1E2GA

Human thymidylate kinase complexed with adp, tdp and a magnesium-ion
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
209
structure length
205
Chain Sequence
RRGALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTEIGKLLSSYLQKKSDVEDHSVHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAKRGERYENGAFQERALRCFHQLMKDTTLNWKMVDASKSIEAVHEDIRVLSEDAIATATEKPLGELWK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights Into the Phosphoryltransfer Mechanism of Human Thymidylate Kinase Gained from Crystal Structures of Enzyme Complexes Along the Reaction Coordinate
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords THYMIDYLATE KINASE
total genus 89
structure length 205
sequence length 209
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2000-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1e2gA00
3CM0A 5CB6A 1K5GA 1G9XA 2CK3A 3Q8XB 2FPKA 5IK2D 3PUYA 2QENA 5KDLA 1IM2A 3BOSA 2ZJ8A 2AD1A 4ERNA 2PZFA 5TVKA 5EP2A 4LJ7A 3BJIC 5G3YA 5FBLB 4YXWD 4L8GA 4DLXA 2ERYA 2W2TA 1E2JA 2XGJA 3KKNA 5GJBA 2GXAA 2NGRA 1U8ZA 2J59A 4OHYA 3MJHA 3GCGA 4EFNA 2XB2A 1BIFA 1M7BA 1XXHB 3EG5A 3M6AA 4M2LA 4OYHA 4B73A 3TBKA 2KJQA 2J5XA 4KLZA 4JYCA 2BV3A 3CH4B 2XJ4A 1J2JA 4YMSA 4A0GA 1KO5A 5BN5A 3CW2A 4EJSC 3LXRA 4MGZR 1P9WA 4JL8A 1CBUA 1W1WA 1XPRA 1W47A 1NBMA 1HT2E 2DFLA 4ZO4A 2P6RA 4Q1EA 4GDFA 4WIAA 5ANRB 4LYJA 4B6FA 2V4ZA 3I5XA 3A58B 2OFXA 3LX8A 1HT1E 2WJYA 3D6TB 5G53C 3EA5A 1GNRA 2HJVA 2BJVA 4DSNA 1OFTA 5CIWA 2FFAA 2FOLA 3AF1A 3K0FB 3W34A 1JAIA 5F98A 4Q4HB 4AKIA 2ZRFA 1YHNA 1WB9A 3AVOA 4URZR 4TZ0A 3TR0A 2OAQ1 5FBQB 4YLGA 4RZ3A 1KAGA 2QTFA 4TL8A 4WXRA 2ZYUX 1FFHA 4L4UA 2OO7A 2J0SA 4AURA 4HUQB 3KKOA 3U5ZB 2QP4A 3KX2A 2OLKA 5L3QB 2Q6TA 4CEHB 3W6PA 3SYLA 4PAMA 3GJ6A 4X8LA 2ZRCA 4UKDA 1C1YA 4TMKA 5FR1A 2I3BA 3TUZC 3DZDA 4LHXA 2HCBA 2H92A 3SOPA 4M53A 1PLLA 2JGNA 2GVDC 4GSYA 1AS3A 3TUJC 2DB3A 1Z0DA 3AKEA 3BH0A 4US0R 4EKDA 4RZ2A 3GLGB 3HYTA 4C0QC 3PIRA 1UKYA 1E9FA 4V02A 4HLUC 4F4JA 1WDTA 2BOVA 1SVLA 4TL6A 1NVUQ 4O2LA 3W9YA 3VR6A 4I1OA 5CJ2A 1OH5A 3ND9A 2VIIA 4HYYA 3K9GA 1ZUHA 1II0A 4M22A 2BWJA 2RHMA 1HY3A 2QA5A 3SJCA 1JB1A 3FPAA 3NHAA 1NIJA 2KB0A 2QPTA 4ZCIA 5TY0A 3AGPA 5CM8B 3B1ZA 2XTMA 2QQEA 1Z63A 3PR1A 1IN4A 1U8AA 4XVQA 4QOSA 3G82C 3ZH9B 1NBMD 2IXGA 3RRYA 1W0JD 3SFVA 4A0HA 3U7HB 1W4BA 2FSGA 2QAGA 2YC2C 3K09C 4JSTA 4HAVA 3R9WA 3NDBB 3LLUA 3Q9LA 1G21E 2DFKB 2ODNA 4M1OA 3LA6A 4US1R 1T0JB 3KUDA 3NVAA 1MOZA 1EFHA 1UM8A 3G5UA 3H84A 4XWOA 1P4SA 2PT5A 2WJHA 3AVWA 5DLQC 2RGNA 5KPJA 2HLDA 1CRPA 1NLYA 2CL0X 2QMOA 3LBHA 4MGKR 4MYHA 3U3MA 4LWZA 1E3MA 4W5HA 2LWIA 2BKEA 1N6HA 5CB8A 2A78A 4GOXA 2J41A 2ZEJA 3TNFA 4TYQA 5G40A 3RAPR 4DWJA 4RVCA 1KJWA 3WXMA 2GCNA 2R6GA 1SXJD 1O3YA 5E3HA 1NIPA 1UPTA 2QUZA 2Y8EA 1LW7A 5J4YA 5KSYA 2Q3HA 4UNQA 3BBPA 4B2IA 5KSPA 3KB1A 2WAXA 2C96A 1C9KA 2Q9AA 3CR7A 1DAIA 2GAAA 5LD2B 3THWB 2WMNB 1P2SA 3C14C 1PLKA 2ZE5A 1H8ED 1X3SA 2ZITA 3U6BA 3ZZ0A 5JS7A 4B47A 2IS1A 3ZZUA 4D6PA 5EE0A 3GLIE 1DAFA 3DMNA 1G5PA 4IOMA 1XRJA 3NC1C 1P60A 2JDIA 3EWAA 4Q66C 4BFXA 3EAQA 1JXMA 2JDID 4NPHA 3N70A 2FF7A 4WZ6A 3SDZA 1V5WA 4ACBA 1QG2A 3U61B 2Z5FA 1XCMA 3BB1A 2NO1A 4UXJA 2QE7D 3U44A 1DO2A 3CPEA 4OBEA 3KQKA 4A8JC 2IHBA 1E99A 2RH5A 3KKPA 1RRPA 5JEEA 2F1IA 3LV8A 3I73A 3WBKA 4LJ8A 3EZ6A 2PMDA 3KJHA 4B32A 4BLPA 3ZVNA 3I92A 2XAUA 5FUYA 1JQLB 3D7MA 3OIUA 1SXJA 2ODEA 2GCOA 1LS6A 1E9CA 2F43A 2ZRDA 2BJWA 1OB2A 3DO6A 5DYGA 2R2AA 2WOJA 4RFVA 2Z0MA 3PG5A 2FN4A 2R62A 4KYIB 4BLTA 2XSZD 3KXKA 3I5YA 1G7RA 5TARA 1ZM2A 3LDAA 4B3BA 2P5SA 4DLZA 1G7TA 2IYRA 4CEJB 1G3UA 2CNWA 4L16A 2FMXA 2YZ2A 2WJIA 4LGMA 4AYXA 4BLQA 1LNZA 4A0RA 4XSGA 3AF2A 1OXXK 1GL7A 2YWHA 2ZRAA 3DEFA 2GK7A 2G3YA 1LTQA 2H8KA 4KI0A 4OQLA 2BCJQ 2ANBA 1XU4A 4DC9A 4HB4A 2GNOA 2G1KA 2J9RA 1E1QD 4ESHA 4EFLA 2MSCB 2ZRPA 4Q1FA 2XXAA 2JLVA 4TT3D 2ZTSA 2VLIA 3ZGXA 1YU9A 3WP0A 2HF9A 3EC1A 4TLDA 4RSGA 4DCTA 5HKKA 1NL3A 1WRBA 3ADKA 1TF7A 2QRNA 4O2RA 1U98A 5AUPB 1Z2AA 4OL0A 2VF8A 4B2LA 2VSXA 3FKSD 4I99A 4C0HA 2ZETA 5BN4A 1AGRA 1G8FA 2IXEA 5EJEA 4NL4H 5TXGA 4QNMA 4IDHA 3EXAA 5FOUA 2GAOA 2IEYA 2CLDX 2OCPA 3H86A 4QL3A 2P3SA 4RD4A 3CF0A 1CR1A 4JLOA 5KDDA 1XBTA 2GK6A 1P5ZB 3G0HA 4TYYA 3K70D 5CYPA 2A30A 2Z43A 4F91B 2QQ0A 4IOLA 2AHOA 2VSFA 2ZUBA 3RANA 1KSJA 1SVMA 5L3RA 5FOSA 2XXAB 1OH8A 4RZXA 3AM1A 2IYTA 1QHGA 1OKKA 1P2VA 1YRBA 3WYGA 1CLUA 1RE0A 3L0OA 2N1BA 5FOXA 5FBVB 3PQCA 1GL9B 2YKGA 4EPYA 1M6NA 4BZPA 2VP4A 5DSZA 1Q3TA 1X6VA 1IY2A 2Q3MA 4HDOB 1S0UA 1UEJA 3HU3A 3NWJA 1TEVA 5BW8A 4MITA 3BB4A 4MUAA 1TL7C 2DR3A 4GMXA 4PAQA 2O8EA 2JJ8A 2CHGA 2RGCA 3EZ9A 2AD5A 2BMFA 4FWTA 4DCSA 3P4YA 2OV2A 3RWOA 1Q21A 1SVWA 2ZRMA 2JLYA 1HQCA 4M1YA 4W7SA 2C78A 4RD3A 1S8FA 2VHTA 4ON9A 3N2IA 3FWYA 3W3AA 2ZU6A 2FU5C 4QJ5A 2IYLD 4QBIA 3MSXA 3OEHA 3IQWA 3LO5A 4WOPA 1OIVA 2GKSA 1W0KD 2XJ9A 4QBGB 1F5NA 1UKZA 4LHVA 3ZS9A 5L3SB 2PLFA 3A1TA 3RS5A 1QHHB 3D3QA 3X1ZA 4I1UA 3TUIC 1LS1A 4DJTA 1E6CA 1E96A 2G83A 2GA8A 3ZD7A 4OHZA 1KSHA 2OM2A 1COWA 1F48A 2OZEA 4Q9IA 2IUUA 1N0UA 4TQ9A 4L5BA 4MRVA 5EP3A 3R9IA 1E2MA 4B44A 1VCIA 1E69A 1MV5A 2ZSFA 4KCGA 1U94A 1ZINA 2BDTA 4JLNA 1DVRA 2FFBA 3CNLA 4MGYR 4EDHA 