3BH7A

Crystal structure of the rp2-arl3 complex bound to gdp-alf4
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
161
structure length
161
Chain Sequence
b'EVRILLLGLDNAGKTTLLKQLASEDISHITPTQGFNIKSVQSQGFKLNVWDIGGQRKIRPYWRSYFENTDILIYVIDSADRKRFEETGQELTELLEEEKLSCVPVLIFANKQDLLTAAPASEIAEGLNLHTIRDRVWQIQSCSALTGEGVQDGMNWVCKNV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribosylation factor-like protein 3
publication title The retinitis pigmentosa 2 gene product is a GTPase-activating protein for Arf-like 3
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 53
structure length 161
sequence length 161
ec nomenclature
pdb deposition date 2007-11-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3bh7A00
1VTKA 5FBLB 4C7OB 4US2R 5CB6A 4EJSA 3CF2A 1BIFA 2NQ2C 3ADBA 2OLJA 2BMDA 2JLQA 3AP3A 4KCGA 5LD2B 4PPNA 4BFZA 1H8ED 2GF9A 1RYFA 1XTRA 1G6OA 4LJ8A 2CJWB 1JALA 4C0AC 1IXSB 3FFBA 1TF2A 3IBGA 2OHFA 3AF2A 2F9LA 3B82A 4UXIA 3RHFA 2ZS7A 5LBIA 2EU8A 2ZS8A 2BBWA 3MGCA 5FR2A 4PC7A 1Q22A 1E9AA 3BFKA 4Q48A 2OBNA 2BBSA 1D2EA 4OHXA 3WBKA 2JJ8A 1TTTA 1WDTA 5FUVA 1X86B 4Q4LA 4A6XA 3SEAA 3W8NA 4KYUA 5GJVC 2CDNA 2A5JA 1NLZA 1Z29A 1XFAA 4ZCMA 4LV8B 5DI3A 1E79A 1XB2A 3CWQA 4BPBA 3AKCA 5KDLA 1AQYA 4N1AA 3TIFA 1HH4A 1E69A 3TAUA 3U3RA 3HU3A 4MGZR 1JJVA 4B76A 3OEHA 2J0SA 1QG2A 2XITA 3TMKA 3C15C 1JBKA 3AF4A 3QE0A 4LPKA 5SZHB 4Q4JA 4TLBA 4BE7B 1W7AA 3R9XA 4JLBA 3WNDA 2W2VA 1DBSA 4V02A 1XEXA 5HE9A 4TYPA 2OBMA 4F7WA 1CJKC 3DOEA 3KUDA 2BVNA 4EQ6A 4LYAA 1PLJA 4Q66C 3SZRA 1FFHA 1GZSA 1MKYA 1XMVA 1ESMA 3N2EA 1Y3AA 4RZUA 1N5IA 3Q5DA 1U9IA 1N6HA 4M0LA 2WSMA 4WXRA 4AI6A 5FTMA 2V7QA 2FSHA 1M6NA 5B30A 1DG3A 4M1OA 3TRFA 2IUSA 1U98A 1VDZA 3KFVA 2PCJA 2YC4C 3CRVA 1XEWX 2QPAA 2IEZA 4KVGA 3QKRA 2XTMA 1ZM7A 5F2EA 2C8VA 1E2DA 2J7PD 1DAGA 4LBZA 3TUZC 1EFRD 3ZIAA 4BLOA 4QGAA 1S2MA 1ETUA 3KL4A 5JI3E 1KI8A 1G6HA 1I4TD 1E2EA 3WHLA 1VIYA 3VR4A 2ZRLA 3R8CA 3DVLA 4PR0A 4HEJA 1KJZA 1E2IA 1LY1A 4OI0A 2G9NA 3RYTC 2CHGA 2FSFA 3E5HA 3EZ6A 2F1IA 5TV2A 5JHHB 1JEDA 4KVAA 3V9PA 2YJTD 2X1VA 2ODWA 3FHOA 4MYTA 4NCIA 4PSKA 2AHOA 1BMFA 5JCZA 4S2EA 3GLFE 1MO4A 4MGKR 1XXHA 5KTYA 2GDJA 4HZIA 2IYSA 3FDIA 3NHBA 3K9LA 1HYQA 1DADA 2ZRJA 4M21A 4Q1BA 1E9SA 1QHIA 4NCJA 2OAP1 4EFNA 1U94A 1L4UA 2MMCA 4M9ZA 2J9RA 2ZJOA 4Z1MA 2FDCA 2D7CA 3OESA 5EE3A 4KSBA 3U4QB 1OXSC 1HY3A 2ZI4A 1RVDA 3FE2A 3BC1A 2WWGA 1AK2A 2ZRMA 2V8OA 1SXJB 1NY5A 4LWZA 1KAOA 1R0XA 2FZLA 3FKSA 1NVVQ 3LXRA 4PHFA 4KFSA 2Z43A 1CRQA 2CLCX 1XJCA 4ON9A 4TYNA 4EAQA 2GBLA 4FXPA 4DLTA 1BOFA 3GLHA 1IHUA 4DB4A 1IJFA 1SVLA 1R5NA 2GJ9A 3FFAA 2XGJA 2ZYVX 4JVSB 2BCJQ 2HEIA 4YMSA 1E79D 2YYZA 1OXVA 2QPOA 5FI1B 4B75A 3EAQA 4D4KA 2HJVA 2ZJYA 2BM1A 3W5JA 1G3IA 2G0NA 2JJ1A 2XAUA 4RZ2A 1NIPA 4HLQB 3OEHD 2GJKA 1DAEA 1QF9A 1US8A 4RD4A 3QKSB 2WV9A 4BGDA 3RS3A 4C0HA 1RRCA 3FPAA 2EFDB 3KX2A 5GADl 2ZI6A 3GLGA 2PZFA 2ZANA 1A2BA 2EFCB 1VCMA 2IHYA 2IXEA 2ZSBA 1SKYE 3PFIA 2V3CC 1SQ5A 1XF9A 1IY2A 5BW8A 1ODFA 3WXMA 1CP2A 1K5GA 4XIGS 4EPRA 4NKRA 4HUTA 4OHYA 5CM9C 1DG1G 3AVQA 3BB3A 4I1SA 2YOGA 3GEHA 4HLUC 2HYDA 4PZYA 5JS8A 3HYTA 2RGXA 1GNQA 1UDXA 2IYZA 2VLIA 1OJLA 1RRGA 5LB4A 5M04A 4ZKDA 5JWRA 3GEEA 3GJ8A 3MRSA 3T34A 2IW3A 3K1JA 1ZC4A 3NWJA 3OFND 3THXA 4G5QA 2BJVA 2G1KA 2WJGA 3EX7C 2FOLA 2PCLA 4KBGA 1Z2CA 4QHTA 5H68A 2ZE8A 3F3YA 5GJWC 2W2TA 1QHNA 2ERXA 2PZEA 2XNSA 1GL7A 1G17A 4O2LA 4ZO4A 3U3KA 3CW2A 4HYYA 2VBCA 5UKDA 2IX3A 2C99A 4DBLC 3B7GA 4PC6A 2C5LA 4BFSA 4UNRA 4DSNA 4OQLA 2ZI3A 3RC3A 2W6ID 1FOEB 3KXKA 3OZXA 4XJXA 2Z5FA 2O0JA 2QENA 2ZJ2A 2QSYA 3R20A 4Q7KA 1YR7A 4DEXA 1OSNA 3AKDA 3SJBA 2WWIA 2WPDD 1UAAA 1UJ2A 1XU4A 2CL6X 4V0ME 1VCIA 3K8YA 2GKSA 3ZH9B 2UVQA 4D82A 3L0SA 1HE8B 1AGPA 2N42A 3ZLJA 5HPYB 1NN0A 2LWIA 1BKDR 1OKKA 3IIJA 2O8FB 2RGGA 1KMQA 4FIDA 2ZUCA 5CDFA 4YMTA 3B85A 1XCGB 5EXXA 3L43A 5HCIA 4F38A 1G7CA 3BH6A 2VSXA 5JI2E 1Z6GA 3MMPA 2NPFA 4TL6A 3NDPA 4MRSA 4IVQA 4Z1MD 4ZDJA 3HJNA 2E9SA 3A4NA 2QQEA 2B6HA 2LKCA 4M1KA 1DE0A 1W5TA 2JDIA 2ODEA 3KXIA 2PEZA 1NN5A 3GEIA 3EZ9A 3RRMA 4O0MA 1GSIA 1WRBA 3IIKA 4FI3C 3FKSD 3QVVA 3MFYA 2G0TA 3A1WA 4UKDA 3I3SR 5EP2A 5FOUA 1XXHE 1OXUA 1ZW6A 1W0JD 5EUQB 4MYHA 4NTZA 2OUKA 3ZZ0A 4AG6A 2HYIC 2WKPA 2OCAA 3VR5A 1P2UA 3J81k 3GLFB 3JZAA 1XCMA 2NOAA 1CR4A 3NBXX 2Q3HA 5EE5B 3GPLA 2F1RA 4TT3D 1LF5A 4O3MA 4L8GA 1G8GA 3T61A 1M7BA 3NBYC 3UK6A 4CEJA 4W5JA 2QGNA 1XCPA 2ZRFA 2JLWA 1OFHA 2JJ1D 3RS2A 2ZEJA 1A4RA 4JSYA 4X8MA 4JSTA 1EX7A 2BHRA 1K6MA 1F2TA 3EZFA 4AKIA 1LTQA 1YZGA 2IHBA 2ZXUA 1N6IA 2JLYA 3ONWA 4KFRA 4M1YA 1G3UA 3C5CA 1COWD 4BRUA 3SYKA 3GLIA 2IYYA 1F2UB 1ZUHA 3EIQA 4HATA 3LA6A 1HT1E 1SZPA 3CRW1 2F7SA 1N25A 2E1RA 4Q9KA 1N6RA 4XVQA 1Z3IX 3BERA 1E99A 1GUAA 1UDWA 1UKYA 1IN6A 1DARA 1AS2A 2F43B 2RCNA 3GMTA 5F98A 4EJSB 2GAAA 3LVRE 2WICA 3CZPA 4MRPA 4QG7A 1E9RA 2QM7A 1J99A 4C30A 2WWFA 5JEEA 1UKVY 2DFNA 1FQJA 1XX6A 3BD9A 3SQXA 3VR1A 1Z83A 1W4RA 3GLGE 3K0AB 5A0FA 2OXCA 4A0FA 3I61A 2YOHA 1XEFA 3M1IA 2XOKD 2DPXA 2Q3MA 2WBLC 3A1VA 3MG9A 2ZSEA 4IOMA 5TARA 4BFVA 5J47A 2JA1A 1AM4D 3GJ4A 3BJIC 4RD1A 3CX8A 3C5HA 2OBLA 4DCNA 3LFUA 1L2TA 5H70A 4UJ5A 4ILEA 4BFUA 5KDDA 1SKYB 3UANA 3PXGA 