1E2GA

Human thymidylate kinase complexed with adp, tdp and a magnesium-ion
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
209
structure length
205
Chain Sequence
b'RRGALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTEIGKLLSSYLQKKSDVEDHSVHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAKRGERYENGAFQERALRCFHQLMKDTTLNWKMVDASKSIEAVHEDIRVLSEDAIATATEKPLGELWK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THYMIDYLATE KINASE
publication title Insights Into the Phosphoryltransfer Mechanism of Human Thymidylate Kinase Gained from Crystal Structures of Enzyme Complexes Along the Reaction Coordinate
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 89
structure length 205
sequence length 209
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2000-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1e2gA00
2D62A 4NYJR 3HR8A 4QL3A 1RIFA 1N6KA 3M4YA 1VECA 4KSCA 1R6BX 2CMKA 2KSQA 1HY3A 2MMCA 2AWNA 4Q4JA 4OHZA 5BQ5A 4CEIA 3U5ZB 1Q44A 5BN4A 3ZS8A 4ESHA 4EPRA 4FW9A 4I81A 4Q7LA 4CT5A 4NYMR 1RYHA 1W47A 1NF3A 1ZU5A 3E1SA 2DBYA 2NGRA 3IEUA 4B74A 1L8QA 2VHTA 3LXXA 2DR3A 1JI0A 3B78A 3NH6A 4L4UA 4X8MA 3W8RA 4B76A 4XVUA 2GXUA 2ZSEA 3ZD6A 2QRNA 1KI9A 2NIPA 1M74A 1KMHA 2C9YA 2R62A 4LBZA 4TT3A 2BV3A 4YDHB 5FUYA 4C2TA 4XH9B 3OF5A 3X1WA 3B13B 3WHKA 2QP4A 5TMPA 2DHRA 3B7GA 2I4IA 1Z5ZA 3VX4A 3MG9A 4G5QA 1ZJ6A 2O8BB 1J8MF 2JLYA 2KB0A 1GNRA 2ZR0A 1J70A 4G01B 1TU3A 1UM8A 1G3RA 3TQCA 3FGNA 3KJHA 5GVRA 5L3SB 1EWQA 3SZRA 3ASYA 4H1UA 1N3BA 2FFHA 3GLFB 2NG1A 4JVLA 3AVQA 3G82C 5C2JB 2GBLA 1FFHA 3Q5DA 1BS1A 2XNSA 1JXMA 5LD2B 4AWXA 1H8ED 4TTRA 5CIWA 1U98A 3MRSA 4QM6A 2QAGB 4EJSB 2CDNA 2WJYA 3FMFA 5A5GA 4DIEA 1CR2A 2PZFA 3KUCA 3UWOA 3M1IA 3KKPA 4BFYA 3ECCA 4KI0A 1JJ7A 3QOFA 4ZIRA 3D8BA 1VDZA 4GSYA 1Z0FA 1H65A 3QY0A 4TL7A 5ANRB 4MITA 4PHHA 2ZRMA 2JATA 1Z47A 4NYIR 2QY9A 3VFDA 1VPLA 3LRPA 3NXSA 4LBWA 3ZH9B 2WJIA 3FMPB 3OEHA 4B33A 4V0KA 1II8B 4JJKA 1UKVY 4PZZA 3TBKA 2C8VA 4C0JA 3U6BA 2A5DA 2QMOA 4Z8XA 1XJQA 3EWAA 3RS4A 5EP3A 3UANA 3C8UA 2YYZA 3BK7A 4M53A 3UIEA 3DOFA 4IVPA 3CZPA 1QHYA 3UKDA 3EA5A 5AJXA 3QKSA 3EWSA 1Q57A 2A7QA 2QPAA 2W58A 3K8YA 3WNDA 1M7HA 3GLIB 1TAGA 4DT1B 2ZRBA 1G7TA 3AF0A 3C16C 4A92A 3P4YA 4DCVA 2HUPA 5SZJA 2A5JA 2JJ1D 2H7VA 4JBXA 1KO7A 4JKYA 5CK4A 3T5DA 3F3YA 3KUDA 4Q4JB 3WBJA 3FWYA 3ZZTA 5GVSA 4CEIB 4HZIA 2OSBA 5CB6A 3U61B 1OH7A 4TLCA 3H0KA 1EFRA 4BRUA 3TRFA 1ZUHA 3AF3A 1HV8A 4D0GA 3EARA 3ZLJA 4RSGA 2ZYWX 1PLLA 5L3RA 4D81A 3U3RA 3GPLA 1GSIA 3CF0A 5L3QB 1IXSB 4NMMA 1KK2A 2ZRHA 4LHZA 5L8VA 3CO5A 2WOJA 2Z83A 3CF6R 2NO0A 2FNAA 1UBCA 1E2HA 4G1UC 2VHQA 4NDZA 4AG6A 1ZNWA 3THXA 1VKJA 2F1JA 1XZPA 1LB1B 1Q1EA 1X8LA 1RKBA 1P3JA 2QUZA 4DUGD 1UEJA 2IHYA 2WSSD 2BJWA 4HAUA 4B3FX 4OK5A 4URUR 3FKQA 1DEKA 3U4QB 3ZJYA 4S35A 3R9IA 4HUTA 4F4CA 4B2IA 3AF2A 1CF4A 3KQNA 1E0SA 5DYIA 5HKKD 5FOSA 5C1BA 4E5UA 2ZI5A 4MRPA 4P31A 5FBVB 3KZ1E 3Q85A 2AR7A 5AJYA 3E5HA 4FMDB 3SFZA 1XCMA 1ZM9A 5DHFA 2HXYA 5E7MA 4KO8A 5F9HA 1AM4D 1R10A 3D3QA 3TH5A 3LXRA 4A8JA 1MRNA 4D4KA 1VCIA 4IOMA 3A1VA 2ZS8A 2AFHE 4LJ4A 1FMJA 5FTJA 3EX7C 5DLQC 4NCNA 1AS3A 3K9NA 1CR0A 4N0EA 2AD5A 5JI2E 2FPKA 5LD2C 4BRWA 4PZYA 3TSWA 4OI2A 4GDFA 3N2EA 3THOA 3BD9A 4FIDA 2N42A 4BFSA 4EJSC 1I4TD 2ZSAA 3FHOA 4GP7A 3OIYA 1NY5A 3TVTA 3K70D 2J45A 1E98A 3DHWC 2IXFA 1CXZA 2WICA 1TQ6A 1RZ3A 3CLVA 1TNDA 4PTLA 1Z6YA 1H8EA 5F9FA 5H68A 3B82A 4HDOB 4IOJA 4CDGA 4XVRA 3AKDA 3ONWA 2VF7A 4EIWA 2Z43A 4MKHA 4Q1CA 4HLUC 1KIMA 1O3YA 1YRBA 4V02A 2JA1A 2LKCA 1KI2A 1IN8A 1MO5A 1ZC4A 4KBFA 4RZUA 2ZAMA 3MD0A 5TDHA 3IO5A 3QKSB 2WVJA 4BE7B 2QGZA 2CL0X 3K0FB 2C9OA 2W00A 3C14C 3QBTA 5J4VA 1R2QA 3RANA 1JAHA 3LW8A 5JJIA 2FZ4A 5C4GB 4D0NA 1P62B 4HLCA 4D4JA 1P9WA 1ZD8A 2RMKA 5FFMA 1G291 2OAQ1 1AGPA 3LDAA 2CCKA 4US2R 1QVRA 1SVOA 4DC9A 4JLMA 1KJWA 2ZRAA 3W90A 1TEXA 3VHXA 1S3GA 3LQRA 4QJ4A 1M1YE 2XGJA 1J90A 4ON9A 1E9DA 4A0HA 4URXR 3LH5A 1WA5A 2QTHA 3CRVA 4LWZA 3EZ7A 4RKFA 4UJ5A 3UPUA 1RPZA 1R0ZA 2IYTA 1R5NA 1Z0KA 1JNYA 3I4LA 3PR1A 4O3MA 1E2NA 4ARZB 1EWRA 1R7RA 4MRVA 2JJ1A 4NBSA 3JZAA 3VU9B 2ODBA 3CPEA 3WXMA 2V55B 4E03A 3LVRE 1P2TA 4LV8B 4TYNA 4CW7A 1XD2B 1NVVR 3TE6A 3LBNA 3SS8A 3U7HB 1NN5A 4LC0A 3NC1C 4IVRA 2CXXA 2YHSA 3K0CA 1ZM7A 1Z0DA 4Q1BA 5D3QA 1N6IA 1OYYA 2HJVA 3QXXA 4OK3A 5FTKA 2CHVA 2D3WA 3BH6A 1HQCA 1KHTA 1T5LA 3PG5A 4C0BA 1U0JA 3DMDA 1UKZA 1QHSA 1OXUA 1GNQA 3BOSA 2AHOA 2ZIAA 1Z0IA 2R8RA 3SE0A 3SOPA 1C9KA 4I1SA 2RHMA 1KDPA 2VSXA 5KDOA 3TGPA 2K5UA 2PJZA 1GILA 1S1MA 1TL7C 2OFXA 4JJZA 1S9DA 1YVDA 4BZXA 2PCJA 2W6JD 3FHCB 1HEIA 2WIBA 3C4JA 4PC1A 3VR4A 4DUGA 3AVYA 3QXHA 4JL6A 4LRWA 2WSSA 3NBFA 4PSVA 3RAPR 3BGWA 1DG1G 2KI5A 4TMKA 5C18A 4KU4A 4MRRA 2O8FB 1G3MA 2GCOA 2MSCB 5HKKA 1IONA 5G53C 2WWGA 4LSGA 2CEAA 4RD6A 3FOZA 3I72A 1C4OA 2WIAA 4NYMQ 3K9HA 3EC1A 3U3JA 1JAIA 3JVVA 1NMZA 3KXIA 1P61B 3AF1A 5J40A 2F7SA 1DPFA 1JR6A 3CUEF 4DLWA 3IPYA 5JSZB 3CKLA 1QDEA 3ZIAD 2ZANA 2IYYA 4FMBB 1OXSC 4IRUB 4WAUA 4OI0A 4JL5A 2FN4A 3DPUA 5KNBA 4BGDA 4TQUS 4ZI2A 4QHTA 1VIYA 2RGDA 2DPXA 3EZ6A 3KJIA 2GK7A 4HB2A 1U94A 3IO3A 4JT2A 5EP1A 3T1QA 1KOFA 2OLKA 1SZPA 2BKEA 5EE9A 1HURA 1KI6B 3TAHA 2VP6A 