3BH7A

Crystal structure of the rp2-arl3 complex bound to gdp-alf4
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
161
structure length
161
Chain Sequence
EVRILLLGLDNAGKTTLLKQLASEDISHITPTQGFNIKSVQSQGFKLNVWDIGGQRKIRPYWRSYFENTDILIYVIDSADRKRFEETGQELTELLEEEKLSCVPVLIFANKQDLLTAAPASEIAEGLNLHTIRDRVWQIQSCSALTGEGVQDGMNWVCKNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribosylation factor-like protein 3
publication title The retinitis pigmentosa 2 gene product is a GTPase-activating protein for Arf-like 3
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 53
structure length 161
sequence length 161
ec nomenclature
pdb deposition date 2007-11-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3bh7A00
1V43A 1VDZA 4LHXA 1GUAA 3SS8A 1FMLA 3Q5EA 5B58C 3CM0A 4FCWA 2C9YA 3KQNA 4Z1MA 4AC9A 4DB4A 3CO5A 1ZM7A 4ERNA 4TL6A 4KITB 4PHHA 2BM0A 1N0VC 2WKRA 4KYUA 4CT5A 1EFHA 4BLPA 1CR1A 1F48A 2I4IA 4OJKA 1CIPA 2AD5A 3I62A 4DWJA 1RPZA 1KTVA 3EZ7A 1FUKA 1R0YA 1FPMA 1XEXA 1AQYA 2ZRJA 3BERA 1F2TB 3BWDD 4OQLA 4D4KA 2QAJA 1G291 4M1YA 4Q4JA 2ZRFA 3PFIA 5H68A 1SVOA 2F6RA 4OHWA 3K0SA 3NBZC 2WIAA 1I2MA 5KSZA 2QTVB 1QZXA 4QG7A 3UANA 3DMNA 1IOZA 3QBTA 4KU4A 1ZM2A 1M7HA 2F1RA 2QTFA 3PV0A 3JVUA 3IUYA 1KI1A 2NOAA 2A5GA 1JQLB 1GITA 5LB4A 3EWSA 3ZS9A 5HKKD 2EYUA 3GJ5A 3CH4B 3FMOB 3QPVA 4WXPA 2A5YB 1EESA 1E3MA 5B30A 2GXQA 4HLUC 2KE5A 3EPJA 3EW9A 1F3OA 4ZV4A 4DLVA 2V3CC 2WM9B 3CNNA 2QG6A 3VR5A 2J87A 1ZUHA 3EG5A 1HQYE 2Q21A 4J0QA 1GKYA 1QHIA 5LB2A 1QF9A 2GJ9A 2H7VA 4PAOA 4EPXA 2EWWA 1ZC4A 4L9WA 2VYFA 4KFSA 2PJZA 1N2CE 2P3SA 1E9CA 3ZLJA 1A4RA 1U2RA 3VAAA 2D62A 4I1SA 1RW4A 2CL6X 1OE0A 2XAUA 4R71A 3THWB 4Z8XA 2IEZA 2FEOA 4V02A 2FGKA 3KQLA 1EK0A 3ND8A 1E4YA 3C14C 5CLQA 2PL3A 1U94A 3EPKA 4LJ5A 4CRWB 3D31A 3LBHA 4YMSA 2ZYUX 1JJ7A 4K81B 3T34A 5E3HA 4PPQA 4XD7D 1SXJB 4JLOA 2AX4A 1S96A 3BS4A 3ICEA 2IYQA 3CRQA 4PHFA 2YC2C 3NEJA 4QGGA 1S9HA 2NO0A 4HB0A 1KAOA 1M8PA 4GZLA 4II7A 3S1AA 3IIMA 1NKSA 3CPHA 1SXJC 3CNLA 5JEDA 1OJLA 2QL6A 3WMGA 3SDZA 1K5DA 4HLQB 2XZLA 1HURA 1WF3A 3A1SA 2ZRBA 3QEJA 3KQKA 3G82C 4D4MA 4Q5IA 4ZIRA 4PPFA 4N0DA 4V0ME 4DEXA 4DLRA 1Y63A 2JDIA 2X8AA 4F92B 1FZQA 1KSHA 2O8CB 3GLFA 2ZANA 3HJNA 5FTMA 1E2PA 2J3EA 3DHWC 3MFYA 5G3YA 1WCV1 1GM5A 4RKEA 1O3YA 2QPTA 3U61B 4B76A 4XWOA 2EFHB 1SVMA 5FI1B 1L4UA 2CCGA 2RAPA 3PUWA 2FPLA 4LYHA 4XH9B 4F4JA 3ZD6A 5FPSA 2VHTA 2R6FA 1G64A 3ZYCA 1D9XA 3UMRA 1YR6A 5FL3A 5JECA 2HYDA 4KHZA 2JLRA 4K8OA 4ZKDA 3X1YA 1P75A 3EAQA 1S3SA 1Z08A 4GBMA 4D0NA 3TW8B 1GWNA 1C9KA 3MJHA 1QHNA 5ELXA 3RC3A 2YZ2A 1R5NA 2O0KA 4PSVA 2FN4A 1OYYA 2ZUDA 1JBKA 4RFVA 2NPIA 4JLKA 2REOA 3BXZA 4DDTA 1OH7A 5H1YA 2ZJ8A 3WP1B 2F55A 2P6NA 4BFZA 1F2TA 4G1UC 1M74A 1OLOA 1JEDA 1QVRA 3OEEA 5J4KA 1WBDA 4LJ7A 2GJAA 3HYRA 1HTWA 3QKTA 4C0LA 1D8TA 4M22A 1G7SA 2CBZA 4XVRA 4D6PA 3KJIA 4L5BA 3PIRA 1S1MA 3T5DA 1PVOA 1VG1A 2I1VB 2IUTA 2KWIA 2OESA 5DSZA 4C0BA 1Z2AA 1TL7C 1DTSA 4I4LA 1NBMA 2VRWA 1TF7A 1I2DA 4QNMA 3GLGE 4MA4A 4OHVA 4QOSA 1EXMA 5GJVC 5KDDA 4HLUA 2P0EA 4JMPA 1KAGA 1LVGA 3A1UA 5AJZA 4A8JC 3PVSA 3FKQA 5FPYA 3U7FB 3ZQJA 2BBOA 4QHTA 2FSFA 5KU1A 2XXAB 2B8TA 4UNNA 3GCGA 1W47A 5EUMA 4UXIA 4C0JA 2YJTD 2B8WA 2EW1A 2GNOA 5TMPA 5AJWA 1Z0AA 3LAWA 5FTKA 4ASUA 2J7KA 2QPOA 3LBNA 4TT3D 4Q01A 4NHOA 3IHLA 5DIFA 1US8B 2PX0A 3C41J 2ODEA 3FE2A 1AGPA 2E87A 3KB2A 4IHQA 3CX7A 5C2JB 1R7RA 2ZSFA 3SEAA 2AXPA 1VPLA 1ZUIA 1W4BA 3QI2A 3TLXA 2HUPA 4JYCA 1G20E 2EVWX 1HUQA 1M2OB 1J7KA 3I1FA 4A92A 1P61B 2AKAB 1T3SA 1X8JA 2CE7A 4KFTA 1IBRA 2ASEA 1OKKD 2NIPA 3FKSA 2ZI5A 3RVBA 4KFUA 3AUYA 1G17A 5B2ZA 2BCGY 3AF1A 3IBYA 3AVQA 1SXJA 2GVDC 4Q4HB 3AKCA 2Y8EA 4TMVA 3CF0A 3TSZA 2F7SA 3I5XA 5EP4A 4B3XA 5KHOC 2XSZD 2P6RA 1RYFA 3BK7A 3QPUA 2J0QA 2C77A 2V1XA 4DSUA 4NBSA 4DRZA 5KSOA 3DOFA 3W8NA 1IY2A 1E2LA 1II9A 2CLSA 2X77A 2QRZA 4RD3A 1UKVY 3TRFA 3K0FB 3KUDA 4OI1A 1Z28A 5EXSA 3T1QA 2ZRNA 2Z4SA 3O8CA 1EFRD 1A82A 2FE4A 1BIFA 1OV4A 1YRBA 2OBMA 3VHLB 3BOSA 4B32A 3CPEA 3A36A 2ORWA 1T0JB 2FOLA 2QP9X 2F9MA 1DADA 3KX2A 4HLCA 5IK2D 4AKGA 1RIFA 1GNQA 2FEMA 1AS2A 1P9WA 4O2LA 4D0LB 1A2BA 2RB4A 1R6BX 2WSSA 4DLXA 1G4UR 2L0XA 1AS3A 2R65A 4Q66C 3UIEA 1FOEB 1EFUA 5CK4A 1AM4D 1U9IC 2PBRA 2WMOB 5FBVB 2ODBA 1Q22A 1NSTA 1R2QA 2VF8A 1Q3TA 2ZI4A 3W9YA 4MDFA 5KUTA 1OFHA 1G18A 1GP2A 2EFEB 2ZROA 3I61A 3RC8A 5H8WA 4HYYA 4TYYA 6Q21A 3B82A 3AUXA 4V0LA 2W83A 1B23P 1T3HA 4PZYA 4U5XA 3ZS8A 1Q3HA 4GNKA 4PX9A 3DM5A 1R0XA 1TEXA 2LCFA 1HA3A 1P7CA 4GMDA 3AVWA 1P60A 1NJFA 1EWQA 2G3YA 3LO5A 5FL7A 2QEQA 4JLMA 1ZCBA 3NIBA 1ZW6A 4M0LA 1CBUA 1ZMXA 2ZEJA 4D25A 5J40A 4BFTA 4LBWA 3KB1A 4OI4A 3IILA 1N5JA 5H70A 4NYJR 4E5UA 1TQ4A 2MSEB 2CLDX 3GFOA 4CYMA 2PH1A 3OZXA 1VKJA 5LPNA 4A4DA 4A0GA 5KNBA 3VR1A 1FNNA 3OE7D 4GZMA 1EFCA 3AV0B 2ZYTX 4ON9A 2QT1A 2Z4RA 4BGDA 2XXAA 1Z2CA 2DBYA 3SQXA 2DWPA 2Q0HA 2CL7X 1FFHA 4ZCLA 2ONJA 5KPDA 4BRUA 2ODWA 4PFSA 2GAOA 5AK0A 2XZOA 1X6VA 4GT1A 1A1VA 1NVVR 3HYTA 1P73A 2XTMA 4JVSB 1US8A 3FOZA 2ZAMA 4XSHA 3I4LA 1NIPA 1P3JA 4XWAA 1E9BA 4U02A 1OW3B 2EFGA 3B1VA 4A9AA 4LGMA 5C4MA 2CHVA 5CYPA 3CONA 1HH4A 1E2JA 1CF4A 4A1FA 4ZCMA 5CITA 5IDVA 1W2GA 3MUFA 2ZRMA 2PEYA 