1YTLA

Crystal structure of acetyl-coa decarboxylase/synthase complex epsilon subunit 2
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
158
structure length
158
Chain Sequence
b'KMATLLEKGKPVANMIKKAKRPLLIVGPDMTDEMFERVKKFVEKDITVVATGSAITRFIDAGLGEKVNYAVLHELTQFLLDPDWKGFDGQGNYDLVLMLGSIYYHGSQMLAAIKNFAPHIRALAIDRYYHPNADMSFGNLWKKEEDYLKLLDEILAEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetyl-CoA decarboxylase/synthase complex epsilon subunit 2
molecule tags Structural genomics, unknown function
source organism Archaeoglobus fulgidus
publication title Crystal Structure of Acetyl-CoA decarboxylase/synthase complex epsilon subunit 2 from Archaeoglobus fulgidus
rcsb
total genus 56
structure length 158
sequence length 158
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02552 CO_dh CO dehydrogenase beta subunit/acetyl-CoA synthase epsilon subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 1ytlA00
2Q29A 4FVTA 4K9NA 4JT8A 3U3DA 4Y6OA 3PDHA 4D5GA 3F6BX 3FSJX 1QPBA 3JWPA 1J8FA 1S7GA 1YTLA 4UU7A 4BV3A 4K9LA 2VBGA 1SZDA 2OD9A 2QQFA 2V3WA 1PNOA 3F6EX 1OZGA 3CLRD 4UU8A 1OZFA 2X7JA 3IAEA 4Y6QA 3RIYA 4V1CB 1BFDA 3OE1A 4GM1A 1OZHA 1MA3A 1N0HA 1S5PA 1T9DA 4FZ3A 4BUZA 1PVDA 4RMIA 4BV2A 4F4UA 4KPUA 1HZZC 2Q27A 4QQ8A 2JIBA 2Q28A 4HD8A 4J16C 4UTNA 5DEIA 2H2IA 2Q5LA 4V1CI 4KXQA 1V5GA 2Q5QA 2OO5C 2H2GA 3ZGVA 5BWNA 5D7NA 2IHTA 4L2IA 1T9CA 2EZTA 2AG1A 4ZP1A 2UZ1B 5IMSA 4F56A 1Q14A 5MGNA 4K9OA 4X3OA 5EJ8A 2VK4A 1YHYA 4V1CA 1V5FA 4I5IA 1U31A 4IAOA 4RJJA 4TWJA 2VBFA 4C78A 4KGDA 5EJ5A 1PNQA 5FEMA 5BWOA 1EFPA 2H4HA 3CLUD 1YNOA 1PO7A 4UUAA 2FR8C 3JR3A 3RIGA 5EJ6A 2EZ8A 4RMJA 4RMHA 1MCZA 5AHKA 3ZGOA 1Z8NA 4HDAA 2H2HA 2VBIA 4GG1A 4BVGA 2QQGA 3CLSD 4JU9A 3IAFA 4BVFA 4D5EA 2HJHA 4UTRA 5EJ7A 2AG0A 2WVHA 2H4JA 1D4OA 2Q5OA 4GM4A 4JUCA 1V5EA 2JI7A 1POWA 2A1UA 1UPBA 1O96B 1YI1A 2JLCA 1M2KA 2JLAA 1YBHA 4G1CA 4IF6A 1M2JA 4MQ5A 4Y6LA 2NYRA 1Q1AA 4Q9DA 1U2GC 4BVEA 4GP9A 4JUAA 4ZZIA 2W93A 1UPCA 3ZG6A 1U2DC 3GLRA 4JUFA 4BN5A 3EA4A 4K9KA 3U31A 1XLTC 5DGTA 2FWNA 4GM0A 4K9MA 2FRDC 4BN4A 4COKA 3PKJA 3GLTA 5K2OA 1M2NA 2IHVA 4UTZA 2EZUA 2PGOA 4GPEA 1DJLA 5EJ9A 4JUBA 5MFZA 4K9QA 4FEEA 4K9PA 2NXWA 1UPAA 4JSRA 2H2FA 4MPRA 2FSVC 2JI9A 3D7KA 3K35A 1OVMA 2PANA 4FEGA 4IG9A 3EY9A 1YHZA 3FZNA 4UUBA 5EJMA 2OD2A 4RJIA 2H4FA 2OD7A 4TWIA 2UZ1A 4MPJA 5BWLA 1Y9DA 2H2DA 3GLUA 2JI8A 5MFPA 3CF4G 4RMGA 4QELA 2C31A 1YC5A 2BRUC 4R8MA 1E3TA 1PTJC 1YI0A 1ICIA 3HWX1 3PKIA 1NM5C 5K6TA 1POXA 1ZPDA 3LQ1A 1EFVA 1Q17A 2VJYA 2WVAA 4J1TC 3GLSA 1PT9A 4L3OA 1M2HA 5DGDA 5K3SA 2EZ9A 2FN3A 1PI3A 3D81A 4X3PA 1JSCA 1O97D 1U28C 3FLMA 3D4BA 2VK1A 4C7BA 2JI6A 3CLTD 4JUDX 4MPPA 2WVGA 5EJAA 1PYDA 1SZCA 4BVBA 5K6RA 3E9YA 2B4YA 2PGNA 1T9BA 4MZXA 2DJIA 3EYAA 4UTVA 4JU8A 4RJKA 4JD5A 1T9AA 4JT9A 1M2GA 4UTXA 4BVHA 2EZ4A 2IHUA 5EJ4A 5MF6A 2A1TR 1Q6ZA 2H59A 5FYQA 2Q5JA 2VK8A 3HWWA 4O8ZA 1YC2A 2OORC 4QPZA
chains in the Genus database with same CATH superfamily
2E87A 3EIEA 3ML1A 4FXOA 1N2XA 4NULA 4RHTA 4UU7A 3ROXA 2WWYA 1IZZA 5LIRA 4S3MA 2AJCA 3DULA 2VUUA 1O0CA 2BJHA 1OE0A 4BMZA 4GUDA 4HAWA 3ZWOA 3TM4A 4Q1VA 4BLWA 2CZCA 4LYHA 4ZT2A 1WB9A 2E9SA 2VS1A 1PT8A 2IFTA 4F2PA 3LUCA 1UKZA 3SEQA 2HHAA 2P6OA 4XVCA 2AVNA 3RYCA 2R1VB 4M49A 2GJ4A 1E7SA 3KYDB 3T4PA 1X13A 2HM7A 3OEYA 4E5MA 1NY5A 4MV1A 5A06A 1UBMS 5AW9A 4CLRA 2HU8A 2DGDA 1C1HA 1FPMA 3BMQA 4WLOA 1F3OA 1JXQA 3U0VA 4QUJA 3NC1C 4MKGA 4B0PA 1A4XA 2YV1A 4TX1A 2HADA 1XRJA 2L17A 2VDKB 3L8GA 1KERA 2D1SA 3JQDA 4MRPA 3ROMA 3RQIA 1TCBA 1VYUA 1BVUA 2FA9A 3PFGA 1P9LA 4AM8A 1IBSA 4OH1A 3B53X 4J8PA 1P3JA 2O23A 3Q7SA 4B71A 4D9KA 5ALSA 3P96A 5AXAA 1J42A 1WXIA 4GVPA 4Y98A 4J2TA 3BXPA 3HCAA 5F2EA 5LUBA 3U56A 3DEJA 4JXJA 3ZBPA 3BQ9A 4KHPB 1AGPA 1E59A 1N5RA 1VGRA 3VOAA 5C53B 1CR6A 4WJLA 1F4VA 3MVEA 1IZ8A 2ATIA 4HSEA 4KO8A 3TX6A 4HSGA 1FX0A 2EIHA 3KZMA 2W9XA 1P0CA 5EMNA 1LX7A 2ERCA 1KDPA 1OAOA 3GLRA 3HCNA 2VVTA 2C4UA 4MI9A 4DQ0A 4GXNA 2VPYA 3HDQA 3C74A 3M5PA 3IODA 1BU5A 3WB0A 2EL9A 5EUCA 1JZQA 2UUOA 3BFVA 3J7TA 4LZPA 4MP3A 2WWIA 3G17A 5EP2A 3Q9NA 3T7RA 5K05A 1P45A 5BOSB 2DXIA 1Y5NA 4H7FA 1V45E 1RZRA 2B5WA 3E2PA 3UJHA 3UWKA 3UGJA 3V8BA 3IKTA 3SEFA 4MQBA 1N2OA 2A0WA 2OXCA 4AI6A 4IX1A 4R9SA 1X8LA 4V2IA 3KJFA 1NXPA 3V2UA 4LBWA 4PZEA 1H94A 2ZT7A 2A84A 5H02A 1JDVA 3QLJA 3BSWA 4GX5A 2RHOA 4Z8YA 4B3XA 3C3EA 1KYIA 1Y7PA 2EF1A 3ICQB 3LDFA 4JXKA 2A58A 1P80A 4Q66C 5EHIA 4QX6A 4IOKA 4BNVA 5A4JA 1WMDA 5JXIA 1IHDA 3SSNA 3JAKB 1D07A 3GXBA 2VF5X 5E7QA 3C45A 4IXWA 4M0EA 2F64A 2AS0A 1P1IA 1BCSB 2GKGA 2WJJA 4FSHA 1W4CA 3AVOA 3WZMA 2VDWB 4D0RA 2X8JA 1FDVA 4PPFA 3OKCA 4XASA 3GU3A 1GQQA 1UJ6A 3L3BA 3CH5A 3KL4A 3R20A 4JX9A 3TECE 1U65A 4TN5A 3OO0A 1RWKA 1ND5A 5B64A 2Z9DA 2A4MA 2IY9A 3MUOA 2OQIA 2YFYA 3ONWA 1W0JD 4HAXA 3HM2A 5EERA 3VO8A 3V8EA 4KR6A 4H0FA 1YS2X 2VOJA 2WMNB 5F9MA 1CKEA 4LI0A 4PLFA 5EP4A 3HYRA 5K2MA 1E2GA 4H7JA 3W6UA 5L3QA 3WSVA 2ETVA 3OZ7A 1C50A 2PVSA 2ZETA 4C0WA 3T1YB 2D1RA 3GGGA 4TYPA 4BKUA 3ZW7A 2FPPA 3U2QA 4AJKA 2WM3A 2WG2A 2XVXA 1KHTA 4MZDA 4B43A 4DWVA 5B1IA 1JZTA 4FDTA 5CM8B 4P7KA 1LBHA 3T9AA 1A04A 4M0LA 4LISA 1GPAA 4N5LA 2D2IA 4NDZA 2B61A 1JDBB 