2YC2C 1U9IC 4JVMA 4Q1AA 4RCZA 1UEJA 3NH9A 3V4RA 2JIZA 1NSFA 1TU3A 5DI3B 3RLFA 1HQYE 1OIWA 4LZZA 4LK2A 4B33A 3OF5A 5AJWA 1KNQA 4RCYA 4FWIB 4TYQA 4DLWA 1KI6A 1Z22A 2IYLD 2YNMA 4DT1B 2REBA 4CEIA 2HLDA 4DLVA 4RD2A 1YZUA 4WZ6A 3ND8A 1E32A 1ZU4A 5CK5A 6Q21A 2O8DA 1XDBA 1IN7A 2J1LA 2Y8EA 3IUYA 4JKYA 4A0RA 1IN8A 3U7HB 2IWHA 4ACAA 3TK1A 3B13B 4Q4AA 4Y0AA 1XEXB 1DO2A 3QF4A 2F9MA 1E2HA 1YR8A 5KNCA 4OHWA 4Q7MB 1S3GA 2LKDA 2J45A 1YZNA 2C04A 5E3HA 5FPTA 4P3YA 5KPJA 4XTCS 1WE2A 4BLPA 3W9YA 1GDDA 2ERYA 3B5JA 3PITA 4ZV4A 3DHWC 3B1WA 1J7KA 3F0TA 4LC1A 1OHHA 1ZP6A 2P6NA 5CDFE 3I5YA 4HLCA 3AEZA 4JKIA 3FMIA 2R6DA 1NJFA 2ORIA 2IS4A 3AH8A 1A5TA 2YZ2A 1UKZA 3O8BA 3ZVLA 3K53A 3VKGA 3OIUA 1MOZA 2A2ZA 2ZYTX 1GL9B 2CL7X 2I1QA 3D31A 3FYHA 3M6AA 4IDHA 4U00A 5HZHA 4IVPA 5CJPA 2DY1A 1ZD9A 2RGAA 2ZI5A 4Z8YA 2FX3A 1FX0B 1N6NA 5L3QA 2O8BA 3E1SA 5HKKA 2IYQA 1NSTA 4Q00A 1P2SA 1CJMA 1VG9B 3O8CA 3C14C 3OE7A 1SHZA 2KB0A 3T06B 3W3ZB 2I4IA 1F48A 1PUIA 3THYA 2VSFA 2BCGY 5K8UA 3AF0A 1XXHB 1L4YA 2ZSFA 2G83A 1JNYA 1T0HB 2DHRA 4MRVA 1K5DA 4PQRA 1E94E 1EK0A 1KSFX 1NI3A 4B3DA 2BEKA 3I73A 3N5CA 1AIPA 2QG6A 3NHAA 3A1TA 4Q18A 1EG7A 1NG9A 1Z0KA 4NZYA 1DAHA 2OESA 4PC3A 3CH4B 4BLQA 2QY9A 3G82C 3H2YA 4L9SA 2PT5A 3NTUA 3MWYW 2ZTSA 4B32A 1ZU5A 2BKUA 3QI2A 3LAWA 4PC2A 4EUNA 5G41A 1ZYUA 4X8LA 5TMPA 1T3SA 3IPXA 1MRSA 2VPPA 4HAVA 1Z6XA 4Q21A 1Q57A 4YXWD 5G53C 2B7CA 4D26A 2BIFA 2FEOA 2A3RA 5L3RA 4ZIRA 3RS5A 4JBWA 2QBYA 2FPMA 2PX0A 5GVRA 2AFHE 1O87A 5CLQA 2GEDA 5G40A 1S3SA 2C2HA 3WRXC 1UADA 3L0OA 2FGKA 1GG2A 1XD8A 2KBFA 1XTSA 3EZ7A 4AC9A 1W36C 4HLUA 1E9EA 4JZKA 1G1MA 1ZJ6A 2B7BA 2EFEB 3TW4A 4B48A 3ETLA 1R6BX 1ZM2A 3T35A 2A5GA 2XZLA 3GJ6A 4WBSA 1E0SA 1MABB 5DHFA 1IXZA 3EXAA 3SI7A 1N6OA 2EYUA 3U44B 2NIPA 2OV2A 3U3OA 5JCPA 1US8B 1EX6A 2DCUA 1EFUA 4PX9A 1R10A 3AVUA 4M2LA 1QVRA 4TMWA 2WHXA 4JL6A 2AN9A 2MSDB 2AD1A 2ZJAA 3IPYA 4QGHA 4R2IA 2VP4A 3PIRA 4E22A 3T5DA 4I1VA 1JJ7A 4URZR 1E4VA 1PJRA 5FOVA 3GLGB 4LPSA 4Q9IA 2V54A 3LDAA 3PV0A 5J4HA 3C7KA 3GFTA 3HPRA 3BORA 2XXAA 2VP6A 1JECA 4ZKEA 4JL8A 5FTNA 2J59A 3WYGA 1RE0A 1W1WA 2HF8A 4EPYA 3LX5A 2QORA 1YJ5A 1G16A 4RSGA 2Z6VA 2HCJB 2AFIE 4EFMA 1EXMA 1P75A 4LHZA 1VKJA 2FWRA 4MYUA 2ZRPA 4QJ4A 3Q85A 3PJRA 3MWLA 5FOTA 4GZMA 1P61B 1X3SA 3SHWA 5KOYA 2H57A 1DAFA 1U81A 2PX3A 1DAKA 1HEIA 4B6EA 1KI1A 1PLKA 2GJSA 5JWOA 3AQ4A 3DZDA 2PH1A 1ZC3A 1P7CA 4OHVA 4UJ3A 2FZ4A 1IBRA 5KUTA 4W7SA 5FTJA 3UWOA 1ONBA 2ZQ5A 1OH7A 2FE4A 5J4LA 3RS7A 4B3CA 3KKNA 4CYMA 1QZXA 3OIYA 4LOAA 4NH0A 4CEHB 1YKSA 1F3OA 1BO6A 1DS6A 4U02A 4LBYA 1J8MF 3ZGXA 2NG1A 3ASYA 4F91B 1E2PA 1ZUIA 4AYXA 2HF9A 1JR3A 1XJ0A 4LJ5A 1YVDA 2BDTA 3L0IB 4XOIA 5AWFC 4Q1DA 1NN1A 4US0R 4A8JC 1JQLB 2IYUA 4M9QA 4CT5A 2OCPA 5BN3A 3AGQA 2VP9A 5FOXA 4PPQA 2IYWA 3QVUA 5TY0A 1Q1ZA 3DKPA 2ZPTX 2GCOA 2J0QA 3HDTA 3MWKA 1LNZA 1JXMA 1P6XA 4IDNA 3T5GA 4PPGA 1E9BA 3RWMB 3W6OA 4C2TA 1I4LD 1Z6YA 2AWNA 1D2NA 4A2PA 3WP1B 4C9BA 5DGXA 1TEXA 3B1VA 2UZ3A 4QC2A 4R71A 2OILA 3ZS9A 1KI9A 3KXLA 4B3FX 3KQUA 3DM5A 3ZQ6A 2NZ8A 1KKMA 1Q21A 2BC9A 2JJ2A 4TYYA 2WWHA 4AWXA 2RGEA 5A5GA 3TBKA 1A1VA 2VIIA 4NCNA 1II8A 2OCBA 4NDZA 1G7TA 2J3EA 4ESHA 2F3RA 3X1YA 1OYYA 3U6BA 5CK4A 2E87A 1EESA 4CEJB 1KOFA 3CRMA 3BE4A 5FOWA 3SJZA 1AJEA 2IK8A 3TSOA 1KO5A 2ZRDA 1F2TB 4V0OA 3EPJA 1ZAKA 2OT3B 1KDRA 3PUYA 2V55B 3QPWA 4HUQB 4P4UA 1WBDA 5IK2D 1FZQA 1NMZA 2D06A 3ND9A 2P6UA 2O0HA 4OJQA 3R7WB 4DLSA 2GK6A 3LH5A 4BFWA 1WBBA 1KAGA 2ATVA 8OHMA 2Q9CA 1IY0A 2AR7A 1KHTA 1RJ9B 3LBNA 4HI0E 4OK5A 1KMHA 1N0WA 3AP1A 5BWMA 5GJBA 1HTWA 1KI7A 2RH5A 3Q8XB 4TTRA 3QUSA 2ZRNA 3FHCB 1N6PA 3DO6A 1ZINA 3VAAA 2KE5A 3FGNA 3PEWA 4QGGA 4I99A 5BN4A 1E0KA 1FMLA 3HWSA 4BFTA 3TQCA 2L0XA 4A0HA 1E1RA 4P0TA 3VTKA 5AUOB 2BJWA 5SZKB 3SR0A 4B6FA 3B6EA 4TL9A 2PLRA 1S4QA 2GVDC 1VMAA 4FMBB 2AXPA 5K8LA 3EPLA 3SYLA 3LBIA 5FTLA 521PA 5JMTA 4AY2A 4OI1A 3ZD6A 3M0EA 2CVHA 2QT1A 1GNPA 3CBQA 4NU0A 4C0BA 5C1BA 5EP1A 1CIPA 3QBVA 4MQBA 1VCOA 1QHSA 1AZTA 4Q02A 1DEKA 1H8HD 3CUEF 4TMKA 3ICQB 3AVTA 2RMKA 4A92A 1KK2A 1KY3A 3H84A 5EQTA 3P27A 3CNOA 1ZVQA 4KU4A 5TB5A 1GIAA 4P31A 3VQTA 4OKSA 5CJ2A 3CX7A 4KLNA 5EE9A 1G4AE 4GRAA 1DTSA 4YQFA 2GAOA 1T5IA 2QAGB 3VMFA 5GJCA 1UF9A 3MJHA 1O3YA 3JZMA 2H7VA 1W49A 4GPTA 1TQDA 1AZSC 3AKYA 3I4LA 3KKPA 1KO4A 1W2GA 3LQRA 3QG5A 3WNCA 5KSZA 3UMFA 3KJHA 4BLSA 2HDNB 1RPZA 4RY2A 1E9CA 5EXSA 3RS0A 4LJ9A 3LW8A 4Q4AB 2A5YB 2QE7A 621PA 3QF4B 4GBMA 3IHWA 1T9HA 3NVAA 4MRRA 1IAQA 3KQHA 1FUKA 1YZQA 3GFPA 1GFIA 2AKYA 1G5PA 4KV9A 3AM1A 4GSYA 4XVRA 3QXCA 4FCVA 1K8RA 2VHJA 3SBEA 2DR3A 3GJ0A 4L9WA 2GJ8A 5DYIA 5C4MA 1P72A 2VHUA 3FB4A 4E5UA 5KPDA 1W4BA 3A36A 4PFSA 4K46A 4JLKA 1X8KA 2FF7A 4C3ZA 5KSOA 4PSVA 1MO6A 2W2XA 2J46A 3MD0A 1FTSA 5FL7A 2UKDA 3BFXA 1ZNYA 1GM5A 3QBTA 1CRPA 1D9XA 2F6RA 2FEMA 2Z0MA 4QKQA 4A2WA 1VECA 2WTUA 4GP6A 3K70D 2H16A 4URVR 2ZUDA 2B21A 1CULC 1XD2A 1UEIA 2C9YA 2NPIA 4IRUB 5L3SB 3LLMA 2NTYC 1TAGA 2C9CA 5L3QB 1TF7A 1YR6A 4NONA 3IDQA 3TAHA 1FP6A 2DYKA 2O8BB 4FMCF 5AJZA 2J87A 2ATXA 4GMXA 3T12A 2FU5C 2W00A 3ASZA 1NLYA 4M1MA 2R6GA 1GRRA 1G3MA 1N0VC 4RD0A 3RDPA 4Q47A 5CIQA 1AN0A 4K81B 4B47A 1HE1C 2DWPA 4PHHA 1V5WA 1KI3A 3ADDA 