1XKQA

Crystal structure of short-chain dehydrogenase/reductase of unknown function from caenorhabditis elegans with cofactor
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
272
structure length
272
Chain Sequence
PRFSNKTVIITGSSNGIGRTTAILFAQEGANVTITGRSSERLEETRQIILKSGVSEKQVNSVVADVTTEDGQDQIINSTLKQFGKIDVLVNNAGAAIPDAFGTTGTDQGIDIYHKTLKLNLQAVIEMTKKVKPHLVASKGEIVNVSSIVAGPQAQPDFLYYAIAKAALDQYTRSTAIDLAKFGIRVNSVSPGMVETGFTNAMGMPDQASQKFYNFMASHKECIPIGAAGKPEHIANIILFLADRNLSFYILGQSIVADGGTSLVMGTQAHDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords short-chain reductase family member (5D234)
publication title Crystal Structure of Short-Chain Dehydrogenase/Reductase of unknown Function from Caenorhabditis Elegans with Cofactor
rcsb
source organism Caenorhabditis elegans
total genus 104
structure length 272
sequence length 272
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1xkqA00
2VT3A 3GDGA 3M2PA 2B36A 4ONEA 1C1DB 2A35A 1E1LA 4HFJA 1PX0A 1EBFA 4J2OA 1WDLA 3GN1A 2QYTA 4WCFA 3IS3A 4PRLA 5KVSA 3E03A 3EZLA 5DBGA 1L1FA 1WZEA 4E5YA 1BHSA 4GSKA 4HNHA 1LA2A 3D5TA 4J49A 3LF2A 5JNLA 2OP1A 2PKQO 1AXGA 4PRKA 2VN8A 1I01A 2DBZA 2PH3A 4XYGA 3IKTA 1YB5A 4CM8B 1P0CA 4PFJA 1GD1O 1P3DA 2H5LA 4M54A 5JFOA 3VPSA 5HS4A 3O9ZA 1Y9EA 2EKQA 3JQFC 1ONNA 1ISIA 2BGMA 1D3AA 4AICA 4R69A 1Z82A 1F8GA 5JAZA 1LQUA 3GZ4A 3NDJA 3T4XA 2HMUA 4PZEA 2P5YA 2DBVO 5EESA 3CZRA 2VTEA 4EUEA 1MC5A 5FFFA 4ALKA 5IZCA 1GYPA 3K31A 5KNLA 1R6DA 5TX7A 5JSFA 4URFA 3AM3A 1E3LA 4I1IA 1DLJA 3CE6A 1NASA 4XJSA 1RKXA 5IFLA 3PGXA 4WASA 1UXJA 3WSWA 1HETA 5TNXA 3ADPA 3H5RA 4BO8A 1NFFA 1CWUA 2GO1A 3BMNB 3FCOA 3SC4A 1M76A 3GMDA 3WSVA 1DHTA 5I9MA 5A3JA 1YOVB 5EQDA 3A4VA 4OKIA 3QLJA 4OO3A 4XZ3A 5JY6A 4XGNA 4YJGB 3DAGA 5LDGA 1KC1A 1B8VA 1U4SA 5HRUA 2AG5A 2RBEA 4JP2A 3GVIA 4DQXA 5IAAA 4N5LA 1DC6A 5FEUA 3C7CB 1YQGA 3R3JA 5JLAA 2HK7A 