1E2GA

Human thymidylate kinase complexed with adp, tdp and a magnesium-ion
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
209
structure length
205
Chain Sequence
RRGALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTEIGKLLSSYLQKKSDVEDHSVHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAKRGERYENGAFQERALRCFHQLMKDTTLNWKMVDASKSIEAVHEDIRVLSEDAIATATEKPLGELWK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THYMIDYLATE KINASE
publication title Insights Into the Phosphoryltransfer Mechanism of Human Thymidylate Kinase Gained from Crystal Structures of Enzyme Complexes Along the Reaction Coordinate
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 89
structure length 205
sequence length 209
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2000-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1e2gA00
4PTLA 2QPOA 2G77B 1D9XA 3TW4A 5C2JB 1P9NA 4KBFA 3HR7A 2FMXA 2RGEA 4M8NE 5FUWA 3GLGB 1RRCA 3TW8B 3VX4A 1N0VC 1G6OA 1IQPA 2ZRHA 5CK4A 1ONBA 1XD2B 1Z47A 4OQFA 4EPVA 2GNOA 2BMEA 3I92A 5AK0A 2OLKA 4C0LA 3I8SA 4HLUC 4JMPA 5EQTA 2I1QA 3BH7A 4QHYA 1SHZA 5A4JA 1D5CA 4Q47A 3FFAA 2ZRMA 2GJSA 3OZXA 4KLNA 2XXAA 4LYHA 2HF9A 3UMRA 4KYUA 3W6NA 5AUOB 5K8LA 3A6PC 2P65A 2AK2A 4NPHA 4PR0A 2PT7A 4FIDA 2YWEA 4P32A 1A1VA 5J4VA 4OI0A 3KFXA 3PUVA 5GJCA 1JPNA 4M1KA 4LHWA 1G7CA 4NYJQ 1MABB 1FUKA 2ZUCA 4R98A 1KO5A 1FTSA 3GEEA 3OEHD 1Z0KA 2B8TA 5JS8A 4KODA 4DCTA 1E98A 4B33A 1NN1A 4N0DA 2VRWA 4JLPA 4KITB 1T3LA 1RC8A 1AGRA 1XNJA 4YC7A 1VIYA 3MSXA 4BZPA 3MGCA 3VHXA 2FE4A 1D9ZA 1XMIA 2Z5FA 2CBZA 3G82C 2E87A 5GJVC 1FL9A 4PPGA 2EU8A 4K8OA 3O8CA 1X6VA 2MSDB 1CXZA 2VP4A 4DLXA 1Z6YA 1KK0A 2ZR9A 3MWKA 1Q22A 4DEYA 1W36C 1E9EA 1OXVA 2GEDA 3AUXA 4F7WA 3VNVA 4QNRA 2VHJA 2VPPA 3GJ0A 5A5GA 1XTIA 3AVXA 2J5XA 1F48A 4LJ7A 1H8ED 1TF5A 2XZLA 1JJVA 3ADBA 2W58A 2JAQA 1EFTA 4GMXA 4B6FA 5EZ5A 5FPTA 2DFLA 4PSVA 4QM7A 1TQDA 3QY0A 1Z6XA 3AUYA 1XEXB 4TYQA 1WA5A 2OXCA 3DMDA 5BQ5A 4AYTA 1XMJA 1NY5A 2LKCA 4PHGA 3QKRA 4OQMA 4P33A 3EPKA 1NKTA 1KNXA 3HWSA 1E9CA 1NMXA 4PANA 2RGNC 4MRSA 2VHUA 3QOFA 5AJZA 5HTKA 2CL6X 3PQCA 4MRPA 3RS4A 2JIZA 4MUBA 5GVSA 5K8TA 4UNQA 3HPQA 3ZGXA 5KYKA 1NIJA 4Q1CA 2ATVA 1BYUA 1OT3A 2ONJA 2RCNA 3I32A 5TARA 4DCSA 1SZPA 1GRRA 3TLXA 3ASZA 1AZTA 5TXGA 4QJ3A 1QVRA 4G0NA 2PJRA 3U44B 2ZE8A 5CYPA 3T34A 2XTNA 4HZUB 2P5SA 3TR5A 1D2NA 4O25A 3RS3A 1DADA 1C9KA 1XRJA 2BHRA 3P20A 4B71A 4ZI3A 1CJKC 3CB4A 3U6BA 4KBGA 3KKPA 1OE0A 2O8EA 1S2MA 1OW3B 3NIBA 4Q1BA 1N2CE 3BAFA 2H1LA 4W5HA 2G1KA 1IBRA 2FPLA 2PMKA 3T5GA 1W36B 3GEHA 3TUJC 4QRHA 1US8A 3IQXA 4FMDB 1P2TA 4M1MA 1YQTA 4QM6A 1NJGA 1BO6A 2YWGA 1XEWY 2BBSA 2CLDX 1ZYUA 4WXPA 3RS0A 2EFHB 4BZQA 4M1WA 5CJPA 1OXSC 5JSZA 2RGBA 3UMSA 4LBYA 4DDVA 2VO1A 2REBA 4M9ZA 4GI7A 5B2ZA 1CBUA 2GWHA 5DI9A 4JJZA 4BLTA 4CW7A 3SI7A 2ZANA 3QF4B 4O0MA 3QVVA 2ZROA 4QGGA 2R6GA 721PA 2YVUA 2QM8A 3THXA 2RGGA 4LOAA 5JMTA 3BE4A 1GM5A 3SYKA 3DZ8A 1XMVA 5FOXA 4HAXA 1OKKD 4PZYA 2IXGA 4MKFA 2JLRA 4EPXA 3MMPA 2A5YB 4IXMA 4O3MA 3L0PA 4B3CA 3OIUA 4E22A 5G3ZA 2VL7A 4F4JA 2FZLA 3HJNA 1P61B 1RZ3A 2BCJQ 4TL6A 1GRNA 1XCMA 1XU4A 1E2KA 4TQ9A 1BS1A 4PQYA 1XJCA 1KY3A 1G3IA 3EG5A 4PPQA 1OIXA 2IEYA 3PEVA 3ZIAD 2A5DA 3QF7A 1RE0A 5CJ2A 4DCNA 1P6XA 1YHNA 5H70A 3BC1A 3LRPA 3M4YA 4GNKA 3SE0A 3R8FA 3H84A 3V9PA 4HAYA 3HPRA 1E79A 4H1UA 3R7WB 4L15A 1GL7A 3BS4A 1W0KD 5DSZA 3AVQA 5FL3A 2XNSA 2GF9A 1LS1A 3OHMA 1N6IA 2FGKA 2YINC 2XEXA 3B1VA 4HZIA 5FTJA 2QT1A 1FP7A 4QFMA 1FX0A 1NN0A 1XEWX 2A2ZA 4W9MC 2F1RA 3SQXA 2OAP1 4ZCIA 3V4RA 3L8ZA 3DM5A 1XCGB 1P62B 1YZTA 4Q19A 4JBWA 5E3HA 3GJ8A 4TTQA 3QXJA 3GJ3A 1UDWA 2QNRA 2DPXA 4MYCA 1XEFA 4IVPA 3EPJA 1KK1A 1VCMA 3ZYCA 5FPSA 4E5UA 1ZMXA 1XTQA 5JWRA 4JL8A 3NKVA 3CLVA 2CVFA 4NL4H 1LNZA 1E2GA 2ODEA 3KB2A 2A3RA 2OUKA 3W8RA 4DSUA 2VEDA 4ZDKA 3F0TA 2V9PA 2QBYB 2IYSA 4CT4B 4PAQA 4DKXA 5BXQC 2Q21A 3VR6A 1KO1A 1ZD9A 3KUCA 1G9XA 2JA1A 3PXGA 3THWA 4JLJA 1GRQA 4PHFA 1N6LA 5B57C 4JVLA 5JZVA 4TZ6A 2WVJA 1VG0B 2Z0MA 1JR3A 4JSTA 4KFTA 2D4HA 2F43A 3SJBA 4RFSB 4R71A 3GLHE 2EQBA 2XX3A 3GFPA 1LW7A 2KJQA 1Z6TA 4F4CA 2D3WA 3FTQA 5EP2A 2LCFA 3X2SA 1I4LD 5HZKA 3CNLA 4MDEA 3VAAA 4Q48A 2QRNA 5FOUA 1JAIA 2G83A 2IF0A 2Q6TA 6Q21A 3VR2A 5L3SB 1T6NA 3EARA 1MT0A 4KVGA 2EWVA 4PSAA 4HAWA 4DB2A 1M7HA 2UVQA 2OAQ1 3CF2A 4LHXA 4PC6A 1IAQA 4RJLA 4A0HA 1WP9A 1A7JA 2JEOA 4PQRA 3A1UA 1IY0A 4NKRA 2ZRIA 5EE0A 2JCSA 1CRQA 2F9LA 4TMWA 3TBKA 4JLKA 2Z43A 1Q3TA 1DBSA 3ND8A 1XXHA 1TF7A 2ZM5A 2WKRA 5G41A 1G8PA 2BWJA 4DWJA 1J2JA 4ASUA 1X8JA 3LA6A 2FFHA 2WWGA 5EP1A 1E9DA 2BDTA 2N46A 3EZ2A 3ZJYA 2GZAA 3S1AB 4XD7A 1E2QA 5TB5A 3IIMA 1Z07A 3AVTA 3VR5A 2JLWA 1S9HA 3OIYA 1XD9A 3KTAB 1QHHB 2RMKA 4B3XA 1RYFA 4EJSA 1Z6AA 3KXIA 2OXRA 3PUWA 4D25A 2CCJA 3ZS9A 3ZQ6A 2A78A 1D2EA 1SQ5A 4ZV4A 4NYIR 1L8QA 3VX3A 5DI3B 1Z2CA 5IK2A 3TAHA 4XWOA 4RZ3A 4HDQB 4HAUA 2QQEA 3L82B 4HLCA 2JLUA 5EXTA 3W5IA 4BLQA 1HA3A 1JB1A 4Q4JB 4AIIA 4TMKA 1W4BA 3LH5A 1JJ7A 2C8VA 2GJAA 5D3QA 4KV9A 4URUR 2QORA 1T4GA 2J59A 2NIPA 2X19A 1P73A 3AKEA 3WY9A 4RD1A 2IYTA 2ZRFA 1VECA 4Z8YA 1U0LA 1FQKA 2GAAA 1TF2A 4TTPA 3SYNA 4F93B 4N0EA 1FPMA 2PLFA 4AI6A 2F9MA 1BOFA 4RZ2A 2UZIR 