3BH7A

Crystal structure of the rp2-arl3 complex bound to gdp-alf4
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
161
structure length
161
Chain Sequence
EVRILLLGLDNAGKTTLLKQLASEDISHITPTQGFNIKSVQSQGFKLNVWDIGGQRKIRPYWRSYFENTDILIYVIDSADRKRFEETGQELTELLEEEKLSCVPVLIFANKQDLLTAAPASEIAEGLNLHTIRDRVWQIQSCSALTGEGVQDGMNWVCKNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribosylation factor-like protein 3
publication title The retinitis pigmentosa 2 gene product is a GTPase-activating protein for Arf-like 3
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 53
structure length 161
sequence length 161
ec nomenclature
pdb deposition date 2007-11-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3bh7A00
5E7IA 1ESMA 2N42A 2EWWA 4JVSB 5C2JB 4IFEA 4JL6A 2C9CA 4A0FA 4MYTA 3P27A 3THYA 3KTAB 2OG2A 3Q5DA 5CK4A 2HF9A 1XD2B 3KB1A 1II0A 1NP6A 2BBWA 3QENA 1OW3B 4LYHA 1GL6A 3ZD6A 3B78A 3GLFB 3VKGA 4RZXA 4ZV4A 3AVUA 1VG0B 1E32A 1KHTA 2HXSA 4B3GA 1HT2E 2IWHA 4CGZA 2CCGA 4Q1EA 5FTLA 3I8SA 2O8BB 2OLKA 1KDRA 1N6KA 3U60B 4D4LA 2AFHE 4S35A 3QEOA 3KX2A 3HYTA 5KSOA 2CMKA 2J0UB 3MCAA 3P1JA 4B3XA 1ZC3A 3C8UA 4TMWA 3RS0A 2KBFA 4BEBA 1S1MA 3ICQB 4O2LA 1K8RA 5CITA 3AV0B 2FPMA 1IY1A 4PC7A 1EFRD 4M9ZA 1Z22A 2Q6TA 4DZZA 2ZI7A 4TMXA 4C2UA 1WP9A 5HKKA 1Z07A 3RDPA 3VR1A 4AK9A 4LV6A 1X8LA 3GJ6A 1M6NA 3B60A 3LO5A 2EFGA 3IDQA 1JPJA 1W2HA 2CLDX 1OXUA 4MYHA 1MRSA 4TMTA 4JMPA 1NI3A 2ZI5A 3EIQA 1E0AA 2O0JA 1G20E 2NO9A 3L82B 4CEHB 1OHHD 4DB2A 2RGEA 2P6UA 1SXJD 1R4AA 3FFAA 2W2XA 1N6LA 3MJRA 1RRPA 1G3RA 3EWSA 1ZNYA 1ZMXA 2C9OA 1AGRA 1IHUA 5EE5B 2V4ZA 2G83A 1E2QA 4GT1A 3CONA 1S96A 2ZRBA 1NSFA 1OYWA 4TWZA 1AKEA 5FBRB 4QGFA 3UKDA 3LVRE 2Z83A 3EZ2A 2ZUBA 2R6FA 1D2EA 5FUWA 1KI4A 2DWOA 3OF5A 3B82A 3LLUA 4QC2A 4KJZA 3MWJA 1BKDR 2REBA 1BYUA 1N0WA 1PUIA 4J0QA 4R2HA 4JSYA 3QG5A 4BFXA 4O2RA 3ICEA 3AF0A 2ZSEA 3JZMA 2BHRA 2QN6A 2P5TB 1NN5A 1GM5A 4HAWA 4XOIA 3QE0A 2JJ1D 4M2LA 3PUVA 1NLZA 3FWYA 5HCIA 4LZZA 5EZ5A 1QG4A 3R7WB 1E2NA 2AHOA 1OXVA 2OESA 2VO1A 1KYIA 1W4CA 3QJYA 2ONJA 3K09C 4PHGA 4C0HA 3CLVA 3PQCA 4FMBB 4Q18A 4DBLC 4EFMA 1SQ5A 3QXCA 1P2VA 1W36D 1JBKA 1UBFA 3MWKA 3OAAD 2ZI4A 4KV9A 5CJ2A 2YINC 5AJXA 3REFA 1F48A 1FL9A 3K53A 1KO5A 1TF5A 4TTQA 4W5HA 1SULA 1P7CA 2FU5C 2WSSD 1TF2A 2VP6A 5DYGA 1AGPA 3MMPA 3BE4A 3IIJA 1RYHA 1WXQA 3R9IA 3LW7A 1VCMA 4HB3A 1XEXB 2DPXA 2BCGY 1JAHA 1KO7A 5KSPA 4X8MA 1XXHB 1ZM7A 2A3RA 1LFDB 3AP2A 3AVPA 1Z0JA 3KUCA 4WZBE 3VX3A 2ZRGA 1LTQA 1IY2A 2ZE8A 5EZ6B 1Z0FA 4HYYA 1XTJA 1A4RA 2WV9A 1R0XA 3ZZTA 1M74A 1QZXA 2ATXA 3RRMA 3KQUA 4ACAA 4ON9A 4B2PA 5B30A 2IUSA 4JYCA 5DHFA 4M1OA 2ZRPA 2ZYVX 4D2IA 1FQJA 1G7CA 2WZQA 5IHPA 2CE2X 1OH6A 3QBVA 1K5DA 4OI2A 4V0ME 3L43A 4LV8B 1GP2A 5F3WB 2GRJA 2QM8A 1UDXA 3EZ9A 4HLCA 4IVQA 1Q1QA 1MT0A 3FHOA 3GD7A 3IHLA 3K8YA 1OFTA 1QHHA 2O8DA 4NCNA 2BJWA 2QAGB 3AF3A 1KI8A 3U5ZB 2J0QA 4TYYA 3WYGA 4BZXA 1ZU5A 4KSCA 4NYJR 5AJZA 3K70C 2UZ3A 2QI9C 4EFLA 3PCRB 1N6PA 1R0WA 2ZU6A 1T5LA 3P20A 1E2GA 5KSZA 2EQBA 4Q4HB 3RS5A 2ZJ5A 2GCPA 3A36A 2LCFA 1X8KA 1CS4C 1T0JB 1XBTA 2C98A 2BMFA 2H7VA 3GLFA 4GP7A 4OQMA 4EPTA 1RE0A 1XB2A 3V9PA 5FPTA 3K0FB 4Q9LA 4LC1A 3U4QB 5FTMA 2WWGA 1NY5A 4LBVA 2J41A 4TT3D 4QJ5A 4B47A 2RGNC 4GDFA 2P6RA 2WKPA 5GVSA 3Q9LA 4NYMR 4Z1MD 1HQYE 2REOA 1A7JA 4WXRA 2V54A 2ODNA 2J0UA 4G5GA 1SVSA 2R65A 4HB4A 2Q3MA 4AKGA 1OB5A 4LJYA 2XTMA 1OPXA 3ZVLA 1SHKA 2D3WA 2EFDB 1XJCA 1I4TD 3X1WA 1CR0A 1II9A 1BIFA 3A1VA 3ZYCA 2GAAA 1J7KA 2OAP1 5FBQB 1NY6A 1SZPA 2GBLC 4PC6A 2ZJ8A 3AKYA 1T3HA 2J1LA 2CK3D 2ZSDA 1GKYA 1S3SA 1S1CA 4DCVA 1GWNA 4QNMA 1N6IA 2QPAA 3BBPA 4US2R 4I4LA 4Q00A 3FDIA 3I32A 2PX3A 2W6JD 4HSEA 1UKEA 1KZGB 2QT0A 2GCNA 3CM0A 1ZU4A 3VHXA 1OIVA 2QU8A 5DGXA 4B71A 4CEIB 3CF2A 1UADA 3NHBA 4GI7A 1SVWA 4HLUC 4QBIA 1CU1A 4B2IA 3K9GA 4CEHA 1T3LA 5A5GA 4TQAA 2FPLA 4HUQA 4GNKA 4Q7KA 3CH4B 2W0MA 1MV5A 3PEWA 1A1VA 1G64A 2BIFA 4Q48A 2IS6A 4A9AA 5KNDA 2ZJBA 4HDCA 4F38A 1KGDA 4O0MA 2GJKA 1U99A 1ZNZA 2C03A 2R6DA 4Z8YA 4DSOA 2RH5A 4N1AA 5EJEA 2YWFA 1G3QA 4RD6A 2QGNA 3ZJYA 5F98A 2MSCB 5KDDA 4CRWB 2RAPA 3DHWC 2IXFA 5AUOB 2XX3A 3X1ZA 2XZPA 3DZ8A 4LI0A 1KK1A 1NLFA 2GF9A 4DUGA 5J47A 2BM0A 2IC5A 3VX4A 2RGBA 4D0GA 1NBMD 2O8CB 4G5SA 1E79D 2J7KA 4QBFA 2VF7A 3SYLA 4ESHA 4A8JA 4XTCS 5J4HA 3SQXA 1FTNA 1W0JA 2GJ8A 1FUKA 2WKQA 3H4MA 2PEYA 3TAUA 3QPVA 2WICA 5CLLA 4KBGA 2HLDD 4W7SA 3Q3JB 4D0NA 1F60A 2CCJA 1R10A 4TQUS 3MJHA 4ILEA 4UXJA 4QKQA 3GLHA 3A1WA 2OBLA 4PHTA 1XTSA 1G16A 1ZAKA 1HQCA 3R7WA 2P0EA 3AKDA 3B1ZA 2ZITA 3K09A 3GJ8A 4FD2A 3WRYC 4PAOA 4UNRA 4AYTA 4DXAA 4IDOA 1AKYA 1ZRHA 5JEEA 4LGMA 4FI3C 2JIZD 3ZS8A 5IRCD 1QHIA 1DAKA 4PHHA 5DIFA 1S9DA 4MKGA 2VP0A 3QVVA 1OH5A 3B1WA 2RHMA 3BOSA 2YC2C 2XB4A 1HTWA 5JBQA 3B6EA 1JALA 1XEXA 1E9CA 3T1TA 2HJGA 3UWOA 4BE7B 4UQOA 2ECKA 2FN4A 2VEDA 4MUAA 5G3YA 3AF4A 1TQ4A 4M9QA 1XXHA 1T9HA 2O8FA 4XVQA 4DEYA 2CL0X 2WTUA 3O47A 5J4YA 4AYWA 1XPRA 1CR2A 2JLSA 4NCKA 4XSGA 3TK1A 2CXXA 2OFXA 5JECA 2GVDC 2V8OA 4QGGA 5AUQA 1IAQA 1M7GA 2HT6A 1U8ZA 2X77A 3WP0A 3PR1A 3F8TA 2JLWA 1KI1A 3CRRA 1E2EA 2CDNA 3U7FB 5B58C 3V4RA 3O8BA 2IBMA 3FVQA 4RZ2A 2XAUA 5BN4A 2F1IA 2QAGA 3LRPA 