1Y9JA

Solution structure of the rat sly1 n-terminal domain
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
140
structure length
140
Chain Sequence
b'ASIRERQTVALKRMLNFNVPHVKNSPGEPVWKVLIYDRFGQDIISPLLSVKELRDMGITLHLLLHSDRDPIRDVPAVYFVMPTEENIDRLCQDLRNQLYESYYLNFISAISRSKLEDIANAALAANAVTQVAKVFDQYLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sec1 family domain containing protein 1
publication title Three-dimensional Structure of the rSly1 N-terminal Domain Reveals a Conformational Change Induced by Binding to Syntaxin 5.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Protein transport
total genus 29
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2004-12-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2060 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1y9jA01
3PUKA 4BX8A 1MQSA 1FVFA 5BV0A 2XHEA 3PUJA 5BUZA 4JEHA 4JEUA 4BX9A 5BV1A 3C98A 1FVHA 4CCAA 1Y9JA 4KMOA 1EPUA 4JC8A
chains in the Genus database with same CATH superfamily
1P3DA 3AJ9A 4AX8A 5T64A 3W3AD 2FW0A 2PO5A 1F0KA 4BTVA 3RI3A 1NUTA 2ISSD 3DZGA 3QUAA 1PO7A 2TMGA 3TUJC 2OLKA 3HB4X 3DAHA 3HU2A 4PNHA 2QRNA 1KEEA 5JAZA 5ALFA 1KZ7B 1T0PA 3VZQA 1QU2A 3PEYA 2QUHA 2ZIWB 2PUWA 4MARA 5AOAA 1BMTA 1S2DA 2NO0A 3BOSA 3FZYA 3LX6A 2FW8A 3TM4A 1Q1ZA 2K87A 4AYXA 3TQSA 4C0XA 2WJHA 2XF2A 5DWVA 1QH9A 4LXTA 4BEBA 2FLKA 3NNSA 1W94A 4AIRA 1X15A 3E1SA 4R5MA 4X62B 3EC1A 1RWXA 4B1FA 2XGSA 4AJNA 4XIJA 3R6GA 1L6IA 1NP7A 1QH8A 3H5TA 2QENA 1O94C 2HLDA 3GEGA 3IAS6 3T7JA 1AN9A 4TUYA 4JI5B 4DCUA 4LCBA 2WMDA 1RC0A 3TTSA 2NN3C 4GE0A 2Z3ZA 3OU6A 4RKYA 2Q2VA 3HDGA 2FEAA 3NM6B 3JVIA 4FIDA 4ZFNA 1GCIA 1M73E 3W9BA 3RUHA 3UW3A 3LPCA 2LCIA 4A2PA 4P84A 3QYFA 4PYIA 4ZI3A 4UBLA 4N0MA 2OFWA 2NZJA 1E9VA 2JAXA 3D2LA 4K9PA 3MF4A 4WFJA 4KVZA 4YCNA 2VG8A 2WK1A 3VR0A 3B38A 4JI3B 5JYBA 4FKMA 4M8LA 3MAAC 3FTFA 5IZCA 2DWQA 4B9EA 3STTA 5FOUA 4AQ7A 1C1DB 4XDYA 2GWRA 3FYUB 3I64A 4RSGA 1QE5A 2XQJA 3F2IA 3F9IA 2OV1A 3G2JA 3UGJA 4FYVA 1BC5A 5A06A 3RUAA 5JSQA 3LPLA 4BJ3A 1ZGZA 1Y9DA 2ZYHA 1P2DA 3CIFA 4I8XA 4UPVA 1XCOA 2HUPA 2OYCA 2V1UA 1Q1GA 3N76A 2IYEA 1Z2DA 2RFLA 3LYAA 1QFZA 4AUKA 3WMGA 5LQAA 3AG5A 1A9RA 3MT7A 4CL0A 2H7XA 3VVMA 1T5HX 2YJ6A 2I71A 2KSQA 2VA8A 2Y1XA 2F3TA 5KVAA 4BNTA 4B3IA 4IZOA 4OM7A 3I5UA 4RFLA 5FJIA 4QBIA 4RETA 5G0TA 3UJDA 4RAOA 4AZ3A 1NDQA 4BB9A 1IHUA 4R84A 3K0FA 1Z0AA 4C6HA 1XCPA 1OXKB 3H9CA 5KOHA 2E85A 1FCJA 1JR4A 3FLMA 1II8B 1KJJA 1V1MA 3OOYA 5AQ1A 3O9VA 3IXLA 1ML3A 2VF8A 3X2EA 4C08A 5KTMA 2XMDA 2C57A 3ABRB 1M7HA 5EWMA 5DP2A 4RMHA 3OZTA 4LTDA 1MJNA 3EY4A 2Y6UA 4LWQA 4RF2A 2JBAA 5BYAA 3UC9A 5KB3A 1V8FA 4JYMA 4C20A 5A9SB 3A3NA 2JEOA 2VYND 5CT8A 3H11B 4F93B 2OD2A 4XFDA 4C3ZA 1C3VA 3PHCA 2GUGA 5CM8B 3S29A 1LWOA 5JISA 3GCZA 4BNUA 3SC4A 1TZCA 4OLBA 3LC0A 1ETHA 3U13A 4NKRA 5DFAA 4RTMA 1LCIA 4B33A 2Q1UA 1RZUA 4M38A 4JKIA 2GCGA 3P9NA 4MRAA 1WQ4A 2B3TA 2GXQA 1L5HA 4WCVA 1NBHA 5D86A 2H1FA 2WABA 2ZTUA 2GTHA 1ARZA 1P73A 2BLLA 3HXPA 4F91B 3P27A 4WDRA 2JLQA 2TSYB 3PQ3A 5T6MA 4IHAA 2QN7A 1UBLS 2VP4A 4IQGA 4DDMA 2X5NA 4D0NA 1THGA 1GCAA 1IDOA 4LY6A 5ALDA 1JNXX 2Q6KA 4CFSA 5JO0A 1TK2A 2N46A 4RH0A 1PLJA 2GCOB 1X19A 4X24A 4WV3A 2HA6A 1QB7A 3IH5A 5KJEA 5COBA 1EB9A 4M7WA 3RS9A 4XSVA 4YAJA 3U37A 4Z3KA 4RELA 2HGZA 2Q21A 2CB0A 4V03A 3V9PA 1LJLA 1U2GC 1TCAA 2NPOA 4QUHA 4QGAA 2ETXA 2RHJA 1RS0A 4LE2A 1SIBE 3ITNA 5EPEA 4D57A 4KAAA 1M76A 3F4LA 2FZEA 5KYKA 5TGZA 3ZGOA 3A9UA 3AZQA 1UEXC 4BE7B 3CVYA 4O08A 2W42A 4DV4B 2H0AA 4KR7A 2G40A 4FEYA 3CNQS 4AJPA 5BMVB 3C41J 3ZW7A 1O2DA 3WYEA 4IDNA 1OAAA 5FFNA 2WTNA 4UD6A 3H83A 3HCNA 3VFDA 1K3UB 4Q4LA 1Z18A 4XIYA 1M2HA 3DDCA 4RPJA 3UKOA 4B3FX 2C84A 4MDHA 4RSRA 4A0HA 1L5RA 3UA4A 1G9SA 2OZEA 3AK4A 4N40A 3EF3A 4Q1BA 1CHNA 5FBVB 2C7QA 5I01A 2PPVA 2PR2A 3NUZA 2W9XA 4RK1A 5K3EA 4CCWA 1VPDA 1TPZA 1MUUA 1UCFA 2BY4A 2IU4A 3I4FA 5C32A 3FPHA 1RYYA 1T8UA 1D5WA 3G2OA 4HZUA 3HU5A 5HJ2A 2A4KA 4A8HA 5IJ0B 3D2CA 1E60A 2AHRA 3OWOA 4F96A 1WZ2A 5JXJA 4GF5A 1SHTX 3F5FA 5F52A 1CU1A 2AYZA 4PLTA 3OTOB 3E7WA 1SXIA 4UBOA 2E49A 4X6LA 4BS9A 1PW5A 2H4HA 4N39A 2WF7A 3P9XA 3I1YA 1KJQA 4OATA 5JY6A 4R40A 4KOAA 4RSMA 2K4MA 4F3CA 4WZAA 2CLMB 2QJRA 3R7WA 3P9ZA 3L1VA 3N7TA 3IEMA 1GEEA 3ISTA 1JEDA 1ZD9A 4X7BA 4YMIA 5NLLA 3VDRA 2YZNA 3DQPA 1IZ9A 3OFJA 4ER0A 4ZOLB 2QPOA 2ZUDA 3EWAA 4P5PA 5G3ZA 3SM3A 4LYEA 5H3HA 5AW7A 4Q24A 4IXWA 3RK4A 4E6PA 4WFIA 1K9VF 1OPRA 2OMEA 3TZQA 4B4OA 1FQWA 1BH2A 1TIKA 1ZFNA 2YL2A 3IERA 4WKNA 3ZVLA 1ISPA 2RSLA 3HUTA 3K31A 5CXXA 5HFAA 4F60A 2DM6A 4H7KA 4ZXFA 2RJNA 1A1VA 5JT1A 3FWKA 3BDIA 3PICA 1J8YF 1IXYA 4KQ1A 3QWBA 2PX3A 3O94A 4BX9A 5AW2A 4L0MA 3AEUA 1Z88A 3JWGA 3Q3VA 3I5XA 1ZX1A 1K8XB 1GAWA 1DTWA 2P2ZA 2RIPA 2IH2A 3HN6A 3K09C 2ZVDA 3L1IA 2XA2A 2MCFA 3H4MA 3BMXA 1UR5A 1FYVA 1KMHA 4MTCA 2XMZA 3ASZA 4NBVA 3TMAA 5BN5B 3ILVA 2AVDA 1SKUA 4ON9A 3DD5A 3DUWA 2V7PA 16PKA 1THMA 2FUKA 5FWXA 5KX5B 3ONNA 4HDNB 4X9XA 1EWKA 1D2RA 2VQDA 5IXSA 1VHTA 4ETMA 1YVDA 1PS8A 3GOQA 5AOBA 2JGIA 2VTDA 3I5MA 2UU9B 1AUPA 1N5IA 3B2QA 1OLUB 2RJOA 4RKRA 2NW6A 1E5LA 3IR5A 5IU6A 2FE4A 5AHRA 1N33B 3MUNA 1J4AA 2JPDA 3CUTA 4D97A 5BOVA 2OPHA 1SIOA 5IN4A 1CZKA 3RG8A 