3BH7A

Crystal structure of the rp2-arl3 complex bound to gdp-alf4
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
161
structure length
161
Chain Sequence
EVRILLLGLDNAGKTTLLKQLASEDISHITPTQGFNIKSVQSQGFKLNVWDIGGQRKIRPYWRSYFENTDILIYVIDSADRKRFEETGQELTELLEEEKLSCVPVLIFANKQDLLTAAPASEIAEGLNLHTIRDRVWQIQSCSALTGEGVQDGMNWVCKNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The retinitis pigmentosa 2 gene product is a GTPase-activating protein for Arf-like 3
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
molecule keywords ADP-ribosylation factor-like protein 3
total genus 53
structure length 161
sequence length 161
ec nomenclature
pdb deposition date 2007-11-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3bh7A00
2BDTA 1NKTA 2JJ2D 2Q3MA 2YOFA 5B30A 2R6GA 1R5NA 1Z6XA 1XTIA 2KB0A 1DTSA 4HDCA 1Z08A 1AGPA 3FFAA 3B60A 3ZVMA 2I4IA 3R9XA 4E22A 5EUMA 3C7KA 3SYLA 2Z83A 4GFDA 4GOKA 1G8FA 5JRJA 4DUGD 4LSGA 4LJYA 5B2ZA 1UDWA 2ZRIA 1E9EA 3LBIA 4Q7JB 1LV7A 1NVVQ 3GLGB 4MDEA 2ZI5A 3TMKA 4OJKA 1S1CA 4M4SA 5FR2A 2W58A 4DZZA 3NC1C 4BEJA 4JLAA 4L5BA 1E69A 1U0JA 2BM0A 2CLSA 2ODBA 3T1OA 3IIKA 1T5LA 3AKCA 1N2CE 2I3BA 4L15A 1KDPA 3RAPR 3LY5A 3WRYC 3K9NA 1SZPA 3OZXA 4GZLA 2ZS9A 3A36A 1Q20A 2XTZA 4UNRA 4KODA 3T1VA 4NCIA 5A5GA 1IJEA 2QA5A 3BAFA 3UWKA 2JJ1D 4UXIA 3BB1A 5DH9A 1T8TA 3SFVA 2ZRAA 4B43A 4R71A 5HR5A 4X8LA 2WV9A 2XNDA 4L9SA 1Z06A 3QKRA 4MKIA 3LW8A 4RZ3A 1PLJA 1XTSA 2VHTA 1U0LA 1XZPA 2NZ8A 4AG5A 4BLSA 3ONWA 3B5JA 4A2PA 1Q57A 4K8OA 4PC2A 5B57C 2X2FA 1ZUNB 1M7HA 3A1VA 1P60A 5KDOA 1VG9B 3L2OB 2FSIA 3AF1A 3EZ7A 3SFZA 4O3MA 1KK1A 3CF0A 3WMEA 1XTQA 1NL3A 2AKYA 4FXPA 2BJVA 1RJ9A 4QL3A 4B2LA 1G7TA 2ZJ5A 2CNWA 1G41A 1WDTA 2YNMA 2IWRA 4A82A 1XD2A 3I61A 2IL1A 3C4JA 2A7QA 4B34A 3VTKA 4B76A 3HWSA 5BW8A 4Q00A 4EKDA 2OCBA 3AB3A 3CR7A 3QF4A 3QKTA 4HLQB 4UNNA 3OESA 4Q4JA 1HEIA 2IHYA 1ZD8A 3LX5A 1GRRA 1OFUX 2XXAA 1CS4C 2FOLA 2AD1A 3MLEA 5K8UA 1IM2A 3U44A 5TARA 4V0LA 3AVPA 2ZI3A 3C15C 4OQFA 4UQOA 5CLLA 3K9GA 4OI4A 4Z51A 2BEKA 3HYTA 3UATA 1BMFD 4BWYA 4DC9A 5JHHB 2CEAA 3SBEA 2PT7A 1NP6A 2WWWA 1MO5A 4CRWB 2OHFA 2RB4A 2C8VA 4B3GA 4PXAA 1J7KA 2P67A 3EC1A 1P7CA 3CW2A 1AZTA 1N25A 2NPIA 2QTHA 3AH8A 4Q9LA 2WWIA 4KBGA 5LB4A 1NI3A 4CT4B 5AUOB 3ZGXA 3B2EA 5IK2D 4PZLA 2ZPTX 1UJ2A 5FTNA 3TE6A 4DDWA 2ZE8A 3CNOA 4ACBA 4PQRA 1A7JA 4M1SA 4JSYA 2A78A 2R6CA 1XXHE 1VCMA 4ZCLA 5AUNB 1ZD9A 5L3VA 5E7JA 2WWYA 3PFIA 3T5GA 3WHLA 2JJ2A 4BFXA 5AJXA 3K0FB 3LDAA 3AVWA 1NMYA 4Q66C 4ILEA 2H18A 1CEEA 1P9RA 2A5GA 4A2WA 3Q7QA 4TMTA 1TU3A 3K1JA 2O0HA 1BOFA 2ZITA 5DHFA 4ZIRA 2O8FB 2EWWA 2X8AA 3B78A 5CJPA 3SJAA 2OFOA 4DVGA 3X1XA 5AR1A 3WXMA 4C2TA 5BQ5A 3QE0A 4PSKA 3G5UA 1NKSA 1OFTA 3CRQA 3O47A 4XOIA 2OZEA 4P4SB 3N70A 3PJRA 3QSYA 1SXJA 1G7CA 3OE7A 2A3RA 2GZAA 5M04A 3FOZA 1RRFA 4JLBA 4TLDA 4DDUA 4ZCMA 2WWXA 2YZ2A 3O8RA 2B7BA 1GKYA 2FX3A 1NMXA 4PPNA 4M9QA 4KVAA 5AJZA 3MSXA 1YZKA 2VSXA 1ZNWA 4D25A 3V00A 2NIPA 2ZE7A 1UBFA 3A1UA 4HAVA 3AEZA 5FUWA 3KZ1E 3FTQA 4NMMA 2QAGB 4JLOA 2OXRA 4HZUB 4DDTA 1AS2A 1LY1A 2H92A 4A0GA 3IHWA 4GRAA 4J0QA 1W4AA 2GVDC 4OK6A 1NLYA 1YVDA 1KO4A 5A0FA 2J7PD 3RRNA 1RPZA 2QMOA 5TXGA 3K70C 4NZYA 1H8HD 1BYUA 1XB2A 4P31A 4A1FA 4M1MA 4AIIA 1ZP6A 2PZFA 5J4KA 1GFIA 5FTLA 2X77A 1E2JA 4JT2A 5JJLA 4KVGA 3O8CA 3ZH9B 3VNUA 4P3YA 4NHOA 3U3KA 2GZDA 4TYQA 1YR6A 2ZYVX 5C2JB 5D3MB 1JR3A 1ZMXA 5JSZB 4WA7A 4N0DA 2L0XA 2A5YB 5AWFC 1UKYA 3T35A 1Z0DA 5J4LA 3OAAA 1P72A 3X1DA 3ZQ6A 2G6BA 4OHYA 2ONKA 4MRNA 2GXQA 1OIVA 4QNMA 1KO7A 2R8RA 2YC2C 1MOZA 3DDCA 2PCLA 3C8UA 1KI8A 2RHDA 3I1FA 4OHZA 1YZLA 4V03A 3VMFA 1WE2A 5J4HA 4M8NE 4F4JA 1KOFA 2P3SA 1ANKA 1E4YA 5ANRB 1KTVA 4KITB 4FMBB 3MCAA 5HE9A 3U4QA 4RZXA 4DWJA 2JEOA 3ASYA 5C18A 1E94E 4KFSA 1G3RA 3EZ6A 1KYIA 3RHFA 3AQ4A 4GT1A 5J47A 4TTQA 5EP2A 4DLVA 1OT3A 2IUSA 3K0AB 2WJIA 3MWJA 5L3SB 3LXXA 3EARA 2OEPA 2IW3A 3PV0A 2GZHA 2BBSA 3VR3A 3HPQA 4WXRA 1VHTA 2MSCB 2VL7A 4RJLA 2FEMA 2C77A 2NOAA 3RS5A 3L43A 1U98A 4JLVA 4JKYA 3KQHA 3Q85A 3T15A 1ZNZA 4FWIB 3LH5A 1E96A 2R9VA 4EUNA 3U7FB 4HUQA 4V0OA 3WY9A 1JPNA 2PBRA 2QAGC 4K46A 3TR5A 3TLXA 1Z0KA 1NIJA 5FPHA 5FUXA 2XEXA 1SXJB 4W5HA 2ZI7A 3ICEA 3QNUA 4MYCA 1AN0A 1XCPA 1NF3A 2VHUA 1E0KA 3VX3A 3K70B 1KMQA 3FHCB 3IUYA 4Q21A 5HCIA 1ZIOA 4N1AA 3ZIAD 3IIJA 3F8TA 5CIWA 1FTNA 2Z5FA 3GLHB 5D3QA 4YDHB 1Z6AA 2XSZD 4V0MA 3PEUA 1E3MA 2OBNA 1GNPA 2KBFA 4JLPA 1G3UA 1N6PA 1P2VA 1X1SA 2PT5A 2A30A 1VHLA 2WJYA 2ZUCA 1J90A 4PQYA 5KSPA 5TB5A 1JR3E 4IXMA 4B73A 2AR7A 1U9IC 2WKPA 2HJVA 2ZE5A 4L16A 2V8OA 3BFXA 1G16A 1XU4A 1HY3A 1EWQA 1XMVA 4IDHA 4IKEA 1CP2A 1OB2A 2EFHB 1NVWQ 4IVQA 5EXPA 1EWRA 3IEUA 2V7QD 1KJYA 3M0EA 4MYUA 1G5PA 2QTFA 3MG9A 3RS4A 1KJWA 1BS1A 4G5OA 2V6JA 2JJ8A 1KZGB 1VMAA 2QROA 5E7MA 4M1KA 1Z63A 1XP8A 5IT5A 1DAEA 4CEHA 5GJVC 1XD9A 3H1TA 4YC7A 4DBLC 2VP6A 3KKMA 2ZS7A 3THYB 4HB4A 4DEXA 1W5SA 1CU1A 5JJIA 4IFEA 1AIPA 4BQSA 3LO5A 3MWYW 3GFTA 3U3MA 2PCJA 2ZR9A 2F43B 1SXJE 3GJXC 3K70D 2ZAMA 3QG5A 1XBTA 2GJ8A 3FHOA 4Z54A 2QT0A 4A15A 2P6UA 3HDTA 3CRVA 4I1VA 4A0RA 5DN6A 4OQLA 5FTKA 3KTAB 1U8AA 2QGZA 3CH4B 3CBQA 4EJSA 3U61B 5FOTA 3WYGA 1KI6B 1KNQA 1HUQA 2VHJA 1NJGA 1M7GA 