3K4QA

Aspergillus niger phytase in complex with myo-inositol hexakis sulfate
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
438
structure length
438
Chain Sequence
SCDTVDQGYQCFSETSHLWGQYAPFFSLANESVISPEVPAGCRVTFAQVLSRHGARYPTDSKGKKYSALIEEIQQNATTFDGKYAFLKTYNYSLGADDLTPFGEQELVNSGIKFYQRYESLTRNIVPFIRSSGSSRVIASGKKFIEGFQSTKLKDPRAQPGQSSPKIDVVISEASSSNNTLDPGTCTVFEDSELADTVEANFTATFVPSIRQRLENDLSGVTLTDTEVTYLMDMCSFDTISTSTVDTKLSPFCDLFTHDEWINYDYLQSLKKYYGHGAGNPLGPTQGVGYANELIARLTHSPVHDDTSSNHTLDSSPATFPLNSTLYADFSHDNGIISILFALGLYNGTKPLSTTTVENITQTDGFSSAWTVPFASRLYVEMMQCQAEQEPLVRVLVNDRVVPLHGCPVDALGRCTRDSFVRGLSFARSGGDWAECFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords 3-phytase A
publication title The structure of Aspergillus niger phytase PhyA in complex with a phytate mimetic
pubmed doi rcsb
source organism Aspergillus niger
total genus 153
structure length 438
sequence length 438
chains with identical sequence B
ec nomenclature ec 3.1.3.8: 3-phytase.
pdb deposition date 2009-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00328 His_Phos_2 Histidine phosphatase superfamily (branch 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 3k4qA01
2EKBA 4ODIA 2DWPA 3K4QA 4PZ9A 1QWOA 2P9YA 4EO9A 1BQ4A 2H4ZA 2P75A 3DB1A 5HR5A 1CVIA 3C7TA 1T8PA 1K6MA 3E9EA 1UJCA 3E9DA 1DKOA 2P78A 4D4JA 2H0QA 3GP3A 4FDUA 2P79A 4GPIB 3QPWA 1H2FA 5AK0A 4PGMA 1DKLA 4HBZA 3LL4A 4GPZA 5AJXA 3EOZA 3FDZA 3K4PA 5PGMA 2EOAA 2QNIA 1XQ9A 1FBTA 4D4KA 2ENUA 2P2ZA 4D4MA 5AJVB 3FDZB 1NT4A 5CX4A 1BIFA 3R7AA 1QHFA 4ARSA 3NTLA 2WU0A 3FJYA 2A6PA 4MA4A 1EBBA 2OWDA 4E3WA 2H4XA 3ZHCA 2P6OA 3PGMA 2P2YA 3GP5A 3F3KA 3LNTA 2WNHA 1QFXA 2ENWA 2P30A 3GW8A 1DKNA 5HTKA 4ARUA 2GFIA 4FDTA 4ARVA 5CU7A 4TSRA 2RFLA 1IHPA 1SK8A 3DCYA 1SKAA 4D4LA 5AJYA 2A9JA 3LG2A 1V7QA 1V37A 4EMBA 3KKKA 2F90A 2BIFA 3D6AA 3QPUA 1RPAA 2IKQA 2P9FA 1UJBA 5AJWA 1C81A 2HPAA 1SK9A 3OI7A 2H52A 2HHJA 2YN2A 1H2EA 3IT0A 3MBKA 3IT1A 3NFYA 2P9ZA 1SKBA 2DWOA 1TIPA 1ND6A 1YJXA 2P77A 1DKPA 2HIAA 1C7ZA 3BIFA 3EZNA 1ND5A 4JODA 2AXNA 1DKQA 1DKMA 2I1VB 2YN0A 3IT2A 3D8HA 3E9CA 1E59A 3QPVA 1RIIA 1YFKA 4JOBA 1RPTA 4IJ6A 3HJGA 5CDHA 3F2IA 4AROA 1FZTA 4IJ5A 3MXOA 2PA0A 1E58A 4JOCA 1BQ3A 2EKZA 2P6MA 3O0TA 2WNIA 3IT3A 1C80A 4QIHA 2OWEA 3D4IA 5AJZA 4PZAA
chains in the Genus database with same CATH superfamily
5AVYA 4QBFA 1SUBA 5BNFA 1K86A 1GKLA 2EJBA 2VDVE 2VP4A 3K0CC 3UB2A 3K4QA 2J6BA 2DGDA 3T61A 1Y34E 2Z83A 3O90A 2WQ7A 4KFSA 1V11A 2X7HA 2QAGC 3C3MA 4HG2A 1RHUA 1ZCJA 3AV3A 3I9LA 4N1AA 1E79A 2JEYA 4RX1A 4XVQA 2W5UA 1BCSB 3LV8A 2GBIA 1J56A 5L3ZA 1NW4A 1B6GA 2PX4A 2VH1A 4L4XA 3W6OA 3U3MA 2VVTA 1ZH6A 2H54A 2PSFA 3S99A 2BEKA 2WVAA 4CM1A 1WUHS 1XALA 3N75A 3L0SA 1GG8A 5E1BA 3TLMA 1YZQA 2WQZA 3KB8A 4RTJA 5DYWA 1L5SA 1QVZA 2QTCA 3HNPA 1FTGA 4NFYA 2GD6A 2PWBA 5DOVA 1G8HA 3WHPA 1ONPA 3VKFA 6NULA 4UU8A 5CITA 9LDBA 3RREA 1Z5NA 1WIWA 2AG1A 2IYPA 3OOWA 4LXUA 5GJWC 4MQBA 2JI8A 2ZBGA 4BVEA 3QWAA 2VRCD 4DCVA 5KVCA 1MF7A 1Z18A 1GLVA 3NNSA 3O2NA 5EHGA 3TXXA 3CEMA 4RY0A 5BYAA 6YASA 3S70A 4L16A 1FNNA 1H66A 2VYQA 4FU0A 5IJ0A 3B1VA 3W8RA 3U26A 3RVOA 4F45A 1WVIA 3NJRA 1QAMA 1EVIA 2Z5VA 3HCOA 3HXTA 2RGYA 4IZHA 5J9FA 3HUEA 1Z8HA 3MS7A 4PGHA 4EI7A 1UBEA 2OZEA 2IH4A 4RY9A 3ZCTA 5FYQA 3W34A 1W2GA 4C7JA 3KPJA 4NL4H 2JLYA 3A0UA 2AFVA 3CB2A 3L01A 1YS7A 4ENUA 1E9VA 1O6GA 3OP4A 1AK9A 2EKQA 1H1TA 1MDFA 2CD7A 5CAEA 5HKOA 2F4VB 3PLAE 1JU9A 4PCAA 3BVPA 4RM3A 1VIVA 4QL3A 4Z5XA 3H5IA 3W77A 5A9TA 1MHTA 2PJZA 2CE2X 3R0IA 1OZ0A 2N75A 4JSRA 3T9CA 5BSFA 2XVAA 3L06A 1YR8A 3H99A 4DPMA 2HWKA 3URMA 3VPHA 1ZCAA 1SU4A 3AFGA 1AGYA 1JF8A 4DLAA 2J3EA 2X9GA 1XNRB 2EU8A 4BAZA 3BMNA 3WLOA 4BC0A 4BYMA 1MPXA 3ESDA 1O54A 3RABA 4G9BA 3AOGA 3H16A 3I2IA 3D8SA 5CNIA 5DNEA 1NXTA 2DTXA 2QZ9A 1W0JD 3FMVA 3FVRA 3OH8A 3ROEA 4RJTA 2CV1A 1UPAA 2FUEA 1NQXA 1Z6XA 2A9KA 3MGBA 5FFMA 1TCVA 5CEEA 2KE5A 4FZRA 4CWAA 3DVLA 4FPXA 3G2LA 2QU7A 4S1VA 1ZY2A 1BU5A 4DF3A 5DN6D 3FKJA 4KU4A 1SVLA 2R8YA 2W6QA 4Q34A 4WCFA 3THOA 5K6TA 1PZNA 1S3GA 4A26A 4XVCA 4WI1A 3OIYA 4QQ8A 2F9FA 5KOHA 1OU4A 2XJ4A 5AOCA 3TQSA 2AFIA 4LOKA 4CIAA 5HNKA 3B3FA 2HU2A 4LGMA 4R71A 1USWA 4EMTA 3K1ZA 3OVMA 2WU3A 1YH3A 4MYDA 1QANA 2RHCA 3NDRA 1F3OA 1L4FA 3BDIA 2CVOA 1JHRA 1JAYA 4G8BA 3AINA 4K8OA 4RGYA 4ODIA 5LZ9A 3INGA 1MKYA 1ZXLA 2Y1KA 3OCXA 5MFZA 2XXBA 2YMMA 5EXPA 5FA6A 1C9YA 4QGHA 4GICA 2CVQA 4QFCA 4JBWA 4EYKA 5ITWA 1ZD4A 4RTMA 4YXFA 3BA6A 3E4DA 3MT9A 5C31A 3G68A 2FQYA 3NXKA 1KE2A 4DLSA 1M67A 3CURA 4JCOA 3TS1A 4EFNA 4LVNA 5CFLA 3WWZA 3LUCA 3FOBA 3O4FA 1ECFA 4FJ1A 1ODTC 3ND9A 2PQ0A 1E4VA 4DRXA 3LCUA 4YNBA 1X39A 2BHLA 3DZHA 4MVJE 4MR9A 4OQ4A 3QUSA 5IAKA 4D6XA 5H70A 3CVYA 1MEJA 5IAOA 1Y80A 3S3TA 1QIJA 3HJCA 2G88A 1Q0HA 4YCAA 4Z4EA 2HU8A 4J43A 3AIKA 3LXRA 1O6BA 4GQBA 2AF4C 5MN4A 4DADA 1I7LA 2D1FA 3BL6A 5ALHA 2B1GA 4JLSA 4TKUA 2W2PA 1RWXA 4HDOB 4HXYA 2UZ1A 4UFOA 4RGQA 5REQA 2C31A 1L1FA 3WOVA 5BNIA 2HFJA 3AKCA 4TYNA 1AZTA 5C2JB 1MB4A 1D2AA 2QLLA 3ITKA 4JC5A 3UMFA 1ECJA 1XHFA 3BFKA 3OFJA 3AU9A 3TZKA 1J5XA 4CKBA 3IERA 2O8NA 3P2IA 4GBMA 1SB9A 2AYYA 2IIBA 5KX5F 4L4SA 3TL6A 2P9JA 3EQ6A 2XJ9A 5DHAA 4OOEA 3JXEA 4P4GA 3IHKA 3PJRA 1K5PA 4HNUA 1I24A 