2C8VA 1X6VA 1QG2A 3LNCA 5FTJA 4OK3A 4GOKA 4IKEA 1SVOA 2AXPA 1ZC4A 3O8DA 4LJ8A 3PV0A 4G5QA 3ADDA 5FL7A 1D9ZA 4LV5B 4R71A 4JVNA 2IYXA 1R6BX 4Q4HA 4A0GA 3IBYA 2RGAA 1I2MA 1XTQA 5FPYA 3PJRA 3RS7A 2V7QA 5EP1A 1Z2CA 3OEHA 2GJAA 3OESA 5H8WA 4CEJA 4ESVA 1VECA 2GWHA 4GP6A 2IUUA 3BH0A 2C5LA 2AD1A 3UANA 5KYKA 3U4QA 2VPPA 4LHVA 1QHNA 2FSHA 4NCIA 4GFDA 1E6CA 1OE0A 5E95A 1OT3A 3AVXA 4EPYA 3V4FA 5JJLA 4ZDKA 3W3ZB 1FZQA 1KK2A 3ONWA 3NVAA 3THXA 1M8PA 3H84A 5FI0B 2P67A 5JWOA 2I4IA 5CB6A 2GTPA 3U7GA 3C5HA 5JJIA 1X1RA 2XJ9A 1N6NA 2EFCB 5FPSA 1NSTA 2L0XA 3WNDA 2IYYA 2XNDA 1TPZA 2ZANA 1WB9A 4AC9A 1W49A 5JWHA 1CJUC 1NN1A 4DUGD 1ZD9A 4Z54A 3OIWA 2FJUA 4ZKDA 2X8AA 4URYR 2JJ2A 3RABA 1ZUHA 4QGAA 2BM1A 3I1FA 1WCV1 1XEWY 1VCOA 2WSMA 1KO4A 1MKYA 1PUJA 1UAAA 2AXNA 4CEIA 3TUZC 1JEDA 2F6RA 3GLGE 1NNEA 5AJYA 4YXWD 3VR3A 1WRBA 2GXQA 2WHXA 5KU1A 2YYZA 4QG7A 3TMKA 2BKEA 1L4YA 1Y63A 2ORIA 3QQ5A 5EXXA 2FSGA 3WP1B 3B1XA 2IT1A 3DVLA 2VHJA 2Z4RA 1DOAA 3AUXA 4NDZA 3I92A 2LKDA 2ERXA 4Z8XA 1KI6A 5BN3A 3U3KA 2UKDA 4GOJA 3CZPA 1S9HA 3IQXA 1EFUA 2IYVA 1J99A 4V0LA 2V6JA 4EPXA 2BCJQ 2O8CA 2EYQA 5FOXA 3EX7C 2TMKA 4PSKA 2OCAA 3RSLA 5EXSA 2OILA 3BORA 1JR3D 1NMXA 2VP5A 1YE8A 1XJQA 3KKMA 3L8YA 2GNOA 5DSZA 4A6XA 3ZVNA 3THYB 4DLRA 3DEFA 1T5IA 4LSGA 1ZCBA 4NE2A 4AYXA 1E4VA 2BVNA 3TE6A 1G3MA 3SQWA 4P4UA 3AUYA 4MGZR 2D7CA 2B92A 3CRVA 2HUPA 2ZJZA 2B21A 5C18A 2ZS7A 4OJQA 1CEEA 2G0NA 3CWQA 3VKWA 3LV8A 3HP1A 3UMRA 4XVRA 4I81A 4DDVA 1ZINA 4DCNA 2DWPA 3A4MA 5HTKA 1QDEA 2ZI9A 1CTQA 5DO9A 2ZRNA 3BFXA 5EP2A 2XITA 4C0AC 5AUPB 1UPTA 1UDWA 2WOJA 3DMDA 4X8OA 4A92A 1Z3IX 1E2DA 2NO6A 4RSGA 4ZKEA 1DO0A 2ANBA 1M2OB 3Q7QA 2BWJA 1G7TA 1YZQA 1KJZA 3GJ7A 4CZ2A 4DCSA 3U6BA 1A5TA 2IEYA 2ORWA 3C4JA 4JT4A 1FTSA 5CDFE 2YKGA 2BV3A 2QBYB 2HF8A 3ZZUA 3DZDA 1DG1G 1E9BA 2JLQA 3P32A 3W6OA 4ARZA 1BMFD 2DY1A 5JWRA 3CNLA 4GMXA 4ZDIA 2ZYTX 3HU2A 4FWIB 1EWQA 5ELXA 3D7MA 4DCTA 4U02A 4YMUA 5FOUA 1V5WA 5E4FA 1EFCA 1MO3A 2F1HA 1LY1A 1Q57A 4FCTA 3NBXX 1E3MA 2WWIA 3VKHA 5GVRA 4IEIA 1L2TA 4KBFA 1L7VC 1EFRA 1KJYA 3NH9A 2PJZA 1GFIA 4A4DA 2GJ9A 4JZKA 2GVZC 4V0MA 4LBWA 2H17A 1OFUX 1P2SA 4HAYA 4MITA 2AWOA 2E9SA 3EXAA 3LBHA 5A4JA 3D6TB 2R44A 4I1VA 2ERYA 2QG6A 1JXOA 3PVSA 2FV8A 2P65A 2QAJA 2WAXA 1P5ZB 3ETLA 3QNUA 2D4HA 2WJGA 3W6PA 1E2JA 4ZCMA 1GRRA 1YRAA 4LHWA 4WBSA 3RRZA 4GL2A 4WAUA 3VR4A 1KK3A 4I1OA 3K9LA 4PHFA 5KDLA 4PPGA 1SXJA 1ZNXA 3D8BA 2OBMA 2EWVA 3RVBA 1OB2A 3LY5A 3OEED 4DRZA 4ZPXA 1DPFA 1E2FA 1P2UA 1UBEA 3J81k 1GILA 4JVLA 3RS3A 4P31A 3IIMA 2DHRA 3B1VA 2YC4C 5TMPA 3A58B 4YC7A 2DFLA 4EDHA 4MDFA 1E2KA 2DBYA 4JJZA 1G8YA 4LHXA 4JLAA 2ZSAA 4MRRA 5KSYA 3SNHA 1LNZA 4MH0R 1W5SA 1GRQA 1ZIPA 3QPUA 3VR6A 1XEWX 1JEEA 1S4QA 2C04A 1Z06A 1ZCAA 2QP4A 4PC3A 1XFAA 3SZRA 3THOA 3ZQ6A 1N2CE 1LF5A 1US8B 5LDDC 1NMZA 1GTVA 4ZIRA 5JJKA 5IK2D 3QVUA 2J0SA 1YHNA 1Z08A 1W0KD 2BBOA 2ZEJA 1II8A 4U5XA 1NJGA 4Q4LA 4FMCF 2GAOA 4NPHA 2JJ1A 1Z5ZA 2F3RA 1YKSA 4K81B 1TTTA 3L2OB 2ORVA 4UJ5A 1NG9A 1JR6A 2ZRLA 4HB0A 2PZGA 3SN6A 3T5DA 1Z6GA 2NIPA 4I1SA 3QF4A 1G6HA 1PLKA 3QG1A 3OAAA 2XEXA 5HPYB 5JRJA 4URUR 4AWXA 1QHHB 4B48A 3TR0A 3SR0A 1OXTA 3BH7A 4UXHA 1Z6AA 1IN5A 5DN6D 1ELOA 1SVIA 1TEXA 2WSSA 1MOZA 2FWRA 2ZRFA 2J46A 2Q9BA 2ZXUA 2WJVA 5FI1B 1GOTA 4KFTA 3IPXA 5TV2A 3KJIA 2XZOA 1CJMA 1P60A 2OO7A 2IK8A 1NF3A 3IILA 4GSYA 1G8FA 1UKZA 2BMDA 4IDQA 2C95A 2ZE5A 1I2DA 4TL6A 3U2QA 3ASYA 3ZIAD 2QUZA 1NVVR 4L8GA 1AA9A 4LPSA 1IY0A 1ETUA 1KI7A 1W44A 1YU9A 3MD0A 5KTYA 3ZD7A 4RD0A 5JSZA 1XJ0A 2B8WA 1ZBDA 2ZM5A 4OI0A 4IEEA 3A1UA 1P73A 4X8HA 2QRNA 2XOKD 2OCYC 2ZR9A 3QXHA 4JIMA 1SKYB 4PO1A 1T0HB 2MSDB 1JECA 3EIEA 1NVUQ 3CNNA 4PTLA 3PEYA 4OHVA 4YONB 2QMHA 3DDCA 4W5JA 3T1VA 4TZ6A 3AGQA 4O3MA 2NMVA 5FBWB 4ZCLA 4MKHA 1TMKA 2OAQ1 2C2HA 3F0TA 1G19A 2C78A 1NL3A 4QBHA 1TL7C 2QSYA 1UF9A 2GK6A 2LKCA 3PUXA 4YMSA 4QM7A 5F9FA 2WM9B 1O87A 2KSQA 3FPAA 3W9YA 2MSEB 5AR1A 2NQ2C 5CIWA 2QPOA 4JLBA 4R7ZA 3KQKA 4QM6A 1J70A 5TY0A 1PJRA 3ZVRA 5CJPA 3CBQA 3VNUA 3W90A 2QBYA 4XVUA 1EX7A 1QBKC 2WBLC 4AKIA 1VYTA 1NVVQ 1ZUNB 4C30A 5UKDA 3AVQA 2QTFA 3QKRA 4PC1A 2I1QA 4HUQB 1GAJA 4LK2A 2PEZA 4NYIR 4TT3A 3T15A 1Q12A 3QSYA 4WA7A 5JI2E 4JLKA 4M1TA 2FFAA 4BLRA 4C0KA 3CX7A 4II7A 4Z1MA 5IDVA 3GFPA 5CIQA 3SFVA 5CK5A 2CHGA 3KUDA 3Q72A 4KYIB 5DISB 2VQSA 1IONA 1FNNA 2Z6VA 1KI3A 1CXZA 1UEIA 3D31A 3OIVA 4IDNA 3NDBB 4BQSA 1E2IA 3IO3A 3KKNA 4JLJA 4A82A 4Q9JA 5FOVA 3SU8A 3W34A 4BUJA 3L0IB 4Z51A 5FPKA 1Z0KA 2BKUA 1U2RA 1K5GA 2HYDA 1QHGA 3HR7A 4IVRA 4KYUA 3U3RA 2CK3A 3AM1A 3SC3A 2J5XA 5KDOA 3AVTA 3NIBA 4A8JC 1NKSA 3GFOA 1OV4A 3N5CA 4A8JB 4IRUB 3AKCA 4BRUA 2W6JA 1RC8A 4JLPA 1W47A 2EFHB 2A2ZA 3RLFA 2YV5A 3TRFA 2AWNA 2D7DA 4F4JA 5F9HA 4MRNA 2V9PA 5G3ZA 4B44A 3NDPA 3FMPB 3GLHB 1NIPA 4DHEA 3KJEA 3EC2A 3FMOB 5LBIA 3ZLJA 1Q20A 2VHTA 3IQWA 4NYIQ 2EW1A 1WE2A 2HCBA 4P32A 1D5CA 3QKSA 4DSTA 2VL7A 3EG5A 1IN8A 2IWRA 3UMSA 1OFIA 1XF9A 3BRWD 4TYWA 3MUFA 3AP1A 3JVUA 2JLXA 4XWOA 1W4AA 1JQJC 1R2QA 4HDOB 3RYTC 3EPKA 3C41J 3BB4A 4BFSA 1NBMA 1IN4A 1E79A 1US8A 4L5BA 4JBXA 4RD1A 3KL4A 1XMJA 4HUTA 1YR9A 1KSFX 1KI2A 2CVHA 4ASUA 2O8FB 3QXXA 3WYFA 4K46A 4KVAA 4LYJA 3CF6R 5LB4A 2HLDA 3KQHA 2CHVA 