4H1VA 1P61B 1NRJB 2QAGA 1W0KA 1G6HA 2JIZD 4DLTA 5FUVA 3TAHA 1FOEB 3OEED 4TWZA 3SJBA 2KSQA 3AF4A 4WZAE 1XEXA 1O87A 4TMZA 4G5QA 4AG6A 2QPTA 3BD9A 2Y8EA 2F6RA 3BB4A 1CULC 2O8EA 3U5ZB 2HJGA 2J46A 1P3JA 2KWIA 1GWNA 2J87A 2RGGA 3O8DA 3FYHA 1W44A 3ZLJA 5FOWA 2JLZA 1E9RA 1QHGA 2UVQA 2R65A 2QT1A 2QQ0A 4CEIB 2DBYA 4JVLA 4DLXA 4NH0A 5JCZA 1E2KA 1KI4A 2VLIA 3HR8A 2D2FA 3EZ2A 3S1AA 1KNXA 3VU9B 2OFXA 3VQTA 3R7WA 5H68A 3LBNA 5JEDA 1KSHA 3CB4A 3KJIA 4OL0A 3RRMA 2UZIR 3QPWA 3IPXA 3FVQA 2Z0MA 3ZVLA 3DKVA 3BRWD 1X8JA 3EWAA 2Q9AA 1C1YA 3RRZA 3SJZA 4B44A 1EFRD 4UJ3A 1JXOA 1N5JA 1E1QA 1NVVR 4FCTA 5FTMA 1NJFA 2HF9A 2QL6A 3C5CA 1XF9A 4WZBE 3RS0A 2VSOA 2WPDD 3P32A 2J0UA 2QPAA 5FPKA 4AK9A 1N6OA 2FA9A 2QNRA 5AJWA 2ZSEA 1PUJA 3TJZA 2JA1A 3THOA 4U02A 1G8GA 3EG5A 1RW4A 4QOSA 3K0CC 4FMDF 1ZIPA 1EFUA 2WVJA 2FPMA 1Q22A 4UXHA 1E2PA 4POAA 2DPXA 2QSZA 4XD7A 4JVNA 4S35A 1FL9A 3WRXC 3IDQA 3UKDA 4HZIA 4HB3A 4MKHA 1M6NA 2GF9A 1J8MF 3UMFA 3WP1B 4DJTA 2HYIC 3BXZA 1NG9A 1MABA 1KJZA 4M1YA 5EE0A 3IILA 1VIAA 2N42A 5FOSA 4B48A 1EFCA 3AVYA 4Y0VA 1ZD1A 4B47A 5FUYA 2E87A 5FL7D 4C7OA 1E79A 2RGEA 3WNDA 1E0AA 5C1BA 2C9OA 3CKLA 4P0TA 4C0QC 1WB9A 1XMSA 1JNYA 5SZKB 2ASEA 1A4RA 3BFKA 3L0IB 3AKYA 1Q1ZA 2CBZA 4Q1BA 2WWGA 1L4YA 4LPKA 4JIMA 5CB6A 4JLMA 1A2KC 1N6NA 1GNRA 2C98A 5H1YA 2JDIA 3SHFA 4DSTA 5CYPA 1J8YF 3NWJA 1X86B 1PVOA 2BVNA 5B64A 4BLOA 2G83A 1YZQA 3GLHA 2GKSA 2ZRKA 5CIQA 1XEFA 5CYOA 4W9MC 2WTUA 4MUAA 4QFMA 1FQJA 2IYZA 2NTYC 3ZVRA 4CEJA 3QUSA 2BJWA 5BN4A 2Z6VA 3MWKA 1YR9A 2C5LA 1FUUA 3H4MA 4QBIA 4RSGA 1I4LD 4MRPA 2OCPA 2ZVQX 5DGXA 1ZM3A 3NBXX 4I1SA 1HTWA 3TVDA 3CF2A 5BN3A 3LBHA 2JLRA 3GLFB 2ZUBA 3DVLA 4DIEA 3W6PA 5K8IA 1VPLA 3OEEA 4LJ4A 4DT1A 3EZ9A 3U60B 1IAQA 1S96A 3T06B 1Z2AA 4ESHA 4NYJQ 1KI6A 2BHRA 2WMOB 3TSWA 3ZS9A 1E9BA 1T3HA 1W4BA 4Q4AB 1WBBA 3BGWA 4R9UC 4BZXA 1N0UA 4LYAA 4QGGA 4BFUA 1OYYA 1XEXB 1SGWA 1OPXA 2VPPA 4Q1CA 1QRAA 1JQJC 1CR0A 4U7DA 1YZGA 1R2QA 2IYWA 1DO0A 1OH6A 3A1SA 1G9XA 1LVGA 4D0LB 4HAYA 3GLIB 4DIDA 2C96A 2O5VA 2V7QA 2ZSDA 4Q9KA 3EPLA 5LB2A 3AUXA 4M53A 4MKFA 5AUPB 3UWOA 3KXIA 2IYXA 3SQXA 1I2DA 5GJCA 1U8YA 2BMEA 2IS6A 3FE2A 1EG7A 3GLIA 2GXSA 2J59A 4TSFD 3DO6A 4HDOB 1K5DA 3NHAA 3A8TA 3C14C 2OILA 3QF4B 3RS7A 1LNZA 1S4QA 1QBKC 3CWQA 2GAOA 4Q4JB 4PPQA 3DM5A 2V9PA 4XWOA 1NLFA 1AK2A 1COWA 2XTMA 4A8JB 2YWFA 2BCGY 4TYYA 2QMEA 1DVRA 1YZNA 3H86A 2DFTA 1Z07A 2DFNA 3CZPA 2GJAA 3KXKA 2O8CB 1F2TA 2QSYA 2DHRA 2JGNA 1XX6A 2FEOA 2ECKA 4A8JC 5DI9A 4ZDWA 4BZPA 5L3QA 2O8DB 3C16C 4JBXA 3PEVA 1MO3A 5FBQB 1GRNA 4BEBA 1BYIA 3B9QA 5L8VA 2IS4A 4JBWA 2C03A 4MITA 1FUKA 1OXXK 4Z1MA 2YC4C 4GDFA 3QENA 5GVRA 2IXGA 1IOZA 3REGA 2GNOA 4D81A 2ZRHA 3U7HB 1YRAA 4HB0A 2FMXA 3G0HA 1P75A 4OK5A 2Q0HA 2CL6X 3WP0A 1XDBA 5CB8A 4M0LA 4QGFA 2VSFA 4H1UA 3ASZA 5KOYA 3T34A 3NG1A 4KO8A 1NN5A 4D2IA 4KI0A 4D4MA 2OLJA 1UKVY 2FFBA 1AQYA 4Z8XA 4Q01A 4WW0A 3TW4A 2F9LA 1CXZA 4KJZA 2QPOA 3NIBA 3OAAD 2ZU6A 3WBKA 4QKQA 5TMPA 3BS4A 3Q9LA 4FIDA 4ZIRB 2O8FA 2VHCA 4B3FX 1UBGA 2YJTD 3SDZA 5DYGA 4B3XA 1TAGA 3FKSA 4CZ2A 2J0UB 2R6AA 3D7MA 4LX0A 2ZXUA 2CL7X 2QORA 1R0ZA 4R2HA 4F38A 3DEFA 4JJKA 4M21A 3LX8A 1ZC3A 2A9KA 4JVSB 1VG1A 4PHGA 4NTZA 1NY5A 3FB4A 1EK0A 4NYMR 4B2IA 2QP3A 1U0HC 3DOEA 2D3WA 4TN1A 1RYHA 5KYKA 1E79D 4U5XA 4URUR 1EXMA 5AK0A 1MH1A 5KHOC 3U7GA 2AWOA 5JJKA 1CJVC 2P6RA 1LB1B 2NGRA 2ZJZA 4TQ9A 2W2VA 3DKPA 4AYTA 2YWEA 4TLEA 1MABB 5EQTA 1H65A 121PA 2V4ZA 1T91A 3NH9A 4GBMA 1IY1A 1Q1BA 2HLDD 2IA5A 1P9NA 3FMPB 1UKEA 1IONA 2P2LA 8OHMA 4V0ME 2W00A 4A36A 5DYIA 1CJMA 4I1OA 1RRGA 4D26A 5FBLB 3QEOA 1I4DD 1GL9B 1GL6A 2CCJA 1F3OA 2WM9B 3CF6R 5EZ6B 1DO2A 3RDPA 5JWRA 1TL7C 3HU1A 4CIDA 1FFHA 5JS7A 4B74A 1PV4A 2IYTA 1DELA 2B21A 4QGHA 2Z43A 1R8SA 1W4CA 3W8NA 4GMDA 4ACAA 4C0HA 1GOTA 2CHGA 1CJTC 5E7IA 3TQCA 2P5SA 5KSZA 1Z0IA 3R7WB 2MSEB 4PO1A 4DSNA 3P20A 4PHFA 3CPEA 4XVUA 2X19A 4BUJA 1K5GA 1Q1QA 1SXJD 1UEIA 4BPBA 3KX2A 2QTVB 2ZSFA 4JKIA 3VR1A 1VCIA 2BIFA 5EE3A 1UM8A 2GJKA 4E5UA 1TQ6A 2IBMA 2EFDB 2FZ4A 5DIFA 3QKSA 1T5IA 1XEWX 2HT1A 1IN7A 3FKSD 4TLCA 2DWPA 2QG6A 1R6BX 1A2BA 1RRPA 2XXAB 3KQKA 1KDOA 1ETUA 2ZUDA 3QJYA 3U44B 5CM9C 2ERXA 1UBCA 1L4UA 4PAQA 1DAFA 4TQAA 4D0NA 3RANA 4GNKA 3EPHA 2FDCA 3SJCA 1R0WA 4UNQA 5LBIA 1X8LA 3PCRB 2PZGA 1NG1A 5JI3E 3H84A 1D8TA 1SKYE 3SE0A 4Q4AA 4BECA 1DAIA 3QF7A 4NCNA 2GJSA 2NMVA 4TMXA 1WMSA 2XNDD 2G9NA 1MO6A 3PXGA 4BLRA 2J7PA 3B1WA 4L8GA 4DLRA 4FMDB 3LAWA 4II7A 4WVFA 3KB1A 3NXSA 4NONA 4AKIA 3BC1A 1KY2A 3C5HA 4PO9A 3RSLA 1CIPA 1NBME 1RVDA 4DLZA 1RFLA 4QJ3A 3GFOA 1FQKA 3QY0A 1TEXA 1E2MA 2JLWA 5ELXA 1KKLA 4LCBA 2N1BA 3B1YA 1JEEA 2VH5R 4PC6A 1GL7A 4HAUA 4PZZA 2NG1A 3AF3A 4QRHA 4RY2A 3KKPA 4RKEA 3ND9A 4GZMA 1N6RA 1GUAA 2KE5A 4UNSA 5G3ZA 1QHHA 2A5FA 2VBCA 3GEIA 3WYAA 4LBYA 3B9PA 4A2QA 1XCMA 2OT3B 3DPUA 2FZLA 5JZVA 1CRQA 2QE7D 4I4LA 4PFSA 2EFCB 4TZ0A 1KO5A 1HQYE 3T61A 1PZNA 4RD1A 1IQPA 1OW3B 5F3WB 4S2EA 3AP1A 3GJ7A 3IBGA 2IHBA 4XSGA 4MDFA 3BE4A 2YHSA 1RRCA 3QKUA 3TH5A 2CVHA 4E09A 5FOXA 5SZIA 3TSOA 2FGKA 2Z4RA 3X1ZA 1T8UA 2YYZA 4IEIA 4ASUA 3K0SA 1SULA 3IO3A 1CR4A 4CDGA 3PR1A 1NN3A 2QMHA 2J41A 2ZEJA 5DN6D 2CJWA 5TDHA 1MKYA 5EZ5A 1HH4A 3QBTA 4UNPA 