1I2CA 2X0JA 3V00A 2FJUA 4G36A 5F3RA 3ABZA 5FTWA 1NW6A 1RQNA 1XD2A 4ENSA 5LLTA 3GJ7A 4EUFA 1FLDA 1P91A 1K3UB 2I78A 2XGSA 3BAFA 4NZOA 1H0HA 1SKAA 2R7KA 2VQSA 1D09A 1LRLA 5ECYA 2Q3JA 3SHTA 3I2HA 4IDEA 2X6TA 3TE7A 1USVA 4DA6A 2FPLA 3HVIA 1KI3A 3PGA1 4D57A 5I8PA 1NR1A 2GVZC 3LZ6A 1AKVA 3R7NA 1KAGA 3HYSA 4GZ3A 4Y2JA 3WK7A 5DRTA 1QQ6A 4BGIA 2IITA 2VNKA 3GF4A 1X70A 4HRYA 4HNVA 5EOVA 4YAFA 3USZA 2PR2A 1ZRHA 2LZ0A 4UOEA 3WGIA 2GPSA 4CR7A 1I7QB 4RWZA 4YCLA 1YI1A 3GLGE 4I1OA 2XKJE 4XIYA 4R5HA 2CYBA 3JQAD 2DKFA 3ANYB 4LYAA 4KYTA 4RD2A 1SPBS 3RJ9A 1JXMA 1NRIA 3CH5A 3TQCA 4DG5A 5C8YB 5ICCA 3CH4B 1QQBA 4I50B 2EQ5A 4FQ8A 4JODA 2PZEA 3FBGA 4ZQGA 4EFKA 2IS2A 5A5VA 1KS2A 3PBKA 4BNUA 4WLNA 1YFJA 3V8PA 2R9VA 3VU1A 4PSAA 4US1R 1ICEA 5MGBA 5LYJB 3AF3A 5DN9A 4KFTA 1N6LA 2GM4A 4JOBA 1GVHA 1KDTA 1UUFA 3PJDA 4V1CA 3OQOA 2EP7A 4CM5A 2QD1A 4MW6A 4BMVA 2Q6KA 1L7XA 3CNNA 4IPTA 4W5WA 4QXAA 5E1MA 5HILA 2O5VA 3G8DA 5JNSA 4A6XA 1C29B 3MGGA 3SU8A 3PKIA 4BLSA 1X77A 4D9NA 2QTVA 3K0SA 4EGQA 5JAUA 4B8ZA 1XVVA 2YWGA 4EHNA 3CGWA 1EH5A 2BBTA 4ZICA 1V8FA 2CNBA 1RM0A 2A5JA 5B7GA 4CYMA 1F12A 3KO8A 5EZYB 5FLEX 1T3HA 2UUOA 3ZBQA 4PLTA 2XTJA 3GGOA 3TLGA 4EY5A 4ZHQF 4DV0B 3ESBA 1W93A 2FZEA 5AMXA 5ALSA 5IG2A 3FUVA 3O31A 3LHSA 3GU3A 2J09A 1UPTA 4JJ8A 1PJ3A 3HYNA 4RDHA 4MVJH 4OHMA 2VPQA 4H7DA 5EYPA 2V6MA 4KO4S 5I5EA 4K0KB 3KNZA 1K89A 1PYOA 4MKZA 5CA0F 2J0SA 2FVYA 3P2KA 4DILA 1ZOOA 2CNDA 3PF9A 1M33A 2A30A 2D2XA 3DLTA 5FEMA 3PNVA 5KCMA 3VJRA 2RH9B 1JVBA 2ZAYA 3AZOA 5E7MA 4RPHA 2AB0A 4K6FA 1QMPA 4KXYA 4NI5A 4UHJA 3WMWA 2VLIA 4IFEA 1SA0B 5BV1A 3MLBA 5FWXA 3G23A 1KZ1A 2BCJQ 2RBEA 3O2QB 4XDYA 2OHVA 4RVHA 3I2KA 1FSZA 1BDMA 1SIOA 4ZZ3A 4QDOA 5BPFA 1U0SY 4Q05A 3M6AA 1UMKA 1NC3A 2HY7A 2WU0A 2XY4A 4EKDA 2W2VA 4EKIA 2CZQA 2FUNB 4YRKA 4RTRA 1FFBA 3OZDA 1OI4A 2Y8EA 5LMUB 1KDZA 4BLRA 2A5YB 2C9MA 3R7BA 3W5UA 3U5TA 1U2GC 3WK9A 3L77A 3K7EA 3M9XA 1UPFA 1K7YA 3AVPA 5CG2A 3GLHA 1CR0A 1WW3A 4KO8A 1BW9A 3R6GA 2OGZA 4ETWA 1YTUA 4WKPA 1JYSA 2I29A 3LUDA 4X90A 4D9CA 3W8DA 5CURA 5JLAA 1XCLA 1NKSA 2GMWA 1AMOA 1LK7A 2CLHB 2WTAA 1TZ2A 4K0RA 1PDWA 5KTRA 4OIFA 4DTCA 3MN1A 5FO1A 5IC6A 1R0ZA 4AQYB 4ZDIA 2QMHA 4JL6A 4TQ9A 5TEVA 1VXOA 1FE8A 3WC4A 5K2OA 1DQYA 2X40A 5JAQA 3QZUA 2IOQA 2EJTA 1K5HA 2XYHA 3UMCA 4CHTA 1H4TA 2CB0A 3DBLA 3I37X 1AUPA 3KOZA 3LLMA 5JSYA 4YCCA 3BX1A 3HCBA 4ENVA 3IC5A 4OXRA 4BGVA 4B7UA 3K0BA 1CHNA 2BUBA 3QLJA 2ZJBA 2X7XA 1YJXA 4CEIB 4CMCA 4J0CA 3FMIA 2AFIE 3K0AB 5MGNA 1HEYA 5BSTA 2FZCA 2IHJA 4DUYB 2VPZA 1G42A 3LYHA 4OD0A 4WVFA 4CM7A 4M49A 3SS8A 4KFUA 4DHWA 1S2GA 2OORC 4MWEA 4BAUA 2CXQA 4CV0A 1C4KA 3E3NA 3KYDB 4PQYA 3MB8A 4LJ6A 2FPSA 5CYGA 2ORYA 5EQJB 1E3QA 4EUHA 2GGSA 3NBMA 3BHJA 1NV8A 5LVAA 2FZ4A 2A92A 2MOKA 3K0HA 3CE6A 4ZT3A 2RGRA 1I1QB 1MCZA 1O1YA 3B85A 3C1OA 5EVJA 1L5WA 1T4GA 1JMKC 5ESRA 1B00A 3W8FA 5E6SB 4AIRA 4BB9A 2PSDA 4NYJQ 3FDIA 2YQ5A 3IAXA 3W04A 4J0KA 3WIUA 1N8TA 1XDZA 3GPDG 1IPEA 3HZOA 4LDQA 1NOIA 1ZITA 3HCDA 1T2EA 4IIJB 2Q4BA 4LDRA 4UNQA 3LY8A 5H4HA 5HK8A 5CDFA 3TMAA 2O8FB 1PG0A 3UH0A 3TX6A 3OEED 1QORA 4DMRA 1JQKA 1YD7A 3CUWA 1SVWA 5ED4A 1ZO8A 3BTSA 3ZY4A 4Z7QB 4BNDA 2PNFA 3ETDA 4Q7MB 1Y5IA 1U2ZA 2Q5CA 3AESA 3LZDA 4RHFA 2WDPA 2RI1A 1WKBA 5JYCA 4O1HA 1IBMB 3QVMA 3QXSA 1K2WA 4LV6A 1WLYA 3NBZC 2EDCA 1MW9X 1SNYA 1B8VA 4QQRA 1W34A 2O59A 3Q7RA 1GPH1 1YQWA 2A0WA 3IVRA 2WSBA 5I48A 5ICEA 1IHXA 1EX1A 4G8JA 3K70B 2ZSUA 3H6KA 3KB2A 4B6RA 5EEGA 1UDBA 5DHFA 2HTFA 121PA 1ZSNA 4NK4A 3RS7A 3OJEA 1PQWA 1V35A 3DBIA 4A0SA 2ZB8A 3U19A 3V7UA 2I6QA 4JUIA 2JD1A 3WGKA 3GEEA 4R8SA 2PX0A 2QRMA 5IWAB 1W9HA 2HHCA 3KDSE 3TFWA 3NHSA 2RGAA 4C0SA 1LK0A 3PXGA 4DM7A 2ZZNA 1CJCA 3OECA 2QM7A 1C9JA 3H83A 2BEVA 4IEIA 2P2CA 3D6JA 3AVVA 1YR3A 1JAXA 2ZJ0A 4IP0A 1R5OA 3OQIA 3C8MA 1ATIA 2EZ9A 4R1PA 2XVXA 3ZXUB 1IHUA 4MCIA 4M9CA 1U2SA 3UW1A 5ICFA 2YJ3A 2JJYA 3VSAA 1TKCA 2FN3A 1ECLA 4BE4A 2VP5A 3WOHA 1EFRA 1CB7A 4OP3A 2QUZA 3F7NA 1N75A 3A1EA 2FX3A 1OUMA 4FMCB 5FJIA 1M2JA 3B1YA 3ZIUA 2WUEA 2JIMA 4URVR 4M9QA 3ZWWA 1M5TA 2XE4A 3T3NA 3EC7A 2WVJA 3UWOA 1GKUB 4PAQA 1IL0A 1XDDA 3JWJA 1XA3A 3W5AA 1BX0A 3QPUA 2OO3A 3HKBB 1Z47A 1LU9A 3PVCA 1R27A 5K45A 5FNZA 1Z4QA 1SG9A 2K2QB 2Q2NA 3EMVA 2NIPA 3CPJB 4JLKA 1F8FA 5EQDA 3LPDA 5EZQA 1XQ6A 2B3DA 4Z0NA 3FSRA 3HFGA 1E1LA 2V9CA 1K8YB 1QLHA 1U9YA 3I45A 4DQLA 4IQ8A 2Q0XA 4Q4HB 3I1FA 3ZLVA 5P8WA 2DERA 1YQQA 2P3QA 3QW4B 4J1TC 3D6HA 3PGKA 5DGIA 1MJNA 1LDEA 1E1QA 3C3AA 5C32A 1L4LA 4I6GA 1C4XA 3PLRA 1LA2A 3ASVA 2FFAA 3I72A 4U2CA 5GONF 2I4NA 4Y1FA 1KY4A 1NW3A 4D9KA 1JWLA 5LOVA 1VE7A 1FYFA 2X9LA 4ZU1X 4BNNA 3PHIA 1JU3A 4TZ6A 4YVFA 1R0SA 2NU7A 2I9KA 1JIXA 3UAZA 3TIFA 1YFZA 3S27A 3H9GA 3N2NA 3ZYCA 4ENTA 1QHGA 2KM1A 4UMEA 3PQ2A 3PYXA 4DIFA 3ZV3A 4E4YA 3CY6A 3D4IA 3E84A 3MAAC 3DFFA 3JRXA 5TMEA 3RHFA 2J41A 4C6TB 4QUIA 3GK3A 2XNHA 4AT1A 4MR8A 2O3SA 3TSOA 5JSZA 1PZXA 2FE4A 2GDZA 2AJTA 4MIKA 3C7DB 3VO8A 5JZ9A 2VF8A 4PZZA 4TLMB 3DKKA 1SUSA 4DSOA 5J2TA 4DR7B 3HL0A 4IGIA 2GETA 1GU0A 3Q9UA 3ED5A 4MUAA 4MHOA 4OGFA 4EABA 1YCGA 2B25A 1D4ZA 1LFDB 1MB9A 3DL7A 4AM8A 1ENPA 2XRFA 2HU7A 1ZAYA 1KEEB 3VU9B 3DPIA 1M7GA 3KOYA 1IQRA 2JFOA 2VPPA 2OHHA 2GZ1A 2A5GA 3G5TA 2Q4TA 1UT6A 3PKZA 1YK0A 1M1YE 1E7SA 5CVDA 1KRXA 