1FZTA

Solution structure and dynamics of an open b-sheet, glycolytic enzyme-monomeric 23.7 kda phosphoglycerate mutase from schizosaccharomyces pombe
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
211
structure length
211
Chain Sequence
MTTEAAPNLLVLTRHGESEWNKLNLFTGWKDPALSETGIKEAKLGGERLKSRGYKFDIAFTSALQRAQKTCQIILEEVGEPNLETIKSEKLNERYYGDLQGLNKDDARKKWGAEQVQIWRRSYDIAPPNGESLKDTAERVLPYYKSTIVPHILKGEKVLIAAHGNSLRALIMDLEGLTGDQIVKRELATGVPIVYHLDKDGKYVSKELIDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHOGLYCERATE MUTASE
publication title Solution structure and dynamics of an open beta-sheet, glycolytic enzyme, monomeric 23.7 kDa phosphoglycerate mutase from Schizosaccharomyces pombe.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Isomerase
total genus 46
structure length 211
sequence length 211
ec nomenclature ec 5.4.2.11: Phosphoglycerate mutase (2,3-diphosphoglycerate-dependent).
pdb deposition date 2000-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 1fztA00
2I1VB 1FZTA 4GPZA 1K6MA 4ARSA 5HR5A 1DKMA 1YJXA 2P9YA 1DKOA 1C7ZA 4JOCA 4GPIB 1FBTA 3D4IA 1RPTA 2EKBA 2EOAA 3FDZA 4ODIA 3IT2A 1C80A 1V37A 1H2EA 3ZHCA 1T8PA 3OI7A 5CX4A 3PGMA 2P6OA 2P2YA 1SKAA 3EZNA 3QPWA 2P9FA 4D4MA 3QPVA 2F90A 3LG2A 3F2IA 3IT1A 4HBZA 3DCYA 3DB1A 1C81A 5PGMA 3KKKA 1UJBA 2BIFA 4ARVA 5AJYA 1BQ3A 1UJCA 2PA0A 3K4QA 2OWDA 2P79A 3QPUA 1H2FA 4D4LA 2GFIA 4ARUA 2IKQA 2P30A 4JOBA 2H52A 5AJWA 3NTLA 2YN0A 4PZ9A 3HJGA 3K4PA 1RIIA 2YN2A 3FJYA 2P2ZA 4FDUA 3GP5A 2H4XA 3D8HA 1DKPA 1QFXA 1BIFA 1IHPA 3E9CA 1CVIA 2QNIA 2H0QA 3FDZB 1TIPA 4IJ6A 3C7TA 4EMBA 3E9DA 2RFLA 3EOZA 2P78A 2WNHA 2OWEA 1DKNA 4D4JA 4EO9A 1E59A 3F3KA 3BIFA 1EBBA 1YFKA 1DKLA 2HHJA 5AJVB 2A6PA 5CU7A 3R7AA 1SKBA 1DKQA 4JODA 1QHFA 5HTKA 2HPAA 2DWPA 2P77A 3NFYA 4MA4A 2WNIA 1XQ9A 2ENUA 2WU0A 1ND5A 2ENWA 2P75A 1V7QA 2DWOA 5AJXA 3GP3A 3LL4A 2EKZA 4FDTA 3D6AA 4PZAA 3O0TA 3LNTA 4AROA 1NT4A 2AXNA 4PGMA 5AJZA 1SK9A 3MXOA 4QIHA 4TSRA 1BQ4A 2P9ZA 3MBKA 5AK0A 3GW8A 4D4KA 2A9JA 2HIAA 3IT0A 3E9EA 1E58A 4E3WA 1ND6A 5CDHA 1QWOA 1RPAA 2H4ZA 3IT3A 2P6MA 4IJ5A 1SK8A
chains in the Genus database with same CATH superfamily
4BASA 1KO1A 4CMAA 1T9KA 3H16A 3CLVA 2IEIA 3DC7A 3OC6A 4E07A 3RYCA 1QPGA 4P5PA 3S1AB 1E2JA 2JHGA 1Y0BA 3LK7A 2XT9A 5IYZA 4N7MA 2X19A 1HNNA 4OJTA 1ODSA 3UHFA 2AYXA 4X8OA 3ZV4A 1VM6A 4HG2A 3A4YA 3M4XA 5KVSA 4HAWA 2G5TA 1XKQA 2AA3A 4TKUA 1HKUA 3OI7A 3DEAA 5EIEA 4LIPD 2O8EA 2HJRA 3VR6D 2VYCA 4QJ5A 1Z73A 1ZD4A 3LHSA 4HN2A 1RYMA 2FN4A 2J41A 2V5AA 4GXTA 4TRRA 3STTA 3W8RA 5AXCA 4ARAA 1V96A 2C4VA 2VHYA 2G4CA 4MGKR 2IPAB 4BNNA 1CW2B 1XTRA 3LY8A 3FBWA 2V3CC 1PFUA 4M9UA 1I9CA 1E5XA 4M6WA 4IBOA 2WICA 4EUNA 2CDRA 4HAUA 5EXEA 4BY9E 1KMHB 4ER6A 2CLHB 4U6SA 5EMJA 2GPAA 2IC5A 4YI3A 3U13A 2IYVA 3BICA 3SCZA 5C53B 2D6FA 4XASA 4W63A 1MF7A 5J59A 4CV0A 3AUSA 4BRWA 1KK0A 2QRUA 3ILVA 1S2LA 1KQOA 1BWQA 1L4YA 5M2QA 2D00A 3HYRA 4XTRA 3W1WA 2OBBA 3QIAA 1RIIA 4ZCPA 1NLMA 1U2SA 4YONB 5T4FA 4NBSA 1MB2A 5H8WA 1DBIA 2WYWA 2WF8A 3G2IA 5EZYF 1MAHA 1CUZA 1DJOA 4ZGBA 3E9QA 2B8WA 1Y5MA 4BN0A 4PYKA 5J4YA 2O3SA 3UK1A 4A5OA 1YUMA 4LXXA 2O52A 3AP3A 4KPEC 3VYWA 5AI6A 2H4JA 5HZKA 3BSWA 1AKEA 4GI7A 4LXQA 5I47A 3D3KA 1CJKC 5ALDA 1Q84A 2Q1YA 1GIAA 4FZVA 5J5AA 3HH8A 3GPDG 1X3SA 3FIUA 3HCPA 3OM1A 3GD5A 4INOA 2AN5A 4TWBA 2HU8A 3CZCA 5BSFA 4LCEA 1F51E 3E35A 4I46A 4WOJA 5JNLA 3VVCA 2GETA 1DNPA 1CERA 4YMGA 3AVYA 1LFDB 2GXUA 4TMKA 2OBLA 1N4AA 2C1ZA 2VSYA 3TBHA 1WETA 4YS6A 1ND5A 5ARCA 5TJ9A 4FGKA 2EBFX 2XMPA 1F9EA 4ATNA 4XI9A 3SXUA 5C81A 1NE2A 4LDJA 3R4VA 3D9QX 3PXBA 3EODA 3I2IA 4NJEA 2J9YB 3IEKA 4DZRA 2AYZA 1DAOA 1JWLA 1G1MA 5BV7A 1EG7A 3VX3A 1M6YA 4DBZA 2M98A 2A92A 2AUTA 2Q5IA 5HBGA 3ANYB 3AEKA 5DHQA 3TLEA 1AGRA 3U3KA 1BE8A 3TH5A 4OYRA 2CF6A 3LKDA 2YXPX 2OV8A 4Z9FA 1AQ6A 1N2ZA 5DNYB 4FT2A 1NKSA 2G0TA 2WWVD 5DB4A 3WB2A 1AHPA 2XECA 2FR1A 4QJIA 1NQ5A 3WP1B 1QFZA 1Y6RA 3FNEA 3WAKA 4AL4A 2GVDC 1OE0A 1ZM4A 2Q4DA 5FNVB 5C3MA 1FP2A 4IFEA 2B83A 4JDPA 1J2YA 1QK4A 2YIJA 1M73E 2RCNA 4GOJA 2GK4A 3B5IA 3U1VA 1T3HA 5JXGA 3R3UA 1EB8A 3EQ9A 1XZ8A 2J59A 4UNIA 2QJWA 4LN1A 2Z4RA 4RVNA 3I01M 1E6UA 1NMQA 3J81k 2JGAA 5LD2B 4IW3B 1KRXA 5K0ZA 4N0MA 3E8MA 5HWSA 4KYVA 2FV8A 2AMJA 2VHJA 1ADJA 2XE7A 3KKPA 3KOXA 4K0RA 4L22A 4B8ZA 2R00C 1MX5A 1ZMXA 4EH1A 2WIFA 3V8VA 1JQ3A 2EDAA 3OWHA 2CHVA 3UUEA 4D8WA 4NK5A 2VHZA 4OA5A 1T8UA 2FWAA 1ODCA 4W5OA 2XMCA 3RFFA 4LBZA 1KMQA 1QDUA 4M86A 4D6XA 4J29A 4CR8A 3I6QA 2FK7A 4QBFA 3DLAA 4Y6QA 5C52B 3OMWA 1IRIA 2CVZA 4YUVA 2MMCA 4JQOA 4LBVA 4MMXB 1OI7A 5CM8B 1XRMA 4HRVA 1Y7LA 3GLRA 4XVQA 3VBCA 3J7TA 4KGVA 1PV4A 4EG0A 1MJGM 3C4JA 1HE2A 4DLXA 1A27A 4JFAA 2GKOA 5FUYA 4JYCA 1OH5A 3EX7C 4ZVRA 5TQ0B 1DARA 3WLIA 4EA9A 2UU9B 3BAFA 1J97A 2R8BA 4PX9A 4RCYA 3BT7A 2H07A 3KB1A 1JSLA 1QVAA 1SVMA 2ID9A 2OCIA 1GVHA 3EGCA 4MB0A 2VF2A 4P2BA 1TT7A 1V9LA 4M1EA 4XYMA 1NBEA 2Y2UA 2Z8YA 2YFYA 1NR1A 1YB4A 1NUAA 4Q7LA 3UOWA 2GZDA 3IXQA 4BMVA 4WINA 4E5PA 2NUPA 3K92A 2ZRQA 2QTGA 1S2GA 1JWAB 4E5DA 3K05A 1DMSA 2IHJA 3DSRA 4YJGB 4RGQA 4UXHA 1AE1A 1YDMA 2B4YA 3CTPA 2B35A 2XMDA 3ZWCA 1J2JA 4AO8A 4YRGA 1W25A 4XCXA 2P3OA 1JT2A 1OYYA 1PKXA 