4MYHA 3OEHA 2YV5A 4EQ6B 4B35A 3D7MA 3RWMB 3Q5DA 1DO0A 2YOGA 3E70C 3X1XA 3I72A 3LXRA 4HUQB 5JJKA 1W47A 4V0MA 4LI0A 1HQCA 5EE5B 3RLFA 4TMTA 1G16A 4BFSA 5GADl 4HDOB 4OQLA 2XJ4A 4WIAA 1SXJE 3FKQA 3EPLA 3C15C 1E9FA 2YOFA 1CIPA 4XWKA 4XTCS 1KI7A 4KXFB 4GOXA 3OESA 2ZSEA 5LBIA 4XSHA 4W7SA 4JLMA 1Z06A 2NO9A 1W2GA 3EZ6A 4WZBE 3U4QA 2ZRLA 4TTRA 4V0OA 5JRZA 3BH6A 1II9A 1U99A 4LUCA 4FMBB 3PUYA 5IDVA 2WMNB 1M1YE 2XXAB 2ZI7A 2WJGA 4LPSA 1JBKA 3E2IA 3AH8A 2OFOA 2ZAOA 4UNNA 5P21A 521PA 4FMCB 2GEVA 4RCYA 4C0KA 1QHSA 4YDSA 2IYYA 4Q9KA 5HZHA 2UKDA 3W6OA 821PA 1YZKA 4DZZA 1NJFA 1UADA 1S0UA 4U00A 2OBLA 1GAJA 1GIAA 3N5CA 4Q66C 1BYIA 2OEPA 4Q9HA 4XVQA 4EDHA 1KZ7B 1M7GA 4JLVA 3SOPA 2ZRCA 1R0YA 3T06B 5JFGA 3I5YA 3X1WA 2OO7A 3LQRA 3AEZA 3TNFA 4WW0A 5JJLA 2WWWA 1E1RD 2C95A 3NVAA 3ZLJA 2NOAA 4DEXA 1FW6A 2ZREA 1PVOA 1XX6A 2A9KA 1DAHA 4US0R 4OI1A 5G53C 3BB4A 3C8UA 1BMFD 3LW8A 1G21E 2OFWA 2GJ8A 2FJUA 2H57A 1MV5A 3KXKA 1FMJA 3QPWA 2XOKD 4NE2A 5BN5A 1EFCA 4TYNA 3C41J 4BPBA 1EGAA 1YR8A 4M9SA 3SC3A 4BWYA 3D6TB 4OQXA 1WXQA 4KVAA 3DKPA 4LHZA 5H1YA 4A0GA 1GWNA 5KOYA 4HUTA 2LKDA 4Q18A 1WBDA 3B13B 3SFVA 1SKYE 5AWFC 3I3SR 3LDAA 1GUAA 5GJWC 2ODBA 3WYGA 3WRYC 4B47A 1XTRA 4BQSA 1CP2A 4PO8A 2QMOA 3SJCA 3DEFA 1BH2A 1I4TD 5IHPA 2O8BA 2ZSFA 1AZSC 2AR7A 1N6NA 5A0FA 1ZU5A 3TH5A 1OXUA 1OXTA 4Q21A 3T15A 1E9AA 5BYJA 3TSOA 3U3JA 1SVMA 1P9RA 1OF1A 2ZJ2A 4K46A 1ESMA 5EUMA 1SVIA 1UKVY 4RVCA 3NBFA 4WAUA 4RD3A 2QMHA 5J4LA 3BIFA 2BBTA 2NZ8A 1ZNWA 2P5TB 2HXYA 4GSYA 1JQJC 1IY1A 4A15A 1LFDB 5BYKA 1FFHA 3ZDQA 4Z54A 2GDJA 1YZNA 2WBLC 2ZRJA 4PX9A 5C18A 3KUDA 4QG7A 4C0HA 1G5RA 1KJZA 1G5PA 2O8EB 1VPLA 4X8HA 4B3DA 2RGXA 3RC8A 1CS4C 3ZD6A 1U98A 4Y0VA 3ZIAA 3NC0C 1US8B 4PXAA 1P5ZB 4WA7A 1OPXA 3K70C 1PLJA 2YWHA 3UXMA 4LZZA 3TE6A 1WMSA 3P4XA 4TL7A 3R9XA 3IIJA 1HE8B 2I4IA 3K0AB 1NP6A 3B1XA 1S3SA 5JSZB 4GP7A 5JECA 3KXLA 1G8GA 3QEJA 5FR2A 2R6AA 2VLIA 4IFEA 4C0JA 1W0KA 1AQYA 3TMKA 4MQBA 1GNPA 3NBXX 5L3QA 2GILA 4GOKA 3RHFA 2YC4C 1QHXA 1YRBA 2Z4RA 2ZYUX 3U60B 2YNMA 3THXB 2EYQA 4FN5A 5GJBA 1Y3AA 2FEMA 2GETA 2A5FA 1XJ0A 1CR1A 1ZM3A 3K1JA 2R9VA 2OT3B 3PUZA 3L0IB 4OYHA 2Q9BA 5G3YA 3OFNA 2GJ9A 4D0GA 1F5NA 3GJ6A 4Q4HA 1UPTA 1XCPA 3AB3A 3CWZA 5TV2A 4P4UA 2Q3FA 1D2MA 2C5LA 2JJ2A 2WV9A 3ICEA 3TIFA 1ZIOA 1X1RA 2IS4A 4OKSA 3CR8A 2J46A 4RD0A 3KL4A 5DHFA 5K8UA 5CIQA 4MDFA 1GL6A 1JEEA 3HYRA 3KQKA 1QG2A 3VFDA 2ZJBA 3AM1A 2D2EA 1CU1A 3SNHA 2ZJOA 2MSEB 4KSBA 1BIFA 3QXXA 1B0UA 4ARZA 5EE9A 2J41A 4M53A 1Q1ZA 1VKJA 2C03A 2GCPA 3AV0B 4MGKR 1AGPA 2GVDC 3IDQA 3TUIC 3K70B 5KPDA 2ZYTX 3LWNA 3TRFA 1G7SA 4X8LA 3RS5A 1DE0A 4CVNA 4AKHA 4V0KA 5HE9A 4GL2A 4YMVA 1I4DD 4LGMA 3SHWA 1E9RA 3DVLA 3H1TA 3LAWA 3CRMA 3MG9A 3U7FB 2ZETA 1II8A 1FX0B 1YU9A 1P3JA 4CDGA 3A4NA 2J0SA 4LDJA 4Q1FA 3RRZA 2ZIAA 2WIBA 3WHLA 2JLSA 1IY2A 1NG1A 4LV8B 2WSMA 3CF6R 2DWOA 1OFTA 4V0LA 1DAMA 3QENA 2QI9C 4AC9A 1DTSA 4QBHA 4ABYA 2CMKA 4V03A 3I1FA 4BFZA 3EWSA 3CH5A 1Z8FA 1E0SA 1P2VA 3LLMA 1ANKA 4NYMR 3WP1B 1OB2A 5HR5A 3QVUA 3T1OA 4EJSC 1UBEA 4TLAA 1W2HA 1GOTA 2QM7A 3PCRB 5IK2D 1T0JB 2G1JA 2VP6A 1ZU4A 2O0KA 2X2EA 3AF2A 4DDWA 1HTWA 1R8SA 5KSOA 1U81A 1W1WA 3QPUA 1BKDR 4HEJA 4ESVA 1ZM7A 2F43B 4DLYA 3UKDA 4NCKA 2EFEB 2ATXA 1VMAA 1RYHA 4UNSA 4MKHA 3UG6A 2BBOA 1GKUB 1X1SA 3AF4A 4FW9A 2GBLA 3RDPA 5DN6D 1TQ2A 4HDCA 1MO5A 4F38A 2HDNB 4I1SA 3PJRA 4DLRA 5FPKA 1E2LA 1ZD8A 1SXJD 1FQJA 1G3UA 5E95A 4A92A 2BMFA 1NI3A 2Q9AA 4B6EA 3U2QA 1QHGA 4QXAA 4PHHA 4A6XA 3Q85A 4Y0AA 1XXHB 3WNBA 3PITA 1KDTA 4WZAE 4XTRA 1A2BA 4MH0R 3NBYC 4URVR 3NC1C 4D4LA 3BWDD 2IS2A 1U8AA 1GP2A 4GFDA 4WZ6A 4BASA 2J7PD 2D06A 5LDDC 4QL3A 3QPVA 3T1QA 4EPTA 1OH8A 2ZSDA 1IOZA 2W00A 3LQQA 1I2MA 4FI3C 4EJSB 1W48A 2G88A 1EFHA 3CBQA 2PEZA 2F55A 4H9GA 4LSGA 4P4SA 2OCAA 3NXSA 3KKOA 4CGZA 1KSFX 3RS7A 3UMFA 2ORVA 4MGIR 1HEIA 5AR1A 2KSQA 4LBWA 1MKYA 4KI0A 2REXB 5F9FA 1YR9A 4S2EA 3SEAA 1CULC 5EE1A 4U7DA 3VQTA 2IHBA 4BFYA 3KQLA 2A5GA 2E1RA 2G9NA 1XB2A 3LW7A 3IO3A 1GILA 3FMPB 1G6HA 1MR3F 2WSSA 3MLEA 2X1VA 4IVRA 4KSCA 3GPLA 2PZFA 3NDPA 1DEKA 4JVSB 4NDZA 2N42A 1ZM2A 2RB4A 2O8FA 1WQ1R 1OFUX 2J45A 3VU9A 4C0BA 3M1IA 3TQFA 2HXSA 5FBVB 1KK3A 2ZR7A 4PPNA 1E6CA 3MCAA 4C0SA 3KQHA 1N6KA 1NMYA 4CF7A 2XTZA 5JI3E 1W4AA 4A4DA 2IYVA 3AP2A 4OHYA 3ZZ0A 3GCGA 5CLLA 1R0WA 2QE7D 3KKQA 2BV3A 1KI4A 2R44A 2ZI4A 2OM2A 3AVVA 2OHFA 4QJ5A 2QP4A 1KY2A 3NBZC 2ZEJA 1XTJA 1W4CA 1DOAA 3FDIA 4I81A 3RWOA 4CIDA 2IS6A 3C5HA 4YQFA 1NY6A 2NTYC 3T12A 3AF3A 1OSNA 1TUIA 2ZVPX 1WCV1 1E1RA 4ZCMA 1ZM4A 4Q9LA 4TN1A 4RD4A 4FD2A 4HLDA 4BUJA 1KI8A 1VCNA 4Q00A 4ACBA 1J8MF 4L8GA 3RAPR 4BECA 3U4QB 1BMFA 1G8YA 5KU1A 3AQ4A 1IM2A 1PLLA 5C4GB 4BGDA 4TYYA 1FNNA 2CDNA 3WYAA 1RFLA 1K6MA 3TK1A 2ASEA 2XOKA 1Z63A 1VG1A 3QG1A 4G5GA 2O8DA 3E1SA 3ICQB 4UXIA 4E07A 1JXOA 2NMVA 2VP9A 3TKLA 3B9QA 2QUZA 2HUPA 5B64A 4Z51A 2CEAA 3TSWA 2CL7X 4A9AA 621PA 1JECA 4LPKA 4BLPA 4JBYA 3Q72A 2HCJB 2GXSA 121PA 2YWFA 4D6PA 3ADDA 5BW8A 1UEJA 1KSJA 2HF8A 2GTPA 1TL7C 3U3OA 3DOFA 5F98A 3M0EA 1R5BA 5AUPB 3QI2A 2BM1A 3ZQJA 5FH9A 2BKEA 3EZ7A 3MAAC 3PIRA 3GP8A 4M0LA 4FCTA 1LF5A 2IYLD 2DB3A 2PMDA 3X1ZA 4O2LA 2FSHA 2H16A 2R2AA 1YZLA 3FMFA 1XPUA 2N1BA 5FBLB 3TVTA 