3CX6A 4G5QA 5F9FA 4DEYA 2YWGA 5FOWA 1J8YF 1U8ZA 4KV9A 4RD4A 3O47A 4FMCF 4Q4HA 4G0NA 5C46F 2QROA 5HKKA 4JLBA 2GZAA 1XTRA 4BLQA 2DFLA 2IWHA 2Q3HA 2QP4A 1ANKA 5L3QB 5L8VA 4BZQA 4MUAA 2FPKA 2W0MA 1JXMA 4B3DA 1EX7A 3WNBA 4UNQA 3FDIA 4CW7A 5TV2A 3EIQA 2LWIA 3VQTA 5IRCD 1XZPA 4LJYA 1E32A 1D5CA 4Q1CA 2IS1A 3K09C 3SN6A 3K9LA 2YINC 1VMAA 4KBFA 4DT1A 3OESA 2JJ2D 3U44A 3DM9B 1PJRA 1M6NA 1N6PA 2C96A 3ZGXA 2WICA 1E0KA 3CNOA 4NPHA 5G40A 2D3WA 4Q02A 1Q21A 1NRJB 4M21A 2QNRA 5B57C 2WPDD 2C95A 2NO9A 2A30A 1TX4B 3GLHB 4X8OA 4YONB 3OIWA 1F60A 2O8EB 1U9IA 4EFMA 1N25A 1MRSA 1ZNYA 2FPMA 2BV3A 5EE1A 3J81k 4Q4LA 2QGNA 3AF3A 1LFDB 1YQTA 2GZHA 3ZVNA 1Z29A 3VNVA 2G0NA 1LF0A 3FMPB 3W5IA 1RRPA 4LSGA 4I1OA 5FTNA 1IXZA 4F4CA 4D80A 1QHGA 2YV5A 2ZS9A 3D8BA 4MYHA 2WVJA 1GTVA 4KBGA 4LUCA 3IHWA 1P5ZB 3HU2A 3K0AA 1GVNB 3JZMA 5EJEA 1UEIA 2PCJA 2QT0A 2PEZA 4KJZA 3SI7A 3PUVA 1Q1ZA 5JCPA 5CK5A 2XJ9A 4US2R 2RGXA 2ZSAA 2JA1A 4IXNA 2CHGA 4Q48A 1RJ9A 3W6NA 3SYLA 2WJHA 2QE7D 3QY0A 2WAYA 5DI9A 4DCSA 4KODA 1NBMD 4HB3A 4JVLA 2WJYA 4LJ4A 5L3RA 2J45A 4JL5A 2BJVA 4LHWA 1BMFD 1KZ7B 5DISB 2DWOA 1NMYA 3QF4B 3SJBA 2GEDA 2ZREA 3C7KA 1JNYA 1GRNA 3TH5A 4JT2A 1JEEA 2ZTSA 3V4FA 1XXHB 2FWRA 2ZITA 4BPBA 2JCSA 2V54A 4Q1FA 3UMSA 2C9CA 3SJZA 4GOXA 4AY2A 1AKEA 1KK0A 1XEXB 1FNMA 3WMFA 3HPQA 4I1VA 4Y0AA 3C5HA 4TYQA 1DAGA 1WRBA 1X3SA 2B21A 2R9VA 2GRJA 2VBCA 4IOMA 4R2IA 4LZZA 3E70C 4HATA 4HUTA 3NH9A 4M4SA 2O8DA 4RZXA 2F3TA 4LBVA 4P0TA 3HR8A 3H84A 2ZETA 3BJIC 2ATXA 4HLDA 4M1MA 4H1UA 4ZDIA 2BIFA 1UDWA 1QHYA 3U3KA 2Q3FA 2ZR9A 2K5UA 2WJIA 1NLYA 2OFXA 2PLFA 1W36D 4IJMA 3OIYA 4Q9KA 4A2QA 3B60A 1JQJC 1W44A 1RRGA 2WV9A 4F38A 3A1WA 1FP6A 1SKYB 3FPAA 3N70A 1NF3A 4UNSA 2IS6A 1UJ2A 1TQDA 2V7QD 2JLWA 5L3QA 4M8NE 2CXXA 4V0NA 5C18A 4R2HA 3U6BA 1MKYA 2H17A 2ZE8A 2ZR0A 1LS6A 3K09A 3GEIA 3NKVA 3T12A 4BE7B 4D26A 3LH5A 4PPGA 1ZU5A 4TT3A 2ONKA 2CMKA 1G41A 1E9SA 3K9GA 4HDCA 2BDTA 3L0SA 2QP3A 3CKLA 2NMVA 1LTQA 2G6BA 5CIQA 3KKOA 4HZUB 4B3GA 2OFOA 1D2MA 3GJ8A 4LC1A 1ZIOA 4B43A 2IXFA 3HU3A 2Z0MA 1XCMA 2RHMA 1G3QA 1I4DD 2XTNA 5DGXA 5KTYA 4CF7A 4LBYA 3A37A 4GPTA 4HAVA 4TYWA 3REGA 4XOIA 3D7MA 1N6OA 3BORA 4MRRA 4OL0A 1OKKA 4DC9A 2ZJYA 1A2KC 1VHLA 4OK3A 4LOAA 2B6HA 2Q6TA 1E9AA 3GLHA 3TVDA 1XEFA 3FFAA 3ZVRA 1BYUA 1Q12A 4DIEA 5DE3A 1FUUA 2XSZA 1ZBDA 1OIVA 4RCYA 1W4RA 4ZDWA 3RWMB 2GETA 5TB5A 3RWOA 1YRAA 3LV8A 4LDJA 1E79D 1VCMA 4QGAA 2RKOA 4NZYA 2IK8A 3ZIAA 4YC7A 3AP2A 3ADCA 1GSIA 3U7EB 1GKUB 1W0JD 3B2EA 3CWZA 3REFA 5BWMA 4UNRA 2E9SA 2KBFA 3RS3A 4EUNA 4OQNA 1JR3E 4A6PA 1EFRA 4JBWA 4QJ5A 2AWNA 4OBEA 1I4TD 1P2SA 2YVUA 3Q9LA 2QENA 4FIDA 1KNXA 2MMCA 2HYIC 4YMWA 2JLYA 2VSFA 2A5JA 2H18A 4O0MA 2Z43A 2GILA 5EE0A 4PR0A 3BC1A 2FZ4A 2G0TA 4Q9HA 3A6PC 3IQXA 3MWLA 3NC1C 4PO8A 5FPTA 5EE5B 2IS2A 2ZRIA 3DL0A 1OB2A 1XCPA 2ZJ5A 2XB2A 2XZPA 3Q72A 3WYFA 4CEJB 1OH5A 2FH5B 4M2LA 4L16A 5IHPA 3QF4A 2IXEA 1CJUC 4LYAA 4TMZA 4WA7A 1IHUA 2Q9CA 3QE0A 1XXHA 1XTIA 1E2QA 4IDHA 521PA 4OJQA 5FR2A 2VHCA 2EFDB 221PA 4HB4A 1R8SA 3TIFA 3PENA 1IN7A 1KSJA 4W7SA 5JWRA 5FR1A 3V9PA 3CLVA 3GMTA 3B9QA 1XRJA 2BC9A 2RCNA 2VL7A 3U4QB 1G3RA 2KB0A 3PEUA 3KKQA 5UKDA 5G53C 5BN5A 3CRVA 4X8HA 5E7MA 4V03A 4DHEA 1FP7A 1E1QD 2ORVA 1MABB 4PO1A 3R9WA 4RD2A 1KKMA 3A1TA 1KO5A 3AEZA 4RFSB 3GLIE 5D3QA 4IDNA 4MUBA 3GFTA 3M1IA 3FMFA 1IN5A 1ZIPA 5HE8A 4PPNA 3WYAA 1AQUA 1YR8A 1KJWA 4YLGA 1TQ6A 5BQ5A 4LJ9A 2O5VA 2ZE7A 3OHMA 2IYUA 1JI0A 3TUIC 3OE7A 1IJFA 1U0JA 4X8MA 4NCKA 3LW7A 4HZIA 5F9HA 1AZTA 4GI7A 2IA5A 3KJGA 1YJ5A 4KSBA 4LK2A 2OAP1 3SC3A 3ZQ6A 3MD0A 3EC1A 4GFDA 4BZPA 2QU8A 2V9PA 4DKXA 2IEYA 3EIHA 3GJ4A 4HZUA 1RFLA 4HEJA 2WMNB 1RYHA 4HUQA 4QBGB 4Q9JA 1DS6A 1H65A 2ZU6A 1YZQA 3DOEA 3WMEA 1TUEA 1ZM4A 2C8VA 3TBKA 1XMJA 2GJKA 1P2VA 1G4AE 1W36B 2ZYWX 2C04A 4WZ6A 3BFXA 4IVPA 1E2GA 1BYIA 1XNJA 5HR5A 2B7BA 1X1RA 5LBIA 3KQHA 1VG0B 5JS7A 1E9EA 1VG8A 5AJYA 2A5DA 3TGPA 1P9RA 2ZRDA 3F5FA 1BS1A 3UXMA 1W36C 1KI3A 3TW4A 4IW3B 4XSGA 3TE6A 1XJ0A 5FUVA 4DSNA 4HSEA 1KO7A 2IYWA 2V55B 2B92A 2OM2A 1F6BA 2N1BA 2WIBA 1QHXA 3GD7A 3I72A 3QVVA 4KCGA 4XIGS 2BOVA 4HAZA 2NO1A 1Q1EA 2OLJA 5SZJA 4XWKA 1UF9A 2IWRA 3PQCA 3H4MA 3RNLA 3VR2A 1U99A 4DCUA 2IF0A 1DPFA 1Z0KA 2H8KA 3B7GA 1KYIA 4NU0A 5CJ2A 2VHUA 4E07A 4QXAA 2XITA 4DUGD 3TMKA 2JJ2A 1VIAA 3BFVA 2RMKA 5GJBA 3B8HA 4B35A 1XX6A 2LKCA 3EASA 1YVDA 1CKEA 5DHFA 4NCHA 4LWZA 2WAXA 4F93B 2F43B 2PZFA 2WPDA 3BH0A 4MRNA 2UZIR 1NLFA 3P20A 4GRAA 3PXGA 2OSBA 4E03A 2BKEA 3G5UA 4Z51A 3WHLA 5JSZA 1N5KA 4RZ2A 3T1TA 1W46A 1DOAA 2AK3A 4LBZA 3MGCA 2J1LA 4I1UA 1CXZA 1GAJA 5KO2A 3U7GA 4CDGA 4U7DA 3PJRA 4CEJA 2VP6A 2WBLC 2ZRCA 3P4YA 2YC4C 1KIMA 4C2UA 4AI6A 3MLEA 4U00A 4M9XA 2X1VA 3PG5A 2AXNA 1YZLA 3Q5DA 3WBJA 3K70D 4Q19A 3GLGA 4NCJA 1LS1A 3RS5A 1W1WA 2GJSA 3U3RA 2IYVA 1I4LD 2ZUCA 2QM7A 821PA 1OHHA 4Q9IA 1NMXA 2FF7A 1J90A 3I5YA 3NEYA 4A6XA 2GCPA 1MO4A 3NBXX 1W2HA 3GLFE 1Z0FA 3QKRA 5CB8A 2IYZA 2V6JA 2VP2A 1A5TA 2CCJA 4OQFA 2OV2A 1Z6TA 2WHXA 4DLYA 2WWWA 3CRRA 3MAAC 4A8JB 2AR7A 3U4QA 2QE7A 4PC1A 4TN1A 2OXRA 1W4CA 3AH8A 1X8KA 1Q1QA 1F2UB 1IN4A 4AK9A 2QQ0A 1KZGB 3BB1A 4LV6A 1MABA 5JI2E 4GOKA 4QHYA 3UPUA 4AD8A 3MJRA 5FUYA 2CLCX 2C2HA 4MYTA 