1G6OA 2W6JD 1ESEA 1L3CA 5E0OA 3ZD6A 2F6RA 4DCGA 5H9VA 2QPTA 3MWKA 4YJHB 4E14A 5L95A 5AK0A 3U44B 1ODLA 5CXUA 3QSGA 2AN9A 4XSVA 2FDCA 2OCAA 4R2KA 1IBLB 2IPOA 4KREA 1VG0B 3FRJA 1B0AA 3E1KA 4H2DA 1FTSA 1L4NA 3T7TA 2QTLA 2CEAA 5NLLA 5KYTA 1KI9A 2O2EA 3OLXA 4QFMA 5DW3A 3LCCA 5LKAA 2KPOA 3DUWA 3ZXYA 3K2QA 3N9IA 3QKRA 3FDZB 3C3BA 2I55A 3GLHE 1NW5A 3NB0A 1N7JA 2WB4A 2DHCA 2HRDA 3MLEA 4CR8A 4ZCTA 1XTBA 1W6RA 1EK5A 2JI9A 4JITA 2VO1A 2QUIA 3CUSA 1JSZA 3FSGA 3PGLA 2PSJA 4PHTA 4CM4A 1CPYA 3FJOA 3KUUA 3WGYA 6Q21A 5KNCA 5HMLA 1JG4A 2QRKA 4FILA 2BTEA 4KIFA 3CEHA 4LWOA 2P40A 2H2DA 4WFIA 5HFAA 5A7HA 2WWIA 1V8BA 2XTNA 4ZOQI 4US2R 1PP4A 1VKNA 2OZLA 3BSSA 1G1AA 4ALLA 2IHYA 1CJTC 4IIXA 2AC4A 2RK3A 4HK4A 4LNAA 1GAWA 2IEBA 2IC5A 1L5GB 2MU1A 1ZZEA 1W0CA 3CPHA 4H7EA 4IH9A 3HK2A 4L2IB 2W70A 1KU6A 1S4MA 4KQMA 4YMWA 2A9JA 4URZR 5C7OO 1NF2A 5EMJA 2GSDA 3H9BA 3Q6NA 1PS0A 5FWYA 3Q7PA 3C3YA 2F90A 4XAQA 5F9FA 3URKA 1LBSA 5LU9A 3LJKA 4M0PA 2EX4A 3K0FB 1GDHA 1WMBA 2QTFA 1MXFA 3C6YA 3ISTA 3WQRA 2OBBA 3IMGA 2F17A 4KXXA 2IHNA 1YRWA 3SX4A 3A9WA 4CCSA 4ZCIA 4DE5A 4KE9A 1J1UA 3H1AA 3UMVA 4JV5B 4UASA 3VV3A 4DCJA 1QQAA 3U60B 1XQ1A 2GYVA 2IYXA 4WX2B 3EPPA 3RFXA 1Y1PA 3V1NA 4FHZA 3U4GA 2PLNA 1PJAA 2EERA 3ID6C 3L46A 5BVGB 1S3IA 1ADCA 1PR6A 5TV2A 3LYAA 4LQDA 2ZI6A 3ZHTA 4F9EA 4D8WA 5BMOA 4WINA 3BIFA 4BNGA 4HNHA 4F72A 1KFEB 4IIYA 4WDRA 4EG5A 1G2IA 1Z0KA 2QLJA 2PV7A 1Q92A 3G8AA 2G07A 3NONA 3R3XA 4QG3A 1SCIA 1Q1EA 3H3JA 1CUSA 2QK4A 4GKBA 4LJ9A 2DWQA 4S35A 2O0HA 3E35A 1UT8A 1J09A 4IX9A 5CDFE 5DHQA 3Q8KA 4IWXA 1BQ3A 4M0LA 3SJCA 4MUJA 3ZBTA 2H2GA 2VTVA 1FTQA 3OOSA 3PUWA 2V5UA 3F6BX 5C80A 4ZREA 2JHPA 4IHQA 4NU6A 4E0BA 3ZVNA 4R51A 3H6GA 3FPKA 1PGOA 2FMFA 4HAXA 2Y1LA 2C7OA 3HVUA 3G49A 1JTVA 3LCRA 4NCJA 2AOWA 2Y4OA 3HGMA 3ZJYA 4TLCA 2JKVA 4IOJA 5THQA 1DBRA 2FR8A 3ZE1B 2PD3A 1JN0A 1QX4A 2ZSDA 3PEYA 2EFCB 4YMLA 3ZLTA 4X65B 3QX8A 5ALZA 3T94A 1JLHA 1DRJA 3HDJA 3R5HA 1YJ5A 4PC7A 2V97A 13PKA 2CL6X 2XNDA 3P2MA 3PK0A 3VR2D 4OLFA 4D4JA 2C1ZA 3VZPA 4S2EA 1E3JA 1MBZA 3DCNA 1GAJA 2WWGA 4EB6B 1IUNA 1V1MA 3NM6B 2VAVA 1FU4A 3NPAA 4YN3A 2Y0CA 4ZQIA 4B3CA 1CFJA 6ABPA 4E7OA 3KLOA 3W2HA 5BQFA 1H2FA 4RE5A 3R3WA 4ER0A 1FJHA 2AW3A 3FPAA 4G85A 4PLHA 2DFVA 1ZLXA 4Q47A 4YFVA 1N1DA 3RAJA 3JQFA 2IIPA 2YS6A 3IPCA 4B1FA 2FWAA 2C57A 4BX2A 1EP1B 4X6LA 3B7WA 4ALMA 3OPVA 3NYQA 2BY4A 1JWAB 4FMBB 2R97A 1XG5A 1TLTA 4UKDA 3QVLA 3C8UA 4YONB 3EX7C 5LQJA 1NFQA 4QGGA 4XGNA 5E7JA 5B58T 4M1TA 1RJ9B 5FOVA 4EHKA 3OY2A 2I34A 5D00A 1YO6A 4Y1EA 2Z8XA 4ESVA 2A9FA 1C9MA 3STHA 1TGYA 3BXEA 4M38A 4TZKA 4BNTA 1PEDA 3GCZA 3UGKA 5F7XA 4N7JA 4LVCA 1AXEA 3UKDA 2REQA 3EULA 5DE3A 3QTLA 3JRNA 3SNKA 2NYUA 4ITUA 3DVSX 3ZGXA 5G0VA 2EF1A 3WGLA 5I01A 3E22A 1JLSA 3TRKA 2AFHB 2FQXA 2ZS8A 3OIWA 4D5GA 1NMSA 1K6EA 1LLDA 2B5OA 3K1AA 4OI2A 1P1CA 2FOIA 1MC4A 1SXGA 2AKYA 3AYZB 2VWGA 2XQJA 3IAS1 1QIDA 2OAQ1 3V8RA 4E5MA 3KZMA 4IWNA 1OWNA 2E1PA 2VPYA 1DJNA 2WTMA 4G97A 5DCLA 1QBGA 3F5DA 3N7AA 1TTPB 5A4KA 3D8RA 2C5FA 3EGDA 4DIKA 5TIIA 3U3DA 3IRUA 3RYHB 1Z5UA 1N5RA 5D2CA 4C0QC 4P3PA 5CJJA 2WWTA 3FOWA 1HZZC 4NH0A 2FLWA 4UHCA 5IH7A 3JQBC 2GFHA 3QKSA 1RCTE 4INOA 4R7GA 1FDOA 3AZPA 3ELWA 3BRWD 4PXYA 4TYYA 5DM4A 2QE7D 1Y7IA 1SC4A 1XD8A 1ZG3A 2VRBA 4ZT5A 1XZDA 2H0RA 4WECA 5DKFA 5F1PA 4CQLB 1KYXA 3GA7A 1EK2A 1RE0A 3ZHZA 4OHBA 1MOSA 4R9SA 5L7YA 4A2QA 4TL9A 5JISA 3M33A 4L28A 4ZYVA 4KK3A 2AJCA 4JXJA 5J5CA 3F2VA 1DAPA 1XRRA 1KJNA 1ZJ6A 1OI2A 2VYCA 5BP7A 4QX6A 1TZCA 4MV7A 2BYTA 2C03A 2QPAA 3DV2A 4MDYA 1EMDA 1CUFA 4NS1A 2HL6A 5FWAA 4BVJA 1LV8A 1IK6A 3D8NA 2D7JA 1AC5A 2ZAIA 2H3HA 4UUAA 1M76A 2WZBA 4QJ5A 2VYND 3C4VA 1OH8A 4N82A 2Z5FA 4QOJA 4XWGA 2HF7A 2MINB 2WLSA 4X60A 5G0WA 3D7RA 3PIRA 1KMMA 2HXYA 1Z63A 1B7GO 2HDOA 3GWGA 3KYCA 2W2LA 1EUQA 1XA0A 2IS4A 1G98A 2IZOA 3NHBA 3DFIA 2UZ4A 3FYUC 1ZDMA 1FRVA 2ZIAA 4QODA 2FFRA 3G2HA 4PAOA 2PUCA 4YYEA 3RS4A 3OCWA 4QXMA 1GZ4A 2IU6A 2WU1A 3I64A 1VTKA 4AN1A 1II8A 4CM6A 5BT9A 4GM1A 4AMUA 4LRQA 3H5NA 1FJGB 1EJ6A 2PL5A 2VNHA 2O1XA 4TWIA 4AJEA 2O5CA 3LTEA 1XGKA 3RYIA 5LL6P 1PR0A 1G6Q1 1X9GA 1CUHA 4RJKA 3BFJA 3N0TA 4D3YA 2OXCA 1TYZA 1QH8B 4GIBA 4PNHA 2BR3A 4JLNA 4JA2A 5COBA 3HN6A 4JI6B 3W3AD 3X43A 4BKQA 1NUHA 1QC5B 4QDKA 2QYTA 3LO8A 1G8PA 1JPUA 2O4UX 2ZPUA 4QXQA 3ZGYA 1I1NA 3II6X 4V0NA 1ZC3A 4KQCA 2GN6A 3DBRB 3FSEA 2PS0A 3PRJA 4OLJA 5CH5A 4F11A 2OYCA 1MV5A 3V6LA 4PW0A 3M6LA 3C1UA 4M0CA 2FPIA 5HF5A 4A8JC 2J30A 5SZKB 2BTQB 5DNWA 1QRAA 1YOVB 1C14A 5FOTA 4NE7A 2C94A 5ITZB 1PYDA 2Y2VA 1FPMA 1GZ5A 3A9VA 3HZHA 5HYVA 3RUEA 1P0MA 3QMMA 5IM5A 3KT6A 5AWFC 4CETA 4Q3CA 4BJHB 4O02B 4GLJA 4GMDA 4B80A 4ZV7A 4DTIA 4BWGA 3IQIX 1JW9B 5FRDA 3L49A 3NASA 3NATA 2ZYIA 4MEJA 3U13A 2R1ZA 4TXHA 5DWQA 1O97D 4MDEA 4P32A 1J5PA 1TO6A 1ODCA 2JW5A 3WYFA 3CRRA 4EL5A 2P2DA 3I1YA 4ME6A 4AW9A 3RI3A 4PNZA 3EXEB 3SC4A 3SOPA 4A1FA 4Y30A 2FPKA 3F3SA 4NZPA 1ZHFA 2CNWD 2OBNA 3EMDA 1P5HA 4JYCA 3EFOB 1UR5A 5T64A 3SHWA 1TOAA 3CZMA 3GCGA 4BQNA 2WQ6A 5IEBA 1EE9A 4JJKA 3L8ZA 4M1YA 3L92A 1RPNA 5B36A 2P7IA 5BR4A 2W4IA 1EA7A 5AW1A 4ZVUA 2B82A 4XTCS 4G2NA 1NXVA 1UKCA 3NCHA 4GGOA 2X1HA 2OR3A 4YWJA 2GILA 4CV3A 5CB8A 3FOFC 3ROMA 1R6XA 4JR0A 3BWEA 1DEXA 1NKTA 5FP0A 2B8WA 2VBFA 4XDHA 2FP4A 