2Y68A 7ADHA 2FZWA 3G17A 4HKTA 1X7GA 1E1MA 1H5QA 4JGBA 3ZNPA 1IHYA 2V6BA 4GMFA 1A4UA 3PTZA 2UUPA 4W9NA 1WWKA 4D46A 4Z6KA 3RUEA 3HDHA 3O26A 2BFAA 2OOSA 5DP2A 2I3GA 4CM3A 4PZDA 1LX6A 3FPLA 4JQCA 3PHJA 3P5SA 4CMKA 3DHEA 4G65A 3H5NA 3M1LA 3WGQA 5IDQA 4JROA 2CY0A 4MVJD 1ONOA 2Q3EA 2ZATA 1E7RA 4QFCA 4TRNA 3GNQA 2WSBA 3TPCA 2ZKLA 4M8SA 3QSGA 1EK6A 1PTJA 1QV6A 2ZTUA 2R00A 4UVHA 4CQLB 5C37A 5CEEA 2RHCA 1I2BA 4EGFA 1B3BA 1DHRA 4ZQHA 4YCAA 2CDAA 4IQ0A 1Z75A 3E5RA 1UDBA 3OMLA 3DBHA 1SNYA 1XU9A 3I6QA 4J4HA 1KBZA 1R4NB 2W90A 2C29D 2Q1SA 3P7MA 2IEDA 3H6KA 2C59A 4YA6A 3F1KA 3GN2A 4LMRA 4QSMA 2O4CA 3F4BA 3GFBA 2D1YA 3C1OA 1IL0A 1B8PA 3G3EA 4E2ZA 5B4UA 4Y67A 4KDEA 1P31A 2V6GA 3E9MA 4FSHA 4Y9DA 5CAEA 3SLKA 1J5PA 1PJ2A 4NG5A 3KYCB 3JQBA 4Y6SA 1XYGA 3MWDB 2NV6A 4J43A 4XA8A 4RO0A 2YV1A 2VHVA 4J7XA 5BSEA 3ZNNA 4PVCA 2EIHA 2X0IA 3GEMA 2X0NA 1GPJA 3WNQA 3O8QA 3WOHA 3INGA 4EYEA 2VHZA 1E5LA 4E13A 3SLGA 1ONPA 5HM8A 3D7LA 3JQGB 3EDMA 3EYWA 3RUHA 4CLXA 4ND3A 1EFKA 3WQSB 1ZK2A 1KVSA 3RFXA 4B8WA 4JN6B 2E37A 1YJ8A 1DRUA 1YH3A 2X8LA 3WFJA 4DUPA 3H3FA 4CL3A 4IINA 2POQX 4B4WA 5CG1A 2J3HA 4CV1A 3QW2A 1VJ0A 3RFVA 4WUVA 3GVHA 3I6IA 2XXBA 3DL2A 4J90A 1Y81A 2G17A 4J0EA 5TF4A 4HWKA 4Q3DA 1HKUA 4W6ZA 4FOOA 4H7PA 4RVDA 1K6XA 4ALJA 4A0SA 4HADA 2PNFA 1JAXA 1T2CA 5L4SA 4RVGA 1VI2A 1DAPA 2P68A 3JQFA 1O8CA 1E7WA 3TL3A 4RF5A 3CKYA 1VSUA 3C3XA 2NU8A 4I5DA 3IP1A 1BTOA 4E0BA 2O3UA 3WYEA 3E8XA 5J23A 3V1TC 1LDYA 3CMMA 3MOGA 2JJYA 1H0KA 1N7HA 3GUCA 2O3RA 4GVLA 4DA9A 3PWZA 1EUCA 1U3TA 2D0IA 1LRLA 5COBA 2QZ9A 1CF2O 4CMJA 4R1NA 3BMCA 3VC7A 1T4BA 3K73O 3H9UA 3HG7A 3M1AA 3ZU3A 3IOYA 3WJ7A 3VZSA 1T2EA 1PZHA 1LXCA 2EP5A 3JQAD 3E5MA 3UXYA 1PJ4A 3FNFA 4OOFA 4GAEA 1N8KA 4O5OA 4WLOA 1ID1A 3WBFA 2B4TO 2AEFA 2GSDA 2IODA 4YJHA 4XQGA 3ZHYA 3ZNOA 2OBNA 3WTBA 4M87A 1QSGA 4PLPA 1Y5RA 5BNFA 5CP8A 1JN0A 1C0KA 4RVHA 2EW2A 3KEQA 1P74A 2YW9A 