1E2GA

Human thymidylate kinase complexed with adp, tdp and a magnesium-ion
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
209
structure length
205
Chain Sequence
RRGALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTEIGKLLSSYLQKKSDVEDHSVHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAKRGERYENGAFQERALRCFHQLMKDTTLNWKMVDASKSIEAVHEDIRVLSEDAIATATEKPLGELWK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords THYMIDYLATE KINASE
publication title Insights Into the Phosphoryltransfer Mechanism of Human Thymidylate Kinase Gained from Crystal Structures of Enzyme Complexes Along the Reaction Coordinate
pubmed doi rcsb
source organism Homo sapiens
total genus 89
structure length 205
sequence length 209
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2000-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1e2gA00
3ZD7A 2ORIA 3LQQA 2ZUDA 1W4BA 2DFKB 4Q19A 1QHHA 4BEBA 2EFEB 2Z43A 1M34E 2ZRCA 5IHPA 3PEYA 5FL7A 3EAQA 2DWOA 4NCIA 2H18A 5EXPA 1COWD 3WY9A 1XF9A 3QXHA 2NZ8A 1GUAA 3X2SA 4YMWA 2GK6A 2Q3MA 3TNFA 4L9SA 2YV5A 3BB1A 2F55A 4CGZA 1G4AE 3CNNA 5JS8A 4LJAA 3ZIAA 2YNMA 3ADBA 4LRWA 4BLRA 3SBDA 4U5XA 3QY0A 1LB1B 1ZUNB 2PMKA 1KMHA 3QBTA 2QUZA 1NVVQ 4Q7KA 2ZJYA 1ZNWA 2H92A 5GJVC 3BJIC 3X1DA 2KI5A 4UNSA 5EZ6B 1M7HA 1N2CE 4MQBA 3QKSA 2GJSA 1US8A 2VH5R 1ESMA 2X8AA 4K46A 4LJ8A 3GLGE 1TF5A 1V43A 3LA6A 3JVVA 1LS1A 1W2HA 5FBVB 2ZYUX 1YZTA 3THWA 1Z5ZA 4LDJA 3L8ZA 3ZJYA 4EKDA 1XFAA 4HEJA 5AUOB 4HLUA 1L4YA 3EZ6A 4G5SA 5E7MA 2O8BA 1T8TA 3A36A 4IXMA 5H70A 1H65A 4KAXA 4ASUD 5JRJA 1VIAA 3LD9A 4LV8B 4KLZA 1M6NA 3LQRA 1P6XA 3LAWA 4JT2A 2CHQA 3OIUA 4AKIA 2J7PA 2JLXA 2AD1A 2VP2A 3RYTC 1OF1A 4PZLA 5DI3A 1OB2A 3I1FA 1SGWA 4IEEA 2YOGA 2R6FA 3GQBA 4BLQA 3H1TA 3BB4A 5FTNA 4YMVA 2FWRA 5JS7A 1UF9A 5CLQA 1IXSB 2ZI6A 4G5QA 5FUYA 1KJWA 5EZ5A 1II0A 1AQYA 1BO6A 5FOTA 2BEJA 3ZZ0A 4LJ6A 4AIIA 1U90A 2VHQA 3EX7C 4P0TA 4EJSB 5DN6D 1E0KA 2BDTA 2WJHA 5KNBA 2BEKA 2O8DA 2IS6A 2AL7A 1OXSC 3TE6A 4F38A 1IOZA 1WRBA 1OFUX 3PFIA 4DHEA 2N42A 1X6VA 2LKCA 4MUBA 1Q1BA 4GP6A 1N6NA 3DOFA 4EPVA 4HB2A 3Q5DA 1HTWA 2NIPA 1I4TD 1AM4D 4DXAA 1OYYA 3I72A 4AC9A 2D06A 4CW7A 1H8ED 5J40A 3U4QB 3T12A 4Q01A 5BXQC 1J90A 3I32A 4QFMA 1KSFX 4HZUA 2O0KA 4UJ3A 1XMIA 2HLDD 2QMHA 2ZS7A 1L7VC 4KFTA 4BZQA 3CR7A 3CF6R 3BFKA 1WP9A 1FX0A 3W9YA 2EVWX 1Z2AA 4XVQA 1G8YA 2ZXUA 1ZU4A 4NYMR 4XWOA 2V3CC 1OKKD 2FG5A 4CEJA 2O8FB 2CL6X 4TMVA 3N2EA 1KK0A 1J99A 2WWFA 4L4UA 1J8YF 1AK2A 3MWJA 5KDDA 2OBMA 4HLUC 3CH4B 4X8OA 3OIVA 2J1LA 2ZJ2A 1YE8A 4POAA 2CK3A 4IDNA 3EG5A 2FZ4A 2OSBA 4PAOA 3EPKA 1OV4A 2IYUA 1KDPA 2YWEA 3B13B 3V9PA 1R6BX 3ZH9B 4D25A 4R7ZA 3A4NA 4KYUA 1P3JA 1ESNA 4TN1A 3VU9B 4LK2A 1S0UA 4PO1A 4TTPA 3PUWA 1GITA 5CYOA 1QDEA 4E5UA 5BW8A 1S4QA 4B3BA 2OE2A 1P9NA 3OE7A 1SVWA 2RGNC 3AVOA 4G0NA 4B33A 1XB2A 1DAGA 1M7BA 1DOAA 1E9DA 3MWLA 3RANA 2OG2A 4A1FA 5C2JB 5FH9A 4KBFA 4P4UA 5JRZA 3TBKA 3SYLA 1KKLA 4AKEA 3IUYA 2FSHA 1P4SA 2V55B 4ZDJA 3ZVMA 3ZD6A 2J0UB 3RRZA 1FP7A 4ITRC 3S1AA 3DKVA 1IN6A 1DE0A 2ZRPA 5FL7D 3THXA 2W00A 4OI1A 4XD7D 4R71A 3LBIA 4TWZA 2JCSA 4CRWB 4EQ6A 2J3EA 2KJQA 4D26A 1P72A 4NCKA 1DAIA 3QIAA 4C7OA 5EE5B 4LYFA 4NPHA 4TZ0A 2FPKA 3ZIAD 3MG9A 2RGBA 2FZLA 2YKGA 5B57C 2J0SA 3B1WA 1G5PA 3EZ9A 4R2IA 2ZYWX 4H1UA 3V00A 2B6HA 1N25A 3UK6A 5KPDA 5FOWA 4ZPXA 1AKYA 1JXOA 3B9PA 1E1RA 2F6RA 3K70D 2MSDB 2QTVB 4LGMA 2F9LA 5D3MA 3UMRA 4PANA 1VG1A 2VTKA 2FSFA 1E1QA 3AGQA 5CB8A 1U2RA 3J81k 3IQWA 3DMNA 1HEIA 4BPBA 1D9XA 1CR2A 2QMEA 3UG6A 2ZRGA 5E7JA 4P32A 4NYMQ 2FX3A 5C4GB 1ZM4A 1A82A 1DVRA 1N6RA 5JLJA 3AVTA 2ASEA 2EFDB 1NKTA 2WJIA 3AP2A 5AJWA 3U2QA 3NHAA 3QKTA 2F3RA 4GBMA 2QTHA 2EYQA 3M0EA 1TF7A 2R65A 4GT1A 4HLCA 4W5JA 4B34A 2O8EB 1ANKA 1CR1A 4TQAA 2HF8A 3RC3A 5AJYA 3BORA 3LX8A 2FEMA 2J7PD 3OZXA 3B9QA 2ZS9A 1W5SA 1JJ7A 3K9NA 4GOXA 2O5VA 3GLHB 1TEVA 1G8HA 1N5JA 3FKQA 4ERNA 2ZRIA 4MGYR 3AVXA 1FNNA 2VSFA 3AVUA 1G3UA 4H1VA 2VSXA 3LRPA 1KYIA 1CLUA 4RZXA 1ZW6A 5AR1A 4E22A 1DS6A 2CE7A 3I5XA 1KAGA 1GOTA 4JVMA 1KK2A 2ZJ5A 2WPDA 4A8JA 4WAUA 1Z0IA 2KE5A 3VNVA 5JJLA 1G7CA 1KMQA 2D74A 2VQSA 1RZ3A 2PEYA 3ZVLA 3L2OB 4LBYA 4GSYA 1RJ9B 2PBRA 2IHYA 1XCPA 3MGCA 4DLSA 4ZI2A 4HAVA 2VP0A 1OJLA 1EFUA 3LFUA 1UBCA 2RGXA 2Z4SA 2Y8EA 5JJIA 4B3CA 5JHGB 4EIWA 4C30A 1T6NA 5E95A 4QBHA 2E87A 3T1TA 4ZIRB 1Z22A 3R9WA 2C77A 2ZVQX 3EIHA 5EE9A 3SJCA 4TTRA 2IXEA 3TK1A 2NPFA 5EXSA 3WXMA 5FTJA 1G9XA 1E96A 3THYA 2G3YA 2D7CA 3K0AA 4LUCA 4RD4A 2BJVA 3NIBA 2AK3A 1W0JA 3Q9LA 2IUUA 2I3BA 5TDHA 3JZAA 3GJ8A 2F1JA 2DB3A 1TQ4A 2XNDA 2CL0X 1NJFA 5KO2A 1YZKA 1MRNA 4HB3A 4TSFA 3IIMA 1NY6A 1EFRA 4HUQA 4IVPA 2ZIAA 1ZNYA 1XZPA 2WIBA 2RB4A 2GJAA 2CK3D 3WRYC 3K0EA 2QRZA 3GD7A 1W0KA 4IFBA 4K8OA 1P2VA 2HJGA 4MITA 1G19A 1QHIA 2R62A 4I1VA 4JZKA 1SKQA 5TV2A 1UADA 2RAPA 2CVFA 4LHXA 1YRBA 1WCV1 5GJWC 5JZVA 4JYCA 4TL6A 5C46F 4NE2A 2YYZA 1KHTA 4RY2A 2IYYA 3K0SA 3DHWC 3FDIA 2UZIR 3NDBB 4LBWA 2PLRA 3ND8A 1RYFA 1W4CA 2PT7A 2VSOA 3DM5A 4OQMA 4MYHA 3DMDA 3ADKA 3HR7A 3DZ8A 4FCVA 2XEXA 1VDZA 5FOSA 3WYAA 4ACAA 2QAJA 3BERA 3WMFA 3U7HB 3BS4A 2ODBA 3AF4A 2QBYA 2F1HA 1LVGA 1W1WA 3LVQE 1YVDA 3OIWA 4B32A 4DSOA 1EFTA 5C1BA 1UBGA 