1Y9JA

Solution structure of the rat sly1 n-terminal domain
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
140
structure length
140
Chain Sequence
b'ASIRERQTVALKRMLNFNVPHVKNSPGEPVWKVLIYDRFGQDIISPLLSVKELRDMGITLHLLLHSDRDPIRDVPAVYFVMPTEENIDRLCQDLRNQLYESYYLNFISAISRSKLEDIANAALAANAVTQVAKVFDQYLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sec1 family domain containing protein 1
molecule tags Protein transport
source organism Rattus norvegicus
publication title Three-dimensional Structure of the rSly1 N-terminal Domain Reveals a Conformational Change Induced by Binding to Syntaxin 5.
pubmed doi rcsb
total genus 29
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2004-12-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2060 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1y9jA01
5BV0A 3PUJA 2XHEA 3PUKA 4BX9A 5BV1A 1Y9JA 1FVHA 3C98A 1FVFA 1MQSA 4JEUA 4JC8A 4JEHA 4KMOA 4BX8A 1EPUA 4CCAA 5BUZA
chains in the Genus database with same CATH superfamily
5JW6A 5M29A 4BFTA 3Q3VA 1JEQA 3V4LA 1N5IA 2PZGA 5H5JA 1E9CA 5T5QA 4X66B 1LA2A 4LE0A 4Y8VA 1S7GA 2QX6A 2W6QA 2X7XA 4BWYA 1G18A 1W0CA 4DUPA 1E0SA 5DLEA 5I3ZA 1CC1S 4QVGA 3PSHA 4D5EA 3TRFA 3VPGA 4ZKEA 4AKSA 4DNFA 3Q41A 5I7EA 1U63A 1WB5A 2L42A 4KRFA 4ZTZB 2GR9A 1NZJA 2J9RA 2ZYDA 2YKGA 1ZC3A 3A6EA 3E61A 4PPGA 2Q5LA 5DXJA 4Q18A 3UC5A 1NN0A 1P7YA 1TAHA 1X8KA 4FMCF 4E5KA 4IQ0A 1A7KA 4QJ5A 4GPIB 3U60B 4Q37A 4NCIA 3A1UA 2EHDA 2JEZA 2QENA 1P4RA 2W6ZA 4LVOA 2O3TA 4WY5A 3JXEA 3VH4A 1J56A 2C97A 2ASEA 2J0EA 1TC2A 3GDOA 4HGPA 3TW6A 5C4GB 3F67A 1UFKA 1XC7A 4LYJA 4DBZA 4JGGA 4CFSA 2MMCA 1DO0A 1I3CA 2BGRA 2VJAA 2AZMA 3TBFA 4G5QA 1OMOA 4I19A 5LOVF 4P5PA 1DX4A 5TQJA 1J8MF 1OJLA 3LYHA 3CX6A 2IEAA 4I8XA 4RC9A 3KOXA 5TMPA 4RWEA 1TJ4A 2WF7A 4B47A 2I2BA 4E46A 2AF4C 3O1LA 5NULA 3E18A 3AERA 3P0RA 2O4UX 4K6OA 3E9DA 1AQJA 4IS2A 1B26A 4EITA 2WOJA 3SHWA 4TT3A 1UT6A 3HU2A 2BJVA 1E5VA 3QW4B 2DETA 4G5XA 2IYRA 1KO7A 5BSEA 1U8EA 1ESZA 3O8QA 2QLBA 3TKYA 3O4HA 4AMUA 3SR3A 3T12A 2D1SA 1F8UA 2RMKA 3AR5A 5T6BA 3WKCA 3JQ7A 3O8OB 2ZKLA 1MVNA 1T3TA 2UYQA 2CNKA 4R5HA 4W5HA 4DDUA 4KITB 2AMVA 4QPJC 1MU0A 1W94A 4IXWA 4XTRA 3X1KA 8GPBA 1PWYE 3B3FA 3QWHA 2BHRA 4L7VA 1MB0A 4CU2A 2Z8XA 3Q5DA 1EDZA 5K51A 3PEVA 2APJA 3COVA 3R3XA 2QRUA 1C9EA 4NFHA 4WLFA 3ROZA 1D6NA 4GMDA 1E3MA 3N2ZB 4IFIA 1CX9B 1K8QA 1RHQA 2UZ0A 4NOKA 3T7IA 4DLLA 3FCUB 1U2GA 2DQSA 5HILA 2ZRPA 3MF4A 1SQGA 4MAAA 1TECE 4UMFA 3WGLA 4UVIA 3WK4A 3GR6A 2AMFA 1XQWA 3DKVA 1W36D 3FFWA 4HH3C 3UJHA 1CUXA 3OTOB 1FDVA 1GZVA 3AVXA 2GZAA 1AM4D 2I1VB 2QNIA 4FU0A 4GE3A 4WY2A 4KQ1A 2PUJA 1CJBA 2C5HA 3LWBA 4MTLA 4OP3A 3ST7A 2O8DA 1OTXA 1Z7YA 4P22A 4BMSA 2HM7A 1QZXA 4BB9A 3RSHA 1E5DA 4RSGA 5I8PA 2JZCA 3PUVA 5SV2A 2W9XA 4EBFA 1QAMA 2E48A 3C5WP 1JR3A 1NVFA 1QHIA 1QR2A 2CHEA 3DCNA 1M9NA 3G5AA 3LBNA 2OFWA 2PAFA 4FMCB 1T5BA 4JN6B 4JUDX 4LG1A 2ZOSA 1EFHA 1X7HA 6LDHA 2YFQA 4G5SA 4BO6A 2E1RA 4AZTA 1JDZA 1YB4A 4GGMX 4IDAA 5DHPA 3TEFA 1QH1B 1FNCA 2BP7B 3G17A 4P3XA 4RH0A 2ZJ5A 1RI5A 4FBMA 1IEQA 5GOTA 5JNTA 3G9TA 3ILHA 4L75A 4NMMA 4II7A 4X6UA 4O25A 2PUCA 2JF0A 2PGXA 1RWKA 4P54A 5FYDA 4D9CA 2FRVA 5JXGA 1Y6RA 3WHKA 2A92A 4AMZA 2FMXA 4FGSA 1CUEA 3I61A 2FFJA 2FG5A 4UBJA 1ZCZA 2R8PA 3WGZA 4E5MA 3JQRA 4RSHA 3WHPA 4WOCA 1L4HA 4H3HB 3WL5A 1Z2NX 2IYFA 3IPLA 3O3CA 4RADA 1TGVA 2Y4OA 3MD0A 1JZTA 2VAMA 1AGYA 1EFPB 4X63A 5CGQB 4TTIA 2NP7A 2JDID 1FVOA 2Z0MA 3K9FC 4QFBA 4Z51A 1UCFA 4CIYA 1OH8A 3QSYA 5JXHA 4BO9A 3ZU5A 3PFNA 1A8QA 3FNBA 3VRHA 3DMDA 4OM7A 1M1ZA 2C5BA 3E2PA 4MP6A 3ZV3A 3IEVA 1CR6A 1PQPA 1Z08A 3CUYA 3VR3A 1FNSA 1MQSA 4NZZA 4E1BA 5F2OA 3QITA 1T4GA 3FROA 3ADCA 1R0BA 4BNJA 3EG9B 2PLAA 1DC8A 3ESYA 1NYRA 2ZT5A 1FB5A 4I4TB 5KYGA 3MTEA 4YT4A 3I4LA 1LZLA 3RR2A 3DL7A 4M76B 1K4KA 5LOVA 1HDYA 3DR5A 2ZBEA 2XVMA 4JXJA 1N1GA 4DCVA 2JCBA 2R65A 4B5KA 2CVOA 3HFRA 3ELWA 2PJZA 3EZ9A 1TT5A 1Y3AA 5J2TF 1YDMA 4OUKX 2ECFA 1Y1PA 5H83A 1L0BA 5KSPA 2IIQA 2QMHA 3DLIA 3ITEA 4ND2A 2QHXA 5M04A 3DQZA 1HE5A 4YECA 1F6DA 3JWHA 2IDKA 3OQBA 4O3MA 4CMIB 3M3HA 4GM4A 4R1UA 5ELLA 3OKFA 1MHPA 3DV9A 1Q57A 1PNOA 2CV0A 3HDYA 1L5NA 3MTIA 4M1EA 3U49A 3HVUA 4LWQA 2HU8A 3LDUA 5CB4F 1E18A 3KYBA 3FUXA 4XJVA 2MSDB 3PEUA 5ALPA 1XDBA 4CHGA 4DHEA 4EVRA 4EK9A 5T8KA 4BWVA 2CEKA 1G6HA 1KZHA 3JRXA 4H3KB 3S29A 3BILA 4X6LA 2XCRB 4XKJA 1YBAA 4ENVA 2VF2A 3WWDA 1OBCA 4GMFA 1JLSA 2B36A 3W4JA 4R9VA 1PYDA 1OR8A 4J2TA 4I5GA 5AI4A 4M53A 4BWFB 2D74A 4NENB 2I1QA 4LQLA 2GYYA 2QZZA 3JQFA 3KLBA 4GP9A 1CS0B 1SC3A 4E94A 4E33A 1FNBA 4INJA 4DLUA 2PANA 4L08A 5CDUA 2ACKA 4GLLA 2Q29A 1GCUA 4TXHA 4C6RA 4HSGA 5FT9A 5CVJA 3RC1A 4KNVA 1HE4A 2ISSD 4BZQA 2H7CA 1J49A 1W6UA 1KFJB 1IHDA 2X5KO 3B1XA 3EEQA 1CUGA 1Z88A 1NM5A 1B2RA 1VBMA 1ZZEA 4R05A 4W7HA 1OBVA 1NW7A 5DEIA 3JX9A 4WUVA 2OXTA 5DBOA 4BNYA 1UZLA 4QELA 3RFXA 1N9GB 1S8NA 4S1VA 4ZV7A 3K1AA 1QF9A 1USWA 1OIWA 2FEKA 2H7XA 3AJDA 2HK6A 4XSGA 4Y6QA 1Z4MA 2UKDA 2ZU0C 3FNIA 2GCOB 2QSZA 3ZDXB 3LRPA 5SYAA 1NNSA 4O2AA 1M2KA 1ABFA 4MVJA 5COQA 4F97A 5JY1A 5L8VA 4RFLA 3RSCA 1BWRA 1FVHA 2HQRA 2C2HA 1OU4A 3IEPA 1H05A 2XODA 3M0EA 3N07A 4B4UA 4FYWA 4F3TA 2XLCA 2HZBA 2GFIA 4JSYA 