1FZTA

Solution structure and dynamics of an open b-sheet, glycolytic enzyme-monomeric 23.7 kda phosphoglycerate mutase from schizosaccharomyces pombe
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
211
structure length
211
Chain Sequence
MTTEAAPNLLVLTRHGESEWNKLNLFTGWKDPALSETGIKEAKLGGERLKSRGYKFDIAFTSALQRAQKTCQIILEEVGEPNLETIKSEKLNERYYGDLQGLNKDDARKKWGAEQVQIWRRSYDIAPPNGESLKDTAERVLPYYKSTIVPHILKGEKVLIAAHGNSLRALIMDLEGLTGDQIVKRELATGVPIVYHLDKDGKYVSKELIDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords PHOSPHOGLYCERATE MUTASE
publication title Solution structure and dynamics of an open beta-sheet, glycolytic enzyme, monomeric 23.7 kDa phosphoglycerate mutase from Schizosaccharomyces pombe.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
total genus 46
structure length 211
sequence length 211
ec nomenclature ec 5.4.2.11: Phosphoglycerate mutase (2,3-diphosphoglycerate-dependent).
pdb deposition date 2000-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 1fztA00
3QPUA 4EMBA 1ND5A 3FDZB 2WU0A 4PZAA 1BIFA 3D8HA 3DB1A 2YN2A 3HJGA 2P75A 2H4XA 2HPAA 5AJYA 1C81A 3C7TA 5AJZA 1IHPA 2F90A 3KKKA 1DKMA 1H2EA 2P2YA 2GFIA 3GP5A 3NTLA 1ND6A 5CX4A 1CVIA 1DKNA 4E3WA 3ZHCA 2H4ZA 2EKZA 3D6AA 4PZ9A 1E58A 1V37A 3GP3A 5AJXA 2EOAA 2P9ZA 4ODIA 3F3KA 2A9JA 4QIHA 1SKBA 4ARSA 4JOBA 1T8PA 1FZTA 3IT3A 4JODA 1RIIA 3LL4A 2DWPA 2ENUA 2I1VB 2HHJA 3R7AA 2DWOA 1QWOA 4IJ6A 4D4JA 3E9EA 3MBKA 1C80A 3D4IA 2P79A 2H0QA 2YN0A 2P6MA 2OWDA 2OWEA 3E9CA 1RPTA 1UJCA 4JOCA 2RFLA 1FBTA 3LG2A 2IKQA 4MA4A 4D4MA 2ENWA 3E9DA 3LNTA 3PGMA 2P9YA 4D4KA 3K4QA 3GW8A 1TIPA 3FJYA 2BIFA 4ARUA 4FDUA 1E59A 1H2FA 1QFXA 1NT4A 3NFYA 1DKQA 2HIAA 1V7QA 1BQ4A 3EZNA 1C7ZA 5CU7A 5HR5A 5CDHA 2H52A 2WNHA 2P9FA 1YJXA 4FDTA 3QPVA 2AXNA 4EO9A 5PGMA 3BIFA 3QPWA 2A6PA 1EBBA 3O0TA 5AJVB 1DKLA 4GPIB 2P78A 1SKAA 3IT0A 2P77A 1DKOA 5AK0A 3IT1A 4GPZA 3DCYA 3F2IA 2EKBA 1K6MA 1BQ3A 1SK8A 4HBZA 1YFKA 4ARVA 1UJBA 2P2ZA 3IT2A 1RPAA 1DKPA 1SK9A 3FDZA 5HTKA 4IJ5A 3EOZA 2PA0A 2QNIA 2WNIA 1XQ9A 4AROA 5AJWA 4TSRA 3MXOA 2P30A 3K4PA 2P6OA 3OI7A 4PGMA 4D4LA 1QHFA
chains in the Genus database with same CATH superfamily
2V7PA 1VOTA 5BQ5A 2B2NA 4F1JA 3D5TA 5ADHA 2Q2WA 3TFOA 4OKNA 3SIPA 2JHAA 4XUGB 4FXPA 1AN9A 1C3XA 1U1GA 4GBMA 5C5DA 1CS4C 1G20A 1EUCA 4ALKA 4GSLA 3S2FA 3A6KA 4TZ6A 1IZYA 3IURA 5AJZA 2YNMC 3FOCA 2V7VA 1FX0B 2E6UX 3K9WA 3PX2A 2IC5A 3UT0A 1BU5A 1KJ8A 4YWHA 3V7UA 2C4KA 5HQJA 3PUXA 5AICA 3FPFA 3WKBA 1C0KA 1A9TA 4TWJA 4HAVA 2LIVA 4DPMA 5E2BA 1I4WA 1Q1BA 3P45A 4I9UA 4MVYA 4RKYA 4HPWA 2ZWOA 2J3MA 4F86A 1XRNA 2Q2OA 1ILEA 1CR2A 1HI9A 1RJ9B 2HOQA 1K2VN 3G1WA 5CDFE 3OF2A 4V39A 3T5TA 1SCNE 2ZK7A 3ABSB 2IYLD 4UZSA 4ZT4A 1UP4A 5IKOA 1JQDA 3NAZA 3WDLA 1QWOA 4ALLA 2A1UB 1HE3A 4BFTA 5DCYA 1HLPA 3JR3A 2G25A 2OXTA 3GEPA 3LPAA 1C80A 3WLPA 4WFJA 2HK8A 4U6QA 2DUMA 5TF4A 2XGOA 3KIPA 4CKBB 3PCRB 1D3AA 3LUGA 3LQ2A 2G17A 5FA5A 3WGHA 3NCHA 2JBWA 5C52B 3GCXA 4DMRA 2IPNA 3V1UA 1NI4B 4OIMA 2P4QA 5IT5A 4KMOA 3OQPA 1A3CA 2AN4A 1HZZA 4C76A 2CLHB 4G8JA 3T7TA 1MFPA 3EA0A 1Z36A 1AUXA 1GCUA 3OCVA 3KSUA 2BV3A 1TIBA 4B3IA 2GF9A 1D1TA 4PN3A 1IVSA 3GF4A 3ZUPA 1NP7A 1EUDB 2XSZA 1ZN8A 4G63A 1FPQA 2RGWA 2ARKA 4BMOB 1FFGA 1RBZA 3C43A 3DPIA 3MQ4A 4V38A 2JI4A 3AESB 1E6WA 3M6FA 2NO9A 5FAXA 2UUCB 1FTNA 4A0GA 3LCJA 3E3MA 2YIVX 2AKEA 3TRJA 1R64A 1OB2A 1P2SA 1BKYA 3KTFA 3OQ1A 4UBIA 4CM6A 3G68A 1DKOA 1I0IA 1B26A 3D6NB 5IBCA 2PX5A 2G6BA 1IEXA 1P0MA 2FX5A 2FZCA 4GVXA 3IUMA 2GBCA 4ZDWA 2FWPA 4LCJA 2VYVD 3CBGA 1U11A 4BNDB 3VQTA 5L7YA 4F3KA 2ZKLA 2KI5A 4IH4A 1F4VA 4WCFA 4AIIA 4DCGA 5C32A 4RMNA 2A2ZA 3C24A 1RPAA 2Z9CA 3JZMA 1UR5A 2PRKA 1KIMA 3TXAA 3GPIA 3NB0A 1E1MA 2XCOA 1TVCA 1Y5LA 5HQ3A 2CFRA 2PX4A 1RRMA 3JWPA 4TSRA 1HETA 5GVRA 1BA3A 1FXUA 1YDEA 5CVCA 1OUMA 1QQ6A 4X85A 4D44A 2V74B 1QHFA 4LHVA 1E9SA 3WKCA 5KJ1A 3TM4A 2A0UA 3ENZA 2FFQA 3NHMA 4OQDA 4UVHA 5CM8B 1LU9A 2OO3A 5JVDA 3DAFA 3UWMA 4DW8A 4JCOA 2YVAA 3CZ4A 4HTFB 5T67A 1OQAA 1WWKA 3A4TA 4YMGA 4J8PA 1CP3A 3UA4A 1OX4B 2XNHA 2VF7A 3BTSA 3BDAA 2XUZA 5JPCA 2NUPA 4CUZA 3STHA 3AVUA 2EHJA 3QIAA 4NCXA 1VRWA 3TRDA 1M34E 4DSOA 1KEWA 2HWUA 5L4SA 4B4DA 3V7YA 1GUYA 3FB1A 4LXYA 1Y8AA 2EKQA 5EGNA 3P2YA 1XZIA 3GRVA 1SOVA 2QYTA 5CEFA 4JYAB 3L18A 1KYXA 4GOLD 3BE6A 1X39A 4IV8A 1XPRA 3D7LA 2O2JA 1L4HA 2BSAA 1XZMA 2O50A 5FL7A 1WPGA 3DE1X 1GM5A 2ZS9A 2FJ0A 5HMLA 2O0JA 3EXHB 1PEKE 3N6RA 1W4CA 1B6SA 1FUKA 5B4TA 4A8JA 1GNQA 3EA5A 4C20A 3R7WA 4OX9Y 5EZYB 4C0HA 4AJHA 4B8YA 1SOUA 3A1CA 4KVGA 1M7GA 3V1NA 1X1TA 1V4VA 4GZLA 2JLXA 2ZWMA 1LJUA 2I3ZA 3DEYX 5KVVA 4G5HA 3ONEA 2RHMA 1CRQA 2QQ5A 4FKBA 4LV6A 4JI6B 5E0KB 2EKDA 3F49S 5D3MB 5KWJA 1IFXA 1JQ3A 4MKFA 3W6UA 1UMBB 1L3CA 4EMUA 1EH5A 2W2OA 1USWA 2A67A 4CMIB 1S7GA 4IG9A 4Y0AA 4IIUA 3ETGA 4EFDA 5C53B 1VKZA 2QGNA 4G5YA 1AKRA 1PF7E 3E2IA 1AKYA 2BIFA 3EEYA 2VI5A 2J3IA 4MVJF 3WNDA 4F9TA 3FUXA 5EYPA 3QE4A 4MR8B 2WJJA 4YB8A 3GC6A 1ILWA 5C1IA 1YE8A 4AZTA 2JIZD 1V7QA 3WMEA 1TKBA 1UFVA 4Q3CA 5A04A 1H2BA 3PS9A 3Q8KA 3EXFA 5DMXA 3TAXA 1QX4A 3GWGA 2X7XA 3JU3A 1DV2A 1XRLA 2FKNA 4PHFA 4XTRA 5CXXA 3WGZA 4KLRA 1FQJA 4G23A 1I94B 1N92A 2VT2A 1N5RA 3EULA 4ND8B 