4RFSA 1BMFA 5JWOA 1KNQA 1N5LA 4M53A 3U7HB 2BHRA 4TSFA 1XEWX 2IL1A 1S1CA 1XBTA 4D81A 1KHTA 5LDDC 4P33A 1GRQA 2ZS8A 4ZCIA 1IN6A 1L2TA 2BMFA 1Z8FA 4TWZA 2EWVA 4DCTA 4YMUA 4OI0A 3K0EA 1G5TA 2A78A 3ZDQA 4TTPA 1W49A 3EZ6A 1ESMA 3RDPA 3TUJC 3QKSB 2AK2A 4CZ2A 1OFTA 4PQYA 2IYTA 4ITRC 4W5JA 4EKDA 4TYPA 4UKDA 4ABYA 2BVNA 2R44A 1E9FA 1KSFX 3L0PA 3W6PA 3BB4A 4PQFA 4TLEA 4WBSA 3WHKA 4PZLA 1TADA 3IIKA 1HE8B 3BBPA 4A82A 3X2SA 5TDHA 2CJWB 2BBSA 3LVRE 1NJGA 4KFRA 5K8UA 3C8UA 2VHQA 5JLJA 4TMWA 2BMDA 4CGZA 2ZI9A 1P62B 1S4QA 2HJVA 1GIAA 3T15A 1LW7A 3DPUA 3AP3A 1G7TA 4JVMA 4Y0VA 2W2VA 4XJXA 4HI0E 2BMJA 4JVNA 4TTQA 1R0WA 4GMXA 5FBWB 3C16C 3C5CA 1GNRA 2W2TA 2Q9BA 4JT4A 3ZIAD 3VR4A 4JYBA 4C4PA 1T8TA 1P6XA 4JSTA 3NG1A 2V7QA 2C03A 3K53A 2FG5A 3ASYA 2QZ4A 2VEDA 2VSOA 2ZAOA 4NMMA 4NYJQ 1G9XA 2IYLD 5KDLA 3LXXA 5AUNB 4PZZA 2IYYA 5JWHA 2W6ID 1CJVC 4DT1B 4ZDKA 4BEJA 2ZR7A 3U44B 1QG4A 3TJZA 3EZ9A 1XP8A 1DBSA 1Z07A 2AWOA 2G77B 5DYGA 5EP3A 4BFWA 3PR1A 3CH5A 1AA9A 2GDJA 2WWFA 2VQSA 4DCVA 3VFDA 4N1AA 3DZ8A 4G01B 1UBGA 3SYKA 5FBLB 2B7CA 1NVVQ 4G3XA 4G5SA 1HT1E 1ONBA 2F43A 1U98A 1VIYA 3QOFA 2HXYA 4H1VA 4LPSA 1SXJE 4L8GA 5CLLA 4OK5A 1GL9B 1CU1A 2GF0A 4C9BA 4C0HA 2RGDA 3QXXA 3EPLA 4TL9A 3TUZC 4XTRA 4MRPA 3PEVA 1KI6B 3K0AB 1E79A 4KYIB 4ESVA 1D9ZA 4KVGA 1RZ3A 4LJ8A 5L3SB 3WRYC 4TLDA 2ZRLA 2J7PA 2GZDA 4KXFB 4TL7A 4NYMR 1E96A 1W0JA 2OT3B 4N0EA 2GCOB 3RYTC 4C0SA 2GJ8A 3FMIA 4V0KA 5CJPA 5DI3B 3CWQA 5KNDA 2EYQA 4NCIA 4BWYA 1RJ9B 5AWFC 4FWTA 4TLAA 4PHTA 4CIDA 2FSIA 2ERXA 3LLMA 5EZ5A 2ZI3A 1DE0A 3R7WB 1X1SA 5EQTA 4A2PA 3QXHA 1W5TA 1XCGB 2CVFA 2IW3A 2R62A 3DVLA 4BUJA 4A8JA 4A0FA 1HE1C 4NTZA 1II0A 2MMGA 2JLUA 4Z54A 5CB6A 2IUUA 1F2UA 2O52A 1XD2B 4JLVA 1CULC 1WB9A 1BKDR 3LLUA 1H8HD 2GKSA 2AN9A 4QBHA 3NBYC 5CDFA 2FFBA 4FXPA 1U8YA 1II8B 4BFXA 4AYTA 4Q7MB 4F4IA 1VYUA 4BFSA 3QIAA 3OIUA 3SJAA 4A0HA 3UMFA 4MGKR 1TNDA 3K70B 2CEAA 3U2QA 4FN5A 5A4JA 2IHBA 3CF6R 3I3SR 3M0EA 2VP0A 3EZ2A 2O8DB 4JJZA 3VKWA 3V00A 2F1HA 3AVVA 4EAQA 4W9MC 3K70C 3QKSA 2KBEA 2VP9A 3CPJB 1GZSA 3W34A 3IPYA 4B2PA 1Z06A 1TF2A 2E1RA 1C1YA 1VTKA 3C4JA 1OIXA 3NC0C 3OIVA 3QSYA 5JJIA 1V5WA 3U3JA 4YDSA 5JEEA 3BE4A 1SHZA 1VCNA 1U90A 1E1QA 1EX6A 2XOKD 1KMQA 3BAFA 1HQCA 3HR7A 4C30A 2CJWA 3HPRA 2WKQA 1ZYUA 3I8SA 3TVTA 3SFZA 4R9UC 1QHHA 2BJWA 3VHXA 4E09A 1E4VA 2WZQA 3UK6A 1XMSA 2DYKA 3G0HA 4Q7KA 4QNRA 2FZLA 4FWIB 1ZUNB 3R8FA 4UXHA 1KI8A 3IIJA 4KI0A 1AIPA 5AUPB 5G3ZA 3GPLA 1TU4A 1OT3A 5TARA 3H1TA 2ZI6A 2P65A 4TZ6A 4HAXA 4LX0A 4IFEA 3E2IA 1ZNXA 4Q21A 3VTKA 2X2FA 4B3BA 1FW6A 4Q1AA 4C7OA 5ANRB 4MYCA 3ND9A 3GJ7A 5HZKA 4P4SA 5AUQA 5J47A 2AHOA 4IDOA 2OBLA 1DAFA 1K5GA 3MWKA 3AF0A 5JHGB 2YWFA 2QRNA 3I32A 3T1VA 2CE2X 1LB1B 2GA8A 1OIWA 1CTQA 3NWJA 4RVCA 2OHFA 5FUWA 2X19A 2ZRGA 1IONA 1YHNA 2VSXA 2PLRA 3FHCB 2GBLC 3HP1A 4B3FX 4LY6A 421PA 1MRNA 4NDZA 3B1YA 4LC0A 3OFNA 4QBIA 2Q3MA 5DH9A 3F8TA 4AG5A 1OFUX 4TYNA 4RD6A 1NP6A 3L82B 1MH1A 3VU9B 4DLTA 1NSFA 4FCVA 3BB3A 3PEWA 2R2AA 5BYKA 2OUKA 3PUXA 1WBBA 4NYIR 1XTJA 2QQEA 4YDHB 1NG1A 3CF2A 3C15C 121PA 1HT2E 1ZCAA 3KTAA 4BQSA 2W6JD 2FGJA 2XNDA 1HEIA 5EZ6B 3R8CA 2DR3A 4LRWA 1KI6A 1T3LA 2G1KA 4WXRA 2GESA 1COWA 2UKDA 2DCUA 4EPYA 2QGZA 3FFBA 3QENA 4X8LA 5L3SA 1OXVA 2ERYA 1OHHD 1JPJA 4QC2A 2GTPA 2J46A 1Q57A 3B1XA 3LVQE 2GCOA 2QORA 1NN1A 4UXJA 2VP4A 4NH0A 4JL8A 5DI3A 5E7IA 2CVHA 3QG5A 1SVSA 1GDDA 4DUGA 3QNUA 5J4YA 1OXUA 1R0ZA 3L2OB 3VR3A 3IEVA 4PSAA 3ADBA 3R7WA 3CIOA 5FBRB 4C0KA 2J0VA 2AFIE 3B9PA 2QMOA 1XF9A 1XEWY 2GAAA 4OKSA 1TQ2A 2A9KA 3I92A 2ZJAA 1XD2A 1WMSA 3DKVA 2HLDD 3AVXA 1KK1A 1VECA 5DNYB 4NL4H 2ZI7A 4QGFA 4TSFD 3AF4A 1DEKA 1NKTA 4ZI2A 1KI2A 1G6OA 1II8A 2R6AA 2ZSBA 3KDSE 1JR6A 2PZGA 1NN0A 1R4AA 3AVOA 4PAMA 4B71A 1OXXK 2ANBA 3B5JA 3LRPA 4NKRA 5BN3A 1DAEA 2YKGA 5HE9A 3K8YA 4BASA 4LYJA 4BFYA 721PA 4MGZR 2REXB 3TKLA 4LCBA 3SZRA 4ACBA 3FHTA 4GL2A 2F9LA 3H2YA 1G3IA 3W8RA 1R8QA 3R9XA 1LY1A 4OI2A 4OQXA 3T06B 1LF5A 4DBLC 1T5IA 3B1WA 2ZRHA 1QDEA 2AL7A 2REBA 2ORIA 2QAGC 1E1RD 2FV8A 1E9DA 4JS0A 4PTLA 2PCLA 4B74A 2ZS7A 1VCOA 3AVTA 3ECCA 1KDPA 3N2IA 5GJCA 2NO6A 1WXQA 4D0GA 2FNAA 3QBVA 2BEJA 4M1SA 5B64A 1E69A 1EFTA 4JJKA 1UBEA 2W58A 2HEIA 1GKIA 1N6KA 2R6DA 1KO1A 1G7RA 4OHYA 2BBWA 2ZVQX 2IXGA 4WIAA 1N6IA 1NNEA 3RS7A 5P21A 5FTLA 1UAAA 2CNWD 1IN8A 2OCAA 4AURA 5JBQA 3RS4A 4CEIB 1DELA 2WJGA 1QVAA 2RHDA 3KXLA 4KLNA 3TNFA 3ZVLA 4L15A 3SQWA 1EG7A 3TAUA 1DAHA 3SU8A 3MWYW 2GBLA 4HUQB 1CJKC 4AYXA 4G5GA 3WP0A 3P1JA 1SULA 1IXSB 1TMKA 1G21E 1K8RA 3WXMA 1ESNA 2Z5FA 4DB2A 4Q7LA 4US0R 1XB2A 4PANA 1TUIA 3SOPA 1FL9A 2RGCA 2GXSA 5IF9A 3L8ZA 4RD0A 4FD2A 1G8PA 2WKPA 1G8GA 1IQPA 2VA8A 3PUYA 2OE2A 1AGRA 1SGWA 4QKQA 3QVUA 1T6NA 2ZE5A 2PMKA 2RGAA 4BZXA 5J5CA 4JSYA 3VU9A 1O87A 5D3MB 2YOFA 2J59A 4DXAA 4HB2A 1OB5A 3AKYA 4EQ6B 3RRYA 3JVVA 4YMTA 3U3MA 2CL0X 3VR6A 2J7PD 2F1IA 4GSYA 2ZUBA 4PSKA 1G8FA 4WZBE 2GHIA 4DDVA 3VKGA 4TLCA 2C99A 3OEHD 2D4HA 2QUZA 5HTKA 2W6IA 3EIEA 4XTCS 3U3OA 3P27A 4G5OA 5JJLA 1KY2A 5BN4A 4HAUA 1KJZA 1KMHB 1P9NA 1JJVA 2OAQ1 1KOFA 1Z0DA 2BEKA 4GOJA 1Z0JA 4LV5B 5F2EA 1TEVA 3W6OA 5EP1A 1UKEA 1X8LA 4P4TA 2J9RA 3P4XA 2ZJZA 1G5RA 5FOUA 4EPVA 3BFKA 1AKYA 