2BGMA

X-ray structure of ternary-secoisolariciresinol dehydrogenase
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
267
structure length
267
Chain Sequence
b'TNRLQDKVAIITGGAGGIGETTAKLFVRYGAKVVIADIADDHGQKVCNNIGSPDVISFVHCDVTKDEDVRNLVDTTIAKHGKLDIMFGNVGVLSTTPYSILEAGNEDFKRVMDINVYGAFLVAKHAARVMIPAKKGSIVFTASISSFTAGEGVSHVYTATKHAVLGLTTSLCTELGEYGIRVNCVSPYIVASPLLTDVFGVDSSRVEELAHQAANLKGTLLRAEDVADAVAYLAGDESKYVSGLNLVIDGGYTRTNPAFPTALKHGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RHIZOME SECOISOLARICIRESINOL DEHYDROGENASE
molecule tags Xidoreductase
source organism Podophyllum peltatum
publication title Crystal Structures of Apo-Form and Binary/Ternary Complexes of Podophyllum Secoisolariciresinol Dehydrogenase, an Enzyme Involved in Formation of Health-Protecting and Plant Defense Lignans
pubmed doi rcsb
total genus 84
structure length 267
sequence length 267
ec nomenclature ec 1.1.1.331: Secoisolariciresinol dehydrogenase.
pdb deposition date 2004-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2bgmA00
2VRBA 2E6UX 2GNAA 5C3MA 1ZEJA 5AYVA 2AEFA 3OH8A 1B15A 3AI3A 1Z7BA 4FBGA 4FGWA 4J2HA 3VPXA 1PWXA 4K28A 1KY5A 1YL5A 3H3JA 4CODB 4D79A 4A2CA 4I5EA 4CV3A 4CM8B 4PLGA 2DBQA 1I01A 1RYEA 3NDRA 4BOYA 1P3DA 2TMGA 2F1KA 3VH1A 1BSVA 1QG6A 1KOLA 3G49A 3NTOA 1DJQA 1EVIA 5G2OA 5ILGA 2FR8A 3E9QA 3ZWNA 4GSKA 4PG4A 4GKBA 4B7CA 4B7UA 4R9SA 2Z1MA 4HFJA 3G1TA 3WJAA 2ZATA 1AUPA 2A4KA 1UJMA 2CMDA 1LDEA 2OBYA 3GZNB 3QQPA 5IDWA 3B70A 1GYQA 3DC2A 4RVHA 4LSWA 4PVDA 1XHLA 1DO8A 1R0KA 3BTOA 4CUJA 5B1YA 4PLFA 2YV1A 3DZJA 1HDZA 1KYQA 1Y8QA 2F00A 3LT4A 1KC1A 3DBRA 1WZIA 1S7CA 4FN4A 3JQAB 1VL0A 3VTZA 5HRUA 4XD2A 2Y67A 1NX6A 1DC4A 3JYPA 3PWKA 3GLQA 4DIFA 1JWBB 5DBIA 1LC3A 3GZNA 3INTA 3RQSA 4JP3A 2OBNA 5JO9A 2EJWA 4GQAA 4E3ZA 3HDJA 4FD3A 5K9ZA 2AQHA 2BHLA 3I4CA 3I5MA 3ASUA 3H9GA 2IYOA 1HLDA 2O7QA 3LF2A 5JMPA 1LNQA 1ISGA 4RQTA 3R3JA 5TS3A 1IPFA 3WBBA 2YFHA 4R5MA 1ZJZA 2PGDA 4AJEA 1E7RA 1HZJA 3HB5X 3MZ0A 3JYOA 2OGUA 4XKJA 2JJYA 3UCFA 4PRLA 4BNJA 3KYCB 5C7LO 5I8WA 3ZW9A 3ORFA 3L77A 1SMKA 3FR7A 5A05A 4IDCA 1I33A 3SXPA 2CVQA 2IXAA 1AN9A 4MVJP 4PG7A 4E2YA 1X0XA 2B4RO 3UCEA 4UVEA 4J3FA 4J1SA 2QW8A 3PIIA 4P22A 3JD2A 4XYBA 4OMUA 4DC0A 1M2WA 3EDMA 3GVIA 1W6UA 1F0YA 1A7AA 4GMFA 1LLQA 3JQCA 4WLVA 3JQ9A 1ISFA 4J90A 3DHYA 1ZIDA 1EEHA 1UAYA 4BMSA 4BO2A 4H15A 2HDHA 2HKIA 4PRKA 4K6CA 2WDZA 3V2UA 5ICMA 5L7WA 1DAPA 4EYEA 1NPDA 1QP8A 1JDJA 3GF4A 3RVDA 4MVJH 5G0WA 4TRNA 3ZU4A 3FPCA 3WWZA 2WTBA 1C0IA 4YBZA 4C4OA 3GEGA 5L40A 2P91A 3SLKA 4EDFA 3L6DA 1LLCA 3FI9A 3AW9A 3A14A 4WJZA 2O2SA 3ZWMA 1DXYA 4HADA 2Y93A 4CM9A 1F8FA 5IN5A 4DQXA 4AVYA 3ZV4A 4MVJG 4YRAA 3ZWCA 3ULKA 2GSDA 4UULA 4J4HA 3KEOA 2B69A 3OM9A 4ZRNA 3L4BC 4H16A 4XQEA 3TOXA 3UICA 1NBOA 3K73O 2X9GA 4WOJA 3DAPA 5B37A 4A03A 1C1XA 3LF1A 5AQ1A 3INGA 3BTUA 5G0SA 1TI7A 2WWRA 3U4DA 3TZKA 4II3A 3WGHA 3WNVA 5KJFA 2Q45A 3QVWA 1Y9EA 4TMFA 1GQQA 3K2BA 5DP1A 1NQAO 1VKNA 5GY7A 1LDBA 2DUWA 4QTZA 2R6JA 4YJGB 1PQUA 3AK4A 3DMYA 4K9DA 3IKVA 4M87A 3ZV5A 1BW9A 1Q7BA 1K5HA 6ADHA 1NQTA 3BHIA 1A9ZA 2X9VA 4R1UA 2R2GA 3OJEA 2TMDA 1SZJG 4WGGA 2P9EA 5ES3A 4OYRA 2WE7A 5LCXA 4MVJA 1CETA 1IE3A 3WYEA 3CXRA 2Q46A 3RU7A 4FJ2A 2A94A 3GK3A 1ZH8A 3D4PA 3E5RA 4PFJA 4CR6A 1AE1A 1T1SA 3DTYA 4U7WA 3TQHA 3AY3A 1P33A 3EAGA 4BNGA 1T2AA 4D44A 2P9GA 3ONDA 4R9RA 5EMHA 1PEDA 2VNSA 3W6UA 4AFNA 4R1NA 1UAGA 2ZB4A 1UDAA 3CMMA 1LRJA 4J7CA 1HYEA 1XYGA 1H6AA 1F17A 4ZICA 1N7HA 2C7GA 3VH2A 3ZNNA 4AJ2A 3NKLA 4YAIA 1CIVA 2X5JO 3NJ4A 1QLHA 1ADBA 3WTCA 1CQIA 4P38A 1UH5A 2VWPA 3VPFA 4FGSA 4FFMA 3FNGA 2ZTUA 5L53A 3VVCA 4YAEA 4WEQA 1CF2O 4DL9A 4FPXA 2Z95A 3RSHA 3LDHA 3CMCO 3WGOA 4CQLB 3DAFA 3MJCA 4CV1A 3BMOB 5KWEA 3PVZA 5G0VA 9LDTA 2H5LA 4Z3DA 2Q2VA 1NQOA 4NBVA 4NFSA 1YB1A 1VJ1A 4R68A 2OL4A 1JAYA 2RBEA 1GQYA 1MA0A 3PEFA 5IFLA 3UOGA 3JD4A 4C7JA 5JC1A 3FR8A 2GUGA 2DTDA 1C0KA 2EP7A 3HUDA 3CZMA 1BVRA 4AJ4A 4YAGA 2DKNA 1KVRA 4YJHB 1LSOA 2Y99A 3W8DA 3CTMA 5DDIP 4JK3A 1VRWA 3ZNOA 4CMBA 3DQPA 1MB4A 2VHVA 4NZ9A 3DOJA 4L4SA 2GD1O 1HKUA 1KY4A 3RFTA 3VH4A 5IDQA 2D3TA 1CQJA 2CDBA 1N92A 3PWSA 1YKFA 1Q0QA 4DPMA 4J7UA 5C7IO 4RVFA 4GX2A 4M54A 4NJMB 1EBFA 2C0CA 1BXGA 2VOJA 1ENOA 2YHIB 3AOEA 1KVQA 3VZSA 1EUCA 2VZ8A 1N1GA 1B26A 2GZ1A 2QQ5A 3VKUA 2C5EA 2WEKA 3ZWVA 3F47A 4RL6A 5K6AC 3GMDA 4XB2A 5T8KA 2QX7A 1NTOA 1PIWA 2X4GA 1BW9B 3PP8A 3GMSA 3IKTA 1Q1NA 3FF4A 1J49A 2BGLA 1PS0A 1P0FA 3BMNA 3GVXA 4JLWA 2X5OA 2X5KO 1NR1A 4IDAA 4KP7A 4LGVA 3U09A 4OOFA 3RFVA 1Q0HA 3QWBA 4JROA 3EVTA 5IJZA 3WXBA 2IE0A 4XB1A 2R00C 1Q0LA 8ADHA 3TPCA 5AVOA 2GN9A 1ISIA 2O2YA 3JQ8A 3OMLA 4IXWA 3V1UA 2Q49A 4MO2A 1A4UA 1SOVA 3H4VA 3L07A 3PFWO 1OAAA 1H9AA 3RROA 4B4UA 1XSEA 4F45A 3FWNA 3K5PA 4J9UE 3EZYA 3ZV6A 4BNMA 1CWUA 2YFQA 3GN2A 3OJ0A 2C7VA 3QV1A 1DFIA 4N5NA 2NTJA 1EDZA 1DSSG 3WFIA 2ZIZA 4EUFA 5A3VA 1QV7A 1LXCA 2RH8A 1U2DA 1GCUA 4PLYA 4URFA 3RD5A 4S1VA 5L7YA 1MXHA 4DVJA 4DTIA 2O3SA 1D1TA 4RF2A 4CV2A 4HKTA 1Y1PA 2PNFA 2Q4BA 2V65A 3D0OA 2NVWA 2YUTA 3G0OA 1YQGA 3CKYA 4R4JA 1NASA 1U28A 4U0KA 3ROPA 2EW2A 1WDKA 5FI5A 1GUZA 2JKVA 4Z0PA 4ALKA 4B4WA 1SBYA 5KVSA 5BQFA 5JCXA 3Q9UA 2EW8A 3C24A 1EFLA 5THQA 