3NKVA 4Q03A 2BMEA 3GEEA 3GJ0A 3OE7D 3DKPA 3G5UA 1G3IA 2YOHA 4DWJA 4YMVA 3SEAA 2PT7A 3K0CA 2PCJA 4YMTA 2OHFA 2Q3HA 3PFIA 2VP4A 2G6BA 4EPWA 4URXR 5JHGB 3DMNA 4RJLA 1NMYA 2QAGC 3VR2A 3ZH9B 2JIZA 2PCLA 1GITA 3LBIA 4BWYA 2IYWA 1M1YE 4KU4A 4P33A 1Q22A 2XXAB 1SVKA 1F2TB 2FSFA 5FUYA 4DDUA 721PA 1Z0IA 3X1YA 3PIRA 1Q1BA 1D2MA 1DO2A 1ODFA 2W2TA 4DDTA 3OHMA 3GCGA 4K8OA 5G40A 1YRBA 5HR5A 1FW6A 1QHSA 3UMFA 3DL0A 1IJFA 5BN5A 2QTVB 2QNRA 1IXZA 2WJJA 4CT4B 1OJLA 4LYAA 1P3JA 4CEJB 3VU9A 2CE7A 3ZS9A 1EXMA 1E2LA 3QEJA 5FR1A 1KIMA 1T8TA 2VRWA 4QHYA 1PV4A 1JAIA 1XZQA 2CJWA 4TMVA 5BYJA 3THXB 2JLUA 2A5GA 1E4YA 2IHYA 3HDTA 2W6ID 2IYQA 2W2VA 2P3SA 3EZFA 3LXXA 4DLSA 2PL3A 4AI6A 2FX3A 1M7HA 1Z2AA 4DLWA 3QI2A 1MH1A 2RGDA 3IIKA 2EU8A 3SJCA 1VCIA 2V55B 4M22A 1N3BA 3X2SA 2VHUA 2GEDA 4M9SA 4CT5A 2QSZA 4IW3B 4NYJQ 3M4YA 2OFWA 2DWQA 4OQFA 2UVQA 3TGPA 2AKYA 4OHXA 5KPJA 1Z28A 1NVXQ 1E94E 2KI5A 3I73A 4OHYA 1H8HD 3MLEA 2A7QA 3SYNA 4E22A 3GEIA 3JVVA 4HLDA 2XTZA 3FOZA 4BLTA 2IYUA 2ZRDA 4KFUA 4Q02A 3CH5A 1UKVY 4KHZA 5H1YA 2ZR0A 2WWWA 3DO6A 2IF0A 421PA 2QMEA 4KLZA 4BASA 4WOPA 3DOEA 1FUUA 2IXGA 4JYBA 1YJ5A 4TTPA 5J4VA 4OHWA 2JA1A 5D3QA 4D4JA 1GIAA 1W46A 2BC9A 4NYMQ 4RFSB 2IL1A 1VIYA 2OUKA 3KZ1E 1AN0A 1KI6B 1NG1A 2WJYA 2XSZD 3ZDQA 1Q0UA 1Z6TA 3T1OA 3T1QA 4KFSA 4V02A 3C5CA 4BRWA 2PT5A 4ABYA 1C1YA 4OKSA 5KNCA 3U44A 4Q9IA 5J40A 4ASUD 1Z6YA 1CJKC 1RVDA 2BDTA 4GZMA 4P4SA 5FBVB 2FGKA 1EGAA 1MO5A 2ODBA 3CW2A 4YXWA 2ZRAA 4EIWA 4TYPA 5FUVA 3HR8A 2ZETA 2V6IA 2ZAMA 2ATVA 3WMGA 5EP4A 2YOGA 1BOFA 2ZREA 4RZUA 1I4LD 3D3QA 4KXFB 2GXAA 2W58A 1Y3AA 3TLXA 3PUZA 5CYPA 5DYIA 1J8MF 1SGWA 1E0SA 4KAXA 4ZI3A 4I99A 1E2HA 4M4SA 5K8TA 1JXMA 1VG1A 2ZVPX 2VYFA 3CB4A 4V0NA 1U9IC 2OCPA 3VMFA 5LPNA 3EPHA 2FOLA 1QF9A 3C7KA 4OJKA 5E3HA 1VPLA 2VP2A 2HDNB 1DBSA 1G7SA 2WMNB 2PLFA 4ITRC 1KDTA 1X3SA 4Q66C 4BPBA 1G18A 3BS4A 2VH5R 3K0AA 1EFHA 1DVRA 2EYUA 1JR3A 1XZPA 2Q9CA 5HE8A 4RCYA 2QT1A 1XTKA 4MYUA 2HCJB 3TQFA 4BGDA 5TXGA 1Q1EA 1S3GA 1GKIA 2NPIA 3P4YA 521PA 3TJZA 4TLBA 3X1DA 5CM8B 1OH7A 1TQ2A 2PMKA 4ARZB 1KDPA 2W0SA 2ZUCA 3KJGA 4MDEA 3P4XA 1AZSC 2O5VA 4PO8A 4EFNA 1IQPA 4MA4A 5D3MB 2WKRA 2J59A 2OM2A 2A5FA 4G01B 2ZAOA 3LXRA 4TLCA 4D4KA 3BH6A 4DIEA 1KSJA 2DB3A 3T5GA 2BBSA 2CHQA 2CVFA 2XXAA 4EQ6B 1F2TA 4UXIA 4RKEA 5FR2A 5FPHA 3VHLB 2CL6X 3T61A 4WXPA 4A2QA 1KAOA 1HY3A 4TSFD 4QXAA 4L4UA 2OXCA 2BMJA 3PXGA 3RRNA 4LHZA 5E7MA 1LB1B 1X86B 2HEIA 3EAQA 3SHWA 4BZQA 5CM9C 2K5UA 5FOTA 5L8VA 4AKHA 3FB4A 4DIDA 3IGFA 4KLNA 2OXRA 2GZDA 4G5RA 1VMAA 1KI9A 1BMFA 3NHAA 2NZ8A 3LQQA 4F91B 3FTQA 4CF7A 1SXJC 5JI3E 3SE0A 1SXJB 1R7RA 2X1VA 1DELA 4BLOA 2JGNA 2IYSA 4X8LA 5L3VA 2N46A 4TL7A 4IFBA 4JLNA 3EPJA 4XWKA 1RYFA 2H1LA 3UIEA 1E9DA 2GILA 3RHFA 4BLSA 2H8KA 1T4GA 4V03A 4OYHA 4C4PA 2QENA 2WAYA 3A6PC 4FMCB 1G5TA 3I5XA 2O52A 5G53C 2CLSA 4IOLA 3OIUA 2NO1A 4TMKA 3ECCA 1GZSA 3SI7A 4LYFA 4R2IA 1NN0A 3RWOA 2FFQA 4ZIRB 3ADKA 1G291 4JSTA 4M1SA 5HZKA 3E70C 1CKEA 1DS6A 2GEUA 2VSFA 3SYKA 3VTKA 1II8B 4UKDA 4QJ3A 1S8FA 4WW0A 1KO8A 1OIXA 4Y0VA 4A0HA 1IN6A 4KFRA 4M53A 1DE0A 1YR6A 4B73A 3WNCA 5FUXA 3NXSA 3VR5A 2H18A 2Y8EA 3OEEA 5K8UA 4LBZA 4OK6A 1W36C 3QF4B 4FW9A 1W36B 4RFVA 3C15C 1E9SA 2OT3B 1U98A 2B8TA 3T34A 4BFTA 4FIDA 3AP3A 3T35A 4TLEA 4RKFA 4JS0A 1CR1A 4MUBA 4RFSA 1FPMA 3Q5EA 3TQCA 3EARA 2CCKA 4EJSA 1U94A 2WVJA 3LX5A 3GLIE 4R9UC 2C9YA 1UEJA 1L8QA 1CP2A 1R5BA 2V3CC 2PMDA 3QY0A 1XTRA 3RS4A 2ODWA 1AM4D 3KKQA 2ZYWX 4L9SA 1KY3A 3IPYA 1Q1ZA 4LJ5A 4V0KA 5IK2A 1DEKA 1J8YF 2PLRA 4M1WA 3A4NA 2VLIA 2ONKA 4C2TA 1VG8A 4URWR 1Q3HA 1W0KA 2F55A 1IXRC 1JJVA 1FX0A 3PENA 5JSZB 1EESA 1AS0A 3GLFE 621PA 4B32A 1RJ9B 1KO1A 2XB2A 4OHZA 2GZAA 3I4LA 1ONBA 2JEOA 2NO7A 4PPQA 4E07A 1WBBA 3Q7PA 1HE1C 1XPUA 1UFQA 2JLVA 3U7HB 4Q1CA 3N2IA 1AZTA 1M34E 2QM7A 2YJTD 3GEHA 5LD2C 4BFYA 5LD2B 1CIPA 5DN6A 2RGXA 1F6BA 1U9IA 1W1WA 5KOYA 1I4DD 2UZIR 4MRSA 4PAMA 1TNDA 3IEUA 4TQ9A 4LHYA 4A36A 5FBLB 2ZJYA 3NEJA 3KDSE 1KKMA 3TSZA 2G1KA 1H8EA 1A2BA 2QQEA 4Q1FA 2GXSA 2ZRMA 2YWGA 4UNNA 4W9MC 1Z83A 1E1QD 2QMOA 4JBWA 4Q4AA 4CW7A 1NRJB 3FKQA 1E9RA 3ZIAA 2VHQA 1S2MA 4HAXA 3L8ZA 4RD2A 2IYLD 2E1RA 2ZQ5A 4QHSA 3WBKA 2XOKA 4TN1A 5ANRB 3QKRB 1P72A 2JLZA 3K70D 5DE3A 3CO5A 5D3MA 1AJEA 4MRVA 4NP6A 1YZLA 4LX0A 1G41A 4NCHA 2HV8A 3AVYA 2F3TA 4RD3A 4HI0E 3PEVA 5JCPA 4N0DA 4LDJA 4MGIR 3FGNA 3NH6A 4EQ6A 5C4GB 3LWNA 5L3QA 2IUTA 2Q3FA 2R8RA 1O3YA 2F9MA 1EWRA 3E1SA 4QOSA 2BBTA 2JCSA 3CRW1 1E1RD 4Q7MB 3SJZA 1Z0DA 2V1XA 3QXJA 5KNBA 2O0HA 1DTSA 3DKVA 1Z8FA 2AK3A 2HT1A 2P2LA 1UKYA 1CF4A 3N70A 1D9XA 1KZ7B 5KUTA 3AQ4A 4Q4JB 4URZR 4TL8A 2CL7X 3ZQJA 4C0SA 3C14C 1TQDA 1VG9B 4UNSA 2VSOA 1OH8A 1VIAA 2IX3A 3ADCA 4ZDJA 2YWHA 3GJ5A 1E69A 3DM9B 3QBTA 4RVCA 2WWFA 1KOFA 1A2KC 2OV2A 2FFHA 3TSWA 3UG7A 4DKXA 2XGJA 2ZJOA 2D62A 2J7PA 2G0TA 4RZ3A 3QKSB 3UATA 2XJ4A 2C77A 1IXSB 5BXQC 1G9XA 3EPLA 3OZXA 3QKTA 1TUEA 1VDZA 3M1IA 2BOVA 5DI3A 1ZD1A 2VF8A 4DVGA 2MMCA 3RANA 4IJMA 1KSHA 4TLDA 4XIGS 1HH4A 4C0JA 1MO4A 2EFEB 4DSUA 4Q1BA 4U7DA 3CZQA 1X8JA 4G5OA 1COWD 121PA 3L0OA 4ZO4A 1MRNA 1N0VC 3FYHA 1F3OA 1MO6A 3CX6A 1K6MA 1M7BA 1N6HA 4E5UA 1Z6XA 1ZM4A 3B9PA 4HAZA 2NTYC 1XXHE 4A1FA 