5JJKA 1DBSA 1SHZA 2J9RA 1P2VA 1PUJA 5IK2D 2REOA 2PH1A 2IF0A 1I2DA 4PXAA 2AWOA 1WMSA 3ZVMA 4QGGA 1E9RA 4EAQA 4HSEA 2WWXA 1AN0A 4DCTA 4I99A 1NI3A 1DARA 3GMTA 2ZRLA 2FFBA 1GDDA 1IXZA 4IFBA 1YU9A 4WA7A 5FOXA 2BJVA 4BEBA 1E4YA 2IXEA 2QT0A 4P32A 4Y0AA 4AYXA 2AX4A 1AA9A 1FW6A 1LVGA 2BKUA 3Q7PA 4QBIA 2W0MA 5KOYA 1W2GA 3U7GA 5FUVA 1IBRA 2VYFA 1N6RA 3SJAA 4Q1FA 1QHIA 1W5SA 4AKHA 2XTNA 1XDBA 2FJUA 4M8NE 1IY0A 4XJXA 4ZDJA 3GLGE 4NYIQ 1KO4A 2QBYA 3LX5A 4GOJA 221PA 2X2EA 3KX2A 3RYTC 3HPQA 4ACBA 2AXNA 2R6GA 2W6ID 4JYCA 2FSHA 1RFLA 1VCMA 2OFOA 4LPSA 2J59A 5HZHA 1E69A 4G5RA 1F2TB 3RWMB 3REFA 1P9RA 3NKVA 2ZYUX 3HWSA 2FF7A 2FEOA 2XOKD 2O8CA 2BDTA 1DVRA 1FPMA 3LWNA 1YR8A 1HTWA 2ZRGA 1KY2A 4DEXA 4LY6A 1XP8A 4KYUA 621PA 4QFMA 3PV0A 5B58C 4TQAA 3DKVA 4Z51A 2XB2A 1CS4C 4WW0A 5KTYA 5TXGA 3C7KA 1TF5A 2GXSA 2X77A 1T0JB 3UMFA 4LHXA 4GOXA 4A2PA 4BASA 1US8A 1OFIA 4KFRA 2FSIA 721PA 2IEZA 3ZVNA 3KKQA 4UJ3A 1AZSC 2IHBA 2I1VB 4LJYA 4D25A 1EG7A 1IN5A 1XX6A 3IILA 1YQTA 2WV9A 5EXTA 3RRMA 4ASUA 3OHMA 3O8RA 2W6JA 4LHVA 1ZUNB 1F5NA 4FMCB 1Z83A 1ANKA 1TUEA 4F4JA 2Z4RA 4TLBA 5CDFA 4DDVA 1YJ5A 1E2JA 4M9XA 1W5TA 1KO1A 3EG5A 2VSOA 3T12A 3MGCA 4RFSA 2YOGA 2ZS9A 4LHWA 3FB4A 4MDFA 4A6PA 1NL3A 4P4SB 4XSHA 2XTMA 4HB0A 4TLEA 3WNBA 4XVQA 2AD1A 2OV2A 4Z1MD 5K8TA 4B6EA 3CR7A 4RCZA 1COWD 3LVQE 5DNYB 4ZDKA 4BFWA 2G88A 2WKQA 1RVDA 1FZQA 3K09C 1XPRA 2RGGA 4C3ZA 2YWFA 4US0R 3ASZA 2OUKA 3CZQA 3MMPA 1E32A 1GWNA 3ZIAA 3BC1A 4LV6A 2A9KA 4NCIA 5J5CA 4AK9A 4DCNA 2E9SA 4G0NA 2VF8A 4UQOA 3T35A 3QBVA 4QGAA 1G3QA 1GIAA 2WSMA 4RFVA 4C7OA 4D80A 2E1RA 5CYPA 1E79D 1II0A 1W4CA 3TVDA 4LHYA 3A4MA 2O8EB 2PT7A 4JL8A 3A1UA 4NONA 1E9AA 1WRBA 2F3RA 2VHCA 4K8OA 3UK6A 2R65A 4V0NA 5IK2A 1LS6A 1U0HC 1P7CA 3MWKA 4BLPA 2VP5A 4RKEA 4MGIR 1XTQA 2IYSA 1M7BA 3EIEA 2G3YA 1XBTA 5AUOB 4BZPA 4C0SA 1XMSA 2WJGA 1DAHA 1X86B 1XEFA 4HEJA 3MWYW 2OT3B 4LYAA 1I2MA 2XX3A 1YZLA 4L15A 3GLGA 3KB1A 4BLSA 4R2IA 2F3TA 4RVCA 4TTPA 421PA 2YC2C 2JLSA 1IHUA 2O8CB 1XEWY 1AKYA 1OB2A 1TUIA 2EWWA 1KK1A 1Q1ZA 2OCAA 3MAAC 1UADA 2WPDD 1D2EA 3KDSE 3L43A 4OL0A 4BFXA 1W4RA 3U44A 2FE4A 1N5KA 1OHHD 5CIQA 3RC8A 3OESA 4W9MC 2IS4A 1EX6A 1HYQA 5LDDC 4ZO4A 3ADCA 4EDHA 2OEPA 5K8LA 4R98A 1JR3D 2W6IA 3LY5A 3MUFA 3CRQA 3C5HA 2JLVA 4W5JA 3QF7A 1US8B 2J0UA 1XD8A 2FPMA 2JGNA 1ZU4A 4WXRA 4WOPA 3GJ8A 5EE5B 3W34A 5G3ZA 4V03A 4KSBA 2NMVA 1XMVA 2XOKA 3G5UA 3KXLA 3MCAA 4Y0VA 5CK5A 2CL7X 3RVBA 3L82B 1JR3E 3FDIA 5BXQC 3AP1A 3WRYC 4X8OA 5K8UA 1R4AA 1UFQA 1YZNA 4W7SA 4CVNA 3H1TA 4PX9A 3KKNA 1XNJA 2HCJB 1AQYA 2QE7D 4Z8YA 2V6JA 2WWWA 4DJTA 2YWGA 2OCBA 4B3DA 1WCV1 1D8TA 1KZ7B 4NCJA 3TAUA 2VP2A 3GFPA 3BB1A 1PLKA 1WQ1R 1NVVQ 2PCLA 1P2SA 4GRAA 4W5HA 4JLVA 2FSGA 1S9HA 2V4ZA 3A36A 4BLRA 1Y3AA 1Z06A 4IFEA 4M1YA 1QG4A 3FYHA 2QPTA 3X1ZA 2DB3A 4F4IA 3RS3A 2BC9A 5BYJA 3AEZA 5K8IA 5B2ZA 2KE5A 3O8BA 3QEOA 3ICEA 2H16A 3GJ6A 1GL9B 2RGNC 4KFSA 1SXJB 5DI3B 2BMFA 3NEJA 1ZC3A 3OZXA 4MYCA 5IF9A 2XSZD 1FUUA 1NVWQ 1ZM2A 2XJ4A 4M2LA 4PZLA 4C7OB 1WE2A 1YHNA 4XTRA 1ZNXA 4XWKA 1SVKA 2O8DA 4DDTA 4Z1MA 2G0NA 2HYDA 3KJEA 1YZGA 2HV8A 1COWA 2HF8A 2O0KA 4LGMA 4O25A 2C99A 3KQKA 3NVAA 4D6PA 1JPJA 5AUPB 1PZNA 2FH5B 4KJZA 1OB5A 5DHAA 3ZYCA 4ACAA 1G8YA 3NG1A 2IYWA 1XRJA 1Z8FA 4Q9IA 3E2IA 5BN5A 4N0DA 4XWOA 3R8FA 2XZLA 2IC5A 2O0HA 4TZ6A 4CGZA 4DSOA 3CH4B 4TTQA 1E79A 1CJVC 2P6RA 3SR0A 1VG8A 5EP4A 2CJWB 4UNPA 2FX3A 3B60A 4C4PA 2WJJA 2Q9CA 3CF2A 2ZU6A 1NIPA 2HF9A 2UZ3A 5JCPA 2W0SA 5KPJA 2ZI3A 3U44B 3T1OA 2QT1A 2WHXA 1ZYUA 2EWVA 2W2TA 1EGAA 3AGQA 3TMKA 3T1TA 3NDBB 1N5JA 1U99A 1A1VA 2ZTSA 3BS4A 4BFTA 3Q3JB 1T8TA 2DFLA 1NG1A 3FMOB 3LO5A 2GK6A 4HAXA 2J0UB 1P4SA 1NSTA 3RNLA 4A15A 2Q3MA 3MJRA 4LZZA 4TQ9A 4DLSA 1JXOA 4KLZA 2QZ4A 4BLTA 3L0PA 5CLQA 4Q19A 4QC2A 2GEUA 4PAOA 2EYUA 2YV5A 4BUJA 2AL7A 2WPDA 3QSYA 4G5OA 2GKSA 1R5OA 4P0TA 1OHHA 3PEYA 5HTKA 4BZQA 5LB2A 5FUXA 1IJFA 2OCYC 2YOHA 4U02A 1JR3A 1EFTA 5E7JA 1CP2A 1CJMA 1AIPA 1GRNA 1KK3A 2A5FA 2ZSBA 2GVDC 4XOIA 4RZXA 1GL6A 2JLXA 1DE0A 4DVGA 3I62A 1A2KC 2OZEA 3V4FA 4MA4A 3KTAA 3BB4A 1MO3A 3RHFA 2XXAA 1NRJB 3PCRB 5EQTA 4A2QA 4D4MA 4J0QA 3SBDA 1NJGA 4LUCA 4DB4A 2FA9A 3W6OA 4ZDIA 1FL9A 3THWA 2NPIA 4YMTA 1B0UA 1DELA 5FPHA 1SKYB 1QHHA 3FVQA 4R71A 3IEVA 3N2IA 3O8DA 4Q4AB 4NCKA 2QE7A 4R7ZA 4M1SA 5TB5A 2ZRNA 4D2IA 2GZHA 3I3SR 4TN1A 1Z29A 2IUTA 1G17A 3IQXA 3WYGA 3GCGA 4AC9A 2H1LA 3SJZA 4DKXA 5L3VA 1RRPA 2JDID 2ZJBA 2ZRKA 2ZPTX 5EZ5A 4IDHA 4YONB 1OE0A 1RRFA 2Z6VA 4E07A 1LY1A 1Z2CA 3IPXA 2V1UA 4NE2A 2J0SA 4MRNA 3TR0A 1F6BA 4Q47A 1SXJC 1XEWX 1OV4A 2HXSA 5AJZA 2XNDD 2ZJOA 2DFNA 4C2UA 3LA6A 5CITA 1OXVA 2FU5C 2FGJA 4PC2A 3QG5A 1KKMA 1MKYA 4Q21A 4B35A 4AG5A 4L8GA 2IK8A 1HT1E 1OH6A 3LFUA 1OW3B 1P5ZB 2B21A 1TF7A 1X6VA 2XSZA 5LB4A 1T0HB 3QVUA 4DDUA 1Z6GA 1ZINA 3QVVA 4FN5A 4G3XA 2GZAA 3LV8A 3LD9A 2BBTA 4DDWA 3LW7A 3QE0A 5F2EA 2OBNA 4MKGA 1OFTA 1S1CA 2WJVA 4H1VA 4A0GA 1XFAA 3D6TB 1KMHB 4Q7KA 5KO2A 2A5GA 4RD2A 3DOEA 2GWHA 3W9YA 3VQTA 3LNCA 2J87A 5D3MA 2ZR7A 4WZBE 5TVKA 1GRRA 4NTZA 1G20E 2ZE8A 4K46A 1LFDB 4S2EA 1P6XA 2ATVA 1EESA 1UBEA 1ZD9A 2P67A 2YWHA 4RD4A 1CJTC 1OT3A 1ZVQA 5KSPA 4O0MA 4CF7A 3PENA 4GBMA 2D4HA 4YXWD 1P72A 5JRJA 1FMLA 