2BGMA

X-ray structure of ternary-secoisolariciresinol dehydrogenase
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
267
structure length
267
Chain Sequence
TNRLQDKVAIITGGAGGIGETTAKLFVRYGAKVVIADIADDHGQKVCNNIGSPDVISFVHCDVTKDEDVRNLVDTTIAKHGKLDIMFGNVGVLSTTPYSILEAGNEDFKRVMDINVYGAFLVAKHAARVMIPAKKGSIVFTASISSFTAGEGVSHVYTATKHAVLGLTTSLCTELGEYGIRVNCVSPYIVASPLLTDVFGVDSSRVEELAHQAANLKGTLLRAEDVADAVAYLAGDESKYVSGLNLVIDGGYTRTNPAFPTALKHGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RHIZOME SECOISOLARICIRESINOL DEHYDROGENASE
publication title Crystal Structures of Apo-Form and Binary/Ternary Complexes of Podophyllum Secoisolariciresinol Dehydrogenase, an Enzyme Involved in Formation of Health-Protecting and Plant Defense Lignans
pubmed doi rcsb
source organism Podophyllum peltatum
molecule tags Xidoreductase
total genus 84
structure length 267
sequence length 267
ec nomenclature ec 1.1.1.331: Secoisolariciresinol dehydrogenase.
pdb deposition date 2004-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2bgmA00
1SMKA 5COQA 1PL7A 2Q4EA 3ANNA 2BHLA 2RBEA 1BXGA 3JQGA 2Z5LA 5T8KC 3WGGA 1N1GA 4ND4A 4AJOA 3U4HA 3GPDG 3KYCA 4RLSA 3SC4A 1HE3A 1WLYA 4GI2A 5THQA 3PVZA 3I4CA 3EGOA 4J9UE 3R1IA 3GGOA 1JAXA 4FQ8A 3P7MA 4WASA 4E2ZA 1E5QA 1HYEA 2Q45A 3QIVA 4I8XA 3TZQA 2EP7A 3Q2IA 4ZRNA 3RUFA 1T2FA 1E1KA 2VCYA 2EWMA 1EK6A 4JK3A 3SBOA 1M76A 1LLCA 3HFGA 2I67A 3UCXA 4AJ2A 4EEXA 2IRWA 1T25A 4PCVA 4B8ZA 4Y6RA 3RBXA 1XQ6A 2NV6A 1NBOA 2V65A 4BO4A 1ADCA 5DBFA 4M89A 4Q3CA 2E37A 2ZQYA 3AY7A 3PYLA 3K9QO 4U7WA 4W82A 3GDOA 2Y1GA 3F1KA 4E5PA 1Y9AA 5JPIA 3P19A 4CM9A 3ULKA 4FR5A 3DFZA 4CM6A 2YDYA 1XELA 1ZXLA 3JQ6A 3E82A 1ZW1A 3F4LA 1I36A 5MDHA 1OBFO 3KO8A 4YQYA 3KUXA 3SC6A 4YBZA 4L76A 5A06A 1VKNA 1R0LA 3DBLA 4KWIA 2PKRA 1EDOA 3VH1A 4DYVA 1PGNA 3F6YA 3GRPA 1D8AA 2W4QA 4B3HA 3ZHYA 1IZ0A 4HBGA 1GYRA 2Y67A 2X9GA 4OGWA 3K96A 4NIMA 1ADFA 2AEJA 1B0AA 3UH1A 1GFSA 1ZFNA 2Y1CA 1DAPA 4MIOA 4NQZA 4XIJA 2OP1A 1DIGA 2DFVA 2YY7A 4BO2A 4NZ9A 2X9VA 5HS6A 5L40A 3T4XA 3ZHXA 1E3JA 1DC5A 3FPCA 1GCUA 3PYMA 1NVMB 2OFPA 1B26A 2Q3EA 4HUJA 4FCCA 4GX2A 4NJOA 4A03A 3FD8A 5G0TA 3IOYA 3DHYA 1X7GA 3GDFA 3OQ6A 2PZJA 4J43A 5KVSA 4XQCA 1PWZA 3ZWAA 1T4DA 3ITKA 4J91A 1E7RA 4TQGA 3NDIA 5CDTA 1OOEA 1M66A 1LDEA 3I3OA 5K9ZA 4NFYA 5JCJA 3CZRA 1OMOA 2X0NA 1CEQA 5EERA 3OH8A 4KP7A 2CZCA 1J49A 1ENYA 2PH5A 3GAFA 3GVPA 4R69A 4IMRA 3GH3A 3I9NA 2GN9A 1T4BA 3GMDA 3IMFA 2JJYA 3GG9A 5TLSA 1GD1O 3MJSA 2UVDA 3BMQB 4HWKA 1J4AA 3PHHA 1EBFA 3TWOA 1OZAA 3DZGA 5EN4A 3D4OA 3PJDA 2I65A 1YDWA 1A7AA 3ZCXA 1N2SA 4P4GA 4PZEA 3ZHZA 3ZWVA 3ZI0A 4FJ0A 1B2LA 5BNTA 4A73A 2EW2A 5BSGA 3BA1A 4IY1A 2JCVA 4C4OA 1MG5A 1U8XX 1SPXA 4ALLA 2J3IA 3JQFA 3K31A 3AUSA 3MEQA 4Z9XA 3WG9A 3FNEA 4RGBA 2DQ4A 4AJIA 4J6FA 3OIFA 4L0QA 4CJXA 3GZNA 4MIEA 2YV3A 2ZCVA 1VM6A 3RUHA 4AJJA 4XDYA 3U4DA 1DFGA 3C7CB 4E13A 1DDOA 2YYYA 1PTJA 1GEGA 1UXGA 2NUAA 3ZNOA 3PJFA 5A04A 1Z75A 4JBHA 2FPIA 2HQ1A 3EYWA 2FR0A 4FFLA 4RVGA 3RU9A 3TQHA 3V2GA 1FDTA 5TIIA 1KIFA 3WSWA 4E5KA 4DPKA 2HMTA 3K73O 2WD7B 4D3DA 4DMMA 1EK5A 3CIFA 3FNFA 3H5RA 4Z9YA 1ZO8A 4EUHA 4CM1A 5ADHA 2I3AA 3RUDA 4PG7A 1E7MA 2C7GA 1KC1A 4IBOA 4RCVA 4RZIA 1SCUA 4EBFA 2EJVA 4BNXA 3WB9A 1BDBA 3DMTC 3QWFA 1LDNA 1MC4A 1NR7A 1SB8A 1R66A 4PLGA 1Z73A 4A27A 2EP5A 3CSDA 1DPGA 4RF3A 3U5TA 4IM7A 2JD0A 3TRIA 2IDZA 1PZFA 5COBA 3SXPA 4AJNA 3V1TC 4DIBA 5IZ4A 2PGDA 3JD0A 3K92A 3IIEA 3PJEA 4UUPA 2YQ4A 3EK2A 2PNFA 1DO8A 4GWGA 1C14A 3ZWOA 2RIRA 2AE2A 1SOVA 3OQ1A 2CVOA 4AJ1A 1BRMA 2YZ7A 1Y7TA 4GLLA 4AJHA 2BGKA 2PZMA 3FR8A 3P5SA 4P8RA 4F6LA 4DRYA 3K2BA 1NR1A 2CVQA 3GFBA 3WJAA 1EVZA 1Z7BA 4D45A 5BNFA 4GX0A 5DZSA 4GVXA 4TRRA 5FF9A 4D43A 2B4TO 3QRWA 2JCYA 4D7AA 1GEEA 3FN4A 1LLQA 3DXFA 3PIIA 4PLVA 3WYBA 3OJLA 5KVQA 1LDBA 1Q0HA 2BI8A 3FPLA 1PEDA 5C7IO 4L4XA 4HV4A 1E5LA 3VZPA 2O3UA 1QV6A 1MGOA 3ZV6A 3WBFA 2Z1NA 3DTYA 3LT1A 1H2BA 4M87A 4Y6SA 2VQ3A 1ORRA 3G79A 2H63A 2O3SA 2FOIA 3SVTA 1U4SA 1C1DA 5IXYA 3PWKA 1VJ1A 3NEPX 4E0BA 2VT2A 2D0IA 4KMSA 4NJMB 5K6AC 3JQBA 2HJRA 1EFKA 1W73A 5IXSA 2VNAA 2XAAA 1Y8QB 3KYBA 4CPDA 4BNTA 5KIAA 2HJSA 1DC6A 4GL4A 3L07A 1YWGO 4J3FA 5EESA 1U7TA 1XU9A 5ILOA 3B6ZA 5EJ2A 3WIEA 4WEOA 1ISGA 3I6QA 4RV9A 1OC4A 4I9HA 4D3SA 1MC5A 4NG5A 4PLWA 4QFCA 3DDNA 3I9KA 3RJ9A 1N8KA 1H94A 3WBBA 2O3RA 2QZZA 1DIBA 3VTZA 3PXXA 3GGGA 1AHHA 4OYRA 1I3MA 1LRJA 3GPIA 4XX0A 3WICA 1ZNQO 3KRTA 2J6IA 5L7TA 1YRLA 3OSUA 1ISJA 1ISFA 4CUJA 1R37A 2P9EA 1BSVA 4FGWA 4KUGA 1ONPA 2FWMX 3GOHA 3PZBA 4N5NA 1FDVA 2G76A 1P33A 3DAFA 2GR9A 4D79A 1PJ2A 5DULA 5L4LA 3LYLA 4J1SA 2X4GA 4S3MA 3WMWA 4PRLA 4DC1A 4GQAA 4AJKA 3UUWA 1O9BA 4YT8A 5BT9A 3GNSA 5A9RA 2OP0A 1E1MA 5JCXA 5CDSA 2D59A 4R01A 1D3AA 2GNAA 4GH5A 3WLFA 1IHXA 2BI7A 3GY0A 4W7HA 3VKVA 3WR5A 2GO1A 3ZWBA 4BNGA 4B7CA 2E82A 4UVGA 5IG2A 3D4NA 4FFOA 2P68A 3QSGA 4MKXA 1EQ2A 4KTVE 2E48A 1HRDA 4NBWA 4D46A 5L95A 1N1EA 1EVJA 3DR3A 4YJFB 3AFNA 1FMCA 1EDZA 3RC9A 3JSAA 3Q6IA 4R3WA 2HK7A 3HDJA 2W2LA 3PLRA 1TT5A 1NHWA 5IJZA 4R9SA 3UCFA 2PV7A 3C7DB 3C85A 3W1VA 4IZHA 1L7DA 3H9UA 4J49A 4TZTA 4ZQGA 4BO9A 1SEPA 2B69A 1ONOA 2VTDA 4FB5A 4OMUA 1Z7EA 1ENOA 1NQTA 1PSDA 4LVUA 4LVCA 1YJ8A 5I7VA 