3EIEA 3QPUA 1RIFA 5KSOA 4KAXA 1KZ7B 4ABYA 1XFAA 1Q21A 2MMCA 4MGZR 3GJ6A 2EWVA 1ESMA 4G3XA 5KPDA 1L7VC 1QHYA 1T4GA 2RH5A 4CYMA 2GBLA 1OH5A 4GOXA 3W3ZB 5AJVB 1IN6A 3BK7A 1UKZA 1SQ5A 4GPTA 1R8QA 1KDRA 4CEJB 4YONB 1M34E 221PA 4B6EA 1LFDB 3W3AA 5HCNA 1GG2A 1IN8A 2VO1A 4LJ8A 3RVBA 3TIFA 3NBZC 5KU1A 4AKEA 3EPKA 2XB4A 4C9BA 3PITA 1G18A 2BBTA 1ZBDA 1N5LA 5KNBA 3E70C 3D6TB 2ZI9A 5DSZA 3KJGA 3Q72A 2ZRBA 1KHTA 4G5GA 2VP9A 3RC3A 2HV8A 4KU4A 4CW7A 2MSDB 1XD8A 4YXWD 3I62A 3EZFA 2ODEA 3FPAA 5CDFA 4CF7A 4OI2A 2REXB 1AKEA 3MJHA 2GETA 1WP9A 2ORVA 2JLSA 3GJ4A 4X8HA 4Q47A 4BFTA 1DARA 4MRRA 4EJSB 3QEJA 3IGFA 3K0AA 4JYBA 4P4TA 4ZDIA 3RLFA 2BKUA 4A6PA 2BBOA 1SHZA 4LRWA 2J9RA 4C0JA 4DT1B 2XNSA 1US8A 2V6IA 2XTNA 3TUJC 2XJ4A 4TT3D 1IN5A 2PEZA 5AUQA 4ZI2A 2JLXA 1CLUA 4DHEA 2VP0A 1ZM2A 2RGDA 3PG5A 2NZJA 5FPTA 2C78A 3OIYA 5FL7A 2GK6A 4N0EA 2OO7A 2J0QA 2ATVA 2WWHA 4O25A 4IFBA 1ZM9A 4DEYA 5F98A 4QM7A 2WJHA 2QE7A 1EFTA 2WICA 3ZQJA 3BB3A 4Q4LA 3OFNA 4IOMA 1HE8B 3I32A 1TEVA 1OKKD 2A2ZA 3LLMA 4MGKR 2H17A 3GLIE 2IK8A 4IRUB 4EQ6A 2IXFA 4BASA 2GCNA 5BWMA 1W49A 3P26A 3QXXA 4OQXA 3RRYA 3VX4A 4MRSA 4MKGA 2V55B 2HYDA 1BH2A 1N5IA 2YOGA 1F6BA 1HV8A 2F1JA 2WHXA 3QXHA 4OJQA 3KXLA 2LKDA 2WSSA 3LVRE 4EQ6B 4WAUA 3GMTA 1JAIA 4A0FA 2CXXA 4C0BA 5FBVB 5DO9A 1Z2CA 1QVAA 2ZR0A 1S1MA 1ZCAA 5HE8A 2NPFA 4D6PA 5KPJA 2JLUA 1G5RA 1XJ0A 1ZYUA 4M1WA 1JJVA 1KI1A 2VF7A 1ZNXA 4LJ5A 2AK3A 2NO1A 2JIZA 5LDDC 1GSIA 1KI7A 3GLFE 3K09A 1F2TB 2XSZA 1IN4A 2ZJAA 4HZUA 2PMKA 4LC0A 1FP7A 2FFQA 3CWZA 4M2LA 2VHQA 1IXZA 2OLKA 4BRUA 2G3YA 4C7OB 3CX6A 1J99A 3R8FA 1DAMA 1SHKA 2CHVA 3BIFA 3KKNA 4ZPXA 3KDSE 4TMVA 1NNEA 4DRZA 2V54A 1DAKA 2Q9BA 2QM7A 3FFBA 1TUEA 5LD2C 3AGQA 2WJVA 1P2TA 2G1KA 4IDOA 4ARZA 3PENA 5FOUA 1VYVA 1NSFA 2KI5A 1W0KD 5J40A 4B75A 1R7RA 4TTRA 2CL0X 3CONA 4C2UA 1SVKA 4D0GA 1MV5A 1Z0AA 4B3BA 2DYKA 3AVOA 1T6NA 1MO4A 1JI0A 1U2RA 1NN0A 4LV8B 2RKOA 3AV0B 4Q18A 5HZHA 4HLDA 4GL2A 5EUQB 2ORWA 1S3SA 3ZZTA 3UMSA 1P2SA 1E4VA 4Q1AA 5G3YA 3X1WA 4WZ6A 4MGIR 3HYRA 3VR2A 3EX7C 3SI7A 4M1OA 1GDDA 1LF5A 4R98A 1KMHB 3I92A 3EIQA 5EP1A 4XTCS 1E6CA 2GA8A 2QAJA 1KGDA 5KUTA 3PUWA 4LJ9A 3W6OA 1I2MA 4F7WA 1HT1E 1RE0A 3SBDA 4BRWA 4GMXA 4HLUA 4IW3B 2XB2A 3E2IA 1Z6YA 1AGRA 2PJZA 2AX4A 3A37A 4QXAA 3U4QB 1Z0FA 2JLVA 3MWLA 4G1UC 2QENA 1U8ZA 1FTSA 1US8B 2EW1A 5TV2A 3UMRA 4QGAA 5JBQA 2PL3A 4OQNA 1G291 2XGJA 1MRNA 2IEYA 3BH6A 2IYSA 4G0NA 2D62A 3DZ8A 3DOFA 1GNQA 1XD2B 2CDNA 5L3SA 5JSZA 3JZAA 1W5TA 3ZZ0A 3TSZA 1H8EA 721PA 3N2IA 1BMFA 3THYA 5EXSA 2FSHA 1SVOA 1SKQA 2QP9X 2CCGA 4EFLA 2FSGA 1OSNA 1G3MA 4O2LA 3BH7A 1QVRA 3IHLA 1HT2E 4D4JA 3R9IA 4FINA 3OIWA 4M9SA 3AVQA 5KNDA 3KUDA 2GTPA 2YOHA 3T5DA 3U7EB 4A4DA 3OE7D 2AXPA 3VR4A 1NVUQ 2X2EA 3B1ZA 2J0SA 2CCKA 3K0EA 2D74A 2IUTA 1ZRHA 1IHUA 4EJSC 6Q21A 4UXJA 1DE0A 2XITA 4Z1MD 1D5CA 1YR7A 2F7SA 2GK7A 3QXJA 4MGYR 4US1R 3L82B 2IYUA 2GXUA 2JCSA 4JL6A 1R0XA 1YKSA 3KFVA 1EGAA 1GKUB 4TT3A 3JZMA 1G1MA 2R6FA 3B85A 2O0KA 3GJ8A 2WOOA 3AF2A 2KJQA 3NBYC 2WSSD 4D4LA 2G0TA 4JYCA 4C4PA 1ONBA 1QDEA 2VEDA 3SYNA 1L2TA 5F9HA 2IX3A 4PC1A 1XEWY 4HDQB 3I5YA 3IEVA 3PVSA 5B58C 2J0VA 1Z5ZA 3UANA 4B35A 5JWOA 1TF5A 4TTPA 1P6XA 1OKKA 2JLYA 3THWB 5BN5A 1RC8A 4NYIR 2LWIA 3CPJB 4OQMA 4EDHA 4F93B 4B33A 1XNJA 5AJYA 1QHHB 3EASA 3I72A 4PHTA 2QRZA 4Z8YA 3R20A 2ZRNA 3BJIC 4FD2A 5IDVA 1L8QA 4JLDA 5KNCA 3D3QA 4EPVA 3FMFA 4TYWA 1AZSC 1ZAKA 4ZDKA 4TL9A 1W2HA 2CNWD 1CKEA 4Q7KA 5J4YA 1II8A 4NCKA 4KSBA 3MGCA 1Z47A 4YXWA 3QQ5A 5K8TA 3NC0C 2GESA 1A5TA 3PUVA 2O8BA 1JALA 3U3JA 4WOPA 4NL4H 3TQFA 1XRJA 3M1IA 3AKDA 1ZUHA 1QHSA 1V5WA 2ZRDA 2NO6A 3Q3JB 3SYKA 4EPWA 1F2UA 1E1RA 4P33A 2ZU0C 5E95A 3KTAA 3RC8A 4WBSA 3KKOA 1E9FA 2SHKA 2JDID 4AYXA 3KQLA 3BORA 1D6JA 2C95A 5GVSA 5JEEA 1CJKC 1Q44A 4YQFA 4OBEA 2IUUA 4HAXA 3K9HA 1A82A 2WAYA 4XWAA 5CK4A 1EFRA 4AYWA 4FWTA 4DCUA 1MR3F 1G4AE 2ODWA 3EC2A 4ZV4A 3CRW1 4LBVA 1JPJA 2J5XA 4TZ6A 5KO2A 1ZW6A 1VYTA 1NLZA 2OAQ1 1G8PA 3CZQA 2GCPA 1KMHA 1KSGA 4LDJA 3IQWA 4LV5B 4EAQA 3WNBA 5JRZA 1OFHA 1UDXA 2CLCX 2D4HA 4NYIQ 2O8EB 3SHWA 2R44A 4W5JA 3NBFA 3LV8A 3CRMA 5D3MA 821PA 1B23P 5TVKA 5DI3A 2CK3A 2Q21A 3L0PA 1QHIA 1Q1EA 4PANA 3E1SA 3VKWA 5FI1B 2WBLC 3EWSA 1KO8A 2ZRMA 3EAQA 1JB1A 1GRQA 2PMDA 2WJJA 5FFMA 2P6NA 2H7VA 5K8LA 2DY1A 1AJEA 2ZRGA 1NN1A 3B13B 1OLOA 2IYLD 2WMNB 2OBMA 4OKSA 2OV2A 3C41J 1RJ9B 1W0JA 1DEKA 1ZU5A 1W0JD 1WRBA 4ZDJA 4QG7A 1JEDA 4B2PA 4D4KA 4RD4A 1NBMD 1W7AA 4YMSA 3EA0A 1YZUA 1OH7A 2WKQA 2VA8A 1ZM7A 4DCTA 2W6IA 3ADBA 2NO9A 2IYQA 2YVUA 3ND8A 1E2FA 2ZRFA 3PUXA 2HXYA 2O0JA 5G41A 3AVTA 3PUZA 4KHZA 4LYFA 1FX0A 5TY0A 1HURA 4V0KA 3PIRA 4C0AC 1F48A 5DISB 5KSYA 5C46F 2EVWX 2QN6A 1JXMA 2ZYUX 3PEWA 5SZJA 2XOKA 3EIHA 3W6NA 1NSTA 3U6BA 1E2IA 1FX0B 1ZCBA 1K6MA 4DCVA 2BM1A 4YMVA 4EPXA 1NBMA 1P5ZB 2KBEA 2YWGA 4LGMA 4YDSA 1XPUA 4Q48A 4B6FA 4KYUA 4XVQA 2QY9A 3VHLB 4BFWA 4BFVA 4BE7B 4HUTA 4TMWA 3FWYA 2QP4A 5DE3A 1S3GA 1VG0B 2Z4SA 3CH5A 1BIFA 1O3YA 1AA9A 1VKJA 2QM8A 3A1WA 4KYIB 4LI0A 4PX9A 4RD2A 2K5UA 2J45A 2ZJ8A 1RZ3A 2DFLA 3GQBA 4K81B 2VRWA 1YRBA 1OJLA 4PO8A 4RFSA 2ANBA 5E3HA 1SVMA 4KBFA 4URZR 4C0SA 1TX4B 3L0OA 5EJEA 4DKXA 4DUGA 1KO1A 2ZREA 3UG7A 5JI2E 