4NCHA 4UNQA 1G41A 2ZREA 4HDQB 4A6PA 4PO1A 2ZRIA 1W44A 5BN5A 1C9KA 4MKIA 4XWAA 2QU8A 5AR1A 1LW7A 1XD9A 2OEPA 4PC1A 4X8HA 1YE8A 4FD2A 1JXOA 2V7QD 2GWHA 2QUZA 3KB1A 3P32A 4S35A 1FQKA 3RVBA 1BYIA 2H1LA 2BBTA 1NF3A 2CCKA 4IXNA 4A4DA 1OB5A 3B1YA 3VU9A 4FMDB 5B2ZA 1UBEA 4IEEA 3ZD7A 1TPZA 4G01B 3SN6A 4KLZA 3U7FB 2MSEB 3I8XA 3QENA 2CVFA 5FL3A 3LNCA 3ZIAD 1SKQA 1U8ZA 1YRBA 4P4SA 4DDTA 2BOVA 4DHEA 4JIMA 1U0LA 1GOTA 1FNMA 2HXYA 3W3AA 2IXFA 2WKQA 3IO3A 3B1XA 3TR5A 3EC1A 3B9QA 1W4AA 4BLTA 2OFWA 3CO5A 3VR2A 1QVAA 5P21A 3I92A 3CX6A 1UBFA 3LLUA 3VNVA 1Z47A 2BMJA 5C46F 2J0VA 1FW6A 1D5CA 4Q1EA 2N1BA 5FPYA 1GNRA 3A6PC 3Q72A 3W8RA 4D4MA 5F9FA 2H8KA 5DIFA 1W4CA 4YONB 1BMFD 3CM0A 1LS1A 3VR6A 1N5JA 2JATA 4HZUB 4KJZA 1GKIA 2OO7A 1BYUA 4MKHA 3WYFA 2CNWA 5KDOA 2ZRHA 3CF6R 2NO9A 1E0JA 1M2OB 1N6LA 1V43A 3U3JA 1VG1A 3RRYA 5BYKA 2ZR7A 1P5ZB 1JEEA 3AUYA 2GA8A 4DUGA 2ASEA 3LWNA 2REOA 3RAPR 4MGIR 1CR0A 3DM9B 4D4LA 5DYGA 1W47A 2QTFA 2RB4A 3OAAA 1WMSA 4TSFA 1Y63A 3L2OB 2QPTA 4PAOA 3REFA 3WHKA 3RNLA 2REXB 2ZS9A 4D0NA 4AG5A 1DVRA 4C7OA 3X1DA 1E3MA 1VYTA 3EZ2A 1ZD1A 1SVKA 3P1JA 2ZJ8A 3FVQA 3K0FA 2QROA 1R7RA 4HB2A 3TQFA 1T91A 1M34E 2NMVA 2ZETA 3EA5A 4MKFA 4FN5A 3R9IA 1KY2A 2DWQA 2CJWA 2X2EA 1UM8A 4OK6A 4QGFA 1C4OA 1KJWA 4Q4HB 1L8QA 1WF3A 4G5RA 2D62A 4DIDA 4MDEA 3CNLA 4A8JA 1J8YF 3AP2A 3W6NA 3PEUA 4IEIA 4DCSA 3A8TA 2V6JA 3AVYA 3SJAA 5D3MA 1NP6A 2EFHB 4YMWA 1X6VA 3L82B 2WKRA 3THWA 3PEYA 3Q7PA 5E95A 4DLYA 2RGNC 5G3ZA 1E1QA 1OIVA 4ZIRB 2GTPA 2QAJA 3OEEA 4LSGA 4QBFA 2F55A 1P9NA 3HR7A 4LBWA 2A9KA 3TGPA 2IXGA 3K9NA 4AKHA 2ZAMA 3WY9A 3ICEA 1CJTC 2GF0A 1FP7A 4JVNA 4DIEA 5EUMA 4C0SA 3GLHE 2CMKA 4MUBA 4IXMA 3OHMA 3NKVA 5DE3A 2IUUA 4QHYA 3VFDA 3PQCA 3U7GA 1ZNXA 1A7JA 1R0ZA 2IL1A 3QG1A 5EP4A 1RRPA 3BK7A 3I1FA 4Q7LA 4QBHA 3IEUA 1T3LA 5CLLA 4M53A 2XSZA 1VHTA 2RGCA 1FUUA 2RHMA 1OIXA 4HSEA 4B35A 2BMEA 3TNFA 2QSZA 2ZRAA 2C96A 3GJ7A 1ELOA 1E6CA 3BGWA 4QXAA 4WVFA 1TEVA 4JBYA 1RFLA 3IILA 721PA 4WW0A 3GJXC 3SC3A 3CRRA 4JLDA 4ASUA 4ZDKA 4LV5B 2IUTA 4E07A 2FJUA 5JEDA 5JHGB 4RFSA 1E2KA 4URUR 1GTVA 2Q9AA 4RKEA 3U5ZB 121PA 3IBYA 3TH5A 3EWSA 1G5RA 4MA4A 2WWXA 2Q3FA 3NEYA 3U3MA 4QM6A 1E0AA 4DJTA 4IFBA 3SNHA 4Q7JB 4DLXA 2EYQA 2GESA 4XVUA 3KKMA 2QTHA 4OQXA 4QHSA 2KI5A 1RC8A 4W5HA 4MYCA 1G21E 5EJEA 3RRZA 1IXRC 1WXQA 5J4YA 2F1HA 4FCTA 2IF2A 3JVUA 1MRNA 2BV3A 3W90A 1OF1A 4A1FA 1II8B 2WSSA 3REGA 3E2IA 2R8RA 2Q9BA 2RGBA 4F4IA 1KDTA 4AKEA 1PZNA 5JZVA 4TZ6A 3K70B 2FSIA 3CKLA 1IN5A 1KZGB 2CLSA 1CXZA 2R44A 3RSLA 1W2HA 1IN4A 1GVNB 1G3RA 5E7JA 5E7IA 3UMSA 3ZS8A 4Q4JB 1GILA 4IHQA 4KYIB 4NMMA 3V00A 1OKKD 3ZJYA 4TTPA 5H8WA 3GJ5A 4OI2A 2XZOA 3T1OA 2YKGA 5B58C 3U6KA 3K9GA 3P20A 3RS4A 1TUIA 4DUGD 2CK3A 5DN6A 2GVZC 1GP2A 4JS0A 3NH6A 4V0KA 4KSCA 1OFIA 1A82A 4EQ6B 3VR3A 4TSFD 2JDID 1S0UA 821PA 1Z6TA 3T15A 5FUWA 1Z0AA 5DISB 1NY6A 3U60B 1OH5A 2YWGA 1YZKA 5ELXA 4CVNA 2X8AA 4NYJQ 2W6JA 4GFDA 3VKHA 4JYBA 4LUCA 2WZQA 2W0MA 3WMGA 4HAZA 1E2GA 1XNJA 3DZ8A 5HE8A 1ZM3A 2ZI7A 1Q20A 1CU1A 2IT1A 3MJRA 3U4QA 3KDSE 1PLLA 2IBMA 4QOSA 1U99A 2AX4A 5CM8B 1LFDB 2QQ0A 1HUQA 3QKRB 1YZLA 2A7QA 4DKXA 2WAXA 1LVGA 3QOFA 3TW8B 2JEOA 1KK1A 1CR1A 3T1TA 3B78A 2CCJA 2IEYA 2IA5A 4Q5IA 1YQTA 4B2PA 4JMPA 4LJ4A 5K8IA 4WXPA 1E1QD 4NP6A 4ZI3A 4UXHA 4AYTA 2BKEA 4I4LA 2WM9B 1M1YE 4LV6A 2JLUA 1XZPA 1NVUQ 2SHKA 2JAQA 3IHLA 3ZQJA 4HB0A 1N0UA 4JJKA 1NVWQ 2H5EA 4NYMR 2O8CA 4BUJA 2GZDA 3QEOA 2ANCA 5TDHA 2OFOA 4CGZA 3C4JA 2GZAA 3F8TA 4XSGA 5FOSA 1L7VC 4YMVA 1E2MA 2NO0A 4JLOA 1PV4A 1P9RA 1VG0B 1PVOA 2QRZA 4DLUA 1AKEA 1OV4A 2WJHA 1Z6AA 2YHSA 5AJXA 2GXSA 3UIEA 3GD7A 4X8OA 4BZXA 2DB3A 4P33A 2ZYWX 3N70A 4GI7A 4MGYR 4JLMA 2NO7A 1T8UA 1G291 3SE0A 3U7EB 2QGZA 1XMJA 1TU4A 1T0JB 4YC7A 3AVVA 2N46A 3DMNA 1WCV1 1Z2AA 4B74A 3C16C 4B71A 4YMUA 2J0UA 1R5OA 3GLIE 1T6NA 2FH5B 1CS4C 4MDFA 4FW9A 1LS6A 3BBPA 1AKYA 4OBEA 3TVDA 5LDDC 4QJ5A 2V4ZA 4M22A 5JBQA 3NBFA 4V0LA 4XTRA 5EZ6B 1H8EA 1KSHA 1ZUNB 1KDPA 3GLHB 1CLUA 1OE0A 1JI0A 2WJJA 3MUFA 3B8HA 5SZIA 4DLRA 4GT1A 3QJYA 5DHAA 3VX4A 4BFYA 3K0CC 2GILA 5KHOC 5BXQC 1G8HA 1S1CA 2JIZD 4XD7A 5JRZA 2JLXA 2YWFA 5AUPB 4ITRC 5KSPA 4JYCA 4IOKA 4TL8A 4C2UA 4LYJA 5D3QA 2JLVA 4AKGA 2YV5A 3C41J 4GP7A 1ZCBA 4GNKA 2ZJ5A 2HLDD 1XTKA 4ZCIA 2D7DA 2AL7A 3RABA 5JLJA 2ZSDA 3WRYC 2XNDA 4Q03A 5JECA 1P9WA 4B43A 5JJKA 5HTKA 2XZPA 3NIBA 1OLOA 1NMYA 4QL3A 4BZPA 3EW9A 4KODA 2CK3D 3P4YA 3WBJA 3KQNA 5DN6D 5DH9A 1C1YA 4QNMA 1KGDA 2GNOA 3Q9LA 4CRWB 4DCUA 1J2JA 4AK9A 2PMKA 2RHDA 5H1YA 4DVGA 1MR3F 1GITA 4DSOA 2O8FA 1GRNA 2VQSA 3E70C 2F1JA 2WJIA 1TQ2A 4ARZA 4KI0A 2DFLA 3MLEA 2A5DA 5BYJA 4IOJA 3B9PA 1KK0A 2GEUA 2IYVA 3TUJC 4E03A 5HZKA 1OHHD 2G1JA 3QXSA 3KJGA 5AK0A 1DAMA 1E4YA 3VU9B 5J40A 1Z0IA 3BB1A 3QQ5A 3LQQA 3FMFA 3THXB 4PO8A 4FCWA 4G3XA 5FH9A 4PQFA 4UNSA 2HT6A 4B3GA 1II9A 3CWZA 1TADA 3A58B 3QKUA 2XEXA 1NKTA 4Q01A 4H9GA 4KHZA 3LRPA 3GCGA 1XZQA 4PHTA 5HKKD 3GLFA 4Q9LA 2AK2A 2QN6A 5EE0A 2J7PA 1CTQA 2FGJA 1ZIOA 2QMOA 3OE7D 1Q1EA 5LD2C 1RZ3A 2QMHA 2ORWA 1F6BA 1ZRHA 4DSTA 3KJEA 1OFUX 3QY0A 1EGAA 1U2RA 1GKYA 1Z8FA 2JLSA 3WMFA 4LHXA 4CW7A 1Z5ZA 3QPUA 4N0EA 4PZLA 5FBRB 4YDSA 4CF7A 2GZHA 3BRWD 4LJYA 1E9FA 1G18A 