1NBME 3AEZA 4FCWA 5FPSA 3PXGA 4A6XA 4W5JA 1KO1A 1AA9A 1ODFA 4Y0VA 3GP8A 3PV0A 1Q1EA 1WP9A 5KNDA 4GOJA 1RRCA 3TQCA 3H4MA 3QBVA 3RSLA 4BFVA 1Z22A 1OF1A 3RS4A 1MABA 4D4JA 3EIEA 4FINA 2WSSA 3CONA 2QG6A 2ZE7A 4I4LA 1YZQA 4ZDKA 1MO3A 1OFHA 1XJCA 2FEMA 4P33A 4PC7A 3B13B 4PAOA 1FL9A 2HYIC 5D3MB 5CDFA 2O8DA 3QF4A 2R6DA 3C7KA 4NP6A 2QAJA 4S2EA 2QTVB 4WA7A 3QBTA 5JCPA 1ELOA 3B1WA 1XPOA 1SVOA 4HUTA 3O8CA 4MKHA 3IHLA 3I4LA 3SBDA 2GETA 3ZQ6A 3VNUA 3WP1B 1TQ6A 3OFND 3IIMA 1T91A 2AWOA 4C0AC 4ZCMA 1GNPA 5HE9A 2FGKA 1NLFA 3GJXC 4KFTA 2O0HA 3REFA 1W4AA 2R65A 2GEDA 2D62A 3QJYA 5J4VA 2VSOA 4HB3A 2FSIA 4NZYA 2CLCX 4X8HA 2WWXA 1KI8A 1G64A 1TADA 3L8YA 4G5OA 3HU2A 1Z0KA 4L9WA 4RD0A 5EXTA 4AG6A 1XD2A 4FW9A 1KZGB 4D0NA 1CR2A 1G6OA 1KI3A 2IF0A 1N6NA 3QF4B 2J7PD 3KZ1E 2QRZA 5L3QA 4BE7B 2CHQA 4EQ6A 1EFRA 1IJFA 4UJ3A 4IRUB 4N1AA 1GP2A 3H1TA 1IXSB 2IYUA 2X77A 1NVXQ 5FTLA 2GEVA 3K70C 4LV5B 4A8JA 1NG9A 4LBYA 3VFDA 1WBDA 1G5RA 1W7AA 1G17A 3VU9B 1GZSA 3A6PC 3MD0A 2P65A 2ATVA 4QRHA 1JEEA 5CK4A 4D4MA 4DDTA 2DWPA 4GBMA 4U7DA 4V0NA 3RC8A 2DY1A 2GBLA 2A5DA 3I62A 3CLVA 2IS2A 3PUVA 1N6IA 3OFNA 3EWSA 4Q1AA 5KNCA 3THYB 3SJBA 3UKDA 3CRMA 3SEAA 2RGDA 4TWZA 3MG9A 2JAQA 1L8QA 4RZUA 1G8YA 3TH5A 4Q00A 2XOKA 1ZRHA 3W3ZB 4BLOA 1W0JA 4RD2A 1QZXA 4WBSA 3P1JA 2ECKA 1P9NA 1TUIA 4JMPA 1WQ1R 3A4LA 5TB5A 2GWHA 1JBKA 3QNUA 3D31A 4DLSA 3KJEA 2GF9A 2P67A 4IXMA 3NEJA 1G7CA 2VHQA 2IHYA 4TYPA 2QT1A 5CLLA 3VKHA 2ZI7A 1IONA 2QT0A 1NF3A 4FD2A 4RFSA 3WYAA 4A92A 4CEJA 4FI3C 4HAYA 1YVDA 5EZ6B 3P26A 1R2QA 2ZRHA 5CYOA 4PO9A 5J4KA 2SHKA 1YRAA 3I8XA 4LOAA 621PA 4NE2A 4PHTA 1EFCA 2CMKA 4LYFA 4BWYA 3ND8A 4K8OA 4M1KA 4DVGA 2DYKA 1PJRA 3HJNA 4XTRA 1G19A 1K8RA 2Q0HA 3I3SR 4FMDB 5DIFA 5BXQC 3U7GA 2D7DA 4CEHA 3U3OA 4CGZA 2ORIA 4B43A 2JIZD 2NG1A 1VHLA 3IBGA 2ZUDA 4OK6A 2D74A 4Q4LA 1T5LA 2F1JA 5GJVC 3E70C 1ZP6A 1G1MA 1OLOA 5TMPA 1DARA 2OEPA 5LPNA 3DL0A 3GLGA 5C1BA 3R7WB 2PMKA 3B1YA 3E1SA 3RSOA 3HYRA 4GNKA 1OXVA 3T06B 3TVDA 2ZJOA 2ZI9A 5F2EA 1N3BA 1LVGA 1XEFA 4IDOA 3CZPA 2IX3A 1NRJB 1US8A 1BS1A 3AP1A 2IUTA 4YMWA 3PEWA 5JSZB 4EIWA 1RW4A 5KU1A 1XMSA 3UPUA 3QKUA 3LVQE 2QY9A 2LKDA 2B8WA 1G3IA 4H1VA 1ZC3A 4PTLA 1G7SA 1QVRA 4JLDA 4LC1A 4RD6A 1DOAA 3I72A 2W6JD 1UBEA 1VIYA 4RCZA 1F2TA 3RNLA 5DNYB 3W5IA 1E2IA 2BMJA 1OKKD 2ZI4A 1Z06A 3LH5A 2BMEA 3ZD6A 3P4XA 2EU8A 3OESA 3NBZC 1E0AA 3ZVMA 5AR1A 5E95A 2EFGA 2F55A 3C4JA 3RYTC 1Q20A 4LBWA 1OB5A 2FZLA 1WXQA 2XOKD 3IQXA 1E79D 2DFTA 1W5SA 4LBZA 3B78A 2Z83A 1Q1QA 5AJZA 3TMKA 4GL2A 1RJ9B 2JLUA 3NTUA 2PL3A 1SULA 1K6MA 3BERA 2JLQA 2CE7A 1P2TA 3BORA 4GFDA 4TQUS 3OAAD 3GEHA 3IUYA 1AJEA 4CT5A 1CEEA 2BBTA 5IF9A 3A1UA 1UADA 5FH9A 1FNMA 5E7IA 4Z1MD 2VRWA 4QHYA 3Q3JB 4DB2A 4QG7A 1OT3A 3DKPA 3SI7A 1ZNWA 1MT0A 4LYAA 1LFDB 1YR8A 1NMXA 2YOFA 1KY3A 2ZRKA 1Z6TA 4PHGA 2JJ2D 1FQJA 3SFZA 3AF0A 1UDXA 2FPMA 2BMDA 3HR8A 1PUIA 4HAXA 4OI0A 2VHJA 4EJSB 4C0JA 3AV0B 2V7QA 3IDQA 3VTKA 1S9HA 2G6BA 4K81B 1XXHE 4ZIRB 1MO5A 4LBVA 3E2IA 2ANCA 4QGAA 5DI3B 5LDDC 1ZM7A 4DLTA 2CVFA 2PJRA 1FX0B 1KY2A 1N25A 3ZLJA 1E9AA 1X8KA 2R6CA 4ILEA 5IHPA 1EK0A 4HZUA 2OBMA 2XEXA 1TEXA 4KHZA 2A7QA 2CJWB 2ZROA 1Y63A 4Q21A 2VP6A 1RRGA 1YZUA 2B7CA 3QVUA 1S4QA 2D06A 3W6NA 4R2HA 2OLJA 3WNCA 3DPUA 4EUNA 3NH9A 1XWIA 2KBFA 1AS2A 1GNQA 1KDOA 1G8GA 4D26A 1IN6A 3O47A 1KSFX 5GJCA 1L2TA 3AVQA 4DT1B 3K9LA 1OHHA 3RS3A 4KVGA 1NN3A 3ADCA 1EWQA 3SYKA 2G0TA 1MH1A 3HR7A 3W8NA 1Z3IX 2H16A 4Q4AB 3LWNA 5E7JA 3UANA 5DN6D 1LB1B 5FUWA 4Q7KA 2BEJA 1NN1A 1JPNA 2A5FA 3UXMA 3X1WA 1SKYE 1ZU4A 1KGDA 1YZLA 2NZJA 1L7VC 5UKDA 2WKPA 1QHHA 4G3XA 5FI1B 3VHXA 1YZNA 3KQNA 2EFCB 3NEYA 1EX7A 2Q9CA 2G9NA 1OW3B 2X19A 4TTPA 1U81A 2O0JA 1JXOA 3P27A 1B0UA 4TSFA 5B57C 4PX9A 4NYMR 3CUEF 3NBXX 4MRRA 2PT7A 5G3ZA 1ESNA 1T3SA 4M21A 2R6AA 2CBZA 2WIAA 5KNBA 4GRAA 1ZUNB 3V9PA 3CH5A 2XNDD 1TF2A 3B7GA 2FG5A 3GPLA 2WJJA 1VYVA 3F0TA 3FTQA 3K0FA 1I2DA 3QEOA 4C7OB 4CIDA 3VNVA 1MABB 4DCNA 2ZR0A 3H2YA 2WSSD 2HV8A 3DOFA 3N5CA 3MMPA 4MA4A 4A2PA 1OXSC 1J8YF 1FPMA 1IY0A 1CKEA 4NCKA 2QN6A 4URUR 3RHFA 2C99A 1HEIA 2WJVA 4ASUA 4DSTA 1OFUX 3AVXA 4KITB 3ADBA 2C77A 3GEEA 1GVNB 2ZSEA 4I1SA 3OE7D 3K0CC 4ZDWA 1WBBA 3K1JA 1BOFA 1HH4A 5FTKA 2JJ2A 3RABA 1R0XA 3U60B 1Z6XA 1XEWX 1KJYA 2XZOA 3ZS8A 3H0KA 3MJRA 4NYMQ 421PA 1H8HD 2YWEA 4LJ4A 2W2VA 1ZW6A 5JJIA 3GEIA 4P4SB 2BVNA 3T61A 4ZPXA 4A6PA 4D0LB 2CCJA 4DKXA 5F9HA 1SVSA 1Z8FA 1AIPA 2BIFA 2WPDA 3L2OB 1VG9B 2LKCA 3AVYA 4JSYA 1PV4A 4FMCB 3I32A 1E2HA 5JWHA 1NP6A 2GXQA 3LY5A 5BQ5A 4MRNA 3DOEA 5FL3A 2O0KA 3FMPB 1UBCA 3DVLA 4URVR 1SVIA 1TU4A 3MWJA 3LVRE 2J87A 2VP0A 3C16C 1E0KA 1QRAA 2WZQA 2F3TA 4QC2A 3OEHD 1JJ7A 4UNRA 2W0SA 1Y3AA 2YYZA 4B3CA 3MWYW 3N2EA 2ATXA 2QSYA 1FW6A 2RKOA 4CEIA 2QMHA 1U0LA 1V43A 2VYFA 5HE8A 3PEYA 1Z6GA 3QPVA 2EW1A 4XIGS 4ABYA 4MYUA 1M74A 5HR5A 3T5DA 4MYCA 1YZGA 2EWVA 4PSAA 5DO9A 5FTMA 4A8JB 4JJZA 5JZVA 4MH0R 3SJAA 3GLFB 3M0EA 2IYYA 3PITA 3IKJA 4MKGA 4W5WA 1Q22A 3QF7A 2WWGA 3PUXA 3VR2A 1LY1A 4DDWA 4ZI2A 1D2NA 2WKRA 4R71A 4U5XA 2WWIA 4XOIA 1SXJC 2C04A 2QM8A 1IN8A 3B82A 5DGXA 1KSGA 4BLSA 4XH9B 4PZZA 2FDCA 4B3FX 4F38A 3GLHB 5JCZA 4ASUD 2OXCA 2PEYA 3K8YA 4KSBA 2HCJB 5SZKB 5GADl 1W36B 2A9KA 