3M0EA 5JJBA 4MHOA 4YB8A 3OBIA 4FZRA 4V0RA 4ENQA 4KQXA 2MSLA 1ONSA 1PFUA 4JELA 2JIDA 4EOGA 4AMVA 1RC8A 4JK3A 3UK1A 4YFVA 5AH0A 1FOEB 1MABB 4QPNA 2N47A 5EKTA 5FLEX 3JQGB 3AVOA 1E2JA 1U2EA 3FAKA 3MAJA 4EAAA 4YJ3F 3NEYA 2PQ0A 5K45A 2CDNA 4J0QA 4ZICA 3EXFA 2Q5IA 3QSGA 3M3PA 4D4GA 5F7OA 5C80A 5F9FA 3LUFA 4L85A 5C8YB 4QELA 1R6TA 4L2IB 4D81A 3TXXA 3P45A 4JZYA 1QQBA 4KREA 1S8NA 121PA 1NFQA 3CEAA 5BN3A 4ZO8A 4JWKA 1UBOS 3OM0A 4ZARA 3WGNA 3GBSA 4DJDC 2M2IA 4NQRA 1OWMA 2CVHA 4LOJA 1W52X 3ZWCA 1L7QA 4LRXA 2OBYA 1C3OA 3KHSA 1UT8A 4FGWA 4B6GA 4D8VA 2EQ5A 3M3DA 1NMSA 1VGQA 3LA6A 4DLSA 3QELB 3FVWA 3U44B 1THTA 4S1PA 2VA9A 5KWEA 5TMPA 5LZ7A 5BVGB 2WFMA 1VMKA 2EJTA 2II6A 1QHIA 3EMKA 3NTOA 3DDZX 3RADC 3DNMA 5KVSA 2OBFA 2QEQA 2AJ8A 3R1IA 4UUPA 2VRBA 1Q84A 4YJHB 1WVGA 5HF9A 4XCVA 3ETLA 2QLBA 2PRIA 2ARKA 3LOQA 5IM4F 5EMLA 1MAWA 4AG6A 3PNOA 3KWFA 4IZ6A 3HQ4O 4MI6A 1EFVB 1TZKA 4PAWA 1V4NA 3LQ1A 1WD7A 1XP8A 3HMKA 2OORA 1GPKA 4FNGA 4WLFA 4N01A 2FSUA 3HCPA 1I4DD 3HH8A 1ABBA 1MQ9A 4QGHA 4MGIR 3ZDZB 5HM6A 4YQEA 4Q48A 2HRDA 1A88A 1TYDE 4IMRA 4D6XA 1XTIA 3IXQA 1N5JA 2WWRA 4PZLA 2COUA 1TQ8A 2AJTA 2JCVA 3ZHQA 2DXIA 3SZ3A 3CE6A 4PR3A 5AICA 1NPDA 5FPHA 4H1VA 3N2GA 4DN6A 3CVJA 3H8VA 2Z6QA 3ODPA 1N8SA 2BSXA 4V2IA 4MUFA 3LGAA 5TQ0B 1Y4UA 4BNYA 3I9V1 4UM9D 1DELA 1KJYA 2HA7A 3DNPA 2GJSA 3QE9Y 3DZHA 3WLRA 1RJ9A 2P3OA 4HQFA 2F2TA 2WA2A 5EP2A 1E3SA 4WGGA 3D1JA 1QTNA 4FZ5A 4OXKA 2YZ7A 3JARB 4FNAA 3N1UA 1LDMA 1JDNA 4NZPA 4IEIA 4PLVA 4PSKA 2JEZA 5A7GA 2HLNA 2VP6A 4MYHA 5EZSA 4LQCA 1QHYA 1RQXA 1Z4LA 3IE0A 1N6IA 2OBBA 3TEJA 1YO6A 2IVFA 1IM2A 1DI0A 3OM8A 4D80A 3THYB 4RACA 2EQAA 3NHYA 4QVKA 1QHHB 1U0OC 4NEHB 4BMZA 4L0DA 4DV3B 3ND5A 3W5SA 4CU5A 3B9RA 5AW4A 3I1FA 1BVUA 4TYMA 3WIUA 1U28C 5KDDA 3KFXA 4Y2HA 3N5KA 2KS6A 3U4CA 1NP6A 4Y1RA 3RC2A 3BMCB 4PXSA 3T9CA 1XTJA 2A1TS 5MHTA 1AKTA 3RS2A 4JBNA 3I32A 4YS6A 2WY2D 3ETNA 4EO7A 1JXQA 1I6KA 1K2WA 1RBZA 2QQFA 3BWEA 3HJRA 3O3CA 5TGDA 5AM1A 1RJEA 3ZH2A 1MO5A 1H2YA 3DKVA 4X8LA 3V4OA 1C3EA 1FYEA 2ZYSA 4G23A 1MOQA 4ITVA 4C1NA 3THOA 1QP0A 5J5AA 2WKRA 3A6DA 4FYKA 5GVSA 1B41A 3A1TA 4L08A 4C7OA 4ZIRA 4GP9A 1CUXA 1LV8A 4BWGA 4KQJA 4MYDA 5FWNA 3DKKA 3FZGA 2O4UX 1QG6A 3GXBA 5DCUA 2EP7A 1NFRA 2V7VA 2EFJA 3KOZA 5JDIA 1A9TA 1FP1D 4XX1A 3TMYA 2J9YB 4B6EA 3GQVA 1E1DA 4I08A 4M1QA 1JKXA 5LWQA 1Z47A 3ICVA 1Q83A 3KBBA 4LW8A 3SBXA 1KPHA 1E3EA 3PDJA 3STHA 4ZHQA 3DFIA 4DLWA 1O96A 4YUVA 1RFLA 4B3MB 3UT5A 2GK3A 3NKLA 4E5YA 5JD4A 10MHA 5JUWA 4DBVO 2GZDA 4UDYX 1D2HA 3UM9A 4YHHB 4LFAB 1CIJA 2JAOA 4V1CB 5CXSA 1RKVA 5FF9A 1NA5A 2MTBA 4XTCS 4ARAA 5HRUA 3E9DA 3PXGA 4F71A 2C3UA 3AONB 4Q7MB 4B7UA 4D79A 2JKYA 2Y77A 4YT5A 4UAGA 3A58B 1P3Y1 5HZKA 3V1NA 4BMOB 2EV9A 4TWZA 1C1YA 1H94A 2V7QA 2XUGA 1E2HA 2XVXA 3GRPA 5B3AA 4R2JA 4P3PA 4LZZA 2HXGA 3LVFO 4H35A 4DRYA 2IBMA 4GI5A 4GM1A 3QOWA 1BXGB 2O23A 1KYYA 4IMPA 1Y8AA 2Q45A 2Y1WA 3LBYA 3ZY4A 4JJIA 4LDZA 4TLBA 2PGOA 4E4RA 5JNLA 3FYTA 3UWOA 1KR2A 2PIDA 3KP1A 3OQBA 1E64A 1IE3A 1SOAA 3HO8A 4PTZA 4ZGBA 1WZUA 2XB8A 6NULA 2GBFA 4XSHA 3EQ7A 1L4HA 1G2IA 3MILA 4PIMA 1KZHA 3S55A 4EJSC 4JJEA 2ZAGA 1J8VA 4NYMR 1MHPA 1R15A 4HEA6 5DLQC 2VC2B 1FSFA 5D3MA 2FW9A 4G6ZA 4W9MC 1NOJA 2ZWOA 4JYBA 1AY0A 1TC2A 2NUAA 1KY4A 3D31A 1MORA 1DKUA 1FC0A 2OILA 2ZWPA 3F46A 3OPYA 4HAUA 3RS3A 2OLJA 1PHRA 2Z56A 5HQ3A 3DFZA 3H4VA 1OZHA 2PBRA 3WIVA 4E5DA 2VFAA 4HDSB 2YYAA 1A2QA 5LZ9A 3G02A 4RHTA 4FU0A 5GIOE 3FZEA 4PQRA 4DHWA 4W9NA 1MG5A 3MHPA 5HIIA 1RYEA 5A9TA 3SHWA 5CDGA 5AHOA 5F5XA 4AJOA 5C1IA 4D44A 1WDLA 5I51A 1L5LA 3SYLA 3TFWA 5CVTA 4LIPD 4LJAA 4MIOA 4F9GA 1VG9B 2P75A 2VNSA 4B4UA 4AICA 2VKQA 3F7OA 3C1UA 4HQOA 3T1TA 3FVRA 3SQWA 2H2GA 5K4HA 4HUQB 1FW8A 3SHFA 3CZPA 3OLVA 4C7XA 1FK8A 2R7NA 1T5SA 4KAXA 3L6UA 1PQPA 4B2LA 1HRDA 1E3LA 3JS5A 2ONJA 1JLRA 3RRZA 1VIYA 4AUMA 1IY8A 4L8WB 1VPWA 3PEWA 3EDQA 1Z73A 4XGRA 2A9OA 4XYEA 3RYHB 4X20A 3DTYA 1UXKA 4RIIA 4B44A 1W5AA 1VP9A 1EKXA 2G76A 3U19A 2C5HA 2DMRA 3EIEA 1NVTA 1UFVA 2YICA 2CHVA 2X5JO 1O94D 1Q1EA 2NAPA 5F2KA 4QM7A 2SKDA 2C1XA 4NBLA 2B4YA 2OFOA 1PG5A 1ZUNB 1XN1A 3IGFA 5F35A 2A5FA 1I1NA 1SBYA 2WUWE 4IS2A 2AFIE 4LTMA 1VRWA 2JJMA 3VNBA 1SD2A 4DEXA 1H4QA 2IUSA 1DWQA 1QGZA 3B1YA 2R96A 2MT9A 1SOMA 3GG2A 3NDIA 2ZE8A 1OWNA 4HDQB 1N6PA 1LQUA 1T0HB 1C4OA 4OA8A 4BFSA 4MH0R 1CSEE 3CSDA 1HDGO 1T1IA 5TEVA 1UPFA 4CI0B 1HH4A 3SF8A 3FJYA 2HQBA 2QN9A 3K1JA 5K0BA 5FCDA 1NV9A 1EVKA 1HLFA 5FNZA 5F9HA 5DHFA 2Q0HA 3FI0A 1NW7A 3HKCB 2ZBPA 5EGSA 3RSZA 4GQBA 3GI1A 1QCYA 3T9EA 2B2CA 2VYFA 4B6RA 5LP6B 3GLIE 4CODB 5C7OO 3JD3A 3FOEC 4MUHA 4QTYA 1CLUA 2K6GA 5ICSA 3JAWA 1W88A 3VNQA 3ITEA 1WCIA 2EATA 1ZOLA 2DFLA 3K9LA 4OY3A 4XQEA 3NHRA 4QG7A 3L04A 2HMUA 3ESXA 4ZO7A 3VR2D 3DZ8A 3K5WA 3RVBA 4BLWA 2WB4A 1ZEJA 5E1BA 3PRYA 5BMVF 2ECFA 5KNLA 4I4LA 1RYDA 3U3KA 3GUUA 1HTTA 4B8ZA 2PANA 2VT7A 4D92A 1S8FA 4E09A 3CRMA 2Y71A 4IP0A 1T36A 2P8SA 3DTVA 2ZVQX 1O87A 3H5IA 1P1KA 1P5RA 2BE9A 1SCQA 1YB7A 1QMPA 1L3IA 2SECE 3IA2A 2ZWVA 3GFVA 1YIDA 3WLAA 1MDFA 1BA2A 3QX8A 3U4DA 2CMGA 4HH1A 1MFZA 1BKSB 2QNBA 2QRUA 4CM7A 2FPIA 3AR6A 4IV0A 4JBHA 3OCUA 2WICA 1O6CA 4BV9A 2C1ZA 1FL9A 3AKYA 3T3GA 3U3OA 4XD2A 4JI2B 1BRTA 3OIVA 