3TA 3F5FA 4DHEA 3CF2A 1AZSC 3CUEF 3F8TA 2IX3A 4URWR 4FMDF 1AQYA 2MSDB 3PUZA 1FOEB 5HR5A 3CIOA 2G83A 2OHFA 1P60A 3TGPA 2VSOA 3KDSE 3VMFA 3KTAB 1E4VA 4PQFA 4JVLA 1R8SA 4LSGA 4RD2A 4MRPA 2XGJA 1D2EA 1E98A 4LUCA 2LKCA 4Q4AB 3VQTA 5C4MA 1AKYA 3QKRB 1Q1ZA 4U00A 3U3OA 4C0BA 5DYGA 2FG5A 1QHSA 1S9DA 1BYUA 3D3QA 4TL9A 1CEEA 1KAOA 2VEDA 2PMKA 4MKIA 4HAVA 3RC3A 1W5TA 1LS1A 3FB4A 3MD0A 3ZYCA 3AH8A 2CBZA 3GEIA 3QNUA 2LKDA 1LW7A 2WWHA 3L0OA 3NTUA 3D6TB 1E0KA 1RJ9B 2Z83A 2AWOA 1AQUA 4W7SA 1G8HA 1KSFX 2F43B 4DDVA 5AJYA 4EPVA 4A6XA 3K53A 3QKSB 4V0LA 4QM6A 2GTPA 1W4CA 1D2NA 1RYHA 2KI5A 4KITB 3VU9B 2WWFA 3AB3A 2QPAA 3N2EA 2HT1A 2J1LA 5JWRA 3DZ8A 4BEBA 4RZ3A 1NMYA 3I61A 1FNNA 3NHAA 2GKSA 3QG1A 4KI0A 3VAAA 3BS4A 3GFPA 1FTNA 1G19A 2BMEA 2IT1A 1A2BA 3AP2A 3QF4B 4TLAA 1ETUA 3CWQA 4JLJA 3K9GA 2OCYC 4NCHA 5JBQA 3K0EA 1YR8A 3B2EA 3KQUA 4B33A 2IYRA 3M1IA 3P4YA 4G0NA 4LJ9A 4MH0R 1QBKC 2FSFA 2C9YA 1XPRA 5FI0B 1XMSA 4AG5A 1Z6TA 4A2WA 4W9MC 1OF1A 2DR3A 4F4JA 3WHLA 3UXMA 4OQFA 2H5EA 4JYBA 2PCJA 2NMVA 2O8FB 5A0FA 3RS2A 3JZMA 1YR7A 2I3BA 2Q0HA 4M1KA 2V1XA 4D0GA 2VRWA 2ODWA 4B3DA 5EP3A 2YV5A 2AD5A 1UKYA 2XB2A 3BD9A 3VHLB 1S2MA 3QQ5A 1E1RD 3FVQA 3E5HA 3OEHD 4NYIQ 2ATXA 5IK2D 2HLDD 2JDIA 4EPRA 4Q5IA 3UG7A 2ODBA 2GEUA 2QBYB 2CNWD 2X19A 1OJLA 2FPKA 2XSZA 3VR3A 4YXWD 1T8TA 1R5NA 3B1ZA 4AKIA 1Z0IA 3ECCA 5FI1B 3SFVA 2ZRIA 3RANA 4GT1A 1SXJB 4NPHA 3GPLA 1GILA 2XZLA 2R9VA 2R6DA 3ZZTA 2IYSA 2FEMA 1JAIA 1U0LA 3MLEA 2YYZA 3NVAA 2NTYC 4UJ5A 2J0QA 2F55A 3OIWA 4B2IA 3MRSA 5G3YA 4AIIA 4QXAA 4KFUA 4LJAA 1WBDA 3JZAA 4FMDB 3LBNA 1NG9A 3FDIA 1OHHD 3SOPA 4QNMA 3NC1C 1IHUA 2WJYA 4ZPXA 1LB1B 4ZIRB 2ZRKA 1E2EA 2WOOA 5H1YA 3U3MA 1KK3A 5JWHA 4F4IA 1W36C 4HUQB 3GJXC 4ZKEA 2VSFA 4D2IA 4WAUA 5JFGA 4A2PA 4EJSB 4HEJA 3SYLA 3IUYA 1T8UA 3L8ZA 1KI7A 2IYXA 4IVQA 1EFRA 4C0SA 4CF7A 2Z43A 1U99A 1J7KA 2C9CA 2KB0A 2YOHA 4IKEA 3FMFA 4NMMA 4PZLA 4TN1A 2ZSBA 3IO5A 3ADCA 5JRZA 3CB4A 2DFKB 1G3IA 4I99A 2GEVA 2W83A 3SN6A 4BGDA 3GLHE 4ZIRA 2KJQA 3BBPA 3BH6A 1I2MA 2EFEB 2V6IA 2ZYTX 1G8PA 1YRAA 3T1TA 4JLKA 3TK1A 2QZ4A 2PT7A 1M6NA 4EFNA 2ZRNA 3AM1A 2D3WA 4DUGA 3OIUA 5E4FA 2QY9A 3T5GA 1ZUNB 2VIIA 3RS0A 2QTHA 2XJ9A 1S3GA 1U8ZA 1RIFA 4I1OA 1I4TD 1ZM7A 3GJ6A 1G3MA 2ANBA 3G82C 1UBGA 4ARZA 1FMJA 4TQAA 1GSIA 1NI3A 3HP1A 2V8OA 3F3YA 4HATA 4P32A 2JLVA 1JR6A 4X8MA 3B7GA 3NH9A 4B2PA 5HPYB 2J59A 4KJZA 1GUAA 3CNOA 3O8DA 1W49A 5CB6A 3WBKA 2NQ2C 3OAAD 1F6BA 5H68A 3U3RA 3W5IA 2H1LA 3OF5A 1XTRA 4A1FA 4Y0AA 4QKQA 2RB4A 3PEWA 4OHYA 4LOAA 5LB4A 2IYUA 5DN6D 4URXR 1VTKA 3QKTA 3T1VA 1JAHA 4P33A 4Q9IA 2RAPA 3B60A 3QEOA 1P61B 4D81A 3WNDA 1BOFA 3B82A 4KSCA 3GLFE 1NLYA 4MUBA 1OKKD 4GSYA 1E9SA 1SKYB 1XTQA 1K6MA 2O8FA 3KB1A 3C7KA 2AR7A 2QPOA 3ASZA 1XWIA 3PR1A 3RC8A 1IXZA 4BZPA 2QRZA 1P75A 4L16A 3ZVLA 3PJRA 4GPTA 3UKDA 4TWZA 3V4FA 1XNJA 2DFNA 2JATA 3EIHA 1G6HA 1OKKA 2YC4C 3SYKA 1RC8A 1QG2A 2NO7A 1CJTC 2AK2A 1NKSA 4C30A 2IYTA 3BRWD 5LBIA 3DO6A 4JZKA 2Q3MA 3KFXA 3TSZA 4B74A 1KAGA 1YE8A 4IEIA 2IXGA 4U02A 3K0FA 2ZI3A 1NN0A 2WTUA 4V02A 1TUIA 3RDPA 2J3EA 1F2UB 4GRAA 2CHGA 2HT6A 4UQOA 1RW4A 2NG1A 4K8OA 4QGAA 4LCBA 3QI2A 3VKWA 2DWQA 4ITRC 4D80A 2QMOA 4NCKA 2JIZA 2DHRA 2QGZA 2OFXA 3CPEA 2YWEA 4O2LA 1KI9A 1UKEA 4ZDWA 3SS8A 2JLXA 1CKEA 1RRCA 4BRUA 4TZ6A 4PC7A 2ZR9A 4C0JA 4BLOA 2A5DA 3DMNA 5CM8B 1Z3IX 3P4XA 2ASEA 2G1KA 3RABA 1OIVA 4NYMQ 4KBFA 2JA1A 1YHNA 3P20A 2ECKA 4V03A 3N5CA 2JJ2A 4G01B 3SU8A 2ZRMA 1LF0A 4C0LA 1XF9A 2IWRA 2ZE5A 2NGRA 2GJ8A 3MUFA 4A8JB 1BKDR 1J70A 3OFND 4UKDA 2WJJA 1WF3A 3KKNA 4PFSA 1PV4A 3I92A 3NHBA 1I2DA 4JLBA 1JNYA 2VP4A 3NDBB 5C18A 3THWA 4IXMA 5GJBA 4C4PA 5P21A 3QVUA 3K09C 1KI6A 4F91B 4ZO4A 1BMFD 4EUNA 4NH0A 4WZ6A 2EFGA 4II7A 2ZQ5A 3LV8A 3PUXA 1Y3AA 4B75A 3AVWA 4LV6A 3NEYA 5HCIA 4PSAA 2ZSEA 1SVKA 4HDQB 3DM9B 3Q9LA 1II8B 