3K4QA

Aspergillus niger phytase in complex with myo-inositol hexakis sulfate
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
438
structure length
438
Chain Sequence
b'SCDTVDQGYQCFSETSHLWGQYAPFFSLANESVISPEVPAGCRVTFAQVLSRHGARYPTDSKGKKYSALIEEIQQNATTFDGKYAFLKTYNYSLGADDLTPFGEQELVNSGIKFYQRYESLTRNIVPFIRSSGSSRVIASGKKFIEGFQSTKLKDPRAQPGQSSPKIDVVISEASSSNNTLDPGTCTVFEDSELADTVEANFTATFVPSIRQRLENDLSGVTLTDTEVTYLMDMCSFDTISTSTVDTKLSPFCDLFTHDEWINYDYLQSLKKYYGHGAGNPLGPTQGVGYANELIARLTHSPVHDDTSSNHTLDSSPATFPLNSTLYADFSHDNGIISILFALGLYNGTKPLSTTTVENITQTDGFSSAWTVPFASRLYVEMMQCQAEQEPLVRVLVNDRVVPLHGCPVDALGRCTRDSFVRGLSFARSGGDWAECFA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 3-phytase A
publication title The structure of Aspergillus niger phytase PhyA in complex with a phytate mimetic
pubmed doi rcsb
source organism Aspergillus niger
molecule tags Hydrolase
total genus 153
structure length 438
sequence length 438
chains with identical sequence B
ec nomenclature ec 3.1.3.8: 3-phytase.
pdb deposition date 2009-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00328 His_Phos_2 Histidine phosphatase superfamily (branch 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 3k4qA01
1H2EA 1NT4A 1V37A 5AJYA 4D4KA 4FDUA 1C80A 3E9DA 5AJXA 3IT2A 3IT0A 5AJZA 4PZ9A 3F3KA 4EMBA 1DKNA 2P6MA 2P9ZA 4AROA 3DCYA 1SKBA 2EKBA 2YN0A 1RIIA 1UJBA 1YJXA 2P2YA 5PGMA 1RPAA 3GP5A 2YN2A 2QNIA 4JODA 5AJVB 4QIHA 1BIFA 3K4PA 2DWPA 3R7AA 2F90A 2H0QA 1H2FA 1K6MA 2WU0A 5AJWA 3QPWA 2P9FA 1C81A 3EZNA 1SK8A 3FJYA 3GP3A 4GPIB 1RPTA 2ENWA 3K4QA 3OI7A 2P75A 2H4XA 3IT1A 3GW8A 1DKLA 2P78A 3EOZA 1DKPA 1DKOA 1QFXA 3FDZB 3IT3A 4HBZA 5CX4A 1ND6A 1EBBA 1XQ9A 3PGMA 4IJ5A 4JOBA 1SK9A 2EOAA 3LNTA 3MXOA 2P2ZA 2BIFA 4ARUA 1FZTA 2HPAA 4D4JA 1CVIA 1FBTA 2P77A 3KKKA 3LL4A 3D6AA 3C7TA 1QHFA 1YFKA 1T8PA 2ENUA 2HHJA 1IHPA 2P6OA 1BQ3A 2OWDA 2OWEA 4PGMA 3QPUA 4IJ6A 2I1VB 2A6PA 2EKZA 4TSRA 2DWOA 3D4IA 1C7ZA 1DKMA 3BIFA 5CU7A 1V7QA 4MA4A 1BQ4A 3NFYA 4GPZA 2WNHA 2P9YA 1ND5A 4E3WA 5HR5A 2GFIA 1UJCA 3FDZA 3HJGA 3QPVA 1DKQA 1SKAA 4EO9A 5CDHA 4FDTA 4D4MA 1E58A 2WNIA 2A9JA 2H52A 2AXNA 3F2IA 3ZHCA 4JOCA 4ARSA 2HIAA 4D4LA 2RFLA 2H4ZA 2P30A 3O0TA 3DB1A 1E59A 4ODIA 3E9EA 4ARVA 1TIPA 2P79A 3D8HA 3NTLA 3E9CA 3LG2A 3MBKA 1QWOA 2PA0A 5HTKA 2IKQA 5AK0A 4PZAA
chains in the Genus database with same CATH superfamily
3ZDRA 4G5XA 3OKAA 4TKUA 1Y8ZA 1WBDA 2BZ1A 2GCGA 1NI3A 2AN3A 1TJNA 1GTVA 1O6FA 3BXFA 4M2LA 4ENSA 2VT2A 3T6KA 1HE2A 3CN9A 4YXFA 4JBYA 1HZJA 1PJ8A 1M10A 3QVJA 4OQYA 4QDXA 4Y6QA 4I3GA 5G40A 2QPTA 2QRKA 2EW1A 4GL2A 2EF0A 1G18A 4WL0A 1IQPA 2P5YA 3WWYA 1W0CA 2GZMA 2BFFA 4WA8A 4XKJA 2PT7A 2P2YA 1GNVA 2VKTA 2W22A 2X14A 5SZHB 3CNQS 1PRYA 1YE3A 3LGSA 3IR6A 4G97A 2HRCA 3WRYA 1M8JA 3BXEA 4OFBA 4WOCA 3U80A 4GVPA 1C9YA 1J00A 1G9SA 1I0ZA 1P2UA 2FWJA 2A0FA 3JARA 3P9PA 4WN9B 4BFVA 4ZTZB 3K4PA 2G9RA 4X6UA 4Y2HA 5H0IA 5HFAA 1OBCA 1E2QA 3NBAA 1Y8CA 2PM8A 4LI3X 5HF9A 3VNRA 2PGNA 4C7KA 4OX9Y 1UBRS 2IE8A 5AW1A 4MCAA 1OFTA 2WM9B 4H18A 2J46A 1ZH0A 4C5CA 5FXMA 2GUWA 2EJTA 3B85A 5EWMB 5JAIA 3NBFA 5MGNA 3CJTA 3IKJA 4HUQB 5J5CA 1ADJA 2W43A 3ZS8A 1XDBA 3D6JA 4XYGA 1EFVB 3EXHB 1XHEA 4P33A 4DVGA 5FBVB 2XX3A 1U3TA 1QZZA 2XZPA 4Z6KA 1IN6A 1VKHA 2J3HA 1I4EB 3FYUB 4N01A 4ZJUA 5ULLA 2ZOSA 2IEDA 2OG2A 2EOAA 5IAJA 5TQ0A 2LWIA 5A62A 4HC4A 3R8CA 1PR9A 4WRRA 1CUFA 2J1LA 3EVZA 3OOEA 3ZWVA 1TYDE 1BOOA 3TXAA 2VYFA 1W87A 4CMBA 1SZPA 1LDGA 5JJCA 2RHGB 2MDTA 3RABA 3ICEA 5IVIA 1T10A 5D86A 2X0JA 4QWMA 1NWHA 1RYBA 1UM9A 2PCJA 3O8OB 2JJ1D 4R2KA 3DZGA 5DNAA 3OZVA 1DELA 4OBWA 1XMXA 3LCJA 1XE3A 1C9EA 4JH0A 1WETA 2GCNA 5IZ4A 2ADFA 4BECA 2BKUA 4I9FA 4DQDA 3VZSA 5B2EA 1IHDA 1Z6XA 3ZE1B 1UEIA 3Q8MA 1C7ZA 3AI7A 3MFQA 4B4KA 4CFYA 4HFNA 7YASA 4Q34A 4QDUA 5EJEA 1F7VA 3KPWA 2QLFA 3N8IA 5LCXA 1AXGA 1D8AA 4PV7A 5JJIA 4R16A 4URWR 4DREA 2BEWB 3SHFA 5BR4A 1OPRA 4LCJA 4TN1A 3DA8A 4UASA 1T2UA 3A4MA 2YFYA 1KERA 3ABZA 5FAXA 4MRPA 1Z5VA 3RSZA 3TRFA 2ZIFA 4K9MA 4L22A 3IAEA 4YQFA 2RHRA 3I5AA 3EDCA 3K6JA 1ULSA 1DC3A 1V1MB 2B2NA 2GHRA 3D59A 4XX1A 3GHHA 5DM4A 3WBKA 4CVNA 5K7SA 1Y5RA 3U6BA 5J58A 3UANA 4FSHA 1UK9A 3LHKA 3B3GA 4IOKA 1M66A 3U3RA 1XZFA 1CQWA 1KDOA 5JPCA 4IINA 1TQ4A 4NBTA 5K4GA 3CH5A 5HEKA 3VHLB 2ZYWX 3NCHA 4CQMD 1JLMA 4Z2AA 1ISSA 3DD1A 3AONB 4FW8A 1GNSA 2X19A 4QOJA 4RLSA 4WFIA 5EFOA 3S29A 2GBLC 3ZDFA 2CL5A 2R6HA 3Q7TA 5JIBA 1MU0A 1EFKA 3TR5A 2C77A 3G0DA 4GP6A 2O0JA 2I2DA 2FLVA 1AHHA 1E8MA 3FIUA 2CK3D 1AHPA 2OBBA 2OYCA 2OOKA 1QOZA 3BGDA 4NI5A 3ID6C 2O2EA 1QZTA 1Y0BA 1O96B 1KHTA 1P0IA 1U7XA 4ZV7A 1DDGA 2DR0A 4RH3A 5CFQA 2DE0X 2BHTA 3C0KA 1PWXA 2AZXA 1DX9A 3BXOA 1EP3B 4TL6A 1NYLA 1K8RA 3A36A 4CMEC 2Q9AA 1VMIA 3AC0A 1IK6A 2ZB7A 3HH8A 1RLTA 2YJGA 4HDNA 2GPNA 4GQIA 2ZIAA 1C8BA 3EVDA 4QTUB 1OAKA 3K0KA 3SMVA 1CP2A 3AVXA 4L08A 3E84A 1IBLB 2CNDA 2DWPA 3T06B 2JD1A 3EC2A 4LCEA 4EMUA 1N6NA 1VCHA 4P2GA 3EQ9A 5AHKA 2Z3WA 3HDTA 4OUDA 5FL7D 3D7MA 4DSOA 1Z82A 3EVTA 5A3SA 5FTNA 4F7WA 5EZQA 1QR2A 3X1XA 1Y82A 1XL1A 3TLMA 3JD4A 1AS2A 3WLQA 4BKQA 4YT4A 4QTXA 3MF4A 1RWOA 3ONNA 2QG9A 4XRRA 4Q1CA 3ZOZA 2PU7A 5I6DA 5BRJA 4E13A 3SE0A 3L8GA 2XUZA 2W2LA 1J8YF 2Y71A 1XTSA 3OZEA 4HS9A 3AB7A 