3DR5A 2O2XA 3H4IA 4BE9A 3RTCA 3LT5A 3VYTB 1G7SA 4ZD6A 3MSXA 2F9MA 3RS5A 4A23A 4ZCMA 4BBJA 1R4MB 4Q03A 1WPRA 3KZKA 2Z8ZA 1QKJA 1QYCA 1QYIA 4KXXA 3PC8C 4U2FA 1XZEA 4UBNA 2GEFA 4F8YA 1R7RA 1VPTA 1G18A 1G64A 4OGLA 3W1WA 3CPHA 4YREA 1T3GA 3D54D 2RIRA 4DA4A 2VBFA 4AQYB 3L6RA 1RBMA 3GLHE 3SHTA 3BK7A 3PJRA 2G1KA 2HV9A 4KQHA 1QF6A 4LNUB 1X86B 3ZLBA 1SXJA 1OFIA 1IQ0A 2EBUA 2HLDA 4UDXX 3AESA 1N7JA 5AHXA 2CLIB 3IJEB 3AGQA 4ZTUB 3HJUA 4ERNA 5LUAA 4J1QA 4NZYA 5HDQA 1XLUA 3H42B 1QIJA 9GPBA 2HRRA 3LECA 3LKZA 1SVMA 4K7JA 5B1YA 2XT9A 2V7VA 3EGIA 4R1TA 4O2AA 5SZJA 1X94A 3GQBB 2Y0PA 5JS8A 1ZAYA 3V46A 1DX6A 1T2VA 2QRQA 2Y0BA 4H1UA 3JVUA 3L41A 4B7AA 3GLFE 3TD2A 1HFEL 4M1MA 4N3CA 1KK0A 2VO1A 4V03A 2GDJA 5EC8A 1R0YA 1IHXA 2Q4BA 3RK1A 2VPQA 5JS2A 3ET4A 4E46A 5MHTA 3WWYA 1P1CA 1U2GC 2PSEA 1FP1D 3JQAD 4GKBA 1KEZA 4B3CA 4OXRA 3BM5A 3WS7A 1GZDA 2JFGA 1KHHA 1RABA 4IIFA 1XZHA 4XM1A 2YYSA 3HY6A 1NG1A 3GRUA 5DV9A 1IY2A 5CW1A 4EJSB 4CMHA 5GOZA 2EZUA 3KAKA 2O3JA 1UK9A 5K01A 3FHCB 5FPSA 2YHUA 4H6PA 2YBDA 4I9FA 4NI5A 3RBXA 4OATA 2OZLA 4MPRA 2VHUA 1ZMBA 8GPBA 2IU0A 4EFKA 1B8VA 2OGWA 5KOJB 4PBRA 1TVCA 1G66A 2TMDA 3QPWA 4BN0A 3NIFB 2GUWA 5G0SA 4TMYA 2OHFA 2ZIFA 3CGGA 2W0MA 5HQ3B 3CUUA 3ENQA 2BGMA 3QQ5A 3I61A 1URPA 3FLAA 1TCUA 3TG8A 4EKGA 4J9VA 4EA6A 3Q85A 5M7EA 1K4YA 2D2VA 4U7GA 3RVOA 2NU9B 1PZFA 2C00A 2R8PA 1O9BA 4MR8A 4YAUA 3LHSA 3CZPA 5IG2A 4B81A 3QE3A 3AM1A 2A9PA 4PGHA 3F4LA 3IAM1 2CYAA 5IH3A 2BMJA 4PX3A 3LPAA 3TRHA 3E22B 1JU4A 2RCYA 3TKLA 3C3KA 1X92A 3EZLA 4MKXA 4J0CA 3UW1A 1Y1SA 1J25A 4KEAA 1PL0A 5KNDD 1DC7A 3GELA 1FMLA 3GEBA 5H1YA 1ONPA 2G5GX 3WHPA 5A6SA 4RY2A 3SOPA 2XGSA 4KSYA 4Q3OA 2A57A 3BWCA 4WOKA 1L4MA 1UK8A 2JJQA 4HFMA 1P0QA 3KKPA 1TD1A 3NKFA 5D1NA 4INPA 1I94B 3EW9A 2AOWA 1OZAA 4MLZA 2O3SA 1RHKA 1G6Q1 2X7JA 1WA5A 2ZYSA 3UK7A 2JGDA 4BYGA 5JMWA 4D82A 4LSZA 5DNYB 2PWAA 4QWWA 3BGOS 2DBQA 4ZKEA 4CTNA 3TF5A 4UNQA 2W6JA 4DLLA 3HZOA 1A27A 1QP0A 4AG3A 1NBWB 1UWCA 4UE2A 3HJCA 4C7OA 3KOMA 3CC8A 5EZYF 5KDOA 3ER6A 5E1BA 3JQEA 3WB2A 2ODAA 2DTDA 3FXAA 5HFNA 3UMGA 5HQ3A 2ZYUX 4YRSA 5IMSA 3UQYS 2UUCB 5FPYA 2X0RA 1E6MA 2VYNA 4B3GA 4B35A 1NJ2A 5L51A 3I0MA 3VU8A 1GQYA 3TWOA 2JKZA 2Y3IA 5FWDA 5C7OO 4C2BA 4TVSA 1P0FA 1T8SA 4Z4HA 1IN6A 4KAFA 4PS1A 4MITA 1O6ZA 4OHCA 4ZCPA 1G41A 5ICFA 2AZTA 1BZYA 1BE8A 1U4NA 3OAAD 1QK4A 3QXJA 1RTKA 3SJZA 4ZAYA 3DQQA 4FILA 3T4UA 3UH1A 2BM9A 1AGXA 2HSDA 4MYDA 3KQPA 4E2XA 4YRGA 5HJ7A 2AOTB 1QH0A 4D5EA 4HXYA 3IVRA 2IX9A 1RR6A 4PC1A 3AEZA 2PNFA 5FPKA 1U0HC 4NHOA 2QJWA 4JJKA 2QM8A 1BVYF 4G8DA 1BJKA 3IE1A 3WJ2A 3U3XA 1FUKA 2Q5HA 3OCUA 4QYWA 3M4JA 2FVYA 1TM1E 1OT5A 2J5KA 1GPDG 3IUPA 2BFAA 2BZSA 5E4YA 1A98A 3BULA 3O03A 4FYIA 4W5WA 2BUAA 4DAEA 2WJZB 1Z68A 4UNRA 4UVDA 4NV3A 3DMDA 3RU2A 1PV4A 4E5VA 4P4NA 3TOXA 3T3NA 2R86A 3INYA 3JTEA 4QJBA 2AZ4A 1CNFA 2TMYA 4XYBA 4PO8A 4RBNA 4UUBA 4IY1A 4PQEA 5E9WA 4UMVA 3WNCA 4CI9A 3NDPA 4V0NA 1RYDA 1F2VA 1LW6E 3MRXA 3PUHA 1PJSA 1Q0SA 1JAXA 5EP1A 2X40A 4O4LF 3K70B 4TVBA 2VDVE 3NONA 3MWFA 1TJ4A 1PTJC 1VHTA 2HTEA 3VR4D 5BN5B 1RJGA 3DDHA 3RR2A 1P1KA 4P5PA 2EU8A 4YT5A 2I0FA 4MJ3A 5ALXA 3WKCA 1QHFA 3IEUA 4UVIA 3SYMA 1USVA 3BOSA 4C0BA 5I5EA 1S4QA 4X8OA 2HUNA 2R79A 1AH2A 2BM1A 4NJMA 4EY7A 2CFCA 2QUAA 5LQUA 1ZOOA 4UBJA 4QXQA 3EC2A 3H2KA 3LT1A 1OLSB 3PR2B 3QUAA 2EG5A 4HGZA 3TE6A 4O6VA 1P3Y1 4QOJA 3QEOA 3TOCA 1T36A 2DWQA 1LNQA 2JLVA 2B99A 4PBSA 4OD0A 3ISTA 2ZBDA 4ZC1A 3V8MA 4HGQA 2HH9A 4RY9A 3V5NA 1VMAA 4GKVA 4QPDA 5EHXA 2XDQB 4DYVA 4WT7A 4EKIA 3CPSA 3VVBA 3SF0A 4RTSA 1I2CA 1W93A 1F0NA 4CQNA 3QKRA 4RH0A 4D5GA 4R8SA 2RKOA 3SNHA 2V4UA 3RC7A 1ZQ1A 6REQB 2CXPA 4MUMA 3HEBA 2VHZA 5DHTA 4CMEC 1Y1QA 1SXHA 1A7JA 4KR7A 3QY0A 4GR5A 3L0PA 5TS3A 1YZHA 3DV0A 4G1BA 3O93A 3UGQA 4RUKA 1C9YA 2AVDA 4QUGA 2JGLA 4YNBA 4R1PA 4X8HA 2NVUB 3E3NA 1QOZA 4G0XA 1OMOA 3HP7A 2ENUA 2JIBA 2E7ZA 3LGSA 2IEAA 3FJOA 1QANA 4IUCS 3VSDA 2JF0A 5M2QA 4LOLA 5EWLB 3W77A 5ADWA 1GTL1 1I0ZA 1TM3E 2B82A 4EHJA 5JBQA 4ENWA 1Q77A 3SF8A 3N9IA 1OLXB 4KGVA 3TSCA 1QDEA 4Z1OA 1CJUC 1TM7E 1WDLA 1U0SY 2C9BA 4UU1A 2ZRIA 1GQRA 5CD1A 4N8DA 4CKWB 2O2EA 1RYYA 1D6MA 1H4TA 1MNQA 2FPLA 1RQLA 2PQMA 3Q9SA 4HYYA 5AUNB 4Z4IA 3K0BA 4DV0B 4KK3A 3A05A 3IQWA 5D5HA 3RSSA 3GWZA 3HA3A 1O5OA 3OHMA 4B7CA 3FPGA 3OJ0A 5JASA 2ZTSA 1SU8A 4HYQA 3K1AA 4BNUA 4PAGA 4HDNA 5DH9A 3U5TA 2B25A 2I1LA 2X9LA 3OPYA 4LQ4A 1GVHA 1JFFB 2G9UA 4GW3A 1RRCA 3KOOA 2ZOSA 2FCRA 2K6GA 3A04A 1MB4A 1SBZA 1RFGE 2ZRFA 3D5QA 4JOSA 1IC6A 2ZYTX 1FRFS 1RHRA 1ZXLA 1YS4A 2YIJA 3P2IA 5IP5A 3S70A 3W79A 3ORSA 4S04A 4F2GA 2AUTA 2NU8B 4C0KA 3DAGA 4Z9XA 2PYDA 3W3AA 1NUTA 2IUYA 4OBWA 4BRSA 1KI3A 2CNDA 2KS6A 2GBIA 2P9FA 3BZUA 1QF9A 3P4XA 2QTBA 2Q3MA 1QWSA 3B36A 4K9DA 2QUHA 4QASA 2V7UA 3KT6A 4US1R 3R3JA 5I48A 2AN4A 2C4VA 2ZIGA 4Q3DA 5IT4A 3TLJA 1RJWA 2PK3A 3GLGB 2MHCA 4A5SA 3OECA 3BD8A 4E07A 3DLBA 3L8EA 4RGQA 1O4WA 3B8EA 4F11A 1U0BB 2EBHX 1AXGA 1SOVA 2C4HA 3O9MA 4MUBA 5EQDA 5A0TA 3K0CA 1SULA 1YR6A 1GCIA 3KHKA 3MCUA 1KL7A 2BI7A 1EDDA 3OBBA 3ZVRA 2C7RA 3D6AA 3CX6A 3KYBA 3W5JA 1TVKA 2WR8A 1DKQA 1RAHA 4AS3A 4EVSA 4C7KA 4CETA 1NGSA 3HG7A 5K09A 4KRFA 3HBMA 1OAKA 3B6KA 3ZXYA 1R6TA 2JJMA 2QE7A 1HDZA 1OR8A 4PINA 