3SOPA 2JJ1A 1TMKA 3DZDA 3GFPA 4US2R 1JJ7A 1R5BA 1QHNA 2H1LA 2QU8A 4IJMA 4XSHA 4EPYA 1HA3A 3HU2A 5EE5B 1A1VA 3ICQB 3VKGA 2VIIA 1NIPA 4MYHA 2IF0A 2P0EA 2HDNB 2C99A 2WSMA 5GJWC 3F5FA 4Q1EA 4NP6A 1GKIA 2B7CA 4NYJR 4US0R 4KFRA 4PC7A 4QNRA 1Z8FA 4HLCA 5EE9A 2VYFA 4P4SA 3PEYA 1P9WA 3SU8A 1D9XA 1H8ED 3V4FA 3D8BA 2P65A 4ON9A 2WWFA 1COWD 3FMOB 521PA 2ZE6A 3RS2A 4ZKDA 4Q02A 1UFQA 3AVVA 2RMKA 3NH6A 1IBRA 3A1TA 4KV9A 2ZRPA 4BLPA 2F55A 3B82A 3ZZUA 3TUZC 2CVFA 3TR0A 3KQUA 1KKMA 3I5XA 4EPTA 3AVUA 2GRJA 1NMZA 3SZRA 2ZETA 1E2NA 3B6EA 2FFHA 1VDZA 1JQLB 2B8TA 2BBWA 3N2EA 3TK1A 1D2MA 3Q7PA 4Y0AA 3H0KA 1KIMA 3RWOA 2PX0A 3AF0A 3QIAA 4RZ2A 4V0NA 1RYFA 1CBUA 2VP2A 4TL8A 3IPYA 1E0JA 4HATA 3GJ0A 1WXQA 2W83A 2FGJA 2I1QA 3LW7A 3U2QA 1CRPA 4DLWA 4NKRA 2ZTSA 4DXAA 2I1VB 4M9ZA 4AKHA 5F2EA 2GCOB 4ERNA 1UAAA 4CGZA 1N0VC 1PLKA 2FH5B 4IOKA 1D2NA 2CE7A 4Q03A 2XJ9A 2AN9A 1KK3A 4TYNA 5KDLA 2F43A 2GJ9A 2GVZC 4QHTA 4JZKA 1W1WA 4DB4A 3LRPA 1OHHA 1XXHB 1DAGA 1KDTA 2IYYA 2HUPA 1YR8A 1OXUA 4TLAA 2LKCA 1KSFX 2RGNC 2REOA 4P4UA 1C9KA 1N6LA 4C0LA 1G7RA 3AP2A 3O8BA 3ZYCA 2B8WA 1FPMA 4B3CA 4EIWA 2IEZA 4XTRA 3CM0A 1XWIA 3QKRB 1SVWA 1E2EA 3MUFA 2OXCA 5FH9A 2C2HA 1E2GA 2C04A 3A4MA 3M6AA 5H8WA 2E9SA 2DR3A 4DLSA 4LY6A 3R9WA 1P73A 2WOJA 2OG2A 1S2MA 1XTJA 3AVXA 1JR3D 3N5CA 3TUIC 4ESVA 3SQWA 3ADCA 1AKYA 2GF0A 2UZ3A 5CDFE 3RYTC 5FBWB 1P62B 2ZJBA 1VG8A 4LBZA 5EXTA 1T9HA 2AFIE 3NDBB 1GIAA 2HXSA 4Q9HA 5P21A 2J3EA 1E9DA 4JSTA 2H5EA 4FW9A 1U81A 1HYQA 2AHOA 1FMJA 1S9HA 2OFWA 3OF5A 4HAZA 5CK5A 1W36C 4URWR 1W47A 1Q12A 5DNYB 1E9AA 4HSEA 2IT1A 2J7KA 2ZSBA 2BMDA 4E07A 2A5JA 4ZCIA 3GEHA 2O8CA 1YJ5A 2ZSAA 4GOJA 4JLNA 4KXFB 4IDQA 4BZQA 1OH8A 4HYYA 1XZQA 4NBSA 3ECCA 4I81A 3ZJYA 4BGDA 4URXR 1J70A 1N6HA 3CNLA 4LC1A 3QVUA 3NDPA 1Y3AA 1LF0A 4TQUS 5EP4A 5KTYA 1F60A 1QF9A 2RHMA 2AFHE 5HZKA 4LV6A 1X3SA 4QHYA 4MA4A 1Q0UA 4A8JA 1IXSB 5GADl 3RWMB 2HEIA 3ETLA 4PR0A 3ZS8A 2FF7A 1H8HA 2HCBA 1LS1A 2GEDA 3WNCA 3KKQA 4JL5A 4NE2A 1ZU4A 2FSFA 2ZVPX 2OCYC 1PJRA 4AWXA 1M8PA 3D31A 4W7SA 5L3QB 3I8SA 3DL0A 4LJ7A 4LUCA 2H16A 4A9AA 5KDDA 4BFYA 2HT6A 3DM9B 1ODFA 2CHQA 1E99A 3GJ5A 2PZEA 1G5TA 3AM1A 3GLGA 1E32A 1TUIA 1Z29A 3VKHA 1E9CA 2UKDA 3KUCA 2WKRA 1U90A 1G17A 3THXA 3P4XA 1KAOA 4JLJA 4JT4A 4Q4HB 3KL4A 5HPYB 1M74A 1QG4A 1YE8A 4PC3A 1TF2A 3VHXA 4DSUA 5GJBA 4TL7A 2IS2A 2FU5C 1M1YE 5DI3B 1AS3A 1FNNA 4RCYA 2BKEA 4XVRA 4NPHA 2QGNA 4PQFA 3NHBA 3K9LA 3OFND 2AXNA 4OHXA 5UKDA 4DLYA 3HPRA 4IOJA 4HLUC 2DWOA 1II9A 2V3CC 3REFA 2VQSA 1P2UA 5SZHB 1OE0A 3P1JA 1WCV1 3QBVA 4LZZA 4NCJA 4OHVA 4Q1DA 4Q9JA 3RNLA 1XPRA 4OI0A 1TTTA 1DPFA 2NO7A 3K0CA 1XTRA 4PPGA 1E2QA 1KAGA 3GP8A 5CLQA 2V1XA 2ZRCA 4AURA 3GLHE 2GAAA 2YV5A 1W4RA 3OHMA 1MRSA 5JECA 4LHVA 3LXRA 1Q3HA 4XJXA 1Z3IX 1D2EA 2IF2A 3PUYA 4QBHA 1J2JA 1B0UA 3QVVA 4LK2A 5IK2A 3SN6A 1P4SA 4FCVA 1E9SA 3WMFA 1TNDA 3LFUA 5EP3A 1DG3A 2FPKA 1LTQA 2REBA 3K09C 4MQBA 3AGPA 3HU3A 2FN4A 2IS1A 1U94A 2GWHA 4Q7MB 4TSFA 4NDZA 3GLFA 1T0JB 5JLJA 4CT5A 3I73A 5BYJA 1GAJA 2H57A 3QXCA 2R6DA 3TVTA 1T3SA 1OV4A 1SVLA 2QMUA 2YWHA 5G40A 2RAPA 5HTKA 3BWDD 2EYUA 3LA6A 3ZVNA 3W5JA 2YKGA 1LS6A 1KSJA 2WZQA 1GITA 4NYMQ 2ZRLA 2D7DA 4GP7A 1GM5A 3ADDA 5CJ2A 2OBLA 3MMPA 4Q19A 2W6JD 3A4LA 1DOAA 3L8ZA 3DMNA 5FPSA 2WAXA 1VECA 1XJQA 1UPTA 3CX7A 3QXSA 3SS8A 1BKDR 1X6VA 2W0SA 3L8YA 3A6PC 2CLDX 2G77B 3CR8A 4ZI3A 4MH0R 2OESA 1VCOA 1Z28A 4DCSA 4F92B 2QUZA 4X8MA 2F3TA 4XH9B 4AI6A 2W2TA 4C30A 2FNAA 5G53C 3BBPA 4B32A 1E1RD 4H9GA 3E5HA 4FN5A 4I99A 4BFSA 1EFHA 2GEUA 4GP6A 1X8KA 1Z22A 2BWJA 2IYRA 4PSVA 1ZINA 4RKFA 3TAUA 4F91B 1VTKA 2ATXA 1VYUA 3CPHA 3WMGA 2QBYA 1Z0JA 2W6JA 1DADA 2JLQA 1FNMA 5JHGB 3THWA 1W48A 1QZXA 4N3NA 3EXAA 2D7CA 4IXNA 2HCJB 1D9ZA 4QBGB 4FMCB 4Q7LA 4M9XA 1XCGB 1QHXA 3FGNA 1G20E 1SKYB 2QRNA 4FCWA 4L9WA 3Q8XB 3OEHA 3CLVA 4KSCA 1UEJA 4KFTA 1GTVA 1DG1G 1ZC4A 2D06A 3LD9A 3QG1A 1IXRC 3X2SA 4DSOA 4EFMA 3SNHA 4QJ4A 2NQ2C 3THXB 2CK3D 5L3RA 3W5IA 4CEIA 3QI2A 4Q4HA 1W2GA 3QOFA 4R2IA 4XD7D 2F1HA 2WJGA 4O0MA 1ESNA 3OIUA 4A6XA 4D82A 4PHHA 3RABA 1G8HA 2ZJ2A 1XMIA 4YMWA 2PH1A 4RZUA 1WA5A 2NO0A 3LWNA 3EW9A 4XWKA 1TU4A 2OAP1 1TQ2A 5A4JA 3F0TA 3R8CA 2X1VA 3F3YA 2XOKD 4PAMA 3RSOA 2GHIA 4MYTA 3TGPA 2B92A 2A5DA 4QM6A 1OHHD 1TF7A 1TQDA 3CX8A 1M2OB 4G01B 4O2RA 4Q5IA 4TYPA 4Q9IA 1CTQA 2ZM5A 1FW6A 3HJNA 5F9FA 1N0WA 1UBEA 4LJ6A 1E2LA 1II8B 2XZPA 4KLZA 1UADA 1E0SA 4ARZB 3KFXA 4IOLA 3LQQA 2CJWB 2ZS8A 1S9DA 1SVSA 4C3ZA 2WIBA 2ZI6A 3VNVA 1ELOA 3NVAA 2BCJQ 4I1UA 2AL7A 3NKVA 4JS0A 3SEAA 2ZRJA 1KY3A 4AD8A 5JCPA 4LOAA 5EXXA 1N5KA 4GSYA 2O52A 1PUIA 4RCZA 4PSAA 2ZJYA 2P5TB 1MT0A 2AD5A 2ERYA 3FMIA 4IEEA 1E1QD 2ORIA 4WXPA 4JVMA 3P27A 4OYHA 2PX3A 4G5RA 3NTUA 3TKLA 3OIVA 3B1VA 3ZIAA 1KI2A 3QPVA 5HKKA 3BH0A 1G4UR 3LLUA 4Q1FA 4M22A 2HLDA 1XTKA 3BOSA 2N46A 3BFVA 2DCUA 2ZYWX 1WBDA 4X8OA 3NEJA 2DFKB 2ZROA 4ASUD 2R2AA 3KJHA 1VIYA 4QJ5A 3AUYA 4FMCF 2BMJA 3I3SR 2RGNA 1DAHA 1GP2A 2ZAOA 2Q6TA 4DCNA 4QC2A 2RGXA 3U3OA 3VAAA 3CIOA 1OYWA 1TQ4A 4QBFA 1GVNB 2JATA 2DB3A 5IRCD 2WPDA 5JFGA 3GEEA 3IIMA 3QKSB 2W2XA 3U6KA 3TW8B 1N6KA 1SXJC 3TNFA 1VCNA 3M4YA 3CUEF 5DHAA 4PTLA 4RVCA 3MAAC 2RGCA 3LQRA 1AM4D 3T1QA 1WF3A 1AS0A 