2BGMA

X-ray structure of ternary-secoisolariciresinol dehydrogenase
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
267
structure length
267
Chain Sequence
TNRLQDKVAIITGGAGGIGETTAKLFVRYGAKVVIADIADDHGQKVCNNIGSPDVISFVHCDVTKDEDVRNLVDTTIAKHGKLDIMFGNVGVLSTTPYSILEAGNEDFKRVMDINVYGAFLVAKHAARVMIPAKKGSIVFTASISSFTAGEGVSHVYTATKHAVLGLTTSLCTELGEYGIRVNCVSPYIVASPLLTDVFGVDSSRVEELAHQAANLKGTLLRAEDVADAVAYLAGDESKYVSGLNLVIDGGYTRTNPAFPTALKHGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Apo-Form and Binary/Ternary Complexes of Podophyllum Secoisolariciresinol Dehydrogenase, an Enzyme Involved in Formation of Health-Protecting and Plant Defense Lignans
pubmed doi rcsb
source organism Podophyllum peltatum
molecule tags Xidoreductase
molecule keywords RHIZOME SECOISOLARICIRESINOL DEHYDROGENASE
total genus 84
structure length 267
sequence length 267
ec nomenclature ec 1.1.1.331: Secoisolariciresinol dehydrogenase.
pdb deposition date 2004-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2bgmA00
5FFFA 4EEXA 3WOHA 1SB8A 1WZEA 4CQMB 1LXCA 1EBFA 1MG0A 2ZYDA 2G0TA 1PTJA 5A3VA 2J3HA 1YOVB 1IYZA 1YONA 2ZTUA 4WASA 4TWRA 2IDZA 2IRWA 4PGFA 3I23A 4E30A 5JFOA 4ND2A 1DIGA 3JYQA 3PK0A 3PPIA 3WICA 3KYDB 4DLLA 4BV9A 4Z0PA 3U3XA 1LTHR 2HAEA 2RIRA 4FIZA 3KZVA 3RROA 4EW6A 1GYRA 4Z3KA 1EFLA 3OIGA 4Y9DA 3CPSA 3GGGA 3QIVA 3E9NA 4PZCA 3X2FA 4AL4A 5A9SA 3AU8A 1U3TA 3ETGA 4YBZA 1LDEA 3H3JA 1K6IA 5J23A 2UYYA 5JAIA 3E03A 3R3JA 4F6CA 1GUZA 4RVFA 4ZQHA 2X86A 3FNFA 4BO6A 1DJNA 3D3EA 2DPHA 3AWDA 3OA0A 1BG6A 1VL8A 3BMOA 3IMFA 3ZV5A 3DFZA 3OIDA 4BO9A 1E1MA 1IY8A 2D2IA 2Q2VA 2BLLA 2Z1MA 2AW5A 3QVOA 2PV7A 2A92A 2AQKA 2BD0A 5CEEA 2ZTVA 3PHJA 2C5EA 2YFQA 4TMFA 1PJ3A 4LSWA 2ZQZA 3IUPA 4NMHA 2JKVA 4GSKA 4PLWA 3IOYA 3S2FA 1ISMA 1PJSA 2CY0A 3AUUA 3V1UA 1WNTA 4ESOA 4BO4A 1RM3A 4INAA 1SAYA 1EMDA 3CEAA 3I6QA 1ZNQO 2OGUA 3P7MA 5L7TA 1YDWA 2JAHA 3KOUA 3NTRA 1QORA 1U7HA 2B69A 4CMGA 2Y0CA 3C85A 4NBTA 2Q4EA 2TMDA 3H8VA 4WOJA 5MGBA 5C3MA 2VOEA 4FB5A 2AQIA 2B4RO 3GPDG 1ENZA 4N7RA 3TZCA 3KYCB 3VZQA 4KDEA 4N5MA 1LSSA 2V65A 4YA6A 3WNQA 4TQGA 4L73A 3QHAA 5KJCA 1HDCA 3GT0A 1GY8A 1PS0A 3F1KA 5I7EA 4E5YA 4YB8A 4WPGA 2DT5A 3QLJA 3TQHA 4XDZA 1ZKMA 3AI1A 1KBZA 4CMIA 1XWFA 1BRMA 1FDVA 3LC7O 1BHSA 2CF6A 2EEZA 3LC2O 4RPHA 4EUEA 3TL2A 4M49A 3VPXA 5KNLA 4G2NA 4BNNA 2WE7A 3H9JA 3OH8A 4KUHA 3WLEA 4RF2A 3M1AA 2YHIA 3DTYA 2QRJA 4NK4A 4AJOA 4NBUA 1ADGA 1HZZA 5FI3A 4MVJI 5KJEA 1I0ZA 2PR2A 3GVIA 1PGJA 5DCUA 2IXBA 1CJCA 7MDHA 2PD6A 1GQQA 3WMXA 2DC1A 5B12A 1BVUA 1MFPA 4CM1A 2HJSA 2ZATA 1Q0QA 3F3SA 1TT5A 1PS9A 2UAGA 3RKRA 3ICCA 3BTUA 4LMRA 3WFJA 2Q50A 4R51A 2X9NA 1JA9A 2CD9A 4OSOA 4EGFA 4HV4A 3B70A 1QKIA 3ZW9A 4EITA 1HETA 1C1XA 4DPLA 4PLFA 3PXXA 4YYZA 4WGGA 8ADHA 1XU9A 4OQYA 1EUCA 3BTSA 2JHFA 2JD2A 3M2TA 1KOLA 2F00A 4IDAA 1GDHA 2PD4A 4ND4A 4RF3A 4GQAA 2BFMA 2C2YA 5U4QA 2QYSA 5ICMA 4J90A 1Y8RA 1FK8A 1SZJG 3UKOA 1ENYA 1EVYA 3DR3A 2O48X 1NASA 3KXDA 4R5HA 1WWKA 4M55A 3UW3A 3DWFA 4OYRA 4B8WA 4PLGA 4E2YA 3P19A 4BUCA 1C3VA 2QQ5A 2X23A 5ICSA 2FPIA 2VHXA 3BMNA 1T1SA 2O4CA 2ZCVA 1QYCA 4N18A 3ZV6A 3IL2A 2CDBA 3I9NA 4R1NA 1B0AA 1QYXA 5DCWA 4K6CA 4BNZA 1MUUA 3ASVA 4BNHA 2NU9A 3I1JA 4Z9FA 2OMEA 1A9ZA 5BSGA 3EZYA 3DC2A 1B7GO 2XF8A 1UAYA 3GK3A 4B3IA 4DREA 4Y8VA 2G1UA 3OICA 3ADOA 3OECA 3BYZA 1JTVA 1PJCA 1ZVMA 3MJEA 1EBUA 2HMSA 2B4QA 3KBOA 2RH4A 4Q3AA 3ZU2A 3I9OA 1E3WB 4AJNA 4AJKA 2VZ9A 3NEPX 2DFVA 2V6MA 1AE1A 4J2HA 4PG6A 4IBOA 1DB3A 4WLOA 4XGNA 1LDNA 3DAPA 3A9WA 1MFZA 2HRZA 5IG2A 1XDWA 4A10A 1QSGA 3D7LA 2Q1WA 2AEFA 3O4RA 3V5NA 1JVBA 5CFZA 4C7KA 1KIFA 4OM8A 4BGUA 3WDSA 4XA8A 2FR0A 5JLAA 1BW9B 2NTVA 4OH1A 4YJFB 1UXGA 1ZEJA 3JQ8A 4E5NA 1RM0A 2V6FA 4MPDA 3DDNA 4N5LA 4F3YA 3JQEA 5L3ZA 3Q9NA 2ILTA 1GQYA 4Q3CA 4QEDA 3VZPA 1PQWA 3HNPA 4M87A 3GEMA 3JQAB 4HNGA 4XQGA 1W6UA 3WFIA 4LVCA 4CLRB 1ONOA 2EIHA 4XDYA 3B1KA 2O3QA 1C0KA 4II2A 1YDEA 1YQXA 5TF4A 3M6IA 3RC9A 3IAHA 3AFNA 1T2EA 2ZYGA 1PU2A 3UH1A 1XA0A 3FBGA 1HKUA 3GUYA 4BO8A 2EF1A 4JN6B 4M8SA 4J7XA 3ZI0A 4D3DA 1JWAB 4YJHA 5I7FA 1I33A 4PCVA 4RLHA 3A28A 5DF1A 1P3DA 4RVGA 4BNJA 4LVUA 3INGA 1T2FA 2OZPA 3MCVA 4Y6SA 4JLWA 5KJ1A 3WJ7A 4J2OA 1DXYA 1HSZA 1E7SA 1MGOA 3JD1A 1YQDA 1Z7BA 2AG5A 1ZK2A 4A7PA 1U5CA 1O8CA 5JDIC 2Q46A 1HDOA 2Q3EA 1AHHA 1KEUA 4IDCA 1O5IA 5IDYA 3HQ4O 3RFTA 3JD0A 4H7PA 4HFNA 1FF9A 4JQCA 1CQJA 4XJSA 1N5DA 2VUSA 2C5AA 4DVJA 1UDBA 3P2YA 3AFMA 4ZQFA 4IS2A 3RD5A 1GADO 4IMPA 4HFJA 4GX1A 4WJZA 1T26A 1OMOA 1X0XA 3WTCA 1KEPA 4GVLA 4DMLA 4DWVA 3HB4X 4RZHA 2WD7B 1OC4A 3FWZA 3GMDA 3FTNA 2AHRA 1M76A 1SOVA 3E9QA 1YJ8A 2AQHA 3I5MA 5K0ZA 5K9ZA 1DPGA 4YRAA 1XKQA 2Q4BA 2AQ8A 4OQZA 3D1LA 2X5KO 3AK4A 4E31A 2AE2A 1LRLA 5BNIA 4Q3BA 2GCGA 3LLSA 2PGLA 2X6TA 5A1TA 4AFNA 4BNFA 3FHLA 5B4TA 3OJFA 4ALMA 3C1TA 3OJ0A 3JD2A 3OM9A 1A4IA 1DAPA 3PZRA 4J9VA 1QYWA 3ZU3A 3BA1A 3GFGA 2HLPA 2I5PO 4TZTA 1UXHA 4TRMA 4TRJA 3CTMA 2I9PA 4UVHA 1JKJA 5T8KC 4BHTA 3GDFA 3RFVA 2DKNA 3SLKA 2BGMA 4DA9A 1LC0A 3H9UA 1E7RA 3ITKA 4CMEA 1T24A 4G81A 4BGVA 3UN1A 4LW8A 2NQ8A 3QVWA 3WYEA 5L7WA 1BDMA 3GHHA 3EGOA 3EDMA 1ZJYA 3G1UA 3OP4A 4K9DA 4BMVA 1HL3A 4XQ9A 3RUEA 1I36A 1KYQA 4EUFA 4L9RA 2X0IA 