2AFHE 4O25A 5JSZB 1Z47A 3TQCA 4MQBA 3FB4A 4TMKA 4E22A 3GLHE 4I81A 2HT6A 3WNDA 5FOVA 3ASZA 2IX3A 1N6RA 2WWGA 4QFMA 5EP2A 3KJHA 2DPXA 4MGYR 4C2TA 5SZHB 3GLGB 2HF9A 1NLZA 1ZRHA 3U60B 4MRSA 4O3MA 1M34E 2P2LA 5E7JA 3GLIA 1YZTA 3KZ1E 2G83A 2EFCB 4M1TA 5BXQC 3I8XA 1G5PA 1CRPA 3AVPA 1N6HA 1XJQA 4B2IA 1K6MA 1MO5A 3QKRB 5GADl 4JKIA 2FJUA 4Q7JB 2NPFA 1S8FA 3Q3JB 4O2RA 3U6KA 2QAGA 4W5WA 4PXAA 1DAMA 4RJLA 2RGEA 3SBDA 1XPOA 2J0SA 1KI4A 2PT5A 1G6HA 4HAWA 2VO1A 3KJEA 1ZM3A 1E94E 1LV7A 3FVQA 4DDWA 3FTQA 4B47A 4D4JA 4FW9A 5FOXA 3AVUA 1FQJA 1YZKA 3LQRA 3ADKA 1H8HA 2OFWA 4AWXA 2AD1A 1YKSA 3VX3A 1XU4A 3NHAA 4LYFA 3Q7PA 1AK2A 2FSHA 4ILEA 2OCYC 3IKJA 4KO8A 1E2KA 1PUIA 1XXHE 3E5HA 4IEIA 4MRVA 3DEFA 1Q20A 1NL3A 3MRSA 4KSCA 3UKDA 2WTUA 4GP6A 1NY5A 2IUSA 3NXSA 4IFBA 2J0UA 2C98A 3ICQB 1S2MA 1SZPA 1ZD1A 1U8AA 3RSLA 4EPTA 2XNSA 4AKIA 4URUR 4CEIA 4KAXA 2JLZA 2GF9A 2WOJA 4RD1A 1E99A 5K8IA 2N42A 1JECA 4AG6A 5FI0B 3N5CA 3W5JA 5JFGA 3X1ZA 3L43A 5K8TA 2GEUA 2IYXA 1IJEA 5DN6D 4FMDF 5L3VA 1R5OA 1E2MA 1ETUA 4DZZA 3OF5A 3AQ4A 3W3AA 1GRRA 1D2NA 1PLLA 2OLKA 2QMEA 4V0MA 1RVDA 5GVRA 1WDTA 3OFND 4Q47A 3VX4A 2XOKA 2XJ4A 3UATA 1XJCA 2IF2A 1XPUA 3LQQA 1MO6A 5JRZA 2XB4A 3W90A 4CVNA 4FMBB 1U0LA 3NBFA 4UJ3A 1KKLA 2IHYA 3TQFA 1Q0UA 2GXUA 4M9QA 1KY3A 1SVLA 4MDEA 1UBFA 3ZVMA 4IXMA 1IAQA 2ATVA 4M1OA 3THXA 2J41A 2XNDD 2ZPTX 1FX0A 1SKYE 2ZSDA 5D3MA 1IM2A 4WZAE 4PC6A 4JIMA 1COWD 4EQ6A 1RKBA 5K8LA 1XTSA 4H9GA 4JLDA 3L0OA 1NVXQ 4ARZA 2ZSEA 2XGJA 2OEPA 1H8EA 1YU9A 4PC3A 3IBGA 4MKHA 1G16A 3RHFA 4C3ZA 1Z0IA 3AM1A 3A4NA 2C9OA 1E2FA 2NQ2C 1DVRA 5HCNA 5FTJA 4URVR 3IO3A 5KNCA 3F0TA 2ANCA 5DHAA 4YMVA 1Z5ZA 2NTYC 1OF1A 1Q1BA 4AYWA 4EJSB 1DG3A 1E98A 2UVQA 4UNPA 4KVAA 4TTRA 1KMHA 4IOLA 2FA9A 3AKDA 5J4LA 3Q7QA 2D06A 3SBEA 4TLBA 1GFIA 1P72A 5JCZA 2DB3A 4IEEA 4BLRA 3K0CC 4EJSC 1NG9A 3IEUA 1HV8A 1XWIA 5AR1A 2VTKA 3CRMA 5J4HA 4TZ0A 5KSYA 1E0SA 3LX5A 2AKYA 2Z83A 3B6EA 2R6GA 4IRUB 4LI0A 4ZPXA 3M4YA 3CRW1 3SHWA 1Z6XA 4EPRA 3TR0A 2PMDA 2D7CA 5A5GA 2DY1A 4RZUA 1Z22A 5EXTA 1VCIA 3DMDA 2W6JA 3KKNA 3TR5A 2PX3A 1MOZA 3WRXC 4HDQB 1WP9A 3RABA 2HCBA 4Q9LA 3LX8A 5SZIA 1NVWQ 1UADA 3FWYA 1KDOA 3FYHA 4PAQA 4PO9A 4EDHA 1VHTA 4MYUA 2H5EA 1WA5A 1R10A 4NP6A 5JHHB 4CEHB 2MSDB 1ZINA 4B2LA 2F3RA 2JIZD 2IC5A 4JL6A 2CK3A 3F3YA 3GJXC 2A3RA 1GOTA 4ZDJA 1GILA 1YE8A 4US1R 1UEJA 3RRZA 1W0KD 3SNHA 2ZXUA 3KFVA 2HDNB 2V6IA 3U5ZB 3Q85A 5M04A 1KDTA 5C1BA 3RAPR 3MSXA 1TU3A 2HLDA 5CM9C 4DJTA 1JAIA 1TF5A 4EFNA 2NZ8A 5KYKA 2XX3A 4JBYA 2BWJA 1WE2A 1Z6GA 1RE0A 2DHRA 2ZRPA 2OXCA 3HDTA 1JAHA 1VYVA 2DFNA 5TXGA 2H1LA 4PC2A 2XTZA 2OG2A 4V0OA 3CBQA 4OHZA 2GCNA 2A5FA 3LNCA 4QM6A 4N3NA 5KOYA 3KUCA 4LJ6A 1QHSA 1QRAA 1UBCA 2D2EA 4JKYA 3KKPA 5FFMA 1WQ1R 5EE3A 3T61A 3L0IB 5JJKA 3QUSA 4A0RA 1DARA 1PLJA 3VNUA 2QM8A 2VP5A 3K1JA 4QHSA 2QA5A 1Q44A 4DDUA 2WOOA 2SHKA 2ZM5A 2C5LA 2FFHA 5FOTA 2J5XA 3CZQA 4TQ9A 3ZZUA 4NYMQ 4Q18A 2A7QA 5F3WB 2FSGA 1JR3D 5JS8A 4DCNA 1E1RA 1NBME 4QGHA 1QHHB 3DO6A 4B3CA 1N0UA 1SHKA 2CHQA 4QL3A 4YXWD 3NDPA 3EC2A 1FMJA 2PZEA 4IDQA 1PLKA 1P2UA 4D2IA 3THWA 2ZJBA 4XVQA 5TVKA 2JAQA 1X86B 3LW8A 2FDCA 4BLTA 2WJJA 3GJ3A 5FOSA 4L4UA 2OBNA 4FI3C 1S3GA 4TQAA 5FH9A 1T5LA 4B6EA 4BRWA 4C7OB 5HCIA 1OYWA 3W3ZB 1TTTA 2JJ1D 3GJ6A 1EWRA 1G1MA 2XEXA 4CT4B 1LNZA 4P4SB 4MKIA 5AJXA 2CNWA 4XVUA 1HYQA 4JLJA 4LHYA 4BFUA 4OYHA 4AIIA 2ODNA 1YZNA 4A2WA 4EIWA 2JLSA 4P32A 1DAIA 3WYGA 4GP7A 1GL6A 1ZD8A 2N46A 4EJSA 3K0CA 3O8BA 1KK3A 2HCJB 3E1SA 2KSQA 4URXR 1J8MF 2VPPA 1KI7A 1SVIA 3AB3A 1T0HB 4KLZA 2JEOA 1F5NA 3QJYA 4P3YA 1NIJA 3SYNA 1RRFA 1R5BA 2H16A 4IVRA 2IYSA 4DLWA 5HPYB 3BRWD 1RC8A 3NDBB 2O8CA 4B33A 1Z3IX 4FMCB 3LFUA 3OAAD 2WJVA 4PQRA 3VKHA 3KTAB 3QPWA 5G41A 5IT5A 4RY2A 5FBQB 1QBKC 3EA0A 3FGNA 4M9ZA 3FHOA 5CM8B 1G3MA 4TL8A 5E4FA 1UPTA 2VHJA 2VF7A 4JBXA 1B0UA 1CP2A 5SZKB 2PT7A 3GEEA 2YYZA 4LV8B 1NI3A 1L4YA 2JJ8A 4Z1MD 1MT0A 1TPZA 3OEHA 4POAA 3B78A 5BYJA 1L8QA 2BBTA 2CCKA 1A7JA 3IGFA 4DLSA 2I1QA 1UFQA 2Q9AA 4CEHA 1GL7A 4L9SA 1MV5A 2P67A 3CB4A 3AKEA 3IPXA 4LHZA 1XTQA 1P2TA 1NVUQ 2H57A 2H92A 1KO8A 1E2IA 1VG9B 2IBMA 3UG7A 1E2EA 1OXSC 4S2EA 2HXSA 1ZD9A 4RSGA 1AJEA 3A8TA 1UDXA 1DG1G 5DO9A 1PZNA 3ETLA 3UG6A 5LD2B 3Q8XB 4JLNA 2QSZA 2O8FB 1XZQA 1CRQA 2QY9A 2ECKA 2OCBA 3A4LA 4Q00A 4F91B 2IT1A 4F7WA 1E0AA 4G5RA 2LKDA 2WWHA 3QXCA 1JB1A 2G88A 3EXAA 5LD2C 1N0WA 1G8HA 2PJRA 3D6TB 1UKYA 1XTKA 1Z63A 2QBYB 3NTUA 1KJYA 1NN5A 4WVFA 4K46A 3ZD7A 1M7GA 2WSMA 2CDNA 2NO7A 3KXIA 4Q4AB 2JASA 4NYIQ 1BH2A 1G8YA 3A1VA 2NG1A 3DKPA 3V4RA 1AS0A 3R20A 4QJ4A 3O8RA 3GFPA 5E95A 4A15A 5F98A 2QMHA 1AZSC 4P4UA 5JRJA 5A0FA 3X1DA 621PA 1J99A 2FU5C 1NY6A 3R9IA 5KDOA 4BLSA 3BGWA 2QMUA 3ZZ0A 3RSOA 3LA6A 1J70A 1YR7A 3SFVA 4R7ZA 1DAKA 3T35A 2DFKB 5CDFE 1E2NA 4JLAA 1ZC3A 5KPJA 1W7AA 3JZAA 1E6CA 1M1YE 1S0UA 2GWHA 1IY1A 2KJQA 1E0JA 2RGNC 4B34A 5J4VA 3QXJA 3KQUA 4PC7A 3PEYA 3UWOA 2ZJ2A 2ZRAA 1H8ED 1XD9A 3X1XA 4HDOB 2FFAA 4UQOA 4ZI3A 4DSTA 1JALA 2BCJQ 2FMXA 1YZUA 3BD9A 1OPXA 1ZVQA 4M1WA 2QN6A 3GP8A 1XMIA 3NVAA 1P4SA 4OHXA 4ESHA 2C78A 4DSOA 2ZE6A 1QG2A 2NGRA 3CZPA 4MKGA 3B1ZA 1T9HA 1FTSA 1N5IA 5DN6A 1D6JA 3B13B 5TY0A 4UJ5A 5BW8A 3L8YA 4URZR 2JDID 