1YTLA

Crystal structure of acetyl-coa decarboxylase/synthase complex epsilon subunit 2
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
158
structure length
158
Chain Sequence
KMATLLEKGKPVANMIKKAKRPLLIVGPDMTDEMFERVKKFVEKDITVVATGSAITRFIDAGLGEKVNYAVLHELTQFLLDPDWKGFDGQGNYDLVLMLGSIYYHGSQMLAAIKNFAPHIRALAIDRYYHPNADMSFGNLWKKEEDYLKLLDEILAEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetyl-CoA decarboxylase/synthase complex epsilon subunit 2
publication title Crystal Structure of Acetyl-CoA decarboxylase/synthase complex epsilon subunit 2 from Archaeoglobus fulgidus
rcsb
source organism Archaeoglobus fulgidus
molecule tags Structural genomics, unknown function
total genus 56
structure length 158
sequence length 158
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02552 CO_dh CO dehydrogenase beta subunit/acetyl-CoA synthase epsilon subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 1ytlA00
3U31A 1EFPA 5MFPA 1U28C 1PI3A 3K35A 4X3PA 2VJYA 4UTNA 2EZ8A 3ZG6A 4MPJA 1T9CA 2Q28A 1YHZA 4BN4A 4K9OA 1Z8NA 4UU8A 3CF4G 4JUCA 1Q1AA 2Q5QA 5DGTA 2VK1A 3IAFA 3E9YA 1Y9DA 4Y6OA 4JU9A 1UPBA 1OZHA 1BFDA 2OO5C 1Q14A 2IHTA 4UTVA 3JR3A 5K2OA 4BVFA 1JSCA 4BN5A 1SZDA 1T9AA 4BVHA 4BVBA 2AG0A 3PDHA 2EZ9A 3HWWA 1PVDA 2Q5OA 4ZZIA 1OZFA 1S7GA 1U2DC 4RMHA 4FVTA 2IHUA 3CLSD 5BWLA 4RJJA 1ZPDA 4BV3A 4F56A 1D4OA 4COKA 2JIBA 1M2HA 3CLUD 2NXWA 2H59A 1E3TA 2OD9A 3HWX1 4FEEA 1YC2A 2H2DA 1POWA 2EZ4A 1PT9A 2QQFA 2WVGA 4IG9A 2OD7A 3IAEA 2Q5LA 4I5IA 4RMIA 4MPRA 1DJLA 1YTLA 2PANA 3FLMA 4UTRA 4IAOA 1Q17A 4V1CA 2FRDC 2C31A 4QPZA 4TWIA 1MCZA 3GLRA 1YC5A 3D7KA 4GG1A 2V3WA 2VBIA 5IMSA 1J8FA 1ICIA 4R8MA 2UZ1B 4GPEA 4UU7A 1PO7A 1U2GC 5MF6A 3F6BX 3FZNA 1O96B 2EZUA 1YI1A 3ZGOA 1U31A 4JU8A 4RMGA 1MA3A 1Q6ZA 1PTJC 1M2JA 2OD2A 5EJ6A 1XLTC 5EJ8A 2JLCA 4TWJA 4UTZA 4Y6QA 4K9NA 2H2GA 4HDAA 4KPUA 2DJIA 5BWNA 3PKIA 1T9DA 2B4YA 4C7BA 4JUAA 2H2HA 1UPAA 3GLTA 4BUZA 5EJ5A 4K9MA 2NYRA 2EZTA 4V1CI 3PKJA 3JWPA 3EY9A 2PGNA 5BWOA 1HZZC 4GM1A 2BRUC 1M2KA 4RMJA 4G1CA 2WVAA 2HJHA 5EJMA 4QELA 4GP9A 5D7NA 4BVGA 2OORC 2FSVC 3GLUA 1T9BA 1YHYA 4QQ8A 5AHKA 4Y6LA 2JI6A 4F4UA 4JD5A 2FWNA 3LQ1A 1V5GA 5FYQA 4RJIA 2QQGA 3OE1A 5EJ4A 4K9QA 4X3OA 1OVMA 5EJAA 1NM5C 5DEIA 2JI8A 4UTXA 1POXA 2H4HA 3EA4A 4UUAA 4JSRA 3F6EX 2A1TR 1EFVA 2H4JA 4J16C 4JT8A 2JLAA 2VBGA 1PYDA 1SZCA 3D4BA 4O8ZA 3U3DA 4ZP1A 4Q9DA 4JUFA 1PNOA 2FR8C 4FZ3A 3CLRD 4FEGA 4V1CB 5MFZA 4L2IA 1OZGA 2IHVA 2Q27A 2W93A 2AG1A 2H4FA 3FSJX 2FN3A 5MGNA 1N0HA 4JUBA 5EJ9A 4JT9A 4K9LA 2PGOA 3D81A 1S5PA 1O97D 4C78A 1YNOA 4MPPA 2H2IA 5EJ7A 3GLSA 2VBFA 4BV2A 1QPBA 2Q5JA 4GM0A 3EYAA 5K6RA 1M2GA 4BVEA 4K9KA 1YBHA 1V5EA 2UZ1A 4RJKA 4GM4A 2X7JA 1UPCA 2H2FA 5K3SA 5DGDA 4MZXA 1PNQA 2A1UA 2VK8A 4HD8A 4IF6A 3ZGVA 4D5GA 1V5FA 4UUBA 5FEMA 1YI0A 4MQ5A 4JUDX 1M2NA 3RIYA 2JI7A 4J1TC 3CLTD 2JI9A 4K9PA 2Q29A 2WVHA 4KXQA 3RIGA 4L3OA 4D5EA 4KGDA 5K6TA 2VK4A
chains in the Genus database with same CATH superfamily
2Y0EA 1REQA 3M1LA 5T57A 4YR7A 2JK0A 4IQ8A 2FLVA 4MRMA 3FNEA 2XXBA 4D7AA 3NAQA 2F17A 3Q7TA 1U1FA 1A82A 2YZGA 4PICA 1C14A 1NSTA 2RONA 3O4GA 2UAGA 5EEGA 1Z5UA 2KW5A 3BMCB 3QE3A 3JQCA 1CJBA 3DL7A 1A1SA 2QJOA 3D6AA 1JH8A 3W2FA 4J3NA 3UFBA 1PJ2A 3DZCA 2A84A 4XZ3A 3OQMA 2AEEA 1FTYA 2P9TA 5EWMB 4X1OA 4DJTA 1YRHA 5K0NA 1OUMA 2DBYA 2JFYA 3GGOA 5JT1A 2OYCA 1M7BA 2IXEA 2XJ9A 2ISSD 2O2IA 3VI3B 4LK3A 1HYQA 5ALJA 1ZHHA 5IWAB 4K9OA 1IH8A 1Z8NA 4UAVA 5AHXA 3RC3A 4LWZA 4M1KA 1N5MA 2G80A 3JSAA 1HL7A 4FEAA 3V48A 1V96A 1Z7YA 3W2IA 4DLWA 2FG7C 2M6RA 2NUAA 1KQOA 5CM2Z 3RBAA 2X8JB 4ALMA 4NYMQ 4EHIA 2PU7A 3DAPA 2H0AA 4J29A 1USGA 1UK8A 2X2EA 4DLTA 2HRDA 3TW0A 1HF3A 2X9LA 2VK1A 2VHYA 2V6JA 2PZFA 1MR3F 4BFSA 5KI6A 4BX3A 2WIAA 1V47A 5BVGA 1T5TA 1P6UA 2ODEA 3EASA 1ZH2A 2X1HA 3ZBTA 3IKMB 3L6CA 3P19A 1GA1A 4F91B 1L3BA 1SZJG 1Q14A 4ER7A 2GPWA 1EXNA 4WERA 1XEXA 3VO8A 4G0QA 3BN3A 3PB3A 4OQLA 3LLCA 3HCAA 2ZRFA 2VIIA 2HMSA 1KH1A 1DKOA 5C7LO 3X44A 1XALA 1L1QA 3E1GA 1JJIA 1GN9A 4LDZA 4RF4A 5KTSA 3ZD7A 1XRRA 2ECFA 4I55A 1ZD4A 3BXHA 3QG5A 1EVIA 4ZAFA 3P2EA 1VRVA 3AOGA 4M9UA 3ZXSA 1PEAA 5I4BA 1I9GA 2YFQA 1PWZA 2W2MA 3OZAA 2Q5OA 1JHMA 1YB6A 1RYEA 2ZVJA 5REQA 1OZFA 3PEEA 4AF8A 5KQRA 2C5LA 3NG1A 5CHEA 3CJQA 2BFDB 5KAPA 2Y1CA 3AL2A 5TF4A 3HFRA 5IAAA 1Q0RA 2JI4A 3F5DA 3KVRA 3HUEA 2V7GA 2CMDA 1QTRA 2QE7D 3ZU3A 4EARA 3LDUA 2D1QA 2D2XA 2GZ1A 5TR9A 1JMVA 1D5CA 3KR2A 3T6KA 2G07A 2P5UA 3UJ8A 2HF8A 3TX6A 3RYFB 4KACA 3OFNA 1VSTA 1PD1A 2PR2A 3F98A 3RSHA 3WGOA 1G9SA 2IUFA 2C4WA 2GYYA 3NXKA 1Y8AA 4MJ3A 2PGXA 2REBA 3EXG2 5EIXA 4G41A 4N5NA 2QL7A 1SK8A 2H85A 2NTYC 1KF0A 2CLIB 1G8YA 2HK8A 3BZWA 3P94A 4L95C 4Y0NA 5FBWB 2HIAA 2NSYA 2O19A 1RJFA 2FDCA 4JCOA 5JXGA 4L9WA 4AMYA 3C3KA 2FSPA 4EG3A 5IXYA 2IPOA 3TBKA 1OILA 1MO5A 1IZ7A 1HE8B 2C4KA 1OYOA 3OJLA 2JB9A 2QIOA 3SU8A 1FX0B 3HUFA 3TTUA 1PR9A 1U9YA 2CLCX 3JQAD 4Q6WA 2TMDA 4H1HA 1NHWA 1RHRA 4L9SA 3OA2A 4RMIA 2XCSB 3S28A 2IEZA 1OHHD 2VP6A 1PJ8A 3TXAA 3UHAA 3LS2A 1I7DA 3AVUA 3CTMA 1MX1A 2F3RA 3SMQA 1AKVA 1ORIA 4MINA 4DEVA 3CLHA 2WWGA 2X14A 1C7RA 2CLLB 2FRDC 4U7TB 4KBFA 1BYUA 3B48A 1JKIA 2Z56A 4QPZA 5EUQB 2YWEA 1FFDA 2G17A 2ZDGA 