1Y81A 1T2DA 3TZHA 4XEHA 2VUTA 1PJBA 3ITDA 4U7WA 2WMDA 3HE3A 3HSKA 1O94A 4HY3A 4MVJF 2W2LD 3B1JA 1NQOA 1JAYA 5EQDA 4CLXA 5JC8A 5I9MA 4G5HA 2W4QA 5CP8A 5AVOA 1IOLA 2ZB3A 5C7LO 1PIWA 1PJ4A 4AJPA 1NFQA 2DQ4A 3OA2A 3ZWNA 1N1GA 3NRCA 1R0KA 4YT8A 3WGHA 4F6LA 1GZ4A 1UH5A 1HLPA 1VSVA 4Q3EA 3JSAA 3INTA 4IZHA 3ZWAA 2BMAA 4UVIA 1BMDA 1Z75A 4JGBA 4QUKA 3ZHBA 1V3VA 2OBYA 3RUHA 2C29D 4GI2A 3PIIA 1TA4A 1N7GA 2IZZA 3WX0A 1X13A 2HO5A 3BTOA 4E5KA 1HLDA 1LBEA 3TF5A 1V35A 1RM4A 5DBGA 2EW8A 2Y1OA 3F47A 3AM5A 3E5RA 3JV7A 5AXBA 3CZRA 4HFRA 2BFOA 1ZJZA 1ZSNA 2CVZA 1GEEA 5F5NA 4D44A 1U8XX 3JQGB 1DFHA 3FI9A 5L40A 6LDHA 4ZN6A 4NG5A 1HYHA 3V1TC 1NHWA 1F0YA 4PN3A 3L77A 4R41A 2DU8A 1EQ2A 1JAXA 4CV2A 1PZFA 3L6EA 4RF5A 2JCYA 1DO8A 2HKIA 5DOVA 1X15A 3RU9A 3FSRA 1DC6A 2NWQA 3IS3A 4U5QA 3KYDA 4ZD6A 5KVCA 2Q1UA 2VYNA 4Q3DA 4IPTA 1GPDG 1EE9A 3OSUA 4MKXA 5JAZA 3LF2A 4MOWA 5IXYA 1YJQA 1DLJA 2ZJ0A 4OXNA 5A03A 3I4FA 1E0DA 9LDBA 2Y1DA 2JL1A 2X22A 4TKLA 4WCFA 4UUOA 2O2YA 4YEDA 4CM5A 1AXEA 2G82A 1PR9A 1W8DA 3BMCA 1PGPA 3EY4A 2I76A 3GF4A 4I9UA 3IUSA 4W82A 4W4TA 4FCCA 2YHUA 5ER6A 3H3FA 1F12A 2NU7A 3K30A 3KRTA 1I8TA 4BMNA 5KVVA 4YRBA 1EVIA 1P1HA 3FCOA 1KC1A 4RVHA 5F3RA 2AEMA 1QV6A 1U28A 1UDCA 1I3LA 4FDAA 1M66A 4YJGA 5TC4A 1B16A 1ISHA 3O8QA 2O3RA 3DZGA 1KERA 3ANLA 1CQIA 1JKIA 2PFGA 3E6AA 1DAOA 5T67A 4TVOA 3BTVA 1SO8A 4FFLA 4B4WA 3L9XA 3Q0EA 4NU5A 4BNYA 1P1KA 3ZU5A 1LRKA 3K2BA 1XSEA 5IZCA 4CLHA 4JJGA 1LX6A 1HDRA 4II3A 4RVUA 1IPEA 1PL8A 4FPXA 2FZEA 2VWGA 3TOZA 4XZ3A 3AY3A 3LSYA 3PHGA 2LDBA 4CR7A 2D4AA 4XCVA 2IODA 4J1QA 5THQA 4AJ2A 4O6VA 5JO9A 2J5RA 4NIMA 3C7CB 5C5IA 3GPIA 2D8AA 4DC1A 3DZJA 1U3VA 3G79A 2W90A 3TZKA 3V2HA 1Y8QB 4OMUA 3DAFA 5L4LA 4OKNA 4QFCA 4DMMA 1NR7A 4DYVA 2GZ2A 4S1VA 4R9SA 1GUYA 4BGIA 5I8WA 3VVCA 5CG2A 1F17A 4E6PA 1I3KA 1WXDA 3DOCA 2XXBA 3AOEA 1JDJA 1U3WA 2O7SA 5CDGA 5LDHA 4PFJA 4YAKA 2IZ1A 3O9ZA 4HP8A 1Y5MA 5F5LA 5MDHA 5L45A 1X7DA 2B4TO 4OOFA 4Z6KA 2OORA 2ZB7A 4MVJG 1MP0A 2JFHA 4GSLA 4IQ8A 4K28A 4UREA 2X4GA 5TLSA 3EK2A 1JLLA 3OMLA 4GLOA 3F4BA 2B37A 4J9UE 3S8MA 1F8GA 1JKFA 3ZZNA 1QLHA 1YXMA 3I9MA 2VTDA 2PGDA 3QQPA 5T6BA 3RBZA 2P68A 3L6DA 3NT4A 1YL5A 5IN5A 1FDSA 3ZU4A 1P77A 4Z0HO 3QVTA 3BMCB 4IJWA 1ENPA 2X9VA 1PJ2A 2YY7A 1K0UA 1UZLA 4XQCA 1LDMA 3E48A 2Q45A 4XIJA 5ITVA 3GOHA 3DMTA 3ZH2A 2G76A 3LT4A 4YDRA 2EERA 5EERA 4CL8A 2DVMA 3X2EA 1G6KA 1Q7GA 1YO6A 3D5QA 5JS6A 4QXMA 4E33A 1HYGA 2DAPA 1Y8RB 2YUTA 3ROKA 2CFCA 3EW7A 4J1NA 5F1PA 1H5QA 3IIEA 1N8KA 3AI2A 4JP2A 3RJ9A 2HK9A 2FP4A 1LU9A 4L0QA 4CUZA 3Q9UA 3LU1A 1R12A 1R16A 4FC7A 1E7YA 1ORRA 3AM4A 1GV0A 3PQDA 5GY7A 3ZWCA 1R0SA 2EHDA 3VAZA 3U4DA 4ALNA 1SCUA 2Y05A 5KJ6A 3W4KA 4ZHSA 4O59O 1GTMA 1NM5A 4B4UA 1NVMB 1KVRA 2GUGA 2CMDA 3A06A 3MJ4A 3PJEA 5KVQA 3FBTA 3VZSA 2BFPA 2VT2A 3NV9A 3RC7A 4CM9D 3RFXA 1S6YA 1UP7A 3U09A 1HDXA 1O0SA 2CZCA 3UCXA 2YHIB 2F1KA 1E5LA 1NP3A 4ND3A 4CPDA 2QRLA 4MINA 3VPSA 1VKNA 5GZ1A 3V2GA 4WKGA 2Q1SA 3NX4A 2E82A 2C7VA 3RC2A 2W98A 3OHSX 5H81A 2W2LA 4EUHA 3RUCA 3T4EA 1NYTA 3LZ6A 5TRTA 2FWMX 3L9WA 3CE6A 3GNTA 3C7DB 4MKRA 3VH1A 2YZ7A 5KWEA 4PG4A 4J7UA 3AY7A 4UUMA 1ISGA 4XIYA 1E7QA 3C1AA 3G3EA 1NNUA 4NR0A 2NVUA 5T8KA 1EUZA 2H63A 4EZBA 3GZNB 1VL0A 3TL3A 3PJDA 1JQBA 3DBRA 4YR9A 3HZZA 4D46A 3EAGA 1EZ4A 1O6ZA 3GUCA 1Z73A 1GYPA 2BGKA 5TJHA 2YDYA 4B8ZA 3BZUA 2A94A 1A72A 1I2CA 4WLVA 3WNVA 3DZHA 3SJ7A 3ASUA 3FTPA 3EZLA 1EQUA 2PNFA 2GZ1A 3U49A 4L4RA 1N1EA 2VNSA 3GAFA 1XGKA 1A5ZA 1NX6A 1D3AA 2X5OA 2I6TA 3NDJA 4IJKA 4CV1A 2YFHA 4JK3A 1N9GB 1E1LA 4XB1A 5TX7A 1DC5A 2HDHA 1D7OA 4RF4A 5JY1A 4DLAA 2X58A 2GDZA 4NQZA 5LDGA 4DBVO 3U4HA 4FJ1A 4ZQBA 3STHA 4D7AA 2RHRA 4NH4A 3Q2KA 3TDKA 4BL5A 1W73A 3DL2A 4YACA 1T25A 3KLMX 4PLYA 2Y0DA 4E13A 3JQ7A 4UULA 3ZHYA 4U6QA 4MDHA 1CIVA 4NU6A 5A9SB 5CDUA 1E1KA 3QJ5A 4IXWA 3JYNA 5JDCA 5L95A 3L4BC 1D1SA 5FYDA 4KTTE 4CQMD 1O95A 4FN4A 4MP3A 3E9MA 1DJQA 1DEHA 4XR4A 5G0VA 4L76A 3D4PA 5TQVA 1JU9A 3PDJA 3ZWYA 1Q0HA 4RORA 4YCAA 3B6ZA 2Z95A 3AUTA 3JQGA 2Y99A 4AJIA 4GWKA 3RUDA 1X1EA 4BO5A 1GCOA 1WZIA 5F1KA 3H2ZA 3RBVA 1YVEI 3S1LA 2ZJ1A 2FR1A 2VN8A 3RASA 1LI4A 1QP8A 3NTQA 3Q2IA 3GR6A 4W99A 4CUJA 3WYBA 3QRWA 2VNAA 2EW2A 4UVDA 5A3JA 4J0EA 2GPTA 1U5AA 3C7AA 1XELA 5JDCC 2OL4A 1Q1NA 4CM7A 1ZUD1 3RIHA 2BHLA 1HDGO 2X9GA 4B7XA 4CUKA 4B4VA 1XR3A 1J4AA 3BHMA 1CEQA 1C14A 2UUPA 1ZMOA 3KHUA 2BKAA 2EKLA 1YGYA 2BF7A 4AICA 2EGHA 3GY0A 4L8VA 4L4XA 3P5SA 1SPXA 4BNLA 2GYYA 3GZNA 4N54A 1TB4A 2V7PA 4LRTB 4PLPA 4CLRA 1KC3A 4OXYA 5I7VA 1KY5A 4RLSA 1BTOA 3MOGA 4JBHA 2XPCA 1QR6A 3D3WA 4J7CA 5HS4A 3OJEA 4I9NA 2B83A 3K8ZA 5A9TA 3VC7A 3WIDA 4H3VA 4CQLA 3DB2A 1NFFA 2O23A 4XYGA 1VC2A 4RJTA 1SC6A 3MJCA 5DBIA 2CVQA 1WAMA 4A03A 5B4VA 5TGDA 2VT3A 1C0LA 1EDOA 3ST7A 2SCUA 3ENKA 3KV3O 4J4TA 3RSHA 4I08A 3EC7A 4G65A 4RDIA 3VPGA 3QWFA 5L9AA 3I6IA 2EJVA 1OOEA 1U4OA 3TZQA 1V9LA 3JQ9A 1X1TA 4EJ6A 5BNTA 3PRJA 2FSSA 1NVGA 1G1AA 2HUNA 2GO1A 2WJPA 3IKVA 3F4LA 4IGFA 2IXAA 4GKBA 2C20A 4QQRA 1B15A 1Q2XA 2X8LA 3FD8A 3GNSA 4YAEA 1P1JA 3DZKA 2JCXA 1XCBA 3H9QA 4IY1A 4JJFA 1MXHA 1IZ0A 3GVCA 3OJLA 3HG7A 1CF2O 4UAGA 1VKOA 3GH3A 4H16A 4ZVVA 3W6UA 1YL6A 1E3LA 3EYWA 1NWHA 2QIOA 1UDAA 4NBRA 2NM0A 3JQDA 4RPKA 4DIBA 