3O8RA 2VP9A 3WHKA 3O8CA 4IOJA 4BEJA 1CRPA 1EFTA 2F43B 2RCNA 1OKKD 2ZU0C 4LBYA 4POAA 2B7BA 2IEZA 5FH9A 1OF1A 3G0HA 1AQYA 2H5EA 2P6NA 1JQLB 3PEUA 3CPHA 3SHFA 4ZCIA 2XTNA 4PSVA 5LB2A 2ZI3A 3BFKA 3K0CC 2REXB 1ZUIA 1XMSA 4DJTA 1OYYA 3SS8A 1E99A 2QE7A 3W8NA 4XJXA 3RAPR 2Q0HA 2R6GA 4HATA 1U0HC 5SZIA 5KO2A 1TAGA 3FHTA 2WPDD 1MABA 3THWB 5AWFC 4DLVA 4BFZA 4Q7JB 5GJWC 1H8ED 3TR5A 5HCNA 1G5PA 3V00A 4D82A 2RB4A 1OSNA 1F2UA 4DEXA 3RWMB 3K9NA 2RGGA 1UJ2A 4CIDA 2ZS9A 2GCOA 4MYCA 2WMOB 2B6HA 4OQNA 4M1MA 2YZ2A 3VQTA 3OE7A 2O8EA 4WVFA 5DH9A 3VU9B 1CJVC 1VHTA 3BJIC 5EE9A 1RJ9A 1XD9A 2I1VB 3NBZC 2ZRJA 4LOAA 2NG1A 3BFVA 2C96A 1GVNB 4F4IA 4AKEA 1LV7A 4P3YA 5C4MA 4BZPA 1ZM9A 2Z5FA 1WF3A 2GK7A 2CNWD 5CB8A 5GJBA 2CJWB 5C1BA 1PLLA 4B33A 4C7OA 3ASZA 3FKSD 1P9NA 2PH1A 1Q44A 3LH5A 4XD7A 3I8XA 3KQNA 4B76A 1TU4A 2IW3A 1Z63A 2FPKA 3W3AA 3AGPA 4DSNA 3K0SA 2YHSA 1P61B 1VYUA 1JJ7A 4D80A 4BFUA 3TAHA 3U3OA 4DCUA 2J9RA 4LY6A 1FP7A 2R2AA 1P6XA 4W5WA 5FTNA 4MRPA 2KBEA 3A1TA 3CNOA 3G82C 3Q85A 3GFTA 5KPDA 4NH0A 4WIAA 2OSBA 2AL7A 3T06B 4LJ4A 5EE1A 5JMTA 1H65A 3LAWA 3LQRA 3B8HA 2GA8A 3K0EA 3WRXC 3SJBA 3I3SR 4MGYR 3GP8A 3GJXC 4Q7LA 2NPFA 3GMTA 3HPRA 4H1UA 2JJ8A 1YQTA 1FFHA 4F93B 4QJ4A 3H1TA 1ZM3A 2A5YB 1ANKA 2ZTSA 3R9XA 1LVGA 3EWAA 2SHKA 4AY2A 3SBEA 2J7PD 1G8GA 1PZNA 1UBGA 1ZM2A 2ASEA 2W6IA 4B2LA 1T8UA 3CF0A 1VTKA 1XDBA 3AF2A 4FN5A 4HAVA 2IS4A 1CJTC 2O0KA 3U7EB 2F9LA 3PUYA 1VCNA 1EG7A 1Z47A 2KE5A 4AURA 4B6EA 1X1SA 2OFOA 3EW9A 4XWAA 1FOEB 2PBRA 1G4UR 3U44B 1DG3A 4HDQB 5BYKA 3AVWA 4D26A 1E0KA 4P4SB 1H8HA 1KY2A 4Q4JA 2HYIC 3BK7A 2WJHA 1RRFA 3CPJB 4QBGB 4WZ6A 2WIAA 4DT1A 1U8YA 1ZP6A 2OEPA 1CR4A 3MSXA 1KMHA 4IXNA 4N3NA 4Q5IA 1U81A 3TNFA 4RCZA 1GKUB 3LD9A 4C9BA 2IHBA 4LJAA 4DLXA 1GL7A 3QUSA 3TH5A 1U8AA 5C46F 4FCVA 2DFKB 3CWZA 3H0KA 3WHLA 1FP6A 1FNMA 1TX4B 3BC1A 4M9XA 2D06A 2OBNA 2D2EA 2QE7D 1Q3TA 3FMIA 4Q1DA 5M04A 2ZR7A 2PJRA 3H86A 2WWHA 2ZPTX 3E5HA 4L15A 4XSHA 4LJ9A 2XSZA 2GDJA 3HJNA 2QY9A 1N25A 1NVWQ 2CLCX 4A6PA 3W5JA 3EASA 1YZKA 1YR8A 821PA 3MRSA 3NBYC 4BLQA 2I3BA 2R6CA 4BECA 1HT1E 4FMDB 1HEIA 4A15A 2V1UA 1ZW6A 3NTUA 1EK0A 3K0AB 4Q19A 3IUYA 1IN7A 1TADA 4GOXA 3MWYW 1KDOA 1R5NA 1T91A 4OQXA 2GKSA 1XTIA 1HURA 2F43A 3RC3A 5B57C 5EXPA 2VHCA 2J87A 2E87A 3NBFA 1LW7A 1AIPA 3TVTA 4TYQA 5DNYB 3HYRA 3KKPA 3LW8A 4S2EA 3TUJC 3KJHA 1F5NA 4A0RA 1N5IA 2OE2A 2N1BA 2QROA 2A30A 1HE8B 2JAQA 5H68A 4PQRA 1GNRA 1HYQA 3NC0C 4PQYA 2CEAA 4QNRA 1DAGA 3MAAC 4GRAA 1G17A 4PSAA 1KNQA 2Z4SA 3PG5A 2CBZA 3GLGA 3AF1A 3CPEA 4XD7D 2QTHA 4EPRA 5G41A 5K8LA 3BB3A 3THWA 4IDHA 4Q21A 4LPKA 2ODEA 5L3SA 1VHLA 3ND8A 4LJ6A 5JZVA 1DAMA 2D74A 2H16A 4JJKA 3U3JA 2AKAB 1T6NA 4KCGA 1YZTA 4YDSA 3H2YA 2ZE6A 5SZKB 4M0LA 1N0UA 1N6OA 1HA3A 1LS1A 4B35A 4HAUA 2DFNA 2GZHA 2H92A 1J90A 3AKEA 3GLIA 4B74A 2NO0A 1E98A 3RRYA 1KKLA 3WYAA 1NIJA 1FMJA 1N5JA 1DAIA 2QP9X 1NKTA 1KAGA 5HKKD 3K70B 5TB5A 1KNXA 1SXJE 5CLQA 4HB2A 1GNPA 2Q21A 3T12A 4OI4A 3EA5A 4B3FX 3KTAA 3CX8A 2OZEA 2NZJA 1PLJA 3CIOA 2VTKA 1JB1A 2ZSBA 1XD2A 2D2FA 1NN3A 2FNAA 4IOMA 5JS7A 1XMIA 2FEOA 3QPWA 3B13B 3HU1A 4AIIA 4G1UC 5AK0A 4WZAE 1KMQA 3ADBA 1E96A 1BO6A 4TSFA 2O8BA 4D6PA 4OQLA 2F1RA 4TTRA 1E2MA 4GBMA 3MG9A 4PZYA 1XCMA 2IYRA 4MKFA 2AK2A 2EVWX 4AD8A 4B34A 3BWDD 3S1AB 3I61A 1Z0AA 4UJ3A 3LVQE 1HUQA 3A8TA 4OK5A 5EP3A 2QORA 1AS2A 4B6FA 3L0PA 2ANCA 1NLYA 2BEJA 4DLTA 2IYTA 5EQTA 1ZVQA 1ZJ6A 3EC1A 3K9HA 1G1MA 2VIIA 4KI0A 5J4KA 1XP8A 2GETA 3LA6A 4TL9A 1OXXK 1RRCA 5CDFA 1P75A 4ZI2A 3BB1A 1QVRA 3KFXA 3KXIA 5E7JA 1QHXA 1R0ZA 2VSXA 2IS2A 5GJVC 4EJSC 4EJSB 3EZ6A 2RHDA 4Y0AA 4BFWA 4PXAA 4N0EA 5EUMA 3A4LA 3FMFA 1J2JA 1WDTA 2F1JA 3B5JA 1MR3F 3M0EA 4JBYA 3TW4A 5P21A 3B9QA 4E09A 3UK6A 1G3UA 1QHYA 2PZFA 4IDPA 2R9VA 3IKJA 1W5TA 4IVPA 3BXZA 4JLOA 5TDHA 2FEMA 1FX0B 3SDZA 3WXMA 2DFTA 1BH2A 1RZ3A 5FL3A 1TUIA 4Q9KA 3LFUA 2BEKA 1OLOA 2ZI6A 3BGWA 3R8FA 5EXTA 1IJEA 2GHIA 1WBDA 4PR0A 1B0UA 3MFYA 4PFSA 3KKOA 4U00A 5L3RA 2QA5A 4LRWA 4PO9A 4D0LB 1YR7A 3U6KA 4ZDWA 1N6RA 1RRGA 5TARA 3UPUA 1RKBA 3VNVA 3R8CA 4A2WA 4CDGA 1DARA 2FFBA 4UNPA 3HWSA 2GEVA 3IO5A 4H1VA 4PPFA 5TVKA 1N5KA 2GJSA 3TW8B 4PX9A 1L4UA 3ND9A 3FHCB 2AR7A 1SHZA 1G4AE 2G1JA 3SFZA 5JLJA 4Q4AB 1QRAA 4RY2A 4JLVA 3BERA 4HZUB 1RPZA 4PC2A 4B3DA 4NZYA 3EIHA 4NTZA 3M6AA 1CLUA 1OFHA 1UBCA 3PITA 4LWZA 2QMUA 4L9WA 4MGKR 3GPLA 3FE2A 4FMDF 3CUEF 4AG6A 5DI9A 1SVMA 1HV8A 4PANA 2DR3A 1GRNA 1KK0A 4JKIA 1EX6A 3R9WA 2KWIA 3SOPA 2NGRA 5HE9A 1TEVA 3UWKA 4B43A 2DYKA 4URVR 1JPNA 2QL6A 4FWTA 4B3BA 4LUCA 1D6JA 1E9FA 1RFLA 3B85A 3BD9A 4FCWA 2MMGA 5HZHA 5L3QB 2X2FA 3P26A 1SKQA 1XRJA 4TZ0A 1ZIOA 4XH9B 1E1QA 3GQBA 3WMEA 1CRQA 2F7SA 1UM8A 5JCZA 5FTKA 3REGA 1FMLA 1E2PA 2QQ0A 2G77B 4US1R 2AFIE 3VAAA 1GG2A 4E03A 2IS1A 3WNBA 4YQFA 2FG5A 1P2TA 1G6OA 2A78A 3CR7A 5FOSA 4Q1AA 2NOAA 1GNQA 3IHWA 3TUIC 1G21E 2IF2A 5AUNB 3LX8A 2ZS8A 2A9KA 2G88A 4DC9A 4PZLA 221PA 2QP3A 4C0LA 3CR8A 1P9RA 4NKRA 3K0FA 2IXEA 5DI3B 1P4SA 3KXLA 4CYMA 2FA9A 4M1KA 1WA5A 4F7WA 2FZ4A 1U0JA 4Q01A 4F4CA 2OLJA 1E1RA 2RGNA 1T3SA 2ZUDA 4KODA 2FZLA 1XEFA 1NBME 3KXKA 4JLMA 1G8HA 4P0TA 4JL5A 4PZZA 1DAHA 3S1AA 4DDWA 4JL8A 2JDIA 2G9NA 3KB2A 5JHHB 4D4MA 3QIAA 