3B5JA 1NJFA 4YC7A 4QGHA 3AVPA 3A8TA 2HDNB 3W3ZB 3T5GA 3TQFA 5EXSA 5DGXA 3A6PC 3QQ5A 4LJ6A 2C78A 5KUTA 4P4TA 3MWLA 2BIFA 1XMJA 1W0KD 3SNHA 4B75A 4HATA 1NN1A 3RABA 4BFUA 1GUAA 3PIRA 3WMFA 2EFGA 5CJ2A 1T6NA 4NP6A 3TJZA 2GJKA 1DS6A 3CRRA 2B6HA 3ZVLA 3VNUA 4B48A 4FCVA 1OSNA 5JECA 3VKHA 2WKRA 1VG0B 5G40A 1EX7A 1U2RA 1BYIA 3W5JA 2QROA 3BFVA 2WJHA 1XTJA 4ZIRB 1KI3A 2EQBA 1NVUQ 2ZXUA 2PX3A 5B64A 1X1RA 4HUQA 1A82A 1T4GA 1ESNA 4BFZA 3LAWA 1SVMA 1XZQA 3OEED 1W2HA 1GKYA 2QAGC 1Q12A 2A3RA 2IYUA 2ASEA 5HCIA 5DH9A 3BH0A 5CM9C 2VQSA 2XTZA 4DLRA 2D74A 1YE8A 1N5IA 3DDCA 1AK2A 2GAOA 1KTVA 5JRZA 4GP6A 3RRNA 2GNOA 1JALA 2CE2X 3BIFA 3QKRA 1FTNA 2MMGA 3CX8A 5FBWB 2ONJA 2C96A 2QTVB 1MH1A 1ZM4A 4P4UA 1U9IC 1M2OB 4MKFA 4DLZA 1ZCAA 1ZRHA 4LJ7A 3L2OB 1CR4A 3PEUA 2CNWD 2WWFA 4TWZA 3WP1B 2OFWA 4DIDA 1XWIA 4FI3C 4PAQA 1D2MA 4OHXA 3PUVA 3V00A 4YMSA 1W49A 2ORWA 4OQMA 3S1AA 4PHGA 5JCZA 2JEOA 1Z6AA 1WBDA 1YRAA 4E22A 4PR0A 3RDPA 3RLFA 3U3OA 1W36D 1A2BA 3PUXA 1YKSA 4DEYA 4XSGA 1NLFA 4D4LA 2UKDA 4I1VA 3A4LA 4OJKA 2WWIA 1R0WA 2QSYA 2RGCA 4M1KA 1DAFA 1UDXA 4YMWA 1HE8B 2RB4A 3P20A 3SJBA 4BECA 5KSZA 2R2AA 2NQ2C 3NIBA 4X8HA 3NTUA 2JDIA 2N46A 4B44A 2PMDA 5B30A 5ELXA 1VHTA 1BH2A 1BKDR 1G8HA 2YOFA 3I1FA 1VMAA 2GHIA 3K1JA 1ZIOA 3TSZA 4TYYA 2NPFA 1NSFA 3CM0A 2V7QD 3TKLA 1G16A 2VEDA 3VR6A 2V9PA 2R6DA 4OK6A 1Q22A 3L0OA 5HE9A 3THXB 3A37A 4PQRA 3AKCA 2XNDA 4PSAA 2QEQA 2C2HA 4IJMA 1FNMA 2GJAA 2ZU0C 4LYFA 5KHOC 1AGRA 3CIOA 4AI6A 5GJBA 1K8RA 1YZUA 1NBMD 5FL7D 3DO6A 4NHOA 3CWZA 3NHAA 3BBPA 2SHKA 4JVMA 1DAKA 1CBUA 2IT1A 2NO9A 4B6FA 2H8KA 2IYXA 1MABA 5AJVB 2REXB 3SYNA 4D26A 1KY3A 3HPRA 2VP4A 3K0AA 3AUYA 2LKDA 2VHUA 2JLWA 1RJ9A 3BORA 2QU8A 2YNMA 3IDQA 4PSKA 4TYQA 4Q9HA 2XZOA 2WTUA 2QORA 1NBME 2R6FA 5J47A 5BYKA 2VTKA 4OI4A 3U60B 3VHLB 4A8JB 5DN6D 1E2MA 2DFTA 1ELOA 1Z0JA 2A5YB 4JLAA 4NYJQ 1Z3IX 5JEEA 2BBOA 3BB3A 1GKUB 1OIXA 2GBLC 3KJGA 4YXWA 3WMGA 1DAIA 1CLUA 1E1RD 1ONBA 2VHJA 1QHNA 1OLOA 3PEVA 3KQHA 1G5RA 3W6NA 4HUQB 4IDNA 5G3YA 3T06B 5M04A 3ADDA 1MO6A 1DADA 1W0KA 2FEMA 1ZCBA 4PHTA 1Q20A 2G83A 4K81B 2DWPA 3IBYA 4QNMA 1G5TA 2NZ8A 3QKRB 1Z6XA 4ZKDA 3DZ8A 5FBLB 1NN3A 4A4DA 4EFMA 1FTSA 3ZZUA 2FV8A 3N5CA 3QXCA 4G5SA 3SC3A 2P6UA 1NLZA 2CLCX 2GZDA 4RY2A 1M7GA 2BVNA 4MYTA 4DLYA 1DAEA 4LC1A 3IBGA 3OEEA 3TNFA 2IWHA 4CYMA 2HEIA 4XD7D 4LI0A 4Q1DA 2BCGY 3IUYA 1IXRC 2IYRA 5E4FA 4CZ2A 1VHLA 3THYA 4KITB 1VG1A 1MR3F 2GESA 3HP1A 3X1YA 4DSNA 2ZS7A 2ZUBA 3B85A 3LQQA 1KO5A 1NKSA 3BJIC 4M1MA 3CR8A 3DMNA 1RRCA 1Z28A 1YR7A 1GITA 2VP9A 3GLHE 5HPYB 2AKYA 3AKEA 4II7A 2MSDB 5JBQA 3B1VA 4TL9A 1PVOA 1CRPA 1UF9A 3CBQA 4NU0A 2CNWA 1T8UA 3QKUA 3R20A 4N1AA 5FPSA 3W3AA 2GVZC 2VLIA 2X1VA 3RS5A 3KQUA 2CL6X 1CR1A 2D2EA 1XXHE 2QQ0A 4BEJA 5TY0A 4CEJA 3P26A 1Q3TA 2YZ2A 2QRZA 2Z0MA 1BIFA 4M9QA 1YZTA 3DL0A 2XAUA 1F2UA 3CH5A 3NBYC 1R8QA 3LLUA 4F92B 1E2QA 3EPJA 2QNRA 2VL7A 3VR2A 4UNRA 3IKJA 4NH0A 3T34A 1WDTA 2D2FA 2XJ9A 2ERYA 1M34E 3LX8A 4N3NA 2JIZD 1OIWA 2G77B 1GP2A 2IL1A 2V7QA 8OHMA 4ERNA 1IJEA 1E9CA 4EKDA 4LJ8A 3AKYA 1Z63A 2BEKA 4I1OA 3CX6A 3GJ3A 2ZE7A 1W1WA 1OF1A 1TQDA 3J81k 3VKGA 1FUKA 4IDOA 4OJQA 3RWOA 3I5YA 1C1YA 1NLYA 5EE0A 1NBMA 5FL7A 5UKDA 3ZQ6A 4GZLA 4O2RA 4P33A 3V4RA 4X8LA 1OIVA 1YZQA 1A5TA 3CB4A 4TL8A 1X8KA 4A9AA 3IIKA 2Y8EA 3KXKA 4WBSA 2GCOB 1ZMXA 2V1XA 1GRQA 4F7WA 3EIQA 4EPWA 4A8JC 1L4YA 2PJRA 2CHQA 2ZEJA 3UXMA 1G4UR 2R9VA 2QMUA 4Q18A 2OM2A 4R9UC 3TLXA 4B2LA 5DN6A 5KU1A 1W46A 2YINC 2OXRA 1VYTA 3H2YA 3GLFE 3ZDQA 4OQXA 1N6NA 2PZEA 3A1SA 5FOUA 2QMEA 1TPZA 2ZJAA 4IDQA 2IYZA 1E1RA 4QKQA 4YQFA 2HYIC 1J7KA 5H8WA 3WMEA 1E2LA 5CLLA 2XEXA 3VR1A 2H17A 4DBLC 4LCBA 2ZSDA 2Q6TA 3ZQJA 4BLQA 2FDCA 3SU8A 3K70B 2ZI6A 2NZJA 4FCWA 2F1HA 2R6CA 1KJZA 2BCJQ 1QG2A 2ZVPX 1KJYA 4U7DA 2ZJ2A 4MRSA 2Q3FA 4WVFA 1UJ2A 2PT5A 1KSFX 3H86A 2A2ZA 4OHYA 1VCNA 4C9BA 4Q5IA 4JMPA 2QMHA 1SKYE 1OH5A 3FKSD 1PUIA 3C15C 1JECA 3GLHA 4M4SA 1SVWA 1JEEA 2Q0HA 5HCNA 3U3KA 5FBRB 3CRW1 2ECKA 4XD7A 1TU4A 4GPTA 5FOWA 4AKEA 1Z07A 1N6PA 1T91A 1L4UA 1XCPA 1S8FA 3OAAD 2FSFA 1RE0A 1W36B 1E9SA 1S0UA 3WHLA 2QTFA 1XPUA 2QGNA 2F9LA 2V6IA 5FUWA 1E3MA 2GJ8A 5J4HA 1GAJA 1ZNZA 1ETUA 1HT2E 1ZNYA 4NL4H 2H5EA 3GLIE 2QBYB 3G0HA 4DLXA 3UMSA 3PXGA 2R6AA 4PANA 2J7PD 1IY2A 5JWHA 4IEIA 4PFSA 2IF2A 2AKAB 2CVHA 3LBHA 3PVSA 3AVUA 1GG2A 1CJKC 4EQ6A 3OFND 1UKEA 4JLDA 3A1TA 4AYWA 2GXAA 1OPXA 2IUSA 2AXPA 2O5VA 2RAPA 3T15A 1V5WA 2EFDB 1ZM3A 4URWR 4MYHA 4DB2A 2QP3A 3K0CC 2EFEB 1Q1QA 1TADA 2BWJA 3K0EA 1TQ4A 3AGPA 3K9GA 4FXPA 4L9WA 1A4RA 2QN6A 5CYOA 4E09A 3EPKA 3HR7A 1D2NA 3V9PA 5AK0A 1P2UA 2Z4SA 4PO9A 4QHSA 4DZZA 1AQUA 1Q3HA 3LBIA 2YKGA 3ND8A 2D7DA 1WF3A 3TR5A 3P4XA 4D0LB 4CIDA 3ZD7A 2JIZA 1II9A 4V0LA 5FOVA 3GFOA 2RH5A 2ERXA 2QPOA 1DOAA 2G9NA 4TMZA 4Z54A 5EXXA 1P60A 4PPGA 1VYVA 2B92A 1W0JD 2VBCA 4PO8A 2CVFA 3F0TA 1XD9A 3QUSA 2GETA 4IOLA 1V43A 2VPPA 1KDTA 5EXPA 3CPJB 1ZP6A 1N2CE 3PFIA 3REGA 3TUIC 4RFSB 5C46F 4L5BA 3WRXC 4M9ZA 3EZFA 5L3SA 1XCGB 1F48A 4UXJA 5HR5A 3AP2A 1NMYA 3HU2A 1T9HA 3EA0A 4DSUA 4MDEA 1D5CA 4GZMA 3P32A 1HUQA 3BFXA 3U6KA 4TSFD 1E2PA 2XZPA 2ZI4A 1I4DD 2Q9BA 2FG5A 1X1SA 4MGZR 1JBKA 1R5BA 3CX7A 2ZI7A 2O0JA 3RRZA 4EJSA 3CNOA 