3FHTA 1T3LA 1R10A 4HEJA 4LPSA 1OF1A 3DMDA 4F4CA 2WIAA 2XZOA 3EPJA 5BYKA 2GILA 4GI7A 2EU8A 1RKBA 1QG2A 1N3BA 1X1RA 2ZYTX 1IJFA 1Z6TA 2G0NA 4JMPA 4YMUA 2OM2A 2O8DA 1ZJ6A 4PZYA 3UXMA 3B8HA 5E4FA 4IVPA 1OXTA 3CO5A 1R5OA 3RS3A 4AKGA 2JASA 5FPYA 3W90A 4OK3A 1JAHA 2VP4A 1Z6GA 3P4YA 1PLLA 2E1RA 4JJZA 1JECA 4MUBA 1OXSC 2G88A 3OEHD 4LHYA 3V4RA 1K8RA 5EE1A 2BV3A 3PQCA 2EQBA 1F5NA 2ZR7A 4LYHA 3H2YA 1IY0A 4OHWA 2XX3A 2LCFA 2Q3FA 4KFUA 2V1UA 2XAUA 5FOVA 4DB2A 2Q9CA 1I4TD 2Q3HA 4BLTA 4AC9A 3CRRA 1G3QA 3GPLA 4AY2A 2FFAA 4YLGA 4LHXA 3AP3A 3UIEA 4EFNA 1XMJA 2F1RA 2H8KA 1G6OA 2AK2A 3EA5A 2QQEA 3T12A 1II0A 2QEQA 3ZD6A 1OXVA 1Y63A 3SR0A 1S0UA 1EX7A 3K8YA 4RFVA 4G5SA 1GZSA 4A92A 4KCGA 1XJCA 4DDVA 3KJEA 5DLQC 1FMLA 5JWHA 2QBYB 3MRSA 3NEYA 5JMTA 3GLGE 3I4LA 2ONJA 1CR2A 3JVUA 4URYR 5FI0B 5IF9A 5J4VA 1S8FA 2IWHA 4NU0A 1KK2A 2FE4A 3MFYA 3L0SA 4URVR 1W36D 1JBKA 2QZ4A 3JVVA 3Q5DA 2BC9A 2QI9C 4R7ZA 5BXQC 2RGAA 2TMKA 3WYFA 2GBLC 2YINC 4UKDA 5FBRB 3KQNA 4DLUA 4JL8A 2OUKA 4WIAA 2BOVA 2F9MA 2D2EA 1G21E 1Q3TA 3FDIA 3VR6A 3X1YA 4TMKA 2HF8A 1HQCA 4P32A 1CJUC 4RD6A 2FPLA 3UPUA 3VR5A 1CR1A 1IY2A 1WQ1R 1NVXQ 4KLNA 3IQXA 1ZUIA 2RCNA 4LHWA 2EYQA 4TLBA 2VTKA 1G8YA 1OIXA 3UG6A 3HP1A 2F3RA 2GDJA 5C4MA 3IO5A 2ANCA 1YHNA 2R62A 1ZM4A 4IHQA 3I8XA 1ZVQA 2FG5A 2W0MA 3WHKA 1M7BA 3VFDA 5LD2B 4PAOA 5HKKD 5IHPA 4B71A 3ADKA 2GCOA 2ODNA 4IDNA 4BFZA 1JR6A 1YZTA 1G19A 3MJRA 4A0HA 1OFIA 4C0KA 1CF4A 3AKEA 4V02A 3UK6A 4HI0E 3A58B 2XZLA 4CEHB 1SVIA 2FJUA 2O8BB 2AWNA 4IDPA 4LYJA 1GILA 3FKQA 3T1TA 4PPFA 3W9YA 1W46A 2DWQA 2G1JA 1V43A 2VP5A 2EFEB 1R4AA 1OB5A 3U3RA 5FTJA 1R0YA 3HR7A 2ZANA 1DBSA 1E98A 1NY6A 4W5WA 3BERA 2ZI4A 1YU9A 1TADA 4HAWA 3ZDQA 1G7SA 2PEYA 4D80A 5LPNA 2GXAA 4IVRA 2BEJA 2BMFA 4YMTA 4ITRC 1KK0A 4F4IA 1LW7A 2B6HA 3TRFA 4CVNA 2CE2X 1E2DA 5CM8B 1BO6A 1XXHA 3WBJA 4E03A 5FL3A 4UJ5A 4L4UA 1C4OA 3IBYA 4ZKEA 2PJRA 4LWZA 3B1XA 5FR1A 1YQTA 2IYVA 1FZQA 2F1IA 3J81k 1UF9A 3W8RA 2JAQA 2ZIAA 1KI9A 3GJ3A 2ZJOA 4JLKA 5J5CA 4JBYA 3IKJA 3S1AB 2FV8A 3VU9A 421PA 3G82C 1KI3A 1ZNYA 5C4GB 2OCAA 2OSBA 2ZQ5A 4QHSA 4M1TA 1DS6A 3K0FA 3Q5EA 4RD3A 4LBWA 4HUQB 2PLFA 2EFGA 2PLRA 3LVQE 1EESA 2J1LA 1U9IA 3MD0A 1XPOA 2C9YA 5CITA 1FP6A 3SC3A 1HE1C 3GCGA 4MRVA 2GEVA 1EX6A 1G3IA 5JS8A 1E2HA 1G64A 2IC5A 1Z83A 1U99A 3CNNA 1N6IA 1W36B 3B7GA 2FWRA 3LNCA 4FI3C 4B3DA 2RGBA 1OIWA 2CMKA 4LHZA 4BLQA 2VF8A 3W34A 4XIGS 4RD0A 3KB2A 3V9PA 1TPZA 2OE2A 1T0HB 2MMGA 4ZO4A 3DHWC 4RFSB 4TL6A 1F2UB 2AKAB 1AQUA 5H70A 4EPRA 621PA 3ZD7A 4LJAA 3K53A 4OI1A 3A4NA 2W6ID 4HB2A 3TBKA 4U00A 2IXEA 2C9CA 4NCHA 3GD7A
chains in the Genus database with same CATH superfamily
1HDCA 1UJ5A 1NKTA 2JJ2D 2YOFA 3IQFA 5B30A 5C7YA 1BAPA 2R6GA 1P31A 1R5NA 2XVZA 1Z6XA 3EC7A 1XTIA 3F6RA 1FDOA 3I12A 4GLLA 4A3SA 1DTSA 1MEOA 1S4MA 4IP0A 2OCKA 1V5FA 3B60A 2BGJA 3RVQA 4E22A 2PWZA 3DWIA 2Z83A 1BG6A 3ZHZA 1XK7A 1L8XA 3GL9A 3Q8WA 4DY6A 1C9DB 4I08A 2VZEA 4LJYA 3HBLA 1CZHA 4D98A 1X77A 1GQQA 1D1QA 1E9EA 3LBIA 1NVVQ 4A8TA 4REOA 4MW6A 2X0EA 2H9IA 2QIOA 3DL2A 4H0CA 3UK7A 1I51A 1UJMA 5K45A 3UMCA 1ZWKA 2VXCA 1S1CA 2I6TA 1JFFB 3HDQA 5FORA 2COKA 4BEJA 1RQGA 4AMYA 1E69A 4X3PA 3T1OA 4MV4A 4CKBA 2QN7A 3F7TA 2NXJA 4CE6A 4OUKX 4L15A 1NE2A 2ST1A 3RAPR 2CLKB 3BMCA 1D4OA 3LY5A 3LKZA 1N9KA 3OH8A 3WRYC 2ZPUA 1J8QA 1IG3A 3K9NA 4UE6A 2FRXA 1LXCA 4IIEA 3K16A 1WM1A 2ZUWA 3A36A 3ONVA 5H5JA 4FOSA 1QGUB 2TSYB 4UNRA 4KODA 1R9JA 4HH3C 4L50A 1PX0A 2JGJA 1GXSB 3S28A 5DP1A 3ZXXA 1NPTO 1PJTA 5JT1A 2WIKA 3CCFA 2JJ1D 2PKYX 4UXIA 3ZI0A 2XCOA 1T8TA 2ZRAA 5C8VA 4FMPA 2YJ6A 4JJAA 1Z4LA 3WKDA 4CCAA 3OLZA 1T10A 5A3SA 1AKVA 1FRQA 1P1BA 3QOXA 5J3JA 3OCXA 4MR9A 2QRMA 4PXYA 3N8GA 2WHQA 3TWOA 2DECA 5CXUA 1PLJA 5JRDS 5AVWA 3AFIA 4XM1A 4W9RA 5DBEX 2NZ8A 1O0SA 4MKRA 1KRWA 1NUQA 4RVUA 3D4PA 4FPXA 5T41A 4KMRA 3VDQA 1I10A 1DPGA 4K8OA 1SU8A 4FT4A 4RPIA 1ZUNB 4DA7A 1S8NA 4WNCA 4ZVSA 1GV1A 1P60A 3LUHA 3RS9A 3L2OB 5KDOA 3STXA 4LTMA 1D5WA 3FHLA 3OCJA 3EFHA 4EUEA 5JTUA 1NL3A 5AOCA 4GSKA 4FFMA 5H4HA 2AKYA 1RJ9A 2PJUA 3LRXA 4G0MA 1G7TA 2PS0A 3NS7A 4KQJA 1JDSA 1G41A 1Q1AA 2O3SA 3KB8A 4WEQA 2IP4A 2IWRA 3UC5A 4ZI7A 4HADA 3H3JA 3G0DA 4GPD1 4DYHA 4KUHA 2FR1A 3C0KA 3LC1O 4ETWA 5IUJC 2B0JA 1BE1A 1BU8A 3G5MA 3N2ZB 4B34A 3E9DA 4Q00A 4EKDA 3OHSX 5BW8A 5I4KA 2IH4A 4KWCA 2BEVB 3WRXA 3QKTA 2Z1MA 5DM70 3KPYA 2ZCJA 5LOVA 2A4KA 5IKOA 2R6JA 1HEIA 3P9ZA 2IQ5A 4CIYA 1WDLA 1FS4A 4U7WA 2P2SA 4QD3A 1KC3A 3ZBPA 1I7QB 3STVA 1DIRA 3RT1A 1CWUA 2FP4A 5NLLA 1GRVA 2PUJA 3CJRA 2QV0A 4QBKA 3K9GA 2UYQA 1TKBA 1XZHA 4OI4A 5TVGA 1S2NA 1P2FA 1LU9A 1K7XB 5BWBA 2FVYA 4XPIB 3SBEA 3G0BA 5E9QA 4PTYA 1KU0A 4DR5B 3AW8A 2C7OA 5F51A 4R5MA 2JGDA 1N9GA 3O7MA 1NJ1A 2VNHA 3H5NA 3QYPA 4TVKA 2A4MA 3EC1A 3F9CA 4OO3A 2FW0A 1DWQA 3H05A 1G60A 1G59A 2XB8A 3RK1A 1CJSA 3S2FA 3BAZA 4Q9LA 2WWIA 1VL1A 1O94A 3OO1A 4FGJA 1DJNA 5EQJB 3NNNA 3TB6A 3E05A 3OLCX 2IZ5A 2DTDA 3BIOA 5DPMA 4DJDC 4PZLA 2HWWA 1UJ2A 3UOGA 1CD5A 1P7ZA 2P8SA 4F1WA 4O8ZA 3RYHB 2X4IA 3Q3HA 3K1ZA 4HQFA 4ACBA 1A7JA 2BFFB 2A78A 3QUTA 4NF2A 5LKRA 3BMNB 1Y8QA 3U4HA 2Y6UA 4OFBA 3NX4A 1T8PA 2DY0A 4JB8A 4MEJA 3L01A 2JJ2A 3ZHXA 3A05A 5AJXA 1LLQA 2B30A 2B94A 