5B2ZA 2EVWX 2V6JA 2FWRA 2OFWA 4NYIR 5AJXA 3PUWA 4FMCF 1U99A 4I81A 1N5KA 2YOGA 1P7CA 1NVVR 2IT1A 4ZDIA 1E32A 1GRRA 1E2LA 1P3JA 2WICA 4P3YA 5AUOB 3GLIA 2MSDB 4NU0A 1TAGA 1Q1BA 2R9VA 5FOTA 4Q1CA 3X2SA 4QKQA 3ZIAD 1DG1G 3VAAA 2NPFA 4KV9A 4KFRA 4JS0A 4XJXA 4NMMA 5C46F 2BBSA 4C9BA 4Q48A 4BZXA 3OEED 4NCJA 1EFRD 2QPOA 4TYNA 2ZYWX 3GJ3A 1XTIA 3F5FA 4GI7A 4UNNA 3LX5A 4ZCLA 8OHMA 4TL7A 4V0ME 3WY9A 2H17A 3SC3A 1I4DD 1DAGA 3RC3A 2OILA 3THXA 3GFPA 3IPYA 2WM9B 3JZMA 3EPHA 3TR5A 3GJ8A 3AUYA 1E2QA 2JEOA 2O8EB 2V54A 4QNRA 1KI2A 3RS7A 2V3CC 4JVNA 3BIFA 1OJLA 1X8JA 2REBA 1CU1A 1X8LA 1X86B 1YZTA 4TZ6A 3UWOA 5JI2E 4XWKA 4R9UC 1K5DA 1U8YA 3AP2A 5JJKA 3Q85A 1S2MA 5FL7D 2H5EA 4Q01A 3BS4A 1IJEA 1ZM9A 3FHCB 4KU4A 4BFZA 4TSFD 3CO5A 2CJWA 4Q4JB 3EIHA 2QZ4A 3T35A 3KJIA 2W6ID 3A4NA 1ZIOA 5M04A 2YWGA 3IILA 1CS4C 1R0YA 6Q21A 1W4RA 1QVAA 4BQSA 2RCNA 1NLZA 4OQNA 1XMIA 4OHXA 1G16A 1GKIA 1G291 1XTRA 4IVQA 1RPZA 2IXFA 2FA9A 3A36A 4BZQA 3NHBA 1AN0A 1GILA 4KFUA 1Q3HA 4LUCA 2EWWA 3TW4A 5JFGA 1BH2A 3HDTA 3NBYC 4Q9JA 3ZQJA 1OHHD 4JL5A 1DAEA 4UXIA 2YWFA 5AJWA 4ZV4A 3CF6R 4IHQA 2UKDA 4M9XA 1XD9A 3FMOB 1XTQA 4K46A 1DO0A 2GJAA 3SNHA 1J8MF 3FVQA 4S35A 3SS8A 1KMHB 2WIBA 4A2QA 2ZJ5A 3Q72A 1ZNXA 3BK7A 1PLJA 2JJ1A 3ETLA 3LAWA 4M1TA 4PHHA 1VMAA 3A1SA 2VHCA 5J4LA 2AKYA 2IUSA 4D80A 3QOFA 3OAAA 1TPZA 4D2IA 2H1LA 1IN5A 1VIAA 2W6IA 5D3MA 5TV2A 1KKLA 1ZVQA 1DEKA 2HUPA 2X1VA 1ZD8A 2QL6A 4NYJR 1DE0A 1QBKC 1W0KA 5BWMA 3GLHE 1GRQA 1NSFA 3I1FA 3QG1A 1ETUA 3VKGA 4TMWA 4Z8YA 5JLJA 3IO5A 1RVDA 4YDSA 1YKSA 3T5GA 5B30A 3SYNA 3REGA 4PO8A 1FX0A 721PA 5KSZA 3L0SA 4NCHA 1AQYA 4Z54A 1RZ3A 1CF4A 4C7OA 2W6JA 3BB3A 3FKQA 1T8TA 2JLSA 5E4FA 2XB4A 3WMFA 5ELXA 1TTTA 2O8FB 3FFBA 3QIAA 4JLKA 2FJUA 4H1UA 3R8CA 2ZI6A 4OHWA 4DSUA 1NNEA 4BRWA 2WJGA 2UZ3A 1LF5A 2IS6A 3K70B 2IYSA 3KUCA 1KNQA 2WWFA 3ASYA 4C30A 1U2RA 2WV9A 2ZRNA 3L0IB 1XMVA 4CT4B 3EC2A 2XTNA 1NN0A 1KI7A 3EZ7A 2O8BA 2EYQA 3AKCA 5H8WA 1KOFA 1AK2A 5EE3A 2DWOA 5J47A 4FIDA 4HAWA 4YXWA 3EZFA 2ZVPX 2IWRA 1M34E 1RKBA 4Q4AA 3BXZA 2IYQA 3VU9A 1E9SA 4NBSA 2WKQA 2GXUA 4DHEA 1KNXA 3EX7C 1QHNA 1WMSA 4NH0A 1BYUA 2A2ZA 2H57A 2QNRA 1TX4B 3ICQB 3OIVA 3IGFA 2QTHA 2QI9C 2A5GA 3RS2A 2R44A 1ZNZA 2JCSA 4CYMA 4Q9LA 2ZRLA 1KZ7B 3ZZTA 1G4AE 1F6BA 2OG2A 1O87A 3SQWA 1RC8A 4EPTA 1VYUA 2OBNA 1KK1A 3QEJA 4IVRA 4DCVA 3A8TA 1P9RA 5FTJA 3IO3A 4E09A 4JJKA 2IYVA 1DADA 1HE1C 4U00A 3SE0A 2C9OA 4KBFA 5KSOA 4IDQA 1KDRA 1BYIA 2ZE8A 2NTYC 1JPJA 2EQBA 2YHSA 4HZUB 3T15A 3BFKA 4DZZA 1T9HA 2CL7X 2F3RA 3CPJB 4XSHA 5FPTA 1IY1A 5FFMA 2HT1A 1N5JA 3RDPA 3L0PA 3TQFA 4E03A 4BASA 3QKRB 3Q5DA 4TLAA 1TNDA 1S1MA 2R6FA 3ZVLA 5GVSA 1DS6A 5EE9A 4V0OA 1AQUA 1XJ0A 4HB0A 3S1AA 4TN1A 4YONB 3RLFA 1GM5A 4E07A 2HT6A 3DZ8A 4Z1MA 5C4MA 3PEUA 4C2TA 2ZSAA 4LPKA 4EQ6B 3KB2A 4PPQA 2J0VA 1UF9A 1P72A 4A9AA 2XTZA 4US2R 1OIWA 1VDZA 3GMTA 4N0DA 4KAXA 3BAFA 4DIEA 1T3HA 4HLDA 1YJ5A 2GJ9A 4UNPA 3HPQA 4H9GA 4LJAA 4B48A 3CR8A 1R8QA 1N5LA 4HZIA 4LJ5A 1XB2A 2PZEA 4NTZA 4TLCA 3BC1A 4HEJA 2OE2A 5EP4A 3F3YA 1SXJE 2B6HA 2C5LA 2Q9BA 1UBFA 4RJLA 2RGNC 1R4AA 5CITA 5BYKA 1UAAA 2P0EA 1AM4D 4YQFA 4ZKDA 1KIMA 3AVTA 4URXR 3LD9A 3LNCA 3BFVA 1SKQA 521PA 3WNBA 1GRNA 2Z4RA 1CJVC 4BUJA 1DAHA 4GP6A 5P21A 1ZMXA 2E1RA 1MKYA 2OESA 4M9QA 3OIYA 5KHOC 4AKGA 3AVPA 1NY6A 4G01B 4Y0AA 2OXRA 3C8UA 4MQBA 1AZTA 1G3MA 3R20A 3TRFA 4BEBA 2FSHA 3UMSA 1JR6A 2HJGA 1EGAA 4LV6A 1E2NA 3VMFA 4B76A 5JBQA 2KBEA 2YVUA 3OIWA 1GITA 4RKFA 1OV4A 2DCUA 1FTSA 3VX4A 1DAMA 1CJTC 3DDCA 3FOZA 2X2FA 3T1QA 4X8OA 2WWWA 1EWRA 4LZZA 3B5JA 4HLUA 4D0GA 4R7ZA 2J7KA 2ZJBA 1G20E 1M7HA 4HATA 2ASEA 1W48A 2YJTD 5FPYA 3ZYCA 3T1TA 3V00A 2FE4A 3GFTA 3K9NA 1RJ9A 2W83A 4CVNA 3MAAC 4M9SA 3GLHA 2ZYTX 1WA5A 2XNDA 3HWSA 2J1LA 4FWIB 3RRZA 2C9YA 3QY0A 1VCOA 4QM7A 4JVLA 3FKSA 3EARA 1YZKA 2E87A 2V55B 1J7KA 4A82A 4J0QA 2AFHE 2EFHB 2WHXA 2GBLC 4PXAA 4F7WA 1CJUC 3X1DA 2WVJA 1TQ4A 3GLGE 3AQ4A 4A0FA 1JNYA 1ZBDA 1S1CA 5EZ5A 1Z0FA 4DBLC 4C0LA 4YMTA 5J40A 2ZVQX 1DAKA 1SGWA 2ODWA 2RGAA 4WZAE 1E9RA 1R0ZA 3B85A 4EPXA 1MR3F 2GRJA 5CM9C 5KUTA 2Q3FA 1B23P 1D6JA 4FCVA 2GEUA 3LRPA 5LBIA 3ONWA 2O8CA 3OEEA 3TW8B 4KVAA 4P32A 3QENA 1E2GA 4JZKA 1I2MA 3P20A 4Q9KA 4CF7A 2RGEA 3SHWA 3QVVA 4URWR 3OHMA 5HPYB 1GIAA 4C0KA 2IK8A 2YOHA 2WSMA 3CWQA 5GVRA 4ACAA 4DLWA 2GHIA 5JEDA 3TJZA 3VQTA 4M4SA 3I61A 1Z07A 4LK2A 1E4VA 4DRZA 1HYQA 1YR7A 4PANA 4QM6A 5J4HA 4AG5A 4IOKA 1KTVA 2QGNA 4L9SA 4PSKA 4DDVA 3K0EA 3AVVA 5HZHA 1F2TB 2W2XA 4CDGA 3BH6A 1KMQA 4HLCA 1W49A 5AUQA 221PA 3VHLB 2YV5A 4M0LA 4URYR 3FMIA 1P73A 3RS0A 1VYTA 2RHDA 4DUGD 3GLFA 4A36A 2O8CB 1ZD9A 1MRSA 3SZRA 3SHFA 1CJMA 2ZS9A 3KFVA 4A1FA 1XZPA 4ITRC 4OK5A 3SN6A 2CVHA 3CZQA 4OI4A 5K8LA 3PEVA 4OI1A 4C0SA 5IRCD 4OJQA 4QBHA 3LQRA 1XFAA 3QQ5A 4IDPA 1OE0A 4Z8XA 2GXSA 4TMZA 4A15A 3M1IA 5AJVB 1EFUA 4MRPA 3CRW1 4C3ZA 5AUNB 4LJYA 3VR1A 1CXZA 4IEEA 2ZSDA 3KKMA 4LHYA 1IHUA 2IF2A 5BN3A 4JL6A 2EFDB 4L15A 4O3MA 5LB4A 2OSBA 1CP2A 1D9XA 3HP1A 1EXMA 1AKYA 1AZSC 2ZJ2A 4V0MA 3KTAA 1E94E 2UVQA 3CRRA 3VR4A 3LBNA 3O8BA 1HTWA 2ORWA 1W44A 4BFWA 3QKSB 2OHFA 2DPXA 3QXXA 3UWKA 1II9A 2IYXA 3U3JA 2VPPA 3GLIB 1OYYA 1OH6A 4JT4A 3BFXA 1G3RA 1US8B 1XDBA 3W5JA 