1IPFA 4D0SA 5BNFA 3I9KA 4PVDA 1PJTA 5DDIP 3FF4A 4PZDA 3KSDO 3KEOA 3U9LA 1K5HA 5HM8A 5TIIA 4XWYA 3BMNB 3B1FA 4K1LA 4WCFB 1J5PA 1AXGA 3NKLA 3AU9A 1A7AA 4YAGA 1U3UA 3SJUA 4ND5A 1D8AA 4GLLA 4I1IA 1NPTO 1WVGA 2GERA 4FFPA 3R6DA 3Q3CA 1LRJA 1HE2A 1DIAA 4LGVA 4R4JA 5CEJA 4RVSA 4R1TA 3I3OA 5L7YA 3UICA 1PL7A 3MWEB 3LDHA 1VE9A 4IXTA 3UCFA 5TJ9A 1R37A 5KKCA 3DQPA 1RM5A 2B35A 2D0IA 1PS8A 2C7GA 1E7MA 1EDZA 5CPFA 3GC6A 1P1IA 1EUDA 2UUOA 1ONPA 2QX7A 4XGIA 1H94A 4PLZA 4MVJE 1LSOA 2PGJA 5EMHA 1KETA 1FDUA 2ZQYA 1ZO8A 4YJHB 5COBA 1NR1A 3HDHA 4D0RA 3TRIA 3HB5X 2AG8A 1YB4A 3DZFA 1TEHA 2VRCD 2CUKA 4P22A 3U4CA 3CMCO 4D41A 2I99A 1A71A 5HWSA 4E2XA 2I3AA 5EN4A 1U2DA 2X0NA 1GQ2A 4U6SA 4IGEA 1I3NA 3MJSA 4HXYA 4IMRA 4IJUA 1RJWA 2RCYA 3GVXA 5BQFA 2J3IA 3GA0A 5JPIA 4GMGA 4BO1A 1K2WA 2YV2A 4RPJA 3KM0A 1HF3A 3KB6A 3R1IA 1KS9A 1PZGA 2BFAA 4QT0A 4CMJA 3VPHA 1TT7A 1BW9A 1DRVA 3F6YA 3H5NA 2R6JA 2C07A 2B5WA 3UF0A 5L53A 4CM4B 4P4GA 1O89A 3R0IA 3DZIA 2DFDA 1NQAO 4AG3A 1Y8QA 4O0LA 3WS7A 2VHVA 3O03A 1FMCA 1BSVA 1FDTA 1IB6A 2Q49A 1XQ6A 4GKVA 4HADA 3PWKA 2A35A 4L74A 3O26A 2GZ3A 5DN9A 4DLBA 4W9NC 1PJQA 5CPBA 5CDYA 2H5LA 2D3TA 4J16A 1BXZA 1E3WA 5JNLA 1P0CA 3IC5A 3COSA 4MO2A 4UEKA 2C0CA 3AW9A 4YT4A 4BQRA 3F5QA 3QSGA 4TSKA 1Z6ZA 4EI2A 3PFFA 3VDRA 1Y5RA 3ROMA 1J49A 4M1QA 4YTEA 4ZRMA 3SVTA 4KP7A 2ET6A 4JROA 2V6BA 1EVZA 3GRPA 4X54A 3PEFA 3GN2A 1K6JA 5AXCA 3WGYA 1E3JA 4DXHA 4IDGA 5TSDA 3VTFA 1WMBA 2FPPA 2Y1CA 2Y68A 1M2WA 2HJRA 4JXKA 1NTOA 2JJYA 1ISIA 3ORFA 4BGEA 3R3SA 5DZSA 4BVAA 1AGNA 1YWGO 2PLAA 3RWBA 2VTEA 2OXIA 3BMOB 1PSDA 5IZCC 1ISJA 1LLUA 4NFHA 1IHYA 2DPGA 5IDQA 4J91A 3VH2A 4HKTA 2PD3A 4ZRNA 3S2IA 1ZFNA 1XLTA 4DTIA 3ZWBA 2ZYAA 1RWBA 1E3EA 4ONEA 3H5RA 3PWSA 4WLUA 3IP1A 4D43A 1V8BA 3TZ6A 2VCYA 3RU7A 3MOIA 1JWBB 1P33A 1UZMA 2WEKA 3G0OA 4GX5A 2VZ0A 4R1SA 2G17A 4XRGA 3E5MA 5JXWA 1LSJA 4URFA 4OL9A 4HWKA 4R54A 4YQZA 4P4LA 4DQXA 3L0DA 2FZWA 3GEDA 2P5UA 3SXPA 1YOVA 4IIVA 1HXHA 4B3JA 3W4JA 5A5FA 1FJHA 1EK5A 4F45A 4Z3DA 3DOJA 3EVNA 1B8UA 2P4QA 4RDHA 3WR5A 2WYVA 4WCDA 3ZNQA 4CQMA 4YQYA 1BWSA 4OHUA 4M86A 4WE3A 3S2EA 5FEUA 4WLNA 1N9GA 3LLVA 4FFRA 1R0LA 4B7CA 4MKZA 4GH5A 5JSFA 1HEUA 4UEJA 3OETA 1X14A 3SC4A 3U4IA 3ANMA 4JCOA 3ZWPA 4J0FA 1WW8A 2PKQP 2WM3A 4MVJP 3QWHA 4PVCA 4XB2A 2CDCA 3U0BA 5L4NA 3C8MA 4A73A 2FPGA 5A04A 4PG7A 3P2OA 2R00A 4DPMA 1DIHA 1HSOA 2VYVA 2GD1O 3D4NA 4ITUA 2DBRA 2PZKA 1LLQA 5AOVA 3L4SO 1YBVA 3H9GA 1Q7BA 1YB1A 3WGOA 3PVZA 1C1DB 2VYND 4BNKA 3WTBA 1A9YA 3PZBA 5CAEA 1YBMA 2O50A 5KKAA 1LSUA 3H4VA 4W9NA 5IXSA 3HADA 3KYCA 5TT0A 2NVUB 1E3IA 4QX6A 4D3FA 3GFBA 3U62A 4CLOA 4E0BA 3D0OA 4IINA 1AN9A 1T2CA 3PP8A 3Q6IA 2P9GA 4AVYA 3K6JA 1H2HA 4J6FA 2ZTLA 4KOAA 1S7CA 5T57A 2NQTA 5BSHA 3W8DA 1ENOA 3K9QO 4R9RA 1JN0A 1ID1A 4GAEA 2HMTA 2E6UX 2PZLA 3KETA 1LDYA 3OQ6A 1R66A 2WYWA 3I9JA 5BR7A 2XOXA 3JYPA 4KWIA 2E37A 3Q1LA 1CRWG 3DHNA 4FC6A 1G0NA 4CV3A 1V3UA 2IZ0A 2Y1GA 5F1OA 2J6IA 3KEQA 2CDAA 1NAIA 4A2CA 5GZ3A 1LQTA 2WWRA 2GN8A 3IDSA 3JQAD 5A05A 3VTZA 5CDSA 1PQUA 2VWQA 2B36A 5A9RA 2C59A 4GPD1 4OSPA 1F06A 4LN1A 4E4YA 1ZW1A 3JQBA 4MIEA 4I5DA 3KSUA 4TRNA 4Y6RA 4B7UA 4I5FA 1P31A 1CDOA 4LISA 2J5KA 3GEGA 4OO3A 4PLCA 3OQ1A 2YYYA 2YV3A 1PEDA 4QFDA 5C7IO 3CZMA 4GGPA 2GSDA 4Q39A 4CMEC 5A02A 3MJVA 4BQPA 1ZMTA 5BSEA 2D5CA 5JY6A 4I8XA 1XQ1A 3LQFA 4ALJA 1UP6A 3D4OA 3PYXA 5GZ6A 1YE3A 3ROQA 3JTMA 4RVDA 2BH9A 2VYVD 2NTNA 3ETDA 3TFOA 1NWCA 4WUVA 4UVEA 1WDLA 1ISFA 3L6OO 4D45A 2C54A 1EE2A 4DIFA 3FNGA 2QHXA 4QSMA 5ADHA 3QWIA 3HHPA 3HN2A 2PH5A 3JQCA 5TS3A 3T7CA 9LDTA 4FBGA 1X0VA 2VWHA 4ALLA 3T4XA 4FD3A 1B3BA 1NPDA 3IKTA 3WYCA 3GDOA 4Q3NA 4RCVA 3SEFA 3D64A 2X0RA 3T7EA 3FPLA 4CMCA 2H6EA 4NDNE 1PX0A 1L1FA 4LCEA 3A4VA 4B79A 2CNBA 2DUWA 1VJ1A 2NVBA 1NFRA 1H9BA 3ZV3A 4WLFA 5HTOA 1J0XO 2E48A 3GG9A 1SEPA 5A4DA 4QO7A 1P44A 1GUFA 3ULKA 1D1TA 3HDJA 1UR5A 4NFSA 3JQFA 5C37A 4KDFA 3VOSA 1YBAA 2Y66A 2CF5A 1ZK0A 1ZSYA 4NFYA 4HBGA 4UUPA 3PGJA 1EK6A 4E32A 2QG4A 2Y1FA 2QRKA 2O3TA 4ROSA 3MEQA 3QV1A 2FMUA 3SBOA 5G4KA 1SB9A 2YW9A 3L07A 5JCJA 3AJRA 4LMPA 3JQ9C 3RCBA 3EMKA 4E3ZA 3LC1O 1H93A 3C24A 3JQBC 5JDIA 3F5SA 3JQAA 3WBBA 1UAGA 1ZBQA 2J5QA 3OF2A 1A4UA 2DBZA 3GGOA 3WSVA 1PZHA 1W0CA 1Z82A 3NUGA 4NBWA 3RKUA 2VZ8A 3TOXA 2VOJA 4IS3A 4Y98A 1R4NA 1QRRA 1ULSA 2BI7A 2B0JA 1NPYA 1M6HA 2GGSA 5EL0A 4XD2A 1H6BA 2I67A 4ZGWA 5JC1A 1ULUA 4CMIB 3D3WB 2YQ5A 2ZB8A 1PWZA 4GX0A 4J4HA 4FGWA 1P0FA 2Y1EA 5AXDA 1V6AA 4Z0TA 2GN4A 3H9EO 4C7JA 4PG5A 1UXJA 1JW9B 1N2SA 5I9NA 4ZJUA 4IIUA 4NPCA 3FNHA 1B8VA 4YPOA 4KWHA 4O5OA 4W6ZA 2AA3A 5ITWA 1YKFA 4KZPA 3NJ4A 3PJGA 4IQ0A 3WGQA 4R3WA 4BNTA 4U0JA 3GVPA 3HDQA 3RJ5A 1PGQA 2RH8A 3JYOA 3F46A 1ZK4A 1SOWA 1GU7A 1X7GA 2RAFA 3M2PA 3QY9A 1NAHA 3EHEA 3PWZA 4BMSA 2NACA 2DTXA 3QWAA 1GD1O 1IUKA 4AJHA 3O8QB 3O38A 2DM6A 2G5CA 2DBVO 4NNJA 4JIGA 5FWNA 1UXKA 5B37A 5ILGA 3HFGA 4ZA2A 1C1DA 3WGIA 2EKQA 2Q1TA 1QMGA 3SX2A 4CMHA 3NTOA 1B3RA 4FS3A 1PL6A 2Y67A 3K31A 2LDXA 1PR3A 3DXFA 4K6FA 3PDUA 2O2SA 1TI7A 3HWRA 2GR9A 3TPCA 1H2BA 1ZK1A 1B26A 3ONFA 3JD4A 4ZQGA 1J6UA 3PJFA 2HSDA 4U0KA 1MV8A 3GQVA 1L7EA 2FSVA 1HE5A 2BRUA 1U9JA 1UJMA 2VQ3A 2EGGA 4RPGA 3ZGYA 4IJVA 3CINA 4M89A 3LK7A 2WSBA 1VL6A 1ZSVA 2PH3A 