5AVYA 3D81A 4URVR 4KC0A 4QO7A 2ZQZA 4MB6A 4A6PA 2P2YA 5EESA 4LHSA 5EXTA 3CLTD 3GUVA 4B4VA 3GLQA 4BOYA 4DN6A 1NVKA 4PWZA 1JILA 5E0KB 1G3RA 3IIMA 5CNIA 3BL8A 4RSGA 3UB4A 5BN3A 5G1OA 2X4GA 4Y2PA 5A9RA 3WA6A 1PR9A 3O2NA 2NYVA 5CB8A 3KHUA 1BAPA 1Y42X 5PGMA 3DF9A 3L82B 2CXXA 4LRXA 4AYWA 1T0UA 2WYVA 3FBTA 3HRHA 3U3RA 2J1LA 1NN5A 4UNNA 3VPFA 4ENSA 4M2LA 2JGFA 5ADVA 3RRJA 1AQNA 5J23A 1XC7A 5FAXA 5A71A 3EPLA 4XD2A 3D6NB 4PE5B 4B3SB 3SJCA 4E03A 1ZHOA 1WB6A 3K0FB 1PR2A 1UJ4A 5KVAA 3A11A 5CA1B 1X74A 2H8GA 2P27A 3U4MA 1WRBA 3KAQA 2BTQB 3WKEA 1L5KA 2XYRA 3B52X 3BMXA 1ZINA 5B37A 2D06A 4LRYA 4ZO6A 4GPTA 1KF0A 3K8QA 3P2EA 4JA0A 1JLMA 1P1BA 3CN9A 1YTUA 1HDCA 1DWQA 3F47A 3PGKA 4MPTA 4OQYA 5EJGA 4KWCA 4LV6A 2JIPA 2OV4A 2H5JA 3MAGA 5AKGA 2BFDA 4WQMA 3WWPA 3N8KA 3PC8A 3TUZC 1UP7A 3A10A 5KWSA 1L4KA 2ETXA 2JCYA 3PRHA 2RG7A 4EPRA 4MRAA 3BH0A 1P33A 3EDMA 3L79A 3C8DA 4IIJF 3VR6H 4LCBA 2VJKA 3E7XA 2VEOA 3RSLA 4AP9A 4E1VA 4Z4CA 5LZ4A 2ONCA 1D03A 2X0IA 5CX1B 2QTTA 3O0TA 5T5QA 3PGMA 5KYWB 1QIGA 3DUWA 4FHCA 1QYVA 3C3YA 4UHFA 4CU5A 4K81B 3GYGA 4CMGA 1P3DA 4D4MA 4G3XA 5C8XA 3T95A 1I4EB 3BIOA 2QN9A 2E37A 4ASUA 5CLQA 3GX1A 4GI2A 2AD5A 3JQGA 4JC4A 4V3BA 3BD6A 3MOIA 1BWSA 4DV1B 3AONB 3TW8A 3O4IA 1UKCA 3JWEA 4P7FA 4Q15A 4U8GA 1D9ZA 3ZGLA 4C4SA 2G82A 1W36B 4Y6LA 3F9IA 3JVIA 3E4DA 3ETDA 2PLAA 3OPQA 4LEIA 3LBFA 3WHIA 4JSYA 1HGXA 3IEPA 4MV4A 2R5NA 3LLVA 5T4EA 5LL6P 1FP6A 2II6A 1VRCA 2Y1CA 2H4YA 3WB1A 4BMNA 5KMGB 4WK6A 1R9GA 4DMRA 2I1QA 3CUSA 3PPYA 4YLEA 3IV9A 5K4GA 5TMBA 4J4BA 1YCHA 5JYEA 2W6QA 1F9EA 2QRUA 3AIOA 2A33A 1ONOA 3VO9A 5BMVB 3AI7A 2GYVA 1WBBA 4ZEOA 3D4NA 1I9CA 1VIVA 3DJYA 3GBSA 1CE8A 3L7AA 5DNAA 3ZE9A 5JAHA 1U0JA 1EQUA 3N59A 4NPAA 1B93A 5IVIA 3HWX1 4FIZA 4JYCA 4IR7A 5DTEA 2YQZA 5LBUA 3U3JA 2NG1A 5B1HA 2R7MA 2RC6A 2V8OA 5FBLB 1B2RA 2ZBQA 2DWCA 1ZM2A 2E4YA 1MX9A 3HDVA 1ISMA 2VK1A 2YS6A 5IC6A 3HBFA 3TIXB 5A62A 2JBHA 5IDVA 2RI6A 5BMVF 3KTOA 4XIIA 4J4TA 1AF7A 1HC7A 5EZYB 1FU8A 1N0WA 3IB6A 4DEYA 5AW0A 1H2FA 1X1SA 1FJ2A 3JQ9A 3R24A 1XI2A 1Z15A 4XH9B 1C0LA 2FDRA 3SS7X 3C7DB 4H17A 4Y30A 1SUIA 4MOWA 3HTXA 2CV2A 2WPDA 4FVTA 5CDYA 2EWVA 3HKEA 3P20A 1YO6A 1GZUA 2QS9A 2VBGA 3FDXA 3NNDA 2IUSA 2QQFA 1OYWA 1C3JA 5FBWB 3DFZA 9MHTA 4NAVA 5T57A 8ABPA 4MDEA 1F1BA 1F0KA 1OZFA 3IALA 4HQNA 4Y6QA 4ZYXA 2X6QA 4V39A 1V7CA 3V9AA 2O7SA 2F00A 2AWNA 3QVOA 3CX8A 3VJLA 4AICA 4C29A 1UWLA 3AEYA 5JD5A 4OHXA 2BFPA 1BEEA 1KYXA 1HE1C 1VJGA 4LK3A 4JB0A 1YZKA 1SU4A 1F5NA 5HUQA 5JZSA 3IL2A 1A1VA 3OOEA 3ZVNA 2OZKA 4LUCA 5DZSA 3FVQA 2R7KA 3FF1A 3C1OA 4FM9A 3AW8A 4E94A 1ZA1A 4QFMA 2GLTA 1S9DA 3O2SB 4J3JA 4ZREA 1I14A 5CH5A 2QP3A 2B34A 2ZZNA 3EG9B 2ZR9A 1WW3A 2QPLA 4C0JA 3B9PA 4DMHA 1LTHR 3K09A 4G1VA 3VKVA 2OBMA 4AY3A 4L1KA 3WLJA 3NT4A 1FFBA 1NI5A 1KMQA 4LYYA 4GOJA 3RBVA 2MDTA 3ZV6A 1EWVA 1PJBA 2CVPA 5LZ7A 2NU8A 1RAFA 2WZBA 4F46A 5CB0A 1OT3A 1E7MA 2ZJ8A 3O9ZA 1JJBA 4O4IA 4BEBA 5AVTA 3NV9A 1RWQA 1UK6A 1XQVA 3DPUA 3EEYA 3SI7A 2WOJA 5T8KA 3GT4A 2DFKB 2JLCA 4N0PA 3FMPB 3O8OA 5M04A 2D54A 2WSBA 4MQ5A 1ONSA 4HKTA 4X71A 2G40A 4MI6A 3D8SA 4JSTA 1Z2AA 2CUZA 1PFGA 1MJNA 3HB0A 3OE5A 5D3MB 4BN5A 5AVZA 1J6UA 3REQB 1ZMOA 2VP3A 3UWOA 5HKAA 5CT5A 1GQFA 2J3JA 1Q16A 2LW7A 3AEUA 3PKJA 4WNYA 4XOUA 4BAGA 5ITWA 5JQWA 1Z29A 2ZJOA 5LYJB 1NQXA 4MQ6A 1FDUA 2TYSB 2L2QA 5FV4A 2VPZA 2LPMA 4JAVC 2GAFA 1F12A 3CMMA 4E4RA 2ZWMA 1FNBA 3A6EA 4HEHA 2VCEA 2O6HA 2E4WA 5EPEA 2BF4A 3TNJA 3U7EB 4DM7A 1QIKA 3AVXA 4NDNE 5KWEA 2G0NA 5CFMA 5ERXA 1Q0UA 3BRWD 5TMEA 3OX3A 3FRIA 1IZ0A 4Q3NA 3CNLA 4RK5A 4RVOA 3D02A 3ZN2A 2Q99A 2AC4A 1L8OA 1BRTA 3K15A 5JAOA 4L3OA 5K3SA 3ZX4A 2I7DA 2JC3A 3EGXB 1LS6A 3PE3A 3CWCA 4R2LA 1Q0PA 1GZVA 3LCCA 5ARBA 1VSUA 4NXNB 1KC1A 2BSXA 4NG4A 2QXYA 4MPPA 3PJDA 4JLJA 2ET6A 4F4FA 1RKUA 1ZJZA 2QMZA 2HY7A 3AR6A 5DULA 2QPTA 3V4VB 5JNRA 4S12A 3AEQA 3HKDA 2OA0A 4AMVA 3U1BA 5GINE 5A4MS 1G3QA 1RIFA 2OLEA 3MPUA 4XSHA 5GM1A 2FPUA 1P9NA 1KFEB 2WAXA 3HA2A 5KIAA 1M0SA 1GAEO 1OZ0A 1HTWA 1VIDA 1NW7A 1FLNA 3ZWAA 2IUEA 4F3KA 4LECA 1NMSA 4BFVA 5HZMA 2UVQA 5KB3A 1YZVA 1FNCA 4GLBA 4A82A 1M3SA 4FBLA 2Z6UA 2C7PA 5L4LA 2YN4A 4IDGA 1NONA 1E3QA 5FLXA 1TUGA 1YL5A 3OI7A 1ZWLA 4MYUA 2DQSA 2Y1GA 4EX7A 3S1SA 3VR5H 4D3YA 4LJLA 5B36A 2CC2A 2PZFA 4X41A 2PM8A 4HNSA 3X44A 5JNSA 2CT8A 5EHQA 1G1AA 3H5WA 1W36D 1JL3A 2AUMA 4MW4A 4ZALA 3ZH2A 4DREA 1JBEA 1YXMA 1ZW1A 3UFBA 1OTYA 1JG1A 2OYCA 1RWNA 3MT9A 1K1EA 5I7RA 4UE6A 1TO2E 4M60A 2H07A 4GMGA 4N8EA 5LP6F 1YIOA 3SSAA 3HCPA 3WXBA 5F9FA 5EQTA 3VAAA 3FFTA 4PZUA 4TT8A 1LLCA 3OE4A 4LDPA 4FEAA 3U7JA 4YRNA 2H1LA 1R9MA 6ABPA 1G6KA 4MUNA 2GCNA 3BB1A 4Z3OA 4I1VA 1ODSA 3D3NA 4F1WA 3HO1A 4GKKB 2QG6A 4QT4A 2O8CA 4R7TA 3JCZA 3GA7A 4EKDA 4MPDA 5FJJA 1YVEI 3BFJA 1AZSC 2C97A 3UKOA 4PCVA 2OCDA 3AHDA 1C1YA 2FP4A 3I6MA 5K8CA 1WJGA 3LG2A 1Z0AA 1CDEA 1DBSA 4RHYA 4BGDA 1AZWA 1QH9A 2Q4DA 1U8AA 4G9BA 1C30A 4UAGA 5IF9A 4TLLB 4HRYA 1KVQA 2ZSHA 1MJ5A 3I9OA 2ZXFA 3SOZA 5C1OA 1UMBA 1JR6A 1F3LA 5REQA 3MNFA 2AQIA 4AS2A 1ENOA 3M4NA 2J6BA 1UOEA 1ZK0A 4G1FA 3A8TA 4QBKA 5EZSA 2H5IA 2PH7A 2ZTLA 2RKWA 4AG5A 4BN4A 4RETA 5JNTA 4XPIA 2MMGA 3Q9LA 2Q7OE 2EJCA 4B8ZA 2PFKA 3KZCA 1N7HA 4BNDB 4JYZA 2FETA 3O3CA 2HFJA 