2CCGA 2J45A 4M9SA 2XAUA 3AGQA 5EZ5A 3TAHA 3RAPR 2H16A 4OHXA 3GLGB 3FFAA 2RGBA 5CDFA 2XOKD 3U60B 1K8RA 1JI0A 4A0HA 2VHCA 5DH9A 3F0TA 1GWNA 3U44B 4DLVA 2ZS9A 1RRFA 1YZQA 3CZPA 2ZXUA 2IYWA 2ZU6A 3M4YA 1JR3A 3K70D 1XU4A 2CVHA 3A1UA 3GLGA 4PTLA 1FW6A 1S96A 2ZRJA 3GLHA 3GQBA 1XEWX 2ONKA 2G1JA 2ZRHA 4IDQA 4IDNA 4BASA 1CR0A 1DO0A 4KYIB 1JR3D 3BJIC 2HUPA 4BFWA 3KL4A 2C98A 4L9SA 2CJWB 2PCLA 3KFVA 1II9A 2ZUBA 1HURA 4IFEA 4JIMA 4PZZA 2OLKA 5E7IA 4D4KA 3RLFA 2P2LA 1FUUA 1E2MA 4FMCF 2IHBA 2ZYVX 2GBLA 4ZI2A 1NRJB 1GNRA 1C4OA 1P2VA 2C9OA 4Q9LA 2J87A 5DISB 1F60A 5EXTA 4CEJB 5CIQA 1CJUC 1SXJE 1YR6A 3CRW1 4IOJA 3LAWA 2XEXA 1F3OA 4AURA 4XVUA 4CEHB 4M9ZA 2R62A 1JQJC 2H57A 4YLGA 4A8JA 5KHOC 1AA9A 2EYQA 3CPJB 3EC1A 4L8GA 4WOPA 1KMHB 4LJ8A 2ZYWX 3BAFA 4V0OA 4MA4A 2WHXA 4GOJA 2GCNA 4DBLC 4K81B 2H7VA 3TE6A 2ZAMA 1FQJA 4HI0E 4A8JC 1E79D 2D06A 2GJSA 3EZ2A 4HB4A 5J47A 1XPUA 2CLCX 4UXIA 2GA8A 3SI7A 5EE0A 4M21A 4OYHA 2XNSA 5CM9C 1W1WA 4RD0A 1G7TA 3AP3A 3GJ7A 1IAQA 2BMJA 4FWIB 2IEYA 2UZIR 2BM0A 4O2RA 2GJAA 1T3SA 1SVMA 5JJKA 4XD7A 4OQNA 1UDWA 1ZU5A 2AK3A 4AKEA 3WMFA 2ZUCA 1YZUA 3N2IA 2J0SA 1SQ5A 2CXXA 3G5UA 3FHTA 3B6EA 1COWD 3QKUA 1U8YA 1Z06A 2OILA 2WWWA 5AWFC 3DOEA 4RCYA 4TLBA 1T5IA 3JVVA 1Q21A 4M22A 1UDXA 1Q57A 2PZGA 1KSJA 3QY0A 3LBIA 1E2DA 4AK9A 5FL7A 2NPFA 3TR5A 2Q6TA 3BORA 5JCPA 6Q21A 1DOAA 1W0KA 3QPVA 1ZIPA 3UWKA 5TVKA 2OBMA 3I4LA 1UEIA 2X8AA 2IUSA 3K70C 2EU8A 1WDTA 5FL7D 2QPTA 2CE7A 4ERNA 2EYUA 2Q21A 2FFBA 1KKLA 4L5BA 2OAQ1 4UNNA 3GFTA 2PX3A 5H8WA 3QE0A 2QU8A 1ZCBA 1NSTA 2ZI9A 4TTQA 3EXAA 4NBSA 2BEJA 2IW3A 4ASUD 4JLDA 4Q9KA 2R65A 3A36A 5EZ6B 2AHOA 1G3QA 1EFCA 2CNWA 4LX0A 4KXFB 1UBFA 4DLTA 2WAYA 1NF3A 5FFMA 2QP9X 4ZV4A 2FNAA 3W34A 2GHIA 2W0SA 1VECA 3SE0A 1WQ1R 3KJGA 1N0WA 2VHTA 4OHVA 1W48A 3ZVNA 1FX0B 4LC0A 1KMQA 1Q3HA 5BYJA 2D74A 2KE5A 2P3SA 4YDSA 2J7KA 5FBWB 1W36B 4RD6A 1S9HA 4EDHA 2VL7A 3BH0A 3W9YA 4HAYA 1YJ5A 3BB1A 1GOTA 4CEIB 4HAXA 3RSLA 2BDTA 2GEDA 4R7ZA 3L0SA 2C2HA 2NO9A 4EPYA 3ND9A 3LA6A 2D2EA 3IQWA 1ZM9A 1VCIA 4E03A 3QXSA 2WWIA 4UNSA 5F98A 4BE7B 2ZI7A 4JJKA 1KK1A 2KWIA 4N0EA 2PMDA 1NBMD 1TQ2A 1N0UA 4I81A 1E94E 3ZH9B 2PH1A 1U94A 1ZU4A 1UBEA 4DLZA 1QF9A 4FW9A 4QBGB 2J7PA 1ODFA 5GJCA 4E5UA 4DVGA 4LI0A 4B44A 4HZUB 3U7HB 4UNQA 2ZEJA 3Q5EA 2XZPA 5DO9A 5M04A 5FOTA 1N5LA 1XTJA 2Z5FA 1D6JA 1Z6AA 3K8YA 4DSUA 2G88A 1P6XA 4TYPA 1P9NA 1E2KA 1VDZA 4KODA 4TL6A 1EGAA 2DFLA 4P4SA 2VTKA 2VP0A 2OXCA 1ZJ6A 1PLLA 4RVCA 4BECA 1G41A 2DY1A 4DB2A 1RPZA 4QBIA 4HDOB 1VYVA 3D8BA 1XCPA 5C2JB 2IXFA 2ZREA 1JQLB 5J5CA 5TMPA 4KVAA 1E2NA 2HDNB 4V0MA 5CDFE 2AKAB 2BC9A 4LHXA 1M7GA 3TR0A 4U7DA 3LLMA 5F9FA 2FZLA 3OAAA 2Q9BA 2XTZA 4NYJQ 1ZUIA 2D4HA 3R8FA 5FR1A 1EK0A 3IPXA 4D4JA 1GRRA 1HUQA 3U44A 2GZDA 3GLIA 1E2QA 4CZ2A 2YC2C 3PV0A 4L9WA 1NVUQ 5FOWA 3IDQA 1T6NA 3KJEA 4BPBA 1VCOA 1LV7A 1E2FA 3DM5A 4CW7A 4PO1A 4JVSB 4GMXA 1DO2A 3NBZC 1E1RA 3OEHA 4BFXA 4M9XA 4Q9HA 2H92A 3DKVA 1QVAA 2GDJA 4C0KA 3OIVA 5FPKA 1R5BA 2HLDA 2H8KA 3L0IB 3T34A 2JLUA 1KIMA 3KQKA 4L4UA 3O8RA 2MSEB 1TUEA 3FKSD 3BFKA 1NN3A 5HTKA 1N6LA 3SNHA 3FOZA 2YHSA 1II8A 3REGA 2XX3A 2GCOA 4JLPA 3K0CC 2GVDC 2O8EB 2OSBA 2L0XA 3RRZA 2GCPA 3B1WA 3N70A 2RGDA 1LY1A 1IBRA 4R9UC 1CJVC 1HYQA 4D0NA 3EPLA 2BBOA 4RKFA 4OJQA 2ZRPA 4EFMA 4DRZA 4M2LA 1ZW6A 1XD2A 4BFTA 2A5YB 4LDJA 1X8JA 3U4QB 3R9XA 1XZPA 2CDNA 4ZDIA 5JCZA 3E1SA 1UF9A 4F7WA 5BW8A 4EQ6B 1E9CA 1YZLA 3LVQE 1CULC 4IDPA 3NEJA 1UBCA 4Q4LA 1VYTA 3QKSA 2XNDA 1CS4C 2R6AA 4AKHA 1HEIA 4NONA 2YNMA 4TLDA 4PO8A 3A8TA 4QJ4A 1NLFA 4Q4HB 5KYKA 3Q7PA 1V5WA 1XTKA 4JLNA 4WVFA 1E9DA 5J4VA 1N5JA 5JS8A 4KAXA 3QXJA 2QA5A 1C1YA 4ACBA 1OIWA 3S1AA 1GNQA 3B9QA 3HJNA 2GXAA 1XMVA 1ZM4A 4Q7LA 2QMEA 5DI3B 1X6VA 1M2OB 1OB5A 4XJXA 4B3GA 4AYTA 1S1CA 1XD9A 1Z08A 2HXSA 1ZINA 2AD1A 2VSXA 3EA0A 3TH5A 4HUTA 