2IYRA 1PV4A 1XD8A 2OCPA 3K0FA 4TMXA 1E2DA 3SR0A 3DDCA 1IY0A 1M7BA 3QEOA 4I99A 4IOKA 1CR4A 3TSOA 2P6UA 4ZO4A 1ELOA 4RKFA 4QRHA 1BO6A 5FUXA 3P32A 4ACAA 4LPKA 1ODFA 1HY3A 1KSGA 3VMFA 1IXRC 3HU1A 3MWJA 1Z6YA 5EXXA 3RS2A 1T8UA 2Z6VA 5JMTA 1KK2A 1OH8A 1YR9A 3NH6A 2W00A 3EARA 4C0AC 1FQKA 3THYB 1TAGA 1EGAA 2BMEA 4XD7A 4BLOA 2RGGA 1KI9A 2ZU0C 4TMTA 1N3BA 1W4AA 2VLIA 3IDQA 4AKEA 3THOA 1N6LA 4MITA 1ZU4A 2CK3D 2OZEA 3WNCA 2WWYA 1SVKA 2O0HA 1ZM9A 2R6CA 3GJ0A 3K9HA 2O8BB 3SE0A 3H86A 5DYIA 4URYR 5AUOB 3AP1A 2ZVPX 3BH6A 2V1UA 1E9RA 2X2EA 1U0HC 2ZIAA 5EUQB 3SJCA 4BFVA 4YQFA 3CX8A 1Z6AA 1XDBA 2EQBA 4NCNA 4B44A 3OEED 3PUZA 2JLVA 5EXPA 3QF7A 2OILA 3T1OA 2V8OA 2QPAA 3RS0A 4MH0R 3QG1A 2EU8A 3P26A 4LJAA 4A36A 4AKHA 2HT1A 1ZAKA 3AGPA 5AJVB 2O8FA 2VIIA 2TMKA 4GDFA 2ZJOA 2A2ZA 4EFLA 3I73A 1XMVA 1SQ5A 4DIDA 1XPRA 4NE2A 3LBIA 2HF8A 3A58B 2G1JA 3IQWA 3QKUA 3GLIB 4MKFA 3EX7C 2R8RA 3NHBA 5C4GB 3TK1A 2YHSA 3RLFA 2GK6A 2QBYA 2RH5A 3LDAA 4S35A 2BKUA 1KO4A 1Z83A 3LY5A 3ZZTA 4WW0A 2FX3A 5GVSA 1UM8A 4FINA 2D7DA 2DFTA 1ZNWA 3RRNA 1S9DA 1GG2A 3LD9A 4Q4AA 2W0SA 2QAGB 3MCAA 2P5TB 2JIZA 5GJWC 4WOPA 1CR0A 1C4OA 4HAYA 1UKZA 1E2HA 4Q1EA 3O8DA 2F1JA 3H0KA 1XFAA 2GK7A 3D3QA 3GQBA 1W0KA 4ASUD 2YOGA 1KDRA 2HJGA 1W48A 2JATA 3TSWA 2WWIA 8OHMA 4OQMA 4W5HA 3X1WA 4Q4JB 3KXKA 5DLQC 4B48A 3KKMA 2GXAA 1OH6A 4MGIR 2QI9C 3GEHA 1GNPA 3EPHA 4BECA 5JI3E 2YWHA 2RGNA 3A4MA 1SKQA 4C0QC 1G19A 1N6NA 1AN0A 4OK6A 1NN3A 1T91A 4B73A 3QXSA 4Q1DA 3MMPA 3IO5A 3FKSD 4PHGA 1ZJ6A 3WBKA 2J0UB 2ZYVX 2YNMA 1DO0A 4RCZA 2HV8A 4EPWA 4P31A 2DWQA 1SVWA 3SHFA 1SXJD 1L7VC 2BM1A 3PCRB 2G9NA 4D82A 2VH5R 4ZKEA 2O0JA 4NONA 2MSCB 3AVYA 5EE9A 1CJTC 3BIFA 4IOJA 1CS4C 3CW2A 4FCTA 4B6FA 1MO3A 2QTHA 1CEEA 2V4ZA 4B75A 3AGQA 2KI5A 1CLUA 2P5SA 1W5SA 4IDPA 2D2FA 1MR3F 4IVQA 3CR8A 5FPHA 3ADDA 2ZQ5A 2QSYA 1JR3A 1G3UA 4WAUA 4D4LA 3KFXA 3KL4A 4M9SA 4Q1BA 1VYTA 1OXTA 3HWSA 1J2JA 2GVZC 4YXWA 4M1KA 1JXOA 1NMZA 3THXB 4TQUS 1OSNA 4URWR 1DO2A 1FX0B 4JLPA 3T5GA 3TAHA 5HZHA 4QBFA 1KGDA 1ZNZA 4DLUA 3ZH9B 2OO7A 3WY9A 1G7CA 1JPNA 4ARZB 2IS4A 5CIWA 2YOHA 3EA5A 3K9NA 5FPKA 1D2EA 1PUJA 2WSSD 4RZ3A 2JGNA 5CYOA 3CUEF 2JJ1A 2ZRKA 3DZDA 5JZVA 3THYA 5KSPA 2FFQA 3S1AB 3ZJYA 2GEVA 2O8EA 2JLQA 3LWNA 3N2EA 3LXRA 3BH7A 3CR7A 2WWXA 2D74A 3ONWA 1CR2A 2O8BA 4ZIRB 1YZGA 4FMDB 2YWEA 1CJMA 3M6AA 2RGBA 2I3BA 2W2XA 4Z8YA 3GLFB 3RANA 4DVGA 3B85A 3RRMA 4DLZA 3EZFA 1T4GA 1Y3AA 4Q03A 1BOFA 4QJ3A 3EWAA 3QQ5A 2JLXA 1OFIA 3OAAA 4JZKA 1RRCA 5FL7D 4QM7A 4IKEA 3PITA 4LHVA 4R98A 3UWKA 1U81A 2NZJA 4BEBA 3MG9A 3AF2A 5IK2A 1ZP6A 2UZ3A 1FTNA
chains in the Genus database with same CATH superfamily
2GBPA 3QE9Y 1OILA 5B37A 1BG6A 2ARKA 4Q3DA 4RJIA 1XMQB 5AICA 3RHZA 4OXIA 1GA1A 5IYZF 3CM0A 3LOUA 5HRCA 4Z1MA 1JS1X 5I8PA 3H5WA 4DB4A 1KRWA 4ERNA 2GPTA 1HZZA 5IAAA 4CT5A 1N0VC 2VDNB 4WKPA 2DKFA 3QE3A 4ND1A 3C6ZA 4YAWA 3P2YA 1CR1A 3ROPA 3Q88A 1NRIA 1ZFNA 1L5QA 1DBWA 4H1HA 3T3DA 2EJBA 3CVXA 1GTJ1 3GPDG 4H3VA 4RMGA 4AKTA 4KPFC 3TO5A 1JQ5A 2I6XA 5DK6A 3TXYA 4YRBA 4CI0B 1VLMA 1XDGA 5K1ZA 4BU1A 1YTUA 2J07A 3DLAA 4MQ4A 4OQLA 1WEHA 2DETA 3VPDA 3AL2A 4PAGA 4M1YA 2SKDA 4BXOA 2WINI 2JHAA 3VNAA 4C7KA 3R7BA 1W88A 2F6RA 3RT1A 4RM2A 3K0SA 3NBZC 2IDJA 2PGXA 1X7DA 4UW9A 4IO1A 3UOWA 5JPDA 5EIXA 1QGED 5B3LA 1Z3CA 1DPGA 1YGPA 2CBGA 3ZGOA 5ITWA 3GZ4A 3QBTA 4D3YA 4KV7A 5IXYA 2HBZA 3I2KA 4NMHA 2F1RA 1JIIA 1T5BA 2QTFA 4KBYA 1FYXA 1IPHA 4PBRA 3SSOA 1R3DA 1NJSA 2C2GA 3GJ5A 3QPVA 4WXPA 5E6RB 4ZWNA 2BI7A 3K73O 4HLUC 2L17A 3UTCA 1NOKA 4CLEA 3MTIA 3EPJA 1IEXA 1F3OA 1CSEE 2X4DA 1PFKA 4UBNA 4ZV4A 3ZV6A 3CNNA 1KH1A 2E4UA 5NLLA 3SZLA 4FKZA 1YFZA 2A88A 3EG5A 1HQYE 2EXXA 4J0QA 4KR9A 5JC1A 5F3RA 1QHIA 1CVIA 1RM4A 3JVDA 4OH7A 4DA9A 3VRHA 2GJ9A 2H7VA 3AEQB 2EWWA 2VYFA 4KFSA 4S05A 1E9CA 3ND5A 4QQRA 3LUAA 6LDHA 1U2RA 2W6NA 1ZEJA 5LYJA 1SOVA 2GEBA 3SHOA 3TLMA 1RW4A 4RVNA 3V1LA 1YB4A 4R71A 1FVHA 3SF8A 3THWB 4K9QA 2FEOA 3CVUA 2ZT7A 1N7IA 1UZLA 2C92A 1N2JA 3SVZA 4A91A 4EGJA 3UK1A 1E4YA 2WYUA 3B53X 1XCBA 3U4IA 5CLQA 3U40A 2Z5GA 2PL3A 4RU1A 4CL0A 3EPKA 3JXEA 3O31A 1YSCA 5IKPA 2O3QA 3F78A 1D03A 3LBHA 1JJ7A 3LIIA 4F9GA 1KGSA 3SR3A 4JR0A 1CIVA 1J97A 1UZMA 2WSBA 1KJ9A 2B25A 4NOMA 4IHJB 5AT1A 5B1YA 4PHFA 3GGGA 2YC2C 5JD6A 3QLVC 1S9HA 2NO0A 2WKWA 3UH1A 4BN0A 3QY9A 2EC5A 4BMPB 3IIMA 1X2BA 2MSNA 1FFDA 4DPLA 5JEDA 3EEIA 1TJ3A 3S2ZA 4Q93A 4TV8A 4CLXA 1YWGO 4AMYA 2NAFA 3C74A 1Y5RA 4BFCA 4HLQB 5K0CA 4B87A 2ZDQA 1HURA 2RHLA 2ZSJA 3A1SA 3F7NA 4IF4A 4LY3A 4NCNA 3QEJA 2XNJA 4RIIA 5JAPA 3PPIA 4MQFB 3T0FA 4Q5IA 4ZIRA 2GN2A 2R5WA 1SC3A 3EQ9A 4ARBA 3NYWA 4KUEA 4V0ME 5GOTA 4DEXA 4HT3B 1FZQA 4WKBA 2WVAA 5IBPA 5HX7A 3GLFA 3HJNA 1JDSA 3DHWC 3PCTA 3GAFA 5G3YA 4DY4A 3V8QA 3OG9A 3ZKWB 3B9BA 3U61B 1LRKA 1XAJA 2WU1A 4XWOA 3PDUA 4OBWA 1J7JA 1L4UA 3ZBUA 3RTCA 2RAPA 2FQXA 1SXHA 1CC1S 2FPLA 2YV1A 3H11B 3LLSA 3PUWA 4XYGA 1HKHA 1TIPA 1RLMA 2WVHA 3ZD6A 1G64A 3NJRA 3ESCA 1D9XA 4GQBA 1G8KA 3WV4A 4V39A 3UMRA 3L1UA 1W9MA 3VM6A 5FL3A 4R5HA 5IFKA 2I7TA 2HYDA 1QB7A 5DGCA 4K8OA 1ND5A 4RVFA 1WB6A 3TDKA 1QDLB 5ALGA 3WXBA 1S3SA 1Z08A 2R6JA 4P82A 1I7DA 4D0NA 2FETA 3TW8B 4RDHA 2V58A 4NV1A 3LX6A 1P19A 1EDEA 