1XKQA

Crystal structure of short-chain dehydrogenase/reductase of unknown function from caenorhabditis elegans with cofactor
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
272
structure length
272
Chain Sequence
PRFSNKTVIITGSSNGIGRTTAILFAQEGANVTITGRSSERLEETRQIILKSGVSEKQVNSVVADVTTEDGQDQIINSTLKQFGKIDVLVNNAGAAIPDAFGTTGTDQGIDIYHKTLKLNLQAVIEMTKKVKPHLVASKGEIVNVSSIVAGPQAQPDFLYYAIAKAALDQYTRSTAIDLAKFGIRVNSVSPGMVETGFTNAMGMPDQASQKFYNFMASHKECIPIGAAGKPEHIANIILFLADRNLSFYILGQSIVADGGTSLVMGTQAHDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Short-Chain Dehydrogenase/Reductase of unknown Function from Caenorhabditis Elegans with Cofactor
rcsb
source organism Caenorhabditis elegans
molecule tags Unknown function
molecule keywords short-chain reductase family member (5D234)
total genus 104
structure length 272
sequence length 272
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1xkqA00
1H6DA 2GN6A 2EKPA 1DIBA 5H83A 2VNAA 3DEYX 1BSVA 3PXXA 4NQZA 3GMDA 2DUUA 5ADHA 3E9MA 3ROPA 3GF4A 2FSSA 2P9EA 3E9NA 1UAGA 1Y8RB 4NFSA 4Z9YA 3KEOA 1JA9A 1R0SA 3OFSA 1BXZA 1ZH8A 4YQZA 3PK0A 4BV8A 5JFOA 1DXYA 4E32A 3IIEA 2D1YA 1O5IA 3RASA 1EEHA 1IPEA 3JYPA 4IIUA 4MKXA 4KZPA 3ZN2A 5K0ZA 1IY8A 2X0NA 2DTXA 1P77A 5DBGA 3ZHYA 2BMAA 4HX5A 4WGGA 2NUAA 4NJMB 5A1TA 5HBRA 1DC3A 1N9GA 1RM3A 2YDXA 3AY7A 1MLDA 2NM0A 4PRLA 2E37A 4RPGA 2P9GA 4XQEA 1PIWA 3QP9A 5IZCA 2VOJA 3NDIA 4ZU3A 4ESOA 3SJ7A 7MDHA 3AFNA 3F1KA 3G1TA 1C1DA 3PYXA 1W0CA 1EFLA 4NFYA 4RF4A 1ZMTA 3LF2A 1ULSA 3KSDO 4ZA2A 4GX0A 3I9MA 4IJVA 4IBOA 4E4YA 3RBXA 3IKTA 3B20A 4CMIA 1DLJA 1HTBA 3CSDA 1HDXA 3EYWA 1E77A 4E2ZA 3TWOA 4OH1A 4KDEA 2HRZA 4W7IA 2JKVA 4EJ6A 2O3QA 4UUMA 3JQGB 4L4SA 1Q0QA 4FGWA 5IDWA 1MUUA 5K6AC 3W8DA 2C2YA 5BSEA 2IEDA 3K73O 4E5MA 3F1LA 4GBJA 5IAAA 1MG5A 3VTZA 3TJRA 4O1MA 3LT0A 1BGVA 1HYGA 4BNKA 1ZBQA 3OA2A 1X1EA 3BTVA 1T4DA 5G0UA 2NVUB 1BWSA 5DDIP 1AN9A 3LC1O 5JCJD 3Q6IA 4GLOA 3WNQA 2GN4A 1ONPA 1XYGA 1QYCA 2DTDA 1U5CA 3FWNA 1R0LA 4B3HA 4ZQEA 1QLJA 4CODB 2BI8A 5AXDA 2QX7A 1NWCA 1I3NA 2NQ8A 1YL5A 5B12A 5DCYA 3DFUA 5I7FA 1EFKA 4TWRA 5T8KC 4KQWA 4O6VA 5DOZA 1KYQA 1IULA 4MVJI 5AXBA 1TEHA 2IYPA 1XKQA 4FS3A 1ZK1A 1X0VA 3H4VA 4ND2A 3LSYA 1YXMA 2B5WA 4MVJG 3WICA 4YT4A 2BFPA 2PY6A 2RCYA 4R4JA 5BNIA 3Q9UA 1UR5A 3SLKA 1PJCA 2B4QA 4J7UA 5JW6A 3ABIA 1CWUA 3I1JA 3ITKA 4YR9A 1HF3A 4LK3A 2V65A 4XRRA 1KEPA 4TVBA 4HXYA 1H9AA 4XDYA 3DMTC 4I9UA 2PD6A 4D0SA 4OO3A 4TZTA 4Y67A 3IQDB 4YWJA 1JQBA 4WLUA 4KUGA 1LX6A 1ZEJA 8LDHA 4J43A 4NH4A 4YJFA 4A73A 1RYDA 4MP6A 2WYVA 1BG6A 1E7MA 1A7KA 4XA8A 2CVZA 1HDOA 1KERA 5TQVA 4I9NA 4CM9A 3ZWVA 4QUKA 4QO8A 1HDCA 2I3AA 4EYEA 2OBYA 4PLVA 1D1TA 3VPXA 1PS9A 1DO8A 4YPOA 2X0IA 3H9UA 3VPSA 3D4OA 2ZB7A 4ONEA 1BRMA 2E48A 2GD1O 4E0BA 4MIEA 3DDNA 2YDYA 4MKRA 4OJNA 3D4PA 3BZUA 1EE9A 3PJGA 4J90A 4DA9A 4YCAA 2XXJA 2O3UA 3JD2A 4R51A 1O89A 2ZTMA 1JW9B 4XX0A 4QXMA 1LC0A 1R4NA 4J3FA 4EITA 2EGHA 4OQZA 5L7YA 3HZZA 1TT7A 1UUFA 3B70A 3BHIA 3W4KA 3HDYA 2BKAA 3PHIA 4D44A 5JLAA 2O2YA 1E7WA 1GEEA 2BFMA 1HLDA 1TXGA 4F3YA 1HL3A 3AY6A 3TFQA 4H7PA 2IYOA 3QVXA 4BNMA 3L0DA 1H93A 1C1XB 1R37A 4XGIA 1WW8A 4BGUA 3VAZA 3BHMA 5I8WA 1EMDA 3RROA 1ENPA 2EW2A 3BAZA 2WM3A 3FBGA 5KVSA 1U28A 3LYLA 1T4BA 3PEFA 4PLPA 3GA0A 2B5VA 1G0NA 3KYBA 4NJMA 3TQHA 4NG5A 5H81A 4ND3A 1TT5B 1TVEA 4CV1A 2CDBA 2E49A 2HMUA 4QQRA 2AG5A 3R0IA 4CMEA 5A9TA 2YFQA 4RJTA 3OJFA 4EEZA 4CM4A 4UAGA 2UUPA 4Z9FA 3DR3A 5IN4A 3LQFA 2G1UA 1LLUA 2OO5A 4CLRB 1R16A 1E6WA 1J5PA 3H5AA 1PJ2A 1VC2A 3D4NA 4KOAA 5IZCC 5KVQA 3C24A 3OQ1A 3VH4A 1XCBA 3ROMA 2YQ5A 2FZEA 1UAYA 1A9ZA 3NUGA 3RC2A 2NU6A 4EI2A 3WYBA 4HFNA 1WXDA 4WPGA 1NQ5A 1B7GO 1NX6A 1QYXA 2AXQA 4ZQHA 1ZJYA 2I5PO 3TPCA 2EJWA 3TF5A 2BGLA 1HE2A 3PQDA 4UUNA 5JMPA 3VH2A 3ROKA 1Q1NA 1HYHA 3LT1A 1JAYA 2QYTA 1LDBA 5G0VA 3TRIA 1SB8A 1LA2A 1XG5A 2PZJA 4HADA 5HM8A 4B7XA 4J1TA 3SLGA 3GZNB 2DC1A 1LRKA 1YGYA 2YHIB 1VL8A 1ZZEA 5L4SA 3X2FA 2Y1OA 2UV8A 4BNWA 3KSZO 1I8TA 2EXXA 1O94A 3UAGA 1KC1A 1F06A 2OUIA 3JQDA 4HKTA 1B8VA 5BSHA 1YO6A 2ZIZA 4FFRA 3SX2A 3CKYA 4DC1A 5JC8A 2D8AA 1QSGA 2P9CA 2UYYA 3BMNB 1IPFA 4NBTA 4JCOA 3LZ6A 5IFLA 2OZPA 4IDCA 3WR5A 4CMBA 1EQUA 3HNPA 3AU8A 5CDTA 1GV0A 1DIHA 3GDFA 3O26A 2QIOA 1AXEA 1YH3A 1ZK0A 3H2SA 1EQ2A 5IJZA 3INGA 3KB6A 1U3UA 1ISJA 4CM4B 4R68A 1YWGO 1JN0A 3MJSA 1L7DA 4X54A 3EK2A 1GQ2A 3EAGA 1HKUA 1JKJA 3ETDA 1VJ0A 3CXRA 2OP0A 4AJIA 5IDQA 3W1VA 3WGQA 5AXAA 4HV4A 3U4IA 3DTYA 4CUKA 4Q3NA 4RLSA 3GFBA 2HU2A 3OQ6A 1HRDA 2FP4A 5G2OA 4A27A 5EPOA 2OFPA 4WLOA 2PZMA 3FR7A 4H15A 4J2HA 4NU6A 3WMXA 2PLAA 3F4LA 2CVOA 1TB4A 3MEQA 2OXIA 1RM0A 4NBUA 1VKNA 5KVVA 3VKUA 3G17A 4RLHA 5B4VA 3DAGA 2AEMA 1FXSA 7ADHA 2VYVD 2CVQA 3KV3O 4JBHA 3NDJA 1BDMA 2O2SA 4HWKA 2FOIA 3PIIA 2PZLA 2B36A 2ZYAA 5L40A 4OGWA 4GPD1 4IDFA 1LI4A 1DC4A 3SEFA 3JQAD 2AQKA 1VKOA 4E2YA 2JFHA 3L9WA 4YJGA 2JD2A 5C5IA 4AJ2A 1PGQA 4BO1A 3RUDA 4Y98A 4XGNA 4PVCA 1ZMOA 4K26A 4Z3KA 2GR9A 1HE3A 3UW3A 5IN5A 3CPSA 2B4TO 3JQ9C 2ZTVA 1A72A 3Q2KA 4G65A 2RHCA 3H7AA 2HUNA 1P0CA 1QORA 1U8XX 1YRLA 4CLXA 5ES3A 2QYSA 2H1SA 3PDUA 5CEEA 3D0OA 3IP1A 2H6EA 1T2AA 3NJ8A 3RJ5A 2DQ4A 3JD4A 2DT5A 2VUUA 3HWRA 1GCUA 3GNQA 