1KTVA 4OHWA 2V55B 2WWFA 5JHHB 2A30A 1NVVQ 1CR0A 2V7QA 4ITRC 3TSZA 5JEDA 4AKIA 3F8TA 4XJXA 5B58C 2WJIA 3BXZA 1G8HA 1QHIA 3Q5EA 2WOOA 4RZUA 1N5IA 2P67A 4JLOA 4QHTA 4UKDA 1UBFA 5E4FA 1VTKA 1AIPA 2AXPA 2WHXA 4Q7LA 1S96A 1EX6A 4M1TA 5KNDA 4OL0A 2QROA 1B23P 2OLJA 3GD7A 1IJFA 4DSOA 3WMGA 1L4YA 3P27A 3GLFE 3BB3A 1EFRD 3FB4A 2ZJAA 4A6PA 4PO9A 2O8BB 2JJ8A 3OFND 3NH9A 2AHOA 4IOMA 4ZIRA 4PZLA 2QSYA 1JALA 4P0TA 3QSYA 4UXJA 4ACAA 4AYXA 1RJ9A 2JLXA 1I2DA 4O2RA 2JJ2D 2WIAA 3DMNA 3GLHA 4JKYA 3BOSA 4QGFA 4B75A 3QJYA 3VR3A 2DFNA 5FI1B 4IDNA 1JNYA 4LX0A 2HYIC 3GQBA 4G5OA 3QXHA 3U3RA 1R7RA 2AX4A 1GITA 4JLAA 1R5OA 2QG6A 1LV7A 4MITA 2FSFA 3Q8XB 1KI6A 1E1QA 4LYAA 3I4LA 1TTTA 2IS1A 2B7CA 3EIQA 2OV2A 4XIGS 5IRCD 2PL3A 4MA4A 2NO6A 5CIWA 3P26A 2BMDA 4TT3A 1FZQA 1NBME 2ZE5A 4FMDF 4PC3A 221PA 1M6NA 2ZAMA 3C5CA 1KDPA 4Z8XA 4DDUA 2PLRA 2XTMA 4TLCA 3CPEA 2NPIA 2FZ4A 4JIMA 1Z0JA 1ZUHA 1JAHA 1E2FA 1F6BA 1YZGA 4M1YA 4QGHA 4C4PA 2X8AA 2C77A 4D0NA 5L3QB 4G1UC 4EIWA 1X8KA 2ZR0A 2F1HA 1M34E 4Q03A 1XD2A 4JLDA 3WYFA 2RAPA 2OESA 3GFOA 4PO1A 4LK2A 1IXRC 4NP6A 1TU4A 4XH9B 3W9YA 3ECCA 4L4UA 4QC2A 1TEVA 2D74A 2JJ1A 3AVOA 4II7A 4HB0A 1Y63A 2FSGA 4Q4HB 1UAAA 1E0AA 1GL9B 4MGZR 3Q9LA 2HT1A 3P4YA 1XTKA 2IUTA 4JT2A 2V6JA 5KPJA 2FFQA 1U9IA 1UF9A 3ZZUA 3OE7D 1EK0A 1VYTA 3NDBB 1ZCBA 3GLGE 3NWJA 1R0ZA 1KO7A 2CE7A 2QU8A 2ZI5A 3B85A 3GLIB 1G7RA 1E4VA 3EC2A 1KSGA 1MABA 3EWAA 5EP4A 2PH1A 4IDPA 4JLBA 5H68A 2P2LA 3DM9B 4LC1A 4D81A 2CE2X 1XDBA 3U61B 1Q3HA 4I4LA 4BFTA 4ARZB 2ZS7A 1ELOA 2CK3A 2H5EA 1MO6A 2G0TA 4FCVA 4GBMA 2GBLC 1II0A 5D3MA 1E3MA 1E2PA 1PJRA 2NG1A 4LYFA 3UATA 2IUSA 3KFVA 3QEOA 3BRWD 3Q7QA 1E9BA 3CNNA 5JJIA 4NYJR 3ZVRA 5DN6A 1NSFA 2ZJ8A 2ZJ5A 4DRZA 3EA0A 3P1JA 4PC7A 1C4OA 1II8B 3NH6A 4MGYR 3FMIA 3AKYA 4OK6A 4PFSA 4OJKA 4MYTA 2XNDA 1Q1EA 1G291 4UJ3A 3K09A 1D8TA 3MD0A 2J87A 4D80A 1C1YA 1SXJA 3ZVMA 5KHOC 3RSLA 2J0UA 3B1YA 4KO8A 4IOJA 2R62A 1G8FA 2BMJA 4ZDJA 1XWIA 4GPTA 3RABA 3RRYA 1QHNA 2C9YA 4DC9A 4DBLC 3UWKA 4WBSA 1Q20A 1U8YA 3K0CA 5DNYB 4DCVA 2ERYA 5L3RA 4AKEA 1V5WA 2QTHA 4GZMA 3Q3JB 5C1BA 1NLFA 5JCZA 3KDSE 1RVDA 2NO7A 2J7PA 3C14C 3PG5A 5DHAA 4NU0A 3BBPA 4EPWA 4B76A 1ZP6A 2GK7A 2AN9A 1VYUA 4MKGA 4WOPA 1AS0A 1JI0A 4MRRA 1FOEB 4PC1A 1E94E 1KI2A 4Q4AA 1SVSA 2WSSD 3I62A 2JLQA 2NPFA 3L0SA 4B2IA 3U44A 4W5WA 1M8PA 1R2QA 1ZBDA 4D4MA 4HZUA 1CR2A 5DE3A 1W7AA 4AURA 4KHZA 2ZE7A 1M2OB 2VSXA 5FUXA 3HU1A 4QHSA 1IN5A 1IJEA 4ZI2A 2ZYVX 2VHTA 1OFIA 4JLNA 1GKIA 1OLOA 3NEYA 3W3ZB 4HATA 3QE0A 3CRQA 1G1MA 4LY6A 4UXHA 1M7BA 1FTNA 2R6CA 2AFIE 5CDFA 2GVZC 4FINA 3PV0A 4M9XA 4DJTA 3EX7C 3HYTA 5UKDA 2WPDD 1WRBA 1ZW6A 2GKSA 2FV8A 2JGNA 3PVSA 2RGDA 4C3ZA 2QE7A 1W49A 5KNCA 4AY2A 4C9BA 1F2TA 2ERXA 2ZVQX 2ZYWX 4N1AA 1PZNA 1AS2A 1ZC3A 2GA8A 2HEIA 2FA9A 1QBKC 2GEUA 1YR6A 2RGNA 3VKGA 1N6OA 2YKGA 1YJ5A 2ZU0C 4P31A 1X8LA 4PAOA 2OFXA 2PJZA 3QBVA 4G5SA 4P4SB 3SZRA 2EVWX 3QXCA 4E09A 2IXFA 5CDFE 5JHGB 1KK2A 3H0KA 1XJQA 1GSIA 3W8NA 1AA9A 2VF7A 3D31A 2W6JD 3N2IA 4RKEA 2QMEA 1NRJB 2GCNA 2AKYA 3FHCB 4DLWA 4OHVA 4X8MA 2QPAA 1SHKA 1T5LA 3FHOA 2B7BA 4K81B 3RYTC 3VTKA 1A5TA 3JZMA 2RKOA 3NTUA 5FI0B 3IILA 3IPYA 3FGNA 4NMMA 1NVXQ 1LVGA 3QKRB 3WNDA 1J70A 2C99A 4LRWA 2GXAA 5FOVA 1AJEA 2O8FB 1W4RA 3LO5A 3VU9B 1UKYA 1ZNXA 2EW1A 4CZ2A 2ZE6A 5EXSA 4US1R 4KYIB 2XZPA 5E7MA 1R10A 2A7QA 5FR1A 4B73A 5TMPA 4IOKA 3HDTA 1MOZA 2FSIA 4RD2A 1HT1E 3U7HB 1DG1G 2V4ZA 3KKMA 1Q0UA 2EYUA 5ELXA 5DYIA 3SJZA 1MRSA 4GMDA 1UBGA 3BORA 4LWZA 1VHLA 3I73A 4PAMA 4NCNA 2AK3A 4HB2A 4TQUS 2V54A 1RRGA 3NEJA 3RANA 1XFAA 5E7JA 1HY3A 3BJIC 1NLYA 3B1ZA 1EWRA 1V43A 3W34A 4B74A 4IDHA 5HKKD 3OIWA 2V7QD 2ZTSA 4BFXA 2Q3HA 3KQUA 4RCZA 2WWHA 3WNCA 5AUNB 5M04A 3IEUA 1OIWA 1U8ZA 3CRRA 3K53A 3TJZA 4Q4LA 2QTVB 2PBRA 2PCJA 3CZQA 2HYDA 2VSFA 2WJHA 4TMXA 4A1FA 4JVNA 3UPUA 3W90A 1KYIA 4IXNA 3KJHA 5FUVA 4Q7JB 3EZFA 1W0JD 4XVUA 4HSEA 3GJ7A 5J5CA 2OCPA 2O8DB 2QBYA 4JL5A 3FYHA 5KO2A 1CJTC 1U90A 1W46A 4I1VA 1P4SA 2PX0A 1RKBA 4ON9A 2RGCA 3FPAA 5FUYA 1LB1B 4C0AC 3OIVA 4F4IA 3BGWA 5KNBA 1GNRA 4IRUB 3JZAA 4AYWA 4JJKA 3FOZA 2O0HA 1NVUQ 2OILA 1YE8A 4FWIB 2Z6VA 4FMCF 4F92B 1EFRA 1NSTA 2Y8EA 2IC5A 3B2EA 4HYYA 1Z5ZA 2B21A 5EUQB 1IN7A 1JPJA 4R7ZA 4DLVA 4HB4A 5CB6A 1DAIA 4DIEA 2IYWA 2BBWA 1NVWQ 3CZPA 1HT2E 3FE2A 1U2RA 4TL8A 3FMOB 3TVDA 3WP0A 1N5KA 1P7CA 3K8YA 1NKSA 4NCHA 1KO4A 5CITA 2V1UA 1E1QD 3H2YA 3C7KA 1ZD1A 3IGFA 1QHYA 2EFGA 3O8DA 5JLJA 2VSOA 4GRAA 4BLRA 1KMHA 2CHGA 3LNCA 2DR3A 1Z28A 1MO3A 3AF0A 2AD5A 4TT3D 1Z0AA 3A1VA 3AVUA 3B82A 3CONA 3KJGA 1JR6A 1ZAKA 5FOWA 4MRNA 2FPMA 4UQOA 3V4FA 1U0HC 2KWIA 5FPYA 1F2UA 5J4YA 4KFRA 3SN6A 1LTQA 2FG5A 5DISB 1QHHA 3DOEA 3VKWA 4KLZA 1N6RA 5GVRA 4X8OA 5HCNA 2QPTA 4ZKEA 2GXUA 2FFBA 4IFBA 3U7GA 2NO0A 2J0QA 2ZS9A 2IF2A 2XGJA 4QNMA 1F60A 2PEYA 2JJ1D 1Q12A 1P72A 4ZIRB 2CLCX 3DDCA 4I1OA 3SFZA 3AVYA 2B92A 1SVOA 1SVKA 3LBHA 1E0JA 4YMWA 3BFVA 2WICA 1HQYE 1PLKA 3GLHB 4OI4A 3QKSA 1XZQA 2WOJA 3LFUA 4NCIA 4D82A 5EJEA 3GLIE 4B34A 3O8RA 1DG3A 3IEVA 3CW2A 1U9IC 3EW9A 1DPFA 2JLVA 3EZ9A 2V8OA 1K5DA 2JATA 1SVWA 1COWA 2MMGA 421PA 1OYWA 4A2QA 1DVRA 4M1SA 1L7VC 4BEJA 1CEEA 2DCUA 3OE7A 1KI6B 2RHMA 3THWB 2CK3D 1KDRA 2P6UA 