4PZZA 2FN4A 3N2IA 4BFXA 2ECKA 1TX4B 4AIIA 1H65A 3DPUA 4HB4A 5LPNA 1Z06A 1KKLA 3AVPA 4K8OA 4F4CA 4RFVA 4QJ3A 3MSXA 2QMUA 1F2UA 5C4GB 4LJ7A 4CZ2A 1A2KC 2Q0HA 2RGNA 3EA0A 4NYMQ 1Q1BA 5FTKA 1BS1A 3HYRA 5B64A 2BEJA 3PUZA 1QHGA 4F93B 2BM0A 4OK3A 3IO5A 3VHXA 3R9WA 1CF4A 4NL4H 2F43A 4JLVA 4M1WA 1P60A 2C78A 4JLJA 4Q19A 1QG4A 1UBGA 4TLDA 3TE6A 4BLRA 2WOJA 3K0FB 1RW4A 4DRZA 3PUVA 3AKEA 1W5SA 2PLFA 5G3YA 4G5SA 3BS4A 4WIAA 3QIAA 3UPUA 4EIWA 1KNXA 4MKGA 1G64A 3K0AA 4LJAA 4A8JB 2V6IA 5EE1A 3TLXA 4IFEA 2ZRBA 3CPHA 4XD7D 2YWHA 3LD9A 5D3MB 1QHHA 2GEVA 4YDHB 3THWB 1HA3A 2O52A 2ZU6A 2W83A 2CE7A 1KYIA 2EWWA 5KSYA 2ZE7A 4Q1FA 2FG5A 5A4JA 1U90A 4BEBA 5J4VA 1P2TA 3K09C 4N3NA 2P3SA 5IRCD 5FBWB 2XNDD 2VP2A 2CHVA 2VHCA 421PA 2Q21A 2R6AA 4TMXA 2VTKA 2OZEA 3GLIB 4XWKA 1KSGA 4CIDA 5HR5A 1ZNWA 1JR6A 1WP9A 4JLAA 1YR9A 4WZAE 2V9PA 2ZJZA 4DT1A 2WAYA 5DO9A 1KIMA 4Z51A 2ZAOA 4M9XA 3MCAA 3FTQA 2R2AA 4WZBE 4KAXA 4R2HA 3PEVA 221PA 2GCPA 2GXQA 2LCFA 2X2FA 2ZE6A 3AVWA 1YHNA 5F3WB 4RZ3A 2WJVA 1ZMXA 4RFSB 1NBMA 3SYNA 3PR1A 2IS2A 1II0A 2O0KA 1IY1A 3LW7A 1LV7A 2FSGA 1HURA 2R6CA 3DEFA 1VYVA 2FFAA 3L8YA 1NMXA 2ZROA 4IOLA 3RSOA 4ZI2A 4H1UA 4ESVA 4MRNA 4IDQA 2HV8A 4Q9JA 3AUXA 2CE2X 4CT4B 1OH6A 2QAGC 1UPTA 5C18A 2P5SA 2ZIAA 3S1AA 2ZU0C 2QEQA 3PVSA 4YLGA 4V0MA 3IKJA 3OFNA 3QNUA 4RD6A 1M74A 3LBHA 2ZRKA 1KSJA 3GFOA 4H1VA 2IWRA 1FMJA 2VL7A 1XTQA 4QM7A 1N5LA 4D80A 4TZ0A 1OW3B 3ZZUA 3BOSA 1JR3D 1KI6B 2F3TA 3ZZTA 4D0GA 3A1SA 4CEIB 2WIBA 1FX0A 2WWYA 3G0HA 3CNNA 1SXJC 3LX8A 4PQYA 3AB3A 4UNNA 1R8QA 2KBEA 3HU1A 4IW3B 4LYHA 5FUXA 1WB9A 3KFXA 1NJGA 2FMXA 2W6IA 2O8DB 1G9XA 3KKOA 1OH8A 1W48A 1G19A 2JCSA 1PUJA 3B60A 3CF0A 3KB2A 3FWYA 2H18A 2AKAB 2JLZA 3WNBA 2XJ4A 4L16A 4OI4A 3M4YA 3EWAA 3FMOB 4RKFA 2BWJA 2WPDA 3BFVA 4LHYA 1DELA 1N2CE 4P32A 2R9VA 3FMPB 2QT0A 4TTQA 2H17A 3PENA 3SOPA 3UWKA 3EPKA 3EPHA 2HUPA 2HT1A 3K0EA 3QF7A 1IM2A 2IS1A 2WOOA 4DDVA 3CH5A 3DDCA 1JR3E 1Q3HA 2J7KA 2OXRA 2ZSAA 3LO5A 3SFVA 1MV5A 4ACBA 5GVSA 1AA9A 2FFHA 4JJZA 4ZCLA 4EPTA 4QRHA 4B44A 3L0PA 2XJ9A 5E7MA 1CBUA 4Y0VA 2ZVPX 2Z4RA 4GMDA 1R0WA 3QSYA 3D6TB 3TVTA 4D0LB 2JJ2D 1DPFA 2EFGA 4M8NE 3P4XA 2VF8A 1Z0DA 5TXGA 3QPVA 2ONJA 1N6KA 1QBKC 3X1WA 2PJRA 4RJLA 2RGDA 2R62A 3NC1C 4O2RA 4TWZA 3EG5A 1AS3A 3KTAA 4LJ6A 3CB4A 1Q0UA 1R8SA 1W0JA 3EC2A 4UXJA 5CIWA 2B8TA 4D2IA 1R0YA 2ONKA 4AYWA 4I1UA 4A15A 5JJIA 1MO3A 1ZD8A 4IDOA 4LHWA 5FI0B 1YU9A 5KNDA 3I5XA 3LV8A 4GOKA 3PUXA 4XH9B 3CR8A 4C0LA 3ADCA 5JSZA 2O8CB 1DOAA 4TT3A 3SFZA 1JPJA 3UG6A 3A4LA 3DMDA 2ZJBA 2WIAA 1MT0A 2ZVQX 3WP0A 5C2JB 5JRJA 2BMFA 1MABA 4TLCA 4EPWA 3THYB 1P2VA 4L4UA 4TN1A 5KO2A 1I2MA 2IC5A 3DOFA 3U44A 2G88A 3RWOA 4LY6A 3O8RA 1CJUC 1XTJA 1S9DA 2QP3A 1N3BA 1OFTA 3K0CA 4RVCA 4A9AA 5K8TA 4G5OA 2EWVA 1E98A 3AF3A 1COWA 4O25A 3SU8A 1E1RD 2YVUA 1VCNA 4F4JA 1E2FA 5EZ5A 2BBOA 3IEVA 4PXAA 1FPMA 1U0JA 1FNNA 2WMOB 3A1UA 3ZDQA 4A2QA 4PTLA 2JASA 2O8EA 2QP9X 1JB1A 1EFHA 1NBMD 2J0UB 3I32A 4HAWA 4A0GA 1E96A 1OT3A 2YOFA 1NL3A 4RD3A 1NVXQ 1KDOA 3Q5EA 3W6PA 1ZCAA 2GCNA 2OCYC 4WAUA 3KUCA 1OXTA 2MSCB 3GP8A 2WMNB 5FBQB 2QBYB 4OHZA 2XTNA 2A30A 1KI2A 2OAQ1 2P67A 1NIJA 2QMEA 1P62B 2GJAA 2IS6A 2QP4A 2XOKA 3BH0A 1GL6A 3GQBA 4QBGB 2VHQA 3SHFA 2X77A 3TSWA 4GOJA 2UZIR 3D7MA 3PG5A 2Z4SA 4TMZA 5KNBA 2V1UA 1NBME 4NYJR 5CYPA 4DLZA 4IVRA 1VYUA 4DEYA 5DSZA 1MH1A 4Z8XA 3TSZA 4DWJA 3AVOA 3IGFA 2QA5A 1GRQA 4NE2A 2QZ4A 4CEHA 1R5BA 4AD8A 2RKOA 1LB1B 3P26A 2FPKA 2PBRA 5AJVB 4BECA 1SVOA 3LVQE 3VX3A 1OYWA 3H0KA 4NHOA 2A78A 4PANA 2QE7D 1DAIA 1HQCA 4LDJA 3B2EA 2XXAB 2D2EA 4B2IA 1G3QA 3BAFA 1U8AA 3PUWA 1AS0A 1XPUA 1XP8A 2ZRGA 2VA8A 4LBVA 4TQUS 3LY5A 1IJEA 2ZUBA 4II7A 1T5LA 3AV0B 4ARZB 4KXFB 3ZYCA 3BIFA 1J90A 5JFGA 3D3QA 5IDVA 4NYIR 2VSOA 4E09A 1Z07A 2KJQA 4URWR 1TQ6A 4JBXA 1MO5A 2FFQA 4TMVA 4ERNA 4M1TA 2VYFA 5FL7D 3SDZA 2B8WA 4IJMA 4EPXA 4B3BA 4AURA 4HAUA 2D4HA 4M4SA 2P0EA 3TR0A 2GXAA 3IQWA 3PCRB 4JVLA 1SHKA 2IF0A 1G8FA 1VIAA 2JLRA 3EASA 4PAQA 1RIFA 4TMTA 5ANRB 3SBDA 2ODBA 2EVWX 1SVIA 1YZTA 4EJSC 4TL7A 4DDWA 1GWNA 3X1XA 5AUNB 3EIHA 3ZVNA 1F60A 1XPRA 4DCTA 1IONA 2QM8A 2XTZA 1NG1A 2GK7A 2YWEA 4HAYA 5CB8A 1E2LA 2W0SA 1HV8A 2I3BA 2OLKA 4L5BA 3H1TA 4HUQA 1W36D 2R65A 3R7WA 3I72A 1XEWY 3AVXA 2CCGA 2WJYA 1Q12A 2A5FA 3U2QA 1U8YA 2GCOB 1TL7C 2OM2A 3QXJA 4P4TA 1RJ9A 3LXXA 3RRNA 2DFTA 4OQMA 4B34A 1EWQA 3TKLA 1TF5A 4POAA 1XRJA 4EPVA 3K09A 5L3VA 1I2DA 4HLDA 4IKEA 4V03A 5F9HA 4URYR 5KYKA 1UBCA 4BQSA 1S96A 3CPEA 2HCBA 3K0SA 3CR7A 2ZITA 3HU2A 3SJCA 3K70C 3IQXA 1AQUA 3AGPA 4FINA 4LHVA 2ORVA 3ECCA 1UFQA 4ZPXA 1NN3A 1Z0FA 2K5UA 3HPQA 2B92A 3A4MA 4GOXA 4WA7A 4JLPA 1G8PA 4DSUA 4JT2A 2HJGA 4G1UC 3QKTA 1B0UA 1TMKA 1G20E 1T3HA 3TJZA 3U61B 5AUQA 4YXWA 5L8VA 1XPOA 1NNEA 1YRAA 1QHHB 4FWTA 1LF0A 3HR8A 4NPHA 2QL6A 2GHIA 1KO8A 1W0KA 2C98A 4EFLA 1NLFA 4NBSA 4OL0A 1G7RA 3NDBB 2CNWD 1KO1A 2O5VA 3FKQA 4U5XA 2C03A 4Z54A 2OFXA 4WOPA 1X1RA 2ANBA 4MUAA 3W5IA 3C8UA 2CEAA 2VHTA 2ZR0A 4M9SA 3T1QA 2ZYUX 3W34A 4EDHA 1R2QA 1QHYA 1X1SA 2PZGA 2VF7A 2GRJA 3DKVA 1KI4A 1KMHB 3BXZA 4LX0A 4M1SA 3OAAD 2R6FA 1B23P 4QNRA 2QAGA 2PL3A 3RC8A 3H86A 4B3XA 1CR2A 1SGWA 4QBIA 5SZJA 3O47A 4R7ZA 1D8TA 5IHPA 4G0NA 