4IOKA 4JS0A 3W5JA 1CR4A 2J0UA 2O5VA 4MDEA 5FUXA 1L2TA 4OI1A 3AVXA 4RKEA 3C5HA 3SJCA 2BOVA 3KB2A 4Z8YA 1DEKA 1ZRHA 2EWWA 4I4LA 3BFVA 4GOKA 1MH1A 2IL1A 2CK3D 1TEVA 5IHPA 1CLUA 3FHCB 3CNLA 4HAWA 4DLXA 1HT1E 2REBA 1T5LA 4LJ5A 3ETLA 2V9PA 4IFBA 4GDFA 5FBLB 4WXRA 5JHGB 2ZRFA 3EG5A 3VHXA 2P6NA 4ESHA 2XOKA 3L0PA 4LY6A 3CX6A 2VHJA 2CK3A 4MKGA 5FPSA 4H1VA 4GP7A 1DE0A 1RKBA 3PEUA 1TEXA 4GNKA 1VG9B 3RWOA 2OG2A 5FOUA 1NBME 3QPWA 2W6ID 1N3BA 1KI8A 4PX9A 5KSOA 5FTNA 1UAAA 1O87A 3VTKA 3EZ9A 1M8PA 4BLQA 3FE2A 4ZDJA 1Q3TA 2X1VA 3DHWC 1ZC4A 3I73A 1H8HD 2OUKA 2QEQA 4NP6A 4POAA 2B7BA 2ZS7A 4QHYA 5FH9A 2P67A 1KO1A 1ZM2A 3U7FB 3K0AB 1JJVA 1XMIA 2OBLA 1U0JA 2CCKA 2O0HA 1QDEA 4H1UA 5ELXA 2AXNA 2VF7A 4JKIA 5JZVA 4RFSB 1J90A 3B1YA 1H8HA 5GJVC 1FP7A 2QMUA 1PJRA 1G21E 1U9IA 1W4AA 1J99A 4ARZB 4XVRA 3JVUA 1KHTA 2KBEA 1VMAA 1Z28A 1A1VA 3LH5A 4Q66C 3CR8A 3PVSA 2WAXA 2PJRA 3KX2A 4NCJA 2FN4A 5B2ZA 4C9BA 2GZAA 2VP2A 3A4NA 3OE7A 1AGRA 1NSFA 2ZRCA 3KKOA 4FCVA 3PEVA 3ZQJA 2ZVQX 1XD2B 4G5OA 1QHNA 2X77A 4MYUA 4TMVA 2C99A 2QP3A 3MWYW 1UPTA 5JECA 3LX5A 1E79A 2ZAOA 3OE7D 2WJHA 2QM7A 3LX8A 2XZOA 2BJWA 4B43A 3RWMB 1AZTA 2XJ4A 1E32A 1M7HA 4JKYA 4JT2A 4K46A 1FQKA 3TJZA 4C0QC 1XCMA 2QT0A 2TMKA 1X1RA 2XTMA 3LW8A 4Z1MD 2JJ2D 2FGJA 2ZJYA 5FTMA 3B5JA 1OXXK 3OFNA 1OT3A 3ZIAA 2WVJA 3Q3JB 5DYIA 1S8FA 5FOXA 3VU9A 5DIFA 2OFWA 2AL7A 3OEEA 3U61B 1ZNWA 2XXAB 3HU1A 4QBFA 2OCBA 2AFIE 3VNVA 1SXJA 2EFDB 4JVMA 3ZD7A 1XCGB 1G17A 5DHAA 3KKPA 5G53C 4TLCA 4PANA 4F93B 2D7CA 5J40A 4DCVA 4NYIR 1QHXA 4QOSA 3U6KA 3SBDA 1W0KD 3AVVA 1GFIA 4BFSA 1G5RA 1Z2AA 2CLDX 3UG6A 1OXUA 2QE7A 4GMDA 3THYB 4XSHA 4M1WA 3QIAA 1UADA 1XP8A 2ANCA 4H9GA 3E2IA 2HYDA 1ZD9A 4KFRA 4XTRA 3CH5A 1PLKA 5CITA 2BMFA 2NIPA 3R20A 4DZZA 2GZHA 3OESA 2BHRA 3FKQA 3UPUA 3SQWA 3FMOB 2CLSA 4DCUA 1N6HA 4OQMA 2F9LA 1MO3A 4IVPA 3EPKA 5C1BA 1TL7C 1I4LD 4B3FX 1NIJA 1MV5A 4LJ6A 2GBLC 4URYR 1FFHA 5JHHB 1CU1A 3LXRA 4FCTA 3ZVMA 2Z0MA 2FOLA 2BCGY 2O8BB 5JJIA 4GBMA 5KOYA 2G0TA 4PZYA 5L3QA 5SZJA 3B85A 2BVNA 5JJLA 3BE4A 1KTVA 1EESA 1KI6B 3IQXA 3LQRA 4M4SA 3CRRA 5C46F 3AV0B 4RD3A 4RFVA 2WICA 2A5JA 3EW9A 3GEHA 4IDHA 3TUJC 5K8IA 2Q9AA 2P6RA 1Z22A 4LC1A 2C5LA 3NIBA 2WV9A 3FMIA 4RFSA 4ON9A 3ZDQA 1R4AA 3UIEA 3S1AB 1EX6A 1L4UA 3BK7A 3IGFA 4PC6A 3AF1A 1U98A 1E69A 1E9EA 3QPUA 3RRNA 1DAHA 2IYYA 3L82B 4OK3A 1E96A 1E2PA 2A7QA 2IYLD 2J7PD 4JLMA 1QHGA 3CF6R 2B6HA 5AUNB 1W2GA 1EXMA 4YMWA 2PLRA 2K5UA 2UZ3A 1GM5A 1VHLA 3AUXA 1RRPA 4HB3A 4I1VA 3QKRA 5L8VA 2IXEA 1GP2A 3U3KA 5FUWA 2W0MA 1X86B 1E0SA 1D2MA 1FUKA 1DAEA 2O52A 3ASYA 1AS3A 1IY0A 3K1JA 4TSFA 2P5SA 4C3ZA 1EFTA 1WE2A 4CRWB 3K09A 4Q1CA 4PPFA 3HPRA 3WMEA 5KDOA 4M1OA 4HZIA 4A0GA 2BEKA 4MRRA 1N6IA 4YMVA 2NO6A 1GAJA 4ZCLA 2QI9C 3H0KA 1YKSA 1FP6A 2GRJA 1YZNA 1GIAA 1P2TA 1P72A 2NOAA 2QNRA 3MJHA 2I1QA 1G1MA 5TV2A 4NU0A 3CF0A 4PXAA 1KI3A 1L4YA 4DDUA 1D8TA 1FZQA 1MO5A 5F9HA 2ODNA 3W6NA 2V3CC 1LTQA 4B73A 1YZGA 2ZPTX 3Q85A 5DI9A 4PC2A 2WBLC 3IIJA 1NJFA 1KNXA 1NVXQ 4LPKA 3ND8A 2FSGA 2ZIAA 1AKEA 1XMJA 2W2VA 3DZDA 2ZSAA 3GLHB 3QUSA 3RS4A 4D26A 4HDCA 4KV9A 2QAGC 4Q9JA 5EXSA 3E70C 3IHWA 1W44A 3LO5A 1TF5A 4D4MA 4TL7A 3AP1A 4KLZA 4DXAA 1YR9A 4BLPA 1NJGA 4Q18A 3TW8B 3HR7A 3I32A 4KBGA 4HB2A 3NC0C 5KU1A 3TVTA 1OH7A 2GXUA 3SJZA 4DLYA 1F48A 1KI1A 4OK5A 1MABA 3FKSA 1P3JA 1P9RA 4DDWA 1XTIA 1WRBA 3LRPA 3V4RA 1N6KA 4LHVA 4IW3B 2ZANA 3HYRA 4C0AC 2CE2X 1X1SA 3EIEA 2A2ZA 1UKZA 2JDID 3C4JA 2ONJA 1KJYA 4AG6A 4P31A 1WXQA 3U2QA 5LDDC 4NL4H 2DWPA 1A5TA 2MMCA 2VQSA 1UJ2A 4PQRA 1RRGA 4UNPA 5HCNA 3LWNA 1PUJA 1OLOA 4MYCA 2YJTD 2ZR0A 2HCBA 1E0JA 4A9AA 3FGNA 1Z6GA 1Z6XA 4V0ME 1S1MA 1G7SA 1T9HA 2Q3FA 4CIDA 2IS2A 2HCJB 3WRXC 2D62A 3GLFB 2ZRLA 1SZPA 2OESA 3KXLA 3QBVA 1MO4A 3CR7A 2QAJA 2XNDD 1QRAA 1XXHA 2IF2A 5J4LA 1KI2A 4US2R 2V4ZA 1P2SA 5FUVA 4Y0VA 