2BGMA

X-ray structure of ternary-secoisolariciresinol dehydrogenase
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
267
structure length
267
Chain Sequence
TNRLQDKVAIITGGAGGIGETTAKLFVRYGAKVVIADIADDHGQKVCNNIGSPDVISFVHCDVTKDEDVRNLVDTTIAKHGKLDIMFGNVGVLSTTPYSILEAGNEDFKRVMDINVYGAFLVAKHAARVMIPAKKGSIVFTASISSFTAGEGVSHVYTATKHAVLGLTTSLCTELGEYGIRVNCVSPYIVASPLLTDVFGVDSSRVEELAHQAANLKGTLLRAEDVADAVAYLAGDESKYVSGLNLVIDGGYTRTNPAFPTALKHGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Xidoreductase
molecule keywords RHIZOME SECOISOLARICIRESINOL DEHYDROGENASE
publication title Crystal Structures of Apo-Form and Binary/Ternary Complexes of Podophyllum Secoisolariciresinol Dehydrogenase, an Enzyme Involved in Formation of Health-Protecting and Plant Defense Lignans
pubmed doi rcsb
source organism Podophyllum peltatum
total genus 84
structure length 267
sequence length 267
ec nomenclature ec 1.1.1.331: Secoisolariciresinol dehydrogenase.
pdb deposition date 2004-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2bgmA00
4KTTE 3L4BC 2X0JA 2IZ0A 1EDZA 4BMSA 4CM4B 2J5RA 2DBVO 2EKPA 4JXKA 4IDGA 5JNLA 4NK5A 5IXYA 4FGWA 2D8AA 4IXWA 1HDYA 3UHAA 3FI9A 1FDTA 4YDRA 5BSEA 4YAIA 5AOVA 1U28A 4GLOA 1DHRA 4R68A 3VPFA 1HETA 4IDBA 4XGKA 3RCBA 5DP1A 4RQTA 4XGNA 1LC3A 4I5EA 4XYGA 2CMDA 1XIVA 2AQ8A 1DC4A 1HL3A 2Q1UA 4FBGA 4NBTA 5DN9A 3GY0A 5GY7A 4PCVA 3B6ZA 3GVCA 1ZW1A 3ICCA 5FFFA 3D64A 3LU1A 2ZQYA 1NM5A 3P5SA 4AICA 2ZYAA 2NUAA 1Q7GA 1L1FA 4F3YA 3JSAA 5JC1A 5KJCA 2O3TA 1U9JA 4MPDA 3LF1A 5TSDA 1R4NA 4CQMD 1U5AA 1SBYA 1DSSG 2B37A 4ZD6A 2CDAA 1R6DA 1UAGA 4UVDA 3LSYA 1NAIA 4Y6PA 4Q9NA 1PL6A 4OXYA 5IAAA 1CQIA 3I23A 4DPKA 3K96A 1DOHA 2A9FA 3F1LA 4JIGA 4X54A 1C0KA 1NYTA 2XF8A 3TZHA 1ZK2A 2C2XA 3UVEA 1J6UA 4QECA 1KS9A 3KETA 1TEHA 2YV2A 3L9XA 3QA9A 2DFVA 1HDGO 2FR1A 3EZYA 3JD0A 1BG6A 2WE8A 1FMCA 3G17A 5H82A 5BNTA 5FYDA 3DB2A 1BMDA 1MGOA 3K8ZA 4RDIA 4D45A 1YKFA 2VTDA 8LDHA 4W4TA 1TT7A 3KSDO 3WMXA 4OOFA 4OYRA 1QYXA 2CSUA 4DQUA 3F1KA 1HLDA 2ZKLA 1BGVA 3NGLA 4CL3A 3EAGA 4E6PA 5JC8A 4YPOA 3RVDA 1A72A 4CL8A 4BKQA 1T2CA 3IL2A 5HA5A 1XEAA 5I7VA 8ADHA 2A4KA 1N7GA 4KOAA 2IXBA 4CUKA 4W82A 5KVQA 3OIFA 4Z0PA 1RKXA 2DUUA 2GCGA 2UAGA 1EUZA 1IYZA 1XR3A 5CEFA 4BNZA 5TT0A 4BV8A 2EWMA 2O50A 1KVQA 3AUUA 3IKTA 5AVOA 1LXCA 1PJSA 1YBMA 3RC2A 4YYZA 2GUGA 3PZBA 2RIRA 4IDAA 1MUUA 3P19A 4RF5A 4PIVA 1LBEA 4AJ1A 3V1YA 1E1NA 3DL2A 5TQVA 1O94A 1H94A 5TX7A 3JQGB 4WASA 4NBUA 3BTUA 3DBVO 3W4KA 4FC7A 1YL5A 4ZQEA 1DHTA 1AE1A 1GUZA 4ALIA 1LLUA 3PLNA 3MEQA 1KIFA 3JQAD 1BSVA 1I2BA 5FI3A 1O6ZA 3DMYA 4RVUA 3GLQA 4ITUA 4OOEA 2Q46A 4Y8VA 4J1SA 4DTIA 1WDMA 4D0SA 4G5HA 3IAHA 4RV9A 2JCVA 3BMOB 3TSCA 2VCYA 4RVFA 1IPFA 4DQXA 1C14A 4WNCA 1MV8A 1WNTA 3KOUA 4AJLA 1NHWA 5GZ6A 1LU9A 1HKUA 2CVOA 2JCXA 3G49A 4R5MA 3NDJA 3IQDB 2YDXA 4E5KA 2OFPA 2C82A 3I6QA 1PJBA 4CR8A 4CLEA 3WGZA 1HYGA 2NU7A 5EPOA 2DBZA 3E9NA 3TL2A 4Y6SA 3D5TA 2AE1A 3Q9NA 3WWZA 4ILKA 3GVIA 4FJ1A 4P4NA 1DDOA 3OM9A 1CETA 3EW7A 5AXBA 4KZPA 2CY0A 3E03A 4D43A 2OP1A 3PTZA 4IPTA 4XQGA 3NEPX 5C5IA 2WYWA 4ZQGA 5ER6A 4P38A 4RZIA 2DQ4A 2IYOA 3PWSA 4CLDA 1ISGA 1WAMA 5ES3A 2AQKA 4CLOB 3PYLA 3LYLA 4RVDA 1E6EA 1OBFO 2FN7A 4KDFA 4GL4A 3GT0A 2GASA 4NPCA 4AJIA 4XDYA 4KQWA 4XRGA 1WW8A 2VWHA 4L8VA 4E2XA 4GX5A 4OIMA 3GN1A 3WQQA 2C20A 3JD4A 4MIEA 1PQUA 3UKOA 1DIGA 1T1SA 1DLJA 1PQWA 3D5QA 3GHHA 4R01A 3ROPA 3LT4A 5TJ9A 1Y6JA 3T7EA 3WBBA 1U3TA 4N5LA 5JSFA 2ILTA 4KWIA 3FNEA 4YJDA 2D3TA 1LSUA 5U9CA 3BTSA 1GEGA 1P1FA 4XA8A 4O0LA 3WYCA 3OJ0A 1NQ5A 4J1TA 1YO6A 4DUPA 1RM0A 4E31A 3N74A 3PJFA 4CM4A 1P31A 3TZQA 3U4HA 3FNFA 2X1HA 3S2GA 4W9NA 5IDYA 2Q4EA 1HT0A 2B35A 2VYVD 1QYWA 2GD1O 2P9EA 4BO7A 3E6AA 3X2EA 1EE9A 1GQYA 2X86A 2OL4A 5ENDA 3AOEA 4PZDA 5L51A 1VI2A 1AUPA 3ETEA 3LC7O 3UH1A 5A02A 1O95A 3L9WA 1CYDA 3WYBA 3OIGA 1E6WA 2WYVA 2XXJA 2Y1GA 5DBIA 4PG8A 4M1QA 1JWAB 1A71A 3GGGA 4ZICA 4DREA 1N2SA 1CJCA 1F8GA 2O3UA 3HJAA 4BNKA 1PS8A 4NBVA 3HDQA 2EG9A 1EUDA 2EP7A 4CR7A 3PFWO 1NBOA 1YE3A 1SB9A 1E1LA 1B0AA 1XG5A 5TF4A 3MJTA 5KIAA 3VVCA 1LC0A 2X9VA 3DHNA 4Y98A 1P44A 2VZ0A 1V3UA 1YGYA 2VHZA 2O3SA 3DC2A 3FWNA 1ZCJA 4AVYA 2GR9A 3PHHA 1KVSA 3U0BA 1HRDA 3QVOA 2X8LA 2D1YA 1JVSA 3QY9A 2O2SA 4W9NC 5TNXA 4OXKA 4BNVA 3DBLB 2DTDA 3GDGA 1D7OA 2JAPA 3WFIA 4ALLA 1DC6A 4BKPA 2C0CA 3NYWA 4AFNA 1U4SA 2EP5A 2JAHA 2Z95A 1RWBA 4IQ8A 2BFPA 3Q1LA 5HWSA 4CM3A 1I0ZA 3GMDA 1YWGO 4S1VA 3S2FA 1PR9A 4BO2A 3NTQA 4GQAA 2JD2A 1R4MB 3E82A 1IY8A 1A4IA 2P5UA 2FOIA 2FPIA 3OJEA 4IBOA 4FSHA 1HTBA 3WTCA 2HUNA 1WLYA 3WOHA 1T4DA 2X9GA 1D1TA 4A0SA 3C7DB 4WEOA 2DC1A 4G65A 4XYEA 3VH2A 2O7QA 3OEWA 4DA9A 4HY3A 5IDXA 4Q3AA 1MFZA 3I6IA 2I3AA 4BGIA 4E2ZA 1NX6A 1UXJA 4JP2A 1HSOA 1PR3A 1PTJA 1NR7A 3SLKA 5JY1A 1RM3A 2PNFA 1X7DA 2VRCD 3Q2IA 1I3MA 1XSEA 3ZWBA 4XDZA 1NPDA 1Q7CA 1B15A 4QT0A 3WGYA 1HDRA 4KDEA 5T64A 3V1UA 3TFQA 2FZEA 2G17A 2QRLA 5ADHA 4J0EA 4M54A 1SC6A 1Y1PA 1RYEA 1XA0A 3JQGA 4B3IA 3QVWA 4CM9D 4BNFA 2HK8A 4TWRA 2QYSA 5JPIA 3AM3A 3JQFC 3CMCO 4U8GA 5EL0A 1ONOA 3GUYA 1U8XX 2VZ8A 2R6JA 1N1GA 3JD2A 3E48A 4RF4A 3KYBA 3AFMA 2E37A 4MVJP 1VJ1A 2ZYDA 1I10A 3GAFA 1P9LA 4QQRA 1TA4A 3BMOA 2AHRA 5CDSA 2JCYA 