3B20A 4J4BA 2WLSA 4KN8A 4PZUA 1PG2A 4YUXA 1J90A 1AN9A 1FVXA 3NUGA 3BB1A 1TMGE 2WAMA 4R68A 1ZAKA 3ZK9A 3ZU4A 2JJ1A 3ND7A 4F2DA 4EI8A 1L4BA 3DQPA 5B64A 1TYCA 2CMDA 1AQNA 2NNLD 1GR1A 3BVPA 3OETA 4KXQA 5CYOA 3WK8A 1B8UA 5D1NA 3UAVA 2XTNA 1U5BB 2OXEA 1BE0A 3B53X 3ETJA 2VRNA 1OAKA 1BQ3A 3W9BA 3ZBPA 3SYLA 2P2LA 4N5MA 1IJFA 4F12A 3CF0A 3ZGNA 4JUFA 1TZBA 1GPAA 2G0NA 2HIHA 4GWGA 5JXJA 2IH2A 2OWEA 1YDEA 1E98A 1NN5A 4F3KA 1FU4A 1Q3HA 4X3OA 5JJ5A 3EZ2A 3P2JA 3K0FA 2V6MA 5EXSA 3ZDCA 3F3YA 4JLPA 5F1KA 3G9QA 1LK5A 3CR8A 4PZLA 1M73E 1RR6A 1C1YA 5EWJB 3P9QA 4GOLD 5KINB 1B8NA 5D5HA 1II0A 2CJFA 1SKBA 2D0PB 5C7OO 5LJIA 2AS0A 2WJZB 3F9CA 4UATA 2C57A 2X3UA 3VH3A 4LDQA 4RJKA 1XL1A 2FW1A 3NV9A 2CMHA 5JNUA 3ZBQA 4ZHQA 4DCGA 4PZAA 5AVTA 2PTHA 2B61A 3EZNA 3LQ4A 2A9VA 1PZFA 5BNZA 1ULAA 3OOSA 3ZV6A 4OSOA 4DGQA 2QAGC 2QLFA 4OJKA 1WPQA 2QM7A 2ZSIA 1QIFA 3DAPA 4A1OA 1V37A 4XJSA 2O3RA 3E23A 1FUEA 3ET5A 2HC9A 4IDGA 1RLTA 3VDQA 2CLEB 4LTNA 4PYMA 2Y1FA 2VR1A 2I3BA 3CSSA 4V0LA 3U31A 1B43A 2YNMA 3AONB 4K88A 1QF7A 4TRJA 3WOVA 5JYCA 4UNQA 2WYIA 2YMQA 4G1VA 4HDKA 3A2NA 2IQ5A 2OQ2A 2WDPA 1JEYA 2H3EA 4R1MA 3NT4A 5EKSA 1DC3A 1RBMA 3MWYW 4KPUA 3B1JA 2VK2A 4GEGA 5KWEA 2XKKA 2JLWA 2D1FA 3ZHQA 3LYLA 1S9HA 1P0FA 3MWGA 3WGVA 2DPLA 1AO3A 2VTEA 2ZIXA 1U28A 4G24A 4N7MA 4BBZA 1OLOA 3ZDZB 1QC5B 4PLGA 3NBYC 3R7LA 3E1KA 3FNEA 3IJPA 1CZLA 1GLNA 1MLDA 2IEIA 4QM7A 5IYZA 3D6JA 1ECLA 4G81A 1V43A 3X1ZA 1SU7A 3IR5A 1TKAA 3EWNA 4QPDA 4A5OA 1C8VB 3D1LA 2JFOA 2P6NA 5F7OA 3ZLJA 1U99A 1YZFA 1KETA 1JHQA 2EERA 3NFRA 2VF4X 3BHNA 5LA6B 3X1XA 2JFFA 3WKAA 3QNUA 4V03A 1GYPA 3JZIA 5LWQA 3GLVA 2QT9A 1W76A 1X0XA 2YVLA 3AERB 3O5AA 4L7QA 4DUGA 3UJAA 4NWIA 3HZOA 1VA5A 5AM0A 2DPXA 2XUAA 3CWQA 4EATA 5IVPA 1LLFA 2E3JA 5FO0A 1XO1A 2FKAA 1UXJA 4GOJA 1K4MA 4KK4A 4TSKA 4ZVRA 5TS2A 3RSQA 5HUHA 5JAOA 3D8BA 2JZOA 1VLJA 4KL8S 4DY4A 4EHHA 4EY4A 5A1TA 5G3ZA 4MPDA 1K5PA 3M6AA 4KFSA 3TNJA 3C3XA 1LKZA 2L69A 1GEGA 4FNGA 2QL9A 2YXEA 4D92A 1L7PA 2I4MA 2VOEA 5EJGA 1XCLA 1LTHR 1U6IA 3DTVA 3IH5A 1JYSA 5C5EA 1YL5A 1XVLA 2YN4A 3ZBUA 2WJVA 2H18A 4W6ZA 4N12A 2JFQA 821PA 3UAGA 5HQJA 4L4ZA 4LTMA 2ZW9A 1NVDA 2JHFA 1KTIA 4II3A 4OHRA 2WF6A 4KNYA 1WV0A 2FZCA 4YHBA 1Z2EA 1SVNA 2IOFK 1DWUA 1GA4A 4C4PA 1T2DA 2ZDGA 3QU5A 3AIIA 4HNTA 3I45A 1KORA 4RLFA 5I8ZA 3IT0A 1R4MA 2C7VA 4B7AA 2ARKA 3FPSA 4U3JB 1SBYA 2EW2A 5IKOA 2JJ1D 1HQKA 4FC6A 1VJRA 4IIBA 3OOWA 1KOGA 1LX7A 5EHQA 4OPMA 1MORA 2B94A 2J0UA 1C5KA 1FSPA 1VZ2A 2FQ1A 4X64B 4YYEA 3QVJA 2J3IA 4AJJA 1LPMA 4C6SA 2Q1XA 3O7MA 1R6AA 2QVCA 1TAUA 2I2DA 1WDKA 2I76A 4QEZA 5EWLA 3ZCRA 3V48A 5J9FA 2R62A 1OT3A 4ZQBA 2FZ5A 4HQLA 3T54A 3QELB 1VBNA 1Q0HA 1QH1A 1Q77A 1SXGA 2CL5A 2BP7A 5JT1A 1ESNA 1W2GA 1DFGA 3QXGA 1ZNYA 3IAAA 2I33A 3QXSA 3WNBA 5E1DA 5CGZA 4MR7B 3WV4A 4C03A 5HZKA 2A4KA 2AOVA 1M6VA 4OIMA 1Z6YA 2TECE 2GFHA 3ECAA 3ZK8A 4C22A 3H75A 1O0SA 3K70D 2NG1A 1ZD3A 4JELA 1NV8A 2BMDA 3CF6R 2D0IA 4O5OA 2AE1A 3VO2A 2CB0A 1UOOA 2AT1A 1Z4PX 3KUCA 2Q50A 2C5GA 2QA5A 4CMEC 1M1UA 1YB6A 4IKOA 1O97C 1PHRA 1RYBA 4D4KA 1T25A 3TRHA 2VSOA 3K5HA 1QH8B 3OSUA 2ZUWA 1FNNA 4H1UA 4XYBA 4TQ9A 4JDPA 1Q15A 5JNSA 4WY8A 2P78A 7REQB 1C7RA 1FFDA 1YNOA 3LUPA 1VA4A 3C45A 4ZCLA 4BQNA 5B1YA 4YAGA 1UXIA 4C76A 2QPOA 2ATVA 4D3SA 2GN8A 5CXQA 3D7RA 1YHZA 2OAQ1 4RQTA 5DMHA 3EG9A 4G5HA 1JV2B 1PW5A 1N2JA 1O5OA 3E0QA 3HKDB 1G1AA 4MHOA 1EK5A 1YUNA 2AD1A 4L3VA 4R0NA 3DKPA 5KCZA 2GX6A 1T29A 3TQCA 2ODWA 3MBKA 5D00A 1ML4A 4AM8A 3KQSA 4RQBA 1KYWA 5E9WA 2VQ3A 1DT3A 3VJLA 3OCCA 1GNQA 1MMFB 1M6YA 1POXA 2OZLB 4PRKA 3BG5A 1DJQA 4IGFA 3T0FA 2DLDA 2IW1A 3HVHA 2WUWE 2H1RA 3UIEA 1AKTA 2AFHA 1B93A 3IDZA 4U00A 4BNNA 1CUHA 4WBXC 3PPVA 2ZSJA 4B71A 3NIFB 1W34A 2IFTA 2A5FA 4F5YA 4QNMA 2EATA 3G59A 5BN3B 1ZRSA 4BNHA 1Z6QA 3CUSA 3LDFA 3W8EA 1E0AA 4MV4A 2A33A 3AETB 3VH1A 4DSZA 4IYRA 1V8OA 3M9WA 1XNJA 5D6OA 4R2MA 3V33A 4GKAA 3TR5A 1H8HA 3OE7D 2POQX 2JLAA 3AJAA 5A7GA 1W9HA 1Y1SA 3L05A 1KEZA 1TKRA 5GGXA 3ESZA 4GKKB 1COWD 1WB6A 4RTJA 2PEYA 3KS9A 5CJ2A 4YJ2A 2DUUA 2GN6A 3MCAA 2WKWA 2DCUA 2A1IA 2J5BA 1RLUA 2I3ZA 3LUDA 1GU1A 2UU9B 3RBXA 1T1SA 1XCPA 4U5QA 3A1TA 4FOLA 3Q87B 1OE0A 4HQRA 1E3TA 1ZUWA 2YASA 1ZIDA 2GTIA 5I4IA 4PQRA 3RI3A 4H1WA 3D7LA 2YWHA 3IPAA 4MP8A 4OJNA 2PWPA 3FVVA 1Z6GA 5G02A 2QJWA 1NQOA 2XZTA 1NQVA 3IALA 1QIHA 4DR3B 4EYOA 4ETNA 4PQGA 5ECWA 3R7WA 3CM0A 1CZUA 5F3DA 5MDHA 3EA4A 3Q7RA 4X61A 5JCJA 1PHPA 4A3SA 3CEPB 4E7PA 4PNPA 1RHUA 1MABA 1V3TA 2EKZA 3R7DA 1XZAA 4DW8A 1WUTA 5JBNA 4O8ZA 2NO7A 3U44B 3BMXA 3CXRA 2Z3VA 2GN0A 4BX8A 4ETMA 1UBKS 4B8ZA 3V3KA 4WXRA 2HV9A 2QX4A 2J4FA 3EXHC 3SM9A 1BXKA 4FYYA 1T0JB 1ZKMA 3LMKA 3PNSA 4QEKA 2FJ0A 1IQRA 1D3AA 5TC4A 3RU7A 1KEPA 2QTMA 3HTXA 2DULA 3F3KA 3ZKAA 2R7NA 3PBKA 3HL4A 1D2EA 3GT3A 4OHUA 5FBVB 1XJ0A 1YJXA 2IUSA 4NBUA 1JYFA 1Y33E 1T3GA 1YR8A 2JLBA 2O05A 3WLIA 3UBTA 1BXGA 4HAVA 2BFBB 1YFKA 1SCIA 5CTJA 2QORA 3MJCA 1ONSA 2W5UA 2IYQA 3AF2A 3I39X 2VWGA 1VSUA 4FP9A 1RJFA 1P61B 2QTWB 4WN9B 1Q0QA 5I5GA 1VHDA 1IBRA 4TV8B 1C30A 4CW7A 2O8CA 4IZ6A 3G1WA 2EW8A 1BJRE 1C3OA 1YTLA 3F4KA 1I4EB 2N46A 3PUWA 4UMDA 3SC2B 4EWLA 1LDEA 1XQVA 2PMDA 4GU5A 4JLJA 4YUAA 4DMHA 4LDJA 4Z4FA 4HQNA 4DUYB 2WPDD 