1YVEI 3OICA 4BGUA 1I30A 1B0AA 1U3UA 3ANNA 2JD0A 2WD7A 2Q1TA 2VZ0A 3C3XA 5FWNA 5JY6A 3NUGA 1E7WA 3RC1A 3UFXA 1Y9AA 4JIGA 1P1KA 3NYWA 5K6AA 1IYZA 3AOEC 2I6TA 2XPCA 4CUZA 1ARZA 1PTJA 4MP8A 3WGYA 5ICSA 4A27A 2BLLA 2BRUA 3DHNA 5FEUA 4YR9A 1PGOA 3PHIA 2NNLD 3KRTA 3F3SA 2Y1EA 4OXYA 5H81A 4Y67A 3IDSA 4BHTA 5TLSA 1TT7A 4RDIA 1E0DA 4XCVA 5IDYA 1R6DA 1JN0A 3ZHXA 1RM0A 4AJPA 5BSFA 3F5SA 3SVTA 1Q7GA 5DCYA 5AXAA 4CM7A 4J0FA 3EMKA 4R16A 3W8EA 3GUCA 4YRBA 3WNQA 3CINA 3QWIA 1LBEA 3ADOA 3I9MA 3AWDA 1LI4A 4BKQA 3KTDA 4E5PA 3KXDA 1ADFA 4BQPA 4NJOA 2I3GA 1P9LA 3UKOA 1KVSA 2V6GA 5ITVA 4BKRA 4MIOA 2GN6A 2FMUA 2RCYA 2PA3A 3H8VA 1LLDA 4Y8VA 4Z0TA 5GMOA 5F21A 4CLOA 1YRLA 4AJHA 3KEQA 4O0LA 1LX6A 1P1JA 2VZ9A 3V1TC 1YH3A 2ZTMA 1E7SA 4DYVA 5JSFA 2C29D 4WEOA 4WASA 4L9RA 1NFQA 4B8ZA 1B8UA 5JAZA 1A72A 3JQFC 3KB6A 1A71A 1X13A 1K89A 4IM7A 5ENDA 3FPLA 5A5EA 2Q1SA 4RQUA 4BNZA 3ZU5A 2GERA 4RF3A 4I9UA 5CFZA 1HDYA 3ZHYA 3VTFA 2DVMA 4IPTA 4OOEA 2H6EA 3NGLA 3ZGYA 2EWMA 4CV0A 2GASA 1PJLA 5DN9A 1CJCA 3P7MA 1I36A 1N2SA 1V6AA 1GFSA 2VTEA 2BMAA 4XQ9A 1BWSA 3H5RA 3OBBA 4E2XA 2H1SA 3U4IA 1VE9A 4IIUA 4ZHSA 4Q39A 1BXZA 1P77A 3UH1A 1ZSVA 4W99A 1NP3A 3RBZA 2E49A 4KUHA 5JAQA 1E7YA 3E9NA 3PDJA 3WGZA 4DRYA 1NHGA 3ZHBA 3KVOA 4QXMA 5TT1A 2Y0EA 4BGVA 4MIEA 1JVSA 3M6IA 3PQFA 1H5QA 1EK6A 1NAHA 1IHYA 5JCJA 4FJ0A 1W4ZA 3WMWA 4NG5A 4XJSA 5I7SA 3F9IA 3WGGA 5KVVA 2E37A 3BXXA 3DB2A 4O1MA 2PZMA 4TWRA 3GN1A 5DCUA 3LU1A 4O6VA 1JAXA 1E3EA 1N1EA 1MXFA 1AHIA 1I3KA 2PKRA 4B8WA 2ZTVA 5EN4A 1E5QA 5HS6A 2Q2WA 4XYMA 2EKQA 1U9JA 3WICA 1JQBA 1ZXBA 1OC2A 3T4XA 2ZKLA 4ZVVA 1IULA 1Y8QB 2AW5A 2VYVD 4YA6A 1GPJA 3TZQA 3TSCA 4DREA 4B4VA 3OA0A 4DLBA 1P1IA 2SCUA 2W4QA 2W8ZA 2Q1WA 3ZU2A 4J1QA 3VKVA 3FTPA 2HLPA 3FBTA 3HJAA 1UR5A 2V6MA 1HXHA 4EZBA 4YT5A 3E8XA 4J7XA 4IS2A 4H7PA 1NQ5A 3JQBA 4PLWA 4R1TA 3VZRA 1EMDA 2X8LA 1PS8A 4OQZA 1BVUA 1V3UA 1M75A 1MC4A 2QRJA 1UDCA 3O03A 4DA9A 3GDGA 4FFRA 4WECA 5B4VA 1GV1A 2IODA 3UN1A 5KVQA 3W4IA 1C0PA 1LSJA 2EJVA 1JVBA 4N5MA 3IC5A 3HZZA 3K2EA 1VM6A 4YVFA 3JYLA 1DIHA 2FZWA 3IP1A 1CEQA 3WJ7A 2VYNA 1I3MA 3VPHA 3AY7A 4YEDA 5KOIA 1MG5A 2PTGA 2OXIA 4AJ1A 2HMTA 3H3FA 3SC4A 3QVTA 3R3SA 4IZIA 2WYVA 3UXYA 4QO7A 3ANLA 5KJ1A 2DTXA 1ISHA 4YACA 4PG8A 3DBHB 1I24A 3DZBA 4ALJA 3ZI0A 1PGQA 3M1AA 4F6CA 3K6JA 4NK5A 4Z9XA 1VSUA 3HB4X 1DB3A 2HK7A 3OETA 3RUCA 3H2ZA 3WGTA 2Y1CA 3GT0A 1VSVA 1Y8RB 3DWFA 2HMSA 3DL2A 3ZN2A 3Q2KA 1VC2A 3RUEA 3GY0A 4BKOA 2RAFA 2XOXA 1YL7A 5A3JA 1DEHA 1C1DA 4UEJA 4BNFA 4BO8A 1ULUA 4BUCA 1QYCA 1UXKA 1P45A 4R5HA 3ZWWA 4XGIA 3GUYA 5A1TA 1KBZA 2H9IA 5TC4A 3F1LA 2Z1NA 4LMRA 2BI8A 3WGIA 2ZYDA 2HMVA 4I5DA 1B3RA 5BT9A 4PG5A 4XRRA 4KUGA 4ZQEA 1ML3A 2H63A 4QSMA 2A35A 4CMAA 2I76A 3WMXA 2ET6A 2B36A 1ENYA 2D4AA 2HUNA 2UUPA 4AJLA 2O3UA 3D7LA 3PYLA 3U3XA 1CDOA 2AEJA 4OHUA 3TN7A 5JC8A 2C2YA 4BNVA 3NT5A 2G1UA 3OP4A 3L9XA 3QHAA 2ZTLA 2EEZA 4KTVE 1YS4A 3E6AA 4JXKA 4UEKA 3B20A 1VL6A 2RH4A 2YW9A 3S2IA 2DBRA 2X22A 1XG5A 2JFGA 4HBGA 1HTBA 2BELA 4WCDA 5IXYA 4WCFA 5TGDA 1AXGA 1WVGA 2VCYA 4CMIA 3IQDB 4OJNA 4LSMA 1ZUD1 3MWDB 4EJ6A 3K31A 9LDBA 4WLOA 7ADHA 2DAPA 1NVMB 2RIRA 4N18A 3JCZA 4NNJA 4ROSA 4JN6B 1X14A 1HWYA 2Q50A 5C37A 4B3IA 4FR5A 4XWYA 5FFFA 1GYRA 4XRGA 2YV3A 4CMGA 1WLYA 3RCBA 3TJRA 2QG4A 5JLAA 4YJFA 3BTSA 1CERA 2QZZA 3GNQA 1KEWA 1XCBA 2J3JA 5A04A 5ITWA 1P0CA 1MLDA 1HE2A 1SO8A 1G0OA 4Z3KA 2Y0CA 2EP5A 3NTQA 1FJHA 1T2EA 3OQ1A 4TKLA 2J5RA 2VRCD 3HFGA 4E5MA 1IHXA 1PJ3A 1U4SA 2FZEA 2PY6A 3JQ7A 3QA9A 4IUYA 4XX0A 5AXCA 1P1FA 3VPGA 1EFKA 3MEQA 1T25A 1T2FA 1SCUA 2BFAA 4GLOA 4KQWA 1N8KA 3OFSA 4Y6PA 5JMWA 3BA1A 3COSA 1HT0A 1E6WA 1DAOA 3UAGA 4J43A 2NTVA 2VT3A 1Z45A 4NBUA 2JL1A 4FCCA 3GVHA 3OEWA 1Q7CA 4L75A 4LK3A 4GVXA 4C7KA 4IXTA 4ZD6A 3I83A 3S2EA 1TXGA 4CMEA 3A28A 3BMOA 4PCVA 5F1OA 4Q3NA 3U9LA 4PLHA 1QV6A 3ZWAA 1S6YA 1LQTA 1E77A 2XXJA 2YV2A 1LC0A 4B7XA 4LMPA 4NU6A 1DJNA 4XR9A 1HE3A 1P1HA 1ISJA 1G0NA 1UUFA 1GTMA 4FC6A 1R16A 4CLEA 4J16A 3PLRA 1XR3A 5HS4A 4QFCA 2PWZA 3I9LA 3MCVA 3K96A 4MVJI 1EE9A 5LDGA 3LVFO 1ZBQA 2QYSA 2YJZA 4DXHA 5DP2A 3BMQB 3WLEA 1EBUA 4HXYA 1EUZA 4U0JA 4NJMA 4IS3A 7MDHA 2PKQO 3OJLA 3RKRA 3A9WA 4D45A 4KWHA 5JY1A 2X6TA 5KJ6A 2EG9A 2YHUA 3FBGA 1LLUA 4J6FA 3WDSA 2FHSA 4IJUA 5EESA 1XIVA 4BNYA 3Q1LA 3C7DB 4W6ZA 4DIOA 3GDFA 3DTTA 5GZ6A 5L9AA 2J6IA 2PGLA 2EHDA 4TKMA 2VHXA 1F06A 5L51A 1JLLA 2LDBA 4MINA 4RV9A 4CMHA 2ZB8A 1CRWG 1DOHA 2NWQA 3Q6IA 1UP7A 4OGWA 1SOWA 2NVUA 2NACA 4YJDA 4NQZA 1PZHA 3VOSA 3H5AA 3BYZA 3MJ4A 3JQ7B 1V9LA 1AGNA 3LLVA 1XU9A 1OFGA 1E6EA 5F1PA 4I5GA 1PGNA 1YOVB 3HFSA 3OQ6A 1UP6A 1PJTA 2XF8A 3Q9NA 5IZ4A 4DPLA 1HDCA 4YAJA 3WS7A 1H94A 4KZPA 4FC7A 5J23A 3GRKA 2X0NA 3D4OA 5G0UA 5JW6A 1LDGA 4RLSA 1HETA 4HFNA 1U3TA 2IYPA 3OA2A 1KVTA 3NRCA 4O5OA 4W7HA 1HDGO 4XIYA 4CQMA 1LSSA 3E03A 3GQVA 5L45A 1ZKMA 1YJQA 4CLRB 1PZGA 2AG5A 5A9RA 4QECA 1NWCA 2HK8A 2J5KA 4JBIA 3ZNQA 4WLNA 5CDUA 3PJDA 4NBWA 4GX1A 3VVBA 5F3RA 2PLAA 3AM4A 4K26A 1F12A 1P31A 2J3KA 4XDZA 1GZ3A 2VWGA 1TA4A 3LYLA 4HNGA 4XGKA 4FDAA 1D3AA 2X9NA 3ST7A 4YT2A 2PGJA 2HU2A 3WTBA 4UREA 3I6QA 3EZLA 3GNSA 4FOSA 4ZRMA 4BO7A 5KJCA 3GR6A 4G5HA 2D59A 5DT9A 3I4FA 5FI3A 3TNLA 5L7TA 4TROA 4BV9A 2HO5A 3WQSB 1R0LA 