1NMYA 2WIFA 3MCZA 5ICSA 1WZEA 2H18A 1PS8A 4ZT6A 4JR0A 3GA5A 5E1OA 2GPTA 3WMWA 3CE6A 3ILXA 1PE0A 2K4MA 1XDGA 3HVRA 1DZ3A 4TMTA 4WZZA 1F20A 4YJ3F 5L53A 3PNVA 1UZNA 4G5FA 4ZIRA 2CDAA 5HBRA 3D5QA 1CJCA 3SBOA 2HTFA 5HGXA 5KQRA 1ZSNA 2ENUA 1PL8A 3QJ5A 1JEYA 1IBCA 2XBMA 2OFOA 3HBNA 4DVGA 1UOOA 5C1PA 5JOQA 5JAZA 2V6MA 1MPXA 3PI6A 3QLEA 5AR1A 4CU5A 5BQ5A 3QE0A 2PVPA 3O47A 1ZHOA 4V3BA 2XKBA 4E12A 3PT5A 4P4SB 4MLPA 3QSYA 2EDAA 1G7CA 4ZRDA 2X6TA 3D1VA 4HBZA 3L41A 4WKNA 4DIBA 3T99A 1SPXA 2WWXA 3GDWA 4IJQA 5D84A 2C4VA 4YRIA 4LNUA 3OJ0A 2KLHA 1U2PA 3WB9A 2E7ZA 5DWDA 4M9QA 1R8YA 2C42A 5AJZA 3D4NA 3MSXA 4YP9A 4I3HA 4YRJA 5TS3A 3R5XA 4HWTA 1DIBA 4NZMA 1NYQA 4RM2A 5ALMA 2BGRA 4ZOEA 2O1SA 3KJZA 4HAVA 2V7BA 2WFMA 3MJVA 3CR3C 1MEJA 1AF7A 4IXDA 3AEKB 4NAHA 3BZWA 1RT9A 5BOVA 4DDTA 1NX6A 2NV0A 2X9NA 2HMUA 5AKGA 5K4HA 3PGLA 4N5DA 3OFVA 1L8OA 3STUA 4QG3A 1P8JA 1YVDA 2BFBB 5A0FA 1RYBA 5KNBH 3WGIA 4H4DA 4DPLA 3C3XA 4WK6A 2CKMA 1QTIA 4G0UA 2PGDA 2VWGA 4XQEA 1Q5PA 4PLGA 2QB5A 4KKVA 1T24A 2P2ZA 2VHYA 2ZRQA 5EJ4A 4A1FA 3HCPA 1I6WA 3T3NA 3N5KA 1Y4ZA 4L27A 1ZP6A 3KC2A 2NACA 3AOEA 1PEKE 4JT2A 1P1HA 3BQ9A 3QVTA 4KVGA 4O5AA 4ZREA 5GZ1A 5AW2A 4J6FA 1AQNA 1XDZA 5JAMA 3WLKX 3AIOA 1UWLA 4B45A 2GZDA 1N4DA 5HBGA 2G0AA 4Z4HA 1YR6A 3H4TA 2B6NA 3PQ3A 4QDOA 1HYHA 1WNFA 5D5QA 3IV7A 5FADA 4X91A 5D3MB 3TLKA 3RIGA 1X3LA 4C76A 3OZUA 4PU0A 5EWMB 1JR3A 3QFCA 3O2QB 3ISVA 3ZDEA 4BMDA 2J9ZB 4MOWA 4MB2A 4YRCA 4YLEA 1UKYA 3GUYA 3ME5A 4FSHA 5J4LA 3WO0A 1RQLA 3O6VA 3ZQ6A 4E70A 3NOOA 4OHYA 4DANA 3HCWA 4ERXA 4QDJA 1KO7A 1VGQA 2Q1YA 2R11A 2R8RA 2ZQZA 4HAOA 4IJKA 2I0FA 3UCFA 5DEIA 2PCLA 1BFUA 3I1FA 3OFKA 1JQBA 2MWMA 1AU9A 3IULA 1WE2A 2JCBA 3IJRA 3ZIDA 5EKDA 3BXHA 5AKEA 1E6MA 1DUSA 2VAVA 1TCUA 2DOKA 4F4JA 2D5AA 1WKBA 1E4YA 3HKCA 2GK3A 4KITB 2XT0A 4YJKA 3U4QA 2YYSA 5C52B 4G0VA 5C18A 1B26A 2RIPA 1G3RA 3D4IA 1KYIA 3I53A 3GNLA 4GGOA 4D56A 1P1KA 1OT3A 1MENA 1WPRA 1YJQA 2AF4C 2Q0QA 4JGGA 3N3BC 1P9LA 2IP1A 1C81A 3HEMA 3MWJA 4FZVA 3LXXA 2QU7A 5L3SB 2GAJA 1LBIA 2LE0A 4Y1RB 1XNHA 4YROA 5G1OA 5HM6A 1I13A 1TK3A 3VR3A 4I1PA 2NU7A 1TJ3A 4XVHA 2VHZA 3HXLA 4JZYA 4W5RA 4RA9A 3I39X 2C77A 5I9IA 1XGKA 3HVIA 4C1NA 1OROA 1E7MA 3O8OB 1M2HA 1OMOA 4OU5A 1UINA 2WK1A 4JKYA 3IAUA 3QVWA 1IN1A 4DWOA 1ZNZA 3PSHA 4YRLA 4Y2YA 4I7EA 1E96A 2R9VA 4B7CA 3P2KA 2ZIWB 1CIJA 5FFNA 3WY9A 2O2ZA 2QAGC 3MXTA 2YYAA 2CVQA 1EJ2A 3PBKA 3ND7A 3VH1A 3E27A 4DA9A 1RMYA 1SN7A 4QYXA 4RGQA 1E1YA 2PYIA 4ZJYA 4F1JA 1SXJB 2ZI7A 4ZVQA 1LRLA 3CLSC 3QMMA 3ICEA 2GM9A 1VSQA 3GIDA 3Q0TA 1KPGA 2CWDA 1HDOA 2H1IA 1XCPA 1NF3A 3I09A 1C30B 1OWLA 4W1PA 1FXSA 1DBIA 1T4BA 1U3FA 2PYDA 5FA6A 3K70B 3BMCB 4HQ0A 4J16A 1ZH8A 5KQSA 2XA9A 3PDUA 1KVSA 3IIJA 3F8TA 1DBQA 1JKMA 4TKVB 1GTSA 3R6TA 1FTNA 4JJ6A 5LZ4A 1L9KA 4BO5A 2POQX 1DRWA 2NZ2A 3GLHB 4Y2JA 3U48A 1M33A 5IXYA 1UK7A 3PEUA 3SFTA 3K35A 1GNPA 2H8GA 4CMEC 1JJAA 1G3UA 1NDHA 1P2VA 1U8UA 1ZLXA 3CNQS 3BL6A 3D6HA 3DLTA 5HIIA 1J90A 5KSPA 5TB5A 4CIVA 1JR3E 3KWJA 4IXMA 2AR7A 3ENVA 3F9IA 3PXXA 1H0HA 3EGEA 4QUIA 1C3LA 1PAUA 4GECA 4IDHA 3WTBA 1PKEA 3HG7A 1CP2A 1ZRMA 3WGVA 3EFEA 4XLZA 1NVWQ 4IVQA 3ZCTA 5AM1A 2QTCA 3IEUA 4MYUA 2PR7A 1G5PA 3RS4A 1U0NA 1Y3DE 3U7JA 1A9ZA 1VBKA 1VMAA 1UFKA 5CYOA 1QR2A 1GNSA 3TJRA 5IU6A 2NTEA 1XTBA 3R7DA 4OIMA 4KIWA 2GKGA 5GJVC 1XD9A 3H1TA 3TZCA 2VP6A 2QYOA 1P91A 3G68A 3DE2X 5FXMA 3MHTA 1CU1A 2Q2VA 2QRPA 4DWVA 3GZNB 2H08A 1SG9A 3JR7A 5AW8A 1CSEE 1YB5A 2PCJA 3KRTA 2ZR9A 2FJ0A 3OY2A 4FGUA 2IPLA 2DUWA 5KYYA 2GJ8A 1ADCA 2WZDA 3KYIB 4YT8A 2FZ5A 1BVUA 1WVIA 1DMSA 1NYTA 3CRVA 3HDVA 2BKXA 4MVJM 4TZKA 4Y2HA 3ECAA 5DN6A 1N1MA 2GFHA 3N0TA 1YBAA 2IOFK 1EX1A 4XJVA 2JFBA 3K6SB 2QGZA 2X1MA 3CVYA 1TZJA 4EJSA 4O4LF 3WMRA 3U61B 1KI6B 4MUHA 2XMGA 5JY1A 1KNQA 4EP1A 1EINA 1A71A 2MDTA 4H1VA 2IV7A 1T4MA 3CS3A 1W0KA 1IATA 4HY3A 5KYWB 1N8TA 1CB7A 2JIZD 3O5AA 3WIVA 4MEBA 3WK9A 4EBBA 5CW2A 4UEQA 3OEED 5A3RA 1J0CA 3VDXA 1R9GA 3FG9A 4BN5A 2VJOA 2BR5A 1NRWA 1RWBA 4I55F 3SAJA 2QPTA 3SIWA 2C82A 1WWKA 5THKA 1UBKS 2N75A 2EZTA 2PRZA 2X3UA 4ID3A 4MMXB 2ZVJA 1YKFA 3V55A 1CULC 2O8EA 2RI6A 3RYCA 2HJGA 1WV0A 3LKBA 4WLEA 1GZ3A 2HHJA 2PXXA 3FYUA 4C7XA 3SC2A 4B6GA 2BZSA 4B3IA 5ENZA 4Z4IA 4NI5A 2IZZA 2J4FA 1Y6GA 1QHGA 3QX9A 2UVQA 4JNCA 1H6CA 2R8YA 4NH0A 3ISJA 5FRDA 1GDTA 1WD7A 4ZQHA 4P8RA 4AJKA 1MZVA 2BONA 1E2KA 1LWNA 4FNMA 4NJEA 2D2FA 4R54A 3S1AA 1KNXA 1JHDA 3VU9B 3VQTA 5E4TA 3NHWA 3TB4A 3LBNA 4S12A 2WQ7A 3K4QA 3AF5A 1L4LA 2M2IA 1QIEA 3SIPA 3DR3A 5EJAA 1I1OA 1Z5VA 4B84A 4G24A 3IPXA 5CP8A 4KXMA 3WWCA 5B5SA 5ADWA 1QO0A 1I3MA 1XQ6A 1Y5IA 1XIVA 1IM8A 3P0EA 3Q0IA 2IY8A 4U2EA 3RRZA 1A2QA 3JQQA 1EFRD 4S1WA 3OQPA 1AO0A 1JXOA 1NVVR 5KINB 4NU6A 2HF9A 1XF9A 3FPBA 1Z37A 3SYMA 4KRGA 2ZTLA 5L51A 2BI7A 2VSOA 3P32A 4HEQA 4BBAA 2BTQB 4AK9A 2ZJ6A 3ROPA 1HSZA 1X19A 1HDIA 2A0KA 2JA1A 1C41A 3UMVA 4U02A 4YEDA 4ZARA 1G8GA 5DXAA 3EG5A 4FFVA 4UHCA 4JYAB 2G4LA 4FMDF 3V3TA 3DAHA 2I2BA 4ZAXA 4QX6A 4Z9BA 1V41E 4HJXA 3T7RA 3LTEA 3LCJA 1X13A 4XD7A 2VPIA 4M0DA 3WL3A 1HE3A 2IZ7A 1OREA 1V47A 1ZD4A 3UKDA 2BFBA 5DM2A 3V6MA 5KI6A 4C78A 3LI2A 1T5HX 4DJTA 3LQYA 4UMVA 2LTAA 3BXZA 4HQNA 4RSMA 5LBTA 3RVOA 4LQ4A 1AKQA 