2XVYA 3I76A 4RGQA 5CX1B 3V1MA 4DQLA 3BHMA 2XLBA 3MJHA 2RHHA 1I24A 2PE5A 5CHYA 3NBUA 4ZQCB 5ELXA 2XA9A 1TDJA 3LBYA 2YZ2A 1YUBA 1LQTA 4I4IA 1DX6A 1QKJA 1XA3A 4M60A 1OYYA 5LOVF 2ZUDA 5ALJA 3S2EA 1L4BA 2REOA 4EGSA 4DDTA 1OH7A 4DMFA 4NQZA 2V9ZA 1YAHA 2P6NA 1Z5NA 3DLPX 3QVXA 5A3RA 4UM5A 2Q5FA 3IOYA 3L6UA 3TDNA 1OLOA 3GJSA 4PGMA 5DLEA 2W2QA 2GK4A 4X24A 3UKJA 2GJAA 2NACA 4C0LA 3F2VA 1QLWA 4M22A 1G7SA 3OZTA 4XVRA 3KPVA 3IV9A 3B3JA 3I12A 3B48A 3PIRA 5D01A 3HKEB 3GNSA 4B4KA 1OBHA 2NVWA 3SHVA 2I1VB 3ZY2A 1PVOA 3NQ41 13PKA 3P0EA 4C0BA 4IZIA 4C4TA 1DINA 1TL7C 3MINB 1DTSA 3HB0A 2VRWA 3OP1A 4QNMA 4AXBA 3GLGE 4QOSA 2CXOA 1CNEA 1W73A 4L8YA 5GJVC 5KDDA 2P0EA 3MS7A 3VSEA 3OVMA 4A8JC 4NZZA 5AJZA 1WW3A 3N0TA 5BSGA 1AQ6A 1O03A 2IU0A 1Z8HA 5E6RA 4ZCQA 1AOXA 2RG1A 4M7PA 1OI7A 2J0EA 4QHTA 1D3AA 2FSFA 4KQ1A 5KU1A 1FFCA 3JQFA 2B8TA 2IXAA 4FHZA 3GCGA 4UNNA 5EUMA 1BD4A 1DQRA 1NE2A 4C0JA 4YCLA 1AX9A 2ZOSA 2GNOA 5TMPA 3R24A 1BE0A 1DXQA 4KR2A 2J7KA 2QPOA 4X1KB 3ZR4B 3WIUA 2J8ZA 4Q01A 4NHOA 1I3MA 3DOOA 5LQSA 3IHLA 4ETIA 1US8B 3AEQA 3DL7A 1PFWA 4BDTA 3SHQA 3FE2A 2KM1A 3SX2A 3ZZ1A 5AVXA 5HFNA 5E0KB 3HB4X 2QMQA 5CA0F 1ZEMA 4I6JA 1I9CA 2HH9A 2QQ5A 3DHVA 3OWXA 2GHQA 1G20E 4B7ZA 3A2NA 4WXMA 2B37A 1M2OB 3I1FA 1DX9A 4PLCA 5HP4A 1UPUA 2AKAB 3GEDA 2EL7A 1QIJA 4L3OA 3QUTA 4B4UA 1IBRA 2P27A 4HVCA 3CZ9A 2NIPA 4RLQA 1QRTA 4CKYA 2OMKA 3X1JA 2QJTA 3SMQA 4IQ8A 2BCGY 3SC4A 4Z7JA 3PKIA 3AVQA 4HDMB 4J0KA 4P54A 4Q4HB 2B9EA 5LMNB 2C42A 4JJAA 2F7SA 3I5XA 1E4OA 5EP4A 4BNLA 5KHOC 2Z30A 4ZGGA 3MOSA 3WK7A 1SU7A 1U3FA 4OLHA 3W2TA 3WGQA 2CV2A 1Z4OA 1SA0A 4P5PA 3I04M 3DOFA 5K3FB 1IY2A 2CLSA 2PU5A 3HKDA 4ZAZA 3W8NA 4CGYA 1KTIA 5JXHA 1JEOA 2YJ5A 2XHZA 5HUQA 1O94A 3GP3A 4E2ZA 1XAGA 3OD5A 1M3SA 5EXSA 3H2SA 2Z4SA 1F2VA 2DPHA 3O3MB 3STWA 2PMFA 1X7WB 3F46A 4J0EA 1EFRD 3MWDA 4L27A 4E08A 5KVAA 1F8GA 1OV4A 4GHWA 4UU1A 5TPZA 3AM4A 4B32A 2NWQA 3ZKWA 3A36A 4L5YA 4LIPD 1XNQB 1DADA 3KX2A 5IK2D 8ADHA 1XPJA 4ZYXA 4Q12A 2ID4A 3F3MA 3OPVA 4K3VA 1IZ7A 5LQKA 5TEVA 5JD5A 2DFDA 4O2LA 4QDZA 4D0LB 1XDSA 2Z3VA 3DD5A 4UXIA 2YBEA 4G4IA 5HIJA 4ZOLF 4JEIA 4LMRA 5D1NA 5BVGA 4GOMD 2R65A 1E9VA 1H2WA 3AEUB 4MHOA 2W7TA 1FOEB 1EFUA 2BRUC 3ZCTA 1Z5GA 5JAUA 1QIIA 2P40A 3HQ4O 3SXJA 4KLAA 3TW8A 2VC2B 4GKBA 5JAQA 3C1TA 4AP5A 5CX1A 3QPBA 2R8XA 5AK3A 2Q1YA 5K09A 1QYRA 3B6KA 1NBEA 2G5GX 4J16A 2ZI4A 3W9YA 1OX4A 2QHXA 5KUTA 1LBIA 3WTBA 2JGJA 4E7OA 2AZ4A 1IHPA 3HBJA 5AW9A 1KY4A 4TYYA 3B82A 1QXSA 5H81A 3DP9A 3PFBA 1LEHA 1CUGA 4G0PA 4U5XA 3ZS8A 1Q3HA 3DAYA 1OXBB 3DM5A 5JZMA 3HA5A 4BJ1A 4AZ0B 2P9GA 3GDGA 2LCFA 4NMWA 3KK0A 1JB9A 3DLIA 2BFDB 4GMDA 3IFSA 3KOUA 1DBRA 4MW7A 5BSKA 2G3YA 4NVRA 1EWQA 1A04A 2B8EA 1E60A 2FR0A 1DOZA 4HZGA 4LQ4A 4D0SA 3FN4A 1UK8A 3KEFA 3RYFB 1CBUA 1ZMXA 1RTKA 2E4ZA 3L8FA 3AIIA 3CEPB 4W1SA 3MINA 1H2YA 1CY6A 3USES 1LI4A 1JV2B 1S2GA 3JZFA 5GONF 2MSEB 4CYMA 5AXAA 3WLEA 1M1YA 1VKJA 5AHKA 2IIQA 2J5RA 1EA7A 2FCRA 3RFVA 5C3MA 4CG0A 2QVBA 1WVIA 4E5SA 2QT1A 1WHSB 2Z4RA 3A06A 3NPAA 2DBYA 2YASA 4HO1X 1SJ9A 3G1TA 3BTUA 3KOMA 4QTZA 2B35A 4U0KA 3SQXA 2PX4A 4Q3AA 1FFHA 1XUOA 1Y1SA 2WJWA 1W6UA 4EDFA 1PV2A 1JWAB 1XQWA 3HRIA 4X1KA 3ASVA 3CSDA 4G09A 1A1VA 1N9ZA 2A84A 1O96A 4PE5B 1US8A 3ISVA 2ZAMA 3T4XA 1NIPA 3U13A 4BNHA 4U02A 2EFGA 3B1VA 3E9YA 4A9AA 3HXTA 5BSEA 3DEHA 2L82A 4NAUA 2O7SA 1G21B 1XRLA 2LR0A 1Y37A 3DZJA 4W1QA 3CONA 3VJRA 1LI5A 5JU6A 2J3KA 5HYVA 3KFLA 1V16B 3JYHA 5ESRA 3UB2A 1U6KA 1T3ZA 4B4WA 2BY4A 1GUFA 2ZRMA 3E03A 2C7RA 3NETA 3WBFA 4R7GA 5MGNA 3CX6A 2JRCA 1URPA 5F9FA 1J8YF 4UTNA 4RMJA 5IXJA 4RMHA 4HDMA 4RD4A 4Q4HA 5AM1A 4YP1A 3VZCA 4CCYB 5HKKA 2D8AA 3H1FA 1A9SA 1UPAA 4DKJA 1B8PA 1V96A 3IQDB 5KKNB 2WC1A 3WMWA 2IWHA 1BD3A 3CUKA 3KQWA 1ANKA 2XNHA 5L3QB 1L7DA 2XH8A 3EE6A 3BXHA 1G0OA 4BZQA 4WZBB 1AKNA 2UZ0A 3QKIA 4KRYA 5G2OA 4B3DA 1G8MA 3IAM6 2SKEA 3QVLA 3D8TA 5LZ9A 1RLUA 3TPFA 1VHWA 3IX7A 7MDHA 1MEOA 3VU0A 3A6JA 3SR4A 3VVCA 1D5CA 3F3KA 1MRZA 2JFNA 1X7WA 1IMOA 1SC6A 3K9LA 3KZNA 5EJ4A 1Z25A 3HUTA 4NAVA 2GNPA 4XJVA 1VMAA 2VQ6A 4KBFA 4M54A 5HDBB 5E6SB 5KTSA 4IMIB 1QGOA 3WHIA 1RP1A 1B4DA 1EXNA 1J42A 4BJ5A 4ZI7F 4FHFA 1TAUA 3O03A 4HHEA 1ABBA 4KAFA 5EJ5A 1RP7A 1NRJB 4M21A 2AFHB 1UODA 3LUBA 4OP3A 5B57C 4HDKB 4W5QA 1Z34A 1OWPA 4FOLA 3G68A 1TX4B 3GLHB 3K8OE 1CYDA 1HZJA 4N5MA 2O8EB 3BL5A 4JQCA 2O4UX 3A1EA 3KKLA 3NWEA 4MP8A 5HFJA 3J81k 1A76A 3B12A 3PF9A 3AF3A 4C2AA 1LFDB 2XB9A 3AEUA 1DIHA 2WZDA 1VIDA 3PE4A 3QLUC 3UB3A 3MGGA 1LF0A 3N6VA 3QMVA 1RRPA 1SC1A 1JSLA 1NJ1A 1W5BA 2E4AA 4TS9A 4W1RA 2VJCA 3U4HA 1F1JA 4XW2A 4F4CA 3FCCA 2VQ3A 1WXGA 4KXYA 1QHGA 2YV5A 2ZS9A 3H2HA 3T94A 1VE7A 2WK1A 3WLIA 2A0WA 4EPTA 1C4KA 1NNI1 4KBGA 4LUCA 3HU2A 4JB3A 3K0AA 4M7RA 5EJEA 3JZMA 5I4KA 1XVLA 2JNWA 2PFGA 3VZRA 2CVOA 5A4KA 4LAFA 4BUCA 3SI7A 5E38A 3FH0A 4JXJA 5JCPA 3IUBA 5DWDA 2QUJA 4LDQA 2JA1A 3A2LA 4DG9A 4AZ0A 5CH8A 4WI1A 5I7FA 2QE7D 5G0VA 2BFDA 1YQEA 3MM4A 3QY0A 4B0OA 4DREA 2C20A 4HB3A 4JVLA 3G2QA 3RYFA 4DBVO 1PT7A 1ZGAA 3QWBA 3V4VB 4D8XA 1NLMA 1MX9A 2ATCA 3PE3A 1BMFD 4IFIA 3TNJA 1ODJA 2C9MA 1NMYA 3GMSA 2H7CA 4GRIA 4Z4HA 5HBRA 6REQA 5KJEA 3QUQA 4B31A 4R16A 2HMUA 4N7BA 3BFPA 4HGPA 4EVRA 2BSQA 