3JD3A 5I8WA 3DTTA 3AUAA 5CEJA 2BGLA 4YT2A 4K9DA 1UZNA 4IQ8A 2GN6A 2O7SA 4TWRA 4BMNA 5IDXA 2EHDA 3AM5A 2AEFA 1PJQA 1OI7A 3KBOA 4LMRA 4R5MA 4WCFA 3WGQA 1T2CA 3PEFA 1RJWA 2OMEA 3WLEA 1DRVA 3BMOA 8LDHA 1YGYA 2EIHA 4O5OA 2XXJA 1Q0LA 1AXGA 3K2EA 3IKTA 3CXRA 4DQXA 3ZWPA 5JMPA 5JAIA 4DREA 3MJTA 4XKJA 3HZZA 1CERA 1GTMA 2LDXA 2V7PA 3TFQA 4J1NA 1DLJA 3QVOA 3RC1A 2YDXA 2NU8A 2OOSA 1T2DA 1RM3A 4L9RA 4XYMA 2W2LD 1W8DA 1LC3A 2NACA 4FPXA 3OJEA 2NU6A 1F8FA 2DPHA 3ORFA 1ZUD1 1LBEA 5JNLA 1BXGB 4PFJA 4BKUA 5TF4A 4EITA 4A26A 3MJ4A 1Y9EA 1HTBA 2YW9A 4TRMA 3UICA 3OFSA 1VRWA 3PI7A 2WTBA 1X7DA 5L9AA 1I3KA 4ZHSA 2OL4A 2B36A 2CF5A 3U4CA 4DWVA 1VE9A 4BV8A 3G0OA 2P5UA 1LSOA 2CSUA 2VHVA 1ID1A 3HQ4O 1YS4A 3JD4A 3G1TA 2I99A 2Z95A 1MLDA 1WW8A 4FIZA 3W8DA 5IF3A 2ZB8A 5IDWA 2B37A 4Q3NA 3COSA 5HTOA 3FBGA 2ZB7A 1IHYA 2ZB3A 1HDRA 2VWPA 4W6ZA 1ZJZA 3JYLA 4GPD1 5C7OO 1C0PA 3VH2A 1JKJA 3OICA 5JLAA 4J0EA 2EF1A 4NK4A 4E31A 4DLAA 3GDGA 1DJNA 1L1FA 2JL1A 2EXXA 3HSKA 2QHXA 3GA0A 4WCDA 4A2CA 3UVEA 4YWJA 2W8ZA 2EJWA 4G5HA 5G0VA 4K6CA 1HDZA 4M49A 3H6KA 4N18A 3WNVA 4KDFA 1ZEJA 1PJ3A 3V2UA 4NH4A 3OF2A 1P1KA 3PFWO 4NMHA 3RC2A 4BVAA 4XQ9A 5ICMA 1IOLA 1YBVA 3A4VA 4XGNA 3RIHA 5L45A 1R4NB 3I52A 4CLOB 3DBLB 4W7IA 5JSFA 2X0IA 3HADA 4N5LA 2HLPA 2GD1O 4J9VA 4RDHA 5I7FA 2PD4A 1M6HA 1PZGA 1E3WB 1P45A 2DBZA 4IUYA 4R68A 4UEKA 5HA5A 3RJ5A 3UFXA 5KKAA 1UJMA 2NWQA 3O8QA 4RPKA 2X8LA 2QX7A 2QIOA 4UVDA 3DAPA 4R1TA 2JKVA 5BSEA 5KJCA 5T5QA 2FZEA 4NFHA 4Q3EA 4QQRA 4PVDA 3PHLA 1KVTA 1K3TA 1YKFA 3JQFC 1P0FA 1IZ9A 3TZ6A 1HZJA 1K6XA 2DU8A 2AQHA 2J5KA 3WS7A 3A1NA 1V0JA 4CV1A 4WECA 3A06A 1X13A 3FCOA 2XXBA 1MUUA 2OGUA 1RWBA 2PD3A 4FS3A 4O6VA 3R3JA 4XA8A 3H65A 3U0BA 6ADHA 1YE3A 4OKNA 2X5JO 1F17A 1PQWA 1K89A 1XSEA 2HAEA 3LSYA 5DCWA 3EAGA 4Y6PA 2RH4A 3G49A 3QY9A 2DTDA 4ZJUA 3PQDA 3T4EA 2HKIA 4LRTB 4DLLA 1XA0A 5FWNA 1PZEA 5DP2A 4W99A 4GSKA 1YBMA 5IN5A 5ER6A 2C5EA 5ITWA 1Z74A 3FNHA 4FFNA 2UYYA 1NWHA 4NBTA 4BO6A 1LQUA 1HYHA 4FJ2A 4NBRA 4DA9A 4Q9NA 1YONA 1TLTA 2Q1TA 3ZN2A 1XKQA 3UF0A 3C3XA 3SEFA 1YL5A 1Z82A 2R6JA 2PH3A 5KJEA 4QO7A 1M6WA 3D0OA 1HDXA 3IAHA 3RBVA 2AHRA 4YACA 1PR3A 4IJKA 4JQCA 1I2BA 1LI4A 3RAJA 1QORA 2TMDA 1XEAA 3DZBA 1E7SA 3RUAA 1ZK4A 2HRBA 3INRA 3O26A 3F1LA 4DGSA 3GZNB 3KVOA 3H9EO 3MJVA 4HFNA 2C5AA 3LC7O 2PTGA 3QWIA 2X5KO 3WYCA 1C1XA 4BOYA 1BHSA 1WWKA 1QKIA 3ZU5A 2X0RA 1XGKA 2D3TA 1I2CA 3K8ZA 3GUYA 4G2NA 3R3SA 3FBTA 1P1FA 1X0XA 1A9YA 1NQOA 2NTNA 4EJMA 1E3IA 2OBYA 2WDZA 3WGTA 3ROMA 5KWEA 4N5MA 1IB6A 3IL2A 1MFPA 4U0KA 3AFMA 1V9LA 2BKAA 1HSZA 1WNTA 3KYDA 3ROPA 5T67A 2J3KA 3GHHA 4ROSA 3I9JA 3GNTA 3C7AA 4LN1A 3QA9A 1QLJA 1HLPA 2CNBA 3H3JA 4UEJA 4YAKA 3TF5A 5I7EA 4DVJA 3ZH2A 3DZIA 4GGPA 4YVFA 4GGOA 2D4AA 4CQMA 1I3LA 1P1RA 2R2GA 3JQBC 3MTJA 4I5GA 1U9JA 4Z0PA 1LU9A 4BNMA 2CDCA 4FC6A 3ZV5A 2V6MA 3MCVA 3W4JA 4CMEA 3ZW8A 3PWSA 3V1YA 4BNLA 2E49A 1NAHA 4ILKA 4XGIA 1IYZA 1N5DA 4G81A 3D1LA 4OXYA 1RYEA 3U9LA 1XHLA 2G82A 3RQSA 3NYWA 1IULA 4PIVA 3F46A 4FDAA 5B4VA 3NDJA 2C59A 3CMCO 1BWSA 3GVXA 5JAQA 3M2TA 2CDBA 4PLTA 3N74A 3HE3A 1AE1A 3D3WA 4I9UA 3RBZA 2Y99A 3WGOA 2O3TA 5IN4A 3E9MA 3KSZO 3PIDA 3BYZA 1MXFA 2JAPA 3LT0A 4OHUA 3WQRA 1JU9A 1KVSA 1VPDA 3QWAA 1JVBA 4JX8A 4ALJA 3JQ9A 2O48X 4J4BA 4Z3DA 4OL9A 2DKNA 1Y5MA 5ENDA 4HKTA 3W8FA 2IEBA 1IE3A 1SO8A 2HSDA 1UXIA 2G5CA 1YXMA 2LDBA 4XD2A 2GLXA 3KOUA 2PZLA 4J90A 4ZQFA 5THKA 4BKPA 3NJ8A 4BO8A 4XCVA 1E77A 4IJWA 4JCOA 4IDFA 4BO0A 4TRNA 4NFSA 3WGZA 1M2WA 1A4IA 1C1DB 4BNYA 4UVEA 1O95A 2CVZA 2NSDA 3IS3A 2J3HA 4PG4A 4CQMD 1PGJA 1YB4A 1LRKA 4RF2A 2VHZA 1I8TA 1YO6A 1LSJA 3JV7A 1SBYA 5H81A 3R6DA 9LDTA 4FW8A 1LXCA 3DMYA 5DOZA 4CLRA 1XG5A 1NQAO 2BD0A 3LT2A 4E5YA 3D4PA 3VVCA 3CUKA 1SAYA 2Q1SA 3ASUA 3VDQA 5IFLA 1D7OA 4AICA 1A7KA 5B4TA 2WEKA 4BV9A 2Q2QA 1TEHA 4LCJA 2FY8A 2RCYA 4KUHA 3TOZA 1LX6A 2GERA 1ADGA 3NUGA 1UAGA 3A28A 3VPFA 4RPHA 3OJOA 3I23A 3V5NA 1GCOA 4PLHA 2NVUA 3HB4X 4D44A 1NASA 3S2IA 1QXSA 5G0SA 3OEYA 4XDZA 5A03A 3RUIA 4CMKA 2H9IA 3HDYA 3I9OA 4C7KA 1HWYA 4M8SA 1NP3A 4J7CA 4B8WA 5ICSA 4NBUA 4H7PA 3PYXA 2X9NA 2HMWA 1FDWA 1I33A 1WAMA 2I9PA 1CF2O 4OOEA 5G0WA 3AI2A 1D1TA 2Y68A 2X58A 4WCFC 5C7LO 2RHRA 4BB6A 1NWCA 3IC5A 5KCZA 3AOEA 3E03A 3LLSA 1G6KA 3SLKA 4BNIA 1HZZA 5ER9A 3HG7A 3LC1O 5JW6A 2YFHA 4YJGA 4U0JA 1WDKA 4GKVA 1KOLA 2EKQA 3ENKA 3TL3A 4CM4B 4ZRMA 3JQEA 4B4VA 3GEMA 3GAZA 2I76A 3I83A 3PWZA 4R4JA 5EIOA 5ILGA 4R1SA 3VPXA 2AQKA 4YQZA 1SB9A 1TT5B 2A9FA 2WM3A 5I9NA 2BH9A 1A72A 1LDYA 3B1KA 4BO3A 3GQVA 5CAEA 2UDPA 4ZU3A 1ML3A 4WLNA 2IYOA 1I01A 5AXAA 1U1IA 2Y0CA 4BL5A 2VOJA 1VJTA 1C0IA 4E30A 1H93A 1V6AA 2BGMA 3UCEA 2EEZA 2VWGA 2VRBA 1GU7A 3BAZA 4IJVA 4CV0A 4DQUA 1LUAA 3GVIA 4B3IA 4XRRA 1B16A 2WE8A 4XEHA 3D7LA 3LZ6A 4YJHB 1YL6A 5KVVA 1U5CA 4OQYA 4WCFB 5KKCA 2V6FA 2WJPA 4O59O 4WNIA 4DMLA 4EEZA 3EUWA 1LQTA 4H15A 5TGDA 3BMOB 1Y81A 1MX3A 3FF4A 3WX0A 3KZVA 3LF1A 4B3JA 3T7EA 3DL2A 3OQBA 5FI3A 1T2AA 4WEQA 2EGHA 3E9QA 1B14A 3LF2A 3BHIA 1KEPA 4OJNA 2YFQA 4JP2A 3C24A 4IINA 4PN3A 3E5MA 3FWNA 5JDIC 3U3XA 2UAGA 3QP9A 1N9GA 1PJBA 1UXKA 1GQYA 2OORA 4XIYA 3DZFA 4R9RA 2GSDA 5A1TA 4B7XA 3IUPA 3WMXA 3U09A 4UUNA 4BO5A 3KEOA 1SNYA 4QFDA 2JHGA 4MP8A 1JLLA 4YEDA 4CR7A 