5A4JA 1FMLA 3ADBA 1XDBA 1N6OA 2G0NA 3IPYA 2ORWA 2RGNC 2LCFA 3A4MA 2O8EA 2VP9A 5L3SB 3C14C 2QAGA 1JXMA 2PZFA 4KVGA 2MSCB 5HE9A 4D25A 5EE1A 1P73A 2JJ8A 3NWJA 4ZCIA 1KDOA 1N2CE 2V7QD 2WWXA 1YQTA 1VCNA 2OCAA 3TLXA 3EZ7A 3OIYA 3FWYA 3VX3A 4A2QA 4BZXA 4TYQA 1MR3F 3AKEA 4RZ2A 2DYKA 2G3YA 3W3ZB 4B3CA 2OBNA 2C95A 4RD4A 1Z0JA 2Q3HA 2FPMA 4QBHA 1DADA 1E9FA 5JRJA 5GJWC 2RMKA 3HYTA 5GVRA 3ZQ6A 3KUDA 5KNCA 3U7EB 1KY3A 2W6JD 4X8OA 3CRQA 1PVOA 3SYNA 2FX3A 4OK6A 3BOSA 3MJRA 4QGFA 421PA 5J4YA 1SHKA 1G5TA 2B8TA 4Q1FA 1E2HA 4NYMR 2PEYA 4YONB 4HLDA 3DVLA 2R6CA 1T4GA 1P62B 5KTYA 2W6JA 4CYMA 1XEXA 4OBEA 4OHWA 2YOGA 1TTTA 5L3VA 3CX8A 4QHTA 1ZNXA 3WNBA 1DAFA 3HWSA 1G9XA 1ZCAA 1V43A 4HUQA 2BBWA 4J0QA 3AVQA 4Q7MB 5FPHA 4HZUA 2QMHA 1WA5A 3HU3A 5DN6A 4Q01A 5E3HA 3SR0A 3QF7A 1OFUX 4F92B 1E1QD 2ERXA 4LJ7A 4IOLA 2GAAA 5BQ5A 1VCMA 1QVRA 4XIGS 2VHQA 2QL6A 3U5ZB 4FINA 2ZJZA 4ILEA 1KK0A 2F3RA 1P5ZB 2J0UB 1IN4A 3CPHA 2FZ4A 4JL8A 5FTKA 1T0JB 1XD8A 3ZVRA 5EE5B 2JLSA 3H1TA 2QENA 2RKOA 2ZJAA 1NN5A 3QXXA 2ZITA 4MDFA 2AN9A 1BYIA 4EIWA
chains in the Genus database with same CATH superfamily
4G5RA 2ZRAA 4FQ5A 1XCBA 5HZHA 5MDHA 3QQPA 5JCJA 4R68A 4M9QA 2WJWA 3CVOA 3RIMA 2BUBA 4RCZA 2V7EA 3NR2A 1B0AA 5CJJA 2BGJA 1C1HA 1MKYA 1OV4A 2XLCA 4UUQA 4NBRA 1DNPA 1ZNZA 2YINC 4B84A 1KOFA 3DMTC 5BYKA 2VDKB 4Z0HO 5BSGA 4J1NA 4BTVA 3C8UA 2TS1A 1IHXA 5FEUA 4WW0A 4LTNA 4OUKX 1TMKA 3R9IA 4YT2A 2VK1A 4E4RA 1QHHB 4V3BA 3ZY3A 3WNCA 1IN1A 5EJFA 4DYHA 3TKLA 4BC0A 3KPWA 4J43A 3PPYA 2TSYB 1DIGA 1JA0A 1GR1A 4DLPA 1D07A 3G8YA 1U4SA 3HI6A 4UUBA 4B9AA 3HJFA 1BTOA 5ER9A 3GRUA 3P1JA 4FFMA 4GOND 3TNFA 3S40A 3JZDA 3DL7A 4ZOAA 4MUIA 5DMHA 3PT9A 3RT1A 4A15A 3LI2A 2RIRA 1VE9A 2XUPA 3PD1A 1U0OC 2RI1A 1XDSA 3T3HA 1GDDA 1L4KA 4OLFA 5FX2A 3RG2A 2O6HA 5CDTA 3UMMA 2FN3A 4LK3A 4ZZ1A 3EPJA 2BAGA 3AR3A 3IUBA 4G5FA 1U6IA 3I6ZA 5CD1A 3WGIA 2AWNA 1R4NB 5IULC 2JD2A 3KJXA 3HEBA 1ADJA 1BMTA 4DLNA 3ELDA 1G5PA 1B8VA 4II3A 3ZIUA 3M9XA 2UZ4A 1UEXC 1JRLA 4X85A 4IG4A 2HWKA 1K2WA 3VR5A 1WULS 4BVGA 1E6KA 3IRVA 2VYNA 4GECA 3WO1A 1DIOB 3FTNA 3KYCA 3VU3A 2LWIA 2BGLA 4JBGA 3EX7C 4LGMA 4R16A 3UOWA 2B8WA 1LV8A 2P1RA 4PYOA 3O2JA 4K3VA 3UTCA 2VT3A 3WRVA 4E6PA 1CT9A 4IWXA 5IDWA 5LFAA 1I3LA 4Y2VA 1E3IA 1MDFA 1YB4A 2O2EA 4BNIA 3EA5A 4KFTA 2RCNA 3KPJA 1IK4A 4MR7B 2X3UA 4PG5A 4TKMA 5LWHA 2FFAA 4LSWA 2Y76A 2C5FA 1O58A 3TEJA 1ESNA 1WXGA 1H5UA 3EYAA 1U4NA 2VP6A 4NXNB 3N7UA 3PDWA 3FDZA 1J21A 2AN5A 4OFXA 5DV9A 4X0EA 3WY9A 4CL0A 3ONDA 3PA8A 1BRMA 4KW7A 1PYOA 1Y81A 4QJBA 1I3NA 4D6PA 5LPNA 3G7UA 2REXB 3I6MA 3TLCA 3FHJA 2UZ0A 4Y2HA 1NW9B 4FZRA 1E6LA 1R4NA 4D9BA 4EUFA 3V1NA 2QX8A 4RWZA 2Q07A 1SQ0A 2IY7A 4BCCA 3PENA 5K6TA 4HFNA 1SUIA 2YFKA 3AFNA 5BURA 3RRYA 4QRHA 2O2XA 4FMPA 1PD0A 1BN6A 3KQLA 5JS7A 3FOAA 3DCJA 1CW2B 4A6PA 3IUNA 5CPFA 6PFKA 1T5TA 1RWOA 2RONA 4B6QA 3M6VA 1J0BA 4WLUA 3B1VA 1K27A 3IIKA 1E3TA 2P5TB 2ZI4A 4OJKA 5FR2A 3IMFA 3EA4A 2ISCA 2O3JA 1LWNA 3AY3A 5E2BA 1RMYA 2PH7A 1LS6A 1WEKA 2HUNA 4WKGA 4DVJA 5DHPA 1QP8A 3IL2A 1FFEA 3QENA 3CTPA 5ED4A 1LFDB 2ZRGA 4EB8A 3G2PA 1GRNA 1C9KA 5TY0A 3SSMA 5TS3A 3KJHA 3DLAA 3O9VA 3T5PA 1QCDA 1WWKA 1FPMA 3F6CA 5ETJA 3B9PA 1QX3A 1VPTA 4TLLB 2RAFA 2VJMB 2Z6VA 3QPBA 5DB4A 5G1OA 4JMPA 1V8DA 2QG4A 1BFUA 2EXXA 3IT3A 4UTOA 1KOLA 1NW4A 2QN7A 4OHZA 2QN6A 3I6BA 4DHWA 1WNTA 4D3YA 1Z5GA 3WYBA 1RABA 5JBIA 1YTLA 3IUQA 1FRVA 5AW0A 4EDFA 3NP9A 1I01A 2Y71A 4E07A 4TSFD 3AEZA 1OLUB 4Z54A 3KCNA 4WI1A 1PQUA 2RGCA 1R00A 4OPMA 3ZS9A 1RJEA 4B6EA 1NVDA 2ERCA 1GPJA 4TMFA 4OREX 1I0LA 5GADl 1O4VA 4UDXX 2WIBA 3KOYA 1EFDN 2OCPA 1H69A 1ADYA 1O95D 1KDRA 2R8XA 2VLIA 1EDDA 2B36A 2V03A 2XWJI 4M1SA 1OY1A 4U2KA 5B57C 1CUZA 4XD7D 3LO8A 1Z4NA 3UT6A 5KYXA 2RDMA 1OE0A 3QA9A 2DFTA 2JH8A 1W73A 5IT4A 3PIIA 3B48A 4MVWA 3QFHA 4NCNA 3TD9A 2R8BA 3I1YA 