4EQ6B 3TUJC 3L1UA 4B71A 2SKDA 1LC0A 2BVNA 4C2BA 3W1VA 4L6CA 4QUEA 2E0IA 1JFRA 4UE2A 4DLZA 3VR6H 1ULAA 3BDAA 1TGYA 4KKVA 4Q24A 2PYDA 4KYIB 1PJSA 4R9VA 1WO8A 2FZ5A 4KO1S 5HDBB 2IYNA 4NF2A 4RVDA 4HX2A 2LCQA 4B7XA 3AHFA 1W36D 3OIDA 1UFKA 2OOSA 5C5IA 1FDRA 3RRMA 2CD7A 1J99A 4RY9A 5G3YA 1GFIA 4F7DA 9LDBA 3T5DA 2A8YA 3LI2A 1VG8A 1WZ2A 4LJYA 5JTUA 2PX6A 5CGQB 2WUWE 4KVGA 3MUNA 5G0SA 3EEIA 1R6BX 5AW5A 4TQ9A 4M0EA 4MVJM 3ZPXA 3NP9A 5TVGA 1CZLA 1V7ZA 1O9BA 3CX3A 1YU6A 3GEHA 4M1QA 5EUCA 2PWYA 5KI6A 2D0PB 3BILA 1UT8A 3EVDA 3S2EA 4DDHA 3G8YA 5LJIA 4LMAA 2B4RO 2H00A 4N0PA 4C4SA 2R00A 1OTHA 3WV5A 3LY9A 4BFSA 1YF3A 2MTBA 1H3EA 2VPXA 3A27A 3M34A 4G65A 1CD5A 4BO6A 2QXTA 1UK7A 2A0KA 2GBGA 1MLDA 2I78A 5LQDA 2VK8A 1PFQA 5GOZA 3VKWA 1WM1A 4AP5A 4O4HF 1TVKB 2JI7A 1Q7EA 2XSZA 4CETA 4KXUA 3CZ4A 3C6ZA 4P7JA 1QQTA 1L7RA 1I6MA 1A2QA 1XVTA 1Y6JA 2F3QA 2WJYA 2ZP1A 3L7MA 3P20A 3OCWA 3CX7A 5F21A 3WGJA 3UG6A 1T36B 1UOEA 3FZGA 4F2HA 5JFOA 3GLVA 3ZGOA 5KU1A 3MSCA 3QEOA 1XLTA 4AKTA 1SVOA 2QUBA 1WVIA 1GGMA 3I92A 3M6UA 4IIXA 4PGHA 3E5HA 3ZHZA 5BRAA 3T5CA 4AQYB 1V47A 4KFSA 3HNPA 3X1DA 2IYQA 1MEOA 4DPKA 2GZAA 2XMRA 3QW2A 4L27A 3EBLA 3PHGA 3WG9A 1GU1A 2WTNA 1JMVA 4E1VA 2VDOB 5B6JA 5EJMA 2IODA 2HTFA 1ODFA 4ENTA 3GNQA 1HDYA 3OPVA 5G4KB 1J9GA 4OBWA 1WTCA 5JPIA 3PTAA 4D26A 3PLAE 1RTKA 2XLBA 3EEFA 4IAOA 4UCXA 4TZ0A 4RZ2A 1O4WA 1EP1B 2AQKA 1A72A 1UXHA 1N0HA 1NMXA 1GRNA 3C6QA 4MV0A 2KBFA 3QJ5A 3T7DA 3ZWXA 2E7ZA 2C9DA 1XBTA 1JQJC 2O3QA 2ZSIA 3LQ1A 3O73A 5LZ8A 3R41A 4CQJA 4EA7A 3HBLA 1LGYA 1NIPA 2CHQA 1R3DA 1VFPA 1Q0HA 2VHVA 5FA5A 3AX6A 4M1MA 4Z86A 4KN9S 4CXMA 4RPJA 1P0QA 1DKPA 1A8PA 1CY8A 2F3TA 1KQFA 4I1SA 4MV3A 1UC5B 1PL8A 3GAMA 3M5DA 2GD0A 3FSRA 2QNIA 3OKPA 3LBIA 3QI7A 4JLUA 4WZAE 4K6FA 4CM4B 2QGZA 1B6TA 3R7WA 5IAJA 2X3FA 4URWR 4LOIA 1CP2A 1YL6A 3DBRA 1U0FA 1ZAYA 2Z5VA 1LK7A 4MRSA 1ZMTA 4INAA 1TA0A 2AV6A 2EERA 5KDDA 2B30A 1V1MA 3HNOA 4HUQB 3CG0A 3L1IA 5CLHA 3ZHUA 1T25A 3KZ1E 3T52A 3L84A 2P4EA 4UXJA 2HC9A 5CP8A 2XADA 1SEVA 4DTIA 1KQGA 5TQJA 5KWJA 1I36A 1YRAA 1O0BA 1VMKA 4CR7A 3FTEA 4Z53A 1H8HA 1KP3A 3WY9A 3ZVMA 5ITZA 4KHPB 4XR9A 4Y1RA 1E18A 5CXSA 2Q7XA 3R9KA 3IALA 5LXTF 3RUHA 1NPYA 1G2QA 1IJEA 3KWMA 3PHBE 5BR7A 4QQKA 3U7FB 1RJWA 1YRQA 2F4NA 3DVAA 5SZIA 4D25A 4M99A 3ELYA 2BONA 1JIXA 4M89A 3S27A 2BEUA 3O8CA 4OUKX 1GTL1 3M6VA 1U80A 4DF3A 1PR2A 3KZXA 4HN9A 1Y8RA 4H7PA 5BN4B 4ZT7A 4BNDA 5DDIP 3PR3A 4QC2A 5C2JB 3MTGA 4UBMA 1T0BA 3CCFA 2AOTB 1DIRA 1G8GA 4E21A 3ELWA 2C8JA 2QAGC 1HFEL 3PEFA 2BLLA 4ZI5A 1SBZA 3EDCA 1QTNA 7REQB 3GRZA 4J91A 4Y6SA 2JASA 1SG9A 521PA 2PZ8A 3WFJA 4YCJA 4DFDA 3ROXA 5HR5A 4IIBA 4JEUA 2FPXA 3AUYA 2BKXA 2F43B 3UBMA 3NT5A 1AURA 4EYQA 2XZDA 3U9TA 4UQOA 1T9HA 2C9OA 4HSGA 4KPGA 4OB6A 1Z0SA 4U6QA 2RIRA 3HVRA 2J07A 3K0AB 4POAA 3OZRA 3L41A 3KVRA 2ASVA 2QJFA 4PPGA 1QNLA 1D6JA 4DC1A 3DMYA 3MWJA 3OD1A 3P2YA 4RVSA 4L0MA 3L0CA 1E0JA 2FKAA 3G8AA 4LISA 1SAYA 2BCGY 3SYTA 3MBOA 3LUFA 3S44A 3TKLA 2J3JA 3E27A 1P2TA 5KTPA 3GJ7A 3KQSA 1KMIY 5J40A 3KJGA 1S2DA 4MJXA 2C2MA 3RC1A 5K0JA 2N0SA 4J0QA 3CRW1 4YAKA 4D8TA 1GPYA 3EW7A 4JUCA 5A9TA 4BZWA 4XM1A 4U4AA 1W85B 1H6AA 1UJ5A 2YZ7A 2FPSA 3CZPA 2GYWA 5FV7A 2Z6QA 1H0RA 2HO5A 2BEVB 4E13A 2DF8A 1ULHA 1FDOA 1P9OA 3HO1A 4IIFA 4FJ0A 5BSUA 2HIMA 2DWQA 4UU8A 3V7WA 4A27A 1AGYA 5AI8A 1FFXB 2TMYA 4WLOA 4L3VA 1QS0A 4RQBA 4FW8A 1IQRA 2Y3IA 2FPKA 4CG1A 3UUWA 3FCXA 4BPBA 1OC4A 4ZOBA 2HSZA 4UM8B 1J00A 1CQZA 2ERXA 3AIIA 3IODA 3SYKA 2Z6UA 1P31A 3CLSC 5NULA 2GEBA 3MS2A 3SHQA 4H7KA 4J1NA 3FUXA 2P27A 3RF6A 1MXFA 1YU9A 2PLFA 2EZTA 3IPYA 3FROA 3L0PA 3M4YA 3NHAA 2R25B 4LVUA 4FLFA 4WA8A 3WK5A 4MYUA 1EWRA 3L40A 1K2WA 1TO2E 5EGNA 3LT0A 2BSAA 3WO1A 1DLJA 4EFNA 5BWLA 5LQRA 3KUUA 4G0QA 3T0IA 3RRJA 3UJPA 3IMKA 1Y4DE 1ZD3A 5FI3A 1HOTA 1M6HA 1SCJA 2XKJE 1RWPA 1YQGA 3WQQA 3GAAA 1TNDA 4P4GA 4ZOCA 1PHRA 3WTCA 4YYZA 1US8B 1STOA 2EBWA 1C7RA 2Q6IA 4TLDA 5B37A 4DGSA 5KTSA 1GRVA 4JZYA 4OXRA 5D5HA 3UAGA 1GZ5A 1VLLA 3X2EA 2HHJA 4MVJG 2G5CA 3O3NB 1WS6A 3PB3A 1GQQA 4KRGA 1P81A 3GY0A 4NEQA 2H48A 4C5AA 3QE4A 1E2HA 3DDNA 2AFIB 5DXJA 3ZDFA 3JZIA 2ZTSA 1KZ9A 2IVFA 2QAGA 4C2TA 4EFDA 2QG4A 2J9FB 1UANA 1Z6ZA 1JR2A 5EAIA 1RQLA 2ZJ7A 3V46A 2P2NA 5K8VA 3GP3A 3IULA 3MD9A 5LQUA 4JI1B 1YZHA 1W36B 1RYYA 2W0MA 2FYTA 3AZQA 3KS9A 4L50A 4WJLA 2VT3A 4WACA 3RDPA 5EE5B 2Z5GA 4TWAA 4TSKA 1TM3E 3UW3A 2MSWA 4L74A 4B9EA 4MVJI 4POOA 4GO1A 3Q40A 2BHNA 2RG1A 2I3AA 2OP0A 5CB8A 1MJHA 4NOKA 2GF2A 2OORC 2PL9A 4WDQA 3NXKA 1XZPA 1PUXA 1C8LA 3AESA 3G7UA 3I8SA 2B94A 5B3JA 1I13A 3T3GA 3UJNA 4JSYA 1IXSB 2EJTA 1RAEA 3PQ7A 4IGEA 5FL7A 2OBFA 5EIBD 7GPBA 3FGOA 2VJAA 1JQDA 4DV3B 2FUNB 5ABPA 1D2EA 4B17A 4QHSA 3A8TA 4GPTA 4HTFA 3EHDA 3BXHA 2H9YA 2J1LA 1H42A 4JOCA 2CSUA 4E5NA 1E9FA 4CM3A 4MRPA 1YMQA 2PAFA 3NJ4A 1ZMRA 1FQKA 1YZLA 1C0PA 2ONCA 1Y9EA 1KS9A 3VKUA 1SD1A 1TRHA 1ZQ9A 4D3FA 4FOTA 4GDFA 3H8WA 1JJ7A 1FVFA 1R8XA 4PNZA 1CFZA 1H22A 4JI4B 3MINA 1V8PA 4LMRA 4U7WA 1MH9A 1G5QA 3PGXA 1CQJB 2ZJOA 5EMLA 3MWDB 5F2OA 5HGJA 3LLCA 1IEXA 3ZIUA 2BBWA 4UZFA 3VHXB 5MF6A 1ISHA 5FBQB 4RIFA 4PFQA 3F7NA 2VJQA 4M1WA 1JDJA 5C9ZA 4HBZA 4KMOA 2PGAA 2O0MA 1F7VA 1PYDA 3HCWA 3NIFB 2H1FA 4WXHA 5H82A 1K6XA 