3ICWA 4M1YA 4O33A 4LVOA 4YCMA 4P9NA 1FFEA 4GMFA 1ZD1A 3BHMA 4Y0VA 2IVZA 3T9FA 1LX7A 5FL7D 4C7OA 3CN9A 4JQYA 5HF8A 3SIRA 2YJZA 4UOZA 3URKA 2IXDA 5C37A 4P0TA 4C0QC 3KCNA 3WIDA 1WB9A 2NYRA 1EP1B 2A9OA 3T5BA 3NFYA 2FX2A 3PK0A 2Q3DA 2Z56A 3ILVA 3U80A 3C74A 1A04A 2ASEA 4FHCA 3A25A 2QD2A 1E1MA 3EGCA 1CRWG 5AICA 5T8KC 1Q1ZA 2QD5A 4Q1BA 3OIGA 1NV9A 1L4YA 2AE2A 2HA7A 3WHIA 5KTOA 4HV4A 2I1LA 2GZ1A 2RHBA 2TMYA 1FCJA 4EKNB 3I9FA 1PVOA 3L84A 4ZU6X 1QLHA 1UC9A 2W6OA 2G83A 5CIQA 1PEDA 1UZMA 3OWHA 3KOWA 5EXDA 4W9MC 4PYQA 4LI3X 4NX2A 1V5EA 2GZMA 4ZYYA 1ODCA 3M1YA 4QU5A 3CC8A 3OUZA 3QUSA 1P33A 2P35A 3EDOA 4X84A 3KSZO 2HH9A 1H42A 5SICE 3X43A 1J97A 3RFTA 4DL9A 4MRPA 1CT9A 2WAMA 3ORQA 5EHIA 5DGXA 2CXNA 4FLEA 2I8CA 4L0DA 3DMTA 1DFHA 2QUIA 3FFXA 3HJUA 4WCFB 3FCYA 3LBHA 2A58A 2YY7A 3VKFA 1JKIA 3GLFB 1EPUA 1CDDA 1RYZA 1Y6JA 2QRUA 2WM8A 2COUA 1X80B 3BICA 5LDHA 3W6PA 1C3EA 1VPLA 5M29A 3U60B 1DG9A 1S96A 4QEZA 4UHFA 4Y2VA 1N2BA 4N3CA 1HO3A 1GCUA 1JQKA 2C5BA 4KIJA 3MZ0A 1FUYB 5DTIA 4IUCS 5EOVA 2KMLA 2R1TA 2QTBA 5A6SA 3W78A 1AUOA 1X1QA 3ABOB 4K9NA 3SM9A 2DETA 4AUEA 2WA2A 3RYFB 3JTMA 2QG4A 1N0UA 4LYAA 3IALA 1XEXB 3GFFA 3LOPA 4QDUA 1HNWB 4Y9SA 3ZLUA 2A67A 5DM4A 3FD8A 4XIFA 1ISJA 1JL3A 3UZUA 4OLHA 3D4BA 3A9WA 2PMBA 1YZGA 2IYWA 3CE9A 2F8LA 2R5FA 3A1SA 3FLEA 3DEIA 3VR4H 4D0LB 4OB8A 1ESDA 5E0OA 3WB0A 3GLIB 2C96A 2O5VA 3QVGA 2W2OA 2XUAA 1BWPA 1VSBA 2O3RA 4Y98A 3U0VA 3EPLA 2XVMA 3NYQA 1X0VA 1GTRA 4E4RA 3UWOA 3KXIA 3LLVA 3KHTA 4UBLA 1UDAA 4TTIA 4U2FA 1ZA2A 4DYVA 1C7JA 2H4XA 2P2YA 2HJHA 1OFVA 1YS4A 2J59A 4TSFD 1GEGA 3PXEA 1AHIA 2QN9A 1WXDA 4YRGA 1ZOLA 2HA0A 3A8TA 3C3EA 2FPGA 4F4HA 1S4QA 4CKWB 1RI1A 1ZVVA 3CWQA 1ADJA 5TJ9A 4D5GA 3AETB 4KQ9A 4R16A 4PYMA 5ICMA 2FW7A 3V8NA 4FEAA 4BTEA 3VZBA 4DR6B 2M1ZA 4A8JB 3F3KA 2GBPA 2UDPA 3QUBA 3D3NA 1XELA 2QMEA 1DVRA 1HT3A 5JAUA 2PUWA 4RYDA 1YONA 2C7QA 4XB6B 1VRWA 3DOOA 3HTXA 1XC7A 1Z07A 2ZT8A 3CZPA 5CNJA 1B8VA 3SZMA 2O8CB 1I2CA 3GZJA 5IJWA 2HW8A 2WY2D 1XX6A 4JP5A 2ECKA 2OZLA 5DI9A 3IXLA 2GD6A 1WTCA 2MSNA 3F47A 3PC6A 1L5YA 1RI4A 1U0RA 1U04A 2OKGA 1BYIA 4KWHA 2NV6A 4X6UA 1N3LA 2RHHA 1PGOA 4MVJF 1F3LA 4XUEA 4E7OA 3D7SA 2IUYA 3EY4A 4B8YA 4DZRA 1O5IA 1FUKA 1DUIA 2YC4C 5GVRA 3AYXB 4UU8A 4IZOA 3REGA 2GNOA 4Q6BA 2YDXA 4X6LA 4ZQBA 4PSUA 1JT9A 4QUKA 5E3JA 1YRAA 5TPZD 3TM5A 4CIBA 3U7HB 1JG4A 1H0KA 4M55A 4OK5A 2HRCA 5EMJA 3I23A 2B61A 3I9V6 4M0LA 4QGFA 2PAFA 2VSFA 2ZYHA 4RH3A 3AXSA 1IPHA 1SUIA 3QXGA 3T34A 6YASA 1NN5A 4D2IA 1J24A 2VP3A 4WQMA 1K86A 2FFBA 1AQYA 2F9FA 5IANA 3E9CA 3HH8A 4CCSA 1QGED 3OURA 4JR2A 1L7XA 3HXMA 1TVKB 3CZMA 4WERA 3NIBA 5K2OA 2ZU6A 4PYIA 1D6MA 3WBKA 2XWSA 4B8WA 4AZTA 4ZIRB 3R9XB 2EBUA 4FE7A 1TCAA 2VHCA 1FY2A 3E4DA 1OUMA 3OOEA 1YIAA 1VPEA 1X1TA 2PSDA 1U2EA 1TAGA 2ENWA 4FEEA 4EY5A 4ZOLB 4GAEA 4HDAA 1LH0A 2CL7X 2JGIA 2ZBUA 4G1CA 1FZTA 2NAPA 4KQFA 4M7WA 1E1KA 2APJA 3A1EA 1TKRA 1CY8A 1ZC3A 2ACVA 1F12A 3RVMA 2X7HA 3ZV4A 2HCFA 4NTZA 2D00A 3O4VA 3IP1A 3ZH2A 4HFJA 4GLOA 5JIBA 3UV6A 1U0HC 2IIQA 2D3WA 2DP4E 3DOEA 1RYHA 1E79D 4URUR 4MV0A 1X1BA 2WZCA 5G4KB 3ZGNA 4GKJB 1ZS9A 3R40A 3IELA 2WD7A 3R0XA 3DLCA 2O3QA 5CLIA 4Q3CA 4UTVA 4YCNA 5FJJA 1NJ2A 3AHDA 2B82A 3B6KA 3EUFA 3LT2A 2AZ4A 1J07A 1Y80A 5T4EA 1T91A 1QSGA 1J49A 5AH0A 3HN2A 3R3ZA 3RAFC 2HLDD 1ABBA 1V3UA 2VFAA 3DS8A 4JUDX 1ZR4A 1AKWA 4R1MA 3O8NA 3SC2B 4J3JA 1RTKA 4QZVA 2YWRA 1VZ3A 3AR3A 2VT3A 3BXFA 1GL9B 2FLVA 1GL6A 4U2BA 5C51B 5JWRA 3FLMA 5JS7A 4LZWA 2QVZX 2R7KA 4B80A 8ABPA 3H42B 3C3AA 4U7JA 4C0HA 3CY6A 1N2GA 2CHGA 2W11A 4QUDA 5E7IA 5E8RA 3WRWA 4KQ1A 2IOQA 2P5SA 1Z0IA 4BWGA 4AW9A 1EEXB 3CPEA 2I3DA 1PL7A 3LQ1A 1RE1A 1T3GA 3FHJA 3H9QA 3OMXA 4GKBA 4OMUA 3HKBB 4BUJA 2IU3A 1DCTA 1K5GA 1MH9A 3K94A 1GLNA 2CXHA 2GUWA 3KX2A 2NVWA 2ODPA 1ISIA 2QTVB 1QRSA 4DUYB 1Y1QA 3TLBA 2AC2A 4MPRA 4DQLA 3DNMA 2BIFA 4E5UA 2GJKA 3RUCA 2YTZA 2EFDB 1JYFA 5DNAA 2HT1A 2Q0SA 2GPBA 4MWBA 2FJPA 3MS4A 1ZESA 4QOEA 2XOEA 1VPWA 2E85A 1CQJB 1A2BA 1ODIA 2XXAB 1L4NA 1ZXXA 4Z3DA 2ZUDA 1TOAA 4G1BA 2G04A 5CM9C 3SHTA 1Q7TA 4MJ7A 3SXPA 1UBCA 1L4UA 3NJ8A 4P54A 3EPHA 2FDCA 1CK4A 2QLMA 1R0WA 1MOPA 1V16B 4TTTS 3NTVA 4LRYA 2J3IA 5AXCA 2ZZMA 5FT9A 3TS1A 3H84A 1D8TA 2CXOA 1HG0A 3R5FA 4Q4AA 5BV2P 1D0SA 5GZ6A 1U4SA 2XDQB 4GRIA 3UH1A 2GJSA 1KMCA 3P94A 3EXG1 3IVMA 2G9NA 3VPBA 1MO6A 2Z04A 2FEAA 5C8DA 4KTVE 5LJLA 2NYAA 4WVFA 1BA3A 1KEKA 2M1XA 1L7NA 5ETJA 4NONA 1UFRA 2V74B 3BC1A 1KY2A 3RSLA 4PO9A 3WIBA 1NBME 4QJ3A 1WSWA 2QRKA 4CQMB 5CNKA 4DQVA 5DBFA 1IY9A 1X7DA 1M5RA 4EI7A 4XWGA 5DTMA 5AW9A 5ARBA 3RFVA 2ASVA 2FPUA 3PIIA 4KNWA 2DPHA 4LCBA 4QSHA 2FEKA 1QR6A 2ORED 1GFSA 2Z8XA 1VI2A 2JEYA 1JEEA 2QY6A 3AR6A 3SS9X 4AQ7A 4E0BA 1GL7A 1Y48E 2BGIA 2NG1A 3AF3A 3VR2D 1YKGA 3ZHQA 1Y98A 3RR2A 2ACEA 3ND9A 2DWUA 1GPUA 4CTKA 1VMIA 1I5RA 3CZ4A 2I22A 1T4CA 3I9KA 5FUBA 3X44A 2KE5A 4W9NC 4UNSA 3AI3A 1NVBA 2Z6UA 4B6JA 1N2IA 3WYAA 5D3KA 1H66A 4A2QA 2LDXA 4MKXA 1AH2A 1QKJA 2RHWA 3CZ9A 5ALYA 1YJXA 2BZGA 3TTSA 3IAM1 4WL0A 5C53B 1QS0A 2ERCA 4Z0PA 2HI0A 5K0JA 1DLIA 2K7FA 4YJHA 4PFSA 3ZU4A 1IZYA 3TEFA 5JS6A 1KO5A 1GPKA 1QHFA 2DG2A 1HQYE 3IODA 2X9VA 4RKRA 3SSMA 3T61A 4BJ5A 4DCOA 1GPJA 1PZNA 1JG2A 4RD1A 