3KV3O 3HHPA 3NV9A 5L7TA 4GVLA 2VYNA 3UF0A 3EGOA 3UGKA 3TF5A 1GTMA 4FJ0A 5IDQA 1MXFA 1E5QA 3ONFA 3QVXA 1T2DA 1ZXLA 2CUKA 3AUSA 4DYDA 5IG2A 2YQ4A 2WE7A 1J4AA 3H4VA 3UICA 3DBRB 4II2A 1CIVA 1UP7A 1DIBA 2IZ1A 2X7HA 1PJ4A 4D3SA 4J49A 2Q2WA 3BAZA 4JCOA 2QZZA 1F17A 4HP8A 2YHUA 3AU8A 2VWGA 4FFLA 2I66A 2I9PA 3NKLA 1IL0A 3F5SA 4HUJA 4ALKA 1UP6A 4CLOA 4CMHA 4DWVA 1BVUA 2W4QA 4JBIA 3VVBA 2X4GA 3UXYA 4YTEA 5EMHA 4J9VA 4CM5A 3QQPA 1U2GA 1CF2O 4XZ3A 3BIOA 4LGVA 4CLHA 1PGPA 1EK5A 3V8BA 4DVJA 2P4HX 1DRUA 2C7VA 4F45A 1KVUA 4O5OA 5I7FA 3E5MA 4YJGB 1EZ4A 2C59A 1HSZA 4KTVE 5G2OA 2YDYA 1YDWA 3ZW8A 3D7LA 2EIHA 2VQ3A 2Z1MA 4AJ2A 4ZN6A 4CM6A 1PWXA 3DZKA 1B14A 4CMEA 4URFA 5EIOA 5BT9A 2EV9A 4NIMA 2HRBA 2HJSA 1LJ8A 2ET6A 3DHYA 4RF3A 2IRWA 4BKRA 4EI2A 4O1MA 3ASUA 3LT2A 5TGDA 1IUKA 1DFHA 1GPDG 2H9IA 4YQYA 9LDTA 3TZKA 1KVRA 4A73A 2W2LA 3CXRA 3RKRA 3U4CA 3U62A 4S3MA 3D0OA 5CDUA 1EVZA 1PJ2A 3RUIA 4BO3A 1M76A 4AJKA 1UXIA 2O2YA 1XU7A 2HO5A 3HSKA 4BGUA 3F3SA 3PI7A 5CG2A 4NFYA 5KVVA 3C3XA 2P9CA 3TOXA 4BL5A 1VJTA 3QV1A 3KLMX 4A2CA 1JU9A 3C24A 1FF9A 2X0NA 5IJZA 2RBEA 4WNIA 3JYNA 3VTFA 3GNQA 1O9BA 5A5FA 1ZVMA 2Q2QA 4GMFA 1JVBA 1KBZA 4B79A 4RQUA 1E3JA 4PGFA 3VHRA 4RVSA 1LLDA 2DUWA 3IP3A 1VM6A 4RPGA 3ZWYA 3ZU2A 1DAPA 3H9EO 2OXIA 1X1EA 3JQBA 3GR6A 1ZH8A 2GPTA 2PA3A 4MVJD 4PN3A 4AJJA 1XGKA 2GNAA 3KEOA 3DZGA 3Q9UA 2Q4BA 4R1TA 2EW8A 4FJ2A 4HADA 4I5GA 5G0UA 3DBLA 1PZHA 5CHEA 4J7CA 4JBGA 1E77A 3CEAA 4HKTA 1GQ2A 1YS4A 1U2DA 3TPCA 2EKLA 1WPQA 3KM0A 2DT5A 2PKRA 4MKRA 4W99A 1UXHA 1R4MA 4NDNE 3I4FA 1B8VA 1N7HA 3GPIA 3ZWVA 3A9WA 3IJPA 1FK8A 3H2SA 3RC9A 2EGHA 1A9YA 3W6UA 3INGA 4CQLB 7MDHA 3HN2A 3WIEA 1EK6A 3EVNA 5IN4A 4PLPA 4NU5A 4J2OA 3K2BA 2OZPA 5IDWA 1ZK3A 3GNTA 1XKQA 1XYGA 4KQXA 4I1IA 4IJUA 2X5KO 3I3OA 3TQHA 1UUFA 2OP0A 3CUKA 3W4IA 4I5FA 1K5HA 3K73O 1ISIA 4E21A 3WQRA 4FQ8A 4IIUA 3R3SA 1Z75A 1I3KA 1XDWA 4HFRA 1DC3A 1FDSA 2AEFA 3RUEA 3JQBC 3VZPA 2W2KA 4ND3A 5L40A 4I9NA 1ID1A 1GCOA 2FR0A 1M6HA 4UEOA 2BELA 2GN9A 1UP4A 4Q3BA 2RAFA 1P1RA 4J1QA 5F5NA 3SC4A 1L7EA 3GUCA 3TRIA 1V6AA 1R15A 1AN9A 1JA9A 3VC7A 3CPSA 3NX4A 2B0JA 2BLLA 1X15A 5KTKA 1LX6A 3KUXA 2EXXA 4OMUA 2YHIB 2HLPA 2HU2A 5AYVA 3QVTA 3JYOA 5GZ1A 4WLUA 2VUUA 3JV7A 1E7QA 1C0IA 3KYDA 3C85A 5LC1A 3TJRA 5A9SB 1YQGA 4O6VA 2PZKA 4YRDA 3I4CA 3KEQA 4WLFA 3TN7A 2F1KA 5GMOA 2YQ5A 4OHUA 3GHYA 4E33A 4G81A 2BF7A 4A10A 2AG8A 1NHGA 3DBRA 4K28A 4K6FA 3HDJA 3IKVA 4L76A 4NMHA 1G0OA 1P1HA 2PD3A 3C7AA 4GKBA 4D44A 5J23A 4L4XA 4PLZA 1LDYA 1YQXA 3ABIA 4CMJA 5B1YA 1I33A 2R00A 3WWYA 2D0IA 4B7CA 1V9LA 4NHEA 3ZCXA 1EDOA 1QYCA 5F1KA 2X6TA 4JP3A 2B4TO 3TL3A 3GK3A 4MVJM 3GVPA 2XOXA 4BKOA 3M1LA 3W1VA 5LDHA 3TZ6A 4FGSA 3PDJA 3PP8A 4FFMA 1E0DA 5CEEA 2CVZA 2NWQA 4B3JA 4YJGA 4KUEA 5B12A 3H8VA 1K3TA 3HDHA 5JLAA 3KYCB 4M89A 3CMMA 5ILOA 5C37A 3BHMA 4BB5A 3GDFA 1QV6A 4E5MA 3LLSA 2EF1A 5JAMA 4Z9FA 1KOLA 3AUAA 4XX0A 3BMCB 1LEHA 5JO0A 3ENKA 5JW6A 1QLJA 1S6YA 3VAZA 4TKMA 4Q3EA 2OOSA 2XPCA 1ISJA 3PGXA 2DTEA 1SO8A 4EJ6A 1NVGA 3L07A 2C2YA 4N54A 5AXAA 3DEYX 1NFFA 2UYYA 3HFSA 3ZWCA 3W8FA 1JKIA 2CD9A 4IXTA 2Q3EA 2GSDA 1B16A 4OO3A 4B8ZA 1E1KA 4AJOA 2Q99A 4LRTB 2O7SA 3PLRA 1T2AA 2Y0DA 3ITDA 3ONEA 5C3MA 1PGJA 3BMQB 3QRWA 1EQ2A 5G4KB 3VPHA 1W4ZA 3UAGA 1CWUA 4UUNA 5DNAA 4WOJA 1P33A 1R37A 4HFMA 1JQBA 1UAYA 4WCDA 4GLLA 4U5QA 2ZTLA 4DMLA 4RJTA 4HX5A 4WJZA 4J4BA 4DC1A 2D4AA 2Y0CA 2GLXA 3WG9A 3DZJA 3D4OA 1X0VA 1NWHA 1Y5MA 2FHSA 3CH6A 3B1FA 2ZB8A 1A5ZA 1T1RA 1ZBQA 2HCTA 1E3SA 4UVIA 4CV1A 4Q3CA 3WFJA 4EZBA 4G2NA 2OO5A 1E7MA 1GUFA 1JTVA 2F00A 4GX0A 3WNVA 3ICPA 3GGOA 1A27A 3MTGA 3PEFA 1PJ3A 2E48A 4RO0A 4TRMA 4ONEA 4PLTA 1B26A 1L7DA 4ZU3A 1SEPA 5CPFA 3L0DA 5BQFA 1YONA 3CE6A 2P68A 2RH4A 4P4LA 1H6CA 1I32A 3I9NA 4R3NA 2AXQA 3JQ8B 1VSVA 5L9AA 4IUYA 4CPDA 3QWFA 4CLRB 4AJHA 3GEDA 3KRTA 4MJLA 4PG4A 3ZU3A 3VOSA 4CQLA 1HE5A 4EITA 4Z3DA 4LISA 5F5LA 3P2YA 2Q1TA 5IZCA 3ROKA 2NTNA 1KEWA 1X14A 3FBTA 4R1SA 3AI1A 4YXFA 1U3WA 2AW5A 2B4QA 2I6TA 1F06A 1OZAA 5TC4A 3T4XA 1BRMA 1PGOA 4L75A 4BNUA 5GZ3A 3ITKA 1Y8RB 1N8KA 2AEJA 2IXAA 1OAAA 1I30A 4JJGA 5L7WA 3D4NA 1J49A 3X2FA 2GN8A 4P22A 1ISFA 1U1IA 4ZJUA 5EINA 4OM8A 3ZHBA 4F46A 2EW2A 3ZWWA 2J3JA 4CUZA 3C7CB 3BMNB 2OHXA 1DBVO 3RSHA 2GGSA 5KKCA 5THKA 2VHVA 3IIEA 4ZRNA 4E32A 3GGPA 4TKLA 4EUHA 5MDHA 1O89A 4GX1A 3PK0A 1PS0A 1UDBA 3O38A 4E0BA 4BUCA 4ZQBA 2GN4A 3PIDA 2Q49A 4LCJA 1HYHA 4RL6A 4NI5A 1DAOA 4JQCA 1I2ZA 4J91A 1LRKA 1P3DA 5JAQA 2YHIA 1C1XB 4ND1A 4YACA 2DPHA 3VPXA 4QTZA 4Z6KA 3LZ6A 3OIDA 1HXHA 1VKOA 5DBGA 5CAEA 5A9SA 5JMPA 1PZFA 3QIVA 1IULA 2V65A 4IQGA 3JCZA 4FW8A 5IZCC 4OKIA 4FFRA 4E30A 2JHFA 3H3FA 4R41A 4XGIA 2VWQA 3EY4A 2QHXA 1CEQA 3WXBA 4D41A 1HDCA 4GSLA 3RD5A 1M67A 1ZEJA 1ZSVA 2AE2A 2ZYGA 3LT1A 4BIIA 3RBVA 1VL6A 5I8ZA 1KC3A 1UR5A 3OHSX 4FPXA 1E6UA 1NTOA 4EGFA 3T4EA 1B2LA 3ONDA 3I9LA 3ZWAA 3ZNPA 3TFOA 4FFPA 3GZ4A 1KC1A 5L95A 5CDGA 1NVTA 3H2ZA 4BO6A 5JO9A 3GFBA 4BGVA 5HS4A 4XIYA 1Z82A 3AY7A 3U4DA 2VOJA 5JDCA 2X23A 4R69A 4NBRA 3PFFA 2E4AA 5THQA 4N5NA 1ULSA 2VRBA 2C5EA 4NFHA 1Z73A 4E12A 3NRCA 4RF2A 2DFDA 4XB1A 4BNHA 1R16A 3GAZA 3ZWOA 4XJTA 3HG7A 2PFGA 1UH5A 2C7GA 3KYCA 4UUOA 4F6CA 1FDVA 3C1TA 4PVCA 1N5DA 4Z0HO 1ZSNA 2VWPA 