1O9BA 1KC3A 3CPSA 1IY8A 2GGSA 4D3FA 4KDEA 2CNBA 1JKIA 1NM5A 3DMTA 3LQFA 1PJSA 1R15A 2JCVA 4DYDA 1J5PA 2I67A 2O7SA 1ADCA 1C1DB 4NHEA 1NHWA 5T5QA 4BVAA 4WUVA 2PD3A 3GC6A 3BMQA 3K92A 4YQZA 4CR7A 4N5LA 4IQGA 1C1XB 6LDHA 2HRBA 1TLTA 2PZKA 4F6LA 4Q9NA 2OUIA 3PGJA 1SPXA 3D5QA 3AUUA 1IOLA 3UGKA 1V35A 3D3WB 4OM8A 3K8ZA 3PPIA 1ZK2A 2DC1A 1P1RA 5I9MA 1YJ8A 4RPJA 4YJGA 1OBFO 2B4TO 1IPEA 2IDZA 3UF0A 3N58A 1ZNQO 2AE2A 4BO6A 3AU9A 4IJWA 1ZFNA 4FJ1A 1ZO8A 4RF5A 4RVSA 3W1VA 4ESOA 4ND3A 3ROQA 1PL7A 1R4MA 1H2BA 1TT5B 5MDHA 2AQIA 3DBLA 3JQFA 2P2SA 3WLFA 1B2LA 3PHGA 1T24A 3K30A 5L4NA 5KKCA 2OO5A 3ITDA 5CDTA 4BNIA 3BMCB 1Y8RA 4HNHA 1J6UA 1DLJA 1U5CA 1X0VA 1C14A 3V8BA 2NUAA 4GKVA 5G4KA 1FK8A 3PYXA 2ZQZA 4Y9DA 4ZJUA 5U1PA 4XQCA 3IAHA 1B7GO 1EZ4A 1ID1A 4PZEA 2AHRA 1CYDA 1DFGA 1PL6A 3NEPX 1PGJA 5HTOA 2W2KB 4I9NA 1ZSYA 2Z5LA 1MGOA 4YB8A 5U4QA 3PQDA 3E82A 3KBOA 2G0TA 2WYUA 3DXFA 4HX5A 2O4UX 4RPHA 1A4IA 1F14A 3GH3A 4DQUA 5CP8A 1DIAA 3UUWA 1NFRA 1K3TA 1LDMA 4EITA 3DDNA 4NR0A 1D4FA 4E33A 4PLPA 5COBA 3TZHA 2CF6A 3E5MA 3E9MA 3MTGA 3ZCXA 4W9NC 1WWKA 3NDJA 4E13A 2ZB7A 3OJOA 3RBXA 2NU6A 1IL0A 2C82A 3HE3A 1PJ4A 2FR1A 4DLLA 2W2LA 3BHJA 1PQPA 3U62A 2B4QA 4ID9A 4E21A 1SEPA 1U7TA 2G82A 1EQ2A 5JDIC 4W82A 4KQXA 5JNLA 1Z6ZA 3TWOA 2G5CA 5JAIA 2Y05A 3P2OA 4NMHA 1DIBA 2DPHA 4YQYA 3MJEA 2NTNA 1JA9A 4INAA 4Q3EA 5JCJD 2AMFA 4PZCA 3EK2A 2UUOA 4AL4A 4CM3A 1X1EA 1E7QA 2ZK7A 1L1FA 4BKPA 1XQ1A 4FQ8A 3LT0A 1W73A 3S8MA 1M6HA 4YCAA 3RIHA 2DFVA 2NSDA 5L4SA 1BXGB 4R41A 1E3WB 4QX6A 4FFNA 1NYTA 2I3AA 3I23A 3X2FA 3QE3A 4HFRA 2VT2A 1H6BA 3DZIA 3JSAA 1FDUA 2CDAA 3I9KA 3VAZA 2JFFA 3GPDG 4E32A 1U3WA 1I2ZA 2B5WA 1U8XX 4EJ0A 4KWIA 1ZK3A 2YDXA 5T6BA 4XZ3A 3G3EA 3H2SA 1D1SA 4E2WA 1K6IA 5B4UA 5ADHA 1PJQA 4OSOA 1TT5A 1K6XA 3Q2IA 1XWFA 2I5PO 3O9ZA 4YRDA 4XYLA 1VL8A 1GR0A 3HDQA 4GVLA 3U4CA 4BB5A 1HRDA 5FF9A 4RF4A 4W4TA 3JD3A 1WP4A 3BMCA 1HDOA 3KO8A 5COQA 1VJ0A 1YB4A 1GUFA 2GR9A 4UVDA 3ZWBA 5B4TA 2UYYA 2CFCA 4BNNA 3QSGA 2VN8A 4MPDA 4FIZA 1T2CA 3U4HA 1LDYA 2B35A 3H7AA 1JW9B 1NVGA 3VH3A 2EKPA 5DNAA 1DHTA 1LU9A 1HL3A 4RO0A 4YT8A 1XGKA 5TT0A 4BO4A 4OXKA 3T7CA 4Q3CA 2Y1DA 3DOCA 4JP2A 3TZCA 1XEAA 4G2NA 4MKZA 2IZ0A 1FDVA 1YO6A 4BKUA 3MJSA 4XEHA 5L3ZA 3PRJA 3BHMA 4M89A 3G79A 4CM5A 4CR8A 2R00A 1A7KA 1NXQA 3M2TA 3KYCA 1M67A 2QYTA 5JXWA 2ZYAA 2BKAA 1GY8A 2FSSA 3IP3A 4LVUA 1Z73A 3HNPA 4ONEA 1KVUA 1K2WA 3LC7O 5A4DA 4WE3A 1FMCA 4RORA 1NAIA 1RJWA 2EGGA 4K6FA 3WX0A 1ULSA 2YQ4A 1GL3A 2CUKA 3SLGA 4PN3A 1MUUA 1W8DA 1T26A 1V0JA 2PK3A 4ALIA 3ZWOA 3JYQA 4RPGA 4Y6SA 1YQDA 2D5CA 3H5NA 3LT1A 1Y81A 3SEFA 4CMJA 1H6DA 1PWZA 4B3JA 4HV4A 3WGQA 2PH3A 2FWMX 2YYYA 2B5VA 4IDEA 1SEVA 4BNXA 3TOZA 3RUHA 3P2YA 2OP1A 1QXSA 1OMOA 1QKIA 4I08A 4NPCA 4FSHA 3RFXA 1MFPA 2VHYA 3FWZA 3E1KA 3GDOA 4R54A 4A7PA 2NV6A 2DFDA 1TB4A 3QVOA 3GRPA 1O94A 4BIIA 1ZK1A 1PJCA 3PI7A 4OSPA 3DZHA 2CF5A 4CLHA 4ZU3A 3R0IA 2PZLA 4CQMD 3TF5A 1KS9A 4IQ8A 2GO1A 1HYHA 3GVPA 2NVBA 2OHXA 4CM6A 3DMTC 3ANMA 3VHRA 3LC2O 3GGGA 3CH6A 2FOIA 3CSDA 2IZZA 1NPTO 1YL6A 2AQKA 3CUKA 3PDUA 3S55A 1IZ0A 3OIFA 5I8ZA 5IDXA 3ONEA 2BFOA 2EXXA 3HN2A 4IIVA 3NDIA 4MVJM 1UXHA 3ZNPA 1E92A 1U7HA 4GWKA 4XYEA 2NQTA 2ZCVA 4UEOA 4CQMB 4WKGA 4XYGA 2WMDA 1HE5A 2VUSA 1MC5A 1X7HA 1DHRA 2IEDA 5DBFA 3MJVA 1XQ6A 4LW8A 2NU7A 3V1YA 3RASA 3NAQA 1EVYA 1QORA 2YZ7A 4E5NA 1OI7A 1I3LA 1I8TA 2O3JA 2A92A 3PK0A 2VWQA 3R6DA 4R3NA 4A26A 4UUOA 4F3YA 5AOVA 1BDBA 2HAEA 1JU9A 4CM4A 2O50A 4BNWA 1H93A 1C3VA 1E1KA 4BV8A 4EUEA 3ITKA 4XGNA 4D42A 2VYVA 3DHEA 3HN7A 3PHHA 3JQBC 1GZ6A 5T67A 4E2ZA 1PZEA 1U4OA 2FN7A 3L6EA 2X23A 3Q11A 1MV8A 2IRWA 2LDXA 1Z82A 1MX3A 3SJUA 5EQDA 3F4BA 3GAZA 1C0LA 5JO0A 2GYYA 4JCOA 3WIEA 4AICA 4FFPA 2GZ3A 4GBJA 1EQUA 3RBVA 4CM4B 3I9OA 4BNLA 4D41A 4NDNE 2Y1OA 1O6ZA 4FB5A 2HJRA 2EF1A 2RHCA 4YT4A 2C2XA 2FPGA 1ZJYA 4J1TA 4S3MA 2Q4EA 3L4BA 2E4AA 3PIDA 4K1LA 4NU5A 2OP0A 4WOKA 3PTZA 5KTKA 1RM4A 3L0DA 3OIGA 4DBVO 4IZHA 2ZCUA 1LTHR 4ALNA 2QHXA 1MFZA 2IEBA 2WE8A 4ZA2A 2CDCA 4TRRA 5DOVA 5T57A 1UXIA 3AUSA 1DBVO 3F46A 2G76A 1UXJA 4LISA 3ZWXA 4I8XA 1NR7A 1KEVA 1MG0A 4BNKA 4A10A 4CUKA 4J91A 2BFMA 2ZQYA 3ENNA 4YXFA 3GG2A 4U6QA 4KOAA 1E3IA 2VUTA 3OSUA 5L4LA 1YWGO 2ILTA 3RUIA 2P4QA 4Z0HO 1H2HA 1XA0A 4OIMA 4CM9D 1FDTA 4BNHA 3AY6A 2VQ3A 4MJLA 1GU7A 3ZZNA 4KUEA 4UVGA 3NJ8A 3JQDA 4YAKA 4ZN6A 4ND4A 1XDWA 5A06A 1QYXA 4J49A 4AJKA 4BO3A 4CLXA 3QW2A 3F1KA 5EJ2A 5TNXA 1X1TA 2QIOA 1AXEA 2O3QA 5KJEA 4AJOA 1ZZEA 2VHZA 4YTEA 1GADO 4A5OA 1X15A 3JQEA 4TRMA 3ASVA 5DBGA 1PU2A 2GCGA 4BB6A 3EVNA 4WCFB 3UW3A 2VNAA 3L4SO 2Y1GA 2W2KA 5ER9A 1ZSNA 3VC7A 3JTMA 4FOOA 4J4TA 2Q1UA 1O8CA 3ZW8A 4CLOB 5A02A 1WXDA 4GSLA 3MOIA 2OORA 1B3BA 4RPLA 3B6ZA 5EINA 4Y98A 4UUNA 2W98A 4ND1A 1BG6A 2P4HX 5G0TA 3TFQA 5CPBA 4O59O 3ROKA 4WPGA 4H3VA 5CEEA 3X2EA 4DWVA 1BXKA 3I9NA 3NGXA 4J4BA 2Q99A 1QYVA 2O4CA 5A9TA 2I65A 4GAEA 4U8GA 2PFGA 4DPKA 4CM1A 3ZH2A 4IGEA 4P4LA 4MKRA 1WW8A 1YE3A 3QVSA 5BNFA 3BIOA 5TJ9A 2G17A 5KIAA 1U3VA 1LJ8A 2GN8A 4IMRA 1SC6A 3P5SA 3WWYA 2I99A 2BF7A 2XAAA 3WQQA 3TZ6A 5JYDA 1WMBA 2ZB3A 5IN4A 1EDOA 3E48A 3C1AA 1RYDA 2I66A 4WLUA 5H82A 5CG1A 2FSVA 4IJVA 4KDFA 1BMDA 4MOWA 3A1NA 4MIYA 4DBZA 4A73A 1PZFA 1E7MA 3Q0EA 3U49A 