3BTSA 1QYWA 4OIMA 2CMDA 4D3FA 1WP4A 4C7JA 5L4SA 2JHFA 5G4LA 3B1FA 2O23A 5FEUA 5T6BA 4CR8A 3ETEA 1GR0A 4YRAA 5LDGA 1A4UA 1JAYA 3V1UA 1BMDA 4F45A 3OECA 1NVGA 5JBIA 2RHCA 4RVDA 1P1IA 1ZK3A 4UUOA 4WOJA 1HSOA 1R0KA 2OO5A 4FJ1A 1UXJA 2C29D 4Y98A 3WQQA 4RPJA 3ZU4A 5GZ1A 1JKFA 3KHUA 4DXHA 5EPOA 2O3QA 2WD8A 2WYVA 3ASVA 3LDHA 4J1TA 3L6DA 3ETDA 4NHEA 4RPGA 5ES3A 4ZVVA 2VRCA 4PZCA 3RWBA 5IAAA 2B4QA 5ENVA 2OXIA 4ZA2A 3VPSA 2O2SA 3L4BA 5EMHA 1GPJA 1FDSA 3IP1A 3L9XA 4RDIA 4CMHA 4XJSA 4JN6B 4RLHA 4OOFA 4DIFA 3DOCA 4YTEA 4MVJF 3ZWCA 3FSRA 1WZIA 5IDQA 3VH3A 1DRWA 4YAGA 5B4UA 3TZKA 4Z6KA 3LC2O 2CF6A 4L74A 1Y8RA 4J4HA 5TC4A 1TB4A 4CM7A 4TKLA 1X14A 2AW5A 5L51A 3JQAD 4I5FA 3OA2A 4MP6A 5JYDA 1IY8A 4TMFA 4EGFA 1SOWA 3H8VA 1DIRA 1W4ZA 2GN8A 4QECA 4KQWA 1T1SA 4XRGA 3D3EA 3OJ0A 3NRCA 4BNFA 3UN1A 4HNGA 3FTPA 1WDLA 2P5YA 4GMGA 5A9SA 2W90A 1MXHA 2G17A 2YHUA 1YL7A 3NT5A 5DCYA 1GPDG 3O8QB 2WE7A 3ON5A 3VVBA 1UUFA 3H9JA 1U3TA 4EYEA 1U7HA 3PLNA 1NFQA 4YDRA 2OBNA 4YPOA 1KVUA 3AWDA 3I5MA 3KM0A 4OSOA 3D64A 3JQ8A 3MTGA 4E12A 3GEGA 2VRCD 4PG8A 3NT4A 2XF8A 3C8MA 3JYNA 3DZKA 3A14A 2B0JA 1RM0A 1WVGA 2C0CA 2CD9A 1Y5RA 4AFNA 5EL0A 4TVOA 2DT5A 4WLVA 5KVCA 1Q7GA 1X1EA 2PK3A 2PKQP 1PR9A 4E33A 4LW8A 1QRRA 2XOXA 1ZSNA 1U5AA 2GZ2A 5T57A 8ADHA 2P4HX 1MG0A 1EQUA 5JMWA 1BVRA 3AOGA 1G0OA 1CDOA 1G0NA 3VPHA 4FSHA 2DFDA 2R00A 1BDMA 1JWAB 5JO9A 4R3NA 4I5EA 3S2GA 1QYVA 2AMFA 3Q3CA 3QE3A 2FSSA 5CP8A 1C0KA 4EJ6A 2A4KA 1EZ4A 5U9CA 2FR8A 4JXKA 4RL6A 1U2DA 5AYVA 3PDJA 2W2KA 5A9TA 5L53A 4WPGA 1B3RA 4HFRA 4J0FA 1V3TA 2FSVA 2HDHA 1Z45A 4FFPA 2X22A 4J2OA 1EE2A 3O4RA 3PK0A 3WNQA 1KYQA 3M2PA 1YBAA 4CMEC 3WSVA 1VI2A 4JLWA 4E5NA 1PJSA 2GN4A 4ZQBA 3OM9A 3V8BA 3ROKA 1DFHA 4E2XA 4ALKA 5H83A 2FPGA 4A0SA 1H6BA 1C1XB 2BFOA 2X6TA 4K6FA 4N54A 1MB4A 3GF4A 2AQIA 4XYGA 1NPDA 2WSBA 5A05A 5TT1A 1N92A 4OSPA 1AHIA 4R51A 2JAHA 3EZYA 1HL3A 1HE2A 1PJCA 1RPNA 2HK8A 5G0UA 3AY3A 1T24A 3ZZNA 5DOVA 3GR6A 4K26A 3JQ9C 4LSWA 5GZ3A 4CM8A 4ALMA 3RD5A 1LSUA 4D0SA 2C7VA 4Z0TA 4INAA 3FI9A 1UDCA 1J6UA 1H6AA 1U8FO 4EDFA 3ETGA 3BTUA 2Y1FA 3O38A 1I32A 3TL2A 2OHXA 3JYOA 2VUTA 2NNLD 3ANLA 1EE9A 1K0UA 3SJ7A 1GUYA 4CMCA 3SJUA 1NFFA 3K5PA 3KSDO 3LVFO 4AJPA 3JQGB 3W6UA 2C20A 2X86A 3H5NA 1H0KA 5AXDA 1JVSA 2EW8A 3KYCB 3IP3A 5KJ1A 1DHTA 2Y66A 4PLCA 4N7RA 2NVWA 1YQGA 3KLMX 2FMUA 4U6QA 1PS9A 4TVBA 3BIOA 3AU9A 4EJ0A 3NKLA 3WWYA 4LMPA 3C1AA 4B4WA 5TJ9A 3C1TA 4I08A 2ILTA 1LTHR 3D3WB 3JQ7A 4P38A 5BSHA 2GF2A 2Y0EA 4FFRA 2B35A 3CE6A 5I8ZA 1JTVA 5I9LA 5L7WA 2AG8A 3E6AA 1IUKA 3ZV3A 2PFGA 3ADOA 4CQLA 5AVOA 3DZJA 4AVYA 5B1YA 5U4QA 1M75A 2HUNA 2HU2A 2VWQA 2VHWA 3AUUA 4DLBA 3Q11A 1EMDA 4HXYA 2JFFA 4BKOA 2E4AA 5JYEA 6LDHA 4L75A 4CLHA 4CM5A 1J0XO 2B5WA 4WLEA 5G4KA 2P4QA 1YH3A 4DL9A 1DIAA 2DTEA 3AI1A 3WYEA 4CL8A 3AOEC 2HMSA 2VNSA 2EV9A 1DRUA 1U3VA 2NQ8A 1V35A 4CLRB 1P1HA 3PPIA 3FNGA 3BTOA 5K0ZA 1BGVA 1HKUA 3L0DA 3RSHA 1A27A 2EGGA 1ZK1A 4H3VA 1DOHA 4ALNA 3HN7A 1YB1A 3TDKA 1ISHA 1NX6A 1JA9A 3S2FA 3OEWA 4CUZA 3H2SA 4JP3A 4MVJE 4BNKA 3NJ4A 5JC1A 1U3UA 3CKYA 4JNKA 1GUFA 4II3A 3LQFA 3F3SA 4QUKA 2YQ5A 4NJMA 2NVUB 1GADO 2DPGA 4YCAA 1A9ZA 1PQPA 4HADA 1VKOA 1KEWA 5CFZA 1QYDA 4CLDA 2ZTVA 1ZKMA 1PJLA 3C1OA 3ICPA 3K30A 1R16A 3E18A 4CLEA 2Q99A 1K6JA 1PS0A 3BMNA 1NPTO 3NTOA 3MWEB 4UUMA 1XLTA 3OJFA 4PLZA 4WKGA 3RC7A 4XYEA 2P2SA 3ZW9A 3GRKA 3JD1A 1LJ8A 2IEDA 4UVIA 5B37A 1KETA 5G2OA 1ZBQA 3GT0A 1G1AA 3FR7A 2IXBA 1PZHA 4F6CA 1HE5A 4R54A 2GYYA 2PKQO 1VSVA 4BMSA 1PS8A 1KVQA 4GSLA 5LC1A 1KERA 2A94A 3V2HA 1YOVA 1KBZA 5DNAA 1UAYA 3W4IA 1HF3A 2PGJA 1F0YA 1YVEI 1WXDA 2VUSA 5CDYA 2ZJ1A 1DIHA 4ALIA 1PQUA 1Q2XA 4ESOA 5CEFA 1MP0A 3JYPA 1BW9A 1EUZA 1UDBA 1E0DA 3VKUA 2X7HA 3CTMA 4IPTA 1BXZA 2PA3A 1OFGA 2B5VA 2G1UA 4LCEA 2QRJA 4PLPA 3WGIA 4L4RA 1ISMA 3RASA 4IDEA 4HFJA 4OKIA 1HE4A 1ZZEA 4XGKA 1EVIA 2DBQA 2AE1A 4YAJA 3ZNNA 5CHEA 1U28A 2ZQZA 1D1SA 1XDWA 3F9IA 4NK5A 4HFMA 1KY4A 1RKXA 4GLOA 4IXTA 4CL3A 2NM0A 1S7CA 3QVXA 3KXDA 1H6DA 3DBRA 1ZMOA 3LLVA 2GZ3A 2VYVA 4NU5A 3QVWA 4YJDA 3AW9A 4CMBA 2UUOA 3H4VA 2BRUA 3QWHA 2Y0DA 3VZQA 4Y67A 3ADPA 3UW3A 5DN9A 2JD1A 2ZTMA 4MO2A 4OM8A 2O3JA 4YRDA 3M1LA 4CMJA 4AJLA 4ONEA 4AJEA 2GDZA 2X1HA 1N7HA 4XJTA 4CR6A 2G0TA 2H1SA 3L4BC 4J2HA 3HDHA 1B8VA 2ZATA 1ZCJA 5JAMA 2VYNA 2AA3A 2VZ9A 3BMCA 4RF5A 4F3YA 3LU1A 7MDHA 4WK6A 4UEOA 4YXFA 2Q50A 1E1NA 2BF7A 2QYSA 1E7YA 4RVUA 5DBGA 2EKPA 4GX1A 2ZYDA 1NTOA 1N9GB 3F47A 1PGOA 3TOXA 1ZMTA 4BO7A 3BHMA 1DC4A 1I5RA 5TS3A 4EZBA 1MA0A 1RM5A 1EEHA 2YJZA 4JJGA 1KVRA 5JO0A 5KJ6A 1QG6A 3NV9A 1PU2A 3GNQA 2Q2WA 1O6ZA 1CJCA 2WMDA 4FGSA 1E7QA 1ZEMA 3EHEA 4CMGA 4WLUA 4RVFA 3WWZA 1UP4A 3IQDB 3RVDA 4II2A 1UR5A 3BXXA 3DBVO 4CV2A 1YJQA 2ZTLA 3STHA 5AXBA 5A3JA 4MVJP 3ZDFA 1PIWA 4B4OA 2O4UX 1F12A 2FR1A 4KQXA 4HP8A 3PQEA 1Z6ZA 3O03A 1KS9A 4QT0A 3PJGA 1QLHA 4I5DA 5TRTA 2VYVD 1VL8A 4UREA 4A10A 3ROQA 9LDBA 2O7QA 2X5OA 1UXHA 5AOVA 3KEQA 2NQTA 2X23A 4R16A 3AU8A 1FXSA 3FWZA 1CQJA 1O5IA 3SX2A 3DOOA 4MVJH 3ZV4A 4AL4A 4E5MA 3ZWYA 3N58A 1ZSVA 2BLLA 3GEDA 4KTTE 4W4TA 4RO0A 1GYPA 3P2OA 4BGEA 5DP1A 2VYND 1V8BA 1DB3A 2QRKA 4U8GA 1ADBA 1QR6A 3GC6A 1WDMA 4HX5A 4BMVA 3GN2A 3JCZA 1NQ5A 5HWSA 4CMIA 1E1LA 2ZIZA 2HCTA 4IGEA 