1Y9JA

Solution structure of the rat sly1 n-terminal domain
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
140
structure length
140
Chain Sequence
ASIRERQTVALKRMLNFNVPHVKNSPGEPVWKVLIYDRFGQDIISPLLSVKELRDMGITLHLLLHSDRDPIRDVPAVYFVMPTEENIDRLCQDLRNQLYESYYLNFISAISRSKLEDIANAALAANAVTQVAKVFDQYLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords Sec1 family domain containing protein 1
publication title Three-dimensional Structure of the rSly1 N-terminal Domain Reveals a Conformational Change Induced by Binding to Syntaxin 5.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 29
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2004-12-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2060 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1y9jA01
1MQSA 5BV1A 1Y9JA 4JEUA 4CCAA 3C98A 4JEHA 2XHEA 3PUJA 1FVFA 4KMOA 1FVHA 3PUKA 4BX8A 5BUZA 4BX9A 1EPUA 5BV0A 4JC8A
chains in the Genus database with same CATH superfamily
4LVCA 3VR2D 1M1NB 1G3QA 3H1FA 1KK2A 3JQQA 5HIAA 2UVQA 4ZEOA 3A9RA 3PTAA 4CM9D 4YCSA 1P19A 1ST2A 4EPWA 5CFQA 5CT8A 1OBOA 3FZYA 2BDUA 1XXLA 5CDHA 5AVYA 3K70B 4RGQA 3U4MA 3I4FA 2WABA 4IINA 5TQVA 1QB8A 2A88A 4F9EA 2IEDA 3DE5X 4O2AA 1ZM3A 4LV5B 1VTKA 1C4OA 4NL4H 3CPSA 4XX0B 2C03A 4EF5A 3SHWA 3TLMA 3EGEA 4WJKB 1P2SA 4KGXA 1K8ZB 3Q7PA 1W9HA 4ND7A 4K26A 5FUYA 1FRFS 1H2YA 3OICA 5LB4A 4YRTA 3ZKAA 5KNDH 4D4HA 2FDCA 1GGJA 1W4AA 5EL0A 1DEXA 5D86A 2ISCA 3FI9A 3HWX1 4XGNA 2Q50A 1CVRA 3QLJA 1O0CA 4BO6A 2QLMA 1MXHA 2ZQYA 2IHTA 4HXEB 3I6ZA 4KH1A 5DWVA 3THXB 2ZATA 1ZO8A 4FCTA 5CG2A 2H0QA 4NFSA 2HFJA 4C0KA 5TGZA 1J25A 2P8JA 3JY6A 4X97A 2NO6A 3ANSA 1N33B 2V7EA 5JSHA 5JWRA 4G0VA 2DBYA 2Y0PA 1PR2A 3X43A 1CUJA 1RKXA 1F5SA 4GI5A 3R6TA 3W6PA 2YIDA 2XA9A 3OO0A 3VC7A 3IAXA 1K3FA 1NW8A 4JVSB 2Y2UA 3N8HA 4MA4A 4PAQA 3BQ9A 4YQZA 2PYDA 3S29A 3VNUA 5FD8A 1MC5A 4BMZA 2HJRA 1E0DA 4WKCA 3VU8A 3FY4A 3VU0A 121PA 1TM1E 2VHQA 2XQVA 3KQUA 3E18A 2CF5A 4P80A 2PL9A 3EMVA 4C4AA 4DV6B 2PX8A 5B3JA 4BP8A 5C7IO 1SU6A 2VQ6A 2C2WA 4UAVA 3WE7A 4YR9A 5TGTA 2QUJA 3GJ7A 4HD8A 4OGKA 5G0SA 4QDUA 3U7FB 1F4PA 1RAFA 3VC2A 1DX6A 1HFKA 2XLCA 2DTXA 4X8MA 1KK0A 1UKBA 1O94A 2XBLA 2VHYA 4R16A 5C1DA 4HC4A 1R0LA 1SA0A 5B2ZA 4RPCA 1W0KD 3BGSA 2DPYA 4RHCA 4EJFA 5K3BA 5K4AA 4CG3A 1G7RA 4F3RA 4N8SA 2H4WA 2QA5A 4JJAA 5B3JC 1S02A 1JIUA 4OFWA 1M8PA 2H63A 1T1GA 2XVMA 2XTZA 3EW7A 3M0EA 1AF4A 1SBCA 4Q82A 3SFTA 4H7DA 3A14A 1LVGA 2CK3D 3WHLA 1DKPA 5BN1A 4B74A 4TZKA 2RK3A 4YC7A 4LDRA 2JHPA 3PT9A 4F4CA 3WLAA 2QPOA 2JI9A 1SC3A 3CKLA 3ED1A 4IW3B 4LW8A 3L7BA 2EDAA 5HIIA 3DZ8A 3R5KA 1D7OA 4HJXA 3K32A 2VP9A 3FYHA 3V2UA 5A2GA 1CUHA 4F8JA 3HKEA 4QYMA 2J3IA 1C5KA 4H4CA 1NI4A 3AJDA 1MZPA 3R41A 1QX4A 3K16A 2B92A 2XDQA 5AHRA 1WEHA 3ANXA 5HEKA 4DE5A 3QSYA 3THYA 3BT7A 3WKDA 4P32A 4GBJA 4RENA 5FP0A 2NQ8A 2ONJA 3K9QO 4IRUB 1A8PA 1J49A 4ZIRB 2G83A 3ZCUA 621PA 1N6KA 1J90A 2JGAA 1G7SA 1HGXA 1WETA 3S2EA 1E1MA 2OZEA 2H3HA 2BDEA 2DE0X 3B7PA 3I52A 2NU9A 4I19A 1L5OA 4ZVKA 3E9MA 2BFEA 1ZR4A 5JZOA 4K9PA 1E2EA 2JJ2D 1Z4PX 3VR5H 1G21B 1S96A 1WS6A 1ZNXA 1WUHS 3U56A 3CCBA 4AP6A 1IMJA 2OCAA 4TTRA 5FBZA 1NBMA 3TMKA 1MV5A 1ZZGA 4P3XA 1FJXA 4R98A 1MD9A 1Z4NA 1Z6GA 2A35A 1Q0SA 2B9VA 3RG8A 2WJZB 3TTYA 2Z2ZA 3B2QA 3FLBA 5KNCD 4HNVA 1JR4A 8ADHA 3DQZA 1F2UB 1V9CA 3A58B 5IVHA 1IDOA 3MXOA 1N2ZA 5J2TA 4MDHA 3H17A 2XVYA 1TO6A 1Z6ZA 3P5SA 4M1TA 4BMOB 5IDXA 3W1WA 3AUTA 2JHFA 1XLTA 1J7KA 1HDXA 3DE6X 4LI3X 3CZ9A 4V0KA 1D2NA 2P68A 1EH5A 1CULC 4U39A 2CMDA 5TMDA 1B0UA 1X1TA 5C34B 1HL3A 1SIWA 3TTWA 4JEHA 5EQFA 4BB5A 2DULA 1IWBB 1I3KA 2EAUA 3GN2A 5CCEA 2IPNA 1NFQA 2XUAA 5CX1B 3WA6A 1MT0A 2WIJA 3IHWA 4K9SA 4MX8A 4O4LB 4BNLA 2OR3A 4TN1A 4EY3A 2JD1A 1P9WA 1UC8A 2AK2A 3M4YA 3OTGA 5BT8A 1IZ9A 4H7EA 2J9XB 1C9KA 5FNVF 7ABPA 1QIIA 3CJQA 3KV1A 3CE9A 1PK9A 5CDFE 2HO5A 3IJRA 3IMGA 1ZH8A 4LZJA 1U6IA 5BN5B 4M55A 4DXAA 3F7OA 2YWGA 3FZEA 1T8SA 1BDBA 4OY3A 2ANCA 2HMSA 1C0PA 2QDKA 1RQXA 1I24A 5FR2A 4KOEC 5HIKA 1C8VB 3CX7A 3WLIA 2VXCA 4MDEA 4BVEA 4JI5B 1Z8HA 3I01A 2J08A 3HJTA 3PXGA 3ZJ5A 2EBUA 1G63A 2AZDA 4IKEA 1WW8A 2VKTA 4MCIA 2WJWA 2H59A 3IDOA 1GGMA 1HOTA 3CH7A 4UW9A 4PBRA 2IL1A 5KYUA 4IIGA 1BROA 3WGJA 1TFUA 2Q5EA 1SQSA 5IEBA 5LA6F 4ZK6A 4JC0A 2ODTX 2OUIA 4QJ5A 3RKRA 4F84A 1UAGA 4V39A 1NQWA 4OTZA 4WNAA 4B45A 1DKQA 4B6GA 4ALNA 3HK2A 2Z04A 3OJWA 4K6MA 4EFMA 1XQVA 4XIYA 5KNDA 1KEEA 1GTJ1 4LZOA 4URZR 5EUMA 4EHIA 1UDAA 1TZBA 2NZUG 4MQ6A 2D1SA 3TVTA 1TZMA 3UAXA 5JS7A 5DHPA 3MG9A 3HN7A 3RFTA 4UFOA 3BEOA 3SC2B 2YN0A 3ZBUA 1E2JA 1OXXK 4A2QA 1O7JA 4K40A 3GLFA 5C8YB 4KXUA 2QJFA 1L8LA 3CR3C 1KH2A 4F0JA 1QOPB 3PFIA 1TQ6A 3DPUA 3MJ4A 2FWJA 3RM3A 4B2LA 3UV7A 1X19A 2G77B 1DZIA 2IZ1A 3C8ZA 2W58A 5KCZA 3F7MA 3GJZA 4FEGA 2FP3A 1M2JA 3NIWA 4XWGA 5IX8A 3F3MA 2V6JA 2GXUA 2VTVA 3A4LA 4ADSG 3K72B 2HQSA 3K5IA 2P6PA 3VC3A 2DT8A 3VSAA 4DLKA 3MJRA 4GQAA 3F67A 4NARA 4RL4A 2F1OA 4UTZA 4C5BA 1ZESA 2O2CA 4JZYA 2WNIA 1DRJA 1IEXA 3QXCA 3EEFA 5AKIA 3ZQJA 1G3IA 1B0PA 3EF0A 3PIIA 4QGFA 4ALLA 4KHZA 3S8YA 2H1HA 4XVRA 2P1DA 1P61B 3QFFA 3REQB 5I9BA 2E4YA 3O92A 3ETJA 5LMZA 2IZ7A 2D1QA 4J90A 2R6AA 3EVAA 4D3ZA 2WSSD 4PG7A 2RIPA 