4J91A 1QR6A 2YYYA 3BMOB 4GQAA 4WOKA 3U49A 1E7QA 1O8CA 3NGXA 1VL0A 2ZB4A 1P74A 4MVJE 3BMOA 5COQA 1SPXA 4TRJA 1XHLA 2HK8A 2NTVA 4MO2A 4QFCA 4MIYA 1PQPA 4RVGA 4N7RA 4E13A 4RVSA 5GZ6A 2FMUA 4YAEA 4DL9A 4CMEC 2HJRA 1RPNA 4AJPA 1KIFA 3PI7A 3ZHXA 1K0UA 2W8ZA 3QVSA 1ZXLA 2HKIA 2W4QA 3MJEA 4EEXA 2GO1A 3DC2A 3DOCA 3EHEA 3H2ZA 5TNXA 1YB4A 1R15A 2PTGA 3LF1A 4A5OA 2FR1A 5KJEA 2IXAA 4A26A 1PR9A 4R1SA 1EVIA 2DVMA 3RI3A 2BFAA 1XU7A 4K9DA 3WGZA 1C1DB 4N18A 4CMHA 1Z45A 1YBVA 3CIFA 5JMWA 1V6AA 2VHXA 2F1KA 5C37A 1KY4A 4DMLA 1E0DA 3F46A 4GGPA 1H0KA 1PJLA 4CMJA 5CFZA 3T4EA 1KS9A 5HRUA 1DPGA 1U3VA 3AUUA 4R41A 3Q3CA 2Z95A 2I76A 4BNXA 4BO5A 3BTUA 1ADBA 2GZ3A 2DUWA 4F6LA 2W98A 2VRBA 1NQAO 3IOYA 3A28A 3L4SO 3LU1A 4M54A 4MVJF 1E3JA 5EESA 4FOSA 4JGBA 2JAPA 3DOOA 3AUSA 4JLWA 4RF3A 3B1JA 1HEUA 5IZ4A 1OAAA 1ULUA 3GT0A 3UGKA 2NTJA 3H5NA 3CZMA 2JCYA 1NQOA 4L4RA 2VT2A 4IMPA 4QFDA 4L73A 5FFFA 1AHIA 5BNFA 2ZYGA 3AJRA 3RUHA 3TL3A 3TZ6A 1PWZA 1LQUA 4KQXA 5COAA 4DPLA 4O63O 5THKA 3S2IA 1WDMA 3VZRA 2PH5A 2J6IA 2VNSA 1S7CA 5KJ1A 3I52A 1SEPA 3FF4A 4LN1A 4RQUA 2PGJA 1PL7A 5A03A 4AJHA 3I9JA 2DKNA 2XOXA 3WIEA 3E03A 5JYEA 5G4KB 2POQX 1CERA 3P2OA 3D1LA 4J9UE 1NPYA 5HA5A 1DHTA 3E9QA 2IE0A 3HDQA 2W2LA 5JS6A 4WOJA 2EG9A 4TSKA 4RO0A 1IUKA 1HDZA 2I99A 2IXBA 5B1YA 1UP7A 1XU9A 2X0RA 1P45A 4E33A 2G17A 5F21A 5A5FA 1LEHA 3GRKA 1XDWA 4IQ0A 3UCXA 1EE2A 3OF2A 3F9IA 3EDMA 4MIOA 1ISFA 2X5KO 5B37A 2QZZA 2B35A 3MTJA 4CLOB 4OHUA 4EUEA 2CMDA 3D3EA 5DCWA 1SB9A 3JQBC 4P4NA 4WCFC 4J6FA 5A02A 3QVTA 5H82A 5T6BA 4J4TA 4Y9DA 4BGVA 4BNTA 2JD1A 4XD2A 1GUZA 5LDGA 1DAPA 3HUDA 4M1QA 5AXCA 5U9CA 3M1LA 4D3SA 1IHXA 4RVDA 4CM8A 2EP5A 3OIFA 1ADFA 1YL7A 3DHNA 1C0IA 1I10A 5DOVA 4DYDA 1HE5A 4YJHB 4D3FA 1QG6A 5EQDA 1H9BA 1ORRA 1KBZA 3PHLA 3K30A 3NEPX 3WGGA 4ALJA 3OBBA 1SOWA 1XSEA 1NWHA 4U6SA 3OHSX 1TT5A 4I5FA 4WJZA 4Q3BA 3UF0A 4O0LA 4Y6RA 3DAPA 3PWSA 4A03A 1B8UA 1JLLA 2HCTA 5TT0A 4BB6A 3V8BA 3ASVA 3PDJA 4RZIA 4BMNA 3WTCA 2YV3A 1Z6ZA 5U1PA 4LRSB 1FMCA 4U8GA 3RSHA 4AJOA 3L77A 3E48A 4FSHA 5F3RA 5G4KA 1YQGA 3DB2A 1G0OA 3I9NA 1SNYA 4IQ8A 4B8WA 1H6CA 2Q1TA 1Y8QA 1NPTO 2PNFA 3GVHA 5TRTA 3WJAA 3GOHA 3OSUA 2NWQA 5DNAA 4PLHA 3UH1A 2BGMA 5JDIA 2Q1WA 1YBAA 3ZU3A 4FN4A 4BQPA 1C0LA 4TKLA 4RPKA 4XYEA 4BHTA 1GY8A 1ZNQO 3ADOA 2WE7A 3G79A 2GERA 3EUWA 3IP3A 1NVMB 1SO8A 1ZCJA 3JYQA 6ADHA 4BKUA 1QV6A 4R3NA 2R6JA 2VZ8A 4WNIA 3DQPA 4J7CA 5HS4A 4LISA 2J5QA 5JO9A 1NP3A 4GX1A 3CTMA 4JBIA 1SZJG 3JQEA 4CQMA 2OHXA 1T1SA 1DJQA 2P91A 3N7UA 4IJUA 1WVGA 4CR8A 1VSVA 4M8SA 4S3MA 4PZEA 4CM1A 3IDSA 5EINA 3P2YA 5CDUA 2FSVA 3OEYA 4MVJP 1X0XA 4W82A 2WYWA 4BGEA 2RH8A 4TZKA 1U7HA 3HJAA 3GLQA 1X7DA 1P44A 1ADCA 2H5LA 5L4NA 3TOXA 5FI5A 1V9LA 1ZK4A 2C2XA 3RWBA 2BLLA 1U7TA 3B6ZA 4PG5A 1WMBA 3UXYA 4P4GA 4YAIA 4B4WA 1BVUA 1KETA 2WE8A 3R3SA 3HDJA 1I0ZA 4CMKA 5F1KA 1DDOA 2C7VA 3BTOA 4PG7A 3D5QA 1HYEA 2HJSA 4WUVA 3E18A 4OXYA 3VC7A 1I3MA 1YJ8A 2CF5A 3DTTA 4I9HA 3NDRA 2FPPA 2G0TA 1YB1A 4J1QA 4CR6A 3GEMA 1E7SA 5BSGA 2P5UA 2C82A 3A4VA 4E5KA 1H2HA 3CUKA 3WYEA 3RD5A 1D8AA 4DQXA 3ORFA 4OXNA 4WEOA 1LLDA 1NR7A 3WGIA 5A05A 4JN6B 1HZZA 3PJEA 4W7HA 1G1AA 1YDWA 2V6MA 3OMLA 1ISGA 4U6QA 4CMCA 3MOIA 3KYCA 3AI2A 5G0WA 4OOFA 1NVTA 4DREA 3G49A 1U1IA 4B79A 4XIYA 5U4QA 5JAIA 1PQWA 4II2A 3PJFA 2IDZA 3TZKA 5K6AA 1XGKA 1DRWA 1UXIA 2PKQO 3WFIA 1F17A 4OSOA 3EGOA 3S2FA 2B69A 3F6YA 3UOGA 2Q1SA 4BOYA 3QV1A 2IZZA 4LGVA 3FTPA 3INRA 3JQGA 4NDNE 2JL1A 3DBHB 4CM6A 1DEHA 5AQ1A 1Z82A 1FK8A 5ITWA 2GUGA 1H2BA 4CMIB 2PGDA 3QVWA 2UDPA 1DBVO 1FF9A 3P5SA 3PYLA 4MVJA 2I67A 4XEHA 4XKJA 1T2FA 2Y1FA 4E12A 2HRBA 5KJCA 3M2PA 1B15A 5THQA 5GMOA 1X14A 2OL4A 3GGOA 4NPCA 1V8BA 5FYDA 2Z5LA 4RVHA 2WDZA 2EJVA 3ONEA 4FJ0A 2ZB3A 1ZSVA 5EQFA 1EUCA 1PGPA 4WECA 3DZBA 5JC1A 1NXQA 1N1EA 5TSDA 2Z1NA 3SBOA 1F8GA 4ALMA 2B0JA 2QQ5A 2VWGA 1KVSA 3U62A 1XQ1A 2E82A 3VPFA 1M76A 3I6QA 1IOLA 1A9YA 4I5EA 2X9GA 5G4LA 5GZ1A 4IS2A 4WLEA 3ZV6A 1TLTA 3M1AA 5CDSA 1PX0A 3C7CB 1FDTA 4H3VA 3PFWO 3WWYA 3GFGA 4MVJM 2J5RA 3RUEA 4J4HA 3C85A 4B3IA 4AJ1A 5L7TA 4RV9A 4AJKA 4Q3EA 4BB5A 3KM0A 1B3RA 2OORA 2X8LA 2GZ1A 3K6JA 3LLVA 1E1NA 4BNIA 4J0EA 5JCJA 3K92A 1O0SA 2A35A 5T64A 3VZQA 3OP4A 1LQTA 3I9KA 3DBVO 3Q0EA 4DBZA 4F45A 5A4DA 4PLWA 2Q50A 3CMCO 4DBVO 3TZHA 1E7YA 1NTOA 4Q39A 4WNCA 2D59A 4FB5A 3O8QA 4YT5A 4Z0HO 5G0TA 1ZK2A 2QRJA 4I08A 3RKUA 3LVFO 4GH5A 4JNKA 1T1RA 3P19A 3AI3A 5FEUA 1I30A 4GKVA 3RC1A 1GEGA 1XEAA 4RPJA 1EVZA 3FPLA 1JKIA 4WCFB 4FIZA 3U9LA 3G0OA 3I4CA 3AM3A 4LVUA 1T2CA 2WYUA 4K28A 1H94A 4GL4A 4A7PA 1J0XO 4HUJA 4GX5A 2PWZA 4A0SA 1U3WA 4YAKA 4N5NA 5L51A 4FPXA 2JHFA 2NU8A 1LUAA 3DBHA 2UAGA 4D45A 3W8FA 5KKCA 1V0JA 3E8XA 5BR7A 2A92A 3L07A 4J1SA 4EJMA 1I2CA 3IC5A 2HLPA 3R3JA 3H9JA 5EN4A 1CETA 4YXFA 5JY6A 3MCVA 3ZNQA 3UVEA 3GG9A 4B4OA 1BDBA 1SCUA 2ZTUA 5CP8A 4BNJA 1R4NB 5L45A 1GUFA 4QO7A 4NZ9A 5CG1A 4YBZA 4PG6A 1RM5A 3LC7O 2TMGA 2Y1GA 3JD1A 1KY5A 1R6DA 4K1LA 4GWGA 1DFIA 1VSUA 1YQXA 2O3JA 2O7SA 3RUAA 2EIHA 4YT8A 2YHUA 1NAIA 2X5JO 2VRCD 4URFA 2X5OA 1Z73A 3PLRA 3JQCA 4UVGA 1UZMA 5JAMA 4I8XA 1CRWG 1Q7CA 2Q1UA 1W73A 1E3EA 1P1IA 3GAFA 1DC6A 3ETGA 3JQFC 4BVAA 3U4HA 1ISMA 1ZKMA 3DAFA 1CQIA 2ILTA 1ENOA 4DUPA 