4YONB 3UWOA 3ZV5A 5BOSA 3IMFA 4PGGA 1RI2A 3B6IA 3FHLA 3K8YA 1KJ8A 5G40A 3PLNA 3K7EA 3W1VA 1Y9ZA 4BLTA 1T9CA 4DJTA 4NV3A 4TTSA 2FMUA 2D06A 4DWOA 2FTKE 2Q5HA 2Z08A 3QFSA 4CTOA 2ZRAA 2J85A 4B3HA 4TQAA 1MA3A 1XTBA 5ULLA 1L3IA 1GADO 3A6LA 3A9VA 1AGXA 3HN6A 3CNHA 3IGFA 4OYRA 3VX4A 1SVKA 1GCAA 1JEQB 2P1DA 4D74A 1IH8A 3OJOA 2DHDA 4U6QA 2B4TO 3HYSA 2NO5A 1BGVA 1J70A 2D0DA 4B32A 3DM9B 5C81A 1R6VA 4W8OA 5GVSA 5LFAA 1YFZA 1NR5A 4KQHA 3KJHA 2O19A 1K7FB 3RS3A 3VR4A 1Q7CA 4CKEB 1VKOA 1SCKA 3WR5A 4QDXA 1Y6JA 5DZSA 2DFLA 4PEVA 4ZJUA 1D6JA 2BTQA 3ILSA 1G42A 1KP2A 1YJAA 2HGZA 3P96A 3U3KA 5HNKA 3OQMA 2CCJA 4B7ZA 3CLVA 3GUZA 1PFVA 3HBNA 3G9XA 4NCKA 2B9VA 5KTMA 2IYYA 4CM5A 2HO4A 2W4IA 2NT4A 2YHBA 4ENSA 3VYVA 3PICA 5L6MB 1T8TA 3BXZA 2ONJA 1JIKA 2O7NA 2XUQA 5FJIA 4CKZA 4ND4A 4YMGA 1FOEB 3D02A 3VR6A 1JHYA 4I6GA 3SIRA 1DXQA 4YT8A 1E9DA 2WZCA 2YV5A 2P0EA 1PR6A 2PMFA 3A04A 2SCUA 5HMMA 5JFGA 2Z6UA 3RRXA 1GWNA 4RGBA 2W2NA 2C20A 3PRJA 4WXPA 4Q05A 4OHMA 2QNBA 2ZETA 3IKVA 2IGTA 3VKUA 3KUUA 5L53A 1AZWA 1MENA 1P5JA 3E15A 5LP6A 1YR7A 2O5CA 3WAKA 2CJXA 1PTJC 3H84A 3NDRA 4F9FA 2FW7A 1LLUA 2GK4A 3A1VA 3CLSD 4FMPA 1NG9A 3E3OA 5E6UA 4U63A 2Q5JA 3UQYS 3BK7A 3TX6A 1IY8A 2P30A 3HCCA 5K3DA 2O3QA 1G8GA 1SCDA 1L7EA 1U1CA 1S02A 1BIFA 1FNMA 1NKVA 3A7EA 3DDWA 4X8LA 2AJDA 3N3BC 3R3VA 3JQ7B 3O8OA 3CPEA 1TTPB 4G4SP 4TSRA 5FTNA 4RDCA 1X70A 1S3GA 1L5KA 3PVZA 4BCBA 1XMOB 2ZVDA 5EQJB 3K1TA 3WP1B 2CDCA 3JASB 3KSZO 4EUSA 4NFSA 1ISHA 2VT3A 4W99A 2R87A 4TZTA 4BCDA 1KRWA 1TT7A 2PQMA 4X1IB 4LPKA 5EGNA 3U3ZA 1UWVA 5DSZA 3HV0A 3KTAB 3ENZA 3JQ9A 1F4PA 1H2WA 3I73A 3K73O 2NTNA 3NG1A 3KJZA 4TTVA 2I6SA 2XB6A 3MUEA 4O2BF 4HK4A 4A26A 2P3LA 3L18A 4HGZA 2NSHA 2ZS8A 2W48A 3PGLA 1JAIA 1GNPA 4FBGA 4OA5A 4V0NA 5I5EA 2IXDA 1RKQA 2JLRA 2Z5GA 2B8NA 4IRXA 2ACEA 3ZHUA 4F0JA 3DL2A 4PG5A 2CLMB 1NVAA 3I9FA 4YEDA 3BSSA 1P0IA 4LYAA 3WIBA 2FR8A 3GCGA 4XQEA 2FRDA 3IXMA 3PTZA 4KWIA 3WTCA 3HNRA 2BGTA 1X7WA 1LVHA 1GTMA 4YJFA 5IC4A 4DV0B 1RDFA 4G65A 3U9SA 4PVDA 3RYIA 2Y0EA 3MIIA 2D59A 2NO1A 1H22A 3Q0EA 1EKXA 4OVKA 3GVIA 1DEAA 1XBTA 2L17A 2FR0A 5A2QA 2FSGA 2J3JA 2V3WA 2HW8A 4C4ZA 2BGKA 4OFBA 2QJRA 4G89A 5K7SA 2BFEB 2R1TB 1Q95A 5T67A 1W4LA 1QAQA 3HABA 4QEDA 2ZUCA 3ZK7A 5HRUA 3TWOA 1AH2A 1SMKA 4KODA 4MJ3A 1A9PA 2NM0A 2RBKA 5UKDA 3GCDA 4HWSA 3VX3A 1WXXA 1IDN1 4EMTA 1Z63A 1FL9A 3C97A 2WM8A 2A88A 1ONPA 1QB8A 2WU3A 3FHJA 2FNAA 5H02A 4AG3A 2IS2A 4FX2A 1H2EA 4D9GA 3FBWA 4Z1MD 4DTIA 1X94A 3AR7A 4G5OA 5T41A 1ZL2A 4RCZA 3DE1X 5JCZA 4DMCA 5BW4A 2HWWA 3F71A 4OREX 7REQA 2Q3FA 2QXTA 2ZIFA 5AQEA 5I7AA 2C5EA 2FW9A 1G0NA 3FKQA 4WNCA 2XDQB 4YB8A 1K86A 4ZYUA 3JQGB 5BNIA 2D5CA 1FMFA 3TQFA 4FHGA 5B1HA 1F06A 4M0PA 1AHIA 2G83A 2H2FA 4JEIA 5LOVB 3GLIE 2A1UA 1Z9BA 1UFOA 3BWVA 4K0RA 2B6HA 4I14A 2X6RA 3F47A 1O94D 4IVQA 4LNUB 4MW7A 4RZSA 2NU8B 1XRLA 4AK9A 4U39A 3CISA 2Q4TA 1EGQA 1FXWF 3ETNA 3OZSA 3DPSA 2H1VA 1Z07A 1ZMRA 1HXHA 1I1OA 1FLNA 1M3SA 3AM4A 3AW9A 1LC0A 1B0UA 1O54A 4GYKA 4ZDKA 2XCLA 2UVPB 3EHDA 1JPVA 1W29A 1XFAA 4ZOAA 1NOJA 1UEIA 1VI6A 3V4OA 4BO3A 1FUUA 1PVVA 2VQSA 2ZRIA 2JAQA 2RB4A 4UXHA 4LF6B 1YJ8A 3IA2A 1EK0A 3EA5A 1IRXA 1NKSA 1CQJB 2WWWA 1NBOA 3K0BA 5FNZA 3ZIDA 5IN4A 4WLVA 2C59A 1N36B 1JQ5A 2Q3MA 3I09A 3MAGA 1OI3A 4NZNA 3QJGA 4K6KA 1BE1A 4LSWA 1D0VA 1LI4A 3DFMA 3EN0A 4Q3EA 4TZKA 5GMOA 3W8NA 5JANA 4KQJA 1SHZA 4FNAA 4BN0A 4HNVA 1SUSA 2Z30A 3H9EO 4HB0A 3ER9A 2FSSA 1XKQA 3A1EA 1MVLA 4JLMA 5SYMA 1NLZA 1T6XA 3THXA 1RHMA 4DJFC 1TX4B 1L8LA 2WDZA 3QENA 3T99A 1GTSA 5TEVA 3LA6A 3RHSA 1KDRA 1EIWA 3BWMA 3OOHA 1D4ZA 3PL1A 3C16C 2OCPA 2QQFA 1T6ZA 3GWGA 4FXPA 5TDHA 2HJGA 1XRQA 3D0QA 1JHXA 2I65A 1T9GS 4FYHA 4MW1A 4WCDA 2X0FA 4A8JC 4CG1A 2CHQA 2ZE6A 3EBPA 3R77A 4P3OA 4UUQA 3UOWA 2I91A 4NPAA 2NZUG 3GEBA 1NBMA 3O8BA 4PY2A 3LUBA 4BXOA 1LB1B 2XJ9A 4JJ8A 2DCMA 1OD6A 4NTZA 4TS9A 1F0KA 1PP4A 3K1AB 2IS6A 4IAOA 1NKTA 1H2HA 3ZLTA 2PUAA 4V38A 3NUZA 1N6HA 1YJBA 3QXJA 3FTNA 4JX9A 4O2AB 5TPWB 4Q03A 3DLHA 2VRBA 4NYMR 1J6UA 3BRWD 4KXXA 1JDBB 2AHOA 1OWPA 2PLRA 1SCNE 5AKKA 4Z1MA 1B23P 4U3JA 2XUPA 4OXRA 4DNQA 3RYHB 1OTYA 3H5WA 1F6WA 1Z7EA 4FM9A 1IHYA 1YDGA 2J7KA 5JVDA 4MQLA 4S2EA 3PFFA 2W90A 1PW7A 4Q3KA 4C7VA 2VXYA 2PSEA 1GTRA 1W8DA 4M46A 2I4LA 2QJOA 3D4LA 3E9QA 2PE5A 4NPHA 1DG3A 1WMSA 5TMDA 3ND9A 3O8DA 1ZSNA 2CHVA 2MIIA 2ZI3A 2YDXA 4TV9F 1PS0A 1OAAA 3DE0X 3MOGA 3RS4A 2IYSA 3CF4A 3HSSA 5DK6A 1PU2A 2Q27A 1Q7RA 3GMIA 3OJ0A 4FLMA 3V7WA 4P7BA 4QDKA 4BJ3A 3GBVA 3H13A 3HVRA 1CFZA 3X1JA 5AVOA 1Q0TA 1W19A 2A0FA 3WLOA 5EJ8A 2JLUA 3IHLA 1YB2A 1GNTA 2H2WA 1DAIA 2FPWA 3KOUA 2OXRA 4PFJA 3V97A 4X7BA 5DYTA 2GJSA 1UC5B 1X6VA 2HF8A 3MPUA 4NNPA 5KPDA 3G2QA 4FGJA 1RRPA 3OD1A 1P9NA 4LVNA 4ARVA 4GICA 2IEBA 2G04A 5JS8A 2CGEA 2XEDA 2DH6A 3K8OE 2GA8A 3O7WA 4KSBA 4MPJA 2Z3ZA 2XTJA 3SDZA 3MELA 4Z86A 2OCGA 3JWIA 1MF7A 2FX5A 4GG1A 5KYTA 4HF7A 3VNRA 5L45A 2ZAMA 1TL7C 3LH5A 3N0VA 4KXNA 2WQ6A 1G8JA 3F7OA 4N39A 3PX3A 4OQFA 4CR6A 4C0WA 1CUWA 1DUIA 1LRKA 4A6EA 4Z7OB 1Y8QB 1M0WA 2RGRA 1BW9A 2E18A 4C3ZA 2ZZNA 3GL9A 3JATB 1F8GA 3O2NA 5HF6A 4CG0A 3T3NA 3BIXA 2NUTB 2BCJQ 5HE9A 2Z56A 3AJ8A 3VAYA 1XN1A 4MVJM 1J7JA 1KQFA 3DBOB 2CK3A 4ANFA 1F7UA 3SF8B 