1JXAA 1REQA 3IHLA 1O6ZA 2NN3C 4O4JF 4XFDA 7ABPA 1SWWA 3LWZA 2O3RA 3AG6A 4DDVA 1Y8ZA 1EA7A 1RBYA 3VZQA 4BUZA 1PG0A 2R1UA 1R88A 1VPEA 3BB3A 1T5TA 4E07A 1G0NA 1UWLA 2JGIA 3JD3A 4GWKA 3SIXA 1U3WA 2C61A 2D2XA 1YBAA 2VUSA 3SZ3A 1LF0A 1WW2A 3CJRA 4IILA 3EZ2A 2B20A 1MDFA 1M2FA 3IAS6 3JQFC 4KU4A 2DPXA 5BN4A 5I9NA 4L8LA 1ZSYA 2VP0A 4H6WA 1F2TA 2OY0A 3IMGA 5M04A 3I5UA 3IT2A 3CNEA 1YT5A 4FNAA 2C5HA 1P33A 4F72A 2PYIA 3L1IA 1NLZA 1Q83A 1MX5A 3GLGE 3N8HA 1TVEA 3H2IA 1UJMA 1WCWA 3ITKA 1N3BA 1MVNA 4I6EA 4JT2A 2IUSA 4RELA 5AI9A 5DRYA 3U5ZB 2HNBA 4JUIA 1PWYE 2FYTA 4ZYTA 3VA7A 1NP3A 3O2NA 1QF6A 1GTL1 3EG5A 4D92A 3B78A 2GVNA 4Y2YA 4A82A 1SOMA 4CPDA 2XB6A 2XCUA 2XNSA 5EE9A 3W5SA 3D3EA 3LLSA 4QDXA 3DM9B 4US1R 1T3HA 2RGCA 4RHYA 1FVXA 1SUAA 3AEKA 4EG6A 1VYUA 4LWOA 3RUPA 2WIFA 4OMUA 4EECA 5KMGB 1RP7A 3Q7RA 2XZTA 4EY4A 1L4FA 3F1KA 2BUCA 1XSEA 5DLQC 3WK9A 1FP4B 2A78A 3L0CA 4PSVA 4KKVA 1QOPB 3UJAA 4EM6A 1H2XA 3R9WA 3AEXA 4GPEA 4B71A 2YXPX 3V1TC 3IUEA 5I48A 2JBAB 5DX1A 5JJ5A 1IIRA 4JFRA 3I4FA 2R3SA 5AHRA 3V48A 4B2YA 1QR6A 1IM8A 1GP2A 4J7CA 4D43A 3MMSA 1SIBE 4DCSA 4ARAA 4C0LA 1GWNA 1KC3A 1PQUA 1ZI9A 3G7SA 1YWGO 2PQ6A 2HWKA 3AC0A 4PLYA 1JKMA 3I6ZA 2JCXA 3IV9A 3MYRA 2J87A 4AY4A 3RTAA 3N28A 4JI4B 4RPGA 2XXAB 4N41A 2H5LA 3WHPA 3R8CA 5LBTA 1QGUA 2XF2A 4TLDA 1Q22A 5FKJA 3TNJA 2G6TA 3FTPA 2C3PA 3QEMB 4CR6A 1VA5A 1N32B 1AHNA 4L8YA 3R6TA 4LWZA 3O7WA 3HB0A 3SLGA 5G0UA 3HDVA 2QD1A 4CFYA 2Q50A 3IBFA 1ULHA 2WJZB 4AK9A 1QF7A 3LYLA 3VPSA 3NVMB 2PUWA 1ZUHA 3S68A 4Z3KA 3W9SA 3K31A 4CM8A 2W8BA 3HRHA 5ALEA 5IJ9B 1B7GO 1RU3A 1Y8QA 4L50A 3RTBA 4EBBA 2XWBF 2ACEA 3R7FA 1HG0A 3TGLA 4EI8A 3H7IA 1L5ZA 1UANA 5SY9A 3VNVA 4DL9A 1K8QA 2BEWA 5K3FA 3P7MA 2HDHA 5HJ2A 1R18A 5KO2A 1LJ8A 5JH7A 3CNLA 5D87A 3IAXA 3AVTA 3IP9A 5KQMA 3CZCA 2I9KA 3LHFA 1LDBA 4TOIA 2BKEA 1NBMA 5ECWA 3O8RA 4A0HA 1XHEA 4C3UA 5BV1A 4H9GA 4LJKA 2APJA 2B7BA 4GPBA 4JLDA 4A3SA 5TLSA 1BXGA 4MIOA 1EWKA 3PQ7A 1DKRA 3IP1A 2PKEA 1UK8A 2HA0A 2I71A 4I99A 5DE3A 1TJNA 4RIHA 2A58A 4ZAXA 3QTTA 3ONWA 4D8WA 3NDBB 5F73A 4FZRA 1TCBA 5CGQB 2OG2A 5ENVA 3BXHA 2NNLD 1JZTA 1XX6A 1PYGA 4UDOA 7YASA 1KP2A 1VXRA 2ID7A 1FBNA 1K6MA 1QFJA 2ZJ8A 1PSDA 3LECA 3Q7TA 4Y2VA 4HFRA 4ZAFA 4OXYA 5G0TA 2H6EA 2NYRA 1P6QA 4AMVA 1D1SA 1QJ4A 4IMJB 2BHLA 5ILQA 1S02A 1GQYA 3WOVA 4I2NA 2YJNA 1DTWB 2WQZA 4FMPA 3Q3JB 5AJTA 1V7PC 3GLIB 5GOZA 1NMSA 1JT9A 1FC0A 3F6CA 2IZ1A 2QNIA 2ILTA 5K3AA 4HAWA 3SMQA 3DHEA 1CTQA 3EHEA 4GL4A 1U02A 1SOAA 4MWCA 2P30A 3C98A 3LBFA 4R2LA 1KY5A 3A6EA 1T9ZA 2FJUA 2QZPA 3MCVA 1Q17A 1UBTS 3KTAA 2FP4B 4N48A 1HDIA 1ZD2P 2QSZA 3N6VA 4DXAA 1X1DA 5ETJA 1M0EA 3KKQA 2GF0A 3WR5A 4ZI7B 3BT7A 2GBLC 3HJGA 4OGFA 2DULA 3MIIA 2WEKA 3AEQA 4PAMA 5F9MA 5AJYA 5KUTA 4YHBA 3TUZC 2XDWA 4PC7A 4Q4AB 3WWCA 5BMVB 1KIAA 4JVMA 3KJZA 4KBGA 1X70A 4MS1A 5JANA 1GAWA 3FI9A 4UDNA 4H7KA 2UXBB 1HF3A 4PC6A 5KREA 4BLRA 4L5BA 4R5HA 2P65A 2H3EA 4HNRA 4DG5A 5C2JB 3AR7A 1XMJA 1Q57A 1VPVA 3R5TA 1XJWA 2JLBA 4FEAA 3NETA 3Q98A 5EKUA 2A84A 3BTVA 1Z2DA 1NVMB 3GN1A 5J9FA 3VC7A 3GUVA 4M9XA 1ISRA 1MC8A 3ZGNA 4B32A 4DRZA 3GBSA 2YWDA 3M6LA 2ADMA 1PJ3A 1SRQA 1Z26A 3MWJA 4MINA 4NLLA 5FB3A 1YI0A 2WLTA 2BMEA 2I55A 3EYAA 3NXSA 3PIRA 1NUAA 1GU1A 4Y7DA 1VMIA 2Q6IA 3AHHA 1M2KA 2O5RA 1IUKA 1YASA 3HC7A 3KC2A 3HUUA 2LP4Y 3I6QA 4HN4B 2X0EA 3OZVA 1U9IA 3ANLA 3V2HA 4B8ZA 4G5XA 4UHKA 3E9EA 1QFYA 1U0TA 3KVRA 4KUHA 3V3KA 2Q46A 2MSCB 2P3OA 1Y7HA 4MRNA 3GH1A 4W6QA 4RENA 3V1LA 3CVJA 2ZBDA 1CJMA 3F6PA 1ULAA 1JH9A 1DC6A 5TNXA 5G0SA 3S6JA 3OMWA 1FSGA 2I7DA 1P5HA 1KEEA 2FI1A 2RMKA 4AKTA 4Z2YA 3KQLA 5JPIA 1UBSB 5FI3A 1AN0A 1MENA 1JG4A 2WA1A 4DYVA 1WSAA 3S29A 1N6OA 3BJIC 4O5AA 5E1OA 1C4WA 1WF3A 1Y1PA 2DFKB 3L6RA 3LLCA 3NG1A 1JU3A 2FF7A 4L9RA 3O9MA 5EXPA 5FWAA 4FCWA 3AVYA 2P6PA 2GJ8A 1UIRA 3UMSA 1PVOA 2D5BA 1LLQA 3PBKA 1HY3A 4MEJA 1YVRA 2G7MC 3M82A 4QFMA 2C1ZA 3T0IA 1DHTA 1UMDA 4L85A 5F5LA 3ENVA 2G9QA 3W2EA 1H22A 4ZYWA 2W7TA 1E79D 3LIPA 3H4TA 4LYEA 3CX7A 4PAOA 1NPTO 2MSLA 3BWYA 4Q0MA 4JJ6A 5GVSA 3FRJA 2I33A 4FHCA 2ZOSA 2QM0A 3JZAA 1QQ5A 3W8EA 1UFRA 4B7CA 2ZJOA 5BSTA 2E7ZA 2ZSHA 1HEIA 4NENB 1G21B 2YHIB 2WOOA 2PZBA 1PNVA 3FVQA 4K88A 2WWRA 2PX3A 3DCYA 4XOUA 3D0RA 1U5CA 2QYHA 1I7PA 1E7YA 2WHQA 1I80A 2IXFA 3N8DA 3HRKA 4PANA 4DWOA 5JJIA 3AETA 4M1SA 3BRWD 2AC2A 3QE3A 4XVQA 2BC9A 1TC2A 2JZCA 1WW8A 1X3LA 1D4OA 2WMOB 2WD7A 2NQ8A 1RWXA 3CB4A 3F5SA 3L3BA 5EJEA 5FWYA 2VSQA 1YK1A 1CB0A 2GA9A 3EAQA 1TGVA 5ALIA 5FAKA 1G0OA 2VK1A 3NYWA 3WGIA 1JB9A 3VR3D 4DHEA 5KZMB 3M6WA 1SY7A 1G8SA 4JITA 4OJNA 3RT1A 4ZYXA 2GWRA 5TQVA 4JSTA 3ZU6A 2DG2A 4ZAYA 1FXSA 3RK4A 4Q1VA 4DMKA 1FJGB 3FDZB 3K53A 1EFLA 1SVOA 1YKFA 2X76A 2X9LA 1OIWA 2FETA 4LJ7A 2VR1A 5B6JA 4OHOA 1RQLA 5THXA 4RDXA 1JQAA 1IEVA 3RYFB 3FW1A 2YS6A 2DE0X 3SQDA 3KYBA 3UO8B 4ZOCA 2C2ZA 4CF6A 2C82A 3DUWA 1Z6XA 4IRMA 1NFRA 5CX1A 3T41A 1YBHA 1X9HA 2HSGA 2AX4A 3R76A 3FMIA 4M7PA 1BA2A 1J2TA 3AK4A 3IAUA 1BFKA 1CZKA 2XI4A 1TJ4A 2Q1YA 4C6SA 1DAPA 3WYBA 3QX7A 4PZ9A 4E2ZA 1JAZA 1U2ZA 3MJHA 4HR7A 3S5JA 3QLVC 4DEVA 3ICEA 1Z2AA 4K2AA 4BZPA 2PRZA 1L7BA 1KMHB 3I39X 2P9GA 5ECYA 2YIDA 3FCAA 1DRJA 4OFXA 4B2PA 4EVQA 3SHQA 1JIQA 1OZHA 5J23A 1RAEA 2OFPA 2X5KO 3F8SA 3QU5A 