3BMNA 4B8ZA 4NNJA 1MFZA 3JQAA 4CV3A 3DHYA 1BVRA 1PJTA 2ET6A 2J3JA 4XZ3A 1CYDA 1OI7A 2VTEA 3L6EA 4MKZA 4YVFA 1F12A 1MXHA 5C3MA 4ZJUA 3PWZA 5DF1A 2ZJ1A 4WEQA 4ZHSA 2ZKLA 3NTRA 1VL6A 2FN7A 3ZWWA 1ZIDA 3K31A 1M75A 4J0FA 1O6ZA 3O8QB 4XJSA 4CM5A 5HS6A 3DBRA 1T24A 3D3WB 2JCXA 3GHYA 5TT1A 4GLLA 5GZ3A 1I2BA 1MGOA 4L4XA 4PLYA 4O5OA 1T26A 3OJ0A 1PSDA 3ZV3A 2YFHA 4GMFA 1KVTA 2EP7A 2HO5A 1O9BA 4UVHA 3S2GA 1MP0A 1WNTA 5KKAA 2IEBA 2Q4BA 4CV0A 5JCXA 5HTOA 4GI2A 4ITUA 3DMYA 4UREA 4XR9A 5EMHA 3F47A 3VPGA 3ZI0A 4B4UA 4BO0A 5KIAA 2NADA 1KOLA 4DLBA 3U4DA 3PTZA 5B4UA 3KYDA 2WMDA 4BO2A 1NVGA 5A9SB 4FBGA 1GZ4A 1GL3A 4G2NA 3GNSA 5I7VA 3ANLA 1MB4A 3ZNNA 2X22A 4JBGA 4CQLB 1GTMA 1JU9A 1E7RA 1GU7A 2WEKA 5I9MA 3QWBA 2NVBA 3BMCB 3QQPA 4KMSA 3AM4A 1Q7BA 1DOHA 3ST7A 1Y9EA 4DC0A 4DLLA 3ZU5A 4E2XA 4FFPA 4BNFA 1PZHA 3GQVA 4BO4A 1PQUA 1WDLA 3PPIA 5KWEA 4W9NA 2BRUA 1ZFNA 2RHRA 1BW9B 1LDGA 3NTQA 1P1JA 1BTOA 1I01A 2RIRA 4BNGA 3RCBA 4B3JA 4ILKA 2ZCUA 4K6CA 2EHDA 2P68A 2GZ2A 4FFLA 3QWAA 4KTTE 3DZHA 3C7AA 4KUEA 4PG4A 5FWNA 2D2IA 5CEFA 2Q2VA 4BIIA 5CG2A 4ZQBA 4BS9A 4R16A 1XA0A 4QECA 4RGBA 4S1VA 3WDSA 4YAJA 3JQAB 4NR0A 3IL2A 3BTSA 1M2WA 3HFGA 5DBFA 3LT2A 2VN8A 3L6OO 3BMQA 4QTZA 1C0KA 5KJ6A 1GR0A 1V35A 1LLQA 4DGSA 3SVTA 4BNUA 1W6UA 3I6IA 1Y5MA 1Z75A 3QW2A 2GRAA 2LDXA 4XQ9A 1N7GA 2WD8A 1K5HA 3KO8A 4J9VA 4YACA 3DZGA 5BNTA 1I33A 1IL0A 1LDYA 2H63A 3GN1A 3OJOA 1YKFA 1B2LA 1NFQA 4ALNA 5JY1A 3KVOA 3GVCA 4L9RA 3OICA 3RFVA 3NT5A 2GYYA 3PLNA 3WOHA 5AYVA 2QHXA 3WLFA 1NR1A 1K6XA 1KC3A 3AW9A 4ND5A 3VKVA 2DPGA 4E2WA 3KLMX 3DZJA 3AY3A 3H65A 5DCUA 1PJBA 2R00A 5TF4A 4GVLA 4KWHA 2HMSA 3WG9A 1CDOA 1BHSA 1ZUD1 4PLFA 1QRRA 3TOZA 4DRYA 4BNVA 2W2LD 3R6DA 3GK3A 1XR3A 4DVJA 2Y68A 5TIIA 1DB3A 4XR4A 3BHJA 1IZ9A 3FD8A 1UXJA 1LSSA 4OMUA 4TKMA 2QZ9A 3O03A 4BKPA 3S55A 2O48X 3PWKA 4BQRA 1N1GA 2Y1DA 4IUYA 1NHWA 1UJMA 1D1SA 4IS3A 2XPCA 3LT4A 2VWHA 4EJ0A 5BQFA 3H3FA 5JXWA 1ZJZA 3HHPA 3ZWBA 3D5TA 2AE1A 3AOGA 4RQTA 5IG2A 5KCZA 2NLOA 1SOVA 2ZB8A 1PWXA 3H5RA 5CHEA 3HB4X 3JD3A 2QRKA 3JQFA 3GUYA 1DRVA 3WQQA 5CAEA 5GY7A 1QXSA 5ER6A 5L7WA 1OOEA 1Q7GA 4MINA 3ZWOA 3BA1A 4OQYA 4DMMA 1JKFA 4J2OA 3WFJA 1PL8A 1X15A 1UXHA 3E1KA 5I8ZA 5LDHA 3NRCA 3JTMA 1TA4A 1OC2A 2DFVA 3KZVA 4PRKA 3MJVA 4D42A 1Z7BA 3I23A 3WBFA 1K89A 2GDZA 2X1HA 4QT0A 5K9ZA 1E1LA 1P33A 3NKLA 4NFHA 2ZQZA 3HN7A 2AA3A 4L74A 4CUJA 3VVCA 3H6KA 1GQYA 3VHRA 1O95A 3LDHA 2ZCVA 2FZWA 3E82A 2Y0CA 1UP6A 2RAFA 2C20A 2J3KA 2OP1A 2D3TA 4C4OA 1OZAA 3UKOA 1T25A 3D64A 4BGIA 2XF8A 3ASUA 3O38A 4TRMA 1EBUA 1WMAA 2CFCA 3MJCA 4YJDA 4G81A 2WD7A 3PRJA 4YB8A 2WJPA 2VOEA 3H8VA 1U3TA 3OQBA 3MJTA 4IGEA 3T7EA 2LDBA 1DJNA 2Y93A 3EW7A 3GZNA 2C59A 1GAEO 1UP4A 1M66A 3FNHA 3TZCA 2C07A 1RWBA 2DBZA 3I5MA 1ISHA 5L95A 4II3A 1SC6A 3L6DA 2AE2A 4L0QA 3QHAA 4FFNA 4YRDA 1Q0LA 2V7PA 1LSOA 3ZU4A 1PL6A 3FCOA 4I1IA 1E1KA 4XB2A 4CMAA 3LC2O 3ANNA 2FHSA 5ENDA 1ID1A 1PGJA 3BMQB 2QRLA 1YE3A 2I9PA 5G0SA 4EZBA 3GZ4A 3IJRA 3OIDA 5ICSA 1LJ8A 4YRBA 5BT9A 2X0JA 5LCXA 1IZ0A 4YA6A 3AOEA 3F3SA 3WIDA 2J5KA 4UVIA 5C7LO 1HXHA 2ZJ0A 3PHGA 4KP7A 4E5NA 4HFJA 5F5NA 1P0FA 1QP8A 4GKBA 3JQ7A 1OMOA 4R01A 1V3UA 2YW9A 2AQIA 2O4CA 5TJ9A 4MP3A 4D3DA 5T57A 4PZDA 2O50A 2Y0EA 3NT2A 1OBFO 3PP8A 1Y9AA 1GQQA 3PGXA 3FWZA 4W99A 4BNLA 1HDRA 3NGLA 1A71A 1LC3A 3KBOA 3ANMA 3STHA 4IQGA 3OIGA 1ENYA 1U2GA 1MG0A 2BFOA 4OYRA 5IXYA 5KTKA 2GSDA 3SC4A 1GD1O 2WD7B 2P2SA 3K2BA 3OH8A 2I6TA 3I9OA 3PHJA 4OM8A 3NYWA 3MTGA 4B7UA 5TJHA 2I66A 3RUFA 4UEOA 1VM6A 3JYLA 3ETEA 1WP4A 3I4FA 1ONOA 3EC7A 4FFOA 4FQ8A 3K5PA 3GGPA 4CM8B 5JDCA 1WAMA 2YJZA 3GDGA 5JPIA 9LDTA 2C7GA 1B14A 1JVSA 1GYRA 4PLTA 1R4MB 4RVUA 2X58A 1E6UA 2PFGA 2CZCA 3IS3A 4Z0PA 1IE3A 3TN7A 1RJWA 2O23A 1LTHR 3HN2A 1A7AA 2NSDA 1ENZA 3RUCA 2GN8A 2X4GA 3VZPA 5J23A 2B4RO 4FC7A 4BKRA 2BELA 3KEQA 1U4SA 4BO9A 3FNFA 1N8KA 2GN9A 3QVOA 4YEDA 1Y8RA 2DAPA 1CF2O 1HLPA 4XJTA 1WPQA 3PJDA 3AFMA 1N2SA 1N7HA 4HY3A 4AG3A 1IHYA 5JDIC 2EV9A 3ZDFA 1E6EA 4BNYA 2WTBA 4HFRA 4D79A 3HB5X 2FY8A 1YQDA 2HMTA 3ZGYA 4IPTA 3UFXA 5A06A 3WMWA 3D3WA 3DXFA 3BXXA 5DN9A 4C7KA 4HNGA 3WGTA 3RIHA 3FTNA 1LDEA 3CEAA 3EMKA 1PGNA 1PEDA 1R66A 4PG8A 1B16A 4TROA 4AICA 4M86A 5LC1A 1N9GB 3A9WA 5FF9A 4LCEA 1LSUA 1JWBB 2PH3A 3OM9A 4JROA 5EIOA 1I24A 4RDHA 3V5NA 3ENKA 2NVWA 4DPMA 3RU9A 1LU9A 2BGKA 4FJ1A 4YT2A 4NU5A 4IZHA 4NBVA 3PGJA 3EZYA 1LRJA 1ZSYA 4HNHA 4HFMA 5TX7A 1CJCA 1YDEA 4NK4A 2C5AA 1H6AA 2AQ8A 3ZWYA 4CLRA 2W2KA 1QKIA 2OBNA 2FR8A 3OA0A 3G3EA 2Q2WA 3JQ6A 1DSSG 1NPDA 3GAZA 4OAQA 4BKOA 3WYCA 3PVZA 5L9AA 3S2EA 3PZBA 2Y99A 5DBIA 5CDYA 2E6UX 3AUAA 3GVPA 4FW8A 3GEDA 1KVRA 4PN3A 4RL6A 1QV7A 3JSAA 1S6YA 2V6BA 3GVIA 3TDKA 3QA9A 3VTFA 4UEJA 3RU7A 1CEQA 2ZYDA 4Z3DA 1F8FA 4WE3A 5F5LA 4Q3CA 2P5YA 3ZWAA 3AM5A 2VYND 4J49A 2CUKA 3H3JA 1MXFA 4R9RA 3KTDA 4UUOA 2A9FA 1Y8QB 2WSBA 1AGNA 1E5QA 2CDCA 1VJTA 4E5PA 1ONNA 4BMVA 3RKRA 4JXKA 2EKQA 3FBTA 1C1XA 4ZRMA 3ZU2A 1IB6A 2UUOA 3JQ8A 2Q99A 4M87A 1X1TA 3NJ4A 1U4OA 4FFMA 3JV7A 5TGDA 3PFFA 5A3VA 4A10A 1MC5A 1YL6A 4ZVVA 1PS8A 3JQ7B 2D5CA 2CNBA 4IM7A 3KOUA 3MOGA 1E3IA 1M67A 1GCOA 3QRWA 4AJEA 3FRJA 1ZSNA 1EDOA 3JYNA 2GF2A 1U5AA 4G5HA 4GAEA 1HSZA 3GY0A 3O4RA 4UUPA 4GVXA 