4UQPA 3QKUA 5HKKD 4NAVA 4MVJP 3TD6A 4RS3A 3HHEA 5F2NA 2GEKA 2OV6A 3KHKA 2O8CB 1PNRA 5FH9A 3FCSB 5JBIA 1EBUA 1EGQA 2WUGA 1BNCA 3M1IA 4HQOA 3T5BA 2B5WA 4UFNA 1P7WA 2O2SA 3GFGA 3TCKA 4AJIA 2YMQA 4ER6A 4GLJA 3OE7A 2VRCD 3KKNA 2O50A 3C7TA 5K5EA 1F8YA 1KZGB 2IHTA 3DE5X 3NYQA 2YFHA 4XVRA 4URZR 1VYUA 2WG1A 1NJ8A 4HBGA 4LJ6A 4TLMB 4CKBB 5IAAA 4UUNA 3H8JA 4MOWA 5FB3A 5JDCA 1NJ5A 4NBSA 4X5OA 4L1KA 1JU3A 1B00A 2CHQA 3CPSA 4F9FA 5E6RA 4C3VA 4K05A 5GIOE 4J7CA 4ND8A 4R41A 3UAGA 2FA9A 3O4FA 3AV3A 4M54A 1SPBS 2HBZA 4U63A 5HHTA 2PUEA 2AG8A 1SRQA 3DTVA 1QIIA 4X8HA 4TT3D 1WW2A 4EA6A 3PEVA 5FPQA 4IKPA 4OIFA 3SFZA 1O08A 2QRQA 4X91A 3MJCA 4O2BF 3S8MA 4KE9A 1RP1A 1DVRA 4LMAA 4ENRA 1ZAYA 5HMLA 1JEYB 3WLTA 1SXJC 2C3OA 1Z33A 5ALKA 1JH9A 4XOUA 3O1HB 4YREA 4BMOB 5CA1B 2ZBUA 1FXUA 4OGWA 1PE0A 2N42A 3AT1A 1IBSA 1DINA 1V2HE 1UZUA 3T5GA 4IILA 4YCJA 4DDUA 1J97A 3RJZA 1W35A 1Z3CA 3SEQA 4QO8A 3QMMA 3RBZA 5E3JA 3ZWQA 3CV3A 4Z0PA 3W5UA 4DJFC 3FVRA 1ZM9A 3HUEA 3CZ4A 1OXSC 1F0NA 3LGAA 1ZGZA 4LTMA 1N4AA 1V9SA 1WPGA 1JDVA 2ZJ3A 1GNLA 1FP1D 4KVAA 3V7UA 5IT0A 3JAKA 4G1UC 5IJAA 1OX6A 3X2FA 2XOKD 2WDPA 4AY6A 1PL8A 3TNFA 4HT3B 3B1WA 1BJRE 1BW9A 1KPIA 3H1GA 4LWOA 4MLDA 5AMXA 3ZQ6A 1TEHA 2ON6A 2IH2A 3IA7A 1J49A 1UMKA 2IPLA 2Y3IA 3AUFA 4YECA 3I2HA 1SVMA 3BRSA 5C5DA 2N75A 3LBFA 1YQWA 4CEIB 1BD3A 1J21A 4OFXA 1G0OA 1NTOA 3KALA 4QPNA 2QL6A 5B64A 4M1EA 1GSAA 3K32A 4PHGA 4B3IA 4M1KA 5IJXA 1YRQA 2W37A 3L4BC 4MQEB 1MIOA 3KPVA 4C7BA 3PICA 1IN4A 5AP9A 1YASA 4IH9A 3RLIA 4DG9A 2LDBA 1K6MA 2Q5HA 3HVIA 5B37A 2P2DA 4F5DA 2FEXA 2KQUA 4MQFA 3HVHA 2W6ID 3OQNA 4WEQA 4DR1B 2B82A 2ZWIA 3C7CB 3TOCA 2VAMA 2E9SA 2MYTA 1NZFA 2PWYA 4NFSA 4QGAA 2UYCA 3IT1A 4XOIA 2XQIA 3KUXA 5TGDA 1OLSA 1E9BA 2X4GA 3NUGA 2A4KA 5C4IA 1OZFA 1K6XA 2OZLB 4C22A 5AKKA 2XVAA 3DPSA 3GPCA 1WQ1R 3SXPA 3E70C 2JAWA 4RK0A 3CLUC 3CGWA 3S2SA 3TSYA 4LOJA 1TUBB 3B7GA 3K2QA 2FSUA 1C0IA 3FPEA 1ZI6A 3HFSA 2V4MA 1QHSA 2OCBA 5HPYB 1KEEB 1PX2A 2Q3MA 4LY3A 5TMPA 2D1RA 1Q1AA 2EJWA 2PU5A 4JJ4A 4JC5A 4OB6A 1Z45A 5JQGF 5K05A 2GM4A 5L3VA 2FDCA 4B43A 5FL3A 3QVKA 5ALZA 2Q3JA 3N8DA 1Z7WA 3TLJA 3ILXA 3GCZA 5D5HA 4EF4A 4JP1A 5IPFA 2EFDB 2O3UA 5G0WA 2JEZA 5KSOA 2FUCA 4CCSA 4JVMA 2JG3A 1Q7CA 3DZIA 5TMEA 4UTZA 1D1QA 4F2WA 1Q3HA 4FSXA 5IKPA 3A1CA 4G0UA 1FSZA 1UCFA 4QG7A 3NWPA 2PGAA 1YRBA 4D0GA 1P1HA 3S27A 5FA5A 4MULA 3G5LA 1XDUA 4ND7A 5ECDA 4RTQA 5F9MA 3SZMA 2WNHA 5DASA 2EIXA 5KDLA 1R0RE 3G8DA 1VLQA 3HBNA 4F86A 1ETHA 2C57A 4Y6PA 1W2GA 2WA1A 3OQJA 1D2CA 4D74A 4IZHA 3WGJA 1BWSA 1C7QA 4CUKA 4JI1B 3UBTA 2JGLA 1Z2AA 1E2GA 2CZQA 4LDPA 5A9SA 5B5SA 3GA0A 1FNBA 5AVXA 4HI0E 2FZLA 4MR9A 4NMXB 4XDHA 3U49A 1C0KA 5UKDA 1TMOA 3NWJA 1OOEA 5IC6A 3D64A 1UZAA 5AM2A 1X1DA 5F7ZA 3VR5D 1U7UA 1JDTA 4N5HX 2GSWA 1ZMBA 2YXEA 3PZBA 4J4HA 5LZ2A 3COWA 2ODEA 2DR2A 3EGDB 5T6BA 2PSJA 4Y1GA 3SZRA 1QGOA 2C1ZA 2FX5A 1VCMA 2V7VA 1TTPB 1QQTA 2YYZA 3L3BA 1OH8A 2CYAA 1T4DA 2WWXA 4KQHA 2H1CA 4FZJA 3CPEA 3H6KA 1I6KA 5DOZA 3HKCA 5E7MA 3IVMA 2NXNA 5EXTA 3TOXA 4M0MA 4BRZA 1YK1A 4KIUA 2YHAA 3P0FA 2P6RA 4NOMA 4MV7A 1R9MA 5KVVA 1HX7A 2IF0A 3FDIA 2BGTA 3T54A 5J4KA 3AYXB 3P9XA 8LDHA 5CCBA 4H6XA 1TRKA 3C3BA 2HGSA 2YYSA 4RY8A 1PWHA 1Y4UA 5JSFA 5ADHA 4DCMA 2QE7D 1IN5A 1WY5A 2GX6A 1GU7A 1RXSA 2HRDA 4N3CA 3VPDA 4ARZB 3O9ZA 3L8MA 3I1FA 3HU3A 1Q1BA 1RQGA 5E4YA 2QIOA 1JHVA 3QFCA 1HT0A 3BE8A 5DTIA 2FB9A 3KAJA 1KEPA 1XJWA 3IDOA 4TXJA 1QF6A 2I8LA 2UYQA 3BTOA 5K8TA 5KVAA 1Y3BE 4Q82A 1XPRA 3BIXA 4XB6B 3L43A 4M1SA 3IQDB 2NYRA 2FR0A 3R6WA 4KYVA 5BPHA 5MGBA 1VM6A 3QU2A 3SR0A 4LRSB 1RI4A 3NEYA 4ZEWA 4AZ0A 4YCBA 4F9TA 4WJLA 4PLGA 2ZYHA 2ODBA 3S2EA 5D84A 1CETA 2VPTA 3Q9LA 3MRXA 3EUAA 5JWRA 3L05A 2QU7A 3D7RA 1ARZA 2M1ZA 3GLFE 1ZIPA 3K0SA 2WMDA 1F2UB 1EUZA 1KI6B 3TLGA 1M6EX 3RPEA 1DMRA 5AWFC 4PPGA 5CVDA 3OOWA 1FK8A 3JWJA 4IHJA 2XNDA 1DOHA 4MDEA 4G0PA 1UAAA 4ZZ2A 4IZOA 2WW8A 2EBWA 3QLUA 4R6WA 5IT9A 4CTMA 4MVJG 5DP2A 3QFFA 3S1LA 1VPEA 3EEOA 3QOFA 2GSDA 2QPLA 3ZY4A 4CLRA 5JYDA 3VU3A 1O5OA 5E2IA 4NU5A 1UR5A 4JUBA 4I1PA 4N7MA 2GAAA 1Z7GA 2OD7A 3L6EA 2P8JA 1BKDR 3AR5A 5BOVA 1K4KA 3AOEA 3T1YB 2DUNA 1E1RD 1KXJA 5JO9A 3ZWXA 1NBME 3IBTA 4WESA 1INLA 1AZSC 3QWIA 2OMEA 2V9CA 2HHJA 3MWGA 3CEMA 1KDZA 3U3KA 1NW7A 3RU9A 4QECA 4LXGA 4UQLA 1DIHA 2J7KA 3PC8C 1CUCA 1VE1A 2QJTA 3FSJX 4KDCA 2O2YA 1M8PA 4O2LA 3TZKA 3HNPA 4CV3A 2HA5A 4FYIA 4D82A 3O8CA 4C7OA 1CY4A 1M73E 3MTJA 4JBHA 3ENKA 3ZQUA 3CSDA 2V1UA 3JWIA 3V2UA 3KOWA 4IRUB 5IC5A 1I3LA 4EHNA 2YZMA 3BMQA 2Y9PB 5JCJA 1D5WA 3H05A 1G41A 1Y48E 3S81A 4TXHA 3HLKA 3KPJA 2BGIA 4OYYA 3RW9A 1MT0A 3B1JA 5AW8A 1UXIA 1CRZA 2HU2A 4BAGA 1M6WA 3A1TA 4QOHA 3W2EA 5KOIA 5JWHA 1QIGA 4PTZA 4G89A 1VCNA 2UZ4A 2O0MA 1TCVA 3V80A 3WTCA 1GDHA 1US8A 3JQFA 2B83A 2FSVA 2JIBA 4JVOA 4RY2A 5TIIA 1RCFA 3H16A 5IH7A 3TQFA 2FWBA 4KTVE 1RJEA 4MRSA 1E1YA 1EFTA 2VAWA 2WJGA 3HJUA 2H9YA 3Q3VA 3L1JA 3R6DA 4EI9A 1Y42X 3I6QA 5DH9A 5HKOA 3UGQA 1JG2A 2D74A 1X86B 5E1BA 1OWPA 4WACA 3WRVA 1OZ0A 1CDOA 2QR5A 4PZZA 3G9UA 5DI9A 1AHIA 1MVOA 3PUXA 1KK0A 1BXGB 4G41A 4B40A 1P91A 1C8LA 5M04A 3PF9A 3I83A 1MTOA 2AFIE 2PUCA 5ECWA 1TO6A 1YH3A 3EK2A 1SD1A 3N3BC 1R12A 4I66A 4MW2A 2QQ5A 3T15A 3TPCA 1HZZC 1HDGO 2ZAYA 2OL4A 1ZS9A 3WQQA 1G5PA 5B1DA 3H5NA 