5GJCA 2VRWA 3T06B 3JVUA 1CR4A 3RHFA 3TGPA 3D31A 2UZ3A 2KBFA 3RSLA 4WZAE 1XMJA 2JJ8A 2R6CA 3BH0A 1GWNA 1VCMA 2ATVA 2QMUA 4PX9A 3GEHA 4EPWA 3PV0A 2VP5A 5KPJA 4IKEA 1E9FA 2A5JA 2VYFA 5B2ZA 3FFAA 1NBME 1F5NA 1OIVA 3Q8XB 3ZZUA 4LCBA 1E1RD 1N6PA 4PTLA 4W7SA 4DCUA 3KFXA 4M9SA 2QN6A 2FNAA 3I8SA 2KBEA 4P4TA 3IEVA 2J87A 4P4SA 3M6AA 4EPXA 3U44A 1MOZA 1NMYA 4HDQB 4LHWA 4MGKR 1E1QD 3CPEA 4U7DA 3QSYA 1EWRA 2HYIC 4KODA 1W36D 1SVIA 4S35A 1G3IA 4BASA 1QF9A 2ORVA 2RKOA 5KYKA 2ZJAA 2XITA 4PZZA 1KAOA 2FGKA 2JJ2D 1CJKC 2QP4A 3IKJA 4KYIB 4NYJR 1E2PA 4OK6A 2QU8A 5H1YA 5EUQB 1X1SA 5FPHA 1W4RA 3TQCA 1BS1A 1GNRA 1P61B 5G3YA 3LLMA 3EWSA 4JL8A 4B6FA 4A2QA 1K8RA 2NO0A 2D2EA 4RD3A 2Z0MA 3NHBA 4NKRA 1U98A 2ZM5A 1GP2A 2EFHB 2JJ1A 3A1TA 3CZPA 5KNDA 1KZGB 5FBLB 2WSMA 3OEEA 4TT3A 3FWYA 5TB5A 4B6EA 1RFLA 2B8TA 3C41J 1MV5A 2AFHE 5JFGA 4OI2A 1N3BA 4C0LA 1VG0B 2MSCB 1Z6XA 4DKXA 4MH0R 3DO6A 4WXPA 3SDZA 3VQTA 1Z06A 1WXQA 1HE8B 1D9ZA 2J41A 1X8LA 3RS5A 2F1IA 3T1VA 2A3RA 3PQCA 1KNQA 1X8JA 2QSZA 3D7MA 1L4UA 1XCGB 4A2WA 5KHOC 2HCBA 5F9FA 2GAAA 2XOKA 2YJTD 2Z4RA 2F7SA 3NXSA 3C14C 3IGFA 1T3HA 4Q1FA 3UWKA 2GESA 4AWXA 2GXUA 1AS0A 1ZU5A 2DPXA 2X19A 3IIJA 3RC8A 4D80A 5LDDC 2CCJA 3QNUA 4OHYA 3RWMB 2ZREA 2ZR0A 5F2EA 5HTKA 1N5LA 5DISB 3ZZTA 2BKUA 4L8GA 5EE3A 3KDSE 1K5GA 4LZZA 4CEIB 3HU3A 3EIEA 1JEEA 1W0JD 3AVWA 4KBGA 3L43A 4G5OA 2DR3A 4DBLC 3GJ7A 1D5CA 5JSZB 1II8A 1ZUHA 4LYHA 1R8SA 3BAFA 1VHTA 5K8IA 2XNDD 1Z08A 4DLYA 1FMJA 1KI2A 5HCNA 2J59A 4Z51A 3EPLA 3G82C 2BCGY 4TSFD 3HPQA 2XGJA 1FOEB 1EFRD 4TTQA 1T91A 2BBTA 2ZU6A 4ZKEA 3SYNA 1R0ZA 4H9GA 4DUGA 3WP1B 4NYJQ 4R9UC 1S9HA 1W0KD 4PHFA 1W49A 5UKDA 1Q22A 1E9SA 1JBKA 1OH6A 4QJ4A 3T5GA 3VR2A 1ZBDA 1XMVA 1F48A 1KI6A 5JEDA 2XZOA 1HV8A 4OHVA 1ZJ6A 1W48A 2FFBA 5HE8A 3FMPB 4GL2A 3DZDA 3RS3A 4QC2A 2YWGA 3WMEA 5FTLA 4Q9HA 3QPWA 4YC7A 1XJQA 1GRQA 4LPSA 1T3LA 3K9HA 5KDLA 2GXAA 4D4JA 2FE4A 1KY3A 2QP3A 1PLKA 2WIAA 3CWZA 4QHTA 1GRNA 4IDPA 2QENA 2JLQA 4IFEA 4JVLA 5LD2B 2FFHA 2P67A 4IVRA 1SVSA 1G16A 1RRFA 4RJLA 2FFQA 2W2XA 3BGWA 2DFTA 2C03A 3T1OA 2WWYA 1E79A 1I2DA 4LI0A 5SZJA 3AF3A 5AUPB 5L8VA 2KB0A 3MWKA 2BBOA 1HA3A 1NG9A 4B3FX 1E2NA 4KCGA 3LXRA 2A2ZA 3NG1A 2WVJA 2XSZA 1OH8A 4LX0A 1TUEA 3C15C 2EW1A 4LJYA 3VKGA 2EWWA 1GILA 2BKEA 2JEOA 2OLKA 2QEQA 4RD6A 3DM9B 2ZANA 2CLSA 2JLWA 5FPKA 2PT5A 1Z47A 2WAXA 3OFND 2FV8A 1U9IA 5EP3A 5A0FA 4A36A 4WZBE 1GSIA 1NVVR 2FSIA 1Z0KA 4JKYA 1SXJA 1NIJA 2OILA 4DSTA 1ZD1A 3U3JA 4B2IA 1CJUC 1RRCA 1G5TA 2J7KA 4JJZA 1E2MA 2PZFA 1U8AA 4HSEA 1YZGA 3CRQA 2HDNB 1NIPA 2QAGB 3TQFA 1T3SA 4V0LA 2GEUA 3ZVRA 1EK0A 3KJGA 4URXR 1G5RA 1A2BA 1KI4A 4BGDA 2VA8A 2ZRJA 1OYWA 2AXNA 5FL3A 4PSVA 4TL9A 4ARZA 1JR3A 5DE3A 2B21A 3GP8A 1YRAA 4GRAA 2JJ1D 2XNSA 5CDFA 5AK0A 2QI9C 4OKSA 3OEED 4QL3A 3GJXC 1MABB 5CITA 1R0YA 4HI0E 2H5EA 1CJMA 2GEDA 1Q44A 3MUFA 2JLYA 1AQUA 3WBKA 4FCTA 4M9XA 5G40A 3BH6A 4O2LA 5G41A 2V54A 3NC0C 2D2FA 2WWIA 2IYSA 1Z28A 2GBLA 3SJAA 3KL4A 4D6PA 3EZ2A 1JQLB 2Q0HA 2JATA 2ZRKA 3DOEA 4M9ZA 1SZPA 1NG1A 3UPUA 2J45A 3QVUA 1XPRA 1CRQA 2XOKD 1FFHA 3QQ5A 2XZLA 2GKSA 4U00A 1E2LA 1W7AA 2OCAA 1YQTA 2GZDA 4E03A 3AB3A 3R20A 3CZQA 3PENA 1MR3F 4RFSB 1GL9B 3CONA 4BWYA 4C0SA 5BQ5A 1WB9A 3HYRA 2ZSFA 3ICQB 2DFNA 2JDIA 2BMJA 2XXAA 4TQ9A 2ZU0C 2VLIA 2QQEA 1SVKA 4DLRA 3HR8A 2EFCB 2GF9A 5JMTA 4K81B 1M74A 1U9IC 3LH5A 3LNCA 4AYXA 3PEUA 3SQXA 4PO8A 4Q7LA 1F2TA 3P1JA 4LV5B 1R10A 5L3SB 1SXJC 3N2IA 4MRPA 1PLJA 2FF7A 4ESHA 4AURA 2OBNA 1NN1A 1IN8A 4MKGA 3GLIA 1P9WA 4QBFA 1JXMA 2IUTA 2XTMA 5EXXA 3NEJA 2ZSAA 1UKZA 5F3WB 2IF0A 1UPTA 2CHGA 3PITA 1KZ7B 3X1ZA 1RPZA 3RSOA 4TYYA 1DAKA 2QSYA 2OEPA 4FIDA 4F4CA 4KU4A 4URYR 4Q4JB 2O8DB 2AN9A 4DUGD 4A9AA 2GXQA 1NSTA 4C0HA 1GTVA 2AD5A 4BE7B 2ZE7A 4KV9A 3VMFA 4N3NA 2ZYVX 1VECA 1A5TA 3CPHA 1XNJA 1DBSA 1TPZA 2ZI7A 2GCOB 5CYPA 4LYJA 3F0TA 3I92A 5SZHB 3UWOA 3OEHA 4M1WA 5BN4A 5BYJA 3X1XA 1P9RA 2CLCX 4DT1A 2ANBA 1ONBA 3X1WA 1CP2A 1Z83A 4JS0A 4B75A 1D8TA 4HATA 3VX3A 2FMXA 2GBLC 1HQYE 2VIIA 2RGNA 2BMEA 1ELOA 2WAYA 5BWMA 1X8KA 3B82A 3AF0A 1HQCA 4GOJA 4MYUA 1XD2B 4EAQA 2DCUA 4KHZA 4Q18A 4AG5A 1N5KA 1XD9A 3QF7A 5FBQB 4BQSA 5IRCD 1QHXA 3NBZC 3QPVA 2ZRDA 3QXCA 4A0HA 5DNYB 3UATA 3CO5A 3GJ0A 3L8YA 4M4SA 1EX7A 2GZAA 4XOIA 4E09A 2YZ2A 4I99A 2QORA 3RNLA 1Z07A 2WWGA 1CRPA 2OFXA 4DLTA 4F4IA 4NDZA 5FTMA 5EP2A 4LJ5A 4D81A 1IXZA 4NYIR 4DLWA 1J70A 2QAGC 4OYHA 4QJ5A 3SS8A 5B64A 4TL8A 2WWWA 4C4PA 1NY5A 4TQUS 3ND9A 1F2UA 2HF9A 1CF4A 3IDQA 3PUYA 4FMDB 2CMKA 4Z1MA 1HT1E 2HXYA 1QHNA 3B5JA 4KFUA 4KVAA 4LOAA 2G1JA 3NH6A 5EP1A 4MKIA 2A5DA 1VG9B 3K0CA 4JJKA 1KO7A 3KB1A 3PUXA 4B2PA 1JQJC 4M1OA 2WMOB 3BBPA 2OHFA 4WIAA 4DIDA 3IQXA 2GJKA 3B1XA 4Q66C 4IDOA 3IBGA 1XCMA 2NGRA 4IOJA 2YC4C 2H7VA 2A5GA 2VHCA 5DI9A 4A92A 3GJ6A 2ZRHA 1FNMA 2HUPA 5E3HA 3P20A 3NWJA 3H84A 1YZNA 1GNQA 421PA 4I81A 2O52A 3TUZC 3FTQA 4M0LA 4DZZA 1YR6A 3A1WA 4JL5A 4Q9IA 1ZVQA 4EJSA 3SE0A 3I8XA 5EQTA 5F9HA 4A6PA 2JLUA 1BMFA 4FCWA 2ERXA 4N0EA 2F1RA 4PZYA 4P3YA 3P27A 4J0QA 1X3SA 5GADl 4F91B 2YOHA 1CKEA 5FUWA 1P2SA 3W8RA 1G7TA 1W36B 5HPYB 1YU9A 4TYQA 1BYIA 3RRYA 2F3TA 2GDJA 2O8CB 4CT5A 5IT5A 1OHHA 4F93B 2QGNA 4WOPA 1X86B 5KOYA 2WOJA 2PEZA 