3KR2A 2FR8A 1HDXA 1UM8A 1L4LA 1NF2A 1K7SN 4TKUA 4CG3A 3WLAA 1GWNA 3HN2A 2R25B 1C9DB 2IIBA 4GE0A 1DWPA 1PTKA 4TL9A 5AO9A 4QDUA 1QAOA 2Q3LA 4ZVQA 1YI0A 4DNPA 4TUYB 2AFIB 2J5XA 3UMCA 2I6GA 3LQ1A 4R2KA 1XCJA 2Y66A 1CVIA 2X0FA 2IXEA 1PT9A 2BF7A 3Q2KA 4QPJC 2EZ9A 4DJFC 1SCQA 3E9NA 2RAFA 2D0PB 1ULSA 2YWFA 4AROA 1DCFA 3PQ6A 4W8GA 4PZYA 1UIMA 3OURA 3TOSA 2VDNB 2XE6A 1UOQA 4EG0A 4MW1A 3T5TA 4CT0A 7MDHA 2E55A 2IP4A 4XDYA 4D4LA 1ATZA 5G02A 3QX3A 2K5UA 2YFQA 4Q9KA 4MWZA 1WKCA 3F67A 2VDQB 3LPNA 3U3MA 3VNQA 4B47A 1KTIA 3R6DA 3R74A 4LDAA 4D9JA 2XTMA 3FNGA 1E3IA 4TMZA 1LDYA 3P2OA 2BFEB 3ORFA 4HL6A 2NUTA 2CBGA 4FHGA 1JR2A 4F5DA 2P8SA 4UEKA 2JGEA 1QPZA 2FLKA 3TTSA 4Q0MA 4L07A 4FNGA 1J0DA 1HE4A 2QN8A 5DW0A 1TKCA 2C3PA 4HDNB 3F6BX 2IDZA 4TTJA 3SJ7A 5L3ZA 3VUFA 4R5HA 1AUOA 1XDSA 3D6JA 3HKCA 1FZQA 2D00A 2HI0A 1D5CA 3ICCA 1C7FA 4U2DA 4DV6B 3RVQA 1XXLA 1V26A 2P9JA 2OBNA 2VQDA 1XN1A 4KVGA 4Q34A 3ZI4A 2C83A 1YS9A 3WRYC 4HAIA 1BGXT 4FZ3A 2FDXA 1AXRA 3VV3A 4DR6B 2HSJA 3IDQA 1S89A 3AY0A 4PO3X 4TVKA 4LC1A 2PVPA 2OB1A 4JR2A 3AYXB 3SZUA 3UTDA 3GQBA 4AP5A 4KG7A 1OUMA 4GT1A 1HYQA 3UB2A 1N3YA 4F3CA 1CHNA 2EHDA 3G8BA 1HT2E 4G89A 5TNXA 4G4GA 4O29A 3F1KA 2YHIB 3MTQA 1Z4MA 4O4HB 1U94A 5TQ0A 2WU0A 3GLIE 3LUBA 3E05A 3A32A 3BGSA 2PA3A 4LHYA 4CKEB 1WMFA 4Z53A 2UXBB 3LP6A 2AIRA 1TD9A 3HFRA 4GBGA 1HLPA 2PKYX 4I55B 2UUAB 1CB7A 2JCSA 2E6UX 5JJKA 3IIEA 1ITZA 1Q2UA 2XVZA 4KE6A 5T3YA 3DHWC 4QQNA 3PCRB 4NONA 4E6EA 2JDIA 4H0CA 1PWYE 4X44A 3CIFA 3EZNA 3JAWA 2JHFA 1X1BA 5FA5A 1TYAE 1V6AA 2WHEA 2RHRA 3OHSX 4XCXA 2XF8A 3C15C 3L8MA 2HJHA 4MVYA 5K0NA 3W9YA 4BMPB 3D3WB 2H4JA 4BNJA 5KYTA 5LP6A 1KAOA 1TZBA 2PUCA 4XIFA 4Q9JA 1NBMD 3I2KA 3M49A 5AKHA 4A1OA 3F73A 3UIEA 5CDFE 1ZIOA 2VL7A 3BWDD 1EVQA 2F59A 3DLHA 5JC8A 3RVRA 1XEAA 4ZZIA 3C98A 2R1ZA 4JI3B 3IP1A 3KPJA 4RPLA 1TCCA 1V11A 2ONKA 3ED1A 3MRSA 3PT5A 4O59O 4BFYA 4RELA 1GAQA 4L3VA 2HL6A 3P2MA 3Q1LA 1J0BA 4Q02A 4GPEA 2A9RA 5GWXA 5HE9A 4R9UC 5DGCA 2HRZA 4RS3A 4JNKA 3U5ZB 2NXWA 3FPFA 3HSKA 2IS6A 1Z83A 1NUUA 2CL7X 2FSVC 4ME6A 1O94A 3D3JA 3GMSA 3NP7A 3WJ7A 2HN9A 1EAMA 5DGXA 2IP1A 1K08A 1PZNA 4UHDA 4F4JA 1NRJB 1VA5A 2WT8A 1HFKA 3M83A 4K6CA 4JC0A 4LW8A 4Z6KA 2PG3A 1Q74A 2J67A 5ESXA 4M55A 3W4IA 1CP3A 5I01A 2OQRA 1MH9A 5K8TA 1WHTB 3PUWA 3HCOA 4EJMA 4FLFA 1RKBA 1AQ6A 2X6TA 3RAGA 5EUBA 1S9HA 4XWKA 2JJYA 4LBVA 3CKLA 4P38A 4M7RA 3P2YA 4AJIA 2ACVA 1NBOA 2YWHA 3OQJA 4X92A 3HCFA 1GXSB 4DA8A 2DQYA 3H4VA 3SXPA 2EFYA 1N2IA 3PL5A 5EE3A 4XGNA 4GDMA 5G4LA 3ZDEA 1R6BX 4EB3A 3UJNA 2JGDB 5HE8A 3DMTA 2EJUA 2FZVA 3TLCA 5D01A 4B6FA 1OROA 5DN6A 1V8OA 4OFZA 5FI5A 3K2EA 4NK4A 2HMYB 1I2AA 3I28A 3JD0A 1XZQA 4IOLA 4IQ0A 1M6WA 2Y9PB 1ZNQO 1LX6A 5BN4B 2BISA 5F5NA 5K0JA 2GVZC 2EEPA 2GZSA 5IJAA 2CNKA 2FEPA 2I6FA 4G5SA 4ZGBA 2ZRMA 2CB9A 3R7SA 1O9GA 5I7EA 1RW4A 3B7PA 3D6HA 3GZ4A 1J8DA 3P9NA 4EYSA 2Y0CA 3FROA 5AUOB 4IDNA 4DB4A 4ZOLB 1E2KA 1S5PA 4WH0A 2P4QA 5KQMA 5AM4A 1I6KA 3RJZA 1B0AA 4BQIA 2IV7A 5CDUA 5I7OA 2GPJA 3RLFA 4C5BA 4RKYA 5DLDA 1ULHA 1GUDA 2VF2A 2QW0X 2Q6KA 4HK4A 3WGYA 2RGGA 3B48A 1IBKB 1H6AA 1H5QA 1V2GA 1GA1A 421PA 3ONNA 4CCYB 4GSKA 2AW3A 5BMVA 4QQRA 4P0TA 1AS0A 1O57A 5K99A 3RBAA 1JNXX 2FV8A 5FEMA 5B55A 4G0UA 4GRIA 2I29A 7MHTA 4JN6B 3A6ZA 3BRQA 1ODFA 4RSRA 2WTXA 1W0JA 2ZIWB 3GPLA 1W73A 1QGUB 4QPNA 2WAOA 1UR5A 4P8RA 1Y3HA 2XUHA 2ZRJA 4W7HA 1F7UA 1P7ZA 3IAS1 1KARA 3BK2A 2ES4A 2HPHA 3I0NA 2P6RA 2ZS9A 3V2HA 3I9MA 2AOVA 2P1RA 3Q5EA 4C14A 4WXYB 1E79A 5E6RB 3VTKA 4P7GA 4GI5A 2YTZA 3STXA 4DIUA 3FCSB 4NMXB 3SXJA 3RSFA 4ML3A 1OHHA 1ZGJA 2C29D 3EPPA 5HS6A 2FFQA 3W3ZB 1R5BA 2W70A 1JX6A 2BR5A 4ETWA 4DA0A 1XZMA 2X19A 3QUSA 1I2DA 4KQ1A 1KI6A 2EBFX 3EMDA 5IAKA 2QRVB 1LU9A 2Q8QA 1FNNA 3K6SB 3BD9A 5HIJA 4YRAA 4MR8B 4P58A 5LSAA 4JSRA 1MKYA 4CFYA 2BPOA 2D5BA 2HA3A 1K8XB 3AHIA 3CMCO 3FZEA 1UFQA 3N7UA 4NH0A 5LIPA 3B1VA 2UUBB 3A6DA 3OIWA 2JAOA 2QNBA 1GRRA 2EERA 4TXJA 3RS3A 2VFAA 5C8YB 3K4QA 2CXQA 5ICCA 1MIHA 3ASYA 1D1TA 2ZUUA 1E62A 4LRTB 1PR3A 4ND5A 3DE4X 1OWOA 3FTPA 5CJPA 5DTJA 2FPKA 2G88A 2QW8A 1MB0A 5LNK1 3ZE2B 3FYTA 4KO4S 3QK7A 2OESA 3C3JA 4J0QA 1OWLA 1WM1A 3C5CA 2Q6LA 2FSFA 3HYNA 1RBYA 3K9QO 5H68A 5HF5A 3SX4A 3TDKA 3VHXA 3ZD8A 4ALLA 5LM3A 1JWLA 2B20A 4CMBA 5JAQA 4KIJA 1MX1A 1BMFD 1PWZA 1A9TA 1G8JA 1K8RA 2YY6A 4LZJA 1Y48E 1ACMA 2EWMA 2VH2A 4U9UA 4DLVA 2FZKA 4GFDA 3DO5A 4NY1A 1NXSA 2ZI6A 3O7WA 1SVKA 3NRJA 2G1PA 1BA2A 2G9VA 4B4DA 3J81A 3HKBA 3OTGA 4UXIA 1B2LA 1RPZA 1NQAO 4OQQA 1FS6A 1KJIA 3SHOA 1X9GA 4Y9RA 3BICA 2FNAA 2NO6A 1UCFA 1EK5A 4RY8A 3LQRA 4W8HA 2ZUVA 3T1TA 4AY2A 5THXA 4H18A 4RTLA 2O50A 4WECA 2DERA 1HR0B 3G2KA 3UJBA 4JITA 5M5BA 4U2EA 3NBAA 2V45A 4R84A 5LMUB 3B12A 4PICA 2XKBA 5KYNA 3QJGA 3M1LA 4FU0A 4V1CB 3DONA 4UW9A 4C3UA 3PCTA 3K9GA 1VSVA 4Y6SA 5CFPA 1QRDA 3AKYA 2QMYA 4QYTA 4PCUA 3B9QA 4H1HA 3ZGVA 2PKWA 1A9QA 1HDRA 2WWHA 3FSEA 1GQSA 3GFPA 5CU7A 5FCDA 1Y82A 5CDHA 1JQJC 4ABTA 2P2SA 4AT1A 1J0XO 2JJ1D 3KDAA 4HQFA 2WJ6A 2HNKA 2BM8A 2F43A 4NWIA 1F1JA 4Q1EA 1V5FA 4UHHA 4BZXA 3HR8A 4IDEA 2ZBUA 2CDCA 4KAAA 3D31A 3DYVA 1EWQA 1D4AA 4Z0HO 1A9ZA 3RANA 5DNCA 2X2EA 2W0SA 2D0IA 1JEJA 2IXDA 2HDWA 3CEJA 1I3NA 1ZZEA 3IUJA 2HMSA 1MFZA 2PGXA 3EISA 