4WUVA 3ZWWA 4YYZA 1Y8RB 1GDHA 3D5TA 4NPCA 2H5LA 4MVJI 4WOKA 1GV0A 1E6WA 1HXHA 2R00C 4O1MA 4XYBA 4M55A 3ONFA 4PZDA 4RPLA 3KV3O 4QO8A 2FRDA 2UUPA 1BVUA 1A71A 1DXYA 1Y1PA 1X0VA 1XIVA 3S2EA 5A9SB 3VOSA 4ZQHA 5DDIP 2GZ1A 1Y6JA 2PR2A 2YHIA 3GZ4A 4H16A 4BKQA 1HEUA 1I10A 1T2EA 3ZNQA 3W4KA 2D5CA 5KOIA 5TX7A 7ADHA 1JN0A 3AY6A 2PLAA 3JQ8B 3TNLA 4IQ0A 3G1UA 4MIYA 3A9WA 4PLYA 4Q3DA 5A02A 3PRJA 1R4NA 4CLOA 4MINA 2Q2VA 2ZB4A 1JDJA 3PGJA 3OMLA 3RU7A 1CQIA 4M54A 4RZHA 1GV1A 5L3ZA 1V3UA 1RM4A 5EQDA 3VC7A 1E3WA 4FOSA 4LISA 3E8XA 5A5FA 3NGXA 4UVHA 4ZQEA 1XQ1A 4WE3A 1QV7A 3KSUA 2A35A 4M86A 1R4MA 2QZ9A 3R0IA 1I24A 3E9NA 5CPFA 1K6IA 1FF9A 2VN8A 4YA6A 2ZK7A 3HHPA 4CODB 2HK9A 3B20A 5TQVA 3AUTA 1B8UA 1GQ2A 1H9AA 4J1QA 3T7CA 2PWZA 4J7UA 4GVLA 2VZ0A 3SLGA 3PP8A 2DUWA 5A3VA 4MDHA 3S8MA 1NPYA 1LC0A 2DLDA 3FHLA 1I3NA 3AJRA 1P77A 3Q2KA 4GMFA 5IZCA 5CEEA 1IPEA 3CMMA 2DAPA 2F00A 1TVEA 2O4CA 3I9MA 1X1TA 1GAEO 4Y8VA 4D42A 4DYDA 2W2KB 3KLPX 4QX6A 3WJ7A 2VTEA 4Q39A 4CM9D 4RJTA 3H9GA 4OAQA 4CUKA 2JCXA 2ZCUA 3ONEA 1WPQA 2YUTA 3NX4A 5FYDA 3AI3A 4XR9A 5JC8A 3UOGA 5TJHA 5TT0A 1EVYA 4A7PA 4YR9A 1YDEA 3VHRA 3QQPA 1JW9B 2DUUA 4O0LA 2NU9A 5DBIA 4QTZA 1UZMA 4ITUA 4G65A 3IJPA 4YAIA 1HDGO 3HFSA 4CLXA 4HY3A 4JIGA 1KC3A 2HMUA 5L4NA 1UH5A 2A92A 3Q9UA 4PLFA 3TZCA 1JWBB 4FN4A 4WJZA 1GQQA 4NR0A 5MGBA 4ND5A 4NU6A 1ZSYA 2I3GA 3RFXA 5U1PA 4UAGA 2HRZA 4CM8B 1Q7CA 1GL3A 2PD6A 4UULA 5HM8A 1P31A 5F5LA 1JKIA 4GBJA 2BFPA 1OAAA 3NTRA 4P22A 1LNQA 1NHGA 5AXCA 1L7EA 3GVCA 4IIUA 2GPTA 4IXWA 1FDUA 3VH4A 1C3VA 2QW8A 4YRBA 4IJUA 1E6EA 2Y1OA 4K1LA 4Q3AA 1B7GO 5GY7A 3S1LA 4KWHA 3JQAA 1Q1NA 5JCJD 2BMAA 1ZIDA 1GZ3A 2GGSA 5JFOA 1NAIA 3RUEA 1IPFA 3UGKA 1JQBA 4IDGA 1QMGA 3VDRA 1PGQA 4CMAA 4L8VA 1ZVMA 4BKRA 1SZJG 1DJQA 1NM5A 1LA2A 1ENPA 4IDBA 3GUCA 4J16A 1GYQA 1I0ZA 3GMSA 3RCBA 5B12A 2NU7A 4WLFA 4W9NA 4E3ZA 1TA4A 4YAEA 3ANMA 4IZIA 3DBHA 3K6JA 3RI3A 2EERA 3OETA 3DC2A 1UZLA 3H3FA 2YV2A 3JQ7B 4PRKA 1VL0A 1CWUA 5HS4A 3GFGA 5F1KA 4GWKA 1R0SA 4TKMA 1O8CA 3QVSA 1WZEA 1OC2A 2AXQA 3QVTA 1BTOA 3NDRA 2H6EA 4E2YA 5A4DA 3HJAA 4FC7A 5JDCA 3PDUA 2JFHA 5CPBA 5FFFA 4DPLA 1X7HA 3BHJA 1E7WA 3F5QA 2ZTUA 2IE0A 3NAQA 4JBGA 4CQLB 4DIOA 5J23A 3PHJA 2FZWA 2NLOA 4JJIA 4NDNE 1E3LA 3CZMA 1DEHA 4Y9DA 4BQRA 4IDCA 3OP4A 2UV8A 4MOWA 3WXBA 2P9GA 3UXYA 2POQX 1CETA 4R1NA 2Q46A 4IDAA 4DTIA 1V3VA 2PY6A 4XR4A 2Y05A 5G4KB 2Q49A 1O89A 3GLQA 3L6EA 4RQTA 1HYGA 2Y1DA 2GRAA 3WDSA 4IS3A 4XQGA 1B8PA 2Y93A 1QYCA 1FJHA 1K2WA 3ZU2A 1W0CA 5BQFA 4FD3A 2EG9A 3VZSA 1R6DA 4BGIA 1QSGA 4DC0A 5AQ1A 1HT0A 3EY4A 5KNLA 3WTBA 3VTFA 2DM6A 3EDMA 3NTQA 3GN1A 4GKBA 1MFZA 2QG4A 4MVJG 3WFJA 4YB8A 3H2ZA 1XWFA 4TZKA 1TI7A 3ZWMA 4ND1A 1E92A 3MZ0A 4EUFA 3B1JA 5T8KA 1HDOA 2FHSA 2O50A 5TSDA 1XU7A 3OBBA 1IL0A 1B3BA 4DBZA 4KOAA 4I1IA 2Y1EA 3HN2A 1YB5A 3BMNB 1T1RA 4R1UA 5F1OA 1R15A 5JXWA 3H7AA 2PZKA 4FOOA 1FK8A 2GCGA 1NYTA 4J7XA 2XPCA 3PHGA 2FP4A 4RQUA 2JD2A 1DBVO 3CH6A 1EBUA 4B79A 3JD2A 4P4NA 1YQDA 1QP8A 3L6OO 1UP6A 3TPCA 3ZWNA 2B83A 3QW2A 5CDUA 3L4SO 1N7GA 3NT2A 1GUZA 4OH1A 1YOVB 3QLJA 4EW6A 2EKLA 1PJ4A 4D41A 2DTXA 2Q4BA 2IXAA 3RKUA 4JBIA 4BHTA 1DHRA 3TFOA 1P1JA 2CUKA 3F5SA 1BW9B 2CY0A 3GGPA 3Q0EA 4RORA 5C5IA 2YV1A 1H2HA 1P74A 4L73A 1HDYA 4NI5A 3QHAA 1EUDA 4LK3A 4B7UA 1DAOA 2QRLA 4E32A 5HRUA 5KTKA 1U3WA 2IODA 4JROA 3OHSX 4XYLA 1VJ0A 2DVMA 4EUEA 5IDYA 2VHYA 3BTVA 3Q1LA 1I30A 4AJ4A 2QQ5A 3N7UA 4OO3A 1F8GA 3WIDA 1ZK2A 1E6UA 4CM4A 5JE8A 4TRJA 3EVTA 3EVNA 3EW7A 3WFIA 1AUPA 2ET6A 2GASA 4PG6A 1PL8A 3DBRB 4MPDA 3NGLA 3W8EA 3BMQA 5JY1A 4JGBA 1EUCA 1XYGA 2GUGA 3TN7A 2Q1UA 4FBGA 5F5NA 5EQFA 3AM3A 3MJCA 1RYDA 4MVJM 3RROA 4J4TA 4QXMA 3QV1A 2VHXA 1LDGA 3PZRA 2NADA 1ENZA 1KEUA 1PJTA 1Q7BA 1VC2A 4L4SA 4DQVA 5JS6A 1H6CA 5COAA 2W98A 2CDAA 1ULSA 1ZXBA 3I6IA 4IIVA 4E21A 1ULUA 3MWDB 3BMCB 3IUSA 4BB5A 3MJEA 3KYDB 3UKOA 3U62A 2TMGA 1WMAA 4BNUA 4YJHA 4OXNA 4BGVA 3M6IA 1NVTA 3KB6A 4MKZA 4BGUA 4E6PA 3DZHA 3DEYX 4ID9A 3ICCA 4XB1A 4URFA 4PG5A 2AQ8A 2WYUA 1O94A 4NNJA 4PGFA 3PFFA 1PWXA 2P91A 3PTZA 3VPGA 3ZGYA 4CQMB 2F1KA 1HDCA 1ZK0A 2WD7A 1QYXA 5JAZA 1NNUA 2C2YA 2J8ZA 3PGXA 4BNJA 3BZUA 3TJRA 2RAFA 2SCUA 3EMKA 3ITDA 3B70A 4RVHA 2WWRA 3DWFA 1H5QA 2BFAA 3WTCA 3ZHBA 3DHNA 3AK4A 4KDEA 1NFRA 5JDIA 3ST7A 4KUEA 3IDSA 1KEVA 4XQEA 1VLLA 2VT3A 2D8AA 3HNPA 5LCXA 1T26A 2BFMA 2VUUA 3DOJA 1B15A 5CDGA 5KJFA 3AM4A 1LLDA 4IGFA 4GX5A 4BIIA 5GMOA 2OZPA 1ISIA 1LLUA 2HMVA 2NTVA 2ZYAA 1SC6A 4CMIB 2IYPA 5BNIA 3HUDA 1H9BA 1I2ZA 4D0RA 1J5PA 3FTNA 4M1QA 3OIGA 3JQDA 1VL6A 4MJLA 3H9QA 1WMBA 2C2XA 2DBVO 3DAGA 3GG2A 3OIDA 3DB2A 5C37A 4QSMA 4MP3A 5A5EA 3CINA 4BNVA 1PL6A 5JY6A 2V6GA 4BNWA 2D5AA 5F21A 4OXKA 3KETA 1UP7A 3RUCA 5EINA 1U4OA 3G17A 3UHAA 4B4UA 3GHYA 2I6TA 3IJRA 3FRJA 5BSFA 1UDAA 5GZ6A 1EFLA 2JFGA 2IZ1A 2ZKLA 3G3EA 3OA0A 5DT9A 3UAGA 3E5RA 5DCUA 3DHEA 5IZCC 1ZJYA 1KY5A 3U49A 1SEVA 3DMTA 2YHIB 5T64A 4A5OA 2VZ8A 4ZN6A 1GZ4A 4FFMA 4ND2A 3WQSB 1ONNA 1PX0A 3IKVA 1K5HA 2Z1MA 1X15A 4BNHA 4DUPA 3ZWXA 3ENNA 4EI2A 4MKRA 1AN9A 3ABIA 4PVCA 1GZ6A 3WGHA 3L9WA 4ZGWA 4Z3KA 1Y8QA 2Q1WA 4IDDA 1DLIA 4R41A 4WNCA 4LRSB 1M67A 3D5QA 4Z9FA 4O63O 4YT5A 3I1JA 4K28A 3M1AA 3ZNPA 4YT4A 1C0LA 2CFCA 2ZJ0A 3QJ5A 1R4MB 4BUCA 