4R54A 2VHVA 3QY9A 4UVDA 4CQMB 1FJHA 4FCCA 4KUHA 2ZATA 3AWDA 1X7HA 2F00A 5A9RA 3N74A 3ZWXA 4XYLA 3GRPA 1LRLA 4NJOA 3FPCA 3HE3A 4TQGA 1ARZA 1GPDG 1VI2A 1HWYA 4BO7A 3DBLB 3GC6A 4N5LA 1R4MA 3KHUA 2YUTA 1YB5A 4FC6A 4YJFB 2V6GA 1PGOA 3Q1LA 2CD9A 1C0PA 2NACA 2VUSA 1ZXBA 2VHZA 3E5MA 4DTIA 5CDGA 4XWYA 3VH3A 3ONFA 1EVYA 4CM3A 2VHYA 3WX0A 4ALKA 1BXGA 3BYZA 1V3TA 2ZTLA 3WWZA 3QWFA 1VE9A 4U0KA 3TL2A 5KOIA 3HSKA 4KDFA 3HDHA 4J16A 1L1FA 2FRDA 2X6TA 4XGKA 4PCVA 3EZLA 3RBZA 2NQTA 3OETA 4ALIA 4MOWA 1EDZA 3Q9NA 4QSMA 5MGBA 1Y1PA 2JFFA 4PLZA 3GNTA 3V1YA 2G82A 4WASA 4RORA 3U09A 3F4BA 1SAYA 2Q3EA 3P7MA 4PLCA 4CM7A 4F46A 4CLEA 1QYWA 3L9XA 1NM5A 3BMCA 3IUSA 4DLAA 1G6KA 1K2WA 3VZSA 4CPDA 2PA3A 1OC4A 3ZCXA 4XRGA 4MVJD 2BHLA 3MWEB 1WZEA 5T8KA 3WXBA 2PR2A 4PGFA 1PJSA 3A14A 3MWDB 5AVOA 4CL8A 1JTVA 3PIDA 3M6IA 3JD0A 5JSFA 3GMSA 4CLHA 2R2GA 3GVXA 1J4AA 1E92A 3QSGA 1CQJA 5EL0A 3S1LA 3WJ7A 4XYBA 2X23A 1ISIA 2DLDA 3VDQA 3UHAA 4R69A 4GSKA 2IZ1A 2Y1EA 3WSVA 3RC9A 2SCUA 1UDAA 2PV7A 2NTNA 3AK4A 3SC6A 4WLFA 1HDGO 4WLNA 4E6PA 3RC7A 1OFGA 1GUYA 3EY4A 3QE3A 4NI5A 4AJJA 3K8ZA 3N58A 3JYOA 3TNLA 4GX2A 3DBLA 3KXDA 1NASA 1YS4A 4JX8A 3I83A 4IZIA 1LLCA 1WLYA 1SEVA 1EK5A 5JE8A 4ZD6A 3CMMA 9LDBA 4DQVA 1YJQA 2Z1MA 1HDYA 3COSA 1D4FA 3OEWA 3TFOA 2JFGA 1B26A 2PKRA 2HMWA 3H9QA 1P1RA 5DT9A 3VH1A 1E3LA 5ITVA 4TMFA 3GPDG 1M6WA 1NFFA 1PS0A 2WWRA 3JQ8B 4DWVA 4NBRA 3TZQA 5A9SA 4OOEA 2PGLA 3IAHA 2JJYA 3QJ5A 2VQ3A 4XB1A 4J4BA 4CQLA 1CIVA 4TVOA 1SBYA 4A2CA 5IXSA 1QLHA 3DHEA 3ULKA 3F5QA 4DXHA 2YY7A 1W8DA 1NAHA 3V2UA 2D4AA 2J3HA 3FNEA 1LXCA 3DWFA 4GGOA 2Y66A 1EUZA 4R1NA 4CMGA 5CPFA 2OGUA 4Y6PA 1DC5A 3L4BA 5TLSA 2YV1A 2D0IA 3ROQA 2CF6A 1KEVA 4KTVE 1UXGA 5JNLA 2O3SA 4RVFA 1AXGA 4MP8A 3ZV4A 1GPJA 4PVDA 2DBQA 3DONA 4DIOA 1Y6JA 3VPHA 1PR3A 3NT4A 3A06A 3ICCA 4DQUA 2J3IA 3ONDA 2VWQA 2RBEA 4ND1A 1UDBA 1YONA 1XIVA 2AG8A 5JAZA 3H9GA 1GFSA 5T67A 4BO3A 3WQRA 4OL9A 5EJ2A 4LVCA 3NV9A 2VRCA 1PJ3A 2VCYA 4BNHA 3CINA 2DU8A 2AEFA 3RJ9A 3KSUA 1HZJA 1XELA 3DFZA 4QX6A 1QMGA 3GDOA 3GPIA 3HFSA 2DM6A 3AUTA 5DULA 5KVCA 4GWKA 1KEWA 2O3TA 4E5YA 2B37A 4R5HA 4QEDA 4I5GA 4IJWA 4MVJH 3QWHA 3GEGA 4Y8VA 5F1OA 2YHIA 3DO5A 1UZNA 2DBVO 5ER9A 1ZEMA 4D7AA 3C3XA 3FSRA 1QYVA 4BKQA 5ICMA 4OIMA 4TRRA 1ZVMA 1Y81A 4IGFA 4WCDA 4JJFA 4W9NC 1JVBA 4U5QA 2D5AA 1WDKA 3HQ4O 4OKIA 4IDAA 3KYDB 2HAEA 3GUCA 4P22A 5JYDA 4AFNA 4BNNA 1F14A 5BSFA 4INAA 3PQEA 4IXWA 4D41A 4NBWA 2EW8A 4M49A 4ZICA 2J8ZA 4CM9D 2A94A 3CH6A 3KYCB 4B4VA 5A04A 2H9IA 1WZIA 5F1PA 3UN1A 3INTA 2YV2A 3QWIA 5JAQA 1GDHA 5IDYA 4Q3AA 4UVEA 1JWAB 4OXKA 2VYVA 3DOJA 3MJ4A 2AW5A 4ZQGA 2CDAA 2FWMX 2GPTA 2Q49A 5JO0A 1I3LA 4RPHA 1VLLA 1JAXA 1PZGA 3I9LA 1ZK3A 3U4CA 5IF3A 4YDRA 4LSMA 3DBRB 3ICPA 3PZRA 3RFXA 4ID9A 5MDHA 4N5MA 1YVEI 4I5DA 3MZ0A 1N5DA 4L75A 2JAHA 3PQFA 3WB9A 1MC4A 5FI3A 4XYGA 4IDGA 2Q4EA 2GLXA 1FDVA 4C7JA 3A1NA 2BH9A 4JIGA 3ZV5A 2C29D 5CEJA 4CV2A 1K6IA 1KVUA 3KRTA 4YRAA 2AHRA 1HSOA 4F6CA 2FPIA 4UULA 1XLTA 4NK5A 3KLPX 1P1HA 2R00C 4P4LA 2NV6A 2VZ0A 4LW8A 3R1IA 1PJQA 2NVUA 4EUHA 1UXKA 1BMDA 1M6HA 2C0CA 2ZQYA 4XQGA 5KNLA 5AOVA 3ADPA 4XCVA 4EDFA 2CY0A 3ZHBA 3ON5A 4RZHA 1EUDA 4JJIA 1V3VA 1J6UA 4IINA 2I3GA 4IXTA 1LBEA 4JK3A 3UCEA 5EERA 5TC4A 4EW6A 4W6ZA 4E31A 1ML3A 2W2KB 2EGGA 4PFJA 4RF5A 5I9LA 2EKLA 3WQSB 2PZKA 4JQCA 2V6FA 4N54A 2EEZA 3F5SA 4CLDA 2Q45A 1K6JA 4XDZA 1RYEA 4Q3DA 3RUIA 2VZ9A 3AU9A 3FNGA 3EVTA 1UZLA 4RPLA 2DPHA 3U3XA 1T2EA 5C7IO 4P38A 2JD0A 1EZ4A 4DIFA 3JQ9A 4MPDA 1JDJA 2X9VA 1EVJA 5T5QA 3PYMA 4OKNA 2GGSA 5DP2A 1GYQA 4FGSA 4PZCA 4RF2A 3UICA 2Y1CA 3OJEA 4R3WA 1P3DA 2Q2QA 2X9NA 3E5RA 3IUPA 3L4BC 3V2GA 1VRWA 8ADHA 1DIAA 1Q2XA 3NTOA 4XQCA 5I7SA 4W4TA 3HG7A 4AVYA 2IODA 2OMEA 4D0RA 3BIOA 3V1TC 1MX3A 1NQTA 1PZEA 2NNLD 5HWSA 3C1TA 5JBIA 1I3KA 5I7EA 4JP3A 4MDHA 2FPGA 4R1UA 1XWFA 4M89A 3WLEA 3W4IA 1RKXA 1W4ZA 2GASA 1DIGA 4M55A 1BXGB 4RDIA 1UH5A 2PKQP 4CL3A 4PIVA 3W6ZA 1A4IA 4BUCA 2B83A 2Y67A 4IDEA 1E1MA 3C8MA 1E5LA 3RAJA 2QW8A 5ILOA 4DIBA 4J7XA 3W4JA 3K96A 2DTEA 4IDBA 4BMSA 3C1OA 2BD0A 2PD3A 1H6BA 1EK6A 4NIMA 5L4LA 3RQSA 1VJ1A 2OOSA 3FHLA 4MJLA 4RCVA 3ZZNA 4R9SA 3GR6A 1LDNA 4IJKA 3VDRA 2E4AA 2VUTA 3FN4A 2EF1A 4P8RA 4D43A 4YQYA 2HDHA 3K2EA 3D7LA 4ROSA 1TI7A 3H9EO 1GZ3A 4LSWA 3W8EA 5L53A 3CZRA 2X86A 4YJGB 1HE4A 3U0BA 1MA0A 4LMPA 3WBBA 4D46A 3LK7A 3NX4A 4XIJA 3W6UA 3LLSA 1NFRA 3UCFA 1ADGA 3V2HA 1GYPA 2AQHA 4BL5A 2AEJA 2TMDA 4FOOA 4FR5A 1I2ZA 2DFDA 4Z6KA 1BW9A 2Y0DA 2Y05A 3AOEC 1GZ6A 1LNQA 3GGGA 1KVQA 1R0KA 3E6AA 1P1KA 1Y7TA 2BI7A 4E21A 3IMFA 4EGFA 1ZO8A 3UUWA 4ND4A 3V1UA 1J49A 2VTDA 1EBFA 4L8VA 1DLIA 2AMFA 1PJ4A 2BF7A 1DIRA 2VWPA 3SXPA 3ZW8A 5CPBA 4BV9A 2ZK7A 1B3BA 3ITDA 4IIVA 1K3TA 5IDXA 1U8FO 3WS7A 4E3ZA 1P1FA 4AL4A 2HK9A 2YQ4A 1MV8A 4ZN6A 1FDSA 1I36A 3ZWMA 3DZIA 2CSUA 2EERA 4IDDA 4E30A 1C14A 3DL2A 1BXKA 4GSLA 5ENVA 3T4XA 3WNVA 1FDWA 1Q0HA 3KUXA 2VYNA 3GG2A 1U9JA 5DZSA 3X2EA 3C7DB 1T2DA 1YOVB 2FR0A 3GN2A 1I5RA 2DBRA 1NYTA 4R1TA 4YTEA 4Q9NA 1P31A 2HK7A 4O59O 4WK6A 4KWIA 4ZRNA 1HETA 1YOVA 4GMGA 3CE6A 1SMKA 3O9ZA 1E3WA 2PK3A 5JDCC 4BO8A 2YZ7A 2P4QA 1B8PA 2C54A 4L76A 2O7QA 1A27A 3ZNPA 1AUPA 3QIVA 4FDAA 3GH3A 3SJUA 1D3AA 2Q46A 2O4UX 1A4UA 