3KALA 4QAQA 4EPTA 3NTRA 4B4KA 1ZGCA 5CD9A 3A36A 1Z22A 5MN4A 4NBWA 1XQ6A 3B20A 2UZ0A 3ILVA 1L7DA 2A9QA 3LW8A 1XF1A 4JU9A 4U1RA 1K97A 4KWIA 3HJRA 4M1SA 5JARA 1TDJA 4BTEA 2GZ3A 2IEGA 4P22A 3OMXA 5B7QA 1SCNE 3KOYA 4GPD1 3LX5A 1SQ0A 2YZGA 4BNYA 2UV8A 4MEBA 3DJFA 4DJEC 2ZXUA 1IAVA 1WP9A 1C0IA 4FINA 2JJ8A 4KREA 4F9TA 1GTRA 4B8YA 2CNLA 2OFOA 3PD0A 3GIWA 4NYJQ 1GKUB 2GPTA 4JUFA 5D3MA 2AKEA 1BD3A 4JYBA 1C4WA 4XAQA 4K9MA 3C7KA 3JAKA 2W2LD 3SG0A 2PGOA 4E51A 3EIOA 1XMIA 1OWPA 1ZU5A 5EJ9A 2HQRA 4X60A 4FCCA 2X3UA 2G04A 2KB0A 3H8WA 2AEFA 5IHXA 1L8AA 1G5IA 1PR4A 1KAEA 5J59A 3VR3D 2Q1YA 3FPKA 2PX8A 4IYJA 1VM6A 4HZGA 2XBMA 3AIKA 4U2KA 5IANA 1L4UA 2O2GA 3DXXA 2I22A 4CGYA 4BP8A 4Y9UA 2NP6A 2EXXA 4ZDJA 3OPYI 4J7CA 3GV0A 2W22A 2AZMA 3BS4A 4OH7A 1FDWA 3R23A 3WQRA 4DCJA 4FOLA 2OC9A 4S2UA 1TVEA 1YJQA 1PSDA 3LBAA 3QF7A 4P54A 4V0KA 5JS7A 3KLNA 2COEA 3NO4A 5FIUA 1FBTA 4CXMA 3IPAA 4KW7A 3BJMA 2C2MA 5DRTA 4NESA 3D1LA 3NGLA 5E95A 4ER0A 3LC0A 5BUZA 5DM2A 4DR3B 3B70A 1QZXA 1I4OA 1T5DX 4G0ZA 4Z3DA 4LXQA 4RV4A 1PG2A 1A5TA 1YZLA 1GTJ1 3T99A 3UAXA 4HNHA 1UMBB 2GZ1A 2ID8A 3EPJA 3GIDA 4IG4A 5HMMA 1W9HA 1NSFA 2XRYA 4BY9E 3A6PC 1S7GA 4NECA 4PC7A 2G83A 2QF7A 5KNBA 4CF6A 1KY5A 2XXAB 4YB8A 2I9KA 4CDNA 3GRPA 3E15A 2O8EB 2WIDA 4DHWA 2UAGA 3BE6A 1KMNA 4G07A 4OKNA 3RDPA 3OCYA 2PX5A 3JU3A 4NCNA 2OKCA 2XYHA 3NQ41 3DVAB 4CF7A 1OZHA 1VGVA 4HB2A 3CF4A 1IZYA 1DJNA 4FKMA 4PZCA 4X7RA 2FSSA 1J70A 1LV7A 1EM6A 4RANA 1E4VA 3TQOA 2M9MA 1KK2A 3I39X 4Y67A 2YQ4A 2O8FA 1AA6A 4URZR 4OJTA 3LYHA 2J08A 3T52A 3OUUA 3U80A 3WQBA 3HXMA 3VI3B 4EW2A 4QXRA 3ZKWB 1U90A 4GGPA 2HA6A 1N8SA 3Q8MA 4XYEA 2PBRA 3WGLA 3EZYA 3QTLA 3RNLA 3LXMA 4I9NA 2WHQA 5IUKC 1A9XA 3VKWA 4M8IA 3MPOA 1QYWA 1EVKA 4QTUB 1X87A 5AKJA 4D8VA 4LFBB 2WABA 1T8WA 3AEKB 2YRWA 3IYLW 4PLPA 1KEVA 5LB2A 5JCOC 2YXDA 3OIYA 2GZ2A 3PXEA 1AKUA 1QCYA 1QHGA 5C8YF 2PSHA 3KEMA 5L45A 1Z4NA 1A95A 2V7WA 3PQ5A 3R1IA 3U13A 3VR5A 4Z7NB 5ED4A 2A35A 4QVGA 2FN7A 3G88A 3AFOA 3L4EA 4G85A 1BNCA 1YZTA 2ZAGA 4LOAA 1SBTA 1PV1A 2QTCA 1E1CA 3F9CA 3NJRA 4KKXB 1Z6PA 2HHLA 1QUEA 3AFIA 3B3QA 3WLQA 1F6DA 3LDGA 3NC4A 3KQQA 1PF7E 3R3SA 1JPNA 1W6UA 2PGDA 5DI3B 5K20A 4OP3A 3IKLA 4FPXA 4JC8A 1DXOA 1OOEA 4OJYA 4YCMA 4BRWA 4RVUA 3IRUA 1FFSA 2EX1A 2HCTA 4CIAA 2B4QA 1YQDA 5TF4A 3ZHVA 3ASVA 4TS9A 2I03A 3PWSA 5K7SA 5DK6A 5FI0B 4ZJYA 1U1DA 3ELWA 3TQTA 2LCQA 3MIZA 4P81A 4PBTA 1ZC4A 5B6JA 1IJBA 4ZKDA 3TW0A 4HUJA 8LDHA 5A0FA 4L8YA 1QC5A 4IHJF 3I34X 5JISA 1T0IA 3GD5A 4DXDA 4Q3AA 5K8IA 1HT0A 4INOA 2OGTA 1TVKB 2CV1A 2H51A 2IT1A 4YV0A 1KFBB 1T6YA 2XVYA 1V8FA 3JZAA 3PKIA 4MVWA 4P3PA 2VRBA 3JWJA 3P8ZA 5JHHB 1EFVA 1RCUA 4G5HA 5KTOA 3WIVA 2FX5A 3GJRA 3WGVA 4CM4A 3GVHA 3AUTA 3KQHA 2DR2A 3OUTA 5BSWA 4QYIB 1T4CA 4TXMA 4IVPA 3UXHA 3E9DA 3MJVA 4MYRA 4ZV4A 4CEHB 1FYEA 5KNBH 5BVGB 5DBGA 2P1ZA 1R2QA 1GKIA 3A3PA 3EVNA 3INGA 4IQ8A 4XJSA 4D9CA 4E31A 4YJKA 1SBYA 1ZJJA 2RGXA 2PMDA 1ISJA 1LPNA 5DNVA 4QEKA 2C99A 2F8LA 1ZD3A 2WYHA 3GHYA 3LQFA 4JT9A 5AK6A 3N8IA 4C4YA 4EHBA 5JSQA 3U0BA 4MJ7A 4MVJP 3KQKA 1YBVA 1WUTA 2P9HA 4JBXA 3I5XA 3R6LA 4JL6A 3BSYA 2C7GA 3D0RA 5EHNA 4B2PA 1U0LA 4CZ2A 5EQJB 3KTAB 1P2FA 1S3GA 4H31A 3S5JA 2PS0A 5C80A 3S40A 3G82C 1A9SA 2FZLA 3DDUA 3DKVA 4MUGA 2FUG1 5B53A 4RF3A 3QW4B 4CRWB 3GCGA 4GMDA 2QN2A 5DO9A 4AZVA 4BQPA 3L4SO 4J0DA 1Z7YA 1XAJA 5K0LA 1GDHA 1FRNA 1QGOA 1E98A 1TZ2A 2BMWA 3B1ZA 4QOIA 4H35A 3SIRA 1G20E 1H8HD 4JLNA 2DMRA 1MBZA 1OBHA 5FTLA 2V74B 1ECFA 1ZH8A 4G5QA 1SEVA 3NTVA 3L9WA 3QEJA 2WF6A 3T34A 2GF2A 3Q40A 5KQSA 4J49A 5DIFA 1EI9A 4N7BA 2R48A 4YACA 4EFNA 5H3HA 1OASA 1Z8FA 2IIQA 3U7QB 4N3NA 1VZ3A 2DJ5A 3UG6A 1VECA 1A50B 4OI2A 4U0KA 4F84A 1IY9A 2R00A 2XTZA 5DWVA 3QYFA 1V8PA 5A5FA 2GJ9A 2GM4A 2PRKA 3HN7A 4I1YA 4J3NA 3DFKA 2O7QA 1OX6A 3GRZA 1Z39A 1DDGA 1P2GA 1R0BA 3G5LA 2VRCD 3PXBA 4E3ZA 2NV6A 4IKOA 1WVIA 4MH0R 4YRQA 4R51A 2Q3EA 1M7BA 3QE2A 1NW5A 3H4TA 3QLUC 1MORA 2RHCA 3AERB 1Z35A 2Q45A 1YS1X 2QLLA 1ORDA 3BAFA 3GI1A 2DSTA 3GJ7A 3QNWA 4LHVA 5E7JA 5FNVF 5JCXA 1PIWA 2PAAA 3MFQA 4UHCA 3MLBA 1MC5A 4M8KA 2G77B 3RU3A 2NO0A 2W58A 2F3QA 4KGXA 4WBSA 3S4YA 2AMFA 4EVQA 1SQ5A 1Z5OA 1MIOA 2HU7A 1ZICA 3GDGA 3MSCA 2DECA 4CF3A 4DG9A 4H7HA 2C54A 2OK8A 6ADHA 5HRAA 3HYTA 3EA4A 3M6MD 6PFKA 3I5UA 2YXEA 3O3MB 3E7FA 3QIVA 1FP7A 5SV2A 3H97A 4QTZA 4PHHA 5BV8A 1TVMA 3MINA 4YAJA 3PYMA 4IP0A 1PK8A 2IH2A 4MWSA 5H9VA 5KREA 2YHBA 1W25A 4B40A 4LY0A 1DFIA 1DCTA 4BVKA 1FFDA 2JI9A 4UC0A 2FWRA 2KBEA 5KZMB 5AW3A 1ZDMA 3JWGA 3ROEA 1YWGO 2YJZA 1RQXA 1G8SA 5SY4A 1GCAA 1CE8B 1FXWF 3EA0A 2GD2A 5A7FA 2Z56A 1JF8A 4I55F 2IPMA 5AM2A 1I4WA 2OP0A 1YB6A 4O0MA 4EKNB 2WINI 5ALLA 1Z2EA 4UZEA 3FETA 4YUWA 1TFRA 2P4EA 2XI4A 2IXAA 3EEIA 3A3YA 1Y4ZA 4QJIA 1M34E 5FR2A 3A1EA 3FG9A 4QU5A 3AQ4A 4O1HA 3UAYA 2P6NA 4OQPA 5FPTA 5BY2A 1DI0A 2HMAA 3BGDA 3PXUA 4D7AA 2XRZA 3L7DA 4BO0A 4RLHA 5FFNA 5IJZA 5JLAA 1XR3A 3NTUA 4PN3A 4G0MA 5REQB 5C7LO 2Q6VA 2C92A 3BC1A 1Z5GA 4TKZA 1JAIA 4Q00A 2ZR7A 3ZU3A 3DW1X 1UIRA 5DYYA 4C0QC 2H65A 2OECA 2VJNA 3LY5A 4BP1A 4PR3A 4CF5A 4NRDA 3J81k 2O1EA 3PGVA 2REQA 1PG0A 1TZCA 5HKLA 1NG9A 1VIAA 5IULC 5CFLA 1AZTA 5DSTA 1DKPA 2PGJA 3A6LA 3IUYA 3IR7A 2FFHA 4U9HS 1EESA 2LE0A 2CNWA 