1M2FA 1S6YA 3KOUA 3SHTA 3T3HA 4OOFA 3D0OA 4FW9A 1PYOA 4XYBA 1S2MA 2OK8A 5D5QA 4EHDA 1NVKA 3I9MA 2PA0A 2ALJA 2EP8A 4ZRMA 3MGGA 3SZOA 3FCSB 1AY0A 1RWXA 3P2OA 4C0JA 2EZ4A 5T57A 3OA0A 4WTOA 4F4JA 2I1LA 4QGAA 2BW0A 2ZZNA 3JVEA 1QO0A 4LJ7A 1NOIA 3O9VA 5GJCA 4K8OA 4U1RA 5AJUA 1KR5A 3V6LA 3AFMA 4F91B 2QRMA 2RBKA 4B6OA 4GNRA 1I1OA 2PWZA 3AZOA 4Q9HA 3JSXA 3IA7A 3R3WA 3T1HB 4JBYA 1PX2A 2K2QB 3B1WA 4R2WA 3IP7A 4US0R 1O94D 2H5EA 5IS2A 4MCIA 2HSEA 1PFKA 1QCYA 2FX2A 3RT9A 1GTG1 2FR8A 4BBZA 4X5OA 3D3WB 5JD5A 5KX5F 3VUFA 1GPDG 3IPAA 3VTFA 3EAGA 3W5AA 1HRDA 4Q4JB 3GH1A 4YPFA 3ZE2B 4HN4B 1WY7A 3GDOA 3RVRA 3R76A 4EQZA 5REQA 4HC4A 3BRCA 4AKHA 1TT5B 1TCAA 2V59A 4PGFA 1U8TA 2FAXA 2I80A 3PYLA 4KO8A 4LDZA 1SUFA 3JQEA 4HAZA 3N2GB 3S28A 1P4GA 4NMWA 5JU6A 2AR0A 4KH1A 4KPUB 2PXAA 3FD8A 3IE0A 4D57A 2AG6A 4F3CA 3K8YA 4PHCA 3RVDA 2VJPA 1UXJA 4RTQA 5MGBA 1M2VB 4LW8A 2IEDA 3T3IA 2O0LA 1NXTA 3EISA 5AM3A 3LGSA 2ZYUX 3H11B 5IM4A 4FWTA 3VNRA 3CUWA 1WXWA 4JMPA 9MHTA 2ZSDA 3CE6A 4PGMA 2CDCA 4FQ5A 2VATA 5TR9A 1CB0A 4JLJA 1E92A 2GJSA 3LUCA 3N87A 1RQRA 4S04A 4MVYA 1Z7GA 3BYZA 3ZV3A 4QRDA 4LX8A 2A9JA 5BYJA 1HLGA 4CM9A 1G8FA 4MAMA 1DI0A 5E6UA 1QQBA 4I9UA 2MR6A 2NAPA 3H97A 1IQPA 1B0ZA 1ZH8A 3AC0A 1JG2A 2HJSA 3HBAA 4G25A 1UMBB 2AD1A 3ETNA 1LPOA 4NKRA 4ZCSA 2VHCA 5T41A 1V3TA 4P0QB 3KT8A 3IV9A 2AN9A 3JZDA 1E1QA 1HF3A 3TZEA 4JHXA 5COBA 3Q7TA 1KSJA 3DP7A 4BJ1A 4I50B 1B6GA 1L3CA 4CG2A 5EZSA 1H2RS 2PL3A 2IHYA 4YAOA 3UJ6A 4PHHA 2C8LA 1EHYA 1UBEA 3BRWA 1W34A 4N6OA 4PLGA 5FEMA 1IY1A 3RS7A 3ZKAA 2WJGA 4CYMA 2XD4A 3E4DA 1VYUA 5DGHA 2WUFA 4HNQA 5BMOA 1ORIA 2CGEA 3GJZA 3MJVA 3K15A 3DHNA 4NG4A 2Q4BA 1W5FA 3BSFA 1GOTA 3UEOA 3TE7A 5AVWA 4W8HA 3CNOA 2JD1A 3UXEA 3OLZA 1NJFA 2I6GA 1KI6A 2H08A 1N5JA 2WP0A 4MCHA 3UWDA 1O1YA 1ZRMA 4ZV4A 2QR5A 2E4UA 3DE2X 3HKCB 4BQSA 4BWYA 5KC8A 2BR3A 2RGCA 3QH4A 3BMQB 1DX9A 4TT8A 4FKMA 4P7BA 4B87A 2D2VA 1RKVA 3CUUA 4JBWA 4TXMA 5JS2A 3HR7A 1D0VA 3EF1A 3EIHA 3F5FA 1WD5A 2VDPB 3URMA 3EDRA 2XDQA 1MIOB 4P7FA 3R8FA 2HXYA 3IA2A 2X7HA 3OFNA 1M34B 4X9XA 2XCUA 2GFIA 2JEYA 3AONB 1KK2A 5D86A 1KHTA 4FGLA 2NTEA 1CRZA 3AJ9A 9GPBA 1HNZB 2A5LA 4CFSA 4HNTA 5KSOA 1RU3A 2G70A 2QRZA 4OH7A 1V41E 3WGKA 2WWRA 2ZJ1A 4LE1A 4XQEA 1MRZA 1KL7A 1EWYA 3PUWA 4HQ6A 5IKXA 2O7RA 4CMEA 1I51A 2RHCA 3P0EA 5FBHA 3U19A 3UMBA 5FOXA 3OVMA 3RYIB 1U04A 3CBQA 4HGZA 1AHNA 2JLQA 2DHEA 5FLXA 2V58A 4KDFA 1OBFO 4RPCA 5KNDA 3HXQA 2WNHA 3GEDA 1O8BA 1VBFA 4MMZB 2JAWA 4RQUA 2XYQA 2Z6VA 4LJLA 3RK4A 3WNQA 3SSAA 4C04A 5CJ2A 2VT6A 3N2ZB 3OH8A 5I7OA 2OKGA 4CR6A 1P2SA 1TYAE 3ZK8A 2VF4X 1UJNA 3HDHA 4QFBA 5F7ZA 3HA2A 1V3UA 3AUAA 3ADBA 4MTLA 3RFUA 3UFBA 1D9ZA 1GYQA 1UH5A 1GQ2A 2R6AA 2V6MA 3EMBA 3GWGA 3KSDO 1JDUA 5EJEA 2ZYVX 1BD4A 2ZKLA 1Z0DA 3IFSA 3IJEB 1JI0A 1QZUA 3PQ2A 2XGJA 4ZICA 1GG8A 1HG1A 1GNQA 2BZ0A 3FNGA 1JQKA 2W93A 4H2DA 4IHJB 4UNSA 5EZ5A 2WDZA 2AG1A 3HP4A 5EJ8A 4GEKA 4Q00A 2QMHA 3TJZA 4GX0A 1NQAO 3NM6B 6PFKA 4BLPA 1U65A 1PK7A 2AXNA 4R16A 3IVGA 1L4NA 2Q1UA 4I19A 4RA9B 4RFVA 4ZEOA 2C54A 2CY0A 4IMPA 2OD7A 5KREA 2V0GA 2C7QA 3ZD7A 2BBOA 1TTQB 1ESZA 2BM0A 1TJNA 5HUJA 4Q4HA 1JHXA 1VKOA 2FUG1 3GLGB 2P1RA 3AETA 2ROQA 5HX7A 2EC5A 2GBCA 1X94A 3FUCA 3PGKA 4C22A 2AKYA 2FF7A 4ARBA 4FWBA 5H5JA 3TEFA 1WBJB 1Z2EA 3LXMA 5J9FA 1DBWA 1DC7A 1PW5A 2R96A 2WD7B 5DM1A 4DWJA 4P4LA 2PJUA 1SCQA 4N0QA 4EJSC 1GITA 4QT4A 6NULA 1IQ0A 3QFTA 1FMJA 2BL4A 2WG0A 4E0BA 2AJDA 3T3NA 2VLBA 1UJ2A 3C1OA 2UYQA 4B7CA 1QR6A 2HU5A 5E1BA 4X97A 4DQXA 2NW6A 1RPTA 3TGLA 3B6MA 1XZLA 1HT1E 2CEKA 3NM5A 4PWZA 3HU3A 3KZVA 3MYRA 1VIYA 2O20A 2C2WA 1P62B 5KQLA 1NMYA 4JENA 2ZU0C 1TRKA 1SQFA 3IOMA 3OWOA 3BA6A 4ZO9A 2PGLA 1KH1A 4TXLA 1J6UA 4WXRA 3CTMA 1S4QA 1TKCA 5JDIC 2IYEA 3GIWA 4PC6A 1UFOA 2FG6C 3E4CA 5SZHB 4HDSA 4R1UA 1QFMA 1QPZA 3NDBB 4AD8A 3DCYA 3R9XB 1RWBA 1I2CA 3H19A 3OZXA 4FFMA 4II7A 3WK6A 1DAKA 4JP1A 4LG1A 2FJUA 2J5BA 4ZMRA 4DG9A 4MQUA 2BFBA 1FDVA 3GAZA 4M76B 1Q3HA 1YA8A 4F84A 4PHGA 3QQPA 4AS3A 1MRNA 4OHKA 3VZDA 4NZNA 1MABA 1WDTA 2H5JA 2JH3A 2XUZA 1UKEA 3AJDA 3N0RA 2B98A 3ISTA 3V97A 5CW2A 2OGSA 3UCXA 2SKCA 3AY3A 3TOSA 4NXMB 3CEHA 4ZI3A 3AKDA 1U2GC 3DFKA 1PWZA 3DVSX 5DCWA 5ALMA 5ICGA 2KB0A 3C15C 4KXFB 1KKMA 2BZGA 3KG2A 2ZWVA 1I80A 3ADOA 2ESRA 4OD0A 4D9HA 1QE0A 3L6EA 3CIFA 4X8HA 2RGXA 2XMZA 1XQXA 4LZAA 4X24A 3I28A 4IQ0A 4BFCA 4KAFA 4AY3A 1ETHA 5JZMA 1RRCA 4RDXA 5KO2A 5LDHA 4MS1A 3DZFA 1QHYA 3OCVA 5ANRB 4AWXA 5J1TB 1C30B 2G07A 3ZCPA 1RBZA 2DPGA 3UGKA 2HT1A 2PZKA 1I3CA 3OM8A 2PPVA 1Z36A 2PGXA 4K9SA 3ZE1B 3MB8A 3IE1A 4YAWA 3AHHA 3BL5A 1O08A 2QRPA 3H13A 1J8MF 1JN0A 3PVSA 3WYCA 2J0SA 2C5BA 3H9QA 1MOSA 3BHJA 3CLTC 4Q1BA 5CDFA 3ZWKA 2FFBA 3RS2A 1E0KA 1RJGA 2B2CA 4M98A 4MV7A 1BQEA 1L9KA 2C03A 4FGSA 4JODA 4Q21A 4RC9A 4WGGA 4E4RA 3ZGZA 4J0EA 1RXUA 3MCWA 2ZM5A 1U5BB 2Y8EA 1QZ3A 4LV8B 3M1IA 2PL5A 5KEIA 2WR8A 3R23A 1DG9A 3CC8A 1AKRA 2PHZA 1JIQA 3L0SA 1T3GA 4J6FA 4PE5B 1V5IA 1QYWA 2BFDB 4R01A 4CZ2A 2P11A 4NFYA 2PGOA 1L7PA 2BN4A 3A9WA 3PUHA 4G4SP 4Q1DA 4YJDA 3LWDA 2XTJA 3T95A 2VFAA 5BSVA 3V1YA 1DXQA 2J87A 3JQAA 1TYDE 1CNEA 2OZKA 3VPHA 4BVLA 1PGNA 1S1CA 4ZO4A 1QYRA 3VVBA 3UMRA 2FEWB 3MXOA 4YRPA 4F04A 3G0HA 1ZP6A 4NAUA 4IR7A 4F11A 4IOLA 5IJAA 