4IHQA 5EUQB 1DAFA 1XCGB 3U3MA 2RKOA 1FQKA 3ZZ0A 1R0YA 5GJCA 4RD4A 2GBLA 3IEVA 2AX4A 2VA8A 3KFVA 1YVDA 3CRMA 3TSOA 1RW4A 1OIWA 2LWIA 2ZSFA 3WBJA 2J3EA 3OFNA 4D25A 3U61B 1W0JD 4CVNA 5B64A 4NMMA 1XPOA 2QRZA 2YNMA 4TYNA 1U90A 1IOZA 1A82A 4GZLA 3RC8A 2J45A 4HLUA 1MABB 2JATA 2OCBA 4C0QC 3I5YA 2RGCA 2JASA 3AVVA 1C9KA 2FE4A 1COWA 3NEYA 4EUNA 2GESA 3C16C 3MWLA 3NG1A 4JT2A 4G0NA 4TLAA 5KHOC 3W6NA 1OXSC 1WMSA 1F2UB 2YVUA 4QHTA 4FINA 4NL4H 4YLGA 3RS2A 4XTRA 1BS1A 1W4RA 1GSIA 3HPQA 4OBEA 2ZIAA 1JNYA 2GCOB 4KO8A 1OKKA 2YOFA 5CYOA 1CBUA 4QFMA 2WOOA 4GMDA 5DLQC 5A0FA 2GF0A 1AS3A 1GUAA 2O8EB 3A1SA 4DLYA 2RMKA 1YZNA 5JEDA 4LCBA 1D2NA 3EZ7A 1B23P 1AK2A 3JZAA 4US0R 2GXUA 4M8NE 2KJQA 3TKLA 1E9EA 4PQFA 1ESNA 1SKYE 2AN9A 3SBDA 2YWEA 4B75A 3I62A 2R62A 2A5DA 1R8SA 3BAFA 5DHAA 1Q21A 2PZEA 2ZJ2A 4FXPA 5AJVB 4C7OB 2WJIA 4PPNA 5IT5A 3UXMA 3E2IA 3QOFA 1W48A 2WPDA 2P5SA 1G7RA 3DPUA 5GADl 1YZUA 4JKYA 2QGZA 4DB4A 4ACBA 2HXYA 3ZVMA 1XCPA 2FF7A 4MKIA 2Z0MA 1VKJA 2ZVQX 3TBKA 4HZUA 1P62B 3QF7A 1CULC 2ZRHA 1SVLA 2JLYA 2WWXA 3HU3A 3B2EA 1GDDA 5F2EA 4I1UA 4DLZA 1XMVA 2X19A 3OIYA 8OHMA 3LLMA 4OL0A 4AG5A 2WWYA 4HZIA 5FL7D 3EA0A 1ZNWA 3MGCA 4Q47A 4EKDA 2XZLA 2CNWA 4C3ZA 2C99A 2QZ4A 5JS8A 4JVMA 1E0JA 2DCUA 3FKSA 4QRHA 3VFDA 1C4OA 3LDAA 2V7QD 5JFGA 3L0SA 3OEHD 3N2EA 2ZROA 3WY9A 3F3YA 3X1XA 1PVOA 4KITB 3I72A 2BJVA 4HLQB 5FFMA 2A5JA 1RIFA 1LS6A 3AH8A 5EE3A 4GPTA 4R98A 2XNSA 3NC1C 3WMFA 4O25A 3QKUA 5SZJA 4A2PA 4KVGA 2J0VA 2JDID 1XX6A 4M1YA 2R6AA 5B2ZA 2ZRKA 5H70A 2ZJAA 2WIBA 4NBSA 1NJFA 4IXMA 4DT1B 6Q21A 2XNDD 4PAQA 4BFVA 1KJWA 4H9GA 1KMHB 4EAQA 3GLHE 1U0LA 3GJ4A 2VBCA 3B7GA 2JJ2D 1GL9B 1G8PA 3OFND 1DADA 1P9WA 5K8IA 1E9AA 3QXSA 1IBRA 2FH5B 3Q8XB 1XD8A 2W83A 4ERNA 4L16A 1BYIA 4NCJA 4G3XA 3K1JA 3R20A 4QL3A 4OI1A 3CRQA 3DOFA 2B7CA 3KQLA 1XWIA 3A37A 1OHHA 2H57A 4YDHB 4NHOA 1S0UA 1QVAA 3UG6A 5J5CA 3FFBA 4V0OA 4BLPA 4KSBA 4D81A 1D8TA 1YZGA 3NWJA 1XU4A 2ZRCA 3ZGXA 3RNLA 4EPVA 1R5OA 3W5IA 4Q9HA 1JR3E 4HEJA 1G5RA 4YMWA 5J4LA 1W7AA 1N5LA 5FOWA 2PX0A 1TQ6A 3AB3A 4DLUA 5IF9A 1DAEA 5AJWA 1WQ1R 3LBNA 5EE0A 2JLRA 3TVDA 1TF7A 1AQUA 1KTVA 3TIFA 5SZHB 3BIFA 2QEQA 1Z29A 1ZD8A 4QGHA 5BWMA 2FMXA 1IM2A 2ZRIA 3AEZA 2W00A 1R8QA 4LJ7A 4NONA 4LC0A 2ZYUX 2ZE7A 5BQ5A 3AVOA 3SJAA 4M21A 1ZYUA 2KB0A 4UNQA 2FGJA 3GLGB 4P4TA 3B1YA 2HJVA 3PUWA 3IBGA 4B3CA 3DM5A 3GJ3A 3RSOA 1W4BA 5L3SB 2AD5A 4JLDA 5JRZA 2IA5A 1V43A 1VYVA 2IYZA 4TMZA 3W8RA 1JI0A 2Q9AA 2X2EA 1LF0A 4MQBA 4NU0A 4C0BA 2Z43A 5BW8A 1XNJA 2QPTA 1KSGA 1W2GA 2O8DB 4IOKA 3F5FA 2G3YA 2FSIA 3GLIB 2FDCA 3CKLA 4F92B 1TU3A
chains in the Genus database with same CATH superfamily
3G68A 5E7IA 5JZMA 1EXDA 2ZUEA 4G8CA 4E2ZA 4JI2B 2VJOA 1WZNA 2I6UA 2MTBA 3HJHA 3EGXA 2W48A 3LVBA 5JUWA 4F91B 3N5KA 4F2WA 1O0BA 4N9WA 1L7AA 1O54A 1RLOA 3FZQA 1JTFA 3PPYA 4QXQA 1JG3A 1EJ2A 3W0LB 1J42A 2AMJA 1VSQA 3P9CA 4CIYA 1NP6A 4L72A 1GARA 1GL6A 3VKGA 3GLFB 4MMXB 4RZXA 4KDRA 1IUKA 2HA0A 4ZV4A 3E23A 3KR1A 2PZBA 2FPPB 2ZCUA 2IWHA 3ODGA 5A9TA 2E21A 4CV2A 1MX1A 3R0XA 3I8SA 2O8BB 2OLKA 1PJLA 2NSYA 3NT5A 4TS3A 5P8WA 4BZZA 1Y1RA 2HWXA 3HADA 4NRDA 3T54A 1M34B 3V8VA 2AFHE 3DAPA 4C4SA 3RVOA 4R1UA 2DT8A 4WK4B 4JENA 1LU9A 1RSZA 3P1JA 3WADA 4RLFA 4TMWA 3SYRA 1H2YA 1S1MA 4PLHA 1JDBC 1TAHA 1K8RA 2Q2QA 3JR7A 5CITA 2FPMA 1EFRD 4P82A 5B3AA 1YS6A 4TMXA 1AURA 4RZSA 5F9MA 9GPBA 1BFUA 1Z07A 5KOIA 1QDLB 3E7XA 3CW9A 4JVOA 4AK9A 4LV6A 4EUFA 2I33A 1X8LA 3GJ6A 5K8VA 1PW5A 4D6YA 3M6MD 3IDQA 1WHSA 2B4TO 2CLDX 3FG9A 4GPEA 4MYHA 1JHUA 5A3RA 3LLVA 3SBXA 5DHQA 5ALDA 3HVRA 1CQXA 3G2QA 3GARA 2BW0A 4TMTA 3AIMA 1NI3A 2HL6A 1PQUA 4X1YA 4YMHA 2FUG1 2P5YA 1QRTA 1ODSA 4E5PA 1KDVA 3VR4D 5HEKA 5IBRA 2RGEA 4IMIB 1XWFA 3RAGA 1PU2A 5K0EA 4ZT2A 1DJLA 2H59A 3MJRA 1G3RA 4QJBA 2XYQA 4QOIA 5JJCA 5L7TA 1IHUA 2X3FA 2XB8A 1DQYA 5FFFA 3H8JA 3TQHA 4BB5A 3IAEA 1C3EA 1CUFA 4AMUA 3F7NA 4HFRA 4F2GA 4X54A 1BSVA 2ZRBA 3WLTA 1RQ7A 4ZREA 4TWZA 5H9VA 4HDSB 2BFNA 2RC5A 4KK4A 2Z83A 2A6PA 2ZUBA 1UZLA 3MB8A 1JNXX 1KGSA 3H8WA 3A1CA 1AX9A 3B82A 5AKXA 4EA8A 1C14A 1U63A 3VR6D 1ECJA 3C6MA 5LZ8A 3N9IA 4FDUA 1AKWA 2ZBUA 2HMYB 2REBA 1X15A 1YZ3A 2OGSA 3I0MA 3IDZA 4PG8A 4R2HA 1GG8A 1YNSA 1UMCA 5F2OA 4BKUA 5CFRA 1EWTA 2CD9A 1DBVO 2WTAA 4DADA 2YWRA 3KB8A 2BHRA 4EFDA 1SCUB 1Z6QA 4C43A 2OORA 4ENVA 1W19A 4GKBA 4WKGA 4CIAA 2K7FA 1HE3A 4HAWA 4XOIA 4GZ6A 2JJ1D 4M2LA 2P0YA 5JMWA 2DFVA 1NLZA 4N76A 2H4HA 4Q3OA 4YRZA 1EVKA 3L7KA 5T4HA 1VMDA 3R7WB 5BYAA 4CIBA 3DMPA 2OESA 1RQPA 2AJTA 2ONJA 2PH3A 1GXSB 4PHGA 5F3DA 3C97A 2JLCA 4FMBB 2HU7A 3UH0A 1GPDG 4ECEA 3AESA 3P2MA 4GRIA 4JITA 3OAAD 1FRQA 1XDWA 2VCEA 2YINC 2ZI4A 4IO1A 4KX3A 4RSHA 5AJXA 3ZWXA 4MROA 1KO5A 3DEAA 4TTQA 2ZK7A 4W5HA 4RTJA 1SULA 1X42A 3DZHA 1P7CA 3QV2A 2LV8A 2H29A 4H18A 4FOTA 5EIOA 3D6VA 5JD3A 2OA0A 2QNBA 2VP6A 1AGPA 1MGOA 1FF9A 2O2IA 1WXQA 4OD0A 1XEXB 2DPXA 4X3OA 4D02A 3BL6A 3IB6A 1OYOA 2HHLA 1USUA 5JXIA 3HUDA 4Y2GA 1JEJA 2A3RA 1WW3A 1W25A 1LFDB 1JHQA 3VO2A 4BIIA 5EL0A 5J2TB 1JH9A 1Z0JA 4WZBE 4HGZA 2ZRGA 1G55A 1NZFA 1TM7E 1VXRA 1JYSA 1PGJA 4L0CA 3WA6A 4GOMD 3LF1A 4LXHA 4ACAA 4OBWA 3VPSA 5B30A 3I64A 4RVUA 3COSA 3IP1A 1PJSA 4IIUA 1WTAA 3H5VA 