2G28A 3AP1A 1M6WA 2ZYDA 3GJ7A 3O1HB 2GX6A 4XSGA 5D1NA 4YMGA 4NMHA 3HZRA 2X13A 3B1KA 4MVJI 1SHUX 3W8DA 1DU4A 3H2IA 1RRCA 5B3LA 4S05A 2N1MA 4UCWA 2V59A 2FGKA 4RMHA 3JTEA 1CZUA 3H6HA 3PF8A 4NR0A 4RS3A 4ASUA 4FP9A 5HIAA 3D9QX 3N2YA 3KEFA 4AJ4A 3IO3A 1FP2A 1CR4A 4M9RA 1FRNA 1MJFA 1MIOA 1OTXA 2QMHA 3PR1A 2NXNA 5IG2A 4O4HF 2FK7A 4RTKA 2ZEJA 2PR2A 4IXTA 3OMLA 5EZ5A 1VQ1A 2QM3A 5ALSA 3K7EA 4U7GA 3EIEA 1FYWA 3EOZA 3GD5A 3UGJA 1Y9JA 4R8LA 1J39A 2Y2VA 3GFSA 1VJRA 5HIJA 1KZ7B 1J8VA 4WWHA 3V7NA 4ABYA 4BO4A 2XUGA 3GJ6A 2EWVA 1ESMA 4G3XA 1FTWA 2B2CA 5KPDA 3ZR4B 4GI3A 1L7VC 3W6ZA 2G17A 2C94A 3OZIA 1Q50A 1YSCA 2MU1A 4KP7A 1FMTA 1Y81A 3GVPA 4OJTA 1JDJA 2XI4A 2R7MA 3RJ9A 1SQ5A 4OGWA 1IOWA 4RPHA 4CEJB 2OB2A 3A06A 4HGQA 4OGGA 1LFDB 3H7IA 3TNLA 3VUFA 1JIQA 2FMHA 1PFQA 1JN0A 3B9BA 3RVBA 3TIFA 3CTPA 1IDN1 3GMSA 5KU1A 2MOKA 6AT1A 2H5IA 4K9SA 4C3OB 3PITA 4O4LB 1G18A 2OD7A 2BBTA 4RQTA 3B2QA 1FU8A 1ZBDA 5G0TA 3E70C 5TQVA 3D6TB 1JR4A 2XE7A 3T7EA 2ZI9A 4ZVUA 3KQMA 3MAJA 5KKNB 5DSZA 3KJGA 2BUBA 2VYVA 1WR8A 2ZRBA 4PLVA 4G5GA 3RC3A 2HV8A 3Q4GA 3K5HA 4FFSA 4JMLA 4DM4A 1KZ1A 3L46A 4XJSA 1A72A 3UPTA 1OZGA 3EZFA 3R3WA 1U1IA 1T9BA 1H2XA 4QUJA 1K8YB 3OZWA 1X42A 3OBIA 4YRPA 5A3QA 2DQSA 2ZKLA 1AKEA 1H0RA 2GETA 2XEDA 3FF1A 2XUQA 4J9VA 2AW5A 4MCAA 1CZOA 4FHEA 4Q47A 5F52A 1ORWA 1LFAA 4BFTA 4O63O 3P0RA 4MTCA 5TNXA 4EJSB 4EMBA 3HA3A 4OU4A 4A6PA 3OJWA 1SHZA 3AQIA 2Z95A 5DE3A 1S3IA 5T3YA 1RWOA 2OENG 2XRFA 1F6DA 2R4TA 4I2VA 4ZQCB 4BMZA 4WFIA 5DDIP 3A1CA 4Q9DA 1GPLA 4DT1B 3R77A 1US8A 1LW6E 5KREA 1QE5A 2XJ4A 3VYWA 3C43A 1LPOA 1QE0A 1PYGA 2XLCA 3OT4A 2H4WA 3ANSA 4RZSA 1M8GA 2VSYA 2X23A 4ZI2A 1YA6A 5EZYF 2YV4A 1M72A 5JS1A 2Y0DA 9LDBA 5JS2A 3G49A 2OL4A 3D2LA 4YI3A 2OO7A 4FDTA 3SMVA 3JYNA 4NBKA 3DP9A 3L8GA 1J33A 4DEYA 2WJHA 4KPEC 4TZTA 5JR3A 3WISA 1L5ZA 2WICA 3I9NA 2OXTA 3ZQJA 3A28A 3VH2A 4U2CA 5JNTA 4ARIA 1E3EA 1MA3A 3OM1A 3P9YA 1C1DA 2H54A 1QB7A 3V4ZA 4INOA 4S1TA 2P2CA 5IPFA 1YB4A 2QN1A 2H17A 4RHUA 2IK8A 4HO1X 1H0SA 4M0PA 4H4CA 1K3UB 4DQXA 1XL1A 2XB6A 1BRMA 1V4VA 3A9CA 3QKIA 4YJ2B 1WZ2A 1W49A 3P26A 3PUJA 3QPAA 3BXXA 1TVKA 4UAVA 4Z4GA 2H1CA 4MRSA 4OUDA 3QVSA 1QJCA 3AHFA 4HXFB 3K9WA 4OJQA 3KXLA 3RIXA 2LKDA 4DM3A 2DR0A 2CXQA 5KKCA 1RCUA 2WHPA 4EO9A 2BE7A 1KY5A 3CZCA 1F8YA 5D5HA 3I04A 1SXIA 5EUCA 4EYKA 1Z2CA 2EP7A 2P7IA 1S1MA 1ZCAA 1Z68A 4HTFB 2NPFA 4EW3A 2W2PA 3LPMA 1O9HA 1PT8A 4NAUA 2D1RA 1LVUA 2A1IA 4NJMB 4TVSA 3DZHA 4IXWA 5LDDC 4F71A 4K05A 2QZ9A 3ZX5A 9ABPA 3GBVA 4RDXA 3K09A 2XNKA 1FFAA 2W2LA 1IN4A 2ZJAA 3DT8A 2G1AA 3JW8A 5A1TA 1ECPA 1FP4B 5L7TA 1VE9A 3GEGA 4WZBB 5C8XA 1K8QA 1T9ZA 3FWPA 1ZHFA 1R9NA 1SHKA 2WT4A 3RADC 1F4LA 2I4TA 4K6HA 4UZFA 1HZZA 2VJYA 3BIFA 3KDSE 3KHKA 3PEFA 4ZPXA 2H29A 2YVAA 3ECSA 4F86A 4DRZA 2V54A 4F3TA 2Q9BA 1AUQA 3HB4X 4EKIA 1TUEA 5C0OE 2D5CA 3L5OA 3LPLA 4EH1A 3LP8A 1PWXA 1UAGA 5J59A 2WJVA 1WZUA 2II6A 3CKKA 2G1KA 3EMDA 4IWNA 5FI5A 3U1TA 2W93A 1O97C 3M5CA 4EHLA 4YRMA 2BYTA 1TZKA 1VYVA 1NSFA 1W0KD 2FVXA 3F7OA 5JVDB 1BS2A 3PLAE 1CZNA 3UT6A 4RV9A 4E46A 2WQZA 3IEPA 4FFRA 3F9RA 1SVKA 3FOBA 2X0RA 4IQGA 2Q3BA 2ZOSA 4R2XA 2DYKA 4I55A 1T6NA 3MELA 5IM4A 1S5PA 4I1RA 1R4MA 5HZHA 3AV0B 4Q18A 2F8TA 5CCEA 4QOIA 5EUQB 2GN8A 3J7AC 4G8DA 5G3YA 4Q1AA 5BSEA 3R41A 1MTOA 1QYRA 3VR2A 5ALUA 5ADUS 4CMIB 1HK7A 2QM0A 3VHRA 5FLYA 5FWNA 2JD1A 1QO9A 2R5WA 1A9OA 1E6CA 2BFOA 1KGDA 3O1LA 1X1DA 3PUWA 4YP7A 1UCFA 3CH6A 1R12A 1MGOA 3Q9UA 4MS4B 1I2MA 3ZZMA 4LDAA 4GWKA 1RE0A 2A1UB 3PQ4A 5ALEA 1CRLA 5IVDA 1IWOA 3RQSA 2XB2A 2I62A 4GMXA 1ONNA 1RAHA 5MHTA 1RMQA 4F6LA 3G59A 4LXUA 3A37A 4IYJA 4N82A 4RBNA 4UAJA 4X65B 4IILA 1QU2A 1EGVB 2ZIVB 1D4AA 1QKKA 3BJRA 3FJOA 4L22A 5E6RA 5TV2A 1BWRA 5DOVA 3UMRA 1G291 3U17A 1T15A 3BH6A 2IYSA 2D62A 1L5FA 2H4ZA 2O2XA 3AZOA 3RV4A 5DSXA 5JSZA 1SWWA 3OQJA 4ER7A 3TSZA 4E2WA 5DLDA 3N6RA 1W2WB 3MWEA 3EQ8A 1JWLA 1C4WA 3FLBA 5EXSA 2XV1A 4WOCA 4PIPA 1I7SB 5H9VA 3AMVA 1GYQA 3CLRC 4P82A 2AQ8A 2EGHA 2I3ZA 3ONDA 4IH1A 1W25A 1YU6A 3BH7A 4EG3A 4LFAB 2E3JA 4BQQA 1HT2E 4FINA 1EFPB 3OIWA 4J0DA 4AUMA 2PFKA 5IBQA 3U7EB 3I2KA 1Y8RB 1GJRA 2AXPA 3P2IA 4GICA 4NICA 1YC2A 3COVA 2OLEA 2RI0A 4CTOA 3ZW7A 4KWTA 3H87A 1GU1A 1ZRHA 2P3LA 1KQPA 2CC2A 2XWJI 4TKLA 2G9ZA 2NXCA 1LJLA 3GGCA 1IEWA 4DEVA 3AUFA 5HK8A 3F8WA 1KRHA 2D59A 1H3NA 4B4OA 5FNZA 9GPBA 3OMWA 3ITKA 2IYUA 2CWWA 3BFPA 4BNDB 3IQHX 4K9OA 3ONNA 1ZK0A 5LQNA 3RI3A 5I45A 1T2CA 4TT3A 4GI1A 1GZUA 3E7PA 3JZMA 1OI7A 4FOLA 2O57A 4A0FA 2WOOA 4W63A 5KJEA 2P77A 2NZVG 3CRZA 3NBYC 4D4LA 2VJBA 4INPA 1FYFA 3DBLA 5U4XA 1W5BA 2O7NA 1Q0QA 4LF7B 2WJWA 2I6UA 5BNFA 2ZW9A 2VEDA 4IZ6A 3OQNA 4JGIA 4BKRA 1UIMA 3DTTA 3NETA 4FSDA 1YQWA 5KHLB 3WYEA 1E7WA 3I5YA 3IEVA 1JQ3A 3C98A 2R7AA 3CGGA 1DTEA 2UZ4A 1E59A 3I28A 5DNUA 2J0VA 4X20B 1CQZA 3UANA 1VB5A 3O0TA 4CR7A 2A6PA 2ZIXB 3OCUA 2Y3IA 1LA2A 1BD3A 4TTPA 4U9HS 5EMNA 1XU7A 2K2WA 1MIOB 2CL5A 1H2RS 3AJRA 1VE6A 3NV9A 4GO1A 4J6EA 4PLPA 3IRUA 3ST7A 2Y0EA 4E6EA 4EDHA 2XUIA 3BVPA 4BB0A 5BWOA 3IT1A 4AXBA 5AJYA 1QHHB 1NNSA 1SRQA 3PRYA 3UMGA 4X62B 1SELA 3DYBA 1C14A 3GT7A 4JODA 5JLAA 3GBSA 3R20A 4FD2A 2IDMA 1YDEA 2UZ1A 4YUZA 3V97A 1USKA 2CJFA 2R1ZA 3KAKA 1D4ZA 4EPVA