1USGA 1UT5A 4OUDB 2I3GA 4MULA 4XDYA 5DT2A 5KYWA 3Q41A 4Q1DA 3MBKA 1UBKS 2R86A 1MIOB 4EJSA 4GX5A 8ABPA 3IEIA 4N1AA 3VV2A 4BFLA 5DXFA 1U1EA 2DBVO 4OU5A 4PINA 4AMBA 5DNYB 4LE2A 5BN5B 1JSXA 2J08A 2WKQA 3KZMA 4LBWA 4OHFA 4O4JA 3CW8X 1Z35A 3EIUA 1R9MA 3P32A 5KAMA 4S1OA 1Y5RA 4OB6A 3VJMA 5IF3A 5JARA 2PUDA 1WPRA 3DL2A 3U9SA 5KYWB 4R0VA 4TM7A 3SIWA 4LXHA 1H9BA 3EB9A 1NXWA 1P3DA 3G1UA 2NWQA 3O1IC 3Q9UA 4Q3KA 1ULZA 4MQLA 1A50B 4WJZA 3TZEA 4DDHA 3K6SB 3T7RA 3N39C 3LSYA 4LBZA 4W9RA 3UV6A 4B6JA 1QGED 5KOHA 4RL6A 5IXSA 1FNDA 3G13A 4E5DA 4XSGA 5AK0A 2RGXA 1R0KA 3HY6A 2HRRA 3D7MA 4LKRA 4NG5A 2XWBF 2QT1A 1O97D 3A58B 4I50A 2ATVA 3C1OA 1CERA 1K08A 3BHMA 4TMZA 3WYAA 4ASUA 3M1LA 4KU4A 5A2QA 5CFLA 2ZB2A 4GSLA 5AJVB 1JALA 1H2FA 3ANSA 4G84A 4PCVA 4AJ1A 3THXB 3Q2IA 4PBRA 1IONA 4G5XA 4IGKA 1ZJJA 3CPSA 4JA2A 5AQ1A 2NTVA 1JHOA 4K9KA 5IW8A 1U04A 3REFA 3WDMA 4L4ZA 2EKBA 1K7YA 1U2QA 4TRMA 4B76A 3HBNA 2F1RA 3GGDA 5BSKA 2GZRA 5DCYA 3P9YA 1Z26A 1DC3A 2JI6A 1SEVA 1IN7A 5C4GB 4AJKA 1IXSB 2FWMX 2X86A 5B64A 2EFCB 1ORWA 1FRZA 4O8CA 4C78A 2PSSA 1EU1A 1TDJA 4IMPA 4A3SA 5A4DA 2A86A 1IXRC 2RGAA 3OFJA 3PE4A 2H7YA 4YC7A 3CU5A 3AG6A 2I7XA 4PY2A 1TXGA 2XMSA 5JAQA 4DIFA 4EG6A 2HFKA 1FBNA 4KUHA 4LY3A 4RH3A 2AI2A 2PO5A 4ZARA 2YR0A 3RYTC 4GM4A 4CCWA 4K0KB 1OPXA 3CLRD 3DYBA 3P26A 1B23P 4AWAA 2WTXA 2NZJA 3TL3A 4BDSA 4F45A 4M88A 3GUUA 2O0JA 4X90A 4ZOLF 1UBJS 1II0A 3H75A 3U1TA 1DVRA 4MW1A 2D0OB 1S8NA 3T52A 5CJ2A 3W0LB 3UMCA 2R6JA 1U7ZA 3VKFA 3DBOB 4Y9RA 1EDBA 4G41A 4PW0A 4MHTA 1N6NA 3N2GB 3P97A 1W25A 4K1XA 4D3DA 1W0JD 1XVVA 1HV8A 2AN1A 2PL9A 1NZDA 3GJ0A 4QVKA 3WWPA 2BM9A 2XQVA 4DR3B 2WRZA 4PAMA 2I9KA 5JNTA 4DR5B 3E3NA 1T4DA 1N5KA 1GNLA 1GRCA 1S4QA 2YDYA 3HL4A 4X3CA 2KM1A 2C04A 2J3LA 4XFJA 4GWKA 5F23A 1QK3A 1VZ2A 3LDUA 2WIAA 3W6OA 4BQOA 1QV9A 2ZRDA 3ORHA 4ZTBA 1YS9A 3TLMA 3ZBTA 5I4KA 5IC6A 3M9LA 5AW9A 3SK0A 1S6YA 4UOQA 4KKVA 5GY7A 3S0JA 3RVBA 4LWZA 2GYWA 5AW6A 2ZUDA 4RVGA 4R98A 3PNSA 4ZVLA 2X2FA 1X94A 4HH3C 3TLKA 1WMDA 3U9LA 5C5CA 3E9DA 1JDBB 2BGUA 2CYCA 2P4UA 4J0DA 2PLWA 3R3YA 1CQIA 1N6PA 2WSBA 4HRVA 1VRWA 3ZKWA 3TXYA 2I7TA 2Q3CA 3ZI7A 2HU2A 4C7JA 3ZE2B 1V8ZA 2GXQA 3CJRA 2QI9F 2P77A 4RDHA 4X5OA 4YASA 1M6HA 2CVFA 3AETA 4Y8VA 4BNFA 3GJYA 4UAGA 3STXA 3A2KA 3ROZA 2GILA 3DMFA 2GM5A 1K5HA 2DHCA 2XIQA 1P7PA 3DZIA 2GJKA 4FEYA 4HWKA 5LYJB 3DMDA 4E94A 4Z1OA 3DE6X 4DWJA 1WHTA 3KV3O 1XJ0A 4DIDA 1A9XA 4F4HA 2CKDA 1Y3IA 1JKIA 1YIOA 3EAQA 3WOHA 4ZHQB 4QM7A 3LCVB 4PU0A 2JLZA 1IEXA 3IS3A 1FL9A 3GNSA 5ICGA 2Z1DA 3TQSA 2O07A 3H1GA 2G80A 4QUIA 3W90A 2OCDA 3TQHA 3TYXA 5DEIA 3DWGA 5AJTA 2ZBEA 4LY0A 5JALA 3A1TA 4WIAA 4HNAB 5K4HA 5TF0A 2NZWA 4RESA 1OLXA 2VRCA 2PX0A 2Z2KA 3EZFA 3PC8A 4MRVA 1EUCB 1R6BX 4P86A 1O94A 3CH4B 2O2CA 3S8EA 4MJ3A 3RNOA 1F8UA 1OJ7A 2CMDA 2H29A 4P92A 5J59A 3OCYA 1ZYUA 3DVQX 2CUTA 1UBHS 1OTYA 3KPUA 4PGMA 3VPHA 3JALA 3FYHA 3E7WA 2FR0A 4DNPA 3AHJA 3H6KA 4Z0TA 3VVMA 4O5OA 3OM8A 1N1EA 4DJDC 4O4JB 1TYDE 3ZDRA 1LK7A 3HU5A 2ZFUA 4EW3A 2W58A 2CL0X 3TQFA 1VJDA 3CWZA 1ZBDA 4OAPA 2I91A 5IU6A 2C96A 2BRUC 1DELA 4L8VA 1UKAA 5EHNA 1TADA 1BE8A 1B7GO 5ITZB 3SJAA 3EPRA 4RC9A 5EEGA 3OY7A 2XCTB 5B3JA 4PTZA 5LB2A 3GCZA 3QLUA 5CB4A 2ADFA 4HLCA 2GARA 1WVIA 2XF2A 3F6YA 2ZYSA 4Q7EA 3RSCA 4Z9AA 2N75A 1JHPA 5IAOA 5L45A 3ER8A 4TMXA 2ZUUA 2E2WA 3L1IA 1E3QA 1NP6A 5LQUA 1D1QA 1HLFA 5A7HA 2GWRA 3PC8C 3FUWA 4M8IA 1A72A 1M6VB 2E48A 4Y6RA 1LJ8A 2EJWA 3TCNA 2Y8EA 4HAZA 4I4TB 3BGSA 1L5HA 2WA1A 2V7QA 3A1EA 3DE7X 2BMAA 1OW3B 3B1XA 3CEPB 1GZ5A 2JFZA 3GGSA 3H2KA 3LSTA 8MHTA 1JDUA 4M89A 5LZ8A 3T1NA 3OIFA 1PNTA 2R68A 4L1KA 3NH6A 4Q4HA 5BN4A 2QTVA 3PNOA 4U7TB 3ET4A 2R44A 3HBFA 5DULA 3WJ1A 1H3EA 4X97A 4K87A 3NVMB 3OZXA 1DCKA 3STUA 3WQSB 4XM1A 4JAVC 2R4TA 5CHEA 4F97A 1H6CA 1VL6A 2G1UA 3BCUA 3OPYI 2IY9A 1L1RA 1FNSA 4FD2A 