4U0JA 4Z0TA 3WSWA 1L7EA 1C3VA 1DRUA 4J1NA 4ALLA 2G5CA 1PZFA 3JQBA 5TS3A 5ILGA 3B1FA 2GCGA 4WCFA 4XYMA 3ZWPA 2A4KA 3ZNOA 5COBA 2XAAA 3WGOA 3ZWCA 5KJFA 2IRWA 2XXBA 3K9QO 4U7WA 1PU2A 2GNAA 3U5TA 3PHHA 3S8MA 4BO6A 3JCZA 2G76A 3B1KA 2VT3A 4H16A 1F0YA 5DP1A 3T7CA 3ZW9A 4EUFA 1KEUA 4TRNA 3HADA 1HT0A 2UVDA 2HMVA 4FJ2A 4IY1A 1D7OA 5I9NA 1B0AA 1X7GA 4Y6SA 1U2DA 3OECA 6LDHA 1QYDA 4Z9XA 1XQ6A 1PTJA 3ZHZA 3FR8A 3TSCA 1P9LA 1FDUA 3OJLA 3ENNA 2I65A 5L3ZA 3Q2IA 4CQMD 4FD3A 2W90A 4IMRA 5A3JA 1Z74A 4AJ4A 1IYZA 4LMRA 3Q11A 4LRTB 2EWMA 1AHHA 3RBVA 1LDMA 3EVNA 1DFGA 1DAOA 3WGYA 3DZFA 3IKVA 3DMTA 2VHWA 3QLJA 3I3OA 2X7HA 3C1AA 3ZWNA 1A5ZA 5C7OO 4K6FA 4UEKA 4YYZA 2HSDA 2PD4A 3FI9A 3AI1A 2HQ1A 3IJPA 4BNZA 4NHEA 5A5EA 1Z7EA 1N92A 4OSPA 4HP8A 3VOSA 4CR7A 2O3RA 4ZGWA 4WLVA 4EBFA 4CLOA 4YAGA 1AE1A 1X13A 1Y5RA 4CJXA 4B7CA 2P4HX 2NU7A 3KETA 2IZ0A 1DHRA 1VPDA 1E3SA 4HBGA 3M2TA 1MFPA 3NAQA 3RFTA 2RH4A 4DPKA 3RVDA 4JJGA 4R5MA 5B4TA 1E3WB 1GV1A 1I32A 3WTBA 1LSJA 1WWKA 2JCVA 4CUZA 1R12A 1RM4A 2JHGA 1DFHA 3ZH2A 1ZW1A 1UDCA 3G1UA 1YBMA 4AJNA 4NMHA 1NNUA 3VVBA 4DYVA 4AJLA 3DZKA 4ZQFA 3GHHA 4WKGA 4PLGA 3WGHA 4LCJA 1GADO 2C5EA 1H5QA 4YJHA 2NU9A 1NHGA 2QG4A 1NBOA 4JP2A
chains in the Genus database with same CATH superfamily
1Q19A 2X2EA 1XJQA 1DOAA 1M2EA 2FUEA 1BSVA 1EXWA 4ZCPA 5DGCA 5B6JA 1QYIA 3PXXA 2YRWA 3RTAA 1SOMA 1UPTA 1DKLA 5DYIA 5FFMA 1ESEA 1SRRA 3WYGA 3GF4A 4DR4B 3AG5A 4J76A 1XJ5A 2GARA 3E9NA 2ORED 4KRGA 1MKYA 4DZTA 1J23A 1F20A 1WRBA 4K0RA 1R0SA 3IT0A 5IKXA 1N6OA 1IJBA 5HZHA 2X0FA 1DKUA 2Q9CA 1BKYA 3CEMA 4MKFA 3VR1A 4YAUA 4TKVB 4K46A 5AH0A 3PKJA 5AOAA 3DE6X 1EEHA 3RASA 4AIIA 3ANSA 1JLKA 1S2GA 2C2BA 4IIUA 4FXOA 4HLDA 1L5ZA 4ZQCB 4D56A 4LF8B 3L0IB 1IY8A 1XN1A 3DP7A 3PCTA 1VIVA 2DTXA 2J30A 1XAIA 4R2MA 4WX2B 3T61A 4QLAA 2XMRA 2PBZA 2EFEB 2ZSKA 5JCZA 2ZSBA 3FVWA 3M9WA 1U8EA 4YNBA 3ZHTA 5HBRA 3RTBA 1DC3A 3OOWA 4K86A 5CLJA 1DZIA 5BR4A 4G5YA 2FCAA 4OV6B 1T0PA 4RPGA 3QP9A 1T0HB 4YIKA 2IDJA 3G5AA 3AFNA 3G1TA 1C1DA 3DUWA 4QRHA 2L0XA 1EFLA 4NFYA 4POOA 4GYYA 4RF4A 2FFRA 1ZMTA 2VO1A 3LF2A 3KSDO 4HWOA 1K63A 2BBOA 2QTVB 3AEQA 4GX0A 2N1MA 2XMDA 4QQFA 1C7EA 3I9MA 1E2HA 4IJVA 1OHHD 5EUQB 3TEMA 5B7QA 2BZ1A 1BCRA 4CMIA 1HTBA 2YZMA 2HA2A 3WJ1A 3QYAA 3CHYA 4EHIA 5FXMA 1FFYA 3LKVA 3L7JA 4W7IA 1CUCA 3ZI7A 2DERA 3OWOA 4S1WA 3TEJA 5HYVA 1Q0QA 4K03A 4M8NE 3T5DA 4BGDA 2JC3A 5K6AC 1QO0A 1V71A 1QE3A 3MT7A 1MG5A 1VBFA 2BF4A 1U8CB 2BLNA 2WT9A 2M1ZA 2YASA 3H83A 3HCCA 3PGVA 5I8PA 2ZS8A 4O1MA 3CF0A 1BGVA 2PRKA 3N2YA 1U6KA 2XXAA 3C15C 1G6OA 2C9DA 4JITA 1N2EA 1WVIA 4ACBA 4B46A 1RXCA 4RE6A 4U39A 5CX1A 3ZZMA 2HQOA 2YWBA 1AN9A 3WGLA 2GXSA 4KYUA 3QKRB 4ID3A 2OPBA 3KVYA 3A2NA 5CITA 2ZRBA 1ONPA 2DTDA 4AKSA 1R0LA 1X3SA 2MSDB 2BI8A 1S4MA 2BSXA 4GU5A 3USCS 1IN1A 3CJTA 2VYCA 2YHSA 2REBA 3QBTA 1EXMA 2DFTA 4PAWA 3KT6A 3S7TA 3EDQA 5I7FA 3PGMA 3QPDA 4BVJA 1EFKA 3CB4A 1KAQA 4CCYA 1S3SA 1SD5A 2H0QA 4KQWA 2ZVDA 1KYQA 3F73A 1WKCA 4MVJI 2I3BA 1L3CA 4QOEA 1KBQA 2JI9A 3KLOA 4C29A 5I6DA 1XKQA 1E20A 2KLHA 3DF7A 4R6WA 3HA3A 3LVQE 3QW4B 1KO1A 5DCLA 2OZLA 5AKKA 3BGOS 1YXMA 2Q8PA 3V8NA 4MVJG 1DBRA 4BEJA 4E07A 3EPJA 3PC6A 2RCYA 2PY6A 5BNIA 2V0GA 3DP9A 3Q9UA 3RAGA 2W0MA 1XLWA 2IOFA 3PEUA 3P9CA 4KNWA 4AN0A 4Z53A 1TFRA 2OMKA 3K7EA 1U6IA 4NY1A 4YAWA 4BZPA 2B4QA 4J7UA 3DOIA 2JLCA 4PBRA 3ELDA 3ID6C 1EXDA 1LPNA 2VNIA 3KZKA 4XVRA 2IWHA 3ITKA 3VYTB 1IEQA 3EGCA 4C3UA 4HXYA 4UE3S 4XDYA 4HB4A 4DZZA 4D0SA 3KOWA 4R1LA 1W0KA 1TO2E 3SYRA 5LMZA 4H17A 1Y9JA 4YWJA 2XUKA 4LVNA 4AD8A 2IEZA 1ZEJA 8LDHA 4MUEA 3U7EB 4WADA 1Y63A 3ZIUA 1RYDA 4Z4QA 2CV2A 3C39A 1AHPA 2P78A 3UK6A 2YC4C 2VF8A 3RLIA 4XA8A 1IK4A 4R2IA 2GZHA 1MABB 2I3ZA 4I9NA 3ZWVA 3CNNA 4QUKA 4Q1AA 4QO8A 1HDCA 4JD5A 4NBNA 5ALEA 4AQYB 5KNBH 4LJ7A 4TXLA 3CEPB 1HGXA 1KI3A 2IVZA 4Q4CA 4RD3A 5LDDC 4F8YA 5TQ0A 1BJTA 1K9VF 4I99A 1WE2A 4YPOA 4EB8A 2ECOA 1L7XA 3N1UA 5A5GA 1ZL2A 5ERGB 5KOJA 4PHGA 3OTWA 1TK3A 3SP1A 1T9GR 2H1CA 2PUTA 3TS1A 3C74A 5BQOA 5KU1A 1QHHA 3CLTC 3PJGA 3O92A 4J90A 1XK7A 4Q6WA 5TQ2B 5AICA 5HQ3B 1FIUA 4EW1A 4TYPA 2GTIA 4Z4GA 2XXJA 3T41A 4C30A 2ACKA 4LGMA 1O89A 2ZTMA 1CB7A 4KG7A 3QF7A 3L8EA 2CCJA 5HKAA 1FUIA 1LC0A 1YUBA 4J3FA 4LDQA 4RY8A 3VR2D 4BUJA 4OQZA 4FFBA 5ADVA 3NBUA 1K4YA 1NIJA 2DH6A 3W06A 4EO7A 4EHBA 4LYEA 3BHIA 3NHAA 2JNWA 4HVAA 3G68A 3KJEA 4FGUA 2I33A 3R74A 4U3JB 1KAHA 2BV3A 2PMDA 3BXHA 4PYRA 4X45A 5JLAA 4M4SA 1VIYA 4D44A 2OT3B 3L8ZA 3OLZA 1M0TA 1Q3HA 1RMTA 3AY6A 1FSSA 2VNHA 3KR0A 2IYOA 2TSYB 5LZ2A 5BT8A 1DX6A 2ZJBA 3L0DA 3OIYA 3UT0A 1C1XB 1RWWA 5GM2A 4CKEB 4BQNA 2MU1A 4HMQA 4ZCTA 5E4JA 1EMDA 4HDQB 3QX9A 2EW2A 4I4CA 3RROA 3SKXA 3ELUA 5C5CA 1KR5A 5KVSA 2CBGA 3KEMA 3HS3A 4N8DA 4PLPA 4B6PA 4NCXA 2H7CA 5JV5A 4ND3A 4HDAA 1PLKA 2KI5A 3NNSA 2VATA 3SNKA 2Q4RA 3DZ8A 1L5YA 4CV1A 2CDBA 1FP4A 5KYGA 4QQRA 2AG5A 4CMEA 2CKDA 2TS1A 4Y2HA 3N07A 2EIXA 2Q4DA 4UAGA 3TZEA 4LQ4A 3JXEA 4EHJA 4UTPA 2UUPA 1Y7LA 3KAJA 4OEHA 2VH2A 3GGCA 1MAVA 4UOEA 1MGPA 1MZVA 5IN4A 1SVOA 4DILA 5JIBA 2OO5A 2J7KA 3UJNA 4DM3A 1J5PA 2BGGA 2LV8A 4ZOLA 5JPDA 1D1QA 4GR9A 5J47A 5FNVA 2DF8A 1TM3E 3G0BA 3ROMA 1DAFA 2VRNA 2YQ5A 3N75A 4WBXC 1DKMA 1G20B 1SVUA 1CR0A 3RC2A 