4IX1A 1ODLA 1P7WA 4IDDA 3S5UA 4XH9B 4FNMA 4CTJA 5LL6P 3ZY2A 2PUCA 1Y6ZA 3L02A 3PD1A 4B82A 2PMBA 4EWLA 5A4FS 2GHTA 4C0WA 2GFQA 3LDFA 2XODA 2OB2A 4E03A 1OB2A 3ZVNA 3LKZA 3KTDA 2IU4A 4KC0A 5EMMA 1NFFA 1MZPA 3ZQJA 3CWCA 1LK7A 3FZGA 4DCCA 1Y98A 2OV4A 4GI5A 1A5ZA 4X20A 1A7JA 1B42A 2Y27A 3F9IA 4G56A 2EIXA 4QGAA 4ZCTA 4ZCMA 3O1JC 1AKEA 3SR0A 4HDCA 2JGEA 1CDOA 4K86A 2RHMA 3M6XA 5KNCD 5L4NA 1RS0A 1ZOIA 3GYBA 3SQDA 3BWXA 3OO1A 2WG2A 4D6PA 4XB6B 1SA0A 3G5TA 3LY8A 3ACCA 3OOJA 1DRJA 2BUAA 2LUOA 1BKDR 1JFRA 1G5TA 2EC5A 4MV7A 5AM0A 2V9CA 2WV9A 1GQ2A 1JDTA 1VYUA 1OVGA 1Y1KE 3A04A 3K53A 4KRXA 1P1RA 3QQ5A 3MGKA 1RWOA 4HVTA 4X92A 2VK2A 2Z95A 3QTTA 2WAXA 1U2ZA 1CB0A 1A5AB 3NU1A 4RBNA 1U9IC 1A0OA 3CYFA 3IX7A 3ME5A 2FF5A 2ZOSA 4J2TA 5HXAA 1ZUHA 5JH7A 4TXNA 4EJ6A 1ZP6A 2QZ9A 3V1YA 3ORHA 1MA3A 3AUSA 1PTJC 1RWWA 3IBGA 3K1AA 2PWYA 2R1TA 2W6CX 4FYXA 2IXTA 1RZVA 2MTBA 4OB7A 4KQIA 1V9LA 1YZVA 1JQKA 3NBYC 4K28A 2VG8A 5AHWA 2EHJA 2EQBA 1LLUA 3BZBA 2DQ4A 4EEXA 2K7ZA 2ZIEA 4IJMA 3PEYA 3V7WA 2UKDA 3CS3A 3L40A 1KZ7B 1FCJA 3JAMA 1E77A 3CH7A 3ZZMA 2JEZA 1V5IA 2QRGA 3ZJUA 1N2IA 3G49A 4FSDA 1VSQA 5CX1B 1AGYA 2LDXA 1OZ0A 5DFAA 4Z49A 1MOSA 1IBCA 1TQ8A 2IIVA 2ZTHA 4ML3A 4DCPA 3RYIA 1A9XB 5A5VA 5EP2A 3IV9A 3H9JA 4FFSA 4JUAA 4YONB 4EGSA 5BV0A 2XXAB 3LUHA 2NXNA 5CA1F 4C08A 4NECA 3LKBA 4EMSA 1HE2A 1OSNA 4RKRA 1ZICA 2FPPA 4UVGA 1KJNA 1Q1GA 1U6IA 5CK5A 3Q98A 4L9RA 3DJYA 1GCOA 2FW7A 4E09A 1A7AA 5FA8A 2NX2A 1JXOA 1G9XA 2Z9DA 2H51A 4JJKA 4K5QA 3R7AA 4RSMA 4WNAB 1Z0IA 1XCLA 2Q1WA 2NO4A 2DWPA 5B64A 1P5JA 4MR9B 2CEKA 5DX0A 2DAPA 1Y1PA 1TLLA 2PGNA 2PUWA 5EJFA 3G8CA 3ZXIA 1E4EA 1NVVQ 2P41A 4A91A 5FTJA 1VSVA 1DO8A 2GBIA 3ICWA 1T0JB 5I5GA 3Q0IA 4EFNA 5MDHA 3TLGA 4QJ3A 1ODIA 5H82A 1WCYA 5KYWB 3GGDA 1RWBA 1D9XA 3KVOA 4RMJA 3G9XA 4FQ7A 5EHXA 3NWBA 3EZ9A 5BMVB 2CYBA 2GAJA 3GV0A 1Q44A 2DH6A 4W5NA 2Z2YA 2WHQA 3UAGA 1MRNA 4M0MA 2I3DA 3OPYA 4G8CA 1DJPA 2PLWA 3DB1A 1DFGA 1U6JA 2HJSA 3LWBA 5D6OA 4ZT4A 5AVZA 1ENPA 3H5VA 4FFWA 1DI0A 1SUBA 2WSYB 4WBNF 2JLVA 1ZIYA 1Y82A 2A5LA 4CPDA 3GG2A 2WJ6A 2YVQA 1YHYA 4G37A 4Q37A 3EMBA 1PRYA 1G291 4JXJA 4N0PA 5ALNA 3ASZA 4OM8A 4B31A 4RPCA 4EF5A 2H4YA 2ZK7A 5HS6A 2Y0DA 3RAPR 3MK31 2X7HA 3ONFA 4QX6A 4WOBA 1Z28A 1YS1X 3AF5A 3L0CA 4L50A 1ND5A 1XTBA 4JK3A 5THKA 4K3UA 3CKMA 2XYGA 3ELYA 1GGFA 3LP5A 3W5BA 3LXXA 4KDFA 3EFHA 5ADUS 1XTSA 5JBQA 3RUHA 3LPNA 3W8DA 3DYIA 5FJIA 3IUMA 3HUUA 2WHEA 3GJRA 3FI0A 5K3AA 1PD0A 1EQAA 3GUUA 4IIJB 1CDDA 4ZCPA 1ABBA 2NXJA 1XZAA 4Y7DA 4OQDA 3AVYA 2Y3IA 3M6LA 1QHHB 1R16A 3I23A 3KPVA 4LY0A 1W4ZA 1QPGA 3B51X 4Y9DA 1Z38A 1AVTA 1TU0A 4BL5A 1U2QA 1NW6A 5JVDB 4DEXA 5I7FA 2V03A 5CHYA 3K6SA 2WUVA 4HLQB 5KJ1A 2GPYA 3U7HB 1POXA 5CB6A 2R8YA 4Q7EA 1WLYA 3ENNA 2GD0A 4N5LA 1Z22A 3H5IA 4ZKDA 5A1TA 1JQ3A 1L4KA 1TCAA 3G9TA 1PFQA 1Y3FE 3BCRA 2PKQO 3QF4A 4NZMA 4TV9A 4YROA 1KE1A 3IMKA 3WHIA 2ORWA 4CZ2A 2ZSKA 1FFWA 4HXYA 4YEDA 4BX2A 1IY1A 1W52X 4TKUB 5EC8A 4FDMA 4GH5A 4J91A 4JGBA 5L6LB 1HGXA 1RVDA 1UC5B 4B46A 1P1FA 4DCNA 1ELOA 3A6PC 2WW8A 2J09A 2ZS8A 1L7EA 2OQRA 2O8FA 4QT4A 2UYOA 1K68A 4A15A 3R74A 3ZW8A 2XGMA 2LIPA 4D9GA 4O4JF 3EOZA 1JYEA 5A9RA 4IMRA 1RQXA 3ETGA 1UXIA 4MB6A 4S1VA 5BSEA 2AH5A 3MJTA 4NH4A 1I94B 2PUEA 1R6XA 3KUUA 2CFRA 4WLNA 3QU9A 2DX7A 4NX2A 1C9YA 3WGUA 3U4HA 3RTGA 2VYND 3VKFA 4MW5A 3ABQB 1EM8B 3G6WA 2CZCA 1NF2A 3EWSA 2JS7A 4IKOA 5JNTA 1TQ6A 1WB6A 1PNOA 3HFJA 2H7VA 5BV7A 4DLYA 4FBGA 2E0IA 3GBPA 3CKKA 1AK2A 3TTSA 1FVXA 3LC2O 9LDBA 1XCGB 1ZQ9A 1JTEA 5F33A 2J9RA 3BHNA 1E60A 4Q21A 4TS1A 2OE2A 1NVMB 5DSXA 3KYDB 2FW8A 3PENA 4GX1A 3VYTB 4TGLA 1ZRHA 3T52A 4UZEA 2BMJA 3RYTC 1YB1A 1SKBA 4G9BA 3ML1A 4V0KA 4ENSA 2Q4BA 1XAJA 1XEAA 4IJVA 2ECPA 2WNHA 3NASA 1YDFA 1RZRD 1G5QA 3GOHA 1S2GA 2HFJA 3MWEA 4FGUA 4J76A 1NP6A 4LHVA 1G63A 4QEZA 3X2FA 1AHPA 4LDRA 4MTCA 4OUDB 5D84A 4TTAA 3L8FA 2VDWB 6PFKA 1IBSA 1P9RA 4AUNA 1F51E 1GPJA 4B6RA 4EHHA 3D7RA 1ST3A 2YMQA 4TQ9A 5A05A 4WY5A 3REFA 4R1TA 4R9SA 2GQ0A 3V4PB 2AXEA 3P2JA 3AF4A 3U62A 3PIDA 4CMCA 3VM6A 1E59A 3I0ZA 3RM3A 2PPVA 1LPMA 2R60A 3GLSA 4I6GA 3MJDA 2ET6A 3RS4A 4FW8A 4ZTUB 4HS4A 2VLBA 2Q5JA 1D9ZA 3THSA 4MQFA 3RS5A 2BFAA 3BQNB 3D7SA 3O0DA 4DLAA 2Z4SA 3G2PA 3IC5A 3O8OB 1U2DA 1JHDA 4I1RA 3SZOA 5BUSA 3E61A 3NBMA 4X7BA 5EXXA 1J70A 1NP7A 1M2GA 2D5CA 4MUBA 2VJLA 2D8AA 2IF0A 3IR7A 4QHYA 5IM4A 1Q19A 3L4BC 4RVSA 1WBBA 3MRTA 2RHBA 3BCHA 2J33A 3W78A 4BNDA 1K27A 4MVJH 3DG9A 1MFPA 2FQYA 4Q9HA 3UB3A 4XPZA 1U2SA 2XB4A 3GMDA 3AJAA 2FDRA 2ZPUA 3KDPA 4MEJA 1HNZB 1IPEA 3TQQA 2P6UA 2ILTA 3EUFA 2MINB 3F97A 1Y1QA 4NBUA 3KK0A 5KTYA 1UKVY 1NV9A 2ZRDA 1W76A 3OM1A 3VR4A 4BWFB 1S2LA 1SVKA 2DFKB 3F4BA 1V0JA 3STYA 3AHHA 3EGXA 1OMOA 4XDHA 5LCXA 1EFRA 1TVKA 3FOCA 5FR2A 3NGMA 3PUIA 5AK3A 3LQ4A 2DPLA 2V7VA 1OH8A 4QUJA 5JWRA 4WJKB 1F2UB 3DV0A 3RU3A 3ABRB 3OQIB 1VG0B 2WABA 3BQ9A 2HDWA 4KWIA 3ABOB 1VXRA 4RQBA 1GFIA 3EFOB 1XQXA 4JP3A 4YJGA 3DKVA 4HAZA 5FBQB 4ETIA 4Q93A 4PSCA 2CD9A 3MB8A 5LBTA 3RTAA 1P0IA 2P8SA 1RPZA 5BOSA 5DNUA 1JSLA 1Z0DA 1ECFA 3OFVA 4I81A 3DCJA 3RVSA 3AF1A 5DH9A 2OAQ1 2RH9B 4RUKA 3D2LA 4L5CA 3U3RA 2HCTA 5DNAA 4FOTA 3HN2A 3MMPA 1ATIA 1SO8A 1CUIA 3HQ4O 1NVTA 4PFKA 1GKLA 1WP4A 2VK4A 5BSMA 