2O8BB 1KDPA 3FMFA 1Z0AA 1WF3A 1XP8A 4MKFA 4UNSA 4JVMA 1KDTA 2GJKA 2VTKA 3GFOA 3LBIA 1WE2A 3EZ2A 1RYHA 2QMUA 2WPDD 4Q47A 1R7RA 2ZQ5A 2OBLA 4O25A 1M7GA 1C4OA 5L3SA 4IKEA 3KTAB 3GJ5A 2NMVA 3AP3A 3PCRB 1VHTA 4HAUA 3CRVA 1JI0A 2BM0A 2GZAA 1R5BA 2OCBA 3EASA 2WBLC 5DYIA 1E2KA 1YR9A 4YC7A 2QPAA 5AWFC 4AYWA 4O0MA 4X8MA 5IT5A 1I4TD 2CXXA 2ZXUA 5C18A 1F2UA 1RFLA 1VG8A 4EAQA 2R8RA 1DBSA 3DM5A 4OJKA 2QBYB 4GT1A 4RY2A 3U3KA 1FZQA 1VECA 1W36C 3DM9B 3CPHA 4WZBE 2P2LA 1ONBA 1L4UA 3DKVA 3NG1A 3C5CA 2W00A 4OQMA 2VEDA 4P4SA 4TLBA 2ZR7A 2AXNA 2YINC 3AH8A 1JR3D 2PBRA 3AB3A 4RCYA 3TAHA 2D2FA 1A2KC 5JS8A 3RVBA 5DHFA 2DBYA 1P6XA 2HEIA 1II8B 4PSVA 4U02A 4D25A 4YMUA 4PQFA 2CCKA 2IBMA 4MGIR 5IK2A 2JLRA 4Q7JB 3QUSA 3WHKA 1KO4A 1NJGA 4QGFA 3UATA 2ZREA 2F9LA 2AWNA 3QKRA 4KFSA 4NKRA 4V03A 4XD7D 5TDHA 2GCPA 4G0NA 1G18A 4Q7MB 2JLXA 2A5JA 1PZNA 1HURA 3K0CA 2JLZA 2G77B 2ZPTX 2E9SA 2FNAA 1VCMA 1Z28A 1F2UB 2QBYA 4A4DA 4E5UA 1Z47A 4G5QA 3UIEA 1A1VA 4B2PA 1N0WA 821PA 2ZI5A 3B1VA 1A5TA 1VG0B 3AKYA 4M8NE 2P6UA 5CK5A 1CIPA 4IFBA 3AF4A 2WTUA 5DI3A 5F9FA 3HPRA 4OQFA 3B6EA 3NIBA 3C5HA 4ARZB 1XTKA 2I4IA 2N42A 1OIXA 4F4IA 2ZUCA 2RGXA 4G1UC 5K8IA 1S3GA 1TU3A 3C41J 3D8BA 1ZU5A 3B8HA 3F8TA 2ERXA 1SZPA 5CJPA 3DHWC 4Q1BA 3UG6A 3Q7QA 2ZRBA 2FH5B 2ZJZA 4GPTA 3LLMA 3AVUA 3SJZA 5F3WB 5L8VA 3LW7A 4FMBB 5HTKA 4HDCA 3NH6A 3I8SA 4KO8A 3A4MA 4PO1A 2QP9X 1Z2CA 1XMJA 1QF9A 1YQTA 3TSZA 4G5RA 3B2EA 1NVVQ 2D7CA 4P31A 1IXRC 3QXSA 5EE1A 3TE6A 2J0UA 5AK0A 2I1QA 5FBWB 3GD7A 1E0JA 4B35A 3SR0A 1W4CA 4QXAA 5C2JB 4Q9HA 3U3RA 4YMVA 3KJGA 2JATA 1KI6A 3WMEA 2BCGY 1CRQA 2GJSA 4KXFB 1DG3A 4BPBA 1E9BA 3KKQA 5FBRB 4OHVA 5C4GB 2B7BA 3S1AB 1NY5A 3BWDD 3V4RA 1H8EA 5DN6A 2YNMA 4PC1A 4TT3A 3FE2A 3CNNA 2IS4A 3K0AB 3KQHA 1UKEA 1Z0JA 2QORA 3JVUA 3B1XA 4DEYA 3FGNA 3MRSA 2QU8A 4P4TA 5JJLA 2X2EA 3T34A 4TQAA 2IYWA 1EX6A 1Q57A 2F1RA 5KTYA 1MO4A 4KSCA 3CF2A 4M1MA 3FFAA 3KQLA 3K0SA 1DELA 1S9DA 3QPWA 1ZM4A 1NMZA 5JWRA 3TLXA 1OFIA 1E98A 2ZSBA 4DDUA 5LB2A 4G5SA 2GZHA 5JI3E 4QGHA 3TAUA 2CHVA 2Z4SA 4IOJA 4JLPA 1R0WA 1QHIA 3EPKA 1XXHA 5EXXA 1FNNA 1SVKA 1VTKA 3JVVA 2ZRGA 1QHXA 3LW8A 1YR6A 1XCGB 3QXHA 4LPSA 5KDOA 2O52A 2VL7A 3CKLA 2BC9A 1XCPA 2KE5A 3WRYC 2V7QD 4GZMA 2JJ1D 4B3GA 4Q5IA 3PFIA 1KO7A 1E4YA 5L3VA 2HXYA 2VBCA 3WRXC 3ECCA 2ZJAA 1X1RA 3W90A 2B8TA 4LSGA 5FTNA 1IOZA 3KQUA 4W9MC 2J7PA 1E9EA 1E9DA 1M1YE 1CR0A 5JSZA 4ZKEA 2WOOA 4JT2A 3THYA 2GILA 3T1VA 1Q0UA 4KLNA 3TK1A 4QGGA 4PPNA 2IWHA 4ZDJA 1ANKA 5KOYA 2QSZA 3WYFA 3PJRA 2BHRA 1E0SA 3Q5EA 2OAP1 1D5CA 2V1XA 4GOKA 4AKHA 2ZR9A 3ZIAA 4KYUA 4AC9A 1ESMA 1W5TA 1XD8A 2FPLA 5HCNA 1Z29A 4JKIA 4AY2A 4LC0A 2G88A 5H70A 3W6OA 4OI2A 1XNJA 4HDQB 1JECA 2B21A 3NC0C 1E2PA 2JASA 2QEQA 4ZI3A 3UMRA 4PC6A 1W2HA 3EIQA 1ZUIA 5H68A 2AK2A 2CCGA 4LRWA 4DSOA 3UMFA 2G1JA 2AXPA 2FZ4A 5KPDA 5HKKD 1VG1A 1XEXA 2CEAA 3K9HA 4Q02A 1D2EA 3U44B 4DLUA 1KI4A 2ZRJA 5HZKA 3O8DA 1KYIA 4R2IA 1R10A 4TMTA 1A82A 4POAA 2REOA 4UQOA 4UXHA 2ZAOA 3WBJA 1G3QA 1TMKA 3EW9A 3A37A 2PX0A 1CULC 4LDJA 2FFQA 2QAGB 4QHSA 1SXJB 1UJ2A 3OE7A 1T3LA 5KO2A 2OCAA 3U6KA 1KAOA 4JBYA 2C03A 4Q4JA 5LD2C 4M1SA 2PCJA 4FN5A 2C9CA 4TL9A 5EE5B 4MYTA 2WWHA 5EXSA 2ZS7A 3UK6A 2CL6X 3IEUA 4C4PA 3U4QB 3R7WA 5AJYA 4DIDA 4WVFA 4BRUA 2ZM5A 1KK0A 2PEZA 1TUEA 1ZAKA 2QAGC 1QHSA 1KI1A 3GJ0A 2PH1A 3GJ7A 4TYWA 4P4UA 2WWYA 3OZXA 1UFQA 4BECA 4BGDA 1GUAA 4B71A 2AX4A 4AI6A 5JWOA 2QROA 2FGJA 1TQ2A 3E5HA 2AN9A 2ODBA 2XX3A 2HDNB 3TSWA 1II8A 5EQTA 2DWQA 3MWLA 2OCYC 2V8OA 4ESVA 1U0JA 1JALA 2ONKA 3QI2A 1N6RA 5DI9A 4R98A 4KODA 4P0TA 1N6KA 3MUFA 2JIZA 4BLRA 5JHGB 2X8AA 3U4QA 1E1QA 4NONA 4EFMA 3A1VA 2RAPA 1BMFD 1GG2A 1R8SA 5FOVA 4FMDF 1XTJA 4GMDA 4F92B 1BKDR 1FP6A 2GDJA 3NBFA 2J0QA 3P32A 1GFIA 1OPXA 1J70A 1LV7A 2QMEA 2NO9A 4HI0E 4N3NA 5CLQA 4OK3A 3QSYA 3U7FB 1AGPA 1XTSA 3QXCA 1KK3A 2HF8A 2YC4C 2FX3A 4JLVA 4D4KA 3VR5A 3BE4A 3RRNA 4Q4HA 3U7EB 2B92A 2VH5R 3VR3A 3BGWA 4WW0A 2K5UA 5FL7A 2ONJA 2V6IA 3THOA 1PUJA 3NKVA 4D4LA 4NCNA 1W36D 2XITA 4DUGA 2FSFA 4NDZA 1G6HA 4V0KA 2RMKA 1I4LD 2QE7A 2IW3A 5D3QA 3RWMB 3X1YA 1FUUA 3ASZA 1NVWQ 1GTVA 4EJSA 1G4UR 1H65A 2BBOA 1HQYE 3NDPA 4QHTA 3QE0A 4XTCS 4JLAA 3AF3A 4TLEA 5EP1A 4B75A 3EA0A 4BFUA 2ZS8A 4PFSA 4IJMA 4PC2A 2D4HA 1G8HA 2VP5A 121PA 1FOEB 3SU8A 1E2EA 2GJ8A 4MDFA 1QG4A 5A4JA 3MGCA 1E1RD 1FQKA 3LFUA 2QM7A 5JMTA 1Q12A 5GJWC 1H8HA 1NG1A 2AFIE 2H18A 1GKUB 1BO6A 4Q7LA 2RB4A 1FTNA 3IHWA 3KL4A 5CIQA 1JAHA 1N6LA 3FHTA 4EPWA 3CNOA 1ZD1A 3Q7PA 3ZVRA 1EESA 2OUKA 2C2HA 3CX6A 1EG7A 4JIMA 1GDDA 1IXZA 5DHAA 1NI3A 1KO8A 2JA1A 5FOWA 4B3XA 3K0AA 3ADDA 2QP3A 5DH9A 5EUMA 4BEJA 2CNWD 1W46A 2HXSA 3OF5A 1T8UA 2DFNA 2NOAA 5K8UA 1NJFA 1J90A 4LHWA 4F93B 1U9IA 4A2WA 1N6PA 4HAZA 4JVSB 1A7JA 4PHFA 4D81A 5IDVA 4DEXA 1P61B 2V1UA 2CE2X 2ZYVX 3R8FA 2OFOA 1TQDA 1G8PA 3MFYA 5E7MA 2ZRIA 1W2GA 4MKIA 2N46A 1XJQA 3DMDA 5FPHA 4Q03A 1NMYA 2A3RA 1P2UA 1S96A 2VP2A 3IIJA 3MCAA 4PQYA 5KYKA 2XZPA 1LF0A 4HUQA 3AGQA 1R6BX 3GQBA 5B58C 1QHYA 3AKDA 4LYHA 4CEIB 3A1WA 4RD1A 2FEOA 4DLVA 4JLJA 3ZJYA 2MMGA 1NSTA 2NPIA 3AUXA 5K8TA 4F4CA 1IQPA 2AKAB 3MLEA 4I1VA 2J0UB 3CX8A 4EPVA 3PENA 1Z6AA 3L82B 1COWD 2J3EA 2ORVA 1ZNYA 2BM1A 1U90A 4LY6A 