1ADBA 4I9NA 3WYCA 3JQ7B 2QX7A 1GUZA 4NJMA 3NJ4A 5TLSA 3OJEA 4BO2A 1N5DA 4OXNA 2PD3A 2PGDA 1HYEA 1KVRA 5EQFA 1LUAA 3HSKA 1FDWA 3A9WA 2J3IA 3OJFA 4EEZA 3BTUA 3EGOA 4GLLA 4IZHA 5JMPA 4CMEC 3W4IA 4AJEA 1VJ1A 4XKJA 4F6CA 1OC2A 1LSJA 1EQ2A 3RBXA 1T4DA 1I33A 4BKRA 2JFFA 4P4GA 5G0VA 1YBMA 1YBVA 4CMIA 1FDSA 1ZKMA 4XQEA 3LC1O 2DM6A 4TZTA 2W4QA 4IPTA 2X1HA 4NK4A 5JCJA 2I67A 1YKFA 1XR3A 4JNKA 1GDHA 1B2LA 2A94A 3MTJA 4CUKA 2H9IA 2PGJA 1AGNA 4G2NA 5EL0A 4BNTA 1NHGA 4OKNA 2HCTA 1PWXA 3G1UA 3L6DA 4BIIA 1IYZA 3DAPA 1O0SA 3FWNA 5EIOA 3ZU2A 1P77A 1XQ6A 4BV9A 2ZQZA 4B8ZA 4K28A 4CUJA 3VHRA 1PGPA 3K2BA 3B20A 4QT0A 1UJMA 3MOIA 3PHHA 1IY8A 3WLEA 3DHYA 1TEHA 1X1EA 3RC7A 4IGEA 3VTZA 2Y0CA 4DYVA 1H6DA 3KSUA 4J1SA 1KYQA 4AJLA 4J1TA 5BSGA 1HZJA 1U9JA 5GY7A 2VRCD 5IDWA 3B1KA 1JW9B 3I1JA 4R01A 4K9DA 3Q2KA 4R54A 4BKPA 4PZCA 4R1TA 3HB5X 2JD1A 3WGOA 1NQOA 4PLTA 1HDGO 2QIOA 3E1KA 4JXKA 3FWZA 2VZ9A 2X4GA 1GUFA 2YV2A 2BELA 1LSSA 1QMGA 1HDRA 4I5FA 1P1IA 3GPDG 4LMPA 1DJNA 4MVJF 4KTTE 4MVJM 5FYDA 6ADHA 3JQ6A 3PEFA 4FPXA 3NT2A 1OOEA 3TN7A 4MKRA 1M75A 1LRKA 2JAPA 1ISHA 3K30A 3OJLA 3TOXA 3HDYA 2B0JA 3GK3A 4GKVA 2JCXA 4RQTA 3RD5A 5KKCA 4AG3A 3ZWNA 4Z9XA 2GZ2A 4YB8A 2IZ1A 3DZBA 1U3VA 4MINA 4L0QA 2DTXA 2NUAA 3JQDA 3HB4X 5GZ1A 4ROSA 3ZWPA 1V9LA 2EV9A 3DTYA 4TKLA 3MJSA 3PFFA 1HDZA 3PHIA 1ZEJA 5AXDA 3GUYA 2IZZA 4IJUA 2CNBA 5DULA 3WJAA 4IJKA 3R3SA 5CHEA 3QRWA 3DZIA 4PLGA 1HLDA 1CETA 2BFPA 2OP0A 3NDIA 5EINA 5ADHA 2O3JA 4P4LA 4PN3A 2RH4A 5ER6A 3DDNA 1S6YA 2FWMX 4IDDA 3PJGA 2WJPA 3GZNB 5H81A 2C82A 1QORA 1DEHA 3EVNA 1E3IA 4MIYA 4RF4A 2X86A 4RPHA 3B1JA 3OIDA 3L9WA 4A2CA 1AUPA 3MZ0A 5DDIP 1F8FA 4R5MA 5A3VA 1K2WA 5C3MA 2VWPA 3B70A 1MX3A 1UDCA 5F5LA 2IYOA 3UICA 2GF2A 1TB4A 2GN9A 3F6YA 4P8RA 1NNUA 2AQHA 3F4LA 1EZ4A 2Q1WA 1TT5A 2W2LA 4DC1A 1A9YA 4B7UA 1PU2A 3B6ZA 3U4IA 4P4NA 4J0FA 2AE2A 2NLOA 1X15A 4NU5A 4R3NA 4PCVA 