3Q8KA 4F2PA 4H7IA 1DELA 1JSRA 1ZMBA 5FFNA 1P4JA 1X70A 2VQFB 1Y34E 1MG0A 4GLLA 4IIXA 4MW9A 4KN9S 5B53A 4DJ5X 3LBNA 3RTBA 4DQKA 1PJRA 1U0GA 2QX7A 2NU8A 4N0DA 3STTA 4DHWA 3O1IC 4YTEA 1G8HA 2GLUA 3R5KA 4BX8A 5CVTA 5TF0A 4MA4A 3TS1A 8ADHA 5BN4B 5DM0A 3C1UA 4F4CA 3JALA 3W7AA 3ZWWA 4FBLA 2RAVA 3K8QA 3LKVA 5JS7A 4XQGA 1N2JA 2QL9A 1XJ0A 2FMTA 1CQIA 3KIPA 1QB7A 3D1VA 3QRWA 3MWKA 2G6TA 1EJBA 1L4GA 1KSHA 2YV5A 2BJWA 3D3KA 3UFXA 1ZVQA 2RK4A 4ZI2A 5IWCA 3AI3A 2NUPA 4RACA 4FYHA 1WXGA 1E1DA 2C2BA 2J87A 3K2EA 4HP8A 3U40A 2BMDA 3SBDA 3I37X 3W5IA 4DPKA 2I9PA 3L6OO 3T12A 4YY3B 2OP1A 3C5CA 1W4BA 3B3GA 3IKTA 3R75A 3T8YA 3N86A 4OA5A 2AG5A 4KYVA 3NTOA 3SJ7A 1ZD5A 1TEXA 2I2AA 2YR0A 1ZGBA 1EE2A 3G2QA 3H8VA 1FPMA 3LYHA 3PL1A 2XQKA 4BB9A 4ZOCA 4DAOA 4EJMA 5BRJA 1P9WA 4ZWNA 1UDAA 4PLPA 2QI9C 2CB0A 2ZRMA 3WNDA 1PT5A 4DRZA 4UOZA 2KM1A 2BTOA 3WOVA 2D4HA 5D5QA 1ZN7A 4YMUA 2QN8A 3WLFA 4D92A 4CKCB 2I0FA 5TJHA 4M0LA 4M60A 3OLWA 1GN8A 4ZYLA 1J6UA 4QHTA 4TUYB 3T3EA 3X43A 3T5AA 4LHXA 1T25A 3L6UA 5TEWA 4I4IA 4BO4A 1XTIA 2VHVA 4BVKA 1VFPA 2DKNA 3P71T 4H1TA 4QXAA 2WJGA 2QAGA 5HIAA 2VH5R 4NZ9A 4BNFA 1GPKA 1ISGA 3RROA 1AB5A 4MH0R 3L8HA 4GNKA 2HMAA 4M0UA 5I8WA 1WHTB 3T9AA 2R1ZA 3TLMA 4EKGA 4U7HA 4F11A 5ISMA 5ENDA 3HCRA 4LCBA 4K9DA 3KYCA 5FPYA 4W99A 1EDDA 5HBRA 4IHKA 2ZRHA 1OBVA 3FVRA 1SKMA 3JAWB 3L93A 2XB6A 2E4YA 2PX2A 3AW8A 1KU0A 4A0HA 4QFDA 2E4UA 2R6JA 5K3OA 3S2IA 4QFCA 4HOYA 4CCSA 1P1KA 3I9FA 1RDFA 1DXYA 3DD5A 2Y99A 4D4KA 5KSWB 2OGWA 3VTKA 5DTJA 3GUHA 2P69A 2O1WA 1TJ3A 2AKAB 1E2HA 3VPAA 2NOAA 4B8ZA 1G1AA 5ICEA 3W6UA 2GCPA 4PG5A 1Y3CE 5AVRA 4F56A 3T7IA 3AVPA 1L8LA 3SVLA 2C07A 4WA7A 1BX3A 3DBHA 3QLEA 1I51A 3MCVA 2V7TA 4ZOLB 4CM9D 1KY4A 5A6VA 4OJKA 4R7ZA 3OEED 2QD5A 3SZUA 2ZBRA 3S81A 3L79A 3TVDA 1GKIA 2EQ5A 5AVVA 3FKSD 2RCYA 4EHLA 1CY4A 3PCTA 3EC7A 4MJLA 3D54D 4BASA 1JFFA 2AF3C 2HRRA 3FNHA 3HWX1 3MFYA 1N2GA 3GPLA 1PAUA 4MOWA 2LWIA 3S2FA 2FPGB 3KEOA 1P19A 3IJRA 4QATA 3IQEA 4JJIA 2IH2A 4HDMB 1UKYA 3FCSB 4MXDA 4XFKA 2A0UA 3VOTA 1KDTA 3ANXA 3KAJA 4LRYA 3I6BA 1LV7A 3QVOA 2ZI4A 4PGMA 3QKTA 3JQDA 1O94C 2EF1A 4U7JA 4H7JA 1I2ZA 4KWCA 4M1ZA 4MUIA 1VLHA 3WWOA 3L0DA 3UMCA 4Q4CA 3KXIA 2VQSA 2ZUTA 3BDVA 3QBTA 4LSWA 1KVRA 1WP9A 3GRUA 4MCHA 4TWIA 3UUEA 3F5FA 5ESRA 3NRJA 1TF5A 1SUIA 1S7CA 4C6SA 5E9JA 5AD1A 1RRKA 1W59A 1QIDA 2JFFA 3EZXA 5LQMA 1RM4A 3PX2A 3K92A 3LUPA 4B33A 4G4IA 3IRVA 4OSEA 4Y1RA 2JGMA 1OX6A 4EI2A 1J56A 2QMOA 3KJIA 3B85A 2GS9A 3H9QA 3P9SA 3CMMA 1HNNA 2HHLA 2IYNA 4LHWA 5LZ2A 4E33A 4EG4A 2C2WA 4I5FA 1A9TA 1NBME 3DA8A 4E6EA 2A1TS 3F5SA 3L5OA 4MGEA 1JLLB 3EOAI 3HP4A 3OCVA 4HWRA 4WSOA 1IULA 2WTXA 3DDWA 4RFSB 4HUQA 2RHCA 1X87A 1CR1A 1NPYA 3ZD6A 5EMLA 3UAOA 2NYVA 1SG0A 2R68A 1W6RA 3CSSA 4JITA 4PIVA 3U19A 3QEKA 1ZGJA 1PKXA 2P67A 1WETA 3DKRA 2QV0A 1DBPA 1E18A 5EZSA 5FNVA 4JQZA 4TT3A 1OFTA 4FDLA 1N8KA 3K6RA 4DJDC 5EHZA 1IN6A 3JD2A 4PHCA 2UVPA 2XTMA 1LRJA 4CM4B 5K3CA 1ZMXA 3S4YA 4PSAA 3VR1A 1R0KA 1YCGA 2AQKA 2NVUB 1AZTA 3PA8A 4LBVA 2J4DA 3FUWA 1M7GA 1VG8A 2Z5LA 4IH9A 1ZLYA 3O8QA 4TS3A 4MYDA 2E85A 4V2UA 5D51S 4CF4A 1A69A 5IABA 4IM7A 1B41A 2JGRA 2WPDD 4J2HA 4RMNA 1YO6A 1HO3A 2WHYA 5HM8A 4ID9A 3LUAA 2GEFA 4H3VA 1AQLA 1ZUIA 1Z7EA 3IEIA 2I22A 1Y7TA 2DUJA 2WAAA 1CY7A 3VO2A 3IVGA 4C4OA 2P78A 5E7QA 2UXDB 2CJPA 2ZRIA 1P5RA 3ENKA 4I14A 1T9DA 4P80A 2CD7A 2PQ6A 1L5OA 5KOHB 1QIHA 3UOWA 4CV1A 1PHRA 1QGUB 2B4YA 2XE7A 3NS7A 4LGYA 4ODIA 1ZCFA 3WGGA 2WJHA 2E3JA 1K8XB 3KFXA 4LNUA 1AHNA 1GA6A 4NAHA 1XMJA 5EPOA 1T2CA 4BUZA 3NB0A 1SIWA 4FR5A 4HGQA 4K6GA 3TZBA 1HOXA 4GE0A 5IARA 3S70A 1SWWA 4D6XA 1O6BA 2ICAA 2GJSA 3BE4A 4C7OA 3LLVA 3EA5A 1PJTA 3NBZC 4RV5A 2PKQP 1UOPA 1XCBA 4QO7A 1B93A 4RYDA 1YASA 2PKRA 2QD3A 1XXHE 3DQQA 2GASA 1P9LA 1PUJA 4IL5A 3WSWA 1QIIA 2X15A 4D44A 4KFCA 2V74B 4KYIB 4G0NA 4DMRA 1O6FA 5FOXA 4A2CA 4ASUA 5BWBA 1GADO 3G3EA 4KAAA 5JFOA 2Y4OA 2C57A 4RABA 1B16A 4P53A 5ITWA 3L49A 4V0RA 1WKCA 2YMMA 3CFYA 1AQNA 1TMKA 3VPXA 1WUKS 5CB4F 1C4OA 2WM3A 4YLGA 1SXJA 4U7FA 2HWXA 2YC2C 2I6UA 2WUWE 3LYAA 5CBKA 2GNOA 3ZXXA 3DZJA 2Z9BA 2G1UA 3SIPA 4CFSA 1P72A 4QHSA 4BJ5A 1OAOA 2WG0A 4LSZA 4R1MA 3SZRA 3UMFA 4FT4A 3O95A 5JO9A 4I9UA 1V4BA 4V2IA 2ZATA 2IYLD 3PUHA 1O6CA 5ARCA 3U0BA 4U7DA 3T1HB 3L6EA 2IIBA 4WW0A 1YA8A 4Y2GA 1GZSA 2JAXA 4A2QA 4RH0A 4ARIA 1T36A 4M89A 2NW6A 3MS4A 1FY2A 2WZDA 3MS7A 4F5YA 5ALZA 5EUCA 3UXMA 2IVZA 5LP6F 4LE1A 1UKZA 1Y63A 2WM2A 1AKUA 1PT6A 3CEHA 3K5HA 4RADA 1B6TA 1U3WA 2IBMA 3DXYA 4HZGA 1A98A 4EKIA 5HGJA 2AN9A 3NEYA 3AB3A 5C81A 3ONNA 4NCNA 3EEYA 3ESQA 3LPAA 2W11A 1WCXA 5CFLA 1GSOA 5EJ4A 4R9VA 2QB5A 3P20A 4M7PA 5EIEA 2IZZA 4IHJB 2QZPA 1SC1A 1RNLA 4BLUA 3DNFA 4ALKA 5B6IA 1C8LA 4IIYA 2JANA 3VPGA 4D0RA 5K4HA 2X58A 4YGXB 1C8VB 4YASA 4KCGA 1LW7A 3S2YA 4C0XA 3KJEA 1NX9A 2ZVPX 3HHPA 1U7TA 2HU7A 4Y67A 4NBKA 1RFGE 1WPRA 3LBFA 4YYEA 2HD4A 1CJSA 1DXOA 3B1JA 3FVTA 5C8VA 5EVCA 2QU8A 4ND2A 3MPUA 3PUKA 4Q4AA 1Q1ZA 2RBEA 3ZHSA 2BFEA 1E1NA 1NYRA 2IDZA 2P9HA 4JJFA 5TQ2B 2VHWA 3QA9A 4KIGA 3TIGA 4BATA 2YJ3A 5AXDA 4UQOA 2QMZA 1MXFA 1F38A 5KX5A 1Z5PA 3PGA1 1JSZA 4DKXA 3I53A 2EARA 3OPQA 4PPNA 4Q82A 3VQTA 3MWLA 1XCJA 3SOZA 2PL1A 3CURA 3I8XA 2VBGA 3PC6A 2ALJA 3VYWA 