1DKNA 2DERA 2ZQ5A 4CQNA 1IJFA 2GM3A 1P5ZB 2J6CA 5K8VA 1I4WA 5DB4A 3RYTC 5E3HA 5AIAA 1TAHA 1KRWA 1SN7A 1UM8A 1VRCA 2XTNA 4RQAA 3QU5A 4QQNA 3TLYA 1N6HA 2REOA 3GX1A 4NDAA 3BRQA 5LZ8A 4AT1A 3KSRA 1HTBA 3MB8A 1I3OA 1SELA 5JSYA 4RA9B 2ZSJA 2R9VA 5KOHB 5TVGA 3WL7A 2E4VA 1XDGA 4KB5A 3SHOA 1RBMA 4DARA 3NT4A 5LKRA 1OX4A 1R0LA 2H2FA 2R751 3UV7A 3W6OA 2NZUG 3DF9A 3OAAD 1JXAA 3OLCX 3TE7A 2VHYA 4DTIA 3J80A 3F8TA 3SEZA 3L93A 2QTFA 3NBQA 1W5SA 3BD6A 3A4NA 5FOUA 3AEUA 4HCJA 3W4JA 5IKMA 2FWPA 1P39A 1FFXB 3SZGA 1YL7A 4RHYA 4AYXA 4MJLA 4XPIA 3LW7A 1KS2A 4GG1A 4JI3B 4QOGA 5K0LA 3X1MA 5EKXA 2W2KA 1N7HA 1OYOA 2X2EA 5JROA 3AHJA 5CX4A 2F7SA 4HF7A 4AMGA 3V34A 3P9NA 1CJCA 3EZLA 4R9RA 1G64A 1M34B 3V2HA 4R9SA 4JOBA 3Q2OA 1MB2A 4QOEA 2XTMA 3T0IA 1RTTA 5T5QA 4X6XA 3X1YA 1Y5IA 3OMXA 5CA1F 2XY4A 4M8KA 1L8XA 1UJ5A 3GLGB 2AV6A 2QSYA 4E2XA 3R7NA 3DE1X 1L7XA 3Q87B 5EQFA 1BG6A 3OT4A 3GLUA 5T57A 1YFZA 5EHZA 3EGXB 4KQMA 4UTVA 1ZOSA 2NV6A 2V55B 2ZUDA 2BFBA 3GD5A 5B3AA 4BX8A 4QGBA 3CCBA 2ZUBA 1ZP6A 3WGOA 1IY0A 1X9HA 2VYND 3BSSA 1DX6A 1P2VA 3CZPA 1YFJA 4MW1A 5LPNA 4NBLA 5EJ5A 2RHJA 1MW8X 2OCYC 3NRJA 4MUKA 4S1OA 5LA6B 3VZDA 3IEMA 3OQIB 2J0SA 3NTQA 1ZVJA 2JKYA 1OXBB 5LSAA 1NZJA 3WJ7A 2BJWA 2BE7A 5ITSA 1GVNB 3NFYA 1RAAA 1SULA 1SVIA 2V0CA 2G0TA 2WUDA 1KFBB 3CN7A 1F38A 4FGKA 4KSCA 4RZQA 5JWOA 5IH3A 1USWA 2X76A 1K9VF 3ZJVA 4IIDA 1XTIA 1VLJA 3N8HA 4RDHA 3TEFA 4U8HA 3ZHTA 4OM7A 3HB9A 2K87A 3TG2A 4IIJB 4POAA 4MUYA 5EJ4A 1G5HA 1H0SA 1TXGA 1IYZA 2C95A 3I58A 1OD6A 3K1AA 3Q85A 5K2MA 5AQ1A 3MW8A 3FRHA 3IEPA 3L8ZA 3PGVA 4J1NA 4E6EA 2HCRA 1I1QB 1DFGA 4NBKA 2IZ1A 3RU7A 1XXHB 3ZU4A 4XB2A 4ERNA 1N9ZA 3B1KA 5CH5A 1UEJA 3A31A 1U3FA 4F97A 4J4TA 2L0XA 2R60A 2XE8A 4JP2A 2JGJA 2CZCA 3L0SA 4LF6B 1H22A 1QWOA 1I24A 3KTDA 3E1SA 4M0KA 2C2KA 1ZGGA 4HHEA 5CUQA 3W8DA 3RRYA 1UINA 1C0PA 3WE7A 1LB1B 1A04A 4A9AA 2CV2A 4PC7A 1H3NA 1E79D 1HFEL 1T2FA 1FFBA 3LRXA 4FE7A 1XC7A 1W59A 4NHEA 5EIHA 4ZVUA 3B89A 5IDYA 4PYJA 3TO5A 5EXEA 4F6CA 3EISA 4AL4A 4YPOA 1V71A 3PA8A 4W63A 4QE3A 1K97A 1XCGB 3F74A 3HXOA 5BQPA 4CM9A 4GMDA 2GRUA 3KP1A 2ZB4A 3W7BA 3E7XA 3PQ5A 4W1QA 1TTQB 3A4YA 5DZSA 5SY6A 5A6SB 3NHKA 1QOPB 3JWGA 3V1UA 3B1FA 3TGPA 1D1SA 2AR7A 5LMNB 3LQRA 3FH0A 5KSZA 2DLCX 3KSDO 4IS2A 4E5KA 3THRA 4YMSA 2I7TA 3KFXA 5FUWA 1M83A 1NY5A 4FX5A 3ZCXA 3QMVA 2C8LA 4MR7A 3HB7A 3OCXA 5E9WA 4CMIA 4ZZ0A 4WZZA 4K6CA 4OKIA 3R0XA 4GOKA 3UKOA 1V4NA 3DHEA 4V0LA 3OTOB 4MV5A 1ADBA 5KTMA 5ILOA 1VBKA 4ON9A 5LD2B 2DEUA 2YWFA 2XCLA 1NP6A 3HEMA 3LQYA 3FPBA 4MVJF 1LI4A 4F2PA 5CFNA 4OHKA 4GBED 2IS1A 1KI7A 1JEDA 1G8JA 1TZJA 4GMFA 4Y0AA 4U7DA 5F73A 2QORA 2R7AA 1JIVA 1X6VA 1JJIA 2Q5CA 4REQB 5BW8A 1E7WA 2X6RA 4ID3A 4K8RB 3GGCA 4LY9A 4R5HA 3A7DA 2A5YB 2FEWB 3VR1A 5LIPA 2RD2A 1FF9A 2O8EB 1QHEA 3KRTA 1A5SB 1RQRA 1YB1A 4OHZA 1X2BA 1ZHHA 1W44A 1AKVA 3NONA 2CL6X 2XZDA 2HW8A 2V7GA 3M81A 2Q0QA 3TVDA 5A04A 2QBYB 4AY3A 1YFLA 3W34A 3AUYA 5DEOA 5AW0A 2PO7A 4BNWA 1DP4A 1AKEA 5EUQB 2WTMA 5FO1A 5BSVA 1JLKA 4PCAA 3H2KA 1KIMA 4CE6A 1IATA 3AERB 4Q39A 4F1WA 1ISRA 1SQSA 1U8YA 4TTRA 3ZV5A 4B5LA 2IH5A 1UPAA 3QSYA 2CVZA 4ZGGA 1KYTA 4UCWA 1BO6A 2X3UA 2CSXA 3UK2A 2C8KA 5F2KA 1XAIA 3MOSA 3IOBA 1I4LD 3UMGA 1EHCA 1LWOA 2ZVDA 3E9YA 1EVEA 1WXGA 4IDGA 3Q2KA 4KDEA 1R9GA 2XWBF 4WUVA 3P0EA 4JGIA 4GE3A 2F55A 4QPCA 2LD4A 1KE1A 5A3VA 4A23A 1I9CA 4J75A 4LJYA 1SUCA 2ZXEA 1Z8NA 3BH6A 3NBXX 3LT5A 3UW3A 2HXSA 4JQCA 3P4YA 4IXWA 1N77A 2AXNA 3HR8A 2IPOA 1YCDA 2N46A 4FR2A 3FAZA 1QBGA 1WEKA 1P29A 3IOEA 4DNPA 1N9GB 4E6PA 1WHTB 3H3FA 1SZDA 4QTTB 1DT3A 2TSYB 4UMEA 4M0LA 1CIVA 2OORA 1F6BA 2ORIA 4G0ZA 4PFJA 1M2NA 3DZKA 1U0NA 3NTXA 3V4OA 4WA7A 4QUIA 5L6MB 1VG9B 1LXCA 3PJGA 1GYQA 1E4EB 1XRSB 2PA0A 3IOMA 4WCDA 2A30A 2VHVA 1UK6A 4WZBB 3RI3A 1W6RA 1WCIA 1XD2B 3KBOA 5GADl 4L07A 4HQKA 4OHBA 5DHPA 4F3YA 5AVWA 1C8VB 4IWXA 2GAJA 5K0GA 1LV7A 3FNEA 2GO7A 2CZGA 1C4OA 4NK5A 2ZLBA 3HB1A 4DNQA 5B3LA 3OQVA 4IICA 1KZ6A 2F9LA 1GUYA 4LF8B 3ZKWB 3TEMA 4AKEA 3EMKA 3WNQA 1AU9A 4MARA 1FU7A 2YMPA 3AP2A 2NO0A 3I34X 2D0PB 2WF7A 3L04A 4ZFNA 2I22A 2V59A 3IQFA 4J0FA 1GRQA 1LDMA 3OKFA 3UHJA 5JRDS 2Z9DA 1NR1A 2ZFUA 5ALUA 2OHXA 4KNVA 3NI2A 3Q1LA 4ASUA 1QG6A 1NY6A 2GK6A 1NE7A 2IRWA 3O4HA 4BFZA 5HF8A 3G5AA 2WTAA 3UJ9A 2ZTUA 4EQZA 1RMYA 2CVFA 2WYUA 4J2OA 5IF9A 3IVRA 3LE8A 2ZATA 3CVYA 4BUCA 4K6FA 3NKFA 1B3RA 1JEOA 3O73A 3GF4A 3K8ZA 4Z86A 1YT5A 1F0KA 3FDXA 5EOVA 4LGCA 4BDSA 4JWKA 2AD1A 4HWOA 2X0IA 9GPBA 4ZKDA 2CFSA 3PDIB 3Q72A 4ZKEA 5NLLA 2AEFA 1QVVA 5BN3A 4PG8A 4BX3A 4RF3A 2JJYA 2VZEA 2IYPA 1X19A 4MLPA 4MO2A 1NW5A 3FMIA 3QOXA 2JHCA 1RJ9A 2YHIB 1AUQA 5K8IA 2WWRA 2NU7B 2BFWA 1F6WA 4WK4B 4X1YB 4AXBA 2J3LA 3JQ6A 2X9VA 1NDUA 4UATA 3BB4A 3SJZA 2P77A 4HFJA 2VHWA 5DF1A 2I7DA 4LJAA 3U37A 2ONYA 3PNKA 2HPHA 2GN1A 2V6IA 4YO7A 4RKEA 3TN7A 3WGGA 3HRKA 2DECA 4FR5A 4HAZA 1E7QA 4Y1FA 3DNMA 1EFPB 4Q1EA 1NMXA 5DM0A 5E6SB 1DMSA 5EWJA 3VX3A 4CNBA 1B0AA 3C45A 1JR4A 5EA2A 3CZCA 2RI0A 2RGCA 5CDFE 4MCJA 2VNHA 3CHYA 2DHCA 3JQBA 5F52A 4OYHA 1UIRA 1V7QA 4Z4EA 4BFYA 1Y8QA 3A2KA 1TFUA 3LT1A 1DZ3A 4BYMA 4XSGA 4A0GA 1EUCA 3I9JA 2Q27A 1KJZA 2PVSA 2ZG6A 3OIWA 2X0EA 4HDCA 1YIOA 2AC7A 1U6IA 3PDWA 2J4FA 4M46A 3C3XA 2R65A 2HLDA 1MQAA 3QVTA 4UZEA 1DHRA 3IX7A 