2ZB3A 4TRJA 4CM8A 2NTJA 1RPNA 4O59O 4DLAA 1EE2A 3KUXA 3Q9UA 1XHLA 2DTDA 4WCFB 1LC0A 2P4QA 1XDWA 4FC6A 3DFUA 1F17A 3MJCA 4BO1A 2PLAA 5A9SA 2Y66A 1HZZA 1NQ5A 3PQFA 3GHYA 3WG9A 4CQMD 4IS2A 3LDHA 5IN5A 4CMEA 4TMFA 3NEPX 2GN6A 2C2XA 3ZWBA 2EKPA 2VYND 3NGXA 2AEMA 3R6DA 1XELA 1B14A 1U8FO 2X9VA 4R9SA 4Z0PA 2OGUA 3ROKA 1PJLA 1KC3A 4IUYA 3G1TA 4BO6A 4RDHA 3LLVA 2Q46A 3ULKA 4BV8A 1BWSA 2ZIZA 3D3EA 2O2YA 2OO5A 4IDEA 1KEUA 1KERA 3QWHA 1JVSA 3PLNA 1PGJA 1GTMA 3W6UA 1E5QA 4IQ8A 3LK7A 1UXGA 1WMBA 2DAPA 2VHXA 3U62A 3OQ1A 1BXZA 1A9ZA 4BNXA 3NKLA 3WIDA 5GMOA 1BGVA 2AQKA 1YS4A 7MDHA 4HX5A 4IDAA 3DQPA 2NADA 1PZGA 2GZ3A 4YVFA 3RI3A 3C8MA 4B7XA 1YONA 4XX0A 3UVEA 4CV0A 4J7UA 4D41A 3SJUA 2FSSA 2X5OA 1J4AA 2HMVA 3JYPA 2J3KA 1EFLA 1U5CA 1VKNA 3VAZA 2VUUA 1U2GA 1J6UA 1VJTA 2O4UX 4PLHA 4GX2A 5F1OA 1T2AA 5I7VA 1MB4A 1YQDA 2QZZA 3G0OA 4X54A 3RIHA 4KUGA 4NBWA 5L4LA 4BNGA 2ZK7A 5K0ZA 3ROQA 4GPD1 3GG2A 2H6EA 3C7AA 1M6HA 4QEDA 1F06A 4NBUA 5FWNA 1C1XA 3QA9A 2AE1A 1U28A 3JD4A 5CEJA 1EVZA 3ZWXA 3KLMX 2PA3A 3H3JA 5JPIA 2PZLA 3LSYA 3OEYA 4XYBA 4YQZA 1KVUA 3ZWVA 1EDOA 1C0IA 4BMNA 3MJTA 2JHGA 3NGLA 3X2EA 3FNEA 1D1TA 2XXJA 3ST7A 4CM9A 3RWBA 4N7RA 2Q2QA 1E6WA 5B1YA 1QLJA 1D1SA 4RDIA 4ND2A 5JW6A 1NPDA 3NT5A 4DQUA 5G0TA 3GOHA 3N74A 1V3VA 3ZHZA 1P1FA 3DBHB 4BOYA 4A26A 3ROPA 3KHUA 1PGQA 3AU9A 4E5NA 4ALLA 5L95A 1IHXA 1HTBA 4LN1A 5KIAA 3ASUA 5I9LA 1YL7A 3I9NA 3D0OA 3H5AA 4D79A 1P0FA 4ESOA 3ZHXA 3K9QO 1K6IA 4GWGA 3TOZA 3TRIA 1XA0A 1ISMA 1RWBA 2QRLA 5L4NA 2NVBA 3ZW8A 3I5MA 3EMKA 3OSUA 4HNGA 5JY1A 1ZK1A 3DAFA 4YACA 4OSPA 3MTGA 3ASVA 3RUDA 3WGTA 3INRA 4EW6A 2UUOA 3UFXA 3RUCA 3O8QB 3A1NA 3L6EA 3PLRA 5A02A 3S2IA 5C7LO 3U4DA 5IZ4A 3ANMA 1O5IA 1PEDA 3H8VA 5TT0A 4KP7A 5U4QA 3QVOA 4KZPA 3EAGA 3FTNA 1BSVA 4LVUA 2C2YA 1HDOA 4A5OA 4W99A 1BRMA 1DAOA 1R66A 4C4OA 1X7HA 1X7DA 2DFVA 1SZJG 2EERA 2RHRA 1LDEA 1GYRA 3CTMA 4MPDA 4NK5A 