3QBVA 4GBJA 2IEGA 1XRLA 3COYA 3GGOA 5ALFA 4MWEA 4LV8B 4WLUA 5F3WB 3VI3B 2PZLA 4EHIA 3SQDA 3EQ8A 4IVQA 3FHOA 5IYZB 4QU8A 1X1TA 4Q6BA 3RGWS 2D1QA 1YKGA 3QW4B 1U1DA 4PVDA 4CTKA 2D5CA 3UO8B 2QAGB 2B35A 1KI8A 1WXHA 3DH0A 4X92A 5DYWA 5BVGB 4BC0A 4C4YA 2JBWA 4J1TA 3OICA 3ITKA 1ZU5A 2I7VA 2XIJA 1JKMA 1R4NA 2GNAA 2Z30A 3IYLW 3KQMA 1YIAA 1NQVA 3DGEC 3EDOA 2UZ3A 3C3PA 1OLSB 3OF3A 4F11A 1BAPA 2Y76A 3PQDA 4MWOA 1VP3A 4RGVA 1T5LA 1KAQA 2H1HA 3P20A 2YQZA 1E2GA 2EBWA 4Q4HB 2V65A 3R1IA 3HJFA 3PCXA 4N8SA 3U7RA 1Z7EA 5LQAA 3BAZA 2PX2A 3K9QO 4K03A 4Q15A 5LZ9A 1RE0A 4DRXB 2BSQA 3IXMA 1K6XA 1NXWA 4NEGA 4LEIA 2VDWA 1Q74A 2R7KA 2XE7A 4OG2A 2GASA 3TXYA 1NY5A 3W5CA 4TT3D 2YN0A 3PKIA 3H1AA 4QJ5A 4B47A 3E9MA 1O6GA 4GDFA 2E6KA 2WKPA 2NYAA 1XQVA 4Z1MD 2NP6A 3V7NA 4XI9A 1MB2A 5K20A 1MO2A 2R65A 4HB4A 4Y2QA 1EINA 1RTTA 2Q3MA 1DOHA 1W6UA 3I37X 4LJYA 1SVUA 2I22A 1C5KA 3Q7RA 3K9CA 1PDOA 1VE6A 1I4TD 1YUBA 2DE0X 2GEFA 2RK3A 1BIFA 2O8VA 4RMGA 3ZYCA 1ZN2A 2OAP1 3I53A 3L9XA 2W2OA 1DMRA 2O4CA 2PZKA 4PC6A 1T3HA 2QJOA 3IKLA 4D44A 2ZSDA 2ZVDA 3K31A 3RQIA 1CUGA 4AJNA 1TT5B 2ASVA 3GJZA 3UXHA 1CVRA 3HP4A 3RSHA 1AG9A 3BBPA 2JKVA 1FJ2A 3FDIA 2ZIFA 3P45A 2VT6A 3ZE7A 2PX3A 3F9RA 4OGLA 3DR5A 1K3TA 3OZWA 1KZGB 2R8ZA 3C87A 3VHXA 3H5AA 1OIVA 2QU8A 3UUEA 4B71A 4GNRA 4HLUC 4B3HA 2PXHA 1UC5B 3K9GA 1FYVA 2HCFA 2I3DA 3RBAA 1H2XA 4HUQA 1RBYA 4ZQBA 4CMEC 1J2RA 3O4RA 4BWVA 1MV5A 3Q3GE 3L1HA 4Q48A 5IJ0B 1KYQA 4A9AA 5KNDA 2ZJBA 2PWZA 1GGEA 1WPRA 1YB1A 1I6KA 2QUAA 2VCYA 4OL9A 4RK7A 4F38A 4CTJA 1OT5A 2D00A 4Z8YA 1R15A 1ZK0A 1ZD2P 4F9GA 5LKRA 4N1AA 5EJEA 4RTPA 4Y1FA 3RTGA 1G3QA 3HKEA 3ZJYA 2Z6UA 3RC9A 2MSCB 2YQ5A 5KDDA 4CRWB 4S12A 4E46A 2RKWA 2YXBA 2XX3A 4Q39A 1BE8A 3OH8A 5AVJA 3MWDB 4HO1X 3X1ZA 4EM6A 1DCKA 1X7ZA 1IVNA 2NTJA 2ZJ3A 2O54A 1BXRB 4DUGA 3WGJA 4D0GA 1R5JA 1NBMD 1EFVA 2J7KA 2XLBA 3NASA 3MRXA 5HJ2A 3SYLA 3TTSA 1MJFA 4QZVA 4B3TB 3SQXA 3QVOA 3STVA 1KZ6A 3FROA 3ZG6A 1YRYE 3H11A 2RHCA 4A6DA 3QPVA 3ZHVA 2X15A 2XQFA 4JEHA 5E2BA 2BGMA 2HLDD 3BGVA 3Q3JB 4G1FA 4Y3UA 3RO7A 2CCJA 1YVEI 4QUIA 5EHQA 5BQOA 2G1UA 1OZFA 4UXJA 4UMFA 3A1WA 2OBLA 4PHTA 1VLVA 1NU6A 2V98A 3IUSA 1HQCA 4EGFA 2C7PA 2BM8A 4WLOA 4WCVA 3B1ZA 1GDTA 2ZITA 3R5XA 4IV0A 4C6SA 1TJ4A 4ZHQA 4FD2A 4PAOA 4AJ1A 1FYXA 3RTDA 5C8XA 1U4NA 3SXUA 4IDOA 1AKYA 3WGMA 3FIJA 2PT6A 1KH1A 2DPYA 7AT1A 4FI3C 1MC4A 3OM1A 4HNAB 3LCVB 1ZLYA 3UHJA 2P90A 5DIFA 5FLXA 4ER7A 3VR4H 2VP0A 4ENQA 3B1WA 3KUKA 3ROZA 3BOSA 1BX0A 2YC2C 5JBQA 3KZVA 3EXHC 5CD1A 1JALA 3WIDA 1F9EA 3E9DA 4ZHQF 5HS6A 1T5SA 2F8LA 1NQAO 3HHEA 2FEPA 1YKFA 1URPA 1HOXA 3C5VA 2VZLA 5I7EA 3AF4A 2IW1A 1I7QB 1DIRA 1T4CB 2J3DA 1BXKA 4WV3A 5KINB 4GMFA 2AG6A 2OHXA 1H2EA 1X39A 2LE0A 1O95C 4FT2A 1KYVA 1ORIA 4QDKA 1JVNA 2J9XB 3P2IA 5E1OA 3E3NA 3ZHCA 2C2YA 3I52A 4LF4B 1UWKA 2VQDA 4ZZ0A 1DQSA 2OFXA 2NVUB 4QQNA 2BDUA 4AP6A 2GVDC 3PQFA 3VR6H 1HDYA 4QGGA 5AUQA 5GZ6A 3D3EA 2Q7XA 2Q5IA 2HT6A 3PX2A 1U8ZA 3KYJB 1M73E 1C1XA 1KI1A 3S0JA 2YHIB 4H7KA 1ZMTA 2HF7A 3VH1A 1J2YA 4X94A 1SK9A 4UVIA 1BQEA 3SF8A 2QYOA 3A9RA 3LNCA 1X6VA 1Z82A 3KJZA 3A3YA 3L7OA 4M83A 4O1MA 3O8OA 5JW6A 4GOKA 3Q7EA 4DPLA 4LGVA 3WLSA 5JR3A 1AT1A 1H1LA 3PV0A 2AN1A 1NVDA 2Z2ZA 4P3OA 3REOA 5KYXA 3UGJA 1MJ5A 4ZOLA 3UM9A 3M49A 2FCRA 2FW1A 5FPYA 3H2SA 1CF9A 3RYHA 5CX4A 1THZA 2QTVA 4FVTA 4P5PA 4BJ5A 1E59A 5HW0A 4RJTA 1A5AB 3LY7A 1Z2CA 4PLWA 4RQTA 3RC7A 3N6XA 4OM7A 4RYLA 1SRQA 3EVBA 4ARUA 2IUUA 2GWHA 3EGVA 5IN4A 1VJ1A 4ESVA 1QYDA 1XMOB 2AD1A 3A6KA 2KLHA 2XA2A 4QTYA 3U4QA 5HSGA 1GAWA 2FSHA 4J0DA 3G7SA 1FDVA 3I4CA 2VDVE 4GFDA 4OV6B 1OE0A 1QHFA 3CLTD 5DSXA 1EWKA 4FJ0A 4ZOLF 4F8JA 3AVXA 1I32A 1K7CA 4RJIA 1Q6ZA 2WQ7A 3THXA 5ARDA 1ZJYA 1ZK2A 4LW8A 4CBVA 4FEGA 1DIBA 4BQIA 5I8ZA 2NUPB 2XYHA 3FVWA 3PR3A 2XV1A 4IS2A 2NU9A 3WLIA 4DUYB 5JJIA 2XJ9A 3IVXA 5FPSA 1ORTA 3MEQA 1NSTA 3WNDA 2XNDA 4HFNA 3ED1A 1TPZA 4G2NA 4BS9A 3RNOA 4FBLA 4EG4A 1MAWA 3L7IA 1ZD9A 2NNLD 2Q6OA 3OIWA 4E88A 2H2AA 4FYVA 3G6WA 4ZKDA 2CJXA 4IQGA 4LDQA 5F1YA 4CGYA 2FKNA 4NZ9A 3RABA 2AJLI 3TKYA 4QO7A 4F5DA 4HGYA 4QGAA 4CT0A 1NVGA 3KAPA 4ZHSA 1ZGGA 2YZNA 1FRZA 3VBCA 3I1FA 4LF5B 1Z56C 2WSMA 1ZX1A 1KO4A 2OV3A 4UTXA 1PUJA 5CCEA 4BO0A 1UAAA 4QG3A 2NO5A 1NJSA 3O93A 3M4ZA 2F6RA 4D9KA 3EVDA 2W70A 2RJOA 4HWTA 3GLGE 2PKXA 4YXWD 2X2PA 2WHXA 1W88B 4CMEA 3MCTA 2SKEA 4UM7A 1O97C 4RK1A 4V0RA 2QJTA 4BMNA 3QFHA 5I3ZA 3WP1B 2V0NA 1OYVA 1X3LA 3DVLA 2JB9A 2Z4RA 3FTCA 4D9MA 4DL9A 1DOAA 5JZBA 1Z7BA 1VA4A 3I92A 1PR4A 2LKDA 3WL3A 3HEAA 2UVDA 2ZUVA 4FGKA 2ERXA 2FZGA 3WZLA 1G66A 1TKRA 3N07A 3TGWA 3QMMA 2R1TA 2I7CA 4P4NA 3U3KA 4R1NA 4GOJA 3CZPA 4RM2A 5DN9A 2PUHA 1RM0A 5KTNA 1N2HA 1S9HA 3D0QA 3FZGA 2IYVA 4X3PA 5G1OA 5ABPA 2O8CA 4ROSA 1B93A 2NNWB 2TMKA 4U5QA 4GWLA 3EX7C 2DFDA 4UU0A 3BORA 2OP1A 3FTPA 4MP6A 3DDWA 5DSZA 1ZWLA 1XJQA 2GNOA 3O91A 4IH9A 1PI3A 2JBAB 1T5IA 3WQHA 1Y80A 2HDOA 3NRBA 5JLAA 1HNWB 5H4GA 4A16A 1E1YA 3O3MB 4O59O 5ESWA 5BNIA 4JUCA 1KMMA 1XV5A 4J0HA 3TE6A 1KXJA 2LRHA 4YUAA 3C5EA 1P2GA 3A28A 1NP3A 1U7OA 1SCQA 1UXIA 1YJXA 3BTOA 3NRCA 5G0VA 5KHAA 3ROGA 2ZJZA 2F1KA 1B0PA 3LL4A 1RQLA 5JD5A 1DEAA 3PA6A 1RWOA 3P2JA 3H8SA 1I6MA 3VKWA 2WAOA 3MCWA 4RY9A 4Y9DA 