3LT2A 1XYGA 1XG5A 1E5QA 1GYQA 3L4BA 1PQPA 1C1XB 2OO5A 3EVTA 5IN4A 3JQ6A 3IJRA 3WQRA 4EEZA 2GN6A 4O1MA 1RYDA 1Y9EA 3GHYA 3PYLA 4PZEA 5JW6A 1KVQA 1PJLA 4NJMA 3UOGA 1PWXA 5K6AA 2VHWA 1NVTA 4JBIA 3DHEA 2FOIA 3JYLA 2CVOA 1LC3A 5JYEA 4PLVA 5I9LA 3FWNA 4OGWA 2GRAA 4DGSA 3DTTA 3WMWA 4RZIA 4CM8B 4CM3A 3E82A 4YVFA 1Y7TA 4R69A 1NXQA 4NHEA 3UFXA 1WPQA 2AEJA 2VRBA 3ETEA 1KEVA 5JBIA 5AXAA 2W2KB 4NK5A 2IEDA 2OUIA 2FR8A 3MTJA 4BO7A 5TT1A 2I65A 2VWPA 5TNXA 3WXBA 1XIVA 4QO8A 3PHHA 3ROPA 4GVXA 5H82A 4CJXA 2ZCUA 1PGNA 4Z9XA 2EP7A 1V3TA 5DOZA 1GPJA 4MVJA 4LRSB 5G0UA 4RQUA 3DBRB 1M67A 2J8ZA 5CG1A 3PI7A 2NLOA 1I10A 4MIOA 4R01A 4O63O 3UCEA 4HUJA 2HU2A 2BELA 2BGLA 4CL3A 1UUFA 2D1YA 4BNMA 1U2GA 5BT9A 5CDTA 1MLDA 4L4SA 4FOSA 3GAZA 4PG8A 2OHXA 3RBXA 2DUUA 3V1YA 1SEVA 1PZEA 3PQEA 5C7OO 1R6DA 2YV1A 1Z7EA 1NQTA 3KUXA 3HN7A 1DDOA 1SBYA 3GNQA 1OZAA 1P1FA 4IZIA 3DBHA 1F14A 5EJ2A 1V0JA 4YAIA 3GN1A 1LUAA 3CKYA 5KCZA 3PGXA 4JJIA 2AXQA 3ZHXA 3W6ZA 3W8EA 3ZDFA 5AYVA 1MC4A 5G2OA 3VHRA 4E5PA 1HZJA 2HMUA 3PLRA 5ENDA 3RQSA 3AUSA 4U8GA 4D42A 3C1OA 3NT2A 4R16A 2HRBA 2VHYA 4I5GA 3TFQA 3PQFA 5T5QA 4CM4A 1B8PA 4XJTA 5JAMA 3ZW8A 1DIRA 3MJTA 2B5VA 8LDHA 2O3SA 1HWYA 1M6WA 3E18A 3LF1A 4GGOA 1VJTA 4ZU3A 1HT0A 4BKPA 3W1VA 1R4NB 1ZZEA 3DHYA 3GGPA 1BXGB 4KQXA 1GV1A 1GCUA 3DZBA 2NUAA 3NT5A 2JD1A 1R4MA 4A0SA 2CSUA 3GRKA 3KYBA 3K2EA 2FHSA 1I5RA 4FJ0A 3AM3A 1MA0A 4YXFA 5G4KB 1YB5A 1DOHA 2O4UX 4IDBA 1UZNA 3ADPA 1ZEMA 3FR7A 3BIOA 1AUPA 5CHEA 4CLEA 4FW8A 2WTBA 2FY8A 2X1HA 3IQDB 4OAQA 4UVGA 1K3TA 3CMMA 2D59A 3PYMA 1E6EA 5DULA 4XKJA 4MP6A 1MXFA 2WE8A 4D79A 4H15A 1T4DA 4MVJD 3GLQA 3C3XA 1KVUA 1WDKA 5IFLA 4J49A 1EVJA 4OJNA 1I2ZA 3D5TA 1I2BA 4WK6A 3ANNA 1QXSA 1DC4A 3A1NA 3QP9A 1QLJA 3ZWOA 3DMTC 3UGKA 4W7HA 4DC0A 5GMOA 3BMQB 1VSUA 3H7AA 4RPLA 3ZCXA 3VZRA 4Y67A 1YS4A 5H83A 2A4KA 5COAA 3S55A 2YQ4A 3ON5A 4N5NA 3DFUA 3MTGA 1N7HA 1BXKA 5JCJD 2P91A 3ZNPA 1FDWA 3H6KA 3TSCA 1WMAA 3CUKA 3DAGA 1QYVA 3OIFA 3MWDB 4XYEA 4BNVA 1HDZA 3ENNA 3KTDA 2RHCA 3NDIA 3OEYA 4L75A 5JO0A 3JCZA 1K89A 1E3SA 1MX3A 5B4UA 3FNEA 1KVTA 1BGVA 3I9LA 3GG2A 5U1PA 3NGXA 4J3FA 2QYTA 3PIDA 1SMKA 1TXGA 4QECA 4BO3A 5ER9A 2IYPA 1WDMA 3ONEA 1QV7A 1M75A 1NBOA 2ZK7A 2ZKLA 4DIOA 1DHTA 5I8ZA 3LVFO 3W8FA 3RUFA 2E49A 1N92A 1P9LA 1R4MB 3NGLA 4P8RA 2P9EA 1DC3A 1GFSA 3QA9A 4PRKA 1E6UA 3RAJA 4CMKA 1BXGA 1LDBA 3UVEA 1YQGA 1TLTA 3KO8A 3W4IA 3DEYX 3OEWA 1Y9AA 4YJFA 5JAQA 1EFKA 1DIBA 1HE3A 1X7HA 4YT5A 1SNYA 1I01A 4TZKA 2PK3A 1HDYA 1O9BA 3GVHA 2NU6A 3QWBA 1DLIA 1VRWA 4YWJA 2EP5A 3UUWA 1Y1PA 5A5EA 4BNUA 1Q0LA 1HTBA 1GEGA 2J3KA 3WGTA 4OXKA 2QZ9A 4XYLA 2Q2QA 2ZTMA 3WLFA 2PY6A 5IF3A 4W7IA 1ADFA 1YH3A 2VUUA 1Z74A 5JYDA 4LCJA 2P4HX 3FR8A 1H0KA 4YRDA 1I30A 4E12A 5DP1A 2OFPA 1LA2A 1Q7CA 1GL3A 4XYBA 5FI5A 2DLDA 4R1UA 3V8BA 4BV8A 3DBLB 1QG6A 4F46A 3Q11A 5AQ1A 4FFMA 4NBVA 1OI7A 4Q9NA 3DOOA 4CLOB 2UDPA 3IP3A 4B4OA 4YJGB 4DQVA 5HRUA 1HE4A 1DHRA 5IJZA 2AE1A 3EUWA 5ENVA 3AY6A 3OBBA 4DBZA 4OIMA 4E2WA 2HQ1A 5L4SA 4BNIA 4RV9A 3GDGA 4ZICA 1P1RA 2QW8A 5EPOA 3H65A 4MJLA 1XHLA 3UHAA 5K6AC 2Y0EA 3GMSA 3H2SA 1ZIDA 3FPCA 4WCFC 4BB5A 1I24A 1T4BA 2XAAA 2WD8A 4IM7A 1KEWA 2Z1NA 3LT1A 4DPKA 4RGBA 2OOSA 2X7HA 3LT0A 1IHXA 3WWZA 1ADBA 5JMPA 3A14A 2PWZA 1UXIA 1VI2A 1U1IA 3V2UA 1ARZA 4JBGA 2JFGA 4KUGA 4B3HA 4AJEA 2HK7A 1OBFO 4ALKA 3BMQA 4TROA 1ZXBA 4A26A 4CR8A 4CM8A 2DTEA 3AUAA 1C0IA 4WLEA 3SLGA 3VKUA 6ADHA 3KVOA 5G4LA 1KVSA 3CH6A 5DT9A 1AHIA 1K6XA 1WLYA 3BAZA 4YJDA 4DQUA 5DNAA 3TJRA 3ZHZA 1RYEA 3PLNA 1CETA 4JP3A 2EJWA 4NJMB 4BB6A 5IDXA 1FXSA 5IZ4A 5IAAA 1QYDA 3AOGA 1TT5B 4R68A 2XXJA 2ZB4A 3QE3A 4D3SA 4TRRA 4YAJA 2PA3A 2Z5LA 3MZ0A 4IQGA 1U4SA 2BI8A 2GLXA 2DTDA 4IDDA 5A06A 1LLCA 2Q99A 1F8FA 5IDWA 2WYUA 1ZCJA 5F21A 4AJ1A 1GR0A 4FFOA 1I3MA 4GWGA 2EV9A 2HMWA 3JQ7B 4FGSA 3BHIA 1E1NA 4BKOA 2IE0A 4HX5A 4BIIA 4WEOA 3WB9A 2C2XA 4CODB 1OFGA 3WWYA 3BHJA 5DBFA 1HYEA 2GF2A 3RI3A 4EJ0A 5G0WA 2A9FA 4XRRA 5THKA 3N74A 3ZNNA 2OP0A 4IUYA 4BKRA 1DRWA 1T1RA 1Y6JA 2DBQA 5FF9A 2I66A 4FSHA 1H6AA 2YJZA 4E21A 2O7QA 5I7SA 3WGGA 4Z9YA 1GZ3A 1IULA 1LLDA 1E6WA 1YRLA 3TN7A 1B14A 5B1YA 4CM9A 3HFSA 3UXYA 3VDQA 3DBHB 3E8XA 4RQTA 3VVBA 4XX0A 1L7DA 2POQX 3VKVA 1MB4A 4PLHA 4BO2A 5KJFA 2D5AA 1U8FO 3WQSB 3N7UA 3DBLA 2NSDA 3K5PA 2NTJA 3OQBA 2NU8A 4IDFA 1H6DA 1WP4A 3F9IA 3ONDA 3ZNOA 4PRLA 1G0OA 3WGZA 5LC1A 2FN7A 2IYOA 3FN4A 2X5JO 1XEAA 2EWMA 4WOKA 2AMFA 4AJJA 4OKIA 4CMBA 1T2AA 2H9IA 4RO0A 2UV8A 3PHLA 2EG9A 1MC5A 4YT2A 4KQWA 4JX8A 4P38A 3WG9A 4XYMA 1R15A 3S2GA 3G49A 1ZH8A 1DBVO 3N58A 3JQFC 3WIEA 4BS9A 4EBFA 2GASA 1LEHA 3G1TA 4ALIA 4J1TA 1IZ9A 4WNIA 5EESA 4R5MA 2V6GA 4DL9A 4EJMA 2RBEA 1DFIA 2O3UA 3TNLA 4XGKA 5COQA 3FRJA 2Q2WA 4MVJM 1IE3A 1ZK3A 4XQEA 3WSWA 3OJOA 3U5TA 4DRYA 2NV6A 4GL4A 4FQ8A 3OFSA 4BOYA 3ZV4A 4R3NA 1GZ6A 4AJ4A 4I9HA 4J1SA 3ZWXA 4FFNA 4OOEA 1VLLA 2JD0A 4BNXA 4CLDA 1W4ZA 2I3GA 3I4CA 4ILKA 2H1SA 1ADCA 4FOOA 3HJAA 2QZZA 4TVBA 3GZ4A 2WDZA 5G0SA 3ZWVA 4CMAA 3BXXA 5EINA 4K26A 3DO5A 2WD7A 1YL7A 1H6CA 4WEQA 2FRDA 3NAQA 3DONA 4BKQA 4WNCA 2NVWA 5HS6A 4CM6A 1BVRA 2R2GA 1LQUA 3VH3A 4MIYA 1MG5A 4GX2A 3WJAA 5KIAA 3QW2A 2ZIZA 4PLTA 2J3JA 4FR5A 1P74A 3B20A 3ZN2A 4CR6A 1E77A 3AI3A 1U7TA 