1MVNA 3CXRA 3ZHCA 5C1BA 4WK0B 1DQRA 1FVXA 3LVQE 2YIDA 4O33A 5LQJA 3IHWA 2VOEA 3EXHC 4FYMA 3DCIA 4G85A 1E3LA 1F4VA 4PX3A 3UEOA 5A5VA 2YL2A 3A4LA 4XCQA 4A82A 3UB3A 2P30A 4BX9A 3FYUC 2QAJA 4KXFB 3QJGA 1ZBDA 1MPXA 2NVBA 5SY4A 2I87A 1PT6A 3IULA 2WYHA 3Q40A 4ZIRB 3IP7A 5DMHA 4MIEA 3W5AA 3I52A 3O3NB 4OMUA 4UTPA 1QUEA 1LPMA 1Q0SA 2GJAA 2WIKA 1PVVA 2QRZA 5K0NA 3BTVA 2FWMX 3AKEA 2OEPA 1PS9A 4J76A 3DF7A 4PXSA 1TYCA 1H2WA 4G1CA 3VO9A 3VR6A 2GD6A 3LC2O 4XVUA 5IJ0B 2QG4A 1GGJA 1P1KA 1D2GA 4RFLA 2BMWA 1ZNZA 2WTNA 5AOAA 4DBLE 4HEHA 3F3KA 4GYKA 5ALYA 4F1JA 1JEYA 1UOPA 1DQNA 1P44A 5ICCA 3LPDA 2OLEA 1KJ8A 2WV7A 3BN3A 2VBGA 2HZBA 2NYAA 4YS6A 1AKTA 3P20A 2RGEA 4NPCA 1ZU5A 2FPXA 1T9AA 1NW8A 1SVWA 1WNFA 1FDRA 2G5PA 2F1IA 1XL0A 1LZLA 2N1BA 3SHWA 5CLIA 1P77A 4EPXA 1NQ5A 2HF7A 1C4WA 1W2WB 3EZNA 2PY6A 2WJZB 3HMQA 4E94A 2CLMB 5ERYA 1RRCA 5TS2A 2D7JA 3RNLA 4QJ3A 3GVIA 5LA6F 2FQQA 3ZZNA 4OB7A 4BZZA 1RRVA 4CKXA 2GNPA 4NSNA 2D0IA 3ABRB 5COAA 3RVQA 4R2IA 4BATA 3CVXA 5DGHA 2GO1A 2XF8A 2DFPA 4XUEA 3RJMA 1J9GA 2GJ9A 2Z04A 1JVNA 5HRUA 1RM0A 4MS1B 4J29A 2P6NA 1UMDB 3SYNA 3EB9A 5AK6A 1RCTE 3MQ2A 1HDIA 4R1OA 1CBUA 2E4XA 2YVKA 5E9JA 4DMUB 3LY8A 1Y8RA 3NALA 2OE2A 5JFGA 1NRWA 2JGKA 3W7VA 5BSFA 1VHJA 5E6UA 1S3IA 3N2KB 5EZYF 1FQWA 1N2ZA 4G24A 2IYEA 3H7AA 1SKYE 5FQOA 1M74A 1MC4A 3PXDA 4D98A 3LBNA 3HU1A 3QLVA 2RAPA 3KZMA 4Q19A 5HDQA 4UZSA 1ZW6A 2BISA 2GN4A 3N2ZB 5LZ5A 2VA9A 3O75A 1E5QA 1M7HA 4G23A 1ZUNA 4DA8A 5HCUA 1DBVO 3T4EA 1EM8A 1QUFA 3KXDA 3T9EA 2P11A 3UA3A 5FEUA 3ZY3A 1THMA 1XMIA 5KMGA 3VJMA 4GZLA 4BX0A 3CU5A 4LC0A 4Q48A 4XXHA 3S5UA 4MA4A 4TZTA 3LKZA 2CBXA 3GC6A 5K3CA 1DAHA 1DCFA 1F48A 3MNFA 4U9IS 2NO6A 1OLUB 4NEHB 1MHPA 3H2HA 4ERXA 4EO9A 1E9AA 2R79A 1KJNA 3G1UA 1OF1A 4IHQA 4YV0A 1RADA 4C87A 1D1TA 4FHDA 4E70A 4KRXA 5FTLA 4KQ2A 5J47A 2FUEA 3QTBA 3KE9A 3LXRA 3DHNA 3EXG1 5AFSA 5D5QA 4AY2A 1TYAE 2W6JD 2D7DA 3BB3A 1H9CA 3FM9A 3BWYA 1F20A 3AY6A 3RYFB 1OZAA 1J99A 4M9QA 2JBHA 2Y93A 3I39X 3OD5A 1U2QA 1XCLA 2JHGA 2MSLA 2VK4A 3DZFA 5LQCA 3THYA 3A9VA 3GFQA 4YR7A 2V3CC 5EN4A 2HJHA 1FP2A 4ESOA 4CG1A 5KNBA 3AY7A 3FCEA 2WFAA 1Q0PA 1SRRA 4L3VA 3PPIA 5BN5A 1NBEA 2IL1A 2DFLA 4Q9DA 1XAGA 2QMQA 3C6BA 4P4UA 5IKOA 3VVMA 4BEWA 2X9QA 4EA7A 2IGTA 3JD1A 5JFTA 4HNUA 2BP7B 3NPMA 3GRAA 1VGQA 3GUYA 2HO5A 5KWIA 5L40A 4UXHA 3SWWA 1CJKC 4ZEXA 4RELA 2Q4DA 3VX4A 2FG5A 4PNEA 4G86A 2ZULA 5JCPA 3GIDA 2CF6A 2HZ7A 4C0QC 3G2OA 3RUAA 5FOXA 4RV9A 3SK0A 4B3GA 1NJ1A 3GJ5A 4DN6A 3CURA 1VSVA 3FJ1A 4GGMX 2A94A 3CH4B 3L8FA 4JQYA 4LSWA 3H8SA 3Q41A 5DBIA 2HJRA 4UQOA 4OAOA 4Y9DA 4ZCRA 1RXIA 5FV4A 3DEKA 5IANA 5TEVA 3VZPA 4UNNA 3RS8A 5CXSA 3GFOA 5JALA 2LPMA 2UZAA 3KR2A 4V0KA 2TS1A 1I1HA 1OPXA 3REGA 7ABPA 2HRRA 2J5QA 1DXQA 5I7VA 3KXPA 1EWTA 3NXSA 2XWJI 1Y5MA 4A6PA 2WJYA 3HTXA 1BVUA 4KFRA 4FSDA 3EDYA 1JQLB 4OGFA 1XRJA 1Q20A 3ETNA 3OZ7A 4LHYA 5B58T 7MDHA 1E2UA 4KE6A 1QOQB 4OJQA 1KWGA 2P4SA 3KOYA 3HN7A 4KN6A 2JFZA 4E11A 4R1UA 3G59A 4ZT2A 5HILA 1P1FA 2NSJA 4RD0A 4XCXA 3TK1A 1U7TA 2XKBA 4MQ5A 4RFSA 1Z2DA 2PR7A 3LO5A 5AVOA 4AKSA 2Z9BA 1GV0A 2W48A 4O4IA 3ZI0A 1WP4A 4EUHA 3GEEA 4O29A 2JLSA 3BWXA 1HG1A 3NHYA 2A9KA 2CEKA 5LBIA 4ZEOA 1Z88A 4HKTA 1PQYA 4D8VA 4UVHA 1C7RA 3OCWA 5CVUA 1VL6A 1J5XA 1U9ZA 4PW0A 2W4MA 2E5LB 3U44A 2COUA 4UHHA 1AZWA 1XVLA 3BE6A 1N5RA 4OA5A 3N2YA 2C7RA 4NICA 5AVJA 2CLDX 2KYRA 3O3OB 3P27A 5I5EA 2ZJFA 2DHEA 3RSOA 2NVOA 2OCAA 5DIZA 4DM4A 3DBLB 2H1OA 1PT5A 1QDEA 1TJPB 1IPHA 2J9RA 3IDSA 7ADHA 4M88A 3D43A 1ECGA 1H2RS 1KK1A 2WU8A 3QA3E 2JA1A 4OKSA 4HLNA 4R83A 4QT4A 4QYIA 5DIFA 5FUQA 3BL5A 3CNEA 2CCJA 4BLWA 4PSAA 2OMKA 2XCOA 3TL2A 2CVOA 4MICA 4HEA6 2FWRA 1L7MA 3FGPA 5AI5A 3IELA 2ZCUA 3JQ8A 2J67A 1COWA 2Z2ZA 3HXMA 1GZ7A 4OK6A 1KOJA 5T6MA 4F4DA 5A9RA 1MB0A 2OT3B 4QRIA 1JG4A 2AHOA 4HWTA 3NWOA 4GH5A 4NKRA 3IHLA 4XFKA 1I7SB 1GT6A 1NLZA 1PV4A 3TB6A 3WK6A 4JELA 4D9HA 4TT8A 4YHHB 4INZA 1TA0A 5HIMA 2I65A 1AB5A 2VDKB 2V1XA 1P7ZA 3E9CA 3O82A 3BEOA 1C4XA 3TUJC 3UG7A 1KY2A 4NXMB 1KGSA 3IP6A 4DUGD 2AQKA 3ZDCA 2CLKB 1DBIA 1C3OB 3Q7RA 2J9GA 4TTJA 1PR2A 1GYPA 4N3BA 2CFTA 4CQMB 1ZBQA 1K9SA 1NAHA 3ELBA 4WCVA 4YPVA 3CRZA 1SHZA 4CM5A 1SCUB 2NTNA 1PX0A 3FSGA 1YXMA 3GJ8A 3JV7A 3LCRA 4X8MA 4XWOA 1NN0A 3MWDB 5FNVB 3PNVA 1F5NA 2YHBA 2X42A 3BIWA 4G1EB 2Z98A 3BEDA 4ZTBA 3CX4A 1AM4D 1X7WB 3PGXA 4Q4HA 2G09A 4U3JB 4EB6B 1RQNA 2A1UA 1T8TA 5DKFA 1IY9A 4CL3A 2PO5A 3DHVA 4JBIA 5F5LA 2PGDA 3PD7A 4TYMA 1POXA 5F76A 4ETWA 3TEJA 4Z3KA 4G65A 2WSSD 3KETA 2IYSA 2A3NA 4GBGA 4CCYA 1DEXA 4IIGA 1BMFA 1L7RA 2Y2VA 3U7JA 1I7QB 3TL6A 4BGDA 4OQQA 3FWYA 3MLBA 1ZNXA 2IPMA 1H2FA 4C6TA 4Q93A 2CMGA 2VWQA 3GA5A 5DULA 1BFUA 2QGFA 3KTAA 1IDN1 4CMKA 3DXFA 3RSGA 2ZUUA 2A0UA 1QHHA 3QENA 4HPWA 2FUG6 1OT5A 2ANCA 3AINA 3JYPA 2FEKA 3ZCPA 2IHUA 4AZSA 3C7KA 3EVBA 3F6RA 3PPYA 4RVCA 5KYTA 1CT9A 2RONA 2GARA 4Q6BA 1BCSA 4D42A 5CA0B 4NJEA 3RUPA 4D0SA 5DN6A 5GZ6A 1N5JA 1JHOA 3EF3A 3LNTA 1A7UA 4B81A 2P2ZA 5DCLA 5HS4A 3NBYC 4DCUA 5AQEA 2TMDA 5H83A 3W6NA 3FDFA 3MSXA 3JZDA 4MCHA 5CB0A 5EZ5A 1DTEA 1G5QA 4V0SA 4LWZA 1UJ6A 2JDIA 4LYJA 2XJ9A 4M3NA 4Q6WA 1EX6A 5KTNA 1PFUA 3SYLA 2QDKA 3VZBA 3U40A 3O0DA 1X1CA 3A9TA 5D8DA 1ATIA 1GG8A 2WA2A 2FMXA 3B8EA 3I72A 4INPA 4PLFA 4RHXA 1O6CA 5GWXA 4D6XA 