4GAEA 1XCBA 2C54A 1P3DA 1TXGA 4QEDA 1F14A 4U6SA 2IZZA 3CPSA 3VZRA 2DBRA 5I9MA 2C82A 1D4FA 5ITVA 2FPPA 1MV8A 5F3RA 4MVJA 4XB2A 3CEAA 3S55A 4CV3A 1DSSG 3E1KA 4LGVA 4YJGB 2O2YA 1CRWG 2C07A 2DC1A 1CYDA 3ZU3A 2WYWA 4E2WA 2PGLA 5L7YA 1HETA 4S1VA 3EZLA 2I5PO 3JTMA 2NTJA 1O0SA 4TSKA 4I9NA 3TSCA 2VWHA 4Z0HO 2NVBA 1DFIA 3QWBA 2AEMA 3O9ZA 2HO5A 3W6ZA 4E4YA 3F4BA 2IZ0A 2J5QA 3HWRA 4LSMA 5K6AA 5I7SA 4RVSA 1P9LA 2J5RA 3WGYA 4WLOA 3RKRA 1BG6A 2I66A 3MOGA 2QYTA 1AXEA 1AGNA 3WOHA 4AG3A 3HB5X 2FN7A 2BELA 5H82A 4F46A 4KZPA 4ND3A 1ZH8A 1XR3A 2V6BA 3X2FA 3RFTA 1VSUA 1A5ZA 3TZHA 3KTDA 4DBVO 4YJFA 5LDHA 5HBRA 3LK7A 1LSSA 4W9NC 1ARZA 2X0JA 4IQGA 2B4RO 3JYQA 1Q0QA 4R5HA 4IMPA 3L77A 3DONA 3VAZA 4U5QA 2RH8A 1E3EA 3INGA 3HDQA 2VOEA 3PQFA 4NBVA 4BQPA 4MVJD 5JDCC 3GVHA 3I4FA 3DO5A 4BNNA 2J3JA 4IS2A 3RFVA 2AG5A 4XZ3A 2D1YA 1CIVA 3PHIA 5CG1A 4OQZA 4P4LA 1F06A 3DFUA 3MOIA 5FI5A 1LEHA 5CG2A 3LT4A 1LDMA 4WGGA 4BNZA 1E3SA 3Q9NA 1HLDA 1NXQA 3EC7A 3DQPA 4CM3A 4DPMA 1BXKA 3U4IA 4BO1A 4BS9A 1S6YA 1PGPA 3H5AA 2D2IA 3JQAB 5TNXA 4X54A 4XWYA 1YQXA 3E48A 3I9LA 1GY8A 2OUIA 4RF4A 4ZICA 3GK3A 3INTA 1P44A 2ZYGA 4TROA 1R12A 5BR7A 1LRLA 3ONDA 2P9CA 5C3MA 5F1PA 1TT7A 3JQCA 1P0CA 4JJFA 3P2YA 2E6UX 3X2EA 3DBHB 4HNHA 4ZD6A 1U2GA 1W6UA 1DC3A 4Q3BA 5DF1A
chains in the Genus database with same CATH superfamily
4C7OA 4B31A 1YSCA 2Q4EA 1NT4A 2I2BA 2Z5LA 5T8KC 4RHUA 3L0BA 4QUIA 4R2WA 2YIMA 3U9SA 3C8DA 3ROTA 2YOFA 3KYCA 2FW1A 1N78A 1IVNA 1J8YF 1QH8A 4L2IB 1WLYA 1QHXA 3LPLA 3WI7A 1MTZA 3EG9B 4B6GA 2WNSA 1GLVA 3EGOA 4LJLA 4NEGA 3JWJA 3ZK9A 4BECA 1PNOA 4F2DA 3K5IA 4MLPA 4PHTA 1X2BA 1E5QA 4OU4A 2Q45A 2I4NA 3AZOA 3FKSD 3GA5A 4G0MA 4RA6A 5DNYB 4I8XA 2BUBA 1W59A 1Z06A 2YXNA 3LKZA 4NPHA 5JS1A 2IYFA 2FUEA 3BFKA 1T8WA 4PZPA 1OB2A 4X62B 4YMWA 2G9QA 4Z54A 1U8EA 2X0KA 4KYTA 5BVHA 2HREA 1M76A 3RYFB 5CD9A 3K9HA 3OZRA 2I67A 5E1MA 1ISSA 4COKA 2QENA 1GGVA 4ZHQF 2HEIA 1CY1A 1RDFA 4Y2RA 5H4GA 2QYHA 4FLEA 4Y6RA 4B8ZA 4BVKA 2P4EA 5JISA 1DNPA 5L3SB 4GL2A 2GCOA 2FGJA 1XQ6A 3DEIA 1OZHA 2Y76A 2FN8A 2NV6A 3PQ2A 4B4DA 1AM4D 1ADCA 4G85A 4QPZA 4Q3CA 4J0GA 2R44A 3AY7A 3GRYA 1MCZA 3ILYA 3PYLA 4UQOA 3VZCA 2PMBA 4ZO8A 4QLBA 4W82A 1YDMA 2YTZA 1VIYA 2OLJA 1NVKA 4LVOA 1QUFA 1W4AA 3FYCA 1KL7A 2BE9A 1JEQB 1N6KA 3D4BA 4E51A 5FBKA 4CM6A 2YDYA 4F9FA 2ZM5A 1DC7A 1ZXLA 4JQZA 1JG6A 3I2YX 1L6RA 2ORVA 2ZQ5A 1XVVA 1WCIB 5MDHA 2WF7A 1I6MA 4F1KA 3CF4A 5B1SA 5DASA 1RRMA 2O2GA 2PBFA 3K0BA 4HH4A 1E4EA 2DWUA 4JA0A 3DBLA 5DM60 4B40A 2GYWA 5HGJA 2PKRA 1T0IA 1EDOA 4FNMA 1XZNA 5KYGA 3F6YA 1TVCA 2HIAA 4I6JA 3GRPA 1EVKA 3QIAA 2PJDA 5EOVA 1IZ0A 4HBGA 2PUBA 3CRRA 7MHTA 4HS4A 3PCTA 4TKVB 5LVAA 2C9DA 2Y67A 6ABPA 4OGWA 1HUQA 3Q8KA 1ADFA 1Y5LA 3M70A 1FPMA 1YZ3A 4HD8A 4B3BA 5HP4A 2I7VA 4DV3B 3DSRA 1OY1A 2QJFA 3JATB 3QNUA 1G21A 3UJBA 421PA 4DSOA 1LTQA 4FKZA 2DFVA 2FYTA 3KQVA 1Y33E 5HS6A 4E7OA 5L40A 3R20A 1E3JA 2GETA 1S3IA 3QXSA 3FPCA 2FCRA 2YHSA 2YJ3A 4LEIA 1GCUA 1OXSC 2Q3EA 4HUJA 4JB8A 2Q62A 3M3DA 4A03A 5WRFA 1AKEA 3C7TA 1L8QA 3GDFA 2PZJA 4JLNA 1WW3A 4ANFA 4U1RA 4BAGA 4UPEA 5KVSA 4FEAA 2NGRA 3ZQJA 4FFVA 4XQCA 1C9NA 2PQ6A 1P5HA 1XPUA 1EUDB 5KYKA 2FFRA 3U44A 4J91A 1Y82A 3GFVA 4FNAA 4TQGA 3PFNA 5CDTA 5C0OE 3QMVA 5AVRA 1TQ2A 1P19A 3KX2A 3H5VA 3I3OA 4K05A 2P41A 2JG3A 5EERA 5JNWA 3O4FA 4V1CA 4GGMX 2CZCA 5LL6P 1MGPA 1ENYA 3GVPA 3NRJA 4IEEA 3CLUC 3OMWA 4M60A 3VNQA 1IBRA 4UTPA 4JLKA 1ZS9A 4H7HA 5FRDA 2QUAA 3Q41A 4IVQA 5HPYB 1DJLA 4KFSA 2UVDA 3OU7A 1ESMA 3EXIB 2GZSA 2OM2A 4CKWB 3RI3A 2AZDA 3V7UA 4P9NA 5ICCA 1A7AA 1AUVA 1O97D 2HSZA 4P4GA 4Q4HB 2Q2NA 3UGTA 1B2LA 5BNTA 2PSDA 4TX1A 2EW2A 5BSGA 3WZMA 1T1GA 4C4OA 1MG5A 5KREA 3DAOA 4IDHA 4I8DA 4MAFA 2OC9A 4ALLA 2J3IA 2OHFA 3JQFA 2J5XA 1W19A 1E2EA 4KQEA 3WG9A 4RGBA 2DQ4A 3RSZA 4MR7B 5CNJA 1RCFA 3SBEA 1J2YA 1E2QA 1WKCA 2YV3A 1ULAA 4XDYA 2ZDHA 3U4DA 1A4XA 1DFGA 3RSLA 4HAXA 3ZCSA 2H1OA 3R24A 1GEGA 1ICIA 1TL7C 1SG6A 3NM6B 3QE9Y 3SHWA 5A04A 4JBHA 1KA9H 2FPIA 3EYWA 3TQHA 3G8CA 5T41A 1IH8A 4UTXA 3LCJA 3W79A 1UBMS 1OUMA 2B61A 3FFWA 4DPKA 2K6GA 3K73O 2WD7B 4ZDIA 1DWPA 3KOYA 4FSDA 4GNRA 4DMMA 4QUDA 2QY6A 2RJ3A 3MBKA 2H2HA 3OAAA 5LB2A 1J9ZA 2FWJA 5AIAA 1ZO8A 3WRWA 4EUHA 3GLHE 3G89A 2H07A 1GFZA 3FHCB 2PNJA 4ZIRB 1R8SA 3AEQB 2FPWA 3BBLA 4RCVA 5CM2Z 2HSJA 3LWBA 3NBQA 2QZSA 3IEMA 1VBNA 3LVBA 1IXYA 1QS0B 4YJ3B 3QWFA 1LDNA 3ACBA 1KE2A 4NZNA 4PLGA 4PSVA 1Z73A 3R5KA 1FXWA 1Y80A 3RODA 4EF6A 2VXBA 5B7NA 3R9WA 1GVHA 4GI7A 3TYXA 2H1FA 2A2ZA 3O7MA 2V9PA 3OPQA 1QH1B 2WMOB 3QBEA 3NCHA 3HB9A 3Q85A 4MQBA 3HCOA 1RABA 2PXXA 3SWWA 5IKXA 4HO1X 3ZS9A 2XD9A 3V1TC 3JD0A 1KOFA 3SE0A 3MHTA 3IIEA 4UMEA 4AKGA 2Y27A 3H8SA 1GPAA 3VKHA 1VHTA 2IPMA 2QRVB 2DPYA 3LX5A 3AG6A 2HXGA 4GWGA 4XEUA 3ZWOA 3PNLA 4RTRA 4U2EA 4AJ1A 1IVSA 2HLNA 4QC2A 4O08A 2HA3A 4TUYF 2YZ7A 4GLLA 2Y3IA 1XALA 3FUCA 4ME6A 4TTSA 4AC9A 4AJHA 3ZHTA 3K4PA 4P8RA 1JH9A 2Z4SA 4X6XA 2QAGA 3K2BA 3RABA 1RYHA 2J5BA 3GFBA 3WJAA 2COKA 2B3DA 5G53C 4DNFA 3B8HA 3CZ4A 1Z7BA 4Y18A 4D45A 2KBEA 2CJWB 5DZSA 2B92A 1BS9A 1KDZA 2FA9A 5LUAA 3ORQA 1PZXA 1GKUB 5CYFA 1DPFA 1A8UA 1GEEA 1LLQA 2JAOA 1JEOA 2V7BA 3BK7A 3G2IA 3LQ4A 3OJLA 4PLVA 5KVQA 2DLCX 3AG5A 3OAAD 4F92B 2B6HA 4I8IA 1CP2A 