1ZNZA 2OE2A 3D8BA 4OYHA 2FNAA 3NXSA 1RRFA 1GAJA 3NBZC 2P65A 3KJIA 2PT7A 4US1R 3AF1A 1I4DD 2VH5R 3L8ZA 2XB2A 1D6JA 1SXJA 1EFTA 4FMDF 4UNPA 5JS7A 4G5GA 2H92A 2TMKA 1SVWA 5CITA 1EWRA 5FPSA 3SQWA 2G77B 2DBYA 4F92B 1W46A 5JJLA 1XWIA 3UG7A 1OXXK 4DDUA 3UATA 5HCNA 3Q7QA 3OEED 1Q44A 5TVKA 3CZQA 1UKEA 2G6BA 5FBVB 1T4GA 3S1AB 2DWOA 3VNUA 4TLEA 1N5KA 2HXSA 5KU1A 3FOZA 3H4MA 4NYIQ 1S8FA 2C9OA 1M7GA 1Z08A 1X8JA 1KTVA 2QRNA 4D81A 3SS8A 5AJYA 4BASA 5DLQC 4ABYA 2GETA 1Q1QA 4KFTA 1OB2A 1XBTA 1U0HC 2XB4A 5L3SA 1G5TA 2Z83A 2PJZA 3QXHA 4IDPA 2CXXA 3THOA 4GDFA 2XSZD 3QKSA 5FFMA 4W9MC 1RKBA 1CEEA 2PEYA 4N0DA 4U7DA 2XX3A 4TQAA 3CRQA 1D9ZA 1OPXA 1EFCA 1IOZA 1TNDA 3QXXA 1QHXA 4HB3A 1X8LA 1QRAA 4R98A 2W58A 3BH7A 1P73A 1Z63A 2GBLC 2WVJA 4ASUD 2GXUA 2PMDA 4URXR 2NGRA 3CONA 3ADKA 4KFUA 1DO0A 3CIOA 2FV8A 4BEJA 1IQPA 4B73A 4D25A 1Z28A 4A82A 3K9HA 1JAHA 1FL9A 5FPHA 2AK3A 2VP0A 4DXAA 3G5UA 2C77A 5LB2A 4PAMA 1XTIA 4RZXA 4PPFA 1M8PA 4JL5A 1JQJC 2IYXA 4KBFA 3HP1A 1Z0JA 3OIVA 2EW1A 1SVSA 3OIWA 2CBZA 1P3JA 2QTVB 3A37A 5FPKA 1QDEA 4I81A 1E2NA 3UXMA 1JAIA 4MITA 1G4UR 1VG8A 1VPLA 2VP5A 1R4AA 2AXNA 3NC0C 1P4SA 4GZLA 4BRWA 4MH0R 5CYOA 3TUIC 1ZM9A 1GKUB 4Q1CA 1BH2A 2WSSD 4BZQA 3B1ZA 2FA9A 4LYFA 3KTAB 3EIEA 4TLAA 5J4KA 2AWOA 1TUEA 1XD2B 3BWDD 4TQ9A 4OQNA 1W0KD 4NCKA 4UQOA 1E2JA 3O8DA 4C4PA 4XWOA 3X2SA 1D2MA 4OJKA 4BWYA 4JT4A 1JPNA 2VRWA 4HAXA 2X19A 3NG1A 4PSAA 3X1ZA 4D6PA 3MWJA 3I62A 4J0QA 3VKWA 4A36A 1WQ1R 1ZM4A 1FTNA 1SVMA 5JSZB 1KJYA 1F5NA 4W5WA 1CJVC 1NKSA 2CL0X 2FFBA 1ESNA 2NO1A 5B57C 1XJQA 4B2LA 2ZE5A 3KQLA 2ZR9A 1SULA 4HZUA 4DC9A 1ZBDA 4TYWA 1G8YA 2ZRCA 4CDGA 2ZM5A 3VHLB 3T1VA 4HDOB 1KK3A 2D74A 4C0JA 2P6RA 3QEJA 3DL0A 2W6JD 2QI9C 3EARA 5IK2A 4EKDA 1W36B 1RYHA 3F5FA 4Q9HA 4I1OA 2JGNA 2AD5A 4LC0A 5IF9A 1M7HA 1VHLA 3ZVMA 4JLNA 1AGRA 2I1VB 2J5XA 3Q3JB 3WYAA 2OG2A 3NEJA 1S1MA 3UKDA 3ZVRA 1SXJD 2RAPA 2O8EB 1KO7A 1XMSA 1XMIA 1E2QA 2DFKB 2V1XA 2NO6A 1J70A 2ZI9A 1CKEA 1ANKA 4P4SB 4L15A 1TQ4A 3BB4A 3V4FA 4LI0A 4KO8A 5JWHA 5IT5A 2P2LA 2KWIA 2MMGA 3CLVA 1ZIPA 5EXTA 4HDCA 4OQFA 1NRJB 4Q4HA 2YINC 2OSBA 5DI9A 4DZZA 4LRWA 2EQBA 1EFRA 4ZDIA 2C95A 5DNYB 4XSHA 2Q6TA 5EP3A 4DCVA 5E4FA 4C0KA 4LGMA 2KSQA 4ZDWA 5FUYA 2VEDA 3RANA 4PO9A 4V0NA 2IYRA 4DB2A 3KKQA 1SXJE 1WA5A 2D2FA 1T8TA 5EXPA 1S9HA 5J5CA 5BQ5A 4D4JA 2IYTA 1H8HA 3FHTA 4C0QC 2D3WA 3I8SA 3KQKA 4QFMA 3WMEA 1KZ7B 4GL2A 2J41A 4PHGA 2P5TB 4FMCB 2CLDX 3R8FA 1E9DA 2VO1A 4KITB 1HT2E 3JVVA 4R9UC 1G7SA 3KZ1E 3UMRA 2CHQA 3GJ3A 3IIMA 2WWWA 3CPJB 4LCBA 2NZJA 2ODNA 2QNRA 2G3YA 5FR1A 2FPLA 1NVVR 1Q3TA 3MAAC
chains in the Genus database with same CATH superfamily
1JI3A 1SWWA 1VTKA 5FBLB 4MWZA 2BGIA 5TQ2A 3EW7A 2EX4A 1VPEA 1QAQA 2VT2A 3LZ6A 4X44A 4P86A 4Y6OA 5SY6A 4WECA 1U5AA 3O31A 4XCQA 1S2DA 5LLDA 1ODSA 1BE6A 4LSZA 3I2YX 4O0LA 1AX9A 4BXOA 2V6GA 4AW9A 3OOWA 1XE3A 1Q6YA 2ZT8A 3LIPA 1TF2A 3IBGA 1KAEA 2OHFA 3IYLW 3V8RA 3WIOA 4BO9A 2BPOA 4ESEA 3LSYA 3S2GA 4CETA 3RHFA 2ZS7A 3DZHA 2Q3LA 1SFRA 2BBWA 5FR2A 3GYGA 2ZWAA 4K9MA 1AGXA 2OBNA 1TD9A 1UPCA 5IWAB 1HORA 4QT0A 2JI8A 2JJ8A 4UDNA 5FNZA 1WDTA 1TTTA 3DO8A 2OORA 1Q0TA 2PRJA 5DK4A 5EUBA 3TOXA 1JW9B 2ZK7A 3W8NA 4ZQEA 3GNSA 3I2FA 1POXA 3GEMA 5GJVC 2A5JA 1NLZA 3ZWOA 4FFWA 1P9LA 2FCRA 1MDFA 5ED4A 3L8FA 4BB9A 4LV8B 4P0QB 5DI3A 2I91A 2AOUA 2FWNA 3GG2A 5TC4A 1U2SA 4CKEA 4COKA 1AQYA 1QX4A 2YQZA 5K3EA 1DIAA 1HH4A 1E69A 1JHQA 1FNCA 1HF3A 1TO2E 3Q3VA 3U3RA 3EY4A 5IUNC 3SVTA 1V45E 1QYCA 2G04A 3OZBA 2CLIB 4BFLA 1JIVA 2XITA 3BMQA 2NP6A 2BTQA 1JBKA 2V7GA 4LPKA 4REOA 4Y2UA 4Q4JA 3H11B 4QPZA 4QWWA 1NPYA 3FNEA 1W7AA 1ZISA 1BW9B 2BZ1A 2W48A 4OIFA 4JLBA 5CFPA 4HVTA 4N76A 3DZBA 1JGTA 3IUSA 3B1JA 4CJXA 1WXHA 2PD3A 3Q87B 3QSGA 5FHQA 3W7BA 3H9QA 5FFFA 4F4HA 1MJ5A 2X4DA 3FGZA 3OQHA 4Q3KA 3T5MA 3PHLA 2F59A 2JVIA 3VBEA 1ZHHA 3DOEA 3M6LA 2XWBF 2BVNA 4M1ZA 3GLRA 4EQ6A 4F86A 1Q0PA 4MQEB 3SZRA 4BMOB 1FFHA 1SA0B 3R5TA 3TLAA 4YYZA 1Q84A 1XMVA 3RVOA 3ANLA 1DMSA 2MCFA 2XA1A 4AXBA 3ZHTA 3Q5DA 1U9IA 3TR6A 2VTEA 4CQMA 1NLMA 1TUBA 3GFSA 4D42A 2QX6A 2F48A 5T3YA 1NNI1 2WSMA 3FYUB 4AI6A 4YQEA 3TQHA 3OBIA 4DMCA 2V7QA 3KU1A 1PS0A 4HXEB 2I7DA 4LNHA 3ABIA 3TRFA 2IUSA 3P9SA 3GCWA 4PVDA 5CPFA 4ZQGA 3C7CB 5EJ5A 1U98A 1VDZA 3CLUC 3KFVA 4C43A 1LPPA 4YCLA 3CRZA 3PUIA 3E18A 1I6MA 3HDHA 1XEWX 2QPAA 4FUTA 4U8GA 5C5CA 1USKA 2GN2A 1ZM7A 4M0MA 5F2EA 2KS6A 5F1PA 2JH8A 1DAGA 2DR0A 4YACA 2B5VA 2OVFA 2QRVB 4LC9A 1DWQA 5U4XA 3ZIAA 1N77A 3O8OA 4QGAA 5CNKA 5JI3E 4UC0A 5K05A 4LZWA 4OSPA 2X23A 2CXQA 4JXXA 4DG9A 1E2EA 2JI4A 3ABRB 1KOLA 2HQSA 3H1PA 2JBHA 3LLCA 1OUMA 2V5UA 2VH2A 2ZRLA 3DVLA 3QFCA 4H4EA 4KO2S 4PR0A 3R8CA 1BDMA 1H0RA 3COPA 3K1ZA 1LY1A 1W30A 1EDOA 3RYTC 4L8WB 1APBA 3EZ6A 5ICSA 2F1IA 5TV2A 3AWIA 5AMXA 4FFNA 3O95A 3ROKA 3NKLA 4UARA 4NCIA 3I2KA 1DIOB 4D8WA 3PUJA 4MW4A 1BMFA 4LMBA 4OJTA 4PSKA 3FUCA 2HPAA 1VKZA 5AI8A 3TQQA 1MO4A 4LQ4A 1O54A 2OK7A 4MGKR 1Z88A 1XXHA 1S02A 4HZIA 4EHDA 2O1EA 3FDIA 4WXEA 5CT4A 4YN3A 3KPVA 1M34A 1ZMBA 3K9LA 1HYQA 4ND8B 4P80A 4H3VA 2V6BA 4WY5A 3OZUA 3K16A 2A94A 1YZYA 1C3OB 5JLAA 4Q1BA 5JOQA 2AI3A 1U94A 1U31A 2Z2IA 5AW7A 4ALLA 2PBZA 2XQKA 1YB1A 3FCSB 4NJEA 5I5EA 