1K68A 4ONEA 1GZ6A 1R9NA 1YVUA 3RUPA 1MB4A 2D2VA 1JWAB 4NHOA 1NW3A 1RR6A 1BU8A 4FHCA 1KE2A 4PXYA 4CEJB 5KWSA 4ND3A 2B5WA 3K1TA 5FEMA 1CJSA 3DTNA 1SJ9A 4TYWA 1JIXA 4JVNA 3VNRA 5IC6A 3ESBA 4E1AA 3ON5A 1GUBA 4JI0B 3DBVO 4UQLA 3TZBA 1PNVA 3HJUA 4YIKA 3N8GA 4QAQA 5AKXA 2LXNA 1X1EA 2EGGA 2C2YA 5H9VA 3LLSA 4Q93A 3L0ZA 4RSHA 2IDZA 4ZOLF 3WK7A 2Q7OE 1P62B 3INGA 3E22A 1I14A 3Q3GE 3GYBA 4FOTA 4H7JA 1CDEA 5TXGA 4GKVA 3ZN2A 2VDOB 2YWGA 1YV9A 1FFXA 3Q3IA 2MDTA 2W2KB 2ADOA 3BIFA 3EUFA 3DQQA 3PXDA 4KO2S 2N75A 3C5HA 2WKWA 5D5PA 4ZA2A 3SJZA 1YNOA 2WQ6A 1U9CA 4WWHA 4DPLA 4AJ9A 4EB6A 4QKQA 3BD8A 1KHHA 2N1BA 3M6UA 5IF9A 4KV9A 5ERYA 3I6YA 1XXHE 1BCRA 2XKBA 2LD4A 4FN5A 3UQZA 4A0SA 1CQIA 1G6OA 3NIWA 3DOFA 3O82A 1ZUD1 1WBJB 3OBBA 4KAFA 5IC5A 4LSGA 4R2HA 4W1SA 5A02A 4HATA 3EFHA 4NOMA 3PT9A 2XYGA 3E5MA 4LBVA 4ZVKA 3WO0A 3U7GA 2VDVE 4MJ7A 1EG2A 4WOBA 3E84A 1RADA 2V6BA 2CXQA 2X9QA 1IOWA 5CLLA 2UVPA 3S2FA 3FD8A 3BSYA 4CLHA 5B30A 3UMMA 4N76A 1YS2X 2DFNA 3WV5A 1AKMA 5SYNA 2EWMA 1R10A 2QAGA 4NOJA 3J81k 1Y6RA 4U2KA 5KX5F 2VZLA 1FMFA 4CFYA 3D0KA 3GFQA 3GP5A 1BS9A 2AGVA 2I4OA 3S2EA 1JDPA 4EBFA 5KNDH 1I0IA 1N2EA 1KP3A 4GG1A 2UXDB 4YUYA 1SC3A 4O3FA 1TTPB 1T0UA 3VR5A 1U80A 2A9JA 1R88A 1NXPA 3ZJYA 4RVCA 3CXUA 5HJ5A 1T3HA 5KTSA 2V5UA 1OI7A 4AJKA 1UM9B 4MIYA 2WIFA 4IXDA 3RF7A 1TW3A 2YCBA 1E2QA 3I1IA 2QTVB 5GJCA 2FPPA 3DYBA 2G1KA 1RACA 3QWIA 1Y3IA 2MIIA 4YROA 3T5GA 1QRTA 1GWNA 5FR1A 3IDZA 2OGSA 2FPRA 2XMGA 5KQGA 4BIMA 2IE0A 4E5KA 4F4FA 2BDTA 2JK0A 3L01A 3QU4A 5C8YF 2WSIA 1L6RA 4Q1VA 2OYSA 1BKDR 4ZV9A 1YCGA 1MR3F 4YPFA 4ZAWA 2BP7B 1X7YB 1A77A 1SZPA 3IAXA 3O8NA 1CY2A 2AD5A 2J5XA 2CXOA 4XPIA 5E4FA 4Q4HB 1WVMA 5IAKA 1KMCA 2G5CA 5TMDA 3D54D 2ZDGA 3Q6NA 2J30A 2P6OA 1CD5A 5L3SB 2RH5A 4DA8A 4FEAA 4KVFA 1NU8A 3I2KA 1XGKA 5AVJA 2OHJA 3S7TA 1EP9A 1C7RA 2EWVA 2VDWB 3Q0TA 2OD9A 1XZPA 4J1TA 3UZUA 5HFJA 1M6WA 4A1OA 2IXFA 4O3MA 2P0YA 3M7IA 3FCXA 3OJLA 1H6DA 3ZTWA 4JY7A 3L0DA 2I4MA 3QXJA 3ZKAA 4Y67A 3GPLA 2PUAA 1MO2A 1Q0UA 3U26A 1SUIA 2J6IA 4U2EA 2C7RA 4RPLA 2WVHA 4MKGA 2ZB3A 1ULHA 1ZWLA 3MWEB 5CLGA 5E7JA 3RRJA 3U4QB 3LT5A 4R1NA 4HNVA 5LU9A 1OWLA 1IN5A 2CJWB 2K2WA 3R9XA 1U8ZA 1VHJA 1I1HA 1WHSA 2GYUA 3SVLA 3NCHA 3MTJA 1CP3A 4BZZA 3A25A 2DQ4A 3T15A 3ZDYB 1I4TD 2M1XA 2BUCA 1UJBA 2BCEA 4U7JA 3GELA 3JASB 3AUFA 4B3GA 1XTUA 1Z4QA 3HN2A 3ISJA 2HJVA 4LGYA 4Z5XA 3FVVA 4TQAA 4OHFA 3F5MA 4X1OA 3O8LA 1N2IA 1Q0LA 5TS3A 5JNWA 1P6XA 2I7VA 2FQ1A 4NRDA 1H1TA 2C00A 2WF8A 3LUDA 3ZU5A 3WJ2A 1BDIA 1V2GA 4M9RA 4URZR 1EVYA 1ULBA 1MGPA 3EGOA 5J5VA 1ANKA 2NTEA 1I6MA 4KRXA 1ZJ5A 4N0QA 1DGQA 2Q5JA 4BEJA 2GX6A 2IJGX 2R8XA 1UANA 3BHNA 3BK1A 3E5RA 3FYUC 7MDHA 5JLJA 4L22A 5JSUA 4Y9RA 2UUCB 4IQ0A 3TJZA 2UYHA 3GUVA 3UFBA 1ULUA 1KMNA 3BTSA 3MUEA 3S5UA 3U31A 3IQHX 2AG0A 4K6KA 1M8KA 2I55A 3MXTA 1DAHA 4C4PA 1XOIA 2WJAA 1HY3A 1JGTA 1ZU4A 3ORFA 4CQLA 1NRWA 3WMFA 5J58A 1HYBA 3DHVA 4E7PA 3EW9A 4OJQA 4ICIA 1E2PA 3ZWNA 2BEVA 2FUEA 1HZZA 1PIWA 4KK3A 2WIKA 1M3SA 1X6VA 4OXRA 3RFTA 5B1EA 1FJGB 2G4CA 2XY4A 3CW9A 3QG5A 3ENKA 2P27A 4UM5A 3PDWA 1SY7A 3V8NA 4IJ5A 4D43A 2JFPA 1AUVA 2HY7A 1G0OA 3HDVA 4X6UA 4IVQA 2HEIA 5FOVA 1I7NA 1KMMA 1NN5A 3K0CA 2C8JA 2BBTA 4EJ0A 4W1QA 2G25A 5AD1A 4QXPA 4JS0A 1VDMA 1FXSA 4HEHA 5FBZA 5P8WA 3HYCA 2N0SA 3TLGB 4KMSA 2NO1A 2HA3A 1NE7A 3QQPA 4J16C 4JP5A 4G4IA 1WXQA 3WLFA 4FB5A 2PBLA 3K9CA 2O3JA 4HAYA 1FUKA 1JTFA 5LIRA 5KU7A 1ZM9A 5GM2A 5GONA 2ZRHA 2IV7A 1D2NA 3QBTA 4PSVA 1IRIA 1YACA 3OTQA 4QRDA 5KAPA 4EJSB 3ZPXA 2IEIA 3KVOA 1QDUA 4TPKA 5HUJA 3BDAA 2WPDA 1Y0BA 4ESEA 1EXVA 4KQIA 5BUSA 5JJIA 1PUXA 3FCSB 3I4CA 4L3VA 3H9QA 3EX7C 4F1WA 3CH7A 1P2GA 2RHLA 4YAFA 5DW0A 1Y81A 4BP3A 1CUCA 1SURA 4EPXA 1GGEA 3NDJA 2EKZA 3MBOA 3P2MA 1V5WA 1UKEA 3O1JC 3RLIA 1D1SA 2C7VA 2FCRA 2BHTA 2WZDA 1ULSA 4Q1AA 3ZBTA 5MN6A 2ODPA 4ZALA 5HQTA 1G63A 3FBGA 2OV4A 2W71A 3SHQA 5A5FA 3D7LA 1IB6A 3UCEA 3W2GA 4YYEA 1ZD4A 3EF0A 3TIVA 3DFKA 2R62A 1K06A 1VHQA 2JK1A 3T99A 8ADHA 1OAKA 4M89A 4CEHB 4HDKB 3RTAA 4HWOA 1PUIA 1REQB 5JZ9A 4G0XA 4CCYB 1MC8A 3QVXA 3TW4A 1Y8RA 3GZ4A 2R1UA 4XYBA 4Z49A 4X63A 1IRXA 3AP3A 2QQGA 4RIEA 4TL7A 4JI1B 4K6OA 2QSJA 3GLRA 2WMYA 1ZM3A 1WTCA 1JS1X 3AETB 4M1TA 4I1RA 1N2ZA 4GOLD 2IZZA 3OEHD 1OYOA 4YWJA 2NPFA 1XZJA 4HWSA 4OD0A 1R27A 4QC2A 4PO3X 3U0VA 1SCAA 3W4IA 3CCCA 3K6SA 3C3PA 3GBPA 1KSJA 1XLUA 2ZPUA 1JLHA 4B43A 2G08A 3CBQA 1Z39A 3RFVA 1JEAA 4Q37A 3EEIA 1QC5B 2OAEA 4P3NA 4V0NA 4R01A 1AKRA 5LN1A 1G8SA 1W1WA 3DT6A 4Z4HA 4W4TA 4JZKA 2J9RA 4GC5A 1D9XA 1YI0A 1P1FA 2QRLA 2IT1A 3U48A 3Q7SA 2AFIB 4RF3A 5BSUA 4WECA 1F7VA 3G8DA 2ACKA 3O9MA 1ZRSA 2AFRA 5A04A 2REQB 1KS9A 5CDFA 2HJHA 3I0NA 2B4KA 1N6LA 1KERA 1VGRA 3Q10A 4IOKA 1E77A 2MSEB 2AZTA 4LX0A 4JQYA 3O5AA 1ODIA 3KKQA 4QO8A 4KYVA 4CNQA 1Y8ZA 4MS1A 2PKXA 3IPRA 3UKDA 2E0IA 1AIPA 4NBWA 2RGXA 1J0CA 2IYSA 2X0RA 2YVLA 4L72A 5B4TA 3NHUA 5C9ZA 2C04A 3NHSA 1H5NA 1DOHA 1Z5ZA 3JQCA 3ZDXB 2LIPA 3EZXA 3KG2A 4D2IA 3ZVRA 4LI3X 5HJ7A 3GLIB 1AKUA 1LBSA 5ELLA 3QU2A 4BFTA 5C1BA 3PXBA 2ID4A 2V7UA 1J1UA 2H1SA 3DYIA 4QDKA 3UFXA 3GT7A 1WSDA 1YC5A 4GOJA 1JVNA 4DLBA 5JCXA 4XVRA 3ISVA 5NULA 2PFKA 3PR2B 5DLDA 4LRQA 2NV0A 2BM0A 5AOCA 2AOTA 3JYOA 4G5QA 2P1RA 