1IN7A 2RGBA 1CTQA 4PPFA 1ZJ6A 5SZIA 4MUBA 2J46A 3JZAA 2VA8A 4B6EA 1QDEA 2KI5A 3TGPA 4OQXA 4AWXA 4B3DA 1YE8A 2GZDA 2HLDD 4TTRA 1UBGA 2OT3B 1E2DA 2BEKA 1OXUA 4N0EA 4EPRA 2GESA 4AYTA 3KXLA 5DE3A 4C0BA 1RRFA 1D9ZA 1E2FA 1D8TA 3TSOA 4ARZA 1ZM3A 2IA5A 3TIFA 1DTSA 1FUKA 1VPLA 4OKSA 1AKEA 2C95A 3MWKA 1F3OA 5J5CA 3BD9A 1U0HC 2G0NA 4HB2A 3W8RA 5JECA 4JKYA 1J99A 1R5NA 1KHTA 4KJZA 1DPFA 1A2BA 2EYUA 4FXPA 4DXAA 2GVZC 4XVUA 4QJ3A 4MRSA 5A5GA 3UG7A 2O8DB 1OSNA 1GKYA 2V9PA 2PCLA 4QFMA 1NKTA 4DCUA 1XPUA 2XZLA 1Z0IA 3QPUA 1RIFA 1GSIA 2I1VB 4B74A 3VX3A 2NO6A 4LV8B 5B64A 5JRZA 1Z6YA 3PUZA 2IL1A 4QJ4A 1Q1ZA 2D3WA 4V0LA 2P5TB 4CRWB 3KFXA 2Z6VA 1KI9A 4Z51A 3BRWD 3FHOA 2IYZA 1JJVA 3NXSA 3QKSA 3THXB 1L4YA 4IFEA 3R9XA 4RFSB 5FPKA 4IEIA 2ZIAA 2KSQA 1M2OB 2DHRA 1P75A 3SQXA 1X1SA 1M8PA 1SHZA 1F60A 1HV8A 4LJ9A 2IC5A 2EFEB 1TF5A 3IBYA 1E79A 2CDNA 2L0XA 3QXJA 2NIPA 1OYWA 1HUQA 1JR3A 2GF0A 3VKWA 3EPLA 3ZDQA 1XF9A 2WAYA 4G5GA 4YDHB 4II7A 5BYJA 2HYDA 1T4GA 2W58A 2REXB 2XNSA 2ZU0C 1N5IA 3L8ZA 3WNDA 3QG5A 1CR4A 3O8RA 2P6NA 2F43B 2ZANA 3B9QA 1UKVY 3BH7A 2F6RA 2NQ2C 1EFTA 1XX6A 4IVPA 2PJZA 4Q19A 2VO1A 4AK9A 1Z08A 2LCFA 3TKLA 5SZJA 1OXTA 4DB4A 1UDWA 1MRNA 2BBWA 3CIOA 5FI0B 3FB4A 5FR2A 1GAJA 2GTPA 3C15C 4LJ6A 1FMJA 1MO6A 1UEIA 4LCBA 4DLYA 1XEWY 2ZI3A 4PZLA 4ZIRA 4NYIQ 4XVRA 3U2QA 4IXNA 2VHUA 4PQRA 3T12A 4DLRA 4NHOA 4D82A 2QGZA 3V4FA 4LI0A 3KDSE 2ZE6A 5HCIA 4M9ZA 1KK2A 2NZ8A 3RRMA 3FYHA 5JHHB 2F1HA 1KMHA 1G41A 4WXPA 3THWA 2W0MA 4JLBA 4HSEA 4PZYA 2PZGA 5G41A 1ZC4A 3PVSA 2CK3D 1NKSA 3X1XA 2D2EA 1S3SA 1JEDA 1JQJC 2MSEB 4CZ2A 5EUQB 4B34A 1IAQA 1P62B 4LX0A 3ICEA 3T1OA 4TTQA 1PVOA 2O5VA 3K53A 4HLQB 1N0VC 1FMLA 3CX7A 1U9IC 1ZIPA 3IEVA 2C98A 2RGGA 5CDFE 4JLMA 4BFYA 2JLWA 1N6OA 5SZHB 4Q1DA 3CBQA 4Q18A 1D2MA 4IW3B 1BMFA 1CJKC 1RYFA 3HU1A 2BKUA 2F9MA 2Q21A 3GJ4A 3QKTA 3TVTA 4LHZA 1T6NA 1JR3E 2TMKA 3KXIA 3IIKA 2H7VA 4NCIA 2GCOB 4MDEA 3CB4A 1XZQA 2FFHA 3LQQA 1ZCAA 1G5TA 2A5YB 3L43A 4AKEA 2NO0A 3B60A 4FCTA 2O8FA 4QBFA 3K09A 1GL6A 4RKEA 2WMOB 2XSZA 1T5IA 4XD7A 3M4YA 4B33A 1WCV1 4BFTA 1OH7A 2VQSA 2VF7A 1VCNA 4KBGA 1A4RA 4GZLA 4PC3A 3GLFE 3IPXA 4AIIA 1XEXB 4UJ5A 3WHLA 1ZCBA 2ZAMA 4GP7A 2VP9A 2KWIA 2PLRA 2PX3A 4WAUA 2F7SA 2IEZA 1GWNA 1ZYUA 1R5OA 2AK3A 3CRQA 4C2UA 2J45A 5A0FA 1Z5ZA 3WMGA 2MMCA 5H1YA 2UZIR 4JBXA 4TMXA 3B9PA 5FUXA 1SKYB 1HE8B 1HA3A 1Q44A 1KJZA 3SBEA 4BFSA 4E22A 5FUVA 1IBRA 3CWZA 4AD8A 1AS0A 1KI6B 1VKJA 1SQ5A 4PPGA 4TMVA 4JBWA 3LXXA 2AR7A 1GOTA 3FDIA 2AL7A 4PR0A 1XD2B 3J81k 1N2CE 1NN5A 2C8VA 2NO7A 4CW7A 4JYBA 1E1RA 3EPJA 1Z83A 4XWAA 5JRJA 2CLSA 1FP7A 2ZJYA 1T0HB 2FV8A 4M1WA 1SHKA 4IDNA 4NYJQ 4DT1A 1KKMA 5DISB 5EXPA
chains in the Genus database with same CATH superfamily
3T7AA 5IKXA 3A3YA 3CCBA 1RMQA 5CB6A 5KVVA 1G9XA 2GWRA 1QWSA 1FDOA 1U65A 2FPKA 4YCCA 1R12A 4F2GA 2EKDA 5L6LB 1E5LA 3ACCA 5BT8A 3KSMA 1JHVA 2Q50A 1X38A 3PUYA 1UODA 1XRRA 3V7UA 4PX2A 4LZAA 1Q91A 2AD1A 2HHLA 4LJ7A 1BA2A 1RU3A 2D3TA 4JLWA 4LY9A 1KFBB 3KKNA 4PYNA 4EGJA 1X39A 3B89A 5AHKA 1BNCA 3SIRA 1XHEA 4JKOA 3GCGA 4DQXA 4OHYA 1M7BA 3M6AA 1N2JA 3EG5A 3EZGA 4U7WA 2OAGA 4UAGA 2BV3A 2ERCA 3CH4B 3FOCA 1J2JA 3ZWOA 1KO5A 3ENWA 5BN5A 3KLMX 4JXXA 3BPSA 4CKBA 4XFDA 1LVUA 2PL5A 1BQEA 3NV9A 3PJGA 3UJPA 1W1WA 2ZYHA 4BE9A 1NBMA 3MUOA 2AZ4A 1GQRA 1Y6GA 1N1GA 5ANRB 4LYJA 4BLWA 1V37A 2WJYA 3NGMA 4L4RA 5G53C 1GNRA 5AT1A 4DSNA 2FOLA 3K0FB 2ADMA 3PHHA 3R0VA 1JAIA 3DBVO 3HYLA 1DOHA 4Q4HB 5A5EA 1H0HA 1X80B 3SEQA 1WB9A 2IDKA 3UHPA 3AVOA 4URZR 3MRTA 3F5MA 5CCBA 1ZQ1A 3F8SA 4G0WA 3BT7A 3PK0A 4LWPA 4TKLA 4EJMA 4RZ3A 3KU1A 4OGFA 4B82A 4CETA 4WXRA 3LVFO 3OHSX 4D5EA 4AURA 3DVSX 1TGYA 1PQ4A 1WZIA 2D0IA 2GK4A 3ZX5A 1P7PA 1PDWA 3IIEA 2IZ5A 2MYTA 2BDUA 3HR4A 3TX6A 3ZPXA 3OI7A 3U5ZB 4QUHA 4KG7A 4YR7A 5L3QB 4X00A 2I55A 4MTCA 5IFKA 3WGQA 5KOIA 4LZNA 3H5IA 1SOVA 1UIRA 2QB5A 1P44A 3GJ6A 4UZEA 4XPIA 4DNXA 1AKRA 1YCGA 2C29D 1HKHA 2PUVA 1WM1A 1ZAYA 4B45A 5EPEA 1UZLA 2P1ZA 1FFXA 3U31A 1HYEA 2HCBA 3SOPA 3UJCA 3RC1A 1GZ5A 1OLSA 2EFJA 1PLLA 3RT9A 3FNGA 3TRKA 2PL1A 1O6ZA 1Y82A 3AKEA 3BH0A 3IP5A 3V80A 1V3VA 1UKYA 1E9FA 1FUIA 3EHEA 2JIBA 3GNTA 3L18A 4O2BB 4A6EA 3L40A 4HLUC 2CN1A 4MS4B 2V0CA 1WDTA 1ECLA 4LXIA 3U7JA 1S5PA 4CTJA 1KP9A 4AJEA 2FZEA 4HYYA 4DNQA 1UINA 1T1JA 2RHMA 4P1ZA 1HY3A 5GTDA 1PD1A 4C04A 4BB6A 3SJCA 1DXQA 1JB1A 2ZYSA 3PJFA 2KB0A 1V26A 3DTVD 3HB4X 4YAEA 4XLZA 3PD7A 3ML1A 3DMTA 1IBSA 3B1ZA 3Q3VA 1IY8A 3FSRA 4QVIA 2XTMA 4Y6GB 4EHNA 1DIHA 2V7WA 4WKNA 1E7RA 4NVRA 1OA1A 1U8AA 4GLLA 4XB2A 3SVZA 1I32A 3ZH9B 1FU8A 4LE1A 2IXGA 1E1CB 4A0HA 1DG9A 4GR5A 2YC2C 4HAVA 1C7QA 3ESAA 4C7XA 1PG5A 4S12A 4DE5A 1QTIA 2I6QA 4REOA 1JE0A 2RC5A 1L4KA 3QEMA 4KR0A 4US1R 1T2FA 3LA6A 3LGSA 2OQVA 3SC2B 3NVAA 2F8MA 1MOZA 1UM8A 1I51A 4UBMA 1XQWA 1YO6A 2WI8A 1VJRA 3EEIA 3G5UA 4H17A 3WRXA 4R1TA 4CUJA 1I10A 5DLQC 2RGNA 3AVWA 1W52X 1X1DA 3BMQA 2INGX 3ILVA 4NH4A 5ALSA 4MYHA 4R54A 3TTTA 4W5HA 4BP8A 2LWIA 1R74A 3AETA 1YUMA 5IH7A 1JEQB 4DNPA 3RAPR 1DRJA 3DTNA 4RVCA 1I6WA 1KJWA 1UK6A 1IEWA 2GPYA 4XB1A 3WLIA 4DSZA 1SXJD 3E9ZA 2H59A 1NIPA 2GCEA 1U8UA 3V3KA 3H9JA 5J4YA 3C43A 5F5XA 3HUTA 3L0CA 1YOVB 1IUPA 3GBPA 3KB1A 3OE4A 2WAXA 