1QH1A 1CD5A 2AR9A 4NS1A 2XODA 3I6MA 1VB3A 2G5CA 1DQSA 5AKGA 2B21A 4KN8A 4MJLA 4P80A 3FPHA 4P92A 4R9SA 3IOMA 1TF5A 4P33A 3JQPA 3SC2B 1DLJA 2AE2A 3OQHA 1U90A 2Y0PA 4Z4GA 2OXCA 5HSGA 1U0BB 5DYYA 2PJRA 3FYDA 5DXFA 1CUAA 2OYSA 4ZMSA 1G8FA 5DT2A 5AHKA 1W49A 4AF8A 1PZHA 2EL7A 3UKDA 2PGJA 1WVIA 1XD9A 3UV3A 4OMDA 1UFOA 4K40A 4K26A 5HK8A 4JQSA 1ZGJA 1GCGA 4LQLA 2G28A 1WMEA 1YR8A 4X1KA 1LCIA 5ABPA 3JQAA 1E5VA 1GRCA 1M54A 4KP7A 3F7MA 5IM4F 2YV1A 3X44A 3TLXA 3VI4B 3K30A 3HI4A 2I6GA 2A1TS 3PSAA 5KTNA 4BJ5A 5HFNA 1EFKA 1XL1A 1AURA 2CB9A 3GLHA 1BMQA 3HXLA 1J20A 3UQZA 3VO2A 2B1QA 3U3DA 3B1FA 4KVAA 4TM7A 4PSCA 4BPBA 4G1FA 3FUCA 2GEBA 2HU5A 2H1RA 1NULA 4ZJUA 3DP7A 3A11A 1CS0A 1VYVA 4PHTA 4WESB 4ANFA 1ZEJA 1U28C 4GP6A 1I6MA 5DGDA 1V1RA 2J3EA 4COKA 4HI0E 4X91A 4K0KB 1K8XB 1Y0BA 2PZMA 2QAIA 3EQ9A 4GMFA 3RSOA 3ZWYA 5FPSA 1WNFA 1KU0A 5M2QA 1D4ZA 1WBBA 2HKIA 1VHLA 4YUAA 3T9DA 4Y2XA 1L7XA 1BXZA 2F9LA 3EXG1 1J8VA 3BCUA 5TMEA 3UNXA 2PUVA 4K81B 3ACCA 5I7FA 4MR7B 4KQMA 3EVDA 4TMTA 3WLOA 1RI2A 1MLDA 4KUEA 2Q7OE 3S1AB 4ACBA 4EG4A 4PZCA 1PNOA 2WOJA 3BTOA 2WZCA 3E7FA 3ETCA 3L8CA 4I46A 3E9ZA 1NW4A 3COJA 2XTMA 3VR6A 2PH5A 3TGPA 2MDTA 1ZM2A 3QJYA 1IQ0A 4UHJA 3COZA 3G5AA 1SCKA 3L82B 3OBIA 1YBMA 2CUZA 2GD0A 3H5RA 3MF4A 4FOTA 4A5OA 4E5PA 1NX6A 4ZCMA 5JCOC 3ETEA 4LJ4A 4LJYA 5F21A 2E5WA 2ZXFA 3BA6A 3DXFA 3EFBA 4LMPA 4YK7A 5K2OA 4G0WA 1UMCB 1U3VA 1SELA 5JSYA 3TLCA 4E1BA 3JQGB 4NZNA 4B4OA 4BTLA 2DAPA 2IDZA 2FE1A 3IP7A 5AM1A 2B6NA 2P3LA 4JEIA 1JHAA 4DYDA 5C4IA 1MJ5A 3SE0A 4DILA 5CYGA 3LBHA 3LH5A 3DE6X 3OHSX 1EB9A 4BKUA 5ERXA 1SHKA 1Q74A 5IVIA 3QUCA 5BURA 1WZCA 3GPBA 5KNBA 2BLNA 4XA8A 1XCOA 5BWOA 4Y6RA 3PNSA 1K63A 3GUYA 4FE7A 4LY9A 2P3QA 4F45A 2Q6KA 4MQ6A 4N18A 3AR9A 1KI6B 1KOFA 2NZYA 4I1PA 3FPLA 2DFLA 3OKAA 1PJRA 2GUGA 3SS8A 1JG1A 2QN9A 3AM5A 4FLFA 3AERB 4C7KA 3DZKA 3EEFA 1X8LA 2C0PA 3FHLA 2VP2A 3R24A 4IKPA 5GONA 3EBLA 4IS3A 2JS7A 2A8YA 1P81A 3RHFA 4Y2TA 1EM6A 2R1TB 3B12A 3DQQA 3H16A 4YRTA 3HB5X 3RTEA 3TPFA 4L1KA 2HNAA 3WB1A 2DETA 3M6UA 4KHZA 1IU9A 2JGKA 2QUJA 2O1WA 1USUA 2A92A 1CEXA 1JHDA 3A6HA 3CRRA 2FZLA 2ZSIA 3LQFA 5EWLB 2YYYA 2FWRA 4EKDA 5M5BA 2G0AA 3RAEC 3GAAA 5DLPA 1Y7IA 1WZNA 2CF6A 2FFAA 3DHVA 3HKCA 3IP3A 5H1YA 4XYLA 5KBYA 2ZRPA 2ZTHA 4AG6A 4OQPA 1ZK0A 5I4BA 3CQ9A 1DC7A 1IPHA 1MF7A 3GP8A 2B1RA 1T5LA 1KJ9A 3GV0A 1R6BX 3TPZA 4QTZA 2ZWIA 4XLZA 3K09A 4RZUA 2ZGVA 4F06A 3QG1A 5CDSA 3V8QA 3PEWA 2JLZA 1K4MA 1K3TA 5CLGA 3CSDA 2RKOA 3U3JA 5IVPA 3WISA 3DWEX 5FTWA 5JYDA 3DMPA 1DMSA 3COYA 5D3QA 3Q4GA 1YK0A 4LF6B 4K6MA 4DBLC 1JEQA 1NT4A 2F00A 4HYEA 1GZ7A 1ENZA 1UBNA 1V8BA 3A7EA 1YB7A 3AR3A 3DBHB 3N1UA 3UHAA 4BXOA 2CHUA 3S81A 5LA6B 1EXWA 1GAEO 4LVCA 2B8EA 3EJ6A 4LA4A 1KYWA 4NFSA 4BFLA 5AVXA 4AF6A 4OLAA 3V32A 2OZEA 3B1XA 3WYGA 6AT1A 1OXMA 3E03A 4JQZA 2Q2QA 5EFOA 2RBEA 3HY6A 1A8HA 1OXKB 1JPVA 5EJ9A 4B75A 1EBBA 1UPFA 4EJSB 3N2GB 4Q19A 4MQEB 1IIBA 2FLVA 3UV7A 1W5TA 1SXJC 3ET5A 1GLVA 1KL7A 1K6EA 1SUPA 1WUJS 2AWOA 4UXHA 2GERA 1QS0B 1GTRA 1HE5A 2P77A 4E33A 2GYWA 1XN4A 1JA9A 4XSVA 2WTEA 1ZSVA 2VO1A 1KNXA 1U0EA 1YI1A 3K4HA 4TRRA 4FYIA 2R1VA 4HBZA 3LYAA 4BTVA 4OXXA 3LPLA 3KUUA 2FMKA 2YCBA 2CBGA 5FQOA 4A2WA 3O38A 4JSYA 2OFFA 3K2EA 5TC4A 3KKOA 1SBYA 3LKBA 4N7BA 2H00A 3MRTA 1MJFA 4D3DA 4N1AA 5C7IO 3ED5A 4WZBB 3T5AA 2NP7A 2C8KA 2PZFA 5JSFA 4MV3A 1CE8A 1PLJA 1BNCA 4V0RA 3GJYA 4BNJA 4MZDA 1NNI1 5D8DA 4EY6A 4C2BA 1T1SA 1Y37A 1DSSG 2DHCA 4WW0A 1QK3A 1X7GA 4R05A 4NNPA 5CPBA 5IFKA 1JAIA 2I2CA 1ISFA 2B36A 3QPUA 4K9RA 4O4LF 4WUVA 4DRXB 5EXDA 2NPOA 1V3VA 2OK7A 2GKSA 2X0DA 2QQGA 3BWBA 5LR6A 3SQMA 2QL7A 3F8TA 1QIIA 5AXDA 1DEOA 3FOFC 4BZZA 3EDRA 4OM7A 1FVHA 2I3GA 1T5SA 2O7RA 3C7TA 4NBWA 3OD1A 1SIWA 4QGAA 5FOXA 4UM9B 5FOUA 1AZLA 3PXDA 1V47A 2OECA 4LN1A 1V2GA 4FS3A 1ZAYA 3RFVA 1ST2A 2C4HA 4D57A 2IOHA 4CMJA 5DI9A 3B51X 3AM1A 2B8WA 3W5VA 4ZK2A 2BAGA 2WM3A 2HF2A 4M6WB 1NN0A 3P2IA 1H8ED 4ZARA 1IOWA 5C1PA 4URVR 4AP6A 3CFYA 4P3PA 3AI2A 4S05A 1JX6A 1W1UA 1ZGGA 4FOPA 2Y1GA 4WOBA 1D0SA 1ZCZA 4AZSA 1OXXK 5CXSA 3COSA 3PI7A 4MVJI 3UWKA 1E2GA 3P2MA 4CYMA 4MV9A 5BV7A 1ZK4A 3NWJA 3OJFA 1LFDB 3PHCA 3EJWA 2JA1A 4X65B 4BLVA 5AOBA 4ASUA 1QO7A 2FOXA 1CQZA 5LQAA 2O2CA 1Z08A 4ZHQB 2Y1OA 3GJ7A 2XH8A 4IYJA 5EXXA 5TMPA 1FS6A 4BGUA 1R6UA 2YKGA 5FHQA 2O1EA 4RSGA 1FRFS 3ICWA 2XWSA 4G0OA 5F7XA 2EWWA 4WBXC 2C96A 4QUGA 5SZJA 3SJ7A 3GPDG 5K8TA 2XUAA 1G16A 3E82A 4CI9A 2AE1A 5AUNB 3HEMA 1CDDA 1T8SA 1U7UA 1Z8HA 2R86A 4OGWA 4RZSA 5CH5A 1DX4A 4ER7A 1KYVA 2PE5A 2BEUB 2FRXA 5EXEA 1ZR4A 1JHRA 2NO0A 4OJTA 1K8ZB 3WLFA 1PK8A 4HUJA 2HQBA 4CDGA 4F6LA 3EAFA 1E7WA 3MWDA 2FMHA 5DBEX 3VAAA 2AN1A 1Z35A 3SHWA 4C7XA 3EBPA 4R8RA 3ZVRA 4GUDA 3G23A 1NQUA 3I12A 1GQFA 4FWIB 2F62A 5EUQB 4ZU3A 3IVXA 4DLSA 3QPVA 2IHUA 1YR6A 2BI8A 4PHCA 3OMLA 1X7DA 4D0NA 4B46A 4RFVA 2OQ2A 1MG5A 2ZBVA 1NBEA 1KFKB 1ZGHA 3KKPA 4G9GA 2FPPB 4TRNA 1UPXA 3O84A 1BW9B 1VQ1A 2KS6A 1N5JA 1UBUS 3ABOB 3E9RA 3JZDA 5KTOA 2V96A 4I81A 3JASB 2B99A 2PX8A 4DV7B 1SN7A 5GV8A 4DIUA 2Q28A 3DS8A 2J46A 3N8IA 4FQ8A 4QBHA 1UKAA 2YBDA 3KEOA 4L7VA 3HUTA 4O3FA 1AZTA 1GYQA 2WUEA 2OPHA 1A9SA 5IG2A 4I5EA 3EISA 5C5CA 3GJTA 4R0NA 4EWLA 4LQCA 4KTTE 4RZ3A 3UBTA 4IDFA 1UJBA 1A50B 