3KKNA 3BK7A 1FUUA 3FWYA 1Z2AA 5J40A 1J99A 4ZO4A 4UNRA 2BEKA 2JDIA 1TX4B 4HAVA 3N2EA 4C2TA 3DL0A 1JEDA 1TADA 5JI2E 4RKFA 3UWOA 4C7OA 2H17A 2ANCA 3GJ5A 4HUQA 1E99A 4EPYA 3CPJB 4TL9A 1RPZA 2W0MA 2J7KA 3RVBA 2OG2A 3GJ4A 2VP0A 1N6HA 1U0JA 2XNDD 3CR7A 4DT1A 2ZXUA 1QDEA 3A37A 4LJ8A 1T5IA 3CX7A 2IYXA 3QXSA 2WM9B 3SYLA 1LS6A 2IWRA 4YDHB 4A2PA 4L5BA 3H4MA 3FKSD 3K09C 4LHYA 5ANRB 3LY5A 2G3YA 1SXJC 2WZQA 4JYBA 5CB8A 2MMCA 3CF0A 1SULA 1UKZA 1ZNZA 5LPNA 1ZVQA 1T8UA 5IT5A 1EX7A 4NYIQ 3JVVA 4EAQA 2QP9X 3L0OA 1ZM9A 3HU3A 3MWYW 3UG7A 1H8HD 2WMOB 3K0CC 5TVKA 2D7CA 3SS8A 1ZCAA 4BRWA 1FP6A 3OAAA 5AUQA 3MRSA 4RD6A 1KI9A 4JS0A 1IONA 4G5QA 2CJWA 4Q1EA 3CRW1 3LXXA 4ZPXA 4EFLA 4M1OA 2FDCA 4AK9A 3MFYA 4GT1A 4LYJA 2GZHA 5HE8A 3BERA 3ZVNA 4U5XA 2GZDA 2HCBA 3QNUA 3G0HA 2QTFA 4PPFA 4POAA 2PT5A 3ADKA 3THYA 1T3HA 1G64A 2OSBA 1Z0DA 1M74A 2FFAA 5JS7A 2XITA 4TMVA 2ZJYA 5FTKA 8OHMA 2O8CA 4DLUA 1XMSA 1AM4D 2AKAB 2R8RA 3AF1A 4ESHA 2JLZA 5D3MB 4B48A 4U02A 4W5JA 2O0JA 1OB5A 4AG6A 1LY1A 3E5HA 2F6RA 1G7TA 1W36D 1UFQA 2ZRDA 4US2R 1TMKA 2IUUA 2XJ9A 5KDLA 4QKQA 1Z22A 3EPHA 2BVNA 1TQ4A 5FTLA 1G3RA 4B3FX 1AK2A 5AJVB 4BFWA 2PZEA 3IPXA 1U94A 4TLBA 4YMTA 5IF9A 4QBFA 1NG9A 1OIVA 3VR1A 4D26A 3HR8A 1GKYA 4NONA 3T61A 1E69A 4LJ9A 4LV5B 1SXJB 2BJWA 3T5DA 1TNDA 1CJUC 4CEJA 3ASYA 2J0UB 2FX3A 2V1XA 3IQWA 4CEIA 3R9WA 1S3GA 1CRPA 1OJLA 3QQ5A 1ZC4A 3A1SA 4IDOA 4EFMA 4MUAA 2ZSBA 4M4SA 3ZS8A 3W5JA 1N5JA 1S1MA 1G20E 3CM0A 2PCLA 1KDOA 1G5TA 4YXWD 2EFCB 2KB0A 2IT1A 2WPDA 3CRVA 3IIKA 4Q02A 3QBTA 5K8IA 3O47A 2HLDD 2AXNA 4IJMA 3WMEA 4DUGD 4P4TA 3UANA 2BKUA 1DAEA 4QBGB 1HURA 4Q4AB 2FGJA 4F91B 2H18A 2RHDA 2P0EA 2HT6A 3U5ZB 2C9OA 3VKHA 4IEEA 1GNQA 1HE1C 5CK5A 3KB1A 2W6JA 5JRJA 4BFVA 5J4KA 3K9LA 2IWHA 3K0SA 2IYRA 2OE2A 5FL7A 4OK3A 3SDZA 1MRNA 3R8CA 4AWXA 4TLEA 2F3TA 4AKGA 1SVLA 1XTSA 2QEQA 4J0QA 4YONB 1Z0IA 2C78A 2ZITA 1NL3A 4Q1DA 5FTNA 4A0RA 5KSZA 1ODFA 2IXEA 3BB1A 4L9SA 1L2TA 3BFXA 3R20A 2L0XA 3ZZTA 3K0AA 5FTMA 4D4JA 1KOFA 3U6KA 1J8YF 3HU2A 2YZ2A 1E2MA 1L4UA 4B32A 3OF5A 4QBIA 4BRUA 1KO8A 4V0NA 1Q1BA 2IK8A 4DB4A 1QRAA 4DXAA 5C46F 1N0WA 1F2TB 2IBMA 4RSGA 3TUZC 1SKQA 3K0EA 3OEED 1Q21A 2GCOA 3GJXC 5CM8B 1OXXK 4L16A 1SKYB 4CEHA 1H65A 3LX8A 4H1VA 4DLTA 3BH0A 2Q0HA 3IO5A 4TZ0A 1N6PA 2Q9CA 3GLFA 1HV8A 1R8QA 2ZRAA 5HKKA 4LC0A 2PX3A 3B60A 3CWQA 4TLDA 1N0UA 4TMZA 4IHQA 4BZXA 4E03A 4IEIA 1Z6GA 2FNAA 4NHOA 4CYMA 1ZRHA 5KUTA 1FMLA 3B8HA 2QY9A 4RFVA 1IN4A 3LV8A 3AKDA 3VHLB 1XD8A 1K5GA 2J3EA 5KTYA 3NHBA 3WXMA 5JCPA 3KQNA 4PZZA 1W0JA 3QG5A 4JZKA 1R0XA 4IDQA 1OHHA 1KJWA 4LJ5A 4LV6A 4N3NA 5KSYA 1DAGA 1OFHA 4A8JA 1XP8A 3CUEF 3K0FA 4TSFA 4G3XA 3R9IA 1UJ2A 2CNWD 3EASA 4GZLA 4KAXA 2AWOA 2DBYA 2WJYA 4DVGA 4R9UC 1KI1A 1TAGA 1YZQA 3EXAA 4WXRA 1FNMA 1Q44A 2VTKA 3AGPA 2QAGA 3IKJA 1T9HA 4G5RA 1NBMA 1QZXA 1HYQA 3AKCA 4ZCLA 2D7DA 4D0LB 3M6AA 1P2SA 2WWYA 2VA8A 1UEIA 1UM8A 3HP1A 1GZSA 2AFHE 3A8TA 4CRWB 3CX6A 3ONWA 3WHKA 2QP3A 1Z3IX 3LX5A 2BJVA 2W2XA 3A36A 2PZGA 5HCIA 4B3GA 3DKVA 3X1DA 1IN8A 3PFIA 1A82A 1A4RA 2I3BA 2YC2C 4EFNA 2VYFA 2W83A 4FCWA 2BC9A 4Q9IA 5L8VA 2FU5C 1E2DA 1Z08A 3LVRE 3U7EB 1S9DA 3SQWA 5BN3A 4HI0E 2X2FA 3SBEA 2ANBA 1GG2A 2B8WA 1KZGB 4QGAA 4AD8A 4JT4A 3A4LA 1TPZA 3PEUA 1XZPA 2GK6A 1ZNYA 2GRJA 3F5FA 4I99A 2W6IA 3PEWA 3CO5A 1LF0A 2RH5A 4Q1AA 1E2IA 4URYR 5EXPA 1VDZA 3GLGA 4Z1MA 5EXXA 3X1YA 3IHLA 4IKEA 3RRMA 3CNOA 4GP6A 5TY0A 4LHVA 3CX8A 1G17A 4YMUA 3CIOA 2CHQA 4LJAA 2CCKA 4R2IA 2EWWA 4ZDIA 4FWTA 2IL1A 4B2LA 3KJEA 2ZQ5A 3THOA 1NMZA 3U3MA 3FHTA 1IXSB 2LWIA 5FBQB 1T0HB 1NN5A 1COWD 3A4MA 4OHXA 1OV4A 4B3BA 3J81k 1T8TA 1TEXA 3RSOA 3AGQA 3EAQA 4XSGA 5BWMA 4DSTA 5BN4A 1MH1A 1T3SA 2HV8A 1KAGA 1JR3E 2QA5A 3REFA 5AJYA 2JDID 3QIAA 4JYCA 2ORWA 1VYVA 1KMHB 3P32A 2IYUA 4UJ5A 2I1VB 2GAOA 2VF8A 1IN6A 2W2TA 4JVMA 4S35A 4BLOA 1KIMA 2XSZD 2DFTA 2KBEA 3MWJA 2ZI9A 4Q7MB 1O3YA 4V02A 3TQCA 3WBJA 1G3MA 2VP5A 1F2UB 1G18A 1RIFA 2DWPA 3PUXA 4M2LA 1RRFA 1TU3A 2G0NA 1E2NA 1JXMA 2IX3A 1S4QA 5KDOA 1GVNB 1XXHE 2FF7A 4M22A 1E9SA 3WMFA 4NYMQ 1ESNA 2E9SA 1G4UR 1RRPA 3CPHA 3L2OB 4A2WA 1YKSA 3AP1A 5F2EA 1E2HA 1N25A 1ZINA 2BEJA 4ZDWA 1F3OA 4M21A 3FFBA 2QT0A 4PQFA 2YYZA 3FKSA 1QVAA 3LLUA 1XF9A 1Z0FA 2BCGY 2R65A 1TQ6A 3B5JA 3OAAD 4B44A 2ZJZA 2H92A 1XEXA 2QENA 3QKSB 4HLUA 4B2PA 1R6BX 2CVHA 4BEBA 4A0FA 1J7KA 3ZVLA 1AN0A 4B43A 2FPKA 1NF3A 1OH7A 2P6RA 1Q1QA 3CH4B 1H8HA 2W2VA 3DPUA 4P3YA 4KFSA 2HJVA 1J90A 2W0SA 4TWZA 4BE7B 2QL6A 1JQLB 5H8WA 1P2UA 1UDXA 4NCJA 2VH5R 1Q57A 1R5NA 3SHFA 4BFUA 2VQSA 4TYPA 1X3SA 3LBNA 2C9CA 2GESA 3CKLA 4JKIA 2CLSA 3MUFA 2IHYA 2R6DA 4NZYA 3VR4A 5CLQA 4L9WA 1ZUNB 4C7OB 1NLZA 2QQ0A 4YMSA 1HH4A 2QRZA 4D4KA 2ZI6A 2QN6A 3C16C 3O8BA 1ZIPA 2AL7A 2F1JA 4EUNA 4OQNA 4C0QC 2YHSA 4DT1B 5AJWA 1E32A 2JLYA 4DCUA 1HUQA 1P75A 1G19A 1XPOA 3AVPA 1CTQA 4QOSA 5DH9A 1VCIA 1AS3A 2GXQA 3B78A 2O52A 4MYUA 5F3WB 5JBQA 2GF0A 3VMFA 1CF4A 2OZEA 3B1WA 2IYZA 5FBWB 3REGA 1RW4A 3GEIA 2ZRNA 4OK5A 5EZ6B 3I8XA 2J9RA 1KSHA 3TGPA 4TYWA 1G41A 4IOLA 4V0ME 1H8EA 4PC2A 1UKEA 1AKYA 3NG1A 2FN4A 2OCYC 3DO6A 1EG7A 1KMQA 1R4AA 1S1CA 3I61A 2REOA 4EKDA 2JIZD 3QF4A 1P9WA 4FXPA 1VG8A 1K8RA 3QUSA 5DO9A 4LCBA 2V3CC 2CJWB 2ZUDA 1DS6A 