5JASA 1V7CA 1KI4A 2R7AA 5EINA 1JR3D 3K15A 4TV8A 3S7ZA 5CK4A 1M73E 1ULUA 1ZUNA 4II2A 1VI2A 5IZCC 1SNYA 1X7HA 1YB7A 1NBHA 1U11A 2GO7A 1X8LA 5E1DA 4CG2A 5GP1A 1JXMA 2Z98A 3TO5A 1VLVA 4NFHA 2D3WA 1SB8A 2Y67A 1KAOA 4D0LB 4TYYA 2H7CA 3KSUA 2DBZA 1BAPA 1GNVA 4PE5B 4JXXA 3WLAA 1I3OA 1VLLA 2P7IA 3BG5A 4BKOA 2HZ7A 2P30A 2FR8C 4I55F 3UHPA 1ZM2A 1PQWA 3NHUA 4RKEA 1T8SA 2FLWA 4KXXA 2QTHA 4NQZA 4ZO7A 7YASA 5HIKA 5JAPA 1E1KA 2QZ4A 3FSGD 4AW9A 3BDAA 4BNWA 5I7RA 2CV1A 4YRLA 1D2MA 4UEOA 3HMKA 2CWWA 4RSRA 2FW1A 4BLSA 1QYRA 3AQ4A 1M0SA 2GEVA 2J32A 2W93A 3MG9A 5K0JA 3II6X 5H02A 3IA7A 4YIKA 4QGSA 3LI2A 4X90A 3ZEIA 4NK5A 3NORA 5HZGA 3OP4A 3D0KA 2ENUA 5HMMA 1DAMA 3ONDA 4ZDKA 4L5AA 5L3SA 1RJWA 1B14A 3OFND 4EABA 4R51A 4JJ6A 3VVLA 1V1RB 2NAFA 2TS1A 3BEDA 4UJ3A 1NY5A 3JAKB 4MV6A 4PPYA 1CP3A 1QO0A 2ZBUA 4R1QA 3GGGA 2QRVA 5GZ6A 3TK1A 2XVAA 3HM2A 3UO8B 2O20A 2GBLC 4IOMA 5FUBA 1NI5A 5KDDA 121PA 4L8FA 4A8JA 1BX1A 4QNNA 2Z3WA 5ALOA 2R6HA 4JVSB 1QRRA 3V9AA 5GGXA 3FYUC 3IB6A 5HUHA 3FMGA 3HCNA 3ELDA 1X15A 4K1LA 3WZMA 1WMAA 3IHKA 3R3UA 1XTRA 4PPGA 1FFCA 2PWAA 5AKLA 4W5QA 4LKOA 2DXIA 1P1JA 3T1QA 1L4MA 2V0GA 3EE6A 3GC6A 2AW3A 4BBAA 1VKHA 4DB4A 3WG9A 1ECLA 4N01A 1I3LA 4NBNA 2OAGA 4RDHA 3NOVA 1TJNA 3GA0A 4R9NA 1WQ1R 1OA0A 1NX6A 2FZ4A 3DWFA 3ZVLA 4MMZB 1M5UA 4DFDA 4MVCA 4F4DA 3WA7A 1SCUA 5ESWA 3HXTA 3N2NA 2IRWA 4HN2A 4LXIA 2WUFA 4RPJA 3VC1A 1TAUA 4W82A 4OBWA 4IH4A 4LGVA 4GP7A 1O96A 2D2EA 1YNSA 2YHIB 1MPTA 4N65A 4XKJA 4CF5A 1YRLA 1F14A 5FOVA 3OIWA 4IF6A 5F7OA 2NVOA 2OBLA 4ZHQA 4OQQA 5I9BA 2BFBB 3QE2A 3ZCSA 2OOKA 4MDEA 2WJIA 1JDSA 1Z2PX 2VNKA 3AI7A 1RQ2A 3G8DA 4L1KA 4RVOA 2J5RA 1PU2A 2DFNA 4WOJA 3RSQA 5TMEA 4F8JA 5KHLB 1IQ0A 1W75A 4KPYA 2VUSA 4KUEA 1NASA 4BJHB 1P77A 1N9GA 2NZWA 3HG7A 1M2NA 1V3QE 3R5JA 3CG4A 4IZHA 2YHSA 3T5GA 2PHZA 1OWLA 1R0RE 4NK4A 5CT9A 5IJAA 1YZFA 4C89A 4F5EA 1HYGA 4ND1A 5C8XA 3O92A 1A8PA 3DUFA 1KMNA 1L8OA 1OU4A 1SKQA 2PN1A 4M99A 4BYMA 5TSDA 1VB5A 2X19A 3MMXA 3Q8XB 5KZMB 1C1XA 3ZJVA 3QUAA 2FHSA 1EX7A 1V11A 3A1VA 2AGVA 3HBLA 4BNVA 3VVBA 5CT5A 2C9CA 2DOKA 2WVHA 3FPHA 4KOAA 1SVOA 3RNLA 4AB1A 1QORA 4R0MA 2JEYA 1R8SA 4KXQA 3VV3A 2BKUA 3DAGA 4BFUA 3S2GA 4YCNA 2Q4RA 3PEUA 3L3BA 4INOA 2PRJA 1ZD3A 4X84A 3OESA 4E88A 3RRNA 2ASVA 4LN1A 3U4MA 1KC3A 3BH0A 2V5AA 3U31A 2KYRA 2PXAA 2ZU6A 3GJTA 1SCNE 4KH1A 2X0DA 3W1VA 1XZMA 3WLIA 4M1OA 2OFFA 4ETNA 3PXBA 3RC1A 3WGKA 4M7OA 3SZMA 4L74A 1AXEA 4D8TA 1H0HA 3R40A 1P0QA 2CBGA 2PX8A 3QIAA 5B1DA 5TT1A 4Z3KA 3E81A 3P2KA 5J47A 1O8BA 3TM5A 2QENA 4K1XA 3OEYA 4DQDA 3LL4A 1TUBA 4ILEA 4V0NA 4B9EA 3ORRA 1CZHA 3PQ7A 3VPFA 1Z6XA 1DRUA 3I6IA 3K30A 4BC0A 4MVJG 2I03A 2DPGA 5E95A 4TSRA 3QOWA 4F6LA 1ODTC 2Q28A 4GWKA 1YHZA 2PL3A 3UJ7A 2G71A 2XUHA 1Y7PA 3Q8WA 1PHPA 5E6UB 3HO8A 4CLOA 5CXSA 1M8PA 1RAHA 1UMDB 5E1MA 1KEUA 2F00A 2EFHB 2ERXA 3E7FA 3PWKA 4X6YA 4EB8A 4YRSA 2PFKA 4XM0A 4TTIA 1EFKA 4P0QB 2ZB3A 4IV5A 4UU1A 1XLTA 2QDKA 1JW9B 1P0MA 2QM7A 4YRQA 5A04A 2FG6C 1Y9DA 3C8UA 4HWKA 5ICMA 2OL4A 2POQX 1D0VA 3CUYA 4B3BA 1E9EA 1P73A 2JFUA 2GHIA 4MUAA 5T4FA 3S1AA 4XR4A 2HW8A 1RHMA 1J5PA 5A0VA 5KYYB 1XR3A 4HRYA 1OC4A 4JV5B 1MPXA 4XWKA 2PYDA 4J03A 3ZCUA 2VTDA 1JJBA 2NNLD 4ZALA 1V6AA 4ER3A 1Y89A 2HV8A 7REQA 4DILA 4XTCS 3ROKA 3DSRA 3IT3A 3SX2A 3CF0A 1U9ZA 1M6EX 2GBCA 3PQ5A 3R2JA 4LJ8A 3UT0A 4BIMA 2WSBA 2J9ZB 1JU4A 1SUEA 2YVKA 3LSYA 2OV1A 2ODQA 1ETHA 2GI4A 1T2EA 3V34A 3GFSA 1T3ZA 2HB6A 1JHYA 1U9CA 3Q6NA 4YJ2A 1S9HA 4S04A 5IMBA 3JD0A 3QPBA 3OJCA 1C3XA 2CXSA 1AMOA 2OFWA 5JAOA 4DLLA 2PRZA 3DJFA 3JVUA 5FLKA 2XEXA 3Q7QA 3ZI4A 3MMNA 3SSAA 1EWKA 4ZAGA 5CLIA 3K0FB 3FCUB 3K31A 3CZRA 5JW6A 5HCNA 4MUFA 5JNUA 1Z13A 2KLHA 3DULA 3OUUA 2HO5A 2XB8A 1JA1A 4KW7A 1UT5A 2DPYA 3LAWA 1G6Q1 4MI3A 1LDNA 2BW0A 3PJDA 4IILA 1V25A 4LDPA 2GK6A 3ADBA 1PX2A 1R4ZA 2XV1A 3EGOA 3ESCA 3LD9A 2C9ZA 2XHZA 1O0BA 3HSKA 5FXMA 1VB3A 1IE3A 2BHNA 1MGPA 2PT7A 3CLUD 3KJXA 5J59A 5G1OA 1MNQA 3DB2A 3RB8A 2QLMA 1KNQA 2QWXA 3JASB 4JB3A 3MA0A 5HILA 5IJ0A 2PXXA 2AV6A 1UXKA 2Y1WA 1IDOA 5BY2A 1DBVO 1WDKA 2Z2JA 3L8ZA 4C14A 5CEJA 3IERA 1RBZA 1E6CA 3QXGA 3U6BA 4XPIB 2Y92A 1WUHS 3ZC3A 4YPVA 1I7SB 5FO1A 3RLIA 1VP9A 1TQHA 2G1JA 5JRDS 2ONCA 5KTMA 4UHBA 3TX2A 3ZOKA 1V39A 2CXPA 3VISA 4ZAVA 1NVBA 3E2IA 2JPDA 2D7JA 3TQRA 4LQLA 1ZW1A 4ENVA 4GXRA 2EGGA 3DW1X 3UHFA 5KQPA 1FP4A 1NW8A 3BB4A 2XZTA 3EEQA 3IE0A 3MINB 1II8A 1O2DA 3WX0A 1QG6A 5I47A 4L57A 2C00A 4G24A 3ZKAA 2GRUA 3IAUA 3OETA 5BSWA 1LX7A 4RULA 4S1PA 2HU8A 3DW3X 3MWDA 4U0JA 1NG1A 9MHTA 3PLNA 5IJXA 2FEWB 2AJTA 4S1OA 3P9RA 1MUUA 1TRHA 4GG1A 5TQJA 1ETUA 3LLSA 1PFWA 2BTQB 2WF9A 3OPMA 4MQLA 3VAAA 1E3SA 4B3FX 5EXPA 3SEFA 5HCUA 1OI7A 4ZTZB 1RPTA 5JI3E 1DV1A 2AMVA 3HO1A 5D3MB 3C43A 3ZHTA 1WXEA 1B3RA 1D0SA 1FBNA 4US0R 4JBHA 4PGFA 3T7CA 4GPEA 1TFRA 2OFOA 4RCZA 1H85A 2HK6A 3C1TA 4K26A 4MV3A 1KFJB 2OCXA 2Q5CA 1CUEA 5AXAA 4RSGA 4BZZA 5K01A 2ZTMA 3KQKA 3AXSA 1UJCA 2V7BA 3LDHA 3ZYCA 5JHGB 3VKUA 4ONEA 1XMOB 3MWFA 3WA6A 2BI8A 4A36A 5CRIA 2VXYA 4CTMA 3BS4A 3JD3A 5JH7F 2B36A 4JU8A 1KQNA 3SXUB 2FCRA 2O0MA 3O3CA 4EL0A 4ER0A 1IUNA 1QYWA 2WKQA 2EU8A 3DVQX 1TAGA 3M6AA 5JZMA 3TTVA 4EPRA 5A4JA 1OXMA 5BQ5A 4DCGA 1B76A 3LC7O 3HR8A 1KZ9A 3FTDA 3UK2A 