2ZBRA 1G8FA 2NU6A 4UHHA 4EI2A 1WCXA 3NAMA 1NX6A 3OY2A 3HCFA 3OJWA 1QYXA 4TV9A 2AS0A 4G89A 4GZMA 4WKOA 2AXQA 5A5VA 4DYHA 3GIWA 4M7OA 1ZJYA 5CFRA 1DKNA 3HACA 4KLAA 2BGLA 3TF5A 1I4LD 1X8KA 4Q4HA 4OQPA 5JMPA 2E85A 5BWLA 2AKEA 4L9AA 3CLUD 3BJZA 5T3YA 4AYXA 1G6Q1 2KWIA 2XNKA 3LT1A 4ZHQF 5FUXA 2X5NA 4TLMB 1MHTA 1JPJA 1MW9X 3THWA 1U2EA 4PTLA 3TRIA 3GCWA 1WXIA 2PZJA 5HM8A 2H07A 1ZAKA 4J1TA 4B7XA 3ZDAA 2R6DA 3GZNB 4KQGA 4MPJA 1LRKA 121PA 3DEZA 3HUEA 1I80A 4XFDA 2G9NA 2Y1OA 2BDTA 2UV8A 1PNVA 1U99A 3B1ZA 1I8TA 4DRXA 3O0TA 1XF1A 5K8JB 2QD4A 3ODGA 1JSCA 4G07A 4MHSA 3T0FA 2OUIA 3JQDA 3EUAA 5BSHA 3EGXA 1ZS9A 2ZIZA 4FFRA 4XWAA 2WT4A 2RHWA 3WI7A 4PYNA 3K0SA 1THTA 5ALQA 5FPHA 2WHEA 3WISA 4OBXA 1NNEA 3FHTA 2C9BA 2GEKA 2UYYA 3WK8A 4X3PA 4NBTA 1NBIA 2OZPA 4IDCA 1G5RA 3WR5A 3H1PA 4TZ0A 5FJIA 5CDTA 2XEXA 1DIHA 3PD7A 1QMPA 3CCCA 5A0FA 4DV7B 3GL9A 1AXEA 2FVXA 3B89A 1EQ2A 1E3QA 3INGA 5FBQB 1U3UA 3UJDA 2FEPA 1ISJA 4PZUA 4XIGS 4ZT7A 3MJSA 2GETA 2H57A 1CJSA 3EK2A 1GQ2A 4M98A 1RI1A 1HKUA 1S02A 1PR6A 2H0AA 3ETDA 1RQRA 2IWRA 1VJ0A 3CXRA 1UM9B 5AD1A 1W59A 4CYMA 2LCQA 4HV4A 5JG7A 2HHLA 2C8VA 2D4HA 4Q3NA 1A5SB 3R0XA 5BV0A 1E96A 3ORQA 1P4AA 2Z9BA 4NARA 5EYPB 2B78A 4DCTA 2ACEA 2FP4A 1ORTA 2XZTA 5G2OA 2RB5A 5ICCA 2OFPA 1EGAA 1CU1A 4UD6A 2WQ7A 4H15A 4NU6A 1XX6A 4G5RA 3V8MA 3WMXA 2HR1A 2CVOA 4Y9RA 3TSYA 5AW8A 2OXIA 1GLGA 5JZVA 2WSSA 4HNVA 1VKNA 3LY8A 4XASA 5KVVA 4JL8A 2V7EA 3G17A 1CZRA 2EAUA 1PVDA 4LYHA 1BCSA 4RLHA 1FFHA 4DSAA 1FX0A 5FB3A 3HH8A 2ZSFA 4MLDA 2VYVD 2R66A 2DQKA 4HXGA 5FO1A 1E32A 2Z04A 2WIDA 3W5VA 2B5OA 2NQ2C 4HWKA 4ZMBA 4OQMA 4B6GA 4BZXA 1RJ9B 4D25A 4HRXA 1VJRA 4MAMA 1HFJA 1QCCA 2JLBA 4TMYA 4ZC8A 3ZWDA 4JSYA 5E6RA 4GPD1 2WF7A 3STUA 2AG1A 1NI5A 1IBLB 4IILA 2AQKA 5F12A 3NC4A 1SIBE 2JD2A 1GFZA 1PGQA 4YRFA 4QTYA 3SBDA 3CA8A 3BEOA 4M0PA 5ECDA 5D84A 2B4KA 4DABA 4K26A 1MT3A 2GR9A 1RRFA 1SU6A 2ZDQA 3BD9A 3QVJA 3TM4A 4A23A 2B4TO 4PV7A 4KI0A 1UBEA 1H23A 2LCIA 2ZTVA 1A72A 3Q2KA 2C04A 4DJEC 2AFHE 2ORWA 7ABPA 1XAJA 2HEGA 1P0CA 1YRLA 3I2HA 1JXAA 1RAIA 2HXYA 4OHRA 5ES3A 4O4IB 3M89A 3V48A 1PSWA 1GCGA 3I09A 5CEEA 3WK9A 4ZAGA 5KDLA 4CF4A 5U4XA 4TLEA 1T2AA 1CNMA 2DQ4A 2HPZA 3DT6A 3PFBA 1WEKA 3PEYA 3TQIA 3PFHA 4HNRA 3VNVA 1GCUA 1QO9A 3ZOZA 1II8A 5EI5A 3T9DA 3IBTA 3FHOA 4WOKA 5CXXA 4UQPA 1ZD8A 3V9PA 1YVUA 5AUQA 3ZCRA 4F85A 1E8NA 2DFKB 2YWHA 1PNTA 3IKJA 2B1RA 2WPDA 5COQA 4D46A 1XI2A 2R96A 1ODCA 4HDCA 2OC9A 4OF4A 3RRJA 4YCJA 4EPXA 4F4FA 2HK8A 3RYCA 4PCAA 3TMKA 4MIYA 4AKIA 4RVSA 3F9CA 2Q5EA 3IALA 2FMUA 1N2CB 5GZ6A 5DHFA 4U2DA 1ZMBA 3UC5A 5DISB 4CMEC 2BL4A 2GTPA 2P69A 1Q7RA 2W8ZA 3QVSA 5E7JA 3MWJA 3LAWA 2HKIA 3QLVA 2X14A 1U9IC 3KQVA 1WDTA 2ZOSA 4ZV4A 2C42A 3ND6A 4RYLA 5JFGA 4AKGA 3L0BA 4R2XA 1CDEA 2IYNA 4TQUS 1R15A 3LF1A 1RE1A 2HC9A 1T8WA 3JR7A 4PAGA 1K2VN 2FR1A 1KP3A 3FJ1A 4A26A 3PQ2A 4LVOA 2DVMA 4UBIA 3RI3A 2BFAA 4K9DA 3AHFA 2LW7A 4OJTA 1LBSA 4OQLA 1OT3A 1XOIA 4LXQA 4N18A 5LM3A 5JD6A 2ORYA 3CIFA 1J00A 4U2FA 2HNBA 1PVOA 1OJLA 1RYNA 1QGDA 2VHXA 3LOPA 4W9RA 1JXOA 2GESA 4R1QA 4H9GA 3ZDCA 2ZJAA 1TVCA 4R8MA 4AMGA 1ISSA 2XNDD 3H2HA 3H7IA 4I6JA 4EVSA 3MD9A 5JATA 4R41A 4C20A 1ORHA 2XEDA 5INTA 3Q3CA 1K8YB 4TTJA 3QXXA 4PRYA 3CJRA 3SMQA 2Z95A 5K5EA 3IQIX 4X90A 3HM9A 1TZMA 2B1QA 2W98A 1T9HA 4KSBA 4RGQA 2X9LA 1P7ZA 1YU9A 3RSFA 2I8AA 2NO4A 2UU9B 4K9QA 4C43A 3DNPA 1RKQA 3LU1A 4Z7JA 4BBZA 3HDVA 4F3TA 4GUAA 3I76A 1H2ZA 2F8SA 5J59A 3AUSA 1FDIA 2FH5B 4MZXA 2QSYA 1OAAA 2HWXA 3UGKA 1QE5A 4LV8B 4X00A 3K9NA 2JCYA 3AETB 1NQOA 2XRFA 2VT2A 4H31A 1ZWLA 3IT2A 2P9BA 3KXIA 3OX3A 4IMPA 1AHIA 2VAXA 2F3TA 3U3MA 3USZA 1W36C 1AGRA 5BOSB 1J2TA 1DKPA 2QU8A 1L4BA 4OXKA 4Q1BA 4NG4A 4OHCA 4Q4AA 4IUBS 3HJTA 2AN5A 1Y4DE 3GT4A 1PWZA 4IEEA 4YALA 3PFGA 1LQUA 4YN3A 3I53A 1BQEA 1F0NA 3E3LA 4KQXA 3GFVA 4EA8A 3AR6A 2H0RA 4X61A 1XZPA 1SKAA 2WSYB 1G7CA 2C7RA 5BN5B 1VL2A 2C7OA 4RQUA 5BYJA 2JASA 421PA 3EB9A 4DMHA 1DXOA 3FA2A 1SQ5A 4AJHA 3EEYA 1HZZC 3I9JA 1TLLA 4V03A 3OZUA 4MWDA 3WO1A 2EQBA 5JYEA 3ELBA 2SKEA 2FUKA 2POQX 3RARA 2MINB 1CERA 2ZQ5A 4WINA 4ZVOA 4M1SA 3EG5A 1F4LA 3EJ6A 4J9UE 1NPYA 4OVKA 1VCNA 1OCEA 2IE0A 3AW8A 4K9SA 5KQRA 1U0BB 2XVAA 3U3JA 2C3PA 4HH3C 4WOBA 4RO0A 2C95A 2CC2A 3OKAA 4B75A 5A4IS 3ZLJA 2VL7A 1KMMA 4NE7A 3ZGXA 4AT1A 5EWJB 1T1EA 2OV2A 1P45A 4K2HA 3UH0A 1VRVA 1XDWA 4FFWA 4DUGD 1DO2A 1EE2A 3OF2A 2PHZA 2YBEA 1IWBB 1S9DA 5HIKA 1ISFA 1R64A 2I7XA 1IBSA 3CNEA 1ZOIA 4CLOB 4EUEA 3EMVA 5DCWA 3RW9A 2CYCA 3LP5A 1ANKA 1C4WA 2ZULA 4J6FA 5A02A 1BD3A 5T6BA 4DEVA 3WLQA 3OTHA 4BGVA 4WDQA 3L0ZA 3KKPA 3AKYA 1GUZA 3FTEA 1JB1A 1OQAA 3HUDA 3LECA 5AXCA 3V33A 4Q9HA 4A15A 4BBJA 3CVVA 3Q0IA 1VCMA 2OV8A 4D3SA 1U7WA 2A33A 4RVDA 3WHPA 5DGTA 1UPCA 1X94A 2EP5A 3OIFA 4P2GA 4Y7DA 4BVKA 2AR0A 3N2GA 4Z4IA 3QQ5A 4D3FA 1AO0A 4PHHA 3ZY2A 3AFGA 4AECA 2FB9A 1EGQA 4PBSA 5IUKC 4F9GA 3S44A 4BUZA 4F9TA 2XODA 4CIBA 1KMHB 2YR0A 3I1IA 3K70C 1KZGB 3WP0A 2FMFA 1XSEA 1HDIA 4MQ5A 2J0VA 3NS7A 4WJZA 2UYCA 2ZVQX 4PR3A 2VSNA 3D3NA 1E1CB 2C2GA 1OXBB 1ZCAA 1JLLA 2QUKA 3AG6A 4IMJB 5TT0A 3V8BA 4BB6A 4C4RA 1K7SN 3OKFA 4LTDA 5EIBC 3S1AB 4G37A 1ISRA 3K0AA 1Z6ZA 1CBUA 3U7RA 2VCEA 5IVPA 3RSHA 5FL7D 1O54A 2OLEA 1OY1A 2IU3A 