4WGGA 4MINA 5A3VA 3RU9A 1DFGA 3BMCA 4YBZA 1B3BA 2QZ9A 4AJNA 1P74A 1HDZA 2PZMA 5DOZA 1R12A 1SMKA 1YBAA 4E4YA 1GDHA 3GN2A 4DPMA 4DQVA 3WGGA 4H16A 2GF2A 4GMGA 3C1OA 4OH1A 3RASA 1BXKA 4OAQA 4KP7A 1JKFA 4E2YA 1PIWA 1SAYA 3CTMA 3VH4A 1ULUA 2X22A 2JKVA 2ZK7A 1V3VA 1SB8A 5G0WA 1P1JA 5F1OA 1WMAA 3FTPA 3SJUA 1XLTA 2WD7B 5TRTA 1GZ6A 3BMQA 4I5DA 3K92A 2GZ3A 5G4KA 4IS2A 2O3QA 1HDXA 3UN1A 2CNBA 4MKXA 5A03A 5FEUA 1Q2XA 3R0IA 1P0CA 3PXXA 1GU7A 4R16A 4U0KA 3S1LA 2I3GA 2H6EA 4J9UE 1EEHA 5CEJA 2YFQA 4MVJF 1QLHA 2FMUA 3VTZA 2JD1A 2BGLA 3AOEC 3EHEA 1CDOA 5K9ZA 3GRKA 3H9GA 1R0KA 3WJ7A 1CERA 3JYQA 5JDIA 1PGNA 1TLTA 1XQ1A 3GVHA 5DF1A 2VTEA 4N5MA 3HQ4O 4GWGA 1DB3A 4IIVA 1YH3A 1FJHA 3ZNQA 1UDAA 1C0PA 3SLGA 5COBA 3QWBA 4WCFB 4EEZA 1VLLA 1A9ZA 4UEJA 5DULA 4B4WA 4XRRA 2NM0A 4RPJA 1KEUA 3ZW9A 2VYND 1NQOA 3DAGA 4LW8A 3PPIA 3PHJA 2HMWA 1NPYA 4EW6A 5L7YA 3WQSB 1EVJA 5U1PA 4PFJA 3LDHA 1YBVA 1WDKA 3MZ0A 3Q6IA 4YT4A 3JQ8A 4YAEA 2W2KB 1HE2A 4KMSA 1ENZA 4GGOA 4CLRA 1BVRA 6ADHA 3ETGA 3ZNNA 5KJEA 4XYMA 2JHGA 3QSGA 3AK4A 5FI5A 2O23A 4NNJA 4F6LA 3PYXA 2Y1CA 4XIJA 4JGBA 4LK3A 4EDFA 3CZMA 3K30A 3OH8A 4WKGA 5L45A 1WDLA 1PGQA 2CF5A 1NFQA 3AFNA 3QWHA 1Y8RA 3G1TA 3MJCA 3RC7A 4CV0A 4RCVA 3RU7A 1F0YA 2CF6A 1T24A 3PVZA 1QXSA 3KYDB 5JDIC 2GYYA 5I7SA 4DMMA 3WLFA 5L3ZA 1TXGA 1ZZEA 3LC2O 4XR4A 3PQEA 4YT2A 1QYVA 1LSOA 3VZQA 3V2HA 1BXZA 5EQFA 1H6DA 1BHSA 2HJRA 4NR0A 4FOOA 4BKUA 1DEHA 2D5CA 2W98A 3BMNA 3GA0A 5F21A 1I5RA 1LQUA 2UUPA 4IDFA 5DDIP 3RUHA 3ZWXA 3ZV5A 4JROA 3KO8A 5T57A 3DOOA 3QVSA 4TRJA 3RJ5A 2C54A 1MG5A 3LF2A 2NU9A 4YWJA 1H9AA 2P5YA 5JCJA 3JQ7B 3OP4A 2EJWA 3HDYA 1I2CA 2VT3A 4QFCA 4OQZA 1Q0QA 4GX2A 4UVEA 5KNLA 1G1AA 1C1XA 4Q3NA 2DBRA 3VKUA 4XB2A 3IDSA 1U3UA 5CG1A 3PZRA 1M66A 2NSDA 1DIRA 4TVOA 4N7RA 4HBGA 3KLPX 3WIDA 1H2HA 3K5PA 4PG5A 1Z45A 3TWOA 5DOVA 4WLEA 5L4LA 2W2LD 3KB6A 4UUMA 4KWHA 5EESA 3DR3A 1JWBB 4EJMA 3Q11A 3H65A 1D8AA 2YW9A 1M6WA 4FD3A 1F14A 5H83A 3HZZA 1MC4A 4ESOA 4OKNA 4FOSA 1JKJA 1RJWA 3H9QA 4K6CA 4WOKA 2NVBA 4BNJA 3IOYA 5TT1A 4YVFA 1P1KA 3DBHB 1YDEA 1B8PA 3JQ9A 1QSGA 2CZCA 4HFNA 4B7UA 3FD8A 2Z5LA 5T6BA 2AMFA 3I9OA 1OFGA 1BTOA 3COSA 2J3IA 4IJWA 1E7YA 4YT5A 1IE3A 4AG3A 3AJRA 3OICA 2OGUA 3SVTA 5A06A 1SZJG 1YL6A 3JQEA 4HXYA 5KOIA 3DZFA 3R6DA 4MVJG 1EQUA 1H6BA 1QP8A 2VOEA 2TMDA 3BZUA 5JS6A 2IZZA 4PZCA 3RQSA 5I8WA 2BHLA 2HSDA 3DZHA 4J6FA 1NQTA 4BHTA 4ZGWA 4IMRA 5KJ1A 3STHA 1BDBA 4MOWA 1YXMA 1NQAO 5EQDA 3NT4A 5T67A 4E5NA 2FZWA 1Y8QA 3WICA 2XXBA 4YR9A 2VT2A 4D0RA 5A04A 1BXGA 1LDGA 2IDZA 3E5RA 1P0FA 3U3XA 1YRLA 4PRLA 4BNIA 3ORFA 4CMIB 4RPHA 1UZNA 3WLEA 2J8ZA 1VRWA 4BQPA 1H9BA 2E49A 4FDAA 3LVFO 1I3LA 1DIHA 2LDXA 2ZB3A 4CODB 3FF4A 4XQ9A 3ANLA 4PG7A 1Z7EA 5JYEA 1HLPA 3FPCA 1I36A 3M6IA 3NDRA 1GYRA 4JJIA 4XR9A 1O0SA 3GPDG 3BHIA 1EMDA 2C07A 2VHWA 2I65A 3JQ9C 2YFHA 4KUHA 4B7XA 2X5JO 3L77A 4I08A 7ADHA 5AXDA 4IMPA 3ZV3A 2PH5A 1ADFA 1ADCA 2BI7A 4CMEC 4R1NA 3FCOA 3RFTA 3VZSA 2WD7A 4L73A 3NT2A 2O3RA 4YEDA 4W7HA 1Q0LA 2A94A 2X9NA 4R9SA 3K6JA 4CQMB 4YJHA 3WDSA 4PLYA 1KVTA 2WJPA 4PVDA 2BFMA 4UVHA 4WUVA 3F5QA 4BO4A 4J2HA 5COAA 4W7IA 1EBUA 4D3FA 3OJFA 1M2WA 4J7XA 2PK3A 1R0LA 2ZJ1A 1DC5A 1GCUA 3FR7A 3ANNA 1IOLA 3G79A 4U6SA 1ZMTA 3K2EA 2G5CA 1NASA 2DKNA 1LRJA 1PL8A 2AQIA 1LI4A 3JD1A 4WPGA 4PLVA 2PR2A 3GG2A 1CQJA 2OUIA 2RHRA 3IMFA 1LDBA 2POQX 3I9KA 4WCFA 3AI2A 4O63O 4C4OA 4QUKA 3PJGA 1DJQA 5IXSA 3EC7A 3OEYA 1ENOA 1SPXA 4FCCA 2FSSA 1HDOA 1AXGA 5A1TA 3DTTA 2Q2VA 3KTDA 1ZKMA 2BRUA 1SEVA 1OC2A 3OQ1A 4DPLA 2YY7A 1NFRA 1Q7BA 4IS3A 4NQZA 4WECA 1E3WB 1PWZA 2YV1A 1PJCA 4Y9DA 4CJXA 1QORA 1P77A 3DOJA 3F4BA 4Q3DA 4AL4A 3PHIA 1YOVB 3ZV4A 2IEDA 1B7GO 3DMTA 1X7HA 1G0NA 3RBXA 4CUJA 3CIFA 4PLWA 3ZWMA 3I1JA 3HADA 4YAKA 2WSBA 3EK2A 5IF3A 4A7PA 3BA1A 2HRZA 3OJOA 3I5MA 3D4PA 2CFCA 4M86A 5HBRA 4YAJA 3PIIA 3GQVA 3E18A 1A4UA 4XYLA 2QIOA 4M49A 2Y1EA 5T8KA 2Y93A 2NTVA 5I9LA 4ND5A 3A1NA 1C3VA 1OOEA 5DCUA 2TMGA 3KHUA 5TLSA 4II3A 2YV3A 1VL0A 3E9QA 5F1PA 4P8RA 1ZO8A 4NG5A 2D59A 4JK3A 3EVTA 3JQAB 4LSMA 1JLLA 3WSWA 1GADO 2NVUB 4DBVO 4ND2A 2Y99A 5K0ZA 2NLOA 1NP3A 4DLBA 1CRWG 2FY8A 3NTRA 4BNMA 3RROA 4L4SA 2R2GA 2FP4A 1ZXBA 4H7PA 2HMVA 3U9LA 2B4RO 3JQ7A 4TROA 4J0FA 1TB4A 3FNGA 2G82A 3WB9A 4MP8A 5TJHA 1C1DB 2H63A 1K6IA 5CP8A 4ZHSA 1E7RA 3AWDA 4YCAA 2J5QA 3QW2A 2FPGA 4A27A 1Y81A 4JNKA 1UXGA 2NTJA 3NAQA 1ZNQO 3ZWNA 1GZ4A 4BB6A 4OXNA 1XELA 1H0KA 1UDCA 4CMKA 4B4UA 3BTVA 1ONNA 3GH3A 5B4UA 4QEDA 5K6AA 1RM5A 1O8CA 2PGJA 4MP3A 3TDKA 1I8TA 4LCEA 3H9JA 2DTXA 3ULKA 4OJNA 3GMSA 5T8KC 4TVBA 5IN5A 4CM8B 5TIIA 1I24A 2NACA 2O3JA 3DBHA 2GDZA 4IGEA 1P45A 5F3RA 1HZJA 4NJOA 2ZIZA 5C7LO 2JD0A 3DZBA 4BQRA 1PU2A 2EHDA 3AU9A 4DIFA 1VKNA 5DP2A 2J3KA 4LSWA 1GY8A 2WD8A 4UULA 4FB5A 2PLAA 2QQ5A 5EERA 2EKQA 2ZATA 3ZU4A 4E3ZA 4PZEA 3RC1A 4A03A 1W0CA 1S7CA 4ZVVA 1R66A 1HE3A 3IJRA 4DRYA 4U0JA 2VHXA 2WDZA 2OBYA 2HQ1A 1EBFA 4BO0A 2Y1DA 2X58A 4R4JA 3G3EA 4XEHA 2R00C 1O5IA 1U4OA 2YYYA 3PRJA 2VUTA 2B69A 1GEEA 1E5LA 4MIOA 1PS9A 1LLCA 4QO8A 3JQDA 4CMIA 4HFJA 4BMNA 1WMBA 2EJVA 4L0QA 5A9RA 4DC0A 2GRAA 3DAPA 3QWIA 3L4SO 4MO2A 3QHAA 3RI3A 2GZ2A 1U3VA 3MJSA 5KCZA 1LUAA 5K6AC 4PLCA 1FDWA 3VZRA 3F9IA 2J6IA 3GG9A 3UCXA 5JCXA 1DPGA 