1O7JA 2C3OA 3SC2A 1G5FA 3PKZA 4OPMA 3LLMA 3GJRA 4K05A 3FCYA 4LG1A 2JARA 4L5BA 4RIHA 3I9V6 1N5LA 4BC1A 5I8WA 2GEFA 1H3EA 4O0LA 5LWHA 4ZJPA 2P2DA 4JQCA 4PG6A 2NOAA 3GJ3A 5F5NA 3WMRA 1P7ZA 5EESA 2JLAA 1MV8A 1AHHA 3DO5A 3MTIA 5CA0F 3A1CA 4MB0A 9ATCA 5EJAA 5L6MB 2AF3C 4ZTZB 2DAPA 3UCFA 1M8JA 4U8HA 5EQFA 3RSFA 3F49S 4JJ8A 4PPQA 1E3IA 3TI9A 1JJVA 2FHSA 1DBIA 4FMPA 3TTXA 2FN7A 2PX4A 5EJ6A 3OQIB 5DHPA 5IBCA 2YWDA 1DJOA 3PD7A 4P3OA 3MHTA 1ACLA 4BNJA 2ZR7A 1SXPA 1PR2A 3DPIA 1F6BA 3P2IA 2J7KA 1N2SA 4OP2A 3T3NA 1RAGA 3SLGA 1RCTE 3I9FA 3QKIA 3O8OB 4O2RA 1DV1A 5FB3A 2Q5HA 3BSWA 4J94A 4PG7A 1KDOA 5DCLA 5AW9A 3USCS 3X1XA 4DA9A 4ZK2A 3TIGA 3Q9NA 5JTUA 1WM1A 1XZHA 2HHLA 2ZJBA 2IH4A 5EWJB 1WUJS 4OA5A 3R5HA 2H85A 4EUFA 1KIMA 4MYSA 1QKKA 3MG9A 5CDFE 3PFGA 1N7JA 1CEEA 4BPBA 2JAHA 2QL7A 4CN8A 4AKIA 2WHPA 3QUQA 1QQAA 5AM4A 1GRNA 1QVAA 1XQYA 4PANA 2G1JA 3UYKA 2HQSA 3V2IA 5EIXA 1NT2A 4M2LA 2FX2A 2B4AA 1L4KA 3EY9A 4RKWA 4OGFA 4OGKA 1DIHA 5HKKD 3BFXA 3K9WA 2V7WA 3PLNA 1XXHB 2V8OA 2MSWA 1LTKA 2JB9A 2OZKA 4ER3A 1U9IA 2ZJ0A 2CHQA 2X9NA 4DMUB 4J4BA 4KITB 1W2WB 3RASA 3DOHA 5EL0A 1HL3A 4PC3A 5CGQB 3VKVA 3OX1A 1H8ED 1YCHA 2XVYA 3QVUA 4F45A 4GPIB 2C1EA 4HC4A 4DC9A 1R4MB 3O0TA 3IEKA 3ROXA 1NJ1A 1R7RA 4QPDA 1VRVA 5TMBA 2QBYB 3B13B 2XNCA 3L6DA 5HR5A 2Y1EA 3DEJA 3TQRA 3V2GA 1AT1A 3HA7A 4GVPA 3A2LA 3N0XA 2Q5QA 2V54A 4Z0NA 4S1VA 1DG3A 3U7IA 1G8AA 3NJ8A 2AKAB 4R9VA 3AHFA 1QH1B 1VL0A 1MJFA 3FSEA 3O31A 3ZW8A 3D8RA 3WYNA 4E31A 4NY1A 1V5IA 3MC1A 4MQ4A 4X0EA 3RS0A 4CM8A 1Q44A 2OAQ1 2OFXA 5CPFA 1ZRHA 2V55B 3V4LA 3IP3A 2HIGA 3D6HA 1NF9A 3IAEA 2AMFA 2ETVA 1USGA 1V41E 2WSSD 4LECA 4MLZA 5REQA 4JBIA 4KQHA 3P9IA 4GR5A 1XL0A 5DHAA 4EHIA 3O74A 3QPCA 1Q3HA 4EKDA 1YA8A 3SDSA 3EMBA 1ZW6A 1M2OB 3BWCA 1MG0A 3HYTA 2EZ9A 3HADA 1P74A 4LMPA 1N0HA 5TSDA 4CKEA 5DT9A 3L8HA 5K20A 3G2NA 3WBJA 5LLDA 2XGMA 3RAEC 2BGIA 4C30A 2ANBA 4XIFA 4KN8A 2Z5FA 1XXLA 2PWPA 4E03A 2XCQA 5JIBA 2Z4RA 3Q11A 4I55B 4EGSA 1CUJA 1P9OA 4LGVA 1ZINA 3FGOA 3IJPA 3LMKA 4Q9AA 4TL6A 2W6CX 2J9XB 4MQ6A 5J9FA 3DMGA 2FMUA 2QZJA 5I9BA 4NDZA 4XR9A 2ST1A 3AVUA 1TYBE 2O0HA 1N9ZA 1RPAA 3JQFC 3MYRA 4ABYA 2R6HA 2HIHA 1DIAA 2IHJA 1V7QA 3ZDRA 1E1KA 1WPXA 3FYSA 2O8VA 3O2JA 3PEEA 1UBCA 4XDGA 1AK2A 5JWRA 2KYRA 3CA8A 3KAQA 1RKBA 4MR8B 3RKRA 1E9EA 5FPSA 1BCSB 5LKAA 3B1WA 4P4NA 4PC6A 3IQDB 3R77A 2I1WA 3DYVA 4B76A 5HZHA 1KORA 1KNXA 3IQGX 2EKLA 3L7YA 4HWGA 5KSZA 3D8TA 5CJJA 1EK1A 4I2VA 5H68A 2FEXA 4MNTA 5IM5A 2JFWA 1PJLA 1C9NA 3ZDCA 1OB2A 4X92A 3T4PA 3R41A 1Y1RA 2X8JA 1XHFA 1UDCA 1TFRA 2BRUC 1DC6A 4NZYA 4Y2PA 1DAOA 5AESA 4G5HA 3NVKI 3E2MA 4YAOA 5IXYA 5EHIA 2XYQA 3K53A 1O1YA 1XQ6A 2XUDA 3BFPA 2EZ8A 2VHYA 1N1EA 4OYYA 5IYZA 4IVPA 3OIYA 4KWTA 1XMOB 3EEFA 1M67A 3OP1A 4OHBA 3UMCA 4V3BA 1KEEB 2J7PA 1T9AA 1G291 4B7ZA 4URUR 3QXXA 5AKJA 2A3RA 5KMGB 1N2CA 1X7ZA 1M5UA 1LKZA 3TDKA 3LC1O 5C7LO 3D4LA 4II2A 4WLEA 1CJVC 1GTG1 2WAOA 4DIFA 3AR4A 3F6BX 3W1EA 5DK6A 4ZYVA 4CMEC 4RHEA 2W37A 4AZTA 4F46A 1PLKA 1QH8B 3L07A 4L73A 5T4HA 3QVGA 3WL4A 1EESA 1LPSA 3A31A 3ZVMA 1TGVA 3VYWA 4OO3A 5T8KA 2FE1A 3IIMA 2RB5A 4N0PA 4DV0B 1X1BA 1GFSA 5JSZA 2VT3A 4GICA 3A06A 3M6AA 1I36A 5AP9A 1EFDN 3B6ZA 2P2SA 2EKQA 2VJQA 3KXPA 3TRFA 3EBPA 1UP4A 3EGIA 3OLQA 3U3MA 4ID3A 4PF1A 2YFQA 2H16A 1ZVQA 3P0IA 4QOEA 2WFZA 4EG4A 1XC7A 1DBPA 2NU9A 2SKCA 1ECJA 4EUHA 1UAGA 3TLAA 2IYFA 1RTKA 2X6TA 1W25A 5TX7A 3KNZA 2YRWA 1EEXB 3EGVA 3DC2A 1GUAA 2AXEA 5ARCA 1DIOB 1EFKA 2JGNA 3B60A 3K3PA 4B2YA 3U6KA 4OOEA 4ZI5A 2GGSA 3MLAA 3IUSA 4KXWA 2HPZA 1N75A 1VI2A 2CFOA 2XB4A 3NB0A 3RT9A 4AS3A 3MB8A 2A33A 2I2BA 2GWHA 1LSOA 5BRNA 1MCZA 1W5TA 3QBJA 3LQRA 4HN9A 4BZXA 3AIMA 4F3KA 4MB6A 2PZKA 5BWOA 1KFBB 2PS9A 3DBLA 4MLCA 3O92A 1GPJA 3F8TA 1MN6A 3B3JA 3IQFA 4K46A 5ALGA 4U6NA 5EP4A 3UMVA 3GCXA 4JLJA 4AZ3B 3MWKA 1B73A 4ERXA 3P4UA 2H7CA 3K0FB 3LUBA 1KFEB 2A3NA 4ARSA 2CW5A 4AULA 5KOHB 2PD4A 2DX7A 1QJ4A 4CE6A 3ZW9A 2R65A 1V1MB 5CFPA 1L1QA 2H9AA 2UAGA 1B2LA 2X86A 3M6IA 2IYAA 3PFIA 4LJKA 3WFZA 1T0JB 2DQKA 5EWMB 1XYVA 1ZQ9A 2LIVA 1PDVA 1KARA 2E4YA 1U0NA 2ZKIA 4LJ9A 3V00A 1QU3A 4EVIA 4FCVA 1Y1LA 2DT5A 1ZCZA 2JBAB 3NHJA 4XUEA 4A15A 3S8MA 1PJ3A 3A1VA 4M6WA 5B37A 2QJOA 3QENA 1FSPA 2ZZKA 2WTAA 1KKMA 2Z58A 4CG1A 3C8UA 1KZ6A 2I0FA 3DVAA 2CY0A 2HF7A 4DREA 1OGIA 4J4HA 2IPOA 1VE9A 1YRQA 1WD5A 2BV3A 2ZVPX 2XZLA 3A9CA 3N0WA 4KWEA 1JDBB 2WLTA 1YBAA 3EA4A 4YGXB 4D5GA 3VO8A 3R20A 2BHRA 1JMYA 1AGRA 1ZI8A 1IWPB 1CKEA 2ZRGA 4IZHA 4K9NA 4HQRA 2JBHA 1L5HB 2SNIE 1JB1A 3IXMA 2KQUA 3LRPA 1V4BA 3UPUA 2GEKA 3NBUA 2OG2A 1TD9A 2ROQA 5D5QA 1RPTA 2C4VA 2Q28A 3BXOA 1QV7A 2J67A 2CYAA 2H3HA 1MA3A 2D5LA 1RZRD 2O19A 1VCNA 5LQDA 3CY6A 4HNTA 1NMYA 1OIXA 1E2IA 2DY1A 1CJMA 1TF5A 5INTA 4B80A 4OBEA 4MZXA 1M10A 2ZUWA 3QX9A 4JFRA 3WKDA 4MJ3A 3ED1A 1W581 2EG5A 2JAWA 1Y98A 3LZDA 4FMDB 4UBMA 2VP0A 2G1PA 1S01A 2H3EA 1ZVKA 4YRDA 1LY1A 3TLYA 4LJ4A 1DZIA 3CEHA 3IBCA 4PIPA 2ZPAA 3AR8A 5JFTA 5HS6A 3M33A 4NCJA 2FW6A 3O8DA 4Z2YA 5KTYA 4EZBA 1IPEA 1C9KA 2UXBB 1DJNA 3KELA 4YRQA 1XP5A 3RHFA 5K0EA 1DV2A 5CLHA 3G88A 4HDAA 1PR6A 2M6SA 3C43A 4P82A 3CLUD 4D74A 1NJ5A 2C9BA 3HGTA 5ITSA 3CVWA 1Y3CE 3TLJA 4KWHA 4Q82A 5LP6C 4UTNA 2DPXA 