4L4XA 4HV4A 1FFXA 3EWNA 1RJFA 4IRMA 1J9GA 2WRZA 1KZ9A 5FAKA 1E5LA 1R0RE 1WL8A 3CXUA 5IXJA 2HU5A 4MQ5A 1KAGA 1QOZA 1M6NA 3P4XA 2YYZA 3LT1A 4O02B 4ZOEA 1QAMA 1SBHA 4UNNA 2R1UA 1SK9A 3U26A 5CH8A 1SCKA 3KE8A 1RWNA 3T5BA 1U4SA 3O83A 4FK8A 2FZ4A 2RJOA 2WOOA 3FDZB 2HTEA 4KMSA 1B2RA 3HGMA 3TZLA 2AKEA 1YHNA 4TL9A 1O2DA 2Q6KA 5IXSA 4XSGA 2VNAA 1Y8QB 4CPDA 1POXA 2XMSA 1N6PA 4DC9A 3L07A 3WK7A 1YWGO 2QD3A 1R18A 2FN4A 2HTFA 2AVDA 2INGX 3GFSA 1I3OA 5LQKA 3W34A 1U7WA 3UM9A 5ILOA 1Z16A 5B55A 1J25A 3WIEA 1BKYA 4ARAA 4H6WA 1BHQ1 1OC4A 2VF5X 4I9HA 3TQSA 3ZIDA 4D3SA 3BWXA 3I9FA 1ADYA 2Q3HA 4NG5A 5CDFE 4KXMA 3FDJA 3I9KA 2J1LA 3ESDA 1IU9A 1N8KA 2PIDA 1OWOA 2O3RA 2QZZA 3W1EA 3I0NA 3VTZA 3T9AA 1G5RA 2CD7A 5I7AA 1X9HA 1OFVA 4Q21A 1RS0A 4DB4A 2BL4A 4OYRA 2E18A 1QPZA 1LRJA 2GEUA 3GPIA 5EMLA 5M7EA 3QPDA 1WEKA 4HB4A 1ZNQO 1EXNA 2YYAA 2J6IA 3D02A 5HKOA 3OSUA 5L7TA 3ORRA 2PBRA 1BSVA 4FGWA 2ORWA 2ZXEA 4KUGA 4FR2A 3M4XA 2FWMX 3M89A 3T06B 5C1BA 3VA7A 1U8YA 2NO5A 5DYYA 1MEJA 4MUJA 3DAFA 3AR6A 4CM1A 1Q16A 1BX1A 1Z28A 4LSZA 5DULA 3LHSA 4RE5A 3H17A 3RS3A 3WMWA 1E2FA 3GJ5A 3ZDDA 4GNKA 3N07A 2G71A 4D99A 2YN0A 4X6UA 3UUWA 4YT8A 4RJ2A 5JZMA 2CYBA 2OCPA 2GNAA 4MGIR 1WSWA 4BMCA 3WLFA 2CVPA 2W0MA 4DQKA 1GN9A 1VLZA 3JRNA 3ZWBA 3FMOB 4O5AA 1RWPA 1WXGA 4UVGA 4Y6OA 3D4NA 2J6CA 1XNJA 4DFDA 1CEYA 4F71A 4OMCA 3ACCA 2OENG 2VYFA 1EHYA 3QSGA 4MKXA 3RR2A 1L4MA 1P91A 3QV2A 4NBWA 2ZIXA 1N1EA 1EVJA 3DEJA 3D3KA 4P2GA 1FMCA 4GXNA 3JSAA 3QEMA 4R3WA 3SYRA 2HK7A 3HDJA 5E9WA 1K8YB 1PV1A 2NSLA 4DQDA 1TT5A 4CU2A 5LR6A 7GPBA 5IVPA 4R9SA 1YC2A 2Z9DA 4MVWA 1OF1A 3AMVA 3UCFA 4UATA 4MWDA 1P2SA 1WZUA 1NQVA 2HHCA 2QTVA 4I1UA 1V8ZA 5ARDA 5KTRA 1CVRA 2BN4A 2A3NA 3K94A 5JECA 2YICA 2FLWA 2YHBA 3CW9A 5CBKA 2C8JA 2XVZA 3LP6A 1E8MA 4PBSA 3T41A 3Q4GA 2HUPA 4D9BA 4HUTA 1VHQA 3P4YA 1M1NB 5CEJA 3AUAA 3OQHA 2BGLA 1Q0RA 4YT2A 2G67A 1QDLB 1I4WA 2CCGA 3BC1A 1SKBA 1UZNA 4AY4A 2O7SA 3LY5A 1HQDA 4ZAGA 2BV3A 3VNRA 3F5DA 1UPFA 3AM5A 1GGEA 2V7WA 1XQWA 3WGQA 1NW4A 3A9VA 2W83A 3DNMA 3IEXA 3KT0A 4M3NA 3RTBA 4N39A 4G37A 1RJWA 2QM8A 4OQ4A 1CV2A 1IXZA 3E3LA 1SQ5A 2PRYA 1FP4A 1D1QA 3P2JA 5FBVB 4MICA 3I2KA 1M6VA 1O6BA 4C0SA 1PNQA 3VJMA 4KFCA 3CXRA 4DQXA 4EL0A 2YS6A 4JZYA 5NLLA 4MR8B 4PE5B 4YUAA 3MLAA 3MJTA 4JWKA 5HMLA 5IH3A 3KELA 3TMKA 1CERA 2PWPA 5EKUA 5HBGA 2IIPA 3F78A 3CJTA 1E69A 5DYWA 1SCBA 2P69A 2P4SA 3MYRA 4DSTA 2EJBA 1DLJA 3A2LA 3CLSC 1GPBA 2N1BA 3EIUA 4WXEA 3RC1A 1QB8A 1XZQA 1ULZA 2NU8A 1T2DA 3TECE 1RM3A 1W8DA 2DKOA 3KQLA 3KQPA 5F2NA 1JB9A 3F7NA 1BXRB 3FLEA 2WILA 4ZKEA 4OHBA 1XRMA 1UAAA 3MELA 4DB2A 1SRQA 3EZ7A 3WLTA 1VA5A 4D3ZA 4RK1A 2QK4A 2WLSA 1N5LA 5AOCA 2VIIA 3LUFA 5TF4A 3WAKA 4QU5A 1A69A 1CJTC 3EISA 1GTG1 2R4TA 3NRBA 3QLVC 4Z9AA 3OJXA 2QT9A 3UICA 1BJKA 1VRWA 3PI7A 3W9SA 1JFSA 4D6PA 4KQGA 2O2DA 3A1WA 3AUKA 1G291 1GXSA 1CFJA 2O20A 1QF6A 1CRQA 3LYHA 3G0OA 4QGSA 3IQGX 4R1MA 1P5ZB 4RTSA 2CSUA 1QX3A 1ID1A 2YN4A 1ZJ5A 2XTMA 3F3YA 3LM8A 1UWKA 5BSRA 2FG5A 4X3OA 3M5CA 2A7XA 4FFBB 1MW8X 4B75A 3EX7C 3BVPA 3KB1A 3RIYA 4Q16A 3RG8A 3TNYA 2CNWA 4L07A 1GTZA 4LNUA 2LVBA 3GGCA 2AK2A 4BN4A 1W88B 2IGTA 3ED5A 3ZHVA 2VWPA 5AP9A 2BH2A 2PZFA 3EC1A 3DFKA 2O2CA 2QTNA 3GDHA 3RANA 3RSFA 3BXZA 3KJFA 4Q9KA 3CLRD 4J0EA 2EF1A 2BFDA 2VTVA 4D25A 3Q3IA 5GJWC 2ODAA 4PHGA 1FNNA 1DKPA 4D6YA 4TMVA 2ZJYA 5LB4A 2XB2A 5KO2A 4RLQA 1C29B 2UVPB 4QULA 4WZBA 4YWJA 3SQMA 1V9SA 2EJWA 5KVAA 1AF4A 2AMVA 1UL1X 3UJCA 2APJA 2XMBA 1LGYA 1YZVA 3VRHA 2R96A 1HDZA 1WG8A 3H6KA 3ZD9A 4AKHA 3ZZUA 1ZEJA 2ZBEA 3KZOA 1PJ3A 5AVVA 2VUIB 4R3UC 2PX8A 1CX9B 4FFSA 2HPZA 2ANBA 5T4HA 1P1KA 2F1HA 3CUEF 4XQ9A 1IOLA 1YBVA 3I1FA 4FMBB 4WINA 1EDDA 3W9YA 4YMSA 3EVZA 3OUUA 2X0IA 2W4MA 3HADA 4N5LA 3TIIA 3A6GA 1JNXX 2HLPA 2OG2A 4Z4EA 4J9VA 2QM0A 3ENVA 3G2OA 1T9ZA 4RDHA 3S5UA 2PD4A 2QVZX 1E3WB 1P45A 2DBZA 3MD9A 5HA5A 4LOJA 3V4ZA 4ZOLF 3GJTA 5FOXA 4DRXB 5KBYA 4Z9BA 1UJMA 3C6YA 1YDFA 1SHTX 3H5IA 5BSKA 5A62A 2OHIA 1V9CA 2X8LA 3MTQA 2B99A 3DBOB 4P92A 2XB6A 3HY6A 3VU3A 1IK6A 1WB4A 2ZI6A 2CNWD 3DAPA 4Q3KA 2QLLA 1ZLXA 4OJMX 4B3FX 4PHHA 5HKAA 2AJLI 5EIAA 1R6AA 2FZEA 3PEWA 1NW3A 4DCMA 3ONWA 3ESYA 2JIZA 3AR9A 1K3TA 3OZIA 1R64A 4NZPA 1UT5A 2BY4A 3PUZA 3DE1X 3TZ6A 3QKUA 4PZLA 3IHKA 3GFRA 3HA3A 4ZALA 3U17A 1AKNA 2FSIA 2D0DA 5E4JA 1ILEA 4WECA 4HJRA 2GF9A 1JT2A 3GFFA 4RADA 4I2VA 2CVFA 3K15A 1F4VA 4HZGA 4XA8A 4J0QA 3U0BA 4JLOA 1KO7A 1V39A 1LBTA 4CIXA 2W2XA 1PJRA 1XSEA 4M21A 4FDUA 2H7YA 5DCWA 5C2JB 2UYGA 1YVUA 2YW2A 3EAGA 4EKGA 4KXYA 2QJOA 2YNMA 3JR7A 1GG8A 3IAFA 4KI7A 4BCCA 4DLLA 4LA4A 3T9DA 3W3AH 4GZ3A 2C00A 5DP2A 3WL3A 3RG2A 1YBMA 4FHDA 3GLVA 5ITWA 3U31A 1K27A 5B3KA 2DSTA 3A6DA 2HX1A 2UYYA 3CKLA 2GHRA 3IAS1 4JP8A 4N7JA 2PUCA 2BP7B 3UK1A 4FT4A 3LQKA 3ZV7A 3FYUC 3VOTA 1IFXA 1SELA 1YONA 2ARKA 4LV6A 1OYWA 1ZHFA 3GU3A 3QTBA 4NOJA 4ARIA 1ZVKA 1ZNZA 2P30A 1K7XB 3L0CA 1G17A 1XKQA 2NXJA 4L0CA 1Z82A 2YVLA 1M6WA 3IAHA 1ML4A 3RBVA 2FSPA 4MI1A 5AK0A 1K8ZB 3QXJA 4IJKA 3UAYA 4JQCA 1NTRA 2GCEA 3GOQA 3I8SA 1SY7A 1W4BA 3MCWA 3WMEA 2JIZD 5FUMA 2TMDA 2I2CA 3QPBA 2BM9A 3E0XA 3V48A 1NJSA 2WAYA 3RUAA 1SBIA 2FE1A 4KC0A 4CF6A 3T3IA 1J09A 2EFYA 4Z7OB 4DSUA 4QYWA 1TZCA 1XC7A 2CHEA 1V2GA 3GZNB 4JD5A 