1AE1A 2ZITA 3FTEA 2JCSA 1AZWA 2Q3DA 2FN9A 4Q1FA 5DTEA 4YP6A 2VSQA 4GPIB 3SKXA 4J75A 5CT6A 1E62A 1KP3A 4XWTA 4ETNA 1BA2A 3VC2A 3PYLA 1FNMA 3PDHA 1RCTE 4L9AA 2ZSKA 3J80A 1V47A 1GEEA 1PQ4A 1WHSA 2FLVA 4I1VA 4J3FA 1A5ZA 1PUXA 3C5HA 2EG9A 4TYQA 3QYFA 5FLYA 1X3SA 2QIPA 1AC5A 5TMBA 2GRJA 3NTQA 3ZCQA 2HA2A 4HUTA 1HEUA 1PJ2A 2JGDA 3RM3A 4LSWA 2ZBVA 1G0NA 3L3BA 4FBGA 3SEFA 1HOTA 3PX2A 4RZXA 3GCXA 1IH8A 5GV7A 4DLAA 5AW5A 3HR8A 1U65A 3H84A 3VTAA 3ZWAA 2ZETA 1UCFA 1VCHA 1LNQA 4HLDA 3GOQA 4M1MA 4Y9DA 1KP9A 1HDIA 3K6JA 5BN5B 2X1HA 4FKBA 5HEKA 4DMKA 4JHLA 1R9GA 4ONEA 4ZDIA 4KQIA 1G21A 2X3UA 2Z58A 2OBXA 3DEJA 4BTEA 5F7XA 5B6JA 4H4DA 3EVGA 4IDCA 3VYVA 1V16A 1HFJA 4WE3A 4IEFB 2ZR9A 3REOA 2WJIA 3DHYA 1X9HA 1B74A 3RB8A 4CLHA 4UDNA 4EGFA 2NVBA 3P9PA 5JSHA 4IJMA 3TLAA 2ZIEA 3N75A 3OFJA 5HS4A 3DJYA 1JQJC 2P2NA 3RV4A 1QK5A 2ZQZA 4Z7NB 5I3CA 2JK1A 2PBZA 4CCYA 2QV7A 1FP6A 5KNDH 1EXVA 4TXJA 2QLBA 1NF3A 1IM8A 2JJQA 1M0TA 1TQDA 1O94D 3GT7A 3CE9A 4FOSA 5IVDA 3W77A 1GYPA 4M8NE 2CXXA 2G80A 5L3QA 1JEYB 2JLWA 4WZBA 1FYWA 2ZE8A 4ENUA 1DX4A 2EP7A 3GEIA 5I4CA 3QQPA 4D26A 5LZ2A 1N3IA 3ICCA 2ONKA 1TVCA 3K9GA 2KHZA 2PMCA 3NONA 1CUXA 4D9IA 1TM5E 3I2IA 1O57A 4XCXA 3TNYA 2Z2YA 5TPZD 4KR7A 2DUUA 4HZUB 2OFOA 2FZCA 3H5IA 5KQSA 1UK6A 1MX1A 1B3RA 2Z0MA 1LVHA 2RHMA 5E6SA 4I2NA 4BP9A 5FJIA 4BATA 4CF7A 4BAZA 3DWEX 5I6DA 3A37A 1XJWA 5J43A 2PD6A 3REGA 3WA7A 2XF2A 3D7MA 1N6OA 4U8HA 3ZUPA 2AFHA 4HDKA 2BFOA 4M0FA 5DLYA 4OK3A 4DNFA 2Q6TA 5J2UF 3GLHA 1JFTA 3ZVRA 1QP0A 1YRHA 3RS9A 1TO1E 2NO4A 3LY7A 1KXJA 1D0IA 4DIEA 1OJ7A 3F2IA 1YDWA 1W4RA 4HQFA 5K7SA 2FN3A 4YAFA 3RWMB 3DCJA 4LKRA 4LVCA 3IA7A 4RA9B 3LV8A 2H07A 1E79D 1VCMA 2GZ3A 2WJPA 3FD8A 3I30X 3P2IA 2XVAA 4NZYA 3W5SA 2ID7A 4RWEA 1L4HA 3F5QA 3RARA 5IH7A 4YC7A 3AP2A 2GR9A 2I8CA 1GUBA 3TZLA 3REFA 4IICA 4CPDA 4CJXA 2E9SA 4UNRA 1USVA 1QYWA 2A1IA 2DULA 4OHUA 3ZY4A 1J9EA 5KNDD 2VNJA 4BNDB 2PMWB 4JBWA 4RHEA 3STTA 2XGGA 4RVOA 1UBRS 4P93A 4CIXA 1TQHA 1Y81A 1P2SA 2QK4A 1YRLA 1QPZA 4B5KA 4FIDA 1KNXA 2MMCA 2ZG6A 4YMWA 3VNRA 4PG5A 5KB3A 2A5JA 1NPTO 3NYRA 1CVRA 1GVHA 5EIOA 1YL7A 2QYSA 1B2RA 1JDBC 3EFBA 3GGJA 4OP1A 3BC1A 3MUOA 2X0FA 1OQAA 4QQNA 1GGEA 1U2EA 2ZTMA 5D7NA 5B7GA 7REQB 1USKA 4HCJA 3IT1A 4EYQA 1IU9A 4FW8A 3V8MA 4AMZA 5DM4A 3QU5A 1CDZA 1NRXA 4M87A 2HSGA 5IVHA 5JCJA 1WZNA 2HSWA 1K8YB 1NHWA 3GI1A 4BWVA 3NYIA 1Q7RA 2IXEA 1C2TA 4G89A 1I6MA 5E1BA 4BMZA 3FNIA 1DJLA 1R4ZA 1ST2A 4TMZA 4WA7A 1MF7A 1I94B 3CKMA 4UNIA 3FIJA 3WIOA 1XTIA 1E2QA 2BGKA 3Q6IA 4IDHA 3RVQA 4LZOA 2DJIA 3C7CB 2D5LA 4HB4A 3E5MA 4HEHA 1KEVA 4AQDA 4BNYA 5D5QA 1CEYA 2BHSA 1U3DA 4IMJB 1HDZA 2WT9A 4KQ6A 4NCBA 1C3EA 2V65A 5JWRA 5FR1A 1HKUA 1YASA 3V9PA 4TM8A 3AJAA 4M8IA 4C21A 5LBUA 5I45A 3WI7A 1BS2A 5ADWA 3FWNA 5MHTA 2ABWA 2OK8A 2E89A 4EP1A 6AT1A 4JI4B 2OGSA 4U0JA 1NJ6A 5FYDA 2VT2A 4YIHA 4C08A 1H2BA 4FFMA 3N2GB 3UKOA 5EEHA 3N7AA 5BN5A 3L6DA 2P9CA 5E7MA 5REQB 1UPXA 1E1QD 1K08A 4ALNA 2XWJI 4M0CA 1N2CA 4RD2A 1ISJA 1CWUA 2UDPA 3E2MA 4BVLA 1KKMA 3A1TA 1KO5A 2TMDA 2RK4A 3Q2KA 3NHKA 4RFSB 3GLIE 3KR2A 1TW3A 5D3QA 4IDNA 2RJNA 4MUBA 3GFTA 4Y6GB 8LDHA 3C5WP 3RBVA 1QQAA 4Q3CA 3C5EA 2QD3A 4Z99A 4O02B 1GG9A 3DSRA 3HYNA 1TQ6A 2F48A 2BSAA 3N86A 4CFYA 1ZJYA 1ZK0A 4QUDA 3TUIC 4DSAA 1EEHA 1PEAA 2IXBA 4X8MA 5C1OA 3L6BA 4C04A 3LW7A 1JEYA 1U0GA 2C97A 5DP1A 4ZVSA 5LKRA 5IC6A 4QDJA 3UYLA 3WLMA 2PV0A 4NRDA 3EC1A 1KZ1A 2Y6UA 3DVQX 3GBPA 3PEFA 3TZEA 1J24A 1ISGA 3R4VA 5AKZA 5GINE 5LDHA 1CP3A 4D57A 3HGMA 2BM8A 2VAMA 1ACMA 3VKFA 4HZUA 4V2UA 3L02A 3MS2A 4BE4A 1RYHA 4HUQA 2WFLB 4BO8A 1QFZA 3G6KA 2CLHB 4JEMA 3TOZA 2ZU6A 3DOEA 4O1MA 5HDQA 4QEZA 3PDIB 4D9KA 1FDWA 3D0OA 4HG2A 2TS1A 4X7PA 5TS3A 1SFRA 1W5FA 2GJKA 1P2VA 2I8AA 5J3JA 4C7VA 4QGBA 4IVPA 4PZ0A 1BYIA 1Z26A 1YS1X 1XNJA 4YA6A 4Z4FA 3GBSA 1X1RA 3O8OB 1H2FA 2QU7A 4YJHB 1BVHA 3BULA 2Q2OA 1VG0B 4IJ5A 1V5EA 2W6OA 3R76A 1ZH8A 3OJ0A 1W36C 3PR2B 1H2EA 2H59A 4WK4B 5BNWA 1ABEA 3HL0A 4X62B 1U7TA 1YHYA 3P96A 2PO7A 1ISSA 1UJBA 5CFOA 4CIBA 1E3QA 2IYWA 2N1BA 2SCUA 2JGEA 1QHXA 1A9OA 1R88A 1Y8QB 3I72A 4G0OA 4GYWA 1IM5A 4RULA 4HAZA 1XRRA 1J39A 2OLJA 2P8SA 4MP6A 4XB2A 1V7QA 5FO1A 1UF9A 3RVLA 3PQCA 5EA2A 1XA0A 1ZZGA 1TECE 1GZDA 2IF0A 1DPFA 4ZVTA 5AM4A 4EZEA 1KYIA 1VL5A 2A1UB 2OCGA 1OLXB 1D8AA 1YBVA 1YJXA 2JJ2A 1VIAA 4KE6A 4B79A 4JY7A 5GJBA 1JW9B 1FU4A 1XX6A 5AVUA 2IPLA 3EASA 2HU7A 3H5TA 3N8NA 1WDWB 3S2IA 4KQJA 4LWZA 3PVCA 4YUXA 1DUSA 2PZFA 5LZ8A 7REQA 3DE2X 3JQAD 4OHBA 2N0SA 3PXGA 3QH4A 3TB4A 3U1VA 4IR7A 4RLSA 3LWBA 1SUPA 1UPFA 1UWLA 2XPCA 2AK3A 2Y3IA 2HADA 1GPMA 1GAJA 3U7GA 4KWEA 4DPKA 4U6SA 3PJRA 2WZBA 3P4YA 3UVEA 2ZRCA 2ORED 1KIMA 1GPUA 1YA8A 3HCAA 4FLMA 3FFTA 4XQCA 4LI3X 4DCMA 5LUAA 4NV0A 4EQZA 5AVYA 3O4FA 3U3RA 2IYVA 1I4LD 2N47A 4FR2A 4ARAA 7GPBA 4N39A 2YRXA 3U4DA 3BSFA 3AHCA 2VDMB 5IJ0B 1NMXA 1N34B 3TPCA 4MQMA 3I5YA 1JKJA 3GOHA 1JFLA 2IEBA 1KA9H 3KZMA 5BNZA 3GLFE 4EF4A 2RI1A 4U2KA 5A5EA 5JSYA 5BWBA 2FFRA 1C8BA 3X3HA 3O38A 4G4JA 3RG8A 1U9CA 1WHTB 5CVJA 5EZSA 2ZBGA 4YAUA 3F8WA 1X70A 1Y9EA 2QD4A 4PC1A 1VA4A 2PBLA 1VPVA 1W4CA 4QFBA 3UJBA 4D9MA 3UAOA 5REQA 2QQ0A 4R1MA 3IVCA 1IJKA 3OF3A 2JFYA 1M6EX 4K6HA 4QHYA 