4ENWA 1H05A 4R68A 4R51A 4UXIA 3IHTA 3T3PB 3WJ1A 4BNDB 4C5AA 3D8TA 3DOIA 3OX4A 1AQUA 2C4NA 3IQXA 1P0PA 4NNJA 3VNSA 3SIXA 4I0WB 1KBZA 5FFFA 3BGVA 3FLMA 4B73A 2VTBB 1BQ4A 4OXRA 2PZMA 3AEKA 1A27A 1A2QA 3ANTA 4NV1A 3ZJ4A 1T29A 3M6AA 4DZRA 4ENUA 4GOXA 3G2JA 3MAAC 2VATA 2PXHA 1VJ0A 3W3AD 1C7IA 1CVRA 5KOJA 4RL4A 5CNJA 3J81k 1SKAA 2F6RA 1U3UA 2IXAA 3A1WA 3DVQX 3C1UA 1P6UA 3S4YA 3PTAA 1I80A 4PSDA 1Q3TA 4YBRA 1E58A 4OJYA 4X00A 3G8BA 1XTTA 3EFHA 5JVDA 3NJRA 4ZU1X 4ZVVA 4EG5A 1TB4A 3DAFA 4KQGA 1PUIA 5DLQC 4S12A 1CR0A 4GYYA 521PA 3VKVA 1M2GA 3LUHA 2PKQO 1P4HA 2A35A 2G1KA 4RIIA 4UU7A 1QQBA 4GMGA 1LLUA 3PIDA 5G0VA 1PDWA 1QAQA 5FOTA 4PIMA 4TXNA 3WGZA 2Q5QA 1M33A 2PS0A 2EBUA 3CA8A 4E5DA 4DT1B 1XT6A 2B4YA 3BA1A 3G1TA 2I3AA 1PFVA 1SIOA 2PH1A 3HDJA 5CCEA 5KKNB 4RTLA 3F90A 3DBRB 3FWNA 1YZVA 1NUSA 1NMYA 2D0DA 4AXXA 4I14A 4Q15A 1OZGA 5GJVC 5KTYA 1DO8A 2I66A 3GMTA 1GUBA 2Q46A 1BE1A 1QCYA 3ND8A 4CKWA 1Z4MA 1RHRA 2CCGA 2KBEA 5GOZA 4F4IA 5BPFA 2FEOA 4TQ9A 2XPCA 4J2HA 1VL8A 3D6VA 3AFOA 1IOWA 1Y3CE 3U9SA 3CLRD 4GM4A 2ZIXA 3L6OO 2EQ5A 1VJ5A 4WFKA 2VCEA 4TSFD 1YJXA 2IHNA 1D09A 3HY6A 4LECA 3DMHA 1L5SA 3O91A 1O5IA 4HY3A 1YD7A 1ZM4A 3LFUA 1EDZA 1TM1E 2G67A 4DJJA 2EDAA 1P62B 3RG2A 1WSDA 2VS1A 2C9OA 4NDNE 2ZUVA 3KD3A 5DLPA 4AKIA 1EB8A 4MQ4A 1YJAA 3V4VB 2AR9A 2ZE6A 2C94A 1HDZA 3OJOA 3FJYA 4YACA 1SK8A 3P94A 4RAOA 4MHOA 4JLUA 4AAYA 4LOAA 3AJAA 5IS2A 3A7EA 1FJXA 3HVJA 2ZI5A 2OR3A 3JQEA 1NSFA 4R4JA 2PSHA 2XDYA 4FWBA 2XBMA 4OXQA 3MTEA 3ZWMA 1I3KA 5KAMA 3ZE0B 4EHJA 3IEKA 3LAWA 2BW0A 3OOSA 3EGVA 4JENA 3ZR4B 4TKVA 5REQB 2M2IA 3SVTA 1GU0A 2BKLA 1E4YA 4M1TA 2WFLA 3O31A 4O5AA 3EWSA 2GVNA 2HPAA 4PFSA 4UARA 3SQNA 3NOVA 5A4IS 1UT8A 2I99A 3GEBA 2HK7A 4WNAA 5AM5A 2CKDA 3KAQA 2NAPA 2G1JA 2V6GA 2IYQA 4MAFA 1YFKA 3SQMA 1LJLA 2PL9A 2IOQA 2FP3A 1HOTA 4EB0A 1JIUA 4MJXA 4WKCA 3TR0A 2NYUA 3AVWA 1ODCA 2RHCA 3DVAB 4US0R 4KFCA 5CFPA 1IG0A 2IVFA 2PKWA 1EQAA 2GFQA 4F96A 1VLMA 4FIDA 1PGQA 2AN4A 2VKQA 4N47A 3A58B 5ALSA 3UAZA 1NI5A 3OJFA 2I6TA 2PVPA 1OB5A 2RDMA 1S8NA 3KZXA 1H8HA 1KOFA 4MLCA 2D54A 3GQVA 3L9XA 5CU7A 4DAOA 5LN1A 4EYQA 2JFVA 1WEHA 2K5UA 1SXIA 3T12A 4ABYA 4ZVMA 4RVUA 5C53B 3E9NA 2FWIA 3FTDA 3OPXA 2WM3A 1M2WA 3B78A 4LYFA 3S28A 2ZR9A 3FSRA 2VDUE 3GJYA 5CDHA 4IVQA 4US2R 3C8UA 5A5EA 1RZ3A 3WGQA 4CR7A 1F0YA 3B3QA 2EDCA 4INJA 2PH3A 2DULA 4OH7A 3ZC3A 4D80A 5KTKA 4DANA 3H1TA 4PO8A 4AO6A 1JDNA 1R8SA 4Q16A 2FPKA 1CF2O 1FTSA 3TLKA 5ALNA 1KO5A 4CKZA 3GZJA 1EPUA 1PNTA 2GEBA 1E77A 1B42A 1RZVA 1T0IA 1T4CB 2F67A 3GZNB 1EQUA 5EJAA 5HKLA 5MDHA 4HQNA 3OPVA 4W5NA 4IPTA 1MX9A 1YRYE 1W4RA 4X93A 1YS1X 2RKBA 1SUIA 2R47A 4EVSA 721PA 1ST3A 1PNVA 1N5MA 1KKMA 1RWWA 2R00C 1SXQA 1TAQA 3L7JA 3OZBA 5A0VA 3PJRA 1ML3A 2FKAA 1GKLA 3LPAA 5AJYA 2ORED 5I7AA 4AF8A 5HJ5A 5TV2A 5AI8A 1XA0A 2FPGB 4OSOA 3L6DA 1TKBA 4LRQA 2O52A 5K0FA 1LX7A 1R6TA 3P7MA 4GI7A 4HEA1 1HXHA 4KE7A 4KG7A 5F3DA 5LWHA 2EG5A 3E8XA 1PP4A 1A8SA 3GVXA 1Z07A 1S9HA 1NM5A 2B7BA 1U8EA 1ACJA 2EARA 4KSYA 3TDMA 4NHOA 1XTQA 1N6IA 3GBPA 3BJMA 1RC0A 4FILA 2Q2OA 5A02A 1CUHA 4TMWA 5LQRA 4GM1A 1KO8A 3CNLA 3EFOA 2PH7A 4URYR 2O5CA 2WD9A 4MEAA 1P7VA 3VYTB 3CBGA 2NU8A 1GA4A 3EGWA 1RXYA 2K4MA 3REQB 3MS7A 1RNLA 1UXOA 3DZJA 4S35A 4BN4A 1MAVA 1KDVA 1JBKA 4DLLA 1U9YA 2NAFA 1U0EA 1CIJA 2HPZA 3GMDA 1GAJA 1U9JA 1QH0A 2FMUA 1KWKA 5B30A 2ZUCA 1O97D 1J6UA 1TC2A 1X94A 1ZJZA 2EJVA 3DMDA 3QA9A 4D9BA 3HM9A 2NUPB 2VTVA 1JJVA 3DV2A 2BYTA 3OZAA 4RZ2A 2OHGA 3E1GA 2C4VA 2YFKA 2JI4A 1HSZA 2XV1A 1Y4SA 4JUAA 4ARAA 4YJ3B 2EG9A 4Q9JA 2XKKA 1WE2A 4HAXA 4WTOA 4PU0A 1Q0ZA 3AQ4A 1KJYA 1QIHA 2YWRA 3KJFA 1PIWA 4GQBA 1Y1SA 4PYMA 3PCRB 4B34A 4MUHA 3R44A 5A0FA 4CCWA 2B20A 2YXPX 5FTJA 4AY5A 5CURA 2PGOA 4ZPJA 3BF7A 2V6FA 2VEDA 3P9KA 1ZG3A 4NFHA 2WAMA 1FL9A 3U62A 1BROA 5TF4A 3M89A 4DV4B 1M9NA 1ZSVA 4BU1A 4HVCA 5BOSB 2WLSA 2Q7DA 1H8ED 3A6JA 4MR8B 3KL4A 2RGGA 4YAEA 2X8LA 2PL5A 1T9CA 1QHFA 1FU4A 3HJCA 3F4BA 3LBIA 3PIIA 4R8RA 1UOEA 2C04A 1NL3A 4Q00A 3C6MA 3FCXA 2PUJA 4B3HA 1WUIS 2WSYB 5G0UA 1G21B 5FR1A 1JSCA 4B3RB 3DOOA 1PGNA 4PAWA 1YHZA 2QJWA 3T3DA 4YROA 3PRJA 5ENDA 4Y18A 4MUFA 4DEYA 1RHKA 2HCFA 1Y3FE 4PAQA 1N7GA 2EEZA 4GM0A 1A4UA 1RKUA 4URHA 4ZAWA 4QJ4A 3ZBPA 4A6XA 3EXFB 2ZRGA 2CXQA 1XZKA 5JHGB 5FA8A 1WXHA 1JJBA 2GZSA 4URUR 3BILA 2BE9A 5C52B 4J16A 5LQDA 1E6EA 5FNVF 5FOSA 1DOZA 4LGMA 2H48A 1KOGA 4HB3A 1TLLA 3B51X 4B8ZA 2XW6A 2NPFA 2WJAA 2HSZA 5EIEA 4OATA 3UB4A 4NU0A 2CMHA 2BEVB 3NTUA 4QFDA 2PZEA 3UMVA 5LD2C 4CI9A 1USVA 4EUEA 4RBNA 1NSTA 5J9FA 2OAQ1 4C03A 3E82A 3K3PA 2H4JA 5JSUA 2CNWA 2JBAB 4AZ3B 4HVAA 4LVCA 4QXMA 1ZH4A 4N41A 1PJAA 2X9NA 1J8QA 1TF7A 2WIDA 4MROA 3UATA 1T5LA 4ZOAA 4J9VA 3NC4A 3LK7A 2Q2NA 3UPTA 1PBTA 1CQXA 1KAEA 2IKQA 3NOQA 4BBZA 4QEDA 3KUKA 3P9QA 4WD3A 1T2EA 4WBXC 3JU3A 4IEFB 3IE0A 4CG0A 3P45A 2HK6A 121PA 3ROPA 4MVJI 3PX2A 1ZEMA 4IY1A 3VZCA 3WIBA 1K1EA 3K35A 5CA0F 2MR5A 3GRPA 4PZ9A 1B6GA 5EP1A 5EMMA 4ZOQI 6AT1A 4RVSA 1XK7A 1RBZA 2IYYA 4Q4AA 2FAXA 3KJEA 4OCZA 2HNAA 5ALGA 5BQFA 2HRQA 4L5IA 3RS5A 3RYCA 2FN3A 1M1YB 1RR6A 2EFEB 4R3NA 4YMWA 2F64A 1L1QA 1NX9A 4OREX 4BKOA 3WGLA 3HZOA 4Q4JA 2AW3A 4D96A 3DUFA 1DU4A 2H5EA 4ETNA 1SBIA 3ISJA 1E3JA 1RAFA 3QFHA 4FB4A 1UDRA 1G20B 1A82A 4ZEVA 3QPAA 