1C0PA 4AJLA 4KUEA 3E1KA 1HRDA 2VRCA 1CYDA 5LCXA 4BNGA 5BSFA 5ES3A 3PFWO 4DUPA 1B2LA 4NZ9A 1LDGA 2IEBA 1E92A 2JCVA 3VPFA 1CERA 3ZWWA 4EYEA 1EEHA 1ML3A 1VPDA 4EDFA 1LNQA 3ZWMA 1DRUA 2P5YA 3PTZA 4ZQEA 5DP2A 5CEFA 4UUNA 5DCYA 4BKUA 3DBVO 3TWOA 1NQ5A 2OBNA 1PGOA 4E5MA 4LK3A 2HCTA 4GBJA 4Y6PA 4ND1A 1TVEA 4HNHA 4LSMA 1IL0A 2PKQO 4J4BA 3UAGA 4DYDA 5HBRA 4I5EA 2HK8A 3M1LA 3PHIA 1VM6A 3F1LA 3CIFA 5ILOA 2P2SA 4UEOA 4P4NA 5G0TA 3JQ8B 2GN9A 3WBFA 1BDBA 2EXXA 5JMWA 1RKXA 1NHGA 3RVDA 5KVSA 3DMYA 3HDYA 4KMSA 4NI5A 5EIOA 3INRA 1D4FA 4IDEA 1KY4A 4RL6A 1XU7A 1A7KA 1LJ8A 3AOEC 5KTKA 4QTZA 5U9CA 2W8ZA 1RPNA 4NJOA 3SC6A 2JAPA 2O3JA 4A5OA 2NNLD 3NJ8A 3HUDA 3QVXA 2Y93A 2PZJA 1DSSG 2P9CA 2R00C 5EQFA 4MP8A 4CQLB 1JVSA 2E4AA 4KTVE 4XR9A 4C4OA 2TMGA 3LYLA 3H5AA 3RUIA 3KSZO 2X0JA 3K92A 4A27A 7ADHA 2JFFA 1P45A 3ICPA 2EKPA 2PZMA 1I32A 2UVDA 3CXRA 3NYWA 1GAEO 1OAAA 3QVSA 1VJ0A 4PIVA 2HMVA 3JD3A 1ZXLA 3I83A 3IJPA 4WECA 4FJ2A 4J43A 2OP1A 4BNWA 3RUAA 2PKRA 2YDXA 3I52A 4GMFA 1Z45A 3KLPX 3ABIA 3CSDA 1OC2A 4HFMA 1UP4A 4M54A 3VH4A 1ONNA 5JCXA 4ID9A 3K96A 4TKMA 2PTGA 5HA5A 5JE8A 5T64A 1DFGA 1CWUA 4JNKA 3G17A 4S3MA 1H9AA 2C82A 3NDRA 1E7WA 2JHGA 4MVJH 5KOIA 2GNAA 5L51A 3RC1A 2W2KA 4E2ZA 4BO0A 1A27A 2VHZA 3K73O 2NADA 4CV0A 3WQQA
chains in the Genus database with same CATH superfamily
1DQPA 4EEXA 4AP6A 2O9JA 1ZRSA 3WOHA 4IUBS 4RPIA 2EG5A 2DR3A 3QVUA 4QFMA 1H22A 3QUCA 1E20A 1Y8CA 3FLMA 1V8ZA 3OF3A 2ZYDA 5DPMA 2G0TA 5DN6A 1O6GA 5BWMA 1NVFA 3CH5A 4CI0B 5I7UA 3FYTA 4IJMA 2ZTUA 4DLKA 4G67A 5FBVB 4MRRA 3FKSA 3P27A 2AFIB 4QNRA 4TWRA 5CNKA 4RMJA 2ODTX 4OGGA 2H5JA 1DIGA 1N6IA 3CZ9A 1OB2A 3GLRA 1DWQA 1XVIA 4S1PA 2ZI3A 2QVLA 3V55A 4BV9A 3U3XA 3PXAA 2HAEA 2RIRA 1UAAA 2O8FB 1NXTA 3EMVA 3AKDA 3I64A 4G0NA 3DZDA 1UWCA 1X7YA 1DDGA 3A8TA 3QIVA 4D8TA 2HV9A 3N8NA 4PZCA 4EJFA 2E4ZA 3D8BA 3NHYA 4AL4A 3AU8A 3JASB 3ETGA 4G0ZA 3HWSA 1BCSA 1QPGA 3MHPA 2UYYA 5GGYA 5F2NA 3E03A 3R3JA 5LP1A 3IT3A 3CEPB 4ZQHA 2X86A 4NYIR 2ZZNA 2I34A 4AY2A 1DJNA 2DPHA 5BP7A 3QMMA 1Z0SA 1X9GA 1BG6A 4UHKA 4OUDA 5CX1B 5LQJA 1NLFA 4FZJA 2PM8A 3BWCA 3EF0A 3FZQA 1PZXA 3IMFA 2I6QA 4FHFA 1CJTC 4HZUA 4Y7DA 1KQNA 4BO9A 5B3KA 1E1MA 3DH0A 1IY8A 3D6VA 1YJCA 4KQMA 4DE5A 2Z1MA 4C43A 1XD2B 2WPDD 1XE3A 3IVAA 3KSBC 3BGDA 3H8JA 1Y82A 4MEJA 3L46A 4MGHA 1XMOB 1Q74A 2CXHA 4HGRA 4HI0E 4RK6A 5HFAA 3VDMA 2C5EA 2YFQA 3R0VA 4TMFA 1Y3AA 4EB6B 1UBTS 1C80A 1CUWA 1QGUB 2YVAA 3PPVA 5KTRA 3THWA 1AY0A 3FY4A 5CXSA 4O1IA 2VDPB 1ZM2A 4KXYA 4PLWA 1QHNA 1BD4A 1PUXA 2FSFA 1ISMA 1PJSA 1A69A 1XQXA 3LDGA 1WNTA 4GU5A 3EG5A 3N6VA 3NGMA 4KAAA 4PBTA 4UBJA 2PX6A 1D5WA 1MRSA 4FMPA 2DUNA 3KLNA 4HDNA 2Y6UA 2VLIA 3CEAA 3C2QA 3DQZA 4L85A 5LBIA 4BAUA 2HSEA 4FQ7A 1Z2DA 3IBTA 5K0TA 5SZKB 4CMGA 3INYA 4ZC8A 3X1XA 4PYIA 1TA0A 2VOEA 2B4RO 1KFCB 5JNVA 2XZDA 3KYCB 1SG6A 2H7XA 4RM3A 3QPUA 5F1YA 3VZQA 4ZK6A 1RMYA 2WJYA 5KSYA 2IS2A 4B9EA 4L73A 3FRIA 3C5EA 4L5CA 4M9XA 2OXEA 2FRVA 2JATA 1DEAA 2ZUUA 4ESHA 4H17A 3BC1A 4LV5B 5I7EA 2ZWPA 1H2RS 1M2VA 1H85A 1WL8A 1GA6A 1QLWA 2RHLA 3D43A 3FSGA 4MW2A 1M6VB 3HVKA 5CGZA 4BB0A 4BLRA 4CMIA 2C7QA 4LXYA 3FNQA 4X1KA 1UIMA 3R8CA 1P60A 3BREA 1FDVA 1NDUA 1O94D 1J8YF 2RAVA 4NDAA 4ZYYA 4LCBA 4TT8A 4GVPA 1L7BA 4IV5A 4RPHA 4YI3A 3NP9A 4EUEA 3GLIB 4JYAB 4KJXA 3RT1A 2X3FA 4OXXA 1T43A 4G2NA 5KNLA 1PEAA 3KOYA 1GZSA 3KUDA 1GGFA 4HS9A 4F8EA 1RKVA 1JDPA 3ND5A 3JAKA 2GO7A 2VPTA 3M1AA 2IVZA 5HZMA 4FYWA 5K3SA 3KJZA 1RC1A 2NVOA 2QRJA 3B89A 2P1ZA 4NBUA 4I3HA 3AG5A 1IUNA 1VLQA 2XHZA 3SVZA 3BD8A 4JLKA 4MLPA 2QM7A 3ACBA 5LNK1 1N2EA 3H0KA 1ZYUA 3U6BA 9GPBA 2IXBA 3RR2A 1CJCA 4Q4HB 4TV9B 5JNTA 5BW5A 4D2IA 2IYVA 5F2OA 5KSZA 1A1SA 4LVOA 1BVUA 2VJYA 4FWBA 1FUKA 2Q6LA 4MUJA 3RRFA 4CM1A 2JIDA 3KQYA 4XSVA 3RYIB 1R6AA 5DLDA 5BT8A 4UPEA 1Z3IX 1TT5A 3TW4A 1PS9A 3IJ5A 5A5VA 5JY1A 4S04A 3X1YA 1O54A 5I6DA 1JE0A 2PO5A 3I01M 1NUQA 2CD9A 2FEKA 1CZNA 1KR2A 4OSOA 3AL0C 4Q66C 4UM9D 1E79A 1OYVA 1M5RA 4UTZA 4EGFA 3TGPA 2XT0A 2YRWA 3B70A 1QKIA 1ZIXA 3HNRA 1JH8A 4ARAA 4IIYA 4R2XA 1J00A 3VOTA 4O4LB 4YYZA 1RHUA 1E69A 3OTIA 3RO7A 1VIDA 1DBQA 2JD2A 2JHFA 2ZSKA 3M2TA 4H7EA 1KOLA 4RF3A 5GJCA 3STYA 1RJDA 1VL1A 3ZIDA 1LFAA 5ITSA 1FPQA 5ICMA 3PNOA 1XRJA 1Y8RA 2ZYUX 4RMHA 3VKGA 4FMBB 4OHCA 1UIRA 3CZAA 4KQJA 2Q3LA 4ETWA 5KC8A 2GDJA 1ENYA 3DUWA 1FQKA 4MLDA 1NASA 4R5HA 6REQA 3VR4D 5GVRA 1OHHD 3TQTA 3IGFA 2NPFA 5HK9A 2Z4TA 1VB5A 4B8WA 4E2YA 2WUEA 1E1CA 1C3VA 1J7KA 2QQ5A 4JUAA 5ICSA 5DIFA 1SY7A 3T5AA 4IL5A 1T1SA 3ZV6A 4BASA 5JEDA 4YDSA 1J8FA 2CLIB 3RS7A 2CDBA 4R1NA 1XPJA 4HEA6 4IG9A 2QTZA 1J0CA 1E9EA 1ZISA 2Q5EA 3LQ1A 4HNRA 4X3OA 4BE4A 1MUUA 1PV4A 3WZLA 4BNHA 2MJLA 4HAWA 3JARA 1Z56C 1U8ZA 3KL4A 5AJVB 4Z9FA 4DSTA 1KE1A 4A1FA 4PQGA 4D3XA 4YRJA 2BSXA 4KVGA 4C78A 2BEVB 1UAYA 1MQAA 3U2QA 4RZQA 1GN8A 1NQUA 5P8WA 3EGDB 3N6RA 3OICA 4RENA 5C4MA 1IDOA 4B17A 1KOFA 3V7UA 3BYZA 1FYDA 2AFHE 1PJCA 1ZVMA 2A0XA 1MU0A 4RFVA 4TTSA 4AN0A 2ADFA 4Q3AA 1SVWA 1NRJB 2RH4A 3M6WA 4QPJC 2PUWA 1JFLA 3DLTA 2O06A 5D7BA 2DFVA 2V6MA 3I6YA 4PXYA 4PG6A 4IBOA 3DAPA 3A9WA 1ZMRA 3MWYW 3PLAE 3VR3D 3CX6A 4H35A 4QUAA 1SG9A 1QSGA 4PHCA 2A78A 2Q1WA 4ENPA 3EIEA 3O4RA 3QK7A 3PD7A 5JYBA 1G19A 4O0MA 5C8YB 1TEVA 