4E2ZA 5KYYB 3AJ9A 1RWVA 3TEFA 2WMNB 3U6BA 4RIHA 3GDOA 4KFCA 3ZZUA 1ATIA 1T9BA 5EE0A 1E8MA 1DAFA 2I67A 1OCEA 4MVYA 3DMNA 1G5PA 4U9IS 4KQMA 1Y0BA 4ZT7A 5B53A 4BN0A 1P60A 2G28A 4BO2A 1ODTC 4BFXA 1CQPA 4YASA 4BMZA 3PD1A 3U61B 3DOOA 3IVRA 3N70A 5EI5A 5CFPA 1JIIA 3BA1A 2Z5FA 4ZEVA 2HAEA 3BB1A 3L1VA 2AOVA 2HIMA 1DO2A 5IAGA 1FXWF 4LRXA 3OQMA 4JYZA 4FN4A 2BZGA 1RRPA 3ESDA 3CVOA 2F1IA 3VSBA 3WBKA 1GG8A 4B32A 3ZVNA 1A8PA 2XAUA 3MBIA 5EKDA 3WLTA 3SQMA 3C7DB 1SXJA 5JD4A 4P3NA 1OGJA 3ELWA 3AIKA 5A2GA 1E9CA 1ZHOA 3RM3A 1XMOB 1WO8A 2BJWA 1WZUA 2G7ZA 4NEGA 3DO6A 2G7MC 3B7PA 1RWWA 4TWAA 2H8GA 5BQPA 1Z2EA 3HUDA 2BEUB 2YBEA 2GYWA 3ZUPA 4B46A 3L7LA 3GLTA 3LDAA 4QU5A 4B3BA 5FQNA 2IYRA 4L85A 1TUGA 4BO7A 3WRYA 4XGQA 4L16A 5BUCA 3GT7A 2WJIA 4LGMA 3HFSA 4I4TF 3VH3A 2HADA 1FFGA 2WYVA 3N0WA 4LOKA 4NU6A 3H1AA 2EATA 2J5KA 2WU8A 3DEFA 5ER9A 5LQSA 2JAUA 1YA8A 2G3YA 3VGPA 4MPDA 1DEXA 2ANBA 2BCJQ 3NBKA 4DC9A 4AZ0A 3Q41A 3JPYA 4HEA1 3ZU2A 4EFLA 4B40A 2BLNA 2A0FA 1J0CA 1TFUA 4D99A 1ACLA 1R6VA 4GMHA 4HEA6 1NBAA 2GPJA 3MTEA 4LJSA 4XDGA 2F1OA 4TLDA 3UM9A 2JD1A 1DX4A 1KU6A 4GHWA 2Q46A 1GGJA 5AUPB 5JW6A 1T6XA 3UMVA 3QNWA 4LC9A 3T0FA 1USGA 4BRSA 3RS9A 5AW3A 4M0PA 1W96A 3FKSD 4CKZA 3NNNA 1TECE 1ADFA 3OLQA 5EKUA 4DYVA 1AGRA 3UAZA 5BN4A 5EJEA 1BQ4A 5CVVA 1HI9A 1O94D 1MT3A 3A4IA 5TXGA 3SZOA 1OYOA 4HNRA 4YO7A 5AW6A 1F51E 3AWDA 1A9RA 1QPBA 3FF4A 3AHCA 2ZGVA 3KVYA 5DP2A 4QL3A 3H86A 1N3IA 2P3SA 1TT7A 1NX6A 3CF0A 4WGGA 3BEOA 2A3NA 2NW6A 1H3FA 4TYYA 2XYRA 1T2DA 3U9LA 1SIOA 1FP4B 2SBTA 4R7TA 4F91B 1HO3A 4EW3A 3QNMA 4RPGA 2ZUBA 1UZUA 3RANA 3VYRB 1KSJA 2P2NA 5KWIA 3R3HA 5KNLA 4CCYA 3I6MA 5L3RA 3HB1A 2A0KA 2XXAB 4MW6A 5A71A 3TQTA 1RBYA 4DDHA 3R09A 1P2VA 2VDVE 3EVCA 3GGJA 3KOYA 3NAGA 1UJNA 3C7CB 3L0OA 3WBBA 2N1BA 5FOXA 4EHFA 4F4FA 3JD4A 3UO8B 4EPYA 1DC5A 1ZK1A 4BZPA 3SE7A 1XCJA 4I9GA 4J7UA 3HU3A 3NWJA 3L6UA 4JDPA 5CNJA 3GZJA 3MIZA 5C7OO 2JJ8A 2CHGA 2RGCA 2V5AA 3EZ9A 3PFCA 5CAEB 1Q21A 2A33A 2NVOA 2QR5A 3CLKA 2J07A 4ZO8A 2ZRMA 3UAWA 1HQCA 3USES 1WVIA 1NI4A 2POQX 3HDVA 2YY7A 3H3JA 3B2NA 3MM4A 3L8FA 4H7DA 4RD3A 1DEHA 4L8LA 2VHTA 4K9SA 1T2NA 4NZOA 2P9FA 3BHMA 3N2IA 5KJEA 1JU9A 1D6NA 3HHEA 2O8VA 3R7DA 3WSWA 3P5BA 4OQDA 1PT8A 4KOEC 4M76B 1BHSA 2YYAA 4DOMA 3WMXA 3ZWQA 2VF4X 1HRDA 1OIVA 3O90A 2X7HA 4ME6A 3T3EA 1W0KD 2XJ9A 4RJKA 1SXPA 1AXEA 3HK2A 1BFKA 3FZNA 3M4XA 1UKZA 5EMMA 2D5CA 4R84A 3MRXA 1IOVA 1ADBA 3BFPA 1NQOA 1DV2A 4U39A 1RXYA 2QD3A 4B7XA 2O2SA 4I1UA 4MP3A 2WR8A 1ISPA 1DIAA 2G83A 2GA8A 1PZEA 3N39C 4O1HA 3JQ8B 2B4KA 2ZUTA 1DT3A 4RPLA 3GRAA 3JAKA 2VYNA 3LUJA 2IUUA 1N0UA 5JNSA 2GCIA 5AW7A 4JYPA 4D9IA 3C1UA 3OOHA 4B44A 2I6UA 2J31A 1CUWA 3N0RA 1VCIA 3TZBA 5BWBA 1MV5A 1HX7A 2BDTA 1PG0A 4JLNA 1DVRA 1REQB 2FFBA 1YU6A 2H06A 2H5IA 4WK2B 3SKXA 4AJ9A 1NBME 3A4YA 1GGMA 1MJGM 1QDLB 1SPXA 1V7CA 2HA0A 3AEZA 1FYVA 3C5WP 3EYAA 4L73A 3PXGA 3ZWDA 4DVJA 4DKJA 1P3DA 1Q1EA 3PU6A 1L7XA 4GOJA 5ALGA 4HSGA 3TZCA 2O05A 3PP8A 1A8IA 3QBVA 4I4NA 3IP1A 3L8DA 4JGBA 2IHKA 1FXSA 1SXGA 1CHDA 4F6RA 4D4JA 3L4EA 2IDMA 3PC4A 2GS9A 1QS0B 3NTOA 3S0JA 5BUZA 1NXQA 5IHXA 2WSSA 5IUNC 3CONA 3H42B 2IIBA 5EMLA 3AY6A 4FFWA 3WYNA 3W2EA 1QFJA 5BW6B 4CXMA 3I23A 4PC7A 2HYIC 1JMKC 3DTVB 5CDFA 2G08A 2QTBA 4AUEA 2R6DA 1JKFA 2I4RA 5KJCA 1B2LA 1O6CA 3QBTA 5I5EA 2R5FA 1GZVA 1M83A 3G9XA 4QOJA 1YK0A 2PUTA 3ZWKA 2QG4A 4OXXA 3E8SA 4FSDA 5MGNA 5LKRA 4MKHA 1OVGA 4PLZA 3R2JA 3IHLA 2QNBA 3V8MA 1U8XX 3K2IA 3WTBA 2I91A 1XK6A 4DRYA 3VDMA 3T95A 4I9FA 2VNAA 2PVCA 4II2A 4CNQA 1YFJA 1AQLA 5K0BA 2PXCA 3ZBTA 3E7WA 2RG1A 1ZDMA 4ZCMA 3CGGA 5CT9A 5ALHA 3OBBA 4IM7A 3D64A 1N2HA 4KFTA 1QQ5A 3REFA 2W2LD 5MN4A 3CGWA 1SA0A 2RK6A 2GEDA 4K9KA 1SMKA 1GNSA 1KAQA 2VBFA 4Z5XA 2CLCX 3AJ8A 5HTOA 3D4IA 3P9YA 2R7AA 3M6LA 3V97A 1J97A 3HU2A 4L9WA 3V8RA 1R0LA 1XD2A 2G4LA 1DDOA 3FUXA 4F3TA 2BE7A 3AUAA 2J4DA 1MG5A 4BE7B 1VL2A 1LJ8A 2HPZA 2MR5A 2FW8A 1OBCA 2FMUA 1SRQA 3GLVA 1XNGA 4R1QA 2FN3A 2ODTX 1UDBA 2NZXA 2P9YA 1FS4A 2BFOA 2VDUE 1O8CA 5F35A 2P9HA 4HXEB 1VBFA 4LV5B 4J91A 5HBGA 4LBYA 2P9QA 2HT1A 4DCPA 2HIAA 3R6DA 1NOKA 1CUVA 1G17A 5HZGA 5EJ5A 2FZKA 1JEEA 2P78A 2Q6OA 5AK5A 2H9AA 2OC4A 3ZKAA 1K7CA 1KC1A 1GTL1 1FDVA 1HEUA 5CH3A 3QY9A 3PUVA 4Y8VA 4F2DA 3EWSA 5KNCA 2XE7A 4F5ZA 3ZCQA 3UKDA 3BSYA 3QLUA 4GQAA 3R7SA 3EXHC 2Z1NA 3DV2A 4Z0HO 2UVPA 3G1UA 3GLQA 4RZUA 4Q00A 4GLFA 4RIGA 1Q0LA 3PRJA 1P9NA 3I04M 3HEMA 3D8RA 4MUXA 3N8GA 4R9NA 1KPIA 1Z2DA 3A9CA 4FOOA 1U2DA 1CQJB 2JKYA 3LL7A 4IXMA 4YPOA 4Z3KA 2Q8NA 3NEJA 1BG6A 2FSSA 2FMIA 3ON5A 2IHYA 4CKWB 3DXFA 2CLHB 2OHJA 4J1TC 1V1MB 2Q6VA 2QT0A 1DEAA 4OIFA 2YV4A 3WYAA 3HLKA 4LQDA 2DE0X 3NIWA 1NUHA 4CQMA 4HAYA 4N3BA 2BELA 3EQ8A 3BRCA 1GVHA 3P26A 4WUVA 4F3NA 3TMAA 3GFSA 4P3XA 4CMIB 5AKYA 2WQ7A 5LP6F 4QLAA 5B1SA 4BWYA 2XDAA 2XGSA 3L7YA 4K8OA 4AIRA 2NSYA 1PJRA 3IBSA 3ET4A 3R6GA 4PWYA 5F1OA 1X8XA 3I3SR 4N3GA 2YV2A 2QLBA 3UJBA 4IMRA 1QIKA 4OM8A 2J3LA 3A31A 2JIZD 3R5FA 3GJQA 2V4UA 1IM5A 4OK6A 2D74A 3SDSA 2EC5A 2XPCA 5GJVC 3DMTC 3V4LA 4I36A 4ZVMA 1WZ2A 3BCHA 5IC4A 1JPUA 1I7PA 2VDWB 3L7IA 2A35A 4Z4EA 2ZRQA 1GGHA 1Z6ZA 4G97A 2B0JA 5C1BA 3L79A 3E1SA 3IA7A 3TM5A 4JZYA 1CNEA 1LBTA 3MD9A 4QJIA 1BW9B 