2WHXA 4FKZA 4CQLB 4GRDA 5KTRA 1MX9A 5KYWB 3W9UA 3OFKA 4I36A 2DB3A 3KZXA 1VSUA 2HIMA 4TN5A 2X58A 4Y2YA 5KTYA 1WBDA 4D44A 1YQ9A 2ON6A 1IATA 3VNAA 5K8VA 3OQMA 4I1SA 5L9AA 3MS2A 2P9EA 1ENOA 2FNAA 4CKCA 3AKYA 1WHSB 2C1XA 4E5UA 5BW4A 3AG5A 2V03A 3EYAA 1M2EA 5KVQA 3PF8A 2UVDA 2Y76A 3FN4A 3DS8A 4REQB 4CM5A 4D0SA 2EYUA 1P4RA 3FRJA 3LK7A 4R7ZA 3S81A 1IJBA 4LSGA 1TB4A 4TRJA 1HDGO 1HORA 1TUBB 4W8GA 4V0RA 3WL6A 4CI9A 2ZUFA 3OX1A 3NHZA 3SXJA 5TEWA 2EKDA 3EZYA 3GD5A 1YJBA 3DTYA 4GGOA 1GZDA 2PH5A 3ADPA 5BSMA 2HLPA 3BRSA 3RUFA 1DSSG 3U4DA 1X87A 2GAIA 2WK1A 1RFLA 4P7KA 5I8PA 2I3GA 2LIPA 2NT3A 1THTA 3EVGA 3SI7A 3V7YA 4FGKA 1QNFA 1DT3A 2F8TA 1UJBA 2QXTA 2IYZA 3EDQA 1U11A 4HFJA 3Q6MA 4Q05A 5T4EA 1SXJA 1TVKA 1XVUA 1BE1A 3G9QA 3I53A 2GPSA 4Q39A 3A9WA 4TRNA 1J0CA 1JLKA 2J3QA 2LWIA 3TSAA 1JU9A 2TMKA 3KBBA 4LBYA 1BHSA 2PT9A 4YCJA 3HU1A 1KY3A 4ZODA 3AKDA 1R12A 4X95A 1BC5A 1E9SA 2V7TA 3FSRA 5FOVA 5BWLA 3EAFA 1EX9A 4L2IA 3G5AA 2I71A 3EQ2A 3MPUA 3UXYA 4ECAA 5JH7B 4X20B 4O4JA 4JUDX 3Q9LA 1QXSA 4D92A 4BNIA 3VR5A 1HV8A 5JDIA 3JARA 2Z9CA 1WABA 1WW3A 4UOZA 4MK4A 4HAWA 2NXEA 4ARIA 4CIWA 3NBUA 3W3AH 4D46A 1VHWA 5IT0A 1MDFA 1MF7A 1YFLA 4I2NA 2VTDA 3GR6A 3HDHA 3LLSA 3W79A 3B36A 5T7BA 4IJMA 1L5RA 2D2XA 5EXPA 1E89A 3QNUA 5FA6A 4GI3A 1S1CA 2FN4A 1OAOC 2OKCA 1ZJJA 4Q6WA 1X38A 4AL4A 3WRXC 3CGGA 2ZI9A 4NTZA 5JHHB 3ZDCA 1U99A 3PJFA 1F48A 1MB3A 2R68A 1KC3A 1L5YA 3HCOA 3PI7A 1HA3A 3ZU5A 4CV2A 3IQFA 1B1CA 3IQGX 3ADDA 3BSSA 4A0GA 4FR5A 4AKGA 5JWOA 3KYIB 2F6RA 1FMCA 3EEBA 1PLKA 4EGQA 2EERA 5CB4B 1P1BA 4ND4A 3GBVA 4BVBA 1KIMA 1OB5A 1XFDA 2ONCA 2PBFA 2X0NA 3K0FA 4O3FA 4INPA 3KL2A 1E18A 4GX5A 4K8RB 3SZ3A 3C5CA 3CKYA 1DDGA 1RMQA 3WIVA 2RHGB 3QITA 2NWQA 3C8DA 3EH1A 3KFVA 1NYTA 1Z74A 3B6IA 3E2MA 4G0NA 5I7UA 3SVTA 2IYSA 1G6OA 3PLNA 2HHJA 1TD9A 3QLUC 5KQRA 3HB1A 5DH9A 3WRWA 2CL5A 1B1AA 4HZGA 2OXCA 2WM3A 3BL5A 4YA6A 4ETMA 3Q8KA 1JIKA 2WJ3A 3KTAB 2HU7A 5M29A 4XGRA 2VBIA 1YFJA 3H6GA 1QTIA 3ZH9B 3YASA 2F67A 3IP5A 1RPAA 1HRKA 3PDWA 1INLA 4DC1A 2QMUA 2QNRA 2B7BA 2H2GA 1T0HB 4X91A 1YUBA 1MOZA 1N1GA 3JASB 4Z1MA 5REQB 4R1SA 1VMIA 3N74A 2PSJA 2JNWA 4H59A 2B2CA 1U3CA 4WA7A 3K4QA 2IY7A 1N5MA 2Y1EA 4H15A 1EESA 4DZRA 3GN1A 4HVCA 3NBMA 3A3PA 3CH4B 4FDAA 2DTEA 5A5FA 1B26A 3D9QX 3DD1A 2ZBEA 4I1IA 4NZNA 2QTMA 3O9VA 1FFWA 1T91A 4YQFA 3KG2A 2VPPA 2GT1A 1W5SA 2JW5A 4OATA 5CJ2A 1HT1E 3C8MA 4FZRA 5JPIA 5CA1A 4N40A 1GFWA 1FW6A 4ESOA 3TLEA 2BCEA 3LX8A 4FC7A 2WIBA 2R66A 4MWOA 4UHJA 4AU1A 1KI8A 1H9AA 5JBNA 1SVSA 1VBFA 4Z99A 4AMYA 4EM6A 1NVFA 1BXKA 2GTPA 3ELWA 2VPYA 3UVEA 4UZFA 1PL7A 4I8XA 4DIUA 2DR2A 1TIPA 1XF1A 3MW8A 4M9CA 4QFBA 5L3VA 3EGXA 1M6HA 2WD7A 4I2VA 4Q1BA 4H2DA 1RJGA 2M1XA 3UKOA 1JWLA 4PX2A 1GA1A 1EINA 3ZE1B 1OPRA 2D62A 3L43A 1H66A 1E5VA 2GJ9A 4PS0A 1SCDA 1JSCA 3NAGA 2P3SA 3B89A 4EG3A 1G8MA 1BFDA 2Y1WA 3M9LA 2HM7A 4XWAA 4RHEA 2N9UA 4PPQA 1NV8A 1DC3A 4NFHA 4OHKA 3NFRA 5IWCA 4TL6A 4QT0A 1K6MA 2QU8A 1N7HA 4U3JB 2DPXA 1EP2B 4R1QA 2IHZA 5DGXA 5EHIA 3UWSA 3UT6A 5JSZB 2HJHA 5D5QA 2ZB4A 3IUBA 3CZCA 4RFSB 3KCNA 1EHYA 4ZCTA 5CLJA 1P5RA 1IY1A 2JGLA 2C04A 3B60A 3BXHA 3AHCA 2V4MA 3ITKA 3L49A 3URMA 1EAMA 1NW4A 1YE3A 4K2HA 2GHRA 4MYHA 4AJ2A 4MMXB 4C29A 2PH1A 5DLPA 4KWEA 4TX1A 1COWA 1PYDA 4RVOA 3WTCA 3E03A 4OHFA 1ISFA 1M75A 4BGIA 4C6TA 5F1PA 2GN4A 3S1SA 4C3OB 4E2YA 4YI5A 1I7LA 2JF0A 5BUQA 1KK3A 3J7TA 3ISVA 1U3FA 4D9IA 3FCOA 1P1JA 3JWEA 4GOLD 4GR4A 4NG4A 4IZ6A 3WJ1A 1B4DA 1U9IA 1O6ZA 1QGYA 1DRVA 2G88A 3AR2A 3EIOA 4FJ2A 4UXIA 1HBJA 1QS0A 1UEIA 4H7IA 1C0KA 2WU8A 3ACDA 2GUGA 3MTJA 2AF4C 5IVIA 3RSSA 3COWA 3CYFA 3ITEA 3QIAA 5K6RA 1KMMA 4LOAA 3BICA 2I2AA 1ZRNA 3EIFA 5BVHA 3PNOA 4MUKA 1JLLB 4ER0A 5I7WA 4X1IB 1IHYA 5LD2B 3RVOA 1JIXA 2JJ1D 1GGEA 4C14A 4MRVA 1JAYA 5GV8A 3WGZA 2ZETA 5DE3A 2ZSUA 1T5LA 1OLSA 3EPHA 1UFKA 1P7WA 1RQ2A 2BH9A 4JJIA 2Y0CA 1AZWA 4TSFA 4NZZA 1V4VA 1NLYA 4CF7A 1PDVA 1XNHA 2PS1A 2WWXA 4YMTA 1GZ3A 1HF3A 1FMJA 1STOA 4DLSA 4WK2B 5FXMA 3G17A 3NUZA 1L1QA 1KDRA 1Z5WA 3WV5A 2G71A 2O0HA 1F6WA 2B2XA 5E1OA 2GDJA 5K1ZA 2UDPA 4UHCA 3UB4A 1SC4A 1OXMA 3RTBA 3UAWA 1ZGAA 3EQ9A 2HJVA 4HMOA 4IIEA 2P5YA 4IPTA 4W1PA 4JXZA 4PCVA 3E53A 2H4HA 3ZQ4A 1KGDA 3B85A 1YRBA 3I42A 3PXAA 4HAVA 4ZKDA 4EZBA 4K3UA 3EUFA 4BFCA 1UMBA 2ERYA 4UE6A 3RK0A 4WZAA 4LWPA 4ZRMA 2FMXA 1DX4A 4UVIA 4DGSA 2CV0A 1KZ9A 1GDHA 1GPMA 2VTKA 3OBBA 1GJRA 3DW1X 4IHQA 1JE0A 4J7AA 5DVZA 3X1YA 3AVWA 1UMCA 3IPLA 2JEYA 4LVUA 1CWUA 1VL8A 2C5GA 5L53A 3ADCA 3Q9NA 3RFXA 4N82A 1MVOA 4PLCA 3ANYB 1G98A 3ESBA 2LDBA 4MUYA 3D6VA 2A59A 2W4QA 3TIVA 2PMDA 5LP6B 3DCNA 4RZSA 4X3CA 1X14A 2X2EA 4XQGA 1NUTA 5BWBA 4KR2A 2P0YA 4S0XA 3ZGZA 1MCZA 1KVUA 3T1NA 4OA8A 1JTEA 3ROXA 2JD2A 2CXHA 5IJWA 1LV7A 2J6HA 2QHXA 2ZJZA 3KD3A 4MMYB 1Q2XA 1ZH0A 5ERGB 3TPFA 2AN3A 3AP2A 4CV0A 2ACKA 1I3LA 3CUVA 4O2AB 3K2BA 3F9CA 2L82A 5HIJA 2HO4A 4JJ7A 3TRJA 3WSWA 2Q41A 3BHIA 3Q9UA 4DMRA 1Q3KA 4G1VA 1ADFA 4I4IA 1GTL1 4GU5A 3N07A 4LXGA 2OAQ1 4R1TA 1FFGA 4OQDA 5EFOA 3CB2A 4AY6A 2LZ0A 2B61A 3VHXB 2JKVA 3O83A 4HO1X 4QBKA 3KS9A 4IDDA 4KE8A 5EAIA 4AQ7A 1NUPA 1C1YA 1DTSA 1NXXA 1Y7PA 3ENZA 4RKEA 1LF0A 3U3KA 2ZZNA 3NRJA 5I4IA 1D6SA 1P62B 1P2DA 2JHAA 3UKDA 5TDHA 