1ZOPA 4OM8A 3WDSA 3AYXB 4K9MA 3VZDA 2YXLA 4XA8A 3OTGA 4UFOA 2H07A 2JIZD 4JI7B 4IXMA 3GT3A 4BQNA 4ER0A 1JMKC 5JLAA 4A1OA 1BW9B 2UXBB 1WQ4A 2GPBA 2NTVA 4L8YA 1UXGA 1ZEJA 3GARA 3JQ8A 3P9PA 1RM0A 1RBMA 3KDAA 4L4ZA 4PZ9A 4IXDA 2CSXA 5FFMA 3DDNA 3N8KA 4HPWA 3D2LA 3JQEA 4UFNA 1NF8A 3VZPA 4Q3CA 4WT7A 2PUBA 5E6SA 2XOEA 3C4VA 5A62A 2GFIA 1URPA 3K6KA 2EIHA 1D4AA 2XQIA 5FB3A 3KEMA 5AJZA 4II2A 2H16A 1YDEA 3DWEX 4MV1A 4CCYB 3SXJA 4DILA 1WU7A 5K0FA 5C7YA 3AFNA 5FAXA 3H7IA 1DADA 1T2EA 3RRXA 4QYXA 1N4DA 4TTRA 1XZFA 2D2XA 2TSYB 2X8BA 3HABA 3RYFB 3UH1A 3A2LA 1EWVA 5BMVB 4MEAA 4MKFA 1JNYA 1HKUA 1W1WA 1MO6A 4UU0A 3IQGX 3KQMA 2WUVA 3HYRA 4JN6B 3KB1A 1WR8A 4D3DA 1M8GA 2IF2A 4YJHA 4LRQA 1G21B 2C4NA 1I33A 2RHJA 1WDWB 5IBPA 4CIDA 4C0QC 4DR6B 3O4VA 2O7NA 4BC0A 4KBFA 1XFAA 2JS7A 4E4RA 1QYRA 5KJ1A 5EMLA 3WJ7A 2CC2A 3W3AH 1AV7A 3JD1A 2W42A 2R0QC 4EI9A 1Z7BA 4C29A 1ZK2A 4A7PA 1NJSA 1JDSA 4B3TB 2Q46A 5KKNB 1HDOA 221PA 4RE6A 1AHHA 1JWLA 4IDCA 3QX3A 3WLOA 1Y4ZA 2HF2A 1G8SA 3WMEA 2HCFA 4G9GA 4EF5A 3ZVKA 5K3EA 3HJTA 1Y48E 2ZEJA 4DM7A 1UDBA 4HGOA 3AFMA 1R5OA 2N75A 4IMPA 1JJ7A 4AT1A 1Q7TA 1X0XA 1AU9A 1G6OA 3AKEA 3AT1A 2B4KA 3AFOA 3HLKA 4QDUA 3WTCA 3V8NA 4ZO7A 2GLTA 2G71A 4HS4A 1MA3A 2XQVA 3HB4X 4KK3A 4A0GA 1OC4A 1RHJA 4CIWA 4K0KB 3TX2A 1Z4PX 2O7VA 4E03A 3SHWA 1KDYA 1IN6A 1WJGA 4MJ3A 2F3UA 1SOVA 2O2IA 1YJ8A 3E9QA 5K0ZA 1DUSA 2CVFA 4WUTA 2HDOA 1MVLA 1XKQA 1UBFA 4NCKA 3TKAA 4MROA 1B41A 1SRQA 5K4AA 1Q1AA 3CC8A 4GWLA 1KZ6A 2DCUA 1U65A 2Q3CA 2AE2A 1TPZA 3DM5A 3DNFA 1EDBA 3R0ZA 4JL6A 4PHGA 4UBNA 2D1RA 2CYCA 3X3HA 3OZDA 3WNZA 3ZS9A 1O57A 5C1PA 1EESA 3FHLA 3MRTA 1G4AE 4FDLA 5EYPA 5B4TA 2GXQA 3RYIA 2RJNA 4JGIA 4ALMA 1J56A 1ZUHA 2W6QA 3PRHA 5JS7A 1PLKA 4J1TC 1JEAA 4QGSA 4WZAB 1G4UR 2EFYA 3T1QA 1C4OA 3ZU3A 2PT9A 5TQ2A 2R66A 2VH1A 3GPLA 2YV5A 1QBKC 2Q28A 5BN4A 1T0IA 2EZ8A 2QUKA 1WB6A 2O8DB 4CMEA 2PUDA 2IE8A 3QVKA 5TQJA 2XYPA 5BUSA 5CYOA 4C0KA 1NJ2A 2EX1A 2HTEA 2NXWA 2Z2ZA 3DS8A 3H2HA 1MJGM 2WFLA 4IJQA 2DB3A 4TTAA 5IAJA 1FTWA 1W96A 2WTMA 3OG9A 3PQ8A 1LZKA 2Q8QA 5T4FA 5BSMA 5D84A 2XW6A 4EUFA 4L9RA 2GCNA 1MH9A 1N0IA 2ZRAA 3TZHA 3KXIA 2R1TA 4JVSB 1NLYA 1S2LA 3A9RA 4U7WA 2YYAA 5LYJB 1U31A 1T10A 1KAEA 1Y3BE 4L0CA 3HE3A 3HSKA 4B75A 1R6VA 1Z5GA 4IIJB 2P9FA 2W2LD 3B1JA 1JAYA 2XCQA 3HVUA 3VYUB 1BQ4A 4G5HA 2I87A 1PCXA 1WCWA 2W4QA 4FNGA 2CJYA 4EB8A 4HAIA 1NATA 3RQIA 5C7LO 3MMPA 2V7TA 3AEQB 1R9NA 1NFQA 2DQ4A 5E9AA 3ZWNA 5AKHA 5F4ZA 2JZOA 4P3YA 1T9GS 2F8TA 4ZT5A 1GZ4A 5ALLA 5FUYA 2JK0A 4IWNA 5JISA 1GKIA 3IRVA 3ZWAA 2JIQA 3EB9A 2VDMB 2OD9A 4L1KA 1E1RD 1X92A 1BMDA 2NO4A 1Z75A 4JGBA 4QUKA 3SF8B 3SOZA 2C29D 4L6CA 4MUFA 5EIXA 4B44A 4H6VA 4C0SA 5EAIA 1UPTA 3WX0A 2XZOA 3LKDA 2A1TS 3H4MA 2G09A 3GEEA 3H04A 2C83A 3AIOA 4ZIRB 3IB3A 2QMEA 1C8BA 3TF5A 1RM4A 2BZGA 1XD2A 2XMSA 4JJ4A 2ZJZA 4LDQA 3PX2A 1WP9A 4GZ5A 1JPNA 3AM5A 4ZVKA 4Z7OB 2X9QA 5CBKA 2H4JA 2JZNA 1ZW6A 4BMPB 1Y4AE 1BC5A 2QLFA 2I80A 2BFOA 3BXOA 2VHUA 2QN3A 4EA7A 5CA1F 1IN7A 4QAQA 5B30A 3JQGB 4XWKA 3EGVA 3OCCA 2HRRA 1IEXA 5FLEX 2YS6A 4G5XA 2ZSIA 4ZN6A 4NG5A 4RY0A 4BRUA 4DYHA 1NZJA 4OA8A 3TAHA 3IBYA 3L77A 5FTJA 5K7SA 1EQ2A 4KACA 3FLAA 3LTNC 2JCYA 2WICA 4HN9A 4ENWA 1DO8A 1VECA 2YXNA 2CVHA 4PZ0A 4ZCTA 2BSAA 1KKUA 3I01A 4HAVA 5CMLA 3T7KA 2Z04A 3FSRA 2ZWMA 4F1KA 1DC6A 2NWQA 4N0PA 1F6DA 3KYDA 2I2XB 2WU8A 4X84A 2Q1UA 2VYNA 4YYEA 1N3BA 2FRXA 1RKUA 3NM4A 4JLUA 4OI0A 1THZA 1UXOA 4W5HA 4RIEA 1F5NA 1FP4B 2ODBA 3FHTA 1M83A 1JR3E 1ZGCA 2WIKA 1N6LA 4YALA 1Z0IA 4D9NA 2AR9A 2ZJ5A 3OLWA 1C3LA 2XUJA 3HVJA 4OXNA 4UQPA 2Q8PA 1MO4A 5KVVA 3C4JA 3I4FA 4MULA 4H7JA 1GZDA 2OCYC 1XTQA 2FA9A 2VDOB 2ZRJA 3QV2A 5H9VA 3UBTA 1XDBA 1Z2CA 2B0CA 1QDLB 1J39A 2PTHA 3I04M 4YRFA 2PIDA 3WKBA 1AUXA 1D5CA 2C7PA 3T1YB 1PGPA 1N7IA 3GF4A 4I9UA 2JDID 3BXHA 4L50A 3PA6A 4W82A 3GCXA 4HQLA 4W4TA 1A9QA 3H3FA 3KRTA 3K30A 3QXCA 4TLDA 3NOVA 5LPNA 3PEYA 1EVIA 1XVUA 1ULAA 3QU9A 2WFMA 3U61B 3FCOA 3AR4A 3LX8A 1R10A 4Y0VA 3EOAI 1EHYA 1QV6A 1U28A 1UDCA 1I3LA 1XHFA 2ORVA 4KNWA 4YJGA 3ZD9A 5K8TA 4EPXA 4YRIA 5TB5A 2VK8A 3LBHA 1KERA 1E3QA 2P2NA 2YMQA 3H8SA 4UNPA 5T67A 2AEEA 1QCCA 3Q0EA 1KMMA 1SCNE 3NDPA 4NU5A 5AW5A 2C8KA 4BNYA 3GRAA 3R9XB 2GX6A 5JRDS 2P78A 2CHGA 3QJGA 3I04A 1ZRMA 3BRCA 3SLRA 5J63A 3C8ZA 2X8WA 1LX6A 1YK0A 2P5SA 1HDRA 2YRFA 4II3A 5E9JA 3W5CA 5ISMA 2FZEA 3SKVA 4N7JA 4EQ6A 5F98A 3NVDA 4LC1A 4J0QA 2H2HA 3AY3A 5LVAA 1ETHA 2LDBA 2ZDQA 4MUIA 1RWWA 4OPMA 4KDRA 5THQA 4AJ2A 3AVXA 5EUQB 4BP1A 3O6VA 1EFVB 3GPIA 3I05A 3K0CA 5ALWA 4CEHB 3W34A 1U3VA 4URXR 2H54A 1ISSA 3D8SA 4OMUA 3IILA 3VISA 1E0JA 2VR1A 4R71A 1PNVA 2XDWA 3V33A 4XD7A 3ZLVA 2JFVA 4LA4A 2EBFX 3RRNA 2JFNA 4R9SA 5ARBA 4BGIA 2BI4A 2UYGA 4TWAA 4QLOA 3DL7A 5JMTA 5CG2A 1F17A 2VEOA 1I3KA 1SXHA 4K6GA 5IANA 1B6RA 4MW6A 1IC6A 2BCJQ 3AOEA 4KR0A 1Y9JA 4US1R 1KYVA 1JDJA 1NN3A 3FYSA 1OBVA 2OEPA 5LDHA 4UHEA 4EHJA 5JU6A 2Q9UA 2CBZA 1UWKA 4FDUA 1Y5MA 3CLRD 1GPNA 2YMLA 5F9MA 4TXJA 1SA0A 1X7DA 2IYYA 4ARZA 2ZIFA 4OOFA 5K0BA 4MVJG 1J24A 1C9EA 2FDCA 3WJ1A 2JAXA 4N0EA 2JFHA 3D6TB 4AKGA 4IQ8A 3G8DA 4TXMA 4KQGA 1W47A 4HDSA 1P8JA 2VF8A 3P9XA 2W2VA 1TKAA 4JLJA 3MPOA 1NRXA 1TYZA 3AB8A 3ZZTA 4EB0A 3F4BA 3H2YA 5TLSA 5CB8A 1LW6E 3AHDA 