3G2MA 1QS0A 3Q3CA 4XPZA 4MW2A 4RVOA 3RG8A 4DIOA 5EJ4A 3CC8A 4FYVA 2HA5A 4MRRA 4QVKA 5KNDA 3K0EA 3W7AA 5BYJA 4P83A 1GQ2A 1G2IA 3AR9A 2YUIA 3FYUC 4P98A 3P9XA 5ESRA 2EG5A 4Q4HB 2V7VA 2H31A 4RYDA 4BO8A 4YDQA 1BHSA 5DM70 2J3EA 1UL1X 4XQ9A 3ZLVA 5K3CA 2A58A 3RC8A 3W5IA 1UKCA 1Z7WA 6AT1A 1HMYA 4LF9B 1LV7A 1X3LA 2G07A 3GJZA 2JG3A 4Q7EA 1N2SA 5IK2D 3GP8A 2JL1A 2BHSA 1QV7A 2EKDA 4KQEA 2OCBA 3MXOA 3I9NA 4QOHA 4U2CA 3ZXXA 4DSUA 1DAFA 1Y1QA 3PX2A 5ESWA 3KWJA 4HNUA 2V65A 5G1PA 1MC8A 3F4BA 1AIPA 1YIOA 4QICA 5BMVF 4QX6A 2JFYA 3N8DA 1IOZA 4B43A 1Y1RA 2X9NA 3OKCA 2C7QA 1BDBA 3OPQA 2FKNA 2BSAA 2HMUA 2MWMA 2ZI5A 3Q9UA 3ER6A 1Z6TA 4QXAA 2E5WA 1KR5A 5GONA 1VP3A 1A5SB 4YV7A 5C31A 1NUUA 2R5FA 2OHFA 3OLZA 2P5UA 3UHJA 2JAHA 3DP7A 4HZUA 2XLBA 1NF2A 4CM1A 4YY3B 1SBTA 1CUZA 3LLUA 4DBVO 4OKIA 1D09A 1N2EA 1NSFA 2Z3WA 4RCYA 2NQ2C 5H4HA 3JZAA 3K05A 3QX8A 4URHA 4ZT7A 4F1JA 4M8NE 4BB5A 3ICOA 3PC2A 2RG7A 1DQYA 4F7WA 1SU4A 1PGJA 3ETLA 5ECYA 2YUTA 1DDIA 2EBFX 2HNKA 4R2LA 4YDRA 1E6EA 1WCIA 4Q1AA 4LV8B 4X60A 4QBHA 5KSOA 1XNHA 3PVSA 5JIBA 2X8WA 3WDKA 3CRNA 1SZPA 4K9QA 1MB3A 3WL7A 5KX5B 3A25A 2ZUTA 1RI4A 3IX7A 4GPAA 1LFAA 4ALNA 1Q16A 3V55A 4RO0A 4CM3A 4RQUA 3KZXA 4J4HA 3KQPA 1CY0A 3UMGA 3ONDA 2VJMB 3KTAA 4WA8A 4CLOA 4MGHA 2YQ4A 3VSEA 4DSTA 4BE4A 4LYEA 1KZ1A 2CLLB 3KQUA 1WCXA 5EQTA 3PQ4A 1QE5A 2J9XB 2W8ZA 3DKIA 1ESMA 1PZEA 4KOEC 1XKXA 3EVGA 1PJ4A 2R66A 2RHOA 4OYYA 3S7ZA 3AR4A 1H0SA 4E22A 4AQYB 2YXDA 3FUUA 4FONA 5AW7A 2ECPA 4F85A 1M0SA 3F2IA 4PG4A 1ZD1A 3KJNA 4WK0B 1A27A 1Y9EA 1F8FA 1AG9A 5MN5A 1JSRA 4UU0A 1W59A 4LRWA 2LKCA 1G41A 2HHAA 3NYRA 1EK1A 5HKOA 3OJCA 3DEZA 3KFLA 2YY5A 4N3CA 1X7WB 3HLTA 3LC7O 1DOAA 1AK1A 3MOIA 4HB4A 4YJFB 3W5JA 4ARBA 1Y6GA 3LCJA 1WQ4A 3RVOA 4L6IA 5HDBB 1ZUD1 1QYXA 2LGJA 3H5TA 3NHWA 4UUPA 4L78A 4DR6B 2G63A 3N9IA 3RM3A 3FHTA 4F6LA 4DLYA 2ID7A 4KDRA 4OU5A 3NC0C 4FDAA 4RY8A 2RHLA 1KVQA 2LV8A 2W70A 4DLTA 4Y3UA 4MUNA 4DR2B 3CLTC 3A0RB 5T7BA 1E0DA 3FWNA 5NLLA 1GFSA 2WV9A 4DXAA 2O3JA 4MUMA 4EG5A 4S24A 3EODA 2VAWA 2TMYA 2PD4A 1PVOA 5DWDA 1K27A 2B7LA 3PF8A 2HDNB 3OIWA 2I6FA 4PHTA 4XD7D 3QIVA 5FLYA 1RI3A 2UYHA 3ZVKA 2R8BA 3AHIA 5K8CA 1B7GO 1TZKA 2SBTA 4IWYA 1U8YA 1BHO1 4O4HA 3IYLW 1W85A 2F62A 4MV5A 5A4DA 2H85A 4U02A 3TINA 1KEUA 4NYIR 1MR3F 1HUQA 3OY2A 3TJMA 2DE0X 4WMLA 1AKRA 1PJ2A 2G76A 2NPFA 2IDMA 4N0EA 5DX8A 1H5NA 2BBOA 3PPXA 3IS3A 2GEBA 1XZLA 1JFVA 4Z4EA 3EW7A 5K5EA 3AFHA 1H8EA 1L5YA 5IJXA 3OMXA 4WXYB 3HKBB 4WE3A 2Q4BA 2VATA 4LXQA 5B2ZA 3DB2A 1UMDB 3SLGA 1QGZA 2CXTA 1CEQA 2QM0A 2QQEA 5J47A 5ALGA 1BDJA 3INNA 2V7QA 3ORYA 1TQ6A 1DDOA 1BKDR 1NYQA 3HWRA 1PQYA 1ADBA 4MUJA 1WZNA 3U5TA 2A1TR 1U9IA 1TNDA 5B3JC 1RAEA 3L1HA 4NC9A 1GOTA 2AXEA 3H5OA 1E3EA 1O08A 3NWEA 3PJEA 4IJWA 4O2BA 2FPXA 4JBNA 5ITSA 2PR2A 3ZS9A 2CLIB 3W3AD 1BE8A 3WL8A 4L5BA 4BNLA 4DQUA 3CVOA 2JFNA 4H7JA 5M2QA 2IP2A 2BH9A 3L6BA 2JIDA 1UMBA 3JQAA 3SXUA 2F9MA 1ZRMA 1H1LA 1P17A 1XFDA 1SPXA 1QIIA 1Z68A 3FPHA 3I1FA 1B41A 1GPMA 1UKAA 2PU7A 3OQIA 2BSXA 1F8YA 2C5SA 1VI5A 2WPDA 3JD4A 4H77A 1KSJA 2FGJA 3CKYA 3PQ6A 2I4IA 4TYMA 1G20A 1SN7A 3A2MA 4LC9A 3HCBA 1O1YA 3AUUA 1PTJA 3I23A 1U81A 3VUFA 2WIKA 1U1EA 3DEJA 3FIUA 3EDRA 5FOVA 2YY7A 1EG2A 4ND8B 3JCZA 1YFJA 2QL6A 5JEDA 1BCRA 2ZWMA 4TRMA 3SEZA 1WF6A 2BR5A 1E64A 2PKQP 1SFRA 2LR0A 4WERA 1L8OA 2ZP1A 2J45A 4NF2A 4OP1A 1GVHA 1XCOA 4H0NA 3QRWA 1PQUA 1K7SN 2FPRA 2CJPA 3JAKB 1GGEA 1O9BA 3N39C 4RPLA 1NUQA 1Q12A 4WOBA 4BGUA 5KSZA 4G85A 4M86A 3R7WB 4AJ2A 4Y0AA 4CDGA 2GN1A 2MSKA 4LAFA 5JU6A 1XMQB 3USES 4MIOA 1FP4B 4MR8A 4X85A 2OESA 5JISA 3GQBB 3KHTA 4KLRA 1OXBB 1QZ3A 2ODQA 3IBGA 4Y7DA 4M7RA 2P6RA 4Y0NA 2YZ7A 3ZHBA 2QVBA 3EBLA 5HX7A 5KDDA 5F7XA 1TW3A 2NQTA 2ZTLA 4HH4A 3BE5A 4MWGA 3UXMA 4B7XA 5HTKA 3IQXA 2KS6A 1V9LA 2PWZA 4IIUA 4JQCA 2KI5A 5EUBA 4JR2A 4LZZA 2J1LA 4AKIA 3CX3A 1VG0B 2Z9BA 1TI7A 2Q6TA 4LOLA 3M1YA 3IHKA 3P4YA 4D81A 3L2OB 5LVAA 3K32A 3MWJA 4ISCA 4MV8A 2NOAA 1BMTA 4EHKA 1E20A 1U0NA 2YWXA 4A36A 5E3HA 2WU4A 3COSA 3WDLA 5JWOA 2D3WA 1V16B 2GZ2A 3TQIA 1M5RA 4ILEA 3ZIUA 4RTOA 2P9HA 1A8PA 2IZZA 2F17A 3ZQKA 3R7FA 3EA0A 4F6RB 4YR7A 1KQPA 2YWBA 4DDKA 2JNWA 2LNDA 3ZCSA 1JIUA 1QTNA 2O0JA 3DE3X 4KGVA 5FBQB 3TTTA 4MCAA 1KY3A 3VKWA 2FSUA 2FEXA 3OQ1A 4I4NA 4JB8A 4BE9A 4G63A 3B2EA 4CMHA 2F3PA 2UYCA 3RAPR 1E0KA 3HA7A 3S70A 3MQFA 1Z3CA 4ZKDA 3G3EA 1DX6A 1I0LA 1EQUA 4DR4B 5BMVB 4EVQA 3B5EA 3RRBA 1L5SA 1S1CA 1ZI6A 3IAUA 4IJQA 1IY1A 4DQDA 4KBYA 2JW5A 3GLIB 3SJZA 3VC2A 3KEMA 4JYZA 3G8AA 3JPYA 2B5WA 1J2EA 2YL2A 4I1RA 4ML3A 5CNJA 4OUDB 3WGHA 2CV2A 2Q9BA 1DE0A 4FB4A 1J06A 5DTJA 4TMVA 4FKZA 4XB6B 1QQ7A 4OI0A 1U0OC 3IVGA 4G25A 4IO1A 2W2KB 2Z8YM 3H16A 4Q47A 3WDSA 1XYVA 2EG9A 2EKBA 2EGGA 2WKQA 3DOCA 1M83A 4WNAA 4GSKA 4RKQA 2G71A 221PA 4XLTA 1NW5A 5JSYA 2ZG6A 1NW9B 1E7SA 3KZMA 2PRSA 4RH1A 4P8RA 3IXQA 1C9NA 2QP9X 4HGQA 3F90A 5DHQA 2CBZA 5DU2A 4DJJA 2P7HA 3DA8A 1KYTA 2Y2VA 3I0ZA 3FNGA 5CK5A 1XAJA 4MQFA 5E7IA 3ZD8A 1J8FA 5BY2A 7ABPA 2A86A 3OEWA 1LTKA 5JLJA 1TJ3A 1DOZA 1VB5A 3N7AA 4GQAA 3TLXA 2DFPA 4C5AA 4FCCA 3A4YA 4NOJA 1WDMA 4EO4A 4WJZA 4L51A 5HXAA 5K0BA 1IEXA 1RABA 2EWWA 4TL6A 5KNDH 3VOTA 1MJGM 2QXYA 2Y77A 3B1ZA 4A8PA 1JKIA 3MG9A 4QU5A 