2VAPA 5F2NA 4E4TA 4IDOA 2JZCA 4DLSA 3IAEA 4CM1A 4OAQA 5B7NA 1UP6A 4LKOA 1VJRA 3M33A 3NV7A 3R3VA 1PBNA 3GHYA 4MGYR 3RU3A 4JLDA 5EEGA 2PMBA 5AKZA 3T7CA 3RHZA 5K0EA 1YQDA 1YJXA 3NGMA 3VYTB 2YXLA 2IDMA 2KMLA 2M6RA 3LPNA 1KDZA 4Y2SA 2ZG6A 3O8OA 1W1UA 1RT9A 1ULZA 3CYFA 4X8MA 3PNPA 4AYWA 1UPBA 1NWCA 4QVKA 1ZXLA 2EV9A 3BGSA 5ARDA 3QKSA 5C1PA 4H1HA 1JKJA 1VI2A 5IUKC 1I1HA 2RB5A 1NXVA 1ZIOA 1ZRSA 1JHZA 2EFJA 3KAQA 4EPYA 4P84A 2GCIA 4MKXA 1TUBB 2J3HA 2FG5A 2J9ZB 2Q7DA 4NCIA 5CFNA 1JHQA 2Q5LA 3HCOA 1W94A 5EESA 4BQIA 1CRWG 1B0PA 4HRAA 1ES9A 2ECKA 1V35A 3ZDAA 3K9WA 4K26A 4PQRA 1QH8B 2P9EA 5D00A 3DUFA 4AN1A 4D02A 1IMOA 2GF9A 1VKHA 3NHWA 4DABA 1XKLA 5EC8A 4AECA 1EZ4A 5DX0A 1QZXA 4TYPA 4YRMA 5DASA 1XNGA 5J3JA 2OBXA 4DQDA 3LDUA 3LYUA 4I81A 1CUEA 4EENA 1G3UA 4D9JA 3IKVA 3F6CA 1NFRA 4GOND 3DAHA 5AKXA 2FQYA 5F2KA 1S96A 1VKZA 4B0OA 2CXUA 2FSGA 5CA0A 3IR6A 1H2ZA 1WPQA 3C5WP 3L49A 3ICOA 1Y80A 5D6OA 3S2UA 2QTFA 3QMVA 3VPSA 2WOJA 1UBRS 1Y8QB 3OTHA 3WLEA 5CDTA 1YVUA 2IY7A 2PCLA 3PNBA 4C1BA 2B7CA 4OHZA 4UUBA 3DVLA 2Y0DA 2XXAA 1MH1A 4Q0MA 3VBEA 2XSZD 3U26A 3TSCA 1UFQA 4DSUA 5KYNA 2YJZA 3C3WA 3AKEA 1MB0A 3RYCB 1Y63A 3C3MA 4YO8A 3ZGYA 1FNCA 1ZKMA 4LF8B 2BKUA 4QREA 1KI7A 3URKA 3REOA 3I52A 2HUPA 2JFHA 3AL0C 4DR3B 2F17A 1Z07A 1ZFNA 2P78A 1E61A 3BIXA 3BGIA 4YP9A 4FBMA 4HFRA 2AI1A 3LBHA 4KN5A 3F9CA 3EHEA 3OZ7A 5DOZA 4CLHA 4ZMSA 2PSEA 5DI9A 2I33A 2PK3A 5FO1A 3NBFA 1K92A 3LUBA 5B58T 1XO1A 4RK0A 4D6YA 3TTXA 3OMXA 1BWSA 4K86A 4YRFA 3U16A 4R8KA 1YT5A 1BE6A 3EAQA 1JECA 1LJUA 4YUXA 2GAAA 4G8CA 2Q3CA 4M6WB 5AW7A 1MO2A 1T5DX 4PG6A 2HMAA 4UHDA 1OXSC 4ZARA 4R5MA 4DAEA 3L93A 2ADMA 1TAGA 4DLKA 1EYZA 1UOQA 4DARA 3WK4A 3CURA 3IAAA 4GC9A 1Q21A 4A8PA 2XZOA 3KR0A 2XVXA 4QIHA 1G3IA 2V7GA 4F4HA 3RLFA 5JC8A 4Q3NA 1N3BA 1UXGA 1KZ4A 3PHIA 4H15A 3AGPA 2WF9A 1BVHA 5A3JA 1ACLA 4UNPA 1WZNA 3L02A 3LVFO 3BXFA 4IMJB 3VHLB 1PG5A 3MXTA 3JQFC 3WWCA 3O4HA 1D4AA 3TRJA 1Z25A 5JVDA 4ZODA 5B1EA 2OAEA 2JIZA 1Z38A 5KQRA 2A9QA 1R6AA 5D6NA 2EJBA 4DEYA 5JMOA 4MRRA 1M0WA 1CNFA 1E6CA 1X9IA 1RMYA 3WZ2A 4A10A 2VH5R 5JY1A 3R6DA 5FCDA 1UOOA 4DANA 3NEPX 3ENQA 1NT2A 1J1ZA 4IIDA 4O33A 4WLFA 4R8VA 5FFMA 1J1UA 4A6XA 4IG4A 2M6LA 1RYNA 4PYIA 2YZMA 1EM8A 4RJLA 1JFTA 1H8HD 2QD4A 1MKYA 3PIDA 1MJGA 1XP5A 2QMZA 4HYEA 4J0DA 2WTBA 4OU4A 5FHRA 2YHBA 4BO5A 4DQUA 3OCCA 1HA3A 1XQWA 3IDFA 1ZBQA 3QUCA 5D3QA 7YASA 4GC5A 1UPAA 3UKJA 1SXQA 5LZ9A 1JU3A 1JDNA 5IAOA 4DUGD 5BSGA 4O0LA 3RAPR 1E3SA 2HCFA 5A6VA 2VT2A 3T1NA 2GLUA 3TI7A 4HDQB 3SXUB 3R0QA 1PDWA 4MUMA 3ZWPA 3RFCA 2I6UA 2WV7A 4NJEB 4U9HS 3BMCA 1EGHA 2Q3JA 4MQMA 1XWWA 3F90A 1GQRA 3MTAA 5FBVB 2QLNA 5IF9A 2V6JA 2R60A 3QBVA 2ARKA 3AEKB 4P7GA 5AVXA 4WE3A 1PS8A 2A67A 1C9JA 3LW7A 4GPAA 1E4VA 4N49A 4TMYA 1EQAA 3GRRA 3I9KA 3S2SA 3BRQA 2HCBA 3O6VA 1T6BY 5TLSA 4ZQCB 5TXGA 3LKZA 1JHVA 2JFQA 1E1KA 4Z2YA 3W6UA 5KNCD 3LZDA 2BY4A 1C9MA 3N53A 1W4RA 3HBFA 4XGRA 2X76A 1XL0A 2KSQA 3VHQA 1P6QA 5CLQA 2NVUA 2YHIA 3WDMA 4E08A 4EDFA 2FK8A 4G85A 5D87A 1T10A 3E9CA 5ERGB 3QBJA 3IUNA 1SCBA 2BZ1A 3VPAA 3C5HA 1MCZA 5C7OO 2WHYA 1YS6A 2A0UA 4R83A 4ZXFA 1VCOA 2YIDA 4KPYA 5B55A 1ZOSA 1B16A 3KUKA 3VO2A 3DNFA 2RHTA 3U4GA 1IK6A 2IDJA 1VJ0A 2W6ID 2WMDA 4HMPA 1N3IA 1BVUA 3VH4A 4QBGB 3F9RA 5AKEA 1CJTC 2J5RA 4I5IA 3ZW7A 1E69A 1QRDA 1YZNA 2JI8A 3GGSA 3DT9A 3P4YA 3QWIA 4HXGA 4MVJA 5G02A 4CFYA 3FKSD 1GUBA 4IX1A 1Z63A 1RXYA 2WT4A 1SOWA 2Z2JA 1PR1A 2YJ3A 2V4UA 1NVEA 2NYAA 3AI3A 4CL3A 4D0LB 1QB8A 1QP0A 1ZHOA 4J1SA 5THKA 1DJMA 1ZGCA 3DAGA 3SS7X 3D8RA 5BYAA 2IP4A 3K9FC 3H5AA 2HA3A 1U9IC 3P9QA 1AZSC 2A1UA 4X95A 1V6CA 2YJ5A 1HYQA 2XYGA 3GA0A 2XA1A 3ORFA 5KDLA 1JLHA 5AWFC 3G0GA 4BQEA 3LC1O 4GL2A 2I3BA 4ND2A 1PV2A 2QVCA 4MVJE 1K7FB 3EIWA 3FHJA 3ZZUA 2OGTA 2Q4OA 3JZMA 5GOTA 3W0LB 4EW1A 3HHPA 1ZIPA 2CW5A 3NVDA 1P91A 3PP8A 1CVRA 4MEBA 4MRMB 4UULA 4ZJZA 1EUCA 1KAOA 1DIHA 2V7EA 1QK3A 1YQXA 3NPMA 3OZDA 4TOIA 5AJHA 5GV7A 3T3EA 4A92A 5K8TA 1BCSB 2NM0A 4BN5A 2QL6A 3JYPA 4JUFA 2EHDA 1EH5A 1N9KA 4RV9A 2NTYC 4GLFA 3KJHA 5DK4A 4KPFC 4BLQA 4BQQA 4EJ0A 3ZZTA 1A3CA 2NUPB 3CONA 1P1CA 2H06A 1IHDA 3MTQA 4ZT4A 4JJEA 2DFPA 4TYYA 4DOMA 1ONBA 4YMUA 2FW7A 1R4AA 2ZGVA 3A7DA 5BNZA 3C6YA 4YQZA 4GYKA 5J47A 4NS1A 2JLWA 1DB3A 4KK4A 4K6CA 4U7FA 2OV2A 2EZUA 1UZMA 2JZNA 3K4HA 2C3PA 5C8YA 1H4QA 1S01A 2XNDA 1AGNA 4R2XA 4XZ3A 4EKIA 1LV8A 1J23A 3IV6A 3L6RA 1GUZA 4ZTUB 1I2DA 1QV7A 2PY6A 4QQFA 4W6ZA 3SKYA 1FUIA 2R7NA 2WHQA 3L0YA 4O2AF 4D74A 1KR2A 1LA2A 3PXGA 4OL0A 2ZYAA 2RD2A 1AQLA 3FOFC 1WXFA 2HK9A 1EK0A 1QGUA 1YONA 2JFVA 3DAOA 4KTVE 1GG9A 4NX2A 4PLWA 4FWIB 1D1PA 3BPSA 3WA6A 3C3DA 2D1RA 4LKRA 3OG9A 2NTNA 4TQGA 9ATCA 3F5MA 3D2AA 1HY3A 4XDGA 2X86A 1UDBA 5K0CA 5ARBA 3L6OO 4LQCA 3P9ZA 1GQOA 3ZWBA 3OJ0A 1LX7A 1MG5A 2G25A 5EUBA 4F3TA 2Q1XA 2XD9A 3M7IA 2ODAA 4G23A 4QUBA 3Q8KA 1Z6PA 3OQNA 2QQGA 5JEDA 1WNTA 2CXQA 3RARA 1B1CA 2O3TA 2RGYA 3I64A 2Y2VA 3FMVA 2I4TA 4G0YA 1JIVA 5BXQC 5FAKA 3IOYA 1C2TA 2FXIA 3WB9A 2FSUA 5HE9A 1DG1G 2PQ0A 4EJMA 5CEEA 1JB9A 1GXSA 4NQRA 1F6BA 4UUNA 2YDYA 1ZYUA 5B58C 1U9IA 3H0KA 3MMNA 3N7UA 4EMBA 2CK3A 3PUIA 3KLMX 1KMNA 3SY8A 1JEEA 1J0AA 2FPPA 5EQFA 2C4NA 5I3CA 2CNBA 3ROTA 3FYSA 5A5FA 4HFNA 3VAAA 1XF9A 1Y7HA 