4Q5IA 1PV4A 2ZRKA 4URWR 1KI3A 4A36A 2O5VA 1DARA 2WAYA 2IW3A 4YXWA 3UIEA 2OCBA 3EIEA 1UBCA 2KE5A 2ZPTX 4MRVA 4LJ4A 5EE3A 4JBXA 2H8KA 3THYB 2ECKA 3L8YA 1EWQA 2WJJA 1E4YA 2XB4A 2HLDA 2ZU6A 1NIPA 2WAXA 3TR0A 3QKUA 3PEYA 5KSPA 4DUGA 2QZ4A 4UNPA 5JEEA 2O8CB 2WWXA 1CJMA 3W3AA 5SZJA 3GFTA 5TDHA 1YRAA 5FL7D 5JWHA 5L3VA 1OH6A 4A82A 2VP2A 3B7GA 2XB2A 5LB2A 3EIHA 5DLQC 5LB4A 4OHZA 1WBBA 1E0KA 3G5UA 2XZOA 4OJQA 3QKTA 3T35A 1VG9B 1W5TA 1O87A 1DAFA 3BFKA 4NTZA 5FPHA 3ETLA 1OH5A 2C98A 1G3QA 2ONKA 1YVDA 1ZUIA 5J4HA 4ZKDA 2DHRA 2AWNA 3R7WA 2G6BA 2C2HA 3AVWA 1EESA 4CEJB 2BOVA 4DSNA 2WTUA 1CR4A 2FH5B 3U3KA 4BLSA 4CEIB 3LBIA 4G01B 3SU8A 3ND9A 3WBKA 1E2JA 3N70A 3D3QA 3V00A 2DY1A 2TMKA 1AQUA 2J1LA 3RC3A 5KDDA 3ZH9B 3IUYA 1DAKA 4Q9JA 3SJAA 1NVVR 4KJZA 4NH0A 2J0VA 2RGAA 3RNLA 3K9NA 3GMTA 3KZ1E 2WKPA 5F9HA 4OBEA 3C4JA 4EPRA 4KCGA 2AD1A 2BIFA 3OEEA 2BM0A 5FOSA 3SBDA 3B9PA 4XOIA 1QG4A 2ODWA 3PENA 1N5LA 3DZDA 1OKKA 2FEOA 2NZJA 3AP3A 2IYQA 1P60A 2NGRA 2FOLA 1PUIA 1YZUA 1CLUA 4HAZA 1DELA 3IBYA 3Q7PA 4PHTA 1OHHD 4ERNA 2YOHA 5HPYB 3ZD7A 3H86A 1CKEA 1EXMA 2QSZA 4TSFD 1E79D 4NBSA 4A8JC 3K70D 4RFSA 2GHIA 5EP3A 4DHEA 4IVQA 2SHKA 2NQ2C 5SZHB 3A1WA 5B30A 4C2UA 2DWQA 2D62A 1IXZA 3D8BA 5FBRB 1MO4A 2CL0X 2UZ3A 3KX2A 2IEZA 1NBMD 2Q3MA 2VHQA 2KBFA 2ZSAA 4HB3A 5L3SA 1XPRA 2F3RA 3T1VA 4RZXA 5SZIA 2QAGC 2CNWA 1WE2A 1NN3A 2P3SA 4KU4A 5DGXA 3UK6A 4JL6A 1KKMA 3BD9A 5E7IA 2K5UA 2ORIA 1EFUA 2JASA 2P6NA 1VHTA 3A58B 3LVQE 5LD2C 3MJHA 3B6EA 2ZRPA 4RY2A 3SR0A 1W5SA 2GCOB 3FVQA 1KHTA 1KNQA 2X77A 5FOTA 4Q7KA 1S8FA 3W6PA 4CEHB 2HJGA 5AJXA 2B6HA 5C4MA 2CXXA 2YJTD 2ZRGA 1DO2A 4R2HA 3GLFB 2C96A 3LD9A 2VHCA 1Z83A 2WKQA 4GDFA 2EFDB 1X86B 2FWRA 3S1AA 2ODNA 3K9HA 5FFMA 2WJVA 4XWAA 2C04A 3TAUA 4DLSA 1ETUA 4C30A 1WB9A 4QJ4A 4KFUA 4URXR 2QAJA 2W6ID 2KI5A 3KJIA 1KAOA 3KTAA 2CCGA 1Z29A 2ZRBA 3GLIA 1JR3D 4JSYA 2WWIA 4WVFA 4Z1MD 1KGDA 1WDTA 1CJVC 3NHAA 4M9QA 1GDDA 3IBGA 5JWOA 4CT5A 5DI3A 4D2IA 4TQAA 3IHWA 4A8JB 1QF9A 2GJKA 3A1TA 3K0FB 1W44A 4HLQB 3F3YA 3PR1A 3K9GA 3RS2A 3JVUA 2ZUBA 1WF3A 1YR7A 3WRXC 1XBTA 3I5XA 3VNUA 2F7SA 4I1UA 2F1IA 1RJ9B 3EA5A 2CHVA 2QGNA 4Q4JA 1G4AE 2VBCA 5SZKB 1KKLA 1GFIA 2IA5A 2OBNA 1OYYA 3T1TA 5CYOA 2QGZA 5CM9C 3L43A 1E2EA 1N3BA 5DIFA 2QAGB 5J47A 3DHWC 2V6IA 3EC1A 4XVRA 4PSKA 2R6FA 4MKIA 1PUJA 4IW3B 4YLGA 3MJRA 1VCOA 2DYKA 1D6JA 2OBMA 2VIIA 3MWLA 5LD2B 4ASUD 1IHUA 4ILEA 4Q01A 2NO1A 4LJYA 4DIDA 2H7VA 4OI2A 2Z83A 4XD7D 1T91A 1ZJ6A 2ZS8A 2D2FA 2XAUA 5G40A 2A5JA 4LBZA 4AG5A 2MSCB 2Z4SA 2ZI3A 4EQ6A 2QMUA 1VIAA 1A2KC 1GTVA 4GOJA 3ADCA 1SGWA 4LBVA 1TUEA 1AKEA 5DYGA 1E96A 1KJYA 2XSZA 4LJ6A 4DLZA 4DDTA 3RRNA 4URZR 2DFKB 1NNEA
chains in the Genus database with same CATH superfamily
3K2BA 5AYVA 1Q16A 1Z8NA 3KT0A 4GMKA 3F5SA 5DTEA 5THKA 5JANA 3C97A 4O8ZA 4Y2GA 4M8NE 2BN4A 5FUWA 2JNWA 3GGJA 4KQFA 1EUDB 1TUGA 1SA0A 3VX4A 4ZVPA 5FB3A 2GHQA 2GZSA 3RCBA 3K2IA 2C0CA 4OQFA 3W0LB 2GNOA 1G6KA 5AK0A 2OLKA 4I5IA 4D0SA 4OHBA 4HLUC 5IMSA 3WSWA 1E5XA 4QHYA 4Q82A 1SHZA 2P68A 4PTYA 4JP2A 3CW9A 3H5NA 4RIFA 1RRKA 3K32A 1AQLA 3DOIA 2G36A 4ZQFA 1ZK1A 1EFPA 2BY4A 5K8LA 3A6PC 3NAQA 2AK2A 3A32A 4RZSA 4P32A 2J0EA 4M55A 3PXDA 2X8WA 5HMLA 1JJIA 4LHWA 1TEHA 4ZVTA 2IYPA 3QSGA 3RPEA 2VXYA 4BX8A 5EPEA 4JJ8A 1VKZA 3HCAA 1LC3A 3GJQA 4KODA 4BX2A 5JS8A 4JYAB 3SC4A 3HCFA 2VRWA 3HU5A 4MDHA 3CRNA 1T3LA 1AGRA 1BN7A 3KIPA 1KBZA 3DVSX 4DSZA 3ZUPA 1WCWA 4PZUA 3TMYA 1N1DA 1YJ8A 3MGCA 1NKVA 1S2GA 1BXGB 1X74A 3PI7A 1QU2A 1NQXA 4ZEXA 1I2BA 2ADMA 1D9ZA 5AI8A 2Q7OE 4WXYB 1DUIA 3G82C 4MV8A 3KEOA 2E87A 5GJVC 4OXNA 5FP0A 1TFUA 3A2MA 1JPUA 2ZR9A 3MWKA 3B3AA 3LPCA 3AJDA 1O6CA 3DAFA 3UC9A 5BSHA 2C57A 5ALZA 4GD3Q 4NY1A 5ER6A 4QNRA 1I6LA 4MWOA 3ORYA 1GZDA 3C6XA 4LVCA 1PD0A 4LJ7A 1H8ED 4L4YA 4DIUA 2XZLA 2C4UA 1GN9A 3ADBA 2W58A 4L3OA 3Q15C 2NP7A 5FPTA 4DBLE 2QQGA 5I7VA 1I1OA 1PT5A 2J6BA 2QXYA 2Z2JA 1P0IA 1A5ZA 2OXCA 1T5SA 3G2MA 4YRRA 5IABA 2LKCA 5HFNA 1H0KA 1KERA 4PHGA 4OQMA 4P33A 1X9HA 1EP2B 3EGDA 1NKTA 1ZD4A 1E9CA 1NMXA 5DOZA 3D6VA 5JFTA 2RGNC 1UOQA 5BQFA 2Q07A 5LA6F 2CL6X 4MRPA 3AOGA 2JIZA 1LI4A 3C3KA 4PZEA 2C88A 4Q37A 1EHYA 2RHBA 3HPQA 3RBVA 4V0QA 4CCSA 5BSVA 3O91A 2CB0A 1WW3A 2M98A 1B42A 4EA6A 4L8WB 3I32A 3PK0A 1R6DA 3EVDA 5A3VA 1KKUA 1X70A 1YS1X 4RH1A 3W3AD 5JIBA 5A02A 1EBUA 1VGQA 4WQMA 1WZ2A 2YMQA 4RK7A 1IL0A 4QJ3A 4QVIA 4G4GA 2Y1XA 3TZCA 5CXXA 4YV2A 2HZBA 4YTEA 2BL4A 5CYPA 4DADA 1PFKA 4LZNA 2AFIB 3PF9A 4HZUB 1QE0A 2P5SA 3TR5A 4C21A 1WP4A 1DADA 1XRJA 2BHRA 4LVOA 4MUXA 5BY2A 3FRJA 3LG2A 2C5HA 1L7NA 1OE0A 2O8EA 3NIBA 1FSFA 4ARSA 1A9OA 3FX2A 2H1LA 4G89A 1VA4A 4ND3A 1IBRA 5KYUB 3GEHA 3IYLW 3TUJC 4QRHA 3A3NA 3TYXA 4FMDB 1P2TA 3NCHA 3EF0A 2VTDA 1LNSA 3NXKA 1BO6A 2YWGA 2O4UX 1X7YA 1XEWY 4UM9D 4GM0A 1B8UA 2AVDA 3THSA 2F8TA 4I8IA 2XUAA 4BVJA 3PS9A 4BZQA 1Z62A 2MYUA 5CJPA 4E5MA 3NV9A 5JT1A 3C5EA 4CMKA 3F6BX 4F86A 4LBYA 3ZHSA 4UEJA 1RLUA 2REBA 3GBSA 4M9ZA 3AHGA 1K2WA 4WNAA 3CWCA 4JJZA 5DI9A 4BLTA 1V95A 3SI7A 3AT1A 5TQ2A 3ZIUA 4AF7A 5B3JC 5KMGA 5C51B 3R7LA 9ATCA 3QF4B 3CLHA 4O0MA 2UYGA 3HYSA 2HMYB 4GZ3A 4QGGA 1RXIA 5KQPA 1TT7A 721PA 4U5QA 4D7AA 2BHNA 3WRYA 2RGGA 2FG6C 3U31A 5INTA 