2B37A 3V5NA 1R0SA 5HWSA 1XLTA 4M55A 2Y68A 4Z9YA 4Z6KA 4G81A 2NQ8A 4BO9A 3OIDA 2JHFA 2Y1FA 2JCXA 3I52A 3IS3A 4PLTA 1PJBA 3W4KA 1ZCJA 2JHGA 3AU8A 1N9GA 5LC1A 3JQGA 4L4RA 2WD7B 3KZVA 3MOGA 2WSBA 4JJFA 2PR2A 4AG3A 2BH9A 3GHYA 2I9PA 1FF9A 2QRLA 4E4YA 3C7AA 2WJPA 1TVEA 3JV7A 4QUKA 3S2FA 5CDYA 3ZHZA 2PH5A 3L9WA 1GEGA 1GAEO 1UDBA 3H9EO 4LN1A 4RVUA 3DONA 4IMPA 3QWAA 3EUWA 4L4XA 1XU7A 3AUAA 3RUDA 1MP0A 3PLNA 3HWRA 2DBZA 5TX7A 3ZWYA 5KCZA 1RM5A 2D1YA 4CPDA 4Q3DA 1K6JA 2HRZA 4ZQGA 1QLJA 5I7VA 1LRKA 4W9NA 2HMUA 3ETGA 2UV8A 4E12A 1EVZA 2AA3A 3NTRA 3JYNA 3HDYA 3BTVA 3PJFA 4OKNA 4CMKA 2X7HA 1OOEA 3FRJA 4NFHA 4TRJA 3E18A 4WNIA 5L95A 1FDWA 3IJPA 3BAZA 1YDEA 3QIVA 4D3DA 2GF2A 3WIDA 4D0SA 4PG6A 4RVDA 3B1KA 3KYBA 3NV9A 1WZEA 3QWHA 3DFUA 4UUPA 4PLZA 1JTVA 1R4NA 4L8VA 2UVDA 1WNTA 1Q2XA 1YONA 2YDYA 4RPKA 1G6KA 3C1TA 3AJRA 2X1HA 1WDMA 3DO5A 4GGOA 3ABIA 3TL3A 2GRAA 4II2A 1YBAA 3TRIA 5BR7A 1HF3A 4OL9A 3MJTA 2QZ9A 1YOVA 1ORRA 4M86A 5CEJA 3GFBA 3JD1A 4M8SA 1BGVA 3PZBA 3C8MA 4JQCA 4AJJA 5COAA 1SB8A 3ICPA 4RZHA 1BTOA 3JQ6A 3A4VA 1L7DA 3LSYA 4D46A 1GYPA 1VPDA 2J5QA 2W90A 4Q3AA 2FRDA 5F1KA 2Q3EA 1O0SA 3D1LA 4E5YA 4RJTA 4ALLA 1GD1O 1N9GB 1D7OA 2CZCA 3LK7A 5EIOA 3PJGA 5C5IA 4JGBA 1U2GA 3LLSA 1VI2A 3KOUA 4E31A 4Z9FA 1U8FO 5A03A 4XA8A 2JD1A 4HFMA 3FN4A 4CM8A 1Y6JA 1OC4A 4TZKA 1YB5A 2GZ2A 1QR6A 2VHWA 5A9SB 4YJHA 2YY7A 5IXSA 2GLXA 4QEDA 2DT5A 1O95A 3MTJA 4P4GA 5IG2A 2C59A 3ZDFA 4MDHA 4QT0A 1IZ9A 3GGOA 3WYCA 3VZPA 4WLFA 3W6ZA 1V3VA 4HY3A 4R51A 3HDHA 4QQRA 1LDNA 1DLIA 3I1JA 3OQBA 1JWAB 1M66A 2PD6A 3RUFA 3I3OA 2BI7A 1X7GA 2V7PA 3ETEA 1DRVA 2PV7A 4I5FA 3AUTA 4MP3A 1H6CA 2NVUB 2WD8A 4E6PA 3WYBA 3NX4A 4NK4A 3HADA 3AFMA 1I3NA 4U5QA 2VTDA 4TSKA 3HG7A 1ZK4A 1Z75A 2CVOA 3TFOA 4UAGA 3KETA 2HMWA 3RC2A 3I9JA 5CEFA 3CIFA 3GGPA 3SX2A 5IZCC 3LT2A 4Q3BA 1T1RA 4PZDA 3GEMA 5JE8A 4NI5A 3PWZA 4JBHA 1R4NB 4XJTA 4DQVA 3DOOA 4GL4A 4JNKA 5GZ3A 2Q2QA 3C7CB 5CHEA 3FTNA 1LQUA 3UVEA 1GEEA 3FD8A 1QSGA 5EPOA 4YPOA 3CE6A 2JAPA 3DBHA 3FSRA 3KSUA 5KVCA 2V6BA 4LCJA 3AI2A 4MVJD 2C20A 5A5FA 4TVBA 1EK5A 1Z74A 2P9CA 1IB6A 4RDHA 3NT2A 5GZ1A 5G4LA 2AXQA 1O5IA 3O26A 2CD9A 1PR9A 1WPQA 4BS9A 1B14A 1E3LA 2ZYGA 3F5QA 2E82A 2WM3A 3BZUA 2NU9A 1Y7TA 4ZGWA 2FR0A 1HDRA 3PQEA 3TDKA 5I9LA 1SAYA 4EW6A 4GH5A 5HBRA 1T4DA 4MP6A 4YJFB 1V8BA 1WAMA 3GG9A 1E1NA 3DZFA 2PZJA 1FXSA 1HYGA 1ZMOA 3GZ4A 3F6YA 4KTTE 5EL0A 4DC1A 3H6KA 2NU8A 3S1LA 4G65A 4D43A 3CEAA 3WG9A 2A9FA 4HWKA 4WCFC 4BO0A 1A27A 3MWEB 4IDGA 4WK6A 5HA5A 5A9SA 2NM0A 1DDOA 2VYND 2DUUA 3IJRA 3PZRA 5DZSA 3RC9A 1QRRA 1NNUA 3D3EA 4FFOA 4J2OA 3DZKA 1GQ2A 2P68A 2HCTA 1YGYA 4J0EA 4GLLA 3RU9A 1XELA 1PQWA 3QLJA 2J3IA 1ZW1A 4E30A 3Q3CA 4MKXA 3L6OO 5DF1A 1J0XO 3OF2A 4BMVA 3OHSX 5BSHA 1ISMA 2FPIA 1GCOA 3KYDB 3D5TA 1Y5RA 1HE4A 4OKIA 3VDQA 4J1NA 3QWFA 2DTEA 4M1QA 4R1SA 2HJSA 3VPSA 5JYEA 3OJFA 3O8QA 2WYWA 3G1UA 2CY0A 4LRSB 2O48X 1H0KA 3JQGB 3PHLA 4JBGA 4BL5A 4EEXA 4I1IA 4XQGA 2UAGA 2DU8A 2B83A 2O3TA 3QRWA 4L0QA 4YYZA 1ZMTA 1R4MB 2B0JA 3DFZA 4RLHA 5TJHA 4PIVA 3DBLB 2PKQP 3D3WA 4RVGA 3T4EA 5FYDA 5THKA 3V2GA 5BSEA 1NWHA 2C5AA 3ROMA 3GAFA 4CMCA 3DBVO 3C85A 4DGSA 5TRTA 2AG8A 1N5DA 4LRTB 3O8QB 4B3HA 3T7EA 1QMGA 5TQVA 4KMSA 4IGFA 1AHHA 1NFFA 3GHHA 4OH1A 3U0BA 1F8GA 1O89A 4GPD1 1R37A 1SB9A 4EGFA 3EHEA 3PYMA 4PLCA 4MVJE 3C1OA 1ZVMA 5EERA 3IUSA 4GGPA 3M1LA 4P8RA 4CMEC 3DBRB 5H83A 3H9UA 1GZ4A 3GA0A 4U6SA 1I0ZA 3B1FA 1X7DA 1PL8A 4GI2A 3S2GA 1B16A 3WBFA 4NH4A 4TQGA 3PHJA 4JJGA 2DPGA 3D4NA 4LCEA 2AEMA 4L73A 3SJ7A 1KEPA 1SNYA 3IMFA 3RJ9A 1VKOA 3ONFA 3ZU3A 1T4BA 2X58A 2DQ4A 2IZ1A 3HSKA 1DIRA 4NBRA 3RC7A 2EIHA 3VZQA 4OO3A 5JAMA 3DZGA 2D8AA 4E5KA 1WMAA 4YDRA 5F5LA 5ER6A 1UZLA 2OFPA 1QYDA 2C07A 4YWJA 4ND2A 5IZCA 2C54A 2DM6A 4BNUA 1LEHA 5HM8A 3CZRA 4I9HA 3DR3A 2J3HA 2HK9A 1BDMA 4PVCA 1RM3A 1DIGA 2D5AA 1YXMA 3ADPA 3ON5A 1ENPA 3SC6A 1H9BA 4CL8A 4DIBA 3DAGA 1E3SA 2NLOA 1EVJA 4GMGA 4A0SA 4RGBA 1EUDA 1I5RA 3GEDA 2O3RA 2PD4A 1LUAA 2RHRA 3FNHA 3WOHA 4L76A 3B1JA 2HQ1A 3GPIA 2BFPA 1RPNA 5CG2A 3D64A 4EEZA 2POQX 4D0RA 4ZQFA 5KKAA 3ZV3A 4CJXA 4GX5A 1E3WA 1YQXA 3U5TA 1GUYA 4EUHA 3KYDA 3RUAA 3GFGA 5JS6A 3RJ5A 5CDSA 5IAAA 1GDHA 3O38A 1R12A 2AQ8A 2HSDA 4CMIB 3JQAA 2IXBA 1YDWA 1K0UA 1LRLA 4L74A 4DMLA 4D7AA 2UDPA 2ZJ1A 1DFHA 2AE1A 4IDDA 1B8PA 2D2IA 4ILKA 4JJIA 5I7FA 5JFOA 2VWHA 1A5ZA 3PXXA 1JKJA 5IF3A 4M49A 1UZMA 4R69A 5JDCA 2JAHA 3N74A 2BGMA 3GNTA 4FW8A 2YHIA 4IY1A 5DULA 3JQ9C 4WNCA 3IUPA 4ITUA 3KLMX 4R01A 3G17A 1I10A 4QO8A 2EGHA 5B12A 3F4LA 2CVZA 1N7GA 1E6UA 3NT4A 5LDHA 5TIIA 4GWGA 3KM0A 4TZTA 1P74A 1KERA 3JD0A 1KETA 4OAQA 1ADGA 1DC5A 3QP9A 1L7EA 4ND5A 5ILOA 2EKLA 4UUMA 5TSDA 3EC7A 2OOSA 1UP4A 1LA2A 2E48A 2DBVO 5DOZA 4CLDA 2XXBA 1PSDA 4QFDA 3EGOA 3W8FA 5C7OO 4AJIA 5K0ZA 3STHA 5JDIA 4ZQHA 5BSGA 2FPPA 8LDHA 4XR4A 3AFNA 3FNEA 5ENVA 5BNTA 1I2BA 1QYWA 1B8VA 4IBOA 1J4AA 1YBMA 2P5YA 4P4NA 3LZ6A 2EERA 3QJ5A 4RCVA 1T2DA 3JQ8B 5G4KB 2FY8A 3P19A 5EQFA 2JD2A 4E0BA 4WLEA 3ZWPA 1E1MA 1V3TA 2D0IA 3PGXA 4MVJF 4B79A 1G1AA 1Z7EA 5U9CA 1WDLA 5KNLA 1VJTA 5DCWA 3VDRA 4IINA 3ETDA 4TVOA 3RWBA 3HHPA 4IJKA 2CSUA 4BO5A 3V2HA 4IQ0A 1PX0A 3RAJA 5JBIA 2JFHA 3AOGA 3INRA 1PJ2A 4UVIA 1JKFA 3UHAA 4NIMA 1ENZA 