1DPFA 2JDID 3U4QA 3C5HA 3CF0A 1T5IA 3PUZA 3CRVA 3ONWA 5HZKA 1GDDA 1Q1ZA 1XTRA 5L3VA 2EQBA 1MH1A 5FPYA 4KSBA 1NLYA 5JWOA 2BM1A 4JLBA 4NYIQ 1CJVC 1TL7C 2YHSA 3AVYA 2OBLA 5B30A 2O8FA 2ODEA 1Z29A 3SU8A 1FTSA 2PH1A 2R8RA 2IXGA 3WRXC 3T61A 3CUEF 5TXGA 3B8HA 1E9BA 1XD8A 3CLVA 2IYWA 4ZCIA 2JLVA 4IXNA 4AI6A 1OXUA 1I2MA 2IXFA 2VEDA 3B6EA 3K0CC 3VR3A 1FPMA 2R6DA 3WNBA 1EFHA 1VTKA 4OQNA 3SHFA 4A6XA 1G41A 4TLBA 1QG2A 4XH9B 2F9MA 1R2QA 221PA 3HPRA 521PA 4L15A 5HKKA 2G9NA 3AP3A 2CNWA 1RYHA 4HLQB 4B74A 1PJRA 2R6AA 1O3YA 1PUIA 2YVUA 3IPYA 3ZS9A 5HZHA 5LPNA 1GZSA 4AKHA 3KJEA 1VPLA 2XJ4A 2VPPA 3CX6A 1Q0UA 4RCZA 2V1XA 3AVVA 1LF0A 5DYGA 3CWQA 4DEXA 3EZ7A 4EJSC 5L3QB 1U0JA 1LY1A 1CS4C 2G88A 4N1AA 2ZR7A 1TQ6A 2RCNA 2HT6A 1PVOA 3P4XA 2J9RA 4NBSA 4GZMA 4D0NA 2J0UA 5C18A 1U99A 3GPLA 4TL7A 3L0SA 1XZQA 3U3OA 4UKDA 1KI3A 2ZRBA 4NCJA 4M1SA 4LPKA 4TMTA 4M1KA 1ZIPA 5EE1A 3CNOA 3SFZA 2K5UA 2WBLC 3RWOA 2CBZA 4OL0A 3QI2A 2W58A 3MAAC 3SFVA 1E3MA 2QGZA 1LF5A 3QOFA 2WSSA 5JCPA 5K8LA 1UBFA 3CRW1 4NTZA 1UBEA 4A0RA 4DWJA 2NQ2C 3T34A 4FMCB 3LO5A 4NCHA 3CNLA 4R98A 3E1SA 4KXFB 4OI0A 3IBYA 2C2HA 2QMOA 1XMSA 4TLAA 3GFTA 3ZYCA 4YMUA 5G53C 3ZGXA 3D6TB 3KUCA 3GLGB 3DL0A 3UMSA 2SHKA 4UJ5A 2ZTSA 4WZ6A 1R8QA 4QG7A 3MLEA 3GCGA 2E1RA 4OJKA 8OHMA 4Z1MD 3CH5A 3KQKA 1Z0JA 2H57A 1NVWQ 3QE0A 2PCLA 4LC0A 5CDFE 5GVRA 1E0SA 2ZJBA 1T5LA 3GLFE 4A82A 1GM5A 4I1SA 2HJVA 3W90A 4YMSA 4DLUA 2O8EA 2IBMA 3QF4B 1PLLA 2ZUBA 1EXMA 4UXJA 4A4DA 2ZAMA 1Y63A 1CBUA 2GCNA 4JLPA 2IYLD 5A4JA 3GLHA 1FTNA 2RGDA 4GI7A 3EZFA 3R7WA 5CJPA 3SR0A 1IONA 2R6GA 4URWR 2AWOA 3FMFA 4V0KA 4M53A 2CL7X 2D62A 3LBNA 1FP6A 4RVCA 2IYQA 3W34A 4XJXA 4G5RA 1HYQA 4JYBA 4YLGA 1R4AA 4JVSB 3TVTA 3K9LA 1G6OA 4GMXA 4DB2A 3OE7D 4AY2A 2ZI9A 1BMFD 5HR5A 3CR8A 1KK1A 2PJZA 1OLOA 1RJ9A 3B78A 4P4SB 2UKDA 3U6BA 1E0JA 2GXSA 3TRFA 2NMVA 4GPTA 2PJRA 2NZJA 3AH8A 4MA4A 1BKDR 2W2VA 4PSKA 3IEUA 4HAYA 1KJYA 1X1RA 3RLFA 1M8PA 2Q21A 3BRWD 4M21A 1G8FA 4DCVA 4Q4AA 2DWQA 3CW2A 1OHHD 4ZIRA 2ZI5A 1N6HA 1VG8A 4B76A 4BLOA 5KTYA 2BM0A 1QRAA 3DDCA 3QENA 3ETLA 3Q5EA 3RS7A 1WBDA 3M1IA 1UKYA 4OBEA 2ERYA 4M8NE 1G8GA 4Q48A 3P26A 1P60A 3SJZA 3B2EA 5FR1A 1NVXQ 4CEHB 1NLFA 1TU3A 2VP4A 3L82B 1E0AA 4Q47A 2LKDA 2XX3A 4DDVA 1KI1A 4DCTA 2ANCA 4ZKDA 1UKVY 4JLVA 4RKFA 1AGPA 2LWIA 1N6KA 1ZD8A 3CRMA 4QHYA 2NO6A 3KTAB 4BFTA 2VBCA 4NU0A 3AV0B 1Z63A 4LHYA 1J2JA 2Q9BA 1T9HA 1WA5A 3TAUA 3TH5A 4V0NA 3REGA 1U8YA 3BE4A 2AFIE 1XTIA 2ECKA 1E2JA 4CF7A 3C4JA 4BLPA 1KKMA 4AD8A 4DIEA 1TADA 1G7RA 3AUXA 4IOMA 3LLUA 5P21A 2IEYA 4NCNA 1UAAA 1S2MA 4UXIA 5KSPA 5HKKD 1OH5A 1R0XA 2CNWD 3EASA 4MGZR 3EARA 4DDUA 1G291 2QZ4A 4HAWA 4Q9JA 3WNCA 1GG2A 3H4MA 1KNXA 2Q3HA 1WMSA 3VHXA 2ZRAA 3I61A 1V5WA 1YHNA 1ZINA 4FWIB 1ZD9A 3A1VA 2OXCA 4OQXA 2OCBA 2DFLA 1VCOA 4M1TA 2H17A 3RS4A 1JR6A 1Q1EA 4DSUA 3EXAA 2E9SA 3OIYA 1O87A 4I4LA 4D0LB 3U61B 3U3MA 5JBQA 3NDPA 4JSYA 3E5HA 1U81A 3R8FA 4D0GA 4Q4HB 4LC1A 4RCYA 1XRJA 1L2TA 1ZNXA 2D4HA 3MRSA 4L5BA 1KOFA 3RS0A 4II7A 1T4GA 2CJWB 4NONA 2PLFA 1KDOA 2RGAA 1JI0A 1JNYA 2NTYC 2ZJ8A 2WPDD 5J4LA 4RFVA 1BYUA 2IC5A 4TMWA 4HAZA 2IYXA 5KSYA 1ZYUA 2J0VA 2ZI3A 4HAXA 1XU4A 1XEXB 2WWHA 4UNQA 3UG7A 1TF2A 4OHWA 2FEOA 2WSSD 1FQKA 4LJ7A 4BEJA 4EUNA 1ZNZA 4JBWA 1GIAA 1NNEA 2C5LA 1IY2A 2C95A 1IHUA 1U0LA 2ZQ5A 3GFPA 3LY5A 3Q7QA 5E7IA 5EP4A 4JLOA 4RZ2A 2FH5B 4DLXA 3W8NA 3DKPA 2G77B 4PAMA 1XX6A 2PX3A 1HURA 1NJGA 1E4VA 1T0HB 2ZROA 3UMFA 4M22A 3AP1A 3TSZA 3UXMA 4B43A 2NG1A 5FOXA 5SZIA 1MO5A 4BFXA 4QJ3A 4BZPA 2P2LA 4Q4LA 4WA7A 2B92A 4FWTA 621PA 2REBA 4B71A 4DEYA 1MO4A 1Z3IX 1YR9A 3K0FA 4FMBB 2Q3FA 5B58C 4TLDA 3ASYA 4LHVA 2JASA 5AJVB 5TVKA 4MKHA 1UEIA 1QZXA 5JJKA 1SVMA 1ZP6A 1COWA 2C8VA 2VF8A 3QEJA 2V1UA 3IO5A 4A0GA 4HUTA 3VHLB 2YINC 4PC3A 3L0OA 4OK5A 1G17A 3LW7A 2OAQ1 2XTZA 3LXXA 4BFYA 1NN5A 5H8WA 4M1MA 4RZ3A 4TMKA 5FR2A 3R9XA 4TMZA 1XXHA 2GNOA 1P75A 2CEAA 3M4YA 2FN4A 5DIFA 4NMMA 3PEWA 3HYTA 1KGDA 3A4LA 1Q3TA 2FSGA 3EA5A 2HCJB 1HT2E 4OK3A 3C16C 3SI7A 5TY0A 1ZCAA 1EFCA 2QQ0A 3AKEA 4LYAA 3B60A 3FMIA 3EW9A 3TAHA 1PUJA 2GA8A 1IN5A 2ZJZA 4FD2A 4QBIA 4Q7MB 1M2OB 1AS2A 1S3SA 1A4RA 3BC1A 3LX5A 5DO9A 4OHXA 2JGNA 2ZYTX 3QKUA 4XTRA 2A9KA 2HYDA 2B8WA 5CJ2A 3W6NA 1GKYA 3ASZA 2DYKA 1KI7A 3KQUA 2ZI4A 3CB4A 1CTQA 1NVUQ 4MUAA 4WW0A 4HYYA 1IBRA 4X8HA 3RS2A 4A15A 4DRZA 2P6RA 4CEIA 2QTFA 2BC9A 1UDXA 4ESVA 2GK7A 3RDPA 4BUJA 3GLFB 5JSZA 1GAJA 5FFMA 5FUXA 1MKYA 1Z2CA 5BYKA 5AUQA 2F43B 2YWHA 4Y0AA 4US1R 3HU2A 3VFDA 1WE2A 4B2LA 4URVR 2X2EA 3AKCA 3QG5A 5ANRB 2JLRA 2GEVA 4CDGA 3QKRA 4KI0A 3PUVA 3ZQ6A 1PZNA 2CDNA 1S3GA 3MD0A 1S96A 1M7GA 2YWFA 2BBWA 2ZR9A 1JAHA 3U7FB 5IK2A 5DHAA 1TAGA 3LW8A 5DGXA 2P3SA 3PG5A 2A5FA 1KDRA 2OXRA 4EPTA 2AR7A 5IDVA 3AKYA 1RRPA 1XTQA 3GEEA 1JALA 1Q12A 3SEAA 4PC6A 1CR0A 3GEIA 4AYTA 2WTUA 3A8TA 3T5DA 1QHHB 1WF3A 3AEZA 1G4UR 4D4MA 1Z0DA 2J5XA 4U02A 4FXPA 3CPJB 3I62A 1QVAA 2VHUA 2BV3A 3BFXA 2ZAOA 5JI2E 1XWIA 1RRGA 2R44A 1NF3A 2W6IA 5JWRA 2REOA 2PX0A 4IW3B 4RKEA 5J4YA 4TT3D 1TQ2A 4L9WA 3SC3A 4OHZA 1JPJA 1KTVA 4QNMA 4UNNA 4C0KA 4JBXA 3TVDA 3WBJA 5JEEA 1P5ZB 4V0MA 4D2IA 2XJ9A 1OW3B 1KMHB 3BOSA 1ZAKA 2W2TA 2UVQA 2WKRA 2W0SA 4BRUA 3K70B 3O8RA 2CLDX 