2ZI9A 1G66A 1N3BA 4PG5A 4AJKA 3OCYA 3OOWA 1DBIA 3CZPA 1CWUA 1US8A 3LHKA 1BS1A 4F71A 1KVTA 3F97A 1G0NA 3H6GA 5DW0A 1YGYA 1DLJA 1RW4A 2D8AA 1DAOA 2UUCB 3L1UA 3HXLA 3QKUA 1J0AA 3FWPA 2BTEA 1BD4A 2LKDA 1B8PA 1SBYA 4B6OA 3RYCA 3GJSA 3NLLA 1RRVA 1G7SA 1XLTC 2FPGA 4HBZA 4JLDA 3KT8A 3TPCA 3I72A 6ADHA 5ENZA 3EXG1 1F2TA 3A6EA 3O1IC 1GDHA 1SG9A 4MUNA 4CV1A 1ULBA 4GOLD 2Q8QA 2O3QA 3INYA 4KWIA 1W5AA 4L8YA 4YXFA 4DR1B 4S24A 4WLEA 2QPLA 4AY6A 1C9EA 2EFGA 2OHOA 3A9UA 5HQJA 2B78A 3RYTC 3IUQA 4H6PA 4HGRA 1OB5A 3BUSA 2DKNA 2WHYA 3ANNA 3IQHX 2X3YA 4AMBA 1JDUA 3H8VA 3IQXA 3E27A 4XDZA 3RCBA 3X43A 3Q8KA 1BHQ1 2WJPA 1M2OA 1LBEA 5DX0A 2WZBA 1NZFA 2JLUA 3BJMA 1YCHA 2WT9A 3ZCVA 2CE7A 4TQUS 2X8JA 2WIFA 2WT8A 4RS3A 3OAAD 3GEHA 5K0SA 4PGMA 4QXMA 3I6IA 4CT5A 1YFLA 4FMPA 1LPBB 5JQGB 2PU5A 4YALA 2DFDA 2RHBA 3H1PA 1Y8ZA 3NTVA 2EZ8A 1MO2A 5JCOA 1FNMA 5JROA 2PBZA 4HNUA 1G0OA 2FZVA 2P4HX 2VRWA 1OBFO 4D98A 1IUOA 5BSFA 3HH8A 4QG7A 4MUJA 4QTZA 4AJ1A 4DB2A 2IEGA 4YVFA 1EEHA 1ZNWA 5DYNA 1VXOA 3G9TA 2XMRA 2QN8A 4LYAA 1N7JA 1LFDB 4AJPA 1CJSA 4K6OA 3W1WA 4MLDA 3E48A 1Z6TA 3HEAA 2Q2NA 1Z18A 4PHGA 1CSEE 1T4DA 4EARA 1VKZA 3SFZA 3L84A 4CLRA 1E3DA 3BQMB 1UDXA 1XUOA 1ORWA 4HAXA 1A9TA 1KEWA 3JALA 5LOVF 5KS2A 2VHJA 4KQJA 5A7HA 4EJSB 1MJGA 3TSYA 4OI0A 1VL5A 3HNRA 3LFHA 4PW0A 3IDQA 3VTKA 2G6BA 5K1ZA 1XXHE 3IJRA 1BXGA 1RRKA 5AVWA 4J8PA 5DI3B 5LDDC 3ZXUB 2AI3A 2LRHA 4PLTA 2CVFA 2WUVA 4FB5A 1YS6A 2H63A 3QRWA 4ID3A 2O7SA 1FX0B 5I7FA 3PDIB 2QLLA 1X8KA 5JFTA 1ORHA 2E21A 5CDUA 4PBSA 5IHPA 4YLYA 2OBMA 2H29A 3E0QA 3V55A 4WY2A 3AZQA 1RXWA 3PDUA 3EGVA 1QZ3A 2B1IA 3VUEA 5L4NA 4YV0A 3G68A 1WWKA 3QVUA 1GKLA 2D06A 5FO0A 4R2HA 3W6NA 2VSYA 3O38A 1HLDA 1V6AA 2P62A 1QH1A 1AS2A 2V3VA 1MDFA 2Y2VA 2J67A 2AUTA 3PQ5A 4NOMA 3EMKA 5DLYA 3UN1A 1E3JA 1IOLA 3O2NA 4NU5A 4QVGA 1IN6A 3D7KA 1LSUA 5GJCA 1IBLB 2RBGA 1FQWA 3AVQA 3NHZA 4XIYA 3Q8LA 1EWQA 3ENKA 4C1NA 1IHYA 1MH1A 1T4CB 3BHIA 3HR7A 3KLPX 3LJKA 1Z3IX 3HU5A 4PLYA 1E20A 3STYA 2NTVA 4J49A 3IX7A 1D5WA 1YUBA 1EJ2A 2V9ZA 5ISMA 3GVCA 4FYVA 4YRJA 4BKQA 3SF0A 4UVHA 1K63A 1BCRB 3UXMA 1VJTA 1ZU4A 2HPVA 4DA8A 2NZJA 2F8TA 1A27A 5UKDA 1SA0B 2NXNA 4G3XA 2NUAA 2W8BA 1E61A 2WNSA 3CSDA 1WKBA 3N2GB 1IMJA 5EMKA 1O89A 2EFCB 5AXAA 5FWYB 4D79A 3NEYA 3CEMA 5HFJA 3V4PB 3YASA 3HTXA 4JQZA 3M49A 1NSYA 3I5UA 4XCQA 4MB2A 2X0JA 4PX9A 4UAVA 3VPDA 1AKVA 2YHIA 1JSRA 2YMLA 2B35A 3CUEF 4IIDA 5JZBA 1SBTA 3H5AA 3V1YA 3WG9A 3K0HA 2A4KA 3KYDA 4YAGA 3H2IA 3IUBA 4DMFA 3DZJA 1IY9A 3GIDA 2B99A 2H1FA 4JFRA 3CH5A 4W5RA 4AY5A 3QEMB 4ZALA 4DADA 2XNDD 1WQ3A 4DF3A 4FPXA 1KXJA 4IJWA 3BMCB 3A04A 3E2PA 1JFFB 1YB1A 4OHPA 3HZRA 3WLPA 3DMFA 1WHSA 1NWCA 1T5OA 4HVCA 4C7OB 4CG0A 3HSKA 3GMSA 5EWMA 1WXGA 1XN1A 2ZR0A 3H2YA 2QRHA 3VZQA 3ZWVA 4EHAA 5BR4A 3DXYA 5DXAA 3NCTA 4WWHA 5CHEA 4D9GA 3MMPA 4PPQA 4DTIA 5CU7A 1EFLA 3H8JA 3VOTA 2XGOA 2OZLA 3N8IA 5T6MA 2WJVA 1HEIA 1Y3HA 2OXTA 4BQEA 3ADBA 1X1BA 3V3TA 1MJHA 2ZSEA 4I1SA 3HY4A 2IPNA 5JVDB 3LHSA 1EE1A 2X5NA 1TVCA 5AVSA 4FFRA 1W87A 2ZJFA 5EERA 2DQZA 2AB0A 2JJ2A 3RABA 1RBQA 4D0RA 3U60B 1Z6XA 4X84A 2C58A 3U4HA 4NYMQ 421PA 1ZJJA 3VR2D 1H8HD 4IWXA 1FP2A 2W2VA 4LJ4A 3GYGA 5T41A 4R3UC 3TPZA 3K4PA 3T61A 2FCAA 4D0LB 4EY5A 5GWXA 3EGWA 4AU1A 1I36A 5F3DA 1AIPA 3CCFA 4FUTA 3KALA 1N1MA 3S8MA 4C0WA 5JARA 3Q8MA 3AVYA 4KDEA 4FMCB 3I32A 2GBFA 1JKMA 1XZMA 1P39A 2JA2A 2CJYA 2O0KA 2PYZA 4URVR 1U9ZA 1TU4A 2XUQA 3UQYS 4BO8A 2ZB4A 3QU7A 3F5QA 4MR7A 2I71A 1SUFA 3HS3A 2FQ1A 1UJCA 5EMJA 4RTSA 4JXZA 1CE8B 5FUBA 3OTHA 3L8CA 3OEHD 4AWAA 2W0SA 1ULHA 3LT4A 2XI4A 2VK8A 2QSYA 2QMHA 2VYFA 2ZJ4A 4Y1RA 2BR4A 2E6KA 3UFXB 1EAYA 2I7VA 3VJLA 5F7JA 1T6ZA 4XIGS 4MYUA 5HR5A 3VNQA 5SYAA 2YJNA 4PSAA 4Z9XA 1QX3A 4A8JB 1A5SB 4EELA 2TMYA 5JZVA 1CZOA 1F06A 1HYBA 1SCAA 2UZAA 3O8NA 3KZOA 2IYYA 5LJLA 1D03A 3IKJA 1R4NB 3JZIA 1TYCA 4RMGA 5FI5A 4LRSB 2VT6A 1ACMA 2WWGA 3IXQA 5BO5A 4BO5A 1HFEL 1ULSA 2J4CA 2PWPA 1U2TA 1V35A 3EY4A 2CF6A 2PTHA 1R00A 2G0AA 1IN8A 3U17A 1NQWA 3KTFA 1NF2A 4B3FX 2I8CA 1GCUA 4L08A 4DY4A 4TUYA 3GLHB 3GG2A 5C4IA 4EGQA 3EK2A 4X6UA 1O7JA 1CIVA 5CT6A 3SLRA 4IG9A 1L8XA 1V45E 1OX6A 2J3KA 4Q3AA 1SKMA 1RYMA 3WADA 3SWWA 1U3CA 1ZZGA 2V6JA 2ZYIA 3ASVA 4UOZA 4XJVA 3EF3A 1RM4A 1MTOA 1KMNA 4FMCF 1U99A 1YFZA 3D43A 5CMLA 5KYXB 1N5KA 1CUCA 5C80A 1LJUA 1U2SA 1XVAA 1PZXA 1NVVR 2AYYA 2OC9A 2Y67A 3ES9A 3LWDA 3MMZA 3OHPA 3UK2A 2A86A 1XHLA 5L7TA 2Y99A 3FOAA 4MVJF 4WLUA 1E2LA 1Z4LA 2XRYA 3C87A 3EEBA 3STTA 4K28A 1N8NA 4P3YA 1PS0A 1RQLA 1I5RA 4I3HA 3TZEA 3UAYA 4Q6WA 1ZOIA 3G2JA 2QM3A 2I3ZA 3GUCA 1M1NB 2R9VA 3DMHA 3GHHA 3L0ZA 5FOTA 2P69A 3N6XA 3T0GA 1SZJG 1YDGA 4Y9RA 1DG1G 1NASA 1QIHA 3TAXA 3ZIAD 3H3FA 4KXYA 4KFRA 4JS0A 4BWGA 4XJXA 1CUYA 3W8DA 2XCQA 3EG9A 4NMMA 4QZVA 2BBSA 2PYIA 4N48A 5ARCA 3FPGA 3L6CA 1NRWA 3DDNA 2OD2A 5JSYA 1L4EA 4QU8A 3GJ3A 1XTIA 4N54A 3WICA 5DM60 4UNNA 5I3ZA 3QX9A 1N2EA 2I4LA 4K9QA 4ZCLA 8OHMA 1QH8B 4TL7A 3VOBA 2C92A 2H17A 3GH3A 3SC3A 3WY9A 5JADA 1I4DD 1DAGA 4DBZA 1ZK4A 2CHEA 3D6HA 5AIAA 4C78A 2WM9B 4HNVA 4C4SA 3TR5A 1M5UA 3UHAA 2ZAGA 4Q1VA 3PIDA 3AUYA 2IDZA 4RQTA 7YASA 1Y5IA 4ZMBA 1DV1A 3WLRA 1X7YA 3MJVA 1KI2A 1YBVA 5GQSA 3IKLA 1V5IA 2ZWIA 4G0QA 