1VC2A 1N2EA 5BQPA 3ZY6A 3P9QA 2DMRA 1CUWA 1I36A 1OYWA 1LXCA 5E9WA 3RRYA 2FWBA 3AR5A 2ZRAA 3QM1A 3SE7A 3IVMA 5IX8A 1VIDA 1U3UA 3KO8A 3I0ZA 4PPYA 5ITZA 2WE8A 4RIGA 3I61A 4TWZA 4OXKA 3LOUA 2OHGA 3B89A 4XVRA 5CVJA 3I9NA 1ZUD1 1AJEA 4PYRA 1K2WA 1L7MA 3IKLA 5DM2A 3I76A 3BKWA 2NU8A 1Z8DA 1G5TA 3PC2A 4MQ5A 3OZXA 3TYXA 4CM4B 1ZJWA 2OLEA 4XIFA 4CMKA 5KNCH 1W7AA 2V3CC 4GLOA 3ZJ4A 1KZ1A 1LDYA 4QATA 4ZQHA 2WJ3A 1JKFA 3MINA 3QH4A 4WLNA 1M2GA 5AVTA 4QLAA 5HDBB 1PFKA 3RKRA 2FN3A 4GOXA 2NVUA 3WC4A 2O3JA 3D5EA 4O6VA 1BH2A 3DZ8A 1I2DA 1E9FA 2WV9A 3B82A 4FGKA 3T5GA 4RESA 5KYUB 1KAOA 3THWB 3L06A 1ZRMA 1NDQA 2QROA 3CE9A 3MEQA 3O47A 4H1HA 3T7DA 2RE8A 3R3UA 3CV3A 3I9V1 2FDCA 2H7XA 4PRYA 4FXOA 4CIDA 2XEXA 4ZI7F 4PYLA 3CXRA 5JLAA 5HHTA 1G20B 1W76A 2Y99A 6GPBA 3H0CA 4IEIA 3ZK7A 3RSHA 1DBVO 3TZHA 4C0SA 5BMVF 1LDEA 2R7KA 5KJ6A 4YT4A 1KVUA 4UXIA 4Y2RA 3SX2A 4KN9S 5JDCA 4YAJA 4W5QA 1MG0A 2FOIA 2FJPA 3JSAA 4Z1MA 6ABPA 2SNIE 2V5AA 3MJDA 1ETHA 1A5BB 4CV1A 1N6PA 2IT1A 4H60A 3LPDA 3LBYA 1NLFA 4AS1A 3VVMA 4CLHA 3TN7A 4MVJH 3ON5A 5FA6A 1P18A 4LDRA 3PUZA 4XPIA 4C22A 2Z2KA 2HXSA 1II0A 2A30A 1M72A 4PXAA 3AP2A 4ZO4A 3HS3A 3RS5A 2FXVA 2HADA 3I0NA 3KQVA 4QUBA 4BKRA 2XVYA 3VH3A 3PA8A 4BN0A 4N3NA 2YX1A 1BMFD 1WDMA 3HKEA 2XY4A 3EEIA 3KVVA 3OCWA 3NQ41 3A1EA 1TIPA 5I9MA 4HZGA 1HMYA 1TRKA 5G53C 1V7CA 4DV3B 1YI8A 1X92A 3LLMA 2IE8A 2ZIXA 3ZY5A 1EK5A 4GWLA 5DTEA 7REQA 5J43A 2WKRA 1ULTA 1W19A 4BNFA 1VI2A 2RI0A 1WULS 4ZAZA 3BWEA 4YUWA 1O8CA 5JY6A 4HNTA 3IXMA 4TTIA 2VNHA 4UATA 3FRHA 2F1HA 1L5GB 3AKEA 3INNA 1MB0A 4Q39A 2BSXA 3PUIA 3MW8A 3PWZA 1KAQA 4HGNA 3I9MA 3ZDCA 3WDMA 3AKDA 1BEEA 1RBQA 1ZRNA 1RCUA 2PFGA 3OY7A 1Q16A 4DCOA 1D5CA 2G09A 2XUDA 2Y1XA 1GVNB 2WAXA 3ZBQA 3GCWA 5ILGA 3ZE2B 3E8SA 3VNQA 1T15A 4QM6A 4REQA 2D4HA 2V45A 2XKBA 3NBKA 1U65A 1DOHA 2ECKA 1JEAA 4LNHA 3MNFA 4B4VA 2C9MA 3H1TA 4UTXA 4OI0A 3D81A 3I2FA 5LBIA 2VHTA 1P31A 3BIJA 4RCZA 4C4ZA 3CX8A 4ENVA 4BJ6A 3ZDYB 1O9BA 1TUBA 4JLVA 5IN5A 5LMNB 1WUHS 2Q2VA 1RKVA 3HA2A 1VGQA 3MXOA 4JOSA 3WRXC 2P6OA 3PQCA 3SZMA 1KXZA 2PUHA 3WJ1A 1KHTA 1QFZA 4H7FA 2YBEA 3VH4A 4TROA 4A6XA 3ZCTA 2P2GA 1X9GA 2NTYC 3WGTA 1MAUA 4A23A 1D07A 1QUFA 1T4GA 2W2PA 3INRA 5IH3A 2W22A 2YY6A 2GXAA 5HQ3B 3DVAA 1ZVJA 5ANRB 1U2QA 2H08A 2AFIB 3KLNA 4RGYA 3QFTA 2JJ1D 2Q7XA 3A70A 4CQJA 5D86A 4X3CA 3R1IA 3LJKA 1UKBA 1ECCA 4JYCA 5FP0A 3EEBA 3RF6A 1TD9A 1E2EA 5KTPA 1ZCFA 3NHUA 3PPWA 5JVDB 3KWJA 1ESEA 3ODPA 1XNGA 2DRIA 2O9JA 4ILKA 1E8DA 1FXWF 2WINI 4E4RA 4YXWD 3W6NA 1KBOA 1Q95A 3MRXA 2OD2A 5CW2A 3DBOB 2P2CA 3MTBA 4TKUA 2KJQA 3UC9A 4WGFA 2IHJA 1JDPA 1TU3A 2A0FA 1GHTA 2MYNA 3MWEA 4YREA 3VDMA 4JKOA 3FTEA 4FBMA 3A1DA 2WT4A 3TD6A 2AG5A 5LPNA 4JI3B 3HA5A 5JDIA 1NVKA 2VNJA 3VH2A 3BGDA 4HAYA 5DNWA 1QVZA 1EA5A 4CN9A 3GPLA 2RH9B 4O4IB 1YU6A 4M83A 1P60A 1EFPB 3S8MA 3FGNA 4TKVA 3EVCA 3EWAA 1J2JA 3LC2O 1GQ2A 3QUBA 4AKEA 3CN9A 1DV1A 3QVVA 1ISHA 1LEHA 2WB4A 3C5VA 1T1IA 3KEMA 2JIBA 4R7GA 5DT9A 2B0JA 2JRLA 3UUGA 1R3UA 2CXQA 3QFHA 3W8RA 3R7WB 4A8JB 1IMJA 4I3FA 4IIEA 3UUWA 5K3DA 4EUHA 4F9GA 1A4UA 3ZOZA 4WBNA 4UU7A 4YP9A 1B15A 2RGGA 4ENWA 1H5UA 3F7TA 2GESA 3N7AA 3MT7A 2D62A 1TAUA 1X7WA 1VKNA 1UZAA 4N6OA 1VM6A 2R6GA 4DE5A 2BKVA 1E8MA 1DE0A 3HB7A 1WXWA 2C83A 3SYKA 4M8KA 2QRLA 4KEAA 5H9WA 3VOSA 3UPTA 1QYCA 3ZWVA 2AF4C 3LT0A 1TJPB 3VPAA 4DC0A 5IFLA 5EYPB 2XVMA 2X13A 3CR7A 3KPWA 3CWCA 3D2BA 4QODA 3G88A 4NU0A 3S2SA 1L5LA 2JANA 4NH0A 5CNKA 5E6RA 4JEMA 3FTQA 3KSMA 3GLSA 4TLMB 2H17A 3FWZA 2IUUA 3SF8B 3AW8A 4EAQA 3ROKA 1K6XA 2IF2A 4GPZA 4XX0A 1U1DA 1MVLA 3C5EA 3G0CA 2ZAOA 4C4PA 3NV9A 5ERYA 4YCMA 1TAQA 1MABB 4RC9A 4LWPA 1C9NA 1G19A 1PJQA 1SAYA 3D6MA 4YRPA 3UJPA 1WVMA 3MMPA 2EP8A 4ZYVA 5B5SA 1GRNA 3R3HA 1QCZA 1VIVA 3TCXB 4BLTA 2QR5A 2OCKA 3STTA 1GUFA 4RVSA 1DIGA 5JI2E 3TDKA 1SCIA 1UBRS 3TLJA 4DWJA 1BE8A 1FE8A 1ZH6A 2CFIA 2C4MA 4M0DA 5FPYA 2WKQA 5BN4B 3PI6A 5IUNC 1EVZA 5C9ZA 5CW1A 1F2TB 3LY8A 5IKEA 3Q7SA 3UIEA 3VU0A 3UHPA 4EZEA 2Y4OA 3WQQA 4QDJA 2VZ0A 4GEKA 4X5OA 4Y2PA 4M9CA 4DY6A 1GL9B 1TYCA 2JJYA 4BNZA 3W1EA 4BNNA 4GRAA 3EZ7A 1PNRA 2FMFA 3PYLA 1O5IA 1PZEA 1KTIA 1DJQA 5SYNA 2PBFA 1TZJA 4ZO6A 2DR3A 2CF5A 1E0SA 4FTWA 4BE9A 1ZN9A 2WJYA 3KZNA 4TL7A 2I62A 4XDYA 4HB3A 2BRUC 1EP1B 3PDWA 5M34A 2JGAA 5AH0A 3HRIA 1RXWA 3WO0A 5HF6A 4WSOA 1IY9A 1IN1A 3ASVA 4HDMA 3DGFC 4OK3A 2X6QA 4UNPA 4E3WA 4N5DA 4RHFA 3U0VA 4MPDA 4UUPA 3ZUGA 2P0EA 1SUEA 3BJRA 4WIAA 2IBSA 3T61A 4WOCA 1R00A 2IHKA 3IB3A 3M4JA 2O54A 1DBSA 5CURA 3TIVA 1FYDA 4MUJA 5CB4B 1JDSA 4X54A 3F74A 4BP1A 5ALMA 4ZO9A 2P2LA 5B3JA 1B0PA 2PWBA 4CLXA 4ZDJA 2BKUA 4U9HS 2OGTA 3KT6A 2VVTA 3ROFA 4QOGA 2B69A 4DC1A 5B7QA 3PWSA 3KELA 3OJXA 2GBFA 2XYPA 4BKMA 2NXCA 4LRQA 1E96A 3IULA 4S3MA 4BBJA 5EAIA 2WF8A 5ICFA 1W5BA 2D1QA 2JL1A 1CJVC 3I1IA 4NNOA 2Q4DA 3TL3A 3I01A 1G6OA 3DZJA 3JQ8A 3U09A 2PGXA 1NMYA 1T4CB 1L7VC 3FPCA 3TSWA 1YXMA 3L7BA 4A2QA 2WSYB 3EXIB 4BLUA 1ZXLA 4D4MA 3ZV5A 1SCDA 4ZC1A 1NUQA 2HD4A 2ENWA 2QVCA 2V5UA 3P5SA 3ROZA 4EB3A 5JJKA 2X5NA 3E9MA 1D2AA 4IUDS 4AI6A 3DV9A 5CT8A 1QYRA 2VS1A 1XWFA 1XVVA 2NTVA 1ZHOA 4YAIA 3VJLA 1A9QA 1HKUA 2ZP1A 4IQ0A 3X1KA 5EUMA 1UWKA 2ZJBA 5KI6A 3GQVA 4PIVA 3EDMA 1EXVA 1CNMA 1OGIA 2B9VA 4C29A 