5D3QA 4XWKA 3VAAA 3ICEA 3SJBA 1A1VA 1ZM7A 3QKSB 4IOKA 1US8B 3KXKA 1VYTA 3K09A 2P6UA 4DCNA 4XWAA 4MDFA 1UEJA 3AM1A 3EWAA 2Z5FA 1OFIA 4LBZA 2KSQA 4EFNA 3THWB 1W47A 1XTSA 3L0IB 1OXVA 2XB4A 1UM8A 1L8QA 4IEIA 3TR5A 1N6IA 3O8BA 2C9OA 2O8BB 2R2AA 2AKAB 4BECA 4QOSA 4YDHB 2OT3B 5LB4A 3VTKA 1RE0A 1NN0A 3KQHA 4PSAA 2QAGA 1G8PA 2Z83A 1IM2A 4XIGS 1FUKA 5DI3B 1KO8A 1DO0A 3NVAA 4O0MA 4S2EA 2QRNA 2WJJA 2GETA 4YQFA 2IX3A 3G5UA 1OFHA 3BIFA 2WMNB 1Q1QA 2FDCA 1FQJA 1XEWX 4XD7A 1E2FA 2CCKA 3E2IA 4PQFA 4Q21A 4C0BA 1XTKA 3D3QA 1MABA 3BK7A 2QNRA 3H0KA 2CVHA 2WZQA 4QM6A 3AVQA 3SYKA 2OM2A 3AQ4A 2QROA 3A1UA 3NH9A 3FKSA 2ATXA 1QVRA 1XPUA 1C1YA 1E9EA 2BHRA 3FPAA 3N70A 4QGFA 3U5ZB 3AKDA 3NBFA 5K8TA 4XSHA 3TUIC 4Q5IA 5LD2C 1QG4A 1VKJA 1ZM2A 2ZRLA 2GVZC 3IHLA 2QT0A 5M04A 5G3ZA 1DARA 1FMLA 1NMZA 1F2UB 2VL7A 4HZUB 5FI1B 2WKPA 4B44A 1N0UA 1NBMA 5BN3A 1Q20A 1H8HA 2JIZA 1E94E 4MYTA 1WBBA 2IS2A 4GOKA 2BVNA 2RMKA 2ZITA 4RFSA 3BXZA 4PC7A 4KLNA 1FX0B 4RD1A 4BZXA 4JSTA 1IY0A 1E9AA 3K09C 1NP6A 1KIMA 1XPOA 4BFUA 4IOLA 3KKOA 3BH7A 3PXGA 4GDFA 4CEJB 1E79D 2W0MA 2W83A 4IDHA 1F60A 1FL9A 2IUSA 5DSZA 3DVLA 1NMXA 2XSZD 3BB3A 3T1QA 1XJ0A 2PZGA 2VF7A 1HE1C 5L3SA 3C8UA 2D7DA 3FE2A 1NKSA 1UJ2A 2JLSA 3W6PA 4TYNA 2REXB 2QPTA 3UANA 3CX7A 4ZO4A 2XTNA 1RKBA 1D2NA 1FZQA 3F3YA 1A2KC 4PXAA 1DAEA 2G1KA 1M1YE 4US2R 1SXJD 1F3OA 3I3SR 4Q4JA 4F7WA 3BFVA 2GCPA 3FFBA 1KY2A 1SQ5A 1AZTA 3W5JA 1G64A 2OCPA 4MRVA 3KB2A 3X1YA 5IK2D 3IPXA 1S9DA 4MGIR 1EG7A 4V02A 2GCOA 1VMAA 4LBVA 4ON9A 4A2PA 3NTUA 5FBWB 2IT1A 4NL4H 1GKIA 4FW9A 1OFTA 1OIWA 4GP7A 4TLEA 1GFIA 4EPRA 2H16A 3S1AB 4B73A 3FMOB 4DCSA 4MDEA 1JR3D 1E2DA 3THXB 1B0UA 1YZUA 2AK2A 2OFOA 3QJYA 1E99A 4EQ6B 1OB5A 2DWPA 2W6ID 2RGEA 1EWQA 3T15A 1E2HA 2ZRFA 3NBYC 4BFSA 3K70C 4C7OB 2I1QA 2Q9AA 4PPFA 3AF2A 3OHMA 4JBYA 4ABYA 1DEKA 121PA 2RGCA 3PCRB 4JLDA 1W44A 3O8DA 1XD2A 1KI9A 1LNZA 1HUQA 1CJTC 3N5CA 1DG1G 5L3RA 1S8FA 3KKNA 3REFA 4BFZA 3NEYA 2WJYA 3GJ5A 3QXSA 4B3GA 4BLTA 3TLXA 4ILEA 2V4ZA 2IHBA 4JLJA 4QHSA 2G6BA 1R0WA 5D3MB 3MJHA 3L0PA 4I1OA 2QPOA 2GAOA 1N5IA 1G3QA 3U3KA 3UIEA 1IN7A 4KVGA 3EA0A 1JJVA 5TARA 2IYVA 3KXLA 1NL3A 2WV9A 1GKUB 4QKQA 1LW7A 4MYCA 2V9PA 2IWRA 1DADA 3MFYA 4JLAA 3U7GA 2BJWA 2NO9A 3QEOA 5A5GA 2CCGA 1J8MF 2RHMA 1OSNA 2IK8A 5J4KA 3IHWA 4UNPA 3SOPA 1P2UA 1LV7A 3RVBA 3G0HA 1W5TA 1VIYA 3ZVNA 1JAIA 4IRUB 4Y0VA 3VR6A 2Q6TA 5EUMA 2IWHA 2W6JA 2C9YA 2EFGA 4DLVA 3ADCA 3ZS8A 3H86A 3LV8A 3ZLJA 2PZEA 3KQNA 3O8CA 3A58B 4X8LA 1VYVA 4BLSA 4XSGA 4DB4A 3WHKA 2ZRNA 1XXHE 3HWSA 4URUR 2WJVA 4MRSA 4EPYA 1G3RA 2DHRA 3F8TA 4PC1A 5FI0B 4A8JB 4B35A 4ACBA 4B3XA 1IQPA 1OT3A 3ZQJA 3TW8B 1KO1A 1KO4A 2BMDA 1Y3AA 5JI3E 2MSEB 1II9A 1TX4B 4CT4B 1XBTA 1QHGA 1OPXA 4PFSA 2AWNA 2NPIA 2V7QA 1JECA 1E4YA 5KUTA 4Z8YA 1A7JA 1Z6TA 3SN6A 1Q21A 1D2EA 4WVFA 3B1YA 5CIQA 2YOFA 5JHHB 4PAQA 3VU9A 4PPGA 3FKSD 2GTPA 3O47A 4GMDA 4YXWA 1ZIOA 2B7BA 1SKYE 3HP1A 3OEHD 2OUKA 1MRSA 1OE0A 1SHKA 4L16A 5LB2A 2QG6A 4JKIA 2Q9CA 1YZLA 4GNKA 4PO9A 4FINA 1P7CA 1RIFA 2OFWA 1AJEA 2JAQA 1G1MA 4UQOA 1Z6AA 2ODWA 1DAFA 1NBMD 3MCAA 3D8BA 3THYB 1H8HD 1Q3HA 2CE2X 1RVDA 1UFQA 1NSFA 2JIZD 3K0AB 4KO8A 4QGHA 4W5WA 2O8CA 3FGNA 4RD0A 1Z6YA 2JJ2A 4PHHA 4ZCMA 2OLJA 4D4KA 3VR5A 2BMFA 1R5BA 4TYPA 2XB2A 3PVSA 1HY3A 6Q21A 3KXIA 5CM9C 3TR0A 2HT1A 3A4MA 2C9CA 4LWZA 2I4IA 2Z6VA 4HUQB 1TUIA 2GF0A 1LS6A 1W46A 4TZ6A 4HDCA 3KFVA 2G83A 1MO6A 3R7WB 1DG3A 1SXJE 5GJBA 1AGRA 3LVRE 3RRMA 4YMTA 3NBXX 3FOZA 1XTJA 1NLZA 3LDAA 4QNRA 3BD9A 1YZQA 821PA 3RAPR 5JWHA 4EFMA 2GILA 2O0JA 5KSOA 1F6BA 1ETUA 2BWJA 4HB4A 2FJUA 3GMTA 3VNUA 2IYZA 2MMGA 4G1UC 2P5SA 2DBYA 2A30A 2ZRMA 2WOOA 2V6JA 5FTKA 4OQFA 4HLDA 1TQDA 4P31A 2ZEJA 4R2HA 1JR3E 2ZS8A 1R7RA 3Q3JB 4Q1CA 1TTTA 4YONB 3AVPA 1G3MA 2OCYC 5FOUA 1NN3A 1OXXK 2JLZA 3KKMA 4Q4AB 4P33A 3WYFA 3LBHA 1ZM9A 4PC2A 2QBYB 1YJ5A 4TYWA 5CLLA 4DDTA 2X2FA 4V0ME 4C0JA 2OZEA 3U7EB 5L3QA 4JT4A 2D3WA 2H1LA 1N6LA 3EPJA 1SHZA 5FPTA 1I4LD 3OAAA 3EC2A 2ZJOA 3TIFA 4BFVA 4PR0A 5DH9A 3A37A 1XDBA 1XJCA 2EWVA 1OIXA 4Q9LA 1W36C 2GZHA 1C9KA 2WJGA 2MMCA 2P0EA 2PL3A 2XAUA 4D4LA 4QGAA 3CF2A 4KJZA 1S1MA 3TKLA 2QL6A 1DO2A 1VCIA 2WM9B 4O25A 5J4VA 1VHLA 4GFDA 3U44B 2VHTA 3KX2A 2I1VB 1KSHA 4W9MC 2IW3A 4B47A 4BFWA 4DLZA 3DEFA 1RC8A 1ZC4A 2X1VA 4FN5A 2A5YB 3I73A 1GL7A 2ZE5A 4ZV4A 2C78A 3K53A 2X77A 3SBEA 2GJ8A 4DVGA 2VHJA 1Q57A 2EYUA 4URZR 1ODFA 3P4YA 2RH5A 5JECA 1YKSA 3GLGA 1IJFA 1XEWY 4AYWA 3GFOA 2C04A 1YR7A 2ZETA 5CIWA 4UXHA 3VR4A 2QP9X 3B1VA 4AK9A 2QA5A 4WBSA 4YDSA 4LHZA 4TLCA 3GLIE 1AS3A 1MO3A 2ZE8A 2HV8A 1P73A 2L0XA 3K9GA 4GZLA 4A8JC 4C9BA 4FI3C 3CIOA 3A6PC 2W6JD 2WKQA 3DPUA 5CB6A 2QM7A 2PMDA 3C5CA 2AKYA 3KKQA 2RHDA 3UKDA 1DELA 3HDTA 3SQWA 1JEDA 3ECCA 2IF2A 2ONJA 5HE9A 1U0HC 2FU5C 2IA5A 3QF4A 4OQLA 3QUSA 1RW4A 4Q1EA 3R8CA 3W3ZB 5KDOA 4LSGA 1YR8A 1ZUIA 4EFLA 4IHQA 3FHTA 5DYIA 4CIDA 1FW6A 2CHVA 1G18A 2BIFA 2IYTA 1SVLA 2QPAA 2V7QD 4LV6A 5J4HA 4RZUA 3NKVA 1N0VC 3W6OA 1CEEA 3V4FA 3QBVA 4JLMA 4FMDF 5CK5A 5EJEA 5AUNB 4NH0A 1ZMXA 4YXWD 3EPHA 4G01B 3OFNA 4DSNA 4CZ2A 3PR1A 1GVNB 5ELXA 1WQ1R 4XVUA 4JLKA 5FUVA 5CM8B 1CU1A 1XP8A 2G0NA 3T35A 3W5IA 2QT1A 2BOVA 4QRHA 4HZIA 1DAMA 2AX4A 2PCJA 2NO1A 