5DYGA 2HT6A 1S4QA 2OBMA 2RGEA 3QG1A 5CM8B 4AY2A 5JI3E 2WWHA 2ZRCA 4BFVA 3K70C 4B73A 4POAA 2WAXA 2OO7A 3SI7A 4DCSA 4HAVA 4B3GA 2HLDD 1CKEA 1JQLB 4HLUA 3IHWA 1FP7A 1IY1A 5LBIA 4JLNA 3EPLA 5GADl 4ESVA 1GTVA 3DVLA 4LYHA 2ZQ5A 3TUJC 3EW9A 3ADKA 1E9FA 4LK2A 2RGAA 3Q72A 3AM1A 4LJ9A 4PPNA 4W5WA 1G18A 3BAFA 5JJLA 2CCGA 1XTIA 1T5IA 2H92A 2WM9B 1ZAKA 2Z5FA 3EC2A 3L0SA 2PBRA 1Q21A 4HI0E 4JYBA 4QXAA 4LBVA 3I61A 5F3WB 4ZV4A 3R9WA 3TSOA 1A7JA 5C4MA 4TLDA 4PQFA 2D7CA 2JCSA 3FKSA 4EFNA 4TMXA 3GLGB 3TK1A 4EUNA 1G8PA 1ESMA 1QHXA 2C95A 5FPKA 2F55A 5FBQB 1N0UA 4DT1A 5KSOA 2BBWA 4P3YA 3QEJA 5DISB 1OYWA 4A6XA 3Q7QA 3B9PA 3NBZC 5AJWA 4KFTA 3WP0A 3OAAA 1D9ZA 3Q5EA 3I32A 1AS0A 2ZREA 4Q48A 2IXGA 4L9SA 5FOTA 2BMJA 3VR3A 5EE3A 4JSTA 1JQJC 1DO0A 5J4KA 3GD7A 1XTKA 1Z0AA 4JS0A 5JHGB 3IIMA 1AJEA 4AKGA 1XJCA 1SVSA 4KVAA 2J7PA 4M9SA 2VSFA 1DO2A 2GAAA 4M1TA 5DE3A 2G6BA 2Q3HA 4MGYR 5L3QA 2F6RA 4MH0R 3Q8XB 3AV0B 3GJ5A 3OFNA 5SZKB 4DRZA 4IVQA 1MO4A 3QXSA 4EPYA 5FTMA 4YLGA 4B43A 2ZRPA 2CCJA 3VR5A 1RYFA 3E70C 4A82A 4Q4LA 1S3SA 2KBEA 4XIGS 3W6PA 2GILA 3CPHA 1Z22A 3M6AA 1XF9A 1TTTA 1X8JA 2I1QA 3R8CA 1E4VA 4TL6A 1BMFD 2RGBA 4LX0A 4US1R 4OQFA 3U4QA 4QNRA 4QG7A 4LDJA 4DCUA 1DAMA 1E2FA 1G4AE 2FOLA 2ZRJA 4Q9LA 3WBKA 4Q03A 2VP0A 2RGXA 5IDVA 3X2SA 4MKIA 2EVWX 1GKIA 3C5CA 4A1FA 1J99A 3MFYA 1W0JA 2QM8A 2GTPA 1W4AA 4AYTA 2GEVA 2W83A 4IDPA 4JIMA 5IT5A 1P9NA 1X3SA 2JAQA 1CRQA 1KI7A 3WY9A 1T3HA 2FMXA 1VG9B 4BQSA 3HDTA 4FWIB 5KNDA 3UWKA 4G5GA 3UMRA 3RC3A 3RRYA 1EFUA 2O8DB 2JLQA 2EFHB 2C98A 1E2GA 4TSFA 3PUZA 3L8ZA 1FP6A 4LOAA 1IQPA 2IYVA 5EE1A 5TARA 4CEHA 4C0KA 2MSEB 1GZSA 3X1XA 3FMIA 1W44A 5JS8A 1FX0A 2OESA 2GF0A 4C30A 3SHWA 5FTNA 3F5FA 5P21A 1UEIA 2J1LA 1TEVA 1NY6A 3ZGXA 5HZKA 4KAXA 2AN9A 2HLDA 2FFAA 5EJEA 3K0FA 3QIAA 1UBGA 3NH9A 4NPHA 1E0KA 4OQNA 1R0YA 121PA 1FQKA 1SVIA 2WAYA 4HDQB 1HA3A 2OLJA 2P6NA 3A4NA 2G0TA 3OIUA 2O52A 3B2EA 3P1JA 1PJRA 1NIJA 3F8TA 3ZS9A 4ITRC 2JLRA 1JJVA 3EZ9A 4Q01A 2PLRA 1IM2A 1OXTA 2YJTD 4IHQA 2ONKA 3NDPA 3KFVA 4FMDF 4PHFA 1D6JA 3KB2A 1R8SA 4NCHA 2CLSA 4FCTA 4Q66C 5FR1A 821PA 4ARZA 1KI4A 3VNVA 1LF0A 4QJ5A 4TYPA 1E9BA 2ZR9A 3VU9A 5JWRA 2W2VA 1F60A 5IHPA 4QBHA 1IAQA 3FFBA 6Q21A 1KI1A 1XD2A 1I4LD 2ANBA 5SZIA 4C0LA 1G7SA 1IN7A 3FTQA 2HCBA 4A0RA 2Q9AA 3I8SA 4KLNA 2FPLA 2J41A 3MLEA 4LJAA 3SDZA 1CJUC 4FD2A 1OKKD 4MUAA 5JFGA 2XXAB 3KTAB 2AFIE 4MYUA 5FI1B 2H18A 4M21A 3SYLA 4GMDA 1JEDA 3VMFA 5AUNB 1G64A 4AKIA 2DFKB 5JMTA 1S2MA 3THWB 4ABYA 1JPNA 2PEYA 4B2PA 4Q9JA 3H4MA 1QHHB 2WMOB 2ZJZA 3CRMA 4GMXA 3ADBA 3T61A 5EUMA 1CULC 5H70A 1E96A 3RS7A 1BMFA 4URVR 3BE4A 1WB9A 1B23P 3EPHA 4EPTA 4F38A 4QHYA 1PLJA 4UNNA 1LV7A 4HLDA 3TW4A 4HB4A 1KI8A 2QM7A 4TMWA 2G1JA 2GRJA 3BXZA 4KYIB 1P73A 3ZZ0A 4YMVA 2O8FA 1CIPA 2ZVQX 3B9QA 5CB8A 3BERA 1KMQA 2IA5A 4MGKR 2QI9C 3K53A 1KNXA 5BWMA 4KXFB 1N6OA 4RCYA 2E87A 3M0EA 3ND9A 4KHZA 3AF4A 5DO9A 5E3HA 3DM5A 3CNNA 3NBXX 3UATA 3T1VA 4CEHB 2DYKA 1UAAA 5JSZA 1VCOA 2IW3A 4RD3A 3GFTA 4QOSA 1FX0B 4CRWB 4OQLA 4HAYA 1AZTA 1GVNB 2IWRA 1IOZA 3K09A 1FNNA 2PLFA 2WWYA 3R7WA 3VX3A 1E94E 2ZYVX 3KFXA 1EXMA 2WKPA 521PA 3PEWA 4PPFA 2OE2A 3JZMA 3QF4A 3QJYA 2BBSA 3NC0C 1KAOA 1KKLA 1N25A 5LPNA 3NHBA 3B8HA 3PQCA 4JKIA 1KI6A 4OYHA 3AH8A 4HAZA 2ZYTX 2BHRA 1G5PA 3FFAA 2IEYA 3CWQA 2GEDA 3I73A 1OFUX 5D3MB 1SULA 3SEAA 1EFCA 4NKRA 1KSJA 2CLDX 2I3BA 2NO7A 5E95A 1K6MA 2PL3A 2YVUA 2ZETA 1EK0A 2OXCA 3L0IB 4ZKEA 4OHWA 3OE7D 4GFDA 4YMUA 2QP9X 2B7BA 4B34A 5EP2A 2GF9A 2TMKA 1P75A 1QRAA 1XJ0A 4B71A 2NOAA 4BLOA 1CU1A 2VO1A 1M6NA 3B6EA 4IKEA 4KV9A 1KGDA 2G1KA 3QPVA 2C04A 5DI9A 1HQYE 3MSXA 2EU8A 3KQLA 3DEFA 4PC6A 1J8YF 2B8TA 5BN3A 3QPUA 4AURA 1Q0UA 2BM1A 4DSTA 2ZUCA 2KWIA 5CJPA 1J2JA 2QL6A 4YDSA 3RSLA 2ZRFA 2P5TB 3RS2A 1H8HD 3U3MA 3GEIA 2AK2A 5AR1A 3MJHA 4JVSB 4ZCIA 5JWOA 2QAJA 2B7CA 4UXHA 1MT0A 3HJNA 1F2TA 3FHTA 4PAMA 3BH7A 1E1QD 3DZDA 2DWOA 2ORIA 4GL2A 2BOVA 1IN4A 1BYUA 1NVXQ 3AQ4A 3QXJA 1U8AA 2VRWA 1UKYA 4R2HA 2F1RA 3EASA 2ZROA 3KL4A 4ASUD 1TX4B 1K5GA 1UPTA 2ZE5A 4ILEA 2QENA 4Q1AA 4C0HA 3TIFA 3KKOA 4PC7A 5KYKA 5JLJA 1AKEA 3U2QA 2ORVA 3TW8B 3AVXA 1U8YA 1S96A 3GJ4A 2BEJA 1D9XA 2W2XA 3WNCA 3HU1A 3N70A 1TMKA 1OKKA 1W4BA 2JJ2D 1E2KA 4Q7MB 5H1YA 4TZ0A 2F43A 3C41J 2CBZA 1KSHA 2QQEA 1G3IA 4Q00A 4B47A 2YWEA 4C0QC 4O2LA 4TYWA 1VTKA 3NWJA 4KBGA 1WBBA 5CDFE 4HLQB 3AVWA 3OIWA 1KK0A 4M22A 4IXNA 4PQYA 3S1AB 3R9XA 4U00A 1LS1A 5IRCD 4EFLA 1DAGA 1RC8A 2IS6A 4TMTA 3ETLA 2WOOA 5KDLA 2DY1A 1XPOA 2V3CC 1E2IA 3GJ0A 2QSZA 1L7VC 2C5LA 1E2EA 2KJQA 4V0ME 1GM5A 3SHFA 5A4JA 2EFCB 3GEEA 3HYRA 1M8PA 1SXJD 4BPBA 3R7WB 1MV5A 4Q4HA 1PV4A 3QF4B 4P4SA 1OXXK 3B1WA 2C9CA 3A58B 5SZHB 3KKMA 1OJLA 1FOEB 1ZW6A 2JJ8A 2RGNA 5KSYA 1F3OA 1HH4A 1XMIA 2V8OA 1VYUA 3U7FB 1T3LA 3BWDD 4DWJA 2OILA 5TV2A 4UNQA 1G7CA 1SXJE 1FQJA 5A0FA 3PUYA 4JBYA 2IUUA 1KAGA 4PO1A 4RJLA 1GNPA 3H84A 4AIIA 4FINA 1L2TA 4RD1A 1E6CA 1NP6A 2DCUA 2RCNA 3P27A 4Q02A 4Q1EA 2IX3A 3FPAA 4LYJA 3ZVRA 1G6OA 2CK3D 4FWTA 1E99A 3AB3A 2PEZA 4HZUA 4QGFA 2LCFA 2O8EA 1GFIA 1LF5A 1MABB 1MOZA 1SKQA 2F1IA 2J0VA 1XB2A 1G7RA 2J46A 3VAAA 4JLBA 1G9XA 3K0AB 1R0XA 2NO1A 2R44A 5KPDA 2UZIR 2IBMA 2OHFA 2IS1A 1RJ9B 5GJCA 2BMDA 