4IHKA 2OQVA 3G6KA 4KLZA 4UBOA 3OLWA 2FUKA 4LV5B 2QN7A 5ERGB 3FHJA 1U8TA 5KSPA 3S2SA 1JA0A 2G6BA 3JATA 5IDXA 2ZRDA 3QTBA 4JOQA 2XZPA 4BV2A 1FVHA 1C3VA 3CR8A 5DHQA 4N3AA 5JXWA 5IM4A 4KP7A 1PT6A 2IKSA 3TPFA 2IZZA 5KYYA 1T29A 3R7DA 1CF9A 4UHBA 4ZP1A 4RKWA 2PSDA 2ZPAA 3WLTA 1UPTA 3QVSA 4ETNA 2HHJA 2RGRA 3P5BA 2XLBA 1EG7A 2FPOA 1W49A 2E2WA 1RRGA 3FPBA 1EVYA 4JJIA 3PD1A 2HT6A 4HEQA 1SC4A 4J4HA 1XROA 4LVNA 4LDZA 4EL0A 3LVFO 3HS3A 2OM2A 1WXEA 4ZCQA 2O5VA 2J33A 3LQYA 4WDRA 2P11A 3ZD9A 3TRIA 4ATNA 3Q3JB 3NT2A 3U7FB 3ZS8A 5KAMA 4CQJA 1IXSB 5JLJA 3DKPA 1II8A 3EOZA 3L6DA 3AHCA 4P4SA 4F3NA 4FYPA 1TU4A 1M74A 2HJ9A 2VP2A 3M9XA 1XVLA 1EDZA 3DDSA 5HZHA 3PF8A 5A6SB 3L2OB 1OI7A 1E2LA 3O4VA 2GEKA 2D3WA 2FEOA 3MS4A 1FSPA 5J58A 1J5EB 5KOJA 3VPCA 2C82A 1K3FA 4UVHA 3T3GA 5ICGA 4L22A 1R74A 2RGUA 1A9OA 1CS0A 2XGMA 3NIWA 3QNUA 1I4TD 2G36A 1BHSA 2WW8A 3A9RA 1HYGA 1SHJA 3T5GA 4O4IF 4ZHSA 4K0KB 1JAZA 1EIZA 2F1JA 3COVA 3D0KA 1Q0TA 1JSRA 1P8JA 4EAAA 3IT0A 4MUJA 1K98A 2W2TA 2OD7A 3D2AA 1KI2A 2W6CX 1NXXA 5CVVA 4YUXA 4ZICA 5BVGA 4EENA 3L02A 4PX2A 1MW8X 3ZQKA 1Q50A 1PS9A 5IPFA 3FBGA 4M6WA 5EWMA 2GXUA 4N6GA 2OHOA 3GQVA 4J43A 4Y9DA 2JAQA 1AK9A 3C70A 3ZLUA 2XUGA 2JARA 3GH3A 2P30A 1XWWA 3VMFA 5LP6B 1OV4A 1SVWA 4DM3A 4EUHA 1ZLYA 3RIXA 4ZDWA 3IAXA 3QXXA 5B2FA 1H4SA 2O2IA 4CM9D 5LQMA 1ICEA 2B2CA 2C0QA 2RB5A 3I1FA 5FUWA 4U7DA 5H83A 1AURA 1B4DA 3G2MA 4TTVA 3EYAA 1KVUA 1VL8A 3E0XA 3GVPA 5FL7D 1BG6A 3HN6A 4PQFA 3UTCA 1LK0A 2IHUA 4X24A 4JQSA 3E3MA 3ECCA 3IERA 5TVKA 1ISRA 2BFOA 5EIBC 2ORVA 3ZOZA 4RXMA 1EGQA 4BAUA 2O0JA 3AR7A 3S8EA 5DNUA 2VIIA 4DILA 1IXYA 3OZTA 1E0JA 1L5VA 1L5ZA 4J6EA 4L75A 5FTKA 4J03A 4TM7A 3V4SA 2BKEA 3U9SA 1YL7A 5EJEA 3ZJUA 2X42A 5F7JA 1G21B 1DQSA 2FB9A 2IXGA 3ZE6A 4JBLA 1I2MA 1YQWA 4BP3A 3A3OA 5FWAA 2O8DA 2ZTVA 3LXUX 1HE3A 4UM8B 1GU7A 4LJ6A 1W7AA 3OE1A 3D8BA 2Z2YA 4IDFA 4JQYA 3I30X 4RNDB 1SOUA 4RVCA 4NX2A 1CRPA 3FUVA 1RBZA 1U4SA 2X23A 3LC2O 3OY7A 4LTDA 5KVSA 4E32A 1QWOA 2WTEA 3AVQA 2GHQA 1JR3E 4YJ2F 1O2DA 1H2RS 3STVA 1R4NB 2DKNA 5J47A 5KNCH 2XUQA 3ADCA 1A8HA 3A7EA 5IN5A 4TV9F 5JJBA 1MHPA 3VVMA 1ISHA 1D1PA 5AIAA 5F7OA 3PC4A 1GSHA 4OI4A 1NF9A 5B1DA 5AHWA 4D6YA 2HGZA 1T6NA 1J1UA 1I32A 3M1YA 3W9SA 1QRTA 2VXCA 4XARA 2XB2A 3I2HA 4MS3A 3ZWXA 2A0FA 3AR3A 4Q4AB 3CZ4A 4G8JA 1CQJB 1JDPA 1H05A 4CQLB 4CDRA 5HGXA 2F55A 4L9RA 2X8BA 3FVVA 4JX8A 1Y9AA 2BEWA 5FJIA 1MIOB 3CLUC 1JIKA 1KK3A 2Y6UA 1XZCA 3SLKA 1A3CA 1NV8A 3IS3A 4WESB 4OG2A 3OQVA 1NP3A 4WZ6A 2WTNA 4W9NC 1SIUA 3AP2A 4MQEA 4K28A 3ZQ6A 2J41A 1A4IA 4Y2TA 3PGJA 4BWFB 3PC2A 3MD0A 1U28A 3H1AA 4DY4A 4RK7A 3AZPA 4DDWA 1ZRMA 1UBJS 3M70A 1LLQA 3VTAA 3FTDA 1R50A 3F5FA 1NBHA 2XQJA 3WV4A 1WTCA 3B2NA 3OX2A 3BH7A 3M7IA 3QKTA 3DD5A 4HWRA 4FIDA 3WLRA 3ZS9A 4KNWA 3WWOA 4COKA 3HHPA 3IESA 1TQDA 1EQ2A 2Y93A 4HGOA 4MQFA 2C58A 1K2WA 3P52A 5LDGA 4RPHA 4W7SA 4QPCA 1QYDA 4GDFA 1JB9A 4YRFA 1CEXA 3WDLA 1ADGA 1V5WA 2PANA 2JFXA 3H9GA 1HG0A 4OLBA 4PO1A 1U6IA 3IAUA 4PCAA 1HFJA 2SBTA 1FMTA 3C0KA 1R5OA 1WMSA 1L4YA 3V33A 3KPWA 1XBTA 1GGEA 1M5RA 3ABRB 4NBNA 2C31A 4RF2A 4YI3A 4WPGA 2OZPA 4M87A 2JJ2D 2BC9A 4GXRA 2QRGA 3IR6A 1II0A 3WDMA 1G5PA 2BFFA 2H63A 2TMKA 2VNAA 3ECSA 4LZOA 4NE7A 4WE3A 5DXFA 4ECEA 4JVNA 4IH1A 1PFYA 4ALNA 3PXCX 4Q05A 1JMVA 4YAIA 2H1HA 4F38A 2BH9A 3MTJA 2P2ZA 2WVGA 4NF2A 4WFKA 4C2TA 2J48A 1REQA 5AVKA 5AVSA 3DA8A 3CRW1 4ESHA 3GFQA 3MJ4A 3B1KA 3ADOA 5J5AA 3SK0A 4D2IA 221PA 5KCMA 4NVRA 4F6RB 4CN9A 2ZUDA 4IDDA 5BNIA 1DWOA 2VNIA 2VNKA 4QXPA 5DI3A 1JGTA 3DAFA 1X15A 4PV7A 2WIJA 2YJ5A 4HZUB 4DNOA 2KSQA 3PEWA 1WXDA 4J9UE 1ZH4A 4B3TB 1W5TA 2XNJA 4HS9A 4WBNB 3TINA 3PX7A 3T1QA 2FPPB 3UO8B 3ZTYA 1DINA 5C52B 2HRCA 2H1IA 5EY5B 2Q9CA 4IHQA 4Q19A 1JPUA 2ZJ2A 2RAVA 1QF7A 4EUFA 2A3NA 3LT0A 4OTZA 1BJRE 1BE1A 1O95D 1OILA 3DMFA 5EAIA 4RL6A 1K5DA 3BQNB 1FPQA 1ZN9A 4H3VA 3JALB 4MUYA 4XEUA 4Q4LA 4KXQA 3MILA 5EKXA 3PNKA 4N03A 5LWHA 2P6PA 1UPFA 1YQQA 1YFKA 4L2IA 4EG3A 3IPRA 4E2FA 5JXGA 3LUPA 5ITZA 2F3PA 4R1OA 5BNTA 1NRXA 4BNXA 1V3VA 4IAOA 2JAUA 8MHTA 5NULA 4TV8A 1QE0A 4OMDA 3WIUA 1LLFA 2WUDA 1PR0A 3PC6A 4OBEA 5JY6A 4UDNA 3TTWA 4W9MC 3WV5A 1TGVA 4PYOA 4H7KA 2OFXA 1ZM9A 3IFSA 4EGFA 4ZI7A 1EFDN 1FTSA 3UA4A 1U2ZA 4HEJA 5T7BA 4KFTA 2V8BA 3BA6A 2IYTA 4RF4A 1X7YB 4OM8A 4ZHQF 4HLQB 1DC4A 2RK6A 4KN6A 3V2GA 4D1YA 1TUEA 1EZ1A 3RYCB 1M6VA 2I5PO 4L15A 1L5RA 4DSAA 5A04A 3IULA 3PVCA 3EIWA 4MRSA 3I8XA 4RJ2A 1S0UA 5K6AC 4OLHA 5KYXA 4Q4HA 4G1CA 2IEIA 3RRXA 4TOIA 4FMPA 4B82A 3Q8XB 4KYIB 4QGAA 1EPUA 4V24A 3WOHA 4YMHA 3F74A 4WUVA 4F96A 1ZNXA 3KVVA 5KQGA 4DUZB 2IHKA 4NZZA 4LXTA 2GETA 4MIEA 4K9KA 4RD2A 4UUPA 1W88B 2GBCA 5J63A 2VJMB 1BS2A 2HGSA 1T4DA 2YOGA 5TT0A 2V7PA 3U1TA 3FUTA 5TMDA 1TF5A 2C5LA 2DR0A 1SCJA 2PKEA 3DBIA 1QDUA 1NVBA 1WKVA 3H2BA 4P2BA 3T7EA 2HT1A 4RABA 3WWDA 1I7NA 3C6ZA 2E85A 4W1QA 3V6MA 4M46A 4EQZA 4Q9LA 5KJ6A 3PQFA 2G76A 4KAJA 5AFSA 2ZE5A 3G13A 2C5EA 2FY8A 5CVCA 2AG6A 2EW1A 1QNLA 4YIHA 2IE0A 3KHSA 4DV5B 3Q6MA 2Y0DA 4BX3A 3FYUC 3O47A 1Z4QA 1XVAA 1KKUA 1RYZA 5AM1A 4YY3B 3INRA 1N2GA 1OFTA 3A14A 4L95C 1IK6A 2V0NA 1DAHA 3F2IA 3ULKA 1COWA 2ZT5A 3FFAA 3GLSA 3CHYA 3QITA 3T5BA 3WLFA 4RACA 2C2WA 3DLCA 2WYOA 4EJSA 1NBEA 4XFJA 