4I8XA 2ZJAA 4BVAA 1K89A 3L8GA 2K4MA 1QHHA 1YFKA 2GTHA 3HP1A 1QVVA 1YVRA 2DU8A 2FUG6 5K3DA 4ETIA 1R0ZA 1SFRA 3IP8A 4YRZA 1M1NA 2DUMA 1UUFA 4JN6B 3H9EO 1YQ9A 5JO0A 2B9VA 2WVAA 3BAZA 3HR8A 3VNSA 4N8SA 3DG9A 3OJLA 1BXZA 1EPUA 3CRQA 1ZEJA 3H8VA 4U8HA 2ICAA 3V2IA 3O95A 3GFPA 4BEBA 2FN8A 2UYYA 3DPSA 3NXSA 4FGWA 4JX9A 5E95A 1XK6A 4LDPA 4M4SA 4PNEA 1EVEA 3HN2A 2DWCA 4N5NA 5DRYA 4HCJA 4PTLA 1HH4A 4ND8B 2YYZA 2N42A 3O47A 1XN4A 3W7BA 1C5KA 1W44A 4Z8YA 1F20A 3QPDA 1I3KA 4I6JA 2OYCA 3RSSA 5JQGF 4NE9A 2IS4A 3GRVA 4F45A 1XSEA 2QW0X 2J8ZA 3DB2A 5LU8A 2W6MA 3CKYA 1CR6A 3BFVA 3WL5A 3NOOA 3QITA 5F7OA 2VNHA 2WQZA 2C1XA 2H1SA 4Z4EA 3A9TA 3S2GA 3WIUA 1WOYA 2JJQA 2P5YA 4HLNA 3R7WB 4QA9A 5GVRA 4MMYB 3DBRB 2IJGX 2FZCA 4HDOB 1I5EA 3DHEA 4Q1CA 2I2FA 4XUEA 3PCRB 1XD8A 1V1MB 4I2VA 1RHUA 1MFZA 1E6MA 2C97A 5A62A 2I6XA 1Z7YA 1VRCA 3KV3O 3VPBA 1WU8A 2BTOA 3FPLA 4FFLA 4FINA 4NEGA 3VOBA 3ZHCA 1JKXA 2CNOA 3KLNA 3MW8A 1KMMA 2BTQA 1PL6A 5ITZB 3TR6A 1ZXBA 2QB5A 4DNOA 4R1QA 4LOKA 3NYRA 4YFYA 1ACMA 1FXWA 1Y6ZA 4Y1RB 3P2KA 2OO5C 3U0BA 5LMUB 4J1QA 3FLBA 1HORA 1K8XB 1KEUA 1XDZA 4GUDA 2QE7D 4OG2A 3CBGA 3L8HA 6CHYA 3DVAB 4OI1A 4WERA 3U60B 4I7EA 5BWOA 4A0FA 4PGGA 2WLSA 3IILA 4WN9B 4L75A 1WPRA 3KWJA 2RIPA 4EAQA 2XWBF 1ISMA 4OLJA 1DCTA 1N2OA 1IUOA 4LHYA 2W2MA 3DZHA 2BEUB 2FY8A 3AEZA 4F4DA 2W0SA 3GU3A 2NSLA 1HOXA 3HO8A 4CM9D 4ERXA 4P3OA 3VPXA 1L2TA 1Y8RB 2GPNA 2YJTD 5L53A 2LPMA 5U4XA 1BW9A 5CVCA 4DLTA 1VZ2A 4NCKA 4ZMBA 4TTRA 4WPGA 4C0XA 4XWTA 3WMEA 3NKLA 1SBHA 2PFKA 5CT8A 1L4UA 2ZBFA 3RIMA 1E1QD 1VHWA 2DC1A 4JOSA 5DNUA 3U39A 3AF5A 5FBLB 5TARA 1LTQA 3E48A 2DR3A 5H9VA 5C4MA 2N46A 5ENVA 2WWTA 4U0JA 2H1IA 3HDQA 3HV2A 4IO0A 4RGBA 4TV8A 4CTOA 2DETA 4JX8A 4GM4A 1OX4B 2WF6A 3T5AA 2OESA 3G8BA 3OIFA 1AZTA 2BZSA 5EMHA 2RI6A 3GF4A 5K1ZA 3VR2D 4WW0A 3WGMA 3I12A 1GTVA 1A2KC 2R97A 4U7GA 4A0QA 3JQGA 2P4SA 1IXKA 1WV0A 3D8TA 3K9GA 3HDJA 5IUJC 1MVOA 4OK6A 2F3PA 3QU7A 2XCIA 1T0HB 1BE1A 1W59A 4LJ5A 2QU7A 2WG2A 1O2DA 1T4MA 1N9ZA 4IEFB 1QRRA 2COEA 3TLXA 2XI4A 3I73A 1S1MA 5TY0A 2H2GA 3B1FA 3EJWA 1KDVA 3ZHBA 4P98A 5EHGA 2QXUA 3T3OA 4OQXA 8LDHA 3KQUA 4J1TA 3PA6A 3AXSA 3RK0A 2FZLA 3CLHA 4ITRC 1VYTA 3D0KA 1R5NA 2UVQA 4FFSA 4D5EA 2WJZB 3DE3X 1SG0A 1ECPA 2FW1A 4GXQA 3TQTA 4CKCA 2RKWA 3OFND 1ORWA 4HFMA 4UHEA 1SVWA 4J7AA 3BL6A 3PDCA 3TOXA 3SR4A 5HHTA 4R3UC 4Q9DA 2ZAMA 3LO8A 3EFEA 1SBQA 3FPBA 1ZD5A 3KKQA 3OUTA 3CKKA 5F76A 1NV9A 2GO7A 3UT5A 4AQDA 3JYQA 2FUCA 2BOVA 2QQEA 1E3WB 2W6PA 2Y4NA 4YCBA 1XA3A 3KJXA 4UEOA 3OQIA 4K9NA 4JYBA 1VE5A 4YXWD 2A4MA 1O6CA 1QWSA 2ET6A 4MR8B 3AI1A 4ZKEA 3RIHA 3ROPA 4D4GA 2VDWB 2YRWA 1AUVA 1L5SA 5FV4A 3TMYA 2L17A 2NACA 1NASA 2H16A 1FYDA 4L8FA 1ULBA 1F14A 2OHOA 4ARZA 1ZVVA 3LFUA 5H70A 4GPZA 2JGDA 4E94A 5KNDD 4RETA 3ZR4B 1P3JA 4O6VA 1UKCA 3ZCUA 3UXMA 5BRNA 1UQTA 1H9BA 3H9UA 3FWNA 4G1MB 4B6FA 1DE0A 4JU9A 2V3WA 4RTRA 3P8ZA 4V0MA 1N2GA 5K20A 2Q3MA 2ZSBA 1VCIA 2B6HA 2PKXA 4G5OA 3U9SA 3VPCA 4ESOA 1NW7A 4OQDA 2Y1OA 3VV2A 1K1EA 1P2BA 1T4GA 5C1BA 3H2JA 3QE2A 4KFTA 2CJPA 1GJRA 3RTEA 4Y1FA 4ZP1A 3C6BA 4XLTA 3W1EA 1H5NA 4K87A 1IZYA 1WV1A 4W7SA 1A1VA 3ZDCA 5EFZA 3A0RB 5ECGC 3K0HA 4V0ME 1TUEA 1CLUA 3A1UA 4WKCA 3JQ7A 3SWWA 3FCOA 3IERA 3T1YB 3AQ4A 4CTNA 1Y6FA 2DB3A 3C5VA 4NYJR 4NH0A 2WA1A 2RGRA 4P4TA 4N7RA 2XDAA 1WQ4A 3GBSA 4UQLA 4BNHA 4WLEA 1FRVA 3A1TA 1F1JA 1YIDA 3Q7PA 4QUGA 4MCAA 3TIVA 2NZUG 1JRLA 4A82A 3GLIA 3C43A 4NPHA 4X1OA 4C5CA 5JNUA 1VL6A 4L28A 5L6LB 1QG2A 3QVGA 3G2NA 1E62A 3QKIA 3BS4A 3VDRA 3PXAA 2VEOA 3UPDA 4HTAA 4IVRA 1MAWA 3ZGLA 1GGKA 1GZ7A 4FKBA 3WL8A 4BWFB 1YR1A 2P3LA 4R2LA 3U7RA 2JVJA 5FOTA 1U2EA 4YFVA 2C4KA 4X62B 1DQYA 5JS8A 2AJTA 1GT91 1YRHA 3G5LA 3I9LA 1IOVA 1YA6A 3GLIE 2XUIA 4IVQA 1SURA 2FJ0A 1DAHA 3QLUC 3KSBC 5HQ3B 1HUQA 4G4JA 4NSNA 4N65A 5JCPA 4IY1A 2EP7A 2IHBA 4MI1A 3BE5A 5EKTA 1L4GA 4ZA2A 4RENA 1GHTA 3A6EA 4QRHA 3AF4A 4G5XA 4Z0TA 1CY1A 2NUBA 4Y9UA 1N92A 2AN3A 3H2IA 5LYYA 3CH4B 3N9IA 1DTSA 4Z99A 3YASA 2OA0A 3MRVA 4KL8S 5JYEA 5F23A 3DC2A 4EZIA 5EJGA 3VR5A 1RRMA 4DMLA 2PSJA 2BE9A 5JAIA 2W8ZA 3LVRE 4IJQA 3OOEA 4WT7A 3FLAA 1GPMA 1K5PA 4KITB 2GXAA 3C8ZA 4ZEWA 2P2CA 3L0BA 2D7JA 2XYPA 2G06A 4BNWA 4TM7A 4E4YA 3KHKA 3VSEA 1E7MA 1WCIA 1E58A 3AR9A 4YY3B 2WD8A 4OHMA 2NXJA 2NV6A 4RV5A 5TPZA 3SHOA 3UENA 3F7MA 3B48A 2PT7A 1ZUNA 2SCUA 3F7TA 3OE1A 4D3ZA 5AI4A 3DEHA 4YRNA 1JQLB 2IWHA 4AXXA 1N6PA 5DRTA 1W52X 4FFNA 3EF3A 1DAIA 1ZA1A 2NU8A 1J90A 4X44A 3M3DA 2AF4C 3ZOZA 4XWOA 1ID8A 2Z1MA 2QLTA 4BX0A 1EFCA 5IDQA 3HSKA 1JBKA 1AQJA 1RWWA 5DI3A 3NC0C 1ORDA 2QLLA 5REQB 1UBTS 2PG3A 3EQ6A 2HPZA 1G20A 3IH5A 3LC2O 1IUNA 4HK4A 3NW9A 2Q4EA 4J03A 1RLUA 2JK0A 2R1VA 4ZQEA 4ZVMA 4EHFA 4BXOA 1FDIA 4K9PA 1F8YA 4PG7A 3LF1A 3LL7A 4UMFA 4BLRA 2XXBA 4XDYA 1DQSA 4DW8A 5BN3A 4L8LA 4WFKA 3WJ1A 2M1ZA 1AKMA 2JS7A 4AG5A 3MMXA 3GG9A 4UNRA 3JYLA 3K53A 4A0HA 2PRIA 1YTUA 3EY9A 1HO3A 5A03A 3L01A 1BMQA 2AF3C 2WWFA 3N7AA 2BKLA 5EXDA 1IRXA 1I8TA 1G20E 4B4UA 1KQNA 1ATZA 2IXTA 1KFEB 3VOSA 1L5MA 4RH3A 1J9ZA 1OX5A 2UZ0A 2VBIA 4HWOA 3HCNA 3R09A 4OKNA 3EQ2A 4FHZA 3ZIAA 2RHWA 3DAYA 1QGZA 3GVPA 1ADCA 1CY7A 2XWQA 3NUGA 3GR6A 4ILEA 1NRJB 2REOA 1MX1A 2G28A 4DE5A 4ZJPA 1KY3A 3B51X 5C8VA 4XJXA 2BRUC 