3NDRA 1T0PA 1Q0RA 4QYIB 3ZLTA 4CUZA 2CZQA 4Y2SA 1ILWA 2AFIA 3H1BA 3LUJA 3I5YA 1QVZA 5KREA 3S5JA 3DTTA 4OU4A 4GP9A 2C3MA 1JNYA 1C3VA 1HLGA 3UZUA 3NETA 4ARZB 3NATA 1ZC4A 3G02A 3D1JA 3WK9A 1ZOOA 2HWXA 2IEYA 4LISA 4WLUA 3OECA 5T3YA 4RTLA 2NUTB 4O2BA 1Q1QA 2C5FA 5HF9A 5TX7A 1FBTA 2BHTA 2JARA 2WHPA 2UZIR 1NVWQ 4MIEA 4RULA 3OCWA 4Q1FA 1O0BA 2XXAB 3MGAA 5DBGA 2FXIA 1D4ZA 3K70D 1BMDA 1Z26A 4ZHSA 2IUTA 2DETA 4DHWA 5HMMA 2VUSA 4KK4A 2FSFA 2M9MA 3TIGA 1GWNA 3AI3A 2HA4A 3V8MA 1VJ0A 5ALYA 4OAPA 2A14A 4FYXA 4LGMA 2XB6A 1SA0B 2VPZA 4OFXA 1CJSA 2WUWE 2PSFA 3DAYA 2AN5A 1Z83A 2RGNC 3N70A 1DI0A 5DSZA 1UPXA 3GRCA 5AM4A 4EL0A 4MR8B 4NMLA 2H7XA 2XNHA 3NNSA 1Z06A 3PHJA 1XKLA 2QR2A 4BLSA 2XV1A 3D6TB 3O95A 4R1UA 3B2NA 1P6UA 3NTXA 2VXBA 5IKXA 2PPLA 3UAZA 1SZCA 3I6YA 3EF3A 4O6VA 3NNNA 2NSYA 1T2VA 4YN3A 3IA7A 2G04A 5IXSA 5HKAA 5GADl 1WSAA 2WM2A 3I76A 2HWUA 1DQZA 2OV4A 4IDOA 2OA0A 4CCWA 4HTAA 2V54A 3B6ZA 1PT6A 1RKQA 4FOLA 4F5YA 4JP2A 5A4MS 3M1IA 3PGLA 5TSDA 2BFOA 5AW7A 5J4LA 4DMUB 2YWDA 5KNLA 2WPDA 3B9QA 5LMCA 1NI4B 3AJRA 1IM2A 4CDMA 3UCEA 2BZGA 4F5DA 4GM1A 4GOJA 5ALNA 4EA7A 3HRIA 2XDQB 1OAKA 4GIBA 4LZZA 4UE2A 5F2NA 1Y8RA 3THYB 1A8IA 2XKBA 3WB1A 3FDZA 3KETA 2UU9B 1AU9A 3HCDA 4DSAA 5F7JA 1S9DA 3TBKA 4DSUA 3AP3A 3EGWA 2O8EA 4QUEA 3C6XA 5DK6A 3P26A 2Z58A 3M6WA 3T3DA 2GYYA 2WU3A 4EY4A 3RANA 3RIXA 1IUPA 1ISSA 1K3UB 1NN3A 4FUTA 2F1IA 2PUDA 2GDZA 1Q95A 1CK4A 4S1OA 5TE9A 3JZIA 1V16B 2RARA 2Q0HA 1NQAO 3WWZA 2YBEA 2Z83A 4CM8A 3VNVA 1YZTA 1RI5A 4M1EA 1LDNA 3IVXA 4EG4A 1R8JA 1VLHA 1PFVA 1U0EA 4KV7A 4PG4A 2GM5A 1UXIA 1WZIA 3AR5A 5AK0A 4A0SA 4DT1B 3MK31 3QYJA 3SSAA 1I10A 1TQ2A 2O8BA 4ND6A 1Z15A 3M1AA 4R7GA 2GRJA 4KO1S 4NE9A 4K9NA 5I3ZA 3RPEA 5J2TB 3W7AA 3H11B 4Y6QA 7MHTA 3GMDA 2VNIA 2HEIA 2FW8A 3BB4A 5TPZA 3TE7A 2ZRDA 2A1TR 4HDOB 1NQVA 4BNVA 1Y63A 2VT3A 1RVDA 1AK2A 2YMLA 2VWGA 5JAPA 1CUZA 2BLNA 2BBTA 3GJXC 3I04M 3KNZA 3MT0A 1QFXA 1K2WA 3KB2A 4IS2A 1GGNA 3FTDA 4QIHA 2MT9A 1TEHA 4FKMA 2HKIA 3SJUA 4HS4A 1C7FA 4FD3A 2CVZA 3B3GA 3ZIDA 2ZE5A 4H6XA 4DLVA 4UM5A 3L1JA 4PQGA 3QELB 2CW5A 4Q4LA 2BW0A 4X7RA 1RRFA 2ZRAA 1E2FA 1UP4A 3A10A 5JE8A 3GLTA 1I3CA 1SURA 2VJQA 4GYJA 5FPQA 4UBMA 4Z5XA 1VL6A 4KC0A 3NHWA 2IZOA 2XNDD 4R2MA 4F96A 4MIOA 1K6IA 1JVBA 5CYGA 3UAVA 1GRRA 4AJ1A 2G6TA 1BHJA 1WHTA 2Z1MA 2QSZA 1T9KA 2ZWOA 4ZT4A 4B3IA 1UDXA 4JOBA 2RBKA 1AF7A 1MX5A 2ZBUA 3KR9A 1ETUA 4GD3Q 4HRXA 3RF6A 3SJ7A 4C76A 4CIXA 1MGOA 3P94A 1I3NA 1Y9DA 4HDNB 3A6LA 3P5BA 3U7IA 2WNSA 2MMGA 1W46A 1UOQA 4B6SA 1GPWB 3QEMA 1E58A 1SZPA 1WCXA 3JQGB 2XZOA 5JFGA 1Z36A 1U65A 5C4MA 1TQ8A 2F3QA 3IXMA 2RGEA 1NOIA 3K5PA 3NCTA 5J5AA 3P0JA 3TFWA 2JIOA 5DWDA 3ZQKA 2P75A 3H2JA 5KWIA 2BGLA 4BQQA 2R86A 3TRDA 2ZTSA 4MGIR 5K8UA 2FOLA 2FW0A 2X9GA 3RTDA 1D0VA 4A8TA 1KEEB 3AK4A 1X9IA 2W0SA 3HZOA 4RK4A 4CF6A 5IZCA 3HABA 4BC1A 2P5UA 1Z7EA 2HMTA 5JJIA 2K7FA 1TK3A 4AJKA 3N7UA 3U3DA 3L0IB 1BYIA 1RW4A 5EY5B 2FUG6 2IEZA 1F0YA 2PMWB 1NQUA 3H87A 3OD5A 4I5GA 3VQTA 1EWYA 2J31A 3KQQA 721PA 2GKSA 3HHPA 2HBYA 4V2UA 4GECA 4LBZA 2OZVA 3FCCA 2ETXA 3Q2KA 2WDZA 1HT3A 4L8GA 2FI1A 3KJQA 4BNXA 3QKSA 2J6BA 3HNOA 1GQ2A 2B8EA 2W8BB 4POAA 5BQPA 1RAEA 3K0AB 5KIAA 1S01A 3PGMA 4I4TA 2FRDC 1V1RA 1D8AA 2H4XA 3LGSA 1KFBB 1U0FA 4M8LA 3GT3A 4IH1A 4BLUA 4GLBA 4DCSA 1QP4A 2AWOA 3G85A 5JY1A 5LPNA 3VZBA 2GEVA 4H7FA 3A31A 1WLYA 1L1RA 2A5JA 5EMLA 3ONFA 1GFIA 2SHKA 4C89A 4H6WA 4XYLA 5K01A 3M6XA 4ZFNA 2HYIC 3L0PA 2WLSA 2FH5B 5GTDA 3LBYA 2CHQA 3GCXA 1VXOA 3HR8A 1Q19A 4HB3A 3A9CA 4K6GA 4Q1VA 3PV0A 3ZKWB 1EPUA 4QD3A 4CUKA 1W0JD 3MTQA 5KNBD 3E5NA 2PT7A 3G23A 3MWFA 4I46A 4S3MA 1TPYA 3L7MA 4OB7A 4TWZA 2QRZA 5ALTA 2WKQA 4DCUA 4MICA 4XVUA 1FIUA 1Q84A 1G0OA 3I1JA 4DM3A 3ESAA 1U0GA 2QOEA 5FBLB 5JAUA 1YXMA 3NC1C 4EO4A 3FR7A 4TV9A 2Q7XA 2B8WA 3I9V6 1DMSA 4BNFA 4DNFA 1CNFA 1JI0A 4DMMA 4CKCB 3BE4A 4N7BA 4BWVA 1U5BA 5AP9A 1B8PA 3QENA 5C5CA 1QQTA 4RXTA 2JJ8A 3KHKA 3DEZA 3EXAA 4JXKA 3GFBA 4MQMA 4OAQA 1BCSA 3COSA 3WRVA 1P6XA 1TVMA 3D8BA 4BAZA 1V1MA 4XZ3A 4YJKA 3HKCA 4YP6A 3KOOA 1O5TA 5EA2A 4PX9A 3CNLA 2QAJA 1YA4A 4WCFC 3L8DA 3WJAA 1EFUA 3IGFA 3X44A 3RYFA 3ZBQA 1QIFA 4ARSA 3U4QA 3GL9A 1W1IA 1QHEA 1WD5A 3BMOA 4NBRA 1I6KA 5DFAA 1L5QA 4MI9A 3SBDA 1O77A 1Y4ZA 2WV9A 1P4HA 2GPNA 3R5JA 2A5YB 3T1TA 2JLZA 2CJFA 2YL2A 4Z3DA 2E1PA 4IF6A 3CZRA 1BGXT 5H80A 4BQPA 3MLEA 4RJIA 3HU2A 1DOAA 3NHYA 3Q7QA 3BFVA 2LKCA 3IULA 1P9RA 3W3ZB 1H6DA 2XWSA 1CXZA 2O2EA 3LX6A 4JLUA 4MLPA 4MUHA 4J0FA 3JS5A 4DW8A 1C80A 2VHZA 1CPYA 4WT7A 4Y2PA 3N3BC 1JU4A 5B3KA 2HY7A 4XUDA 2FWIA 1NULA 2X8JB 3JZAA 4U7PB 4V3CA 4ZHQA 1KO4A 1V5WA 5EJGA 5IM4F 3UHPA 4RE6A 1O96A 1TX4B 3BXXA 1BCRA 2V7VA 2WKPA 2XOEA 4FYPA 2Q8PA 4OA5A 2WM8A 5FJIA 4RLSA 4PU0A 4MGHA 5CNKA 1HZJA 1PV2A 1L8QA 2PKCA 1RZRD 1BYUA 3AUSA 3T99A 1AQIA 1M1ZA 3ENVA 4MPDA 2BGRA 3T5MA 2R6CA 5CUQA 5EE1A 4EY8A 2C4VA 5M2QA 2C9MA 2GPAA 2Z3ZA 1LXCA 3LUHA 5IVDA 1UKEA 4ED9A 4QODA 4BNDB 1YQQA 1EFLA 1XDSA 1NVVQ 1QE3A 1U2ZA 3OT1B 4W9NA 2Q0XA 1W5TA 4OAOA 2CV2A 3JWPA 4IKPA 1YS2X 4OMDA 1RACA 4XTCS 3IR7A 2QN9A 3U81A 3TXXA 1IRXA 1SC9A 4J75A 1Z33A 2X3YA 4H6VA 5TS2A 3HSYA 3VU3A 1Y6RA 2IYFA 2QK4A 4J2HA 1KS2A 4RESA 4XM0A 3ZE7A 4ZVLA 