4CV3A 1U7TA 3B20A 3H5AA 4EBFA 2PZLA 3P2OA 4RPKA 3CSDA 4IGFA 1LSJA 2RH8A 2G0TA 3CINA 1LQTA 3PQDA 2EEZA 1HE4A 4RPLA 4DIOA 4E13A 4IDDA 4CQMA 4RZHA 1IZ0A 1R0SA 2VNSA 1SNYA 2BGMA 3C8MA 1PSDA 1ZJZA 2PY6A 5H81A 3SC6A 3DWFA 2V6BA 1PZGA 3I52A 2CDCA 2B36A 3F4LA 2W8ZA 3OFSA 3SX2A 4BO1A 1ARZA 4HWKA 4E5PA 2PH3A 4BVAA 2PKQO 2YJZA 4EUEA 2WM3A 3QP9A 3W6ZA 2Q1WA 3HWRA 3AI3A 2X0IA 4FR5A 3RBZA 5KJ6A 1IHYA 3GF4A 1KERA 1VSUA 5HM8A 2Y1FA 1Q1NA 2H5LA 2SCUA 3B1KA 4UVGA 3UUWA 3T7CA 1GUYA 2PD4A 2BGKA 1QYDA 1NAHA 5FF9A 3WJAA 4C7KA 5JAIA 2B5WA 2UDPA 3ZN2A 4ZRMA 4D46A 4UEKA 2O4CA 4NU6A 3FRJA 3ANMA 4Z0TA 5TS3A 5COQA 4YB8A 4LMRA 3KSZO 5BNFA 4FS3A 5DCWA 2QRKA 3E9MA 4DIBA 2ZTVA 1ML3A 3GFGA 4GSKA 1MLDA 2NADA 5ER9A 1E3WA 3RJ9A 3OETA 2WMDA 5DZSA 2PZJA 4EUFA 1ADBA 3WSVA 2UVDA 5B37A 3SJ7A 4Y6RA 2DPGA 1K89A 1YOVA 5JFOA 3DTYA 3DQPA 4BNLA 3G1UA 2QX7A 3ETDA 1GFSA 1BDMA 4W6ZA 5KVCA 4M8SA 1M75A 4JLWA 1IPEA 1EE2A 1OI7A 1QRRA 4ZQHA 4CMGA 1TI7A 2VN8A 3JQ6A 4NJMB 4CR6A 1TT5B 3I9JA 4CMCA 4IQ0A 3WX0A 4Y67A 3MWDB 1GAEO 1U8FO 5DT9A 2DLDA 1GL3A 4Z9YA 6LDHA 2AA3A 4ALJA 1WXDA 1FXSA 1OMOA 2JJYA 4PLFA 1KETA 3QLJA 3O8QB 2ZCUA 3AOGA 3PQFA 3JQAA 3V1TC 2NVUA 4NK4A 5KKAA 3IP1A 4I9UA 4O59O 4CMAA 1H6AA 2Y67A 5CFZA 3NDIA 3NJ4A 2NNLD 3VPSA 3W8EA 2Q1SA 3RAJA 1A7KA 1VL8A 3PYMA 4OL9A 2HKIA 2WYUA 2A35A 3HE3A 1C1DA 4YQZA 5AXCA 2FR8A 2GN6A 3A4VA 3GNSA 3PDUA 2QRJA 4LMPA 4M87A 4BNTA 4I8XA 5MGBA 1WZEA 2IODA 4R5HA 3GDOA 4CMBA 4L4RA 4U7WA 3UW3A 1H93A 2PWZA 4PLHA 3H5NA 1N1EA 3DO5A 4TMFA 2AEMA 4YJFB 4TQGA 4MKZA 4QXMA 4ZQFA 5HRUA 1W73A 3I83A 1SOVA 3NTOA 1MB4A 3GC6A 1F12A 1PJQA 4WLOA 5BNIA 3GZNB 3BTOA 3WGTA 2PGDA 1ONPA 4TSKA 1ZK1A 1Y8QB 3TZCA 2P9GA 1BXGB 1IB6A 4CM8A 3DZIA 3WGHA 2OBNA 4NFSA 5ENVA 2BH9A 3PWKA 4J16A 1KY4A 2E82A 3U09A 3MCVA 4RGBA 4YAGA 4WE3A 4R51A 3A28A 4YT8A 2VZ9A 4XD2A 2V6GA 2V7PA 3INRA 4RLSA 3HB5X 4GAEA 4FFNA 4R1UA 1E3IA 1YB4A 3QE3A 3PJDA 3ZHXA 4NZ9A 4DBZA 1V35A 4LN1A 1ENYA 5C7OO 2X0RA 1ZMOA 5BSFA 1K6JA 5JYDA 2ZTMA 3A06A 2C29D 4A5OA 3ST7A 1WWKA 1T25A 4BOYA 4CV2A 5JE8A 4MVJE 3B70A 4CM7A 2P91A 1EFLA 4INAA 1GYQA 1XU9A 2Y0EA 5JDCC 1NWCA 1J5PA 3OQ6A 3K9QO 3DXFA 2X5OA 3D3WB 3L6DA 1JAXA 3FBGA 3INTA 4YJHB 2VYVA 4FN4A 3RFXA 5A5EA 3ADOA 4TZKA 1QR6A 1U7HA 4IDEA 3DONA 1KEPA 4QX6A 4L74A 3S2IA 5C7IO 2ZB4A 3IUPA 4D7AA 3RWBA 3RKUA 2EGGA 3MOGA 2JFGA 3OQBA 4TRNA 5ILGA 3JQFA 1HEUA 4J90A 1ISHA 1VC2A 3M1AA 3PGJA 3H3JA 1JAYA 2CVQA 3ZU5A 2V6FA 2HMSA 3AW9A 1N9GB 4BNXA 1LA2A 4J3FA 1N92A 4OGWA 3VH3A 1A7AA 1K0UA 5JMWA 4XJSA 4E5YA 3EDMA 3WGOA 1EUCA 2NQTA 1XWFA 4MDHA 4NBWA 4UUPA 3B1JA 4ZA2A 2UV8A 2DU8A 1FDUA 3HFGA 4GPD1 2DM6A 4M55A 4MIYA 1QG6A 2NVWA 1I01A 1D3AA 1X1TA 5B4VA 4H15A 3W4JA 1Y5RA 3M2PA 3S2EA 1W6UA 3C1AA 2V6MA 1DLIA 1MC5A 1AGNA 4FIZA 4QSMA 5G4LA 1WZIA 3V5NA 4D3DA 4AJPA 1B3RA 3Q3CA 3ZNOA 4JN6B 3AUTA 3S8MA 4GBJA 2Y68A 4IY1A 2FWMX 3I9MA 3OECA 2WWRA 2IYPA 3KXDA 4ID9A 2IEBA 3GOHA 4L9RA 4CLXA 5JCJD 5L53A 4DXHA 4A26A 1PL7A 2PD6A 2RCYA 4R54A 4HNGA 3U4IA 4RLHA 2B5VA 4WLNA 3H5RA 1LRLA 4J4HA 1LNQA 2P2SA 3UOGA 1TVEA 3DFUA 3CZRA 2FRDA 4UREA 3U5TA 4R9RA 1ZEMA 2DVMA 4DYVA 5KWEA 1E3LA 1LDMA 4BO5A 1Z6ZA 1W8DA 2JFFA 4P4GA 4XKJA 4U6QA 1U5CA 1ZJYA 1OC4A 4RDHA 1F8FA 4XCVA 5ICMA 2P4QA 3AM5A 3MTJA 3AM4A 2HK9A 3PJEA 1YB5A 1JDJA 4YRBA 3F47A 3OF2A 1MG0A 1T2EA 3GEGA 3LC1O 3KSUA 5BSHA 5JY6A 3TNLA 1YL7A 2Z1NA 3OSUA 3QWAA 3S55A 5CDTA 4CM1A 2BI8A 4YRAA 1WVGA 2VRCA 4JBHA 1NVMB 3FSRA 4JJFA 4NJMA 1TT5A 1QMGA 4EJ0A 3DOCA 5EN4A 1PQPA 3WGIA 1DXYA 5JXWA 1XHLA 3MJVA 4CM9A 1P1IA 1K6XA 1MP0A 5ITWA 1BW9B 1GQQA 3ZWPA 1EFKA 3HNPA 1C0LA 1EVYA 2PTGA 5ICSA 4BGEA 3O8QA 4K1LA 5KJFA 1HYEA 1LLQA 2W90A 5EJ2A 3TOZA 4ND4A 1ORRA 1DIAA 3BYZA 1ZK4A 4DLAA 3KBOA 4XYBA 2Y1OA 5AQ1A 1KYQA 1RPNA 2O4UX 1E3EA 3ADPA 3R1IA 4GWKA 4MVJH 2I76A 3SBOA 2GZ1A 3K31A 3VDQA 1Z7BA 2ZTUA 4IJVA 3WS7A 1Q0HA 3O03A 1YQDA 2ZCVA 3NJ8A 1X13A 5BSGA 4BV9A 1HZZA 2QYTA 4GVXA 3BHJA 4ROSA 3UCFA 4XWYA 3SEFA 2WEKA 1YJQA 4GH5A 1NXQA 5LCXA 1HF3A 4J43A 3H7AA 3VDRA 4IZHA 5ITVA 3JYLA 2D5AA 1GR0A 3PHLA 3MOIA 4TZTA 3RUDA 4B4OA 2J3HA 3QJ5A 2HMUA 1YJ8A 3L6OO 1E92A 2AQHA 1I3NA 1V3TA 4YJFA 2YUTA 9LDBA 1RM4A 2HDHA 5FWNA 2NQ8A 4GGPA 3RIHA 4HNHA 5DBFA 1GV0A 3GVXA 1H5QA 3FTNA 1D4FA 3GZNA 5A05A 5A4DA 1QKIA 4C7JA 3L6EA 4RORA 5IZ4A 2Q45A 3UCEA 4IDCA 3WGQA 4ALNA 4EEXA 4BO9A 5L4SA 1DFIA 1GV1A 5CPBA 3ZV6A 1Y9EA 1VJ0A 3M2TA 4OSPA 3RFVA 1JN0A 2QG4A 1V0JA 3NUGA 2VHYA 3OA0A 1GYPA 3O9ZA 1R4NB 3MJ4A 4BMVA 1K2WA 4XQCA 5A9TA 1X7GA 3EYWA 5U4QA 1B8UA 4J4TA 4KUGA 3EZLA 3HB4X 1MXHA 2CDBA 1E7WA 4AJ4A 1AXEA 4LRSB 1PZEA 3IS3A 3E1KA 3W8DA 1ZFNA 4K9DA 4BNNA 4BNGA 2BD0A 1NR1A 1ZSYA 2NU6A 4MVJI 3AY6A 3PHGA 3JYPA 3G0OA 2BFOA 3O26A 3JD3A 4QO7A 4NH4A 1YVEI 1J0XO 3AY3A 3E8XA 3ZZNA 1VE9A 1MX3A 2PKQP 2UUOA 3U49A 4WLVA 3ZH2A 3ON5A 2OMEA 3Q0EA 1X0XA 4TRRA 4E2WA 5LDGA 1ZK0A 3KZVA 2AG5A 1ADGA 1GPJA 4DL9A 2OORA 1D1SA 4AJEA 1PEDA 1UJMA 4BNYA 3D3WA 2I99A 5CDYA 4B3HA 2D2IA 2Q50A 2G1UA 4J1NA 5G0TA 3ROQA 2FSVA 2JFHA 4D79A 2A92A 1YB1A 3VKVA 3IUSA 3OBBA 1GZ3A 2I5PO 3FR8A 2BKAA 2LDBA 3FNHA 3MWEB 2VUSA 4YA6A 2VNAA 3NT5A 3GEMA 3WBFA 4QFDA 3H9UA 3Q2KA 3LQFA 3ZHZA 2Y66A 2G76A 2BMAA 2EERA 4D42A 1ENPA 5JAZA 3ENNA 1T4BA 1N9GA 