1QOZA 3TRJA 2I91A 5DO9A 4FMCF 1P7CA 2MR6A 1GLVA 3CF4G 1JYSA 3LGSA 4YRCA 5HF5A 1J99A 1FYWA 3FBWA 1YL5A 1TU3A 1X8XA 4KKVA 3EXEB 1SQ6A 4LHWA 3KR2A 3LGAA 1XXHB 4XCQA 3G0CA 2WMNB 1PJ2A 1XMSA 2H65A 2YY7A 1VHWA 1TX4B 4EX6A 1K0UA 2PV0A 3NS7A 4L3VA 5ITVA 2IOFK 1X7ZA 4PYMA 4U7PB 2G76A 3LT4A 2JA1A 3IEUA 1YCHA 4OHRA 3VHQA 1Q7GA 5IBRA 2W48A 1F60A 1OGYA 1YO6A 3DFFA 5H4GA 3KAPA 1QVZA 3T5PA 3FCUB 5FLKA 4ASUD 4P80A 4X3PA 3C45A 1CBUA 3SX4A 2EX4A 1E9FA 4B43A 1C3XA 4V1CA 3TLMA 4JP2A 1BWPA 4MVWA 1ZR4A 2B34A 5CNJA 3T0GA 4MYRA 2JLYA 4GO1A 2A7XA 3M5PA 2B4AA 3Q9UA 3ZXYA 3VU8A 3EGEA 2C3OA 1BXRB 3MINB 2HIMA 4HAXA 3MELA 1R16A 3SJCA 3TE7A 4C4ZA 3NBAA 4OU4A 3IAS6 4WAUA 5K6TA 1ORRA 4HGPA 2ZS8A 3QBDA 5GY7A 1PJRA 4G1EB 1J7JA 4YUVA 3IKMB 3KL2A 2Q5JA 3IV9A 3KQVA 2O0JA 3O74A 3U4DA 4E15A 4EIWA 1SCUA 2Y05A 3EIOA 1TO2E 2BGIA 2WABA 4LDRA 1J2TA 1Z5PA 3GBPA 4TX1A 1EFUA 2PX8A 1EX1A 1LGYA 1U2EA 1NM5A 5FORA 5E3JA 4B4UA 1NVMB 2CVPA 3F6EX 3SQXA 5CB4A 4LJKA 4RBNA 3PJEA 1TQHA 3CKMA 5KVQA 3VZSA 1D6JA 2BFPA 1IY1A 5D2CA 4D9BA 2R8RA 1PSZA 2ONZA 2W2TA 2ZOSA 3RC7A 2ZTHA 3V9AA 2XE4A 2YINC 4JOBA 1CUIA 5HZKA 4C7OB 1FFYA 1J1ZA 1GTZA 2F1RA 3AV3A 1HDXA 4RGVA 1O0SA 3RHTA 2CZCA 3UCXA 2C5HA 1U0HC 1DAHA 2VS1A 4HN4B 1BFDA 1O94C 4PY2A 5E4JA 1QPZA 5GZ1A 3V2GA 1SHJA 2AH5A 1ZKDA 2CFSA 1GGEA 4LMBA 1IH8A 3BXPA 1IMJA 1I7DA 4W1SA 1UK9A 2IW3A 4LHVA 1MB2A 4LJ9A 3T4EA 4ABYA 1AGRA 3I2HA 5ULLA 2W6OA 3QUQA 3C3KA 4RFLA 1GPKA 4U2FA 1G7TA 4EPVA 3GNTA 4TOIA 1V5GA 4MKRA 4HT3B 3VH1A 5KWEA 4X24A 3AY7A 4IVNA 3NLLA 1GSAA 3C1AA 1NNUA 3CXUA 4ARVA 1L7RA 3VO8A 1EUZA 2H63A 3LFTA 5IT4A 3GZNB 1OT3A 4D1YA 1EM8A 1S0UA 1WW3A 1PT5A 1TYEB 3L8FA 1OF1A 1XXLA 3PJDA 4XOIA 5KWVA 1EUYA 4R83A 4D46A 4OI2A 1KRHA 2GVNA 5ALOA 1JSRA 3V6LA 3I2KA 2BGKA 3TL6A 2YDYA 4D6YA 3BGSA 3PTLA 2A94A 4MI6A 3T15A 4G56A 1AO0A 3W90A 5BYBA 2ATVA 4ZJYA 4GBMA 4R81A 1RLUA 3GLGB 2YXEA 4AKTA 3UC5A 4PPFA 2IEAA 4RK0A 3DE0X 1JLKA 3ZD8A 3TMAA 2CNLA 3KQKA 1N1EA 3GAFA 1XGKA 5DGTA 2QJWA 3IDQA 3HV2A 4H0CA 5EJAA 1IPHA 4KKXB 1PI3A 1Y33E 2HA3A 2XB4A 2I6TA 3E53A 4FFVA 1ZIPA 3UG6A 4JK3A 1BN7A 2V7EA 3EQ8A 3MGAA 4LY3A 4MR7A 3SM3A 5TX7A 1DC5A 4G24A 4AO6A 4BBJA 2BUCA 1K7EB 2P7IA 3LVRE 3MOSA 3U4HA 3OCZA 2FPOA 1KMIY 2PKCA 2VUHB 1PK7A 4XAQA 2JFXA 3PUVA 4NH4A 5K3DA 3KPJA 1UBGA 2B1IA 3DL2A 1IEWA 3B3GA 2QSZA 4PLYA 2OK7A 2WSMA 3KLMX 4KXQA 5EG5A 5KOJB 1EJBA 5DYNA 3R40A 1XAGA 3TIXB 2ODQA 1KZ1A 1M2KA 1VLVA 2BFBA 1WUHS 3SZLA 2ZBVA 2KPOA 1OXTA 4MDHA 1CIVA 2IIPA 4Y2TA 4NU6A 3RGGA 2YZ2A 3RWMB 3VR5A 3GT4A 2JLVA 1GR1A 3W7BA 3A9TA 1E1KA 3KTFA 1YMVA 5FYDA 4Z1MA 4C6SA 2WJVA 1K8XB 4CQJA 3E9MA 1JR3D 3NHFA 3SR3A 4X6LA 4XR4A 2XNKA 3OIWA 5H5JA 3S0JA 2PNJA 1ICEA 3C7TA 5T6MA 3R5FA 3Q3VA 1GUBA 3JWEA 3ZWYA 4G0MA 1OH8A 1UJBA 2A9OA 2HM7A 4BBZA 1V5IA 1U80A 2Z95A 3AUTA 4UTPA 3GJ4A 5KNBD 1Z5ZA 3MLAA 3HKBA 4EOGA 3RUDA 3IAM1 1AQJA 5CNIA 1TCVA 4BO5A 1GCOA 4OHXA 4BZXA 3RBVA 5LXTB 1IM5A 1BH6A 1ESCA 4HNVA 3RASA 1LI4A 4HB2A 5A6SB 4J8PA 5K6RA 4RVNA 4UDXX 4W99A 3PG5A 2C2WA 1BNCA 1IJEA 3MIZA 2EW2A 2R79A 2R97A 2HW8A 1CR2A 2B98A 4J94A 1P0IA 2GPTA 3F3KA 4OBWA 4RXTA 5DNCA 4CZ2A 4CFSA 3KTAB 4PRZA 3MS2A 4IOKA 1WV1A 3AY0A 4JODA 1Z5VA 3JVUA 4FU0A 2QNIA 2ZIEA 3G2QA 3RIHA 2BHLA 3AR6A 4B9AA 4LF8B 4WNAA 1JX6A 1OXBB 2CEAA 2NV2B 5D6NA 4CCAA 2H0RA 5K1ZA 1EWQA 1D2HA 1CEQA 2FKNA 3OE7D 4A8JB 4PPQA 3HVIA 5DJ5A 1X94A 5SY6A 1PUIA 1ZMOA 1VP3A 2A3RA 3KHUA 4FGZA 3EGXA 2WIBA 3HKEB 3HXQA 1XDGA 2F7SA 3R41A 3CO0S 3GY0A 3RSOA 5J2UA 3KZXA 3AEQA 2D5LA 1FXWA 4L8VA 4L4XA 1T0JB 4GPIB 2O05A 4MQ4A 3MUOA 3GZNA 2V7PA 4PLPA 4JQZA 4V02A 3AV0B 3HEAA 2PZ8A 2OFWA 4JHLA 1FNMA 1HLGA 1CY1A 3P26A 4OXYA 1N9ZA 4P5DA 1R6BX 4YRPA 1YB2A 3RRJA 5I7VA 5CCBA 3T4UA 1DI0A 1WSDA 1ZUIA 2ORED 1IWPB 1C4WA 2XPCA 3E7XA 1QR6A 3PA8A 4JBHA 4KCGA 4ZT4A 3TQRA 3D3WA 1XPRA 1NG9A 5HS4A 3I5YA 1VPLA 4QJIA 4K46A 3VVLA 2O5CA 3VC7A 1V45E 3DB2A 3CRW1 1HMPA 5DBIA 3R7DA 2YASA 3IKLA 4QUDA 3REQB 3OFVA 4A03A 1QNFA 4LBYA 2ZUCA 4KN5A 2ZB2A 4QVKA 4FYIA 3IOBA 3OM1A 4F21A 4ACAA 5A4AA 4UAJA 1D9ZA 3WA7A 3WHIA 2ADOA 3OCWA 4U4AA 3EC7A 3EWSA 3WYNA 1QDEA 3VPGA 5L9AA 1FB5A 4FFBA 1I7LA 2F3TA 1OOEA 4AD8A 3DVRX 1V9LA 1JMYA 1A2KC 1PYGA 1X1TA 3A6ZA 3BH0A 2A84A 1L8OA 2VUIB 4IGFA 1GZVA 2IXAA 2X2OA 4KFTA 2QMHA 1Z6XA 4QQRA 4KIJA 4R2JA 1SUEA 1U0RA 1D8TA 1O03A 2ZYTX 1ODTC 3DZKA 1P61B 3A27A 1CF4A 4MTLA 2K2WA 1XZDA 2PWYA 3GVCA 1JXOA 2BEVA 2AFVA 4POOA 4EQZA 3TCXB 2JA2A 4INOA 4UAGA 1VKOA 3K0KA 3EGWA 4DCMA 1OLSA 1YZHA 4H16A 1LV8A 4OM7A 4ZVVA 5LUAA 1YL6A 1E3LA 2JLQA 3IIJA 1JFRA 1GVNB 1I7NA 1E0KA 1O7JA 1UDAA 4NBRA 3DVAB 4UD2A 5KTOA 3CGWA 2IYTA 5LZ9A 4IIBA 1ICIA 1JHRA 1K08A 1QIMA 3CLTC 5DDIP 2RGUA 5DXAA 4PZDA 3DNPA 3LYAA 3MCAA 1DQYA 5FULA 4F5YA 1RZRA 4X1OA 1JHVA 1K5HA 1J0EA 3UK0A 1W36B 4ARIA 1ECGA 4G26A 5CVDA 4K1LA 1RTTA 2ZYIA 3VPDA 4NDZA 4CHGA 5LU9A 4Y1GA 5I8PA 1UDRA 3NKLA 2D5IA 3BWBA 2WZBA 3PDHA 1U3UA 2AZTA 4GC5A 2WYIA 2FW9A 3KZCA 2Q3MA 3QH4A 4MR9B 1D9XA 3OVMA 4Z9AA 1JP7A 3E22A 4MI1A 3BILA 5B7NA 1CRPA 1Q3TA 2GERA 4GGMX 3QOXA 4GQBA 1DIAA 4LGVA 3UWKA 1MO5A 3JTEA 3KJEA 3CYFA 3L84A 3OUZA 4D0GA 3SZ3A 4R1TA 4KXXA 3T9AA 3AKZA 3UICA 3G8CA 4G5GA 1F8UA 4IXTA 1RTKA 1IQPA 5KKCA 1RM5A 2JJ2D 3UH0A 