4M49A 3WMXA 3U5TA 1HYHA 1I3KA 4OAQA 5I7FA 2W2KA 1WW8A 3FNHA 4D42A 1P45A 1Z74A 1ULUA 4XRGA 3IJPA 5ICMA 1QYDA 4YAKA 1ZCJA 4WEOA 3B1FA 2B5WA 2HKIA 4LSMA 1W4ZA 4N5MA 2O7QA 4LW8A 1K3TA 1VM6A 3H2ZA 4GL4A 4J4TA 2D5CA 1EE9A 2JFHA 3EVTA 3ITDA 4NJOA 1PL7A 3RAJA 1YWGO 2NTNA 4LK3A 4YRDA 3RASA 3O03A 1WPQA 2PD6A 1NWHA 2HJRA 4LCJA 3MEQA 1ZXBA 3DC2A 4PIVA 1KOLA 3BMQA 3WLFA 2AEJA 3BTVA 4DTIA 1L7DA 1Q7CA 2B83A 2VTDA 4CMCA 5IF3A 4FGSA 4XB2A 1MFPA 1D4FA 1HT0A 2WWRA 4UREA 4ND4A 4BO0A 2B69A 4B3IA 5K6AC 5AOVA 4MVJP 3EUWA 3U0BA 5JC1A 5L51A 1L7EA 4J91A 1I8TA 2Y1DA 3E18A 3IDSA 1CJCA 3QQPA 3HDJA 4GI2A 2I99A 4L4SA 4RVFA 3UH1A 2GGSA 3GPIA 3BMCB 1U3UA 2FPPA 1Z7EA 3PRJA 4FW8A 5LC1A 1MXFA 4DMMA 3S2FA 3RC1A 4OMUA 1G1AA 1NHWA 4OGWA 2B5VA 1SO8A 3JYNA 3NAQA 2BHLA 2PY6A 2JD2A 3JD3A 2NU7A 3PIDA 4OJNA 3SBOA 1IUKA 3KSDO 3U09A 3KYDA 3X2FA 1I30A 4R1UA 4RPGA 4ZRNA 4Z0HO 2RCYA 4I9UA 3EK2A 1HXHA 2DT5A 4DBVO 4A73A 4OYRA 1K6JA 1E77A 4YJHB 4YAGA 3L0DA 5C5IA 3GRPA 1DLIA 4Z9FA 2DVMA 2V6FA 3L6OO 4QO8A 4L76A 4BNMA 3OA2A 1NX6A 2VHYA 2G1UA 4DPKA 4NJMB 3U49A 3U3XA 4MVJG 1SAYA 4NBVA 5U1PA 3DZHA 3MJEA 3OIGA 3PZRA 1XEAA 4PLWA 4AJPA 4D45A 1HDYA 2CF5A 2DU8A 3PYXA 1T26A 1OBFO 1PJCA 3LQFA 4BB6A 4IMPA 1W8DA 1M66A 3F1LA 4LGVA 4YXFA 1Q2XA 4QO7A 3P19A 1Y9AA 1YXMA 2QG4A 4WLNA 5BT9A 4ZQGA 3GGGA 4CMIB 4BNIA 4ZQBA 3IP3A 2FOIA 9LDTA 2GLXA 5FI3A 3VPHA 3DZKA 1BXGA 4AJKA 3AOEA 2VNSA 3NTOA 3GR6A 5KCZA 3PJDA 4YRBA 2Y1FA 3RKUA 1C3VA 3ZZNA 4CR7A 1I2CA 3OFSA 1SMKA 4GX5A 4B4OA 4BS9A 4Z3KA 1DFGA 2VWQA 2Y0EA 4OHUA 3WNVA 2OBYA 4BHTA 3Q2IA 4MVJH 4L4XA 3A06A 4L8VA 1NQAO 1DIRA 4O1MA 1I3LA 4O63O 2CSUA 2C5AA 1BW9A 1C0PA 5JDCC 4RPLA 3RBZA 4AJHA 1ULSA 1HEUA 2XOXA 5THKA 1FDVA 1R15A 5EERA 3E6AA 3GNTA 1SOWA 3GGOA 4LSWA 4FS3A 2RIRA 1ZK0A 3ZWYA 2C7GA 1LC3A 4YQYA 4B3HA 5CEFA 3KLPX 2DUUA 1Z6ZA 3BXXA 4B4VA 2PR2A 2HMWA 3FF4A 1G6KA 1HE3A 1U4OA 5TSDA 3PXXA 