1HEUA 3HQ4O 3KUXA 1BRMA 1RKXA 4OXNA 4BGEA 4BMNA 2X86A 1GPDG 3A06A 3RKUA 1U5AA 3PFFA 4B4OA 5JPIA 2Y66A 3AM3A 3SBOA 3ENKA 4DLAA 2YQ5A 3EYWA 1ONPA 5T64A 4EI2A 2O23A 3KV3O 5T8KC 1FDSA 2W2LD 2EV9A 5CAEA 2OMEA 3RI3A 4JX8A 1HLPA 4PLVA 5I9NA 2GN4A 3QVXA 1D8AA 1R66A 4N7RA 5CPFA 3GOHA 1IUKA 4IDBA 3KSZO 1I32A 4CQLA 1U1IA 3WFJA 4RZIA 4O63O 2BGKA 3KLPX 5CDGA 1E5LA 1I2CA 2Y0DA 4HP8A 1BHSA 4EJMA 3ICCA 1ONOA 4EBFA 1XKQA 1EE2A 1HZZA 3EW7A 4BO1A 3TL2A 5TF4A 2VOEA 1UZNA 3H65A 4R3WA 4F46A 3H9QA 2BD0A 2X0IA 3KSDO 1W0CA 3O4RA 3WQRA 1NPYA 3M2PA 4GX0A 4XIJA 2QRKA 1LSUA 5AXDA 4DMMA 3WR5A 3EY4A 4AJNA 1M6WA 1GV0A 4X54A 2FP4A 1NVTA 3WB9A 3PJEA 5JDCC 2VUUA 2NADA 1KEUA 1ONNA 2OZPA 4ZQBA 4BNTA 3OECA 1HDXA 1DC3A 5BNIA 1UXGA 3H9JA 3WSWA 1DC6A 2X0RA 1ZEMA 4FS3A 1E1LA 4W7IA 2GPTA 1E3JA 3R1IA 1RWBA 3W4JA 1M76A 3AI1A 3N7UA 4CLRA 2X0JA 1P44A 4UVHA 1KIFA 3I6IA 4D3SA 5F5NA 1Y5MA 4N54A 4OQYA 1DRUA 3FCOA 3WSVA 3DEYX 4PGFA 3FNFA 3IOYA 3KHUA 2J8ZA 4ALMA 1OZAA 1A9YA 4NFYA 3UCXA 1TEHA 4BQRA 3BMNB 4LVCA 1PS9A 3JQAD 5I7EA 2GDZA 4NBTA 4HUJA 1VLLA 1PR3A 2P5UA 2ZJ0A 3K9QO 5AXBA 4CL3A 3IIEA 2VRCA 2JCYA 1HSOA 3OEYA 1YBVA 1HSZA 2DLDA 1ZK0A 3IL2A 1DPGA 3AM5A 4BGIA 4DUPA 3LC1O 4IDFA 3QY9A 1DRWA 5MGBA 1PGPA 1ZXLA 3GVCA 4XDYA 4J9VA 4Y6RA 3FHLA 4FFLA 2V6FA
chains in the Genus database with same CATH superfamily
2VRBA 4DLKA 4EG6A 1A88A 1OBVA 3D8HA 1GOTA 1XD8A 2FV8A 3HB0A 5I3ZA 1GTG1 2AEFA 5AYVA 4F4UA 1B15A 2YICA 3J80A 1H2XA 3EZGA 4WSOA 5LVAA 2WPDD 2HJHA 4FBGA 4FGWA 1FJ2A 2PFSA 2A7QA 2H65A 4GMXA 4J2HA 3F3KA 4Y2SA 1KY5A 1WDTA 3EZ6A 3H3JA 4AB1A 1W0JA 4Y9UA 5LIRA 3NALA 1QJ4A 2GA9A 4CV3A 1Z0UA 5JQGB 4QU8A 3TLKA 1VL5A 2BMDA 1S5PA 4LZWA 1P3DA 2ZT8A 2VJMB 3PS9A 3VH1A 1BSVA 2BEVB 3G49A 4WBNB 1C3OA 3PKZA 4G1EB 5BV1A 3M3PA 4WK4B 3UY4A 1K8QA 4GSKA 3WL7A 3ZWNA 3ER8A 2XA1A 3QBEA 4X64B 2BAGA 1JG7A 2EBFX 3QITA 2K6GA 3G1TA 4TKUB 3O73A 5TPWB 5HQTA 3WJAA 4TLAA 2ZATA 3F5DA 3B6IA 3FCSB 1LPBB 3GJ0A 2CMDA 3H9BA 1AK1A 2C96A 2OBYA 3GZNB 3QQPA 3SGLA 4M8LA 1EWKA 2QM8A 5IDWA 4P4TA 2EW1A 4RVHA 1VTKA 4LSWA 1E0AA 3RRNA 2HSZA 4PVDA 1QIIA 5CR9A 5KTSA 2BFFB 2CZQA 4ZZ1A 1R4AA 2ZIXB 5B1YA 4OIFA 3TECE 3JRWA 1TZMA 2WV9A 5EEGA 2AD1A 3DOUA 4L9SA 3KVYA 1PV1A 3LK6A 5F4ZA 3BD6A 2G9QA 2H7XA 1WQ3A 3QVJA 1WZIA 2FP4B 1S7CA 2J31A 3NOVA 3Q7PA 4KX5A 3VTZA 5TEVA 2XDYA 3BH6A 3LHIA 4NMWA 5B3LA 4RTNA 3ZS9A 3HCDA 1L9XA 1NXPA 5DBIA 5TQJA 1VG1A 2F62A 1L7AA 3INTA 3RQSA 3BDAA 4M99A 1GUAA 2G8LA 1GM5A 1EJBA 4WZAE 4ZEMA 4Q4CA 4P35A 3BE8A 2N42A 1X1DA 2JVIA 4JP3A 4OJYA 4YCCA 2V97A 3ZU6A 4KR0A 4NV0A 4OP1A 2PGAA 2W6ID 2XGJA 2Z5VA 1MIOA 3O3CA 4GYJA 1EJ6A 1QHNA 1F8YA 4RY8A 1HG0A 3LF2A 5JARA 4C87A 2C04A 3A9UA 3ZCUA 2DEUA 1TM4E 2CFIA 1ZN2A 3G2JA 4Q9DA 3R76A 5H9WA 5K8JB 2CLHB 3B1YA 5E1BA 1ZW6A 3H1EA 1SUWA 3AETB 3IDFA 4QSHA 3HB5X 3HWSA 2ST1A 2YWEA 4MI9A 2QV0A 2QLLA 1E63A 3NKVA 2XMZA 2JCGA 1FTWA 4JEMA 3CO0S 2PT5A 4TTPA 5C7LO 3G68A 3VSBA 1YRQA 4A15A 3RS7A 3GLRA 3WWDA 2WUVA 2DSTA 3UKJA 4CETA 4MCHA 1NVBA 4HEHA 3ZZ1A 1PP4A 1ZGZA 2VQ6A 5P8WA 4BN5A 4OAPA 1UMBA 2H9AA 2H51A 2CXUA 3T5BA 4Q4JA 4J1SA 2YXEA 3JD2A 1PWEA 3R24A 5IEBA 4DC0A 4LF6B 1M2WA 4F4IA 2QY6A 1F4LA 4JDPA 2J9RA 4QYIA 4LI0A 1A7AA 2IFTA 1G9SA 4PC6A 1KR2A 4YRQA 2QRPA 3YASA 1C2YA 1KI9A 1P4AA 1ZIDA 2V8OA 3D6VA 3TKAA 1XK7A 1UAYA 4PQEA 3W05A 5JUWA 1PDOA 3ICOA 4H15A 2LPMA 3K9NA 2PDAA 4DM7A 1JJ7A 4BBAA 1W25A 1FXUA 2QLMA 2JNWA 1UT6A 1Q0RA 2WDZA 3L7YA 3NTXA 4JQOA 4BYGA 4MV3A 4F91B 1XFAA 4Y2TA 1HQCA 4EYEA 4TRNA 5EI5A 4OMFG 2B6HA 3FPCA 1NW8A 4IMIB 5L40A 4O2AB 1SVKA 3ESBA 2O8CA 5KNDD 3WRVA 1KDTA 1OWPA 2A2ZA 2HXSA 2J9YB 4BUJA 5CD1A 4K9OA 2NYVA 2R6R1 3ZWMA 4F8YA 3SS9X 1ZOIA 4CF3A 4RZSA 5LYJB 3DO8A 3CPHA 1RC1A 1EX9A 3NM6B 1IEWA 4CL0A 4YECA 1RW4A 3NRBA 3I01A 4DLTA 1KYVA 1USGA 3ZEIA 3ZWCA 3LCRA 4U8HA 3ULKA 1XVTA 3N0XA 2GSDA 2UKDA 2CXQA 5BRAA 2GEJA 2B69A 3OM9A 4MA0A 4ZRNA 4LF4B 1I1QB 4H16A 3TOXA 5KYXB 3EAFA 5B37A 3GXBA 1C1XA 5J5CA 4FDTA 4HX2A 3BTUA 5G0SA 4Y18A 2WWRA 1YS7A 5J4YA 2VYFA 3I4LA 3WGHA 2Z9DA 3WNVA 2V59A 4QG3A 3PENA 3EMVA 1JAHA 4Y6QA 1GUBA 5E9AA 5HIKA 3QVWA 3CH7A 1YC5A 4JHLA 1FPQA 3CEJA 3CWCA 1ZIXA 1GQQA 4QZVA 3LP8A 5DP1A 4LJ8A 2MCFA 1SUCA 4H60A 2VSNA 2IUUA 5GONB 2CNOA 2R6JA 4LGYA 3T5MA 4YJGB 3OTOB 3TTXA 4DKJA 3AK4A 1N8TA 4K9DA 4MUYA 1E32A 3IKVA 4NCAA 4PYIA 3HRKA 1BW9A 2XE7A 4OJKA 1K5HA 1JYFA 4QULA 5CYOA 2F43B 4MWSA 3L0ZA 4FFBA 4X65B 4ZCQA 1A9ZA 2XGOA 1N7IA 2YIDA 1QVAA 2N75A 4EKEA 1GARA 3SYLA 4MA5A 3HYLA 2P9EA 4F1JA 2PUAA 4FZJA 2WE7A 2BM1A 5ECYA 4MWZA 1FVOA 2FSUA 1UJ6A 1H4TA 1ODJA 2K2WA 1ZH8A 4MKIA 4CR6A 1G6OA 1Y1KE 3TH5A 4DDKA 5DLYA 1DAIA 2EBUA 1P33A 3AY3A 4OBWA 1T2AA 1NLUA 2C5LA 3IB6A 5IAEA 4R7TA 1H0RA 2VNSA 3PNSA 4AFNA 3O2SB 3PC6A 4CIAA 5EJ5A 2EWWA 4MB2A 4B7ZA 3K20A 1A69A 2O20A 1LRJA 2PUTA 1L1QA 2OG1A 4UHHA 2JJ8A 4DCJA 5A4FS 4R98A 1NYRA 4EGSA 4I6JA 1T29A 1H6AA 4QPJC 5ALXA 3E0XA 5D01A 3SIRA 3MIIA 3VH2A 1BWQA 3AXSA 1VKZA 3LWNA 1B93A 1N1MA 1XRLA 2X5JO 3M1IA 5HKLA 3WE7A 3ENZA 2GCOA 3ELDA 1QLHA 3I9V6 2FDCA 1OFUX 1GPNA 2D8MA 2HGZA 3FDIA 1L5KA 1UH5A 2VWPA 5E6RA 2VNJA 3VPFA 3FNGA 3MWKA 2PMWB 4WEQA 1MRNA 2ANBA 4R81A 3OZVA 3HA3A 1UMDB 4MH0R 4WJKB 2NU9B 1I2DA 1G8JA 1XMIA 2BZ1A 2CJWB 