4C4TA 2HV9A 3HCDA 2EW8A 4N01A 5JISA 1RZUA 1X42A 4KQMA 4FIZA 3GJTA 3LPDA 4HEJA 4Q9AA 2FRDC 3KKLA 5G0TA 5IP5A 4CW7A 5KSWB 4UPDA 1U4OA 2B7LA 1CR4A 1HZZC 1X70A 3D8HA 3GN1A 1V5FA 1DX6A 2EEPA 4E88A 1K3TA 2ZJ5A 3AKYA 2Q3DA 1RABA 4LRUA 4BNJA 2YIMA 2ZB4A 3DHYA 4NBVA 3ZWWA 4KDRA 4UVHA 4TKMA 1GFZA 1CVLA 3RJ9A 4UJ3A 1RAGA 2PRSA 3W4IA 4FLMA 1CV2A 2FMFA 2PBLA 3W05A 3QYPA 2JFXA 4I5DA 3U7EB 3G1UA 1ZEMA 4HH4A 5E8JA 2O7QA 3ZY5A 4GWGA 1NFFA 5H1YA 3DS8A 1QOZA 4OGWA 3LUKA 4XM0A 1CPYA 4UTRA 5BV1A 1GDHA 5LM3A 4A4DA 3AW9A 3A6FA 3P45A 2YWGA 1PJLA 1TK3A 1WXGA 2IYXA 2PZAA 5LQJA 4RGYA 4MWZA 5F4ZA 4JQSA 3ZNQA 3AEYA 2Y0BA 5HG0A 1YFZA 5FI5A 4X7BA 2MCFA 3IEXA 4RF3A 2OLKA 1G6KA 3RV3A 2JKYA 4D9BA 4L02A 4PZLA 2R1TB 3OF5A 3EZYA 1TQ2A 2GFHA 4J7XA 1Z9BA 3VMMA 1PSWA 2XDWA 2DUJA 2HRRA 5AXDA 1U9ZA 2XDQB 1WMBA 4UU7A 4CG0A 2HCTA 1M6EX 1R5JA 1X7XA 2XXJA 3H8SA 5JCXA 3LTNC 2BGLA 3L8DA 4P4NA 3IMCA 2P0EA 3A6HA 1V48A 5DEIA 3PLRA 4JVMA 2HFJA 4B4KA 2IW1A 1PIWA 2YICA 4ZCMA 5B3KA 1CKEA 5G53C 3BB3A 3T3PB 4FEYA 1S2OA 1YSCA 1NI4A 3R4CA 1KH3A 4CIBA 3IKMB 2OCKA 3N74A 4LX0A 1P2FA 2YRXA 4QBIA 5J4LA 1E77A 1NLFA 4KMMA 1CUJA 2NT3A 1YI0A 2GJAA 3KPVA 3AJEA 1IY2A 3QUSA 3I2JA 3QJYA 4YJFB 3THOA 5AD1A 1Y1RA 1W4LA 3MJCA 2ORED 1NBOA 1X39A 3DJYA 5FXMA 2IH5A 3KSMA 1E4EA 4KWEA 4LAFA 1U3UA 1ONOA 3D5QA 4KLRA 2GYYA 2ZUDA 3H0EA 3TKYA 1NI5A 1QC5A 4FFVA 3QG1A 2IS6A 1KJIA 4LYGA 1T5IA 4UCQA 5ITVA 5MN5A 3TEMA 1ZN2A 1UT6A 4J9UE 5EJ6A 4F9FA 4LQLA 1HC7A 2ISCA 4MKGA 4Y2YA 2BRUA 2PN1A 4BV9A 4EMTA 5A4AA 3GT3A 2G9RA 1M6VA 3U31A 2O8FB 1T35A 4WLNA 3RD5A 2ZRGA 2P9FA 5IT5A 2H85A 1NTRA 5BUZA 1WKCA 4R40A 2EX1A 5ETJA 5IJWA 1RYHA 2GM9A 1JEYA 1HZZA 2CBGA 5GIOE 1XKTA 5BR8B 3EXHB 3VDNB 1NXWA 1DKUA 3IQZA 4C14A 4DLNA 5DTJA 4OA8A 3WGTA 1I4OA 2OO3A 2VP9A 1QGOA 1USUA 1XKXA 1OWLA 2AGVA 4OQNA 3TLMA 4B6GA 1T5SA 5I7VA 5JZSA 4Q4HB 5IBPA 1L4FA 3VTKA 4ZAVA 1BROA 3AETB 1WY5A 3EXAA 2INGX 2V6FA 1XEWY 1RCUA 5K3SA 1EXNA 3R77A 5EE1A 3ZWAA 4D4IA 6LDHA 4KWTA 5B1DA 1K8YB 1WLSA 2CL5A 3VPGA 3WYFA 4R4JA 1FX0A 1EGAA 2RHMA 5T6MA 4NYIR 3WL3A 1D8AA 3CY6A 5TJHA 4EUSA 1WWKA 1XDBA 4R9UC 1IHPA 3OJCA 4J9VA 3GMSA 3IVRA 3UMYA 1YJ8A 4LSWA 3A36A 3NHBA 2NN3C 4JBHA 4LYHA 5EIAA 5E4TA 2VTDA 3WNCA 5EP2A 2FUKA 3DCIA 3F96A 1NQVA 3U3OA 3AERA 3I45A 3SJAA 3UMSA 4DG5A 4IOMA 3AR4A 2H6EA 4H77A 4JITA 5LBTA 3LQKA 3OQOA 2VBGA 2ZJZA 1YGYA 3E18A 3B20A 2P4UA 3ESRA 3TFOA 4JUBA 1JBQA 1L4KA 2ZRHA 4PCAA 2CCKA 2FMKA 4MW2A 3C1TA 5C8ZA 1IJBA 1RI1A 3JQ8A 4FNMA 5I45A 2UXCB 5CXUA 1TQDA 2FPWA 4HDSB 4BZPA 4CGZA 2WG1A 5LLDA 1EIWA 4XSGA 4YROA 1RXEA 5IVIA 3U48A 3SJUA 2IELA 3AFGA 2BFBB 4HF7A 1M54A 4LJKA 1LQUA 4A0SA 1OA0A 4K88A 2QS9A 2NIPA 2VJCA 4BNKA 2A2ZA 1IH8A 3MT7A 1Q7CA 2EJVA 2DM6A 4NNPA 1QCZA 4YMIA 1TL7C 1P75A 1RHRA 4P93A 3QU5A 3UKDA 3WSWA 1W4ZA 3MMZA 5DYNA 1O95D 5IF3A 1EVIA 2C7OA 1BMFA 1II8A 2X23A 4U39A 3MT8A 4XRRA 3RSOA 1KOGA 1YB6A 4JY7A 5ADVA 2E4WA 3ED1A 3K70C 1Y37A 3RC8A 3Q85A 3SM9A 2H1OA 4IZHA 3MELA 3H5IA 5ELMA 3F97A 4MS1B 3KT6A 4N9QA 1E1MA 4CMHA 2VQFB 1PQWA 2GJ4A 4GKBA 3GMTA 2HD4A 5F1PA 3C3XA 4I3FA 2G0NA 1LPMA 2AE1A 4RJ2A 3AI7A 5E4FA 4FFPA 1I7SB 3DGFC 3NBZC 1L4HA 1MP0A 1SXJC 3CZMA 3WWZA 3OX2A 4KV9A 4QXAA 1RHMA 3L6CA 3BSYA 3QA3E 2BFFA 3UHOA 1CDDA 1M7BA 3GJXC 4HVLA 1N6IA 1QTRA 1R4NA 5TMEA 3ENVA 2NO6A 4B8YA 1JXQA 3E9MA 4AZSA 1LQ2A 2XGMA 4JKIA 5GONF 4XEUA 5ULLA 1EEHA 1N2EA 1WBDA 1O6FA 3GEIA 3M9WA 5I4IA 2OAGA 4TVBA 3KXPA 3STVA 4DLYA 4BPRA 4OX9B 4KWCA 4O4LF 1IN4A 3HUEA 3KPJA 4D8XA 1U3GA 2F3RA 1Z0FA 1BRTA 2IUUA 1AV6A 4KQIA 1XAGA 1G19A 4LC1A 2VYVA 1Q11A 5B53A 5T3UA 3V4LA 2ODNA 3V2UA 1UK9A 1R6VA 1FXSA 3QOFA 4QDUA 1V95A 3ANNA 3R5SA 4E11A 3LH5A 1FP4A 1VLQA 4M8SA 4AU1A 2YV5A 4OGGA 1YULA 1EINA 1JKMA 2V45A 2A9PA 3OZSA 4IILA 4CLRA 5KTTA 2VTVA 3DDWA 5HNKA 1PZEA 3HFGA 1YCGA 1IUPA 1VE6A 4UHBA 5CVVA 4CV1A 5A1JA 3HWRA 4MS4A 4NZYA 1NN0A 1X1BA 4PSKA 3F6EX 1RNLA 2X8AA 4FDUA 3ZDYB 3N0VA 1X1QA 1TTPB 1ZK2A 2I54A 3KYDA 4ZIRA 5J4VA 4YIHA 2CL0X 3ETDA 3B2NA 1TD1A 1RC8A 1N2JA 5T64A 4ZJYA 1GO2A 2TMDA 3GFSA 3KAKA 3O8OB 5DHAA 3U3XA 4ZI7F 1ZJWA 3THXA 2EU8A 4ESHA 3BWYA 3ZVNA 4OHFA 5C7LO 1IE3A 3AVWA 1KEPA 1YOVB 3LWBA 3NEJA 1Y48E 5LP6B 3QKSB 1PZXA 4C7OA 2JHPA 4TS3A 3L8EA 1HT3A 4QSMA 3BF8A 1ZD1A 1AB6A 1QKKA 1Z5GA 1K0UA 3I3OA 1EFVA 4WOBA 5L3VA 4J0GA 2O5EA 1G63A 1LW7A 1PHPA 4DLAA 3I2KA 4JSTA 4ZVPA 2PZGA 1L5YA 3DE5X 3V4OA 3PT5A 1NV8A 1EEXB 2DQYA 3F8TA 4K46A 3W5UA 1UZUA 3PQ3A 2ZSUA 4W99A 4IOJA 5U9CA 4PZPA 4LJSA 2FEXA 2OXCA 3I6YA 5CM9C 4RTMA 3FM9A 3DUFB 1XWIA 1CDOA 1EWVA 1HL7A 3DW3X 1LZLA 1T4CA 3PSAA 1C3LA 2E1RA 4LHVA 4RKWA 4JJAA 3EH1A 3QV2A 1MO5A 3HYNA 4AJNA 3RUCA 3H5TA 4BNUA 1NG9A 4IUDS 5EYPB 4EY6A 1KIAA 2NU7B 2OHIA 3L7CA 4EG5A 3V1MA 3DMTC 4UBIA 4IGAA 1EVQA 4PPNA 5JWHA 2AFHA 1BKDR 2BC9A 1WXDA 1XYVA 2ZR8A 2FZ4A 2RBGA 5CA0B 1A8IA 3VNVA 3TD6A 1QVRA 4NC9A 4FONA 1SXJA 3F71A 3OZFA 4KVFA 1NXSA 4E6PA 4NU5A 4NCNA 4DR2B 4BFWA 4BGVA 1M2OB 1B8NA 1QP8A 4EARA 3GAFA 3U7HB 2XXAB 5EP4A 3B82A 3TUIC 3MLBA 3M2PA 1Y3HA 4D9NA 2WPNA 3ERCA 3LZ6A 3A28A 3EGDA 4ZOEA 4AK9A 1SK8A 3I9NA 2AFHE 2CK3D 1JZQA 3ZN2A 4MPTA 4JASB 5CB0A 1HSZA 3SZ3A 2C2XA 1SXJE 3KFVA 3NKVA 4RIHA 4AJ1A 4B85A 2P9HA 3OTWA 4FFBA 3DHVA 2GN8A 