5KSZA 1N6OA 2G0TA 1P2TA 2P6NA 2AHOA 1EGAA 1U8ZA 3U3RA 1R5NA 4DDWA 4C2UA 2EU8A 2TMKA 2OV2A 1II8B 1K6MA 3CRRA 1QHYA 3MMPA 4MKFA 1EESA 2WWXA 4RD2A 1JPNA 3K0FB 4BRWA 2P65A 2H8KA 1WDTA 1CIPA 4JL6A 4Q7JB 4QGGA 5H68A 2NO7A 1E2QA 3PIRA 3THOA 2QE7A 4M9QA 1N0WA 4Z54A 4CEHA 2ZPTX 1G7SA 4Z8XA 4C0QC 1TEXA 4NHOA 2N1BA 5FPSA 3PEVA 4NZYA 5SZKB 1I4DD 3KTAA 1Z0FA 1KI8A 4Q03A 3RRNA 3V4RA 1AIPA 1XXHB 3QXJA 4C2TA 5F98A 4D82A 4W5HA 1KI6B 3EC1A 2OO7A 2A78A 3ZDQA 4IDQA 2P5TB 3FHOA 1E32A 4PQRA 1KO5A 2ZUCA 3FB4A 4LY6A 3TJZA 3SZRA 1CXZA 2OESA 4XTCS 4QBGB 2GHIA 3LWNA 2FPMA 1G6HA 2V8OA 1KDTA 5GVSA 2O0HA 1SKYB 3VX4A 5KNCA 2IS4A 2LCFA 3CBQA 3QXXA 1OXTA 4G5GA 3P32A 1BH2A 2ZE6A 3F5FA 4PPNA 2AXPA 1AZSC 5AWFC 4RSGA 2ZSEA 3AGPA 1TMKA 4CYMA 1G20E 3TMKA 2QM8A 3FVQA 3TSWA 2HEIA 4Q02A 4O3MA 1B23P 1JB1A 4ZCLA 3IO3A 3RABA 3OAAD 4Q4HA 4E07A 1GNPA 5J5CA 2QY9A 3MJRA 2XZPA 1NI3A 4PHGA 1MT0A 2CJWA 1GRRA 4US0R 4C0AC 3B85A 4IJMA 3GJ4A 1AKEA 4IVQA 4Q9KA 3R9IA 2WHXA 2GWHA 1J7KA 2DY1A 2YC2C 4C3ZA 3QPUA 1Z6GA 1E9CA 3ADDA 1Z0AA 4ZDWA 1W4AA 1XEXA 4MRRA 2FGJA 1S1CA 2KWIA 1SXJB 3QKRB 4DC9A 1QBKC 2IS1A 4I1UA 4LJ9A 2FA9A 2FFAA 2WICA 5AJZA 4AKGA 1T8UA 4UNRA 3JZMA 4Q1AA 4QM7A 1E69A 3OF5A 3E70C 3TW4A 1E2IA 2A7QA 4HB0A 3WP0A 2BBSA 3WHLA 1LFDB 4HDOB 3QVVA 1IXRC 4N0DA 1KSJA 2VP9A 4PPQA 1E2GA 4DJTA 3KJHA 1CULC 4QXAA 1SVOA 1U94A 3IIKA 4ASUA 1BOFA 1LTQA 5K8UA 1AA9A 2ORWA 3A1SA 1ZM3A 4ARZB 3VKWA 2FPLA 5FBRB 1NRJB 2C99A 4NP6A 4WXRA 2B7CA 1E2KA 1KJZA 3WYGA 4G3XA 5EE0A 1T0JB 3U6KA 5HCIA 4AG6A 5EXTA 3B1ZA 5LBIA 2ZSBA 1P62B 2C96A 4Q00A 3MSXA 1PV4A 1KK3A 4FMCF 3HJNA 1VYUA 5DN6A 3NC1C 1IJEA 2ZSDA 3I4LA 2IL1A 3PJRA 3FYHA 1D2MA 2IEZA 2VP6A 2C98A 1OH7A 3W3AA 4EDHA 3BWDD 4V0OA 3MWYW 4F92B 2ONKA 3C7KA 4TMXA 3K1JA 5AJXA 2HXSA 3TSOA 4KFSA 4B3DA 5KU1A 5FOVA 1IAQA 3K8YA 1DTSA 3HU1A 3Q85A 3SHWA 5C4MA 4O2RA 3VKHA 2FOLA 4OI4A 2N46A 2RGGA 4XVRA 1H8EA 2GJ9A 721PA 3WNDA 2XXAB 4CVNA 1UDWA 1VCNA 3B7GA 2HLDA 4X8MA 2OAP1 1E98A 2BCJQ 4PHTA 4V03A 4KSCA 4ZI3A 3TUJC 2JA1A 1E6CA 3OESA 2ODNA 5E4FA 1TNDA 1F2TB 1K5DA 3I5YA 4B48A 3AUYA 1OKKA 2V6IA 1XEFA 3GLIB 1E2EA 5J47A 1E9RA 3VR1A 3KZ1E 1C4OA 2J46A 4JIMA 2QE7D 3EIQA 1ZC3A 1ZCBA 3CKLA 2VO1A 4LJ4A 1HH4A 2R9VA 3QG1A 1BIFA 3GJ3A 3GLFA 4Q1DA 3AF1A 5CK4A 1EX6A 5BN5A 2GRJA 4ZDIA 4JMPA 2F43A 3WMGA 4F4JA 1IN4A 2GVDC 3SNHA 3CX8A 3U60B 1ZRHA 3KQLA 1DAHA 1AN0A 1FUUA 3Q72A 4Q1BA 4HAUA 5DHFA 1R5OA 4M2LA 4ZDKA 4JLNA 4OJQA 1IY1A 4A0FA 1SULA 1TU4A 1W2GA 5TMPA 3KJIA 3KUDA 1QHSA 1Z8FA 1KSGA 4DT1B 4PQYA 4MRNA 1G21E 1D6JA 3IILA 4KFRA 5JCZA 3CM0A 3Q7PA 3FHCB 2IYRA 2NOAA 3H2YA 4JVNA 5DLQC 1UKEA 4M1YA 2ZVPX 1GL6A 3KKPA 3GLHE 5IF9A 4KITB 2J0QA 2CXXA
chains in the Genus database with same CATH superfamily
1PJZA 4I50B 3ZD7A 4BEBA 2R4QA 3EMVA 3PGJA 4D8UA 1Z13A 3AM3A 5IDWA 4G1VA 2CW5A 3RUEA 4KMMA 2A9RA 2DWOA 3KTFA 2H18A 2I71A 1ZH4A 5DX0A 1XF9A 1SUFA 3U26A 3K3PA 1IZ9A 1FDRA 1V6SA 1G4AE 1OLSB 1VIDA 1YBMA 1Y42X 3KSUA 3ZE6A 5JS8A 4CGZA 4LJAA 3I2GA 1Z7WA 4PIPA 3ZIAA 2Q45A 1YDGA 1EVJA 3BCHA 3OQIB 1TVKA 2Y4OA 1YNSA 1DKLA 3P94A 4EGQA 3C39A 3QY0A 3VV3A 2OYSA 1SQFA 2PUCA 2PMKA 3QBTA 3DVRX 5CFOA 4DNXA 1WB5A 4NU5A 4HDMB 3EXFA 1O57A 1WQ3A 4NWIA 2KI5A 4D4GA 1PAUA 5DTMA 1N2CE 1X70A 2LPMA 2PZLA 4YTEA 4AUNA 3IE2A 2GJSA 2GEBA 2VPQA 4K46A 4M38A 5AM5A 3GLGE 2ISSD 2XBUA 3HJGA 1L8OA 3JVVA 1W2HA 2C5BA 3TXXA 3GEBA 4OGWA 2Z57A 5DVZA 5DLDA 1EHIA 4YRAA 4FYHA 2R00A 3GPIA 4EKDA 4GLBA 3O74A 3ZCSA 3WBFA 2OAGA 1L4YA 2A14A 3EZ6A 5KJ6A 1N5RA 4LRSB 2A9QA 3MTBA 1O6CA 4W5NA 2JKVA 2O8BA 2CGEA 1T8TA 2K2WA 4EBFA 3HCEA 4CM1A 3TCNA 1K7YA 2XKKA 4KAXA 1VIAA 3LD9A 4LV8B 4BP3A 4F6RB 4KLZA 1M6NA 2ODTX 2W4QA 1U3TA 3QX3A 2B0JA 2VWHA 3KEMA 1I0ZA 1RM4A 3NTVA 4JBNA 4AU1A 2JLXA 1M10A 3FDFA 4PZLA 3K8OE 4FGKA 2YOGA 4FFLA 2FFRA 4KFCA 4XCVA 2FWRA 3R41A 1UF9A 4XB6B 1RBMA 4BEWA 5EZ5A 4KWIA 2YR0A 1YI0A 4BAGA 1C4XA 3ZZ0A 2X5JO 1G20B 1RAHA 1U90A 4XCXA 3WK4A 3LQ2A 3Q7SA 5ELMA 3AINA 1ST3A 1T1SA 2VUSA 2YWXA 4L5YA 3W5HA 3I9LA 2YFQA 2Z1DA 2AFHA 1XLTA 2PH5A 1RE1A 2IYNA 1OXSC 3TZQA 3ND6A 4D8XA 1LC0A 1OFUX 3PGKA 4OXRA 1XQXA 2YIDA 1DOZA 1BXGA 2HA7A 2N3ZA 2H4XA 2NV2B 2C2ZA 2XVYA 3N0XA 3HKBA 4WY2A 1MJ5A 3W3AD 2Y76A 3ICOA 4ZC8A 1GPAA 4EPVA 4HB2A 3U48A 1YIAA 3AYXB 2NIPA 1I4TD 4RHUA 5LOVF 2XRZA 5DYTA 3I72A 2PGOA 2GAJA 1M1NB 2CSUA 1VSVA 1K6IA 1IHOA 2Y92A 3DVAB 1O9GA 1SXGA 1RLJA 3NTOA 5BQFA 2WAMA 3VAZA 4CW7A 1UBRS 5CDSA 5J40A 5EGNA 3T12A 4Q01A 5BXQC 1PJ2A 4QFMA 5JSFA 1AMOA 4HZUA 3WK5A 3ZJ4A 1RZVA 1PT5A 4M7RA 2RDMA 9ATCA 2VQDA 2OWEA 4XGQA 5EVJA 3S81A 4OHFA 1JIKA 2VT2A 3ER6A 3DBLA 1H5UA 3BFKA 1AGYA 1JKMA 1FYFA 4LVCA 2OTCA 2VK2A 1KQFA 1FX0A 1Z38A 2EX4A 1Z2NX 4QQKA 3A3NA 4EHNA 5JO9A 2VTEA 3KK0A 3P4UA 4NMWA 3QJ5A 1ZU4A 1K3UB 4F56A 3W5CA 4AMYA 1Z26A 2R60A 5GZ6A 2FG5A 2X1HA 4CEJA 3PZBA 3AEKB 1KK0A 2JCVA 1PX0A 3C85A 3KYDA 4JU8A 3MWJA 4HLUC 4D56A 3DZFA 3OIVA 4X3OA 4U7GA 3PNBA 2AOTB 2FZWA 4BX8A 1K7EB 2WFAA 2ZJ6A 1GUFA 1VI6A 1XA4A 4PZ0A 2WWTA 2RCYA 5DHSA 2BGNA 2A86A 2LD4A 3R44A 3B13B 1R6BX 1Z3CA 2QUHA 3BIOA 4JDPA 1G2IA 2ZKLA 4GZ3A 3UM9A 1JU9A 4D25A 5DOZA 5EJ7A 4KYUA 4TN1A 1FFXA 2O2SA 3H2GA 4PO1A 3PUWA 4JK3A 3REOA 4ZN6A 1PJSA 3OE7A 