4OHMA 3ZD8A 4LJ8A 3OZ7A 4PCVA 3IEPA 3N8NA 3KKLA 4CM8B 4BOYA 2ACVA 1FTYA 2QB5A 5EOVA 3UAZA 4RK4A 5EQJB 2NSDA 2NU9A 3PGXA 5J5CA 1Q0PA 3DLCA 1KI7A 4FMBB 4PSUA 4OOEA 4CM1A 3MCTA 2FVXA 3VPXA 4WJLA 4BMCA 2H4WA 5K3FB 1GFIA 3MCWA 5JH7B 3A6GA 1XTVA 3K0KA 2EFJA 2P9CA 1GPLA 2QTGA 1Y7TA 1RLMA 3BHJA 5AKXA 3NHZA 3P0FA 2HPHA 3R5KA 3OU7A 2C1XA 3A8TA 1RC1A 1ZU4A 4R1PA 4XJXA 1NE7A 4L76A 1GDTA 1G59A 1N25A 4L5JA 2CN1A 2X8WA 5BRJA 2B78A 4HDOB 4BKQA 1I2AA 1ZGZA 4US0R 3BVPA 3S4YA 1OAAA 1Q14A 2CNLA 4QXAA 1VZ2A 1F60A 1NVUQ 3T5DA 3UHJA 3A3KA 4B5KA 3K20A 3OQBA 1ZMBA 1E64A 3BH6A 1W5SA 4MJ3A 4DADA 1S1CA 3PTZA 4RTOA 1H6BA 3EGIA 3DLTA 1HDRA 3BORA 4ND1A 4Q9NA 3TR5A 1HL7A 3HUDA 4P93A 4LHYA 4IF4A 1SCUA 3NGMA 3K71B 5TEWA 1U4SA 1HH4A 3OP4A 5E3JA 3UMGA 1I7DA 1YQEA 5KYXA 3K0CA 2EW1A 1QZUA 5IZCC 2VOEA 3ZPXA 2WQ6A 3BXOA 3KVYA 4QE3A 4FINA 2FSVA 4R1OA 4DLTA 4U2CA 4PLFA 1IC6A 1BX1A 4LVNA 2BFBB 5HG0A 3RLFA 4BFCA 2BDTA 5AD1A 3AVPA 1BIFA 4DMGA 2ZVJA 3ASYA 3AXTA 3IV6A 1UM9A 3Q9NA 5KNCD 3NEJA 1LZKA 5EIAA 3SKVA 1NM5A 5ES4B 4UJ3A 2ODBA 3GCGA 1F8XA 2NO4A 4XLTA 5LZ7A 4B4KA 3B3FA 2PH1A 1N1MA 4F4HA 4RK7A 3CISA 3Q3HA 2CVOA 4HZUA 4J91A 3KTAB 1TX4B 3SX4A 3ZNQA 5HP4A 4RE5A 2HRBA 2VSXA 2R85A 1A1SA 2H5IA 4OHRA 4N6GA 1EE9A 3JTEA 4LQ4A 4LF7B 4R2XA 3RE1A 3AEQB 9LDBA 1EUYA 3RU7A 4D46A 3ZJTA 3LZ6A 3Q9UA 3UCEA 3ISJA 1KS2A 3PNLA 4GOND 1G2IA 1NC1A 4WJZA 4MS1B 2R5NA 1QMGA 4GF5A 4MI3A 4X3OA 2ZR8A 3NMUF 3PUVA 1R74A 5KYVA 1SUFA 1SXQA 1BD3A 1NHWA 2FDXA 5AVVA 2HDOA 4BRSA 1OV6A 4ROTA 4V1CB 2GK4A 1H9CA 1MEOA 4UTNA 4AQ7A 2DEUA 1GQOA 1BEZA 4LF4B 1M6VB 1T24A 2GHQA 5F3DA 4QG7A 3USZA 4MVJD 4DKJA 4DZTA 1MOQA 2VXBA 3L7YA 1EK1A 5AKKA 3HY3A 1WDKA 4ZI2A 1BXRB 2PQ0A 3SOZA 3GW8A 4FSHA 4FZ5A 1VG8A 1FU8A 2ZS8A 4LPKA 3WLAA 4ARBA 4XYBA 4JT9A 3B20A 1QHEA 5E95A 3JRWA 5B12A 3QELA 3TCKA 1CHNA 2F1JA 1VA4A 2CL5A 2VP4A 4Y9UA 5IDYA 1GCOA 4Z4QA 3Q8MA 1NKSA 2WWWA 2W98A 3TIFA 5FUVA 2VDOB 1HTWA 3KZVA 1JLLB 1V8FA 1CUVA 2P9FA 2M6LA 1RE0A 3HVJA 2ZSDA 1M5TA 2PUAA 3DE3X 2GFHA 2IE0A 2QM8A 1U98A 1ULZA 4GT1A 4NQZA 5DTQA 5EKTA 1SHJA 2PUTA 1X7YB 2P78A 3OFJA 1JSZA 5LUAA 4G0NA 1JJAA 3S44A 5JD4A 2IS1A 4GLJA 3L4EA 3W34A 3A6LA 3J7TA 5HF8A 4DCMA 3WGKA 1FP2A 1E3EA 1UMDB 3PJGA 1J2RA 4PLVA 1J39A 4LI3X 1GY8A 3QUQA 4MEBA 3U17A 1RQ7A 1NURA 3ELDA 1U8XX 4JDUA 2VAVA 5I5GA 1Y7LA 1H6CA 2VWPA 3HP4A 4O29A 2H29A 1BHQ1 3C7KA 3OWOA 3OPYI 4Y2JA 5EE5B 4ZDIA 3W5HA 2Y1FA 4HDSB 2EZ4A 1IN8A 3LX4A 4I1SA 1ZAKA 4PICA 5FUMA 3CNBA 2IXTA 3AW9A 5CFOA 1RHJA 4TN5A 1NNLA 1U5BA 1N9GA 2NYUA 4J3NA 3AX6A 1IXZA 4UASA 4QPPA 4KV7A 2I78A 3QU4A 4JVNA 1WO8A 2HBZA 4KLNA 4RFSA 5JS7A 5MFPA 3MAGA 4TWRA 4OJQA 5ALZA 2YMMA 1MC4A 3KB2A 1DTEA 1B8PA 5C34B 1N2CE 4W9MC 1QV9A 1Z4PX 5DHUA 1JIXA 2RGNA 3QW4B 4QTTB 4XYEA 4EW1A 2FE4A 1OWPA 1LD3A 3ZD7A 2ZB4A 3NBMA 3QIVA 4QDTA 1NDHA 2PGLA 3LCCA 4JB0A 4LI0A 4WERA 4DCVA 1YKSA 3AY3A 3IHKA 4D9FA 4Z7OB 4I4NA 2CV0A 2FZVA 3VTZA 4KPEC 1XHLA 1ZI8A 4U2BA 1O96A 2VPTA 3BWCA 4L5YA 3HCNA 4FW9A 4BKPA 1V8PA 3MOGA 4KGVA 2IQ5A 4KGDA 1I7QB 1L4EA 5FPQA 5D2CA 1C9YA 2XRZA 5E1BA 4I6GA 4YT5A 5FV7A 1OY1A 4XCVA 3M70A 4B79A 3HXPA 2YOHA 3NGLA 3PNYA 2C7RA 1PL6A 1YIDA 5CX1B 1OLXA 4G25A 2KB0A 5JQGB 1NXPA 4EW3A 3IDQA 3C87A 1J7JA 1ZOSA 3VAYA 1UF9A 5KINB 2E87A 2H1CA 3SZOA 1IZ8A 3OTIA 4HMQA 4PRLA 3GI1A 1P2FA 3HB1A 1ZG3A 3CS3A 3K94A 4J0QA 2XA2A 4FQ7A 3V2UA 4UNIA 4WY5A 3EMKA 3WNZA 1P9OA 2EATA 2XYGA 2OLKA 3B5EA 3RBXA 3FUUA 3OOHA 1SZPA 1T2UA 3R41A 1CFZA 2YZGA 1ZU5A 1HOXA 2N75A 3B3JA 3JATA 3V4OA 5EJ5A 5JTUA 4URFA 4GI1A 3CN7A 1NKVA 2WRZA 4LJLA 3M0EA 3L1KA 3QSGA 1ETUA 2XLCA 4Q7JB 1ZWLA 4J1TA 3T7KA 4BLSA 2HF7A 4JP2A 2WI8A 1B41A 4OA8A 5SY4A 3WX0A 3ABRB 4N8SA 1YUBA 3S2GA 1JECA 1UP6A 2Z83A 1QYXA 4CLEA 2W48A 2DLNA 4X1KB 1Z83A 4NZMA 3WBJA 3JQAB 1JFRA 4UDXX 5KYKA 4YDRA 4GXRA 4QBKA 2QMQA 3AWDA 4LG1A 2ETVA 4UM5A 4AN0A 4FCCA 4BX3A 2JGMA 4P2GA 3L92A 2Q6TA 2GZDA 2O2YA 5AHOA 3BDIA 2AOUB 3G9UA 2ESRA 4QELA 3GT3A 3HYCA 4BFXA 1FQOA 4H17A 1O95C 5AKIA 2BFOA 1IM2A 3UAOA 4FNMA 2DB3A 1IQUA 1V1RB 5TMBA 3U31A 2O06A 4U1RA 2RGXA 4OXIA 3DZFA 3W7VA 3NDIA 2WHPA 3CH4B 3DDWA 1GFZA 5CK4A 5CNIA 4L15A 4AJPA 5C3MA 4YJDA 3G82C 3KDAA 1PTJC 3D4OA 4P34A 3CVWA 1Z0UA 2J9YB 2X0IA 1O6FA 2AHRA 2FFBA 2PXXA 1GNPA 3M3HA 4LHSA 3ER6A 3JXEA 4ZVLA 4CTMA 2JLCA 1M3SA 4IFBA 2W4MA 3GRYA 3ULKA 3ZXSA 5DGIA 2C3UA 3BMOA 4YACA 1DBWA 4GPD1 4W5RA 1E5DA 1A9ZA 3VYWA 2X4LA 1HM5A 3A1FA 3HDJA 3RG8A 3HLTA 2OAGA 1NPYA 4QFBA 3EZ9A 1WDTA 4PO8A 1VMDA 3FYUA 2Q6OA 4FK8A 4Q3KA 2H9YA 1T8TA 2KLBA 3ZIAA 4CZ2A 1RAFA 3ZD6A 1Y6ZA 4BN4A 5DNDA 1VJ5A 2ILVA 4HEA1 3REGA 1YRAA 3TXYA 2PKWA 4YRQA 4RD2A 4Q34A 1U2DA 2EEPA 1RRVA 3MJTA 3Q88A 2JI7A 4XVHA 3RU2A 3WTBA 1DKNA 3ZU2A 1H5NA 2FPGA 1H2YA 4A2CA 2XOKD 4BBZA 2YWXA 3H99A 4EJ0A 2RD2A 2B0CA 3GFSA 4L5CA 4ZN6A 3I9V6 4ZT6A 2E89A 3WWZA 4LV8B 5LZ5A 3IA2A 1C9DB 2R00A 4TL8A 2XIQA 5H9VA 1VKRA 2IP4A 3H18A 4ZV9A 2OBLA 3G6KA 2AS0A 2O4UX 4FSXA 4UHCA 2PHZA 3C5HA 4BNGA 2EQBA 2VWGA 4AURA 2DWQA 3KXDA 3UW3A 1XQVA 5GONB 3VPDA 5C8YB 2PPLA 3QBVA 3UATA 1CJBA 2YRFA 1RLJA 2YWCA 3RRJA 3NTQA 4GXNA 1W0KA 4WKBA 4F7DA 3DVRX 2QSYA 4LZPA 4S1PA 3IOYA 4BQSA 4LJAA 1T3TA 2ZB2A 1URPA 2D2VA 2WM9B 3S2UA 2OFXA 2FQXA 1OI7A 4HXFB 