4KJZA 4Q0MA 3VTAA 1Z5VA 3EVDA 3F8SA 4B3DA 1JG7A 2E1PA 3I04A 4R8RA 2RGNC 3FPAA 5D00A 5HIMA 3DE0X 1FMLA 4GVLA 3EPJA 4DRXA 3H1PA 3O4FA 1LLUA 4K40A 4BUZA 1UBSB 4LKOA 1BE0A 3U09A 4RL6A 1YZFA 1P19A 4TZTA 5MN4A 3EZLA 1TJPB 3BIXA 5E1OA 5DWDA 5I4KA 5LMZA 3L6RA 5IPFA 2TECE 1ADCA 4H6VA 2EEZA 3LXUX 1E5DA 3RUEA 4HZUB 3TRKA 5KTRA 4YEDA 2IBTA 3JQ9C 3PU6A 5EMKA 3IDSA 1JQKA 1X7XA 3I04M 3FB1A 5EZYA 5IN5A 1DJMA 5LBUA 5E2AA 3TNLA 1YDWA 2O7RA 3KLMX 4G0PA 4U02A 4R8KA 5DHTA 1P9LA 2QD5A 2IYPA 1I2ZA 1UJNA 2I80A 1MXHA 2YXNA 3LL7A 4IKEA 3GGPA 4JN6B 5MGNA 4WZAB 2WUDA 4QARA 4UEKA 3R7WB 1GZUA 1N25A 1UXHA 2RDMA 3FSGD 4HNAA 3ZHUA 4E2FA 1OMOA 1KK2A 5EJ8A 2P7HA 1GFWA 2WT8A 4B5LA 4W5OA 5BT8A 3K9FC 5K8IA 2JI9A 3H5AA 3H86A 5FL7D 1KPGA 2RHWA 1FU8A 4XVQA 4FJ1A 2PU7A 1Z68A 3K9NA 1EFUA 3IHLA 1DC5A 2PD3A 3CUKA 2DUNA 2WPNA 3PC8C 4KKXB 5EP3A 4HBZA 3H8WA 3VR3A 2J4CA 5KI6A 4BRUA 5JARA 1KFKB 2P2NA 3L18A 5CXQA 2G70A 3TAUA 1VJGA 2QRJA 4MQ5A 2VHJA 1CZNA 5HDBB 3SSNA 3AU9A 2PUVA 4YMWA 5FAXA 2ZJ8A 3ZHZA 3GEMA 4BV2A 1T2NA 1YTLA 3KL4A 3L46A 1DTWB 2OYRA 1HKHA 4W9RA 1EGHA 5TS2A 2B99A 3FWZA 3GD5A 1EI9A 1SKBA 1Z16A 1MBZA 2ZRCA 1R18A 3P0HA 1UPTA 4ZCSA 1XMQB 1KMHB 4WKBA 3D9QX 4O4IF 4JUBA 2JF0A 1ADYA 1T25A 3SHTA 1E9SA 2QLMA 3GGJA 4ZQHA 3DFFA 1QIMA 3JRNA 1EFAA 1YDEA 2QTBA 2VXOA 4BX8A 5FWXB 1BHSA 3U5ZB 2VK1A 5KTKA 3P2JA 1JE0A 3BCSA 2HU2A 2QUBA 3IB6A 3EIFA 4NCXA 1C3XA 4U0JA 3GDHA 2ZRFA 4TMTA 5CIYA 3UAXA 5KTTA 4G9GA 1N2XA 4LOHA 2D5CA 1AOXA 4Q19A 5EWLB 4CKYA 3R4CA 1UH5A 5CHEA 5JZVA 1XQVA 3CLSD 4QA9A 2GF9A 1CQWA 1KQFA 2GTPA 1IUKA 1LDGA 2KPOA 4C22A 3AJEA 4BQRA 2PRYA 1RBMA 3PKIA 3UMFA 1URPA 4MCAA 5F1YA 3ADDA 4MQUA 4N47A 1A5SB 2NQ8A 5CDSA 5BQ3A 1TRKA 2PMFA 4WBNA 2G28A 5J3JA 1MC5A 5JZSA 1HETA 3A6JA 2IWRA 1TQ2A 4YDRA 3EXFB 3KB2A 3TLBA 3TSAA 5CBPA 1R5JA 5JBIA 5LPNA 5ED4A 5AQEA 3RT7A 2AL7A 2QIOA 4LDJA 1T8YA 4QUIA 4DCSA 2V4ZA 3KQPA 1L5ZA 3N74A 3U9TA 5BN3B 2JFHA 3UG7A 3KQNA 4FZJA 1S8OA 1Z0IA 4K81B 1P0PA 4OCZA 3S28A 1C3OB 4LISA 1BEUB 1G8JA 2Q6IA 2W2PA 3MEQA 1P18A 3LT0A 4YPOA 3C6ZA 4FW8A 2W2QA 3R3WA 1GYQA 4OHWA 4WY2A 1GPMA 4TN1A 3QHAA 2PSHA 4P58A 2ZXEA 1KHTA 4YJFA 1HEIA 4FWIB 3I2HA 1TT5A 2Q4TA 5BMOA 1WS6A 2FGJA 4DCOA 4ZJYA 2OSVA 2JD0A 2PKCA 3CTPA 2CL6X 4N5HX 3SKVA 2HNBA 2BGGA 3WP0A 2G6BA 4EVQA 4Y0NA 1N7IA 3AR2A 1MAAA 2AD1A 1L7BA 1VCHA 2PG3A 3ACDA 4ALKA 4M87A 4HLUA 3KR2A 2WF6A 3ZE0B 5LJLA 1ADBA 3D6UA 2P8JA 1BDHA 1RQPA 2C2XA 1P4GA 1XDSA 2P9CA 5BWLA 3KVVA 2XA9A 1JHVA 4K1XA 1XNHA 3QVLA 3WNVA 4EFDA 5BOSA 5M04A 3L7OA 3M9XA 2O1SA 1L2TA 5JC8A 3THXA 1JL3A 2YQ5A 2ZSEA 1MW8X 5FI1B 2EF0A 3F5DA 1HQKA 3OCZA 2CL5A 3TNDA 5L7YA 1YU9A 3B6EA 2I78A 1OFIA 1HO3A 1G16A 3N2GB 1Q7RA 4J0GA 1N7HA 3HLYA 4PLGA 2Q5EA 1UWKA 3F71A 4ACAA 2F8LA 2BMDA 3Q0EA 4BQIA 1A76A 3KHUA 1RYMA 3TDMA 4QDOA 4F8EA 1L5FA 4J1SA 1KGSA 2DPMA 2JGDB 2QUJA 4RQBA 5LR6A 5JS1A 1YUBA 2VDKB 4D02A 3W04A 1RJ9B 1SVWA 2A0FA 3BQMB 1FU7A 2VNIA 1LK7A 1JLKA 2OBXA 3FMFA 5CH8A 1VECA 3VU8A 4COKA 5BW5A 4U9IS 4H4CA 6YASA 1VI6A 2QK4A 4NS4A 5JMWA 3CONA 1RIFA 4GEKA 2XXAA 1EAMA 1RCFA 3ZKWA 3ADPA 1JR6A 2X5XA 3DW1X 2VUTA 1ZR2A 2CHEA 2J9GA 4Z1OA 5A62A 2AA3A 3BH6A 1WXXA 3H65A 4YASA 4BLSA 5E95A 1E98A 4HGRA 1LW6E 1FRVA 1FVXA 2P7IA 3L0OA 4F86A 3AL3A 4PXAA 4ER7A 1GQYA 4BGIA 2V45A 3WV4A 1Z62A 5F76A 4I55F 3BL8A 4AW9A 2ERXA 1RTTA 3QUBA 3ZI7A 5EOVA 4DXDA 2CV2A 1ABEA 1QUEA 2OHGA 3BM5A 4TTVA 1YMVA 1L7AA 1JHMA 2BJVA 2CXRA 2DF8A 2QYTA 3ILYA 3NO4A 4EPRA 5JCOC 4ZVMA 1QIHA 2CVQA 3ZU6A 1ACJA 2R25B 4GZMA 5MF6A 3L5OA 2AHOA 4FS3A 4NMMA 3QF4A 2GBGA 5I9SA 4HDRA 5HILA 3LTEA 3M2TA 5HK8A 1R6VA 4LCJA 1KU6A 4RY2A 2P9HA 2XGOA 5DEIA 4F21A 3V7UA 3HU1A 3R3YA 1FLNA 5E0KB 4G4JA 4V24A 1R4AA 3C85A 4MPPA 3K2IA 3VHQA 4DLPA 4L9RA 4C7OB 2VPXA 3R7FA 4ZIRB 1B43A 3H9UA 1FXWF 2VQSA 3D4IA 3NWPA 5J4LA 4CTKA 2A5DA 2IRWA 3UIEA 2QVBA 3AYXB 1I1OA 5DTRA 3TR0A 4WBSA 1QBGA 4HMOA 4J07A 3VTFA 2XQVA 4HZIA 4WNYA 1IHDA 3WRYA 4CM6A 5ABPA 3WB2A 5H3LA 3KKKA 1PJQA 4IEFB 4EGQA 3TAXA 4ZHQB 1P1IA 1OKKD 5DSXA 4C4ZA 1DUSA 1O96B 1ZSYA 2XAUA 3RRYA 1C3JA 2R7LA 1X80A 2YWHA 4Z0PA 1VPEA 5KUTA 3TO5A 1QYCA 3IMFA 3TD9A 2O4CA 3DWEX 1CR4A 3V8MA 5JS7A 4UTRA 1BMFA 4UARA 1K7SN 1KI2A 1Y7TA 1I10A 1KR5A 1R37A 1S5PA 2FOIA 2WU4A 2QYSA 3EGXA 5DBEX 4ETIA 3EVTA 5IASA 3NORA 5J4VA 2V8BA 4PLPA 5CYOA 2DQSA 1Y6JA 2CXSA 2ZDHA 2FPOA 3A6HA 1PL0A 3IT2A 3RNOA 1LX6A 5KOIA 1FUYB 3OSZA 4HSGA 3BT7A 4TUYF 4YACA 2QYHA 4HVTA 3V1KA 3DKPA 4KKVA 3WLTA 3RROA 1YR3A 1YQXA 1IBLB 1HYEA 4V02A 1WWKA 2MSDB 2X0FA 4HI0E 1Q0PA 1X8KA 3F7TA 2DFPA 1YKGA 4UXHA 1GV1A 5KHLB 1MZPA 1LFAA 3FTDA 1IJFA 4MLPA 5KYVA 3RU3A 4CR8A 2GO1A 2IU6A 2XUPA 1QO0A 1CUFA 1CUDA 1EFHA 3KE8A 4NJMA 4YP9A 1O0BA 2CB9A 3DMTA 4KUHA 4IGFA 2J6BA 1ORVA 1KMIY 4CQJA 2J3LA 1EWVA 5ALEA 2RAPA 4XSGA 5D3MB 2Z3WA 3PNBA 1UOPA 3GGGA 1YFKA 2XW6A 3EYWA 1KC1A 2LRHA 3AUAA 4NK4A 2NUAB 1M1NA 1IONA 2ZQYA 2QV7A 3KC2A 2ILVA 3OPYB 2A9PA 2AE2A 3HCAA 4RFVA 5IDVA 3KWMA 4IX9A 2P1ZA 3RPEA 4BIIA 4TTPA 4DQVA 3I6ZA 3G9UA 3KIPA 3QNWA 1GKLA 4QLAA 5LB2A 2XRFA 3H2YA 3FHOA 5IKPA 5DTIA 4FZ3A 2R1VA 3VHXB 5HCNA 2CXNA 4H3SA 4KHZA 4LBYA 2VBFA 4ZYXA 2IBSA 3G8CA 3PF8A 4K9QA 5D8DA 2TYSB 2CE2X 3FPGA 3HBAA 3MM4A 1IG3A 