4IJQA 4S1WA 4ZARA 2PL3A 3RANA 1JDBB 1DKPA 5CW1A 3TJRA 1R10A 1T4CA 3WMRA 4F8EA 1QGZA 2IYUA 4W8HA 3MMPA 3R3YA 5FTKA 4PONA 4TLLB 4KDRA 4UQLA 2OHOA 1RQPA 2PGNA 3CF4G 4HEJA 4I3FA 2F1IA 1W1UA 3VDNB 2PRJA 1RCUA 2IP1A 3H86A 4R2WA 4C2AA 3ZJ5A 4OM8A 2BJVA 3VFDA 1G9XA 1RMYA 3N8DA 1O2DA 5ECGC 3ZV7A 2IWRA 3G82C 3T1OA 1UIRA 4J4TA 3W9SA 1E0KA 3HE3A 5LQNA 1C7QA 5HRUA 3M83A 3GCWA 5CUQA 3C3KA 1KEEA 4TMKA 3O8OA 1YJCA 1A1VA 1P60A 4KWTA 3BGWA 3DR5A 1E96A 4PNPA 4KLRA 5LD2B 4NNJA 1KI1A 1E7RA 4H08A 2HPHA 1BHQ1 5FPHA 2AN3A 3EXIB 3WTBA 4CEHA 3NP9A 2PU5A 1N32B 4J0JA 3K5WA 2C96A 1EXDA 1TNDA 1KFJB 2C2YA 1NSFA 2ZUTA 1ZL0A 2R8BA 4RV4A 1E1KA 1P1JA 4EEXA 3CLUC 3DL2A 4Q19A 3THSA 5KTNA 5LUAA 1WV0A 2QQ5A 5KYYA 4TLDA 4PFJA 3AX6A 3CMCO 3UJ8A 3E4CA 1QB7A 2LIPA 3OPXA 3KELA 3I92A 5A7GA 3EVTA 5ICGA 4FD2A 2XEXA 4N8EA 4OVKA 5KNCH 4C7OA 3F96A 1PSZA 3N6XA 4YEDA 1BDHA 1ZS9A 3F78A 1QDLB 4NHOA 3K70C 4V0QA 3VGJA 4URXR 2ZUWA 2AOXA 3JQQA 1NA5A 3A10A 1NNUA 2B99A 1K75A 3EH1A 3QEJA 3TTYA 2GJSA 4Q4AB 2X2OA 5JHGB 2FPOA 2IZ5A 4W1SA 5IZCC 3GLSA 4H3KB 1VA5A 5MN6A 4CXMA 2FTKE 1PWHA 1NSYA 2YOHA 3SM3A 5CG1A 1CR1A 3MSCA 5FUQA 4TV9B 5FOQA 1EQ2A 1D4FA 4RE6A 1UP4A 2R8PA 2VZ9A 5TARA 1KP2A 2JJMA 1AX9A 4C7XA 3KOWA 3U7FB 5PNTA 1Q21A 2X19A 1KXJA 3FWKA 3KKZA 4OUDB 2Q99A 5GGXA 5I8ZA 4D9EA 3M3DA 4QQKA 1MB2A 4AICA 1N7GA 3V1YA 1R8QA 1SEVA 2QRPA 3TNYA 3UMMA 5JV5A 1VDZA 3TJZA 3CRVA 2MSKA 3GJ3A 1UBHS 2JRLA 3CKLA 3QX7A 1YL7A 4PFQA 4S0ZA 5CM2Z 5A4AA 4EUNA 2BHSA 3PEEA 3SJUA 5CB4A 4CIWA 1VKOA 4IRXA 1FVHA 2IVFA 4M6WA 3RV4A 4Y0VA 4EUKA 2HJWA 1KY5A 3F5FA 1NIJA 1Z5OA 3UUGA 1IWBB 3PDUA 3H4TA 5IW8A 5HVNA 3TKAA 1J25A 3G2KA 3M6VA 2O4CA 2QAGB 2QLFA 4M0DA 5FTNA 4B84A 4GP9A 1KAQA 2B69A 3LI2A 3GQBA 1RADA 4MROA 4P53A 3AR9A 2Q46A 1ZEJA 4UW9A 2LE0A 4XQEA 4JQCA 4JBLA 3K72B 4FSXA 1NVGA 2E4YA 2Q6TA 3LD9A 2O2XA 3OO0A 4NDZA 5IK2A 3V4SA 3LY9A 3ZLUA 2AN4A 1EGMB 3JWEA 2PXCA 3R41A 3PITA 2Q2WA 4TM8A 4ZOLF 5JSUA 3KAQA 3PNOA 4XR9A 3WLHA 4DBVO 1PJ8A 3HBAA 1KPGA 1ND6A 1PNVA 2BFFB 2ESRA 2H2AA 2G25A 4LIPD 8ATCA 5JZBA 2IV7A 3HFSA 3H9CA 1RLTA 1UOEA 2NTYC 1QG6A 2WIKA 1N6NA 2L69A 2UVPB 2XDQB 2JAQA 3DTVB 1T6XA 4F5WA 3C48A 5TQ0A 3NHZA 5BY2A 1Z82A 3P52A 2PANA 3BGVA 3ND8A 5AKZA 4K9OA 3E9CA 1O58A 4WIAA 1M0SA 1GLGA 1RSZA 2X6RA 1SC3A 2D1YA 4IJ6A 4IJVA 1WPXA 5LJLA 3UGJA 1TD9A 5CK4A 3C2QA 3CH7A 2D5IA 4BASA 4AULA 3MRXA 4O25A 2WHEA 2FWRA 2K87A 5DPMA 9GPBA 3UJHA 2R0QC 3HH8A 2ZYSA 3Q5EA 1L5QA 2ZVJA 5DYNA 1PI3A 5JVDA 2QDKA 2UXBB 2GKSA 3I3OA 3K4HA 4Q1AA 4YUAA 1NUPA 2W6NA 2VDOB 3FWNA 1SBZA 3HACA 4B7CA 3U7IA 3VYVA 1VJGA 2M32A 3EGEA 2BF4A 4GO1A 2Q2VA 1OYOA 1BDJA 1G3MA 4RU1A 3SNHA 2CEKA 4IDBA 4LDNA 2HBZA 4U5QA 2IOFA 2FPGA 2NXJA 2O9JA 2I3AA 3A1TA 3E81A 1EHIA 5CBKA 1JA9A 3P2EA 3BH6A 1NJSA 4H4CA 5AKGA 1PBNA 3BWDD 4CKWA 2GAOA 1KBZA 1E4EA 2BGNA 4IUYA 4OQZA 5B1DA 5I51A 1I14A 3EXG2 5E6RA 5C7IO 3COWA 1G8GA 1Z73A 2FXIA 3CZRA 3I9OA 3KV1A 5JFGA 2B0CA 2BGJA 4MQFA 1LZLA 5F5NA 5ERGB 4DUPA 1EDOA 2VRWA 3I0ZA 3IUSA 3ZCRA 4GYKA 4BKUA 3NVMB 5IWCA 1Z33A 1WWKA 4RD3A 1UKVY 1Z83A 2FE1A 1U2DA 1TTHA 5L40A 2CDCA 2ENUA 3LDFA 4H15A 2UVQA 4R2XA 1LBIA 2HMVA 2DWUA 4R9RA 4DM3A 4WCFC 2QZJA 3CLTC 1DT3A 3HU2A 4MVJF 1VMEA 3N1UA 1F2UB 2GHQA 3N3BC 5CX4A 4Z99A 4C0WA 1AH2A 3Q0EA 2NU9A 3OZXA 4OGWA 4COOA 1Z4KA 2ERYA 4BO5A 2G9ZA 3AXTA 2GCOA 2EKPA 1IE3A 3DKRA 1FXUA 1RXUA 1X7HA 1YR9A 3K8OE 2EW8A 4L0CA 2VTKA 3MQ4A 4CCYB 4MV4A 2QL6A 2ZSFA 3C5WP 5E6UB 2Q5JA 2HWXA 2YUTA 1Q7CA 2DP4E 4IVNA 1JR3A 5EAIA 3VISA 4B2PA 4EW6A 2ZT8A 1YWGO 3FNHA 1NF3A 2CFOA 1ORTA 4GX1A 4L22A 4PTZA 3HVHA 4RBNA 1LVHA 2FW1A 3ETCA 3GEBA 1O96B 1E6UA 1PT7A 4G6ZA 4L07A 1ACJA 5EZ6B 2GHIA 2W4MA 4MV6A 1BOOA 1TAQA 2DOKA 1BTOA 2F8MA 1V8PA 4GOND 4QWWA 4RY2A 5C0OE 1US8A 3N87A 3PDCA 4F8YA 3IKTA 1KFKB 1GU7A 4F1JA 1Z2OX 2ZBFA 3EVAA 3GNTA 3JZDA 4M1QA 1NZDA 1U31A 3V97A 4C0BA 5AM0A 4LKRA 4EMSA 1HFEL 2ICAA 3KKKA 4MP3A 4MINA 4MPTA 1XTQA 4W9RA 4WXHA 4UU1A 3ZCPA 4HNTA 2RGUA 4MZDA 5DXFA 4G56A 1B93A 1IDN1 2XA1A 3K6KA 4L9SA 3VR1A 3QEKA 5C5CA 1B76A 1QOPB 1WXIA 3LK6A 3R0XA 2BFEB 4QU9A 3VV2A 3AVYA 3M3PA 4MLZA 5TE9A 2QTNA 5FI0B 1TZMA 3F6EX 4AECA 3H75A 4G0NA 4PQGA 4FSDA 3NHPA 5G0TA 1T9GR 1XEXB 4DRZA 2BR4A 2HRQA 1E8NA 3EB9A 5L3RA 1N2JA 4GRIA 1KY3A 3GYBA 5AK6A 4B2YA 4OIMA 5FPYA 2ZB4A 3AW9A 2BRUA 5LZ8A 2AV6A 1UMBB 3FTNA 4AJ4A 4B6GA 1KH1A 1ZJZA 1POWA 1U8ZA 3FPHA 2B4YA 5IKEA 4NXMB 1GGFA 2HDWA 4CG3A 4B3XA 3CB4A 1OXUA 2VJDA 1NPTO 4WT7A 4PLCA 1PCXA 2AVDA 3VKUA 3IJRA 4Y6GB 3JQ6A 4HXGA 1JNYA 4JGBA 2GK7A 3EG9A 4N7BA 3M6WA 3PC8C 3HJBA 3MCZA 3PFGA 4V02A 2M1ZA 2E48A 3PGVA 4TTPA 1KI8A 1J8QA 3PPVA 5HIJA 2VYVD 3TOZA 3RYCB 1FW6A 2ZI9A 3P2JA 1K7CA 4MPDA 5DHSA 1GG2A 2B2NA 1DRKA 3D7LA 2ANCA 2J0VA 4DV7B 3DEJA 4XJSA 1K88A 3JWGA 2I2AA 1E3SA 3F5QA 1NATA 2DFKB 4JA0A 4P4NA 3S1AB 4Q82A 4G0MA 4RVOA 4WASA 2Q7DA 3QOWA 4N40A 4NS4A 4D25A 5KDLA 3M5PA 1M2OA 2W6CX 2YVKA 2CLOB 3F49S 3H7AA 3LUFA 2ODPA 4E5SA 5L8VA 1V1RA 3FVWA 3DUFB 3NALA 1EVLA 3PYMA 2QZ4A 1VLMA 1JJVA 4W5JA 2PT9A 2ZS7A 3AEXA 2YWCA 4JIGA 2IZ7A 2P79A 2VDJA 3E61A 4CUJA 2DC1A 1S4QA 2Z3WA 2ZTHA 2IUEA 1XTVA 4IVPA 1DEHA 4Z4IA 2HMTA 2W8ZA 3E5RA 2OY0A 2XYRA 4UM5A 1HO3A 3JYHA 1MFPA 1QXSA 1RRGA 2A57A 2RHWA 2ZKIA 3ENNA 2WHYA 4I9HA 4DLYA 