2VJOA 2ZR8A 3K09A 4OMFG 4XCQA 1QUEA 5DEOA 4P0TA 2I6TA 2VJYA 1I5OA 3MJVA 1K89A 3U3MA 5FPYA 5JS8A 4ACAA 4MKFA 2H1SA 3HYLA 1PJ4A 3G2NA 1PSZA 2C4HA 3RUCA 1SN7A 2G40A 3VH1A 3KOWA 4XQCA 3GJRA 4BV2A 4KXNA 3K4HA 1PAUA 4MUFA 4YV0A 3O8OA 5BV0A 2I1WA 3LQKA 4LX0A 5C8VA 1YR1A 4J49A 4ZYUA 3VR4D 2JI6A 3FCAA 1NXSA 1RYZA 1Z35A 2FPUA 3RU7A 1HQKA 2PO7A 3EDMA 4P82A 5CYOA 3V2IA 1LC0A 4KO3S 3NTRA 3N7AA 4YPOA 1I7DA 1P8AA 1XCMA 2GN0A 2FGJA 3A1CA 3FCXA 4Q24A 5LOVB 3TIXB 3CCFA 4U0JA 3EA0A 5K0CA 2AWNA 1UK9A 1EVEA 3T7SA 2XYPA 4F8YA 1U7DA 4UCWA 4J16A 1Y81A 5ITSA 1EYZA 4NAHA 1GUYA 1LY1A 2V6IA 5ICSA 4HLQB 2VKQA 3JATA 4B71A 4CQMB 4P3KA 2R7NA 2NU7A 3VVMA 5CA1B 3FPSA 4YUVA 4XLTA 5IK2D 4RM2A 1BZYA 1PJCA 1PQWA 5FBRB 1PFQA 4LIPD 3IKLA 2FSSA 3SS7X 5AQEA 4YJ3F 3P9CA 5EEHA 1MQSA 4QPJC 4EYGA 1NJ2A 2COKA 5LU8A 2WHRA 2I4RA 1KH3A 4M21A 2ZIVB 4ZARA 1XN1A 3IX7A 3RVMA 3DA8A 1K6EA 1KXJA 3FTNA 1SHZA 2A9JA 2HNAA 1G8AA 3HYRA 3HUTA 3EGXB 3L4BA 3OU7A 2I33A 4YI3A 3DTNA 3MMPA 3MYYA 4J0JA 4GMKA 4YRAA 1UJ5A 4BMDA 2GILA 1WTAA 1AS0A 1FU8A 4TVBA 3QX8A 5KYGA 4YR7A 4HLNA 4F2PA 4EDFA 5K45A 2YINC 1GDTA 2I67A 3OZDA 3CEAA 4UHEA 2EVWX 3H42B 4B3TB 4KU4A 3AEYA 5C80A 3SSOA 1MH1A 2HHAA 3FKQA 3U0VA 2GCNA 1VPVA 5B53A 3W1EA 2X7HA 3D6FA 2QVLA 3OMXA 4RK0A 3IMFA 1MDBA 3FI0A 4RVGA 2AHOA 1J56A 4FLEA 3HL0A 3ZEAA 5GVRA 4EARA 4GBED 5AVQA 2EX0A 1D3AA 1WPGA 3OBIA 3V1MA 5HOEA 5DISB 4QGBA 4YMGA 1SQFA 9MHTA 1SGWA 1GPNA 1BQ4A 3PKZA 1CD5A 1K86A 3H3XA 4QVGA 1IZ8A 4R2HA 3SQNA 1PTJA 3PFFA 3PXEA 5L7YA 1B14A 2PZ8A 2TMDA 1MJNA 3ROPA 1E62A 2LR0A 1XWFA 2WMOB 1FYFA 3CY6A 2O2IA 3NTUA 3PQ8A 4G5HA 3FRIA 3R3SA 4C6TB 4CCSA 4JYCA 1ETHA 3SDBA 2I6XA 2LBPA 1IN8A 1PL6A 2X9QA 5EOVA 2ZS8A 2I2WA 2MSCB 5LP1A 4RM3A 4X66B 1MLDA 3OPVA 2D3TA 3OTWA 5FUXA 2ZKIA 5IAGA 1TZJA 5JNRA 1N5LA 2G9VA 3IVGA 5TQ0B 1AKMA 3A9UA 3VR3D 3WGNA 4B76A 4LRQA 3DDHA 3AERA 3DE0X 4LZAA 4LGYA 1DC6A 3TUJC 3I9NA 1P7YA 2YWRA 4UARA 5ALUA 3INGA 2YOHA 3SIRA 3UJDA 5E4FA 2BTEA 2QUKA 4MWSA 3EOZA 3FVRA 3GUHA 1RQ7A 2APJA 4KN8A 4ZEWA 4RL6A 3UH1A 1TCVA 3KEOA 4PG6A 4AZVA 2G1KA 4NU5A 4WJZA 2FN3A 4RTSA 1SOUA 5GWXA 1XNQB 1Z3IX 3NTQA 3JQCA 1NW3A 4NIMA 4PR3A 3RC2A 4DLAA 3ROTA 2CLMB 1GPYA 1ZJZA 2EQAA 1WDKA 4W9RA 1LQUA 3L1UA 4RXMA 3MTBA 2J0SA 2IPOA 2IZZA 2Q07A 8LDHA 4NBTA 2YXBA 2VJDA 1G8JA 2O2YA 2P0EA 4M46A 3O4RA 3GVIA 4HQNA 3M5PA 2EFYA 1CUBA 4TM8A 5EJMA 3G0HA 4D02A 1DIOB 1LTKA 1USIA 3A27A 3VTAA 1BVRA 3WMRA 3TMAA 1Q7CA 4BE4A 3D8UA 5EKXA 4ZYTA 2ZG6A 4JQYA 1OYYA 4CFSA 4HWGA 4JD5A 4OMCA 3IJ5A 2AXNA 3IAAA 5CJPA 1D1SA 3FYUB 4DSOA 3P2KA 1IQ0A 2VJAA 3F71A 4UC0A 5K0LA 2ZBGA 1N9KA 1CQJA 2GXQA 2IGBA 2V4UA 3KFXA 3U6KA 2HSDA 1O6GA 5I9SA 1V9LA 2J3HA 1V2HE 3OZXA 4N3NA 2E3JA 2HOQA 4N9WA 5KWEA 2J9FB 1ZUNB 3RKSA 4ZCIA 1T6BY 5FWDA 2JGDA 2J07A 1JA9A 3P20A 2H11A 5FNVA 5THXA 3UAYA 5BSWA 1JG4A 5AVZA 3SOPA 4EJ0A 1FXUA 4RTJA 1FFSA 2R7AA 1BMFD 2YWFA 3DKPA 2EHDA 3KPYA 3G5MA 4KDRA 5BNFA 1B8VA 4D8TA 1K8XB 2FRVA 1UMCB 3JWIA 2O1SA 2V5UA 5INTA 2AE1A 1ORVA 1WSBA 3ICOA 4ZMSA 5A9RA 4Z4IA 2JG3A 4JVMA 1KQNA 4LTDA 3O47A 3QXHA 3TR0A 2YUIA 5B6IA 1MX1A 1R37A 3DDNA 1RE0A 4L7QA 4ZKEA 2XUFA 4QXAA 4JY7A 4C2UA 1JHDA 1M3SA 3TLJA 2G5TA 1DB3A 2XRYA 3TVYA 3DAHA 3GG9A 4NONA 5CGZA 1QFZA 2GARA 4LJ8A 4RTOA 2A9KA 1TTTA 3C3XA 4MLCA 5I4CA 2VNHA 4J76A 4JUCA 2GZAA 2AJLI 2ZBVA 5LA6A 2F59A 2C8JA 2W6JA 1XZBA 4LRWA 2WY2D 1WMEA 3N39C 5I7OA 3DL2A 1QDUA 1RD4A 2EIHA 2HSJA 1QQ5A 4NQZA 5CNIA 2QX6A 1F6BA 2XD9A 2ZYIA 1EZ4A 3EDCA 1JAZA 1E7RA 4QRHA 3A04A 2PWZA 3EMDA 5A3SA 1Z8NA 2WUGA 3T1VA 5MFPA 1QYWA 4YT4A 3BIXA 4Z0HO 5FEUA 2VA9A 3EIQA 1Z0IA 5FULA 3PVSA 4D79A 5CXQA 1ZBDA 2AYYA 3RUIA 3ZYCA 4Z9YA 1QGAA 2B30A 2BFFB 4ZAYA 2Y1OA 1TJNA 2I4OA 3OE1A 4BU1A 1ZSVA 3KAKA 3Q85A 4LOKA 1T1JA 4ROTA 4GZLA 2QRMA 3QKUA 1QPBA 5YASA 1MZVA 1Z7GA 3HYSA 4HWTA 1PZHA 3HNRA 4M0FA 5CM2Z 1L4NA 2ECPA 2ONZA 3LDGA 4KIJA 2CXRA 2HPHA 4D0LB 2PKWA 1MEOA 2QTLA 3A3NA 1O8CA 4WXMA 2INGX 3SXUB 2F3PA 4DRYA 4D99A 4PAWA 1YDEA 2Q8NA 2WP0A 3K0CC 1KDZA 5D7BA 1TAQA 2V7BA 1YDMA 3TF5A 1J1ZA 2V58A 5KQLA 1W29A 5HJ2A 5LC1A 1I7NA 4PXAA 3AG6A 4RV9A 1G18A 5F9MA 2I6GA 2WHPB 5ICFA 2IOFA 4HGNA 1QR6A 3QOXA 3KD2A 3V1TC 4BFTA 1PCXA 1WF3A 3AESA 3GU3A 5LDGA 2I2XB 4KACA 2PMEA 3UOAB 3U3ZA 3ERCA 1Q0UA 1A50B 1XDDA 2CJWB 3HJCA 4GPAA 4UHBA 1TF5A 2CC2A 3QE4A 3U7QA 1YTUA 1J8VA 1FP4A 3NTVA 4N54A 3FR8A 2DWOA 4HGOA 3W78A 2B7CA 2ONYA 1XMIA 3CZQA 3OOJA 4U5QA 3N6RA 2Q5JA 1R4AA 3P9YA 4GSLA 3ZHSA 4XWOA 2JFNA 3N59A 4RQAA 1FMFA 2FRXA 4N18A 3PE4A 2DKNA 1R64A 4D5GA 4DPKA 1YQTA 4Y9UA 2Y0EA 3GUZA 1BXZA 3FUCA 1LVHA 1PR0A 3K8ZA 1QZZA 2KB0A 4UXHA 1KZHA 1O89A 1YVDA 1QHGA 3B9BA 3U5ZB 4HAOA 2YXNA 2RHLA 3IBYA 4MQUA 3R8CA 3MTEA 3CF4A 5KKCA 2F90A 2FR8A 2X86A 1NBEA 1QP8A 3OF3A 4KE9A 4ENRA 5JNLA 4UZSA 1Y9EA 5FDFA 2WWIA 2WWRA 1TL7C 3DWIA 4BNKA 1JR3E 4R5MA 3KZCA 5ALQA 5ICGA 2BJVA 1ST3A 1Z4QA 2W6ID 4RZQA 4QC2A 3T7CA 3WGKA 5KJ6A 4W6QA 1KVQA 1NFRA 2YQ4A 3IS3A 4II7A 5EP2A 4QM7A 3BD9A 4OHVA 3DNPA 1JHOA 1BRTA 2EFCB 4AG5A 3PHGA 4H3HB 1DE0A 3FUWA 1NQ5A 3I12A 3SC4A 2R3SA 3DZJA 1DRKA 3FPCA 5LDDC 4TKZA 2F64A 4B85A 1B76A 3JTEA 4GG1A 3M6VA 3W6UA 4YRLA 2JRCA 2NVUA 2P9ZA 2REXB 3CWQA 3I1YA 4JBWA 4KQ2A 3VGJA 