4J9VA 3TTXA 5HJ5A 3QVJA 1U31A 4MB2A 4A0RA 4D6XA 1FC0A 4G0VA 4XJVA 2G9QA 3TB4A 3DPIA 5D87A 1E2IA 4DV1B 2B2CA 4EHLA 5BUQA 2F7SA 5E1BA 2CZQA 1QF7A 3Q9NA 2ZETA 3W3AA 3TSOA 4Q7JB 3LQYA 4GI7A 4UASA 5PGMA 3KUXA 3SKVA 3R7WB 1WETA 2HXGA 4P7FA 1QK4A 1SKAA 5KJ1A 2AGVA 3C41J 1L5HB 4I4TA 3PC2A 4BBAA 4IX1A 2FZKA 4QJ5A 3AVUA 4EUKA 5MF6A 3ACCA 1QU3A 4U63A 3CRNA 4UZEA 4K2HA 5I7AA 3F8WA 3ENNA 4L4YA 3D7LA 3SIXA 3L1KA 3K73O 1SK9A 3SR4A 3SFZA 1J5XA 3NPAA 2NV0A 2FF7A 1OXTA 2IU4A 3HLKA 4CMCA 1XYVA 2PGAA 1XB2A 2A0FA 1U0EA 3C3PA 2JHPA 3HJGA 3K6JA 4FZVA 4HLUA 4HLNA 3W06A 4M1TA 3PQ6A 3WL7A 4Z4IA 1MVOA 3GIWA 1I7QB 2X0RA 1NV8A 1WD7A 2P90A 4OOFA 2GCEA 4KH0A 3E9ZA 5DI3A 2XKAA 4QEZA 4PZ0A 3E7PA 3A6KA 4LYYA 1JZQA 1R6DA 2V6BA 1G3UA 1RPTA 3SHWA 5A3VA 2HU8A 3NONA 3ZLUA 3Q0EA 3I5YA 1JHQA 1YQDA 3H18A 4JX9A 5H82A 4F2HA 2TRSB 3VZRA 2R25B 1IM2A 1DXHA 1BE1A 2FUNB 2QP4A 1WCXA 1E5DA 2V6GA 3CTMA 3EIQA 3L7MA 3NHPA 4H7PA 3PDIB 4YFVA 4YAGA 5JNLA 1PR9A 2Z04A 3PGA1 1US8B 4DC0A 1E99A 4ZI3A 3PT5A 3PC4A 4HGNA 3BH7A 4I4TF 1EXNA 1W46A 2GN1A 2QXUA 1E2LA 4F6LA 1KJWA 4X54A 1NVFA 1JHUA 3JWEA 3ZUPA 1XMPA 4BO1A 2P65A 5I5EA 3BTVA 3RFCA 1XTUA 4CKBA 4OKSA 1W8DA 4RXTA 1Q1NA 2AX3A 2FZ5A 3CLSD 3KKQA 3LOPA 1A88A 3MUOA 4Q1EA 3D64A 3PXXA 1RQXA 1K7EB 2V96A 3O91A 2PLAA 1XCOA 1OIXA 2WF9A 3QKIA 4O0MA 4Y0NA 3Q3HA 5EIBC 1O1YA 2X23A 1EP1B 4K9NA 3SIRA 3SS9X 3WLAA 4QOJA 4GAEA 4LA4A 2E4ZA 3Q98A 4REOA 2W4IA 1Z2EA 2JEOA 4DDTA 3E23A 4KE9A 3P9RA 4EGCB 5C81A 4QGGA 3I8SA 1XOIA 3H4IA 4ZTZB 5A0TA 1AB5A 4B40A 3KB6A 1A04A 1F0NA 2WSLA 4YECA 1XRRA 5ANRB 3PWTA 2FWPA 4OM8A 1I0ZA 3WWEA 2RH9B 1C8LA 2XSZD 3PDJA 2WD9A 4V0NA 2V7WA 3S2SA 3WP1B 1NFQA 1ZIOA 3MSCA 5IVHA 4CM3A 4EMTA 2PQ2A 2C94A 2I4TA 3PHIA 4KX5A 1VHQA 4M1MA 3SZMA 3LF2A 1WUJS 4YBZA 3UMFA 3B53X 1JE0A 3G7SA 3BWYA 5F51A 3UK1A 3AG5A 2NUTB 3NAZA 1TC1A 4RS3A 3M4XA 1RE0A 1TRHA 4BKOA 4DCTA 3CUSA 1W36D 4F86A 1XU9A 4YCBA 2W5UA 2IEBA 3ZZ0A 5BP7A 4LF6B 2XQGA 2ZKIA 3OLYA 3F2VA 4ZCMA 1XK6A 2OT3B 2EARA 3LWZA 4P3KA 2DUMA 3IHLA 4ADSG 3BE8A 2CFCA 2QJRA 1DHTA 1MH9A 4PHCA 4YO8A 4OXYA 4N3CA 2JLWA 1ZC3A 2UXBB 3P2MA 4E15A 1E5QA 2C42A 4LYHA 4I6JA 3WL4A 3UOAB 4R5HA 2NN3C 2WFLB 1CUYA 2VPTA 1K5DA 2FVYA 2XCUA 3CLSC 3E4DA 2H2AA 5JSZA 2YWHA 2JIDA 3D2AA 2CHUA 4PC3A 2G8NA 2Q0SA 2X13A 2FE4A 4M0CA 5YASA 3I0MA 1QG4A 4FFOA 1RC1A 4JX8A 4QT4A 4S05A 2HWXA 5EOVA 3Q2KA 2ZIFA 2RHJA 1EHCA 3JATB 4AP9A 1JFRA 2AE1A 4CDGA 1UWKA 1DV1A 4EELA 2AXEA 5I4BA 3ZK8A 4HH0A 5JNSA 1G20E 1EG2A 3N28A 2FHSA 2CL6X 2QF7A 4DCOA 5CK4A 2Q41A 2IWHA 3X1ZA 4OLAA 1NV9A 4XQEA 2HWYA 4DLSA 2X8WA 1G291 3JQGB 1ZNYA 1LK5A 1VSVA 1LKZA 2NYRA 4NAHA 4X94A 1SOUA 1NC1A 4WBNA 3TJMA 5NLLA 3GMTA 2DQYA 1QPZA 1GAWA 1E0AA 3KJFA 1W9MA 5KZMB 2OZVA 5LU9A 2PUAA 5BWMA 3MG9A 5GOTA 3LY7A 4BUJA 3RYIA 5B1HA 4P82A 3MHPA 1H8ED 4DIMA 1ZM3A 5JFOA 1UDBA 4JELA 1ECFA 1BQ3A 2O7RA 5FOQA 2TMGA 1KZ7B 1U3CA 2QD3A 2HF9A 1UPFA 3QUQA 5IN5A 3HHPA 4RVSA 3W8NA 3PG5A 3ZE9A 1XQ1A 4CKYA 1IJBA 3GCGA 5ES4B 2XHZA 4YMSA 5DX8A 4ZEWA 4KHZA 1UBUS 4ZAWA 2JAOA 2O7QA 2WWRA 5J4KA 2XGMA 4BQFA 2BJHA 5JYBA 4HCJA 4KLNA 1CF4A 2QYOA 1XX6A 1KF0A 1PGPA 4HRYA 4FFSA 1UK7A 1VPLA 3NIGB 4UUPA 2A3RA 5TMBA 1VJGA 3ONEA 1Z73A 5BSTA 3PUWA 4DB4A 2P5UA 3CRVA 1SKQA 1PX2A 2VYCA 3HUTA 3KJIA 3LCCA 3ZBPA 5TVGA 4CKCA 2ECFA 3ZGOA 2XTNA 4BJ1A 5K3CA 3ZHVA 3W2IA 4M7RA 1BD3A 3BZUA 2R60A 1ZISA 2IC5A 2ORIA 3PR3A 3RSSA 1N2SA 2BKUA 3KT0A 1DCFA 3L6CA 1IHPA 4RQAA 5DGXA 3T12A 4JDUA 3RRXA 1IRIA 4RADA 1ZIDA 5HOEA 4GRDA 4QHSA 3VFDA 1ZOSA 2AF4C 1CY1A 2PZMA 4UTZA 5C5DA 2QTWB 3DO5A 4YMUA 1K4MA 2J5KA 3FNQA 1EFHA 2IPMA 3NXSA 4LK2A 4N47A 4DCPA 3PP8A 5JUWA 2AXPA 2W93A 1I51A 4WX2B 3H5TA 2AFHB 1R10A 3BMNA 4U7GA 2QX4A 1QB7A 4URHA 5EP2A 2RB5A 1T91A 3X1WA 4CMKA 4YAKA 4AY6A 2B4YA 2ZTSA 3HKBB 3GJ3A 2QRNA 4M8NE 4PCUA 4WCVA 4Z9BA 2YCBA 