4XDHA 1X2BA 3LHFA 2HLPA 2EJUA 1HI9A 4HBGA 4XDGA 3T5TA 5LQDA 5AK5A 3PI7A 4CIBA 2PWYA 2WINI 2TRSB 3C5VA 1P4SA 2FP4A 2SCUB 1UP4A 1VHLA 2HPZA 2IVFA 4TOIA 1L9XA 1JNYA 1E3DA 1SCQA 1OOEA 1NVUQ 1RQRA 1JG2A 1QTRA 3DMRA 3O92A 2HZ7A 1XMIA 3PQCA 2C1ZA 3U7QA 2WAAA 2C95A 2X8JB 4CLHA 4IQGA 521PA 3F5QA 3L6UA 2BFPA 3ZY2A 2CHFA 2JLCA 2N1BA 2XGSA 3DZBA 4J7AA 4K5QA 4URFA 3ZH2A 5IJ0B 3WV5A 4CDRA 5AOCA 1XAIA 4M9SA 4YBZA 1J1UA 1SR8A 2PGNA 3KQOA 1T5LA 5DN6A 1Q17A 1ZONA 4QGAA 4FYKA 4RMHA 3HNOA 2CC2A 5T4FA 4OGKA 1U02A 5K8UA 1J0XO 4CLDA 3NNSA 2OQIA 3UAWA 1XEAA 1WCIB 4MVJH 5DCLA 5EHIA 5EJ5A 5ICCA 4NEHB 4DCUA 1AOXA 5AKGA 2C77A 2DBRA 3OQOA 2EJTA 4GVLA 3MMPA 1PNQA 1YB7A 2JI4A 3ESRA 3UTDA 2ZJZA 2VPYA 3P2IA 4ZAYA 1H3FA 4Z8YA 1FRVA 4RZ3A 4GP6A 2ZAYA 3C7AA 4V3CA 2FMHA 2ZBFA 3NWBA 1EQAA 2JFXA 1QRDA 3MBIA 4G1FA 4KLZA 5HWSA 1HLPA 3GEGA 4QRIA 4MS1A 4MRMB 4IJMA 3SEQA 2JAPA 1OAOA 4X7RA 5FDFA 3O8NA 3CW8X 3V7FA 4CMAA 4DV7B 3ZQ4A 2VA9A 3BXXA 2VJPA 1HH4A 5GGYA 1A8HA 1CJMA 2ANCA 3UV7A 4ZT2A 2YQ5A 3HB7A 4WRRA 2F1JA 4AI6A 3EXIB 3RC3A 3NRBA 4QTYA 4X8OA 2VCHA 1T0IA 4PAGA 3C6XA 1EP3B 1I7PA 3HJHA 4PCUA 1PSWA 3SC2A 3WMWA 3E5MA 3TLMA 3WYNA 5BPHA 4MWOA 2YRWA 2OTCA 4OBWA 3HDTA 4QWMA 1UEJA 3BHMA 5CXXA 4ZI5A 3VR0A 4F4HA 4DAOA 2X4GA 3CIOA 3I6BA 5EIOA 4CKCA 4PAMA 1TZMA 4AN4A 1IM2A 2JJQA 3BD9A 2FZGA 3DMTA 5FR2A 3VC1A 5IS2A 2CL6X 2WRZA 2VJYA 3E2IA 4HWOA 1OH5A 1V5IA 1AQ6A 2YINC 5AHRA 3EULA 1ISGA 1XRMA 3TXXA 2XWJI 1FP7A 4FGLA 4YRPA 4OI1A 3SBEA 2O8BA 1SRQA 3FOBA 3KO8A 1D4OA 2OT3B 2RH5A 2VYFA 4MUIA 1NJ6A 2YVQA 1T1RA 1SB9A 5CDTA 4Z5XA 3WLJA 3PUIA 1M7GA 1WABA 2JFGA 2VZ9A 1JT9A 4QECA 2L18A 3TAHA 4E5UA 1M75A 3OKPA 2YNMC 1GL6A 2A9RA 5AKZA 2GBPA 4DNPA 2VNIA 2VSXA 4KO3S 1MAVA 2G1UA 3C48A 5A0VA 1NQ5A 2ECKA 2HSEA 4MYDA 4AL4A 2CFSA 2EKQA 3MJFA 4NCAA 4GPTA 4OKNA 3MINB 4N5HX 3GD5A 3VNVA 4CYMA 1YA8A 4MQ5A 3B9BA 1LPAB 1MPTA 4EP1A 4FKMA 3PC6A 4IHJF 2P65A 3ZJUA 3NHFA 4IG4A 3FMFA 4CEJA 5E95A 1GRVA 5CX4A 1V8DA 2W37A 3HP4A 3I01M 2PX6A 4QO8A 2XRZA 1ZWKA 4ZZ3A 2YYYA 2IUTA 3MFQA 1AGRA 1DB3A 2ONCA 4V39A 3OLYA 2BFOA 2P9YA 1O6BA 4YMIA 5G4LA 3T38A 1SUWA 5P21A 2OO3A 3L8ZA 1HLFA 1I10A 2B82A 4M3NA 3PC8C 3BC1A 3DBVO 3ZWQA 4WBNF 3WGTA 4RZ2A 3ON5A 2OV8A 3CEAA 1KHTA 3E82A 4DCMA 4ZCRA 1Y48E 4LIPD 4J0JA 1V96A 2Q9UA 3BBLA 2QR3A 3KEFA 3NO4A 3OC6A 2VL7A 5AK6A 3GPDG 2O2SA 4GKBA 4X3CA 2CUZA 1GGKA 3QBTA 4LMAA 1M2NA 3G82C 4KJXA 5CA0A 3WA7A 3LDHA 1BQEA 3ZWXA 5C3UA 2Z6QA 4QQ8A 4TLDA 1FS5A 3D1JA 5JARA 4XE5A 5KOHB 4Y1GA 1G3MA 5CJJA 2NU7B 3ZC3A 3IQDB 2OLEA 2W11A 3WJ2A 5BV1A 1P5FA 4E32A 1O0CA 1ULUA 2QSJA 4TWJA 2O07A 2QIPA 2B20A 3M1IA 1MX5A 4OFWA 4QZVA 1JSLA 5HA5A 4BBJA 3AUTA 4CUJA 1TTTA 1G66A 4NECA 1R18A 4QE3A 4EFNA 4L3OA 1GZ5A 4FB5A 3CKLA 3DMTC 3QKSA 2C2YA 1H1DA 3E9MA 4GPD1 5K3AA 5EMHA 4K2AA 2XNDA 1WHTA 1JDTA 1P5RA 3LUKA 4H4CA 4RKYA 5CCEA 3TTSA 1SUPA 3ETDA 4OTZA 5AVWA 2WFZA 4LYDA 4JMPA 1PL6A 4M88A 5BSRA 2A59A 2NN3C 2E37A 2QSUA 5LBTA 4BZWA 1WM1A 4D2IA 5JC1A 2DKNA 4B35A 1UIMA 3U17A 5KMGA 1P81A 1HE1C 1L4GA 3KZVA 4OAQA 3TQOA 1B1AA 3AO0B 1UBSB 1TDJA 3G8YA 3IV7A 4R2XA 4LJ7A 3NBFA 1R50A 1OGIA 1WXDA 2A9KA 2H4HA 1KZ6A 3WRXC 1QPBA 4DPKA 2NXCA 4O4IB 5FWXB 2CLDX 4LCJA 1M2OB 1N4AA 2V54A 1NJFA 1X13A 4MVXA 5IZCA 5BNFA 4B8WA 4TKVA 3E9ZA 4C2TA 4DLAA 3G7UA 4NCXA 1RQLA 2B8TA 4YRTA 5GINE 4HLUC 1F5SA 3QYFA 4OXYA 5CEFA 4PNZA 9LDBA 2FZ4A 4HDNA 5ALLA 1OXVA 1HORA 2PZFA 1H4VB 4YP0A 4BMOB 2V7UA 2Q3JA 2C92A 2JGNA 2VDWA 2CUTA 4HGNA 2M6SA 4XCQA 1L4UA 1ZISA 3B60A 5B4VA 3IP9A 3SS9X 4HEHA 2WAYA 4LJYA 1K75A 4FDUA 2ZI4A 4EHBA 5FORA 4YQZA 4Z0TA 4C5BA 2HGSA 3ZBTA 4B6SA 4ND6A 4ZVVA 1Y8AA 16PKA 4UFPA 1AHHA 1PJCA 3DHEA 4IDNA 3IQGX 5H81A 5JFOA 1G4UR 1NP7A 4XWYA 1WBDA 5JPIA 3P9IA 2J5XA 2C4MA 2XBUA 3ZZMA 3BWBA 3Q7EA 3K3PA 4BGIA 5JJCA 5L3ZA 3SYKA 1FQOA 3ILXA 2IV7A 3VVMA 3I2IA 3SK0A 6REQA 4KQ6A 2BFDB 1KH3A 2QE7D 5FUBA 5IBPA 4K28A 2ZR8A 2EZ8A 2W6OA 1ACMA 3WBKA 4BO4A 1XTQA 1BMQA 2WHYA 3DWIA 1U3CA 1FXUA 2D8MA 3B3GA 3N2IA 5CW1A 3Q8XB 1RTKA 1H1TA 2IHBA 4EZBA 4MHSA 3UWDA 4XM0A 2CUNA 2LCFA 4KQ9A 2MYNA 4YLGA 4F04A 2CFOA 1EK6A 1K92A 2FF5A 1ZNXA 4ID9A 3O93A 4C4SA 3KYCA 1IPEA 4IH9A 4FYJA 4EYGA 5ER6A 4TXNA 5B37A 3FDIA 1ULTA 1SHUX 1RYFA 1VL6A 2FYTA 2P11A 4I7EA 4TQUS 5F77A 2WFAA 2CY0A 2X23A 1LU9A 3ZNPA 2V7GA 5JE8A 3KJEA 1Q7EA 2ZK7A 4BCCA 2VYVD 4D96A 2HRZA 4DQXA 2FE4A 2D62A 2PVSA 1TM3E 3O4IA 4WKBA 2JGIA 1TMYA 3SZLA 1N6NA 3M8KA 1WW8A 1EUDB 2AXNA 1P1FA 1P2SA 1RWWA 3KZOA 4E51A 1T10A 1XA3A 4HLNA 2BUCA 3UJPA 1Z17A 3BRSA 2V3VA 2H4JA 3NTVA 4M60A 1TUBA 1PL8A 4HYTA 4GRDA 3W3AH 5BWNA 1G8SA 2CHGA 4IWNA 4WXEA 3WIEA 3D0RA 1XF1A 2YWCA 3ZWVA 1QMGA 1KR2A 3MYYA 3ZXYA 1FUKA 3DD5A 3E3MA 4LGMA 121PA 1K4YA 2JIOA 3GELA 4KR2A 3HH8A 1R3UA 2B78A 2UVDA 3IBCA 4FMDF 4KK3A 4PZEA 1AUPA 3C3DA 3RHFA 4AP9A 4N47A 3DZKA 2X1HA 1AKYA 1T4DA 1G9TA 4GM0A 3WB1A 4BFSA 3N0TA 4PICA 1TM5E 1EFRA 1QG2A 1ZW6A 3N2KA 4Q16A 4BIMA 1P9RA 2A57A 4N18A 2FPSA 4PLFA 2WFLA 4FHCA 4OYLA 4B48A 3AP1A 4BNFA 5LZ9A 1E2JA 2P4SA 4B3DA 5LYJF 4PC1A 1U1IA 3D81A 1PDVA 1RRVA 3B3QA 1FMTA 1RLJA 2Q8PA 2YHIA 1EEXB 1EFVA 1G291 2PGAA 2B3TA 4L6AA 4Q24A 4QOGA 1D4AA 4BP9A 3C6ZA 5D3ZA 5DGXA 1O2DA 3QVVA 3GFPA 4HWKA 