1UFQA 3FYCA 4IR7A 3REFA 3TIXB 3UAGA 2YMLA 3KSRA 4B6PA 1EIWA 2XBUA 4X65B 3ELYA 5DX0A 4QICA 3GJ8A 1IVSA 2Q3LA 4Y2RA 3L6EA 1DWOA 3AI2A 3H8SA 4ISCA 4FYYA 4TLMB 3DE4X 1A9XA 3FXAA 5CA1A 1U3FA 1NQVA 4G1CA 4TZ6A 1JIVA 2GPBA 2O2YA 2OAGA 1XA4A 2EHJA 2FZCA 4I6GA 4QGFA 3NTUA 3N59A 3LDAA 5EG5A 5BO5A 4DA0A 1QKIA 3WK8A 2OY0A 5FH9A 2GAAA 1G17A 3ZDAA 2QWXA 4M37A 3ETGA 4NOLA 1TM2A 2PBFA 3IHWA 4X20B 5H4HA 2OESA 1J09A 1UINA 1VE6A 2GPJA 4N6NA 4MW2A 4V0LA 4WW0A 3R7DA 5GV8A 3W5JA 1JT9A 1BSVA 4BFUA 2XKKA 2YIJA 5IDWA 3GT0A 3CX3A 1P8AA 1Y7LA 2IY7A 3B8EA 2WE8A 1ECFA 4JSTA 1A7UA 2YJ5A 4LQ4A 3V1YA 2VJCA 1A8UA 3OD5A 1ENYA 1IQPA 1L3CA 4LE0A 5JC1A 2I6GA 1L8AA 1P7WA 3WLJA 1RBYA 1TA4A 3AFOA 5ALOA 5IC4A 3QV1A 4PAGA 2YKGA 3AFIA 4AJ4A 2FZWA 3LPMA 4BFCA 4BFLA 1VL6A 2ZVJA 2C8VA 2R751 3FHJA 3MWYW 5BVHA 3PJRA 3H2SA 4CG0A 2W2LA 4Z6KA 4R54A 2OXRA 3SF8B 1IBSA 4RX1A 1RJFA 1N57A 4YCMA 3PDUA 4E12A 2D1SA 4RTNA 2C4WA 4V0OA 3DL7A 3FUTA 5JR3A 1MVLA 4QX6A 2FDCA 1EHYA 4XW2A 5FHRA 4EB8A 2D0DA 4FMDF 3HWRA 3ICPA 3LBFA 1IBMB 3KAJA 2J0QA 1WB4A 1WV0A 1P4SA 3X0DA 4IG4A 1JSLA 3JAWB 2PGNA 1E9RA 5IAOA 1YQUA 1U2GA 1WCIB 4LHZA 2AH5A 1GNQA 2IEAA 4FLEA 2C5SA 4PZAA 5FFFA 4E3ZA 4JJ7A 5AMXA 4M1YA 4OM8A 4EELA 5ALPA 1PEYA 2PUGA 1T1JA 3S1SA 4R9UC 3R8FA 3GX1A 3ORQA 3T3IA 1C41A 2J48A 4RD6A 4W63A 5AVRA 4UULA 4QSMA 4AB1A 1HDRA 4CCAA 5EAIA 5B6JA 4WD3A 3NR2A 1I33A 2JFYA 1T36B 3FF1A 4FOPA 1TVKA 3BH7A 2ZULA 3DTVB 4QGBA 4LYGA 1M72A 3C8HA 1J56A 3NOQA 1ZOOA 4ZVUA 4AWBA 1J00A 1J2UA 4JU8A 4TRMA 3NDBB 4YA6A 2IXAA 2FWNA 1ENPA 1FP2A 2FPIB 2R4TA 1XPUA 3R8XA 2WWHA 2JW5A 3LT4A 3TCNA 4LRUA 5KIAA 1J7KA 1N1GA 2QLJA 3OFKA 3EB9A 3NNNA 2GT1A 2PH1A 4MWCA 1WXWA 2FZ4A 4JAVC 1QB8A 2CLFB 4PM4A 1DOAA 4JNKA 2P9ZA 3GJZA 3Q3HA 3ZHSA 1W8IA 3RKSA 1GQRA 4BB6A 4LN1A 5KVVA 2ZM6B 4L9SA 2QX8A 2WYOA 3JZAA 4V0QA 5E9WA 4EEZA 4MI9A 3RSQA 2FG5A 2WYVA 3EDOA 4E1BA 1G38A 3E22B 2LTAA 1W19A 3QY9A 1V11A 4E94A 3K8ZA 1C7EA 3ABZA 3F67A 2VHUA 4YAEA 4PN7A 1FFXB 4Y0AA 3O83A 5IULC 4FMBB 3UBTA 2ZJ2A 2C96A 4B48A 2QG6A 3N5CA 2Q07A 2WG1A 3IYLW 3QH4A 4M9UA 1QUFA 2E82A 2IHBA 2XCOA 4H0CA 3R3JA 4WLVA 5H82A 1G5PA 5EIHA 3ZHBA 4NSNA 3ZH9B 1ECPA 4HLDA 4DVJA 5AKYA 4PYQA 4DB4A 4KQGA 4AN0A 1A27A 1CQIB 1WE2A 4MQEA 4DLXA 4UUBA 3ZWAA 2WIAA 1MLDA 3CUEF 4LRTB 1QGDA 4ZJUA 2ZCJA 1Z8NA 7REQA 4HS4A 3RTEA 1D4OA 2NNWB 3M82A 4UZFA 4C0AC 3HXTA 3K09A 4AY6A 2A5YB 4LWOA 2UVPB 3IOYA 3NH9A 4N3AA 5A2QA 1YZGA 2F9FA 3JQAA 2FX5A 2Z1MA 3LHDA 1K9SA 4JT2A 2H1WA 4AK9A 7AT1A 2QAGB 5JNTA 2QPAA 1L7OA 1M9NA 4BGDA 2WYIA 3AR5A 4KDEA 1DUIA 4PSCA 1KRHA 1F06A 1OGJA 2WVGA 1L1EA 1PT8A 3ILHA 4GZ6A 2W6NA 2LUOA 5FOXA 4EKEA 1WMAA 2XDQB 2Z98A 3D3QA 4KIJA 3JALA 1G20E 4IFEA 4L6IA 4PVDA 5DLYA 3RUFA 3U4GA 5JEEA 2C2ZA 1NC1A 2Z2JA 3K32A 4TM8A 1YS4A 1I01A 1QCZA 1TM1E 4GL4A 1F1JA 1K08A 2JGAA 3WQRA 1UKBA 4JHLA 1K3TA 4I50A 4YRNA 1PK7A 1ATZA 1IB0A 1Z8HA 3DAPA 1R0XA 4PSDA 3S7ZA 4AX4A 4CZ2A 4OKNA 3PX7A 1G5IA 1Z0SA 2BWJA 3JWHA 2HK7A 4CCSA 1EX9A 1UMKA 2Z2KA 1OVGA 3GMDA 4M0MA 1NVDA 2FPPB 2I54A 4GOND 4PO8A 2VJKA 5HTKA 3VI3B 2JIRA 1IN8A 5EZ5A 2PLRA 2W6ID 4BVJA 1UPBA 1O6ZA 3MTAA 4J3NA 1L5VA 4MKXA 5HWSA 5K6AC 3OCJA 4NU5A 1Q0HA 3H1GA 1C29B 3PQCA 4ROTA 4N7MA 2OFFA 5C53B 2WHQA 3CNOA 3NBYC 4BVAA 2OLEA 4JT4A 3WGYA 4D0GA 1PQWA 5SYAA 4BP1A 1XU4A 3G3EA 4FFMA 1OXVA 4XD7A 3T34A 5KNBD 1FEZA 5BUCA 4II7A 2Y67A 2XCLA 3GL9A 4XPIB 5K03A 3ANMA 1N3IA 2WC1A 3K4PA 4JR2A 3A6PC 4QQKA 5HKAA 4OK6A 4XQGA 4Y98A 1KH1A 1LB1B 4R0VA 3SQMA 3GEBA 4RM3A 1GAJA 4S2EA 2NNLD 1J7JA 1V9SA 2G1AA 1GHTA 3BE4A 1L5MA 3I9NA 4GLFA 4JU9A 4C4OA 1N0IA 3GVHA 4CL8A 3DL0A 1WL8A 3MWDA 1E0KA 2KBEA 4FDAA 4F56A 1SBHA 5E4JA 1SRRA 5BSTA 1XG5A 3KAPA 2X1HA 5FBKA 1JG4A 4B7CA 2YMPA 4AZ0A 4EY5A 3PK0A 3U4MA 4EPTA 2QS9A 2B25A 4LYAA 3L8ZA 5HX7A 3UN1A 1CP2A 1TJ3A 2AR0A 4ZZ2A 1XAIA 2PUHA 2ZSFA 4JT8A 4NU8X 5DT2A 1G8MA 3L0PA 3WP1B 3R9XB 4TYQA 1YFLA 2V0GA 1DCFA 3DTTA 2HCJB 3WVNA 1LA2A 4UDOA 1DX4A 3H2ZA 3OM9A 4BYMA 4EG3A 2DKNA 5ICCA 4FM9A 5LM3A 2RI6A 5FXMA 3T7DA 4QBKA 3UG6A 1FU4A 5DKFA 4EZEA 1PJSA 2V1XA 3OMXA 5SY6A 4Y0VA 2I3AA 2GZMA 2GM3A 4A0GA 3OKFA 2Z0MA 3AFGA 3G17A 1VBNA 2H7YA 2IK8A 5CVJA 3W3ZB 3DD1A 4M76B 3QBVA 2C88A 1C8VB 3L40A 2Z1NA 4YAGA 3DEAA 4U7PB 1GO2A 2IDJA 3FKSD 1L9KA 1XZAA 4UW9A 4DUYB 3KLOA 3EAGA 4G0OA 2XQFA 2NU7A 3EWNA 4F8JA 1E79D 2UUAB 3FWYA 4ISBA 5IZCC 3CV3A 4ZZ3A 3DMDA 2FQWA 2VCYA 4XEUA 1UP6A 3VZRA 5G1PA 4YFYA 1T9GR 4BXOA 1G21A 1BFKA 1NYTA 3WJ1A 2CCGA 2O50A 4DM7A 4R7TA 4MI3A 2LP4Y 2VHVA 2FVYA 4HY3A 4CQLB 2Q9BA 4HEQA 3WA7A 2R7MA 5EXTA 2D1RA 1FFDA 1XRMA 2WSYB 4NXNB 8OHMA 5MFZA 1EXMA 2BEVB 2DHEA 1BWPA 1A5BB 1NQXA 3PQ4A 3OCWA 4CVNA 4OQQA 1W76A 4OEHA 4U2FA 1EUQA 3GV0A 1JALA 4K9SA 4ZPJA 3WO1A 1K7EB 4TT3A 2VOEA 1CUGA 3DL2A 3SEFA 4O4HA 5KVCA 3ACCA 1J8MF 4CR7A 3O93A 1JHXA 1LX7A 1JG3A 2DU8A 5C8VA 2IUYA 4QOHA 1V3QE 1T2VA 4A10A 1ZR4A 4FFNA 4X1YA 5FUWA 4DMFA 1LPOA 3UK2A 1E1LA 2FFRA 3SLRA 1RM4A 5BP7A 3AGPA 1YASA 5AW8A 3K5IA 3PX3A 5FR2A 1JECA 3KYDA 2XH8A 2QXTA 2ZB4A 4JHXA 1HT0A 5CA0B 3ILSA 3V4VB 2EJBA 1XEFA 3FDZA 5SY9A 5GONB 1PV2A 3ILXA 2ZSBA 4QUDA 4C21A 5DO9A 1SNYA 2RKOA 4IGIA 1I3KA 4M22A 2JIZD 3SC3A 4MR7A 5ALQA 2B34A 1XDDA 2NTNA 3C8ZA 