3GRZA 3LPNA 3SZLA 1G8SA 4X7BA 1HY3A 2ZI4A 4G8JA 1RQXA 3HP4A 4GLJA 5AI4A 2VSYA 4REQB 1YOBA 1YIAA 2JGJA 2W93A 4JOQA 4CIWA 5ECDA 5JYEA 3FKSA 5ICGA 3W78A 4MB0A 1HL3A 1RXIA 1V4VA 3B3FA 2K7ZA 3HVHA 4PHFA 5I7HA 1KYXA 3EEOA 4WL0A 3DFZA 4EAQA 1E8MA 2RAVA 4WK2B 3TFQA 4FXPA 4MQ5A 4DE5A 4MUJA 2X0RA 1GUBA 5EXEA 1ZA2A 3K20A 3SXPA 4FSHA 5CW1A 4AZ3B 3V8NA 3GUCA 2NYUA 3DDOA 3OPXA 1LPOA 4BNTA 5FV4A 2XMPA 4LRQA 2Q6LA 2LW7A 3IKMB 2F8SA 2J5QA 2IEDA 4OGGA 4L85A 1TXGA 5ENDA 2HJVA 1LSOA 2ZJYA 4EYQA 4UAVA 1ISGA 3VOAA 5AVSA 1E6UA 3TS1A 4MJ7A 1CP3A 3DP7A 3Q3EA 4TSKA 3CLKA 4HK4A 4HLQB 2GJKA 4Y98A 3AHJA 2ZIWB 1QF9A 4AF6A 2ZBDA 1QIFA 4RD4A 3QKSB 3WZMA 4I6EA 1L5ZA 3NQ41 4BGDA 2OHHA 1RRCA 4DN6A 4RJTA 2I8CA 3I9V1 1YUBA 3KX2A 4K26A 1RAGA 1L8AA 4F71A 1PWEA 1RYNA 4AP5A 2ZANA 1M1ZA 3EXEB 4DLWA 2NSYA 5FA5A 3KNZA 2IXEA 2ZSBA 1RRMA 1KF0A 5KQPA 2A1IA 1TQ8A 5BSWA 3ZLVA 1IY2A 3QJGA 5BW8A 1IIBA 1UBMS 1FP4A 4GC9A 4I5DA 4LGVA 4RHTA 3TOVA 4NKRA 3NYWA 2NLOA 4I0WB 4INOA 4M8IA 4OHYA 3UT5B 2YDYA 3HO6A 5JALA 3IQFA 4I1SA 4JI3B 3I9NA 4UCFA 4AN1A 4BLVA 4BP9A 3HYTA 1W96A 4P5DA 1Z2OX 4UUPA 1GNQA 3G2KA 3WHPA 2IYZA 6LDHA 1EVEA 3NOOA 1N1EA 3HUDA 1OBOA 4B4VA 3KVVA 3SX2A 1SKAA 3GJ8A 3SD7A 1YDWA 3JS5A 4TKLA 4WKBA 1X2BA 5AJUA 3K1JA 2BEUB 4IJ6A 4Q3AA 1HE3A 3ZLTA 4RMGA 2HRZA 3GRPA 5H68A 4KBGA 4QHTA 5CMLA 9ATCA 3KQYA 3C3KA 4FONA 2ZB7A 3V4PB 3DMGA 1P81A 4UZEA 5HJ7A 2B8JA 5UKDA 2VBCA 1UFKA 3VNAA 2WG0A 5KX5A 5I8ZA 1V5FA 1G2IA 4E2XA 4BFSA 1UDCA 1TYDE 3G5LA 3ML1A 4OQLA 2ZI3A 2DZDA 4MDYA 5K20A 4BO0A 1Y1TA 1G8AA 1DLIA 1QAOA 1P19A 3R7AA 3GT7A 2O0JA 2QENA 3DH0A 1BFUA 4ZOLF 5K0EA 1M2HA 1VCHA 1Z6QA 4UVIA 4DEXA 4Q7KA 3SJBA 6REQB 3CO0S 2WPDD 1UJ2A 1T4DA 1OFVA 1VCIA 2GKSA 1VHWA 2GWRA 3K8YA 3N28A 4ZTZB 3K94A 4MICA 3L0SA 1EUCA 3PNQA 3UB2A 1JQAA 3ZHOA 3TTVA 1X0VA 2LWIA 2XLBA 1UPXA 4IG9A 3THRA 4NOKA 2O8FB 3ACCA 1IATA 1Y1LA 2ZUCA 1UC8A 3L4EA 3O38A 4MX8A 1L5MA 1PGNA 1XCGB 2ZBVA 4WBXC 4F38A 3BH6A 3IPCA 2Q3CA 4D8VA 3P71T 2NPFA 3IEKA 1XYGA 3O2SB 4WESB 5F77A 2GARA 2QRQA 2WF6A 3JAWB 3MW8A 3A4NA 1NC1A 1RP1A 5HS6A 3X1MA 4Z2AA 1XMQB 1ZGZA 1YMUA 3W5CA 1IUOA 5JDCC 1YRHA 2ISQA 3GEIA 3ZY3A 2WB2A 1CUCA 2YQ5A 3COVA 4U63A 5ITWA 3EZ9A 1K3FA 5C8XA 5K9ZA 5TNXA 5THQA 1EJ2A 3FKSD 3MFYA 1CUGA 4CMBA 2G0TA 3FLBA 4UKDA 1SBCA 2B0CA 1IG3A 2WUVA 1RI1A 1W5BA 2I2XB 3M6IA 5DNAA 2O0MA 1W0JD 2CFCA 2O4UX 4NTZA 2OUKA 3EGVA 2QLMA 3O9ZA 3WISA 4DQUA 1C30B 2WKPA 1N8TA 2XADA 3MJ4A 3C3YA 4KTVE 1P2UA 3EZXA 3NHRA 4NC9A 4IFIA 3VR5A 4C4TA 3GLFB 3L1IA 2R6R1 2Q3HA 3NUQA 1MJFA 5EE5B 2VXOA 3GPLA 2C0CA 3JYLA 5CG1A 4TT3D 2APJA 5AVZA 2VF5X 4S2UA 2ZXEA 3CN7A 5D5PA 4WQMA 3MTDA 4L0DA 3T61A 3TXAA 3ZCQA 3K1AA 2ZRFA 1OFHA 3H13A 4JSYA 1A4RA 1R15A 1T15A 4R3WA 1EX7A 2QT9A 2D0IA 1K6MA 3EZFA 1W581 1XN1A 2PYZA 4CF5A 1N78A 2JGDA 2H2DA 2IHBA 2IQIA 1S2LA 3UMYA 4WEOA 1XZ8A 3TPFA 4M1YA 3O74A 1AXGA 3C5CA 3DG9A 4HGNA 1F2UB 4WK6A 3LA6A 5ALEA 4E5KA 2XBUA 1XKXA 1P4HA 5FO0A 2EJBA 1P1FA 4NARA 4Y8VA 3SZ3A 4D96A 5DKFA 4FLEA 3IUQA 3ZX4A 2E1RA 4TWAA 4Q9KA 3JQQA 3QXGA 4RTNA 2N0SA 5L51A 2N3ZA 1MC1A 3AG5A 3UGJA 4S0ZA 5DTMA 5IYZF 3U7JA 5I7VA 3QU7A 2XT6A 5P8WA 3AEQA 4AUMA 2GAAA 3INNA 4DZTA 2EHJA 1XCJA 1E18A 3C5WP 3H8VA 1B6GA 2J3HA 4MPTA 1H23A 3STVA 2LNDA 3AR3A 2WWFA 2V97A 4O4JB 2DFNA 2FMUA 2XPCA 3JD3A 3LUHA 2O8VA 3AY0A 4D8XA 4ZK6A 1D1PA 2I4OA 2OO5C 3BHNA 4EKGA 1M0EA 1QTQA 3B36A 1T2CA 1Z83A 3DAFA 3SQXA 2B8EA 3IBTA 3HFRA 5A0FA 4A0FA 1V3UA 3TECE 2YOHA 3NHPA 2XOKD 1FBTA 3FPBA 3MG9A 4AS3A 3LT5A 1TAHA 5JNVA 1M8GA 1S3FA 1B2RA 2DBVO 2YICA 3TSYA 2V4UA 3CX8A 3BTVA 3C5HA 5AOVA 1L2TA 5KVVA 4W63A 3FROA 4CFZA 4R1MA 2V7VA 3IIIA 4G5XA 3PXGA 3D6UA 1U9IC 2IZ1A 2A7XA 3ZIUA 1G5QA 1UEJA 4HRYA 5CUQA 2RARA 5A4FS 2XXJA 5DI3B 1HQYE 4J90A 1OIWA 4LZZA 3ZZMA 4B33A 3KAJA 4BNFA 5C34B 5AJWA 4CKEB 2ZYAA 4WE3A 1Y42X 2RH4A 3DWGA 2RC5A 4RCYA 4WGGA 2IXBA 4FYVA 4TYQA 1U63A 4I1RA 4R0NA 1Z22A 2REBA 4NAVA 2HLDA 2MT9A 2DLDA 4GO1A 5EZYA 1YA4A 1WUKS 3I1IA 4ZALA 5CK5A 2BELA 4DTCA 2PQMA 3IUYA 4A0RA 3IAS6 1TW2A 2OXFA 1O6GA 3NXKA 4NBVA 1GQQA 2IWHA 1TZMA 3TK1A 2Q45A 4YJFA 2EF1A 2AFRA 4OBWA 3L7JA 4Q4AA 4UAGA 2AN3A 4Y0AA 1JYSA 2CBXA 3KPJA 2WJ6A 1DO8A 5JG7A 1DBRA 5AW1A 4EZIA 3WWYA 3VR5H 1EU1A 3N8HA 2MOKA 3PD0A 2WU1A 3H4TA 4FZJA 5I9LA 1C50A 4UHCA 3RF6A 3RT9A 5CR9A 1ZKDA 1AUPA 5FPTA 4K9LA 5KPJA 3NP7A 4XTCS 1WE2A 2IYFA 1CVLA 3W9YA 1J00A 1CS0A 4ZV4A 1NI4A 4D9BA 1J7KA 3PXEA 3FZEA 5IP5A 1FFCA 2Q8QA 4RF5A 1VXOA 3LDHA 2P6NA 3BCRA 1YZ3A 4HLCA 5CDFE 4G5FA 4C6HA 4DPLA 3UJPA 1CZUA 3FMIA 1VGVA 3NYIA 4KE7A 4PCAA 3VR5D 1ISMA 2RGUA 3ZE0B 4CF3A 4EG4A 2IS4A 2B4AA 5J1TB 3K53A 1UBTS 1YJBA 2DH5A 3OIUA 1MOZA 5KCMA 1OA0A 4RFLA 2FXIA 3K1TA 3IB3A 2CL7X 1MMFB 1HT0A 2P1DA 3FYHA 3MLBA 4MIYA 4U00A 4IVPA 2Y1GA 1NZDA 4J7AA 4RE6A 4ARAA 2PUCA 2ZI5A 2X0NA 3GGJA 2IJGX 5DT9A 4H17A 2ZQZA 2Q1SA 2RHRA 3QWAA 4R6WA 1G0OA 1F0KA 2OO3A 3PL5A 4ZGBA 4O3FA 1EYZA 1DDIA 4JUAA 5A02A 1CUHA 5HKKA 2IYQA 4BO3A 5CB4A 1TRHA 2CHUA 4Q00A 1P2SA 5C53B 4RTRA 2P0YA 3FDZA 1V5GA 2H5JA 2D4AA 1J0XO 2X9VA 1QS0A 3BYZA 3T7EA 2AYXA 2FN8A 2KB0A 2W6MA 2W6QA 2YJZA 3AR2A 3EXHB 5HKLA 3FNFA 2NTEA 2WIKA 3PNKA 3KV3O 4KE9A 3O0TA 3UWPA 3THYA 1OU4A 2BCGY 