4F06A 3ZE9A 5B1YA 1W0KD 3ER6A 5LJLA 3PC8C 4Z3KA 1C80A 1VLZA 1ILWA 2Q9BA 2XOKD 4BGUA 1NVGA 1QSGA 1ZWKA 1JQBA 4I08A 1B43A 1M1YB 1XAIA 2XNSA 4MITA 1YV9A 4FD2A 4WFIA 5EKSA 4ZVSA 1SBIA 3P5SA 4UJ5A 4JC4A 3AL3A 1F0NA 1UC4B 5DW0A 3FTCA 2OBYA 3ITNA 1D04A 4NQZA 2XGOA 1YMUA 1KDYA 4EWLA 1P7ZA 2CL6X 1W35A 3O2NA 2E5WA 4QTZA 3PFCA 1J06A 1YZGA 2GD1O 2FLVA 3FPKA 4G9EA 1S7GA 3AOEA 1KE2A 2W2LA 3TB6A 5JOQA 3DO8A 1GPBA 3WRYA 1JV2B 1KEKA 3KR1A 4D44A 2ZSHA 2GDJA 4UE6A 3HG7A 1TADA 1WULS 3GBVA 2O07A 4DDVA 1TUGA 2JGIA 4BFYA 4BX3A 4S1WA 5GVSA 2NXEA 3DZ8A 4I5EA 2GK6A 3E7XA 3TI9A 4J2HA 5EZYA 1LDNA 3JRXA 2RC6A 3DW1X 3ESQA 2HB6A 3FYCA 1EFPA 4L9AA 3Q3CA 5IC6A 1QG0A 1U7DA 4AP9A 4PM4A 1J07A 3O1HB 3EIOA 4QLAA 3HZZA 1U7PA 3L4JA 4MK4A 5DSZA 4GGMX 5JVDB 2CD9A 4EABA 1QQ7A 3E7WA 5DCLA 4QECA 4DWWA 3JAKA 1PVVA 3PRJA 1RRPA 3JYNA 3V9PA 2AG0A 3NTVA 1VKRA 1JILA 4TRMA 1Z7EA 1DKRA 1L8AA 3T8YA 1LRKA 5CMLA 1YQTA 1JBEA 1NVTA 1ZD8A 4FB5A 3FF4A 1E2KA 4YJ3A 1KQ3A 5K3BA 4IG9A 3U40A 2FW9A 1WMDA 1H3NA 2WAOA 2PS3A 2H29A 3OZCA 4H7DA 3ZXYA 1N57A 2BGMA 4AF8A 5F33A 1N5KA 5J5VA 5C3UA 1S9DA 1VGRA 1QIIA 4FEAA 1WUIS 5AJVB 3T4EA 5JNWA 1Q0UA 3LF2A 6ABPA 1PT5A 2L18A 4F97A 2WHPA 4RADA 1ZCZA 2ZJBA 4PYOA 3RHFA 3RLIA 5ALKA 3N8IA 3TTSA 5AXAA 2CSXA 4OK5A 3BMCB 2YVQA 1ZC3A 2FLKA 2ZIGA 4KMRA 1Y3CE 3FVVA 2ZYHA 4JLNA 4PZ0A 2Z08A 2I34A 1SEPA 5TGTA 4DRXA 2Q3HA 3AFHA 3FVWA 3OO0A 1JPNA 5JHHB 4NIMA 4A3SA 1BMDA 1XK7A 1ZJ5A 2RJ3A 4R9NA 5TEWA 2XIJA 4MV9A 1JALA 1THZA 4RSRA 5AOVA 2YDXA 1YNSA 3A6LA 3UMMA 5A04A 1VI6A 1Q0LA 3S7ZA 1TO6A 3W78A 2HEGA 2WKRA 3QOWA 3RUDA 4PAGA 2X7JA 2VP6A 2PBZA 4PVCA 3AY0A 3B5EA 4Q03A 5EIFA 3OQ1A 4ZAZA 3SBDA 1WSDA 1XRLA 4X3CA 2PKQP 2NVUB 5HPYB 2GFQA 4URXR 2PT6A 4M87A 3EVCA 5B1SA 2DFDA 3ZX4A 3FTDA 2PJZA 2ERYA 3IGFA 4NZ9A 1JDVA 3A06A 4KLNA 3SR0A 4RDCA 3SYRA 2J4DA 4XX0A 5I9TA 1JIKA 4X91A 1JL3A 5E7MA 3LECA 3ZLBA 2HADA 2ZJ3A 5KNBH 1Q44A 3ILYA 1RE0A 1YHYA 2DWUA 2O6LA 2VHXA 2NUAB 1P4JA 4F56A 3N8KA 1EWKA 3QF4A 3VKVA 3WKCA 2AMVA 3PCXA 4EJSA 1X9HA 1CDEA 2IIPA 4HMOA 2ZWMA 4MV5A 4NHOA 1TXGA 3AY7A 1PVDA 3KUCA 4LJ8A 4PFSA 5IAAA 2GN9A 4BU0A 2R8RA 3TL2A 1AGPA 3T7RA 4DM4A 2OV1A 3SBXA 2ANCA 2A1UB 4AVYA 3KQMA 4GZ6A 3BXPA 1WF3A 3NHUA 3TNJA 1M83A 4HV4A 4QYTA 1ZN8A 1C8VB 1XTBA 2VSOA 1QV6A 1VKNA 3E81A 1NVDA 5AHOA 2GPBA 1BJRE 3PSHA 2PZFA 2RH8A 2YWXA 1H8EA 3RQSA 2CHUA 2WZDA 2WAAA 1GTMA 4CEHA 2AIRA 2I1QA 2X0KA 3IHTA 2ZUWA 3ICEA 1F8XA 2QN8A 4URHA 1EUCB 3CCCA 5COAA 5A4JA 1KEEA 1UIMA 3CX8A 3AV0B 2J5QA 1CZNA 4DR6B 1HDGO 4FS8A 1CB7A 2V7XA 1IL0A 4GP7A 5CG2A 2OB2A 4E03A 2NO7A 4YC7A 1X86B 2CLSA 4J90A 4KIJA 3IAS1 1P7YA 2J7KA 1VIAA 2WHRA 1QQ6A 4UM7A 5K8CA 3LNCA 3QVTA 3ILSA 1RVDA 3AHDA 3VYRB 2G04A 4LSZA 5A5VA 1ZS9A 4CDMA 3T7KA 3N6RA 4IO1A 2EARA 2O1EA 3RO7A 4DIFA 1Y5RA 2R2GA 4KGZA 4IL5A 1AN0A 5IMBA 3U0VA 3GZTB 3LUPA 1DDOA 1FU8A 1KU6A 1OXMA 1TLLA 3GEGA 4TXJA 2C95A 1X7DA 1IIRA 1L5VA 4YR9A 2F8SA 1K4MA 2YR0A 1UJ6A 3DBOB 3OT4A 3ZV6A 1NJ6A 1GU0A 4HWRA 2GRUA 1ZVKA 2GZHA 2YUIA 4K9KA 2P90A 3OESA 4M1OA 4OQEA 4YWHA 3TECE 2H9IA 1QPBA 2DFKB 3H8JA 5E9AA 4P83A 4TRJA 2ZT8A 3JVVA 4A2WA 3K16A 1QGUB 2JAQA 3Q9UA 5BN1A 1PDOA 3MHTA 4F8YA 2J9RA 3DZGA 2EJCA 1VP9A 4GOMD 4JOQA 2N47A 3E22A 1AA6A 1M75A 2J09A 3LQ2A 2F1OA 5FWAA 3IQDB 3OSUA 4BJHB 4GVPA 4HI0E 4DNQA 2AZDA 3QWAA 1DOZA 2RGUA 3NLLA 1LF0A 2MSLA 5KYXA 4S1OA 3OMLA 2P9ZA 4PAMA 1ZJYA 3C5EA 2G5GX 4IKOA 3ZBUA 1AH2A 2ON6A 2QSZA 3N70A 4BN4A 1M0EA 2O5CA 1YAJA 2AC7A 3COPA 4QAQA 3LD9A 4DRZA 3OOYA 4MHTA 3U81A 2QA5A 1OZHA 2HWKA 5JH7F 1XP8A 2WUDA 4PQYA 1XTJA 3CH6A 4BP3A 1GXSB 3F67A 4RMGA 3RB8A 1SD5A 1IG3A 1FTNA 2RONA 4M7RA 4RY0A 3RBVA 1P7PA 1W88A 4K5QA 1N7GA 2FPPB 2XUGA 3HN7A 4X64B 3NFRA 2V6BA 5E9WA 4Y2VA 2JJ8A 3D7NA 4ZCRA 4A1FA 3DMDA 4B3SB 3KETA 4F8EA 2FU5C 3R0JA 4JBNA 1PZHA 2EOAA 2GJ9A 3HJUA 3Q9LA 4Q37A 3VNQA 4C6RA 4MR7A 5FWDA 4M36A 1CY4A 1W5EA 4Z7OB 1QHHB 4HLQB 3AV3A 5KMGA 4IRXA 3PR1A 1M1NB 5IWAB 1CF2O 2BI7A 1TAQA 2C20A 3W8EA 5ADHA 2KBEA 4OHRA 4TN5A 1MTOA 1N1GA 3LS2A 3M4JA 3PWKA 4YDRA 5AOCA 3HM2A 3HS3A 1A4UA 2VDVE 1RQGA 1WSAA 3CNBA 3O3MB 6ADHA 3LFTA 4E2YA 5GMOA 3VR5D 3UA3A 3DAFA 3K2EA 3PGLA 1N0UA 4S3MA 4YLGA 2WF5A 4G0NA 4RPHA 4HEHA 4O08A 1RJ9A 4AZVA 7MDHA 1AMNA 1UJCA 1T1EA 1IN1A 2W2PA 2WAMA 2DE0X 1RBMA 2D62A 3L4BC 1GGVA 4LRYA 1QE5A 2IX3A 2C9BA 3HDGA 5FOUA 3HL0A 3TD9A 3AT1A 2GAFA 3CLKA 4TSFD 5TPZD 1SKMA 2DG2A 3SE0A 4E51A 1EDZA 2B82A 3NTLA 3INRA 1SO8A 1N2CA 1G2OA 4NU6A 2ID8A 5DBGA 4WZBB 4CQNA 1MA0A 3GNTA 4H7HA 2RKBA 2OC9A 3MUFA 3FWKA 1HMYA 4DY6A 1RPNA 1AQNA 1KETA 1BFUA 3BTSA 3UHAA 3VU0A 4ZYZA 1H2HA 2B0JA 1XROA 1I4EB 1Y3FE 3ZE0B 1H1LB 1YC5A 3CN7A 4PNPA 4U7HA 2LWIA 821PA 2PMCA 2I6TA 2X41A 3B1XA 5CB4F 4D9MA 2LKDA 4C3VA 4PX5A 1HE3A 2FPGA 3W8FA 1N2CE 1SA0B 1SUAA 3HSYA 3VOTA 1RJDA 3L2OB 3MAAC 3WL4A 4B83A 3QWBA 3D6NB 4OHUA 4X0EA 4U9IS 3ZU2A 5KYKA 5LXTA 4CG3A 2RJNA 3P0RA 4P5EA 2C5GA 5IK2D 2AVNA 3Q8MA 5CIQA 2Y1GA 5AI9A 5D85A 4AUNA 3OZVA 4RANA 2X0FA 4MH0R 1GSIA 5FJJA 3RC2A 3D8BA 4F1WA 2PANA 2WIAA 3CNQS 1EFRA 1AD2A 4QQRA 1XDSA 3PUVA 4JYPA 1YL7A 4UTPA 3KQNA 1YRLA 1SKQA 3PIRA 1FXUA 1YCDA 4GAEA 5AUPB 1LPNA 1A5AB 4NNJA 1BX0A 3KQKA 1XVLA 1FRQA 1KO5A 1UAYA 3AVVA 4P86A 3ZY2A 1BRMA 1R5BA 