2OBLA 2OG2A 4B3XA 2B8WA 4H9GA 4LPKA 3QKTA 3SJCA 4QBFA 4WZ6A 3WYAA 1E0JA 2AK3A 4A36A 2ODEA 3IGFA 2WZQA 1KYIA 2FWRA 3UG6A 3RSOA 4UNSA 4PC3A 3W8NA 4DHEA 3O47A 3OE7A 2X2FA 4ZDWA 1HE1C 1E2DA 2FGKA 1G21E 5J4LA 4FMCF 5FH9A 1W7AA 2OCPA 3L8YA 3PUWA 2FFQA 2J3EA 5GJVC 3PJRA 1AS2A 3RS0A 2GDJA 3FE2A 1KNQA 4KCGA 2FZLA 4EPVA 2XITA 4EPXA 3VTKA 4AD8A 1H8HA 2C03A 1QBKC 3SQWA 3BFKA 2J0QA 4KODA 1TQ2A 4M1OA 3SFVA 5DIFA 2QA5A 2GCPA 2IYLD 2CHGA 4QM7A 4ZCLA 2X19A 1E1QA 2UVQA 2F43B 4TLAA 2PZGA 2J5XA 4UXIA 2KBFA 4LBYA 2ZJ5A 3IHLA 4TMVA 1QVAA 2JLUA 2L0XA 3CONA 3HU3A 4M0LA 2A78A 4DXAA 4XWAA 2P2LA 1KDRA 2ZI9A 3THYB 4GOKA 1N0VC 4OHVA 2XB4A 4OBEA 1RW4A 4QRHA 1K5DA 4JLJA 1KZGB 3QI2A 4DLUA 1G41A 2GXQA 1O87A 1ZD1A 3LLMA 4Q4HB 1LNZA 2WMNB 4WZAE 5FTLA 4XTCS 2JJ2A 3SBEA 2VIIA 2VA8A 4V0MA 1G19A 4IEEA 4DLVA 1U8ZA 4KVGA 4URZR 4F93B 4ZI3A 2HT1A 2H57A 3GP8A 4OKSA 3AP3A 4IXMA 4KFUA 1XU4A 4RZ2A 2BM0A 5EUQB 1Y63A 1G6HA 4CEJB 4GT1A 2QG6A 3Q9LA 2ZE6A 4U5XA 1E0AA 4HB3A 2YC4C 4I4LA 1CTQA 3AVOA 4B3BA 3OIVA 3AUXA 1JB1A 1XXHA 1U81A 1T3SA 3JVUA 5AUQA 3SYKA 3W5IA 5B57C 1F2UB 4D82A 2NTYC 1SXJA 4JVNA 5DI3A 1W48A 2ZJYA 3EXAA 2GCNA 3A1WA 1CEEA 1YR9A 3B1ZA 4HZUB 2NO6A 1XTRA 1U0LA 1Q1BA 2RHDA 3DM9B 5E7IA 3I5XA 4MQBA 2LWIA 2GJSA 1ZIPA 2PMKA 1SVLA 4UKDA 4LV5B 3PITA 1XEXA 2C77A 5G41A 2IS2A 4TT3D 2D06A 1SQ5A 2N1BA 1OH8A 1U90A 3AVVA 5FL3A 3HYTA 2P5SA 2A30A 3ICQB 5KNCA 3GJXC 2V54A 4IW3B 3K9LA 4WIAA 3SN6A 4V0OA 5JHHB 4OI1A 3TUZC 4ZPXA 1OFHA 4HAWA 5FPTA 1LW7A 2PX0A 3MWJA 2JASA 5FI0B 3GQBA 4C0AC 2ZM5A 4Q9KA 4JZKA 2CK3A 1NG9A 2F9MA 2GJ9A 1EFHA 4F91B 4JBWA 3QPWA 2CJWA 3IIJA 2GA8A 1DTSA 1Z6TA 4HDCA 1N5LA 4JT4A 2ODNA 1KO8A 1NKTA 1IN6A 4M1WA 4IOKA 5JS7A 2ZUDA 1G3UA 1YR6A 3B1XA 4ZCMA 1QF9A 2IYQA 1GL7A 1KSGA 3SQXA 2BMEA 4L16A 2P3SA 4QBGB 2VH5R 2X8AA 3X1DA 1NNEA 5HE8A 4MUBA 2O8BA 1DG3A 5BW8A 5AWFC 2RKOA 5JZVA 4A2WA 3I8XA 3CW2A 3K0SA 1UDWA 2ZRDA 2WBLC 1N6LA 3IQWA 5EZ6B 3GLFA 1G8FA 3DKPA 2ZITA 1NN0A 4BWYA 2ANCA 3QENA 2EW1A 3BRWD 1RRGA 3I92A 4PPQA 4URYR 3CNLA 1WXQA 1G8GA 3OEHD 4RZ3A 2QAGA 1XTSA 2ODWA 3GJ7A 4JSYA 5FR2A 1NMXA 4NZYA 3EZ2A 2CE7A 1MRSA 3GEHA 4WXPA 1G1MA 2ATXA 1E9EA 1N0WA 5GJWC 2J7KA 1SGWA 1QZXA 2ZSFA 2REBA 2Q21A 1BOFA 2EYQA 4HYYA 3GLHB 5JEDA 3NEYA 3O8CA 3U7EB 1U9IA 1YZKA 3B1YA 5KDDA 3UG7A 4GNKA 3AVTA 2JLZA 5F98A 5DSZA 1ZBDA 3D7MA 4B32A 4QJ3A 1ODFA 4Q4AA 4CT4B 2DWQA 3EIHA 1II8A 1N6HA 1SHKA 1Z2AA 1XXHB 1ZUIA 1WP9A 3D31A 2HJGA 4DLTA 1EFRD 4JLOA 4B3CA 1UBFA 2P0EA 3QNUA 4JLPA 1KDOA 1QHGA 1BO6A 4Q7JB 4RD0A 2OAP1 5FPYA 1GOTA 1LTQA 4GI7A 3EAQA 4JLKA 2ZRIA 4LJ5A 1TF2A 2ZJ8A 4I1UA 3GLIA 3VKWA 2P65A 1W36C 1Z08A 4EQ6B 4A0FA 1VIAA 5J4YA 2ZAOA 3WYFA 1XEXB
chains in the Genus database with same CATH superfamily
2D62A 4NYJR 4RLQA 2YQ5A 4F3RA 5FUQA 2P0AA 1OBFO 3JAKA 4QL3A 1RIFA 2ZAGA 2HLNA 2CMKA 2KSQA 1N2OA 1UOEA 1M6HA 1T1EA 1QZUA 1ZK1A 2WU0A 3ZI0A 5BQ5A 5LQRA 4MW1A 3PFNA 4I50B 4MDYA 4IXWA 1N2HA 4LXGA 4EA8A 2VQ6A 4QBKA 1WEKA 3OPMA 3B48A 1JEYA 1E7YA 1MQAA 3GG2A 4N0PA 3ZU2A 4OREX 4J3FA 2RHWA 1TT7A 1G0OA 1ZU5A 2QNBA 3IEUA 4XWGA 3WGYA 3ZWPA 1IK6A 4FHDA 3NOXA 4B74A 1YZVA 2AJ8A 2VHEA 3K9FC 2YS7A 4YCCA 2VHTA 4L4UA 1KAEA 4B76A 2ZSKA 4X8MA 2Z5GA 2KPOA 4U63A 4QOJA 3EHEA 4XVUA 2GXUA 1WXIA 2HR1A 2DVMA 1M74A 2R62A 3Q7RA 3KEMA 1BN7A 1UINA 4LBZA 4MO2A 4YDHB 5K3BA 1RT9A 4B3JA 4EJ6A 4ESEA 5C32A 1CQXA 1P2DA 2X23A 5E9WA 2G5CA 3EY9A 2ONYA 4K9MA 2HJWA 1U28A 3G49A 1TVMA 1I4WA 3B7GA 4FGZA 2B37A 1L4KA 4Z4CA 4PSCA 3F1KA 4FONA 4Q3DA 2Y6VA 3HSKA 4ZARA 3UJ8A 3VX4A 1GAXA 5IVIA 3HBAA 2ZT6A 4WESB 1J8MF 4QNNA 4Z3KA 3A3KA 2ZB7A 1I7QB 1GNRA 2ZR0A 3Q6MA 3TBFA 2J31A 4G9BA 4MXDA 5TVGA 1J5XA 2Q2WA 3TQCA 1KYXA 1WBJB 2QI9F 3KJHA 2NU7A 3KU4A 1Q7BA 1SUEA 3SZRA 4ZA2A 2MCFA 1U5AA 1HETA 2NG1A 3AVQA 3I9FA 4D3XA 2OXTA 2X0EA 3H9QA 4KTVE 4BLVA 1BS1A 3SF0A 3L6BA 3ZWOA 3TZQA 5JJBA 4Y6OA 5GQSA 2OZLA 1JAZA 2FR0A 5CIWA 4TTRA 4A1OA 1U98A 4TXJA 2ZB8A 3MRSA 2QAGB 3DDNA 4WK0B 4QM6A 3FMFA 4H35A 1IC6A 2V7WA 5EFOA 3C2QA 3BQ9A 3MOGA 3QZUA 4ZU1X 4O5OA 5BNFA 2I91A 1JA9A 3UMBA 1D03A 3VC1A 5KJFA 3L7MA 3MLBA 3ECCA 5LZ9A 3K6JA 1Y6RA 4V38A 1LU9A 5L53A 1BGXT 1VDZA 1WDKA 3CLKA 3HJGA 3Q10A 3ZNOA 4B6QA 3O3MB 4P0QB 5JMPA 5ANRB 3T5TA 1WKBA 2ZRMA 4UFNA 3ZGLA 3NHMA 4EP1A 1BGVA 4MIOA 4FYMA 3T3HA 1B0ZA 3VFDA 2JIBA 4I55B 1GCIA 1IOWA 1VPLA 2QV7A 1NATA 2Q4RA 3BRWA 3LRPA 4IDDA 4QYTA 4ZVMA 1Y5NA 2VNAA 2C3MA 3FMPB 5L3ZA 4V0KA 4B33A 5K0CA 4JJKA 2BRUC 3PTAA 3ZHSA 3SAJA 4OMDA 1HYGA 1GQQA 2EC5A 1RAHA 2D13A 3HUEA 3AHCA 1O6ZA 3FLEA 3RS4A 1UWVA 4BLUA 2C7GA 3SZUA 2VDWA 3C8UA 1E62A 5BOSB 3LS2A 4YRLA 3DOFA 4MVXA 3FF4A 3SHOA 4HBZA 4DAEA 5IBQA 2JBHA 2JCGA 4N3AA 3GLIB 1YC5A 2V45A 3FPSA 4A3SA 4E2XA 4D9FA 4DT1B 1NU6A 1G7TA 3S7TA 1IBSA 4F60A 1KBQA 1V7PC 4XUDA 1PK7A 5JTTA 2YJZA 2ZXEA 4CNQA 4DCVA 5J5AA 2R4QA 1M6EX 4AX4A 3FZEA 2VDPB 3IAXA 4IYJA 3LT1A 1GU1A 3UT5A 2H11A 3TW6A 3WBJA 3B3QA 3FWYA 4C7MA 2RH8A 4O6VA 4EMTA 4C1BA 1ZZEA 4LQCA 2H4XA 4I4IA 2XUJA 3IDFA 3T52A 3TRFA 2R1ZA 4CUJA 3KR9A 2VJKA 1BFKA 2ZYWX 2BGWA 4GE0A 5L3RA 3U3RA 5KOHA 1NF9A 3GD5A 4FHGA 3GPLA 2QXTA 2GNPA 4EW6A 4TWJA 2WE7A 3WLPA 4NMMA 4BVAA 5L8VA 3S1SA 2IEBA 3CO5A 1SOAA 3GI1A 1UBCA 1ISSA 