5BN5A 3AXSA 2FW6A 4N4AA 4G25A 1SNYA 4G1UC 1QTRA 4ZU3A 4OQPA 1XNGA 1RMQA 2QUAA 3D81A 1K2VN 5EJ6A 3D2BA 3PUVA 5ITSA 1M0SA 1JLKA 1U7WA 1YA6A 1PEDA 2WOJA 4ENVA 2JIZD 3K9WA 4EMBA 4KKXB 3D4IA 3Q3IA 1TAGA 5ALQA 4H3KB 3TAUA 2QSYA 1F7VA 1CY7A 1R0ZA 2I6SA 3MRXA 4YWJA 3M6AA 3RAJA 1PCXA 3RJZA 4AYXA 4B6PA 4AT1A 4D43A 2WYWA 2XB9A 4PLHA 3PCRB 3URKA 1JLLA 2QSJA 1JVSA 1DDGA 1SULA 3GAAA 5DHFA 1FFYA 4YLYA 1EFRD 4HAUA 3T61A 1L8QA 3UJ8A 5ERGB 5FEMA 1J56A 2O48X 1PO7A 4EKDA 3GAFA 5JTUA 3ZHQA 1XMOB 3ZWCA 3N53A 3EVBA 2AV6A 3AUYA 1HG0A 3F67A 1NQOA 3JRNA 2OVBA 1EVLA 3AEQA 3L4JA 5ICEA 5A4FS 4LFCB 3GO4A 4EO9A 1QBGA 2FZEA 4DPKA 4B8WA 1ISSA 1SG6A 1UP6A 5HRCA 2BSQA 3RK4A 5AH0A 4GFDA 3GV0A 1WSBA 3MJDA 1E7SA 2GHTA 3E27A 5ALEA 3RTEA 3DT9A 3UF0A 5ENVA 2I8CA 2JLQA 3ZU6A 2YJGA 4B3BA 3VR6A 3THSA 2YWFA 2LBPA 4LIPD 2QQ5A 4JBXA 4DJEC 1LDYA 4C87A 4QTXA 3HK2A 1Z47A 3PB3A 5TQ2B 4ARUA 4E2WA 3IKMB 4PHTA 1S3FA 3EZ6A 3EH1A 3NJ4A 4UUMA 2QVLA 4URZR 2NU9B 3K31A 3PZBA 4AW9A 1BCRB 2WUDA 3K9HA 4RTPA 2DB3A 4FSXA 2C5GA 4NE2A 2YY6A 1P44A 1K63A 3CONA 1EFKA 4OG2A 2W2TA 1HE4A 1U3VA 1QH1B 3G49A 4MP3A 4JL5A 4PLWA 5EMMA 5G0VA 1AKWA 5CYOA 3MQFA 1U8AA 2XUAA 3IA2A 1Y4SA 2BHLA 4NBWA 2XBUA 2X5XA 2OO7A 2C8JA 3G2OA 4JYPA 3WGGA 4R3UC 2H51A 4MRNA 2PE5A 1JQKA 2G76A 2NO5A 4EECA 3GOHA 1A5ZA 4CBVA 2FTKE 3BRSA 3IOYA 2EZ4A 1JECA 1XBTA 2XD9A 1PR0A 2AKYA 1KRWA 5IFLA 1Q22A 1WHSB 4KXNA 2HA6A 4ICIA 4BIIA 1Z38A 3R23A 4S2EA 3UV3A 1B3RA 1AK2A 1D04A 1GG5A 4B82A 1LNZA 4XCQA 4XWKA 5H70A 1K8XB 1U9IC 1U2EA 3AKYA 1JR2A 1ODJA 1W0JA 4JJGA 4NJMB 3ZV6A 3O8OA 1EQAA 4MEBA 1C4KA 3HDQA 4O5AA 5F33A 4DMUB 3MCAA 4B4OA 1DJOA 4F5ZA 4W1RA 2C83A 5CVTA 4DARA 5A9SA 3QE3A 4PO9A 3N75A 3GMIA 4LS3A 3NG1A 4CM1A 2VDVE 4E7OA 3T38A 5JEDA 2CL7X 1JSCA 3DDHA 2J5RA 3A1SA 3FYUA 3KHKA 1M2HA 3OWXA 5G02A 5SY6A 1ID1A 1VL0A 2IPXA 4WACA 3TBKA 3PTLA 4HQRA 1OSNA 4RVNA 2F3SA 2WJIA 2EWVA 5G41A 3ZW7A 1EE1A 1CNMA 3CLRC 4YRDA 3ZIDA 1VPWA 2FUKA 2AMFA 2ZJOA 4IHKA 4KYUA 2BKAA 2H85A 3X0DA 1FUIA 3O0DA 3KR1A 2Q5HA 4BN0A 1L5FA 4D3ZA 1PS9A 3EN0A 3UFXA 1G18A 4OGKA 4BEJA 2QQ0A 4D5EA 3VNAA 4Z1MA 2BEUA 3CZ5A 1JBKA 4Q4JB 2AMYA 1YMVA 2AG6A 1PJLA 2JFGA 2O8DB 1XPJA 3E84A 2G04A 3JD3A 3S1SA 1OYYA 2FA9A 2HIGA 1UMKA 2ZJ4A 1U7HA 2WWVD 1W7AA 1IN8A 1GTRA 5CA1B 3N9IA 4P5DA 5I7RA 5K0CA 4KWEA 3B20A 3CISA 1RVV1 1R5JA 2I87A 1QRRA 2XLBA 1CWUA 3HGTA 4MUAA 2M6SA 4CIAA 4X65B 2FFQA 1FU8A 3PXAA 1OGJA 2JBHA 3A9UA 3IJ5A 4JLAA 4UW9A 2WJPA 4EG8A 2PYIA 2I1VB 2Q99A 1KDPA 2FJUA 2NZ8A 2YHBA 3DR3A 3M6XA 1KK2A 4N3AA 3VNRA 1NXXA 4Q7QA 3Q5DA 5DFAA 5KTMA 3DXZA 4J2HA 2RHWA 2XUJA 3ZS8A 5B7QA 1KS9A 1R66A 2PL3A 1LEHA 4MS3A 3H8SA 4XI9A 2PS3A 4URFA 4F3KA 3NRJA 2BFOA 3CSDA 1HTTA 4MCIA 4MUMA 5LQMA 5JQWA 3LL7A 4EW1A 4JEIA 1KETA 2NP7A 1PWYE 3EWSA 1UJ6A 4QE3A 1T6YA 3EDQA 4RY9A 1WB9A 4LV5B 2QUZA 1VKOA 2POQX 3L4KA 2QS9A 2IP4A 4KSYA 3PXDA 4TYWA 4EATA 3ZLJA 1VHWA 3F2IA 1SY7A 3NDPA 2EGHA 1CX9B 1UZNA 3EQ9A 4G0XA 4XJSA 2Q7XA 4ND3A 3I5AA 2ZAYA 5FTWA 5E1MA 3L5OA 3LBHA 1EE2A 3EEQA 4D92A 4L15A 1QQTA 3ELYA 3CIFA 4TXJA 3ZK7A 3F9CA 3HA2A 1I7PA 1DHRA 3DT6A 4YEDA 1DI0A 4EPTA 2OE2A 5CH5A 4BS9A 3QZUA 2LD4A 4R1OA 5F5XA 1V37A 2XYPA 4GIBA 1RQPA 1KH2A 2Q4OA 1JP7A 2P75A 4KREA 3RSQA 5AVZA 2QTMA 3QOYA 4PLYA 3GK3A 5KPJA 2O8BA 2QROA 3VR2A 2Q6IA 3GLQA 3IYLW 3HH8A 1WZUA 3SAJA 3TLAA 5JPCA 3PE6A 3PHGA 4EY4A 2I4IA 3B6IA 3IR7A 3ZHYA 3CF2A 1AZSC 3V1KA 1TCVA 3KQQA 5J2UF 2MSDB 3WICA 5HCUA 1FOEB 5HR5A 1JPVA 3CRZA 3HR4A 2QKYA 2G83A 2B2XA 3ZX5A 1T3TA 5DYTA 2VSOA 1UJ4A 1C0IA 3KDSE 4L4XA 3KTAB 2HHAA 3OZRA 4MLDA 1VLLA 3AB7A 2OV1A 4PQFA 1H0SA 5JS2A 5IH7A 4LF5B 3GWZA 2OPHA 1XQYA 1K98A 3K0KA 2XGJA 5FUMA 4LUCA 4NZ9A 2ZIUB 3TG8A 2V6MA 1T9CA 1Q1ZA 2CKMA 3A6HA 3G2QA 2WEKA 2ZIEA 3EPLA 1KEEB 4BLWA 2DLCX 1QHSA 4TL9A 1BYUA 1G60A 4KR7A 1KAOA 3RC9A 1V5IA 5BSEA 