2Q99A 4NFSA 1PQUA 3VKUA 2CVQA 3EHEA 3WTCA 1DB3A 2HSDA 4FGWA 3WS7A 2CF6A 5HS6A 2UDPA 4CLEA 3WWZA 4J1NA 1EBUA 2RH8A 4MJLA 3SJ7A 3VZQA 4PLZA 1HWYA 1NP3A 4FFRA 3K6JA 3NTQA 4BO7A 4E33A 3GDOA 4L73A 1GY8A 1JVBA 2O3TA 3TFQA 2IYPA 1JLLA 5G4KA 2NVUA 4DC0A 5HBRA 1V3TA 3WDSA 1IZ0A 3BHJA 1TT7A 1K5HA 2ILTA 3ONDA 3UN1A 3QJ5A 4UUNA 4L4RA 3IQDB 1NVMB 1W73A 2YDXA 1DJQA 4EBFA 1MGOA 1F14A 2JL1A 1Q0QA 1M6WA 1R4MA 5I8WA 4CUZA 5K6AA 4HFNA 1ADFA 1N9GA 2Z95A 4A03A 2ET6A 2NM0A 1FJHA 5THQA 2EJWA 4S3MA 1ZO8A 2X22A 2O48X 2Y99A 3ZGYA 5BNIA 2DBRA 4FJ0A 3H9JA 4II3A 2FR8A 4D3SA 1YL5A 4WE3A 4Z3DA 2CVOA 4IM7A 3DOCA 1ZSVA 4PLVA 4JIGA 4YAJA 3JYQA 2Z1MA 3AI1A 2UV8A 3KTDA 5T5QA 4S1VA 3RUAA 3QWFA 4NH4A 1LRJA 4MVJI 1TT5B 5DN9A 1C14A 5L3ZA 1UZNA 3VZPA 4J7CA 4D0SA 4ZQEA 1KY5A 1M2WA 5A5FA 3GT0A 1I24A 2C54A 3G49A 4B7CA 1HF3A 4R41A 1ML3A 4RPJA 3HFSA 3UAGA 4OH1A 2AQIA 3OEWA 1G0OA 3SX2A 1DSSG 3D3WA 4DPLA 4W82A 4FB5A 1BG6A 1U8XX 5T6BA 1Y1PA 3HN7A 1V35A 3HWRA 4MVJA 4D3DA 3A14A 3STHA 4Q9NA 1Q7BA 1ZSYA 4MIOA 5ILOA 4NIMA 3W4JA 3OH8A 5A9SB 4JBHA 9LDBA 2I9PA 1ZH8A 1HDXA 4XYLA 4QX6A 1N92A 3JSAA 2VQ3A 2PKRA 3RJ9A 1DC5A 3AFNA 1E3EA 1CYDA 4KUHA 4WOJA 2WTBA 4J3FA 2FY8A 3PVZA 4J9UE 3V1YA 5C7OO 1CQIA 3GFGA 3I4CA 1NPYA 3Q6IA 2UVDA 4OQYA 4K1LA 4ZJUA 4D44A 1GEEA 3WMWA 1UDAA 4IY1A 4FIZA 1JKJA 2P2SA 4Y6PA 1Z45A 4QQRA 1LI4A 4BNKA 4HP8A 2WYWA 3VZRA 3BAZA 3NJ8A 1FDTA 3DMYA 4XGKA 4RV9A 3OETA 4Q3NA 4BNYA 2NACA 5ER9A 5TGDA 4CMAA 3IMFA 4F3YA 1UXHA 3FTPA 3KV3O 1E7MA 2PFGA 3CH6A 4E12A 4CLRA 4CM6A 3IJRA 4XRRA 5F1PA 2YUTA 5JDCA 1GYQA 4AL4A 1Y5MA 4RZIA 1NTOA 1BXKA 2H63A 1I36A 3TZ6A 5L40A 3WGGA 1Y8QA 4IDCA 1W0CA 1YGYA 3QVWA 1MLDA 1NXQA 2P9CA 4CLOA 1LQTA 2AW5A 5B37A 5L53A 5DBFA 4I5EA 4GH5A 5L45A 3EY4A 4ALIA 4BNVA 4DRYA 3PPIA 4Y8VA 3LC7O 4WLFA 1Y8RA 2X6TA 4WNIA 1ISJA 1RM0A 4NFHA 4RORA 1A72A 1J0XO 2DUWA 1KEPA 1PJBA 3AFMA 4N18A 4BGVA 3T4EA 4WLEA 