1BWRA 2QT1A 3H1BA 3GARA 1ZXXA 1W88B 4LDNA 1VFNA 3TB6A 4BEJA 1CJTC 4UEJA 3FKSD 2EFDB 3STXA 4ZCQA 4XWKA 1R5BA 3KB6A 2BFNA 3T9BA 2EU8A 1IBKB 2B5OA 2CUKA 1P9WA 4X0EA 3THRA 1ZM9A 621PA 4B7ZA 3PE4A 3NHRA 2JAHA 4C88A 5CA0F 3FHTA 1AGXA 1TYBE 2AUMA 2R1ZA 2V6FA 4IUYA 3GNTA 4CIVA 4DLNA 4DR5B 1YGPA 3V9AA 4DVGA 2IV7A 3M6MD 1Z63A 5EWJB 3DCNA 2HSZA 1ECBA 1BQ4A 4LNAA 2XUGA 4OK6A 4G5SA 3PJDA 1TCAA 2AFHE 2P5SA 3B5IA 4HK4A 5CU7A 4K9KA 4IDCA 3TLZA 1MJHA 2KWIA 1DUSA 1RYNA 1LSJA 2OZKA 3OA0A 4BMYA 4HV4A 2RB4A 1D4FA 2ZE7A 4MPPA 3RYCA 2C03A 3CEPB 4A91A 2OCYC 4DIEA 1NX9A 3BZBA 3DC2A 3EA4A 3Q41A 1Y9DA 1JEQB 4EMSA 3ZE6A 3N2IA 1PWZA 4H77A 4LQDA 2PAFA 1QG2A 2J3LA 1E61A 3CLSC 3RO7A 3WLRA 4BXOB 4BN5A 3DZGA 2G72A 1LDMA 3HCWA 1BWPA 1BTOA 2Z2XA 3E3AA 2EZTA 2WE7A 4KMRA 4JLNA 4C3OB 3ZR4B 4B3DA 2HMUA 5A9SB 2ODWA 4FEGA 1THMA 4OAOA 1R6AA 4DM7A 2UUAB 4CG3A 1JJVA 2NO6A 1TCVA 3P0HA 2Q9AA 4X7BA 3GGOA 4MW7A 1V6CA 3KXIA 4FE3A 3U7IA 4B7AA 3V8VA 1TZCA 1PJCA 1KQGA 3FWPA 1DJMA 3UYKA 3A36A 2IQIA 3KU4A 3QVUA 3MPOA 3TECE 5EPOA 2HRRA 4ER0A 3EZFA 5DPMA 2BHNA 2Q0SA 2R1VB 3SJBA 5CA1B 1N33B 2VJKA 1CJKC 1JVSA 1TZBA 5JBIA 1HQDA 1OGJA 1ST3A 3Q72A 1GYPA 4UM8B 5KAPA 5K0ZA 3ERCA 2QF7A 1P1CA 5B57C 3QI7A 2R79A 4OMCA 1QH0A 4HT3B 4CCYA 1GLGA 3LZDA 3Q85A 4TXMA 1XNQB 2VSOA 2BM0A 2YASA 4J4HA 4DA9A 1JIUA 3I32A 4RO0A 2Z9BA 3I2GA 2ZPTX 2FRDC 5DB4A 4D99A 3I9JA 1WUKS 2HF9A 1DT5A 2CZQA 3PNQA 3TX6A 3FNQA 5HE8A 4JEHA 2XZPA 1TA4A 4HADA 4D0RA 5LU8A 3B1WA 1I30A 4V0MA 2OXIA 3ZE7A 2CVPA 1AO0A 4QQ8A 2FR8C 4QWMA 4B45A 4B09A 4Q3AA 1O9GA 1KFCB 3ES9A 1BG6A 2EX1A 1N6HA 4UBOA 2DTDA 3QXXA 2COEA 1FMCA 1T5OA 2I1WA 4PO3X 3PHJA 3G2KA 3IUJA 4BEWA 1V16B 1VJRA 2A9JA 1SGWA 3F3KA 1BQEA 1UPUA 3H2SA 3ONVA 1XRSB 4KGXA 3NWPA 1FFXA 4BO4A 2OXEA 1EJBA 2ZUCA 4DM4A 1FSZA 4KQJA 5CK5A 3F5DA 3ZW7A 5CFNA 2KE5A 2ZIFA 3BSWA 5E7MA 2QWXA 4P0TA 2X42A 5CLLA 3ZYZA 3MBKA 5IYZA 1PWXA 3EH1A 2O6LA 2HA3A 2NADA 2GETA 3NR2A 2ZATA 3LQRA 2ODAA 4E4TA 4I14A 4ZPXA 1ZIDA 1GZVA 2J5RA 3PEVA 3IERA 4UD6A 1KAHA 3BB4A 3LC7O 4ETWA 3NM6B 5I7OA 2R6R1 2VKTA 1IEWA 1QMPA 3K5HA 3K1AB 5EZ5A 2VA8A 2Z0MA 4R7ZA 3V6LA 3GVHA 2FSPA 3C6YA 4KDEA 2BFCA 2YQZA 3OAAD 4UULA 2Z98A 3GJ3A 9ABPA 5CP8A 3H9EO 2Q4TA 4RW0A 5CUQA 3R9XB 1JJ7A 4Q9DA 1E2QA 3DF7A 2BFMA 4PZDA 5DWVA 4C4YA 5F35A 5INTA 5F23A 1NMEA 5DNAA 4H3SA 1WMSA 3H9BA 3ZJYA 3WL4A 4FVTA 2IXBA 1SVUA 1PJZA 4D9CA 3BXXA 3CUEF 3HVHA 2ZRBA 1OW3B 2JCYA 3TVYA 1IBCA 5JRJA 1XEXA 4H7DA 3JVDA 4F11A 5EQFA 4XR4A 1U8AA 1RZRD 3M5CA 2I66A 3QXHA 3WP1B 1GG8A 4RPLA 4MB2A 1C3OA 1NAHA 1S3GA 4G0QA 3KLPX 4JL5A 4EMTA 1P3Y1 3AB7A 1PEYA 1F14A 3TL2A 4Z9BA 5DHSA 3G1TA 5DNEA 4PRZA 2ZAIA 5BWCA 3DPSA 5CLJA 3LK6A 4M1TA 2HO4A 3WICA 4RY9A 5D1NA 2QMOA 4ZGWA 3TTWA 2B7LA 3X0DA 2C7GA 1DP4A 4ILEA 3HABA 1NFQA 1XTRA 5KTRA 4B9AA 1EDDA 2ACKA 1PV2A 2H7YA 4FYVA 2VZ8A 5CCDA 2E85A 3OCJA 1UADA 4X94A 5JH7F 5B58T 2Z3VA 4E6PA 2G9UA 2OFOA 3F90A 5PNTA 1O6BA 1SB9A 2GA8A 5A6VA 3ZWPA 3LDGA 4W8HA 2FK8A 5TPZD 1PDVA 3KOOA 3NHPA 5JZBA 4WCFC 1LTQA 4J49A 4FT2A 4JVOA 1CFJA 4M8NE 4ENRA 1Z0JA 3USES 5I9IA 2AK2A 4F7WA 1ODIA 3E2PA 1HFEL 2Q5QA 3HP7A 5B3LA 1WETA 3HCOA 3Q8WA 4JWKA 4IKEA 5ITZB 2H2GA 2JEYA 3FWYA 2YOGA 4N4AA 3FCCA 3VNRA 4DMMA 3U56A 4K9LA 3WLEA 1BVHA 1KYTA 1SQ0A 1BE0A 1LWOA 1AKTA 2NU8B 3KSAC 2OC9A 4B3BA 2I34A 4AM8A 2A57A 4E32A 4EHJA 4NXMB 3QKUA 1I5OA 4XDHA 1PR6A 3QJ5A 2Q5IA 5IKMA 1E6MA 4R98A 3MINB 3OT1B 2XTNA 4U02A 2C1EA 2ZYTX 3H19A 3ZW8A 4XVUA 2JARA 3M4YA 2NVUB 1XJ0A 1CT9A 2XLBA 2EDAA 4JP8A 2VJYA 4D79A 4K7JA 4DV6B 1XZDA 2HGZA 3DULA 4RJLA 4RTQA 2QNRA 4L3OA 4HYTA 1MOSA 1Q7TA 1TZKA 1Z4OA 2QOEA 3C15C 4IXMA 4Q4LA 1X8JA 3SZUA 3OTWA 3ZGYA 4MLPA 4RTKA 3R7AA 2J7PD 5BVGA 1BN6A 3AB8A 2QAJA 4GPAA 1KO7A 2ZRGA 1D5WA 2R6HA 4TMYA 5IZ4A 2NPIA 3O4HA 2VXOA 4K9QA 1E92A 1ZFNA 3G2NA 4WCDA 3DZHA 5HDQA 4ZZIA 5B1SA 2H0AA 4X90A 3O90A 4LSGA 4EG5A 2CXNA 3D3NA 1K08A 3ZWCA 2CXPA 2C5BA 2YWRA 2P4SA 4JI5B 5JCXA 4I1OA 2XXBA 1R16A 5EE0A 4Z4IA 2BMDA 5T4HA 3KWMA 2DFVA 4AMZA 4QGSA 3U61B 3BIWA 1F5NA 2C42A 2GZRA 1LV8A 5IK2D 1FMTA 1RACA 3FSGD 4XPIB 4EL0A 3RUDA 3QFSA 3OEHD 3M1AA 2O20A 1KDVA 4P31A 3RC3A 1DIHA 2W2VA 4X7MA 2AQKA 4MQBA 5IU6A 1OT3A 1VLQA 4CF7A 2WUDA 2YHBA 4GQAA 1E2HA 3CVYA 2ZW9A 3KFVA 3ESRA 2PL1A 3HKEB 4KMSA 4D97A 4FB4A 4A36A 1XD2A 3ZX4A 2ZYUX 1ZEMA 1OWOA 3G13A 3H4VA 1MD9A 2VA9A 1JUDA 2ZU0C 3HSKA 1OPXA 2F3RA 3IO5A 3OZGA 4MWGA 5H16A 5HEKA 3F5FA 2IV2X 3UJ6A 4HVCA 1P2VA 1QIGA 2I6SA 4NR0A 2IZZA 3OUUA 1KEUA 2V59A 3HDYA 4TRJA 3RUEA 1WDWB 3HO6A 2IS4A 1Q84A 1B74A 3G1UA 3NBXX 5GGYA 4FFMA 1C7EA 5ADVA 4ZOLA 5K4GA 1AA9A 2XUFA 2ODPA 5H83A 1JLMA 3I4LA 1RXUA 1X80A 3EOAI 4I8IA 1T2AA 3DT6A 2N47A 2V8BA 4CF5A 4ZCRA 3VZDA 1AUVA 1DC5A 2FPXA 3V8RA 1X1EA 3RU3A 4AB1A 2H5JA 1IVNA 4YMLA 2DPHA 1OMOA 4REQB 2QQ0A 1D6MA 3NV7A 4Z0NA 3RVNA 3QWHA 1UEIA 2G3YA 1DC3A 3QKTA 1V1JA 1Z73A 3LTEA 5G0WA 3GELA 5L3SA 4A4DA 1GKUB 1NRIA 4D3ZA 1CLEA 1QJCA 1VCNA 3FFBA 1LPMA 4O08A 4BO5A 3GJQA 1NI5A 2B8NA 1D8AA 1ND5A 3M2TA 3PWTA 4HJRA 1TUBB 3KL2A 2XYVA 2K2WA 3R2JA 4RLQA 1NUPA 1CY2A 1G17A 2CKDA 4RXTA 3TNYA 1RLOA 1PR4A 2VT7A 2CMKA 3A9VA 3VVBA 3WTCA 5IF3A 3IKVA 2CK3D 3N59A 5F33A 2ZRFA 5FBWB 3EVBA 5BW5A 3K7EA 1JTVA 3FB4A 4MLDA 5E6SA 