1GQQA 1JLLB 1YZNA 3OFND 3P5BA 4PO1A 4MUJA 3UAVA 2ZIVB 2DZDA 2DQYA 3KVVA 3VV2A 1XA3A 4W1SA 4ZV4A 1ONOA 4GPIB 4ZI7B 4K3VA 3IESA 2CDAA 2Y67A 1W85B 4LC1A 2W00A 4U6NA 5M2QA 3TRDA 1RYYA 1G5FA 1VJCA 1G4AE 3OI7A 5LDGA 1FRVA 3NASA 4RD1A 1CS4C 2ERCA 4DC1A 3RSLA 4LZLA 3TMKA 4FW9A 2QLBA 3QQPA 5JSKA 3ZG6A 3CKMA 3R4CA 5B3JC 1WZUA 1Z13A 4JI6B 3GHYA 3PVCA 3SHTA 5HNKA 1IK4A 3LS2A 1JDUA 2Y2UA 4W9RA 4Y2UA 1L7OA 1MC5A 1Y6RA 3PITA 4YMUA 5J1SB 4D79A 1LSOA 2QL9A 4WIAA 1CZOA 4LZOA 4LQ4A 5L53A 2IK8A 1ATZA 1PSZA 1Q7BA 3NYIA 4Q3CA 1CVIA 4YRTA 5CEJA 2ORVA 3JYLA 3RGGA 3CKLA 5EE3A 4RTOA 3O93A 1EVIA 1EFLA 2FVXA 2IPXA 3I3SR 3R3SA 5AI9A 3RK1A 1P0MA 3EFBA 1WDWB 3M70A 3RKRA 5KJCA 1HNXB 4X92A 2MMCA 5FUVA 3NVKI 1T3HA 5AR1A 2BCGY 4BJ6A 3VTZA 2QTZA 2ZU0C 3FMFA 4LNUB 4BUZA 4ZVSA 1T26A 4LHZA 4ND5A 4XGQA 2ZSHA 2EKZA 4TSRA 2WE7A 2K7ZA 4QODA 2C4WA 3RRMA 1T2CA 1XNRB 2XRFA 3DV9A 1NUPA 1JR6A 1GIAA 1YHYA 4BVKA 1U3GA 4W7HA 4AG5A 3F7MA 4PXYA 1QS0B 1K2VN 5H68A 2O2ZA 3INNA 5EEHA 4FDLA 5CRIA 1XEXB 2P65A 4KAFA 3RCBA 1CDDA 2P3SA 1JT9A 1JJAA 5BV0A 1P0FA 1UZNA 1CUIA 2HSDA 4Z2YA 3CTMA 3N8GA 4M49A 5H81A 1LW6E 3RK4A 3ZWKA 2V0NA 4RK1A 1O0SA 4LZZA 1CEXA 4DG5A 2QPAA 3VTAA 1OI3A 2PUVA 4FJ0A 2NQ2C 1B14A 3RLFA 3TCXB 4J0DA 4ZO4A 4CM3A 1AH2A 4K03A 1GLGA 4ZARA 4P0QB 2J9FB 4AUNA 1DG1G 2RC6A 3CE6A 5DI3A 4DDMA 3KDSE 1I1NA 3UFXB 2V4ZA 1VFNA 5D85A 4KHPB 5D1NA 1D2HA 1NG1A 1RYZA 1ZC4A 2FVYA 3GO4A 3H17A 2KX7A 3H4VA 3RBAA 3VSDA 4F71A 3Q0TA 3HK2A 3LUKA 4H16A 1DDIA 1XA4A 4WLEA 3CX6A 3L41A 3ZU6A 1HL7A 2WQ6A 4OSEA 4CF4A 3HXPA 1NE2A 2ZAMA 4RV4A 4F5YA 5F3WB 1KIAA 3AFGA 5BURA 3F6SA 4IDCA 3NC1C 1O87A 2ZTSA 3U4CA 4LZNA 1M0WA 3HCNA 3R0JA 4LJ8A 4CTOA 2EZ8A 2YMMA 8MHTA 2XSZD 1PQWA 1NOIA 4UVIA 3TQRA 4EMSA 4DCVA 2ZM5A 2ZRJA 4ZO8A 4B75A 4YCLA 3B9QA 4YYEA 2DSNA 5IKEA 1B93A 3HLTA 5BT8A 3DMGA 3IYLW 3AJ8A 3CBQA 3BFVA 1Q7TA 3PT5A 3M6FA 4GW3A 4DADA 1FTNA 2FU5C 2ID9A 4JWTA 1LTHR 4GWLA 4GIBA 1KEUA 1SBYA 4MV0A 4RYDA 2QRVB 3CISA 3GLSA 3IMKA 4ENPA 5L3SB 1R6VA 4QNRA 1X7ZA 1XAJA 2R84A 1A97A 3QYPA 1FVOA 1JAHA 2W2PA 3LXMA 4O8ZA 4NENA 3E18A 1IULA 2YVAA 5C7YA 1KPHA 4CG3A 2VF5X 1EX1A 4HDSA 3I53A 2B7LA 2JRCA 3L01A 3PT9A 4MB0A 4R7TA 2FW7A 5ICMA 4N1AA 1T5TA 3DWEX 1V96A 2V3VA 3I6YA 1M2VB 4BKUA 4JC0A 4R9VA 4RFVA 4Y2QA 1V16A 2JATA 2OHHA 1KU6A 2DY1A 2HWUA 4OHRA 3ORHA 3DNPA 3V8RA 2JAHA 2YXBA 2VJAA 5CP8A 2O7RA 1TM3E 2OBNA 2X5KO 1E1LA 3AJRA 1YRAA 4JOSA 4KWEA 4CM6A 2QVZX 2DQSA 4OO3A 2MINA 2C7PA 5HIJA 4A91A 5K0EA 2HFKA 5HGXA 3UV3A 1Z47A 2XUPA 4J94A 3KKKA 1B0ZA 1KFKB 2BZSA 3L8DA 4Q3EA 5BVHB 4XH9B 3GELA 2CLLB 1TYZA 4GS5A 4C7VA 3JATA 2AI3A 4L4SA 4XLZA 1LI7A 1N57A 2EGHA 3O2QB 5GVSA 1IHPA 2IX9A 3G3EA 4J0GA 2LP4Y 1N2GA 1X9IA 1GA6A 1XQ6A 4G63A 1Y1LA 4QM6A 1JHUA 3BUSA 4FHCA 3A27A 1KJJA 5ES4B 2RAUA 2IXDA 3KYCB 2LCQA 2IUYA 2EHDA 4RTMA 3KWLA 3KV3O 3VTFA 3C4JA 4OLJA 4LTNA 4OI1A 5BV1A 4EDFA 3SQXA 1L7VC 2VF4X 3KJIA 4PWYA 2PZLA 4ROTA 4D4IA 1VHWA 1JAYA 3MBOA 2O3TA 3RANA 5KNDA 3QE4A 1JPNA 2ZJYA 4DCPA 5K09A 1GQYA 1UAYA 1DO2A 2FE1A 4FDTA 3S7TA 3NLLA 1IOZA 4FBGA 2WIAA 3FB4A 4Z9AA 1QK3A 3JVDA 5FBWB 1AUPA 4INOA 3T7AA 5E8RA 3U7GA 3I62A 4HYEA 4QYMA 2IE0A 1WSAA 5IC4A 1HYBA 2F3RA 2H4HA 3A04A 4RF2A 3GFBA 2FJPA 4O4LA 2RK4A 4V03A 3EVNA 3KO8A 3OIDA 1PHRA 4PG5A 4LRXA 1H2XA 3LG2A 4B1FA 3WR5A 4E51A 1X39A 2F8SA 1M2KA 2IYOA 1AMNA 2R2AA 3AOGA 4RULA 1P8JA 1QC5A 5KEIA 1QGZA 4Q3DA 1N5DA 4YJ3F 1WV0A 3HY4A 1VE7A 1YULA 1NIPA 1V5IA 3IP3A 4PIPA 4TOIA 5CPFA 2XCSB 1WQ4A 1JEAA 2PQ0A 3PCTA 2HX1A 4KIJA 2HD4A 1ZR4A 4P7BA 4XCVA 4JVNA 1ZM2A 2OK8A 3CRRA 4LRYA 5ER6A 2OFFA 2D4HA 4WMLA 3KR0A 4LUCA 4IEEA 3I28A 3LZDA 4I7EA 2G72A 1T5SA 1XZBA 1QV6A 5U4QA 3VYRB 1YZKA 2QX8A 2AEJA 4ZQIA 5SYAA 1QP7A 1FQKA 2GERA 4R5MA 1ZU4A 3CUEF 1L4LA 1E6LA 2QTVB 3H5AA 1MX1A 3B82A 4H0FA 4IM7A 4M9RA 2DBZA 4N5MA 4WZAA 4TRRA 4YRRA 4YRKA 1OKKD 2AWOA 1V8OA 4X6YA 1G9TA 3D0QA 3NQ41 3CLKA 2P9BA 4AN0A 4RJLA 3L84A 4EX6A 1NUAA 2JH8A 4TYNA 4H0CA 1RKQA 3WL6A 1NOKA 5IU6A 3ZDDA 2X40A 3FA2A 4GBMA 4M8IA 1TU4A 5CW1A 5KHLB 4KPEC 3MMZA 5JZSA 3AHEA 4B35A 1GZUA 1S4MA 4P3NA 3RVPA 4B76A 5TPWA 3I6MA 1VB3A 3ZK9A 4P1ZA 3HCBA 2JIZA 2WUFA 3I8XA 4WLVA 5K3DA 4QVIA 2RB5A 4UMFA 1AD2A 1ZRHA 1PVOA 2NZXA 3AVPA 3TI9A 1EWRA 2YNMC 2G5CA 2IITA 3MGAA 1NASA 5DHRA 2OFPA 1E1CB 2ROQA 4C01A 3IVGA 5JMPA 1I0LA 4BLVA 5IK2A 1JR3D 3DCNA 1Z4PX 3KT6A 1M7BA 4KC0A 4MS4B 4R0NA 3WL8A 2ZVJA 5FI5A 1ZK1A 3D4LA 4B3MB 1R0CA 1YVEI 4H60A 4E2ZA 1B23P 1QYWA 5DXJA 3RWBA 1DRJA 1K89A 3CLUD 3D9QX 1JLHA 4D8XA 1PEKE 2R7NA 4YFYA 3N0VA 5L7YA 3BGOS 2X0KA 1SVOA 5ALTA 1QNLA 1RCUA 4B3JA 4MJ3A 1T36B 2XHZA 2P5SA 2PMEA 1BHJA 1XDZA 2VWHA 4Q7JB 2PZKA 2R85A 2G70A 4JYBA 1PD1A 4NZ9A 2I1VB 1CNMA 2IUFA 3ACCA 3BWMA 5GZ1A 2CNOA 1ECLA 3K5IA 1MR3F 4MRVA 2HMTA 4RMNA 2PN1A 4KQEA 3TLAA 3GLHE 1T8SA 3DKIA 4IH4A 5DT9A 1RRPA 2VDRB 1WZEA 3FDZA 3GNSA 2UUAB 3FNIA 2GAFA 4PBSA 3F7OA 5D3KA 2R2GA 3EH1A 3QKIA 4K6KA 2OYRA 5EHXA 2V54A 4MWTA 5D2CA 4CMGA 4FDMA 3U4HA 3ROZA 4J3FA 4G5GA 5JD5A 2R8BA 4R9NA 2X7HA 2YJ6A 2GZ3A 2WKSA 2WRZA 1OXXK 3T41A 1G66A 1Q83A 1VYHA 2QZSA 3EPHA 1I7PA 1FS5A 3TSZA 2IC5A 2WWVD 3B52X 2BV3A 2EKLA 3UO8B 3UJAA 1E1KA 4TS4A 4Y7CA 1NVFA 3AR3A 1XRNA 2WLTA 3HCEA 4K9OA 4XJTA 4RORA 3DLBA 1A9OA 3E9EA 1U6JA 3T1QA 