1XCBA 3V2GA 3RUAA 4IINA 5BR7A 1DRVA 1T2FA 1UZMA 1WP4A 1SOWA 1Z74A 3ZGYA 5A3JA 4UAGA 3P7MA 4OSOA 4FC6A 2O48X 3LT0A 4DGSA 4LVUA 5I9MA 2PV7A 1SCUA 2C5AA 4H3VA 2JL1A 2YZ7A 1GD1O 5JBIA 4OQYA 4BO8A 2HK7A 1KEVA 1DRWA 1T26A 1VPDA 2DAPA 3WYEA 3DFZA 3ZHYA 4N18A 3FWZA 5DCYA 3A14A 1KY5A 1ZIDA 5B4TA 4BNWA 4K26A 3R3JA 1DJNA 2NU8A 3OMLA 5I7EA 1QV7A 2B83A 4MVJA 2RHCA 3H6KA 1RYDA 4PG6A 4HV4A 4Z3KA 3ZDFA 1Y9AA 3PWZA 3CKYA 1ISMA 2J5KA 3LK7A 5IFLA 2Y05A 5G0SA 3DHEA 4R3WA 3D1LA 4JX8A 1MA0A 3GRPA 4WEQA 3OJLA 4IM7A 1LSSA 3F6YA 5G0VA 4DLLA 3L4BA 3OA2A 3SXPA 5T5QA 3NGXA 1NNUA 5KVSA 5L4NA 3FN4A 1MFPA 4ALMA 3ASVA 1V8BA 2GERA 2ZB7A 1ZUD1 2E6UX 3EMKA 2FPPA 2PGLA 3IC5A 1IHXA 2NV6A 4PLGA 3FHLA 4MP6A 4B8WA 2HMTA 3DDNA 1Y7TA 4WCFC 5HS6A 3V2UA 3JTMA 4GKVA 3WTBA 1NPTO 4WK6A 3D3EA 3KVOA 4Z9XA 3UFXA 5HTOA 1PX0A 4GI2A 2ZQZA 3FPLA 4FFOA 1HWYA 4RVGA 2BFAA 4RVHA 3RUFA 4Q39A 3VPGA 1UXKA 2H1SA 1PJTA 4IZIA 3VH1A 3LLVA 3WNQA 1AHHA 2DBQA 2WTBA 3N7UA 3ROMA 1BWSA 1E1MA 5I9NA 1XQ6A 1AHIA 1IZ9A 3HUDA 3WMWA 3DAFA 3HN7A 1EVIA 3ZI0A 3JQCA 4EYEA 3RUCA 4J7UA 4LVCA 1JW9B 1PJLA 1BW9A 3F46A 4BS9A 3DMTC 2I67A 4B4VA 1H2BA 2GO1A 1LDNA 1LTHR 2XAAA 2QW8A 2ZJ0A 1LDEA 3MJEA 4I9HA 4IJKA 3WR5A 4PRKA 1G6KA 3N58A 3EUWA 1UZLA 3O4RA 2IE0A 3BXXA 1DO8A 2HAEA 1E7SA 4XQEA
chains in the Genus database with same CATH superfamily
2QT9A 3L4BC 4KTTE 2WM9B 2X0JA 3P2EA 4IIFA 4LCBA 5CA1F 5FBVB 1EDZA 2FWBA 3DDWA 2IHUA 2CL0X 5CVCA 5JQGF 5KYGA 4M1MA 4CKBA 2I4TA 1QK4A 4IXWA 3FCYA 1R0RE 4MV5A 1CUCA 1U5BA 5EAIA 1AOXA 1E4YA 1FDTA 4FSXA 4YDRA 1A2QA 1CUGA 3HVUA 4GLOA 4BVFA 4YAIA 3VPFA 2CHVA 1XMJA 3G2PA 1HETA 2QRMA 3QFHA 5EFOA 3RCBA 5JYCA 1NMSA 1QO7A 4Q48A 5DX1A 4BUZA 4XPIB 4I5EA 1WXQA 1PO7A 1VBKA 3HBLA 3DPSA 1XIVA 2PUDA 2Q1UA 3PQ7A 1DBRA 1VMIA 3BAFA 2WSLA 3V2IA 2EATA 2GT1A 3ZU6A 3DBIA 3B6ZA 3L0SA 4JQYA 1I3OA 1ZW1A 3M9LA 3GFOA 2P8SA 4JWTA 5FFFA 3E81A 4B2LA 4BJ3A 1OBCA 4WERA 4ZZ2A 3ECSA 1VHTA 3LU1A 5FH9A 4FNAA 2ZQYA 5JASA 1W76A 4TWZA 4C3VA 1DKLA 1JHMA 2NUAA 2FGKA 2PJDA 2ZYAA 4J0IA 5FT9A 4LJ6A 5FI1B 4F3YA 3JSAA 5JC1A 1CVRA 2O3TA 4IFIA 3RRZA 1JJVA 3DMGA 3CB4A 4PNZA 4XSVA 1N3IA 5TSDA 2I0FA 1R4NA 2CXQA 3I2FA 4NPAA 1SBYA 2QGZA 1U1GA 2OAP1 1R6DA 4EKYA 3KZNA 3LSYA 2MSEB 4UVDA 3C43A 3EEYA 4Q9NA 4V02A 2V1UA 2DERA 5IAAA 4FB4A 4OP1A 1HV8A 3HXLA 1V95A 2QX9A 4MKGA 2QMHA 3OZFA 1C0KA 5DSZA 1NBMA 1CE8A 1YBHA 2JIRA 1F2UB 3K70B 3F98A 3SBEA 3NBUA 1KS9A 5GQSA 2VA8A 4RXUA 3KETA 3V7NA 4AU1A 3FSJX 4I14A 2B2XA 1Z4NA 1UJ4A 3JD0A 2ZBDA 1O77A 3N2LA 3SS8A 4JVLA 1MQ9A 4YPVA 3T3NA 2EAUA 5FYDA 1Z5PA 3WRYA 5BN1A 1MGOA 1JHDA 5LIRA 3AP1A 1XMQB 4D45A 2VTDA 3DT8A 3M8KA 4W4TA 1G21E 1QONA 2WUFA 1E2HA 1O6CA 1U11A 2ZRBA 3DHVA 2D1QA 2CSUA 4K1XA 3NTLA 1HLDA 5ALQA 8ABPA 2FEKA 1YRYE 4CL3A 1ECGA 5JC8A 2FPIB 3RS8A 1A72A 4NHOA 3H9BA 1XKXA 4FHEA 2W9XA 4JY7A 4FYWA 3WGLA 2FEXA 4JYAB 4RU1A 2WNHA 4ZARA 8ADHA 5I7VA 3RB8A 1QLWA 4QT4A 4R2WA 3ZD6A 5L3SB 3GCZA 1NM5C 1NN1A 1OA0A 3FRIA 3CX7A 3D3KA 2YXEA 3OIFA 4HVTA 1GKUB 3OF3A 4QPJC 3W2TA 4PBSA 2XCUA 1U9YA 3IBSA 4NYMQ 2UAGA 5DNVA 4ZZ0A 1YQUA 1C81A 3DW3X 3DZ8A 4FE7A 4JLPA 1CRLA 4UXIA 3G9ZA 1PR1A 2QM3A 4Y2XA 1G20E 1E4OA 3ACBA 1KVQA 3O8NA 3OZWA 4YAOA 3Q8LA 1RKVA 4EZEA 2BTQA 1CR6A 2NZWA 1LXCA 4YY3B 5JFGA 1IATA 2XYHA 4NBLA 2VPPA 1N0HA 1IN7A 1Z3CA 3P19A 4PIVA 1VB5A 3QU5A 1VXRA 4AJ1A 4UATA 1H94A 4WX2B 3BQNB 5D6NA 4WASA 2PJRA 1TM3E 3M89A 4TS3A 3DBVO 3W4KA 1H23A 1YL5A 3LGSA 4KE8A 3NVKI 1T4GA 3ZG6A 1T5SA 2X2OA 3JQAD 4H1WA 4WVFA 1ORDA 2CLMB 3DMYA 2NVOA 3GLQA 4HH1A 4OOEA 3WB2A 5BR4A 4RLQA 5A62A 5H16A 3FMPB 5DM70 4DLZA 4I1YA 1SQ6A 5ALKA 5LWHA 5C53B 2F4VB 3BMOB 1L5WA 1ZC4A 2VCYA 2ZRCA 1IPFA 1BD3A 3IKJA 4WNCA 3N8IA 2FXVA 1JHZA 3U4AA 2QRPA 4AJLA 1NHWA 1OPXA 1PKEA 5GZ6A 1HKUA 4PCAA 2L69A 4C43A 3UIEA 4DTCA 4ARIA 4LQ4A 3G6WA 2ZI5A 4YUVA 1I7QB 3RIEA 5EJIA 4E5KA 4EG1A 2AZXA 1WPGA 4NE9A 2PU5A 1PJBA 4MGHA 3V46A 4CR8A 3GRUA 5GONF 1YA8A 1Q0PA 2DH5A 4ZI2A 3DHWC 5LA6F 2R751 2AE1A 3Q9NA 5AVZA 1OSNA 4ILKA 2D1RA 5NULA 2XGGA 4I4TB 2JGFA 1LB1B 5C18A 1BYUA 1NW5A 3KKEA 1JI3A 2PZAA 3ZW7A 5FAKA 4HZUA 2CY0A 3E03A 3HV0A 3DBOB 2OP1A 3FPHA 4JXJA 1CUDA 3IEMA 4LI3X 4AM8A 3WYNA 5BO5A 3U44A 4JJZA 3AKEA 4QPCA 3MT0A 4C6TA 4LJRA 5EVJA 2D4HA 5AIAA 2JZCA 4CLDA 4OGKA 3N7AA 2O8NA 4LSZA 4QOFA 2JIMA 4CLOB 2BFDA 5A5VA 2E1RA 2COEA 4YRRA 2NZUG 3FUVA 4XDYA 3T4UA 3BK7A 3JW8A 1T6BY 4KQWA 2ZCJA 1HR0B 4EKNB 1TLLA 3F5MA 4L8VA 2VWHA 2YJ3A 1VOTA 3BMXA 5ALTA 3UXMA 4HS4A 4L7VA 2QX8A 3SU8A 3EVDA 4MW2A 5DYWA 2DB3A 1E9BA 3F6EX 2V7QA 1PQUA 2QE7D 4NTZA 4N9WA 1T1SA 4QE3A 4KR3A 1C7JA 4JL6A 3BE8A 2PLFA 1VCIA 3HCPA 5T6MA 2DWQA 3Q40A 5DTEA 2ILTA 3REFA 3UJ7A 2XTMA 1R3DA 3RYFB 4RPCA 2CL6X 3A70A 1TU3A 1USGA 1BCRA 3UMCA 4MW7A 4NULA 3G9TA 4ZDKA 421PA 4FMBB 4JLBA 4M1KA 5IBQA 4J0HA 4UAUA 3RS9A 3M9WA 4AN4A 2O8BA 1OAOA 3PTLA 5THXA 4KODA 3OT1B 3K0FB 2EZ4A 2GHRA 3IT0A 5HRCA 1KJYA 1GZ7A 1QIIA 1XTQA 5AHXA 4E1VA 5IDYA 4KFCA 1IY1A 2B8WA 5J2TF 3DEZA 3DDSA 4UM9D 4WJLA 5JSQA 2VYVD 2WUDA 2PRZA 1TU0A 1YCDA 2F43A 4LF4B 2P9EA 1EP9A 1SG0A 3EXEA 3BS4A 3FKSA 4IH1A 4MZDA 4DANA 4ECAA 4MRNA 2IHTA 1DEKA 1ZNZA 1DKPA 5L51A 1AUPA 4RTSA 3WHKA 4V1CI 2X5XA 1FFWA 1RR6A 4QVKA 3UWDA 4HB4A 1DGQA 4O4IB 