2BZSA 1BE6A 4P4NA 4B82A 1ADFA 4H1TA 5AJUA 3U2QA 4IFTA 3JZMA 1P45A 2Y8EA 3C3CA 3FMPB 1JTEA 1J5PA 3JVVA 4NBKA 5HF9A 3HI6A 5JYBA 4MGIR 3RK4A 3Q85A 3R3SA 2ZSEA 5CB4A 4FZRA 2PRYA 4GPZA 2O8DB 3KDAA 3B12A 2VIIA 2EX4A 3MRVA 3PC7A 2IEDA 4JR0A 5DPMA 2J59A 4PLPA 3R6TA 2WP8J 3OPMA 2C82A 1U9JA 4CT5A 2I22A 3PX7A 3JWPA 3MYRA 1Z0SA 4O1IA 1XNRB 2A35A 4E12A 1F4LA 2QAIA 4KO2S 1ZRHA 4MIEA 4WZBA 1E7QA 3OZUA 1HDGO 3DZCA 3FI0A 3H2JA 3RC7A 4P36A 1XD9A 4UAJA 3REQB 1T1IA 2HRCA 3R5JA 4ILKA 1KE1A 4W5OA 4LW8A 3GLGB 1KAOA 5FBZA 1VMIA 3RUPA 2XDYA 4WV3A 1B15A 2ZIAA 3RIYA 4R9SA 2GARA 2PPLA 3NBUA 4G5YA 5KWSA 5KNBD 4WFQA 4OAPA 5HP4A 3IAS6 4I3HA 3IMEA 4UREA 4X92A 1N6OA 5H3CA 5HQ3B 1F12A 1E7WA 3JQFC 4FNMA 5IC5A 4C43A 2FN3A 1FPQA 3DM5A 3P52A 4BLQA 4DBLC 5AW1A 1T8UA 3NLLA 1Q0ZA 2AX4A 1XHEA 4NVRA 2O48X 3H6HA 3MK31 1Q44A 4PG6A 4QOIA 5CDGA 5LZ4A 2F43B 4DV4B 2OGUA 4ZZ0A 1ODSA 2IIPA 3EGEA 2UUCB 1Z8NA 4DG8A 4QDJA 1V5GA 3OLCX 1JKJB 3WGIA 2XF8A 3GBSA 4DJ5X 2GZDA 4I50A 3KV3O 5CX1B 2IH5A 3AP3A 4DDHA 3F4LA 5E1OA 3FVWA 3LKZA 1CUJA 1QWOA 4TLAA 3ZTWA 4B4KA 1X7GA 4RD4A 3WHLA 1ITZA 1SBHA 2BEUB 1KY4A 2CMKA 3ZDQA 2A9OA 3FH0A 4FDLA 4HZGA 3IXLA 3M83A 5EHZA 3ZNOA 1TOAA 1L7AA 5EE5B 1YU9A 1BXRA 3T1YB 4F2GA 2C8LA 1WO8A 5AHKA 3ZE1B 2QT1A 5D01A 1GU7A 3VDNB 2OD9A 1KAHA 2B0CA 2PQ6A 3R74A 1P74A 4RTNA 1Y1KE 3M2PA 4AJKA 1HNXB 4BKMA 1XZFA 3IAM1 1CXZA 1QP7A 5CCXA 4Q4HA 4PZYA 5F2NA 2MSNA 4GEKA 4G3XA 2A5JA 2H2DA 5JWHA 5B2EA 2WBLC 1UMDA 1JE0A 1TA9A 3KFVA 4PGAA 1QWSA 3SHQA 4AJLA 4E88A 4O08A 1RYEA 2XRMA 4D7AA 1P9OA 3BZBA 1MAHA 3ETHA 4XA8A 2ZB7A 4U9UA 1IWOA 1FX0B 1TGYA 4J9VA 3QV1A 3T9FA 5CT8A 3STYA 4FDTA 3QJYA 4LN1A 4NONA 4F2HA 3C74A 1XCGB 1EP9A 4L85A 3L93A 5T6MA 1RD4A 2FX2A 3EDCA 1X0VA 3B9PA 3WMFA 3LCMA 5CK4A 3K2QA 3H2HA 4OL0A 2E49A 5DWVA 2JKYA 2GPWA 4I99A 3N74A 1F2VA 2JATA 1J42A 3FPCA 5ER9A 1RAFA 4L9SA 4MK4A 2HIGA 1NDUA 3TLCA 4LS3A 1O96B 1U1DA 5KNLA 2IHVA 1YV9A 2ZBRA 3HXKA 2GJ8A 3KR0A 5IM5A 2C3PA 2DR3A 5HBGA 4XQGA 1Z0DA 2XT6A 2BMWA 5C8YA 4NAVA 5FV4A 4MO2A 1CUIA 1AA9A 1RLOA 4HH0A 1X1DA 1V8ZA 2XNJA 1V35A 4JQZA 3TTXA 4Y2QA 2XWQA 2HBYA 2OV3A 3I34X 5KJEA 1A50B 1UZNA 3AEXA 3ND5A 4G0YA 1DL5A 3MC1A 4OHZA 3WOHA 1OLUA 4BTEA 3CPJB 2ZBVA 3PXCX 3K8ZA 4EMUA 3N0RA 3R3JA 4YT2A 4TYQA 4R1OA 1IU9A 2V7WA 1TKCA 4M89A 4FE7A 4C4TA 3WLRA 2GILA 1EUCB 3B48A 4HNSA 4QTUB 4DXHA 1UOQA 2I2AA 2JGAA 3UG7A 4EG4A 1WHTB 1WR8A 4FR0A 2VJMA 2ZWIA 1ZSYA 3E70C 1N2IA 4TWIA 1KF0A 5TGZA 5AYVA 4BO2A 5IXYA 2PX3A 5ERXA 2AN9A 1TAGA 3P4UA 2ST1A 4DYVA 2B30A 2HIMA 4CODB 3ONVA 3RPEA 4TS4A 5A1JA 4EQ6B 1GD1O 5AK3A 3H4MA 3PCTA 3H3JA 3ELDA 1B6GA 3D4IA 1Q1GA 2E6UX 1L5ZA 4GRIA 2PUVA 4K7JA 3SQMA 1A7UA 2GCGA 4HXYA 1A9QA 3M6MD 5H1YA 3ZGYA 4URVR 3L4EA 4C2UA 3TIXB 3S1AA 1F4VA 4DSNA 1HYGA 4AYXA 4R8KA 1GA6A 4MZDA 3ZGOA 1C4OA 4YLEA 2VUIB 2UAGA 1XE3A 4TYPA 2FRDC 4K9OA 4D79A 2OUKA 2ZWOA 2BBSA 1IHOA 1U1FA 2HBQA 1KVSA 3AHCA 3KD3A 4UM7A 4JC4A 1ZBDA 4OXKA 3LXXA 1I7NA 1LTQA 3WC4A 4ZD6A 4E5VA 1QFMA 3DDCA 1XF9A 3NHYA 1C0KA 2O06A 1R88A 1TA0A 1BU8A 3QPWA 4WNIA 3I2JA 4HB3A 5DCYA 2ZZMA 1SO8A 1WXEA 2QX9A 3OKAA 5FULA 3U39A 2YN2A 1YS2X 3WGOA 1AQYA 4KV9A 1U04A 1SKUA 2GZSA 3BGIA 4Q7MB 3I64A 3D31A 1I2BA 3U16A 1UDXA 3RAJA 1RYMA 4WN3A 4EY7A 1TO6A 1GGJA 3RC2A 1C7EA 3TN7A 5KUTA 2D2IA 1I94B 1KAGA 3ORFA 1TVKB 4GC5A 1FP1D 1N0HA 2DY0A 2PHZA 2VNJA 2JJ2D 2X1LA 4QXQA 4BP8A 5BMVA 2ZJ8A 1E7RA 3DO8A 3FBGA 1Q1QA 1X2EA 2ZQYA 4ACBA 1V3QE 5IU6A 2G82A 4JU8A 1JF8A 1QQBA 3GLSA 3GT7A 3TPFA 5B30A 2LIPA 3SAJA 1OV4A 1Z5VA 3D6VA 3EZYA 2JIBA 4GI3A 2B1RA 1A9RA 4JD5A 1DBPA 4G41A 3OQJA 3WQSB 3R0QA 5K6RA 3QLTA 4ENQA 2FP3A 3IQHX 3QOYA 1Z22A 2VC2B 5GP1A 3RJZA 3NIBA 3I53A 4IRMA 3LY8A 5F2EA 1JU4A 2MYUA 1JEYB 1U0FA 2B8JA 4IX1A 4XIGS 4UUMA 2P2YA 3RAGA 2R85A 4QJ3A 3D2CA 1DQSA 3KLPX 4XIIA 2O0HA 4KR0A 2PWAA 3HU1A 3MJHA 3URMA 1P5ZB 1I3LA 1YCGA 2O7RA 3AVUA 2W8BB 4GX0A 1T8SA 2XQIA 3PVCA 4R3UC 3SJCA 1CU1A 5EHNA 4A1FA 1VHQA 2O3UA 2X4DA 3BTUA 3PGA1 1ODCA 2BI8A 3TW4A 1VYHA 4M2LA 3KOWA 1BX3A 2PL5A 4A2PA 4CMIA 5DBIA 1AKVA 3DGEC 3O03A 1Z18A 3SIWA 2BMVA 4AS3A 4HDMB 1BDIA 4P35A 1L4FA 1TF5A 1QTQA 1PK7A 3CRQA 3TVDA 4BVJA 1Z4QA 2WVAA 4N0MA 5J5AA 3PRKE 3B8HA 3B52X 4A8TA 1MJNA 2R6ZA 3GRZA 5KEIA 4I5EA 1DRWA 1ZITA 3JYLA 5I7UA 5FJJA 5IJ9A 2HCFA 4R9UC 3K5WA 3GXOA 4JUIA 4KQ2A 5HK8A 4IJVA 2UUBB 2E5FA 1RKXA 2AG0A 5F1YA 1J9EA 3RUCA 1FMLA 2AUNA 3QWAA 4WQMA 4LDPA 3HUFA 4QHSA 4CJXA 5B1EA 5BYAA 1KJNA 3RQIA 1T2EA 3AJ9A 4OQEA 4YLYA 2GTPA 2R8YA 1I0ZA 1Z7BA 3NTLA 2NU7A 2QR5A 1EX6A 2FHPA 2QP4A 4CKXA 1Z33A 3TBKA 1IB0A 1XQ1A 1Z6ZA 2I3DA 2JD0A 2C2MA 2XMZA 1Q11A 3N76A 4MNTA 3ZYCA 1HPLA 2J9FA 3CG4A 2YWDA 1DFHA 1M7HA 4Q3BA 4TXMA 3TIGA 5E8RA 5BRAA 2WPNA 3CINA 4DLVA 1RFLA 2H1LA 3DWFA 4YMWA 3HCWA 5L4LA 4WKCA 4G9BA 1PEDA 4OLJA 2O8EA 4PPNA 1Z62A 3CHYA 2DQYA 3QFFA 4NE9A 4TTPA 5DLDA 1E2EA 4BO5A 2ISQA 2FUNB 4E15A 4UPVA 3QE9Y 4RF2A 3LPCA 1RKBA 2RI6A 3LTEA 5KZMB 1IK4A 3LZ6A 4XUEA 2GVNA 3E7FA 3IEXA 3OCVA 1N2ZA 3PFBA 5K3FB 3UFXA 3FNFA 4CLRB 4UTPA 1Z0JA 3HUDA 3CE9A 1CNMA 4J75A 1AK2A 5KMGB 3HKEA 1R7RA 3D6TB 1XVIA 2ASVA 1YQQA 3D8TA 1U11A 3I01A 4GNRA 4JWTA 4II2A 4EJSA 5JZSA 1FE8A 2FZWA 3UKDA 4Z6KA 1XQ6A 1YO6A 1RQNA 3FLBA 