2WSMA 3K4QA 3QU2A 1CD5A 3BGDA 3E58A 1V6CA 3AZOA 2QR3A 2BKAA 4F9TA 4J6EA 1E5TA 2HJGA 3PXDA 3RE1A 2UYHA 1QIKA 3K8YA 4YNBA 3NYRA 4CI0B 4LPKA 1E2GA 2Z83A 4FM9A 4ARUA 3AJ9A 3LOQA 5LQSA 2QSYA 2Q0XA 1BVUA 3I52A 1X2EA 2MSNA 3VYVA 2OMEA 4V0ME 2GR9A 4IWXA 2QGZA 2QN7A 1Q6YA 2FZLA 2O3UA 4HNVA 2YCLA 5HRUA 1UC4B 3K6JA 4QBHA 1AC5A 3TCXB 2QXTA 5AJVB 5HJ2A 4YUXA 5IU6A 1G7TA 4FSXA 4A16A 4NOMA 4UFOA 1HDCA 3EJWA 1ONSA 5KSYA 2HU5A 5LJIA 1Y80A 2AI1A 2DH5A 2GCNA 4ZOAA 4U8GA 3A6ZA 5G40A 1GSHA 1M34E 2NZUG 4BWYA 3WK4A 5AM2A 3PVSA 3UZUA 2QZJA 3A6LA 2IVFA 2P4QA 3MMZA 4X8HA 3VPHA 4C4SA 4E7OA 3RSLA 1DC4A 3MTQA 4MX8A 2OXTA 3TW8B 4B34A 1WZIA 4E1VA 3RAJA 3GH1A 5B7PA 2XX3A 3UJNA 4OUKX 1QGDA 3IGFA 4GKKB 4O2BB 4WACA 4JGIA 1JVBA 4QFMA 5CJ2A 1M76A 1EFRD 3S29A 2PUFA 2RI0A 3O2SB 4IO0A 3L0IB 1NONA 1OU0A 3BKWA 1Q16A 2WAOA 4G1CA 2XT9A 4B6OA 4XVRA 2WJZB 1QH8A 1FRVA 1SUFA 1QZTA 1F2TA 1FE8A 1EIWA 3MSXA 2VP2A 3SMVA 3E1KA 4O5AA 2QRUA 5TPZD 2F7SA 5LJLA 1QRSA 2WFLB 2IV2X 3UIEA 5M5BA 4G81A 4ZEVA 3ZE0B 4CCYB 1DTEA 2C9DA 3GNLA 4LHSA 4NZNA 2GCEA 4CU2A 1IDN1 4TZKA 2FFBA 3EVAA 4DMKA 3TFQA 4EGCB 2H17A 4HDSB 3QU4A 2IZOA 2EERA 3OIUA 5B6JA 1JR2A 3ZCTA 3A4MA 4EQ6B 1JIJA 3R0ZA 1O95C 5AHKA 2QTCA 4QU5A 3TVTA 4NCHA 2JI6A 3E3AA 4YRFA 3ZZUA 4MUHA 3HEAA 2Q9BA 2DECA 4FGKA 4IGAA 3T7KA 5IW8A 2Q7DA 1OR8A 3NC4A 4UVEA 1GFZA 1GZ3A 3FF1A 2PD3A 4NFLA 5I4KA 3O2JA 1V7PC 2G9UA 2QTWB 2YV4A 4KWEA 5HS4A 1IM2A 1YL7A 2H9AA 1WUYA 2HA3A 2KS6A 1IU9A 1H23A 4P6VF 5LP1A 5LWHA 3VKGA 3S44A 1TZBA 2P6NA 4US1R 1E92A 3OE1A 2YXPX 4Q3OA 5LNK1 4ZVPA 3GBSA 1LFAA 2O1SA 4DC0A 1NF3A 5HKKA 2Q50A 5B2FA 3FTFA 4CIXA 4UE2A 3AP3A 3HRKA 5L6MB 1UBNA 3H0KA 5EJAA 3DF9A 2FW0A 2QY6A 1SOWA 2C5FA 2FZ5A 3A1SA 3CRNA 4KDCA 3SBOA 3W4IA 5SYMA 4C5BA 3DYVA 3G88A 5K3DA 2F8SA 1JIUA 3W9BA 4MS3B 1CUUA 3NZEA 3OOWA 3SKXA 1M1UA 1WZUA 2VKQA 2YN4A 1SJ9A 3INTA 1XRMA 4YFYA 4EELA 5CH5A 4EI7A 1EVKA 1QFZA 3PBKA 3MERA 2C95A 3P52A 1SHLA 4UUAA 4D0GA 3ND8A 1E3WA 4BWVA 3A11A 4QTTB 4I5GA 4MDYA 1SPXA 2F9FA 4IDNA 1S8OA 3IEKA 4AMVA 2HU2A 2JJ1A 3HM9A 2FUG1 1M8GA 2BC9A 4KXMA 2FR0A 3OD1A 1HMPA 4MR7A 4F2GA 2NACA 1PFKA 4AJLA 2IZ5A 4M8IA 4DEYA 1SQ6A 2X9VA 3SC2A 3WQBA 4R69A 5CB0A 1AXRA 3WWCA 4P3OA 3G68A 2H4JA 3WSTA 1HC7A 4WDQA 5KWEA 1KMHB 1M0EA 1KYWA 1N32B 2GN0A 4QUKA 3D3NA 1ULBA 1T8PA 3NM6B 4RTOA 2QVXX 4PZLA 4QUGA 3FNRA 1AOXA 5CD1A 3EPLA 3H1BA 4WKCA 2J41A 1K75A 2C97A 4JSTA 1G21B 4B2LA 4B5KA 4EYKA 1H22A 4X62B 3N6RA 4D6YA 5JU6A 2ZXEA 2IEIA 2P5SA 3I73A 1WMDA 5A9SB 1JYSA 1LRKA 4F84A 4YRGA 4BEWA 2OCGA 4KQWA 2B6HA 1HSOA 3KLOA 5A0FA 1XKLA 3AKZA 1QZZA 1Q0HA 1TKRA 2V7PA 1BEZA 4YJ2B 4GQAA 1A9ZA 3LUBA 4KQGA 2FWMX 4PVDA 3KB6A 4YYZA 1M1YA 1MOPA 2FFRA 1JEDA 1P5FA 2QM3A 2P9EA 1GRCA 2WWHA 4OIFA 1L1FA 4R8VA 2KPOA 4NV1A 4AZ0A 3D3EA 3K1JA 4NAUA 3OQVA 3KE8A 1GCGA 3EWIA 3MUFA 4BVLA 3PYXA 3B2EA 4S1WA 4Z0HO 4HH1A 4KL8S 5A06A 5CA0B 1J2JA 4M9SA 3Q7RA 4O4HA 1F60A 1O9HA 2QROA 1BMDA 1HDZA 2XMQA 3HXLA 3O38A 3F6PA 4G4SO 4KQEA 4LX0A 5KHOC 3TECE 2Q1SA 3DEFA 2PGOA 3M4XA 1X94A 1H2EA 2IEAA 2PYIA 5JTUA 1BJRE 3AEKA 4NBTA 1KQPA 4J0GA 1UFQA 4KITB 3H2HA 1G5RA 2XNJA 1N2XA 2DQSA 3RARA 2WICA 2ATCA 4KV9A 2WJVA 3T5BA 1V3VA 3HYTA 2Z1DA 1FNCA 1G8FA 4EW1A 4HVCA 3Q2OA 3FMPB 2BOVA 4MS4B 1SUPA 1VPEA 1B6GA 2PS1A 1LJUA 2XLBA 2QZZA 3C6ZA 3IOMA 3DCYA 1QQ7A 3QP9A 4X1IB 5KQGA 1N7HA 3TG8A 1SBHA 2OHHA 2W6QA 1USWA 3PQ2A 2BEVA 2AN1A 1GV0A 4ZVQA 3H4VA 1DAFA 4LMAA 2VQ6A 1LBSA 1QUEA 3KVNA 1V48A 3ZGLA 4AZTA 4EJ2A 1UDBA 2R751 1E6KA 1U8CB 2X7JA 1UPCA 1FFXA 4YJ3A 4MEBA 3M4NA 1DQPA 1N4AA 1ZC4A 3DMFA 1N5OX 2XAUA 3LCVB 4FKBA 3C2QA 4HNSA 3UN1A 2OSBA 1LQUA 1PV1A 1N5IA 4O4LA 3W1EA 2PJRA 3HZHA 4BEVA 1SBCA 4FHFA 5DTEA 1M1NA 2QGFA 4OF4A 1JDVA 3MS2A 4NCIA 5LBUA 5HYVA 5GOZA 1FIUA 2A94A 2WZCA 3UAXA 2G28A 3PG5A 2DWUA 1EVYA 4MQ4A 3I3OA 4OHWA 1Z7WA 2OCYC 3KETA 4UNQA 5AVYA 2R1UA 4UFPA 4AN0A 1DIHA 1I2DA 1TA9A 1GZ4A 5E6RB 2XYQA 4FCVA 5HX7A 3VO9A 4K7JA 2IX3A 2XUDA 1BXGB 1C9KA 2PMWB 2HPVA 2QZSA 2GCOB 2JLRA 1NXVA 3PXCX 3QE4A 4OIMA 2ZJOA 4EY3A 1G8KA 3H1GA 3RK4A 2G0TA 1NVAA 1UXJA 2CEAA 2OT3B 4BMVA 1DPGA 1AQJA 4Z4QA 1PUIA 2DHEA 3FPEA 3UHJA 1E6MA 2JI7A 3N8KA 4M8KA 3JZMA 3ZHXA 2Z2IA 5LYJA 1RKXA 2FP4B 1KFKB 2XY4A 5GTDA 1V16B 4CODB 1EUQA 2IBTA 2B8WA 3EIQA 3P97A 5FBLB 5E9WA 4XYLA 1T34A 1NNUA 1UPFA 1CUWA 1ZOOA 8AT1A 2WNIA 1MP0A 2FVYA 4AG5A 1MU0A 3C97A 1U0FA 2RHOA 1ZD8A 1KEZA 4MPDA 1FDWA 1T2AA 1B8UA 1VLZA 2JAUA 2ZRPA 3H6HA 3AOEC 1FBTA 1Z83A 3I9LA 3PD0A 4RL6A 1YFJA 3DO8A 1EFPA 1XPOA 1UKBA 2PKXA 3GEEA 1ECPA 1R7RA 3KAQA 3QNUA 5J2UA 1CZUA 1FYWA 2KBEA 1PR5A 2H3HA 5HDBB 4KUGA 1ZIPA 4KO1S 4OXRA 3PL5A 1XZDA 4FNGA 2ZSFA 5H68A 2PH3A 1E1QD 3HWSA 3KSZO 5B1EA 5A2QA 4UTNA 1IHXA 4CR6A 5FPKA 3BFXA 1FMLA 2I8LA 3HPRA 3WFIA 2CLKB 4L5BA 2GESA 1RWVA 3GMIA 2XUQA 3GYGA 3PS9A 2RIPA 2W48A 2ZEJA 3QKSB 5HGXA 1HLGA 4BXOA 2EDAA 2QORA 3QXJA 3ZV4A 1ORDA 1P2DA 3PNBA 4WH0A 1WULS 1TGVA 2HRBA 2W2LA 1QAOA 2XYVA 3AEYA 3D9QX 1RRGA 3JW8A 5EEHA 3L7KA 1V45E 4KO4S 4NICA 2IXDA 1GQFA 2DSTA 1T13A 3QV1A 1C3JA 3WWDA 5K0EA 3HXOA 3N53A 4LJLA 2DTEA 2AFHE 2GWRA 2JH3A 3EZ7A 4J90A 1TZJA 1XZGA 3BMOA 3CV3A 4GVLA 4UU8A 1AX9A 2Y1OA 4YT5A 4P8RA 1WKVA 3OE4A 1QH1A 4N5IX 1ULHA 3RTCA 