4RGVA 2C2MA 3LVFO 2BMDA 1V5WA 1ULSA 1Y8AA 3K9LA 4YXWA 5I7HA 2F43B 4H17A 2GK6A 2ZRDA 3AM3A 3UZUA 1RQLA 1M2EA 1WDMA 5D01A 1P81A 2QVGA 3A1NA 4HEA1 4XLZA 2ZJ3A 2NW6A 3GPIA 2WG1A 4C0XA 4E03A 2D5CA 4WNAB 4OP2A 3NNDA 2OESA 3J7TA 4LJSA 3ND7A 1GZDA 4BPRA 1FRQA 3I1IA 3WQQA 4I66A 1GL7A 5EHNA 3A3YA 4UE6A 8AT1A 4EG7A 1EZ4A 5EGSA 5TVGA 3IAS6 2Q2OA 4HRAA 4FGJA 5JD4A 3C0KA 4W8OA 3HV2A 4PRZA 3HM9A 3OT1A 2PVCA 2I8AA 4U2EA 2JFFA 3E7DA 1PZEA 3GG9A 3HU3A 4X44A 3FPFA 2O8BB 4X00A 2CHUA 1RWBA 2H08A 1QOQB 4EDHA 3U4HA 3IXLA 1GUYA 3MCAA 4DCNA 2PZFA 1XVUA 2YWDA 3A25A 3COVA 1ZK1A 2ZRLA 2OBYA 5EXDA 5IC5A 2MT9A 3GAZA 3IBCA 3R5KA 5B53A 5CXXA 3RD5A 1OW3B 1E3WB 1TEHA 1T9AA 4Z4FA 1VP9A 4BATA 5BPHA 1PJZA 4OGGA 2FY8A 2O7NA 1RJWA 2DPYA 1P8AA 4WLEA 4BQFA 3FCXA 5ALWA 4J29A 1MOPA 4GR9A 4NCXA 4R1LA 3LW7A 1C8LA 5JHHB 5DHTA 3G2JA 1E1MA 1P61B 2V4MA 4ZDJA 1PTKA 4NBWA 3B8HA 4ZRMA 2C1XA 1U0FA 3IT1A 3RE1A 1BGVA 2HD4A 1H42A 4RS3A 4O8ZA 4A7PA 2PDAA 4I4TA 4A5SA 2ON6A 2A1IA 3OPYI 3D6VA 4MYUA 4JI1B 1HT2E 1P2BA 1GPUA 1K5DA 3OZWA 4C01A 1HM5A 4B8YA 1J2TA 1Z4IA 4MI1A 1SXJE 1T2NA 3UJCA 5AH0A 1A8PA 1RM3A 3EIEA 3EXHA 1G9TA 4UDNA 4DKXA 1SOAA 3OETA 4XUGB 3CNBA 4V3CA 3IVAA 4ZT6A 5JCZA 2VNIA 5EJGA 2ZTVA 3UT5B 2CMHA 2M6KA 4CQMA 3LOPA 3N74A 1Z8DA 1QS0B 4O2BA 2P6MA 3K1YA 4LJRA 1ISIA 2IYLD 1F4VA 2XWQA 1UM9B 3TR6A 1SVNA 4BOYA 2WOOA 3T5BA 4KR3A 3BPSA 4QUBA 1EUCB 3FTQA 1N6OA 2R25B 4FCWA 1AO0A 5JSFA 1P6UA 3M49A 4HUQA 1Q1GA 3GLIA 4Q7JB 4RESA 4MV0A 1KQOA 3RU2A 3MIZA 1FMTA 1EKXA 2HRBA 5CFRA 5B7QA 1XRJA 1Y6QA 1U2TA 4D3FA 4K9DA 1T8PA 1DXYA 3E82A 2VAPA 2WFAA 3DE2X 4L08A 5C5DA 1ZGCA 4K3VA 2CMKA 3L0ZA 2NMVA 4NECA 5B1EA 1M54A 1E1RD 2D62A 1Q57A 2E85A 1NFRA 1YACA 4IHKA 5EZSA 4I55F 5KTSA 5KYXA 3GMDA 2PZAA 1N3LA 4FXOA 1WCWA 1AHIA 3GFVA 4MUYA 4WFQA 3VBEA 3RS5A 4FYVA 3DF9A 1GADO 5HHTA 3SXUB 1HE8B 2G36A 1IJBA 4AS2A 2WHQA 3QMWA 4PPYA 3PR2B 2XZDA 3QELB 4JWTA 2LBPA 4YP0A 3D0OA 1TMKA 1E66A 3Q5GA 4HPXB 4K86A 4RWEA 4XPIA 4G1MB 1U0TA 2ZRPA 3RVBA 2R6JA 4B4WA 2JHAA 1MUUA 2ZG6A 1U0LA 4AF7A 4HAZA 3TZEA 2FSPA 3KM0A 2N9UA 2HNBA 5FADA 1I13A 5FT9A 3CZCA 3PPYA 3CBGA 1XMVA 1R3UA 3H0EA 2NUTA 1E64A 3MTIA 1E99A 1F0NA 2CJFA 3KTAB 4HATA 1R0YA 2J59A 5DX1A 2W8BA 3DMTA 3ZDYB 5THXA 3OZTA 3U09A 1Z68A 2GAFA 1YDMA 1UEIA 3KIPA 3D2BA 2DY0A 4YTEA 1IIBA 3D6TB 1QK5A 3EE6A 3QK7A 4F4DA 1GTL1 3ZI7A 4ZCPA 2WKRA 5LNK1 1K7SN 5F3DA 4HH1A 2HK7A 3OEYA 3U4CA 4FFDA 1UMCA 3U3XA 4KMRA 3F5SA 3LG2A 4E13A 1L9XA 2AVNA 4G0XA 1JLLA 3DMPA 1CY0A 2X76A 3C6XA 2V65A 3GRPA 5DTJA 2V6BA 1TT5B 5IVIA 2WT8A 4AY4A 4X8LA 1X8LA 4D46A 2ZEJA 4HMOA 1XRPA 4CT5A 5BN3A 4FFLA 2JBHA 2WM8A 3HI4A 4LYYA 4RENA 2C2KA 3IT0A 3ANSA 3DTVD 3U7RA 4EF6A 2V03A 4EMUA 1MJHA 4KQ1A 5HIMA 4XRGA 1XZKA 3OJOA 1GPWB 1ZNZA 2HFKA 4G5RA 3RUAA 4BO7A 4NCHA 4RSMA 3LQ1A 3HRKA 1PS9A 1VPLA 2Y68A 1YRAA 5L3SA 1E7YA 2Z1MA 4JN6B 2WHPB 1SD5A 5JCPA 4C5CA 1ISPA 3TIGA 4F60A 5E38A 3CRMA 3DTTA 3P96A 4LZNA 4PSVA 4YMUA 1RM5A 4EJ6A 2CUTA 3KQQA 5ES4B 1KS9A 3WL8A 3B9PA 5FH9A 2AMLA 2EJUA 4MUNA 1RIIA 1RHMA 4BRWA 2XUJA 1W2HA 4O0LA 4UCWA 5E2IA 4OGLA 4BMDA 2IFTA 5TMPA 1P8JA 2BSXA 4IJ5A 4P4TA 4QYIB 3UYLA 1YKFA 4DR6B 3NR2A 1P7CA 1WUJS 4H27A 4HLQB 5T4EA 1C80A 1UXIA 3LKDA 3QW2A 2ZAOA 3AB3A 1G3IA 3LT0A 4GZ6A 4OHCA 3ETJA 3QFHA 2G1JA 3GIDA 4IJUA 1IN4A 2HT6A 5DT2A 4D5EA 1ZR4A 2WY2D 3PUKA 2F64A 4X8HA 5LXTA 2FGKA 2FWIA 2HXGA 2OK7A 2Q5OA 2W6IA 3X1KA 4C7VA 2AW5A 3WS7A 1YRYE 1Z56C 1KZ7B 2J85A 3X2FA 4DDWA 4KAXA 4XB6B 5AW0A 1KJ9A 4BS9A 1RACA 2I4MA 5CD9A 2UUAB 4BBZA 2CXXA 2WMOB 4UM9B 1ONOA 1T6NA 3COPA 3PR1A 4H60A 9LDTA 2WWWA 1W30A 4O4IA 3WWPA 5AVZA 3HN2A 4AXBA 4IDOA 2RGWA 2PEYA 2GPJA 2Z57A 3R3SA 4HN2A 1BYIA 4KX3A 1B73A 3I0MA 1JS1X 4GBGA 5IVKA 2DTDA 2ZJ1A 1I80A 2VNSA 3O82A 5GJCA 3ZWNA 3C41J 4JFRA 5G41A 1XIVA 3AQIA 4LJYA 1KK1A 1SJ9A 2LIVA 3GUUA 4WLVA 5BURA 3K6SB 1NHGA 1EP3B 2YR0A 3EHEA 2GEJA 2G08A 2MCFA 4C4XA 5JALA 1I3CA 3N2LA 4YAKA 3ONVA 2JJ8A 2RGDA 3HCNA 2XTZA 1DSSG 1Z5VA 3WA7A 4MWCA 1H1LB 4LFBB 1OLOA 1SD1A 1AJEA 1M8KA 1TW2A 3E27A 4MI3A 5IUNC 4Y2GA 1EG2A 1HH4A 1SHKA 3ZKWA 2BGWA 3AY3A 3G7NA 4HGNA 3GRAA 1GSAA 4YQZA 5FLKA 1CUUA 4Z0TA 3RGGA 2O8CA 2V74B 2BGIA 2QVCA 3EHDA 4HKTA 4CV1A 1N9ZA 3IO3A 2NUAA 3MC1A 3LMKA 3TQQA 1ZYUA 1EFLA 5TY0A 2YIJA 5H8WA 3N07A 4R6WA 1Z7BA 2C54A 4CUZA 1F2DA 3PRKE 2PSHA 2W37A 3B1FA 3LP8A 1RQXA 3CZ4A 3H6HA 4PINA 5JNWA 4LE2A 3UANA 1T91A 3IJPA 3QFFA 3T0FA 4X5OA 4DLVA 1XZIA 2YW2A 4HQ6A 1ZW6A 4G0OA 3OIFA 1ZNYA 3BSWA 5EUBA 2WJHA 4YYZA 1Y3IA 3B3QA 5GOZA 3X1YA 5GINE 1TK2A 2P4HX 4QQNA 3PFIA 2HB6A 4HLDA 1B0ZA 1XMPA 2XCIA 3HYTA 5LP6A 4RD4A 4HOYA 1HA3A 3RBAA 1JQDA 4P80A 3PNKA 4QO8A 1UXJA 2YV3A 4Q1BA 1FFAA 4PIMA 5E4TA 2F9MA 5D85A 3WYCA 1NP6A 3NHRA 2PUWA 4WZAB 5EWJB 2QAIA 5E1OA 1F3LA 5KTYA 3L4BA 4L0DA 3DO5A 2ODQA 1C9DB 3BREA 4IFTA 2ASVA 4PCUA 5FBLB 3DE1X 3QX3A 3DE3X 1N9GB 1PR1A 3PD7A 2AEFA 3I62A 3LBHA 2JCYA 4GWLA 5D3QA 1KZHA 4Y8VA 3WK4A 4GGMX 4JENA 3N2KA 4DLPA 4PY2A 5FNVB 1DIGA 4HUTA 5KDDA 1QU2A 2GBGA 1Y6ZA 2O20A 4A0QA 1VL8A 1HT0A 3BTVA 4MTCA 1Q7GA 2X0EA 4KBYA 3I42A 1DV1A 1QZZA 1WU7A 3HEMA 3JPYA 4LXIA 4RMGA 1V2GA 3KVYA 4MGYR 4GUDA 1I0IA 3G85A 3OKCA 3UMYA 5CT8A 4M9RA 1KVQA 3GMIA 2V7GA 4ZVNA 2GXUA 2ZM5A 1HT1E 3MRTA 1I4OA 4UVEA 2UUPA 