4KXLA 4ZI7F 1C9NA 1TQ6A 1RXUA 4LPKA 1EH5A 3Q7IA 4PX5A 2YV2A 4YALA 4YPFA 4OP1A 2BGWA 3R2JA 3HCFA 4FONA 3STUA 3TR6A 4EBFA 4UKDA 2WAAA 1UWLA 4J90A 1W96A 4Q3LA 4TL9A 3QIAA 1XQYA 5CFOA 2XT0A 1EAYA 3QXSA 1A9RA 1PJZA 3GJZA 3L92A 3WGKA 1II0A 2WWHA 3PXXA 5EMJA 1RKVA 3LCUA 4GMHA 3OKCA 1D0SA 4LRTB 4UM9D 1YR2A 1ZRMA 2VBFA 3TJZA 2I67A 4MW0A 3C6XA 3JVUA 4H7EA 3RFUA 3DZHA 2WB2A 2H59A 4ENVA 3JQRA 4IIHA 4AS2A 5K99A 1WZCA 4HXEB 3DYVA 4DQXA 1T9GR 1NAIA 3OQPA 3ABQB 1J25A 2EX1A 2I2WA 3R3JA 2JVJA 2ZROA 4LXYA 3PHIA 2BHLA 5KQRA 2F90A 2ILVA 4MHSA 4H1TA 2NNWB 1HETA 1IAVA 1I2MA 2I78A 2CY0A 3OCYA 4RADA 3EDMA 3K8QA 4PRZA 3EQ2A 3FHTA 1GTL1 1G3IA 4IDAA 3JWEA 1OR8A 1FZQA 3H9BA 3ZXIA 1N32B 2RHDA 4DIOA 3P2KA 4GPEA 4JMLA 3NHJA 4IIUA 4MWOA 4EP1A 1XNJA 2EKDA 4HH4A 2PMCA 4WCFB 4UOQA 4BB6A 4ZGBA 3TF5A 3H5WA 5F9FA 3QBEA 4H7HA 3EG9B 3GUHA 1V1MA 4F06A 1BGWA 2H92A 4ZO7A 4M7RA 2HQBA 4RMIA 2LDXA 3TS1A 1ZGJA 5DCUA 1M6NA 2YCBA 2WV9A 1Y1QA 4UU8A 1MVLA 1Z29A 2GQ0A 2E55A 3T5MA 4JU8A 3JY6A 2P68A 1L7BA 4DSTA 4ZAZA 2FI1A 3I4CA 3B6JA 3F96A 3X0DA 3T1VA 1JMYA 3WDLA 1ORRA 4ZRMA 4WKOA 4CDNA 1JKJA 4NFYA 2P1DA 3FLEA 4WXRA 3RWMB 5LQAA 5LL6P 4MUIA 1QFYA 4NXNB 3MIZA 1U0HC 1WX1A 3DP7A 2E1PA 4RJKA 2ZDHA 4QRDA 3GJQA 5FA6A 2J32A 1J1ZA 2ZBFA 5L3QB 3TZLA 1R5OA 1KARA 1REQA 1NJSA 3RC3A 2ICAA 2Q7OE 2JAXA 4NYJR 2D59A 2YZGA 3A10A 1AA6A 2J48A 1VC2A 3R5FA 2C59A 2PSDA 2ALJA 5HZMA 1FRNA 4X7RA 3JQGB 3ADOA 3V00A 1QZUA 1U2DA 2X58A 5TQVA 3KB2A 2ZBVA 3GEHA 4KSBA 5K0JA 5K6AA 4U6QA 1VMKA 3STXA 1F3OA 4EGAA 1DQZA 1BS9A 1QE3A 4P80A 2Q5IA 4WXMA 5A4FS 4IBOA 3OLQA 1IVYA 2XWSA 5ELXA 3OJEA 5DLDA 3D3JA 4C7MA 1CF4A 4Z5XA 3VR4H 3UFBA 1V3UA 2IHKA 4WNCA 1UOQA 2GPTA 1G7CA 1LDBA 3LPMA 2W2LD 2NTYC 3E4CA 2VCYA 1YQ9A 1PNOA 1W47A 2UVPA 1BDHA 1T5BA 4G67A 1QNFA 5KYKA 1QLHA 1J4AA 4TTVA 4HG2A 4PLTA 2JLZA 1U7OA 1NQXA 1S6YA 2CVPA 3PGMA 4JLNA 5BNWA 3R8FA 3F5MA 4FMBB 2XKAA 2NVUA 2AWNA 3R6TA 4KLNA 4KWIA 1PK8A 2X0RA 4MUXA 1IY1A 3FOAA 1V11A 5BUZA 1MAWA 4MVJM 3P4UA 2FQWA 3OE7D 3PE4A 4WINA 2QT9A 3C87A 2WWTA 4TSKA 1SCAA 3WGVA 3SSOA 5IASA 1P7PA 3BD9A 5BSKA 1W5EA 4J0QA 4I4LA 4TS9A 5HOEA 4D4HA 5IEJA 3OBIA 1RMTA 1GRVA 2ZIGA 3ZJ5A 4K46A 5M7EA 5TMBA 1BXRB 2WF5A 1WXWA 2J0VA 2QT1A 1OAOC 3FPAA 4MW6A 3IDQA 4JODA 5HS6A 5IN4A 4DB4A 3DTVD 1A4IA 4LHEA 2GFHA 5JI2E 1BU5A 3U1BA 1BIFA 3TDNA 1DJMA 4ZO6A 2X77A 3HDVA 4COKA 4ITUA 4DM7A 2FSSA 2ZXUA 2V5VA 3BQNB 4QDZA 1TQ2A 1W4BA 4FHFA 4GR5A 2ZR7A 4PC2A 1NNEA 4RZ3A 1G2OA 4IIYA 4D43A 1PR4A 2PQMA 3GMSA 3ANMA 3OZCA 4UZFA 1XRQA 2D5BA 2RGNC 1JPJA 1KFEB 4CXMA 4YI3A 1M72A 1Z5ZA 3W8FA 1E9EA 2FP4A 2FDRA 4EVQA 1EI9A 2Y99A 1L3IA 1WPXA 4P82A 3RUIA 1G60A 3PFIA 4XX0B 3AHDA 1C1YA 4MPPA 2Q8QA 5DX0A 1R4MB 4ARBA 3UN1A 2C2GA 3PSHA 3ANSA 1GPH1 3HO8A 3EXIA 4KNWA 3ROQA 3G7NA 1GGEA 2XNJA 3NEJA 3MCAA 4P86A 3MD9A 4EDHA 1Z34A 3H6GA 4Q7EA 5DGTA 4X3OA 2JS7A 3UM9A 3ZDYB 1NBAA 2VZ0A 1CZRA 1Y7PA 4OAQA 1G3QA 4WKGA 1HKHA 1XWIA 1GLNA 1KE2A 4HGYA 1KMCA 3VSBA 1JS1X 1JU4A 3CWQA 3WA7A 3IAFA 2HEIA 3M2TA 3W2GA 4XYLA 4F3RA 1A2OA 1B2RA 4QU8A 5THKA 3E2PA 4B82A 1A72A 4M89A 3A11A 4K6HA 3RFFA 2GEVA 1LBEA 1QVAA 2B21A 3K16A 1UAGA 3OZGA 2ISSD 4NZYA 3DKPA 3WIUA 3PXAA 4BAUA 1Z4IA 4CIVA 4CN8A 3NG1A 1C3JA 3KOOA 1LZKA 5JNWA 1SHJA 3QJYA 4R81A 4XYEA 1JDPA 2IZ0A 2PKRA 2L18A 1RM5A 3IERA 2X6QA 4BZXA 1Z74A 1OI7A 2AI1A 2BM9A 4N7BA 2HA3A 5CITA 4JNCA 5B53A 3WNZA 3AFMA 2F43A 1JYSA 2HMVA 5LXTA 4JR1A 1DEHA 4U2DA 1R5JA 3ZI7A 1KYWA 4P3PA 4D8UA 3OF2A 3SI7A 4JX8A 3REOA 4Z7QB 1E8NA 2YUIA 5ALPA 2DMRA 1DL5A 4BHTA 1RWQA 3R6LA 2ODQA 1VP9A 3JS5A 2QVLA 5D7BA 1G5TA 1FLAA 2NTEA 2B1JA 2CJXA 1Z62A 2IS2A 3N0TA 4PGGA 1USUA 1E94E 4JCOA 5G0TA 4F6RB 4MYDA 1CQJB 4JVSB 3R76A 4RQTA 3ZV4A 4MCIA 4DUPA 4FQ5A 4BQNA 1CS0B 1KEEA 3BXPA 3F7NA 4AMBA 4CIWA 1SKBA 1U04A 4GBJA 4KMSA 4TV9B 4Y1RA 1N2BA 1IJEA 3GP5A 3ELWA 5BY2A 1AQIA 4FCVA 2G0AA 4EPVA 3B9BA 1E96A 2ZBGA 1DKRA 4FGUA 1M0TA 2QLJA 2XCIA 5SZIA 1YZQA 3DCJA 3IDFA 2VG8A 4F0JA 2FEPA 2NTJA 2VAXA 2PIDA 3WLKX 5J2UF 3LOUA 3G0GA 2VA8A 2F8LA 2F3UA 4B3BA 3RS7A 1W9MA 4OL9A 1KP2A 1YAJA 3MWJA 2QS9A 2EC5A 2VDQB 3F47A 2FFHA 4BVEA 3V8PA 3RAPR 1UPFA 1MAAA 4G0QA 1MO2A 1PDVA 5IT4A 3ZZ1A 3RVMA 2JF0A 5HZKA 3V42A 5KU7A 4UXJA 3L7CA 5CX1A 4D9KA 2VHJA 3G9TA 3GGSA 1TYBE 3RS4A 3DBHB 2FTKE 3IPYA 3FKSA 4FFLA 4P3KA 4PF1A 3V4ZA 3K94A 4BN5A 1PQ4A 5EUBA 5JAQA 4RDIA 3DL2A 5FYDA 5CYGA 4Z9FA 1JSLA 2HHLA 4B2LA 3OZWA 5JS8A 2HU7A 2DWCA 4KO3S 3QPCA 3T7TA 1Q0TA 4RCVA 3WZ2A 4GKBA 4F5EA 3EFEA 2EKQA 3BIJA 5C7LO 2RK3A 1MCZA 3QP9A 1PJ3A 3EXEA 3FBWA 3GLVA 2ORWA 1FLVA 1XZQA 3EW7A 1N3BA 3STHA 1EA7A 3OTGA 1X7XA 2ERYA 6CHYA 3UC5A 3WMEA 2Q50A 3U2QA 4FE3A 4EYKA 4YIHA 4RABA 4RGBA 3U39A 4WXEA 1KZ4A 3SQLA 4U5QA 1C29B 4FT2A 4U00A 5LZ4A 3RV3A 2BR5A 3H99A 2X3YA 4GZMA 3FSEA 3RGWS 4E46A 3HVUA 3WOVA 2IBMA 3UJHA 3CM0A 4HX2A 4KK4A 4B48A 5KWVA 4EELA 1QTQA 1ZVKA 4H6WA 1RM4A 1H6BA 2OOSA 2C5BA 2QP4A 2ZK7A 2R7KA 5KQMA 5DNWA 2HV9A 3AJDA 4RHFA 4DJDC 1Q19A 2Q8PA 4X0EA 3IBCA 1SKUA 2QTTA 1G8KA 2VSOA 4HEQA 4JEMA 1ZA1A 3ZY6A 3HQ4O 4RWZA 2OG1A 2QYOA 2C8VA 2PX5A 3BXXA 1Q84A 5IBRA 2AZMA 5TGTA 3NHBA 4OOFA 4ACAA 4BBPA 3DMTA 5BUCA 1EXMA 2ILTA 4S2UA 4XD7D 3R7WB 4CL2A 4MW7A 4CJXA 5ADWA 3AVVA 1DQPA 5CPBA 3LP8A 1ANKA 3GWZA 1RM3A 