4ETMA 3G2QA 5TB5A 3NFRA 3LTEA 4BX2A 4QSMA 4D0NA 4ZU1X 2DPGA 2B3TA 2B4YA 5U4XA 1AD2A 3ADBA 1BKYA 3L77A 4BNZA 2NO4A 2FTKE 1FFEA 4HJXA 1J09A 5AJHA 1F2UA 3VVCA 1IB0A 3ZWYA 2FPMA 4LRQA 3WK6A 1RYMA 1WV1A 1KBQA 2AF3C 2IYYA 2RDMA 3H8VA 4FYJA 4OHBA 5ARDA 3T7SA 2AV6A 4INZA 4BVJA 4ZOQI 4GAEA 3K9LA 1JKMA 2GJAA 3EZ7A 4D92A 4D9GA 2GHTA 4P4UA 4KACA 4XJVA 2CW5A 4ND1A 1J7KA 5DHUA 1G2PA 1M5UA 3JV7A 5L3RA 1NMXA 3QWIA 3K8YA 4NHEA 5B3LA 1WZNA 2PS1A 4NZOA 4MWBA 1J5PA 3X0DA 5IVKA 4MW2A 4C89A 4G23A 2JZOA 3KKKA 3CURA 2V97A 5T3UA 2QROA 5DBEX 3HBJA 4BTLA 3ZGNA 1QHSA 2V5AA 4BKPA 1N8KA 1N9KA 4CM8A 3GVXA 2DLCX 1P7VA 5IK2D 2Q28A 3BCRA 3FGOA 2ZI5A 4ODIA 4AY5A 5JXJA 1EVIA 1RI3A 3MB5A 5I7WA 2C4MA 5ALPA 4P4GA 4LSGA 3G0GA 1W2WB 1QRAA 2V5VA 2ZS8A 2AK3A 2GFQA 2PWBA 4HNGA 4R31A 4YN3A 3S2YA 1N9GB 1DCMA 3EVDA 4HXGA 3JZDA 3Q5GA 3SM3A 4C0AC 5AR1A 2XB4A 4GSLA 4EUEA 5GTDA 4JMPA 1S7CA 3W6OA 3P2JA 3HR7A 4DY6A 5FRDA 1KJNA 1VJ5A 1XZPA 2JEYA 1VHDA 3BWBA 3M89A 4HDKB 4WK4B 4X1KB 4D0GA 3W3AD 3AZQA 4W1SA 1OXMA 3G0CA 2YV4A 5LNK6 1P73A 1WL8A 3E53A 5C7IO 3QFTA 4KQXA 9LDTA 5SY6A 3KQTA 4L08A 4RFSB 4R7GA 2E82A 2C2OA 1CUWA 4B4UA 4ZMBA 2QRPA 1ODTC 4GHWA 4UBLA 1NPYA 3WWEA 3IA7A 4B87A 4BDTA 4CYMA 4ZYVA 1VPWA 2O5CA 1QO0A 1Y1KE 2BR4A 2LVBA 2ZZKA 4D3XA 1PK7A 2JNWA 1J2RA 4M9CA 4LXGA 2NUTB 2I62A 3PTLA 1X9IA 2H31A 1SC6A 2XDYA 3OFJA 3W2GA 1XX6A 3QFSA 4A8JB 1N6OA 3W9BA 2GHIA 3QXSA 3EVAA 1UUFA 4MP8A 4KV7A 5TJ9A 3OZRA 4E88A 4D46A 5BQ3A 5CGZA 1G4AE 2EARA 5C51B 1JHYA 4RA6B 1DNPA 1E2DA 1XL0A 1CJCA 5TX7A 1AK1A 4EA9A 2FPRA 5LQJA 1SXGA 4KI7A 1R6AA 1HI9A 3HZRA 3QF4A 2CLFB 2QMUA 2QRZA 4JI0B 4LPKA 1IMOA 3F2VA 1C7JA 1DHRA 3DMTC 4BPBA 1Z07A 2QJFA 5B12A 4X6LA 4XRGA 1PX0A 4Q1AA 4KITB 2A5LA 4GP6A 1JAHA 4W99A 4DIKA 1C3EA 5LA6A 4KQ9A 3ZY2A 3HYLA 3G5UA 3CWZA 1GQ2A 2CJXA 2QMEA 3QOYA 2RH8A 5JCJA 2AXNA 2HU5A 3FPAA 4ZT6A 2FRVA 1ESZA 3LUAA 3LZCA 3UVEA 1TJYA 1UC4B 2AI1A 5ICEA 4MINA 1JE1A 3QELB 1I10A 5GP1A 3BL5A 1XZFA 2KM1A 3E7WA 3HVIA 4PG6A 2GYYA 4WNAA 2YX1A 3RG8A 5J4KA 1N6NA 2YOFA 5INTA 1DEOA 1T13A 4ZEMA 3E5NA 1CD5A 1MPXA 1KO5A 1CNMA 3R5TA 5ALMA 5KSWB 2QUBA 3OFVA 3EHEA 3X3HA 2PD4A 3ANNA 1YT5A 3DEIA 2DJIA 4FQ8A 1G16A 1RWOA 1CYDA 5HPYB 2AMVA 1SAYA 3O3OB 4RKQA 1PZMA 4BMSA 4V3CA 3JQGB 2OORC 3W5SA 3MA0A 2FUCA 1O0SA 1PFQA 1B3BA 2WZQA 5I7VA 4KXYA 1NIPA 1D1SA 1OH5A 1KZ7B 3T54A 4CG1A 4M54A 5BUQA 2H85A 3B3AA 4IJ6A 1DC8A 1E9CA 1HWYA 1J20A 4JOCA 4CKXA 3S6JA 2HWKA 3ZW8A 3DUFB 1SZPA 3WYBA 4YA6A 4U3JB 4MLDA 4MAAA 1RQ2A 2B78A 3OLYA 4JKYA 4Q18A 4UNSA 5U4QA 1PQYA 3UMYA 5CYOA 4ZVMA 3FHOA 5H4GA 2X7XA 3FNIA 3HGTA 1M73E 4WFIA 2WJHA 3Q10A 4B6GA 4CQMB 1RT9A 3DB1A 3NP9A 1SCDA 4L0MA 5EUQB 5JCZA 2IHTA 3BTSA 3LBNA 1E3JA 3CXRA 1V7PC 3ET5A 1Y5RA 4LJYA 3VPHA 3TD6A 1NFFA 721PA 3UK6A 2WQ7A 2ISCA 1G3MA 3QZUA 4GPAA 4YONB 4A16A 4F5YA 1T2CA 4Q7MB 1VJRA 4DNFA 2BCGY 3RC1A 1X19A 3V42A 3GOHA 1JQBA 1I6LA 2LP4Y 4FFMA 1E1NA 1V8BA 3E9QA 3PJGA 4XGRA 3ICEA 5GONA 1L7EA 3CG0A 3DBRB 3VYVA 2PXCA 1Y8QA 2WRZA 4IPTA 3NV7A 5IX8A 2JRLA 1PNTA 1RPNA 2VHXA 3DOHA 4OJKA 1H9CA 1QFZA 1MZVA 2X2OA 2PCJA 3JQBC 2IIVA 3A1VA 3I6IA 4HVAA 5AWFC 2FSPA 2XECA 1PL6A 1WR8A 3EFOA 3FPSA 3IPLA 3LQKA 2PIDA 2OHVA 1YA4A 2ZRNA 3KWJA 3AYZB 4C06A 1J97A 3DDNA 2GCOB 3LCMA 1T9HA 2IELA 1VE3A 2FMFA 3NZEA 3L7KA 2GXAA 1T6ZA 4CW7A 2XYQA 2AOUA 4RKFA 5LJIA 2EHJA 4UXHA 2NUAA 3GNLA 2PR2A 1O95A 4R2IA 3P0IA 5KJFA 2SCUB 4L72A 4ZOAA 2E4ZA 3L1VA 3TAHA 2B8EA 5K3FA 1F4LA 1EVLA 3A4YA 2BGRA 4W5OA 3K1AB 4Q82A 1DQRA 3T9CA 1GU1A 2W11A 4WOBA 2PN1A 4HG2A 2R11A 1TM4E 3D8RA 3H5TA 4HH4A 2AN9A 5COQA 2VCHA 4QGSA 2ZDGA 3GGSA 3FDZB 2CBZA 3EIHA 1QIEA 3I9KA 4MVXA 4RDHA 3AILA 4G5YA 1BCRA 2FEXA 4OHOA 3RVKA 1GKYA 3ENNA 1IZ7A 2H2DA 4KLNA 4QGGA 5WRFA 3DDWA 1L3BA 3BXXA 3TIVA 4BFXA 1D2EA 2NTJA 4XB6B 4F06A 2XJ4A 3WRWA 2C3OA 2QX6A 4J1TC 3KB2A 4F1KA 1TEZA 3UYKA 4LF4B 3NM6B 3TMYA 1R3DA 3HCBA 1PQUA 2B69A 2QORA 3DZHA 4FT2A 2QE6A 3OLZA 3UUGA 1G4HA 4D9EA 2IGTA 2R8RA 4OSEA 5EJAA 4P7BA 3KQLA 1E4YA 1V43A 2H1FA 2PLRA 1KZ4A 1VG8A 3PHIA 5CEEA 1ILEA 2D4AA 3ABSB 3M1IA 1JH9A 3JS5A 3VJKA 2OFFA 4UTVA 1PR1A 1ZN7A 3KPYA 3HCCA 3PITA 2DY0A 4WN9B 3U4HA 3N39C 4FFVA 2BJWA 1U7UA 3E23A 4BX8A 4XB1A 1UOOA 2WIAA 1KKMA 3D9QX 2Z9BA 5F1YA 3M6LA 1ULZA 1I9GA 3L07A 3I42A 4HLDA 4ARCA 1D4FA 2C9MA 1MQAA 4F3TA 2FMXA 4GO1A 1KQFA 2Z57A 3H1FA 5EL0A 5C8ZA 4I2VA 2GK4A 5SYAA 1XCBA 1SD1A 4GL2A 3DG9A 3DXYA 1YF3A 4LJRA 1Z7BA 1ODKA 3KZVA 1HMPA 1OY1A 1I7LA 2BI4A 4QQFA 3UATA 2CLMB 2DF8A 3KJGA 1KJWA 4DABA 2B92A 4LDRA 3TBHA 3WYFA 4BUZA 4D9MA 1ELOA 3DZIA 2O8NA 2ACEA 3NVKI 5CIWA 4Y1EA 4A2CA 4YPOA 1J90A 2Q21A 2XE4A 1EU1A 2HA2A 4TRJA 4EY6A 3ZOKA 4DBVO 1ZK3A 1D4ZA 3KYCA 1R4MA 5LP1A 1AMNA 4A9AA 2CKMA 1T9CA 2WPDD 5I5GA 4M22A 1TAGA 1UZAA 1UPUA 1DFHA 5K3CA 1H3FA 2QZJA 1OC4A 4MAMA 3TLYA 1PFWA 2QM0A 3K9WA 4BO5A 3B9BA 4MW6A 1LLDA 1FXUA 1RLTA 3HL4A 4LSWA 4D43A 4NYMR 3HZZA 4C4TA 4L9AA 3UHJA 4AXBA 3KLMX 4L76A 3T1HB 2VSYA 3EXFB 1JSLA 2A1UB 3R0XA 4IIHA 1QGDA 3LHKA 2HW8A 2CDRA 3H1TA 4PLWA 4C0LA 4U2CA 3O4RA 4BQNA 3KJEA 3UMMA 4CEIA 5TGTA 1UXHA 5BQPA 1PKEA 4RWZA 3HJBA 3N2ZB 1BX3A 3C3MA 2VHTA 4O08A 2EJTA 4YO7A 3AEUB 1PGJA 4H08A 3NWEA 4BLRA 3KELA 3C8UA 3C39A 2XYVA 2GGSA 