3HEBA 5A1JA 1GA6A 1IG0A 3HDYA 2CK3A 4BEWA 4H9GA 1PU2A 5DGDA 3UTCA 1P9OA 3P9KA 1L7PA 4XDGA 5AVKA 1GQFA 1DADA 3FW1A 3T4UA 3GLFA 1ZBQA 1J42A 2DZDA 3PNMA 3DOFA 1R74A 4FC6A 4OSEA 3TLZA 3LYLA 4FEAA 2G6TA 5LLSA 1J97A 2Q3LA 3ZDFA 1CERA 2IIQA 2OUKA 3B1XA 4C9BA 4EG8A 5FB3A 4N3GA 3HO8A 4YRZA 4UEWA 4G0VA 4QBIA 1ZRMA 3Q11A 4UULA 2VJMA 1W5BA 4TRRA 1R9MA 3F8TA 1VPWA 4S2UA 1UMDB 2PS1A 4FDUA 1F14A 4JP8A 3JATA 1QIEA 1S5PA 4Y6RA 1NBEA 3VHRA 4UTPA 3CZPA 4TTIA 4RTKA 2TMKA 4JQYA 2CVFA 1EWQA 1BFKA 4UC0A 2H1SA 1DXOA 2RJ3A 1TEXA 4E22A 4KR2A 2DH6A 4E33A 1WHTA 2FN9A 5L4LA 1EWVA 4DLBA 3CTPA 4OV6B 5F3WB 4OQQA 2VSFA 3ANXA 3R6LA 1SZPA 2V6IA 3DE5X 3I5YA 1RMQA 3CEJA 4LHVA 5K20A 3FETA 2O54A 3BH7A 1DG9A 3R24A 2WM3A 1RVDA 2ZBUA 3E15A 3Q85A 5LQSA 2PS9A 3WGVA 4KXUA 1KMQA 4PLFA 5KTMA 1YQ9A 3D4LA 2R4TA 4OXNA 1JA1A 4S12A 1JJFA 2SKEA 3LM8A 3WRXA 3ZBPA 3F9CA 1AXRA 2YIVX 1Y4SA 2HXSA 1IM8A 1VLZA 1P4JA 2GFIA 2WJAA 3LRTA 3OQBA 4PZCA 5I9MA 1K4YA 3IAAA 3VPGA 3DNMA 4BP8A 2FR8C 3PZBA 3FLEA 4C78A 1HPLA 1AMNA 3NX4A 3DXXA 2OLKA 1QH0A 1U7XA 2Y1EA 3F3YA 4OHYA 3ESCA 4LDPA 1TVMA 5IYZF 3GFTA 4LW8A 3WHIA 5I7AA 1VE9A 5DIZA 4EB3A 2N46A 2NU6A 4G65A 2XBMA 4QPPA 3MD9A 1OH5A 4YP7A 1K8ZB 1RLOA 2CJPA 3LY7A 4B4VA 1UODA 4FNMA 1ZR2A 1D9XA 1A82A 1VPTA 5HZMA 3OHSX 1NBME 1KYIA 1NGSA 1L7DA 2GZ2A 2LWIA 2YFYA 3I2FA 2D0DA 3OCZA 5I7EA 2NP7A 2F1RA 4U2FA 1G5FA 3NHJA 4MMYB 4JHXA 4F3TA 3LUKA 4MQ4A 2NM0A 5D6NA 1WCXA 3I9JA 3NTRA 4KE8A 2P65A 3JQFC 1QCDA 5C51B 4BWVA 3P0IA 3K9BA 2YBDA 3F1LA 2ZIXA 1KAHA 4KQIA 4WKNA 1GRVA 5A71A 2VTBB 5ALJA 1KZ4A 1GLNA 2ZRMA 3AEKB 1YJAA 4OXQA 2LVBA 1Y0BA 4E09A 1Z17A 3B9BA 4Q9IA 5LOVF 1WHSA 2IX9A 3MOGA 1M0WA 4W5RA 1FDSA 4LRSB 4ABTA 2RJNA 2WG2A 5EMMA 3DLBA 1Y8QA 2GK4A 5BRJA 1MO6A 2WWRA 4RA9A 3GJ8A 4A2CA 1OAOA 2QZZA 4EQ6A 1M2KA 4LBWA 1E2FA 3MSXA 1X2EA 2H11A 1E77A 1Z28A 1ZISA 1ZOIA 3ZC3A 1DCTA 3ZJVA 1ZX1A 3GFFA 3R5FA 1KAEA 2PGAA 4ND4A 5M29A 4ESHA 1H3EA 1YVPA 5ILOA 1XTZA 3V34A 4XI9A 3BZBA 1BG6A 5HEKA 2IBTA 2NVWA 3OM9A 3UOGA 1PD1A 1XXHB 3H1TA 1H6AA 4AG5A 3SVLA 4GWKA 2YS7A 2IYZA 4TWBA 5CMLA 3RS8A 1JB9A 4CKEB 5J58A 4P7FA 1JHQA 1WPQA 1Z4LA 3QHQA 1P1HA 1ZZGA 1KHHA 3PICA 1V71A 4HEA6 4XFKA 4Y2TA 4LZPA 2C2ZA 1ULBA 2COKA 1TF2A 4JBGA 2ZFUA 3ZY6A 3DEAA 2WFLB 1F4LA 1BROA 4AZVA 1ADYA 2E5LB 4C4OA 3BKXA 3JQGB 1I5EA 1IB0A 1QK4A 3VKGA 5KCZA 2NUPB 1L5NA 1DKLA 1QIHA 1K8XB 1YMQA 1JKJA 2HA5A 2VF5X 2JHFA 4GP7A 3ZU6A 3IRVA 5H3CA 4FQ7A 4WACA 4P4SB 2NZUG 3IUMA 3GMSA 4DA0A 1CQIA 1SQ5A 2XMSA 2IXEA 2V0NA 5DB4A 3IKVA 4AVYA 4I9UA 1PR2A 3ICPA 1U80A 2BGRA 4M98A 3ZU2A 3QY9A 5KKNB 2JBAA 2G4VA 3W9YA 1E2IA 1A9XA 4C3UA 1RWQA 3EFHA 3VC2A 3WHLA 2O3QA 1X42A 3W9UA 2FPWA 4FYYA 4QUEA 4G0WA 1KH3A 2XUQA 3VU3A 2NYVA 3QF4B 4MP6A 3MWEB 1T34A 4WL0A 2HBRA 2Y99A 4OY3A 1T24A 1K0FA 3B1KA 4LSGA 3I83A 4GNRA 2ETXA 5E2AA 1G9SA 3TM4A 1YQUA 1DIHA 1RYBA 2DQSA 2Q4OA 1WXFA 2YICA 1Z7EA 3CF2A 3ONEA 3R5TA 4WY8A 4MDHA 4AP5A 5EQFA 4R81A 4DLZA 3PIIA 2PUTA 4EGAA 1W36C 5LYJA 3WGTA 3THYA 3K0KA 1PR4A 4ZVQA 4BLOA 4L5AA 3BGIA 2O7VA 4F86A 1JDNA 3G2IA 1FFHA 2QJOA 1DKUA 1HE1C 1ZGGA 3Q3HA 4FYMA 1F8UA 1NQWA 4LXQA 4P7JA 5B4TA 5EUQB 1C4WA 5JBIA 1NY5A 3FYUB 5HXAA 2OD9A 1PEKE 1Z38A 3HBFA 2V5AA 2ZTUA 2AD5A 3F97A 3L2OB 1W0KA 4I19A 4KIGA 4Y6LA 3V1KA 5B4VA 4ZIRA 3BK7A 5TRTA 1OYWA 5FF9A 2AX3A 1AIPA 1W4LA 2VBIA 2GTIA 1U7TA 1G3RA 1T36A 4X45A 5A6VA 2R6GA 4DMCA 4BQSA 2D5AA 8LDHA 3L9XA 3SDBA 3EQ9A 3I0NA 4QLAA 5H0IA 3REFA 4DL9A 4NCBA 1N0UA 2P6RA 1ZH4A 3H8SA 1JX6A 2P8JA 3CR3C 3LT4A 4HDKB 4MS1B 4CIYA 3NRJA 3JASB 5DJ5A 1E0JA 2CXUA 3T7EA 3WJ7A 4QYSA 2JB9A 3SX2A 5KJ1A 2GWHA 4JXKA 3IP9A 1CW2B 5EKUA 3VR4D 1E2UA 1H5QA 1NVFA 1KIFA 3C6KA 3UJ9A 3GLFE 2DPLA 4QUGA 4YP1A 1CY7A 1HTBA 3HY3A 4BHTA 2DY1A 2YWEA 2XV1A 3DHYA 4HH4A 4QUHA 4A8JB 4EY8A 1SXIA 4R1SA 3N8GA 2PYIA 2RAFA 3WZ2A 4MUHA 3TAHA 4BZWA 1GVNB 1LC3A 4UBJA 3S55A 2IELA 2YY7A 3ZWOA 3T7KA 1RT9A 1P74A 1BMFD 4UNSA 1YNOA 5IANA 3PTAA 1Z5GA 1OD6A 2GNOA 2V4ZA 4KIWA 4US0R 5DHUA 4HDSA 2E21A 3IV7A 4JYAB 2VDUE 4BB5A 2QW8A 2NU8A 3L6CA 3FX2A 5J40A 1Y7TA 4UM9D 2UUBB 3ESZA 5U4QA 1XMIA 3SXJA 3AM4A 4RSHA 3AHDA 4PX3A 1C9KA 5C37A 1AKMA 3GX1A 4FOPA 4FEEA 4K9SA 4B6FA 2BFBB 1HFWA 1QRTA 3AJ9A 4ZI3A 3UPDA 5JT1A 2VR1A 4B82A 1XB2A 3SC2B 2ID9A 3H2SA 5MHTA 2XB2A 2VPWA 3E5NA 2MJLA 1ESCA 1OCEA 2CW5A 1JEJA 1MRSA 3OF5A 4FLEA 4P33A 4PLWA 2XUZA 1AZLA 1C5KA 3HA3A 3QWIA 2FPRA 2IK8A 4UAUA 5G4LA 4LECA 1E60A 1NU8A 4Y1GA 3O21A 4K9QA 5FPTA 3UG7A 1RI1A 1ODKA 4XGIA 4B45A 1N78A 3GXBA 4QEZA 4ENWA 1DE0A 5IP5A 2QBYA 1CQJB 3ICWA 4ZXFA 2PUBA 4IR7A 4NONA 5F35A 3TW8A 3MJEA 2VYFA 1L7MA 4S1NA 1IQPA 4OREX 1NW7A 2JH9A 5D87A 4BVLA 2WK1A 2CLMB 2QV7A 2VSXA 1E0SA 1OJLA 5K3DA 4D4HA 3TW0A 1HF3A 4JH0A 3E3LA 1G21B 4E94A 2ZRBA 4GXQA 1M6NA 1EK6A 1USUA 1BCRB 1YNSA 3FMOB 4Y6QA 3KQPA 4YAOA 1TYBE 3MAJA 3OPYB 4R3WA 3G8CA 1RJFA 3I9NA 3RK0A 3PD0A 2P6OA 4CEIA 4IHJA 5JNUA 2WAOA 1G2PA 3ROKA 1S8OA 4JU8A 4OMCA 3S40A 5CFPA 2OHJA 3R6TA 1UK8A 1LNZA 2HOQA 2TSYB 4RQAA 5ENDA 1OC2A 1XJCA 1D7AA 1NMYA 1N6PA 1SHLA 2E0IA 1L5VA 4K87A 3HGTA 3SC3A 2ZU0C 4TT8A 1IEQA 1LQUA 2QVXX 4PQFA 4QSHA 3DH0A 4IVQA 4PBSA 5DMHA 1C7IA 4JBIA 3NXSA 4MB0A 1KVSA 2WWXA 3DBVO 4U9UA 3RG2A 1VJCA 2QTRA 4K1XA 4RVFA 1ZL2A 2IPAB 4FONA 3C3DA 