1O2DA 4EPYA 3SMVA 4U2GA 1KIAA 2ZVDA 1K7SN 2C42A 2O8EB 1VYVA 3VNBA 3FOEC 4FBLA 4YRRA 2XXBA 2RE8A 1EHIA 4L6CA 1T5OA 3CX6A 4QL3A 3MMXA 2XKKA 4PHGA 5DLYA 3T7TA 5IAJA 3T5CA 4ZK2A 1P9NA 1OQAA 5G40A 1IEVA 1O94D 1GQOA 2XWQA 3WOHA 4RPLA 5J47A 1WBBA 1DINA 2A86A 1WV1A 2DBRA 3GFPA 4HKTA 1LF5A 2XLBA 4GMHA 4QQ8A 1YDHA 1DG9A 3SICE 3IEIA 4D25A 1C2TA 1PL0A 3AXTA 1M8FA 2JATA 2BEJA 3M6UA 3HP1A 2FPXA 2O52A 1IXYA 3RT7A 3B5IA 1SUPA 3OEHA 1G59A 1QK4A 5CPFA 1FJGB 2AX3A 2GEBA 2V3WA 4CEJA 3DP9A 2O8BB 3SG0A 4UNIA 1IUOA 2HN9A 4S1NA 1EBFA 1UC5B 4E08A 2VTBA 2BR5A 4HDMB 4JLOA 1FP2A 4INJA 1ICEA 4NCKA 3K1AB 1EP1B 4I6EA 5EHGA 2X0FA 3FMFA 8MHTA 2NO9A 5J40A 4M8SA 4JXJA 1O9GA 2VZ9A 5G53C 2D2VA 2G6BA 3EMBA 3LHSA 4PFQA 3LSTA 2R84A 2OZLA 3EWNA 2F8LA 1QYVA 4KPUB 1U8YA 2GEDA 1QCYA 2DQZA 5JYBA 1P4SA 1D2RA 1F3OA 1KJIA 3O5AA 3PB3A 1JLRA 1UWCA 1XTQA 4NAVA 1FXSA 4FHDA 1KRHA 5FF9A 2TYSB 4MP8A 4Y67A 4DJFC 2QN3A 2G0NA 10MHA 2VDUE 2P4EA 2AI1A 1U1GA 2ZU0C 3IMEA 4LDZA 4LDJA 4V2IA 5K0SA 5SY4A 4UVEA 2OXIA 4FK8A 1Q1GA 5D7NA 3ZE9A 3ZQ6A 1WHTB 3PIRA 4IFEA 1U7OA 4RD0A 1H1DA 4HAZA 1NR1A 5IMBA 4GLOA 3Q3JB 4L4XA 3GZ4A 4UVHA 3ZWPA 4CLOA 3KYCA 4PEVA 2BTQB 5AVXA 3IMKA 2Q5IA 2EW2A 3OIGA 4CW7A 4C0QC 5ESWA 3B3AA 2EJUA 1VCNA 1Q1ZA 4YDQA 1UPTA 1XG5A 4Q93A 2WJPA 4FXOA 3ZWBA 4MW9A 5PGMA 4OHXA 4DAEA 2QROA 3QIVA 5LIPA 5EWLA 2FDXA 3EJ6A 3LZDA 3G2MA 3HXQA 2TMGA 2A1TS 3MTAA 1C9EA 1WXQA 1Z0SA 3RARA 4ARBA 1Y7TA 2GD1O 2DQ4A 2A7QA 1HDEA 5T3UA 1GRNA 1BKYA 3GPCA 4GC9A 1W49A 4OHMA 3V7NA 1EE1A 1HMYA 4LSMA 3TQFA 4LYDA 3UN1A 3PC8A 3BJIC 3BZUA 4ZQGA 2ZSFA 2JVIA 1P2TA 3ZU4A 3AOGA 1U6KA 3JQDA 1M2GA 3N2ZB 3BSWA 1R0WA 2VRNA 4XD2A 5CAEA 3SYMA 1UBUS 2VH2A 1HM5A 2C84A 2MSWA 2GAJA 2WWHA 3GRZA 3CLSD 5E6RA 4LFCB 3QX7A 1NSFA 2O2GA 2REOA 2XW6A 4ZT5A 2IV2X 1KBZA 3QKSB 1OV6A 4ZAXA 1V11A 1E3QA 1IB0A 2ECOA 4EY6A 3PRJA 1HX7A 3R6DA 4FYMA 4F9TA 4IIYA 5AIAA 1CEYA 1TRKA 4EKNB 6CHYA 1ZK3A 821PA 2BUCA 4I4TB 2QX4A 3LKZA 3K31A 2WV7A 4X93A 1GG5A 3JRNA 4TMVA 1AT1A 1QV6A 4LJLA 4M9RA 3HO6A 5TJHA 1OCEA 2OBBA 3A1SA 4KQCA 2VP0A 2YIVX 3VSCA 2BE7A 3U7RA 4HNTA 4U6NA 2H2AA 1I2CA 2O3RA 1T4DA 4IGFA 2QRPA 4K0RA 2EQBA 5H3LA 3UJAA 4YAUA 4CZ2A 2R9VA 3H4IA 3UGJA 2XQIA 2G5GX 4MW6A 2PEZA 3I9OA 1R18A 5I9MA 1XO1A 4WOCA 3S4YA 3AOEC 4DSNA 1YRHA 4JI0B 4PNEA 4GDFA 4WD3A 3KJHA 3G2LA 3UJCA 4BIMA 4DF3A 2OHHA 1W2HA 4EGAA 3I62A 4BJ3A 1SUCA 3ZLJA 4OHYA 4DQDA 2CUKA 3MCUA 5LUBA 2QPTA 4BQSA 1EGHA 3FM9A 4OM8A 2ZSEA 1PJTA 5HM8A 2OECA 4RELA 4RZHA 1EFPB 5FFNA 1DWQA 1U5BB 3TSZA 5AVSA 3I34X 5J4YA 1XTJA 3VYVA 4TUYF 4D98A 4IV0A 1XZMA 3DHYA 1Y1PA 2OL4A 3GOHA 4YXFA 3OJFA 5F2OA 3GEGA 4J6EA 1JYFA 1N5RA 1P0MA 3GMIA 4MWZA 2MSEB 3FJYA 4IICA 1Z22A 2ZI5A 1OTXA 3C6YA 1V1MB 4L3OA 3KTDA 3HKCB 3D6NB 2IXGA 2QZJA 4N03A 4HG2A 4FONA 4NYIR 4YUYA 3FSGA 1JL3A 1GCAA 2KI5A 3U4CA 4JGBA 3L46A 1ADJA 4G24A 4C5CA 1JUDA 1DKLA 3RYFB 2V7QD 4A23A 2XCTB 3U4QB 2A3RA 3BMOB 4W4TA 3ZHBA 4KVZA 1THGA 3VKWA 1IQPA 1BIFA 2C4TA 5EXSA 1WMAA 3KWMA 3QUQA 4HEJA 3N2GB 1FDWA 2JLCA 2AD1A 5FWXA 3E7XA 4URHA 3PEYA 3CU5A 3HBNA 3OM9A 1ZJWA 3QQPA 2AUMA 1I0LA 2DT5A 3DFMA 4HGZA 4D9HA 2NZJA 2QSYA 3OCXA 2BFWA 2OXEA 3BFJA 4D4GA 4FYIA 4FLMA 4H08A 1QU3A 1RE1A 3MERA 1P5FA 1NKSA 3ESCA 1AHNA 4XJTA 2EJVA 2IYQA 3MRVA 1U2QA 1GT91 1I51A 3QUTA 4WNYA 2EFDB 2P8SA 3VDMA 3MJEA 1KQ3A 1ZXXA 1SIUA 1ESZA 5FHQA 2O5EA 5ES3A 1DP4A 1PT5A 3K3PA 1QIMA 3PWZA 4ZAGA 1PJSA 2EARA 3FNRA 5KTTA 3WIBA 1BCRB 2JASA 3D3WA 4LCEA 1A5TA 2DFNA 3DV2A 3I0ZA 5DW3A 5DNVA 2FWMX 3FWPA 4BRWA 3T3OA 4P92A 3PITA 4NENA 1A0OA 1GSAA 1BDJA 3EZ2A 3H2IA 3K9NA 2J8ZA 1SBIA 2YJ6A 4E5MA 1W35A 4DLRA 3CE6A 2ZWPA 4NPHA 4BFXA 4C4RA 4X64B 3TM5A 3T1HB 2MWMA 1GPAA 1JDVA 3AY7A 4X63A 5AXDA 4AZWA 4EB0A 2WHEA 2NX2A 1M6EX 4R2XA 3VO8A 5IJXA 4N76A 4ZC8A 1HDRA 2CMGA 3H2ZA 3T1OA 5KQMA 4EKYA 2WFMA 3NM4A 3SOZA 1XK6A 1K8QA 2D54A 1I9CA 2R1TA 4TLCA 5A4AA 5LQRA 4U8GA 1NDUA 2IYLD 5AK3A 4LOLA 3SNHA 5EKSA 3RAPR 2RB5A 1V3TA 2XBMA 2FPGA 4ZEXA 1IK6A 4NABA 2ZUTA 4HFRA 1TF7A 2HQBA 2Y1CA 3CF4G 1C1XA 1MOPA 3DHNA 1MOSA 1NYLA 2LUOA 3OC6A 4J9VA 4YMIA 5LZ8A 4CKXA 2GZHA 1VRWA 4QELA 4K9OA 5ANRB 2LIVA 4IDQA 4QG7A 1KJNA 1OH7A 1VPWA 4EJSA 4HZUA 2OMEA 4KX3A 2CE7A 2MYUA 3HJHA 3UANA 1IBSA 3FOCA 5HUJA 1EJ2A 1G20E 4B4WA 3NVAA 3O4JA 3EG9A 3UUEA 5IH7A 3OCJA 1VHQA 3O8OB 5KSPA 3RUPA 1LQ2A 1YZ3A 2GBFA 3CPJB 3E3AA 2Z2JA 4HQFA 2FPOA 4L8LA 1ZGBA 4DWWA 3DBRB 4JLJA 4OHOA 2DJ5A 2EFEB 1XN4A 3ENNA 2VF2A 2A0FA 3QPUA 2OCDA 2E6UX 4OL0A 1E2IA 2J3DA 3EXFB 1CIJA 3CX8A 1YH3A 1Q7GA 1A1SA 1R4MA 5DT9A 1C1DA 3PC6A 4EW1A 3SZLA 1KI6B 3WRYA 3L1IA 4RAQA 1AKNA 1G3RA 4L4RA 3V9PA 2GK7A 3UC5A 1Y8QB 2Q5OA 1SULA 4GGPA 3VZDA 2P2DA 3FKSD 5BO5A 4D41A 2I76A 4AMUA 4MPTA 1CBUA 1ADGA 3I32A 4I5IA 1YRYE 4YXWD 4RDCA 4S2UA 1IEQA 3WB9A 3THRA 5AI4A 3UATA 4UNSA 2I1VB 1H23A 4TVKA 3ZTYA 4B87A 5JNWA 2H1FA 2QX7A 3ZCSA 1RXUA 4AF7A 3IE0A 5C5EA 3MWGA 2IVFA 1JDBC 4NE2A 1G38A 3DHEA 4CQMA 3OJ0A 3N0VA 4DR5B 2D0DA 1JYSA 3HVIA 5BSKA 1UBKS 3HWWA 1N5KA 2ZCVA 1CDEA 1AXEA 3AGPA 3ONNA 3WLHA 3AV3A 2BKXA 5BRAA 1LUAA 2ZYRA 3FOAA 1FXWA 2BOVA 1IEWA 1L7BA 1LPSA 3BQNB 3STTA 3LBAA 2PH7A 3GEPA 2AGVA 1P2BA 3EA4A 3O26A 1OXSC 1RS0A 4O59O 2ZUWA 3T9CA 4MULA 