5CVTA 1V8FA 1IHOA 2CLCX 1VOTA 2IOHA 3G0DA 3IP3A 3QUBA 4RFSA 5JADA 2RHGB 3NS7A 4W6ZA 2LDBA 3U7HB 1W85B 2XIJA 4RWZA 1J00A 5BSTA 4C7MA 2BHRA 5JTUA 1ZPDA 2G8NA 4LJLA 2BFCB 5ALXA 5KI6A 3LT0A 2G06A 1E6MA 5LDDC 1EGMB 4P33A 2GUWA 3RKRA 2Q5JA 4YMUA 2PRSA 1I3OA 3CRZA 4AZVA 5CW2A 1U1IA 1EJ0A 2P7HA 4MWOA 4YLEA 4BGEA 2FP3A 1M8JA 2Z9DA 2Z1MA 1JHAA 5I7AA 1HT3A 1OFTA 4BOYA 3CF4A 2RK6A 3ENKA 1W93A 2XZDA 4P8RA 3SKVA 3T4PA 5DM60 3Q6NA 4TYPA 3FYUC 4N54A 2QN8A 3ETNA 5LQRA 2BVNA 4CV3A 2Q50A 1KSFX 3BK1A 2V0CA 4F45A 1O5IA 3SLKA 4TWAA 2VJLA 4UAVA 2WTAA 4GBED 2OZPA 2YHUA 2GK3A 3NHMA 3ANMA 3PX3A 3CMCO 1GO2A 2X1LA 3QV2A 4JNKA 3P0RA 4YMHA 1E1MA 1HE8B 2GPBA 4P81A 5EFOA 3HO1A 1TFRA 2Q1TA 2WIJA 4XVCA 4ZZ1A 1RXEA 3K35A 3IIEA 4TRJA 4OREX 3JAWB 2WM2A 3LVRE 3I23A 5K8UA 5LZ4A 2HMVA 4CDRA 2HWXA 4ZQEA 1NYTA 2ZI9A 1S4QA 1YAJA 3TD2A 3DPUA 1SBCA 2BMJA 3O8OA 4JVNA 4TTQA 1IQ0A 4YJHA 4F9FA 5FWNA 1HGXA 4QWMA 5IKMA 5LP6F 2W2TA 1KVRA 2A86A 3DDUA 4JYBA 3VR4A 2V7QA 4ZQFA 4QUAA 2IKQA 3ASYA 1DAPA 3GLTA 3NT5A 2QYTA 3ZTWA 4NYJQ 3TFOA 4RF3A 3T7DA 1IBMB 1YMUA 3MUNA 4PLGA 5AUNB 1Y8QA 2WTXA 2OOKA 3S70A 5ITSA 5E3JA 1VSBA 4DT1B 2ZBQA 3O2QB 4RENA 3U44B 1XALA 3KELA 4KACA 3T95A 3GD5A 3W2EA 3AI2A 2G77B 2P4SA 3NDJA 1KQOA 1HSZA 3AHJA 3K6KA 1OLXA 3JQ7A 1H2XA 2L18A 1I10A 2VNAA 3K9QO 4BFWA 2AUTA 2RHCA 1KMCA 4F6CA 2GDJA 2R751 1GKLA 3T9FA 3IBCA 3IELA 3WKBA 4A5OA 3SYKA 4UQPA 3UUEA 2B7CA 3DZKA 4EYKA 1KEPA 3WK4A 2QTTA 3Q3EA 5IVIA 1FDRA 3KLOA 3O93A 3W79A 2PSSA 4L8GA 5CLLA 4Q0MA 4F3RA 5JS1A 1IB0A 1KBOA 2RARA 3TX2A 2RGDA 2WAMA 3HHPA 3KSZO 3QXXA 4ENRA 3EPLA 1QGUB 3H2IA 4O63O 1Z5VA 4MRPA 2AR9A 3IEIA 2IE8A 3LLVA 1N7JA 4YJFA 5L3SB 2AKEA 3M70A 3EY4A 3CSSA 4BQRA 4OEHA 1JHOA 4UUOA 5TQ2B 5HZGA 3IDSA 1W0JA 4CTOA 4MXDA 4N0EA 2B2CA 2ZBRA 3RYTC 1WXFA 2C94A 1PYDA 2C8LA 3K5HA 3GRPA 1Q6YA 1TMYA 3KHSA 4R9VA 5IJ0A 4YECA 4C4AA 1L5GB 1QIEA 2EJUA 1V1MB 1SELA 3N3AC 4IZ6A 3WGZA 2FSIA 3HLKA 4P7GA 3R7WB 1X1SA 2VAXA 5DT2A 5EQTA 4H17A 2GEFA 2AZMA 2IW3A 3DVAB 3O8LA 3H5RA 4OQYA 5CB6A 3TFQA 4HBZA 3LL7A 3I9KA 4B9EA 2RB5A 3CS3A 3OJXA 5KQLA 1CULC 3OZIA 3L4KA 1BKDR 1E7MA 3E81A 4AZTA 2Q1XA 1H8HD 2QUIA 1ZMRA 4MMXB 4QBHA 4F72A 5LNK1 4H6PA 1XVUA 5TIIA 2HJ9A 4DNOA 1TEHA 4IQGA 3L5KA 4MQ5A 1W6RA 3DV9A 3UHPA 2EOAA 3HE3A 3AF6A 3S6JA 1MJNA 1O4VA 4FUTA 5A3QA 2NYAA 1BE1A 1EGHA 3B36A 1ZMBA 3OLXA 1WBJB 4F4IA 1L8OA 5GGXA 4BFSA 4KOEC 1E77A 4A0HA 5JH7B 3IAHA 4MGKR 1TNDA 5FV7A 2ZAIA 2ZTLA 2CEAA 3U2QA 3K70B 2WG2A 4Q7QA 3L7LA 1ZUWA 4I55F 2JCYA 1GTZA 2VP0A 3EZ2A 3LHKA 4MWTA 3VKWA 4MI6A 1Z15A 2G36A 5EYPB 3SS9X 4RX1A 2I99A 3ZJUA 3TSAA 2EW8A 1RVV1 2CJPA 4KNVA 1XZAA 4D8YA 1SK8A 1UR5A 1M1ZA 3AR2A 4O4HF 3OIVA 1C1YA 2IYAA 3JVEA 2BGMA 5DBFA 4XYEA 1BEUB 3OY7A 5JJIA 1JYFA 5A62A 1RYZA 3I2FA 4YDSA 1RI2A 2WLSA 1IBKB 1QCYA 4OQDA 4UD6A 1U90A 2HRBA 1ML3A 4BNWA 2Z6QA 4MK4A 4N3AA 5E6UA 2WM8A 3VA7A 4C30A 4GWLA 1Y4ZA 3AESA 3IODA 4CDMA 5B7QA 3JAWA 3I8SA 4CE6A 3EGIA 1JZSA 1C2YA 2YY5A 5K0LA 4BS9A 1XMSA 3O4HA 1ORWA 2O3TA 4DYVA 3EG9A 4EYGA 2R1TB 2IUEA 1ZK1A 2VF4X 3N39C 4JU8A 5AUPB 3VU1A 1AIPA 1IOVA 1X2EA 3ILXA 3SJUA 3E82A 3H83A 1TU4A 2NV6A 1T4BA 4GZ6A 4BB9A 3FOEC 3DKIA 5D7BA 2ZI6A 2I7CA 4J2HA 2C88A 3HFRA 1S2IA 1SR8A 5TF0A 1Z88A 3RRXA 4Q21A 3TZKA 5EQFA 4ZVOA 3EEOA 1RWMA 3R44A 1SCUB 2IOFK 2QG9A 4MYCA 3E9EA 3LQKA 3KQQA 2RGYA 2JBAB 2I34A 3B6MA 3TD9A 3TNDA 5I48A 4HDRB 3MWKA 1BW9B 2JIMA 3N07A 5IW8A 3IT0A 3NWJA 4HLNA 4V3CA 3U37A 3RQIA 5LLTA 3ST7A 3OCZA 4IINA 3C7AA 3FHCB 4X63A 4B3FX 3WOHA 2C8JA 3W4KA 3SQLA 4LY6A 1ISIA 2DFPA 4EI7A 4NDZA 4B3TB 5EKDA 1LPSA 5EWMB 4KXXA 3UBTA 3ZU4A 1CJCA 4LC0A 4QBIA 3B52X 1UK7A 3F8TA 4F5ZA 4UOZA 4TYNA 1KEKA 2AS0A 4TQGA 5B3JA 2AYZA 4ZXPA 2FMKA 4N5NA 4U7FA 3VU9B 2J85A 1ORVA 4DLTA 4BKPA 3GT0A 2R2AA 5BYKA 1WBBA 3QV1A 5J59A 1DJQA 4IHKA 4YDHB 3WAKA 5JW6A 3L1JA 3IB3A 4BQSA 1J1ZA 2W6JD 1NDUA 1ZD2P 1PNOA 3DC7A 1AKWA 2XI4A 2JHCA 3IOBA 4BNMA 3ESBA 3RJZA 4WXRA 1U02A 3PXEA 1RDFA 2ACWA 2DCUA 3MTBA 4QZVA 1KYYA 2QGZA 3BGSA 4HWPA 3PPXA 5L3SA 1OXVA 3MLAA 4YV1A 1V8DA 2J46A 1BDJA 1Z5UA 3M1AA 3OX1A 1C9YA 4K6KA 5IF3A 2ZULA 1OZHA 1S8AA 4U6NA 5E7IA 2VP4A 1M10A 5T4BA 1BGXT 2CXHA 4ZALA 2I7DA 4BVHA 1U9YA 4TOIA 4DUGA 5IN5A 1V1MA 3Q1LA 3RUIA 3PGKA 2OD9A 2O23A 3EZYA 5DFAA 4ZARA 4DMLA 3QX7A 3IEVA 2I8LA 3R7WA 4ZU3A 4IDGA 5D5HA 3ADBA 2VCYA 1E5VA 4JP1A 3L8MA 4CI9A 1FSGA 4PRKA 5CB4B 2IH5A 1RXUA 3VR4H 2PS1A 2QMOA 2WM3A 3G02A 3FPCA 2CD9A 2Y68A 4TUYB 3WDLA 2A9KA 3VAAA 1G9SA 4F1KA 4LXGA 2L2QA 1L5FA 1EP2B 4DNPA 2ZJAA 2FG7C 1EUCB 1I9GA 1WMSA 3DKVA 3B6JA 4UZEA 1KH3A 1I1OA 2PWPA 3LDFA 4AJJA 1TM7E 2C5GA 3WIVA 1JQKA 2R8EA 1DEKA 1NKTA 2CUZA 3RC9A 2V5UA 1YGYA 3IMEA 5EWLB 1KI2A 3V55A 2UU9B 2PXAA 3OHPA 1WW8A 1G6OA 2EV9A 2XCLA 3JATB 2YJZA 1QO0D 3A3KA 4O4JA 3AVOA 2VK2A 2O19A 5JJCA 4IV5A 4X20B 3LOQA 2ANBA 2FF5A 3QEKA 3HYCA 2CZQA 1FXSA 4R8SA 4QUGA 3V8EA 3AJ8A 1UWKA 5ALUA 4UVDA 3ZCRA 4BASA 1BEEA 4BFYA 1I7QB 4R1NA 2I2CA 3Q9SA 2R85A 3IVGA 4LCBA 3TKLA 1ZN2A 1UM9B 2MR5A 4DQVA 1W94A 2F8MA 4ACBA 4L51A 2I03A 1L7RA 2VWQA 4L8LA 2A9VA 2F9LA 3BDVA 1G3IA 1GQQA 3R3HA 4IV0A 1R8QA 3M6FA 1AG9A 4KPEC 4OQXA 2C54A 3EOAI 4R0MA 1T5IA 3HUDA 1XL1A 1S4MA 1QDEA 3CWCA