3KZCA 3WK4A 3BMOB 4JMPA 4CV1A 5ECGC 5DIFA 5G0VA 9LDTA 1PFWA 2HLDD 3B3AA 5EMJA 5HK9A 3QJYA 1HUQA 4R68A 4NFSA 1YB1A 1VJ1A 2OL4A 3HS3A 4LQCA 3FFTA 2QRGA 2OAQ1 3PIRA 1GQYA 3FJYA 4RJIA 4TS9A 5IFLA 4GNKA 5REQA 1IY1A 3VJRA 1C0KA 3LFTA 5EJGA 3ZIAD 1MVOA 3K1JA 3LGSA 5BW4A 4DLYA 3DOEA 3PEWA 4QAJA 1AKVA 4FYVA 3NHBA 2OYRA 4YUAA 2Y99A 1VP9A 1S2GA 4NCXA 3AR6A 4N8EA 2X4IA 5FR1A 1Q92A 5DDIP 5D1NA 1VRWA 3SZOA 3ZNOA 1X8KA 3DQPA 1L5OA 3JZFA 4NZ9A 1RR6A 1Q0ZA 3CCBA 3TXAA 1HKUA 1OVMA 4QHYA 3RFTA 3VKFA 1WKBA 2CDBA 2D3TA 3HCOA 1KO5A 3PWSA 1MA3A 3Q15C 2CC2A 2I6XA 2A7XA 2IGBA 3NAZA 4DPMA 4C88A 5EE5B 3I8OA 2ASEA 5I4KA 1L5FA 1ZUWA 3AERA 4J7UA 3SZ3A 1M1XB 1NV9A 4AF7A 4GX2A 3NMUF 2LKCA 4D9GA 1CHNA 5L3QB 1TTPB 3KDPA 1EJ2A 2Z2JA 3T9DA 2RGNC 5KOJA 5KTMA 2VJMA 2C0CA 2IZ6A 3EULA 3R5JA 4I1PA 3VU9B 3KQSA 5DNYB 4WBSA 2G4CA 1N5OX 3HKDB 5CA1A 1RAAA 5IH3A 3VZSA 3JU3A 1GQOA 2ZUVA 3VKUA 2ZETA 2R8XA 1Q1QA 1Y3CE 2C5EA 5IWAB 3F5FA 2HM7A 4HYQA 1RJ9B 5CCEA 1XXHB 5BORA 3LQ4A 4Z9AA 2QX7A 3CF4G 3SXUA 2DPLA 3NHKA 1UWKA 2RG1A 1PIWA 3KUDA 3MGBA 3PP8A 3QEOA 5GOZA 1Q1NA 3VKWA 1J49A 4I6GA 3WFZA 1P0FA 3BMNA 1KK3A 5DMHA 3U6KA 4URWR 4P36A 2QL7A 3EZXA 4GHWA 4I7EA 2X5KO 3ZIAA 1YASA 3C97A 4IDAA 4LGVA 2X8WA 4M8NE 3U09A 3M6VA 1ESZA 2I03A 2XE4A 2QUHA 3EVTA 3TZLA 3WXBA 3V6MA 4L85A 5E7JA 4AWAA 2FPPB 3T5CA 1KFJB 4JUCA 1A97A 5AVOA 2VAVA 3A25A 2O2YA 3JQ8A 3OMLA 1E64A 3OX2A 2Q49A 3L43A 5BUSA 3AVXA 1JQJC 4M6WB 1F38A 3H4VA 1EIWA 1FDIA 2UZIR 4B4UA 5LNK6 1CVRA 2B99A 2DSNA 1XSEA 2IBMA 3FHCB 5KKNB 3E7PA 1Z4PX 1L1RA 4J9UE 1V41E 2A6PA 3EZYA 4YJ3F 3WGNA 4BNMA 1CWUA 3MAGA 2JI9A 3OJ0A 2C7VA 2I1WA 2PYIA 3DFMA 3CZ4A 3LHDA 3P9YA 4GBGA 3ZDRA 4UJ3A 1NZJA 1OYWA 1UC8A 1VIAA 1R27A 1ZM9A 4KSYA 4PCAA 4TSFD 2PUCA 2V1UA 1U2DA 1TRKA 1XTVA 4OD0A 1OH7A 1MXHA 4LQLA 1D1TA 4UDNA 3KPWA 4J6EA 1BN6A 3KBBA 1L4FA 1IRXA 2FA9A 2PNFA 4IP0A 3VHQA 1PT8A 1Q1EA 2IYEA 1YQGA 5HX7A 5CJ2A 1XJQA 2EW2A 2QLFA 3FB1A 3K8YA 3ROPA 4D4HA 2WJVA 3VM6A 2BYTA 2X76A 1RLOA 5HE8A 5EXSA 3QE9Y 2JGNA 3AP1A 4TTTS 1WDKA 4ALKA 1RYNA 3TDNA 2J5BA 5KI6A 3CRW1 3ZS8A 3E22A 5KVSA 2G06A 4LY6A 2NZJA 3C24A 4FT2A 2Z2KA 1EFLA 2Q4DA 1YVEI 2FEXA 2ZT5A 4HMQA 3ZTTA 1I30A 4MVCA 1JQDA 2C2KA 3UC9A 4IOLA 2Q1TA 2VZ0A 4PQFA 4ASUA 2GEDA 3U1BA 3IXLA 3UGJA 4LGCA 3IMKA 4P0TA 4YRJA 4CDNA 1TQ2A 3IPAA 3I64A 3G1WA 4IIXA 2X42A 3QE0A 3P20A 4BP1A 3NNSA 2W0MA 1P2UA 5LJIA 2QI9F 3HYSA 1IYZA 2JFNA 3DEHA 3AOEC 2I6TA 3DVAA 4MP8A 2FTKE 2ZGVA 3PGVA 4FGZA 1A9XA 1WD7A 1S8AA 4LXQA 2H1LA 5B3JC 3COZA 4IRUB 3DHNA 2BRUA 3BB4A 5FEUA 4YR9A 1UIRA 3GD5A 1AQJA 3PRHA 2BMVA 4OGGA 4OXYA 3W3AA 3IAAA 4DMKA 2JGDA 4O25A 5DYTA 1I4LD 5FOWA 3SJBA 1D0IA 3O3MB 3AKYA 1T6BY 4BHTA 1RHQA 1ZVVA 2QD2A 4UFOA 5C9ZA 1JIUA 3O8NA 3RGWS 1E0DA 1WXEA 3DE7X 2R8BA 3LNTA 2SKEA 4HDSA 4PAGA 1U81A 4XCVA 4GOXA 1NSFA 4FUTA 1J8FA 3GI1A 3VR6H 3ZHXA 2D5BA 2F59A 2LXNA 3L0SA 2XAUA 2I4LA 3SVTA 5AVXA 2F55A 1TW3A 4MLDA 1EESA 5INTA 4J0FA 3EMKA 1SVWA 2JW5A 3DE5X 3P0IA 13PKA 1YK0A 1NZDA 3PICA 3UC5A 5TMPA 1KP2A 3FMGA 1L5GB 3WNQA 1GU0A 3QWIA 3O2QB 3GLFB 2O7RA 1AMNA 1FFXA 2B61A 2UVPB 1BX0A 1E9FA 4PBSA 3KTDA 3OO1A 2JBHA 3A36A 1D4ZA 1CPYA 2JEYA 2I3GA 3JWIA 4G0QA 1FSGA 1KVSA 3GZJA 4BQPA 2FRXA 2JFOA 3MJFA 2YVLA 5ITVA 1V26A 1AMOA 3BL5A 3EDCA 2I29A 3GJ5A 1NULA 3UAVA 1NRXA 1AZSC 1UC4B 4M0PA 3W2EA 2Q0SA 1LLDA 2BTEA 4OYLA 1GSHA 2IV7A 2HWWA 2CZGA 1USUA 3QPDA 4Z0TA 5CLHA 5CB4A 1OF1A 2QJRA 4O4JA 1OIWA 3W9SA 4CLOA 2E4ZA 1PVVA 3STUA 3EVEA 1LX6A 3J7TA 3KQWA 1P1JA 3ETCA 3FZNA 3W7VA 4DYVA 1YH3A 1BYIA 3HBJA 2H4HA 1CEEA 3KXPA 2EWVA 4XLTA 4AU1A 4L9RA 4A3SA 1QHHA 3HO8A 1B8UA 1P9OA 1QTNA 3DMHA 3JQFC 2FU5C 1QH1A 5F52A 5SICE 3ZDYB 1OASA 4C0QC 1L7QA 3V9PA 1A71A 4UC0A 2C97A 5AM2A 2B8EA 4MMZB 1IBSA 3IO3A 4KN6A 1RAFA 1S8OA 4L8LA 4G6ZA 1G8SA 3ZQ4A 3IURA 2GTIA 2WKRA 1I6KA 4XVRA 1N25A 4JI3B 1HDYA 1NBEA 2DKFA 2PXCA 5AW1A 4IPTA 4OOEA 4EMSA 4QXQA 4DKXA 4MS4B 1SXJB 3ZIDA 5LOVF 4O2AA 3VNAA 3NR2A 4CV0A 3L01A 5JAPA 3R4VA 3OT1A 4RD3A 1N2SA 3K9HA 1GFSA 1V6AA 2VTEA 1JPVA 1FU7A 3HCNA 4NF2A 1BA2A 3K2IA 4XQ9A 1MEJA 3N0RA 3TTTA 3H5RA 3L0PA 3KZKA 3U4IA 5BVHA 5HM6A 1BXZA 3Q7QA 1A8PA 3PUWA 1NP3A 1BE0A 1A2OA 1JEQA 4KUHA 4W5NA 4IWYA 3E9NA 3PDJA 2ZIVB 5IJAA 1NHGA 4IYRA 3KVOA 3OT5A 1XQ9A 3EWNA 5C4MA 4KXQA 1BO6A 1JVSA 4ISBA 1JTEA 5M7EA 2NX2A 3M6IA 9ATCA 2GF0A 4ZQCB 3ZQ6A 1EK6A 1NAHA 3HGTA 1PYDA 3DOHA 3IMGA 2XR1A 4JLNA 5ALJA 3IIKA 3RJTA 2WQ7A 1T15A 3I2FA 3ZGNA 3NANA 1QE5A 3D0QA 4NG5A 4QJIA 4UMEA 2I6SA 1JGTA 3JASA 2BFDB 2FW0A 2VHJA 3D7RA 5F7JA 4XJSA 5H3HA 1ZYUA 1YA6A 4QJBA 2FFQA 4FZVA 3WGGA 5KVVA 3I5AA 1FRZA 1U7DA 1DAFA 2ZPUA 3LKBA 4X97A 3TZBA 4MO9A 4O1MA 4QXPA 3V80A 2FDRA 1FNBA 1NVDA 1FUEA 4JHXA 4EHBA 1WOMA 3OM0A 2Z6QA 2XJ9A 4LC1A 1L7VC 2P9TA 3IVGA 3LT5A 5EN4A 3SHVA 5BWBA 3KOOA 3U26A 1P7WA 1VDZA 2QP9X 5FADA 1UFQA 2Q2WA 3F3MA 2F17A 1KYXA 2P3LA 4OA8A 3WB0A 3ITEA 3G9QA 1ZXBA 1QAMA 4GBED 4ZVVA 2W9XA 5FPKA 1Y8QB 3BWXA 3FB4A 5BWLA 5JBNA 1J0BA 3HM2A 1WPGA 1ZL0A 3DTVA 3TSCA 3ZCRA 3HCPA 4B4VA 3BXFA 4ZRDA 3SAJA 4U3JA 3OUZA 2OILA 2JFWA 2SCUA 1V71A 2Q1WA 3COYA 3FTQA 3HH8A 2D7CA 3IJEB 2MSLA 2HLPA 2ENUA 4J1QA 2JLXA 1N3LA 2OY0A 3O4GA 1GN9A 3E8XA 3DW3X 1NL3A 1OA0A 4JELA 1T8PA 3LMKA 5G1PA 