4TYQA 4NSNA 1AA6A 1E6WA 2R5NA 3LCVB 4BCCA 4DARA 2AFHE 4X0EA 4CKWB 4ER0A 2B92A 1K7YA 2H8GA 4HLCA 4M1QA 1Y3CE 3T6KA 3GGGA 3PITA 2PCLA 4FHCA 3BXGA 8OHMA 1W5FA 3IQFA 3LO8A 1B6TA 4GOND 2BEVB 4QDKA 4UNNA 1IJEA 2C98A 1N2CB 1QGDA 3L7KA 1OT5A 1RXCA 2VHQA 1RZVA 1QF7A 1MNAA 4ARBA 2J09A 4GR9A 3HDQA 2EG9A 1EUDA 1DQSA 1L4YA 2EP7A 2QTAA 2WC1A 3GFRA 4OD0A 3EGXA 4DCTA 2Q5CA 5CA1A 2RGAA 3OCWA 2JJ8A 5JQGA 1B0AA 1SC1A 2D0PB 3RGWS 1W25A 1WHTB 2DF8A 1FXWF 5EMNA 5IYZB 4GG1A 2J9YB 1YZQA 3R3UA 1I5OA 4JYZA 4YGYA 4IWYA 2X9QA 2OGSA 3DC2A 3EVEA 4L3OA 2QAGC 5CHYA 5EIBC 3AB3A 4J1TC 3U7RA 4AXBA 4LF9B 2J0VA 1Z6PA 1KVSA 1XTJA 2GM9A 1NW6A 2JLAA 2RG1A 2V8OA 3QFCA 4JODA 4MUHA 4S1OA 2WM8A 2D1YA 2BCEA 2X8LA 1JDVA 2ZSKA 4RY2A 5EXTA 2FWPA 3T1TA 1D6NA 2C94A 4W9NC 1L1RA 5FOQA 2CFRA 3DBLB 1LVGA 2DTDA 3UHFA 4BFTA 4DT1A 4J0GA 1QHEA 1DC6A 2ZBGA 2C0CA 3NYWA 1CXZA 2VBCA 4OSEA 1N2BA 1KFBB 2H31A 1M2NA 2JAHA 2R6CA 1I7LA 3FZQA 3SSOA 4AZVA 1PKXA 3Q1LA 4IZ6A 4O4JA 5HWSA 1E1YA 1TM5E 4S1VA 3BL8A 2XCIA 2B8TA 2IU6A 3NTQA 1JYEA 2WLTA 5K8IA 1FUEA 1IY8A 4WBSA 2CD7A 2FOIA 2ZT7A 4ZOBA 1PVOA 2FMHA 3O6VA 1L5NA 2NXNA 4X64B 3UKDA 1OYYA 1Q1BA 3LCMA 4XAQA 3M5CA 3UG7A 4ED9A 1XJ0A 1W0KD 3C7DB 3AJDA 4WEOA 2GARA 1OU0A 4FOLA 3TLZA 3OEWA 2J33A 1T0IA 3EC2A 1SKAA 4B9EA 3R9WA 3IULA 3ZVKA 4U7HA 5ALHA 2FCAA 2VRWA 3D3NA 5AHOA 4BBAA 5FDFA 1MFZA 4RIFA 3I6IA 3UBTA 4BPBA 1DO2A 1TVKA 3SR0A 1NX6A 1P7PA 2FRXA 3FFWA 1HSOA 1PR3A 3BFVA 1LX7A 4JP2A 5LQSA 4OHZA 5CFMA 5AJUA 1JP7A 3BX1A 3UNXA 5CB0A 3RNOA 5B7PA 3I61A 2TYSB 1A1VA 3S2YA 4QPPA 3ZWBA 1EM8A 2WIFA 5BN5A 1LH0A 1P0MA 1Q7CA 5HJ5A 3RIXA 1S02A 3P0FA 3I62A 3R9IA 5T64A 3BXFA 3LVBA 3DKRA 3K70C 2AI1A 4GKKB 1CS0A 3ZWDA 5ADHA 2BGJA 4CM9D 1XA0A 5E4FA 3QVWA 3PFIA 4BNFA 5A4JA 4DSNA 1PG5A 1MJGA 2QYSA 5JPIA 4BN4A 4RD4A 5KUTA 5EL0A 1BXRA 2GN0A 2NZ8A 3PUHA 1W1UA 4UBOA 4RYDA 2DX7A 4NZNA 2SECE 1SK8A 2Z56A 4R8VA 1XPUA 1Q6YA 2OHIA 4A8JB 3V8NA 4EHHA 4QUGA 2GBGA 1CR1A 1QH8A 4FFDA 3ZVRA 3OC0A 2V4MA 3T3HA 2V45A 4BVHA 5KNBA 2WIKA 4JB3A 1GNSA 1X8KA 3JQPA 2JCYA 4M8KA 5CDSA 4B35A 3A6PC 1E3DA 3TF5A 1IBSA 4CL0A 1SCNE 2QD2A 2IIBA 3D2LA 1WUTA 2DKFA 2FDRA 2PYDA 2QJRA 2W0SA 4TLMB 4YJ3B 3IP6A 5IDQA 1ISRA 1U3FA 1MAAA 2SKCA 2OXTA 4B46A 1F3LA 3PGVA 1H4VB 1T0HB 1T2DA 3AUSA 3H11A 1CX9B 1RVDA 2OKGA 1NMZA 2VF5X 2YQ4A 1S2DA 4J07A 4W5JA 4HLUA 1D07A 3H4VA 3DBRB 1PR2A 3CLHA 4BX9A 1CIVA 5KYTA 2WVAA 4RK4A 3ABSB 1DIBA 1JU3A 2IZ1A 1QVVA 3HFRA 3L0ZA 1PTJC 3TLGA 2EFJA 2LTAA 1PJ4A 2WU4A 3M6XA 4MWDA 2QEQA 3PRYA 2Q2WA 2RI6A 1WDTA 4KVZA 4XVCA 5HKKA 1L5QA 1NXVA 2QZZA 1YJCA 4LC1A 1F17A 3KX2A 3MBIA 4HP8A 2NO9A 4BECA 3K0EA 4UHBA 1IRXA 2D5LA 1K7CA 2BUAA 3KWLA 3VU0A 1BQEA 4OB6A 1SCKA 4UMEA 1O96B 5K2OA 3NHWA 2CMHA 4CMHA 2IY8A 2WFLA 3FDXA 4O3FA 5IVHA 2W4QA 5SYAA 3A3YA 2RMKA 4PGAA 3NM6B 4JBNA 5DVZA 3SC3A 3QQPA 2IY7A 3BIOA 3ILHA 1EK5A 3V8BA 2AV6A 2XQIA 4M0LA 4EECA 2VQFB 3B38A 4IP0A 3O94A 4GHWA 5KYUA 4JENA 2IDJA 4PNPA 2PQ2A 4AB1A 4RKYA 4I1RA 5F2EA 5IJ0B 5IBRA 1EZ4A 1HFWA 1HSZA 4KTVE 2ZYWX 4W8OA 4R9UC 1PEYA 5CCXA 2PKWA 5B2EA 2J0UB 1JG6A 4I8IA 2FQYA 1HBJA 1PYGA 2PSEA 3IB3A 3PXBA 3EWAA 4WXPA 2Z1MA 4JC0A 4AJ2A 1VDMA 4AN0A 5B2FA 5CIYA 1IBKB 1OWLA 1DUIA 1R0YA 5FPYA 5D3KA 1E1RA 3CCBA 3DZKA 2AB0A 2ALJA 1Z2NX 3FOWA 3T94A 4AAYA 5BMOA 1KJ8A 1ZMBA 4DLSA 1B14A 4LOAA 8GPBA 5LU8A 1P81A 2ZRJA 4URFA 2RB5A 3M6MD 3AZQA 4WH0A 4WDRA 3ZDDA 1CFZA 1EM6A 1SXJA 1KDPA 2XEDA 4RF3A 2IRWA 4P3OA 4K7JA 2IXEA 4GICA 4AZ0A 4EI2A 3V6LA 4AY5A 2QZJA 1QKKA 1VPWA 1KZ1A 5EEHA 3LT2A 5TGDA 4CFYA 1GPDG 3F96A 5JTTA 1KVRA 2C3UA 4F4HA 4IHQA 3CXRA 4BY9E 1H2ZA 2ZBVA 4PE5B 1RRFA 3CNQS 4ITRC 3TE6A 2PT9A 2EU8A 4MI6A 2F3RA 4RZ2A 3KSAC 1ZHOA 5CDUA 3T7IA 5HKBA 1EVZA 3DFMA 1PJ2A 4X92A 4DQKA 1UMBA 1PHRA 4C9BA 3IOBA 4KFSA 2QDKA 4NCNA 1CS4C 1MEEA 1W85B 3OFKA 4BO3A 1EFTA 1V48A 2B98A 4EVSA 2J67A 5BPHA 3DEAA 2I71A 4XFDA 1U2GC 4DR1B 2VJOA 1TO1E 2HO5A 3B5IA 3C3CA 1WUIS 1TW3A 4D3YA 5CG2A 3TOXA 3CCFA 4AYWA 2ZE8A 4YUXA 4NV1A 5GVSA 3KLMX 1JA0A 1ZN8A 2CYBA 1WZUA 1PZMA 3E84A 2WJ3A 3PQ8A 4C4ZA 3GFSA 4G1CA 5A5FA 1ZVMA 2Q2QA 4P4SB 1JVBA 4B79A 1J5XA 4RUKA 5KQGA 1E66A 4RVSA 3A1UA 5CFLA 3IMCA 4Z54A 2IV3A 1QFMA 4QREA 4GYJA 5E1BA 4B71A 1C4WA 3HY3A 1PBNA 1CUZA 4OK5A 5J2TA 1GGVA 5EUBA 3KAQA 2LIVA 1V37A 1M83A 5L3QB 1Z0DA 2WICA 3QXCA 1X1EA 5IAKA 2ZRFA 3LVQE 1ZH8A 4DLUA 3BWYA 5JBNA 3T5MA 1XGKA 1OXBB 5BRNA 1UPXA 3LBIA 4E7OA 2ZYSA 1JQJC 1T9AA 3B52X 1UPBA 5FOTA 1P5FA 1QH9A 1SGWA 1WQ4A 1KO8A 1V43A 1VHDA 1YQTA 2ONKA 4XPZA 4YMWA 4FU0A 5CHEA 1K8QA 3I2YX 2VS1A 3CEAA 2WT4A 3NDPA 1TD9A 2Q3LA 4X7BA 3TPCA 2EKLA 4RDCA 1DUSA 4JLSA 3RABA 3SF8B 5DK4A 4K6MA 4FGLA 4W99A 3VZBA 1A8PA 4EG3A 3AETB 4NDNE 3LWDA 2YH2A 3B3FA 4LMAA 5KNCD 1N7HA 1ZISA 3DEFA 3MPUA 4H08A 1QM5A 4Z9BA 3A9WA 3ZR4B 4X20A 1DUVG 2IHVA 2XNJA 3F3MA 3WHPA 3IALA 4DWOA 2B3TA 4CQLB 5TVKA 5FWYA 2A58A 4QBFA 1FBTA 1UZUA 3LKZA 3EVNA 1ZGHA 4N8EA 1KKUA 2I2BA 1FXWA 4J2OA 1AGYA 5H9WA 4F8EA 2IOYA 2OV2A 3GLIB 3JAWB 1YZGA 3K2BA 2OZPA 5HP4A 2PX3A 2AX3A 1X7YA 2OHVA 4I36A 4WUTA 2ZUCA 1OTXA 3O3OB 4IJUA 4KQXA 3HFJA 3KU4A 3N07A 2PUBA 2CHUA 4CIBA 3MVEA 3CUKA 1SKUA 3L5OA 1SIWA 3C2QA 3DV9A 3REOA 4E21A 5JAPA 1B73A 1J8VA 2R47A 3BKXA 1S8NA 2ONYA 4RA9B 