3ADOA 1XU7A 4XIJA 1LTHR 2H1SA 1UAYA 3I83A 3UUWA 3ZV4A 4UULA 1C1XB 3ANNA 3RUFA 4YEDA 2E49A 4KQXA 3ONFA 1UXIA 4GLOA 5CDGA 1LLUA 1PGNA 4WLUA 2PKQP 1MXHA 4AJIA 1NBOA 5L7YA 5BR7A 2FHSA 5CPFA 4IIVA 1LLQA 1A71A 4IZIA 3U4CA 4E2XA 4UVDA 5BSHA 4R16A 2DBQA 4L75A 3VDQA 4OXYA 4FJ2A 1NR1A 5EJ2A 2GRAA 3M2TA 3NT4A 2C20A 3ICCA 2I3AA 4OQZA 3UGKA 1V6AA 1ADCA 3HADA 1EUDA 2PGLA 3PJEA 3I3OA 1MUUA 3VPFA 2EF1A 3FD8A 2A9FA 2AG8A 2GERA 1LSUA 5B4VA 4CM1A 1MC4A 1OFGA 4U5QA 3WB9A 5G2OA 2X7HA 2VRBA 4YYZA 2GN4A 1A5ZA 2C07A 5DZSA 3AY7A 5DCUA 3VPGA 4CV2A 1A7AA 4XYMA 4R1SA 3MJVA 3PDJA 4NFYA 3TFOA 3ON5A 4U0JA 2FP4A 3JQAA 3V1UA 1T2FA 2Y0DA 3GG9A 4IJWA 2HQ1A 5LCXA 1ENOA 1PJSA 3W8FA 3HUDA 3FBTA 1XQ1A 2Q4EA 4Q3BA 3CPSA 3AK4A 1OI7A 4HFRA 5TT1A 4NR0A 1O89A 2HLPA 1V0JA 3DBLA 2NU9A 3WXBA 4IGFA 3Q0EA 5A9RA 4QUKA 4OXKA 4A10A 2X0RA 4PG4A 3P2OA 4RF3A 2DTEA 3H2SA 5JCXA 3L07A 3OBBA 3ITKA 1EVYA 3PFWO 4W7IA 4XR4A 3ZU4A 4BNWA 4E4YA 1ISFA 3AOGA 4AJOA 1NQTA 2J5RA 1Z7BA 3VVCA 1GZ4A 3ZNQA 1PL6A 5JAQA 3ZW9A 1XLTA 2LDXA 2FZEA 2VYVD 2PZMA 1R0LA 4FBGA 4HFMA 1RJWA 4JK3A 1TA4A 2W2KB 2C0CA 2AA3A 4UUOA 5JMWA 4XWYA 1E6EA 5F21A 1UXKA 1KETA 1GCUA 2NQ8A 1SC6A 3F47A 3WYBA 4YAIA 3ZI0A 4NZ9A 1JU9A 1ZJZA 3L9XA 2BLLA 4LVCA 4E5MA 5JYDA 3KO8A 4ZA2A 2HUNA 3RC2A 5I9NA 1ENYA 3HE3A 4NDNE 3LYLA 3ETEA 4UUMA 3UW3A 1VC2A 1XSEA 3UCFA 1X13A 1PJ3A 3GVCA 1O94A 3BMQB 1OAAA 5TQVA 4RLHA 3CXRA 3E9QA 1U2DA 3CEAA 3H4VA 4BKOA 1YE3A 2P9EA 3TF5A 1V3UA 2ZCVA 1WXDA 3ZV3A 3VPXA 4BKUA 2Y1EA 4BO4A 4BMSA 5U9CA 3KBOA 5ICSA 1T24A 5ITWA 3W4KA 1B8UA 4EITA 3NRCA 2VRCA 1WZIA 5DF1A 1GV0A 3SC6A 3IUPA 1DPGA 5JAIA 2AMFA 3KYDB 4QFDA 4TWRA 3ICPA 1I5RA 5KJCA 4CMHA 1IPFA 3NDRA 3DTTA 4DXHA 5CG2A 1DBVO 2HAEA 2ZYGA 3KM0A 1CQJA 4E2YA 3ABIA 2JCYA 4E30A 1T2DA 3OP4A 4Q39A 1MV8A 1PSDA 1I32A 1R16A 2UAGA 3AUSA 4ALMA 2G5CA 2OMEA 4Z9YA 3GHHA 1E7YA 1ORRA 3OQBA 3DZGA 3PHLA 2PWZA 1E3JA 4ND1A 