4IZOA 1V5WA 3HBMA 4AI6A 3DE1X 1TCCA 1TM7E 3G7SA 4D9GA 2GF0A 2W4QA 4IDFA 4JKYA 1BW9B 2DUNA 1QLHA 3IDOA 5JXHA 1YQWA 4I4NA 3BFXA 1DV1A 4G5RA 5AVVA 5ALXA 5L3SA 2HF9A 4U6NA 2ZSJA 4QDOA 2PKWA 4B35A 1NKVA 4HPWA 2DHCA 5DM60 4ALJA 1MG0A 3O9ZA 3P9IA 3SVZA 4A8TA 2HJ9A 3N2KA 4EG8A 2VJDA 3LWZA 4M54A 2X14A 4IJ5A 5JSZA 2IV2X 2WIKA 5JEEA 4CM8B 4Z2AA 3SNKA 2Q3LA 3L06A 4E15A 1IIBA 2XV1A 1QAMA 2RMKA 4MUAA 1U90A 5CH3A 4ASUA 1Y4AE 2A88A 3Q3IA 5CXXA 4PQGA 3DE0X 2G17A 3JQGB 2K7ZA 1GV1A 5DIFA 4C7KA 1ZGZA 1XCGB 1N8TA 4DNPA 3MBIA 2PJRA 3IT2A 3JARA 3NBKA 4QFMA 3LE8A 2F59A 3D3NA 1N2HA 1KY4A 2QZSA 4MIOA 5ALGA 2D5AA 4ITVA 2R7KA 1EUZA 4IXNA 4A0GA 1DAPA 4ZCQA 1C8BA 1OXKB 5CDUA 5K0FA 4YV2A 2P0AA 1WEKA 2XOXA 3ZW9A 1PLKA 1RQ7A 1TF2A 3K5HA 3UJ9A 2M1XA 3B2EA 2FH5B 3ZOKA 1GFSA 2QSYA 1B0AA 1E8DA 1ZN9A 1MOQA 4Y0NA 5A6SA 4NU0A 4WJZA 3CNLA 1QUEA 2PRYA 3EC2A 4K9RA 1DMRA 1YDFA 4JGIA 4CKCB 2YYYA 1FA9A 4L5BA 1RI4A 3M6AA 1FMFA 1YASA 3AQIA 1ENOA 1QO7A 4OQQA 4B3RB 1OKKA 4II3A 4Q4DA 2JDIA 1GYRA 2WJ4A 4H17A 2OQRA 2AD5A 5PNTA 3U80A 3N7TA 2HQSA 4XB1A 2BJWA 2GM3A 3UT5B 1SQGA 2XCLA 1XFDA 4IDEA 3LBAA 4F12A 5T7BA 3JWPA 3NETA 2HV8A 1W87A 2ZCJA 4CU5A 2DHDA 3OQIB 3ZVRA 4QKQA 5IEJA 1R6DA 1PSDA 1UBOS 2BMDA 4S24A 3E0XA 3OJEA 2VJMA 3ZC3A 3C1AA 4HNUA 2QYSA 4AXBA 4MYHA 3LUDA 5HYVA 1W6RA 1E5QA 4FYKA 2W2XA 5HIIA 1WXEA 4ARZB 3VZQA 4D8UA 2JGDB 1WMAA 2FQWA 2O8NA 1ZC4A 2Z5FA 3IEIA 5GP1A 3T0GA 2H4FA 2ODBA 1SXIA 3BCUA 1Y6GA 4GR5A 3H99A 1EFAA 1U4SA 2EGUA 2W9XA 3R5XA 3C74A 1QIEA 4G63A 4ESEA 1VSQA 2B1GA 3L1HA 1J70A 4EMUA 1R5OA 5HUHA 3KDPA 4B3IA 2YMPA 3PNYA 4OYYA 4DMHA 3FR7A 3BA1A 1IN6A 3LAWA 2ZS7A 4ZKDA 1YIOA 4W9RA 1K2VN 1O54A 1RWVA 1H4TA 2ONZA 1QNFA 4YVFA 2QT9A 3IUQA 1KO4A 1W6UA 3ET5A 4NYMR 4CKXA 5JS1A 3OJFA 4BO8A 4FSHA 3NC4A 1NOKA 4AG3A 1B15A 1Q17A 1OFGA 3BJIC 1KTIA 1Z16A 2IIQA 2ZYWX 3C3YA 4C0BA 1EAYA 5KWEA 2DH5A 4ALLA 3C16C 2VUIB 2C4UA 2X4IA 5EWJA 4W9NC 1ONPA 4B76A 1O6GA 2X8LA 3P9RA 5JR3A 3C6MA 4NFLA 5B4UA 4FZJA 1FVHA 2Z43A 3DXYA 4U02A 3P9XA 1PGOA 4EJ6A 1BFKA 1J0EA 3GJRA 5KKAA 5EIHA 2IDZA 2VP2A 4BP8A 1PYGA 3CHYA 2O1XA 4WEOA 3PHHA 1OY1A 4NFHA 2X2EA 4EKDA 3GLIB 3EIQA 1F2UA 1RCFA 1XF1A 3CLUC 1RRGA 2D2FA 4L9WA 3UJDA 2IHKA 3BERA 1BX1A 3LXRA 2QL7A 3QVGB 3OETA 4OB7A 1Q50A 3RC9A 1GM5A 2H4WA 3TRDA 2PE5A 5ALPA 2EL7A 4IH1A 4X94A 4BB5A 2WA2A 1RR6A 1AT1A 2HU2A 2WJPA 2GBLC 2JB9A 2VJLA 1E2MA 2IY8A 2ZOSA 4JNKA 3K6SA 2VJYA 2PX0A 3A04A 2J6BA 4M0CA 3SIWA 5K03A 5EL0A 1J5XA 4G2TA 3S2ZA 2ZEJA 4MQ6A 5ESWA 5IH3A 3O82A 5CFLA 4OI0A 5TQ2A 3RFXA 1TJ4A 3B3FA 4HWTA 1PR6A 1QDEA 3GLQA 2HFKA 4JLOA 2WJIA 4LZLA 4P38A 4ZDWA 2R8OA 2XRYA 4AF6A 3C39A 4GOLD 3AFNA 4OM7A 2A94A 2CLLB 1GUYA 3DT6A 2QX6A 5FTLA 4J0IA 2XB8A 3GRKA 3OLVA 3I6ZA 4E5YA 1NQOA 4OHXA 1YVPA 4OLFA 2H51A 4UE3S 3WJ7A 1UOPA 5JHGB 5DK6A 3CVUA 4TYWA 4FS3A 5CITA 5AVKA 4EI7A 1BMFD 1DQRA 1FEZA 1LLQA 1V8FA 2YL2A 2QX7A 2PR7A 2WAYA 1A9PA 3HDTA 3HEAA 3HVIA 2OWDA 3VYSB 5ILGA 1CUDA 3G2OA 1WCIB 2BFCA 3A6PC 4WESB 2AK2A 1VGQA 5DTIA 1OWPA 3L77A 1Y3DE 2ZM6B 1CUBA 3CGGA 1CZRA 5AR1A 3AVQA 3W9SA 1B41A 1ZUNB 2NZ2A 1IK4A 4Y18A 1FU4A 4DUZB 1T6NA 4Z7JA 4HPXB 2KLBA 3VR4A 1LBSA 3GPLA 2D2EA 2CMDA 2WUVA 5CDSA 4BRUA 4PZYA 5K45A 1Z13A 3L4EA 1NQWA 2NU8B 3QKWA 1L7NA 3DZJA 3D4BA 1IBSA 2ZRCA 5H3CA 4YRSA 1WG8A 1NX6A 1ZSNA 3FI0A 2Q9CA 4KZPA 1OYWA 5AKJA 5AW2A 3MCUA 5LMZA 4RDHA 1AO0A 2IPXA 1NP3A 4W9NA 4C0QC 1MV5A 2AK3A 2R1VB 3KV1A 3DWEX 3JYOA 4BXOB 3EJ6A 1EXMA 2V9ZA 1BU5A 2HQ1A 3SJCA 5IT9A 1P6UA 2XUFA 2ZIWB 2B21A 2I2BA 3PKZA 3D54D 3T5TA 4RVOA 2ZPAA 4RABA 3WIOA 3ZVKA 3A9UA 4BGIA 2PNFA 3T9DA 4UUPA 1X6VA 1M1ZA 4Q01A 1H3FA 1Q77A 1D2AA 2AKAB 2P9JA 2OENG 2VYVD 4CCYA 3D2LA 4YRBA 2VDRB 3GK3A 5CDGA 3K9HA 4G8JA 3HVKA 2HO4A 3I04M 5CGZA 3SIXA 1CZKA 4YUAA 1A8QA 2WTUA 4NZOA 4H0NA 3TB4A 4BJ6A 3G2KA 3JW8A 1D4ZA 4X3PA 3ROFA 3RSCA 2N75A 4C6TB 5HJEA 3EEOA 3ABIA 4ML3A 5HZMA 4ZQIA 1XRJA 4K2HA 1YS7A 1NBMA 4KNYA 2HDHA 3CW2A 5EZQA 2ZT5A 2YMLA 4HKTA 5AVQA 4NMMA 1H2XA 1I0IA 4RK1A 1M1XB 3PFGA 3RKUA 4BTEA 2QQ0A 5IH7A 1DUIA 2AVDA 2PX5A 1V6SA 3RJTA 4EIWA 4K81B 1PFVA 5ALWA 3HUTA 2DFTA 4YRQA 5C0OE 2QR3A 1G4UR 2Y0PA 4OGFA 1IULA 1JMYA 2OQVA 2IHNA 1QIFA 1HYBA 1T6ZA 1WF6A 2R751 2F1KA 2I1VB 2HWWA 4KO4S 4DJDC 2RHBA 2C3YA 2X13A 4JD5A 1HDOA 4YCLA 3LVQE 3I2GA 4L8YA 1Q0PA 3WIVA 4BO1A 2H17A 5C80A 4W5RA 2OHHA 4W1RA 3QLVC 1IVNA 5L8VA 5I5GA 4JYAB 1FNMA 4G37A 4N47A 1T9GR 1EXVA 4KNWA 3GRFA 5TQVA 1XZJA 1LS6A 2FOIA 3CIOA 4CUZA 3MWLA 1HXHA 3AOGA 3LKVA 4KXQA 3UY4A 5GINE 4R1MA 4MRVA 5DM0A 1LLCA 2HMVA 2IOQA 2Q99A 2RH9B 2A14A 2RGWA 5EJAA 4L3WA 5B7GA 4RE5A 5ESDA 4DQKA 1RLIA 5B36A 1ADBA 1ECCA 3HBJA 3PF8A 5HF9A 3TL3A 3V7YA 1N5RA 4EG1A 3EDQA 3V33A 1V5EA 3IAS6 3AF0A 3IUJA 3Q5EA 4HLDA 3WLSA 1UXKA 2A7XA 2E87A 4KKXB 4E1BA 5DV9A 1R3UA 4O1HA 2I62A 3E3AA 5JCJA 4I55F 3TW6A 4DDKA 5D2CA 4NXNB 1BEUB 1X7XB 1XJ0A 4UUOA 3RUFA 1D6NA 2C2BA 2P9BA 4CHGA 5AVZA 5CCDA 1XVIA 1I5RA 2X6RA 2JGNA 2HRZA 2O2XA 1HURA 5DF1A 4WZ6A 2KM1A 4GLJA 1KOJA 2RAUA 3GLUA 1BWRA 5SYMA 3ZLTA 5BNWA 4Z3OA 2AMFA 5BQFA 2CUZA 2YHUA 3UKOA 1E9RA 1NI4B 3BX1A 1RKBA 4Q12A 1PQPA 5DGTA 3ZE6A 1KHHA 5C1IA 1H0HA 1V3VA 4OQYA 1N5DA 2HXGA 3L18A 1CUVA 1IQUA 1E4EB 4UBNA 2FDRA 2R6R1 2GM5A