5LMUB 1VJTA 2ZPAA 4HYEA 1UWLA 4YBRA 1GNRA 4O0LA 4NDZA 3A9RA 3ZIAA 1QV9A 2Q5QA 3NBAA 5E2IA 1LY1A 4OHXA 2FSHA 5C5IA 2WT8A 4FFBB 4R40A 4PAMA 3GIWA 2N1BA 4GL2A 1KBQA 2FPWA 2AMFA 1L7MA 2J3QA 2C98A 1ZU5A 3ICOA 4ID3A 4BMXA 3HPQA 2FUG6 3H8SA 2YXBA 4MQMA 1DWQA 2NZXA 4TLLB 1EJ2A 3QOFA 5DP1A 3IT1A 2HI0A 1VYTA 3AVVA 3B70A 4JODA 2QIPA 3IESA 3IJPA 2VXOA 3B9QA 3PC8A 5DXJA 3A1UA 1ZKMA 4HQOA 4D9EA 4R2HA 3TG2A 4DV0B 1O0CA 2IZ7A 2IXFA 3PLRA 3ET5A 4FJ2A 3KS9A 1SZDA 5I7WA 2XBUA 4XYEA 2ZAIA 4LE0A 5KYUA 5J2TF 1NMEA 4MNTA 1Z4QA 2CW5A 5LLTA 4EW2A 4MW4A 4CL3A 4QOSA 1I3CA 1RI1A 1J49A 4BVBA 4C0LA 4CM7A 1QV6A 4JROA 3VYSB 3WKDA 1YJ8A 2JAOA 1SXJD 2XTAA 2Z43A 1ADJA 1L7BA 2RBKA 1MEJA 3TB6A 1DJNA 3L1VA 1AHIA 3CB4A 3SY8A 4EO4A 1RLTA 4A26A 3QEMA 1JSXA 3QMPA 2RAUA 4YMLA 1QYCA 1HFKA 3SHVA 1GZHB 2C58A 2F43A 1EFVB 4DRYA 4F3RA 1FMFA 5IASA 2X0EA 1PF7E 3QVTA 1QC5A 4XVCA 4J0JA 1Y7LA 1H9CA 3UJDA 1OAAA 1KIMA 4IYJA 1C7ZA 2QMUA 3GRFA 4AN4A 1Z74A 3DBRB 4NMLA 1QE3A 3S6JA 1YJ5A 2ZB7A 3P9QA 2OFXA 4YAJA 1FYXA 1G21E 1JKXA 3C6XA 1EP3B 2IXBA 5CYPA 3AEZA 1E79A 3JS5A 5J63A 1CJTC 3VNRA 3QMMA 2BGJA 4UREA 2JFQA 3JQFA 5KMGA 1MO6A 5JSHA 2WDPA 4U7WA 3B5IA 1U3TA 2HADA 4FYYA 4EDFA 3DVAA 3H2IA 5BN5A 1W4AA 3UJBA 1ONOA 1P4AA 4LJ9A 2V9PA 4I99A 4F46A 2AFRA 4PSKA 1KNXA 1Q0PA 3RS2A 2QG9A 3WB0A 1PW7A 2DHQA 2WKRA 3JYHA 4KK4A 3RGWS 5LR6A 3B1VA 4D1YA 5KWIA 3TZHA 3H8JA 4QXRA 4RD4A 5HR5A 1OI2A 3IKLA 3L01A 1MW9X 1BCRA 2E1RA 4YN3A 4D3SA 1XNHA 2XVMA 4YMIA 4UTOA 1BRTA 3NLLA 3O93A 4QA9A 1ID8A 3U3MA 5KC9A 2FU5C 5CH8A 2OWDA 5DGIA 3HKBB 5K0CA 2PKWA 1CEQA 4UXJA 3ADCA 1G8SA 3GLRA 1D8TA 5ES3A 2I1VB 1XVTA 3JQ9A 1JHQA 1THGA 3NBFA 4ZOBA 2C2ZA 4LJ5A 2RGRA 3OQBA 3AUJB 1E98A 3AEXA 1XTUA 3DYBA 1IWOA 1EVZA 2GTPA 3HSYA 4F93B 3V3KA 1YWGO 4BWGA 4TV8F 2X8WA 2XOKA 3LP6A 5GM1A 4R8MA 3AHEA 3IE1A 5J3JA 3ZJYA 3PFWO 4A5SA 3ZZ1A 5JISA 3OJEA 4B5LA 1W36D 4GI3A 2G1AA 1RC0A 1GRVA 1K66A 3LHDA 4XIGS 2I3AA 4Z1MA 2Q21A 3VBCA 5ALXA 3P7MA 2PBFA 1D3AA 1KTIA 3O94A 4LGCA 5JAZA 1UK6A 4CLDA 4B47A 1Q83A 4WK0B 4F7DA 3N0WA 3VZCA 1KEWA 3PEWA 4PBSA 5H1YA 3GJ0A 1OLOA 2NZ8A 2PZLA 1P60A 4R3UC 1R4MB 1XNJA 2OHVA 4AG6A 6NULA 5BSGA 2NQTA 3GX1A 4P4SA 1EHYA 2I67A 1N2ZA 1TCUA 1IY2A 2XD9A 1A96A 3E03A 4PV7A 1WXXA 2WI8A 5FUXA 3VR5H 2IDKA 2ZZKA 1M2JA 4YJHA 1ZOLA 1A27A 2DY0A 5IVKA 2O1XA 3KKOA 5EUMA 1Z6TA 4FX5A 1A9PA 1AT1A 3LYLA 4Y6QA 3HJCA 3UPDA 1RW4A 2NADA 1KY5A 5EI5A 5MN4A 1CZLA 2H2GA 3SQNA 1NP3A 4TTTS 4X6LA 2Y71A 3NHKA 4H1VA 1U81A 1KBOA 2QAIA 1DFIA 3K9GA 1HDEA 1QO0D 3TZ6A 2CXQA 1ZCZA 1KEEA 1W5EA 3EAFA 1VE7A 2GFHA 5ICSA 1GPYA 4I1SA 4OGFA 2P0EA 3I5AA 1UOEA 1CY2A 3IEMA 2ZIFA 4LOHA 1WEHA 3SYRA 1K9VF 2XAAA 3TEJA 4UUMA 5WRFA 5H4GA 1HA3A 5AHRA 1ISHA 4HAOA 1EGVB 1K3UB 1ZD9A 4DM7A 3VYRB 1J7KA 1NYQA 1WIWA 3AR3A 2V1XA 2BE7A 3QFRA 5DGHA 1YIDA 2MSWA 1FQKA 2AYXA 2HA6A 1HURA 3FMIA 4X20B 1D8AA 2ZBPA 3HXQA 4OGKA 2I2FA 2YWJA 2P4EA 1T9HA 3EVBA 4O2LA 2LE0A 5JAQA 2F1RA 3PUWA 1Z7GA 1UOQA 1X86B 3K8OE 3DDOA 4GP6A 4LK2A 2D1YA 2L17A 4PRLA 3OT1A 4ESVA 4MLPA 4HLCA 2I34A 2P1DA 4UM7A 3JQGB 5EMNA 5C31A 4CKWA 4KKVA 4OYYA 4UPVA 4EHBA 3HV2A 2J0SA 2CMFA 2XWPA 3F7MA 1J00A 2UUBB 5CVUA 4JP2A 1UBGA 2EBUA 5B57C 4JKOA 3NTVA 1BJKA 2CUNA 2VLIA 3AXTA 3G9QA 3GB9A 1JKMA 2HPHA 2VDJA 3HSSA 2E9SA 4Q3CA 5CLQA 3ZW9A 4EMBA 4ZYVA 3AETB 2RH8A 3EAGA 1OLSB 1GGKA 1L4YA 1BVHA 4LJ6A 2QG4A 3LA8A 1CK4A 1WMBA 3OU7A 1P29A 4MGHA 3JQPA 4FFDA 1PX0A 2B34A 2FPLA 3KOXA 3OI7A 5DRYA 4JLSA 3JV7A 3RPEA 5CLGA 3PJFA 3AR9A 2HA4A 1NUSA 2OB1A 2VDUE 3GXBA 3JQ7B 1AF4A 4KR0A 1UBJS 5CVCA 3O7MA 2R1TB 1M0WA 3I0MA 2YWXA 3R0QA 4LI0A 4N47A 3WGYA 4YPOA 5F5XA 3UANA 5K6AC 3C3AA 2K4MA 3LY9A 5EWMA 3RSOA 1SRRA 4JYAB 1S3FA 2WYHA 4MIKA 4RTKA 1Y3BE 3SN6A 1T9BA 4F8EA 5FTMA 2V55B 1SXPA 2H07A 1HTWA 3R1IA 1JGTA 2PWZA 4L8WB 4ETWA 4YBZA 3KALA 3ZXYA 3FLAA 1YMQA 3NTQA 2FEXA 2O2EA 5D3ZA 3UMSA 5AKYA 4DGSA 2DUWA 1HORA 4KR3A 3TWOA 4B17A 1W1IA 4GI2A 1KJWA 1E2DA 4L85A 3PTLA 2X8JA 4KYTA 3LRPA 1C30B 2BGUA 3GLKA 2I2WA 3P2YA 4R2IA 4ZICA 2A0WA 4J0EA 2X4IA 1CS4C 4WZBA 1JQAA 4RE5A 2AT1A 1YOVA 5IUKC 5FPTA 3IRUA 4F4JA 1GPMA 2C8LA 4EG7A 3W9YA 4YCSA 1GPAA 4OI1A 4Q1BA 2C8KA 1OX5A 4KX5A 4AF7A 1A77A 1NJFA 1T6XA 2P9JA 1XI2A 2YRWA 2B3DA 2I2DA 1KK0A 2VO1A 4MVJM 1A4IA 2EW8A 3BRSA 2R8ZA 4OATA 3RQSA 3E7WA 4KB5A 4EG0A 2L0XA 2W90A 5ECDA 1FFBA 3UHOA 1LBQA 2C0CA 2X5JO 3N8GA 1CUJA 2IPLA 4G8DA 4UEQA 3WFZA 5KC8A 3OCCA 2G4VA 2JC3A 1N6IA 3G13A 2H4ZA 1ZI9A 3PPWA 5DM60 1P61B 4BGIA 1SVMA 2YJ6A 3OMXA 4PINA 4UTXA 1N7JA 3PQCA 3R41A 1XWWA 5HDQA 5FWXB 5ED4A 2QSUA 1PLJA 4ZARA 1A3CA 3EDYA 3BWVA 1J2YA 3FF4A 5ALFA 2HCRA 2A7XA 2GKGA 1L7AA 3IAAA 1QV7A 1TCVA 2VT3A 4KGVA 2P27A 3AR4A 1VYVA 2JH9A 3F4KA 5AJYA 1FU8A 1JG2A 3ZK9A 3CE6A 1QZUA 4JJAA 2JLXA 3QLJA 4CI9A 5JO0A 2A1TR 5DRTA 2BFDA 1MX9A 1H2YA 4HDKA 4JOBA 2QT9A 1S02A 1ADGA 3K0HA 3JYPA 1IBKB 3JVEA 2GYUA 3AY3A 2VZ0A 4KO2S 4NYIR 4WXRA 2QAJA 5BOVA 5CCBA 1QF6A 2JA1A 5LM3A 4H6PA 2D0IA 1BE8A 1HYHA 3DC2A 4YAIA 2VP5A 2ZJ4A 4WLOA 4DIBA 1YS2X 2P2NA 4M22A 3REGA 2DT8A 2C78A 3B3FA 4Y6GB 3WLLA 4C4AA 3B9RA 5JPDA 2JJ2A 4FBMA 2VUIB 1U5BA 2OZKA 4E6PA 5BR8B 1SCKA 2RKOA 1Q57A 1LFDB 2QL5A 5J4KA 2PKEA 2DT5A 5EIOA 2AOXA 3R77A 4DC9A 3H17A 