5K0TA 2WFMA 4B33A 2OECA 1M7BA 2WQZA 4NV0A 1DOAA 3MWLA 2BEVB 2QTRA 3L4KA 3LMKA 4J6EA 5BVGB 4JQCA 2EKQA 3TTUA 2Z5VA 5C2JB 5FH9A 1LCIA 4JODA 1KKLA 3WISA 2QUAA 2AS0A 3ZW9A 1NPTO 3IUYA 4AKEA 2FSHA 1P4SA 5JY1A 4E5DA 3ZVMA 3ZD6A 3RRZA 1OGIA 1GGKA 1IH8A 1ZJZA 3QPDA 3CVUA 4FS8A 4WLEA 3QOWA 2FPGB 5TMDA 1PZHA 1R18A 5IFLA 2VRNA 4XD7D 1Z5UA 1Y9EA 2YZGA 1U28C 4TWZA 3MW8A 4QECA 2Z56A 4Z4HA 1L5HA 5IXJA 1D1TA 4YYZA 3LA8A 1NRIA 3O4HA 3R0XA 3ZQ4A 2FPKA 3QYJA 4CM8B 1FFBA 2FZLA 1UMDA 5B57C 2F59A 3DYBA 4L5IA 2J0SA 3KAQA 3EZ9A 3CVYA 1ACMA 4H1UA 1WSAA 4EHDA 4DR1B 1UM9B 1U6JA 1DMRA 1QYVA 5I9TA 1QO0D 2F6RA 4MQEA 4WI1A 2P0YA 1A96A 2PUJA 3UO8B 2MSDB 3BXGA 4P0QB 4LGMA 1PBNA 4EGJA 3O93A 3SLKA 1M1XB 1EPUA 3VO1A 2FSFA 1ETHA 4FOSA 1U2RA 4UMVA 3IQWA 2XNCA 1PD1A 3DMNA 4RDHA 5H4HA 2H1OA 1CR2A 4ZVTA 1IATA 4BIIA 4AZ0A 2Y0CA 3EIUA 1KWKA 1N6RA 5IT9A 1RABA 3EGOA 1QRSA 2RIRA 4Q37A 5TQ2A 3IMFA 4Y1RB 3W04A 1NKTA 1V2HE 2FSUA 5BORA 5L7YA 3ZXUB 5ICFA 3W4KA 2RI0A 2G71A 2DPYA 2M1ZA 2VHYA 1C7ZA 1XHFA 3PL5A 4JROA 1TF7A 2O5RA 5NLLA 2R65A 3QW4B 4HLCA 3LLSA 2IOQA 3KP1A 4LQLA 2Y1GA 1SU7A 4GGOA 2HF8A 3PFCA 3RC3A 1IUPA 1E2BA 2FEMA 1SD1A 2J7PD 4GOXA 2IIVA 4PG5A 3TD9A 1U2DA 3RAFC 1L5VA 3FYUA 1TEVA 2XGMA 1QX3A 2B9VA 1WJGA 3FKQA 3PNPA 2E7ZA 4QWWA 1PEAA 2Y68A 1FNNA 4YRNA 1B7GO 2C88A 4BVEA 2PRZA 1OZAA 2ZBRA 5JJBA 1G3UA 2PZBA 3Q2OA 5JPIA 5JXIA 3EBLA 3P9PA 2GZRA 1KYIA 2JI7A 1IEWA 1A27A 1WB6A 4ZA2A 3I5XA 1UC9A 1SC3A 1KAGA 1Z8NA 1GOTA 2PZ8A 2QLTA 2WQ6A 1YA6A 2WPDA 4MA0A 4UU7A 5JD5A 3MSCA 4WAUA 3TW8A 3NTRA 1JFTA 2NTVA 2HMSA 4P4GA 1G7CA 1DKOA 1T5DX 2IEGA 5C8DA 3T5PA 1RZ3A 1DC4A 5PGMA 5CFZA 3L2OB 2P4HX 4GSYA 4L72A 1VA5A 1GSAA 1EFLA 1PJTA 3CXUA 2MYUA 2X8BA 2HEGA 2R85A 4ZI2A 4IDEA 4S04A 4FBMA 4EECA 5LMUB 3EGDA 5ADWA 1NUSA 3T9EA 3NI2A 1UDRA 4V1CB 3T1TA 2ZCUA 5BURA 1O6ZA 2GHRA 5KCZA 4TV8A 1NW6A 4M0EA 4QUJA 2NPFA 4MIEA 5FTJA 1V8BA 3KU4A 3THYA 4DV3B 4ILKA 3H3XA 5ALHA 5LM3A 1OX4A 2D7CA 1VJ1A 3T5AA 2BJVA 3PUJA 3NIBA 3HHEA 4CM6A 3K73O 4RM2A 1BTOA 3Q9LA 2OK7A 1LJLA 1UK9A 1ZA2A 3F7MA 5ICSA 3BPSA 4JN6B 2WY2D 3AT1A 1P45A 4KQIA 2D2VA 4CF5A 5D1NA 1CZLA 3HYCA 3HRKA 4KOAA 5M34A 2XNDA 2DB3A 3GG2A 4QOIA 2ASVA 1V16B 4F1WA 4YRTA 4CQLA 5AJTA 4DLLA 2FR8A 5J59A 3KQWA 4OQEA 3IIMA 4ZEMA 1O1YA 1O03A 2AW3A 4MP6A 3N0VA 4FYJA 5DBEX 4ZQFA 4E13A 1O5TA 2RB4A 2W2KB 1V96A 1YULA 2DQ4A 2WUFA 4MV0A 3HYLA 3GD7A 3OM1A 4IFBA 1TRHA 3NBKA 2HJGA 5J58A 3N28A 1QHIA 1Q1GA 2C2MA 4L2IA 3HB1A 3QEMB 4QPCA 4YRPA 5TV2A 4NEHB 2ZWMA 3QVWA 2RAPA 4R2XA 3O1LA 4OJTA 4QBTA 5AXDA 5AHRA 4KQGA 4LHXA 5AW2A 1YRBA 1FFDA 2H9IA 4LN1A 1U9CA 4ZHQB 5ER9A 1UWCA 3VHXB 4OL9A 3AO0B 5I4BA 4TL6A 2DTXA 1R74A 3CUUA 3F8SA 5FBQB 5C46F 2O5EA 3KXDA 4ZANA 7YASA 1AXEA 2UZIR 1RYFA 1W4CA 2X1LA 4DARA 1YBAA 1YI8A 2ZP1A 2R4TA 4J2TA 5E4TA 4B8WA 2K6GA 1DIRA 2VR1A 1FIUA 1SHJA 1D09A 3DZ8A 1KS9A 2XEXA 4JUBA 2DULA 4JUIA 3FLAA 2FEPA 3PDWA 1LU9A 2C0QA 1CQZA 4PN3A 2PS9A 3BS4A 3AF4A 2RI6A 1DTEA 5GV8A 1YVDA 3B3JA 1CC1S 2W90A 3IB3A 4NAUA 1Y1TA 4H4DA 1CNMA 2YWRA 4N6OA 3JVUA 4FB4A 2OHOA 3WYEA 4YJ3A 2IZ5A 2B20A 4MCAA 2R6JA 4YVFA 2Z09A 1B76A 2KBFA 2AF3C 1C5KA 1JTFA 1SRQA 4WZAE 4G8DA 1QR6A 2AFVA 1LK7A 5D51S 5HFNA 2FHSA 3S7ZA 4BKUA 2F8SA 2ATVA 2QMUA 1EM8B 3K0BA 3S8MA 3ZWXA 1FW8A 2K7FA 1QGOA 4HPXB 4ENPA 1ISRA 4XM2A 3N3AC 1E9FA 2EZTA 4FJ0A 3V3KA 2XF8A 1JHAA 3OQJA 3ISVA 5GPBA 4DFDA 3K5WA 1WUTA 3ZZUA 4GRIA 1BE1A 5A02A 1N6PA 4PTLA 5EZSA 4W7SA 2B2CA 4HWOA 3KFXA 4ARAA 4DCUA 5CH5A 4IS3A 4UU8A 2R8OA 3PHJA 3B9RA 2HJ9A 4YQEA 5EKXA 3ZCQA 3WGUA 4KNYA 3PE6A 3M6AA 3U44A 1FVXA 3HB7A 4HDQB 1E1QD 1HO3A 3HGQA 4BNXA 4KODA 5IBCA 4F4FA 5JYEA 2RHOA 1E4OA 3MVEA 1R4MA 5GOTA 2HRZA 3S6JA 4NMLA 1E5XA 5DM60 1JG3A 1RHRA 2FGKA 2JJ2D 2QTCA 2R6ZA 4ISCA 1E2PA 1DJQA 1ZD2P 5EUQB 3DEYX 3M4XA 1W4RA 3RUIA 3RFXA 3TQCA 4NIMA 1PG0A 1NW3A 4CV0A 1GNRA 1FE8A 3NWOA 1QGUB 3HJHA 3LLMA 3EWSA 4JL8A 4MI6A 4K9DA 1JDPA 1K8RA 1DJNA 1OGJA 1QNLA 1KH3A 3DNMA 2P4EA 3KTDA 4J4TA 4ND2A 4GAEA 1G9SA 2G40A 4ZI7B 3A1TA 3DLPX 3MIZA 3V4PB 2B8EA 1KZGB 3SZUA 4RC9A 2OR3A 4QTXA 3C41J 3FY4A 3M1AA 4EG0A 1N3BA 4C0LA 4CIYA 4IQ0A 5C9ZA 4V39A 4YT8A 1Z6XA 3M9LA 4NBUA 3NIFB 5BNZA 2BRUC 3CNEA 3SDZA 3IAAA 2I7XA 4NSNA 4GE3A 2FLKA 1YA4A 2Q3DA 2J41A 1HX7A 1GQFA 5NULA 2FN7A 3SC2A 2PKRA 1XVTA 4J9UE 3ORQA 3L01A 4A2WA 4E94A 4FGZA 5HIJA 4M1EA 1YR2A 5F9FA 3ZOKA 2XOKA 2YJTD 2Z2JA 3PGVA 1E7WA 3W5DA 1CS0A 2R1VA 2WUWE 3C14C 1SK8A 4AZ3A 1S2OA 3LGSA 3GHYA 2IPLA 2GESA 2EJVA 4RF2A 1UPUA 3FSJX 1IHPA 4RH0A 3T3OA 5FQOA 2XNJA 4HQOA 4NRDA 4YHBA 3SSAA 1C9JA 2WYVA 3RYHA 1E1CA 4RGVA 4EARA 5KJFA 2DKOA 1D2GA 4MMYB 3RWMB 1Z36A 2CXPA 4M88A 1J56A 2WUDA 5HTKA 1IWPB 1A8QA 4TZTA 5HM6A 5DEOA 1NW5A 4XLTA 5EE3A 3EY9A 4HWTA 3FI0A 3R3ZA 3HCCA 4MDYA 1HL7A 3TZEA 4UBMA 3M3PA 2JVJA 3I39X 2WNHA 1DTWB 5AM1A 3WQQA 1UFOA 5LZ9A 1IU9A 1ZUHA 1K68A 5ES4B 3KQMA 3ZQKA 4W99A 2C2XA 3G8BA 3RHZA 3M9WA 4MHSA 4CKYA 1KI2A 5HCNA 4DJAA 1EEXB 1SBZA 3G82C 4WRRA 3B2QA 2O2EA 4M0DA 2P7IA 4TSFD 3HPQA 1DKQA 4FEYA 5TMEA 4N82A 2B4TO 2FN3A 1DBRA 2RARA 1DT3A 2BBTA 5EPOA 5FRDA 5GM1A 3HXMA 1U1CA 3TG8A 4DUGA 3WL6A 4NYJQ 3D8UA 5DOVA 4TV8F 4C3VA 1JBKA 4OSEA 2Y77A 3OA2A 3KPVA 1KFKB 5FBKA 4KWHA 