5DPMA 4TZ6A 1UOOA 2VZLA 4QTYA 4L4ZA 4EG4A 5JNUA 3BE6A 3NC4A 4XWKA 1VE1A 3IDZA 5CFMA 4HZGA 1QU2A 2F3PA 1T5HX 3GRKA 4OUDB 3A9RA 4BC1A 4BKOA 3ZDEA 1JG2A 2HFJA 2PS1A 4WVLA 3WGYA 4GDMA 3FNQA 1LGYA 3PQFA 5KTOA 3FHCB 3KLNA 4EHJA 4BFZA 4H2DA 4JB3A 3AEQA 5LCXA 3TI9A 1Z4OA 3KVNA 4GOOD 1JLRA 1I1HA 1QK5A 3ET5A 3G7UA 2MTBA 3OG9A 4DQVA 1Z8DA 2YWCA 3A4NA 3ZU5A 4CE6A 2W4MA 3M1LA 1SU8A 2QHXA 3FHLA 4UEOA 2FEKA 5TGTA 1W4RA 3K73O 4INAA 3WMRA 4BMXA 2X5XA 5REQB 4OHXA 1GKIA 2PUAA 1G291 2DHDA 1BC5A 2J9FA 4G67A 4OU4A 3C3KA 1GZUA 2IEBA 4MQ5A 5TGDA 3V7NA 1NQTA 1GEEA 1TTPB 3OQIB 2VATA 4V39A 3C97A 3GGPA 3SG0A 3FUVA 3A28A 2EWWA 4N9WA 1R50A 1OZHA 2DLDA 2ISSD 4UM9D 4V3BA 3G9QA 3N28A 4U2CA 3ZQJA 1OHHD 4JC8A 4HFJA 1DAEA 2QZSA 1T29A 2Q3JA 3L04A 3CF6R 3BF8A 4UXIA 5AJWA 5HIJA 1QGAA 3FMOB 3EE6A 2HK6A 1L5RA 2RCYA 3OX2A 5DNCA 2JEYA 1JDBB 1TJ3A 2DLCX 1KMHB 3R44A 2ZJ5A 1C8LA 1TM7E 3BK7A 1PLJA 2JJ1A 2Q49A 3ETLA 2XBLA 4FDUA 4IIUA 1VMAA 4ZC8A 5TNXA 2VHCA 4D9NA 3AFMA 4C6RA 5J4LA 1UBSB 1GCGA 4D80A 2PS3A 3QOFA 2J4FA 4TWJA 5ALNA 4L4SA 1CY0A 4PFQA 4M7OA 4R51A 3ILXA 2IELA 1FMFA 4IR7A 1Y9AA 2I4NA 1VIAA 2Z3ZA 4FCCA 4X20B 3NBQA 2HUPA 4KC0A 1DEKA 3VC7A 5CAEA 3CISA 2VDMB 4ENTA 1W0KA 2CFTA 1KEUA 2HWYA 2A0XA 3GLHE 5DGDA 1NSFA 2GRAA 3I1FA 1EFAA 1HETA 1Y7TA 4TMWA 5CUQA 4Z4QA 3NAMA 3P0EA 4PHCA 3LC7O 2B2XA 2F3UA 2V97A 4YNBA 1GTJ1 2GFQA 5B30A 1E6MA 3ZHBA 3PYXA 4OAPA 4U2GA 4PO8A 3OBIA 4PYMA 5KSZA 3HVKA 1OWLA 4L51A 1RZ3A 5GONA 3N7UA 1U0EA 2XB9A 5JAZA 3OKPA 3FKQA 2CXQA 3OCXA 3O4JA 4YP5A 1NR5A 4RDIA 5DTMA 3QVJA 3S2IA 1EGMB 5SY9A 4ILKA 3LECA 3KR2A 3QIAA 4UDOA 4OHWA 3HRIA 3OF3A 1NOIA 1TM1E 4JJEA 1FUEA 3EQ7A 4E33A 2MYNA 5CLJA 1QRRA 2OVBA 1U7UA 3A10A 4DIBA 3FZEA 4ZA2A 3QLUC 2WV9A 1MX3A 2FUG6 3ITEA 5GINE 1U7HA 1P4RA 3EC2A 2XTNA 3DFFA 4G8JA 4A2CA 1HTBA 3IUPA 3ABZA 1VBNA 3EZ7A 1MP0A 4J3NA 3AKCA 1R16A 5I5GA 4OMCA 4DPLA 4C22A 2RI0A 5HGXA 1C1XA 4JYAB 3HZZA 1NXXA 1QB7A 3U3XA 5EE3A 4NXNB 4FIDA 5LQDA 1XGKA 1Z39A 3OWHA 3F4BA 4IIFA 4YXWA 4MUHA 2ZVPX 5JQGA 3RFXA 5KCMA 5HIIA 1VHJA 1ADJA 2IYQA 1MAHA 2BF7A 3VC3A 2PGOA 1LBHA 3VU9A 3ZCTA 1E9SA 1CNMA 1SBIA 1YDHA 1Y9EA 1LFAA 5DJ5A 2QI9F 1ZH6A 1ST2A 3OSZA 4HCJA 1FYXA 5DHTA 3FTEA 1K3TA 4LVCA 4QWWA 2QQGA 1FNCA 4NH0A 1Q7CA 2QNRA 4I8IA 5I9NA 4R1MA 3C8MA 2FOIA 3BILA 4B5KA 3ILYA 4LW8A 4BKUA 1MC1A 1JG3A 3H04A 1BEEA 2OR3A 5F77A 3TGLA 1AZLA 4JYMA 2IVFA 5EQJB 1KDVA 1G4AE 1YR1A 4RLQA 1O87A 4ZT3A 1P0CA 3TJRA 4C6TB 5C8DA 4NK4A 2B4AA 1N75A 3V1TC 1VYUA 2H4WA 3E3OA 5BQXA 5LQRA 3UWDA 2O2IA 3AX6A 3IO3A 1R66A 1C3LA 1E1DA 2HEGA 2Q9UA 3GDWA 2QX7A 2IYVA 1DADA 3PQEA 1ISMA 5JDCC 1JLMA 9ATCA 3SE0A 2J3QA 3O3OB 4BIMA 4B3MB 1P91A 4CR7A 3CEPB 1BYIA 2QV0A 2EHJA 4PE5B 1WHSB 4B7UA 5IUJC 5LP6A 1OASA 1T9HA 3HDHA 2QTRA 2DH5A 5FPTA 3O8LA 1IY1A 1KF0A 2ZPUA 4G8DA 1NU6A 3RDPA 4P7BA 4B4OA 3T3NA 4HPJB 3ZWCA 3UC9A 3QKRB 2ZQYA 1S1MA 1DS6A 4CMEA 3S1AA 5L40A 3WQSB 2PX5A 1GM5A 5CLGA 2HT6A 4ZVUA 4L5YA 16PKA 1UT6A 4JAVC 1MIOB 4PIVA 2JS7A 3CY6A 4C2TA 2ZSAA 3T1NA 3EXEB 2ZJ7A 3KB2A 1VCHA 3NVDA 3SSNA 3EVNA 5EZQA 4C5CA 3IUMA 2XTJA 2QJTA 4F9GA 2NXJA 4KAXA 1M6HA 3G59A 2AFIB 3I42A 3BAFA 3K92A 2RHLA 4UREA 4HLDA 3N7TA 4X93A 2JNWA 2H2FA 3HPQA 3E1KA 4B48A 2ZIFA 3CR8A 4LJ5A 1N5LA 2O20A 4LDPA 4BB5A 2OE2A 1O2DA 1PT9A 2O0MA 3K5PA 4PCUA 2C5LA 2EARA 4FONA 1R4AA 2NM0A 4P5PA 3ENQA 5BYKA 3FVTA 1VI5A 4HRAA 1MAAA 1QS0A 2P0EA 2VAWA 5CA1A 1C41A 4ZKDA 2B4QA 4NNOA 1WBJB 2LVBA 4PZCA 2Z6AA 1KIMA 1FYWA 4NESA 4WCVA 5H4HA 3ME5A 1PQUA 2Z4RA 4ZQFA 4ZK2A 4PO3X 1ZK3A 4HH1A 1DAHA 1RYBA 5DK4A 4KUHA 3D3JA 1ZMXA 1MKYA 3OD1A 2QV7A 1NJ6A 4IUBS 1PKEA 3TDMA 1FDIA 1T25A 4Y0AA 3C8UA 4MQBA 1OWMA 1JR6A 3I2IA 1RAEA 2GSWA 2QRVA 3EVAA 3NNDA 3VMFA 4B76A 3F46A 3AXTA 3OIWA 5H0IA 4LMBA 4RKFA 3GJYA 4EL5A 2I7XA 1DAMA 4J1TA 2X2FA 3NKFA 4QXQA 2ETVA 2JJYA 3VKFA 5KYTA 1A98A 1EEXB 2H31A 4LZZA 4J0KA 4CQLB 5ITVA 2P9CA 1Q7GA 4R7ZA 1F8UA 2J7KA 1Y3FE 2QJWA 2ZJBA 4HATA 3I01M 4KQXA 2BJHA 4FHZA 1IULA 3GFTA 2Q99A 3N75A 5HJ5A 4JROA 3KZXA 2R8OA 2WF9A 1Q0HA 5AI8A 3VI3B 4KQHA 2YS6A 4CVNA 1XDUA 3O1HB 1QGOA 3LZ6A 5EIFA 2YL2A 2GR9A 2P27A 3QY0A 5DHRA 4HQOA 2L82A 2XVYA 4MW7A 4E0BA 4AO7A 4QM7A 3WTCA 1C81A 1YZKA 2E87A 3ISTA 1J7KA 5LYJA 4A82A 1RXVA 1F20A 3FUTA 2EFHB 4PXAA 4F7WA 1BCSA 1CJUC 1X1CA 3H7AA 4BLUA 1O5TA 1ZEMA 4RFLA 5JNVA 3COVA 4FFSA 1ZBDA 2J3DA 1LNQA 1YNSA 2GPTA 1XLWA 2JKZA 3P4UA 4YV1A 2FK7A 3O0DA 2AN5A 3E8MA 1FFAA 1E9RA 1N7IA 4BN5A 5CM9C 1G8MA 1EK6A 1QAMA 2Q3FA 1B23P 1D6JA 1BDBA 1A9YA 1DXOA 1UK9A 2CDCA 2OWDA 3EGDB 1LH0A 2Q4EA 3G9UA 1WTCA 2CNNA 3GDHA 3TW8B 3QENA 4CLRB 5I9LA 1LX7A 2YZ7A 2NYUA 2PJUA 4D9FA 2VDPB 4CF7A 3O94A 3Q2KA 2OBXA 3SHWA 1GA6A 3OHMA 5HPYB 1KTIA 1Y4DE 3NIFB 2FEPA 1XMXA 1WVGA 2IK8A 4OB6A 4PLVA 3T3DA 3ZEAA 3L93A 5IC6A 2AF3C 2UV8A 3OUUA 3ZZMA 4MV8A 2N3ZA 3VVBA 2Z8YM 4MMXB 3ROEA 3SHQA 4ZQBA 5IJXA 4C07A 3NWEA 5LZ9A 1KP2A 5TT0A 4DZRA 2Z5VA 1KTVA 3RVQA 1AV6A 1L7PA 2QGNA 3A3KA 4L9SA 2BPOA 3K0EA 4O2BF 4PSKA 4K9PA 5FUQA 2X8BA 3WGIA 2W2XA 3CG4A 3VHLB 1KJNA 221PA 2YNMC 5EJ4A 1TCUA 2YV5A 4EEKA 2P6OA 1SURA 2NZVG 4P22A 1OX4A 1QP8A 3GLFA 2J0EA 2ZZNA 4ZVVA 1USUA 2Z8XA 3DR3A 3F6BX 4PSCA 5I9BA 3WK8A 5KCZA 3HXTA 3I9JA 2CHUA