4ZVNA 3ETNA 1YIOA 3OWHA 3RO7A 1MF7A 5FPQA 3REQA 3GQVA 4OUDB 1VKJA 3MELA 1WPRA 1M1XB 2D0OB 1NP7A 4ZMSA 3L0DA 2LNDA 3GXOA 1DWOA 2PX2A 4E5DA 4R68A 2VYND 3N2LA 1AXEA 4GXQA 4DUGD 2V96A 1RKBA 2NSYA 2QUZA 3ODPA 1UEJA 2HW8A 4HMOA 3MJSA 3AETB 4HAUA 3BL8A 4B3FX 5EKTA 3IUJA 4YH1A 3G8CA 1U3DA 4D8WA 1DEKA 3CXRA 3ZJYA 1CX9B 2CDBA 2Z56A 3AR4A 3PBKA 4HUTA 5CPFA 1A9QA 2VAWA 4DV4B 3NHYA 3JASA 2G04A 1CVRA 2ZIEA 3HLKA 5AKZA 2C42A 2RHHA 5DYIA 2BAGA 4X6XA 3DLHA 4MRPA 3IHKA 5AVJA 3UM9A 3KZ1E 5K0ZA 2AR7A 1JNXX 2ZIZA 1NW6A 4WEQA 2ESRA 3MCWA 3W2GA 5E7MA 1ECJA 4MINA 5JCXA 1R10A 1H2HA 3RH0A 4A8JA 1MRNA 1LZLA 4LOLA 1VCIA 5ALLA 3VGJA 1M6YA 4EHKA 1YUBA 3AFNA 2AFHE 4OQPA 1KFKB 4AJHA 4N01A 1K3FA 2PIDA 3EX7C 1AS3A 4Y3UA 2D1YA 4KQ1A 3EULA 4TPKA 2AD5A 2VDUE 2V7VA 4QYXA 5DX1A 3UAWA 1FYVA 5KNBD 5JNWA 3FMGA 5LD2C 2R2GA 1LRLA 3HKCA 3TSWA 5ENDA 2C00A 4GDFA 4FIDA 4KLCA 3RIYA 1YKGA 1JIJA 2ZSAA 3FHOA 3H4IA 4PQGA 1NY5A 3MT7A 3UAOA 2FUCA 2DPYA 1M8FA 2J45A 2A94A 2CNKA 2IXFA 3QELB 1RZ3A 3I53A 5E0KB 5H68A 1CQIA 4MVJH 5TGZA 2XCSB 3GJZA 4IP0A 5JAHA 4EIWA 4QELA 1T6XA 4IWYA 1PJLA 5KYVA 2KHZA 4AG3A 4HLUC 3T94A 2XMRA 2Y1WA 3VC7A 2F59A 2Z4TA 4KNYA 4I5EA 2LKCA 1KI2A 1IN8A 1IEXA 1NJ1A 3M6MD 4KBFA 4YRDA 3SZGA 5GINE 4P0PB 2V5AA 1WCXA 3N87A 3BYZA 3IQFA 2O5RA 1WEHA 4PCLA 1DBPA 1SD2A 4H3SA 5JJIA 4XQ0A 1OWLA 4LAFA 1L7RA 3O8OB 1VP3A 1ZD8A 4DBZA 4JUCA 1H23A 1PSDA 4LXQA 2C9ZA 5FFMA 1ECLA 2X2OA 2LZ0A 4L74A 5C8YA 1GZ7A 1YB6A 3WKCA 4US2R 1ID8A 1NULA 1SVOA 2GYVA 1TRKA 3W90A 2ZRAA 5CXUA 1TEXA 3TEMA 2W2OA 1DCTA 2JAPA 1C7ZA 4M99A 4F45A 1J90A 4H7DA 4OG2A 1LX7A 4D8TA 4A0HA 2QVZX 3IE0A 2HWYA 2WSYB 2XUPA 3EZ7A 3KZMA 1XZNA 1R0ZA 1F0PA 5K2MA 5KYUA 2WD9A 2IYTA 1TAQA 2ES4A 1Z0KA 3FDZB 3NIFB 4GVXA 3RJ9A 1NGSA 1LBSA 3MM4A 5JV5A 1WHSA 1KZYC 2GPNA 2XQVA 1RXUA 3QMVA 1A8HA 3EDCA 4R1SA 4TWAA 5I01A 5A3SA 4E03A 3SSOA 1PFQA 3ONDA 4WBNA 4WGFA 2X5NA 1HLPA 1I24A 4NI5A 3AF5A 4UBIA 4TLMB 4CCAA 3LBNA 4CMEA 3S8MA 3DDUA 2ZTHA 4WNCA 1OX5A 4IVRA 1DIGA 1NXQA 2RG7A 1PWXA 3A9CA 1VM6A 5D3QA 1N6IA 2HJVA 3OZ7A 3QXXA 4OK3A 3KEQA 2CZGA 3AERB 3V2UA 3O94A 3PG5A 4C0BA 2CYBA 1U0JA 2FW1A 2Q4BA 1QMPA 2AC7A 3OCVA 3VI3B 1UKZA 1Z12A 2JK1A 2C2ZA 4R81A 5BYAA 5J2UF 3BOSA 2INGX 5U4XA 1KKUA 2AHOA 1Z0IA 3SE0A 4WK6A 1O4WA 2E21A 5AHKA 1U8EA 2RHMA 1WPXA 3RIMA 2LUOA 3GRYA 1M8KA 4O2AF 2PJZA 1GILA 3WLQA 2I33A 3RBXA 4BCDA 4F3TA 1FRQA 1YVDA 2EJCA 2VYNA 3KQMA 2WIBA 3NETA 3CUYA 4DUGA 4B8ZA 2Q7DA 4LRWA 3SZOA 1EHYA 2GB4A 5F2NA 5I7AA 1GQYA 1QO0D 3SS7X 1T1RA 4EB3A 3RAPR 3W2IA 2X6RA 1SA0B 4FFLA 2WMDA 2IHUA 3K92A 2HDHA 4TMKA 5GOZA 2JHAA 4S1OA 4L7VA 1V11B 2ZBRA 3G6WA 4MRRA 2D0IA 3JYPA 2AFHA 2O8FB 2GCOA 1IONA 1FLAA 5G0UA 1SFRA 3ZEAA 1IZ8A 4NRDA 4N5HX 1YVEI 3UV7A 3DF7A 2WIAA 4NYMQ 5KI6A 3PWSA 4JASB 3HR4A 1JAIA 4UEWA 3KXIA 3U3JA 3AF1A 3EZYA 4XM1A 1ZJZA 3BMOB 3M6UA 2C5SA 3QW4B 2G36A 3BJZA 3KQWA 4G1FA 1WIWA 5DV9A 3UHAA 4CHTA 4XPIB 5A4MS 4DLWA 2QSUA 3HNOA 3IPYA 1TO1E 1T34A 1QDEA 3CKLA 5IDQA 2BFOA 5A5EA 4QODA 4IH4A 5F2OA 4ENPA 3AIKA 4M1QA 3H3JA 3GP3A 4IRUB 1ENPA 3GOHA 2Y05A 5EWLA 4B7XA 2FN4A 2WD8A 2M1ZA 5KNBA 4BGDA 2C0CA 2IGBA 4ZI2A 5I7HA 5CA0B 2RGDA 3KYBA 4FS8A 4BGUA 2GK7A 3CNQS 4PINA 3IO3A 3GNSA 5EQDA 1P91A 2XCRB 1KOFA 2BKEA 5EE9A 4E3ZA 2BEWA 2Q1WA 3C3EA 2VP6A 1C8LA 1DBSA 5KMGB 5T7BA 1X70A 1SHZA 3EQ6A 3GW8A 2J9RA 4AULA 1T0PA 2DOKA 3LLVA 1I2DA 4PXAA 5CNIA 1IFXA 2XODA 1R6XA 4WXEA 3IAEA 3ZVMA 4FW8A 4QGGA 2R8OA 1WSDA 4EGFA 3E1KA 4HSEA 1WXEA 4KR0A 1AN0A 3RBAA 4CI9A 4OB7A 4DCTA 5H9WA 1SK9A 5J2TF 1R50A 4AZWA 4RTNA 1NI3A 2GQ0A 3AESA 3RUEA 3OKFA 5CT9A 1YU9A 4XCXA 5FOXA 1JQ3A 2PUDA 2BJVA 5H81A 3RYCA 2PVPA 2QT0A 3D2CA 4Y0AA 3OWXA 2AX4A 4P83A 2A1UA 1IOLA 2E5FA 3ROPA 1C81A 4FYVA 2OFPA 3L7OA 3WV5A 5KOYA 5FWYB 5KCZA 2DERA 3NHWA 4DA0A 1HNWB 2CDCA 4CMGA 3IQGX 1E77A 3SR4A 1Y34E 4TV8A 3OJCA 3M82A 1LNQA 1GCAA 1OWNA 2FJUA 3QHPA 5L45A 3GLGE 2QBYA 3VGPA 3LX5A 221PA 3KX2A 2O6HA 1SUPA 3HV0A 3HPQA 4J1TA 3VKVA 4Y2YA 1S89A 4G56A 3L9XA 4N3CA 4YMLA 2NTNA 3HU5A 4LPSA 2J59A 1CUSA 1WB4A 2PMBA 4ZVVA 1E69A 4G5RA 1RYMA 3EK2A 4HGNA 1VJDA 3AEUB 3NKVA 2ZYUX 2JD2A 2IOYA 2FF7A 2PGOA 2XOKD 2O8CA 2QLMA 5LOVF 4KN8A 2JGIA 1O94C 4M0UA 2ODAA 1E3QA 2YYYA 3FYCA 4FUQA 1RWWA 3TRKA 3VV2A 1VC2A 1Z6ZA 4KMRA 3N0RA 1ID1A 1PZGA 4ND3A 4Y7DA 3SX4A 2LCQA 3CUTA 3KZKA 2Q6VA 4AZ3B 4TQAA 1Z88A 3GV0A 4OA5A 5KTYA 2WABA 1GNSA 2WFLA 3P94A 5TXGA 5HCUA 4KXXA 3KO8A 5HDQA 3H5RA 3H6GA 4NULA 1OFIA 3D5TA 3DV2A 3HACA 4XR9A 5ALXA 2WNHA 1YBVA 4INAA 5DHSA 5JSHA 2IEZA 3E2PA 4OXRA 4H2DA 3KKQA 3ZU6A 1AZSC 4DMFA 1LPOA 2FN8A 2GBGA 4OXIA 4X61A 3BX1A 1K8QA 3OQIB 1W36C 3RUAA 1V4VA 2LV8A 5BSFA 1EG7A 5BR1A 3VJKA 3IILA 3G6KA 4O8CA 1PWYE 4YROA 3WVNA 2I2DA 2QRVA 2WV9A 1KEEA 1ZIYA 3RRMA 3V7UA 2W9XA 4ASUA 5BQPA 1JMKC 3H1FA 1IIRA 1K66A 3PUKA 3VOTA 4FMCB 1TUEA 2IITA 3BL6A 3GZNB 2Z4RA 1IBCA 4TLBA 3JALB 1QO0A 1WW8A 1USGA 1LX6A 4B4KA 4DDVA 2A3NA 1KO1A 2OBBA 2B5OA 1P2BA 3EG5A 5IW8A 2VSOA 1K92A 4OMCA 4RFSA 4LHWA 2GI4A 2ZS9A 1CFJA 1FNSA 3FB4A 3OQBA 2XE7A 3L7DA 1D4ZA 4FMPA 4GRDA 1TM7E 4IKOA 4XSHA 4TLEA 5B1DA 2YRXA 4DC1A 3AIOA 4DSZA 1FDSA 2OV2A 1IY8A 4MAMA 3VDMA 2OHOA 6ABPA 1UMDA 4RQBA 2ENWA 3QWIA 3PQ8A 4EMBA 