2Z6AA 1WZ2A 5A9TA 4E32A 1H1LB 4C0SA 1QYCA 3MWDB 2D8AA 2GJ4A 4ND1A 4F4UA 4BP1A 1PZGA 2VHJA 1ZKMA 2VP2A 4AAYA 5JNTA 3HN6A 5ALWA 3WNBA 1E7SA 1NV9A 1VXRA 3N2YA 4Z1MD 1R6VA 3FYCA 1B2RA 2J3LA 4EYQA 1GZ7A 4D0NA 2CY0A 2EJTA 2GN1A 2Q28A 1E9FA 1G9XA 4CT5A 1Y5MA 1Q0LA 3FHCB 4C21A 3SYKA 3P2OA 3SN6A 3VU9A 3FBGA 2UYYA 3GT4A 1K75A 1LK0A 1ML4A 2E49A 5GP1A 1XZ8A 1R3DA 2R8ZA 1KAOA 1PEAA 4K86A 4X45A 4Y1GA 3SGLA 2NYAA 1DQSA 1XNGA 1ZM4A 2OILA 3CWZA 5DV9A 2B1IA 3CRRA 4B3GA 5GONF 2G72A 4BKQA 3GA5A 5HRCA 1K0UA 3GRPA 2WD8A 1PBNA 3L6DA 3SCZA 4E14A 4C43A 3L7KA 3A36A 4GC5A 4I4NA 4LPKA 4OUKX 2I29A 5K3FB 1HLDA 1CQIB 1NP7A 1CIVA 3LCVB 4AZ3A 3DMFA 1KJ9A 2EWVA 3FGOA 4QEKA 3AERB 3AZQA 2IV7A 4U7DA 3PPVA 4J0CA 3UV3A 2E55A 3FZQA 1NBWB 3F49S 2GD2A 1RTTA 2DM6A 4HWRA 4L08A 1HNNA 4N7RA 2O1XA 4ND2A 4PFJA 1POXA 1E4OA 5ILGA 4EUKA 4QKQA 1V6CA 1ZY2A 3BMXA 2KE5A 1PLJA 1XX6A 1Y33E 1P44A 1Z37A 4NJOA 3N0TA 4OJYA 4A6EA 1L5MA 4GMXA 4JH0A 4XEUA 1E6MA 2ZRLA 3K8QA 2F7SA 1RPZA 1XWWA 1J06A 3ETNA 3K05A 5I7HA 2V3VA 2WAAA 2W8ZA 3BBPA 4K6HA 1TZ2A 1U2DA 2B4RO 3N0RA 4Q4HB 3DKVA 1O57A 4FHCA 4HAUA 1QTQA 3TZBA 2ODNA 2MINB 4BLVA 4R0VA 4LWOA 4NVRA 5B58C 3A7EA 1V25A 1YCHA 5FOQA 4J4BA 2J32A 1SQ0A 2HWKA 3NC0C 3E5RA 4H27A 4B7XA 3BSYA 1EGQA 2JANA 4WESB 1R3UA 1MO5A 3QBVA 2XZLA 1I7SB 2CNKA 3WG9A 1CQJB 1C3JA 2X0KA 4TKUA 3KVYA 4JB0A 2HDNB 1TAGA 4B5LA 3SHFA 2O07A 2PUJA 4IO1A 5JCJD 2OQRA 3TCNA 3LBHA 1PEDA 4LXXA 2DQYA 5IBQA 3TLZA 3WWEA 5L95A 5FNVB 4C0WA 1SUSA 2QV0A 4WDQA 4ZZIA 4MYRA 4XKJA 2L18A 4JWKA 1P7VA 1RCFA 2J3MA 3HCEA 4AF8A 3VV2A 3PP8A 3ONWA 3H2HA 3F9IA 1SQGA 4I4CA 5KUTA 2BFDA 5KX5F 2AR7A 4GVLA 5DM70 4D7AA 1QH9A 5EP4A 3SEAA 3ZY4A 2GM9A 1TI7A 2OMKA 5AO9A 4FEYA 2IA5A 3AM3A 1KFEB 1V8ZA 3IV9A 4GOND 1G41A 1E5DA 1VSTA 2GAOA 3MBOA 3B6MA 2MOKA 1PJ3A 2OC4A 1N9ZA 1V71A 4H3SA 3TX2A 5FYQA 4TSFD 3PDUA 4AYWA 5MN5A 2QLFA 4ZQEA 2BP7A 3SKYA 3L7YA 1ISGA 1EFCA 1NRJB 5EESA 1RXSA 1C0IA 2GKGA 2G70A 2IYTA 2EYQA 3E82A 1CV2A 5I45A 3H5TA 4W1SA 5KYKA 1W2WB 4L5JA 3DP7A 4KIFA 2C0PA 2IK8A 1JEQA 2YFHA 3FPLA 1E3LA 3QKIA 5JZ9A 5LQAA 4DRZA 3BWYA 1PS8A 4L95C 4URXR 3KV3O 2IEAA 2PLRA 2YRXA 4PANA 4RDHA 3OIFA 3ZX4A 1O1YA 4JASB 3L8HA 3HMKA 2N1MA 3P2JA 5E6UA 4BNUA 1GPUA 3MAGA 3TG8A 3F0TA 2X1LA 4KUHA 4PZ0A 3TXYA 1GAQA 1U2TA 4IM7A 2DUUA 2QS9A 1L5KA 4XD7A 1MXFA 3U80A 4LPSA 3B9PA 3CNBA 5LVAA 1MRNA 4JT8A 1QKKA 4R8KA 1K6XA 3L0OA 1J2JA 2C77A 4ZO4A 1AV7A 2JHCA 4B6OA 3FKJA 1P7PA 2YXEA 1WULS 2ZIEA 3ZV5A 1N5OX 2R1VB 3NJ8A 4XJVA 4IIHA 1QBKC 3FFWA 5JFTA 2H0AA 2NVOA 3QW4B 3G9TA 2GN9A 3E2PA 2RGAA 3C6KA 4A0QA 4O29A 3PX2A 1ISHA 2QT1A 1DXHA 1BDIA 1GN9A 2HRDA 2B36A 1Y34E 1CE8A 3G5LA 3CB4A 3MS4A 4PZDA 4OV6B 2I9PA 5GPBA 4E3WA 3AZPA 1RBYA 5B1DA 1OFUX 2ZIWB 4P2GA 4D26A 3KAQA 3LDUA 2QAGA 5HR5A 3VR6D 3F5SA 1FP4B 2A58A 3IR5A 4MYUA 2VVTA 5LCXA 1EEXB 3Q7EA 3SLRA 2OV2A 3WWYA 1PWZA 1RQNA 1FK8A 2EF0A 4MWTA 3LC1O 3ZVLA 1KYQA 3ZWAA 3DVAA 3OO1A 2HTEA 4LHWA 1RRPA 1NZFA 3DUWA 3V6LA 1L7NA 2YC4C 3BHMA 4H1UA 2B4KA 2W6QA 4DDUA 3ABRB 2C2OA 3DLHA 3WZ2A 2W2MA 2C82A 1HO3A 1UZAA 3BGVA 1QAQA 3FPEA 2R5NA 5DYGA 1UMDB 2SKDA 2PU5A 1HWYA 3EN0A 3LUDA 1SPBS 3BXGA 4PXSA 5DCLA 3ZI7A 2QN8A 1FS5A 3OY7A 3EUAA 2WVGA 3HP4A 5JARA 4MRAA 5KJEA 3STYA 5E2AA 5BW8A 3C85A 2ZTUA 4RD3A 2H18A 4TV8A 5HTOA 1YZKA 1ZOIA 3K15A 3PC3A 5E7QA 2NSHA 5JZSA 5CD1A 3FTCA 4GM0A 5BN4B 3JVUA 1JEYA 2OP1A 5IVKA 1BJKA 2B35A 4JJGA 3QVKA 3UNXA 2XE7A 4QZVA 5K2MA 3COPA 4TS3A 1VGRA 2JB9A 2NVUB 1GL7A 4MJLA 1Y5IA 3C5HA 1Z0FA 1AKVA 3NTLA 1VCOA 4MVWA 2FUG1 3WLQA 2CE2X 3UJ7A 1Y1RA 4DADA 3M2TA 4YAWA 1V3VA 5L4NA 1WTCA 3IXQA 2CLKB 3NW9A 5FOSA 2P3OA 1DT5A 4EY7A 5A3JA 2NAFA 3L8ZA 4QNMA 5AHXA 1X77A 3D0RA 3WA7A 1RWWA 3IXLA 4TZTA 5DLQC 2UYGA 1Z47A 4JL8A 1NW5A 3A25A 4JIMA 3KL4A 5DIZA 5SZHB 3EPLA 3DAFA 4UMEA 4RQBA 1UBTS 1LDGA 2FYTA 5I9IA 4UVDA 4QBGB 2W93A 2X7JA 1DKNA 3GLGE 1SCUA 3V1KA 3GFTA 5CHYA 1PEKE 4MHSA 3VKUA 2OK8A 4N3BA 3F5DA 1P5JA 5FTLA 1FDRA 5IM4A 1BU5A 1KY5A 3UICA 5BRNA 1DNPA 4R84A 2HQ1A 3OFVA 1VKOA 2WU4A 3NXSA 5EUQB 3ZCRA 1V26A 1DKUA 3ZIAD 3GGCA 2E82A 2G1PA 2QPAA 3KPJA 3M1YA 4HUQA 4EX6A 3L7AA 2PMBA 4Q4JA 3QJ5A 2PH3A 2AIRA 2VYVA 3RC7A 2AG6A 1Y1SA 2IYPA 3GYGA 2ZB2A 3RBAA 1H6AA 1L6IA 2Q4BA 3F7NA 1CUFA 5AKYA 4YRMA 2QL6A 4AB1A 5A1JA 4XWKA 3D3NA 4FCVA 2W2OA 1QH8B 2OZLB 1JR3A 2PUTA 1UIMA 3HPRA 2V97A 3I9V1 4IMIB 5AXBA 1PYGA 4GL2A 3E9EA 4G5FA 2BMEA 2VK8A 4D0GA 2Z8YM 4P0PB 3IV7A 4BGDA 2Z95A 1JDSA 2REQA 3KOUA 4OMUA 5DX0A 4JVNA 1CY6A 1Q83A 5EIWA 4AJEA 5KYNA 2BFCA 2J0VA 3P2YA 4DIFA 3TQQA 1Z82A 2JJMA 2VQSA 4TPKA 3IIEA 3Q72A 3TRIA 3AI7A 4B8WA 2WKWA 3BWDD 3VUFA 3JWGA 2G76A 4ERNA 2JH8A 4YRSA 1JH9A 1XJ5A 2ZSJA 2B0JA 3RS9A 4AX8A 4MW4A 3BIWA 4NU8X 5BUZA 1AXGA 4P2BA 2FPPA 1N8NA 4F1KA 1IOWA 3CLRC 3OOYA 2YFQA 2IXEA 3GJ8A 2C5EA 2H1RA 5D3KA 1V3QE 4CLOB 1J42A 3VGPA 2ZYGA 3AR4A 3EB9A 3V34A 4ARUA 4WXYB 4F6RB 2VF5X 1P80A 4HAIA 421PA 4D3FA 1LFAA 1JFTA 2AMJA 2JFPA 1GL6A 1U9JA 2XCUA 2PYZA 4UQPA 4ZQHA 3M6FA 3N8IA 3ORQA 3AV0B 3H16A 4C4SA 1XYVA 4Z2YA 1JP7A 1EQUA 1NWCA 5IUNC 4JB3A 3F3SA 4JX8A 2P4HX 2Y9PB 3A70A 1FDUA 4WSOA 1IY2A 3OJCA 4QRDA 1X94A 3UCFA 5KOJA 3ZGNA 2V9ZA 3HJAA 1ZOSA 4MR9A 3S2UA 5LFAA 2QRUA 