1PS8A 1E2PA 2HBYA 4ZYTA 1RXVA 1YIDA 4OQZA 3RIMA 4CEJA 3L0IB 1U8TA 1UDCA 1XU4A 3O03A 4FFRA 4WECA 1K7XB 1MJGA 3CF4A 3KEGA 1L4NA 3QPVA 4B3CA 1JT9A 5J4LA 2CW5A 2GXUA 4MITA 2OFOA 1OGJA 1JVBA 2FOXA 1WCXA 3CNLA 3IAEA 3HZZA 3OVMA 4R9VA 4RZXA 5MHTA 1M2KA 1Y98A 1JSCA 1RMTA 4D4MA 3WJ7A 3JWGA 4NYIR 5HILA 1CHDA 3C3DA 1ACJA 5AO9A 2ZOSA 3AY7A 1XVUA 3L1KA 5AOAA 2BFEA 3ZVMA 3V4FA 3UGTA 1QYIA 2OHGA 3BXGA 1DBPA 5KJ1A 3UXYA 1J42A 1XWWA 3ANLA 5F98A 2DTXA 4YACA 2OCDA 1I24A 4ALJA 4FQ5A 1QBKC 3DOIA 4XFJA 4JT2A 4AMGA 4X9XA 1PGQA 1UBLS 4EY3A 2MWMA 4G56A 4MS3B 1TYAE 1Q11A 1D2EA 2XYQA 3HB4X 4NK5A 4DWWA 5JXJA 1DB3A 3NTUA 4X66B 1IBLB 1BFKA 1PL0A 4LECA 3UUEA 1NW5A 4ZC1A 1SIWA 1E9BA 2P2ZA 1YJ5A 4LMAA 1E5VA 3WL3A 4B5KA 1FY2A 5FHRA 3ZN2A 3E61A 2HA5A 3QFHA 5ICEA 3PNKA 3RUEA 3GY0A 1GSAA 2QXTA 1BS2A 4MI3A 4L51A 2EDCA 3CVVA 1C1DA 2FP3A 1JG4A 1T2VA 2G08A 2PRJA 3OOEA 3RSFA 4TS4A 1ULUA 4ZAYA 4DAOA 5LKAA 3KKZA 3NGMA 4R5HA 1M2JA 2A0YA 2VP0A 3MHPA 3NASA 3GUYA 3R23A 3ZWWA 2H9IA 3TCNA 5KYUB 1ZKDA 1LJLA 1OR8A 3FPHA 4PO8A 1H2RS 1ZNYA 2BI8A 3AJEA 3LH5A 3HCCA 3NYIA 4JVSB 4KQ1A 4MV0A 1U7XA 4N0PA 2IV3A 3S0JA 5KINB 4LDPA 1T91A 2HBZA 2PLWA 5IM4A 4KUGA 4ZDJA 1ML3A 2A1TS 4DBLE 1CRZA 1SU8A 4H27A 4AF6A 4CMAA 3G5TA 1QDLB 3E8SA 2ZSAA 3QY0A 2OAP1 3FLAA 1FXWA 3WL8A 2UUPA 2F1OA 3PYLA 3KX2A 2ZDHA 2AEJA 4G2TA 4LDNA 4MAMA 5I4BA 2G1UA 3EXG2 3MWDA 5BR1A 3L9XA 1NUQA 3T54A 3QHAA 1JDVA 1Z3IX 4MUBA 1ND6A 3LM8A 1P0PA 4YP9A 1TJPB 1AB5A 4XPIB 2XW6A 3NBMA 4UEKA 1LTKA 1AC5A 5DNCA 3S68A 3DKKA 3S2IA 4UCWA 4HUQA 1L4MA 3HJNA 1DT3A 2JFGA 2X22A 3DKIA 5DNUA 4AMVA 1YSCA 5IXYA 4D4JA 5TGDA 3DAHA 3SIXA 2DCUA 1D2AA 4X8LA 3BILA 4CMIA 2VCYA 1T35A 5B1EA 2JI7A 1TC1A 4KN5A 3MWDB 3K31A 1QCCA 3CLSD 4N82A 1NVMB 4N18A 1T3ZA 2J48A 4YP5A 2YOGA 3JCZA 3KJHA 1KO4A 4OB7A 2OV3A 1EZ1A 3KQHA 1RABA 4L5IA 1ETHA 4HNRA 5SZHB 1HWYA 2Q50A 5C37A 4XUDA 3L0BA 3P8ZA 1KKLA 4OUDA 2C7BA 4E5UA 1CUIA 4CEJB 1MTOA 3MUNA 4MLZA 4L8GA 1G17A 1GYRA 5FUWA 1V5FA 4J76A 1WLYA 4MI1A 4Q16A 2QTHA 1RRPA 3AO0B 3RE1A 4GVPA 1PFQA 5F33A 2JVJA 3BTSA 4NP6A 1IEVA 2QZZA 2JLWA 1XCBA 3AEXA 1P0CA 5E3HA 1HE2A 4NYMQ 3HY3A 3BEOA 4XARA 4FNOA 1JEOA 1G0OA 4IH4A 2ZSUA 4BU0A 2EP5A 4EX6A 4Z3KA 4CTMA 2H29A 2G5TA 2OCPA 4UM5A 1FXWF 1IMJA 1Y3AA 3I37X 1RU3A 5LP6F 4O3MA 4M8KA 2PEZA 1PJ3A 5TF4A 1X7YB 5M29A 2WJIA 5AHXA 4JV5B 3LOPA 1Z2DA 2QR5A 4MVXA 4Y2YA 2JH3A 1EFKA 3A31A 2ZE7A 3ESYA 1T25A 2WSSD 4TL6A 1D03A 4Y6PA 5BQ5A 1WULS 3BA1A 3COSA 1G21B 1D04A 2YXBA 2ZDQA 3FOCA 3H86A 3I0ZA 4K9PA 3UAGA 2VA8A 3ZGLA 4CN9A 2Z8ZA 3HJHA 5DCLA 1Z45A 4QRIA 3LUFA 4A8PA 4DNFA 4EWLA 1HV8A 2N1MA 1XMOB 4PW0A 1L5MA 2JFUA 4UBLA 3V97A 2ECKA 2H1WA 1MJNA 1S89A 1XTIA 4XI9A 2V9ZA 1Y5IA 3BRWA 3H2BA 2YWRA 3OPXA 4G0OA 4BAZA 3A28A 5KQPA 1I9CA 3EVAA 3Q2OA 4EA6A 1DEAA 1DJOA 3HEBA 4ND7A 4E09A 4B3GA 2Q6KA 1AUXA 1A3CA 1KQ3A 1QV9A 1BIFA 2PO7A 1GPH1 3L1UA 5E4TA 2AFHE 3AF4A 5DK6A 2JJ1D 3H4IA 3L8HA 4C29A 1R00A 2EQBA 4JP5A 5M2QA 2QD4A 4FGJA 1YHZA 4XR9A 4TXLA 1ILWA 4LSGA 1HNNA 2NXNA 1UUFA 4DTCA 2FE1A 3HJFA 1PT7A 1EP3B 4JUFA 1OGIA 1V4NA 3C3MA 4F1WA 1R16A 1YRHA 2IPLA 2JJ2D 2ZUSA 1XR3A 3DVRX 4QFCA 1MOPA 5TY0A 1NLFA 3R8CA 3FNQA 1AO0A 2XDQA 2I80A 2NZXA 5JQWA 1JHRA 1ZI6A 3TKYA 5BUQA 3T1NA 1AKTA 1DTWA 2X5NA 3BMQB 3WLEA 5CMLA 4DXHA 4HXYA 3HXQA 4JIMA 4GR5A 4EW1A 2B34A 5ED4A 1ORTA 4C4PA 1A9OA 4HSEA 4IVPA 3OEHD 3DDSA 4Q4HA 3CPEA 3IT1A 2Z58A 3A9WA 5AJWA 5JY1A 1PBTA 2EG9A 4FKZA 5CYPA 2YHUA 3ETNA 3S2YA 2QQ0A 5DHQA 2X7XA 3OPMA 2EFEB 4ZT2A 1LI5A 4YCBA 3OU6A 4BNYA 1WXWA 4W6ZA 1L8XA 3B3GA 4Y6GB 2Q5HA 3H1BA 3GDFA 3QU2A 3BWYA 4OHMA 4F6RA 2CL7X 4O2AF 4NATA 3DMDA 4FX2A 4XSGA 3WRYA 1EFAA 2FZKA 1IG0A 1YZNA 2NV0A 5HKOA 5L51A 4DA4A 1JLLA 1OFTA 2LDBA 2VO1A 3ESXA 4RV9A 4X20B 5KOIA 2XZPA 3LLCA 4XTCS 4QOEA 3DE2X 4LZOA 4B32A 1BU5A 2BKVA 4M1YA 4GYWA 3THWA 4R0NA 1M2VA 1BU8A 3WGLA 5K2OA 3H5AA 4L02A 3MJ4A 1D6NA 1V9LA 1AGNA 1AGYA 3JQ7B 5A6VA 5L8VA 4CVNA 5LP6B 4PYOA 3TZEA 5ELLA 5IULC 2B8NA 3LC0A 1MX1A 1RDFA 5DI3A 1Z7WA 2WJYA 3UPDA 2G9ZA 2N3ZA 4DJ5X 5IJ9B 5JCOC 2OCKA 3H13A 1J8QA 3VJMA 5KOYA 3IA7A 1HDCA 1X7ZB 3ZHTA 2XKBA 5J23A 2PL5A 3JALA 1MPTA 3D7KA 3HI4A 1V2HE 2HLHA 3T0FA 2BTQA 3IGFA 1LDGA 2JBAA 1QONA 3C39A 3L7IA 1JH8A 5CRIA 1MB3A 1U3TA 4WY5A 2IIVA 5EFZA 2N0SA 2IYPA 5A7GA 1X7YA 4EL0A 1HDGO 1E1RA 4HQNA 3CRRA 4CQMA 3VGPA 2RKBA 3TXYA 4DSZA 3CHYA 5L45A 1JMYA 3EGCA 1S3SA 1YJQA 1H2YA 1VSBA 2AG5A 3LTEA 3NUZA 1NWCA 4MYHA 2DLNA 2QXUA 2ZI3A 3ZGOA 1J5XA 3AR7A 1XXLA 3PJDA 3QTTA 4UZEA 5DWQA 4FR0A 4KQMA 2PBLA 5DV9A 2QU8A 2IPXA 1G7CA 4JLPA 5F3RA 1BWPA 4O08A 2WD9A 3RG8A 4F2PA 1O0BA 2YC4C 3E05A 1X74A 2Z5GA 3F78A 4HNAB 4KACA 2ORIA 1J8DA 4K40A 2EYUA 5JAOA 3LYLA 1OZHA 3CX6A 3MSCA 4O2BF 3T3IA 4A0RA 3KSMA 5F3DA 3M5PA 4L4YA 1D3AA 2VQDA 4YT2A 4DV3B 3FDFA 3FKJA 1K7SN 4WBNF 5K0EA 2GS9A 1ODTC 2N47A 2D59A 4PYMA 2B98A 2YY6A 3L46A 3E15A 2H00A 3LLMA 2C5HA 1C3LA 1MNQA 4MS3A 4AD8A 4Z53A 3H1AA 3ZY4A 4DILA 3CM0A 4TROA 3SM3A 3UJHA 1GZ5A 3HCRA 4FT4A 1OXTA 5J4HA 2HO5A 4B31A 4CDGA 4KQ6A 1Q83A 3CPSA 1USKA 4D3FA 4HN4B 4RK0A 3KS9A 2IZ5A 2C5GA 2CNBA 4HQOA 1JKIA 4DCMA 4PBTA 3DMTA 1GTJ1 1BZYA 1R15A 5EHGA 1HR0B 1ILEA 2JCVA 2X0DA 3Q8LA 4P7JA 4DYDA 2ZYHA 5HF6A 1GA4A 2IPMA 1ADCA 