3EGWA 2G88A 2PRKA 3PC2A 3IT3A 1XPRA 2RGGA 2DM6A 2OUKA 3CZQA 4NBUA 1K88A 2CC2A 1QF6A 3NHZA 1KEPA 2PVSA 3FPHA 4BKOA 3AG6A 4LV6A 4OGWA 1SOWA 5J5CA 3UJBA 4UQOA 2VF8A 1T9GR 1WPQA 3OQNA 3DZFA 4QGAA 4N5NA 3BULA 5GZ3A 3TN7A 1U7OA 4RFVA 2FG6C 2VBFA 4FFVA 2R25B 1MRZA 1RHMA 1S2IA 4JFRA 2FY8A 1KDZA 2O8EB 1SRRA 3A4MA 1QK3A 3NORA 3UVEA 4EUKA 4C14A 1YOVA 2OOKA 1W0CA 4IS3A 2F3RA 1H2BA 4FFBA 3TL2A 1DC3A 1OFGA 2JAOA 1Y8RA 2R65A 4NR0A 2ZDQA 1A4XA 1AHNA 1F20A 3BD7A 3NUQA 1P7CA 2RIRA 3PXBA 3A32A 3MWKA 3C6QA 3GXBA 1CP3A 1XTQA 2IYSA 1M7BA 2G3YA 4PYMA 5HFAA 1DAHA 3KUKA 3AC0A 5G1PA 2N3ZA 5EJFA 1CNEA 3MWYW 3FNIA 4NOMA 4PXYA 3TDMA 2OT3B 4MR7A 4EGCB 2Q1UA 3PF8A 4LYAA 1PGNA 1GPUA 2B25A 2XX3A 1JLLB 4CKXA 4B3RB 3GLGA 4L15A 3KB1A 4JQOA 4UZEA 3L8CA 2AEJA 4GZ6A 3EGDA 4TTPA 1A8IA 4OKNA 4JJ6A 2G40A 3M4JA 3LUJA 1IHUA 2H4WA 4CV2A 3WQHA 1V4NA 3EXIB 1BSVA 1AKYA 1UZMA 2JI6A 3LP5A 1TUIA 4UTPA 2CKDA 5CIYA 1NX9A 1U9YA 2GLXA 1D2EA 4OL0A 4BFXA 1I3OA 1W4RA 1G21A 2FE4A 2IZOA 4IHAA 4K26A 5CIQA 1BU5A 4XASA 1UFRA 2GZ1A 1NBOA 1GUYA 5FWDA 3IKLA 4RZHA 3H5OA 3UYKA 5LDDC 4ZO4A 4F4HA 3ODGA 3KHSA 1E2UA 3IUMA 2GZRA 2H3EA 3BWXA 3DYBA 3M6XA 3ENZA 1US8B 4HT3B 2X1LA 1XD8A 5GTDA 5ED4A 4N12A 2JGNA 5KHAA 1XQXA 3GJ8A 5EE5B 3W34A 2ZJ1A 4EYOA 1FFCA 5I9SA 1ODKA 2QRJA 4JCCA 1WVIA 2XOKA 4RPKA 4BN4A 4EZBA 4E13A 1LDMA 5AW4A 4JNCA 3FDIA 1JE0A 1AOXA 3AP1A 2KW5A 3HUFA 5K8UA 1RDFA 1UFQA 3IERA 4ZAFA 2XF8A 4ALKA 4DXHA 3PFBA 1XNJA 2HCJB 1AQYA 3K7EA 4B4VA 1X87A 4BGEA 2V6JA 3X1MA 3NIDB 4PN7A 1UDRA 1Z6QA 4GPIB 4DJTA 4KV7A 3IR6A 1WUKS 4C29A 3DLBA 1P5HA 4RJ2A 1I5OA 3W06A 1DL5A 4IHJA 4ENVA 4QGBA 1V3QE 4DWVA 1I0IA 4MRMB 3T7CA 5LZ5A 1S9HA 4XE5A 3GWGA 3OTIA 5LQMA 4I3GA 1H9CA 2MSNA 2AN1A 3A36A 1SUCA 5HF5A 4RGYA 5F4BA 4BWFB 1UP7A 5K2OA 1QG4A 1U80A 2YVLA 2CJYA 2IV2X 3N2GA 1KL7A 1QANA 2RONA 3RUPA 2VN8A 3U4DA 7AT1A 2LE0A 2NUPA 3DNMA 4F4IA 5IAJA 4NABA 4TKVB 1A4UA 1H4VB 3TX6A 2HBQA 3AEZA 2B61A 3EE6A 5K8IA 2KE5A 2OGUA 4MW6A 4QUBA 2PMWB 3OZXA 4R1TA 4MYCA 4DR6B 4NX2A 1AMOA 2O3UA 5IN5A 2QF7A 2RJ3A 4M2LA 1ZM2A 4C7OB 1U5BA 4CL3A 4XTRA 1L3BA 2BTQB 1YZYA 1H93A 2C2YA 3JQAD 3OLXA 4KAJA 2VT2A 4DJAA 4GSLA 1OUMA 1BMDA 4I50F 2Y2VA 3K1AA 2HV8A 4GL4A 4MUGA 5DTIA 1GSAA 3HKDA 5A0TA 5IXJA 1ULZA 1CE8B 3WRVA 2W6QA 4XCVA 2BFDB 1SPBS 3I0ZA 4BVGA 1RBYA 3ZU4A 1PEKE 1LDNA 1JPJA 3D6NB 3I45A 2YIVX 3HJBA 4LFCB 4O0LA 4JJAA 5DHAA 1MQ9A 1TO6A 3R3SA 4ACAA 4Q93A 4LDPA 5H7XA 4YCDA 1QTIA 2R48A 1R4MA 2FUEA 3LQ2A 2HSZA 2VT6A 3SSNA 1U8CB 1EWVA 4EA9A 3C7TA 5BUQA 1SQ6A 4DF3A 3R8FA 1Y3HA 2IC5A 4FGSA 2PZ8A 1LPAB 2BEVB 2P6RA 4K03A 3SR0A 1UOOA 3AR9A 2V7EA 2VYVD 4I6JA 2OHVA 3L1IA 4UNPA 1A9XB 2FX3A 2Q6IA 3PKZA 3VBEA 3VJMA 2WJJA 1TYEB 3FSRA 3JARB 2Q9CA 1C1XA 1U9JA 1GPMA 2W0SA 3U44B 2ZI3A 3CLSC 3HN2A 2QT1A 2CVOA 2QJFA 2WHXA 2J5KA 3ZHZA 4UEJA 3T1TA 1PGPA 1ZLYA 4O4HB 3KHKA 4ZV9A 1O95D 5A1JA 2Z9CA 5EHXA 4G0VA 1O89A 2FW8A 3Q3JB 1YBHA 2ZZKA 4BNTA 1J0AA 3N6XA 2GK6A 2BGKA 3BBLA 2J0UB 2R5NA 1TM1E 2JJYA 1SIUA 1VPEA 2K87A 2ARKA 3TAXA 4KLZA 3EQ9A 3V1NA 2QZ4A 3SEQA 5K03A 4Q19A 1GA6A 1G5HA 3KWLA 4JBNA 4CUKA 4M7WA 4PAOA 4YR9A 2ZBQA 3QUTA 3EJ6A 4UU7A 2YV5A 1KAMA 5DZSA 4BUJA 3TJMA 1NDQA 5EIEA 1FFXB 2GKSA 3L1HA 4D3DA 1R5OA 3ESQA 4FHFA 2XBLA 3T7TA 2FMIA 2C8JA 1I4EB 3PX3A 5E9JA 2IHKA 5FUXA 3ZLBA 2HU7A 4KPEC 4RMJA 1XRQA 1HYHA 4AZSA 1ESDA 3JAWA 4JD5A 2WWRA 4PE5B 1AIPA 2VJLA 4KQJA 2ZSBA 3ZQKA 2AYYA 3I8OA 4E3WA 3R0ZA 2JLXA 2G7ZA 3I62A 4B9EA 3HO6A 3V4FA 2B99A 1WUTA 4MA4A 4BJ5A 2XXAA 4GSKA 4J6FA 1NJ2A 1O96A 2ZJ6A 2HPAA 3QUAA 4D4MA 4X5OA 1GAQA 1HBJA 1E6WA 3EG9A 3GGOA 4DB4A 1DTWB 1CCWA 2XNKA 4KIGA 1E9VA 4YMIA 1LPNA 2HJRA 2NPIA 4YMTA 3FAKA 5EEHA 1QHHA 1BAPA 1O77A 3U40A 3N2IA 4MAAA 3O8DA 4Q4AB 1HWYA 2W2QA 2JFXA 1RPNA 2P78A 4Z4GA 1R9MA 2A0WA 3HA7A 4G1VA 3DBRA 3I3SR 4NECA 3WLOA 2QTVA 2PZJA 2FRVA 1G17A 3ICPA 2HO5A 2J9YB 3COJA 3PKJA 4FYHA 4AC9A 4BPRA 5HRCA 4B31A 2QKYA 4ZVQA 2HNKA 5L3VA 1RRPA 2JDID 4MUHA 3NHFA 3N5KA 3UO8B 3QI7A 2Z2YA 4IDHA 1WCWA 4YONB 4E07A 4R3UC 4NATA 5BVHB 1S7GA 2PA0A 4LWPA 3IPXA 3VH1A 3UKJA 3NV9A 4NE2A 5FA5A 2B5WA 3B3AA 4MRNA 5T57A 2WVGA 3COZA 4Q47A 4C4OA 3A1FA 3DQZA 2HXSA 1E64A 5GONA 1PKXA 4AJ4A 3HBMA 3HQ4O 5KAMA 5LZ2A 3E82A 4Q21A 5C7LO 1MKYA 3AJEA 5IAAA 4G81A 5KCMA 4IIVA 2AFRA 4L8GA 3WGNA 1FPQA 1X9IA 2NXJA 3I3OA 2I9PA 4IUYA 4V0QA 1JEYB 2B3TA 3A1CA 4IH1A 3L8GA 4UM7A 3L7AA 3QVUA 4ZVKA 1JHQA 2JZNA 3JQAA 2HA5A 3NHUA 4POAA 4RDXA 2I6GA 2XGSA 3F7NA 3SZMA 2NACA 2G0AA 5GGYA 5F2EA 1A9SA 1FJGB 2OBNA 4H1VA 4QDKA 4A0GA 3PJDA 1XFAA 4Q7KA 2DHEA 3RHTA 2YNMD 2ZB2A 1MXHA 2PGAA 4F4UA 1WW2A 5D3MA 1OVMA 1Z5OA 5H3CA 4WZBE 5TVKA 1GRRA 1NZDA 2OV4A 4KTTE 1L8XA 4N6GA 3MYRA 2C8LA 4K46A 5SY4A 5I7VA 1K0FA 3N28A 5CFNA 1X1TA 1N2BA 1NI4A 3IJEB 5GIPE 4BZZA 1G6Q1 1ZD9A 2E37A 2P67A 3EFBA 3GHHA 1Z68A 5AW3A 1W30A 3JQ9C 5KSPA 5LQDA 3QFFA 2XIJA 2BFFA 4GBMA 2D4HA 1H0SA 5JRJA 1FMLA 1SIOA 1NJFA 4Z4FA 1RYNA 2QL7A 1JA1A 3IS3A 2VYVA 5DN9A 2NU7B 1P1IA 3A6PC 1IVNA 2J08A 3HVRA 4BN5A 2XMCA 3MBKA 2COUA 2FP4A 1YBAA 2RHRA 5AM1A 4G23A 1XJ5A 2EV9A 1XMJA 1SXIA 1TVCA 2NVBA 4RK6A 2AQ8A 1X3LA 3RABA 1ZICA 4BFUA 5CJ2A 1T6NA 3OJFA 3TJZA 2OZLB 3CRRA 4FNOA 5T3YA 3ZVLA 5IUNC 13PKA 