4PYOA 521PA 3UMFA 3ROMA 4AICA 3UAWA 1GPYA 3GP5A 2OFWA 2XVAA 3LVQE 5FOWA 4DXHA 2B98A 3ONNA 2QPTA 2DYKA 5CBPA 2G4VA 1IBLB 1ZCBA 1NONA 1W47A 4NFHA 2OC4A 2QU7A 4GI5A 1TM5E 2VPPA 2IU4A 1Q50A 1CX9B 1PL0A 1UBLS 2MSNA 3DVAB 5HXAA 5A0VA 4S1NA 2CLDX 4CHGA 2V6IA 1IOVA 3E7PA 3L93A 3GOHA 2ZYAA 1YAJA 1C5KA 3AUSA 4QSMA 3W9UA 3O26A 2IVFA 1VIAA 4L4XA 2FPLA 3IELA 3GFGA 3RV4A 2H31A 2WFAA 4EQZA 1H0SA 3RRFA 3RS3A 3AUFA 3F96A 3FI0A 3AL2A 4JGBA 5DNCA 3QJGA 3TI9A 2VHZA 1YQ9A 2O05A 4L0DA 2ZIWB 1WHTB 3BM5A 4G8DA 5JS2A 2QRVA 1A82A 4R8MA 4JJZA 2LZ0A 3H11B 3MWEB 4ZQGA 1RMTA 1T91A 1VGVA 2WSLA 4BC1A 1A7KA 3SEZA 1LUAA 1TTHA 1NNSA 1WS6A 3AJ9A 1DCKA 4MQMA 5JS8A 1PG5A 1HA3A 4MUXA 4MA4A 1AKNA 4MYRA 2VDKB 1TYEB 5SICE 1Z5OA 4UJ5A 3RVLA 2IXDA 3ZI7A 1SKYE 1XKQA 2WP0A 1TEXA 1ECGA 2JK1A 4WZBE 3QBJA 4R51A 3ORQA 1I13A 4HGOA 4KE7A 4HDKB 2D54A 4CQNA 2QTVA 3V2IA 4IX1A 4PXYA 1OZGA 4N7JA 4YP5A 4ZAWA 3PCTA 2ZM6B 3OPVA 4NHOA 3QEKA 4GGOA 1MUUA 4WBNB 6YASA 3DL0A 4XX1A 5JAOA 2VK2A 1QLWA 3UGKA 3DDHA 3D2CA 4GOOD 5G4KA 1MT3A 5K20A 1GYRA 2OYCA 1R7RA 3H3XA 4RM2A 2UZIR 1EFCA 5CD1A 4HEJA 3ODGA 3KJEA 1X7WB 3A4MA 1T0BA 3CIOA 1VBKA 1DHRA 1X7ZA 3N0VA 3G9TA 1PX2A 3ENKA 3KTDA 2XWJI 4IWYA 3OQJA 1M2NA 2WHXA 2X2FA 4YECA 3OU2A 5EUCA 4AWXA 2PWPA 1PFQA 2ZQYA 1RSZA 5FLXA 4IJUA 5F3WB 2XDAA 3MGKA 5IS2A 2B7CA 2H59A 1E2JA 3HR8A 4HEQA 2CV2A 1QVVA 3MWLA 1SH7A 3NH9A 4ZOAA 4GYKA 4YMUA 4A0QA 3U5TA 1EM8B 2QLTA 2YS7A 4KYTA 1CF2O 1PX0A 3SJZA 5E6RB 2B4AA 4ALMA 5M7EA 1J0CA 1ZJ5A 4TTPA 3ZJUA 4DQLA 4X1IA 4LSWA 3S2EA 5A4IS 3AVWA 4OUKX 4MRVA 1HYBA 4XX0B 1QGED 1QP4A 1NVVQ 3QVXA 2DCUA 4NBTA 5COAA 3ZBTA 2ZB8A 1P1JA 3K32A 4WXYB 4ER5A 1Y6FA 2AG6A 4AMGA 4BZQA 2O0MA 1PD0A 1EEXB 4KB5A 1SVSA 3H05A 4KK3A 1U63A 1TUEA 1YRBA 3L8EA 1P0PA 1C9MA 2BVNA 1NW8A 2GPJA 5DFAA 2EWMA 3OTGA 1TMOA 5IASA 3W5DA 3MN1A 4MTCA 5LYJA 2ZUUA 4FDAA 4R8LA 3TOZA 5CFMA 4CUKA 2B35A 1QF9A 4PGAA 1JN0A 1WZIA 2I6XA 5A9TA 1ZIPA 1ND6A 1P44A 1X74A 2AR0A 2E82A 1NVAA 2GB4A 4YJHA 4E6EA 4HLNA 3E4CA 4MYTA 3OQIA 2YC4C 4HPJB 1XZBA 3GJ0A 4UUBA 2VRCD 1NE2A 2I3AA 2PTGA 3KNZA 1KAMA 2GPTA 4NCHA 5FBVB 4CM7A 2GSWA 3LSYA 3GRRA 4BZXA 4IINA 4KIFA 4CLOA 3L7MA 1C1DA 3H7AA 1NFFA 2ZBPA 5THQA 3JVIA 2ZTLA 4E3ZA 1QTIA 2J0QA 3S27A 2ZRDA 2Y67A 3FOWA 1KYYA 2IYEA 4HDMB 4W1PA 3WHLA 4DCNA 1I7SB 1BEUB 4U7PB 2HCFA 1SC1A 2JFPA 2P4UA 3ELBA 3UMYA 1G8HA 4M0UA 4NNJA 3HHPA 1M2VA 4EY8A 3W5AA 1XTTA 3LQ4A 1JL3A 5BSWA 4P2BA 2YV4A 3CWQA 3PGA1 1P75A 3F4LA 3DKKA 3T3HA 2H1LA 3QV1A 4P3KA 3P9NA 4UFPA 1WQ4A 1PUJA 3LA8A 2PXCA 5J2UB 4AZVA 1G4HA 4BGEA 4ESOA 4V0QA 1I0ZA 5BRAA 1H93A 3LUFA 4R1MA 4CU5A 1TEHA 3O5AA 5EQTA 3CH6A 1ZD3A 3A04A 4Q1EA 4JENA 5ICEA 4XGNA 4B74A 1QDLB 4HQNA 4TUYF 1HE4A 2J0VA 1GZ6A 1TLTA 2YV2A 1FP1D 3JYLA 3KOZA 3NAQA 5T64A 2JGLA 2XCIA 1XKTA 1E0JA 1Z7GA 2D1RA 1Z12A 4DLBA 4PQRA 2PFSA 4UAVA 4X63A 1KEVA 4BNXA 4Z3OA 3A7DA 4LGCA 821PA 4DR4B 1G8KA 3ILVA 4OLJA 3I6IA 3JD4A 2FMTA 3I04A 4YT2A 4NZPA 1MO5A 4B3TB 2WDZA 3DYVA 3PXAA 4ZRDA 3OCUA 1RFGE 4J03A 4RHEA 4E15A 3EB9A 1E9RA 2AV6A 3K0EA 4Q03A 3WJ2A 2AQHA 4JC8A 1SU8A 2ICAA 2C2XA 3DWIA 5KVQA 2EBUA 1E0AA 1W48A 3K1ZA 3WK7A 4A27A 4RPJA 2QZZA 2NZXA 2OKGA 4QU9A 5KJEA 3MUEA 3RIMA 4TMXA 2PLWA 2NU9B 4PPNA 3CYFA 2I22A 2X1MA 3FNEA 1KGSA 3D5QA 3WKDA 2ZIEA 1E99A 4Z5XA 3C8MA 4HB4A 1W4RA 5FYDA 4QUAA 2VBGA 1G20E 2XRMA 2HAEA 3AQIA 1Z28A 2BE7A 2YXDA 1TQDA 1TT5A 4FDMA 4BQOA 4GP9A 3CO5A 3FFWA 1YQUA 3GJ5A 1I4TD 4Y9DA 4AYXA 1DOZA 4HHEA 2F64A 1A69A 4ZEVA 5BSMA 2JH3A 2GPWA 1GA4A 2J6CA 1JXOA 1UL1X 2E9SA 2QE6A 3P2EA 2RHCA 1K8RA 1U3DA 2DHQA 1R8QA 3DXXA 1T2EA 4HSEA 2IWHA 4F12A 4HNUA 5F5XA 1HSOA 2C2YA 1L4MA 4IUBS 4OI2A 5CYPA 4DSUA 5JWHA 4CLRB 1HDXA 1SCUB 1AMNA 4DTCA 1BGWA 3DLBA 2RAFA 1J8YF 5KYXB 5DLDA 4HEA6 4HWGA 2X2OA 3E1KA 5CH8A 1ZW6A 2JJ2D 1FCJA 2Q1TA 2RI6A 3NTRA 2X8JA 4EX7A 1ZL2A 3R6GA 4J43A 5BNTA 4FN5A 2PDAA 4MUIA 2QD4A 3RSQA 2IBMA 4GR9A 2BN4A 3KSZO 4W1RA 4UEOA 1GFWA 1N6RA 1UM9B 2NSLA 3Q7IA 4D9KA 4QWWA 1H9AA 4F2PA 1RS0A 1UQUA 4BFZA 3VV2A 4IJVA 4UUNA 1XOIA 4Y9TA 2WKSA 3C97A 1MO2A 3WGGA 2Q07A 4HVTA 3USCS 7MHTA 1SIUA 4ZZ0A 2Z4SA 3LDAA 1NMXA 4MRAA 3NEYA 5IDVA 3AF6A 2H0RA 3L7AA 2YC2C 1UBEA 4G6ZA 4YMTA 4FJ0A 3Q15C 3PIDA 2BDEA 4OM8A 4ZD6A 4B3JA 2JAXA 4U6SA 2CMFA 1JR3E 3I01M 1PR2A 2CNKA 4G67A 4JUAA 1Y1LA 3HBLA 4IDNA 3O1IC 4B83A 3IHTA 2GEVA 1FQKA 4ZXPA 3ETNA 4FHFA 3IE1A 2QP9X 1HUQA 5E1DA 1WTCA 4R4JA 1O0SA 1PYOA 2DC1A 3OIDA 1F1BA 5AM2A 1HE8B 4OEHA 1ISSA 2I7XA 4X93A 5HJ5A 3RRMA 2E4ZA 3CH7A 4RWZA 1O0CA 5ALGA 3RBZA 5ENZA 2JASA 2OBYA 3G89A 3WMXA 1XIVA 5A4KA 2H48A 3DBLA 5LL6P 2R65A 1ZJZA 1DRKA 2WFLA 1FW6A 2D8AA 1ZC4A 1L5YA 3UJDA 5K6AA 1YMUA 2VCHA 1HQYE 4TX1A 2AZXA 4YR9A 5BYBA 4BKOA 1YJXA 4KQGA 4RSHA 5JD3A 5C18A 3ZGZA 1QGYA 3MJ4A 1OXUA 3TSAA 1RYBA 2MR6A 3HXKA 4MDEA 1XCBA 3NYQA 3IPXA 4UHEA 3IBSA 1E9VA 3SR3A 4RHCA 1EFUA 4OHVA 3QELB 1H2AS 1CR1A 3KUDA 4HH4A 1TMKA 2AFIE 4KAAA 3IT0A 4O5OA 1SFRA 2PBLA 3JZFA 1KRWA 2WJPA 3PUYA 2XQJA 2OSVA 3K8YA 2DLDA 3NBUA 3QU7A 3E7DA 3QKIA 1XZPA 4IGIA 4I1IA 4NY1A 3UTCA 2C9YA 2QSUA 3A3PA 9MHTA 4O8CA 2QTRA 3KKNA 5K8IA 2EGUA 5DSZA 4KZPA 2P2ZA 4HLCA 2O8EB 1OAKA 1W6RA 4KPUB 2DBYA 3TQRA 1FSPA 1IL0A 2B1GA 4CL3A 1T5DX 2H85A 2PS0A 3M1IA 