2KHZA 3BMOB 3J81k 2O8FA 2MT9A 1TYEB 5ELMA 2HQ1A 4XUGB 2ATIA 1D7AA 4RD2A 4OGFA 3TOSA 1L7DA 1ORWA 4QWWA 2C96A 2MHCA 1AUOA 4W1PA 4UVGA 3PFIA 1WLYA 1MO3A 4DLNA 4LFAB 3S2IA 3J80A 3A27A 5IAGA 2J8ZA 4ZP1A 5DNUA 3K6SA 1GA1A 1WMEA 4IFBA 4KQCA 1RZVA 2BJHA 1UUFA 2REQB 3ECSA 2FE1A 3IUQA 4IY1A 5H9VA 3ZCTA 2JCGA 3PGXA 2BLNA 3C8MA 3RS9A 1C1XA 3AMVA 1DMSA 4JLDA 3ZN2A 4PWYA 4ACAA 3WS7A 4CI0B 1FY2A 4D9FA 5JRJA 3KQYA 5FO1A 3CQ9A 2JAOA 1W4ZA 1INLA 4O0MA 4NG4A 4R8VA 3FYUA 4Y98A 5DGTA 1N2BA 5A05A 4NZPA 2I71A 1J8DA 4FOSA 2A9QA 3TTWA 1BAPA 1P31A 4PCLA 1PR4A 1A4RA 1J2RA 3TOXA 4P5EA 3H1BA 3S55A 4K2HA 4Y1RB 1QOZA 3I0NA 1PD0A 2DM6A 3S2FA 1X1CA 2F43A 1SVIA 2WWHA 3BHIA 2GN9A 2Q7DA 2I1LA 4IX9A 2IOQA 2XMBA 4R41A 3T3IA 1X9HA 4JQYA 4WIAA 2X58A 3EUAA 4JIMA 4F1WA 1K3TA 3UF0A 3O1HB 3ZHYA 1EWKA 1DXYA 2BMFA 1WZUA 3FB1A 2Z2KA 2DOKA 3RFTA 4B3RB 2XITA 1C7ZA 5L51A 4ZDJA 2XCSB 1ECCA 4JBWA 4BNXA 2WJHA 4IDDA 1FYVA 4L27A 4MVJD 5JVDF 3C6KA 3P9YA 2E87A 5EOVA 1G6Q1 2HDOA 1CEYA 3FDJA 2H8GA 5ALNA 1U7XA 4ATNA 2D6FA 2QTCA 4UDYX 1NHWA 1SXHA 2WFMA 2EOAA 2HTFA 2YC4C 1GLVA 2YH2A 1SKMA 1Y5LA 4TMZA 1YACA 4TUYF 3WYFA 2Z04A 2G1KA 3AF0A 4UMEA 4Q3NA 3UNXA 2Q5FA 3RTBA 3DZDA 5JAMA 4Y1FA 1HFJA 5GM2A 5LC1A 2RC6A 2MJLA 3NIDB 4WA7A 2QVLA 4B6GA 3THRA 4K9DA 4KYIB 3JRNA 4BX2A 1HRDA 2J4CA 5FA5A 4DMRA 2O2XA 2XA1A 1WNFA 3CZ9A 4G4SO 2ZIXB 3GRCA 3PTLA 4UZEA 4K6CA 4M7WA 4C88A 2AMJA 3AXTA 4MWBA 5FX2A 2AK3A 3ESDA 3RF6A 2C2GA 2C4VA 3FSEA 2RSLA 2XDAA 1HM5A 3LPDA 1QQTA 3SU8A 3K9NA 4AWBA 4BEBA 1DAHA 4ECAA 1WF3A 2YS6A 1R9JA 4F06A 8AT1A 721PA 4RVFA 5A62A 2ZT8A 2XXBA 5H4GA 1KXJA 2QRNA 4NXMB 1EAYA 2D7CA 4LJ9A 2ZUUA 2P8JA 2CE2X 4MGZR 2I7CA 3B3JA 1M8GA 3GGJA 4PS0A 5KC8A 2F8TA 3FM9A 2BFCA 3QW2A 3DR3A 1BROA 4QQNA 1Q91A 3E22B 3CXUA 1KYYA 3BB3A 1NR1A 1UC8A 2XCQA 1AMNA 1B0AA 2OAGA 3C7TA 2VOJA 1P39A 3EG5A 2JVKA 4FGKA 3NM4A 1XGKA 5CD9A 2FWMX 1PJQA 3OMLA 4KB5A 1J5XA 4TWZA 3SQWA 4HMPA 1XV5A 3G02A 1GFWA 2P5SA 1R74A 2BTOA 1EBFA 2QUIA 2RAUA 1FTNA 1N5OX 2ZM6B 3WGGA 2O54A 1UBJS 2O2DA 2W2OA 5BT9A 4Q9KA 4B6FA 3EUFA 5FOUA 5DI3A 3RT9A 4Y9SA 2DR2A 4B3JA 1KH1A 5C1BA 2PTGA 3H2GA 4JMLA 3B1VA 2N9UA 3UJ8A 2P2SA 1GV1A 4EGCB 1MXFA 1Z0AA 4P3NA 2OHHA 1LW7A 4CT0A 4JXXA 2QU7A 4GZ3A 1U0GA 4IMPA 4HXEB 4OMUA 3IA7A 4F3YA 1LJUA 4IDCA 4TTRA 2E89A 3EWSA 3M4JA 5AXCA 2V1XA 4QXOA 5KU7A 2BWJA 4M0DA 1G17A 2HHJA 4LXUA 4AD8A 2JPDA 2G9NA 3FHOA 3WK7A 4TZ0A 4YYZA 1M6WA 1U5BA 4RS4A 3CRVA 5H0IA 2VG8A 3S7TA 3WICA 1KYZA 3FCAA 3AF6A 2GYUA 1XKTA 2X77A 5A6VA 1KMHA 4BVAA 5EESA 3TX2A 4NQZA 1FFBA 4D26A 1HMPA 3K0KA 4IIVA 2WKPA 4D02A 2WJJA 5A4AA 1MEEA 5ECGC 3RJTA 2ONYA 1IYZA 3GWZA 4G0VA 5CLHA 4A2QA 3E81A 3JQ9C 3VBEA 2YMLA 1SOWA 4MXDA 3GDWA 4BMXA 3PNPA 2KWIA 1A4IA 2XY4A 3QPBA 5ALZA 5HCIA 4ZIRA 1ISFA 3KKZA 3O73A 4BV3A 3T1HB 2HWKA 5CT6A 4KPEC 1QZZA 2NSJA 3BMNB 4A82A 3CKKA 3JD0A 3O83A 2IU3A 4QYSA 5G1NA 3VVBA 1T1GA 3WWZA 4QDTA 5AUOB 2RBEA 2ZRQA 1E2LA 1SKQA 4P7FA 4XGKA 3WMGA 1A2QA 2DTXA 4FMBB 2G9RA 3UMRA 4AX4A 2V9PA 4B83A 1XSEA 1MA0A 1VE1A 2BFDA 4FFPA 4R01A 4URUR 4ZFNA 1MO2A 3LUAA 2EKLA 1N32B 3ETGA 4N5IX 4OXIA 3PDUA 4OJTA 3H9QA 3FPGA 3ZLUA 4XWGA 2QQ5A 1YA4A 5KKNB 4OOEA 1CY6A 1QHGA 2EV9A 2ZM5A 2ZBPA 4IDPA 5TSDA 4L74A 4BNZA 1LH0A 3LUCA 1U0RA 3BFJA 1F2UB 3EAFA 4JZYA 2YRFA 4W82A 3WYAA 4PG8A 5LPNA 2PIDA 1LDMA 2CE7A 1FRZA 4YNBA 2VRCA 5LIRA 1KYIA 5BNWA 2NAFA 4FTWA 2IZ1A 3TQRA 2WQ7A 1OPRA 1MW8X 3SJBA 2P62A 1Y3CE 2GPSA 2HH9A 4CV1A 3IO5A 4EI9A 2B37A 4GOMD 5EUMA 4KVAA 2I55A 4KPFC 6ADHA 5AW3A 3HUEA 4ETWA 4JEHA 5FNVF 4KXUA 2AVDA 2I4RA 2J07A 4AFNA 1U1GA 2G6BA 3IURA 1XAHA 3Q1KA 5F2KA 4KYUA 4ZICA 4P5DA 1L8XA 1V48A 1TYBE 4AMYA 4EGSA 4CF7A 4TPKA 3RV3A 1MC4A 2JI8A 4HLQB 4YK7A 4CR7A 3Q7QA 2QEQA 4NPCA 4D3XA 1DBVO 3PC4A 4CFZA 3TRKA 1M2WA 3K94A 4LXIA 1PS8A 4UVHA 5KSWB 2BKXA 1XOIA 1NRJB 10MHA 5JJKA 1SQ0A 2A78A 1GCIA 4QA9A 2RONA 1K0UA 4MH0R 3WJ1A 1YI0A 2DRIA 1FYFA 2FEOA 3N6RA 3UMSA 1L5VA 1M2VB 3I6IA 2ZRFA 3DT8A 1GYQA 3NQ41 1TLFA 5E6UB 5C8DA 3F49S 6YASA 3K9GA 3U7GA 3OCUA 3UATA 3VTZA 1M54A 3IBSA 1JQEA 3DOUA 1SURA 4ESHA 1PT7A 4MS3A 5ALQA 1XVTA 2J46A 1YZ3A 1Z3IX 2N42A 4JVMA 1R4ZA 1YU6A 1LLDA 2UDPA 3EIXA 3KKNA 1GPUA 3RUAA 4F71A 2DEUA 1PT6A 3KKPA 2YYAA 1O9HA 4F91B 5BW6B 4GZLA 3DVRX 3NT5A 4LOAA 4UC0A 3ZE6A 3C0KA 1ZH2A 3MWLA 1CLUA 3QE0A 4X24A 1D6SA 3RU2A 2FOLA 3WLLA 5MN4A 2WIDA 4JUAA 4UASA 2ID9A 3NBKA 3GFRA 5EZYA 1VKJA 4YUVA 4I3FA 1CRWG 3CNLA 2B4KA 2XZDA 4K9PA 1MFZA 1C3LA 1PV2A 3HBLA 4YRLA 4DZTA 2IYUA 1JR6A 2NACA 1E2KA 2NZXA 1DVRA 4QG7A 3DDNA 4RTMA 2HF9A 3AESA 4W1RA 4V0RA 2Y68A 4YTEA 2OEPA 3FMOB 5IW8A 4CMKA 1EXVA 3ODPA 5C1OA 4CLRA 3W7VA 3EZ7A 3E4DA 1GKUB 1RVV1 1XZJA 3MJDA 4DWVA 3EMKA 3OUTA 2FQYA 3O9MA 4HX2A 4BU0A 4TKVB 2XT0A 4QTTB 4EPVA 2FPLA 4Y6GB 1OI7A 4OQPA 1Z6AA 3KEQA 3FDZA 4ZVTA 2WWFA 5JUWA 1MAUA 1Y81A 1Y1TA 4KUHA 1IVSA 3GJXC 1XL0A 1NDQA 3CZPA 3D3WB 3HGMA 2O23A 4KRGA 1YKSA 3FNHA 2G40A 1I32A 2GHRA 1X7YB 1GNLA 3AUAA 2IU0A 4C7BA 3FTDA 1FEZA 3W9SA 5DNCA 1APBA 4RF4A 3KKMA 2HIAA 3WKBA 4YAIA 3HY6A 1U28C 2BGIA 4HSEA 3T7JA 3P0IA 3QEKA 1MJHA 2O2HA 3K6KA 3U7IA 4AY5A 1H8HD 1SG6A 2GXQA 1YQDA 4OF4A 1Z8FA 4JBLA 5CCDA 2FVYA 5C32A 1IY0A 2NO6A 2DHQA 2P7IA 3D1VA 