4JT2A 4A8PA 2PRYA 4CEIB 4JQOA 1PJAA 3NTOA 2FSHA 4FX2A 4YJ3A 4WLNA 3STWA 2QPLA 4X7MA 2ZTLA 3HA5A 3TCKA 4U4AA 3NOQA 3ZCTA 3K9BA 1I36A 3Q2IA 1J22A 2ZQ5A 5CU7A 3VO1A 4CTNA 3QEKA 1CJUC 3CURA 4EITA 1V11B 1T29A 4FNOA 2G3YA 1GG2A 4DOMA 3JVIA 2O7RA 3ZLBA 4YJ2F 1GQRA 3H3FA 3ZIUA 3PYLA 3S2IA 1UOPA 3TGWA 1GL9B 2ZBFA 4DJJA 1PJ2A 5CIYA 1UF9A 5ADWA 2QDXA 4UDXX 3K6KA 2YHIA 1K4MA 4JC4A 2CLEB 4A26A 1Q1AA 4S1VA 2EBFX 4B6JA 4Q19A 4Q9AA 4B80A 4DYVA 3OQNA 2C5SA 1X7GA 2BEKA 5BSUA 3RG2A 4LMPA 1KSFX 4CM3A 2VAWA 4OSOA 2R25B 3SU8A 3NUQA 3MELA 1Z56C 2OAEA 4Y6LA 1IIRA 1MR3F 3N2KB 3J7AC 1L4YA 3OF5A 1VE5A 1XZCA 3H9CA 3L7NA 3OJLA 2V7XA 4CLDA 3U44A 2HIHA 3UF0A 4E3ZA 1T6YA 4E6PA 2O59A 1M2VB 1P33A 2JAOA 3E61A 1OZGA 2LCFA 1KOJA 4HRYA 5DGHA 3U4AA 4OK6A 3NHLA 5HJEA 1Z0UA 4BRSA 1BDHA 5TPWB 4EIWA 4D8WA 1SCKA 3S55A 2PK3A 4MB6A 1R6BX 4B81A 1NJFA 3D2BA 3QWIA 4ZVOA 4HH1A 1LS6A 1M1YA 1GR0A 1L7AA 3LT5A 2VH5R 1NN0A 2NTEA 1JJ7A 1XDWA 2PD6A 3CISA 5CLFA 5SZKB 4KQIA 4OGLA 1Q7EA 5AI8A 3W5BA 2YMPA 4PHHA 4Q01A 2HA0A 1P2GA 1XD9A 4TTSA 3W5IA 1NJ1A 3QA9A 3WL3A 1CYEA 2IEGA 5CVJA 1YGPA 5KTPA 1PJQA 2CBXA 1PEYA 2HL6A 4J7CA 1W85A 4L3WA 5LM3A 5FLEX 2L69A 3RFUA 3D8RA 4GPZA 4KTTE 3WMFA 4DUGA 4G5YA 1KNXA 3MPOA 2HK9A 3IUEA 3P7MA 4BJHB 1AMOA 1N0IA 1C41A 4FGZA 5DBFA 4KGZA 1T5SA 3NALA 2O3QA 2OKGA 3CF0A 3F5FA 2ZBPA 1EFTA 5FWXB 2XMRA 5J43A 2XOKA 1MA3A 1ZXLA 3WI7A 1II0A 3OOWA 4KUGA 1VP3A 1VOTA 1YOVB 3LGAA 3RV3A 2CHGA 1ZD3A 1JPUA 5EHQA 4D97A 2H31A 1E60A 4FYVA 4TS1A 5BT9A 3E58A 3AI2A 4N8EA 1E92A 2ZU6A 4DKXA 3C39A 5B7GA 2QTZA 3INTA 3JQ8A 4FFLA 4IDBA 4BQNA 2ODWA 2ZM5A 2JH3A 3EFEA 4PX3A 2VT7A 2NPFA 4Q02A 2NZ2A 1DIRA 2WLTA 2HPAA 2GBLA 1XEAA 4IJQA 4NENB 1GOTA 5HHTA 1KPGA 4IRXA 1RYBA 3WDMA 1ZOLA 4ALJA 5I7EA 4LQDA 4KGDA 5IS2A 2YRFA 1X3LA 2WVJA 4IZOA 4JB2A 5G4LA 1EFKA 2ZK7A 3GJTA 3TIIA 1YT5A 2ILTA 3UPDA 3UJ8A 5KZMB 1W73A 5HF5A 1XZNA 1X42A 3X0DA 1U2GA 3U7JA 2WF5A 3JQAB 1XEWY 1Y3CE 2D74A 3TLYA 1M67A 1N2EA 3PICA 3X3HA 2FPGB 4YLEA 4FYKA 4B4OA 1AKTA 1GZUA 4HVAA 4IXDA 1RFGE 4N6NA 5CVVA 3BB1A 4AIIA 1BXGA 4QLAA 5FPPA 1OXVA 2V0NA 1CS4C 2QRGA 1O95C 1SIOA 2D5CA 4Z49A 2KSQA 2CDCA 1BRMA 2Z2KA 5KNCH 3KLBA 4PGGA 4RGBA 4PC2A 4AICA 2H2DA 2C95A 3DR5A 3TQSA 2R5FA 3LFTA 1H0RA 1OA1A 4TMXA 2G4CA 1FTGA 1Z7WA 2OWDA 4DMFA 1X0VA 3QJYA 3IDFA 4HYQA 2GJKA 4DSZA 2F2TA 3KUKA 4AMBA 4N01A 5C37A 5JISA 5SZIA 4QARA 1FFEA 5AKXA 3HO8A 3ND5A 2P9JA 4IHAA 3ZD9A 2BGMA 3DOOA 2XYQA 2PGNA 3BQMB 2XF8A 4QVIA 1NPTO 2YTZA 2ZVPX 1MAVA 1G5QA 1WXWA 3D6UA 4FPXA 1Q12A 2J5KA 2V1XA 4HPJB 2ESRA 1UKAA 2WOJA 2PVSA 4Q3CA 1WPQA 1TAHA 3HC7A 1ZUHA 4XVHA 5CP8A 4TZ6A 1R9NA 3F9RA 1XCJA 1T3SA 4RSRA 3M6MD 1HNZB 3DMRA 5F76A 5KQGA 1BXRB 3GZNB 3NB0A 4KQ1A 4ILEA 4ZI5A 1U63A 1W59A 2G1UA 1QPZA 3E4DA 1GPKA 4B7ZA 1BOOA 4HZIA 3HGQA 1GEGA 3KYDA 3BJRA 5TF4A 2JD0A 1QANA 5L3RA 1JAIA 5DNAA 4A16A 4LF8B 2AZXA 3THSA 4JVOA 3FBTA 3VR2A 1YQWA 3DC7A 1D1TA 1NF9A 2H65A 4S05A 1EM6A 1WQ3A 3FPGA 3SHQA 4L4UA 4CM9A 3BJEA 4OXYA 4L85A 2BFBB 5LMUB 5U9CA 1RWBA 1YAJA 4YY3B 3JSAA 2XODA 4DZZA 3JR3A 2AH5A 1A3CA 1QB7A 2YHAA 3A37A 4KP7A 3WK8A 3ZHUA 1L5FA 1DADA 2Q3LA 3JALB 4I9GA 4NZ9A 5DP2A 1VDMA 3U37A 2NT4A 5AKJA 3V8PA 1FYWA 3WL8A 4FYHA 2Y1KA 3EF1A 4II2A 3S28A 1T1SA 5BVGB 2VSQA 2ZB8A 3F2VA 1V8FA 2KX7A 4OD0A 1JHYA 3JZFA 2JKYA 4CEHB 3RT9A 1RC8A 1D6MA 4CMIB 1FFHA 4MQLA 1Q15A 4LRUA 4LC0A 1XVVA 3ZJUA 1H9CA 4X1YA 5SY6A 1T6XA 2CUZA 3U1TA 4WKGA 2XMDA 3TAXA 3V1LA 5HYVA 3B1ZA 1J1IA 2HMWA 5ALKA 1RLIA 1X1DA 5DM4A 2I78A 2HNKA 3W2IA 5CFOA 5HJ5A 4UCQA 5JJCA 3S7ZA 1KF0A 4R2LA 1D2AA 5H4GA 3EXIA 3I30X 4TWRA 3UAOA 1A71A 2DX7A 4L8WB 1AUPA 13PKA 1UBFA 5CB4F 4V1CI 3HWRA 4IX1A 2QXYA 2QXUA 4L0DA 2WJGA 4RFLA 3K0KA 1PUIA 4DJDC 1PLLA 3BXZA 3H7IA 4ZZ1A 2BEWA 5KWJA 1GCIA 1M2OA 4XYMA 3X1DA 4M99A 4MGYR 3LF2A 2IP2A 2IQ5A 1YFKA 3MEQA 3IUNA 2B5OA 4W5WA 4EENA 1DBSA 3DJFA 1N5JA 4L57A 4WOJA 3AR9A 1BX1A 1SKQA 3EC1A 1ZNYA 3FA2A 1YK0A 3I5MA 4LXIA 2OFPA 1WEKA 1A9XB 2FE1A 4UPDA 1A4UA 1G6KA 3T1YB 1DJQA 4FMPA 1W0KA 2PKEA 3JD3A 2BI7A 3LYLA 1TUGA 1Y3DE 4YPFA 2E85A 3WGGA 3HCCA 4HEA6 3EZ6A 1O54A 1DBQA 1FNSA 2AEEA 2IDJA 2PTHA 3OI7A 5AJVB 2OGWA 2X8LA 4FWIB 1GAXA 2WHYA 2B4TO 2CK3A 2GHIA 4QPPA 5DCWA 3R74A 1AC5A 4YB8A 3OTHA 4XR4A 4WK6A 4L27A 2K7ZA 3LHIA 4R4JA 3C3YA 3OZ7A 1KOGA 2J0UA 1TEXA 4ZOEA 3D6MA 1YZVA 5DMXA 2VF7A 4MUEA 1J5EB 2VSNA 3GA7A 3HUEA 3P2MA 3X1MA 1KVSA 3GGJA 4P4SA 3ZV7A 1PZMA 3W5SA 4G1BA 1ZI9A 2LW7A 6REQB 4Y30A 4KLNA 1ZX1A 3AEQA 4NESA 1PQYA 2RI1A 4PF1A 1UL1X 4HYEA 1V47A 2ZS9A 1ZU4A 3L7LA 4L50A 4Q47A 4HX9A 4XUEA 1ENYA 1Z5OA 4M1YA 3HM9A 4I5FA 4QEDA 2RHBA 1XDUA 4M0LA 4R1LA 3H8WA 5K8TA 4EGCB 2V3CC 3EMKA 1MRZA 1Y42X 4N12A 5AVWA 3C97A 1OU0A 1KO8A 1YC2A 1F9EA 3OIWA 4MKZA 5DN9A 3QXJA 3T5AA 5K8LA 1RRMA 2QMQA 3VNRA 3NHUA 3VBEA 2PL5A 5AW3A 1I2ZA 1PQUA 2GTHA 3DF7A 4QOIA 2AEMA 5F3WB 1V8OA 1O6CA 2QRNA 2V6BA 3O74A 1JXAA 3RVLA 3EPJA 4D42A 1I0IA 2XGSA 4L0QA 2BP7B 5H3CA 3A1FA 2AC7A 4FSDA 4HPWA 4I50B 4PRYA 3RASA 4BS9A 4RJTA 2R751 3CVVA 1SEVA 2QR3A 3CZPA 3EIHA 3OQPA 1EVKA 1DHTA 1U0LA 2CFCA 2O2JA 2YS6A 1XC7A 2H2WA 3FZGA 2PXXA 1QGUA 4NMWA 4HNRA 1Y3IA 3WHPA 1KXZA 3Q15C 1W5FA 5KTOA 1DELA 1UUFA 2R8EA 4DMGA 5CLQA 