1SXPA 1J7KA 5T5QA 1RXUA 5EC8A 2JEOA 4WUVA 4JT9A 2FW7A 2XY4A 1NONA 1V48A 3O9MA 2P90A 3OI7A 4REQA 2AWNA 4QGGA 3DD5A 3K92A 4LC0A 4WESB 2O5EA 1ZD3A 4IQGA 1QZTA 3V8NA 2MHCA 1U2EA 2QEQA 3ET4A 3IKMB 3K9BA 3V4RA 5EP4A 2ID9A 4KIJA 3OAAA 3QUTA 1OKKA 3OTHA 5H0IA 5KYTA 3EXIB 1EGHA 1FZTA 4JOBA 1V95A 2OUIA 2FUCA 1UKVY 1G4AE 4KIGA 3AUUA 1IOLA 1GZ7A 1YR7A 2O8VA 3UGKA 4TXMA 4MW1A 4D3YA 2YXLA 1Y4DE 2DQKA 3STTA 3PPIA 4EMUA 1XLWA 1QE3A 2DC1A 5JSKA 2ONJA 5I9MA 3RAFC 3H11A 4OKSA 2FQQA 3PE6A 4ER7A 2B4TO 4M9UA 3U61B 4K1XA 2W6PA 2J41A 2CVFA 2VAXA 3P2KA 2DFTA 4IJWA 4CIBA 4FJ1A 1ZA1A 2A1UB 4P0QB 3AEYA 1GGMA 4EATA 2HJ9A 1PL7A 2V7QD 4HDMA 3OKFA 1NSTA 3OX1A 1H2BA 3U9SA 1TT5B 5CDFA 4BBJA 4DR5B 1O6GA 3DBOB 5EMNA 1GLVA 5K8IA 3ASZA 2R6DA 2H0QA 3BZBA 4ZVSA 1MAHA 1WUTA 2R4UA 3OUTA 4HAZA 2FEKA 4CXMA 3MGAA 2I3BA 4G1CA 3DPSA 1R0BA 2IHVA 4P4UA 4RFLA 1FQOA 3OEHA 4LRXA 4RNCA 4BNIA 4U7HA 1N2IA 3FLBA 5C4IA 5CDTA 4PSKA 5LNK1 3BMCB 3ZD8A 1RVDA 1UWCA 1U5CA 5HUJA 4AQ7A 4BWFB 3NHMA 4LYDA 1SULA 4G5XA 4PU0A 1U0LA 1O58A 3T1OA 3PLAE 4WN3A 4D96A 1G9XA 2FSHA 1SD5A 2WB4A 4XQCA 4BWGA 1U6JA 2H52A 1UJCA 1SCNE 1U31A 4JLKA 4JJAA 1T1GA 4PZEA 4ZZ0A 3S28A 1LVGA 1SD2A 3K16A 1YT5A 2QRUA 5A3SA 1TYZA 2F9FA 5HTOA 5DASA 1NTRA 4WY8A 1FSSA 4AZTA 1DEOA 2QT1A 3RK4A 1G21A 2B5OA 5K3FB 3KBOA 1EFPA 2QVXX 3K6KA 3Q6MA 1A4IA 4GXTA 4I1SA 2VUIB 2PX6A 1RQLA 3BXZA 3ZCQA 3K0HA 4DQUA 5F4BA 2GARA 1HNZB 1NI4B 1NFRA 1NOIA 2O1WA 2PSHA 1NXWA 3EIWA 1XRRA 3N07A 4HDRB 3SSOA 1Y5NA 4KR6A 2HU8A 4OQLA 5HRAA 4N48A 1AO3A 1UKAA 2O5RA 4NR0A 3TZHA 5EIWA 3E9MA 3HKEA 1OH5A 1RWNA 2RGGA 3AUJB 3B12A 3DLPX 3MTGA 2QKYA 5GAJA 3K9WA 4OHZA 4ITRC 3TLAA 2Z5FA 5ALZA 1TCVA 5CFNA 5DHRA 5FI0B 5REQB 1NI5A 4K9MA 4QDZA 5AJZA 3W06A 2D5LA 4IHAA 3SD7A 4DLLA 2W2LA 3KKLA 2G1PA 2B4QA 2GK7A 3AKEA 1IIBA 3C7KA 3L05A 4E21A 1TZCA 5EUQB 1XZQA 1DELA 1MO4A 2X1MA 2UVQA 3R9XB 1Z6ZA 3TWOA 1CX9B 2JKZA 4K9NA 3ZH9B 4NMHA 4FZ3A 3HO1A 4P54A 3JS5A 8ABPA 3OZUA 3EYAA 3QMVA 5EJAA 2OA0A 2ZSHA 2QP4A 4R1OA 1JA9A 4BASA 2XBMA 4OP2A 4Q3EA 1KRWA 1UJ2A 5JCPA 1Q7RA 3NBKA 1JYSA 2AMFA 2BHTA 4PZCA 4AL4A 1X1EA 1URPA 2PFKA 4FQ8A 1OZGA 3CVJA 4GYYA 4R8RA 2NSDA 5ALMA 1QO7A 3L8EA 1W35A 3Q4GA 3FKSA 2NUPB 1R3UA 3UJDA 4LDJA 1Z36A 5LQCA 5EUMA 3TCXB 1E2GA 3GRAA 4KGDA 4E6EA 1Y7LA 3WLJA 3GLGE 4CEHB 2C3PA 4BVLA 3MINB 4GRDA 2XQFA 2A14A 1DTSA 2Q29A 3JSAA 1W93A 3BFJA 3HXPA 1EDEA 3VAZA 2EBWA 1BHJA 2XCTB 3BIJA 1XZJA 3GPDG 2EFDB 1V3QE 1SCBA 2YJ5A 3WGUA 2QBYA 1KAGA 3WB1A 2B5WA 5J2UA 1U8XX 4L3VA 4Z4CA 1XAIA 4X84A 2AJBA 1L8AA 4XZ3A 4ER5A 2B9EA 3OFND 1DBQA 2LE0A 3IIJA 1XD2A 4BC0A 3HEMA 2HW8A 2I2FA 3IBYA 2QX8A 4TLBA 1KJNA 4Z7NB 2G70A 4BLPA 2GKOA 4Y2QA 3TAHA 1BE8A 1ISPA 1ZMXA 3F4KA 3FPAA 4OSOA 4ZIRB 5B4UA 2R47A 3Q2IA 3MINA 3EEIA 3CNBA 3QENA 5KSOA 3WYNA 1XWFA 3O9ZA 4YRDA 4XYLA 4ZOBA 3DYVA 3GCGA 2XUFA 3RYCB 1QRDA 3B9QA 4B84A 1GR0A 3G2KA 3HDQA 4GVLA 3U4CA 3WA6A 1HRDA 3F6RA 5FF9A 5GONA 4BB5A 1U63A 1GCGA 5IC4A 4KO3S 2AF3C 1I6LA 1G5RA 4CG2A 4HGOA 1NLMA 2HL6A 2QTAA 4BQEA 3SFZA 1VJ0A 1X8JA 3RW9A 2QENA 2HA4A 3IJ5A 2B4AA 3I5XA 4UVDA 4TKZA 3VU1A 3ZWBA 2LNDA 5B4TA 1N2JA 2J1LA 3I8SA 3G7NA 2BFBA 4JR0A 4XWWA 1E6KA 1JILA 2ZI4A 4FZRA 5CB4F 3GWZA 4FIZA 1T2CA 1Y3HA 4MRNA 2W83A 1JW9B 2G67A 3SY8A 2EKPA 3C3CA 8GPBA 2C2GA 1HL3A 1XEWY 4YT8A 2NXCA 3BORA 1XGKA 2VAWA 4FLEA 1Y6ZA 1ZLYA 3HMQA 4YGYA 1UKZA 1ONBA 5FXMA 3K9GA 1KRHA 4Q3CA 1GRNA 4JP2A 3C70A 3TZCA 1GSOA 3U4QA 5KZMB 2IZ0A 3I5UA 1FOEB 3MJSA 1P3JA 4XEHA 5L3ZA 2BGWA 3BHMA 1CE8A 3HZRA 3P1JA 4CR8A 3N2GA 8MHTA 3NP9A 4F2DA 3M2TA 1DWQA 2R62A 3C3EA 3W04A 4KJZA 3ZWKA 3ACCA 5FORA 1RRMA 2BKAA 4IIHA 1L4YA 5B1HA 3IP3A 1CZKA 4LBYA 5B6IA 1SK8A 2O0HA 5GP1A 1KVUA 2CLLB 3OLYA 4XTRA 4RORA 5IC5A 1RJWA 3D43A 3WX0A 4QQKA 5J2TB 3LV8A 1NY5A 2YQ4A 2RIPA 2BFNA 2F1IA 4PQGA 1NMYA 3E9RA 5HKKD 2JBWA 2HBRA 1BEUB 4ALIA 1O77A 2XMQA 5BMVF 2YUIA 3I01M 5KYWA 2IW1A 4N6NA 1Y81A 3M49A 1H6DA 4B3JA 1ODIA 2XTNA 1ULZA 4EMBA 2P78A 3DE4X 3TW4A 3O8DA 2YYYA 4HLUC 4BNXA 1QK4A 3V00A 4GO1A 1XZHA 3BQMB 3NCHA 3VVMA 5L3SA 2WP0A 4E08A 1AY0A 5F73A 1PO7A 1OMOA 1QKIA 1KO1A 3NVMB 4NPCA 4QLOA 1E3QA 4REQB 4A8TA 1ZOSA 4FSHA 5J2TA 1UCFA 1BVHA 4A7PA 1VKRA 1V8PA 2DFDA 4JKIA 2AC2A 3B6KA 4RUKA 3RU3A 2ZM5A 1Z22A 2QDKA 2QOEA 4JVMA 4LXYA 4YRLA 1WD5A 3BQNB 3TVDA 4JYZA 1MJFA 2JLUA 4MDFA 2WPDA 3UXHA 4CBVA 1XHFA 1E1RD 3AONB 2PX4A 1KS9A 3F67A 4NOJA 4CQMD 2UYOA 2B25A 3ZE7A 2YHBA 1XZKA 4OL0A 1HYHA 4TV8F 3OQVA 2OHXA 4RS4A 4C5AA 3FCXA 1JAIA 4KU4A 1GGFA 4CM6A 1JPJA 3RVQA 4URZR 2YXPX 2PT6A 2YN0A 3JQRA 2ORYA 4ZOEA 4UM8B 4ZCMA 5FA6A 3LC2O 4JX9A 3GGGA 2RK3A 3B13B 3DDZX 3E3NA 4WFJA 3B9PA 2I6UA 1M0SA 5I8ZA 2IHNA 2BEUB 2BFOA 1CIJA 4GOJA 4MVJM 3SICE 4UM9D 4XWGA 1UXHA 1U7HA 2GOYA 4GWKA 2ZCVA 2OPHA 1HFKA 5D3MB 5KNDH 4UAVA 3DLIA 4CQMB 4NCJA 1XJCA 2BT4A 3PNBA 4WKGA 1YFZA 3IHKA 3AVVA 3BAFA 4YJ3B 2B0CA 1TAQA 4M0KA 4N49A 3C16C 2CXOA 4ZI2A 4JENA 4YRGA 1UC5B 1DO2A 4JB2A 2NU7A 3OZBA 2AH5A 3CZAA 3RASA 3V1YA 3AVYA 1EVYA 3A6PC 1T0JB 5AR1A 2YZ7A 2ZI5A 3LFUA 1VZ2A 4OPMA 5EXTA 1GWNA 2X1VA 4Z4QA 1E3DA 5EJEA 5AUPB 3G9ZA 3TFWA 1TQHA 2IU0A 2I54A 2OGZA 3A7DA 2R3SA 4AYTA 4QFBA 5LZ4A 3I9FA 3FM9A 2WILA 4F3YA 2Q6OA 5AOVA 1Z37A 2A3NA 3AQ4A 1BDBA 3QKUA