2OKGA 5K8UA 3FUTA 1CW2B 1O94D 3MPOA 1XXHB 4DA7A 1NBWB 3BGIA 3E0XA 4FFVA 4D3DA 4DNOA 5IZCA 1YV9A 3R6GA 1JNYA 2HBZA 3L40A 2EZ8A 1ZGHA 3IUEA 4ZRNA 2I1LA 1E94E 2OOKA 4D7AA 1TLTA 1ADGA 3HJCA 2BEKA 1QQ7A 2ZUTA 2Y1OA 5B7QA 5TPZA 2P30A 3A1TA 5JH7A 2C2WA 4MYRA 4U7GA 5HOQA 3IE1A 2Q3EA 4F6LA 4FLMA 4BLQA 3H2YA 4HAIA 4L9SA 1EM8A 3AWDA 3MWYW 3WNZA 4G1CA 2J6HA 1P1KA 1PU2A 2H9AA 3ESDA 3PNYA 4TKUA 4XVHA 1JXAA 3AOEA 3OJFA 5KSWB 1QJ4A 3PQ5A 1EBBA 4D46A 2YS6A 4X8LA 1QRRA 2AG5A 1EAMA 5HGXA 2I65A 4K86A 3IAEA 2QRJA 4HAVA 1OX4A 2VDWB 2XF2A 4Q21A 1U7UA 1QIIA 3TM4A 2RI6A 4M76B 1A71A 2FEOA 1MF7A 1IAVA 2FCAA 2PWAA 3CEMA 3E05A 4FDAA 5K6AC 3U4MA 1PJSA 1CQIA 4ZYUA 1KMCA 2FPMA 3V2IA 1CV2A 3FBTA 1FUEA 2AFHE 5GVRA 3RIXA 2HIAA 4NF2A 3LC0A 2CD7A 3BXHA 4HNQA 1JDPA 1S3SA 3FPGA 3B5IA 4PFKA 4Q3DA 2FGKA 4KREA 3RBAA 3KQTA 1CC1S 3ZDEA 1I1QB 2POCA 2B7BA 5IC5A 3B6ZA 3DDHA 4QARA 1VKOA 3L8MA 4IZ6A 3ZQKA 2UYQA 4R1OA 5DHFA 1RQRA 2VJDA 1TT7A 3VYSB 2O3UA 3EXAA 4U7TB 3TQOA 5LQNA 1LD3A 3OKPA 4GH5A 2Q6KA 2EYUA 4MJLA 3U3OA 1SOWA 4BV2A 4EOGA 2DCUA 2YMQA 1EFUA 2PSFA 3GEGA 3NT2A 2X42A 5T41A 1F8FA 1WOYA 1QVRA 4JWKA 2WI8A 1L4NA 2WHXA 3EVZA 3CUWA 3N2ZB 4JL6A 4TMWA 1MX5A 2NX2A 4BBJA 1BXGA 3AEYA 5D8DA 1JE0A 1E7SA 3L05A 4HPJB 5BMOA 3ILVA 2NU8B 4FB5A 4ND7A 1FLNA 1SUSA 2BM8A 2G07A 4CCAA 1NAHA 3I34X 1OU0A 3HPRA 1FP4B 1C4KA 1JECA 1YSCA 3OUUA 3K8ZA 1O8BA 2HF8A 1DKQA 4EPYA 3MHTA 2VKQA 4Y2VA 3WGUA 2HCJB 1RQNA 4EFMA 2O54A 4LHZA 1RSZA 5A4MS 4QJ4A 4KGZA 1U0EA 5CG2A 1M54A 4AT1A 1A69A 2EEZA 1IUPA 3HVJA 2O5EA 1JDVA 4L57A 4EHHA 1JEYA 1P61B 2OC4A 3HI4A 1V6AA 3UW1A 5KOYA 1LDMA 3WAKA 4RZHA 4IILA 1DAFA 1P8AA 3FR8A 4H3SA 4ROSA 4MV6A 2IOFK 5AOBA 4E2WA 3F78A 3RSHA 4C3VA 5JWOA 4DWVA 1J9ZA 3AQ4A 2ZYIA 4MSUA 4BVJA 1JQDA 1P7CA 2Z98A 4RIEA 4UJ3A 4UTVA 4LVUA 1NT2A 1YDHA 4S3MA 4S1WA 3T3EA 5A9RA 1CE8B 5KUTA 1ONBA 3F5SA 1MFPA 1KORA 3C97A 4FXOA 2DQYA 2H4WA 2YUIA 3OLCX 13PKA 2HLHA 3KVYA 5TMEA 1EGMB 5AI5A 4DG5A 4B3CA 5LQCA 4HMOA 3A1NA 3A9TA 3WQBA 4MQ6A 4PAWA 4XFKA 3RJ5A 3IOCA 4LOAA 5IFKA 4NH0A 1XHEA 4S04A 1RABA 4WN3A 1S2OA 1BO6A 2HA4A 1QKIA 1J8MF 2VT6A 3B6KA 4JJEA 5KOJA 2NU9A 4P4GA 3ANXA 2DY0A 3PHHA 3SOZA 1WQ4A 3WRWA 1E2PA 1ZUIA 5T6BA 4AYXA 4OEHA 1N9GB 2HF9A 1XJ0A 4MWSA 3K8QA 4WLUA 5CH5A 1YVDA 2BDTA 1S4MA 2BLNA 3L1UA 2HWWA 4HL6A 1EUCB 3W6ZA 4ZRMA 2XUIA 4US0R 3OQBA 1JQLB 4M9QA 1AKVA 4WY8A 4HC4A 5ETJA 2OCPA 2H2HA 3CSUA 4CT5A 1FRFS 5BN3A 1SUPA 2Q4DA 2Z5GA 4PICA 2IYWA 4YJGA 4X64B 1YZVA 1LLFA 5AHWA 1YQXA 2VCHA 4BGVA 4J1QA 3ROXA 2AZDA 1J07A 2CVOA 4PS0A 4UU1A 4RPJA 2V5AA 4F3RA 4QUAA 3PZRA 4CL8A 1OVMA 3CTPA 1KRHA 1THZA 4DIKA 2B6NA 4ZAXA 4X93A 2O3QA 1L5VA 4MA5A 4B7UA 2XZDA 1ODCA 1ZD3A 2UDPA 1CUFA 4HQ0A 5KEIA 4MHTA 4BJ1A 3L4JA 3VH1A 1PNTA 1Z6YA 2AWNA 2JFWA 4A2PA 1K27A 3BHIA 2QV0A 4YFVA 1J21A 4Y7DA 5DGXA 5FNVF 1ZN2A 1FRQA 2ID8A 1AK1A 5EY5B 2UZ3A 1KH3A 4QC2A 4DMKA 1KI9A 5KQMA 1O5IA 4DMMA 1A2OA 2WP0A 4J4TA 3SFTA 4B3FX 4ZEOA 1PK7A 4GI1A 5FF9A 3TMYA 4MQ4A 3KQUA 1KKMA 1PWZA 4HNHA 2JJ2A 3NDJA 3N9IA 3WYNA 5KWJA 3NHZA 3V1NA 2J9FA 4O1MA 4IUDS 5A5GA 1A1VA 4P38A 2VIIA 2OB1A 1GEGA 4JENA 4FHFA 4MJXA 3HKBB 1Y9AA 3HN2A 1MBZA 4NDZA 4L6CA 4LFAB 3WGLA 3H16A 4MVJM 4E11A 2DHDA 2VOJA 3U6BA 3E9DA 2BEWA 3KKEA 1JQ3A 2H08A 1IU9A 3BWXA 3NEAA 3K1AB 4QA9A 2YYYA 4QYXA 1RWBA 1BQEA 3ETGA 3NATA 4GS5A 3CRMA 4OJMX 1R9MA 2NU6A 1HDXA 3C3CA 3LJKA 4KXNA 4WI1A 4ZYZA 1BH6A 4JJ7A 2QTWB 5IW8A 4KXLA 4E4RA 3SXUB 3PFWO 1HSOA 4BRSA 1JU3A 4RWZA 4HUQB 4ZT7A 3QPWA 4CG1A 1UC9A 4Z2YA 4QTYA 2D06A 2E1PA 3DYBA 4DLSA 2CDRA 5NLLA 2GK6A 1K8XB 3DZCA 1T5OA 1L8OA 2B5OA 3QVGA 5EIOA 3IQIX 2BJHA 2H1HA 2XVZA 1KHTA 1RJ9B 2CXNA 3BIJA 3N1UA 3R1IA 1YTUA 1KI7A 1QO9A 1L5RA 2P9ZA 2Q5JA 3DFUA 4Q6WA 1N6PA 4W5NA 4MPRA 4D45A 2DF8A 1EFKA 1V9SA 1ZINA 2P4HX 3T4EA 2YN2A 4D9HA 4B2YA 5IKOA 4H15A 3VAAA 3PTZA 3U4DA 3ZNNA 3F3MA 4QGGA 4EW3A 3ESCA 4BVHA 5BN4A 1E0KA 2PFSA 3I4FA 4LXGA 4M1QA 3EZLA 3MMNA 2C9BA 3MVEA 3T7KA 4Q16A 4XDZA 2OV4A 4WN9A 4D79A 5KYUB 3GIWA 3ER9A 1F4VA 3C0KA 3SP1A 4AZ0A 4G0PA 4B6FA 1L5OA 5H9WA 2BKVA 1V5EA 4EG7A 2GVDC 4G37A 2AXPA 4HS9A 3VAZA 2PV0A 3OM9A 5DRYA 4CDRA 4BMNA 3HCEA 2WLTA 521PA 2QHXA 3R3YA 4ADSG 5I3CA 4LZOA 1FYXA 2XUAA 1GNPA 4C7KA 4KX5A 3QU9A 5JNUA 1NYQA 3R6DA 2GAFA 4MQBA 3RKRA 1QHSA 4Q02A 4EMTA 2P11A 3FX2A 3DNMA 5KJ6A 3ICQB 2RMKA 2EJTA 2X76A 1E8DA 2O2CA 4E14A 3H84A 3CNOA 1ZVQA 5T57A 2EQ5A 1KGSA 1TJ3A 4GKJB 3BN3A 1NP3A 1N5DA 1J8DA 1OOEA 2CSUA 3NV7A 4G4GA 4PNPA 4PTZA 5CJ2A 1ZLXA 4C7BA 4DLAA 1J0BA 4ZICA 2XMQA 1G4AE 1BDBA 1DTSA 1FRZA 3ZWYA 4GG1A 4F6RA 5E6SA 5C31A 5CU7A 1V4BA 1UF9A 2PMCA 4YJHB 5KBYA 1KZ1A 2JJMA 3LK7A 2H7VA 1EXVA 1BTOA 2PL1A 5C5EA 1QYWA 2P9QA 4X90A 5EZYB 4IH4A 3E9QA 1E3IA 2CDAA 3UMFA 4P98A 4LF9B 5K03A 3UWMA 4L2IB 2YH2A 3QFSA 1RPZA 1E9CA 2BFEB 4V1CI 4Q4AB 1TLFA 3DAOA 2QE7A 5FFNA 4HDRA 621PA 2DLCX 4GBMA 3KEFA 4N39A 1GVHA 3SE7A 3IHWA 5L4SA 4JP3A 1L7BA 3EHEA 3NM4A 1GPH1 2ZDGA 2QLJA 1AV7A 4ZTBA 3AM1A 4XVRA 5DP2A 4MB2A 4MUEA 2VHJA 4TXJA 1N57A 4XQGA 1GGHA 3ASUA 5FRDA 3GJ0A 3ZHQA 4IQ4A 1XLWA 4KLCA 2FR8C 3UUEA 4X97A 4CU5A 4FS3A 4FFMA 2H1VA 3HJFA 4K46A 3E7WA 4CFYA 1J2UA 1X8KA 2FF7A 4C3ZA 3DZIA 1I80A 1MO6A 3SX4A 