3SYKA 5H59A 3DZ8A 1O58A 1XMVA 1WW8A 1A9YA 2VVTA 1QFYA 1GQ2A 5K09A 3LUAA 2P27A 3CKKA 5F5NA 4IXMA 1Y6ZA 1U4NA 2G71A 2ZJFA 1F8XA 3I9FA 5DRTA 4B3CA 3OH8A 3OIUA 5NLLA 5D3ZA 4E14A 4FE3A 3EXFB 3WQQA 4U9IS 1H5QA 1YRWA 2X22A 3D81A 4IMRA 2FZLA 1NUAA 1QGYA 3OQ6A 4ML3A 3Q2IA 4WLNA 4AQDA 2GPTA 1DKOA 5IN5A 1XCMA 1XU4A 2R48A 3ZR4B 2JI8A 4AQYB 1EHCA 3CLSD 4IFTA 4PQYA 1IPFA 4RSMA 4PPQA 4KVFA 2IEYA 2W4MA 4IQ4A 1C3EA 4V3CA 3ZIAD 3EH2A 1VL8A 2A5DA 3E2MA 3JQRA 1G60A 5CJ2A 4CTNA 1P6XA 1T3GA 4YLYA 4UHEA 4HQLA 4WCDA 1QH1B 4OH1A 2BGMA 4NF2A 1OX5A 3R8FA 4FLMA 1IVNA 4IGAA 4UVDA 1HOXA 3HPRA 2BSAA 1TK3A 1C30A 3VBCA 5I01A 3GCXA 4H1UA 3DT9A 3E9RA 4U2CA 5IYZF 1H4QA 3OZEA 4H31A 1JDNA 3FSEA 2OAEA 3I6QA 1BXRA 4R8KA 5AK6A 5E8JA 3ZU5A 3AEQB 3M9WA 2FPSA 3KLNA 2WFAA 2ZWIA 4P82A 2XUOA 1N6IA 2I76A 3CTPA 3OHMA 2AZTA 3ML1A 4UVEA 1UPBA 1FP7A 4QFMA 1XEWX 1V11B 5EY5B 3D8HA 2W2KA 2D54A 5TJ9A 2NACA 2F1RA 2ETVA 4W9MC 3ZCTA 4ZCIA 1RHUA 2CLMB 1TE2A 3GVHA 3ZHTA 3D9QX 3EE6A 4TTQA 2FHPA 3GJ3A 1KDZA 3QEMA 1DIBA 2PS1A 5IKXA 2VQEB 1XEFA 3KUKA 2ZJ3A 1YC5A 4IVPA 4LF9B 4KOEC 1C9NA 5CA0F 1EUYA 4OV6B 4B3TB 1UMKA 1WUTA 1BE8A 4LK3A 3UYLA 1QGED 3W9BA 4E5UA 3GVCA 5FFNA 4JL8A 1VLHA 3NKVA 5A9SA 5CA1B 1DUVG 3W6UA 4XYLA 2CVFA 3KB2A 2D0DA 3W8RA 3WLHA 2BW0A 3B51X 3DDZX 3DFMA 3F0TA 5DBIA 4I5FA 4R51A 2QBYB 2IYSA 4QYTA 4XWYA 2Q21A 2BI4A 1KO1A 3KELA 1VL0A 2JA1A 4YWJA 4JLJA 1KU0A 1GRQA 3H0EA 1O97C 4PHFA 3QIVA 4JVLA 1F8FA 3D7NA 3RHZA 1VG0B 4TZ6A 1JR3A 1T0IA 4JSTA 5IJXA 2F43A 1PWEA 2PBLA 2Z9DA 4RFSB 3GLHE 2EQBA 1SXHA 2XX3A 5FNZA 2YZNA 2FAXA 2KJQA 1Z6TA 2EV9A 4MW7A 3SIRA 4AJ9A 4F4CA 2UVDA 3BHMA 1I4LD 2FQQA 3X2SA 2A5LA 2C4VA 3CNLA 5DXAA 3ZI7A 4YCSA 4RY0A 4H1WA 2PUGA 3DLBA 4MVJA 2QRNA 3D1JA 1JAIA 2G83A 6Q21A 1ZR2A 2JBAA 3VR2A 2VN8A 1T6NA 4MV9A 1MT0A 3DLIA 2EWVA 3WISA 5I5EA 2IBTA 4Q34A 1M7HA 2R8PA 3OY7A 2OAQ1 4P7KA 4H4EA 4M87A 2X7JA 4YYZA 1OI3A 4DILA 1EX1A 3OI7A 2JEOA 4PQRA 1ETHA 1IY0A 2AJDA 3D0QA 4QJBA 2I7DA 3DZFA 3WO1A 1CRQA 1UR5A 2ASVA 2F9LA 4TMWA 1CE8A 4UEQA 1OWMA 2B35A 2Z43A 2WINI 2BDEA 1EH5A 2HRDA 3D2BA 2A3NA 3TSCA 1EXVA 1EZ1A 1AQIA 1QJ4A 2IU3A 3ND8A 4PFJA 1Y3DE 2ZM5A 1Z26A 1PJCA 1G8PA 3EBPA 4ALMA 2BWJA 4X63A 2BE9A 3G79A 4C2AA 5JVDA 5LLDA 4D4HA 1BVUA 2WWGA 2YHAA 3WL5A 3RJ9A 4CG1A 1E9DA 2BDTA 2N46A 5KC8A 1QMGA 3IXMA 3K94A 4YRIA 1P1IA 5DGTA 2R8ZA 2MIIA 3DFKA 1XVUA 2QD1A 4XD7A 3LQ1A 3IIMA 1MX5A 3H65A 1N9GA 1D3AA 1R6TA 1YB1A 5BV8A 3R3VA 2O7QA 3IC5A 3DTVA 4MO9A 5JY1A 1XD9A 4HGNA 1KPHA 3CLRD 4LHEA 5BUZA 2H63A 1NXTA 3R3HA 1L5QA 1GYPA 1RAEA 1Z6AA 3A31A 2ZIWB 2UUCB 2OXRA 1RACA 3DCIA 4F1WA 1ENPA 1PCXA 5BSEA 3ZS9A 4D8VA 3ZQ6A 4L3VA 5G1NA 3UUEA 2A78A 1D2EA 4EO4A 1GTMA 4DV7B 4ZV4A 4B4VA 3VX3A 2DLDA 4HWKA 5DI3B 3M34A 4RKRA 4Y6GB 4P35A 5IK2A 3TAHA 4XJVA 2I2FA 1OAAA 3K73O 3OZRA 4XWOA 3PA8A 5B6IA 5L6MB 1YFZA 1EBBA 3L82B 2FZEA 4V2IA 1IMJA 3DW3X 1DIOB 3JD3A 4Q4JB 2UUAB 2WFLA 1YMUA 2PD3A 3PUHA 1JJ7A 2GJAA 4DMMA 4JNKA 4PLTA 2AI1A 2W11A 5BUCA 4HN4B 1FFXA 4V2UA 3WRVA 3NBUA 2ZTUA 2HC9A 1I3CA 3AHDA 3WY9A 3EEFA 4C5AA 2HDOA 4L74A 4Z8YA 1U0LA 3EIOA 4RKYA 1FQKA 1KR5A 4G56A 1TF2A 4TTPA 1V25A 4DFDA 1TYCA 1VLLA 2Q27A 2RIRA 2I4TA 3H04A 2E6KA 4X7BA 2NVUA 5HF9A 3VPHA 4WE3A 4RZQA 3LK6A 2I2XB 3M6MD 2Q1WA 3TB4A 4MYHA 2YV5A 2WUFA 1PR4A 4ENTA 1PBTA 1D4OA 4ES6A 1Z6QA 4MQEA 4EHIA 5TT0A 1DO0A 3E70C 3KZNA 4AN0A 4W8GA 5IMBA 3I72A 4N6OA 1NASA 3LWZA 4V0MA 1KRWA 4PFQA 5C3MA 3WL7A 4BMPB 3AUTA 1IHXA 3BMNB 4JFRA 3WGKA 2PZ8A 5EE5B 4KZKA 4AJ4A 5GADl 1NFRA 3C15C 1E9FA 1RYNA 3HA5A 2GDZA 2PXAA 3HMKA 4JX8A 4KO4S 1KI7A 4KXFB 1HDZA 4XTCS 2OLEA 2WG0A 4IILA 4WFJA 3OESA 1DU4A 2FHSA 2AHRA 4LVUA 1TM7E 1SA0B 2R86A 3K8OE 5LBIA 2YWXA 4EI7A 1AOXA 1R9JA 4BNFA 4V3BA 3V4PB 1YUMA 4Q16A 4V0OA 3F49S 4EG5A 3AFNA 3DT8A 3ET5A 2JCBA 2TS1A 5KNDH 3RC9A 3VC1A 5IDVA 3FGOA 4JP3A 4J0GA 3G5LA 3EGEA 3BYZA 3S8MA 2OBXA 3O0DA 1KVRA 1V1RA 4O4HF 5LLSA 3UF0A 2I65A 1PR2A 1EFPB 2OO3A 1AV6A 521PA 2FN9A 4FMCB 3SLGA 3MTIA 4AZWA 3BJRA 1LDMA 1QCDA 4NOJA 1QHSA 5DK4A 4A10A 2M1XA 2IYYA 4Q9KA 1EDZA 2P9TA 2XY4A 1M9NA 3TGLA 1GEGA 2MSWA 2N3ZA 5K5EA 4W5RA 1NM5A 3OUUA 1GAJA 2FSUA 1V7PC 2JI7A 4XVQA 4QDKA 3STTA 4NS1A 3KBBA 3UMCA 3NW9A 4JWKA 1KZ7B 2QRGA 1M7GA 2ZRCA 4AUKA 5JFGA 4YGXB 5H0IA 2X76A 1T34A 2CMDA 4HQOA 3WGUA 1I1QB 1E89A 1RAGA 4GOLD 1IZ8A 1E3QA 1NVFA 3LQRA 3AEZA 2H07A 1MO2A 3BQMB 4HMPA 1SJ9A 3OKPA 4UUNA 1V5IA 4WW0A 5TMBA 1WBJB 4YCAA 3LCJA 2NOAA 2JEZA 2A57A 1FW6A 3SS9X 3WLIA 4HCJA 3WSVA 3EQ2A 3CB2A 2ZREA 1V9LA 5T6BA 5L51A 1TKRA 4BN5A 5LJIA 4OI1A 3X1JA 1YVPA 1XZMA 1BMFD 3CNBA 1G21E 4F4FA 2GJ8A 4LYEA 3MQFA 1M8GA 2WP0A 4R3WA 3C24A 5BN5A 3QYJA 4JYPA 1WVGA 4TYNA 4R69A 3TTSA 3C41J 4AICA 1I30A 1YR8A 4M9SA 3UK2A 3SC3A 2ISSD 3D6TB 3FYCA 5BNWA 1I10A 1WXQA 1RJFA 5AM1A 3OX3A 5H1YA 1GWNA 4HUTA 1GCIA 4FE4A 1KGSA 1WBDA 3B13B 3SFVA 3AHIA 1RTTA 2PX4A 5AWFC 3PC8A 4EVQA 4XVHA 2AC4A 3EGDB 3UMFA 1YL5A 3A1FA 2HJSA 1RYYA 3DBHA 5JXHA 2QMOA 4RC9A 3RWBA 1LDNA 5IHPA 2ZSFA 1N6NA 4E46A 4BVGA 3TH5A 3T15A 1OXTA 2IZZA 4OVKA 4Q21A 1E9AA 1FFEA 3AX6A 3WLFA 4K46A 3ASUA 3ESXA 1UKVY 4Q15A 5LYJA 5C1OA 2TRSB 3W7BA 4WAUA 2QMHA 5K3BA 1RI2A 5FA5A 5J4LA 2WUDA 4ZT4A 4MUNA 3VC3A 1OXMA 1SUBA 