4B3DA 2CNKA 4TGLA 2FSFA 2G9VA 3P2YA 3KWFA 3FDFA 3T9DA 2ILTA 1MU0A 2M6SA 4Y7DA 2PFKA 3K31A 1C1XB 5CP8A 1V3UA 4MUBA 3UY4A 3STYA 5AJUA 4AMGA 3DNPA 1BXZA 1VKRA 2IXDA 2C58A 1OQAA 3DMRA 3OLZA 4KAJA 1YHNA 1RI5A 2HIAA 3QV1A 3AHCA 3PTZA 1XE3A 3T7JA 3EIOA 5BW6B 1TLLA 1Q2UA 3PZRA 4B3GA 2C2BA 3B78A 4HFRA 2NNWB 1C1DB 3TR5A 4B2IA 4DDHA 4YLGA 2VLBA 3NOVA 4LBVA 3DZCA 3BTOA 1N25A 3A2LA 3BXPA 4EGSA 5MN5A 4H1HA 3T3HA 1OBOA 4MWDA 1OI7A 1TK9A 4QAQA 1NQAO 5KI6A 4YI5A 1JHZA 2KSQA 2WA1A 4MRVA 3F98A 1ZFNA 3CMMA 4NV3A 4TUYB 5G3ZA 3GLGB 1H8EA 2DYKA 2I3DA 4J7UA 3IOYA 4MUIA 4RK7A 4XA8A 5KHAA 3WLLA 2BGGA 4UPDA 4X41A 2BAGA 4IINA 3TXYA 4J7XA 4OSOA 2FLVA 4MQMA 4AZWA 4KXQA 4DW8A 1GNTA 1QRRA 3L1HA 1IXKA 1BHO1 2G77B 4HS4A 1G38A 1X7XA 4EO9A 2IW1A 3DKIA 4II2A 1X6VA 3NJ4A 4QT4A 3M34A 1Z5WA 4Q4JA 3I8OA 5I9LA 5EE0A 1EM8A 3ZY2A 3DW1X 1V11B 1E6WA 1CB0A 5KYKA 3IO5A 2PWZA 1AB6A 1TCBA 3TRFA 4B4KA 5LDGA 3QXCA 3O4RA 4WW0A 3CX4A 3OCYA 4YWHA 5DDIP 2ROQA 1WY7A 4B3JA 1PW7A 3BB3A 4TTTS 3KE9A 2JI7A 2O0MA 4YLYA 2KYRA 1K7FB 4GF5A 1EP9A 5JASA 1XLVA 5EIBD 5JARA 4AQDA 4A5OA 2YC2C 4CGZA 2ZZMA 4OLHA 2N47A 2GUGA 2BFWA 3HN7A 4ER6A 1NXXA 2QENA 2H00A 3I1JA 3ITNA 3K6RA 3RSCA 1QHSA 5KJCA 5HF6A 2FG7C 3PE6A 1EG7A 2FWMX 3OFNA 5LQMA 4BNWA 2QTMA 4LX8A 3WO1A 5FR1A 3DLPX 1NU6A 3THXA 4MPRA 4D96A 3WNVA 1SC1A 4FT4A 1XNHA 1CXZA 4E46A 5IJ0B 3QMPA 4FT2A 4QYWA 4C3OB 1N2SA 3HUUA 4CE6A 3LSTA 1A98A 3MCUA 4OM7A 1QYVA 4IV8A 3SBDA 5I9SA 1YBAA 5BSVA 5BUZA 5I9BA 4D9IA 1OYYA 1S2OA 1YMVA 2V9ZA 3I04M 4LQLA 4S04A 3NC4A 3UBMA 2Y67A 4HGYA 4HWOA 4KN9S 2CUZA 4KGZA 4TZ0A 4M86A 1XZMA 2OKGA 4MKHA 2GESA 4OL0A 4V0OA 1LW7A 1MAUA 5CAEB 3STVA 4M9SA 4LFCB 2R6FA 1JU4A 5IDVA 1KSFX 2OE2A 5DWDA 3Q7SA 2GZRA 1Y3FE 1Z88A 1JKXA 1G5QA 2IKQA 1WY5A 3DZFA 3D0RA 1E9BA 1O94D 3I04A 3TPCA 1SUIA 2HWUA 4DDUA 3WGZA 1GZ6A 5EHZA 1JXOA 2GEDA 4MEBA 1YQGA 3EWAA 2GYYA 3BMNB 2PHZA 1GCGA 2AZXA 4UTZA 5KUTA 5DV9A 4DR3B 5TEWA 1Z12A 2ZTMA 1OXKB 4R0NA 3AOEA 2CDBA 4W63A 3KS9A 5H3LA 4G5QA 3RQSA 4QPNA 2V59A 1OX6A 3KQUA 2HA7A 3HO6A 1L3IA 1U2DC 1ESNA 2WWFA 3MJDA 2PZKA 3Q0IA 4G2TA 3BMQA 4L27A 4UOQA 5I5GA 3FZYA 4B4OA 4BTLA 5ABPA 3OUTA 4CW7A 1GKYA 1Y5RA 1M66A 1SZDA 1AGRA 1MIHA 2IL1A 2OUIA 3PSAA 3WADA 2HF8A 3U7HB 2XNCA 4M8KA 4K05A 1CLUA 5IVDA 3EOAI 1JNXX 4WCFB 4YP5A 4YJHA 1XR3A 3A36A 3BEOA 4GOKA 2AG8A 4NNOA 4Q00A 4TV8F 2J3IA 3HA2A 3QG5A 4K28A 3GPLA 1UJNA 3DD1A 3SLRA 4WEQA 4MIOA 1OFUX 3JAWA 4OKSA 4ENQA 5KOHB 4LXXA 2AFIB 1RKUA 2KS6A 2NSHA 4BP1A 2C9DA 1ZXBA 2BMJA 2EATA 2HRRA 2IV3A 4F4CA 5A62A 2D1SA 3EUFA 2PRIA 3O8LA 4UOZA 4UVHA 1GTSA 1JHDA 1NBHA 5L3VA 1PG5A 2CHQA 5J3JA 1JAZA 3VX3A 2DFLA 1L7EA 1A9TA 1W6UA 2JVKA 3KJXA 4EA9A 3QVTA 4D99A 2ODNA 3SSOA 1CE8A 1Q5PA 2V45A 3QA3E 1GFWA 1QWSA 1QVRA 1W47A 2FGJA 4EGFA 1T4MA 2DPMA 4HWTA 5GM1A 4L5IA 1YB7A 4RF4A 1XCGB 2W58A 4FINA 4H7JA 4NJOA 4F4UA 2WPDA 2XGOA 3QBDA 2JGFA 1W29A 3NT2A 4MX8A 3EBOA 4PPGA 3L8HA 1W59A 5LYYA 3WYAA 4EYGA 3TG2A 3D1VA 1EHCA 5HK9A 3TNDA 2H6EA 3HXPA 2HX1A 1CQZA 4TTVA 4DRXB 4EG1A 2XOKA 7AT1A 4MQEB 4JMLA 3G0DA 4V2IA 4MR9B 4AKSA 2JGJA 2RGGA 2XITA 5TXGA 4NRDA 1XKLA 2IHVA 3G2NA 3PI7A 5B7NA 4LOJA 1FP2A 2AEMA 5FORA 2C88A 1QLWA 2BRUC 2V7QD 1OU0A 3H4VA 3GJ4A 4L9RA 3VU8A 3VZDA 4XYLA 3AFMA 2PG3A 2Q27A 1RR6A 3OEWA 3SYMA 4HNRA 3R7AA 2UYHA 2PRSA 3S81A 2I80A 4TKUB 1Y6GA 5HF8A 5REQB 1Q17A 2UZ1B 3ZHVA 3RRZA 4CMAA 5JNTA 1P1RA 2NO1A 4KN5A 4DQ0A 2GZDA 3GOHA 1KA9H 3A58B 2Z9CA 2CZGA 3CCFA 4AZ0A 4CHGA 1HMYA 2QTZA 1Z35A 1TO1E 1NMXA 3WSWA 3FKSA 3F6CA 1HL3A 3PUJA 4CKBB 5K0GA 3X2SA 4IIVA 4PVDA 2G8LA 4B2LA 1EJ0A 1FDWA 1FPQA 3KT3A 4WLOA 4PNEA 1FC0A 1O9HA 4QOSA 3RIYA 3WGOA 4QEKA 2YY6A 1YKSA 2XYGA 1GG9A 1GQYA 3FB1A 4RSRA 3HLTA 3PFBA 3BJZA 1QFZA 1SC9A 2XUKA 3A2NA 2PZMA 3GFQA 3TFQA 3V48A 1IHPA 1Q1ZA 4XCVA 4EB0A 1GAXA 4Q9AA 1S9HA 2IXGA 1XD2B 1QFYA 1YB6A 1SQFA 1XSEA 2ACEA 3E7FA 4L4YA 2FXVA 1SR8A 1SU8A 2KQUA 1Z6YA 4D6YA 4YPOA 1AQNA 3VYRB 2QY9A 2H1IA 4KXNA 4YJ3A 3NDBB 2WOJA 3RBZA 2BP7A 1P4AA 4C0KA 3VZQA 1IJFA 1XPUA 3KWJA 3WLEA 5LMNB 1VPVA 2J07A 3DXFA 1PO7A 1P2DA 4GLLA 4G24A 4UNPA 4PHGA 4U2GA 3V7WA 4U7DA 5C8DA 3ANNA 2QTAA 4X84A 3GJZA 4P31A 4M2LA 2RC6A 4QZVA 3GGSA 2SKCA 3LXXA 4J03A 4NZZA 2YJNA 3A6HA 2VCYA 2UZ0A 4KQHA 4WZ6A 4CTMA 4RULA 2HSEA 2WJGA 4I1VA 5F7JA 2H1VA 3H5AA 2MYPA 5SYAA 1JG1A 4D3XA 2R2GA 5DSXA 4NFHA 2QG4A 4XEHA 4N0PA 1XUOA 1N5LA 5F33A 2F3TA 3MAGA 2E3JA 1V8DA 4WKGA 5JU6A 2NO9A 5FL7A 1RPTA 1U8XX 3KVVA 4G84A 3A7EA 1A72A 4IIFA 5HKKD 1Y5MA 1NVVR 3A2MA 2NUBA 3F4KA 3PNLA 2C4TA 3QJ5A 4JYPA 4LDJA 3I9V1 5FPPA 1E1CA 4MWZA 1M7BA 3TDNA 5BNWA 4GMFA 4V1CB 5EXXA 1CUIA 2G5CA 4M8LA 4MW7A 3GDHA 2XUHA 1T0UA 3AJRA 4EUSA 3GRCA 5JVDF 3E1SA 3L7IA 4WXRA 3D2AA 5DFAA 3ZGLA 1NG9A 2I2CA 3STWA 1CZLA 3HDQA 4II7A 4BJ6A 5C1BA 1GARA 3LBIA 1O7JA 2H4ZA 2PN1A 2QTVB 2X9QA 2FYTA 3COSA 3VR5A 4J4HA 1RJ9A 3EH2A 3PNPA 4X20A 2FSIA 4CF3A 4Y9SA 3TBFA 1GL3A 2NSLA 1W52X 5CT5A 4B3IA 3MS2A 5KWIA 2Y4NA 1ZU4A 3ZYZA 3SQXA 1Y89A 1C8KA 4MKFA 1DPFA 2CBZA 1YJQA 2V9PA 1WQ4A 2A7XA 2V3VA 3BORA 1CWUA 2H1FA 3G13A 3L0PA 4M0UA 5D8DA 4LYJA 3ZCSA 2DMRA 1QNFA 2EJWA 3PFHA 4FYKA 4TMWA 2BEWA 221PA 2AMJA 2PR7A 4P6VF 5EYPB 2E4AA 4ZPXA 1XVIA 2WYHA 3E2IA 4QDXA 4IICA 4N12A 1N6IA 2P41A 3C15C 3G79A 5C35A 