2R1TA 4RESA 1QE5A 3BWVA 3H0EA 4CETA 4XIIA 4Q4DA 2NU9B 2Z8YA 1Y8AA 2P41A 4G84A 4OHVA 3UA3A 1W48A 2NQTA 2FFBA 1O6BA 2G9VA 1L7AA 3ENVA 4GX5A 3NT5A 3GGDA 3RS3A 4I14A 3D7RA 5FTLA 1E61A 3L7LA 3GZNA 2BELA 1XJQA 4WNYA 1S3IA 1XAJA 3KO8A 4Y30A 1B2LA 4XE5A 2ZCJA 1NBHA 2C3OA 2GXAA 1QGDA 4YUAA 4HEQA 2FG7C 3KSMA 3WMRA 2O6LA 5ISMA 4MHTA 1PLKA 1ZOPA 1MX5A 3CWZA 3BXHA 3ZU2A 4Q9NA 4QXPA 2QENA 4IFEA 4JVLA 3RHSA 2P67A 4OMDA 1WMEA 4RK7A 1NXSA 4XGRA 3E5MA 4J1QA 5FLKA 5F21A 2PUVA 3T1OA 3F3MA 1I2DA 2A94A 2YH2A 1I1HA 3K1TA 5A7HA 2EGUA 4N65A 2W7TA 3H5LA 4MIKA 3X3HA 1E2NA 3L41A 5DSTA 3NAZA 4B3FX 3I37X 1PFGA 1J42A 1FCJA 1O08A 2X2OA 4LX0A 1TUEA 3C15C 3ILXA 3OZDA 1K98A 2C4KA 2Q1TA 4LVOA 2EWWA 5ETJA 2C4HA 1M1UA 3HN2A 1GILA 1RR6A 1XN1A 2BKEA 2QEQA 4RD6A 4XFDA 1MTZA 1W4LA 5FI3A 1JMVA 3HO1A 3HCPA 1QUFA 3AG6A 5H83A 3SZLA 4BX3A 2JLWA 4ECAA 4NPAA 3EJ6A 2JFNA 3RS8A 4YV0A 3K6JA 2WAXA 3E82A 2CYBA 2AN1A 1VJDA 4I0WB 3HUEA 3QM1A 4MWDA 4UBOA 4IDDA 4WZBE 5A0FA 1ZHOA 2VBIA 1R8XA 1UK7A 1Z0KA 4HUJA 4UUQA 1NI4A 5T4FA 1UCFA 2HCRA 3AUAA 4WEOA 4JR1A 3U3JA 3LT5A 5EIEA 1XDDA 1CJUC 2J7KA 4RS4A 4CMKA 3P52A 4G09A 5FAKA 3CRQA 3UTCA 4CLOA 4D3YA 5HKOA 3OZRA 3VC7A 2QRPA 4YJ3F 5G02A 2FI1A 2GEUA 2IDZA 5LMZA 2AQKA 5LZ5A 3UKOA 3FVRA 2A1TS 4LY3A 3KJGA 2I2AA 2PYDA 4BGDA 4DLNA 4G1EB 5KYYB 1I6WA 4EY8A 2I80A 2AXNA 5E9AA 1U8EA 3RQSA 2FMHA 1U4OA 1CUEA 4ZT3A 2F1OA 2G1AA 3AHHA 2PL9A 2XHZA 2B21A 3ER8A 5B7PA 2GHTA 1YRAA 5E6SB 2G1UA 3BIXA 2JJ1D 1S7GA 4QGBA 5CDFA 2MJLA 2DLCX 4E6PA 3OEED 2PGNA 3NANA 3GJXC 1MABB 4G5HA 1CF9A 5THXA 3VOTA 4AJNA 1P1HA 3MZ0A 4HDRA 5JALA 1Q44A 2CY0A 1U3FA 3FTFA 5DB4A 1YR3A 1NXPA 3KSZO 4KR9A 3WBKA 1I7QB 5F64A 1YVRA 1S3FA 3I04M 4K9LA 5G40A 2ZQZA 2JFBA 2V98A 2ZBUA 4HYQA 2H2IA 4U3JB 1TJYA 2D2FA 2YHBA 4FX5A 4HFNA 1M66A 2DRIA 1FNCA 3HVJA 5K0NA 2O3UA 1R88A 1WZEA 3SJAA 1JQLB 1G63A 2DUNA 3AEYA 4M9ZA 1ZUD1 2D1RA 2VXBA 2J45A 2XYGA 2PUBA 4K6KA 1MH9A 4UVDA 2FPPB 4I3GA 4I5IA 1XPRA 2M98A 1FFHA 2PZJA 1VQ1A 3QQ5A 2GKSA 2O2CA 3H2KA 3H2BA 4UATA 1QV9A 3R20A 5KNCD 2VJNA 1UINA 3VHRA 1PX2A 4RFSB 4KR0A 3VAYA 3CONA 4BWYA 5BQ5A 1CUFA 3UV6A 2CYAA 3ACDA 3LRXA 3UFBA 1J8VA 3HYRA 2ZSFA 4CG1A 2DFNA 1NU6A 2XXAA 4FGWA 1GEEA 2AOVA 2PAAA 1HYGA 3K94A 1QK4A 2ZZNA 4K81B 3TLAA 5LQKA 4JBGA 4ZT4A 2QV0A 3LWDA 4WNAB 2WHPB 4AYXA 2OOKA 4G1MB 4B4UA 1BRMA 4WCDA 1H2WA 4Q7LA 1F2TA 1R10A 2NNWB 1L4FA 1SXJC 2X6RA 5FHQA 3BJZA 2Z2XA 1PLJA 4YBZA 4BATA 5B2FA 1DQPA 4R1MA 1P8JA 4QOHA 3F71A 1P0PA 2EZ9A 4BYMA 2IUTA 3R74A 1K63A 4HX2A 2X4GA 1IG3A 2XUOA 5F3WB 3BA1A 3SXUA 4YV2A 1D0VA 1W5EA 3X1ZA 3RSOA 4EZEA 4TYYA 3F2VA 2QSYA 3PFGA 3SLRA 3X1KA 4AQ7A 5BVHB 1W85B 4K9RA 4MICA 4URYR 4L0MA 3ELYA 4GI2A 5DM4A 1EDOA 3VRHA 4BNWA 4EM6A 2O8DB 1ID8A 3ML1A 4P36A 2OHHA 1ABEA 1RWMA 1A5AB 3PC7A 1YQXA 4RX1A 5EFOA 3BD8A 1CEQA 3RI3A 2ZAGA 3T8YA 2MINA 2ZYVX 1AT1A 1QH1B 3JRNA 1A5TA 3CPHA 4LX8A 1M2EA 1P0CA 2HJSA 2ZI7A 4FJ2A 5FA6A 3VR2D 4ZJZA 3KYIB 3I92A 2G07A 1IRXA 3FOCA 5F12A 5L7WA 5BYJA 4A1OA 1Y7LA 2VRCD 3X1XA 1SUSA 1S6YA 3D4NA 4WSOA 3LUCA 4XUGB 4E5PA 4UCXA 4DNPA 4H4CA 2VHVA 3E81A 2ZBDA 3O82A 5IJ0B 3X1WA 1CP2A 4CL3A 5MHTA 1YSCA 4XA8A 3A6JA 4REOA 3WJAA 4A23A 4HATA 1VM6A 4JMLA 2RG1A 5E1DA 1SFRA 1WU7A 2FMXA 3OI7A 3E9ZA 4R6WA 3VX3A 2GN9A 2EP8A 4DUZB 3FHJA 4MWGA 4ZU1X 1ELOA 1PG2A 2YWCA 3IDSA 5D00A 2Y66A 2HFJA 2DR2A 2A8YA 4MYUA 4C4YA 3D8HA 4RCVA 4CCWA 5IH7A 2GD2A 1ORDA 4F86A 1I7LA 4BQSA 4M60A 3FOBA 3TLMA 1JE1A 3HLTA 4UCFA 5K2MA 5IUNC 1PEDA 3FNBA 4BNDB 1C9NA 4A0HA 1Y80A 13PKA 3UATA 2V65A 4K40A 2QIPA 4LZNA 1RPNA 1JVNA 2GZAA 3AG5A 3GDOA 4LMBA 4XOIA 3AWDA 5F77A 5G2OA 2VAXA 3A9SA 4JP1A 1OYVA 1SD5A 3K96A 1VE5A 4BQPA 2WWGA 3LT2A 3ZNOA 3IPRA 1N2SA 1ZUNA 1UBSB 4YLEA 1HWYA 5FTMA 2BKVA 4BMYA 4LJ5A 2QY6A 3I1JA 4DLWA 4ARUA 3EXEA 5IW8A 1WUJS 2P9GA 2FB9A 4TL8A 1E3SA 2R8EA 3L18A 1QRRA 3MBIA 3A3OA 2JW5A 5JNRA 5AK5A 1U2EA 2HF9A 3DBHB 3L0CA 3IDQA 1U9ZA 4KQCA 4KEAA 4KVAA 5CFRA 3PC8C 3PDHA 3EEFA 4J0IA 5I7FA 3PX3A 1ATZA 3NH6A 4PLCA 1KZ1A 2P27A 3WQHA 2A5DA 2CMHA 2Q99A 3NONA 4MW6A 1KO7A 1KY5A 1YGYA 2GH1A 1JQJC 3KB1A 3PUXA 4FOPA 1V8FA 2WMOB 1OFVA 2OHFA 3CTMA 5AOCA 3RYFA 3ZCXA 3OOYA 4Q66C 1LPMA 1N0IA 3GXBA 3R09A 3MF4A 5I5GA 1F38A 1LQ2A 4IOJA 4MLPA 2UZ4A 4LY9A 2B98A 5IRCD 4DR3B 2H54A 1WZUA 4KK3A 4EJ6A 5DP2A 2A5GA 1FVOA 2VHCA 5L4NA 2HOQA 1M5TA 1ZX1A 5EMJA 1GGMA 4P3PA 3LFTA 3GFBA 1T8PA 2H0QA 3OO0A 5HZMA 2HUPA 3G23A 5CDGA 3NWJA 3H84A 3UVEA 1YZNA 1GNQA 2CUKA 3PXDA 1FUYB 4FGSA 3LY8A 4FILA 4M0LA 1YR6A 3GGPA 4HO1X 4JL5A 4ZT2A 2Q7OE 4DZZA 4UM7A 1ZVQA 4Q9IA 4EJSA 5EQTA 2M1XA 3R4CA 2VNHA 3LUBA 1ZK3A 2PD4A 1PDVA 4RGBA 1EB9A 1YBFA 3O0TA 4XZ3A 1EHCA 2EBWA 1F2DA 1MC1A 1T34A 2Q28A 1AC5A 2XMGA 3WLOA 4F91B 4U7HA 1V48A 3MMXA 3JQ7B 4IS2A 4JJ6A 3STWA 1P2SA 1OBHA 3GGSA 1XAGA 2RAFA 4UUPA 5K51A 1YU9A 3W8RA 4CIXA 5HPYB 4TYQA 4ZAVA 1Z9BA 3RRYA 2GDJA 4IJ6A 4NC9A 2O8CB 5THKA 2QOEA 5IT5A 3ZJTA 2XB9A 2QGNA 4YP9A 4X65B 2XWSA 1FTQA 5KOYA 2JDID 2GKOA 3W2EA 5INTA 1T5IA 1A4XA 1MV8A 3PUZA 3QVJA 3ONWA 4CLEA 2B7LA 4ZVKA 4ALKA 1T5BA 5FKJA 5BQXA 1XTRA 1QK3A 1MH1A 4KSBA 4KIFA 4WCVA 3VMMA 1FTWA 4P35A 4MAAA 3FUCA 3E6AA 4JLBA 3ORSA 5AKYA 5HMMA 3EGXB 4MWZA 1BDMA 4NYIQ 4V2UA 