1W76A 2G9RA 2HXYA 4ZP1A 4K9QA 1DBQA 1IY1A 5CPFA 2XUGA 4A15A 3OUTA 3BDIA 1KYTA 4QDUA 3V1MA 3WIDA 2HSZA 4XGRA 5CVCA 3JCZA 3GWGA 5AKHA 4AJEA 5A5VA 4JUFA 4B5LA 5C18A 4J1TA 3KUDA 1KJZA 1M1UA 2IY7A 4XASA 4OXKA 2O8EB 1PGNA 3AIOA 1FP1D 3D6HA 3TLGB 1VPLA 3N8DA 4RUKA 2VDPB 2C3OA 3NHSA 3QOYA 4N01A 1UOPA 5DOVA 4B3DA 10MHA 1WXGA 3RC8A 4Y0VA 1V71A 1MA0A 3IAFA 4PXAA 3PC6A 4D97A 5GAJA 1W75A 5I6DA 1G9SA 1MU0A 4RPJA 2X23A 3NPAA 4LZZA 4X3OA 4TL7A 1HE8B 2XIQA 3K0AB 1KHHA 1NW5A 2LBPA 3VSAA 4LISA 3KAQA 5FR2A 3HEBA 4OOFA 3AUUA 4IFEA 1HI9A 4WNAB 3UFBA 3QFCA 4DCOA 4KR2A 4ANFA 4C0JA 5TQ2B 5KJFA 4ARCA 5KMGB 1DWUA 1I4EB 3ZXUB 3PHBE 5FHQA 3V4VB 1GNPA 5L3QA 3EXIB 2JCYA 5AW2A 2HNBA 2PSFA 2B5WA 1HLPA 1I0IA 4KUHA 2D8AA 4Q12A 1C7JA 5KQSA 3GJSA 4RVSA 4IV5A 3F2IA 3QNMA 1M1ZA 4BTVA 2FEMA 2GETA 2R3SA 2A5FA 3RYIA 4EHBA 3KSMA 1NQ5A 1XJ0A 2OHXA 1ZM3A 4Z9AA 3ZZMA 4FX5A 4AJHA 1ZK0A 1TKBA 1Y1LA 2R8YA 3MUEA 2XGGA 5G3YA 4ZVUA 4E30A 3QOXA 1ENYA 4D0GA 3GJ6A 1UPTA 2I2WA 1P5HA 3K5WA 4EBFA 1D2GA 3UJHA 2XXJA 2Q3FA 2O9JA 2V9ZA 2PXCA 3EUFA 3TEJA 5C8VA 5JNUA 3U4IA 1C2TA 4WNIA 4C2BA 5JY6A 2OCXA 5KTTA 4OLJA 5B1SA 1BMQA 1GFWA 1X1RA 2DJIA 2PZJA 4OKSA 2IS4A 2VBFA 3CR8A 4RD0A 2FW9A 5U1PA 1DRKA 4MDFA 1EEXB 3GGDA 3IELA 3LQ4A 5CCBA 1QG2A 1VE5A 4Y7DA 3TL2A 3VFDA 5LNK1 4JI7B 3RADC 3GD5A 3SNHA 2EIHA 5IBPA 2J3DA 2HEGA 4TRNA 4DMFA 4ARZA 3IBSA 3GLRA 2HK8A 3PPXA 2J41A 3K0KA 1Q1ZA 1VKJA 2DQYA 3KEMA 3O0TA 4M53A 1C30B 4N9WA 5C3UA 3TCKA 2IOQA 4MV7A 5KPDA 2EW8A 3USES 3TRFA 2J4DA 1G7SA 1BXRB 1HFEL 1P5FA 5JAZA 3NDIA 1UOOA 3EIWA 2H1HA 4X8LA 1E1NA 4JC5A 5A03A 1U9JA 4V0KA 3ZTWA 4B84A 5TGDA 1E9RA 3DVLA 2VFAA 3H1TA 3O93A 4KYVA 5IVHA 2ZETA 3L7OA 1PO7A 1Z3CA 1XNRB 1P3JA 1P9LA 3C5VA 2W2KB 1QYDA 1FJGB 3HG7A 1XNQB 4Y2YA 4G5HA 1SUFA 3V4OA 2G4VA 4Q1FA 5EJ2A 4CIYA 2JIDA 5ERGB 5TMDA 3RRZA 4UNIA 3LX6A 4N49A 3NORA 4LV8B 3GDWA 4PIPA 3QEMB 4TKMA 4V0SA 4DG5A 2WSMA 5F2NA 4QSHA 4FFNA 4G4SO 2JGLA 4D0RA 3F9CA 2BDUA 4V0LA 3GP3A 4DPLA 3ZPXA 3IVXA 3BE8A 2HU5A 3JAWA 3MGGA 5KYNA 2VAXA 1R9GA 4GPAA 3G23A 1CQWA 4QBHA 3W6ZA 4V03A 2A86A 4BFZA 1DFIA 4PE5B 3EWSA 3WNQA 1MUUA 3CH5A 5A9SB 1E0SA 3WP1B 1PSWA 5KAPA 4TKUA 1FDOA 2PMCA 4KXUA 4EJSC 2C7RA 3L8CA 3Q87B 1BTOA 2JI4A 1O6FA 2Z98A 3K4QA 5JXIA 2ZAGA 4RHUA 1S8OA 4UHCA 4O4LA 3ONVA 1GOTA 2MR6A 2QSJA 4DJEC 1J4AA 3DDUA 2O0KA 2X2EA 4DDWA 3VTFA 4N39A 3VKFA 3QPUA 1H1LA 3UGTA 4HEJA 4ESVA 2F43B 4DLYA 1NW3A 4OEHA 2GT1A 4KQGA 2EFEB 1IDN1 4FOOA 3MMNA 2CL5A 3TCXB 1GPWB 4R6XA 3HNOA 1WXIA 3VDRA 1LTKA 2WYWA 4LRYA 4BV9A 3NYRA 3LPMA 1G2QA 5JQGF 4BZXA 2F8MA 5DN6D 2R68A 1Z0ZA 1ZMRA 2JBAB 5FDFA 4HDCA 1MO5A 5DX8A 4BB9A 1UDBA 2XMRA 5ESDA 1EA5A 3MPUA 2CWWA 1S02A 2WK1A 1XK7A 1E2LA 2V97A 3OU7A 5GM1A 5K01A 1ADJA 4N47A 2C2KA 4R2JA 1X3LA 1SXJD 3WDKA 2PGIA 4CQMA 1SCDA 4YCNA 1G3UA 2VYVA 1CE8B 2Q9AA 1KEEA 1MEOA 2ACEA 4PHHA 3IALA 4LCEA 2HTFA 1H2BA 3LCCA 4N3BA 2G76A 2ZBPA 3KJZA 5JVDB 4WT7A 4DNXA 1WEHA 3GVPA 5ELMA 1QGOA 1CY4A 4XQ0A 5LYYA 2DUJA 1RP7A 4URVR 1W9MA 2GCEA 3LZDA 1CVIA 1LRKA 5LQDA 2IS2A 2VNSA 1PGOA 5IC6A 1YA8A 1JQBA 1N9GB 2V8BA 4XZ3A 3S27A 3K1AA 4WZ6A 4YJ3F 2P62A 3DTVB 1PT7A 2OORA 4EL5A 3T1QA 4Y1GA 4FI3C 1IOZA 2H08A 2W00A 2OB2A 3OWHA 3C3JA 4MIOA 3CBQA 3ZBUA 2GAFA 3FRIA 5ITZA 1R00A 4H9GA 4LSGA 2LW7A 4LS3A 2ZUUA 1KQGA 3JWPA 3FLMA 4K40A 1U2GC 1KSFX 4OMUA 3RS7A 2PT9A 3SCZA 1MV8A 2LIPA 4DR1B 2ORVA 2Q0SA 1SOAA 1N2ZA 3ROGA 2IKQA 3WGJA 1MW8X 5IJ9A 1Q0SA 3EODA 3HDGA 1YR9A 1L8AA 3ICWA 1CULC 3MTBA 1UAYA 3F6PA 2V98A 3KR0A 3CUVA 3O4FA 5EE1A 1ZK3A 3PIIA 2A5GA 2E1RA 2Y27A 4OM8A 1G6HA 2R8OA 2WFLB 3ZUGA 1WV0A 1CNMA 1NUSA 2B6NA 1T5BA 1V26A 1ATZA 2PX6A 3NDPA 4WGGA 3GAZA 4NAUA 1Q0ZA 3PP8A 1FFXB 2RB4A 3ZNNA 2AS0A 1WQ1R 1OFUX 2J45A 3GWZA 3P0IA 2C61A 1A7AA 5ALYA 1KK3A 2RHGB 3EVAA 1IJKA 4KYTA 3UAVA 1YFJA 1OBOA 5IPFA 2WQ7A 1NF9A 5HFJA 3WIVA 4BP8A 1PZXA 1M6VB 3IV9A 4CF7A 2I3AA 2XTZA 3LC7O 2NVUB 3ZHBA 1DNPA 2FPUA 5EZYA 4LDZA 5T5QA 3GCGA 5CLLA 3KKQA 3WLMA 1QOPB 1XYYA 4N3CA 5ALRA 5EERA 2IPXA 1NXWA 3M83A 2OHFA 2P9FA 3ID6C 3HTXA 4KDCA 2QP4A 3O38A 4HDKA 2W2NA 3CSUA 1KY2A 4MQEB 1IAVA 4MKRA 1T15A 5AHOA 1X1EA 1XTJA 3JD2A 3QJGA 1DOAA 2WT8A 2DWCA 4CM8A 2K2WA 3ZK8A 3RBAA 2G28A 3H9BA 3OOEA 1NY6A 2NTYC 1VSBA 1TUIA 4C20A 2ZVPX 4GVXA 4NVRA 4E2WA 4CF4A 4BAZA 3UTCA 3SQMA 1E1RA 4NV0A 3F6RA 2QTVA 3C8ZA 3E35A 2HDHA 4W5TA 1HDYA 1P18A 3MELA 4PCVA 1MC1A 1J8MF 2GM4A 2EF0A 4UAUA 4B4OA 4BECA 1YCFA 3CCBA 3IOYA 2FWMX 5KU1A 3K9FC 1CETA 1PLLA 4I9NA 4GZ6A 5DBGA 5C4GB 4U7WA 2CDNA 2ZYDA 2NX2A 3JR3A 1EZ4A 2XOKA 1UZNA 2HREA 2R47A 1S4MA 2YMLA 2X1LA 4H27A 2D1YA 2VJKA 4RKWA 5FPQA 4L2IA 3ICQB 5IG2A 3ZI4A 4A6DA 2NMVA 1S8NA 1V1RB 4XPZA 4GZ5A 4XAQA 1XN4A 2PWYA 1RHJA 4LGYA 5B64A 1QZ3A 4A9AA 1LX6A 2P3OA 3ABRB 4LY9A 2FR8C 4BOYA 4CV1A 4IUBS 5FKJA 4LPKA 1ZIYA 3JWGA 3U0BA 2Q4OA 3QZUA 5K0LA 4X00A 2JGMA 2HCJB 6NULA 4RVHA 2A0WA 1QIFA 3LCUA 4MZDA 5AP9A 2VWHA 5HGJA 2GK3A 5BW8A 2JA2A 1ABBA 2GTPA 1TL7C 4NIMA 5LKRA 1L4EA 3CT6A 3M0EA 3PGLA 1QFZA 1UFRA 3QI2A 2DMRA 4MKZA 2EP7A 2PWAA 4YRNA 1NBEA 2H7YA 4G37A 1I1NA 1XQ1A 3TQSA 3E3AA 1P0PA 1P1JA 3E53A 2HU7A 4WSOA 1PQPA 4FCTA 2HSJA 4KOAA 1EXWA 1SBNE 3KSBC 1T9AA 1GSHA 4MUJA 4DUYB 4Z9XA 4OLFA 