3MWJA 1RRVA 5CDHA 3ACDA 5DYYA 1Y1LA 3OOJA 5KOHA 5CPFA 4U2KA 3D3NA 3RLIA 4WZZA 3AZOA 2IYQA 4JLOA 1RCUA 2FFJA 3SPXA 4ZYLA 3WLQA 1REQB 4PLZA 1G16A 5EMHA 3WO0A 3I92A 1QZZA 4V0KA 5TVGA 2FUG6 1NR1A 3HDHA 4PX3A 5BN1A 4YI5A 3TRIA 2QGFA 2ZBFA 3HB5X 3V8EA 1TEHA 2VRCD 2YHAA 3QU2A 2EKZA 4L2IB 3U9SA 2ZJAA 4P22A 3TJMA 5HIKA 3KQLA 5EN4A 3DVQX 2X4LA 1GFWA 3KR9A 2WHPB 1RJWA 3GMTA 3VX4A 3RBAA 1XF9A 1IWBB 4FK8A 2YICA 2O59A 3NONA 1JYFA 2C5BA 1FSPA 2J3IA 2GETA 4Z49A 1XDSA 4RA6A 2IHJA 5FLYA 1I2DA 2VQSA 1K1EA 3R3XA 4JJ7A 4JBLA 3LH5A 5JOQA 4RPJA 3NIWA 3VRHA 3KM0A 4DNQA 3CVXA 4ZAVA 3KB6A 1PZGA 4ISBA 3SI7A 4CMJA 5DLYA 3GNLA 1TT7A 4HH4A 1GU0A 1BW9A 3VPHA 3C70A 4YP9A 3M6XA 2C07A 4JT9A 4X90A 4GRDA 5L53A 4PO1A 5KC9A 2H57A 3ILSA 2FPUA 4EGAA 4P35A 5DM2A 4F4CA 2DFDA 1K6MA 1NQAO 1QGZA 4QATA 4O0LA 3TW0A 2B2NA 2VNKA 3O03A 3PXGA 2OO7A 4ZKEA 2X4DA 1DKOA 1X70A 3K1YA 2EHJA 4GPAA 2IV7A 4JLSA 3CX4A 1OBOA 1KAQA 2A35A 3L6BA 4KBYA 5HIJA 4BFTA 4MYHA 5JSZB 2AC7A 3OOHA 4MI9A 5JCPA 3LOQA 3VU9B 3HBMA 4DJTA 5CDYA 1F1BA 2XJ4A 4Q21A 5FI0B 4B6JA 4QULA 2R65A 4LWQA 5BYJA 2D3TA 3OZFA 1E3WA 5B1SA 3LD9A 1AUVA 1T4MA 4C30A 3T3MB 3UJ3X 5HCUA 2F8MA 2W83A 3COSA 5HKKA 2C0CA 1L1QA 4WKCA 2NU8B 2GM5A 3UMBA 4BQRA 1VZ3A 2C5FA 3EGDA 1Z6ZA 3U37A 3EVEA 3SVTA 3BE4A 1QGOA 2WJWA 2F9FA 3IUQA 3B7PA 2V7BA 3LHSA 2ET6A 4OK3A 3D6AA 1NUSA 4XM0A 3JWPA 1EAMA 2BFNA 1GZUA 3KAKA 4PAOA 4X54A 1IAQA 3ITNA 1JQDA 1U0OC 2QP3A 1AQUA 5AXCA 3WGYA 2VF5X 3FDJA 1R8SA 2GLUA 3HJNA 3P4UA 5D01A 4WXPA 3I28A 3OEEA 4G5SA 3VAYA 5B7PA 1XJCA 1UKVY 2HJRA 4JXKA 1QOQB 3RTGA 5EJ4A 3ICEA 2JJYA 3B5EA 3ORFA 3L40A 3MNFA 4U0KA 1GKLA 5DZSA 4BVAA 5JALA 3TEJA 3MTEA 2CXXA 3IVRA 2AXPA 4JVMA 3CZ4A 1ISJA 2BFEB 2VJOA 3NTXA 1LLUA 4PYJA 3H3XA 2D7JA 1IHYA 4NFHA 2DPGA 1BMTA 4J91A 4UCXA 1MQ8B 4BJ1A 4PS1A 5DXFA 4OI1A 1DIOB 4FS8A 2Q27A 3H5LA 1T1JA 2G1KA 1ZFNA 3P2IA 1TW2A 1UJ2A 1RWBA 1E3EA 3PWSA 4ZI7A 2DHDA 4ZOEA 4WQMA 2FPSA 4K05A 4OIFA 4UHHA 2F6RA 1NLZA 2P4SA 4G4SP 5DT2A 2CLOB 1L5GB 4DCVA 1NN5A 3JZAA 4WVFA 4DMUB 1QFXA 2XMCA 5DX0A 3W8RA 1JWBB 2BEUB 3KQSA 3QXHA 3AVWA 1UZMA 2FJPA 2WSSA 3B6MA 4IGIA 2GBFA 4R1SA 4UTRA 1JJAA 5AVTA 5KHOC 3GLFA 1ECBA 2FSGA 3DFMA 3ZV7A 3E5MA 4F11A 3SFVA 3VM6A 4E1AA 5BPFA 2R11A 3GP3A 3LUPA 2GUWA 4YQZA 2DFKB 3QLEA 4R54A 4TM7A 4DABA 4RADA 1VE6A 4MJ7A 3EQ6A 2XT9A 4DY4A 3R6WA 2JIOA 4W5TA 1M1XB 3AFGA 1B0ZA 4B3JA 3WAGA 1KI7A 4MVXA 1YDFA 5BQOA 4Z4FA 3DOJA 4D0LB 4RDHA 1OIVA 2PBFA 2WYVA 3C7KA 3MBOA 3T3GA 4C3ZA 4CQMA 2A1TR 4YQYA 2VSXA 4XUDA 2QMUA 4PNHA 1QQ5A 2O8NA 4JT2A 3ZI4A 5FEUA 1MEJA 4FFRA 2J85A 3IODA 1T5HX 2HTFA 3B9RA 4OJYA 3U5ZB 1TAGA 2B30A 4WNYA 2NZUG 1PFVA 3L43A 3B36A 3U4IA 5FPHA 3F8SA 4P98A 3EVDA 4WN9B 2QYOA 3H19A 3JRNA 3N2GA 4MVJP 2VT6A 4XB2A 3P32A 3U0BA 3K2QA 2BTOA 2ZJFA 4A73A 4CL0A 4ZCMA 4DPMA 4QGBA 1DIHA 1A5TA 3LUFA 4AKSA 3NRBA 2B8TA 3C6ZA 2DETA 2P77A 3LRTA 4OP2A 5AJUA 3UKJA 4LOIA 3IP5A 4WACA 2HLHA 1AX9A 1YBVA 4EDHA 1YB7A 1G20E 1ZRNA 3KXPA 1XTIA 5E1BA 1C1DB 1V3QE 3EPRA 2IQ5A 3OD5A 4BNKA 1N9KA 3L92A 4D02A 5CAEA 2JEOA 2JJQA 3C16C 1JG3A 3H4VA 3UJBA 3F3MA 1E3MA 3KYCA 2NVUB 4NF2A 3KJNA 3D4IA 1LBSA 2DWCA 3Q3JB 4LOHA 3U62A 5AI8A 4A2QA 4EGCB 2B7CA 3W1WA 3HU5A 3B13B 2ECFA 3FZNA 1I1QB 2HRCA 5LA6A 2W43A 2FFRA 3F7OA 3K8YA 3LA8A 5FAKA 1SVIA 4PC6A 2ZTLA 4KOAA 1JU3A 2YWRA 2YR0A 3A4IA 4TWBA 3RT7A 4O2RA 4LNAA 4EY3A 1Y89A 4CQNA 1Q77A 4CI9A 1RVV1 2AXNA 2BE9A 6GPBA 5KNDH 2OD7A 3JWJA 4G41A 1YRQA 3RAPR 5BW8A 1AO3A 2F1IA 2H1CA 3IA7A 3IT0A 4GAEA 4GE3A 3BD6A 4AKEA 2H4XA 3MCWA 3CURA 3K9LA 1TYDE 5A5GA 3Q0IA 5F7XA 3OQ6A 4QOIA 3VR6D 2WYWA 2HU7A 3A6GA 3I9JA 4ER6A 2XOXA 1G4HA 3CVWA 2V96A 3VPCA 4LNHA 1V43A 4EA8A 3EULA 1E2NA 2DWQA 3UQYS 1R64A 1WXHA 3NPAA 3H5VA 1E6CA 1V3UA 3QBJA 4HWOA 2ODNA 4H6PA 4CT5A 4R8MA 5F1OA 9ABPA 5A7GA 2J6IA 1T4CA 1NMQA 1RXCA 2CDAA 2YH2A 2IFTA 3IDSA 4L4YA 4A2CA 4WBNB 5GZ3A 3GFSA 1JA0A 5HKAA 5DGIA 3NOOA 3LUGA 5AI0A 1H05A 2B36A 4WKPA 5AW9A 5A9RA 2QJTA 2WINI 4LK2A 4DJEC 3DLAA 4KMOA 4EUNA 2J0SA 3VNUA 1F06A 4LN1A 1NBHA 4Q1CA 3RE1A 4YK7A 1ZW1A 5FRDA 1XUOA 4HVTA 1OTHA 4CNBA 2A3NA 1CDOA 3W2EA 2J5KA 3PXUA 2H7CA 2JAWA 4PAMA 4ZWNA 4OO3A 3RS8A 3OQ1A 3ZZ0A 3HKDB 2WTUA 4PQRA 2QI9C 2GS9A 4GGPA 1Z2NX 2GSDA 1E2GA 2NQ2C 3IOEA 4CMEC 3MJVA 5EJ9A 1KO5A 5EIAA 2D5CA 5BSEA 1CTQA 3W3ZB 2DUJA 3F97A 5JY6A 5KMGA 2DXIA 4RD4A 2AKEA 2ZRBA 3C74A 4PC7A 2BH9A 1P29A 1KOJA 3NNDA 4M9UA 4MUXA 1IOWA 2EEPA 4W5WA 1DX4A 3IHLA 3N39C 4WUVA 5EHNA 2C54A 4DIFA 3C43A 5CH3A 4FOLA 1DCMA 4QSMA 4H9GA 1G5RA 1J9GA 4FLEA 4L15A 3GFRA 4UXJA 1DTEA 3HN2A 5ALTA 5TS3A 3T7CA 2FEOA 1US8B 2Q41A 2ZUBA 4FBGA 4JUDX 1ZXXA 1HPLA 2EZTA 4Q3NA 3UWDA 3WYCA 3IKTA 3CY6A 1VMAA 2C5GA 4G4JA 5IJXA 1GAXA 2X0RA 5CBPA 4JYPA 4QUBA 1L1FA 3D31A 2H4FA 4LCEA 5DHFA 1ZINA 1ACMA 4IO0A 4B79A 2CNBA 2DUWA 5CLLA 4F60A 3GIDA 2I4RA 3OIUA 1YV9A 4NPAA 3DHWC 3QXSA 4ETMA 1KPGA 2HCJB 6YASA 1EFRA 1ZGHA 4BZZA 4OMDA 5HTOA 1SIOA 4DRXB 2Q5LA 1SEPA 1E9DA 1WABA 5CT4A 3ZK9A 1TRHA 5AW0A 2H4YA 3RK1A 3EPJA 4NBLA 3ULKA 3EXIA 4NFSA 1ZI8A 2P2ZA 2PT7A 3V1MA 1DJPA 4LYJA 1QG0A 4KDFA 4ENTA 4HLDA 1YBAA 2Y66A 3F96A 4I4CA 1QO7A 2ERXA 3HCRA 1SVSA 3WYGA 5K0JA 1Y8AA 1HDEA 4K40A 4LJ4A 1SVMA 1NVXQ 1V8DA 1EK6A 2BFFB 2EWWA 2H7YA