2G5CA 4X1IA 5HZMA 3LXUX 4DCNA 3A4MA 5LIPA 3TLBA 2O8NA 3G8BA 4MR9B 4OOFA 4HRAA 4ZK2A 3S7ZA 4CKCB 4MVWA 3RARA 2XXBA 3G7NA 2HNAA 4HEQA 5CH3A 5EIEA 4NAUA 2XGSA 2Y71A 4JQCA 3FUTA 1K8XB 2HOQA 3LT4A 3DMDA 4JC5A 4ZAXA 3PTAA 1E2DA 4ZKEA 1DO0A 2ANBA 3ZIUA 4DC1A 1ZJJA 5JROA 1YZQA 2GVNA 4FI3F 3ZZ1A 4CZ2A 2ORWA 3DEHA 4JT4A 4UCWA 4EYKA 3ZW9A 1C9JA 1C8KA 1P44A 5CDFE 5HX7A 3PPXA 5LKAA 5AK5A 2HF8A 4NPCA 2P27A 2XUIA 3LP6A 1DG1G 1NRWA 1CQIA 2IY7A 3CGWA 2BFCA 3AB8A 1Y33E 4A8PA 4ARZA 1I9GA 4FFPA 2E4VA 1BMFD 5A02A 1P7WA 4Z7JA 3CNLA 4GMXA 1EIWA 3V6MA 4X1KB 3HU2A 1DBRA 1AE1A 1RMYA 2QRHA 3E84A 1ZBQA 4G0ZA 3KSRA 5T6MA 1ZN9A 3EXFA 4P22A 1MO3A 4Y2SA 1FQOA 1Q0PA 4QBTA 1LY1A 1Q57A 3DOUA 2EJWA 3PI6A 3RFCA 1VL5A 3R0ZA 1F0PA 4OYRA 4G24A 1CB0A 2QAIA 1EPUA 4RKRA 2IHZA 4JODA 1L7VC 2PJZA 2GJ9A 1YBFA 4JZKA 4K28A 2GVZC 4HDMB 4U7HA 2H17A 4QU0A 4XD2A 2HJRA 2H11A 4QPZA 3WWZA 4R0NA 1U7ZA 3EXAA 3LBHA 4MITA 4R16A 5EERA 3GRUA 5C8YA 1LPSA 4FC7A 3ZOKA 1NX9A 2HU5A 2WIKA 4CJXA 4DIMA 2WFAA 3ETNA 4I1VA 5LUAA 2GN0A 1U2TA 1RT9A 2P65A 2DJ5A 1GKKA 2OO3A 2GB4A 2WI8A 4K6FA 5DP2A 1JQBA 2QAJA 1DKLA 3H5WA 3O2SB 3RHZA 1LFAA 4UNIA 4C21A 2WWRA 4RGBA 5A2QA 2R0QC 1JSCA 3CSDA 2J30A 1E2JA 4RIHA 4AS3A 2XODA 2I4RA 2YUIA 3G49A 1FFXB 4GLBA 5F5XA 3V1LA 3VNRA 3GN2A 2FJ0A 3NHRA 2AW5A 3IP7A 4XYMA 4PHFA 1SXJA 3ECSA 1FFWA 5C8YF 2P3LA 3LKVA 2J4FA 4QU5A 3INTA 4TTAA 4BHTA 1B00A 3SBOA 1XZIA 1I33A 4ZPXA 1A2QA 4YRMA 5MFZA 4QTUB 1G21B 2BZ1A 1UZMA 3KR0A 4CMCA 1FY2A 5C53B 3RS3A 1HE4A 2QJRA 3THSA 2YC4C 3T7DA 4J1NA 3A58B 3WS7A 2DFLA 4B6GA 3EEIA 4EDHA 3F97A 4Q3KA 2DBYA 3TIXB 2L18A 3VJMA 2VYND 4NABA 1Y9EA 4P7JA 4WZAA 3UNXA 2BISA 4MRRA 5KSYA 1U7DA 4PFJA 2Y1EA 4D9CA 5MDHA 4RV5A 3W05A 3AZOA 3G8CA 3QPUA 1MFZA 4RM3A 1KH2A 2HRQA 3P0FA 1S4QA 2B1IA 1P4AA 3KOZA 4NE9A 3V4LA 4JJ6A 2L42A 3EOBI 3ZQ6A 4K9SA 2IUEA 2Y66A 1K06A 4HH0A 4WEOA 2IQ5A 3RAJA 2OQIA 3QVUA 2B4YA 1NT4A 1Z08A 2XF2A 2BBOA 1W0KD 2GO1A 2ZEJA 3ETHA 4CPDA 5A3QA 1ZK4A 4XUDA 3P2YA 4DRYA 4LCJA 4FFBB 1HM5A 1E1MA 2G7ZA 2F3RA 3ZE6A 1SB9A 1MB3A 3DR3A 3L2OB 2X5KO 3B2NA 4K81B 4RH3A 2FN7A 1OGYA 2M2IA 3ED5A 1EWVA 5I5GA 5IDXA 1JR6A 3NVMB 2ZRLA 4HB0A 1E92A 3SN6A 2POQX 2NIPA 2E89A 3JALB 4OY3A 2Z56A 1RXVA 3GMDA 2WTMA 1G6HA 1F6WA 5EWMB 2VAVA 5I7UA 1JEYA 5HPYB 1FRFS 4EUEA 5JXHA 4HN4B 4CCYB 2P69A 2DH5A 3COVA 1OTYA 2XE4A 4IBOA 5C35A 4NAVA 1B42A 1MOZA 3MM4A 4IIXA 5D01A 5JDIA 2J46A 1OU4A 1RAFA 2H2GA 2Q9BA 4RV4A 4R2LA 4Z0HO 2B0JA 3RVMA 5KTRA 5FI1B 2HTEA 1BNCA 4KFTA 3O8LA 3IKMB 5IKEA 5ADHA 1P60A 1G8FA 3M6LA 3Q8KA 1I2DA 4TL6A 4F2PA 1LI5A 4BNJA 3DVSX 1LBSA 2QUZA 3I2IA 4DBZA 3D1VA 2I5PO 2X7XA 3GEDA 3KLPX 1NQUA 1F5SA 2L82A 4K05A 4MW5A 4MW6A 4PVCA 4RD0A 4DV4B 2W6MA 4ZAGA 1FBTA 4OI0A 3A1UA 2CF5A 4HEHA 2AOUA 4KUEA 4EJ2A 2OCYC 2BFMA 2XUDA 4KYVA 2PFGA 3AI1A 1TAUA 2IPLA 4RK5A 1KFCB 1JECA 1KZ4A 1OU0A 3CNNA 1V45E 1H42A 3EIEA 3OC6A 2Q2VA 3OMLA 4PTLA 4OHVA 5EPEA 3MBIA 3SIWA 3WK4A 4W5JA 5DCYA 4TZ6A 2BCEA 3BD7A 4EKNB 1QO7A 1FU4A 3FPKA 1TMKA 4F04A 1JX6A 3DDNA 4R0VA 3KSZO 1QIMA 4QBHA 2C78A 2BLLA 4WCDA 3NYRA 1UF9A 1WY7A 5L45A 1P8JA 1KBZA 1K92A 2LKCA 2OVBA 3EZGA 4G84A 5CM2Z 4QTTB 4OXXA 5ALJA 3UJDA 4CR8A 1UKAA 3O82A 5C7YA 5HM6A 2WM9B 3KZCA 1N9KA 1YCHA 2IYPA 1BWPA 3QM1A 5J2UA 2N3ZA 2MSEB 1Y4SA 2NQ2C 5ADVA 1SPBS 2XUAA 1NNUA 3H9GA 2HMTA 4OQDA 1XN4A 3RC1A 4FHDA 4EFKA 2PAAA 4YREA 2H4FA 4JR1A 3AERA 4YVFA 2PR2A 3CBQA 1CS0A 4FIZA 3MHTA 5CHEA 2CXNA 3OT5A 2O2JA 3IPAA 4X7PA 3ANXA 5C81A 1EX7A 4EKEA 1QBKC 1NVVQ 3N2LA 3PNSA 4LWOA 5L3ZA 4XPIA 1VB3A 1RAEA 3A27A 4N41A 1YTUA 2PFKA 5J2UF 3QKRA 4CM3A 4KQXA 3X2EA 2I6GA 5BV0A 4A0QA 4AXBA 1W87A 4LK2A 2O7QA 2Q6VA 3WYBA 3RK4A 1Q12A 3F90A 4WA7A 1N5MA 1U0OC 4BBAA 4HRVA 2RSLA 3JATB 4BLRA 3OZSA 2JARA 3CX7A 3LXMA 4C7KA 3DEZA 2JI4A 2ST1A 3GFPA 1EQAA 1ZD4A 3EDCA 1JKJA 4PTYA 3RIXA 3N87A 2XECA 1PEDA 3OIVA 10MHA 4FKMA 3NDBB 1WG8A 1E2IA 4F92B 3KKNA 4TTVA 4IGAA 3N1UA 4INZA 5JRDS 3GW8A 1FDOA 1LSJA 1TQHA 2YL2A 1A9OA 1K5GA 3ICWA 1WUYA 4IVRA 5AHKA 4CLOA 3AM1A 1GFSA 4NBLA 3DNPA 2J5XA 4GICA 3JQPA 2DLCX 5KDOA 4IPTA 1CYEA 1EFLA 2IODA 2H1VA 3N5CA 1Y9JA 3EBLA 4GXRA 4IRUB 4RETA 3PDIB 1LTKA 3EPRA 4DWWA 5G1PA 2PZJA 2CB0A 3DPIA 3RLFA 4XE5A 2ZPUA 3QVXA 3VDRA 2BUAA 1V96A 3EMBA 1ECCA 4XX0B 2O50A 3MMXA 1XZMA 2H08A 2CNBA 2XDQB 1J5EB 3ZX5A 4DHEA 3G1TA 1QLWA 3ROXA 3DHEA 1I4OA 1SCKA 2OCIA 5LMNB 3PFCA 3ZK7A 1Q20A 1Z68A 1XP5A 3JVIA 4QYWA 1FS6A 1WE2A 5FTWA 3MJDA 4DSTA 2VL7A 3T4PA 4X66B 2XWQA 4G8BA 2LDXA 1UBTS 2MT9A 1Z3CA 5HIKA 1MAHA 3F4KA 4EEKA 4Z3DA 4CKYA 3MUFA 3WGIA 4B83A 1HC7A 3MUOA 2MYPA 4GF5A 1AUOA 1YB7A 2FPOA 2H85A 4CLRA 4I66A 1R2QA 3QKIA 4RF5A 3EPKA 1NJ2A 5KCMA 3U3XA 2DH6A 4YMLA 4N3AA 9LDTA 1M2NA 1E79A 1NPYA 3VSBA 1L5MA 3TOCA 4EY7A 3TCKA 3EEFA 2BTQB 1STOA 2HKIA 4IFIA 4DMUB 1P2FA 1TMOA 4OATA 3AY3A 1Z12A 3H6KA 3JQAA 4K46A 4LYJA 3LPMA 1E3QA 2JI7A 1JWLA 2J8ZA 2RGYA 2XMDA 3I1JA 3OE7D 3AILA 3DKPA 3G5UA 3JQ8B 4GLFA 3N28A 4DWJA 1G8AA 3A1NA 3F96A 4ZAVA 2UYCA 1PD0A 1G8KA 1LSSA 2PT7A 1FDIA 2R68A 4HPXB 4JXJA 5BNWA 2OHFA 4S05A 5EHNA 1GQSA 3KVNA 4NEQA 5MHTA 4B17A 1LK5A 4PIVA 3DMTC 3IVMA 4HQNA 4EPWA 1D4ZA 3OZRA 2W9XA 2YN4A 1NMYA 2ZIGA 5BN4B 3VR2A 1U80A 