2ZJYA 4FSHA 3GFTA 5E3IA 1I7SB 1CQPA 5G4KA 4W5QA 5FQNA 3DB2A 2XNSA 1OF1A 2UZIR 3GUZA 4MUBA 2A0WA 2IYEA 1DBIA 2VHCA 1MQAA 1O9GA 1XTVA 3PT5A 3EZ7A 5KPJA 2FQXA 1Y8QA 2VTBA 3JASB 3I0MA 2AOVA 3GOHA 1VE3A 2JA1A 4WHMA 5JSQA 4Y9TA 1LV7A 3PQ3A 4NMWA 4B2YA 4CG2A 5KNBA 3HKBB 3NIWA 3LKDA 1SXJA 3BPSA 1UC4B 4OUDA 3RS9A 4X8OA 3RFFA 3ZU3A 5HIJA 4TKLA 4FEAA 1GY8A 4M6WA 2Z4RA 1N75A 2JBAB 2I2XB 1K4MA 3KCNA 5H7XA 1G63A 1PAUA 3LHSA 1DAKA 4WJKB 2PS1A 4RU1A 2C4UA 2R6JA 2IK8A 3D8TA 4L78A 4F2GA 1EWYA 4L2IB 1Y3BE 4WNIA 2BISA 2FUG6 4GX1A 1M10A 1YZHA 2W6MA 1SZJG 2BSAA 1C7FA 3JQEA 3D8SA 5EXTA 2OFFA 4CGZA 1DJQA 1OSNA 1NSFA 4JJ4A 2CYAA 5SY4A 4CEJA 3GMIA 4E7OA 1JP7A 2FX5A 2G7ZA 3ZU6A 4EY8A 4S3MA 2HMYB 3IR6A 3TRKA 1H2FA 4CM1A 1VOTA 2C9ZA 4ZVRA 2FSVA 3BD8A 1JJFA 1SA0B 1S89A 4KSYA 3M34A 4MJ3A 4UPDA 1JEAA 2WYWA 4IOKA 2X9QA 4W82A 4XLZA 4AY2A 3IOMA 1NQUA 3B7PA 5EZYB 3R6LA 5ELLA 3NBYC 1U7HA 5CJPA 2W42A 2QVLA 1P5FA 2CNDA 2R5FA 3KKZA 4L4UA 3IHLA 1ADCA 2H5LA 5L4NA 1H2XA 3JPWA 1XTZA 5FI5A 3V55A 4F0JA 2GSWA 2GJKA 3ABZA 2C2XA 1Z5ZA 1VMAA 3RWBA 4PG5A 1U7TA 1C9YA 4RGYA 1WMBA 5LZ5A 4G5FA 4NV0A 2Q27A 2ZTSA 2BGJA 4B5KA 3RSOA 1NXOA 4OI1A 3V4ZA 4B4WA 1KETA 2WE8A 4B47A 4JC4A 2K7FA 2V4UA 3HPQA 2R8OA 3VMMA 4AO6A 2OAEA 1DDOA 2C7VA 2P27A 4NOLA 3V1LA 4KXWA 2JLXA 2YVKA 1HYEA 1FU4A 1AQNA 3CSUA 4IJ5A 1RJGA 2YX1A 3NDRA 3IBCA 4DQLA 1XCJA 1W8IA 2GS9A 3E81A 4OCZA 5DN6D 1OX5A 3OT1B 4DNFA 2F8LA 2W6JA 3TW8A 4ZEMA 5BSGA 5BVGA 2C82A 3UWPA 3PUVA 3IMKA 3KE9A 4X71A 1YVPA 2O8FA 2R68A 1D8AA 3TQRA 4DJDC 4DSUA 1R3DA 3NNDA 1NR7A 3B51X 5A05A 1RAFA 1HZZA 3PJEA 3OMLA 4M0CA 1ISGA 3DJYA 3M1IA 3NETA 4KQIA 3AI2A 1LH0A 2NAFA 1W2HA 1GT91 3PUYA 4K87A 2OCDA 1LI7A 1YU6A 3KOXA 4OOFA 4TWZA 2HLHA 1M7BA 3SZLA 2MR6A 1Y9ZA 2WKWA 1UPBA 4EGQA 2HQRA 5FBLB 3WNZA 2BEWB 2PX4A 1JKJB 5J3JA 4JWTA 5K51A 3PJFA 4FEYA 2GM3A 4I6EA 1AQ6A 4I1OA 3M3DA 4DGQA 1ODSA 3WL8A 1BMTA 3OMWA 4FOPA 1UXIA 5B57C 1IOWA 1UJBA 1IONA 2DBYA 3DDOA 5IUJC 1MAUA 4NCJA 2OYCA 4JASB 1V2GA 4C4SA 3TXXA 2B69A 3F6YA 4WCVA 5AHWA 2XBLA 1KQOA 3FLAA 4KK3A 3A1DA 3LTEA 1HH4A 1ZRSA 4O4HB 3JQGA 3GV0A 2G71A 1DTSA 2YXPX 3MCTA 4CM6A 4W9MC 1GSAA 3O90A 2IYRA 2RIPA 3PQ4A 4TMTA 3D4LA 1EB9A 1VIAA 3UA3A 5EIXA 2PGDA 1Z4NA 3QVWA 4KR9A 1QFYA 3O8BA 3SM9A 3PYLA 1FF9A 3FI0A 2WMYA 4MVJA 4XWTA 1Z35A 2WUEA 4ABYA 4XEHA 2QQ0A 4D8YA 1XD9A 2AN3A 4DR6B 2RGAA 2AJLI 4F5ZA 2HRBA 1KP2A 3GJQA 4YS6A 5KJCA 1JDBB 1B15A 1G8PA 2AZ4A 1E79D 4A5SA 4YMVA 5KQSA 4ZO9A 1E0SA 5EOVA 1P2TA 3FUWA 4KEAA 3K5WA 4FJ0A 4R9NA 4UUBA 1JI3A 1ZJ4A 5EQFA 3NFRA 4WECA 3DZBA 3UGTA 1G291 4NQRA 3G2KA 1EVEA 2AWNA 2H2DA 2Z1NA 3QI7A 3W1WA 2VHEA 4MA4A 4TTPA 1F8GA 5CFLA 3MIZA 2QQ5A 3DXYA 4LNHA 4UU8A 4B34A 3DD5A 3OZDA 5K0NA 3G9ZA 2Y92A 2ZVPX 2E82A 4PZPA 4EG0A 3QY0A 3IMGA 1T9ZA 1IOLA 1RHMA 1SD1A 4A8TA 2WR8A 2OB1A 5IRCD 1Z0FA 2DPXA 2X9GA 5GZ1A 2HM7A 4IS2A 1J9GA 2AD1A 1Z28A 3KTOA 4WLEA 4F91B 4WOPA 4CIWA 1CB0A 2HN9A 4U7JA 3ZIAD 4G4IA 1PT8A 4PEVA 3RS2A 3FCYA 5FA5A 1FTNA 3M4NA 1S2DA 1QHGA 4BB5A 1B3RA 1PX2A 4DTCA 2GZ1A 5LQDA 1E1NA 3W77A 3ZE2B 5LMNB 1MBZA 1SQ0A 2ZWMA 3I5UA 4NZMA 3GUVA 5JCJA 3FY4A 2OC4A 2OZVA 3ISVA 4LQCA 5IBRA 4MITA 3TW0A 3I9KA 2PGNA 3STVA 2EZUA 1CNFA 1Z08A 3PLAE 3WVNA 1WO8A 1WOMA 3QHQA 4PC3A 1GWNA 4DBVO 4M9CA 1XCPA 4Q39A 1F7UA 3KR9A 2IL1A 1GKKA 3E22B 1M5TA 3WFZA 3I1FA 1NVVQ 4C7XA 4I08A 1EM8B 2RHMA 2ZSHA 3LVFO 5KWSA 2XCSB 4UW9A 4IHJA 1RE0A 4G8JA 4JNKA 4DHWA 3LQRA 3AI3A 4LOHA 2HT6A 2OB2A 3IE0A 5ALMA 2NU7B 4E94A 3RC1A 2NPIA 3C2QA 4ZO6A 5JNSA 5HUQA 3SMVA 1EVZA 5FR1A 1JKIA 4WCFB 4P7GA 4CQNA 1R6VA 3N8GA 4J3NA 3TJZA 4AX8A 3K2IA 1F8XA 1U98A 4YRCA 2FW8A 2WYUA 3OQIB 2JJQA 5ECGC 2Q7DA 1LWOA 2FPMA 2XB2A 1N5MA 2PWZA 1RRMA 2IYWA 4YAKA 1IDN1 2NZUG 4FPXA 1R6TA 3G2MA 4MUYA 4RX1A 1YZLA 1D0VA 4J1SA 4EJMA 5ICFA 2GMWA 3DOFA 2O19A 5EN4A 1RXWA 3A9CA 1CETA 1SKMA 1SXGA 5IH3A 4F4IA 1E3DA 1ETHA 1NJ2A 1FSZA 3R09A 3R7DA 4B4OA 5IYZF 4FT2A 1BDBA 1R4NB 2JHAA 2SICE 1M8FA 1GUFA 5EWMB 4QO7A 3C1UA 3I6YA 1PRYA 3NWJA 3OHPA 1NMXA 1H0SA 4X6YA 2FW0A 4LNUA 3LC7O 2TMGA 3FIUA 1SHKA 1KY5A 2XH8A 1TAGA 3AF1A 3BFXA 1OXVA 2I6GA 1VSUA 2Z5FA 1F6DA 4GWGA 1U28C 1O08A 4MI3A 4KRFA 2MJLA 3C97A 4FN5A 1SKQA 1L4HA 2DWUA 2YHUA 6REQA 2X5JO 2EKBA 4UPEA 3V8EA 1BJKA 3T7TA 3AJDA 1PJ8A 1L4LA 1JDPA 1Z73A 3PLRA 3QG5A 1UZMA 2HCFA 4IHKA 4UVGA 5E8RA 1R0CA 5JAMA 1J2UA 1O87A 2EWVA 2Q1UA 1I7LA 1W73A 3QUCA 1WV1A 3MG9A 3JQFC 2W6ZA 1YK0A 4QPPA 2PUHA 4ZKEA 1Z6PA 1CQIA 2ILTA 3AKCA 3SFZA 3BMNA 1YOBA 2RFLA 4NNJA 1NC3A 2OQVA 5L6MB 1MFZA 4ARSA 3DHYA 4RM3A 2C84A 2D5IA 5CT6A 1T1JA 1UKBA 4L57A 5TE9A 5KBYA 2AWOA 4R1MA 2FXIA 2HO4A 3EE6A 3E7PA 5LU9A 1OI7A 2WP0A 3L6EA 1OREA 4MKZA 2R6R1 4YVFA 2H8GA 1MXHA 2Q5JA 4QG7A 3PWZA 5DF1A 4WEQA 2WJZB 2GEFA 3OCXA 3OWXA 3UMSA 2HLDD 2ZKLA 4BQSA 2ZBVA 4L08A 4INOA 3NTRA 1N6RA 1L2TA 1VL6A 3B6JA 3C43A 4HRYA 3E4CA 4HRAA 1WCV1 1ZIDA 3Q5GA 4RSRA 2HSEA 2GAFA 2WYHA 5EGNA 2EFCB 4L6AA 2EX4A 4D8UA 5BW8A 1M75A 4J0FA 3UWSA 2QQEA 1PFKA 4CM5A 3FUUA 4RQBA 4N3BA 1MO5A 1AKWA 3KKEA 2C9OA 3DBRA 4H0FA 5HS6A 3UXHA 2VDRB 4YRRA 2MSEB 3GHYA 5TT1A 4Q4DA 4P83A 4RHUA 4Y2PA 4ZOLB 1MB0A 4PRZA 2Q7XA 4OQFA 1A77A 1KKLA 1RWMA 2BFCB 2A7XA 3OOHA 2EP7A 2E4XA 2HO5A 