5A0TA 4QTTB 2CUNA 4LGVA 4DLZA 2H6EA 3R7WA 1JF8A 3DNFA 1RKBA 1UXOA 1Y9AA 2PXHA 5ADVA 1DGQA 4JI1B 5LU9A 3ANLA 3RVQA 1L5HA 5C35A 2CLOB 4AXBA 2EGGA 1JQBA 3IDSA 3K0EA 3QMPA 4R8LA 4AM8A 1K63A 4V24A 2ZSHA 3JPWA 3UQYS 4ICIA 1E3IA 4IDHA 3PLAE 2QP4A 3TLKA 5J5VA 5KVVA 4K03A 2HEGA 4XGKA 1E9VA 1MABB 2F1KA 2WUDA 4HCJA 2OAP1 4X61A 1TF2A 2M1ZA 3DG9A 4EHNA 4EYSA 5M7EA 2MYNA 3PFBA 4F1JA 2NNLD 5TB5A 1H4SA 4ER3A 1KDTA 3L8GA 4MQ5A 4FB5A 3GVXA 3I9LA 3G79A 1AO3A 4XGIA 2XQJA 4QQFA 4KI0A 2OTCA 3BD6A 2FG6C 3O4FA 4FMBB 3WICA 4E6EA 1EJBA 1PNTA 3GT0A 5ISMA 4I5DA 5AESA 3FYSA 2PSEA 1ESEA 2O23A 3M4JA 2VT6A 4JA2A 4CLRA 2QAGB 5C9ZA 1VKZA 3D0KA 3EDOA 3AW9A 4RXUA 5E6SB 3F1LA 3U1VA 2Z09A 4K5QA 4NCIA 2AOTB 3HB5X 5BXQC 2XA1A 5F5LA 1SC1A 2BMAA 1GDDA 3Q88A 1Z0DA 5EP1A 1RADA 1T2EA 3FCSB 3DVAB 1KFKB 1F4LA 1R5BA 3EISA 2P9BA 1OW3B 2FX2A 2XHZA 3O75A 1TU0A 1E0JA 2Y05A 3OZTA 1S4MA 2XY4A 4JR1A 3KUDA 1NMQA 3ESYA 4Q9DA 4AS1A 3QF4A 5JCPA 1AKWA 2NGRA 2OFXA 2V6GA 3PWTA 1KYYA 5B1IA 3W8EA 4GKJB 2CSXA 2WG2A 1H85A 3CLTD 1IXKA 2ISQA 1CZLA 4NJEA 1P4GA 4WCDA 3REFA 2CFSA 1ZK2A 2ODAA 3LLUA 4OH7A 3FDFA 2J59A 2PNJA 1X1SA 1FNDA 2VDQB 2J3JA 3O7WA 4Q1AA 1YIOA 3HLTA 3QWBA 2BGNA 4O8ZA 1EP3B 3JQ7B 3KTFA 4B0OA 5LWQA 1JEYB 1T2AA 1Z4KA 4NJMA 4PCUA 1LZLA 4RPKA 5NULA 4RANA 1PSDA 4XVQA 5HCNA 5HDBB 4ER7A 4GR5A 2EP5A 1DQNA 2BZ0A 2IZ0A 1EDDA 3AY0A 3V3KA 4E5KA 1RHQA 3LD9A 2WDPA 3QZUA 3BWMA 1FBNA 4G8DA 1S7CA 4OJNA 4QBTA 5D3MA 3H5AA 5HX7A 1F9AA 3D5QA 2VK4A 4NCJA 2OD7A 1FFXB 1U5AA 1CQPA 2HXGA 2PT6A 2QVXX 1VKRA 1LZKA 3KQHA 4XCVA 5JC1A 3BRWD 5AUQA 3GNTA 4UJ3A 1XE3A 4AW9A 5KOHA 5IWAB 1NT4A 2Q9UA 4MARA 2ICAA 3UMRA 3L5OA 2H1IA 5E1MA 2PD4A 2AB0A 1B3RA 2WSSA 4AUMA 5AHOA 4IQGA 3LOQA 3F96A 4ND3A 4NS1A 1E2BA 3T94A 1XCGB 2OOKA 3D7NA 1SVKA 4TSRA 5ILQA 3LBIA 5I6DA 2JA2A 2JFXA 4JITA 4CR6A 4JT9A 1XZFA 3HBJA 4KREA 2BFPA 5G0UA 4KAFA 1P3JA 1QTNA 2RBEA 4AIRA 4WLVA 4BP9A 2YWJA 4X3OA 4X71A 4C6RA 1KBOA 2NLOA 2O1WA 3F5MA 2GPYA 2Z9DA 3LA8A 3NEJA 1KK1A 2CWWA 3IQWA 4LQCA 4MLDA 2HBZA 3DAOA 4UCFA 1YR7A 3T9DA 1C81A 4BO3A 4XH9B 4C07A 4ZJPA 6YASA 3A26A 4U7GA 1NFFA 1JBEA 1ZBQA 3I8XA 4G85A 1W30A 1R27A 3ZVKA 1JFLA 4KXVA 1GUAA 4BFUA 2I87A 2B1QA 4J94A 1NW7A 2VYFA 4MWGA 3SMQA 2PSHA 4D4JA 5LL6P 1KA9H 4TTIA 4RY8A 1UPBA 2P5SA 2IHYA 1SBNE 2C5BA 1OTYA 3D59A 3E1GA 3OT4A 1L7QA 1UK7A 2V6MA 4ZVMA 2OO3A 4ZD6A 1EZ1A 5BQFA 4IG9A 3VPGA 1XIVA 3COJA 1NF3A 4S1WA 3R3UA 1SXQA 1C7QA 2DY0A 2J46A 4N7MA 4OGGA 5LIRA 4NYIQ 2XNKA 3TW4A 2DLCX 2ZTMA 5PNTA 2UUAB 2NV0A 1N6HA 1FX0A 3CLVA 3D0QA 4QUBA 1WPRA 5KCMA 3SD7A 4I3GA 3WDSA 2H1CA 3VO2A 2ZPAA 5LSAA 3GUYA 3RGWS 3QMWA 1J2UA 6AT1A 3DTVB 4DILA 4ESVA 3O8QA 4HN4B 4PAMA 1ZC3A 1VKHA 3QY0A 4F4IA 5ESRA 3FHJA 2ECFA 4DBLE 1GILA 3ZXYA 4B75A 2IDMA 3OEHD 3VJLA 5JTTA 3DEJA 4MZDA 2P3LA 4TQAA 1UFQA 2GCOA 3UJNA 1I8TA 5KTKA 1QQBA 5EJ2A 4V02A 3FPFA 3UJHA 4FB4A 4EL5A 5I9TA 1P3Y1 3S5UA 4AKHA 3CNOA 4IFTA 2E21A 2D1TA 2Z5FA 5I5GA 1EK2A 2R85A 1CYDA 3TLCA 4YV7A 3COYA 5G3YA 1QGOA 1GAJA 3HEBA 3KQOA 4UHDA 4WHMA 1PHPA 3JQFC 1G64A 4H3VA 3ZZ0A 4MR9B 5E9JA 2GASA 2XGMA 1OH8A 1UWLA 2DFTA 1KMHB 1W34A 3I64A 3ZR4B 2OYCA 2XADA 4YJ3B 4MITA 4IHJF 2G67A 4ZP1A 2DOKA 4L4SA 2KYRA 2MTBA 5F9HA 3ASUA 1GN8A 3CF2A 3N0WA 4P54A 2XRMA 5DHRA 3R3HA 2GCPA 4WW0A 3WGTA 3SIWA 2ID9A 4A6PA 2IU3A 3MUNA 4E0BA 1TW2A 2YDXA 3PEFA 3H7AA 1N9GA 4KQGA 1HMPA 4WZZA 2W5UA 1Y37A 3SHOA 1YA8A 2GLTA 4M98A 1SH7A 2RKOA 5EWMA 1F12A 2JCSA 2KBEA 4JBHA 2Q3FA 3SVLA 3QVVA 5FPSA 4B8YA 2B37A 3NWOA 4BEWA 2HA3A 1U7HA 3HKBB 5GJVC 2BGIA 3MCVA 4JVLA 1M1XB 1ORHA 1W4BA 2QW1A 2YQ5A 1YRWA 1PZXA 3PC4A 3PSHA 3QUAA 4PSKA 5JW6A 3DMGA 4PZZA 2CUTA 3KR0A 1L4BA 1JMVA 2I9KA 5AI0A 4R8RA 5L3SA 4J7UA 3G9ZA 2CXXA 5JLJA 2GAAA 4J6FA 5ALFA 4NLLA 1E59A 5B1EA 1VPLA 4WH0A 2P30A 5EJ4A 1FQOA 1T9CA 1OXKB 1IAQA 1NQTA 3GO4A 4EI7A 1HTTA 3UY4A 1JE1A 3PQFA 2EZ4A 2DRIA 1WNTA 2Q1TA 2XMPA 4RVNA 3WWCA 1WQ1R 1K7CA 4LK2A 4RGYA 1E0KA 2I4MA 2B5VA 4YT2A 2PRKA 3D5EA 5GONA 3LUAA 1A9QA 2BMFA 3KZNA 2A1UA 4II3A 4E70A 4WN9B 1KP9A 4X6LA 1S2IA 4HLUA 2B8NA 3NORA 4QTZA 3DULA 4G1MB 3U3RA 3PCXA 3ZNOA 4EPTA 1H4QA 5AW9A 2PUEA 5JI2E 4WUVA 4EW6A 3G6KA 2FX5A 3BZWA 5FHRA 2G17A 4MMZB 3TB6A 1MKYA 1KY4A 3G3EA 3G0GA 1GKUB 1VL0A 1JTVA 1XTTA 2R2GA 3AJAA 4IYJA 4Q9JA 5FR1A 2O8FB 3OJOA 1A7AA 1O9HA 1W85B 3ABZA 3DL7A 4G1EB 3HJNA 1AK1A 4K6OA 4PVDA 4Q9NA 5ENVA 4PLTA 2B4YA 2YNMD 2O9JA 3HJGA 3O90A 2MCFA 3B7GA 2WQ7A 3QWFA 3VAYA 4QOFA 4M1WA 1ZJ5A 1IC6A 5GZ1A 1BEEA 2ZUBA 4OSPA 2HHLA 3WLLA 1L7RA 1NAHA 4QJIA 4UNRA 4Z53A 4BEBA 1EIZA 1L5VA 5CH3A 4E11A 3IOBA 1P2FA 1RHMA 1CJTC 4RABA 1E2NA 4UREA 1Q0HA 5C1BA 2EEZA 1EEHA 5K3AA 3R3YA 2Y9MB 4LECA 1UK8A 4N6OA 4Q1DA 4R40A 1DEHA 4Y6OA 4CKEA 4W5TA 4JIGA 3OWHA 1DMRA 1UWVA 4DWVA 4HLDA 1X8LA 3K5WA 3K9CA 1FYEA 1ZONA 4G86A 3ZV4A 1V43A 3PWSA 1WZEA 1XDZA 2XUDA 5KQPA 5CPBA 1QHHB 4ZZ0A 1L1EA 2SICE 2VHTA 3HDQA 3EXHA 4J3JA 4DS3A 1H1TA 4G25A 3DUFA 2PMCA 1DBWA 1FPQA 3GLIE 3NM5A 1SHKA 3BMNA 1J24A 4IWNA 3JQ9C 3EC7A 5CGQB 2XB8A 4WFIA 3RNOA 2JIQA 2VP5A 2X23A 4V0LA 3SBEA 3VYTB 5KX5A 5WRFA 1NU6A 4DEYA 3ZI4A 4Z7QB 3STXA 5K5EA 3AL0C 2OV3A 2F3SA 4GMGA 5DOVA 2C7OA 3AF4A 3T38A 1EWKA 4F5EA 2X22A 1AQJA 3FF1A 4QHTA