1H69A 2KWIA 4MGZR 4FEGA 4TL6A 4WKGA 4V1CB 5AICA 3FFWA 4BU0A 5ITVA 1CZKA 2YXLA 2W37A 1TZCA 3TSCA 1RXYA 3X2SA 3EY4A 4ZRDA 1FX0A 2EFJA 2X0NA 5JXWA 3ZGNA 2BFNA 2XOXA 1I36A 1VKOA 2W2NA 3CPSA 4QPCA 5KKAA 3O26A 5FYDA 5DM70 4XSVA 5IXJA 4Y2TA 4H3HB 5F3DA 3W06A 4BNXA 1SVSA 2XRZA 1GTRA 4FYJA 2NM0A 4C5CA 2VCYA 4I9NA 1UPUA 3DWEX 1Y1RA 1DRKA 2QXYA 2QL6A 3EQ9A 4NNPA 3EB9A 3K4PA 3KQOA 4NOJA 1S5PA 4IDHA 2H2AA 4Q1FA 4MCJA 5EG5A 5ADHA 3FOEC 2JJYA 3U61B 5K8IA 2O3RA 3WL8A 2OVBA 1NY6A 3D3JA 3IIKA 1G5HA 1K06A 2B37A 4A6EA 4EMUA 5BSVA 1XZQA 3SYLA 1QHEA 1RU3A 4LFAB 3SHQA 4MRSA 1FFAA 4FGWA 1RAGA 1H4SA 1UH5A 1WB4A 1T8RA 3CZMA 4IP0A 4NU5A 1JDBC 4QPJC 3GEHA 1DG3A 4QYMA 1NAIA 1A2QA 1CZRA 2CDCA 1I5RA 1AIPA 4DW8A 5IT9A 4ZYUA 1DPFA 2HMTA 4R81A 2LCQA 4C3ZA 4B7CA 4K9KA 1CUAA 1DBQA 5AVSA 1BJTA 2PSFA 4BMDA 4RNDB 1QLJA 2LW7A 2VNJA 1Y6QA 4KBGA 1FTNA 3VR6D 3EEOA 2DBQA 3NYIA 3OQPA 1YJCA 4NU0A 4MDFA 1LNZA 1WPXA 3TTTA 4P81A 1GY8A 4R8RA 4OQZA 2ZUFA 1GZVA 1M66A 3G2NA 5FUWA 2ZT6A 2ZYSA 2XBMA 1KEPA 2OHOA 4IKEA 5ALMA 4UXHA 3RO7A 1FVOA 2XIJA 3G02A 3HJRA 4DJEC 3NNDA 3VVMA 1RM0A 1VCHA 2ZJBA 3K09C 4N6GA 2ZSIA 4V38A 4XCVA 4REOA 5KREA 3HXPA 1BC5A 3GP3A 5CIWA 2Q3CA 1CXZA 3IP8A 4OKSA 5ECYA 4P5EA 4KGXA 5FULA 4F86A 2IS6A 1WW3A 2R7NA 3A7DA 4IIDA 2AOTB 3AY6A 3BIOA 4I3HA 2X3UA 3A58B 3LXMA 1ISMA 3O91A 1RWNA 4RK4A 3V7UA 2Q8PA 3GI1A 1XTPA 3IEUA 1F2DA 2XGGA 3NP9A 5BNIA 2VHUA 4OP1A 2HQRA 4Z8XA 1ZGZA 1PBTA 1Q15A 4D98A 2A14A 3LCJA 4ZGWA 2NZYA 3FCAA 4FD3A 1VKRA 4K6CA 4A2WA 3NFYA 2G3YA 4P5DA 3JWHA 4TRRA 4BAGA 3KQLA 1E2BA 5F7XA 4OQXA 1TJ4A 1TIBA 3BMQB 1ZGGA 3SR3A 1OXSC 1YIOA 1BW9B 4CKBB 1Z06A 2FEKA 1H2XA 2H5IA 2RG7A 4ZV4A 1NULA 4CEJB 5CX1A 2UXBB 4AKGA 1JZTA 1KAGA 4NP6A 1YRBA 2JGDB 3BA1A 1DQYA 3IDAA 3R3SA 4IVNA 3R6LA 4RNCA 2JGKA 4XUCA 5T4EA 1A9XA 4L3OA 3AU8A 4OX9B 3I2JA 5C1OA 4FZJA 2XXAA 2R8PA 3IDOA 5BUZA 1K8YB 2ZT5A 5JSUA 1LLQA 4EAQA 4MWGA 2MIIA 3KG2A 3GAMA 4MVJA 1FLDA 3FPSA 2YOHA 4RS3A 1FJGB 1NXQA 1RLJA 1KTVA 4NESA 3H9UA 3FRJA 2HHCA 3KM0A 3L0BA 5E7MA 3UYLA 2IYYA 3WVNA 2V59A 4WNAA 1DQNA 2VJYA 1XPUA 1H2WA 4MR9A 5TARA 4TT3D 4XOIA 3NHAA 2PZEA 2DBVO 2ZXFA 1Z0SA 3MAGA 2J0UB 3ICCA 1U2GA 2M6KA 1BE6A 4MLCA 1PNTA 2H08A 3A7EA 2F8TA 2WJ4A 5KYWA 2OXIA 5B2EA 1SHJA 4N0QA 4XIIA 4ED9A 3GDWA 4BN4A 1QH0A 3K5IA 3PGVA 3L84A 4S3MA 4UM5A 3RT9A 4OJYA 1W29A 3LDGA 1GILA 2Y2UA 2G1KA 5BMVA 1L4EA 3EGXB 2AL7A 2ZSEA 3RJ9A 1U5AA 2YJTD 1X7WB 1JLHA 1UKEA 2IC5A 3BWDD 1LDEA 2C29D 5TGDA 1YDMA 3BRWD 4PEVA 3G23A 4DCUA 1YBMA 3K9FC 1KJZA 4H3SA 1NRIA 4KREA 2O23A 1Z75A 4G36A 1LF5A 1PJQA 1YRAA 3KZ1E 1TVCA 3LYUA 5A71A 1AGPA 2R96A 4Z8YA 4KIWA 4LXUA 3R7SA 1QU2A 1B6SA 2PT5A 1T0HB 4YJGB 5AKEA 4J0DA 2HJWA 3C4QA 3CT4A 4PLGA 2O5VA 1C5KA 4PNZA 3DKPA 5IYZF 3QVSA 1S1MA 1C7JA 2QX4A 1D7OA 2IHTA 4KLRA 2L42A 3V7NA 4GPBA 4TWBA 3DEJA 1JEQB 1M1XB 3JPYA 3M5WA 1T6BY 5K4AA 3U09A 1E8NA 3IPAA 1C3EA 3K71B 1ZJ5A 2WU3A 4L9AA 4YJFB 5PGMA 3F49S 4M1TA 3FIUA 4BKUA 4XWOA 2OA0A 2YXNA 3UKOA 4LQDA 3HVHA 4RLFA 4RZ2A 1N0VC 1FNBA 1EGMB 3B9PA 1A88A 3QHAA 1JG1A 2X8LA 4UM9D 4DM4A 2VPXA 5IDXA 3OLCX 2NWQA 3EGEA 1XYVA 2F3SA 4HBGA 2YBEA 3M4ZA 2NU7B 5GONF 1IQUA 3CZAA 4ND8A 4IIJA 3WYEA 3LZDA 4MGYR 3UWOA 1QHHA 1YDHA 5IKMA 1DEHA 4LBYA 1ZSNA 4IW3B 1KYZA 2B82A 1FDTA 1THZA 1ZQ1A 2DSNA 1L3CA 4I1VA 1DAEA 5L40A 1C3VA 4N48A 1PV2A 3RSFA 1NOKA 4GLJA 4JSYA 2C84A 3NATA 5ICFA 4JL6A 4WA8A 3OZVA 1NDUA 2Q9UA 3DWGA 3Q7PA 1FQJA 3UFXB 3G7UA 3VPSA 1V3UA 3NAZA 1G19A 3GR6A 4NARA 1HM5A 2BMVA 4YQZA 1V1MB 4EEZA 1KKUA 2O0JA 2I91A 4UEJA 3R3VA 3ULKA 1HDXA 5J2UF 3PSAA 4MICA 4WASA 4CM5A 1R74A 4TKUA 4U9UA 2YCBA 1K2WA 1AN0A 1D2EA 1JQ5A 1R27A 2ZJ6A 3K9CA 4CUKA 3C3YA 4OBEA 4IIFA 1FK8A 4D9FA 2ZRBA 2JBHA 3F46A 4JI8B 4CMJA 4C7VA 4ILKA 4RO0A 3SF0A 3AUKA 1TNDA 2EZ4A 4M49A 4N12A 1EJ0A 1Q7GA 5CX4A 3T15A 1EXWA 1XZJA 4IG9A 4DCTA 3TR0A 1JHRA 2YIVX 5A4MS 5K20A 1EZZA 3HCOA 4KQMA 3SF8B 5IT4A 1Y81A 4WVLA 4XGIA 1K4YA 3UA3A 1HNXB 4NNOA 4OY3A 3LT2A 3ORYA 2XGOA 3CZ4A 3PZRA 3W5HA 4OK3A 5I48A 2AYYA 2EJWA 3ISJA 4J0QA 1IXRC 2C77A 4MKIA 1U0EA 2QAGB 4BP1A 1TXGA 4XDYA 1GNPA 3ROXA 4CKXA 4RY0A 1MHPA 1T1RA 3KAPA 3FXAA 3KYDA 4QNMA 5TPWB 4HX9A 5DTIA 1HRDA 3T3GA 3WIEA 3BFJA 1J9EA 2WOJA 3PF8A 3Q5DA 4HPWA 1GZDA 4M1WA 2NTEA 4M54A 1JHZA 4GS5A 4JVLA 3BQMB 3DGFC 2QRPA 3GFPA 2B7BA 4WN3A 3UY4A 1QG2A 2OOSA 3RVOA 5BQ3A 1FRNA 1TJ5A 2X0JA 1DKMA 4LISA 3OHMA 4D9BA 1N78A 3I0NA 2WMOB 2ZYWX 4GZLA 5I4CA 2VDWA 3DFIA 1JA0A 4PYMA 4QXOA 5DO9A 5SY9A 4B0OA 2VRCD 2ZJYA 1RRVA 3BXFA 1YBVA 1F12A 3MPOA 4IXDA 3KB8A 3GGSA 4OMDA 2O7VA 3W5CA 3TE6A 2GAOA 4G1MB 1GVHA 3E9NA 4MLZA 4GR5A 1QGAA 2F1JA 4HAIA 5AKJA 4EATA 3DBHB 2B9EA 1T1JA 1JG7A 2SBTA 3LW7A 3PXUA 5CW2A 3EXIB 4XIYA 4ZVMA 3IJEB 4MV8A 3LBAA 3TNJA 2VRNA 2ZBQA 2FN7A 3BD9A 3QLTA 3MILA 1N7IA 4LUCA 3ZWBA 1N6HA 5BWCA 1NXPA 1NFRA 1YIAA 2NZVG 2FSIA 3BREA 3O8OA 3WL7A 4B71A 4D4LA 4AJ2A 5I9NA 3EIXA 1ZY2A 2CFIA 2BEJA 2ZUWA 4FC6A 2ZKLA 4IIBA 5A2GA 1VBNA 4RTQA 4BX0A 1EE9A 1F0KA 3O9VA 2OD2A 4O4HF 5EJ8A 1TU3A 2COUA 5LZ4A 4Q1DA 7MHTA 4JCCA 5DOZA 3NDPA 4CGZA 4UTZA 3CRZA 3KZOA 3HKDB 2VCHA 4RGBA 4BP9A 1EZ4A 3IH5A 3DH0A 4G01B 1E6UA 1FDSA 1N2EA 4BNTA 4CMHA 4B3SB 1SUSA 3CNHA 3WGMA 2EWMA 4Q4HB 3SPXA 