2HL6A 4FQ8A 4IIUA 4P33A 1NF2A 5KNDA 2C9ZA 2R6DA 1I3KA 2VL7A 1QO0A 2OTCA 1FC0A 2H59A 1DZ3A 4Z0NA 1MPTA 2OZLA 1LW7A 1HG0A 4QJ3A 1AS2A 1WZNA 3TNFA 4BVBA 4UEOA 2PS3A 5JZ9A 2XNDA 3PQ2A 5D3MA 2GN9A 2EHJA 4JB8A 3H2KA 2WKWA 2RAFA 3KR2A 4I9GA 1L7EA 1T6XA 4H3HB 5SYNA 1TZKA 1R15A 1Y8AA 1AN9A 2Q5LA 1CUJA 2XKAA 1CKEA 4LPSA 4WA7A 4EMBA 2G9QA 5DNYB 3R41A 1JR2A 2V7WA 3NX4A 2Z2JA 4ESEA 1X15A 4MUAA 1LX6A 1FYEA 2F3TA 3K0CC 3ZJ4A 4H31A 3K9WA 1GQOA 1D2MA 2YHIB 4O2AF 2HU2A 3RHZA 3WWEA 5GZ1A 1MIOA 3G7SA 4WLUA 1PZXA 4OBXA 3KKOA 1EGMB 2WWFA 5T4EA 4DXAA 4EYGA 3R0ZA 2Z4SA 2YIMA 5A9SB 1B43A 2P9TA 1RLJA 2PZKA 1YHYA 2H1HA 3D5EA 3KEQA 4WLFA 1TQ6A 1UFKA 1I14A 2VP3A 4KQ6A 2FKAA 4X60A 5D85A 4FGKA 1KWGA 4I1PA 3T41A 1YIAA 1XF9A 5P21A 5C8VA 3GMTA 4N3BA 3O74A 4UQPA 2AT1A 4E33A 5DNCA 2E5FA 3SIWA 3KJZA 4G81A 2ZLBA 4DIKA 1MAVA 2HEGA 3K9FC 3HDJA 4JI0B 3IKVA 3SDBA 5EY5B 1Z5GA 3ZIDA 1G0OA 1ZM4A 4GPAA 3EVFA 3M33A 1DU4A 1J9ZA 1FBNA 4GKBA 1YB7A 1FQKA 1AU9A 1JHPA 3QHQA 2VTBB 1OFUX 4W9MC 5LMUB 3IEIA 3U81A 1F5NA 2QUJA 2B3DA 4JL8A 5B1YA 2R00A 3SXJA 4CGZA 3VR5A 3WWYA 3C4VA 4KE9A 2RGEA 4NHEA 3K5WA 1EDOA 1QYCA 2CHQA 3KOXA 4M4SA 4U02A 1QJCA 4E6EA 2VDQB 1C9KA 4MV6A 1CY0A 3S99A 5GM1A 2AN3A 1Q1EA 3WRXA 2Z9CA 5C8XA 3IELA 3IURA 4Q4JA 3BGDA 1Q12A 4YP7A 4MJ3A 4PO9A 1TYZA 5TPZA 4FGSA 5DPMA 3TZ6A 4WACA 4A3SA 3PDJA 4LF8B 3WLAA 5E7QA 5AH0A 3SZUA 4A8JC 4KMOA 5JADA 4CG1A 3L6UA 4KUEA 3H8VA 1T34A 2QN3A 4BU0A 1O0BA 3HDHA 4GW3A 5SZIA 3R5XA 1F20A 3KYCB 4M89A 4Z4QA 5C37A 1UWLA 3VVMA 5A6SA 4K9NA 2UXBB 1XLUA 3A31A 5CIQA 1XZAA 4L9SA 4HQFA 4PR3A 4F0JA 3N0VA 1KOLA 2BDEA 2QD4A 4KXUA 5AUNB 2IPOA 1NLFA 4JLJA 5IK2A 3KU1A 4FOTA 3HR8A 4MMYB 3VR6D 3RDPA 4JSYA 4DJ5X 4DCGA 3MCUA 4EJ6A 1UDXA 3MXOA 1OH5A 5K6RA 4QU0A 1OYOA 5AXAA 3WY9A 4EX7A 4G41A 3UEOA 3CNHA 3LOQA 2HUPA 2E4XA 3ZWCA 2OT3B 3UUEA 3N2KA 1JG3A 4QM6A 4IXTA 2R84A 1DQRA 2P78A 2Q3EA 3CR3C 4PIPA 5DN6A 3T5GA 3GXOA 4YROA 2RE8A 3PNPA 1E1KA 1P6XA 4UHJA 1VIMA 3HBMA 4LRTB 3SZOA 2QTHA 4KO2S 4L8WB 4GUAA 2Q0XA 2ADMA 3CKLA 4KXMA 4TXNA 5E2IA 1JXAA 3UYKA 4E07A 3LUPA 3AY0A 1JIKA 3BMQB 3DCNA 1EQ2A 3MLBA 4DLWA 4JOSA 1W4ZA 2F3UA 2WYOA 3UAGA 1KXJA 4N3AA 1CWUA 2RKBA 3DV0B 5DNAA 5HZKA 3NASA 1JQBA 4WCDA 2I80A 4O4LF 4ZWNA 1KDRA 2HWUA 3SHOA 2WR8A 4M36A 5SICE 4UM9B 2PZEA 3C6KA 1RU3A 1KI2A 2D4AA 2ZU0C 4X63A 4RM3A 1T5IA 3R5HA 2BTOA 1EHCA 4BGDA 3CV3A 3D4OA 4UD6A 5JH7B 4GDFA 1A97A 4RESA 2FDCA 3CH6A 1M0TA 4I4IA 1QCZA 3FFBA 4BMOB 4C0SA 5TEVA 4BLQA 1GAXA 1A5ZA 4R7ZA 5AQEA 1ZBQA 5C1BA 1E3SA 1ZD8A 3D6UA 1Q1ZA 3L01A 4Q3CA 3WFJA 2AUTA 4CV1A 2IPAB 2IZ7A 3HJCA 4G2NA 3KAPA 1KZGB 5IKMA 1GUFA 5CLFA 5B2ZA 2QQEA 4V1CB 3EIFA 3QELB 1L5RA 4RPIA 4Y0NA 1A8UA 3O2SB 3SZGA 2FEOA 2E21A 1RJGA 4BV2A 4F56A 2II6A 3RYHA 2KSQA 1CUBA 5FOUA 2H0QA 4TQAA 1PJ3A 2IY9A 3IESA 1OKKD 4A0FA 2XT0A 1X7XA 4I3FA 1SEPA 1SD5A 4HDKB 4PBTA 5CPFA 3YASA 2WOOA 4LXIA 1YONA 4P4LA 1KPHA 4JKIA 1H6CA 1AK9A 2VPQA 1I32A 4HMPA 3FFTA 1ZD9A 5BVGA 5KTTA 3HU3A 1BEEA 3MBOA 3AVQA 3HLKA 4KRYA 2YJ4A 4IUYA 5HPYB 1PDOA 2KQUA 2VDMB 1Z6GA 5ARCA 1KK3A 3EQ9A 1NYLA 4LX8A 3B85A 3SNKA 2N46A 1VL2A 4PPGA 1V9CA 3OE5A 2IJGX 3DZCA 3ZU3A 5JI3E 2HXSA 5ERGB 4Z3DA 5C32A 4JLUA 1VIVA 2Q1TA 2WFAA 2IHJA 1NQUA 1WUJS 2AYXA 4PQFA 4E14A 1KEWA 2FEPA 3FBTA 1L7BA 3KC2A 4OQLA 3R77A 3EGVA 4RV5A 1DBPA 1XRNA 2I6TA 2RAUA 4KITB 1BRMA 1PGOA 2C2KA 2VJMA 3G2OA 3IILA 1Y8RB 3RW9A 1N8KA 3DPIA 4MXDA 3EQ6A 1JIIA 2IXAA 2IHBA 4JJGA 4PEVA 2H1WA 2ECQA 4YRGA 4EELA 2GN8A 4MRMA 5IU6A 2O57A 3NHZA 3EY9A 4US0R 4I6JA 1U1IA 1AV6A 1RADA 3GJ6A 4DWWA 1UEXC 2ODQA 3BB1A 4OM8A 1F6BA 4F2DA 3JXEA 4B4DA 4UAJA 5CGZA 3ORSA 2IP1A 4C4PA 4UNIA 3LQKA 1FU8A 3KLNA 1SBZA 3BMNB 2OHXA 3F8TA 3RC3A 5KYYB 4GKAA 1KPIA 1XOIA 3RSHA 3VNBA 5KKCA 3AKZA 3B6JA 2VHVA 2GRJA 3MCAA 2VFAA 1U0BB 2TECE 3GGPA 4LHVA 1DDIA 1KQNA 1O89A 1RQGA 1S2IA 3A1EA 3H17A 2IQIA 1U7XA 4PPNA 4BUCA 2NN3C 4LOHA 5DHRA 1CBUA 1ULAA 2CJXA 1E5TA 2FFHA 3MT8A 4YCMA 3D43A 4LJYA 4RL6A 1AQJA 1J0EA 4NI5A 3NH9A 3N0XA 4JQCA 4ECEA 1LK5A 1XKLA 3RVRA 3SM9A 1LRKA 3MJHA 5BWBA 2FUCA 2OBBA 3K9CA 3O21A 1O94C 4NESA 2QQFA 4LVOA 2BY4A 1AZLA 1Q0SA 3BZBA 4BWVA 3J80A 2LP4Y 1VKOA 2JC3A 5DBGA 1UWCA 4HAIA 1YFKA 2D7CA 2V65A 2R8YA 1P2GA 3DDCA 4IQGA 4MEJA 2BEWB 4UMFA 5CCBA 3K1YA 4OF4A 1Q77A 3I0MA 5IZCC 2E89A 3S6JA 1THTA 3COPA 1TA9A 4E30A 1FXUA 4EY7A 4R41A 1E2MA 3V1LA 5BW5A 2DZDA 1HDCA 4GSLA 4IDOA 2HGZA 1M67A 1JKJB 2X1LA 1E4VA 4BIIA 3JWGA 4Z2AA 3RBVA 4HXGA 1K27A 5JD3A 3M4XA 3T3EA 3FYTA 3OHSX 3ZCRA 2V4UA 4FPXA 1E6UA 1NTOA 4LRUA 3ABQB 1DZIA 2XUZA 3PDCA 8ATCA 2VZEA 1GU1A 1NVKA 1Z5UA 3K53A 1AKVA 2VLBA 1WL8A 3I9LA 5EIHA 1RP1A 4JNCA 4PYOA 3UKJA 3TFOA 4DMFA 2H8KA 1V5FA 5L95A 1LKZA 2IUSA 2X3FA 3GFBA 1ZMRA 3V8RA 4BGVA 5KU1A 1AK2A 1MJFA 2CE7A 4I4CA 2X23A 1U99A 2JIBA 4B6JA 1ULSA 1H65A 2H1IA 2VRBA 2C4NA 4JA2A 5JVDA 1IN4A 4GOKA 5I7UA 5LXTA 3QA3E 1SHUX 4XB1A 2MMGA 1W8IA 5TR9A 3ZWOA 1K8ZB 2GEDA 4U2BA 2A3RA 2BKVA 2C7GA 1L7MA 2OLJA 2VDOB 3LECA 4RACA 3C1TA 3S1AA 3AG5A 1JKXA 4PVCA 1P29A 1ZSNA 2ZXUA 4PV7A 3CJQA 4TN5A 3QNMA 4HXFB 1ZONA 5KOJB 2ZVQX 1I1HA 1O6FA 3VAYA 1FLVA 5KBYA 1MDFA 2JLRA 3RU9A 3WWDA 2RJNA 3WLLA 2ERYA 1OWMA 3BMCA 2XD4A 2P4EA 1AC5A 4P92A 1M5UA 4G85A 5AI6A 2COKA 