3IUPA 1JDBC 3ZCQA 1CY4A 3LUHA 3AQIA 4WUVA 3KU4A 2UYOA 4H18A 221PA 1SN7A 1P4RA 2YV3A 1LGYA 2ZUUA 3HCRA 3N0RA 5DHQA 4ALJA 4ZHQF 3T7CA 4X7RA 1A97A 1JBQA 1RHKA 2MMCA 1UBTS 1C7IA 3PHGA 3V3TA 3GLKA 2BHNA 1E7YA 1ZIOA 1ISHA 4HQ0A 1M2FA 5C4MA 4KR2A 1KK3A 4X93A 3AB7A 4DCJA 2CSUA 4EA6A 2UZ0A 3K6KA 5DGDA 1SC9A 4RPGA 3K5PA 1EDZA 1ODFA 3GMIA 4MPTA 1U11A 1RWOA 3Q5DA 1AGXA 1JVBA 3L7BA 3IFSA 3OKCA 1O4WA 4Q9LA 2C61A 4Z53A 2BTEA 1N3BA 1ZNZA 2HA4A 3K9GA 4REQA 5DV9A 4OQYA 3RODA 1Y8RB 4FUTA 4OH1A 2AUMA 4HZGA 2HJSA 1S9DA 1JWBB 2JLCA 1SO8A 2PZAA 3F3MA 3HS3A 3JAKA 4C3VA 1DT3A 1JEYA 1QFSA 2Q41A 3IKMB 4NG5A 1F8UA 4QJ3A 3Q6IA 5HHTA 2J5KA 2BFNA 3PXEA 1SK8A 4DG8A 2AFHA 1SQFA 3PUKA 3A10A 3K8QA 4RKFA 2B8WA 3CZAA 1PV4A 3CW2A 4L5IA 2ZCUA 6REQA 3CQ9A 4HNSA 1QFXA 2GARA 3K6SB 2QN6A 4QZVA 4KXQA 3OESA 2HFJA 2J41A 4CKWB 1CUIA 2FPWA 3WGIA 1RYBA 2OGTA 3Q9SA 1B3BA 1XMJA 4M88A 4Q7KA 4F4HA 3FY4A 3CWQA 1Y5RA 2H59A 4OI2A 2IPLA 4W1PA 3UOAB 1A0OA 4J3FA 3ZHXA 4L7QA 1PGNA 2ZANA 3H0CA 5GJBA 3L06A 2QLFA 5K51A 5LZ2A 1EEHA 1SU4A 3TR6A 3OZEA 3VM6A 3ZS8A 1LBEA 2Q1XA 2ZIXB 4AF7A 4HUTA 3G5UA 1ZJYA 4Q4CA 5IABA 4DC1A 3WBFA 1EG7A 2ODNA 4UQOA 1ZSVA 1E1QA 3Q1KA 3VAZA 2BMWA 4RMJA 1D9ZA 2FJPA 5BW4A 3ZLUA 1XAHA 3JVUA 4CL2A 3BF8A 1NFFA 4KODA 5EIBD 2IQ5A 1CY6A 4HAOA 4R3UC 3CEPB 4N9WA 4UNPA 3PR3A 3QPWA 1OXMA 1QGAA 3DOCA 1XAJA 3PVSA 4YCSA 3IRUA 3QLUA 2RGGA 2V9PA 2NUPA 5I7AA 4JJFA 1EVZA 1R0LA 3E9RA 1JAIA 4AMBA 5HKBA 3LBHA 5D85A 4LJRA 1HEYA 3SC6A 1OLXA 4HLNA 5JYCA 3RC1A 2CXPA 3IPAA 3HVIA 3ZCVA 1XKXA 2AOTB 3A05A 1W5FA 3K4QA 2WIJA 3H1BA 2P4UA 4PGGA 2OK8A 3MSCA 1OJLA 1JTVA 1K5HA 1RYFA 4L5AA 4WXMA 1BH6A 3GLGA 1AQYA 4AROA 4TYYA 1Y48E 3VC2A 3ROMA 4L57A 1XZCA 4J76A 5JXGA 3DF7A 3OT1B 2CD7A 2XUAA 3MJEA 3CF0A 4U7HA 2GBPA 4X60A 1YL5A 4WK4B 3W8NA 2ZRQA 4L8VA 2FF7A 4BPRA 4RWZA 4J43A 4JGIA 1GNPA 4OOFA 3GAAA 3OJFA 2O3TA 3EBLA 3FNIA 4IXTA 4LNAA 4OYLA 3GDGA 2C2WA 3E7XA 3WXMA 5FWDA 3CNHA 5KJFA 3A04A 1USVA 1KBOA 1KZYC 1CNFA 4U4AA 1FFYA 3ND9A 3KXDA 1IXZA 3P26A 1UWVA 1UXIA 2O3QA 4PE5B 5FKJA 4G24A 5KQRA 3FFXA 1NL3A 4BMCA 5AK5A 2YTZA 1T3TA 4LHSA 1PR4A 1ZDMA 2IELA 3LDFA 3UMBA 1LRKA 4D56A 3FNGA 4Y3UA 2IOYA 4DJTA 3S99A 2EF1A 2KI5A 1HKUA 3AJAA 2JJ1A 1L4GA 1YS1X 3DBOB 4CQMA 4R1TA 2WHPB 3EQ2A 1U3UA 4X7MA 3RWBA 3TTUA 1J1ZA 4K8OA 3Q8KA 2AMYA 4E70A 1LBHA 2PTHA 4YI5A 1M2JA 1PFGA 1JBKA 2JH8A 1PZMA 1V47A 5HF6A 1UF9A 1OV4A 2CNNA 3OE7A 3VRHA 4DMLA 2EOAA 3KKZA 2GD0A 3MCAA 4B71A 4CXMA 1F7UA 4O1IA 5CYFA 1Y37A 5CURA 2BR5A 4URXR 4ZK6A 3BHIA 1GQ2A 1U9YA 4Z54A 5CDHA 3C3YA 4DCTA 1YB1A 2Y8EA 3BMOA 2ZIAA 3O4JA 2ZR9A 4XWOA 3CH5A 2O14A 1VLHA 3QYAA 1S4MA 3WLIA 3GP3A 3OEYA 3UYLA 4R0NA 1BHQ1 2BJHA 1PQ4A 2BMVA 4ARVA 2NG1A 1GLGA 5BNZA 2QVCA 1E94E 1HDOA 2CFRA 1RQRA 1P33A 2BDEA 1MHTA 3IVRA 1NNI1 3N87A 4NBSA 4HYTA 2QP9X 1PYGA 4PLYA 1NJGA 3EPRA 4CDGA 1CIPA 3C3CA 4U6QA 2JJ2D 2Q5CA 4YP0A 4BVEA 2OHHA 2ESRA 1XSEA 2NXEA 3DHEA 2JHFA 4LPKA 4TQUS 2B7BA 5HF5A 5JO9A 3MD9A 3MIIA 1EZ4A 2GEJA 4OGLA 1H5QA 2YXEA 4Q9HA 2W5UA 4DABA 5BSKA 3VC3A 2JI4A 3M8KA 3RRNA 2HQRA 3KYCA 2OORC 3SS8A 2DP4E 4E30A 2AJCA 1X9IA 3KV3O 1GQFA 2GKSA 1XYGA 3DOUA 3O7MA 5EIFA 3I8XA 1GA1A 2FDXA 3SBEA 3KX2A 5REQB 2PLAA 4N8SA 1ORTA 5KOJB 3II6X 3SJ7A 5LJIA 5HZMA 2WJJA 3MTEA 1E89A 2FJUA 2FSVC 5A3JA 2IEBA 3ABSB 1W4ZA 4MS4A 1HORA 3IHKA 3K9QO 3SPXA 3R24A 1AMUA 1O08A 3QPUA 1SBNE 1LNQA 3KUXA 1GCGA 1IZ7A 1F60A 3RVLA 2JZNA 2OQVA 4CF6A 4CM9A 1E1RA 2QG9A 4FFBA 5L95A 1N5DA 4MYUA 3MTGA 4L4YA 3DLPX 4UCFA 2FOXA 4I5FA 4CIYA 1E4EA 1JPVA 3DOOA 1KK1A 3AP2A 1RZ3A 5AHKA 1A82A 1QORA 1RZVA 3BQ9A 3U3XA 5PGMA 1AN0A 2ZRBA 4ZQEA 3D2BA 4N65A 3WMXA 2FEWB 2BEWA 1R0YA 1FDWA 2D74A 4RE6A 3OHSX 2CMHA 4PZ0A 1VLVA 2FWIA 2HWUA 3X1KA 4D4HA 4HHEA 4HX9A 4X64B 4F8YA 1UMDA 3FKJA 2V4MA 4HGPA 3H9JA 2YH2A 4RGVA 1P5HA 4WKOA 4BNFA 2FPUA 2A0YA 2H6EA 2X9LA 1GAXA 1A2OA 4X1IA 3VU9B 5E9JA 3KB6A 3S27A 4W8GA 4UAVA 4R71A 2IIPA 4TTAA 4W82A 2G72A 3A26A 3NVAA 5FLYA 2WWWA 1FS4A 3BRWD 4YI3A 1X1DA 3U2QA 4CHTA 3G2KA 1V7ZA 2FLWA 3Q4GA 1H0RA 1YXMA 1AKYA 1ONBA 2BGMA 4O29A 1E99A 1H42A 1OYYA 2BEJA 2X8JB 4Y6QA 1GZHB 3LIPA 3OT5A 1PFQA 3QA9A 1SCIA 3ADOA 4RMNA 4U00A 4NARA 3LVRE 4I1PA 2EJVA 1JW9B 2L2QA 5FWAA 5IYZB 1E7MA 3QP9A 5FOSA 2AS0A 1OWPA 1IM8A 1CF9A 1TKBA 2W7TA 2HL6A 1CY8A 1GNSA 3HLTA 1RU3A 1F9AA 8ABPA 5HRAA 4KYTA 4N03A 4YREA 5F4BA 5KTOA 5JDIC 4MV3A 1X7ZB 4CIBA 2GBLC 5JCJA 4HV4A 4ANFA 3LYHA 4OAPA 1OGYA 4RABA 3UB3A 1KQNA 2CLHB 3M4YA 3PUJA 5JPIA 1JR3A 4RGYA 2YWRA 1SIUA 2EKDA 5C51B 1BD3A 1Z8DA 2G82A 3UHPA 2E48A 4DW8A 3I76A 3R3HA 1H0HA 1ZVMA 3LKZA 4Y6SA 3QVGB 5FADA 1R2QA 5BPHA 4L95C 3LOPA 2I1VB 3HN7A 1X3SA 1B6GA 4R2WA 2FPXA 3BXGA 1DEAA 2C5EA 1OC4A 1MNQA 2WKPA 1VMEA 5JSZB 1YJAA 3Q9UA 1EGMB 3I05A 1Z3IX 5CB6A 2VPTA 5A5VA 2B7CA 3IMKA 4GOXA 2GN4A 3GGDA 3LX4A 3NHWA 2WQ7A 1JHOA 3PQDA 1Z6TA 1P2FA 1ZM2A 4KDRA 2UYQA 5BSEA 5CYPA 4BN5A 4OHYA 1U9ZA 1ZGBA 1WCWA 1P60A 4GGPA 5BYJA 3AEKA 2NU9B 4D41A 4OQEA 2ZBGA 4R41A 1CS4C 3RIYA 3I9MA 4YQYA 3JATA 3V55A 2FSPA 1AA9A 3WMWA 3USES 2H2HA 5BNIA 1J1IA 1QV9A 4YR9A 1UQTA 2E4WA 1BYIA 3E35A 1Z25A 3IDQA 5AUOB 1QGUA 1FMCA 3BFKA 4O2AA 3AJDA 4PYJA 2OC4A 1YAJA 3FZQA 3DBLB 2CFTA 4I4IA 1S2OA 4TTRA 