1TJ5A 4DLUA 3Q9LA 3TNLA 5JOQA 1ZMXA 4QEDA 3UMRA 3LHSA 4EABA 1M1NA 1NZDA 1QX3A 3HCRA 4KJZA 4BVLA 3NPMA 3A6FA 4MR9A 3SZGA 1R5OA 2I67A 1UDCA 3KB1A 2ZRKA 2IZOA 5AJHA 3BSSA 3KFXA 4P3YA 1GGKA 3DEJA 1M6YA 2ZI6A 1I6KA 1XD8A 2NV6A 3GJXC 5DM1A 3TVDA 2PEYA 2G83A 1JSCA 1A88A 1TT7A 2WICA 2EEZA 4P7JA 1U5BB 4BO3A 1N9GB 1Y3CE 3PPYA 3W1WA 2Z1NA 4DCJA 4QOSA 1Y4DE 4YWJA 1DEKA 1R9JA 2ODQA 3I5YA 3FFTA 5JR3A 5HOQA 3BF8A 2PZJA 1M66A 2VTEA 3VTFA 1NHGA 2PXAA 1PGOA 3EC2A 1T26A 3TEJA 1K92A 5JLJA 3U1BA 2A33A 4KGZA 2QTLA 3VOTA 4EHBA 3EXG2 3SZLA 3EEOA 4U3JA 3MAAC 1A7AA 5JSQA 5K0GA 3PQ4A 3ZZUA 1HE1C 4DIBA 5EJ7A 2WIDA 5T7BA 1XU4A 4LZWA 5KPJA 4NMLA 4PO9A 5F2NA 1X0XA 4J90A 3DM5A 5EPUA 1U28A 2Q0XA 1GSAA 3CSSA 4Q9JA 2MR5A 4EH1A 4AWBA 3HCAA 1H2RS 5AKEA 1V7ZA 5IDXA 4GX5A 1BFUA 4V2IA 3MA0A 2QS9A 4RJKA 1VHJA 4YLEA 2O8FA 4KRYA 2JIQA 3WGYA 3WL7A 1E63A 2HUNA 3LWNA 3N05A 3G0IA 4M36A 8ATCA 4ZCTA 1OFTA 1P7VA 1R12A 3CG0A 4BNUA 4EF6A 5DLEA 1CXZA 1XRRA 5LP1A 4U7DA 4CWAA 1UK7A 4QXOA 2PMWB 5G40A 4QOEA 4PG8A 2JGRA 4N3CA 3ONFA 1SXIA 4NBKA 3ZWQA 4NZYA 2DT5A 3PGMA 4BP3A 5JCOA 5GP1A 1EVKA 2ZXEA 4Q3LA 2FEKA 4RL4A 4YJFB 5J59A 3ZBPA 1ZUNB 1ODCA 4BNLA 1CV2A 3BL5A 4M3NA 5B1YA 3OE5A 4BNKA 4ZEOA 2ZR9A 4OH1A 5LD2C 3LO8A 2OAQ1 2QJFA 4DDKA 4XUCA 4EY3A 4CRWB 1ICIA 4C08A 5KSYA 3HZHA 3K9HA 3JATB 3IKTA 3AV0B 1W2HA 2AMYA 2JIZA 2O2DA 1ZM3A 1LVUA 4IEEA 4PLGA 2AXNA 2E4YA 2WIGA 1JG7A 2XTZA 4IGAA 4YAGA 5E7JA 3DD5A 2HQ1A 4UVDA 1NUSA 3OF5A 2DM6A 3KYDA 2WJWA 1E3SA 3OZSA 4N0EA 4M0PA 4QULA 2P41A 4PR0A 5IMBA 2VN8A 4S35A 1QFSA 3RQSA 3U39A 1KORA 3O8QA 3C3DA 1EP2B 3C5WP 3SYLA 1B76A 2O7VA 2QDXA 2WJVA 4BGIA 4MLZA 4H3VA 1H0KA 3CLTC 4MYHA 4MI9A 4RABA 3VNBA 4MUHA 4B43A 1ONSA 4MRMB 1N2BA 1CPYA 4YCAA 2WW8A 1B3BA 1IB6A 2GOYA 2JAUA 5EIBD 4LXIA 2W6QA 1VFPA 4HDQB 3P0JA 5DK4A 1YV9A 2QMYA 3NATA 1ZDMA 1XDDA 1ZD9A 1IWPB 5KYYB 3PF8A 3BMCB 3LP6A 1SC6A 4KSCA 3NHJA 3P71T 2A9KA 4XB1A 1Z6TA 4IIHA 2BFDB 5C8DA 1NU6A 4QTXA 5HKKA 1M2JA 5FCDA 2Y68A 3D64A 5AWFC 4ZI5A 2LNDA 3AH8A 4L5AA 1RI4A 1NNUA 3G2OA 1O58A 1OTHA 4RANA 1DVRA 1XR3A 1QPBA 1SMKA 3E05A 4FYWA 1XZHA 4I1VA 2AD1A 3UANA 1YULA 5CJJA 2HV8A 3JAKB 5GMOA 3NKLA 1EE2A 4UFNA 1ZNQO 4ZCPA 5KVCA 1Z38A 3IQZA 3SFTA 3AILA 2JDIA 4QNRA 2XJ4A 4UM9D 2O48X 2YVLA 3FYUB 3KV1A 4ETMA 1LRLA 4P5EA 5JFTA 2ZAYA 4PG6A 3DEHA 1ECFA 1X7XA 3AIMA 3NBFA 1L8QA 3WRWA 3U1TA 4XIIA 4AJEA 3GYBA 5AIAA 2X8LA 2E4VA 3IJ5A 2EJBA 1N6IA 3VBCA 1QAQA 3F46A 1UINA 3K5IA 4FFNA 3VC2A 5TT0A 3IBTA 1BO6A 2OV2A 2XUJA 4JODA 3M6IA 1M1YA 1F0KA 2FPGB 3SEFA 3AB3A 4D8TA 2ZWPA 4URHA 1SXJA 2CZGA 1UZNA 3EZXA 3IAAA 3DG9A 4OXNA 4M88A 2V7QA 4UZEA 5I6DA 4K8RB 5MN4A 2BCEA 5IBQA 2PRJA 1YUMA 3TI7A 4W6ZA 4ER3A 2FEAA 1QQ7A 1TO6A 2WJGA 3FSJX 5L53A 3DMDA 4DA4A 5ELMA 1MW9X 4DWWA 2R25B 3NW9A 1MRZA 1UXJA 1HV8A 1F48A 4JWTA 4KUGA 1ZHFA 2VTKA 5K0FA 2AUNA 3CKLA 1JHMA 1Y3AA 1ODKA 3K96A 4FDVA 1JHVA 1B8OA 3A37A 1JTFA 1UWVA 3KOWA 4HXEB 4DNOA 2P6RA 1NRWA 1VLJA 3WIUA 4FFVA 1PQPA 4IHQA 4KWTA 4LC0A 1ODSA 2O4CA 4RHXA 4TLBA 4Z4HA 1RMQA 1G2OA 1Y42X 3FHCB 4KQEA 3BD8A 1WXIA 1A9XB 5B3AA 2VNKA 2QIPA 2HH9A 4OV6B 4X6YA 4B31A 3VHLB 4DUGD 4CKZA 5A6SB 3EPRA 2NZVG 4BVBA 5EJFA 5K7SA 2G1KA 3AVVA 3ZK9A 1RHRA 2N42A 2ORVA 3LLVA 5HIKA 1QO9A 1MC5A 5DM4A 4DLAA 1OFVA 5ALTA 4A8HA 4MV1A 1K6JA 3L7OA 3RAGA 3D6FA 4UVGA 2AYXA 2ID8A 3JSXA 5IJ0A 5DISB 1HSZA 1C1YA 5JUWA 4I66A 3WK5A 1SXPA 1O97C 3D8SA 3EG9B 4RSRA 3TPCA 1NKTA 1QDUA 3AONB 3JVEA 3ZHBA 4RU1A 2L0XA 3MS7A 4R71A 1BD4A 2AIRA 2RHJA 4A15A 2H4JA 1DZ3A 3F2IA 3S5UA 4B35A 1E2DA 3RYCB 2Q5HA 4YLGA 3PX3A 1TPYA 5HIMA 2B5VA 3QMVA 2NPFA 3VR5A 4FSDA 1KI3A 1C1HA 3PGVA 1IHDA 1J99A 4P82A 3RJTA 3X2FA 2BISA 3F6RA 3ZHUA 3NNDA 4LE2A 1EINA 1WNTA 4MUBA 2Z9DA 1EDEA 5F4BA 1NVFA 4S0ZA 1YHNA 1P77A 5IM4A 1N3IA 5AVYA 1QIJA 1G7SA 1U9YA 2UXCB 3EF0A 2YCLA 1RBMA 3L1JA 3PC7A 4E0BA 3J81A 1YUNA 3PZBA 2J6IA 3NKFA 4IIJA 4NZ9A 2AOWA 4Q01A 1TU4A 1GRQA 1SUSA 2O7SA 1K0UA 3B9RA 3KJXA 4BWYA 4PY2A 3H0KA 2FEPA 1VE6A 1NW9B 2Q5OA 4OVKA 4QYIB 3SZRA 3AFIA 3DDOA 4FMDF 1MVOA 2B8JA 3I1JA 4DC9A 1AX9A 1Q0RA 1QLJA 4KN5A 4O02B 1KE1A 4B34A 3LOPA 4PSAA 3HLYA 3IUPA 2ZRQA 2NT4A 4Q1FA 4UHDA 5I45A 2R6FA 3VSDA 5HIIA 3UOWA 5C80A 4EK9A 1TB4A 3IQDB 4PYKA 3P0IA 1I3NA 3CA8A 3JPYA 2H9AA 1PL7A 4ZZ1A 3IAM1 4CCYB 3ICOA 1AMUA 1PGQA 4RNCA 2VPIA 2LVBA 3UQYS 5J4HA 4MRPA 3NHAA 4KO4S 4NK5A 4O1HA 1QU3A 1VI6A 2BEKA 3H1FA 4F97A 2OORA 2PL5A 3C7CB 5HPYB 5KTTA 4FU0A 4JUBA 5E9JA 1S9DA 3QK7A 4UAUA 1RPJA 2B4TO 2FSHA 3C6XA 3TMYA 5AW0A 3TQQA 2MYUA 1WB5A 5AUOB 5JXWA 5LKRA 3N8KA 5I3CA 4R0MA 1QTQA 3MCAA 1U7OA 1TLLA 4XUDA 1LVHA 1QNLA 4J7UA 2B30A 3ESXA 2IGBA 4MDHA 4MOWA 4C7VA 3BDVA 5FTMA 3OZRA 3HP1A 3RK0A 3ZHSA 4C3ZA 4E22A 4Y98A 2FUG6 2PS1A 2ZDQA 3KE9A 1ADGA 3MERA 5T4FA 3TBKA 3L77A 1KAEA 4KK4A 1HRDA 1Q1NA 2BGKA 4CG0A 7MDHA 5IT4A 3DONA 1W85A 2IVZA 1FFXB 4JMPA 4LMBA 4TXHA 1GZHB 3VM6A 1Q92A 3AFNA 4EPYA 4C2TA 4IZIA 2PS3A 5FBHA 2D8MA 1GTZA 3GFRA 3LL7A 3WYEA 1M1ZA 2Q49A 1POWA 2V7WA 5IYZB 3LY7A 1C9JA 2ECOA 4ARUA 2HHHB 4AL4A 1IEQA 3TRKA 1JHXA 1Q3KA 4YP6A 2QORA 2NTJA 1W94A 3QPAA 3KSBC 4DR6B 3D7SA 4RPHA 2XGSA 4IMRA 5HR5A 3NYRA 3E1SA 4M0CA 4QHYA 3W3AA 4M4SA 4R2MA 5K9ZA 1R3DA 4TMZA 2PX2A 3MGCA 2BFCB </