4EEKA 2ORIA 1SKYE 2VF8A 3JYNA 5JCXA 5JAUA 4QYIB 3IO3A 2JK1A 2I4OA 4EUHA 2ZAOA 3F6YA 4BGEA 3JD4A 3H5AA 1HT1E 1IBLB 2PD4A 1SIUA 1TLTA 4EKYA 2ZIAA 2F1IA 4OJMX 5CURA 1BMTA 4ZI7F 4BKQA 2CT8A 3B1FA 1NURA 1I32A 2VHQA 5BN3B 4PIPA 1DADA 2H4XA 1KHHA 2P62A 5DIZA 1UDXA 3EFOA 2ZT7A 2CLHB 3GLTA 4X0EA 1Z8DA 3H1TA 2QVCA 2DCUA 2F3PA 3H1PA 4D79A 5JOQA 5KOJA 4GRDA 5AK4A 4QUDA 5KTRA 1RMQA 4ND7A 1AB6A 3F74A 2WYVA 4YJ3F 4XM1A 2K5UA 3DR3A 4A3SA 4QLOA 4KPFC 5DWDA 4PN7A 1LEHA 1N3LA 3R0VA 2RI1A 3K9HA 3VFDA 3UH1A 4A8TA 4LRUA 3OKPA 1ZK4A 2HWWA 4UFNA 2QR2A 4NBWA 1KWKA 1XYGA 2WFZA 4LVOA 3ER8A 2F9LA 2PPLA 3W90A 1RBYA 1O97C 2PL9A 2V7XA 3KJNA 2X5XA 1GKYA 1SBQA 2WTEA 4Z9AA 5FNVB 1X0VA 3T94A 4ARAA 4G0WA 5ECGC 4ZDWA 4EY4A 1Y7HA 1ECGA 3OC6A 5BN4A 3T7TA 3HFGA 4P4UA 4F04A 4RTNA 2DFVA 3E48A 4H4CA 1G6HA 2V3CC 2DG2A 3W04A 3VC3A 1YOBA 1CRZA 3SE7A 3WICA 1YUNA 3OIDA 3AR6A 3H11A 1OQAA 1PVOA 2NP6A 4TSKA 1NZFA 4ISCA 2R6AA 3KHUA 3TXXA 3A3OA 1L1EA 2PYZA 4H6WA 5LYJF 4MKZA 2O5EA 4C0BA 1IM5A 3U4GA 2GETA 4YQEA 1KETA 4OHBA 5B55A 9LDTA 4B3MB 4U2CA 1FQOA 4PS0A 4HV4A 1JHVA 2QY9A 1E6LA 3L0SA 4M76B 3VH2A 2A9PA 1ZUWA 4H17A 1AKMA 3UOAB 3OECA 3PNMA 2R0QC 2IV7A 4Z5XA 5LN1A 4D4GA 3CX3A 3F8TA 3O9ZA 4FDTA 3ZLUA 3NALA 2B99A 1Q2UA 3HB0A 5KYVA 1EUDB 3KEFA 1MB0A 2A78A 5ECWA 5LQKA 1XP8A 2NTNA 2B94A 3LQ1A 1KI8A 4FWIB 1I8TA 2RDMA 3T38A 4ZAYA 1ESNA 1QE0A 3G0DA 2GHQA 3PHLA 3WDLA 1VLQA 3GFOA 4UNIA 5DLDA 3A6FA 3CUVA 3P4YA 4K9QA 3RFCA 3STWA 4I7EA 2BKLA 4B87A 1EDEA 4TUYA 4LWPA 1OVMA 2IW1A 4Q16A 2L19A 3DZGA 5CA1B 3FPLA 3V8BA 5CB8A 3LJKA 4L7VA 4OPMA 2IEYA 3RHSA 2W2LD 3L2OB 4JI6B 2LR0A 1GLNA 5E7JA 3EDCA 4DC1A 4YXWA 1BGWA 4WLEA 1RI4A 4PS1A 4XE5A 2CK3A 5KQMA 1WHTA 1E5LA 4IJWA 4AL4A 1I1QB 1TK2A 2GM3A 2HSGA 3AH8A 3AIOA 4C7KA 1M8KA 4M53A 4NCKA 3QEJA 5A4DA 1V95A 3HGMA 4O29A 1P7VA 1EI9A 4G0MA 3JAWA 1FDVA 3EF1A 1QK5A 3RU9A 3B2QA 4M86A 3T5CA 1F9EA 1VDMA 2BHSA 3PRYA 2DVMA 2JFWA 3ZIAD 1ESCA 1XD2B 3A6HA 1Q0TA 1W85B 2HF2A 3OQ6A 4IZIA 3IIIA 3WGTA 3EFEA 1RQNA 1YL5A 4QAQA 3WIVA 2WIBA 5GINE 4JT8A 5FFFA 4HJXA 1UK9A 3Q3HA 4XXHA 2F4VB 3ZVMA 4JC8A 4ZCIA 2WSIA 3BD6A 1UAYA 3ITDA 3IEPA 4QICA 2F9MA 3CRRA 4JBNA 4LX8A 3OTQA 4LOIA 5I7VA 3QW4B 4BCCA 2GSDA 4ZOLA 4H1WA 2H0RA 2AD1A 3H19A 2GJ4A 1CQZA 2I76A 3LSTA 2DUUA 3OWOA 2ZM5A 4HAYA 1KOLA 3BE5A 4MRVA 1R66A 4QJBA 4B3JA 4WBNB 4B9AA 1T36B 1RZ3A 5FHQA 3T7EA 4OX9Y 2ES4A 4UBKA 5CDGA 4GXTA 1IVSA 3R5HA 4KE7A 4RX1A 2FPGA 1G42A 2YUIA 3IP3A 4PY2A 2XGSA 1EWQA 1A9YA 3FHCB 4PYJA 4D0SA 2WJJA 1XLVA 3DAYA 3IQHX 4KQXA 5M29A 3G9UA 1L5MA 2XF2A 4EL5A 3QVXA 2RB4A 1I0IA 4L6IA 1I6LA 4BLPA 1NTRA 1OD6A 2RGXA 5FCDA 1VJGA 1M33A 1FNNA 4NJEB 1XVAA 3H5LA 5IDQA 1E6WA 2CJWA 1N6KA 2VDKB 1TQ2A 3CR8A 3PGJA 5FV4A 3AFGA 4MV1A 4AK9A 3QX8A 5FV7A 5I8PA 1VSUA 1FSFA 5BT9A 4D46A 1AF7A 1O87A 3CEPB 3DE3X 3F0TA 3HHEA 2B5WA 1EEHA 2AWNA 3KO8A 1W19A 2PUJA 3C3XA 1X8KA 3PPXA 1E79D 2I3ZA 3QVWA 5AJXA 4ZQHA 1PQ4A 3IAS6 1JXAA 1XG5A 2A9VA 4QECA 1GAWA 3HEMA 5FI3A 5FHRA 3V4FA 3A9CA 2J8ZA 1UPTA 4RZUA 3V42A 5KYNA 2JLWA 4WZZA 4RHUA 2HA7A 1T35A 4XRRA 3TGWA 3NEJA 1THMA 4HKTA 4KFRA 3VR3A 5FD8A 3RVMA 1W30A 4BVEA 5IH7A 1KEVA 1GL3A 3DDHA 4L0MA 1GDTA 1JLLA 3C24A 4MARA 5BSFA 1ZBDA 1GLGA 1L7OA 3B1WA 3TIXB 1D2RA 1C3LA 2PG3A 3ZU6A 4EMTA 4QQRA 3GEBA 1A71A 1J8MF 4RFSA 5L3RA 1NAHA 2N47A 4H7FA 4IY1A 1CRLA 1FEZA 1TA0A 4E22A 5K4GA 4N5MA 3TBHA 1TTPB 4O2AB 1BU8A 1PR4A 2WINI 2ZFUA 3H1EA 4JBYA 3HV0A 5LDDC 4OHKA 1GT6A 4HH3C 4MYUA 2H1HA 2ZRCA 1PDWA 1V8DA 4POAA 4PZDA 4B09A 4CHTA 5KOYA 1TYDE 4DADA 2BHRA 1IZYA 3C3PA 2VDQB 4CM4A 1MB4A 4QYXA 5KNCH 3CN7A 5JZOA 1Z2NX 3AF0A 5CVDA 3FVWA 1U7WA 2NVUA 2ZYUX 3TJZA 3VU1A 5CLJA 2EG5A 2NQ2C 3A4TA 4XOUA 5KPJA 1MMFB 3IQFA 8OHMA 4I19A 3WZLA 3LIIA 1TM5E 2E82A 1Q0LA 3RJ5A 3ZK7A 4HPXB 5CCXA 1FRZA 4IVQA 5MN6A 2ESRA 1L1RA 3CLTD 2NZ2A 5E8RA 4CU5A 1QO9A 4DZZA 2CXTA 5I3ZA 1I9CA 2Q3JA 3UV6A 2XNDA 4M38A 1FC0A 4C43A 4Z1MD 4LDAA 5L3SB 3I45A 2GN9A 1E0KA 2CKMA 3ORFA 4P1ZA 1U0LA 1ENYA 1K8QA 1BD3A 4IDBA 1M75A 1UWVA 3FCEA 5KOHA 5CFOA 1QGUA 2C9BA 1QBKC 2I2CA 2OBMA 1X1TA 2EEPA 1IMJA 2PH7A 2QRVB 4Z0PA 4AAYA 1F6DA 4OXQA 2AR0A 1ORTA 4XWTA 1OT3A 2E87A 3DTTA 4C76A 1XDWA 4PPQA 1QRTA 1GPH1 3CR3C 1T5IA 3PHHA 1NXWA 4TSFA 1KMIY 3QVGB 4LJ4A 3V7FA 2A4KA 2A67A 3TJMA 5E0KB 2V8BA 3HCDA 4JBLA 4HEJA 1QXSA 5G53C 1XRLA 1PQPA 2SECE 3GP5A 3MT0A 3QTLA 4MO2A 4E2FA 3ZWDA 2FK8A 4WPGA 2BLNA 2B4TO 3Q15C 2VP9A 2UZ3A 4MPJA 2R6DA 1G20B 4NI5A 4OV6B 3RRMA 2VDMB 1NJ1A 4ZU1X 3VO1A 4C4PA 4IMPA 4BO5A 1AKQA 2XJ4A 4U2FA 3EEFA 5AOCA 1LQTA 1YDGA 3RCBA 3ROTA 4E2ZA 5F1OA 3VA7A 3ZDBA 4WKPA 4BS9A 3O2QB 4LXTA 2R2AA 2XCTB 4MGIR 1ZR4A 2GVZC 4OQNA 1OYYA 3PD7A 1JZSA 3HJNA 4ND3A 1BE0A 3CF4G 2BZGA 3T1VA 3H97A 2C4MA 1RJDA 3BWMA 5FQOA 3VSCA 3P9ZA 1AGRA 1YULA 3AHIA 4TT8A 5JNSA 3REOA 1JHAA 3FWHA 4GX2A 4FUQA 1N34B 2BI4A 2C5HA 5DISB 3G1WA 3QI7A 2RAPA 2ZUSA 4LJ7A 5DGTA 3BF8A 1PEKE 2EQAA 1U2PA 2Z5FA 4NMXB 5A03A 4R2WA 2X9NA 4MWEA 721PA 1V8FA 5SZJA 4UDOA 3EG5A 3WWEA 2ZWMA 5HIJA 4I1PA 3EIWA 4PBRA 3E0QA 1V4VA 3SBXA 3PP8A 4DDHA 4IQGA 3TPZA 1RYBA 5JADA 4Y30A 3JR3A 2HA0A 5F2NA 1T8YA 3NTRA 1KGDA 3ETCA 4QGBA 1BVYF 4J3JA 3LLUA 1HDRA 1OREA 2WE8A 4Q05A 4RSHA 3N8DA 4B4KA 4CFYA