1TCBA 4E7OA 3M4NA 4B2LA 4B81A 2X2FA 1Z26A 4RMNA 1F3OA 1MEOA 2H4XA 3NHLA 4FQ7A 4Q1CA 3N6XA 1DTWA 2IYXA 2CV1A 5A5GA 1ISRA 3O82A 2BAGA 4QDOA 1I2DA 2X2PA 3FHCB 2WIFA 1HE2A 1H6AA 1SJ9A 2XNCA 4HR7A 4WVFA 3OZVA 5F73A 3FAKA 4F96A 1PJBA 4HPJB 1A9OA 2XQKA 2YWGA 1L9KA 1HTWA 3NGXA 4HDRB 3UYKA 1TEXA 1OYWA 3ZZTA 2P90A 2XCUA 5F52A 2FFRA 4NXNB 1SD5A 2EC5A 2NVOA 3QZUA 2DG2A 3I9V1 4Q34A 1GZDA 1J24A 3JQBC 3H11A 3K4PA 4NS1A 2G25A 4EMSA 3HY4A 3UTCA 3U48A 6GPBA 1Y5MA 3I9OA 1N6LA 2JVIA 3S8EA 5D3MB 1U6JA 1E1RD 3MHTA 1XLTA 4TXLA 5CG2A 4RU1A 1PLKA 2HXYA 5LXTA 1JQJC 2I80A 3VJRA 3N5KA 5F7ZA 3O0DA 2PUFA 1QKJA 4Y2XA 2HJVA 2I7TA 4RE6A 3LYUA 1JFLA 5AVRA 2UYYA 3N7UA 2XMPA 2CXQA 1WX1A 4U7WA 2QN7A 3BWXA 2XNHA 3V7NA 3OA2A 3Q88A 4DLXA 1W1WA 4KRXA 4D9HA 4YHHB 3SJ7A 1DU4A 2GSDA 3P0EA 1N6KA 3UPUA 4EJFA 1E3JA 1CUFA 2VAXA 1N0WA 2VHYA 4JJAA 4EENA 3FOFC 1FC0A 3HHEA 3HDHA 2JHGA 1GRRA 1C7FA 4BUCA 5CM2Z 1DWPA 4F46A 2UVPA 3QPCA 1EUYA 3N0WA 3KAQA 2G5TA 3LT1A 1DGQA 3H4VA 2BM8A 1HV8A 4BQFA 5HKBA 3DTNA 4R54A 5D85A 1IHXA 4JUCA 4BNDB 5DT2A 3RSGA 3G6KA 4QARA 3OHSX 3WNDA 2EZ4A 1OLSA 1VZ3A 3OJFA 1BTOA 1Y80A 4WDQA 3A1NA 4YMTA 3HPQA 3KIPA 4LDNA 1VJCA 4RV9A 1ZJ5A 1OLXB 2HA0A 1R00A 2V9CA 3IVMA 4A91A 9ATCA 4IGKA 2IQIA 2IU6A 2XZOA 1XIVA 3B7GA 1TCVA 1Q19A 4DT1B 1DJLA 2BIFA 1U3FA 2C5LA 3DOOA 4HFMA 1NNEA 4S1OA 1OGJA 4MR9B 3DTVB 3SVTA 4R2KA 3E48A 4YMVA 1YR1A 2HOQA 5KYWB 3WJ7A 1QGED 2JGLA 2OO7A 4K6GA 4UZSA 5HRCA 2TSYB 1ZEJA 2UXBB 3OT4A 4RFVA 2O1XA 2GEJA 3W6ZA 1T0PA 4GF5A 2GXAA 1UJBA 1WSAA 2C03A 4HDSB 1MW9X 3WLTA 1AB6A 2OORC 3N6VA 1MABB 4UNIA 3TIVA 4N7BA 4ZRMA 4NX2A 2VNAA 2SKDA 4L5JA 4PZ9A 2AWOA 3M33A 4FFWA 4LWPA 4H15A 1E6UA 4JZKA 4RSRA 1N9KA 2W2VA 3B6KA 4EHNA 3AI2A 3RT1A 4GGOA 4ENUA 1QG4A 3LP5A 3L0OA 3TRDA 1MOZA 4ZEOA 4AJ1A 2W93A 1NXXA 4NEGA 5ALEA 4CL3A 2FI1A 3HACA 4ITUA 3FCEA 3LHDA 5FH9A 1MRZA 1K9VF 4O29A 5FAKA 4AYWA 5AXBA 1XAGA 1A04A 5DH9A 4KFRA 4EY6A 2PL1A 1JA1A 3NIWA 1IUPA 1ORVA 2WE7A 3QF4B 3W77A 4XQCA 4OH1A 1LQ2A 2F1RA 3Q98A 2JCSA 4YDHB 4FZ5A 3WL6A 1QF6A 5CITA 1DCMA 5AM2A 3MGGA 1ZCBA 2MTBA 3QGMA 2REQA 5HQTA 1SA0B 4FFOA 4MRNA 1T5IA 2YIMA 2N3ZA 1GKIA 1GZUA 2WVHA 1RHRA 5AK4A 2P0YA 1RAAA 4BAGA 4TZ6A 1ZBQA 3H3FA 1RXYA 3HFGA 4CE6A 3ZVMA 2YWJA 2JB9A 4WFIA 3O3NB 3ZWNA 4BJ1A 4MDEA 1A97A 2YV4A 3ESQA 5TF4A 1RQ7A 4S05A 5KHLB 3I42A 4G86A 3TLBA 2VXBA 3SJAA 3PPYA 3DEFA 1PJ3A 1W47A 2R6CA 2WWYA 1T9GR 1R0SA 3CLRD 1ODFA 2A7XA 2KB0A 3PXGA 2H0AA 3ENNA 1K3UB 1ZW1A 5BV0A 1YGPA 4UW9A 2VFAA 3R0VA 4YASA 3AKZA 2QM3A 2WNIA 5HJ7A 2J3QA 1N8TA 4MULA 4NDAA 3IEMA 4G37A 3HZHA 1LSSA 1DV1A 4JQOA 4MW0A 5BSTA 2I9KA 4BTLA 4B6EA 1L7VC 1X80A 1I1HA 1XK7A 3A31A 4RIGA 5JAPA 5JYEA 1PG0A 4J1NA 4WUTA 4XD7A 1YDFA 4R71A 4HAOA 3C7DB 4U6SA 4W5WA 3JQGA 3QFTA 1MQAA 2EIHA 4R7GA 3VPFA 1KP9A 3ASUA 1V7PC 1WCV1 4KIFA 5B2FA 4L0DA 5JH7A 4GBGA 2A1UB 1XA0A 2DSNA 2WF8A 1KK0A 3LCCA 4OMFG 2Y9MB 1FMCA 5L7TA 1G55A 3LRTA 4Z4GA 3PENA 1U0LA 4PU0A 1KP3A 1Y9JA 1Z2DA 3GCWA 4Z0NA 3UH0A 2L2QA 1QV9A 2Y0BA 2YZKA 2Y27A 2C0QA 4MWEA 4BJHB 3NW9A 4E6PA 5KOIA 4I55B 4LJAA 2EW1A 2ZIEA 3QFRA 1B6RA 4MQEA 4GBMA 2HRRA 4BAUA 5IAAA 4MWDA 1DMRA 1N7JA 1G5IA 4D9IA 1T3LA 1K2VN 1L7MA 5F4BA 3AETA 4IDHA 5CT4A 4YC7A 2UUAB 5EEGA 5J58A 1RSZA 4FDVA 4JT4A 1G9SA 4H6PA 5D7BA 3TLAA 4W9MC 4KUEA 1H93A 1NT2A 4P2GA 3UWKA 3GZ4A 4IJ5A 2FK8A 3DAFA 2WA1A 4G26A 4HD8A 3E7DA 3K72B 4DAEA 4YAKA 5KTKA 1TA4A 4BP1A 1Y3DE 1WPRA 3EIEA 1ULBA 4P81A 4Y9TA 5KTNA 5HIMA 3BT7A 3QBDA 4DABA 2WYUA 1X1TA 1IXSB 2C2BA 4XUCA 1CKEA 2HUPA 3G23A 2FDRA 4TN1A 3N8KA 5ETJA 1NUTA 4FBLA 2ZS7A 3DDZX 4XGNA 2JI9A 1G8YA 4IUYA 2XKJE 4MWSA 1NBIA 4PFSA 4YRNA 4MYHA 2EARA 2CCGA 1JXAA 4EL0A 1C8KA 3C70A 4Y9RA 2X42A 4LWOA 4NH0A 1D1SA 1THZA 3MGKA 4JVNA 3QG1A 2DLNA 1J2YA 2B5VA 4XAQA 2GZRA 4HRVA 1ZN8A 3CBGA 3QI2A 2RGUA 1FJGB 1E5TA 2G9UA 4RXMA 5GIPE 3IMKA 2BRUC 3TEMA 1ISSA 3EY4A 3ECCA 4NU6A 2GVDC 3T3HA 2V97A 1EJ0A 4OJMX 4ZU3A 3L8GA 3MS4A 1RZUA 1OWNA 5AP9A 1J09A 4IP0A 1E6MA 1T2UA 1A5AB 2F3TA 3GG9A 3SHVA 1RE0A 4EUKA 3S81A 2PUBA 1DAPA 3WGYA 3PRHA 5D5QA 3ZVLA 2GF9A 4FZ3A 2RCYA 4U2FA 1BOFA 2IZOA 4C6TA 2JANA 5DEOA 3L0ZA 4LZWA 3BA1A 1FS4A 5KSYA 2E5LB 1DCKA 3I5YA 1FU7A 4GXRA 1MH1A 4H7EA 1QB7A 1N8NA 2QZPA 3BA6A 4PAWA 4ZA2A 1FFGA 5EZSA 5I8WA 3T7RA 4AWXA 1GTJ1 2D1TA 3COWA 1M34B 3KYDA 2Z43A 3OZDA 1GDDA 4G84A 4OHWA 4Q6WA 4BFXA 5JATA 1TJYA 5FOSA 4RDXA 1SXJD 3H1AA 5AI9A 5EP1A 3ACDA 3F0TA 4PF1A 5DLYA 2PMEA 5ADVA 2VQEB 4JLVA 1O6ZA 2PKXA 4MVJF 4YV0A 3W5UA 3FCCA 1QYVA 3RSSA 1U0TA 1ZH8A 1ULZA 3I2YX 2RK3A 2QJFA 3FNQA 1J0EA 1XVVA 3SYNA 3WVNA 2XB4A 4ZVLA 1N33B 4J7XA 1EH5A 4LGCA 2FUG6 1MN6A 4K1XA 5FI1B 2WILA 2GTHA 1REQA 3RYIB 1EZZA 3N2GA 3EQ7A 2DBQA 1H4QA 3I6ZA 3CG0A 3U4CA 3BRCA 3PL5A 1EB8A 2GM4A 4M0MA 2XV1A 3EFOA 5EFOA 2PRZA 4JP2A 3IDFA 1NPTO 3QNMA 1K08A 4FJ2A 1JVBA 4FW8A 4LZNA 5KVVA 3Q9LA 1O03A 5JQGA 1LPBB 3DW3X 2DX7A 1IWBB 1ID8A 4ZGBA 4MSUA 1BEUB 3PU6A 3GF4A 4FI3F 1JN0A 2QL5A 2ZUVA 1D9ZA 3A58B 4JJ7A 2GEKA 4MWTA 2EZTA 4V0ME 1LI5A 5HIJA 3FYSA 1QIJA 1ZVMA 4WGFA 3Q8MA 3TE7A 1Y3HA 1OZ0A 2HXSA 2VP9A 2W2MA 4IPTA 5KI6A 3O90A 3LAWA 2O1EA 4M38A 5SZHB 2VDKB 3K09C 1WDWB 4UUAA 4EPYA 3GMSA 4CQNA 3NAQA 1IN1A 3FUCA 1DDGA 2GEUA