2VHWA 4QHSA 1SHZA 4I66A 1XK7A 3R9KA 1Q1NA 2XUIA 3KEMA 4BJ1A 2G06A 1QYIA 3NT2A 1ABFA 3OEEA 4YRAA 3BJEA 1QF9A 3R0JA 1IZZA 5ALTA 4MRPA 1TYZA 4D9KA 2ZJ4A 1Z38A 1WAMA 5CIQA 2E37A 4Q6BA 1CUBA 1L0BA 4NL4H 5JAHA 1KWKA 1MX5A 3MUFA 2WM8A 3UAZA 5H0IA 4FMCB 1BN6A 1DJLA 1U1IA 4B46A 5BYBA 4LDRA 1ZGGA 3H97A 3MOGA 4KBFA 1I2BA 4WKPA 5DM0A 4AJLA 1CUVA 3ANTA 1O77A 4M6WB 2AWOA 3WKEA 2G04A 1OI4A 1QZUA 2OM2A 1VKNA 3CLTC 2VHXA 3DVAB 1KJIA 3FCUB 2ZIGA 2IXTA 3QPDA 4DLLA 4EFNA 1UPXA 4EM6A 5ISMA 1NKSA 1SCNE 3S3TA 5FQOA 3ZVKA 1G1AA 2WWTA 3PC3A 3NTXA 4Q39A 5G0VA 3D3EA 3IEPA 2IE8A 4BZQA 2HF2A 2D2IA 1M1YA 3KUCA 2QVXX 3CKLA 4CKZA 3M4XA 3GEEA 3S1LA 4GSKA 3TAHA 3IT0A 5DPMA 4AWAA 4G5OA 1W9HA 2ZBQA 5GGXA 4PTLA 4ZCLA 3UUFA 3R8CA 2G83A 1X74A 2QGNA 1DHTA 3R23A 2WB2A 1CV2A 1VG1A 2WJPA 4J16A 3DLIA 4JITA 5GONF 2HFKA 2HLDD 5BN4B 2RC5A 3VKUA 2IS6A 4W5JA 4NV3A 1DQSA 3H3JA 3ESCA 4YYZA 2A86A 4GDMA 1QVWA 3HWSA 1TE2A 1N8TA 3AEQA 1W8DA 1M6YA 2P9JA 3A1WA 3HRIA 4NAVA 5KPDA 1EUYA 1SVKA 4QFMA 3TYXA 5FWYA 2CV0A 3JYNA 1H3NA 5DWQA 3EXG1 4ZU1X 4J1NA 3ZK7A 2QSYA 4JMLA 1Z5GA 3GW8A 2WJVA 1FJ2A 5IAEA 2Q27A 1NLZA 2QNIA 3IP9A 1RAHA 1U8YA 2AIRA 5IBQA 3T3HA 1ZC4A 4RZHA 2IEYA 1ZLXA 3L0CA 4HH4A 4E2WA 3M6MD 2BFEA 1DQPA 3EW7A 1JHYA 2I6TA 3GZJA 1STOA 5ITVA 3GP8A 1SAYA 2I7XA 4IQFA 1PK8A 1QRSA 4HWTA 3WKAA 1Q50A 1XJ5A 3OQ6A 3QOFA 1MPTA 3AUXA 1PW7A 4C2TA 1VCOA 1TQ6A 5EJ2A 4DRXB 2ATEA 3IRVA 2WVJA 2FSFA 3DDWA 4KO1S 3AF4A 1X1TA 3B5EA 4HQKA 4RVGA 1AJEA 4UMEA 4WINA 2O2HA 5K6RA 2FU5C 3A3YA 3HDHA 2WHRA 1Y8CA 2C0PA 3C3KA 2CHGA 3DV9A 4OYHA 4MICA 2XUFA 5EVJA 1BWSA 4PZUA 4AO7A 3H18A 3ZQUA 4B17A 2AMVA 2PNFA 1R0SA 1X7XB 5EZYB 1WOMA 4AYTA 3GLTA 3HLKA 5EY5B 4G4GA 1VKOA 1V96A 2EFYA 3KXLA 1GTSA 1LPMA 5CG1A 4KN5A 3ES9A 4FYPA 5AO9A 4TROA 2ENWA 4KE6A 1E0AA 2UZAA 2OQRA 4CMIB 3IPYA 1HE1C 4RWEA 4P7JA 4CF3A 3TQHA 4D9HA 2JASA 1XZKA 2F55A 2AQIA 3F97A 4HNAB 2JLXA 4BFYA 3P2KA 1ZK1A 3LFHA 4BWVA 4K9DA 3AOEC 4M49A 4NG4A 2DHDA 2ODEA 4E4TA 2QUAA 1P0IA 4MUXA 3TRDA 2WU1A 4KLZA 4NI5A 4Q1DA 3BEOA 2IYVA 1N9KA 5IWCA 3BSFA 4MGKR 2SHKA 3C74A 4JJZA 5IKEA 4X8MA 1IK4A 2A0WA 3A32A 3H3FA 4EY4A 621PA 2AN3A 3HB5X 3TFOA 5FOTA 1YQTA 2G3YA 3OZXA 1GG8A 3HHPA 2LKDA 3PGVA 2TMKA 3D0QA 4GM4A 1C1HA 1CQJA 1Y8QA 3AI3A 5FNVA 2HQOA 4ZYWA 2PH7A 2Q0XA 2YASA 2W4IA 4WVFA 1JKIA 4AY5A 3A8TA 2BZ1A 3L6CA 1NF8A 4I7EA 2ZUSA 4LQDA 3FPJA 3CXRA 4YXFA 3PNMA 1X14A 4K1LA 1WMBA 1M2VA 2HWKA 1QAQA 2VF5X 1K27A 1YZLA 3W1VA 5KYGA 2PSDA 1HEUA 2IHVA 2P2YA 4G26A 3RV4A 2AOUA 2ZB2A 1YK0A 1U4SA 4BX3A 4Z4CA 3SFTA 4HK4A 1WSWA 4JXXA 3UPTA 3L1JA 3MWJA 2CV1A 3SQLA 2FR0A 1XRSB 1KEKA 3K0EA 1PT7A 3STWA 1OBFO 1WV1A 4H17A 4N5MA 3TE7A 1DAIA 4F6LA 3GEDA 3QFSA 1SC1A 4O1HA 4MJLA 4GXQA 4KK4A 4L50A 4YRMA 2W8BA 4G5XA 4Y2XA 5CFRA 4NZOA 2W2OA 4FEGA 4UMDA 2IGTA 2PR7A 3EIWA 2FUG1 4NONA 4PPGA 1O89A 1NW9B 2C58A 2FXVA 4JBWA 3HKDA 1BD4A 4AURA 1G3IA 1PBTA 2HPHA 1NVXQ 1RRKA 2BSAA 3K92A 3ZZ1A 5AVWA 5FTKA 4NK5A 5T4BA 3O21A 2F48A 4A8TA 4CIVA 4YVFA 2CFCA 3OUTA 1VJ0A 5CBPB 4JUAA 3CRVA 4F72A 3FOFC 1OH5A 4WNAA 2BGLA 3EZ2A 4GRDA 4Z9XA 2J9FA 3C1OA 3WWOA 5E7MA 4EUEA 3EIOA 4QOSA 5H1YA 2OZPA 1GPWB 5CPBA 1QR6A 1VSBA 1Z0UA 3IAM1 1ZGAA 3NC4A 5LXTB 1Z45A 2BYTA 1RLMA 3PRHA 5FX2A 1U4OA 3IQZA 1U81A 4ZAYA 5K6TA 2D6FA 3FB4A 2RKBA 4FYXA 1KY5A 1YMUA 2ZT6A 2YYYA 5TARA 4QYIB 3SSOA 3URKA 4TGLA 2IITA 3GRZA 2VXYA 4BMVA 4C2UA 2M1ZA 1Z2EA 4ND8A 1DMSA 1TIPA 4F7DA 5DN9A 3VUFA 3EA5A 1WZNA 1BU5A 4LSMA 1R5BA 4LDPA 5BV1A 2H92A 5D87A 1UOQA 4HL6A 4LWZA 1TTTA 1TT5B 1VSQA 3HYSA 4F12A 4B6FA 1X0VA 1XZIA 2HRBA 3T38A 2UZ3A 2DLNA 2JA1A 3HRHA 3VQTA 4CDRA 3O8CA 3PNKA 1FQJA 2PFSA 3DPUA 1U5BA 3DZCA 4C7JA 2P69A 2M6KA 1KE1A 2YBEA 3ZDBA 1GDTA 2HMSA 2Y1FA 4XEHA 1SEVA 4ZI7A 4X00A 4BNNA 4EUNA 4L5YA 3ZXIA 4A2WA 3U44A 1I3MA 5JE8A 1M6EX 4J1TC 2B92A 5BOSB 3L1UA 4XKJA 3PSHA 4MAMA 1AZTA 1JTEA 1N4DA 3KV1A 3N05A 4HYYA 1DRKA 1Y9ZA 4AMYA 4D9BA 4Z7OB 1CQXA 1KS2A 5B2ZA 5CB4A 5D7NA 1U8TA 2IYNA 2LBPA 2KBFA 4R2XA 5IW8A 3W9SA 4YJHA 3UY4A 5FOQA 3K70B 1K97A 3RAGA 4X90A 1IU9A 1YTUA 2JEYA 4J0FA 2EU8A 2CL0X 1W93A 3S2YA 1CUUA 1MZVA 5EFZA 5C4IA 3TLMA 2XZOA 5ELXA 2XOXA 1XR3A 4MW4A 4KGXA 3GAMA 3I72A 3SY8A 4NVRA 3FDFA 1IYZA 1YDMA 3W5DA 2XXAB 2I8LA 4DSNA 2XITA 4ZOEA 3ZKWB 1D6SA 2C77A 3M89A 1QOQB 3VJRA 2C2HA 2IEDA 2W83A 4TMYA 1W75A 3MJVA 4DT1A 2A0KA 4EDHA 3K1YA 3LQ4A 4NFYA 1THZA 1RE0A 1OHHA 3IIIA 1TMYA 4UEOA 2PX6A 1HV8A 1NDUA 1F2VA 4IWNA 1ZM7A 5JZOA 4G41A 2WUGA 4JL5A 5TQ0A 3CH4B 1ZNQO 5DNDA 1T4BA 5JFOA 1Z6AA 5BQXA 1I7PA 4R5HA 1G6KA 2PK3A 3GT3A 4EJ2A 1NSFA 3MGKA 3O75A 4Q34A 2H52A 2LPMA 2BI8A 2E2WA 2YN4A 3R6LA 4IIJA 3OO1A 5FUVA 3AFNA 3JARA 1PJAA 3L8CA 3RAPR 4BBAA 5KNBH 1P29A 4HJXA 4AU1A 1NW5A 2FGKA 2GXAA 3GNQA 1LPBB 3H1EA 3OE5A 4HDRB 3R3SA 1NXQA 4MVJA 4RZUA 3HHEA 1XVIA 4LY3A 3HY6A 4OHZA 3GCGA 3RK0A 5TR9A 6AT1A 5B3JC 1GP2A 1F5SA 2HJGA 2Z6VA 3EARA 1PL8A 3I01A 3TBFA 4RS4A 1E0JA 1CC1S 4FFVA 3Q8WA 3NHZA 2ZE5A 2CJPA 3FUUA 1P2SA 1LFDB 4M8SA 3HUFA 1GFIA 2O0MA 5EXSA 3RC3A 3H2GA 3JWEA 3K0CC 4MVJM 2MSCB 4P81A 3Q8LA 2Z8XA 5KYTA 2WHYA 1BHO1 3HA3A 3UUWA 2ORED 4CIDA 1XHLA 1GLVA 2WVAA 3I01M 4AY2A 5IYZF 1UDWA 1JA0A 2BRUA 1X80B 5BUQA 4Z4EA 1VSVA 1VA4A