4MH0R 4B6OA 4M7PA 4MVJD 3JWIA 3T5GA 3TLXA 1PIWA 1XBTA 2I4LA 2VHJA 3GVPA 4CTKA 3EEIA 2F4NA 4JUAA 4ND8A 4AWXA 3EXHC 5FWXB 1AKUA 1JFSA 5BYBA 3O4VA 1R50A 2WSIA 1BAPA 1OFTA 2VHEA 4PTLA 4EAQA 1UC4B 4PBTA 3NTVA 3VPBA 1SCQA 4V2UA 1GFSA 5AVXA 5AK5A 2R5WA 4Y2QA 3F73A 3A6GA 3CTMA 1V96A 2VK2A 2ORVA 4KGVA 2IOFK 2W22A 3ZHQA 4JMPA 3DT8A 3GC6A 2J7PA 4LRUA 5F1OA 2GD1O 3EF3A 4KXLA 3SZRA 3EC1A 2CL5A 3PXDA 4DS3A 5CFMA 2H92A 3QITA 1A77A 1MJFA 2WF7A 3FZEA 2KBFA 2XWJI 1SPXA 1GV1A 4P7GA 4ZQBA 1NMZA 1BW9B 4MAAA 4GW3A 4R41A 5KQGA 1A8IA 3GEGA 1Z25A 2P4QA 3RT7A 3DYIA 1A4XA 1MN6A 1NYQA 4JUCA 3VSBA 2DJ5A 2GZHA 3KUXA 5JRJA 5JS8A 2ZBDA 2YV5A 1L8OA 1W49A 3QEOA 4U5XA 3BCHA 4H0FA 4QGSA 2HR1A 3NTXA 4UREA 2AJDA 3CLUD 1V3QE 2EBHX 1NVKA 4LAFA 3DSRA 1U1GA 1VJ5A 4TL7A 1P31A 3R75A 2QRVA 4B46A 3ZIAA 1GZHB 3U9LA 1OYVA 2OV8A 4Q3NA 4NBRA 1UWKA 3GVIA 3JCZA 5CJPA 3RKRA 2QSJA 5JQGF 2GPNA 4I14A 2CHGA 5G0SA 1OHHD 3MRVA 2A94A 3SKXA 1YRQA 1YGYA 5J43A 3OE1A 2ZJAA 4E5NA 3E3MA 1PTJA 5HP4A 1HEUA 4L8VA 3MOSA 4L4RA 3HUTA 4LHWA 3GLQA 4QA9A 5TSDA 1JDUA 2I66A 2JPDA 2PKWA 2Y9PB 2EL7A 4TYPA 4UDYX 3T34A 1DHTA 4D79A 2R85A 1FYXA 4Z2YA 4E2FA 5JJ5A 2EBWA 1E2QA 1PWEA 1WZUA 1XQWA 4QDZA 2NVUA 3C70A 4ZI2A 3IAEA 3DKVA 4DCPA 3MHPA 2XCRB 1FZTA 2EJCA 1KDPA 1CUWA 1QH8A 4BMZA 1USKA 3O8NA 1MPTA 3TLEA 2O3TA 3H9EO 2H2FA 4B6SA 1X8XA 1FTNA 4XSHA 3S7TA 1H6DA 1C30A 1Z7WA 3CU5A 4O4LB 5FKJA 3UHFA 1CDZA 1SHZA 2FWJA 2Y9MB 1DEKA 1O87A 3D5EA 4IDCA 2FUG1 5J4KA 2PH7A 4PZUA 5A6SA 4XYEA 5EJ9A 2PUFA 3CVUA 2YVQA 3RUFA 1V7PC 2W2TA 4Y2XA 4MVWA 4HFJA 5EG5A 1YUNA 1YC5A 3CCBA 4RJJA 3ZNOA 2FFQA 1PK7A 4ZO8A 4F3YA 1U9JA 3EWNA 3RS3A 1LRKA 1U7WA 3OZRA 1U3VA 4AZ3A 1PX0A 1T8YA 2FWNA 2KX7A 3DV0A 4M36A 4OU4A 2JFBA 4XWYA 4UFNA 4BNDB 2QJRA 4MLPA 5FXMA 2BL4A 1H2RS 3GAMA 2FMKA 3AESB 3DAGA 2R1TB 3DBOB 4TOIA 4D41A 2P35A 3M7IA 5DGXA 4CKXA 4DMGA 3M1AA 4IXWA 2GPBA 2W6OA 3ESQA 4LNUA 2KHZA 2G1AA 4Q3BA 1ULHA 1ZD5A 2PXXA 5IM4A 3T3MB 1UPUA 3TG8A 3WMGA 3WBFA 2EJVA 1UKZA 3M82A 4QOHA 4QECA 5EKTA 3SR3A 3TQFA 4DJAA 4UTNA 4CMHA 5IT4A 5A3JA 1TW3A 2Z6VA 5ESWA 2ECFA 5K5EA 2D0PB 3IX7A 4Q7LA 3B52X 4IS3A 4J9VA 5KTKA 4I2NA 3AHHA 5CFZA 1E3DA 3ZEAA 3ECAA 3NORA 1BVYF 3EEBA 3NKVA 3WGNA 2WFZA 4HB4A 4IX1A 2BEVB 1Q0QA 2H51A 2XTMA 3C3JA 3F1KA 3OQIB 2HSDA 3UK0A 3OU6A 2P9TA 1G291 2Q3HA 4IAOA 3M1IA 4MJ7A 2RKBA 4XUEA 3L4SO 1ESZA 3EARA 2DTEA 4RIIA 1NTOA 1KSGA 2I4RA 2R1VB 2CYCA 2XTAA 4V0MA 3WLRA 2HA3A 3WNCA 1L4UA 1SVIA 3MT0A 4QNRA 5DISB 2J46A 4XGQA 1BEEA 3AHIA 3JQ8A 3RKUA 1DRWA 1CUVA 1HYQA 2I22A 5BRAA 5EIEA 4BQEA 1GCAA 1GP2A 3ES9A 4AFNA 1HX7A 4D9FA 1ISSA 5HX7A 1COZA 4E5VA 1S9DA 1EGVB 4MV3A 3CLVA 2OBXA 3QXJA 3CM0A 1UFVA 2PD4A 4G86A 4GC9A 3QPAA 4IO0A 4UEOA 5AM2A 1ELOA 3CWCA 5HIAA 1SGWA 3V6MA 3FYHA 3UUEA 4AY6A 2QRHA 1C7ZA 3CSSA 4WN3A 1KZGB 2PYDA 3OD5A 1I3KA 1EK1A 1ND5A 3VC7A 2OD7A 4FGSA 5DF1A 3WJAA 2VWQA 1R64A 3ENZA 4NV1A 1S1MA 2B83A 2H5JA 4B5LA 1QV7A 1LVGA 2Z3VA 1Q0RA 3KPUA 4P93A 1MAVA 5LOVB 1TI7A 2A33A 4HCJA 2YHIA 2Q3FA 1YBVA 5ALVA 2JCSA 4K6GA 7ADHA 2DHRA 2YBEA 1DAHA 1Q44A 2JZCA 3CJRA 2NU7B 4GM0A 1MR3F 4ZO9A 5E0KB 5EP4A 4K81B 5EUMA 4CF5A 1VP3A 2YCLA 4RCVA 4B8WA 2ZSKA 3HDGA 3Q1KA 2V7BA 4CCAA 1D8AA 5EP1A 2J3LA 1BWPA 1T6ZA 2FSGA 4JL5A 4P8RA 3QVKA 5I4CA 1Y4ZA 1QIGA 4TV9A 5KOIA 2WUFA 4F4IA 1TQDA 3ZCVA 1POXA 1SVUA 5JSZB 1IN1A 4IZIA 1SUWA 3Q2KA 2HMWA 2Q3BA 4GQIA 4F71A 4OUDA 4J4BA 1UWCA 4CR6A 5J2TB 5IHPA 4CIVA 2IOYA 7REQA 3H8JA 4ALJA 3IQFA 4F6LA 4Q15A 1WKCA 4JLVA 1CIVA 2GYWA 3H5OA 4G89A 4MKRA 3RSFA 5BYKA 1G5TA 3PI6A 4OXXA 2HBYA 2O05A 3BE8A 3IHWA 3L4BC 3SDZA 2GTHA 3UT0A 5K0TA 3VO9A 3GRKA 4HY3A 2RC5A 5C7YA 1T1SA 1R0WA 2B92A 4N5LA 4QAJA 4DZRA 4YUZA 2F3UA 1ESDA 4TKLA 3ST7A 2YJ4A 4RLHA 2DKOA 5LB4A 1XQ9A 3I73A 1Y8ZA 1U8TA 2PBRA 1U1DA 4KMMA 3BILA 5AJVB 4DLRA 2JGKA 9MHTA 4NMMA 4YCJA 2PJRA 4B7ZA 3TZBA 2I4OA 1Z2DA 2CFRA 3T7DA 3KWLA 5KYNA 3DC7A 1V4BA 1XA4A 3QKRB 4YPFA 3L9WA 3ROTA 2GKGA 1SG6A 5B3KA 3K92A 1G8FA 2NZJA 1SCUB 1T1IA 2ZI7A 2CY0A 2GF2A 1IJEA 1V7ZA 4BU1A 2IHBA 2NT4A 3DO8A 3L0YA 5CVJA 3ADDA 2HKIA 4G4IA 4WADA 4ZWNA 2F1KA 5HS4A 4CM4B 4DT1B 4PZPA 2OMKA 5EIFA 4TS4A 2BH9A 3SIWA 4DARA 1Y3AA 2VHYA 2Y05A 3KAPA 5EPOA 2XGGA 1U65A 1SUCA 1HDXA 3MGAA 1JDJA 4RH1A 4ICIA 4LMBA 4OHRA 4BZXA 2OZLB 1QHHA 3NHFA 4MPPA 1NKVA 2J5QA 3BOSA 3M6MD 3PEUA 4KL8S 5AHKA 3DJFA 2I71A 4ZVTA 2H2IA 2J6CA 2RGBA 4NMHA 1A4IA 3L8MA 2VIIA 2VRCA 4TKVA 2I1LA 3DPSA 3B6EA 4MWBA 1T0HB 1UFQA 2OAEA 3N5CA 1L8LA 4FOSA 4EVRA 1VOTA 2Y1GA 4WJLA 3FI0A 4EI2A 2IHKA 3JQPA 5FWYB 1VE3A 4E5KA 5K8VA 3KU4A 3H11A 2WABA 2JJ1D 1WXEA 4TT3D 1U3CA 3BJRA 5MFPA 1HFKA 1YS4A 3M4NA 1TUGA 3ZQ4A 5E8JA 1RRFA 2V4UA 4V38A 4XIIA 4BFLA 1WBJB 2WWYA 4PWYA 1STOA 1NX6A 4LJ4A 1TC1A 3H2GA 4ADSG 3OP1A 1IK4A 2JAWA 4R83A 3KDPA 1P6QA 1PT9A 3OZEA 5TB5A 3RRXA 1DJMA 2AMVA 3LT5A 4EBBA 4W7SA 3RC7A 5IHXA 3ER8A 3VR5H 2ZI4A 4MQ6A 4IY1A 2JLWA 3E7XA 1J0CA 2WP0A 3OCVA 3WRXC 3VDQA 4HAUA 3QYJA 3GT7A 5CVEA 1BMTA 5KNBD 1B16A 1MIOB 1T5SA 2ODBA 1KEKA 3C39A 1PL7A 2X5XA 4XD2A 4IGKA 4F8JA 1TJNA 1OAKA 5AJTA 4BFWA 5JECA 1PHPA 4FK8A 1B3BA 1TFUA 4MUMA 5LXTF 1CP2A 4U2DA 2GJKA 2Y0BA 4RF5A 5DNAA 3BT7A 2XMPA 2ISCA 4G5HA 4K3UA 4EB8A 4DBLE 5DN6A 3VYUB 1OWPA 1ETHA 4H4EA 4IUDS 3GVXA 4FZ3A 2YVUA