3G8DA 1V26A 2YRXA 1XO1A 4DLNA 1W4BA 1A96A 1HDZA 2PZMA 3G0IA 4LY9A 1R12A 1PLKA 3LXXA 1YBAA 2R87A 2ATEA 3PFHA 3EXG1 2C5BA 1GSAA 4DQVA 3ZLVA 1IUOA 2KS6A 3F6PA 5HG0A 4H16A 4ZQIA 4BVKA 4AY6A 4HN2A 1PE0A 1C8BA 3CPEA 3PA6A 3EXHC 3TXAA 1WSWA 1SUDA 4KP7A 4E2YA 1E2EA 3G8BA 3VH4A 4DB4A 3RF7A 2G9VA 2RFLA 2ZUSA 2ZK7A 4YQEA 4C20A 3PE3A 3E8MA 4ZRDA 3IPAA 1WMAA 4M9ZA 5TRTA 3C7KA 3F2VA 4K9RA 4XGQA 5G4KA 3AKDA 4OJKA 2OXFA 5DTMA 3IT3A 4RK6A 2ICAA 5A03A 4LBVA 3PIRA 3KSBC 3EH1A 5EPUA 3R0IA 3R5JA 5E2BA 3PXXA 1L4KA 1EXDA 3WK9A 2CEKA 1K6MA 3S1LA 4C7MA 4XTCS 1CDDA 4IHJB 1I4TD 2H6EA 2R68A 2ZBQA 5CEJA 2C8JA 2YFQA 3ILVA 1J00A 5BN4B 3FZYA 1TCAA 1ZNYA 2X76A 3VTZA 2FQ1A 3KQSA 3AOEC 2ISCA 3AVUA 1LF0A 2RJOA 1LVUA 1UMDB 3EHEA 4HC4A 1BEUB 5JTUA 2VDUE 3GEIA 1R0KA 3AR4A 3EVGA 5HM6A 1TFUA 4AY2A 1E8NA 1CERA 4I66A 3WJ7A 2QOEA 1ZOLA 3G1WA 1W2GA 2G06A 3AEQA 3LGXA 3O90A 1SBQA 5DF1A 1VDZA 1FFYA 2RHHA 3KQPA 4N5MA 3ND7A 5IC4A 5A0VA 3HQ4O 1DB3A 4RH1A 4NU0A 2JI9A 2OBLA 1P4AA 1SUEA 1G3IA 4IIVA 4J75A 3TXXA 3W5IA 5J4KA 5HNKA 5TPWB 3HCFA 4LJ8A 3VUEA 3SLGA 2M6SA 2GQ0A 5FFNA 3MS4A 1ODJA 4M8IA 4R84A 5AMXA 1VLLA 1A9ZA 2YWRA 1VPLA 3KXIA 2W4MA 4LG1A 4XRRA 1GFZA 1KEUA 2BN4A 3KOOA 4N3CA 4RX1A 4ISCA 3FZNA 4YRPA 3UK2A 2PSSA 5JRDS 3PHJA 4IUBS 3LHIA 3R0XA 4J0DA 3WJ1A 3R5SA 2J31A 3PNKA 4PFJA 3LDHA 5JXJA 4YT4A 4KW7A 3JQ8A 1X92A 2A9PA 2VO1A 2VDPB 4ILEA 3WNCA 3A3OA 4DV5B 1ENZA 1BVRA 1Y9JA 3QTTA 3KYIB 1X86B 4G9GA 4TUYB 1H2EA 3P9SA 3ZNNA 4UM7A 4CEHA 1HE8B 4KR7A 2EFYA 3FB4A 3QSGA 4DNFA 1FSPA 3LZCA 3U37A 1KYWA 5J47A 5BYJA 3AK4A 3OTGA 2MYTA 5DEIA 4MWGA 1EPUA 2C2HA 4D1YA 2QENA 1ZWLA 4QGSA 2PX8A 3EA0A 5L45A 4LRYA 3U4QB 2XY4A 3ACDA 4GR5A 5HDBB 1OB2A 5BRJA 3RVBA 3LLMA 3PQ3A 4C87A 3A1TA 3AFNA 1ESCA 2VG8A 5EWLB 3G1TA 3E35A 1RJFA 3MJCA 4MTCA 2O5CA 1L5YA 4Q18A 1VLZA 3AX6A 2PIAA 1W19A 3KYDB 4N1AA 3K9HA 4Q66C 2ZSBA 2JIDA 4MR7A 4N0QA 1UEIA 3OQOA 4EG5A 3AUXA 2AKEA 4FWIB 1QYVA 3R8XA 3JX9A 2Q4OA 3AEXA 4DEYA 1W87A 5EQFA 3GOQA 1BHSA 4NR0A 1Z0UA 3LY9A 1DEHA 4JOCA 2W98A 5F21A 2AJCA 1JLLB 1I5RA 2UUPA 2C4UA 3ZV5A 3DUFB 3F9CA 4MQEB 3T7DA 4EG8A 1G8GA 3QVSA 1SBCA 3RJ5A 1G5QA 4R2HA 1VQ1A 5KSYA 3AM1A 1ABFA 5JCJA 5DO9A 3ZKWA 1MOQA 3IE1A 2IHKA 4FZ3A 3BHNA 1I2CA 4DDWA 4QQ8A 1Q0QA 2O0LA 3PENA 1SIUA 4GX2A 4YMIA 4P34A 5CA0A 4BLOA 2DBRA 1V7PC 1Z0SA 4XB2A 3HXQA 3IDSA 1U3UA 4UHHA 1GXSB 4K2HA 3DZDA 4ADSG 4TVOA 1DIRA 1MF7A 3H86A 4N7RA 5ALWA 3I28A 2HO4A 3KLPX 2B78A 4LXXA 1FUKA 3ZE7A 4BDSA 3TWOA 1Z45A 5G1PA 2C78A 1WABA 2WSSA 2ZSHA 5EESA 4EJMA 2BHSA 5BV2P 1D8AA 1T2NA 1ZGAA 1AQ6A 4G84A 5EMLA 5H83A 2I6UA 4N82A 5GJVC 4QBIA 3V55A 4OKNA 3H9QA 3COVA 1UJ5A 1X8XA 2FSUA 4UASA 1SUAA 2NVBA 3I76A 4OHWA 3IOYA 4C7VA 5LWQA 2QNBA 4RMIA 2OOKA 2RH5A 4PXYA 1TKAA 5A4IS 4LFCB 1S3GA 1N7JA 1B8PA 4KK4A 1QSGA 2CZCA 4BFYA 3D8UA 3HY4A 2XEXA 2XOKA 1P18A 1MJGM 3FD8A 3KK0A 4D9BA 3UJ9A 2QZSA 1RRGA 5T6BA 3VO1A 1T13A 1N3LA 4HMOA 3I30X 5JZMA 2ODBA 1OLXB 3TW0A 1XAJA 4A5SA 1YACA 3NP7A 4TTRA 2J3IA 4DR5B 4TXJA 4DCMA 3OOSA 3ODPA 4YT5A 2WTUA 5IKXA 1C2YA 3N3BC 3JQEA 3MTDA 3ZE9A 5KOIA 3DZFA 4QYWA 2PX0A 3HMKA 3BZUA 2VOEA 2PL3A 2YVQA 3GZJA 4FXOA 2Q5EA 3AMVA 2QQ0A 3ZHRA 4BWGA 5I9TA 3LQ4A 3W79A 4BHTA 3RREA 5I8WA 5EMMA 4QNNA 5J40A 1FYFA 4ZGWA 1AGRA 3O4VA 1BDBA 4UNSA 4YMLA 1NQAO 2PU7A 1BE0A 1OFIA 5T67A 4LF5B 5E9WA 2XXBA 4EHBA 2QTZA 2QP3A 1V1MB 2VT2A 2V54A 4FMCB 4I4LA 2CLHB 4GT1A 5AVUA 2Z83A 4ZCLA 3P9YA 5AIBA 3A6JA 4CMIB 5BSMA 1QZXA 3IAEA 2AVDA 1UZNA 1Q95A 4MJXA 4V2IA 3D8NA 4LOIA 2K5UA 3HCRA 3B9RA 4HCJA 1VGRA 1S4MA 2I4MA 2QPOA 4DSZA 4LFAB 2FN4A 4TS9A 1XMIA 2YBEA 2E49A 3ZUGA 3GAAA 3LVFO 4CCYA 4UPEA 2OAQ1 3K9BA 3ZJ5A 4CODB 3FF4A 4XQ9A 4O2LA 4N0EA 4Y9UA 5E6SB 1D09A 2P2ZA 3C6BA 1Z7EA 3NDRA 4F92B 4MW1A 3JSXA 5JSKA 4QWMA 4R1LA 2HJWA 4N0MA 3TLXA 2WUVA 3N6XA 4NMMA 1EMDA 3PPXA 1IMOA 4RNDB 3RIGA 3JQ9C 4KUHA 3VR3D 2H2HA 4B0PA 4YDQA 2KLBA 3L77A 3UOWA 4IMPA 4DNQA 2JFPA 2PMFA 5DHTA 1FSGA 3HCBA 1IOWA 4YREA 2UYGA 2BI7A 2ANCA 1GGFA 1MO6A 3PKJA 4OXXA 2A0XA 3FDJA 2WD7A 4ZT2A 3ZQJA 2P6NA 3VJRA 3AV0B 3DDOA 5REQA 2WWXA 4YEDA 1Z88A 1Q0LA 2A94A 2XA2A 3K6JA 2NT3A 2POCA 4G25A 4YJHA 3WDSA 2AWOA 1H1LB 1SR8A 4R71A 5LFAA 2BFMA 3ZDAA 3F5QA 4ZYWA 5DB4A 2Q5IA 3EGDA 4J2HA 5COAA 5IC5A 4BO4A 2FQQA 1ID8A 4D3FA 3OJFA 3ICOA 3FYSA 4OB7A 1O5TA 2AOWA 2GBPA 1GOTA 5DEOA 3WV4A 3O3NB 1L4HA 1IOLA 1Y6GA 3WMFA 1RPTA 4GM1A 3A9VA 4NBNA 4HX9A 4HEQA 1ZMTA 3BGWA 4K9PA 2QJTA 2BKEA 3K2EA 3PX3A 4JOQA 1VJGA 2D7JA 1B4DA 5HXAA 1NASA 1A5TA 2DKNA 2L17A 2XVZA 3MQFA 3JD1A 3VR4D 3DCIA 1UM8A 3HA3A 5ESXA 3MGKA 2PR2A 1U2SA 3OEED 4HNRA 2HNBA 3OTQA 4NJEA 4MA4A 2E6KA 2OO3A 2IOQA 2POQX 3GCDA 1KL7A 2H3EA 3K20A 4JN6B 5HEKA 2V59A 3PJGA 4HNAA 3SJBA 4C3ZA 1OIXA 1YMUA 2QF7A 3HBJA 3G5UA 3I64A 5JMOA 4Q3OA 5K0LA 1Z8HA 4L5JA 1E2QA 2VLIA 4Q47A 2ID8A 3RVOA 5EGNA 1M1NB 2FSSA 2WTAA 1AXGA 2PJUA 2ZI6A 3H1GA 4MV3A 4UPVA 1ZQ1A 4BX8A 1JZSA 3UY4A 4TKVB 1ZKMA 4DRXB 1KMMA 5ENZA 2VNKA 5ULLA 1P2UA 2QSYA 3EPRA 3IUBA 3BGSA 3OQ1A 2X4DA 4IS3A 1KO7A 2Q3HA 1E3WB 2WB4A 4NQZA 1PWZA 5CLGA 4AZWA 2FOLA 3K72B 2QTTA 1TC1A 3DOJA 3F4BA 3G0GA 5F7ZA 4AL4A 4C4SA 4RHYA 2IEDA 4KO1S 3KNZA 4WNAA 3DMTA 4D8TA 4DKXA 3NM5A 2YZNA 3CF6R 1CNMA 3CIFA 5ALOA 1T5TA 4YAKA</