4HVAA 1YTUA 3L4SO 1K88A 4FNGA 2P8JA 3FB4A 5LYJA 1TUBA 1L4LA 3ZYCA 3KU1A 2OWDA 4M37A 4YQEA 4B4UA 5HYVA 1LW7A 2J85A 3L0OA 3D6TB 2KPOA 2YBEA 3T5TA 1E0KA 3BFJA 5CDUA 2JHCA 4PYMA 1RJ9B 1T9GS 2AWOA 4DDVA 4JB0A 2JD0A 5L4SA 4MUGA 4KTTE 3WFJA 2GTPA 3D3NA 4ZPJA 1RM0A 2XUKA 4Y6SA 5DBOA 4IGIA 1RYHA 2KI5A 3GXOA 4R1LA 2WWFA 3B12A 2HT1A 1ULUA 3ZTWA 2J1LA 2QB5A 3FVWA 3LUCA 4HS9A 5JQGF 3GLKA 3I61A 4KWTA 2GKSA 1IVNA 3QG1A 1K4YA 3RJTA 4RDXA 3TW6A 3WB9A 3GFPA 1WZCA 1G19A 3DZCA 4QUDA 2OC9A 2FX2A 3K9GA 5E9JA 4AF8A 5JBQA 4NCHA 1G8SA 3K0EA 3R7SA 5MFZA 1RKVA 4A6DA 3OE1A 4CF6A 3IKTA 5EJAA 3MWEA 5AM1A 3B2EA 3AF5A 5C8DA 2FW7A 3T54A 4B33A 3LTNC 2EQAA 1PF7E 5HM6A 1QQ7A 1KFCB 4LJ9A 2X5NA 4KC0A 4MH0R 2MWMA 6ABPA 3O4HA 1A8IA 2FZWA 4QXRA 2K87A 1TEZA 4AZVA 5JAHA 4ND4A 2BSAA 3HXTA 3ZJVA 4UAJA 3KZCA 3VMMA 4ROTA 1C14A 2O8FB 3ICOA 1WMFA 2XF8A 2BM8A 2C00A 5LXTB 5HP4A 1JWLA 4KK4A 4L72A 2CY0A 4DMRA 4QPDA 4WY5A 4UMDA 1UJNA 1EGQA 1MFZA 2VT6A 5HFNA 3T0GA 1Y4DE 3EWNA 1CEXA 1N8KA 1VIMA 2XA2A 5K51A 1N33B 3OCWA 2XB2A 4Y1RA 3UGTA 2P62A 1S2MA 3NYQA 4L8FA 1N9ZA 3ENKA 3VHLB 1E1RD 3BDVA 3OEHD 2PUTA 2XCRB 2VF5X 3EQ2A 1L7OA 2YRXA 4FDAA 1Y9DA 1DBQA 4WBXC 3TM5A 1HDYA 4Q5IA 3ITNA 2GERA 2X19A 4YDQA 1XZCA 1Y1PA 3EPPA 2F64A 2XSZA 1T8TA 3M6IA 3Q7TA 5P8WA 1O6GA 4NHEA 5KWJA 4REQA 2P3OA 3FSRA 5CMLA 4RK0A 2ZRIA 3PNVA 3RANA 2XZLA 3GPLA 4YGYA 2R6DA 1TUBB 3ZZTA 1U0LA 1MO2A 1P18A 2X1HA 4EI7A 1QOZA 1SC9A 3ABQB 5D5QA 4LOJA 2F55A 1H4SA 4AY4A 5G3YA 4MW9A 5BYAA 3EMVA 3L4BA 1WBDA 1AKUA 2QVXX 3ZGNA 2BHSA 3JD2A 2V5AA 3SOPA 4QNMA 4AN1A 3RF6A 4ZIRB 1FDUA 1LB1B 5JT1A 5JZBA 3SKXA 3K72B 2ZRKA 5ALZA 1E2EA 2WOOA 3E8SA 4B80A 4XASA 2FQ1A 1MX1A 4FN4A 4DV4B 3HDVA 1FMCA 1JV2B 2YY7A 4KMRA 5EFZA 2UDPA 1UOOA 2B78A 4DA8A 4EYGA 4XCXA 4C7MA 2WU4A 4ZKEA 3SVLA 4XLLA 2VSFA 3U7QB 3ZOZA 1PFGA 4WAUA 5JFGA 4A2PA 2Q7OE 1DLJA 1Y5MA 4JDPA 3H8JA 2XMBA 3A11A 4Q6BA 5DTRA 2JI4A 4TS9A 2B8JA 2CJYA 3AIKA 4QVIA 2XMDA 2DZDA 2W8BA 1UP7A 4C0SA 5BR8B 2AOUA 2KB0A 2NAPA 4IKEA 4E5VA 4PZLA 3JAMA 1U5BA 4GUAA 2PO7A 5IASA 2H06A 2AYZA 2CLKB 3UUGA 1J23A 4KYVA 5JRZA 4I99A 4MI9A 1L3BA 2GEVA 3SXPA 1X38A 5TNXA 5I7OA 5IVKA 5ALWA 1YE5A 3COWA 3TLGA 3BH6A 4GS5A 4J49A 4CG2A 1QLWA 2EFEB 2GFQA 1ZK3A 1G8PA 3JAKA 5WRFA 1YRAA 2J3MA 3NS7A 4MUJA 3TK1A 2O1SA 4LOKA 1ENOA 1UPUA 2XNHA 3A9VA 2C1ZA 1M6NA 3I64A 4JXKA 3P0RA 4EFNA 4UPEA 2PKRA 3A4VA 3OZTA 1JTEA 2B35A 1IDOA 1N8SA 1XF1A 2VIIA 1S3GA 1M8JA 1RIFA 3FF1A 3EOBI 3H2SA 4FCCA 3TZQA 4EJMA 3HXQA 3GJ6A 4NNPA 4FB5A 1G3MA 2ANBA 4X6LA 4TQAA 1IY9A 3H42B 1MNQA 3IHKA 3GVXA 2O54A 2FI1A 2AOXA 2V8OA 3F3YA 4C4TA 4DE5A 5C1PA 3B7GA 3NH9A 2BONA 2B61A 3DYIA 4J2TA 1RP1A 1KWGA 5CB6A 3WBKA 2NQ2C 3MJCA 2Q5CA 1MTZA 4HT3B 3DLBA 2PK3A 3U3RA 3W5IA 3ADDA 4CUJA 2H1LA 4QYWA 5DNDA 5C5IA 3JQAD 1M6EX 2AIRA 4I3FA 4I1PA 3RUPA 2O5CA 3L7KA 1TJ4A 3BMQB 4P33A 1KE2A 3T1VA 4B6SA 5H02A 1U9YA 5EJ4A 4U2CA 5LOVB 3GRFA 1NLYA 3ON5A 1S2IA 4U2GA 3OQ1A 4GSYA 2IRWA 3OP4A 4NOJA 1XTQA 3IAXA 1K6MA 3FN4A 1U2DC 4L8WB 2AR7A 3BRCA 4U2BA 1XWIA 4BO9A 3T7SA 3G6KA 2EHDA 2ZUSA 1RWKA 2BGTA 2HA0A 1NVBA 2V74B 1JBEA 3BRWA 3PR1A 3IAUA 4QGBA 3UO8B 4D56A 5KNLA 3A32A 1WBJB 2L19A 4GPTA 5F3DA 3V4FA 1XNJA 2AG0A 3WK7A 3VZCA 2JATA 1PW7A 2Y99A 4CCSA 4F04A 4FQ8A 1G6HA 2PT9A 4KGZA 1KC1A 1PJ2A 2VJCA 4N5NA 1R9JA 2DSTA 3DAGA 3JWJA 4HFMA 2XB8A 1NKSA 2G08A 3K1ZA 1YHYA 5CEJA 5AHWA 5LBIA 2VUIB 3Q9SA 4C2BA 1XDWA 2Z57A 5J63A 1QG0A 2AA3A 4YRTA 4D26A 4B74A 1SU8A 2VNKA 7ABPA 5KQSA 4JI7B 1LA2A 3LHIA 4LF7B 4O2BA 3W5DA 2CGEA 4HKTA 1GGKA 1M2FA 2CHGA 3DWEX 2HT6A 3QWBA 1ZXLA 2R11A 3LRTA 4QGAA 3GJTA 4LNUA 1IM5A 4LCBA 4R7GA 3H17A 3QI2A 4MNTA 4ITRC 3VBCA 1SBCA 3VKWA 3LG2A 5AQEA 5BY2A 3TZLA 2HA5A 2JIZA 4GI5A 2A7XA 1VDMA 2J9FB 3ISVA 3PKIA 1KI9A 1XVLA 3HV0A 4BNXA 3BGOS 4IJVA 5EERA 3IQZA 1LUAA 4NU8X 4CV1A 5JY6A