4N7MA 4FQ7A 3LP8A 4HFNA 1NI4A 2PTGA 3CNBA 3LC7O 2R8PA 4YJ2B 4RKFA 3B5JA 4Y9UA 2NSHA 4MHOA 4MKIA 1XGKA 4AT1A 4OATA 2NUAB 4OHRA 4G2NA 2P6OA 1O0CA 2RHBA 2RG7A 1KXZA 3FBTA 1P1FA 2NTNA 3FWPA 4H59A 3MSXA 1Z3CA 3TBKA 1W36B 2WVJA 2OBYA 2WDZA 1KI8A 1Q83A 2YNMD 5DI3B 1QRUA 1AU9A 1FTQA 1QVWA 4RIEA 4B2IA 2JI7A 4K6OA 3KOWA 4U0KA 1V9LA 1DBPA 2BKAA 1HSZA 4Q1FA 3AF2A 1WNTA 2JLXA 3TIFA 5ALGA 3ROPA 1LV7A 3V00A 1G8JA 2ZSUA 4WFJA 3ILSA 1G4HA 2FEOA 3IUEA 1W75A 4LN1A 3O8OA 1Y4AE 2CNBA 1JU4A 1YNSA 2UZ3A 1T9GR 2WHPA 3H3JA 4YDHB 4YAKA 3FXAA 3MNFA 5FR1A 2H31A 1RZUA 4RS3A 4LF8B 3ABZA 2QL9A 4OHYA 4LYHA 1G2QA 2OZLB 3P2KA 4YVFA 2I0FA 4WN9A 4LZLA 1UMDA 1P5RA 1VG8A 1GGNA 7AT1A 1DQZA 5K4HA 4I5GA 1U9JA 2C4KA 1BEUB 3CKMA 5J4YA 1LU9A 3VC3A 2AJDA 2P77A 4FC6A 3OI7A 5KYVA 3TM5A 2EAUA 2HU8A 3PWSA 8ATCA 3LYUA 5FLXA 3QLUA 3T3GA 2VDLB 3LXMA 4NICA 3U9LA 2G82A 1BCRB 2PL5A 1V4VA 5FR2A 5ICFA 3RQSA 1IEVA 4GP7A 3UMBA 2NG1A 1G8HA 2Z3ZA 3DW1X 3KU1A 3NYWA 4PIVA 1LVHA 5JQGB 2GDJA 1BWSA 3GVXA 3RHSA 5MFPA 1WPGA 1W85A 3HE3A 2Q21A 2ZWIA 3IA7A 1UPBA 1VP3A 4JR2A 3G0DA 3M34A 2NZVG 5C51B 1GM5A 4IDPA 3WGOA 2L82A 2O3TA 3EARA 4HLUA 4OHUA 3KSZO 3BYZA 2J46A 2JAPA 3R0XA 3S44A 1GUBA 1V71A 2G7MC 1VPDA 4R0NA 4HWRA 3JQ9A 4J4BA 1BA3A 2G04A 1U31A 4JSYA 1W5BA 4Z3DA 2VYQA 1E1CA 1U8TA 5KDLA 4AYWA 2Y6UA 4HKTA 4EEKA 3ITNA 4R9VA 2Q9BA 1IMJA 3ZHQA 2LDBA 3LTEA 1Q7EA 5THKA 5DGDA 3NJ8A 1PO7A 1GSIA 2PAFA 3SHTA 1DTEA 1SBNE 1VQ1A 3E9EA 4DT1A 3A04A 3PNQA 2H2WA 3WGZA 1M2WA 4YI5A 1A4IA 1C1DB 4CE6A 2QQGA 1NG1A 4BNYA 5K0EA 1O95A 1TVMA 5JYBA 2L19A 3ICWA 3U6BA 2WDPA 3HO6A 3GUHA 3KHTA 2JLUA 5EXEA 1YZUA 3HR8A 4IXMA 4LDZA 1J24A 1I8TA 2QSZA 1YO6A 3NHUA 3SR0A 3TM4A 1O8BA 3NTVA 1UMBA 3UJHA 1RAFA 1SBYA 4H6XA 5KYXB 3FVQA 5DOZA 1D04A 1XG5A 1NQAO 1S4MA 4LWQA 4RGQA 2OEPA 4BTEA 1Q7RA 4FYKA 3RFUA 2E21A 3ASUA 3VDQA 2I71A 5IFLA 3W5BA 4W5TA 2VJMA 4IOKA 1QB7A 2WEKA 4MJ3A 5LQJA 2Q2QA 2IWHA 3LLMA 3IV7A 4KIGA 4LCJA 4D0LB 5B64A 1LTKA 1VCMA 2FNAA 4EGAA 2GM4A 4WNYA 1LX6A 2Q6TA 2GERA 1ADGA 2QV7A 4I1PA 4LY0A 3RHZA 2IYVA 3OJOA 5KOYA 1I7QB 4PLHA 3EXEB 2NVUA 3UV3A 4XX0B 3ETLA 3K09C 1GZHB 4QHYA 3PUJA 2DHEA 4V3CA 2EBFX 4X7RA 3SR3A 1QBKC 3RUIA 4CMKA 3ZE6A 2W6NA 5ALIA 3HDYA 2WICA 1KXJA 3KJGA 4B8WA 1N6HA 5FBRB 4H7PA 2HMWA 1FDWA 1UBFA 3H1TA 4ER5A 2XCSB 1H8HA 5TQ2A 2BEWB 4GI1A 4KX5A 4WCFC 4ARZB 3DD1A 1L2TA 2JEZA 3CTPA 3IPLA 4U7JA 3WL8A 3S2ZA 1O95D 1XDDA 2P8JA 5KCZA 2QU8A 3AOEA 3ZLTA 3EQ9A 4GLJA 3LLSA 4EJSB 3MCZA 5T7BA 1BX3A 2WBLC 3H2GA 4BNIA 5ARBA 3CHYA 3LC1O 1FA9A 2YFHA 2IXEA 1YBHA 2OY0A 2W43A 5IULC 3FSEA 1DG9A 4ESVA 1TKBA 1WDKA 4LE2A 5AI5A 1KOLA 3BFVA 2FMIA 3ENKA 1EYZA 1E4OA 2FX2A 2G06A 2PX6A 4P4UA 5I48A 5IDVA 2I76A 3IP6A 2E4WA 3KQMA 1RLIA 3Q12A 4R4JA 4CIWA 1OI3A 2DLNA 5BOSA 3A25A 4UTVA 3QYFA 3IMKA 4PAQA 3A6KA 4JJEA 5GV8A 1L4BA 3LE8A 4PCAA 3N2KA 4WBXC 4GD3Q 4YCNA 1I7PA 4BP8A 3PC2A 3ZWKA 4KVZA 2P27A 5EPUA 3GUUA 4ZU3A 4WLNA 1KMMA 3UOAB 3O4IA 1RZ3A 3V1KA 1XU4A 5T4FA 2PX2A 4DQLA 1V6AA 3AVWA 3DMFA 2C5FA 1YKSA 2GYVA 5K3AA 2XF2A 4EPRA 1GU7A 4NH0A 2WT9A 4KYVA 1LUAA 4MQ4A 2R0QC 2ZSFA 4UUAA 4XRRA 1YZKA 3S1AA 1K86A 4B3IA 2HPAA 4L02A 3WRYC 5ADVA 1IHDA 2R66A 2PEYA 3O84A 3I5XA 2V6FA 4H1UA 4J0HA 1M54A 1DZIA 2QUZA 2QMEA 4O59O 4N6GA 1Z0DA 3AB7A 3G2HA 5KWSA 4DJDC 4LJ8A 3K72B 3ZJVA 1T3LA 5C1OA 4Z53A 1U7UA 5LZ2A 1T2AA 4WEQA 2OHJA 1V8OA 1NE2A 4KOEC 1B14A 1BWRA 1XL1A 1SCIA 1KEPA 1GT91 3C6KA 4OJNA 1NZJA 5CRIA 2YFQA 1TCUA 4J76A 2I7TA 5I8PA 4NJEA 3PLAE 3BULA 2OAEA 3MA0A 5KAPA 1XTJA 3ZK7A 1XF9A 2O5VA 2JCBA 1GHTA 2UAGA 3P27A 2OORA 3OOSA 1C4XA 4P5DA 4ZVQA 3VPAA 3WC4A 2V7GA 4DWJA 1YS6A 1RJDA 1W76A 2GSDA 2JBHA 2WHEA 4YQEA 3RVRA 1W49A 2J87A 3WMXA 2JIPA 1SNYA 4MP8A 1EFTA 4TWZA 3BTSA 2OD9A 2FWIA 1WP4A 4WK2B 2EFGA 5BVGA 1J99A 4C4TA 2JHFA 3DVQX 4OQFA 4AJ9A 5IT0A 1KQPA 1YA8A 4MGHA 3RF6A 4DZZA 2ZRIA 3L1IA 1TQDA 3T6KA 3HO8A 3RRFA 2ZJ3A 1X6VA 2CDRA 2ZI3A 1XCJA 1JI0A 1P7PA 1V6SA 2XUAA 3V1UA 3UG6A 4JKOA 2FWPA 5FFNA 1R8XA 1MJNA 3JARA 2WJAA 1Q84A 4OBEA 1ZQ1A 1G19A 3KVNA 1FX1A 1SVSA 4WA8A 5DM2A 1P1IA 1KFKB 1ZK3A 3C8HA 4KSYA 4IXDA 4P54A 4UUOA 4JI7B 1UXJA 4Y98A 1DKNA 4MGZR 5BY2A 4ZFNA 1H85A 1XMVA 2EWWA 2MT9A 3F8TA 3ASVA 3KHUA 2Q5FA 3L2OB 1MOSA 3LDHA 1M2FA 3ETDA 4NHEA 1P2UA 3TQQA 1LPOA 1TK2A 4M99A 3TLZA 4PZCA 4EHJA 13PKA 5CCDA 2FDXA 5DGXA 3WO1A 4LQLA 2IZ5A 2C3MA 1JIXA 1JE0A 3TFWA 5EMHA 4UXJA 1YQWA 3IP1A 2OAGA 5E8RA 1G2OA 1RAIA 4J0CA 4ZT6A 3VVMA 5J43A 3CM0A 4JN6B 4JIMA 4LS3A 4U00A 2B4KA 4DLZA 1EUYA 4QREA 1JDTA 3TLMA 4M53A 3WWDA 1WZIA 4Y9RA 4IICA 5IDQA 1IWBB 5EYPA 2BFCB 3LFUA 1SU6A 3L8EA 3NU1A 3LQYA 1JDSA 3N3AC 2CBXA 2HSWA 2OE2A 4A6EA 1C7EA 1TB4A 2XA9A 1X14A 2AW5A 2H4XA 4O1IA 4K9LA 4IHJF 1GNLA 1OX5A 3FCXA 3OA2A 4RE6A 1J42A 2HBYA 3RYFA 3T12A 5JYDA 4W9MC 5LYYA 1NG9A 1UBLS 2I4MA 1M83A 4MUHA 4PU0A 3O4GA 3NHWA 3CX8A 4EYQA 4F2PA 4Q48A 5CYPA 4BNFA 4UCWA 4B6QA 1NDHA 3L84A 3FTCA 3GDWA 1OLXA 2Y8EA 4TTQA 3RSCA 2IP4A 2R6FA 1BEEA 4TMXA 3WYNA 2Q5HA 3NT5A 4R6XA 4BVGA 1GPDG 3O8QB 2OFFA 3D2CA 2H00A 1IWOA 4A6XA 4BCDA 3VVBA 1UUFA 2ETVA 3H83A 2IHJA 3H9JA 4C3OB 6PFKA 5AVJA 3PLNA 1NFQA 3NPAA 1DXOA 2I3BA 1KVUA 4OSOA 3I5MA 5ALEA 1ZM7A 4HX9A 4V1CI 5LXTA 3ZCUA 1ZVVA 1A50B 4Y1RB 3KWLA 