4DABA 5J9FA 4XUCA 4M46A 5DASA 1ZHOA 2ISSD 4DCJA 3LBIA 5DBEX 4BWYA 4ETNA 2IYWA 2FY8A 1Y0BA 3WSTA 4OHMA 3OU2A 4HNHA 2AIRA 1K9VF 3H6GA 5JCJA 1SVKA 1F2TB 1Z0IA 4FOSA 2D5IA 1RWMA 3IBFA 1Q1BA 3VVLA 3DVAB 1DO2A 4EY8A 3GCGA 2D1RA 4K8OA 3PC8C 5G40A 1UINA 1XMPA 3PXEA 3R9KA 5HR5A 3IA2A 1FW6A 1Q7GA 2I3AA 3DL0A 3INRA 3N3BC 2QNRA 1OD6A 4MWBA 3N0WA 2WJJA 2FWBA 3OZBA 4FFSA 1KS9A 4M38A 1OJLA 4CT4B 1P7YA 1WL8A 3SE7A 1ICEA 4R7GA 3VU9A 2Y05A 3SZ3A 4A1OA 4FOOA 2V96A 1QRUA 1M8FA 5CYGA 1MP0A 3GCXA 1DFIA 3QEJA 3TZBA 2Q4DA 5G2OA 4UU8A 2VRWA 1KMNA 2P2NA 1M66A 3GCZA 4QHYA 1PV4A 2CLHB 5LZ4A 2PQ2A 4TMVA 4TV8A 3FBWA 5MFPA 13PKA 3HFSA 3MBKA 3E58A 2W2VA 4KH0A 2FVXA 3EZFA 4DLSA 2NO4A 2I03A 4QYIA 1N2EA 1UODA 3JWGA 4RQBA 1M8KA 1M7HA 1YA8A 1Z2AA 3PQ8A 4W9RA 5DRYA 5EMKA 4HQKA 4ZWNA 3O73A 3QI2A 4G2TA 2ODAA 1Y6QA 2RGDA 1Y5MA 3CKMA 4ZQIA 3ZWVA 1OPRA 1RYMA 3JYHA 5IC5A 3VOBA 1T9KA 2EIHA 1G4HA 1NDUA 1UJ6A 4TV8F 4NYJQ 3WISA 4MUMA 4F85A 2C1ZA 2AFHB 1NBAA 3EXG2 3BWXA 5BPHA 4ES6A 3CW8X 4OQFA 4UASA 3TLGA 2W5UA 2CMHA 3MXTA 1UC8A 2WD7A 2OYSA 2XY4A 3B3QA 1NVXQ 3I09A 3OECA 5KPJA 3I73A 2G1PA 3C6XA 1ZUWA 3MLEA 3SX2A 4RIEA 4E22A 3RD5A 4WKPA 1RWVA 1U7XA 4Q7QA 4KFUA 4PTZA 5B6JA 1Q2XA 4ZARA 1M8JA 3U3DA 1PBNA 2ZR0A 3MGKA 4AWAA 3DO6A 4B6SA 2OL4A 3LC1O 4JJIA 2JANA 4KLZA 1LPNA 3ZV4A 4BASA 2FEXA 2Z08A 1NXPA 3LS2A 4JYBA 1KEZA 1JQ5A 2ZSHA 1YJ5A 3BZUA 3A3NA 2YDXA 1OCEA 3KQSA 4KNVA 4Y6QA 4BP8A 3IBCA 1SUFA 4KW7A 1E3SA 1DKMA 4DR3B 3K6SB 3RAEC 2NQ8A 2C57A 3WSWA 1XQ1A 1QH8A 2QRQA 5FULA 1BJRE 3D0KA 4RFSB 1JDNA 1V26A 4PG5A 1AN0A 1KI6B 1NG1A 4X60A 1P2DA 5FIUA 3TN7A 3ZU5A 2WJZB 4IDBA 3ZUGA 4U0JA 4L8YA 3WGGA 1DNPA 2JIDA 4GQAA 1FLDA 2XCLA 5TQ2A 4O29A 4G5HA 5IJXA 3T5TA 2FPSA 3P96A 4H4DA 4ABYA 4HPJB 5KNCA 2PZMA 2XMCA 4W1SA 4EYSA 1HFJA 4B09A 2G9QA 1TMYA 2MU1A 4P4SA 5FBVB 1CY4A 2J5RA 4C14A 2HWYA 3MZ0A 2FN3A 4GLLA 4M36A 1SG6A 4XYEA 4DMKA 3KT6A 2VRBA 4MS1B 4QXOA 3SYTA 4C5CA 3EUEA 1MAVA 3OFVA 4XB6B 3HR8A 5FUVA 2PSEA 2ZETA 2ZB2A 2ZAMA 4PG4A 1EGHA 1BWSA 1ONSA 2FEAA 5EJIA 4RTLA 3VDNB 4O8CA 5IVPA 2LPMA 1H6BA 2VR1A 3TGLA 3VNAA 2YOGA 4P3NA 5IXSA 3OCJA 3U80A 4TWBA 1ZXBA 1M6VB 3D3WB 3EIOA 3G1WA 4PLZA 5DNAA 3TLEA 4AUKA 3HXQA 5DYIA 1SGWA 1P5JA 4B3IA 1S4MA 1GNLA 3U4DA 1E2HA 1EHIA 1JLRA 1JXMA 2QDKA 4OH1A 2GJ4A 2WMYA 1U9IC 1A9YA 3FUWA 3O03A 1SUCA 3UV3A 2HAEA 3TRDA 4OJKA 4HH3C 1VPLA 2R6JA 4MIKA 1QWOA 5FPQA 3UW3A 1RI1A 1E7MA 1WXEA 2C61A 2WM3A 4Y9UA 1KDTA 3BMOA 4Q66C 2BY4A 4QDJA 3BS4A 1C9NA 3CZ4A 3FPEA 4JUFA 1JR3A 1ODCA 2WU8A 4Y0NA 2HA5A 4YCDA 1MHTA 4C88A 2P8SA 3YASA 2C59A 2WA2A 2I3ZA 4BGDA 3BZWA 5TXGA 1Q1EA 2QX7A 1S3GA 1GKIA 2GZ2A 2NPIA 2HWWA 2GZ3A 1EVEA 2HXGA 2H1RA 5CM8B 2IYNA 3ZNPA 5J3JA 2PMKA 1PJBA 1CJSA 1KDPA 1TGYA 1THTA 1DWOA 2H4YA 5LYJA 3WJ7A 2ZUCA 5BW5A 3PHBE 4M0UA 4PO8A 4EFNA 1O4VA 1KP9A 4J6FA 4MA4A 4MULA 2WKRA 3DMTA 2IU0A 2G70A 3VO1A 2VHYA 3A6HA 3DBRB 4JB8A 4FILA 4WZBB 3R5TA 1HETA 2Q5QA 1KFBB 2RH8A 2OCLA 4MICA 4P08A 1ICIA 1I5OA 2HO4A 4KQ2A 1Y8RA 1HLPA 4ZU3A 3KQWA 1KSJA 1JIKA 3GCDA 1Y4UA 1DEOA 2BBSA 2XXAA 4HGRA 1WX1A 3R6GA 3NI2A 3AOGA 4HGQA 4QGSA 4MW9A 1U0NA 3T61A 1LC0A 3KU1A 3LC7O 4CR7A 2JVIA 2ZVJA 2L69A 3INNA 5EXDA 3M4JA 4M89A 1RWBA 4BXOB 2UZAA 3EAQA 2COEA 1ODKA 3H2BA 5CM9C 5IM4A 3X0DA 1H66A 5DXJA 4AWBA 5L8VA 4AKHA 5TQJA 6GPBA 4MARA 4DIDA 3CC8A 4IHKA 3L02A 1WVMA 5FD8A 1UK8A 1TJNA 2GZDA 1SPXA 2PV7A 1VMAA 1KI9A 4ZVNA 2PK3A 2G07A 4CF7A 1AN9A 5JI3E 3HKCB 1YONA 2WFZA 3UJ9A 1R7RA 1D03A 5B1EA 5BWLA 4JI6B 1XLTC 5IM4F 1UKBA 2AYZA 1DELA 2X1VA 2IYSA 5L3VA 2XHEA 4XWYA 4BDTA 2PUBA 3EPJA 2H0QA 5B1DA 1HWYA 3ZYZA 1BVHA 4CM4A 2F90A 2R751 3DSRA 2QTAA 3UIEA 5F7OA 2GILA 3I9LA 1BCRA 3RHFA 1MOPA 2E7ZA 4B3RB 1UPUA 3JQ7B 3PPIA 3K35A 2O07A 2G67A 4HFJA 2PKCA 3LY8A 3A6PC 2BR4A 5CX1B 1G5TA 1MC5A 1VMKA 2HLNA 4FK8A 5GM2A 1V0JA 1YOVB 4DMMA 3GDGA 1EVYA 4OUDA 5GGXA 1H05A 2NO1A 3ECCA 2FE1A 1GZSA 3IELA 1P39A 2YFQA 1A7KA 2FFQA 4ZIRB 1SXIA 3HE3A 3LQFA 4KBYA 4RULA 1M2EA 1ZESA 2PD3A 3JTEA 5HZKA 3WGVA 3SYKA 1S8FA 2XH8A 2Q3BA 4TS9A 1OIXA 5AW3A 1EDBA 4A0HA 2GF2A 3GA5A 3P94A 1BE0A 3SEZA 1DE0A 4BCCA 4BC1A 4B73A 3U56A 3F49S 1GCIA 3A9VA 4XQ0A 1IM8A 4LVUA 5T4FA 1DJNA 4KG7A 3OFKA 2QMYA 4FQ7A 5EQFA 1E9SA 1ZFNA 2WYOA 2B8TA 1DL5A 1G20A 3RROA 1T3GA 4CM9A 4QEKA 4RKFA 3ZKAA 5JNRA 3PC6A 3C3BA 3IS3A 3D2LA 1F6DA 2FMHA 2H06A 6LDHA 5KYYB 1GAXA 1T2UA 1LBTA 3DFUA 1I5EA 4ND3A 1YJCA 1U94A 2WVJA 3DLAA 3I3OA 4AJKA 5KAMA 3GLIE 2C4MA 4CN9A 2P9QA 5ESXA 1L8QA 4MVJE 4RADA 4Y6OA 4NNOA 1V9SA 3GBVA 1UPFA 3SDSA 3ZH2A 1NC1A 3CNEA 1PZEA 3RS4A 2ODWA 3GUZA 4TVKA 5F1OA 1E3WA 2EOAA 4L9SA 1KY3A 2IIVA 1DFGA 1KFEB 1Q1ZA 3IPYA 4LJ5A 2JZOA 5K8CA 1KYZA 3LUAA 5C4IA 1Q3HA 2C3OA 4EMSA 2FLVA 2MINB 1CYDA 5A3VA 4R2XA 2ECQA 1BDHA 1ZGCA 1SURA 3S28A 3VH4A 1JJVA 3OBBA 3PENA 2PUDA 1N3YA 4KN5A 3GROA 621PA 3L7NA 4YJHB 3C24A 3T5CA 1SXHA 1RJ9B 2QRPA 3SR3A 4CDRA 1OZGA 3NR2A 4OHZA 4DCGA 9ATCA 3NHKA 2JEOA 2QTLA 4HSGA 4OTZA 1JSRA 4K87A 1VI2A 4PYRA 3AFNA 4CTMA 3Q7PA 1HE1C 2EZ9A 5A5VA 4GOOD 1WWKA 2OOSA 2QQ5A 3F5SA 3Q6MA 4Q1CA 4JXXA 1Y8QA 3GEHA 1NNSA 4NJOA 1L3IA 4BFYA 3CA8A 3M2PA 4OVKA 2XMGA 1R4ZA 3F71A 3NYIA 2RGXA 1F6BA 3BGIA 1U9IA 1ZJZA 3RRBA 4CUJA