1MO2A 2PR7A 3AFOA 4O4JF 5K3CA 1O95A 1P9OA 2QTCA 1J49A 4BX2A 3VKHA 3I1IA 2WKRA 1VG0B 3OT1A 1U2RA 4P7BA 5G40A 1TCCA 4AXXA 2O7NA 2VJOA 4KNWA 3W5JA 2I87A 3H1BA 4UVIA 2WM8A 3T9EA 2WJHA 3L0CA 4ZHQF 2MYPA 1L1EA 4UAJA 3IVGA 2ZXUA 4DCPA 3H3FA 2GEJA 1E0DA 1C9NA 4E11A 4HUQA 4QQ8A 4BFZA 3TFWA 1PW7A 3G8BA 4ES6A 1W2HA 1GKYA 1HT0A 2B9EA 3AJRA 2B2NA 3PDCA 3R3ZA 4R0VA 2H2AA 5YASA 3BH0A 3V7NA 4F86A 1F5SA 5AM2A 1ZVVA 2XPCA 4PYRA 4YTEA 3RRBA 2D74A 4FT2A 5CB4B 2GAOA 3RRNA 4AY4A 4IHKA 3O82A 4D9HA 4AJIA 2EBUA 2EZ4A 2GNOA 3JQPA 1RYYA 3PTZA 1JALA 3TW8A 3BIFA 2ONJA 3M49A 5A5FA 3CT4A 3PEFA 5FBWB 2AQHA 2C96A 1UIRA 2JHCA 4WECA 4B2YA 1XVIA 3UHOA 4P4GA 4XWWA 4QICA 1ZCAA 1ZRHA 4B40A 2HRQA 3L2OB 3KC2A 4UHCA 2W2LD 3IYLW 2CNWD 2H5IA 3WP1B 1A2QA 3GRKA 4PAQA 2RH9B 4OHXA 3PUVA 2H2IA 1U7XA 3OSUA 1AKUA 5IJXA 4ALJA 5IDXA 4NBKA 3LKZA 1QONA 1UBUS 3A9TA 4PHGA 3S1AA 5JCZA 1JU9A 2WQZA 3LUHA 5MGBA 1O6FA 3DAYA 4E22A 3L4SO 1ZL0A 1CHDA 3PX7A 1WM1A 4FIZA 3C97A 3ROQA 4H7HA 3K35A 2OGWA 2K7FA 3MTQA 1DWPA 5KVQA 3RREA 3E8SA 3D3EA 3A4LA 5BSHA 2QSYA 3W7VA 3CVUA 1MJ5A 1SEPA 3SK0A 4R51A 3ZGNA 4PTZA 4BECA 5KSZA 2R2AA 2NXEA 3CGGA 3NIBA 4ZU3A 2GN8A 5TSDA 4J0IA 1P7WA 2A88A 2VAMA 2JDIA 1Q11A 3NTUA 3ZE9A 2PMDA 5B30A 2PY6A 5KOHB 5ELXA 1G8HA 1NYTA 1PK9A 2PK3A 3RUCA 4BVJA 3VDQA 4XUEA 3QY9A 4YPVA 3DBVO 1PEDA 1UC4B 3GUVA 4RIIA 5COAA 2V7QD 3OPNA 1G16A 1TYCA 2EG5A 2R6DA 4OK6A 2GLTA 5HGXA 5LC1A 5A4FS 3REQB 5DM4A 5HE9A 3A37A 2DPHA 4JEIA 2VKTA 1UBOS 3F2IA 1E60A 3IA2A 5EWMA 2C2HA 1B6TA 3NV7A 1FNMA 2YN4A 5AM0A 3RTGA 5AIAA 3ZWCA 1T43A 2MWMA 3KQYA 5KHOC 1IPFA 1NUSA 5IH3A 2O5CA 5GJBA 1RC1A 2C4TA 4WZBA 4NHOA 5FB3A 2OO5A 2EARA 1DAKA 4RLHA 1HDCA 2ID8A 2NO9A 4B6FA 2AKEA 3AJ8A 1TB4A 4QUHA 5H4HA 2REXB 4ARVA 1N77A 4D26A 2NXCA 3HPRA 3JASB 4CNBA 2UV8A 1SUSA 1EUZA 1B42A 1CVIA 3NAGA 4OLFA 3AUYA 1XHLA 2BFWA 3R0JA 4GWKA 3T7EA 3X43A 4F72A 5EUCA 2YNMA 2XZOA 1XT6A 4Q9HA 2WTUA 3RUHA 2QORA 1XXLA 3KLBA 3CU5A 4NZ9A 2XA1A 2VTKA 3U60B 5CD9A 3NEPX 3T7JA 3QX9A 2W8ZA 3EXG1 3ZBTA 4A8JB 3ZY4A 3ZZ1A 3EBOA 4JLAA 2GZ3A 4B9AA 1Z0JA 4UBLA 5BQ3A 2Q1SA 1O8CA 1GGJA 2BBOA 1Q95A 2GBLC 3JYHA 3WMGA 4YXFA 5DRTA 1QHNA 3IDZA 1OLOA 5KJCA 3RHZA 4N7RA 1G5RA 1YL6A 4ZFNA 4ZOEA 3KQHA 1RP1A 3SZLA 2WYUA 3T06B 3WWEA 1IRXA 1DADA 2P4UA 4FGUA 1SBZA 3A05A 1I2CA 4RULA 1ZDMA 1VQ1A 1Q2UA 2N47A 2D1QA 1MGPA 4JQCA 1Q17A 3JQBA 3V42A 3FOWA 3HFGA 4L27A 1Q20A 1C0PA 4NV0A 3G2JA 5A4DA 1DCFA 3NRCA 4DDHA 5K0JA 4EVIA 1CQIB 1G5TA 1XA0A 1H9AA 3DVAB 4HQOA 4X1YA 4X24A 1I2BA 4TKUB 4NJMB 3X44A 3URMA 2FV8A 2Z95A 4G5SA 3FR7A 3WSWA 1DT5A 4TWBA 1KVSA 2P6UA 2QIPA 3FTFA 3D0KA 3QE2A 3M6VA 2ZW9A 1DAEA 1XZJA 4IIUA 3T5CA 4RBNA 2H2GA 3IBGA 3MMZA 2RAFA 1VYHA 3FETA 5DHQA 4HS4A 4JP8A 3UHPA 4LI0A 3LL7A 1L3IA 1YONA 5E4FA 4MEAA 1VHLA 1T2FA 4PGMA 5KVCA 3HP1A 3IIIA 1BEZA 1VRWA 4WUVA 1NV8A 4HDSA 1Y89A 1WU7A 1O0SA 2WRZA 4QQRA 5C8YB 3MJDA 5KTMA 3DLPX 2HSDA 4I4NA 3DMNA 1Z28A 5HPYB 2CBXA 1JLRA 2WY2D 4AKTA 3AKEA 4QQKA 3OPVA 3OJWA 4B6GA 2MSDB 2OYCA 3AJDA 4G8CA 1RFGE 4TL9A 5KQGA 3TGLA 1PVOA 1M0EA 4HDKA 2QVYX 2W2LA 3CBQA 2CNWA 4N1AA 3PDUA 3ZDXB 2V8BA 1PJTA 2YDXA 3IHTA 3VH2A 3STHA 2VLIA 3NO4A 1YCDA 2WA2A 3UAVA 4EYGA 2CL6X 1CR1A 2EZUA 1UOPA 4JY7A 3E9QA 3PTLA 1C1DB 4UTNA 4DV2B 4OX9Y 1RPJA 4CEJA 4M86A 1WHSB 2IPOA 2NSHA 2YV2A 1G98A 3IXLA 4LVUA 5FORA 2B8EA 3ZDEA 2NP7A 2ZWPA 5AJUA 3PXUA 2YZ2A 3Q0IA 4UDOA 1QNLA 2CNBA 2IHZA 3M3PA 3AEYA 1SCQA 4YB8A 4WBNB 5IT4A 3MAGA 2B2XA 2XAUA 3NBYC 5A4AA 3LYHA 2NZVG 2UYCA 3IURA 3TCKA 3WO0A 2QNRA 3ZGOA 3EPJA 1RQXA 3D8SA 3WX0A 1K97A 1O1YA 2PUJA 3IKJA 1ZOOA 2IPNA 3H0EA 3PUJA 1WDTA 1NAIA 3F71A 4K2HA 3CEMA 4UFPA 3P9IA 3IJ5A 4PXSA 1ZJWA 4N3NA 2JIZD 1OIWA 3KV3O 5IBCA 1DC4A 3V1LA 1KU0A 2D0PB 1GCOA 1O9HA 3OJEA 2V7QA 1SU8A 3TKYA 2QM0A 2D1FA 3E8XA 4ZT3A 5DRYA 4TTIA 4Q6BA 4NU5A 4P6VF 5CGZA 4ZXPA 4I1OA 2V6MA 1QUFA 3CX6A 1OXMA 4Q24A 1U2DC 2P8SA 4MCIA 4QXRA 1NDHA 3CE6A 5AQ1A 3J81k 5IVHA 1FUKA 1DOZA 4BGIA 2E4YA 5TJ9A 2EJWA 4LFBB 3I5YA 3QWAA 3AI3A 1GTG1 1PRYA 2XDQA 3EISA 5EE0A 3KEFA 5UKDA 3VDNB 3AYZB 3ZQ6A 2V0CA 3UA4A 1UPXA 3TRHA 6REQA 1OIVA 3CB4A 1MVOA 5CRIA 3ZCSA 1VSUA 1UQUA 1JZSA 5D86A 4GHWA 5EGNA 2AFHB 2GCOB 3H17A 3UFBA 1D07A 1MXFA 1GRQA 2V1XA 3EN0A 3HJUA 4F7WA 3E9RA 4K5QA 1L4YA 1XC7A 2J3KA 4JR0A 2CHQA 2AGVA 1XROA 2PZLA 1WKVA 1E7QA 2ZEJA 2BJHA 3DH0A 4KUHA 3UXMA 2FLKA 3LT5A 2R9VA 4S24A 3EVZA 2DETA 3MCUA 4IMRA 2E4AA 1E7MA 5IKEA 3OZVA 2FWMX 2QRMA 3S2IA 3W7BA 1E3WB 4B2LA 5AM3A 5KU1A 1W46A 4HGOA 2YINC 4UCWA 4BVHA 5A03A 1H5QA 3U3ZA 3DE5X 1KETA 2D5BA 3H2YA 3T7KA 3ZDFA 5KHLB 5FLXA 3A2MA 3LCVB 2QN3A 4HX2A 4UM8B 3V4SA 1T2NA 3AUSA 1N6NA 3PFCA 3ZDQA 4ZYZA 4F5YA 1TPZA 4IDQA 3KBOA 5EWLB 4QYIA 4RFLA 3MAJA 5H8WA 3P4UA 3WMEA 1SR8A 2P7IA 1POXA 3R4VA 5DTRA 1GV1A 3VR1A 5B6PA 1JU4A 2H17A 2VTEA 4BNIA 4JP1A 3ZUGA 3ISVA 3DFIA 3PFKA 3R5TA 4JJ8A 2QR3A 1DEOA 4G8BA 3GUHA 4YX9A 1K3TA 3FR8A 4FCWA 2F1HA 1OZHA 2BCJQ 1RAFA 3R7DA 3Q3HA 5K09A 1U1FA 2JIPA 1AV7A 3PNLA 5DU2A 2G67A 4U7DA 2Q3FA 4KQIA 1UJ2A 2DF8A 2I0FA 1JDPA 4M8IA 1JGTA 4OHYA 4Z7NB 9LDTA 3M4XA 3QXGA 4C9BA 1IBLB 2Q62A 4YECA 3FKSD 2FETA 3AESB 4FR2A 4HQ6A 1O08A 1C9EA 2ID9A 3L93A 5IC5A 2BKLA 4G4IA 5C8XA 3RYCB 2CNN