2V5VA 3QH4A 4GMFA 2WNIA 2YMMA 2B30A 2Q4BA 5FORA 4CV0A 5JCXA 4R71A 2W48A 2WF6A 4UREA 1CUYA 4XR9A 1P4JA 1GG2A 1QIDA 2WJVA 3F47A 4BO0A 3D7MA 4DLBA 7GPBA 1GRCA 2P3OA 2XE6A 4TV9B 1GLNA 1QOQB 1ZIYA 4F5DA 3FCEA 3DV2A 1DIOB 4UKDA 4EELA 1GO2A 1EBBA 3A4NA 1NVGA 2PJUA 5FOUA 5KQMA 1HDEA 4HDRA 3NVKI 4LY9A 5FPSA 2UYGA 5P8WA 1RI2A 4G2NA 4NYJR 3V6MA 4F86A 1WXQA 2VF7A 1GTMA 3AHGA 4DY6A 5BVHB 1JU9A 1M2NA 1M3SA 4Y2VA 2WEKA 5I9MA 3GPBA 2NVBA 3D8RA 1N6KA 2Z3VA 2CJXA 4S1PA 3ICQB 1E9BA 1Q7BA 2BFEA 1JEQA 2LP4Y 2GXQA 2ZYRA 3EEBA 4FYYA 4MRAA 4P84A 4RA9B 3B6KA 5IT5A 4KIGA 5B2FA 1W76A 4BNFA 1PZHA 1ESCA 1SBHA 2NUPB 4AW9A 4FZ5A 2F43A 3GJ4A 1G8HA 3Q5EA 4DRXB 2GPWA 2ZSEA 2O8NA 5HQTA 1EFRA 1P1JA 1ORDA 1BTOA 4N0EA 4BNGA 3N87A 4ILKA 3V46A 3ZOKA 4K6CA 3FMVA 1UBFA 1H1LA 3JRXA 1DCTA 5J5VA 1MV5A 4KUEA 4S2EA 4PG4A 4GMHA 1AZSC 4G8CA 4K9KA 4F4CA 3KVRA 1GNTA 2O9JA 4UNNA 3IEXA 2KX7A 2KPOA 1YIAA 3F74A 1LW7A 2R6CA 3TR6A 1JEDA 1LV8A 4P92A 4Q05A 5BWOA 1O0BA 3MK31 3G2LA 2QE7D 3FPKA 2X15A 3QXJA 2XD9A 4RGBA 2PZ8A 3WDSA 1V8ZA 4YAJA 3JQAB 1T5BA 3NPMA 3AJ8A 2AFVA 3HFGA 2ZBDA 2CHVA 2WWXA 3KTFA 4LBZA 1KI7A 3BMQA 3K0FA 1C0KA 2P2GA 4LZWA 3B3AA 3DLBA 2ZBEA 3A1VA 1LLQA 5D3KA 5FWDA 1MQSA 3RAPR 5TDHA 3SVTA 3I6IA 1Y5LA 2GRAA 2LDXA 2WZDA 2ZM5A 2OBXA 3NTVA 3R5SA 4IG4A 2R5NA 4J9VA 4YACA 4KQKA 2H63A 1LDYA 4IO0A 3GN1A 4M0KA 4B48A 2Z2YA 3VZBA 2IPNA 3SX0A 4ALNA 1CZHA 1NU8A 2H7YA 2V7UA 2PT6A 4LYYA 2CK3D 4F3NA 3RFVA 3REQA 3U56A 3CUUA 1NQWA 1X77A 3PLNA 4FYHA 2LD4A 4HR7A 1SUFA 5LB4A 1K6XA 4I8DA 1KC3A 5HP4A 1L5VA 4E2WA 3KLMX 1UBLS 5DX0A 3AY3A 5DCUA 1PJBA 3BL5A 4Y6OA 2O1XA 4HH1A 4RWZA 2HA7A 4BWVA 3G0GA 2WVGA 2H29A 4TMVA 3WG9A 4PLFA 3ZI4A 1OLSA 1STOA 2O06A 3JQPA 2JVIA 3GRAA 1L3BA 5AMXA 1KE1A 4EUNA 5JZBA 2XKKA 2H4HA 1HG0A 3ILXA 4NESA 3GK3A 1WZUA 4J7AA 2C57A 5ILQA 2B0CA 5LJIA 1GQRA 1K27A 1VKJA 3N53A 5DSZA 4YY3B 2XE8A 4GECA 3Q3GE 1J8MF 1TAHA 2VIIA 4J75A 3HEBA 1LSSA 3IB6A 2NO9A 3SQDA 4JMPA 4TKMA 3WK6A 2YXDA 3KELA 4BKPA 3DM9B 2P1ZA 2ID4A 2DFLA 3SR0A 5I48A 4TKZA 5IEJA 1BMQA 1T29A 1HR0B 1QRTA 2J6CA 3VOTA 2G80A 2PL1A 3FPJA 1EG7A 1PG0A 1WTAA 3R3HA 2XPCA 4BFZA 1WP9A 4EUKA 3T1TA 4DVGA 3WZLA 4ZVPA 3H3FA 4D4JA 5EZ6B 1ZJZA 3AR5A 3HHPA 5IUNC 1OZGA 1YHNA 5IG2A 3LM8A 3SIWA 1JBEA 1RWKA 2HPVA 3H5RA 3M6FA 5E1MA 5LU8A 3JD3A 4BMYA 3JQFA 4UHBA 2BVNA 4RKWA 1EB8A 3FZEA 1BEUB 3KS9A 1NW8A 3AI7A 2QX9A 2ZYVX 5L7WA 2IS4A 1Q7GA 4B3TB 1Z56C 3G5LA 4OQYA 1UC9A 1X8XA 2AV6A 4J2OA 3E1KA 2Z8ZA 4Z0NA 3RIYA 3VX4A 5JNUA 5LDHA 3CW9A 1OC2A 2DFVA 3V1KA 5H16A 1E2QA 3NCHA 4C9BA 3KZVA 1X86B 4EHKA 1Z7BA 4YGYA 4HYTA 3WBFA 2C88A 4OXRA 5NLLA 1B0PA 2JIMA 1W0JA 2B6NA 3LPCA 5EG5A 1I2DA 1E1LA 2IHZA 2Q0XA 2R1TA 1H4SA 1M6EX 4HQKA 4ADSG 1P33A 3NKLA 1NN3A 2AA3A 2H11A 2VPZA 3BXOA 4IICA 4L74A 5EHNA 4CZ2A 3IXMA 1X1RA 4A8JB 3A6GA 3NHFA 1T0IA 1FFXA 2ZCVA 1JT2A 1UP6A 5L3QB 1E2EA 4XB6B 2OZEA 2V9ZA 3C87A 1LY1A 2C20A 1T9GS 2J3KA 4QUIA 1FFCA 4EF6A 4ZYVA 4EI9A 2G4VA 2BONA 4LXIA 4C4OA 1OZAA 1Z4OA 4O3MA 1W35A 5FPTA 1U7ZA 5EZQA 3GJ0A 2BDEA 3ASUA 3N2LA 3NIBA 1E58A 2CFCA 3LO8A 3IEIA 3PENA 5G02A 3UAWA 3AF6A 3PRJA 2PANA 3W2FA 3NEJA 4YB8A 1A0OA 1J9EA 3ELWA 4GI5A 2VOEA 3JW8A 1U3TA 4EVQA 4A6DA 4UNRA 4NDZA 3ZE7A 2EJBA 3EW7A 1JS1X 2C59A 1XZHA 2RB4A 3EASA 3OC0A 3HA7A 2ZWOA 1Z0ZA 4X91A 3K0HA 3FNHA 1JILA 4FU0A 5EP1A 4PN7A 3UW1A 4C7OB 1UANA 1ISHA 1RAAA 4ENQA 4IXNA 4K3UA 4II3A 5FBWB 4LDRA 4FZVA 3L6DA 5SZIA 2AE2A 2WIJA 1PN3A 1FCJA 1VSBA 2NO1A 2BCEA 4MPPA 1CG6A 4BWGA 1BGXT 2V7PA 3K32A 1KH1A 3FCOA 4I1IA 4U2EA 3LPMA 4CMAA 1M72A 1MDFA 3EY9A 4LC1A 4XB2A 2G06A 2HX1A 2YVLA 3FCUB 5C8DA 1NMEA 4P7BA 3TTYA 2E4YA 2ZJ2A 1ZGHA 1I6LA 3BWMA 2QRLA 2R6ZA 2I9PA 2F6RA 5K05A 2XQIA 3E05A 1YRQA 1G9XA 3GLIB 2ODPA 4IL5A 1NE7A 3JPYA 2GNPA 3KD2A 4EWLA 1CP2A 1KDOA 1LJ8A 5BT9A 3TCNA 1XO1A 1SCDA 1ZIOA 2X0JA 3H84A 2ZJ6A 3LQKA 3M6LA 4WGFA 4YA6A 4EGAA 3AIOA 1E9SA 3FB1A 1OH8A 3ECAA 3Q7SA 1OXMA 3VR0A 4B9AA 4EKYA 1B0ZA 3BCHA 2ECQA 2ZJ0A 4KP7A 2V6IA 5F5NA 5CM9C 4R01A 2VF5X 1V3UA 1MB2A 2CT8A 3CG0A 2O4CA 3RF6A 4LUCA 4UQOA 2RGEA 3MMNA 3OLYA 3ZE0B 1EVQA 1OBFO 5E6UA 3HVKA 4GBGA 1VDMA 3FYUC 1B73A 3PGXA 2O8CB 4PGAA 4D9BA 3W5CA 4BNLA 1LZKA 1DXHA 1A71A 1NW3A 1YVDA 5AM0A 5BUSA 2I7TA 3STHA 4D4HA 1W85A 4ZCSA 2WJHA 1NMQA 1DQZA 1ENYA 3HGQA 2ZDGA 3OX1A 1U0LA 4M7WA 4QBGB 1Q3TA 3Q3HA 4AO7A 4F2PA 5IXYA 1DTWA 3B85A 1TIKA 4RHCA 3G8BA 4WN9A 5EVJA 3SC4A 3U1VA 1K7XB 1R6BX 1NY6A 4OM8A 1QRUA 1DV1A 2QD1A 3IUEA 4B7UA 2IX9A 2I66A 1J0EA 1EAYA 2GCPA 5IJ9B 1HMYA 3GD7A 4P54A 5JS1A 5F77A 1TEXA 4GZ6A 4ZGBA 2O07A 1FBNA 4X6XA 3C70A 2ZIXB 3HLYA 4FQ8A 3ZBPA 2H4JA 3GGPA 2QLFA 3JALA 4HAUA 5KTTA 1KAEA 2JJ2A 3CX8A 1QHEA 2QLLA 4E03A 1D6SA 1N2IA 3DVRX 4EFDA 2WA1A 9LDTA 3CRZA 2WM9B 3EVAA 4MR8B 3BX1A 3N7TA 3F5DA 5KTSA 4KK4A 5J2TA 4MUJA 1E6UA 1G8MA 3IS3A 4N5DA 1IE3A 3UT5B 3SJZA 1NW6A 3HN2A 1A7AA 3C8DA 3R7SA 3H86A 4DDHA 1YRHA 4H4EA 2GN8A 4ND8B 1I1OA 3VZPA 2B4RO 4BO9A 4JJ7A 4NZZA 3FNFA 4H59A 2GVDC 2QMZA 4KPUB 3QVOA 2ZWPA 4XWGA 2QR2A 3D2CA 4KR7A 3LHFA 1JHUA 1EPUA 4O8ZA 4AY4A 1VKRA 1Y8RA 2FP3A 4TXJA 1XLUA 2V4ZA 4C5CA 2DAPA 3CVWA 1SUSA 2VDNB 3LBFA 5IX8A 4Z99A 3PJDA 3T7AA 5HKKA 1M2GA 3DT8A 2OSBA 2GWRA 2M98A 2J67A 2EV9A 3QKUA