2PXXA 2Q5CA 2J46A 4JBNA 2R4TA 3IUJA 1ZNYA 2OWDA 3TZLA 2J6BA 4JHLA 1HG1A 3EVDA 4TXLA 1GDHA 1IEXA 2FMFA 2EL7A 3EMVA 4GMFA 4BLUA 5CAEA 1CNMA 1C29B 1HYHA 3QBTA 1IY9A 2FEMA 3VPHA 3EQ8A 4F21A 4F45A 5C1DA 5HYVA 4GXNA 5LLSA 1FVFA 1GU1A 1CULC 2NPIA 3MJEA 5L3SB 1D4FA 2BFPA 3GRAA 5IJWA 4RTLA 4XPZA 1TAGA 1WW8A 3I58A 4NONA 4MIOA 3TAHA 1NF9A 3GEBA 4FMCF 4UUAA 1BJRE 3D7NA 1AUOA 1FJXA 2NSDA 2OZVA 5CA0B 2F8TA 1QS0B 4HWPA 3IRVA 4RD0A 2R1UA 1NOKA 2Y93A 4UBMA 3RDPA 1HE1C 4R1PA 4F0JA 2DWPA 3IUBA 4PHHA 3ZI7A 3JQ7A 4BN0A 4EHJA 3KSUA 4AM8A 4M3NA 2FLWA 1W44A 3WRXA 5E4JA 4KP7A 2HHAA 4KIGA 5HDBB 4P5PA 5AR1A 1LW7A 1N1GA 2RH9B 2WYHA 4X20B 2WYIA 2WJPA 5A5VA 1X87A 4FD2A 1ZDMA 2GWHA 2M9MA 3OA2A 3WKDA 2AX3A 5ALKA 1FQKA 4A4DA 1BYIA 2H1LA 3ETCA 1NF3A 4DJDC 4E1AA 1OB5A 3G2MA 4FZVA 4TKUB 1KEZA 5DWVA 5BN1A 5DNEA 3ZD7A 4G01B 2CLHB 3CXUA 5BOSA 1M2JA 3QV1A 3HCBA 5CDTA 3WJ7A 2R8ZA 1N4AA 2XD9A 3ODGA 2VTBA 2GNPA 1THMA 3U16A 2BSQA 3L9WA 4UM8B 2ZJ3A 2VF4X 4G6ZA 4OB8A 3C24A 3AI2A 3CT4A 4JJFA 4Q3CA 2VZ9A 2J3LA 4P84A 3TR5A 1H2XA 1C3JA 1W4AA 3CLTD 3GA0A 3CO5A 4BLTA 2PXHA 1YRYE 4LZNA 5JCOA 3ZCRA 1L4BA 3M49A 4GE0A 3VNVA 3LLUA 1DXHA 4HRXA 2BMJA 2L18A 2GD0A 2XMZA 3C3DA 3CINA 2J0VA 1D5CA 4Q1EA 4J43A 4IIJF 4CKCA 3EFEA 3Q72A 1JRLA 3W8RA 2PT9A 3K0KA 4RLFA 5DIFA 1I24A 4YONB 4B3HA 2QX4A 4E6PA 4EVSA 4X6LA 2O8NA 3OUZA 4KWHA 3PDCA 4PSCA 3ZV4A 5CH8A 3U4CA 4HZUB 4LJKA 4H2DA 5DWQA 4LF6B 2UXBB 2OO7A 1BYUA 4UUQA 5E7QA 1D4OA 1EK5A 1NW6A 2B94A 4FFSA 2Q50A 4WH0A 1M2OB 1FUYB 3VNQA 3E81A 4WLOA 5CITA 3AUYA 1O9HA 1JEEA 1P5ZB 1ZQ9A 1E6MA 3LS2A 2ASEA 1I6LA 3LWNA 3PDJA 3QEMA 3IL2A 1HFKA 3HFSA 1ZEMA 5DYGA 1IM5A 1RHQA 1PJAA 2UUPA 2F1KA 2JZNA 2VDVE 3F6CA 4CKWA 2BYTA 1D04A 1W88B 3QELA 2QPTA 1IUKA 4V0SA 3ZQUA 1FS5A 1QQ5A 2YASA 4KR7A 1NHGA 1R4NA 4C7OA 4P82A 3X1DA 1M1YA 2XIJA 3KQQA 1BOOA 1UKAA 3CLRD 3Q10A 2QROA 5TEWA 1H2BA 2HA7A 3V4ZA 3MCZA 1M34E 1JBQA 4B6PA 2UUBB 2R1ZA 1T2VA 2ZETA 2NMVA 3EA5A 3UV6A 3IT2A 3O4GA 1ACJA 3PFGA 4XQ9A 5CEFA 3JD1A 5EG5A 4IF4A 1ZVVA 1E6EA 1CEXA 4QGFA 1KJWA 4Q4HB 1L8QA 1GADO 4G5RA 1YACA 2P4SA 2X40A 4LXYA 4DLPA 1J2RA 4L5CA 1ZZEA 3AP2A 1XRMA 1ISHA 2W2KA 3BHMA 3PEUA 3QW2A 2GD1O 4IEIA 3W6NA 5JQGA 2VK1A 2X9LA 2Y1DA 4YMWA 1ODTC 2EFYA 2F3PA 3THWA 3OPYA 5KU7A 4DLYA 1ONNA 2P35A 2X5KO 4LSGA 2DG2A 3QUQA 4QBFA 1I13A 3LPMA 4LBWA 1GKLA 2IXGA 1GZ6A 3K9NA 3L7DA 5ICFA 1U5BA 4TMFA 3QX3A 4FDUA 5IJAA 3RVKA 1FP7A 1M1NA 2DGDA 2HIMA 5EUMA 1N8KA 3C2QA 2R7KA 2XOXA 4G67A 4QPDA 5DGHA 4CLRB 1QPZA 1XQVA 2DFVA 4IXMA 1RZRA 5DE3A 3B3JA 2IUUA 1JIIA 3VFDA 2QD1A 4BTVA 2VSNA 4CM3A 1A7JA 3C3WA 4QBHA 2R84A 4Q7LA 4EG6A 3GC6A 3THSA 2MSNA 4I5EA 2YMPA 4EHBA 4OHBA 1VHTA 5IDYA 4HNTA 4WNIA 2BMEA 2G28A 5E1BA 4IHJA 5H59A 3TNFA 2H0QA 4J3JA 5TVGA 1ST3A 2NXNA 4WK0B 1QWSA 5BN3B 1BD4A 1T4CB 1MIOB 3A26A 3N76A 4KQXA 2C7QA 3G8CA 3G7SA 1NYLA 3HVKA 2PS3A 1UK8A 4A7PA 1Z2PX 2XGOA 1VB3A 1JWBB 1XVLA 3L4SO 1N7JA 1KA9H 4E07A 2FQQA 2IY8A 5JEDA 1E2KA 1JYFA 5EFZA 4URUR 3FNHA 1P4RA 1GTVA 3EMKA 4JVOA 3U5ZB 2QN8A 1WR8A 4LDZA 1P2BA 4MA4A 1E1MA 2PN1A 2WWXA 4GUDA 3FTFA 4QM6A 4IFBA 3SNHA 1O9BA 4Q7JB 4DLXA 1J8VA 3FRJA 1CVIA 3N0WA 3P4UA 3QM1A 2G76A 4RK7A 1DHTA 1QE0A 3BF7A 3LCCA 3LVBA 1JXQA 4LOKA 2UZ0A 1P6UA 5ADWA 1FNDA 2P90A 4H6VA 3S3TA 1WXQA 5J4YA 2F1HA 4FCTA 1BDJA 2VPZA 2G5TA 1T2NA 1WZIA 5E2IA 3O6VA 1A5SB 4L78A 1ILWA 1ZH4A 3DLIA 3REGA 2XUHA 1WZ2A 3PFBA 1PZNA 3TRJA 3W2IA 2FSIA 5E1OA 1Z9BA 2BEWB 1IN5A 1UBHS 2CLSA 2FWPA 2R44A 3WK8A 5CT9A 1IN4A 1GVNB 1MOPA 2NU6B 1E3LA 1JDUA 1FDTA 3IDAA 1OKKD 3NT4A 4JAVC 5H8WA 4Z6KA 1CEQA 3GJ5A 3ONVA 3P9KA 4JYPA 2XT9A 2FPPA 4KVZA 3OJ0A 4Y0NA 3WGOA 4CUKA 1H2RS 1ORHA 4CMGA 1U80A 2RBEA 2P62A 3QLVA 4MUMA 3K9GA 5B58C 5IVHA 4JYAB 3MILA 2Z8ZA 1HYEA 3ED5A 2M6KA 2WHYA 2GVZC 1GP2A 2GUGA 4KSCA 1CUJA 1HC7A 1YI8A 4B0PA 1UBKS 5LZ2A 3TF5A 10MHA 5HX7A 2JDID 5IEJA 3T15A 1S8OA 1LJ8A 3G8YA 2C3PA 1YZKA 2YWGA 5ELXA 4L75A 2GLUA 2X8AA 3MF4A 2GPAA 4NYJQ 4OXKA 4DC0A 1CUDA 4G0QA 1UFRA 5K3OA 4JYBA 2AKEA 5BN4B 1FDVA 4HAZA 1XNJA 4ND2A 3ZJUA 4BNNA 1XELA 1ZM3A 1KVUA 2E49A 2IT1A 4MVJE 3VYUB 4BQPA 2ZCUA 3I76A 4HVAA 5K7SA 3ECSA 4HS4A 3U4QA 3KDSE 5DYTA 1T0BA 4IBOA 4QOSA 1IN1A 5KC8A 2GASA 4OM7A 2AX4A 1OYVA 4Y1RA 4BMPB 4FHGA 1K89A 2QQ0A 2VRCA 1DUIA 3G1TA 3CG0A 3TQRA 4W8GA 2ISSD 4OHMA 3RGWS 1YZLA 4DKXA 1UR5A 2WAXA 3QOFA 4EO9A 3IEIA 4X3OA 4YYEA 2CCJA 1PQWA 1XVTA 5DCLA 4FQ8A 4LJ4A 2QB5A 3KVNA 4OLHA 2C9DA 4WXPA 3WLEA 3CXRA 4BGUA 4JP5A 2VG8A 1D5WA 3R8XA 4UXHA 5ALZA 3CE6A 3JALB 2GZRA 1NVTA 2VTVA 2J4FA 4GWLA 2G4VA 4GR4A 3ZQJA 1P7ZA 4JJKA 3Q15C 4Q0MA 1FXWF 3FWNA 1SHLA 2YYSA 3PNSA 2AEEA 3QEOA 1ZSNA 2H3HA 2JRLA 3PR3A 3VGPA 3T0FA 1J5EB 1JT9A 3DOIA 3GXOA 4K3UA 5DX8A 4UU8A 4CTMA 4XSGA 1RZRD 1T9GS 4ALIA 2Y05A 1E2MA 1ESZA 5BSHA 4F6RB 3MMZA 5E6SB 1VG0B 4DRXB 3FF4A 5AKYA 5LJIA 5B5SA 1PVOA 4DLUA 4L28A 1U2EA 1QMGA 2WJHA 3PKIA 4HX9A 1NW7A 3RT7A 5JXHA 1NXQA 3U7IA 2O9JA 1MN6A 4XGNA 1G2QA 1C0PA 4X8OA 3IESA 4YUAA 2V7XA 3RVSA 3OFVA 2YBEA 2PA0A 3FRIA 1G291 3SE0A 5GGXA 3U7EB 3W06A 1WEKA 1XK7A 1XMJA 5THKA 4C08A 4YC7A 4HXYA 3HBJA 1QKJA 3FPJA 1JG2A 3PC6A 2V5VA 2X8LA 3KLPX 1DBVO 3PNBA 4PZCA 2ZVJA 1XZAA 3V7FA 3D8RA 3BBPA 4OBEA