2R2AA 3DEAA 3FMFA 1Y5IA 1FNBA 3MQ4A 3OM9A 5FBLB 3TVTA 3ZDFA 1N5RA 4P7JA 4BAUA 4K3VA 4PLGA 8ADHA 3H5AA 3JYPA 4NEGA 1L6RA 4QTTB 4DV1B 2PLAA 2ZYGA 1CR0A 1IIBA 2GPYA 4B5KA 4I55A 1U1CA 4IIUA 4OY3A 4WKGA 4WXEA 3TSZA 4L4RA 3FYUC 4AKIA 2ZJ7A 1UDCA 1JG4A 2CYCA 4JC4A 2ZB2A 1XSEA 3BXZA 4PEVA 5BN5B 2AG6A 3Q5EA 3CZ4A 4GI3A 3F3KA 4BGVA 1AZWA 1HSZA 2P67A 1JHMA 1M6WA 4UKDA 3RUCA 1UBFA 2V7VA 3MQ2A 2KM1A 1XA3A 2AG0A 1Z18A 5KNBD 3W7AA 4AUNA 2WI8A 2Q5HA 3A7EA 2WP8J 4KO2S 4CWAA 2OLJA 1KVSA 2OUIA 2C54A 1B23P 3GD7A 1IJFA 4BUJA 3WMGA 4E88A 2Q8QA 1L4YA 1DFGA 1LQTA 4KMRA 3C4VA 4EZBA 1EFRD 4Y9RA 4M0KA 3DBHB 1ODSA 2CVOA 2PA3A 2ZPAA 2F3PA 2ODAA 3A6JA 2VJOA 3PSHA 2HJWA 3OFND 4QECA 5CVJA 4BGIA 4P3XA 1NQAO 1YBAA 1PYDA 2XHEA 2WYHA 3H42B 1XMOB 4XRGA 3F9RA 1EK1A 4R2LA 2PD6A 3ROQA 5LYJB 3GLHA 4J7CA 4JKYA 5EIFA 1ACLA 2AR0A 3BOSA 4B40A 1UZMA 1SQ6A 5IJ0B 3H3JA 3QJYA 1JDBB 1U2EA 1WD7A 1SZCA 2WTAA 3M5PA 4DQVA 1O94A 3MPOA 1TCBA 3G59A 3RJMA 1GCUA 1CVLA 4G5OA 4IDDA 4U7HA 2IP2A 3ZCPA 3V1LA 2DFPA 3PDCA 3COZA 3ZV3A 4Z7NB 3QPBA 1GITA 2Q2NA 1E1MA 1R5OA 2UZAA 2J9GA 3OPYI 1DT3A 4L4SA 3VPXA 3HDYA 2FSFA 3P4UA 1Z15A 3LYAA 2YJ6A 2JAUA 1QMPA 4MUEA 3LP8A 2LTAA 4NABA 5BNFA 3T9DA 3I4LA 4KKXB 1T24A 4G0XA 1I14A 2OV2A 4XIGS 2PL3A 3QELA 3I9LA 4MA4A 5EIXA 1I2AA 3IUNA 3KAPA 1RI4A 2NZYA 1MOQA 4LE2A 1REQA 2Y1DA 3LF1A 3LHDA 5BR1A 1GPAA 4QOFA 5CXSA 3OJCA 4PC3A 5HKAA 1M6NA 5TQJA 2X1HA 1P0MA 1WXEA 1T5HX 2XTMA 1QU3A 4NX2A 3CPEA 4JX9A 1SKBA 4BO3A 2W4IA 2DUWA 4MP8A 1GTRA 3EVNA 3HYCA 1YI0A 5H7XA 1IQRA 5JSKA 2GPNA 3N6RA 3HCDA 2DG2A 3W04A 3TM4A 5LWQA 3OQMA 2AXQA 5A4KA 1MVLA 2OGTA 4QULA 4K1XA 5IAEA 3WAKA 5L3QB 1VKNA 1IUKA 2YQ5A 4PZDA 4QUIA 3FFTA 1LTHR 5BNTA 1IYZA 3DHVA 3MCWA 3SY8A 4Y6OA 4C1BA 4JLDA 2LUOA 5J2TA 4KAJA 2R4UA 3RYIB 4PYRA 1ZIDA 3HFSA 1IXRC 2FZWA 3FNGA 3UWPA 1BU8A 3SYMA 4L4UA 4QC2A 5L95A 2JJ1A 2I7VA 2QVGA 2Z8YM 3AVOA 3KCNA 4HB0A 1Y63A 4KQHA 4OHUA 4XEUA 1GL9B 4GHWA 3TZKA 1YZFA 1Y5NA 1WZEA 1XTKA 2IUTA 3AUFA 3GT0A 3U1TA 5I9LA 3S1SA 2FFQA 1U9IA 1UF9A 2CNLA 2P8SA 4P4NA 3R6WA 2QV7A 4RESA 4M7RA 3ZGOA 1X42A 1NW9B 2F4VB 1QYRA 4LZJA 2CEKA 1C50A 1IJBA 1N7JA 1UT6A 2PGDA 4KIGA 1KSGA 3ZYZA 4EI9A 3GLIB 2HF2A 5EP4A 2PH1A 4PYLA 2BSQA 2CWDA 1N57A 1Q84A 4IDPA 4MPJA 3PNPA 3DM9B 2XH8A 4LC1A 1C9MA 1RZRD 1Z6ZA 4Y0NA 4ARZB 5AESA 2IH5A 4TLLB 1W52X 2PH3A 3HN2A 4XIFA 1NRIA 1MO6A 3KR2A 3E3OA 2E37A 4OSPA 1JIIA 2PFGA 2NN3C 4N5MA 4TKZA 4XDGA 4GI1A 1GO2A 1KY4A 4LJLA 1YHZA 4AMGA 3MTQA 1C8KA 2JH9A 4RQTA 4CMEA 1W35A 1YV9A 3BRWD 3D6MA 3CNNA 3OJEA 4NYJR 4DRZA 3AINA 3P1JA 1GUFA 1QQBA 2A33A 1P45A 3I5UA 4RHEA 4X0EA 4CM4B 2FEWB 4PFSA 3KSAC 4MW6A 5A3SA 1Q1EA 1G291 1QIGA 1W2WB 3HWRA 3PQDA 1VI2A 1NBHA 4UJ3A 5CHYA 5JDIC 4O29A 4QUEA 1W85B 2SECE 2IELA 4EA7A 2J87A 1C1YA 1WW2A 3ZVMA 3X1MA 1PV2A 2OWDA 3RSLA 2QNIA 4KO8A 1WB6A 4Y8VA 1S5PA 4IOJA 4B4UA 4PW0A 4Q7EA 3W5HA 3L07A 1S3IA 2FK7A 4BV8A 4D8TA 3JAWB 4HRVA 1XWIA 2BKXA 1E3LA 4CIBA 2ZB8A 5EMKA 3IB3A 3WWDA 4DCVA 1K6JA 5L3RA 1K5PA 3U13A 4TKUB 5E0KB 1ZN2A 2H1FA 1V5WA 1L0BA 4Z0TA 5I9BA 4JCCA 1U8UA 4HDMA 4GZMA 3OA2A 4MPPA 5C1BA 3IH5A 1E3WA 1NLFA 4MGEA 4O4LB 1E3TA 5JCZA 4WKCA 1RVDA 2NO7A 2PSSA 2HM7A 3PHHA 2PAFA 2QYHA 1JQKA 1KS2A 3LQYA 3BBPA 1QYCA 4KH0A 4NU0A 3V8RA 3VV2A 5C81A 1QGZA 2AN9A 2L82A 2V5VA 2X9NA 4WOPA 1AS0A 1JI0A 1H1LB 2QJFA 4R1TA 2GCGA 1KI2A 4ILKA 1DWQA 4M7OA 3WL8A 4JXJA 1OTYA 1SVSA 3FAZA 4NDNE 1TMGE 2WIFA 3MJFA 1DJOA 4XE5A 1KOJA 1THTA 3SMQA 1T29A 4EGCB 2VOJA 3U44A 2VKQA 1M8PA 4AT1A 4IGEA 4JD5A 1DJPA 4KPUA 2GEKA 4D4MA 2EHJA 1I3NA 3M4XA 5ED0A 2EJTA 3CZAA 2JZNA 3NNNA 3AEUA 1PNVA 3C70A 3HO6A 4GGMX 4KMSA 3EJWA 3JPWA 5AVZA 4RA9A 1FNDA 1CDDA 4P3OA 4RTNA 4EEKA 3KVRA 4DJJA 3U9SA 4CQMB 4Z1OA 4AMYA 5A06A 4EGFA 2VHTA 5JO0A 1RTKA 5FUQA 2FUCA 4O4IF 5ALGA 3WTCA 3GAFA 4IKOA 3FH0A 1EP3B 3W3ZB 1KEEB 2NUAB 1ICEA 4PGAA 3RGGA 1C0LA 5BMOA 1M7BA 2WTMA 3HB7A 3LUCA 1G21A 2R6CA 4DL9A 1OFVA 4FHCA 5CDFA 4DNFA 1QQ7A 1PX2A 4BDTA 1BN6A 3RAEC 3PHLA 3EX7C 4S12A 1ODCA 2WPDD 1ZW6A 3FSJX 4IZ6A 4RPGA 4CUZA 4MQUA 5DSXA 3ZV7A 2RGDA 1AKNA 1Z45A 1Q74A 4NFSA 3HCPA 4AP5A 4ATNA 1EDEA 1R4MA 1HLFA 2QE7A 3H3XA 3ZWPA 5KNCA 2PO5A 5FLKA 3K1AB 4C9BA 4K7JA 1EQAA 2XQKA 3W05A 2FEPA 1YRQA 4OLHA 1MJNA 3ORRA 2GEUA 2RGNA 1MG5A 1BGWA 1N6OA 1NLMA 4GEGA 5ITZB 1X8LA 3PEEA 4KC0A 4R1MA 1V16A 3PGJA 4IH9A 1WAMA 1SIWA 2FETA 3X0DA 5D7BA 1XDUA 3GT7A 3PF8A 5EJIA 3H0KA 3I2JA 1XJQA 2Q2VA 4IIFA 3USZA 4U6QA 3W8NA 2AJLI 2GX6A 2W6JD 3N5KA 1E64A 3N2IA 1HYEA 4HPWA 3WGTA 3EVTA 4RKEA 3TLEA 2ZDHA 1NRJB 2AKYA 2GKGA 3T4EA 4OHVA 3JQ7A 2VG8A 3BCRA 1SHKA 1T5LA 2G07A 3A11A 4K81B 1UMBA 4J76A 5AI4A 1N2XA 3NTUA 5CRIA 5FI0B 1OTHA 3IPYA 3SOZA 3UW3A 5KTSA 1LVGA 2R6JA 3Q8KA 1IWBB 1M73E 1W8DA 4MB0A 4QATA 4LE0A 2POCA 2CFTA 1R50A 1X1AA 2QR5A 3LO5A 4WN9B 3RUIA 1UKYA 1FRNA 1ZJZA 1ZNXA 2ATCA 2D0IA 2HQSA 5EXSA 5JTTA 4ZEOA 2LNDA 1RAFA 5E7MA 1E6EA 4F85A 4I4TA 4B46A 4E51A 5FR1A 5TMPA 4IOKA 3HDTA 3R7FA 5AJUA 1HT1E 4XPIA 3S55A 2IOHA 3BL8A 3ETDA 3RIXA 3RSHA 3WLNA 1XRQA 5EZYB 1DG1G 1WTAA 2NSYA 2NSHA 1JG1A 1FTGA 3SJZA 3ZY3A 1VHLA 3KOUA 3D0OA 1P6UA 3I73A 4LXXA 4DUZB 2COEA 2PKQP 4HDKB 4FQ5A 2YHBA 2AK3A 4NCNA 2Y0EA 4NMHA 1TKCA 4GC5A<