1MABA 4Z4CA 2CFSA 1PT7A 3OE7D 1SUIA 3Q88A 4Z4HA 2C3OA 3R9KA 5JSKA 3DZKA 1WVGA 3TE7A 1Q0UA 1S89A 2JIDA 3TW8B 2A67A 4KYUA 2PVPA 1JSCA 1GL7A 3ZLVA 5TQ0A 1Q7GA 2FFQA 1E2BA 2Q5OA 3K0CA 4E33A 4LW8A 4MCHA 3G0GA 2BMJA 1SCQA 1ZSNA 621PA 3OFND 5AIBA 3O8RA 4D80A 4HNQA 3JU3A 3RNLA 4Q18A 2IY7A 4KN9S 1DQYA 1BVRA 4G01B 1YS7A 3MUFA 3AOGA 4H6PA 4BC1A 1KEZA 1T2UA 1QQBA 4MA5A 4YMHA 4M6WB 2XNJA 4YECA 2UZ4A 2V0CA 5JO9A 4OU5A 2RIPA 4R3NA 3EBLA 1QNLA 2OB2A 1D6MA 4UXHA 1S1MA 2HGZA 3QE3A 1CR1A 2B3TA 2CV1A 1I0IA 4TV8F 3O9VA 4CT0A 4E03A 5DGIA 1VOTA 2A4KA 3OZGA 1Z12A 4DKXA 4MYUA 1G5FA 4ZTZB 1N2CA 1QYIA 3L1VA 4MULA 4MZDA 5A9TA 3RO7A 3USCS 5TPWB 4HVLA 3AL0C 1ZCBA 2BHRA 4WJKB 3B48A 3DEKA 2AJ8A 2B1QA 3AJEA 1CZUA 2HF7A 4JP1A 3SDZA 2X22A 2G1AA 3OQNA 3TB6A 3VYUB 1P18A 3PK0A 4GXRA 5AICA 4H1TA 1Y89A 3M2PA 4FGZA 3L0PA 1XZEA 1UC8A 1YBAA 3GIWA 1BMQA 1K4MA 1RHKA 4JLWA 3JZAA 1VLMA 3KJHA 4WKPA 1AO0A 3MCTA 1WHTA 5TVGA 2GN4A 4LYDA 2B9EA 4LDQA 1M6YA 4D4HA 5IUNC 1DFHA 1U6JA 3VNUA 1ZA1A 3PC6A 3O47A 5H83A 4C30A 4A82A 1TW2A 3NHMA 4J0KA 4R05A 1J20A 2X6TA 1WQ4A 3EXIA 3DDHA 3QUSA 4IRUB 3V1YA 1GL9B 3CZ9A 4I9GA 3X43A 5A05A 5K0FA 2HFKA 3PFCA 3RVSA 2VP3A 4R51A 5CMLA 2V6JA 5LZ5A 3EZYA 3AHDA 3AP3A 3GCXA 3K05A 4UHBA 3CLVA 1SXJB 3ZZNA 1AS0A 3DCNA 3UTCA 5GZ3A 3NIFB 4F9EA 2IS6A 2FWAA 4HX2A 4HWTA 3G0BA 2D0PB 2WJZB 5IAGA 2XKAA 3N75A 4A8JC 2J09A 5ADHA 5J40A 1Q1QA 3QH4A 3MAJA 4QTXA 4CTOA 1U8FO 3FHTA 4LHZA 1RQRA 3BTUA 1C8BA 8OHMA 4UBKA 3TL2A 2GWRA 2VUTA 3TBFA 1Z4JA 1XWWA 5K0LA 4AX8A 2WNHA 1XL0A 1E9VA 3KHKA 5HF8A 3SJ7A 2WPDA 2VBGA 4CVNA 5JRDS 4CMCA 1EEXB 4MYDA 3T4PA 3JQGB 2C20A 4D9MA 3V7FA 5HRAA 3OZWA 4BBAA 5DM4A 3IP3A 5KJ1A 1KKMA 1JMVA 4EG7A 1U1FA 4EVQA 1F3OA 3RRXA 2VPPA 2W2VA 3IE1A 1I1HA 3A6PC 4HZIA 4MUGA 2V7VA 2J6BA 1PS9A 4ZO9A 3V3TA 3S8EA 4EJ0A 5C4GB 4LJAA 3BIJA 3GO4A 4HNVA 2GPAA 1QS0A 4EGSA 1N77A 5TJ9A 3DW3X 4TVSA 3P32A 3AKDA 2JLAA 2YZKA 2ILTA 5KTNA 1EWKA 1LTHR 1AS3A 3K0FB 1XJCA 2OCDA 1HQCA 1M2JA 1M2VB 3JQ7A 4RM3A 4P38A 4B48A 2YWGA 3FCCA 1QH1A 2Y0EA 5AM1A 1RYYA 2B35A 3RLFA 3CE6A 4QICA 1B1AA 3D1JA 5KMGB 4DR1B 1IIBA 4MS1B 2CZQA 3HLKA 3Q3VA 5AJXA 1EP3B 2WTUA 3O90A 4AVYA 3DZJA 1V4BA 2Q4DA 2QRVA 3DB1A 4I4LA 5F73A 1M75A 4JEUA 2HU2A 2I7CA 3AUUA 3H16A 2GO7A 3GT7A 3HUFA 4DV7B 3NMUF 3Q11A 1EMDA 4HXYA 1CQPA 4AUEA 2EBHX 4DNQA 2VCEA 3RYCB 5CM8B 1NSFA 1JXQA 1XTQA 1P39A 3CRW1 1OA0A 2KLBA 1NNLA 4CLHA 4L3WA 3QMPA 1U9IA 1U02A 3RHFA 1SN7A 4KJXA 5H02A 4JL8A 4RJLA 2WPDD 1PFQA 4TTPA 1XDGA 1L8OA 2DTEA 3TLYA 4BLWA 3MM4A 2H1HA 1U3VA 1WHSB 2JIQA 2NQ8A 3DZCA 2WJGA 3FJYA 3LUGA 5C46F 4P53A 3OHPA 4L5IA 4DA4A 5EIWA 1A8QA 3GLUA 3V7NA 1UWLA 2WSSA 4TS4A 3FFAA 2DR2A 1YB1A 3TDKA 1NX6A 4ZT4A 3S2FA 3I2FA 3H97A 1UANA 4CUZA 3H2SA 3JR3A 4H60A 3RARA 4MVJE 3RAFC 3C5WP 3NJ4A 2KYRA 3GL9A 1QVAA 4WD3A 3E7PA 3ZJ5A 1CDEA 4J0IA 4QUKA 3W8RA 2QD5A 2IHUA 3C3DA 1YJAA 1RAGA 2B2NA 3QEKA 2DPGA 1FJ2A 2QTHA 1N5OX 1PQPA 1YZLA 4YONB 3UUEA 5KNCH 4ADSG 3LHDA 3ZCTA 3F6SA 2W00A 3KDSE 4GT1A 1TZMA 1PJLA 1XTVA 2MSEB 3ICPA 2IYAA 2PU7A 2J3QA 2JFQA 4LDAA 4CLEA 4DJEC 4ZDKA 5BMOA 1RZRD 4XGQA 1XLTA 1HFJA 3C3JA 1NN0A 3AX6A 1XJ0A 3ZW9A 3I61A 4PSUA 4PX9A 3VGJA 1U7OA 3GRKA 3NOXA 2IEDA 3ZKAA 4ACAA 4EGQA 1KETA 5BXYA 1CZLA 3E8SA 5G2OA 1ZBQA 4QM7A 3EAFA 2BJWA 3H0CA 4KLAA 4OX9Y 2ZWOA 3BZWA 2JAWA 4WIAA 1PZHA 4L95C 1YZYA 1M9NA 1PBNA 16PKA 3SS9X 2PKQO 4W1SA 2AOVA 4CEIB 4UFNA 5T3UA 1ZOPA 2HV8A 1C8LA 5LC1A 1GITA 1OR8A 1FX0B 5C53B 5ILQA 1KERA 1TK9A 3QVVA 2VDNB 4YPFA 1KBZA 5DHSA 5AW3A 2A33A 3QU5A 5DHRA 3V8EA 1G7TA 4C87A 2VUSA 5CDYA 2VF7A 1OIXA 3CB4A 5CLJA 4I50F 4X1YA 4XUDA 2P1DA 5CEFA 3U3JA 3HJFA 1ND5A 4HWGA 2Y9PB 2FDCA 4D4LA 4LCBA 3TPFA 3BIXA 3VKUA 4LQ4A 4D8WA 4B3SB 4G23A 1F3LA 1S2IA 1NDUA 2B5VA 2C83A 3V42A 3HJTA 4KQCA 4H1WA 4PLPA 3QX8A 5FTKA 3UBMA 5HNKA 2UZ1B 1S96A 4QZVA 3BX1A 3WRVA 4WN3A 4B7ZA 1N25A 2ZSEA 3JZFA 1R5OA 4RTMA 3RASA 1ST3A 2HF2A 4IDEA 4TYMA 3B6MA 1Y1RA 3PXDA 2HWYA 4OKIA 5JI3E 1XJ5A 1AZSC 2FPSA 4W5HA 5A1JA 3BWYA 2DBQA 2IXDA 4RSHA 2FPXA 3GMIA 5CHEA 1U28A 2ZQZA 2IIVA 4OGKA 3F9IA 3MOSA 4HFMA 4IXTA 1RKXA 4GG1A 4QLOA 4X1KB 3FNQA 1OVMA 2K2WA 4NENB 3FZYA 3L4KA 4U9UA 3QVXA 2H18A 2HADA 3ZCVA 4OMFG 1XT6A 3ZJTA 1RYNA 2GZ3A 4NU5A 1N2HA 3AESA 4CMBA 5JMOA 1WD7A 2UUOA 2WB4A 3A6HA 4KBYA 1T0HB 2Y0DA 1WZNA 3QWHA 5CA0B 3QXGA 1IZZA 2OO5C 1O7JA 3ADPA 4MO2A 2ZTMA 1XCOA 3HJRA 3T7IA 4F8YA 2O3JA 1UMCB 5JNUA 3A3KA 3EXG1 2AN1A 4RSRA 4YRDA 3DKPA 4ONEA 3SFVA 3UAWA 4WKNA 2FWNA 1E18A 1MIOA 1A5SB 2XDYA 3WLJA 1ECLA 2W4IA 4EZIA 3V3KA 4J2HA 1KK0A 2M1ZA 3OCYA 3L7OA 1J1IA 3HP7A 3LHFA 2QY9A 4INPA 5IMBA 4EW1A 2V5AA 5F9HA 7MDHA 3VNAA 4WK6A 4HUQA 4AZSA 4AROA 1ZJWA 5H9VA 2BF7A 1YS9A 1E7YA 1L4FA 2ZYDA 1Z2DA 3BJZA 1N9GB 4DIOA 1ZMTA 3NWPA 4BO7A 5JSZB 4TXHA 5DBHX 4PYLA 4LJ7A 2DEUA 4JJGA 1KVRA 3GT4A 2DCMA 3OCWA 5JO0A 3IQIX 5KJ6A 1MHPA 1IN8A 4WZ6A 2Q2WA 1O6ZA 3CV3A 2WMDA 3GGSA 1C9YA 1A8PA 2X9LA 4MPPA 3DM5A 2X8JB 1T29A 1UFKA 4IHKA 4WFQA 3T7DA 3DBVO 3FLAA 4CV2A 1Y48E 3THYB 2ZYTX 5E3HA 2KPOA 1H69A 4GUDA 3RS8A 3ZDFA 1G4UR 1LK5A 1XA3A 1GA6A 4FZJA 4DCCA 1LI5A 1L4GA 5IARA 1JLMA 1VYVA 2G8NA 1CR4A 3HJHA 1DADA 1Z6ZA 1LZLA 1PR2A 1AZLA 3H5OA 3PJGA 3TAUA 4R0VA 3EB9A 3EQ7A 3KQYA 1HNNA