1ZEJA 2IS6A 3FFAA 3FN4A 2PHZA 1WUKS 1TFRA 3PEWA 3LDGA 5ADVA 1DLIA 4FIZA 4BYGA 3IPCA 4YJGB 2RGUA 3AJEA 3EZGA 3Q9NA 4G1FA 4L85A 4V3CA 4DSUA 4ZK6A 1F2UA 2YJ3A 3USCS 1MORA 3AUAA 4G8DA 4D4KA 3ZX4A 3L0DA 5EWLA 2DPYA 2JK0A 3K53A 1OFVA 4KQJA 2QRLA 3ZQJA 1JT2A 2CDBA 1Y6GA 1W73A 1F9AA 1FP7A 2Q3BA 3N0XA 4UE3S 2Z8XA 3QZUA 4JY7A 3FR7A 5EY5B 3R7BA 4AJ4A 1NNLA 2PRJA 2DBVO 4JEHA 2NU6B 4E1VA 3TQSA 3T3HA 4J6EA 4JJKA 3ZWPA 5ED4A 4RPLA 3TWOA 2EJBA 1KI2A 2YASA 4I50B 4EAAA 3D3WB 2GN0A 1PGJA 4KVZA 4DQKA 1A9YA 4LSZA 4HDRA 4XJVA 4R0MA 3WRXA 5IW8A 3NIWA 1GDTA 2PWZA 5JE8A 1XTPA 3Q6MA 3EBOA 4EJMA 3M6XA 1L5GB 3PFCA 3IALA 3LUAA 1DWOA 4MI3A 1YRLA 1MB3A 4NCAA 3QG5A 2HAEA 3OOYA 2PMKA 5B2ZA 3QIVA 2Z2XA 1E5DA 3UXHA 1FXWA 5JCJD 1J0XO 3HA3A 3EY4A 5ISMA 4IQGA 4NYMQ 2Q49A 3C1AA 4WY5A 1J07A 2C4MA 2OAGA 4ZU6X 5FORA 5AUQA 3WB9A 2WJ3A 2O2HA 3G8AA 1YBMA 4IGEA 4V0OA 1W88A 3BD8A 4KJXA 1Y7IA 1HYEA 2QW0X 2VJBA 2ZJAA 1UODA 3T3NA 1VLVA 4YDQA 2XCRB 3X43A 1ZZEA 1FFWA 1WKCA 4WFQA 1FTQA 1QDLB 3C97A 3MXOA 4MYSA 3O9VA 3TNYA 2RE8A 3ERCA 1MGPA 1PLKA 3K7EA 4KL8S 4MWDA 1FUEA 3QKSB 4FK8A 2ZTMA 1E60A 1G19A 3IXQA 4R3UC 5GVRA 4PG7A 4I5EA 2CNLA 4KRYA 2F8MA 1BJKA 1A4RA 1ACMA 3OT5A 2GVZC 2DG2A 3VC3A 1QTIA 1TVMA 5JW6A 5D3ZA 4KH1A 1NZDA 3CNHA 1GGMA 3VR4D 3CPJB 3KWMA 3DQQA 4J1TA 4MP8A 2AF3C 3JD3A 1P2FA 1NC1A 2SCUB 2DQ4A 1CKEA 1OC2A 3MUFA 4FFVA 4HL6A 4MVJH 4MI1A 4Q37A 1BXGA 2UUPA 3G2PA 3LP6A 3M4XA 1PN3A 2J45A 1N2CB 5E1DA 1W7AA 4RZUA 2C9CA 2NSLA 4FYKA 3AXTA 3JALB 4L5AA 4BV3A 4CIDA 4N6GA 2I3BA 3PNMA 4WKPA 4OH1A 3TVYA 1G8PA 2JVIA 1WLYA 1EK0A 1ZRNA 4DLAA 3DNFA 3E22B 1GGHA 5IRCD 3M5CA 2YQZA 1L5LA 3WFZA 2WJPA 4PG6A 2JBWA 3CUUA 1QMPA 3AG5A 4WVLA 1GU1A 3MJEA 2XZLA 2JEYA 4RA9A 3R9XA 2LRHA 2I33A 2UKDA 4QAJA 3WIOA 4AQ7A 4BOYA 1E2BA 4L02A 1MABA 2D2IA 1AGPA 1WD5A 1T9DA 3DTNA 1G6KA 4QJ5A 2GCPA 1U0OC 4FC6A 3DB2A 3EASA 1CZKA 2BFAA 1VL5A 1GL7A 4FINA 5ES3A 3USES 1SXPA 4G5HA 1DG9A 1C0LA 1WD7A 5EERA 5HA5A 1BWRA 3GJ7A 2I5PO 4EL0A 1M8FA 4JK3A 4D81A 4LE0A 2NXEA 3FTFA 5H02A 1CJSA 4X44A 1C7FA 3AESA 3OFVA 4BNNA 1RD4A 3D0KA 3ND7A 4L78A 5AK0A 3PBKA 3G8CA 1A9XA 3AF5A 1MT3A 1W75A 4FDVA 4G9EA 1MX5A 3ER6A 2WVAA 3A25A 3HKEB 1R9NA 1GG2A 4TN5A 4LC9A 4WY2A 3DPIA 3TVTA 2Z58A 4AB1A 4L74A 3LKVA 3OMLA 1QH1A 4HEJA 5AJXA 5AJZA 4DDHA 4I3HA 2ZI9A 2QL5A 1G2IA 1GG5A 1Y33E 3CLHA 2J9YB 4KCGA 1A76A 4P35A 4O4HF 4I19A 2QVCA 2R96A 4JLSA 4UREA 3GLGA 4M1OA 1R37A 4OLFA 1G8AA 4Q0MA 5FHQA 1ZY2A 1P2GA 4B83A 1S2DA 1QGUB 1KC1A 1R3DA 4BNKA 3AEXA 1T6YA 3MINB 4UTRA 4DA4A 3DV0A 4DS3A 1LLFA 4WKBA 3H97A 4MUGA 4ER0A 2CLIB 2G9QA 1Z5GA 4MKFA 5KOHA 5JD4A 5LYJB 2A7QA 3TMYA 2WT4A 4L6AA 4ZZ3A 4NATA 2C61A 1Y4ZA 2PEYA 1VGVA 1NHGA 2CN1A 3DOJA 4KQCA 3U0BA 1ZJ5A 2C97A 2E4AA 2RAFA 1CEQA 3WNCA 1E62A 1QO9A 1SXHA 2ZE7A 1JVSA 2Y05A 3TKAA 4DPMA 4JI8B 4OI2A 4MIKA 2NM0A 3FCOA 2WE8A 3C5HA 1GWNA 2Q45A 1W4ZA 5IJ9B 4TTIA 5IG2A 4IIJA 3WB2A 3F73A 1C9MA 4WBNB 2K2WA 3BCHA 1ODKA 2C5SA 3G2HA 1H3FA 3PFFA 4PR3A 1CC1S 5E9QA 1O7JA 4U02A 3WICA 3I5UA 1RXVA 3BJZA 2ZVQX 1OB2A 2A14A 3FUWA 1PWEA 2BKAA 2H00A 2QX6A 5GONB 1RAHA 3QHQA 4BLPA 1KO4A 4BCDA 1O54A 1BX1A 4MNTA 2CXHA 3IUQA 5JAPA 1FSSA 1L6RA 1GGKA 1AGXA 1KEWA 1FEZA 2BMEA 3Q10A 2PUHA 4NCKA 4W5HA 5ARCA 4BEVA 3N28A 4DOMA 2QYHA 4GP9A 5IWCA 3INTA 1JE0A 4RHCA 1NNI1 3F6CA 4CM9D 5DRTA 3QMPA 1C3XA 4N0DA 3ZHUA 3U5TA 1ODJA 3ZGXA 1WU7A 1Y6FA 2ZT8A 2VT7A 4LJSA 2V9ZA 2OQ2A 5CVTA 2EU8A 1FP6A 1ZSYA 2XBLA 4H3HB 2ZR0A 4DR3B 4N12A 3C3CA 1NG9A 3LQQA 3UB2A 1A1SA 5CB8A 5LP1A 1A8HA 2C54A 2JFFA 1V3QE 1G8MA 1TJ5A 1SU6A 4X1OA 2XB4A 3R4VA 4TV9F 4N0MA 3IOYA 1TD9A 3RU2A 1EDEA 2Q21A 1GSIA 1IJBA 1KH3A 1Z15A 3PJFA 4E03A 4QXPA 3UK1A 2GZHA 5JH7B 3UJ6A 1VPLA 4P81A 5L7TA 3TB4A 1E2KA 2QSJA 1CQPA 3Q6IA 1GZ3A 3SIRA 3SQOA 5FPKA 2EXXA 5BQ5A 4DWJA 5H9WA 5L8VA 2VTKA 4N4AA 4JKOA 3KLMX 1Q74A 3CRQA 4UMVA 4ZOLA 3I6BA 1IWOA 2X8JB 3BFJA 2PT9A 5LC1A 1FDUA 3WLAA 4IUDS 2QVGA 2GNAA 1SR8A 3QTTA 1QH8A 2OO7A 5EYPB 5C5CA 3OO1A 1DTWA 2L2QA 1C7JA 3MWEB 4M38A 5T4BA 3CZAA 1QIFA 5K8JB 4L7VA 2WPDD 3JQ9C 4CT4B 3CZ9A 1M8GA 1TDJA 3WLFA 2OV4A 1FX0B 3BKWA 1ODIA 1WDLA 3WI7A 2O8EA 1TK9A 4XIGS 4YAKA 4D97A 2QVXX 3U3JA 3JRWA 3E7WA 4LJ7A 4MP6A 5JMTA 2X86A 3F71A 1QH9A 1LDYA 2R6FA 1JHYA 2QBYA 2R6GA 1BDIA 1H9BA 3RJTA 1R4AA 1MN6A 3STWA 1MA0A 4BRSA 4GNKA 4RZSA 4HVLA 3VOBA 3OJCA 3SC2A 3RC1A 2ZIZA 3U7RA 4HXGA 4C2BA 4Q66C 5LLSA 4URVR 1NVGA 4C9BA 5P21A 4OQEA 1OWNA 2X4DA 5AJWA 1JFFA 1TGYA 2A4MA 2VQFB 4F6LA 2WD7B 1RJDA 2VSYA 3AWIA 3D7NA 1AGNA 2XIQA 1CERA 1BWPA 3DSRA 1SXJE 3FXAA 3H11B 4AKTA 4FEAA 5I51A 2P9GA 4BVFA 2AN1A 2GUGA 3N6XA 4B46A 1R4NA 2G4VA 3GW8A 4V2IA 5AXBA 1HNWB 4LYAA 1VB5A 1R64A 2OVFA 2AFIA 2NW6A 1IFXA 2ZRDA 3PQ3A 4YMLA 1A8PA 3K70D 4MVXA 4KRFA 3PYMA 4JJGA 4EY6A 2J5RA 3N7AA 4NR0A 1UOOA 1SFRA 3IODA 3A1NA 3QFSA 4HDKA 2F1RA 2VPPA 1RLMA 4RK6A 5A7GA 1QJ4A 2OXIA 5EHGA 3WWDA 4JV5B 3M3DA 2XT9A 3THWA 2NXCA 1W25A 4LNAA 2XZOA 4ZA2A 1AC5A 1OQAA 2GWRA 3QW4B 2EQAA 1S2GA 1SG0A 1XU9A 5F1KA 3L49A 5FBZA 2R6AA 4JJFA 1OBOA 5JNRA 2WT8A 3Q3CA 2XB6A 4E5YA 2FDXA 2Q1UA 3CWZA 3C98A 5AVRA 4F84A 3OU2A 1H9AA 1N6RA 4FKZA 3U3DA 1T9BA 2W71A 1F7UA 2D3WA 3L4SO 1OU4A 2GYWA 3C85A 5B3JA 1CRWG 1GDDA 1ESNA 2VLBA 3G0BA 3HYRA 4GGOA 5AXAA 3S2YA 5I9LA