3AOEC 1K08A 4AP5A 1PBTA 1Z4NA 2OAEA 4NV3A 2PX6A 5REQB 2ZAIA 5JVDB 1H93A 2DJIA 3GJSA 3HP4A 3G02A 4GKVA 3SU8A 5IN4A 3CVOA 3WRXC 3E4DA 3II6X 3CUEF 3N59A 5CDTA 3GUCA 4OMUA 3I52A 3DCYA 3WC4A 4ZCIA 2FP3A 1XVAA 5CBKA 4U39A 1OXUA 1I2MA 3C3MA 3B6EA 1FPMA 3OFSA 1G41A 1RCFA 2D8MA 4HGNA 4UE3S 1QG2A 3HRIA 4XYBA 4PN7A 4R2LA 2F9MA 1R2QA 4OYYA 3EVZA 4EZBA 3HPRA 3ABOB 4KAJA 4B74A 3ETHA 1S89A 3B3GA 3ZS9A 4O8CA 2ZXFA 3A28A 4J0FA 1VPLA 5CPBA 2VNJA 2DQSA 4FSXA 4J91A 4FYYA 1RQ7A 1Q0UA 3PXCX 3WKCA 1Y4ZA 2KW5A 4YALA 3RUCA 1GT91 3FYCA 2VPTA 2JGAA 1LF0A 5KTOA 4R2KA 4XVCA 4F3TA 2VDWB 3OQBA 4MS4B 3I5AA 4TM7A 2GZ2A 3KZKA 1U0JA 1HSZA 1PHPA 4G5FA 1QX4A 1CS4C 3TS1A 1SC6A 3V3TA 2ZR7A 1TQ6A 3AUTA 1BMQA 3KOOA 5A4KA 3PTAA 2J9RA 2C97A 1KF0A 1VLJA 1X92A 4MJ7A 3INRA 1M0EA 4TL7A 4WECA 3VH1A 1CFJA 5DCYA 1XZQA 4B6JA 1A8UA 1VL1A 4GPEA 5DNCA 1OC4A 4KQ2A 3KWFA 3F5SA 4TMTA 4UPVA 1V3TA 2X9QA 3NKFA 3TM5A 3LM8A 1OAOA 1JJFA 3EXHA 1B6SA 2K5UA 2GLUA 3RWOA 2UVPB 4IKOA 1WS6A 1QIKA 5DTRA 4OL0A 3T9CA 1QK5A 1WMDA 4QYXA 1LF5A 2OBBA 4DW8A 1IL0A 4M8KA 4GQAA 4HPJB 4OXQA 2ZUSA 3G2NA 5I9SA 1AO0A 2PUTA 2P9YA 4NTZA 1N0HA 3UGTA 4DCPA 4AF7A 4Q3OA 3LO5A 1H5NA 3FH0A 5GGYA 5L4SA 3B52X 3FM9A 1ZIYA 4TLLB 2QMOA 3FDJA 1YFKA 1XMSA 4YBRA 2PGIA 3FCSB 4EA7A 3L77A 2AKEA 2HWYA 1BFKA 2E37A 4UJ5A 4O4JA 1NBEA 1SQ6A 1A9RA 3NJRA 3L6CA 1R8QA 3P9XA 4QG7A 5IJ9B 2B83A 2YMPA 2JGRA 4OJKA 4O0LA 1C9EA 1E6EA 4G1BA 4EOGA 3G5TA 3KQKA 1AUOA 4YV1A 3RBAA 2UYCA 4YB8A 3DVSX 2VLBA 1I5RA 2J9FB 1E0SA 5AOBA 2FPUA 5AW0A 1GM5A 5B1YA 4C4TA 2O8EA 1E60A 1OLXA 1T6XA 4HKTA 4G1CA 3A3PA 3S3TA 5JIBA 2VTBA 1ZDMA 1PLLA 2IEBA 1EXMA 2QD3A 4A4DA 1YRHA 1Y63A 4WJLA 3GDHA 4OUDB 4H59A 3SKXA 4Y67A 2IYLD 3GLHA 1FTNA 3EF1A 4OD0A 4Q82A 3HYNA 2R6GA 4OF4A 1OX5A 1AGNA 3DBOB 1U31A 2D62A 3RU9A 2HA3A 1AZLA 3O1IC 3BXFA 1SOMA 3C3JA 3UPDA 2VQ3A 4JYBA 2OV6A 4OJNA 1ONOA 5K7SA 1EE9A 1ECLA 5HKLA 4TMFA 1ZN8A 1QRUA 2QVLA 3H87A 3RUAA 1JFFB 1BG6A 1BMFD 1K6XA 1QUEA 1Y8CA 2WR8A 4BTVA 1KK1A 3UWDA 1OLOA 1X13A 4C20A 1HFJA 3TBHA 4P4SB 1XDSA 2UKDA 2GXSA 3S1LA 3TRFA 3MOGA 4GPTA 4FR0A 2PJRA 3PQ2A 1VGQA 3TL3A 1KJYA 2Q21A 4M21A 1G8FA 2Y9PB 3KVNA 1U63A 4RETA 1G5QA 2DWQA 3GN1A 1OHHD 4RDXA 1D6NA 3NDRA 2ZIZA 4NENA 1O96B 2VAVA 1U65A 4I9UA 3NW9A 5KVSA 2YS7A 3JR3A 1QRAA 3KD3A 3DDCA 3THRA 3WGJA 4S1NA 3Q5EA 3H2SA 1G8GA 3C6MA 4Q48A 5EFZA 4E30A 1OX6A 4CEHB 1NHWA 1TU3A 2GR9A 3KWMA 4GLFA 2V7WA 1VPTA 3HCDA 3MWDA 4FSHA 2LKDA 4Q47A 3RGWS 3SM3A 1UJBA 2XMRA 2SKEA 4EG4A 2GF2A 3OPVA 4QDXA 2ANCA 3Q5GA 4HSGA 3TINA 2BI4A 3HY3A 3CRMA 1G55A 1MJFA 4MUJA 3ADOA 3FCXA 4BFTA 1DCKA 1UODA 2VBCA 4NU0A 4XW2A 5KAPA 1QRTA 3EAGA 2P90A 3C2QA 2OA0A 4FU0A 4CFYA 5JW6A 4V0NA 1XE3A 3RFVA 1GXSA 5JXJA 1FK8A 1P4JA 2A1IA 2DQYA 3KT0A 1Y3BE 2OV4A 3C4JA 1COZA 4JITA 4N39A 3C7CB 1TADA 2H2WA 4AECA 1TT5B 1ZZEA 3LLUA 1V39A 1F12A 2Z95A 1DBVO 1X38A 3HVHA 3OLQA 4WCFB 5JD6A 3C7TA 1THGA 3QPAA 2P5YA 2OM6A 4IDCA 1XEAA 3EASA 5D86A 4WTOA 3EDMA 4IH4A 2W22A 1X9HA 1KNXA 2EJBA 4E7OA 2IZ0A 3FTNA 4O4IA 2XVXA 2ZRAA 4V24A 1YHNA 3MCVA 1ZG3A 3C87A 1G6Q1 4N9QA 4IUDS 1R6TA 1ONSA 4EB0A 3F6BX 4ZV9A 1NPDA 1BN6A 2ATEA 3UJ8A 4BZWA 2DFLA 1VCOA 3D6AA 2KM1A 5D3KA 1E8MA 2H17A 3ET4A 3GFGA 2FLWA 2PYZA 3EXAA 3ITKA 3PD1A 4TKVB 3VPSA 4D0LB 1O87A 3GDGA 1LJUA 4IM7A 4JSYA 4IGAA 5K0SA 2E5FA 1Z8DA 1U81A 1YS7A 3JQ6A 4D41A 4DDMA 5A2GA 3R8FA 5DMXA 3R0JA 3G2MA 1BCSA 1XRJA 4L5BA 3GPCA 4ZU3A 3DG9A 1P18A 3RS0A 1QKKA 3T3NA 4II7A 1GQSA 1QFXA 1GZ5A 1T4GA 2CJWB 3D6NB 4AIRA 5DF1A 3UAZA 2Z6QA 5AVSA 1JNYA 2ACVA 2ZJ8A 3BK2A 1WMAA 5H59A 1E3EA 2I8CA 3N2LA 4RFVA 5JH7A 4TMWA 4CG3A 1JDTA 2IYXA 3ZHVA 2J0VA 2ZI3A 5TRTA 2FN8A 4HAXA 1XEXB 2WWHA 4ZZIA 3U1BA 5IZCA 4OHWA 2RKWA 5IYZA 2FEOA 1T2VA 2BN4A 4KN8A 4NULA 3JR7A 4JI8B 1ZXBA 4UBKA 4BEJA 4PPYA 4JBWA 4AJ9A 2C95A 1IY2A 1DNPA 1T4CB 2C5LA 2HGZA 3VO9A 4LZLA 2ZQ5A 1CDOA 4PVDA 2HH9A 3GFPA 1NXTA 1QB8A 1WHTB 4OCZA 4AO6A 3O3CA 3IRUA 3KLPX 4D4HA 5AKGA 2H2DA 1U6KA 1H2BA 4PAMA 5I4CA 3HA2A 1CK4A 5AIAA 8GPBA 4IILA 2I2CA 1E4VA 3RSFA 2OMKA 4COOA 4L28A 3BYZA 5IKXA 3NFRA 1CUXA 2CLLB 4YYEA 5ENDA 1QFZA 1RYDA 1W35A 2HU2A 3TI7A 2BH9A 1BCRA 2NG1A 3BGVA 3UXMA 4B43A 4C6TA 1VL5A 4BFXA 5K0EA 5AI9A 4BZPA 5CFMA 2DUJA 1TOAA 2ROQA 4DLAA 5BWBA 4TTSA 1IBSA 5A0VA 2O1XA 2XUHA 4FWTA 2R6R1 4Q93A 4R1NA 4B71A 1IEQA 2Q5HA 1SC1A 3PNVA 1H5QA 1YR9A 4FMBB 2Q3FA 1WOMA 4PCAA 4EW6A 4TLDA 5A71A 2H3EA 1MFPA 5AJVB 3EG9B 4EYQA 2C8VA 5G0VA 4TKUB 3QEJA 1VIVA 5L95A 2C7PA 4IJUA 1LW6E 4HUTA 3VHLB 1WU8A 1ISPA 3NV7A 3DXFA 4PGMA 3U4GA 5CEJA 1C1XA 3LXXA 2ZYAA 3A9CA 4OAOA 4MI9A 1NN5A 5K99A 1ZUWA 4B3SB 2NQ8A 3DFZA 5H8WA 2RBGA 1U04A 2YJZA 2XA2A 4O4JF 2OV8A 4RZ3A 4M1ZA 2YJ5A 1OY1A 4G6ZA 4TMKA 4CQMA 2GFIA 1POWA 1QR2A 2CEAA 2R84A 2V3VA 3D1VA 4GKAA 3PEWA 1ECCA 3CZMA 4PSCA 3A4LA 3ZY4A 4MUKA 1FVHA 1DEHA 2DFVA 1MHPA 4OK3A 3C16C 2FWAA 2CMGA 1TW2A 4FZ5A 2EOAA 2JFFA 5E4JA 5TY0A 5M7EA 2PNJA 3OZEA 2WTNA 3RBVA 4R84A 4LYAA 1TJ5A 2ECFA 2ZJZA 4UBNA 5AM3A 3JALA 3JAWA 1IPFA 1PGNA 3PKJA 1M2OB 1WUKS 1X2EA 3L5KA 1N2HA 4KXLA 4LDZA 5CYFA 1A4RA 4W5OA 4HH0A 4OHXA 2Q2OA 5LDHA 4UU1A 2ZYTX 1O54A 3EB9A 4J0DA 4R51A 1YMQA 3QKUA 3GGGA 3HFRA 3P97A 3PNOA 4L9RA 4WINA 3VU0A 1HI9A 3AS