1SXJB 4YTEA 5BW8A 4JL8A 1EZ4A 1K6EA 2O3TA 3DE0X 4GNRA 4QREA 3CUVA 1GGKA 3R0QA 4RF5A 4B09A 2JFBA 3CTMA 1L0BA 3BWMA 3F7TA 2HCRA 3ETHA 4RYLA 4AUMA 3HABA 1IL0A 3OQ1A 3U4AA 4IEFB 2OC4A 3G89A 5CDSA 2VI5A 1T35A 5CR9A 3IE0A 1CY7A 2Y6VA 1O8BA 3QJ5A 2VZ9A 4CIWA 4LOHA 1OB5A 2WFLB 4YLGA 2H4FA 4DMMA 5J4LA 1E92A 5JFTA 1Z0IA 3DDOA 2VZLA 121PA 1G63A 4CKCB 1UC8A 4B6PA 3L4KA 5B58T 4CLEA 2FQYA 2HA0A 3DEZA 4K46A 3RSCA 4I8XA 1I7SB 4I8DA 1KY4A 3EG5A 1R1DA 2QDXA 2X2PA 1W75A 4PLGA 4KFCA 3TNYA 4G0WA 3LOPA 1OIXA 3EBLA 2R2GA 1FE8A 1EMDA 1S8AA 4TZTA 3ZBQA 3MTIA 2QN1A 2PO5A 1QG2A 1N3BA 3SR3A 4MMZB 3KJXA 3W04A 1TYZA 2EDAA 1MVNA 2W7TA 3OOHA 3ZWDA 4OOEA 3GFTA 1NI3A 1QS0B 2YWEA 2X0NA 3R9IA 3UWMA 1YC2A 1DPFA 1U9ZA 2XYGA 3AZOA 3ZK9A 1CB0A 4YCAA 3VNSA 1SUSA 1P4RA 2BBTA 1J33A 4CR8A 3WAGA 3W7BA 1KXZA 2PUDA 4BAZA 2L0XA 2IF2A 3GHHA 3H8JA 1Z73A 5E0OA 4GYYA 3B82A 3WK8A 5A3QA 3FD8A 5CFOA 1MJHA 2QVGA 3OM8A 3SYRA 2DUMA 1ZOPA 4WKNA 4Z7OB 4JDPA 1FYVA 1IQUA 2IYEA 4WL0A 4L9WA 1RKVA 1OXSC 4BFCA 3ND8A 2AYXA 1P5FA 1X8KA 2NTVA 2JEZA 3CA8A 2P79A 2C2ZA 5HCNA 3L1JA 2BR3A 2N1BA 4RMIA 1Y1RA 5FUBA 4FMBB 4CEIB 2TSYB 2JIOA 5JVDF 5LQDA 5HR5A 4JELA 5F5LA 3QX9A 4Q4CA 2G4LA 1HXHA 2RGNC 4QU8A 5D00A 3WK9A 3FCEA 4TKUB 1EJ0A 2QGFA 5H3CA 3B6ZA 1W29A 4J7XA 4M8NE 1C2TA 5CB6A 4TN1A 2QA5A 2YIMA 3SKVA 1SUPA 2QG4A 3CS3A 1SXIA 3W5HA 5CA0B 2AE1A 4Z4FA 2HA5A 5JAIA 3RM3A 5ALRA 2G9QA 5K8JB 3NW9A 4MTCA 3QYPA 1UWKA 1L1EA 2ZSIA 4IV0A 5LA6F 4F71A 2BL4A 2EDCA 2C03A 3E35A 4HN9A 5JH7A 2E4XA 4P92A 3HJHA 3RUCA 5IFLA 1GGVA 1SMKA 2NXEA 3AHEA 1VLVA 1KI1A 2EFJA 3LWNA 4PR0A 2P6UA 2YN2A 3FZGA 2IGBA 4FHEA 4Q6WA 2WWVD 4J91A 2AFHA 1QLWA 2Q1SA 2HYDA 3U81A 3W2HA 1ABBA 2GLXA 1LTQA 2ZROA 3F6CA 2OOKA 1D2RA 3ILHA 1JJVA 3INTA 4LYFA 1KO7A 5TVGA 3PA6A 1W52X 1YQTA 4JEUA 1D2CA 4XSVA 3TQHA 1WF6A 3MK31 3GGCA 4I5GA 1FMCA 1NVVR 4GKJB 4IBOA 4BQOA 3ESCA 5F9HA 1R15A 1KYTA 3AV0B 4KQ2A 3TAUA 4RIGA 2H1RA 2WILA 4UBIA 2PQ0A 3OA0A 1GAJA 2MSDB 2NT4A 1SRQA 2X8LA 2ZJBA 3H2ZA 4GWKA 4JP8A 3UPDA 5C4MA 4QXMA 5EHGA 2Q2QA 2J85A 1EFKA 3PDIA 4UU0A 5A5DA 5BR1A 5AI0A 3FZNA 1R8XA 3AF6A 3KQSA 4EI7A 3GEGA 3IVXA 1KOLA 2XCRB 1ZD5A 4WGGA 5BRJA 3CZAA 2A59A 3IXMA 1HNNA 2O4CA 4AIRA 1FCJA 3HLKA 2VNJA 2OENG 4ER3A 5EIXA 1EHCA 3LL7A 2FUG6 3GWGA 4KN8A 4KN5A 3ZHUA 1Q7RA 2W8BA 4RIEA 5E8JA 4EHNA 1E32A 4BL5A 3KOWA 4C3VA 1B8OA 2F1IA 2IHYA 1PI3A 3PFBA 1E6LA 1O97D 1KJYA 2OHXA 4FJ0A 1ZCZA 3MMNA 4G5XA 2WM9B 4DCOA 2O54A 4V38A 2F9LA 6NULA 3KUXA 2FWBA 1AV7A 1I8TA 3RTEA 1E6EA 1NC1A 3ACBA 3KRTA 4RQAA 4DE5A 2GCGA 3UKDA 1XJ0A 3NWPA 5IT9A 3TFWA 4M0UA 1M2GA 4JJFA 1QCZA 4A2WA 5JEEA 5KKAA 1EHIA 1E9DA 3G2NA 1NJGA 2CVHA 2UVPA 2XTAA 4OKIA 4WKGA 2EW8A 5EE0A 1I1HA 4DQKA 1VBFA 2VQSA 3FX2A 4URFA 1NA5A 2IYWA 1Z5UA 3C6XA 4NH4A 1UH5A 4MHOA 4RFSA 5EYPA 3ELBA 5AXBA 1QX4A 1T2NA 3U3OA 4FDAA 1MOPA 5SZHB 2A0UA 3GG2A 4G97A 5DI9A 2GA8A 1WU7A 4UMEA 3AESB 4RZXA 1ORRA 2ODTX 3BHIA 4TT3A 3RTGA 1E20A 1QM5A 4PQGA 3A2NA 4Z0NA 4DMFA 3ADDA 4DWOA 4B7UA 1PJZA 2H1CA 2JKVA 5B3JA 3RJ9A 3JQBA 4J6FA 4KDFA 3GFVA 4E12A 2EEZA 3EH2A 2O3UA 5HMLA 1TLLA 2B0CA 4CMCA 1EFLA 4OX9Y 3RSQA 3CE6A 2VLIA 3QENA 5CJJA 5EXXA 4NBVA 5EIOA 5LA6B 1JFSA 4AECA 3R5SA 1XHLA 2FWAA 2EZTA 3D0QA 1WHSA 5HGJA 1ABFA 1RADA 3PUZA 4ED9A 1DKLA 1RJDA 3I8SA 4P98A 3KTDA 3ZDZB 2WB4A 3ISJA 1O8CA 4M1OA 1KZ6A 2HO5A 4RDCA 3YASA 2D3TA 4D4HA 3TUIC 4LYEA 5BWOA 4X85A 1TUBB 2IPOA 4UPDA 5F4BA 4MYTA 1O3YA 1BKSB 1R0CA 3A28A 1UZNA 2ADOA 3EXG2 3IAHA 4M9SA 4DLPA 3EDRA 2CNBA 3ETJA 3R6WA 3EZGA 1SHZA 5K9ZA 5DHPA 3LVBA 3U62A 2P0YA 3BCHA 4REOA 4GQAA 4NOLA 4D6PA 1DKRA 3HC7A 2X3FA 5FEUA 3VVLA 3I53A 2EX0A 3D7SA 2OK7A 2RGBA 1WEKA 2YXLA 2W2KB 1P1RA 3AG6A 3DBOB 5HM6A 4OOFA 1FNSA 3FRJA 1PT5A 2SKCA 1MO4A 2IZ5A 3PYLA 3AF0A 1CUAA 1IEWA 1VIYA 2X15A 3R0IA 3ZE1B 3ZHCA 3C3CA 4ACBA 1QP7A 1EKXA 1IN1A 4OREX 4QUAA 1SCUA 2Q1TA 3B7GA 5JPCA 3KSBC 3D7RA 2FI1A 1CZNA 5BOSA 4LSMA 2WJVA 5DTQA 3H18A 1SIBE 4B6RA 4LY6A 1BWRA 2I78A 2P9QA 1TE2A 1DG9A 4ZYYA 3OQBA 5DN6D 1XMVA 3DEHA 4CHGA 4Q5IA 3A1CA 2PX6A 2VAXA 4A36A 1YBMA 1Z4OA 1BQ4A 4CMEA 1FBNA 1ZMTA 2OGSA 5K3BA 3TZBA 4MS1B 2NTEA 1G8YA 2REOA 2SHKA 1LDMA 3IGFA 2QX4A 5IJ9B 2DPHA 3BUSA 4Z1MD 5L53A 2XNDA 3V4LA 3K94A 4OGFA 4ZPJA 3T1OA 3GAMA 4AD8A 2C8VA 1Y4AE 3FTCA 1G21A 4GGMX 1UXKA 4IF4A 4RYDA 1XDBA 4FGUA 4MR7A 1DTEA 4A73A 3P9SA 4JXXA 2GN4A 1NKVA 5TPZA 3TVYA 1UT6A 4JC5A 3DE7X 2K7FA 3Q0TA 3RYFA 3P7MA 2GDZA 1H0RA 3DEFA 4HMOA 4DQLA 2BHRA 2O06A 3GD7A 2UZ3A 3PU6A 1P19A 5GM2A 3RQSA 4B6OA 1DX9A 2FFAA 2XUKA 3HDHA 3EMKA 2CJWA 1JSZA 1M8FA 2O52A 5EZ6B 2LRHA 4YRCA 3WKAA 5B6PA 2JLYA 3N70A 1G3UA 4FZJA 3U3DA 5BNZA 3C2QA 4GLLA 1VFNA 4QBHA 5HS4A 2DCUA 4NKRA 5FR1A 3VC1A 3JWHA 2WKSA 3CLHA 1RHJA 3MTDA 1C29B 1U3UA 2VYCA 3D1VA 3DZJA 4RM2A 2WIBA 4UD2A 5AKEA 1ECBA 1PNOA 1N0VC 4TQGA 3M6WA 5DHAA 3V1LA 4EI9A 1KDTA 8AT1A 3QSGA 4YQEA 4HH3C 3NHJA 3FYSA 3RKSA 1AO0A 4G26A 1IWOA 3UWPA 1B00A 1T5HX 1YGPA 1HZZC 1VE1A 2PRZA 1FK8A 4YRKA 5BR4A 5IJ0B 2H11A 4IRXA 1LTKA 1RQGA 2Q6TA 2H2GA 1P91A 2EG9A 4YRIA 1TCVA 4N47A 2A7QA 5B57C 3GARA 4CL3A 4TM8A 1G8AA 3L7IA 2XZTA 3LQ2A 1KMHB 1N1DA 5EI5A 5C37A 1VA4A 3ESXA 4C3ZA 3WRVA 4ID3A 4QECA 3A0RB 3DL0A 4W63A 2I71A 4MO9A 3LGAA