4HXYA 3VH3A 4EUHA 2O50A 3PYLA 4KOAA 1R0KA 1FK8A 1YB4A 2WYUA 4TVOA 1WDKA 2D4AA 3RQSA 1P33A 3TZQA 3U9LA 1FDUA 5ILGA 4CMBA 5EMHA 3K5PA 3VH4A 4IXTA 1JA9A 3LF1A 3AM5A 3N58A 4IDFA 4INAA 1QYXA 1ZUD1 1Q1NA 1YVEI 2EEZA 3OJ0A 5L7TA 4FC7A 3K2EA 3ANLA 1BXGB 4EZBA 4AJNA 2F00A 1NFQA 3AOEC 2I5PO 3FBGA 3H7AA 3S8MA 3UKOA 4BGIA 5IDXA 4UEKA 3C7DB 4K6CA 2HK9A 1JKFA 1YRLA 3KXDA 1QR6A 1LDGA 2Y67A 3IL2A 4GWKA 4WCDA 4CM4B 4UEJA 3FRJA 1EUZA 4GGOA 1JDJA 4PLFA 2X23A 1LDBA 3WGZA 1PS0A 2ZB7A 3L77A 4HY3A 2O3QA 4NBTA 1NWCA 3DBRA 3AU8A 4XD2A 4ITUA 3BMOA 4AVYA 2ZQYA 1GR0A 2WMDA 1VL0A 3BHIA 4LISA 3KETA 3H65A 3JQ8A 5JO9A 1BW9B 3V2UA 1GADO 3CMCO 4IXWA 3IKVA 3S55A 3VTFA 5DCYA 2DKNA 2NU6A 3JYOA 2FPGA 3HZZA 4FCCA 4TROA 1N1EA 3WGHA 5G4LA 3P2YA 4CLDA 1D8AA 2ZB8A 2EHDA 3JV7A 1BMDA 1E92A 3AUAA 1H6AA 5AYVA 5CDTA 4MOWA 5JO0A 2WYVA 1E3WA 3JCZA 3GRKA 1SEPA 4YTEA 5TIIA 3GA0A 3V2HA 1H9AA 4FFLA 2JFGA 3ZCXA 4FR5A 3LZ6A 1R0SA 4DIFA 1H93A 4H15A 1KS9A 1VKOA 3KSZO 4CQMA 3SVTA 3EZYA 2I76A 3KYBA 1LLCA 1U7TA 3QP9A 5HTOA 1KVQA 4UVGA 1LSOA 3D1LA 2VYNA 4ZHSA 3PGJA 4AFNA 3ZWWA 4ZGWA 1UP4A 3R0IA 1T1RA 1ZFNA 2YFQA 3D4OA 3OQ6A 5H82A 4NQZA 2G0TA 4AJ1A 1M67A 2HMSA 5A03A 1E7SA 1YQXA 4Y98A 1PR3A 1E7QA 1XG5A 3CSDA 5TS3A 1SB9A 2UYYA 1I0ZA 2IDZA 3DMTA 4Z0TA 4M89A 2WE7A 3TZKA 3FSRA 2J3JA 1F0YA 4PG6A 4UVIA 3I23A 3UOGA 4EJ0A 1A4IA 2EG9A 3DO5A 4RQUA 5G4KB 2NVUB 2DC1A 3WICA 4HV4A 4UUPA 1H9BA 1DIBA 5CDUA 4UAGA 1PQPA 1WVGA 1HE2A 1QLHA 4ID9A 4CM5A 1X1TA 2FPIA 2WE8A 3MWEB 3FI9A 1RM4A 4XGIA 5ITVA 4ZU3A 4P22A 3RUIA 1GPDG 1PGOA 4PG7A 1R4MB 2I65A 4XCVA 2X5KO 4Y6RA 3UCEA 2EJVA 3WR5A 4PG5A 2JAHA 3E48A 1N9GB 3QVTA 5CDSA 4NPCA 4U7WA 4JJIA 2YZ7A 2YHIA 1LEHA 2NTVA 2ZYDA 3AY6A 5F3RA 1DIAA 1YL6A 2EWMA 3ZH2A 4GQAA 1UZLA 4A27A 1PS8A 2VOEA 4DYDA 3AY3A 3Q3CA 3HQ4O 1DRWA 5A06A 4RJTA 1ENZA 2YQ4A 3WBBA 1I2ZA 2O3SA 2BKAA 1GZ3A 2X58A 3IUSA 3ZWMA 1SB8A 4J2HA 4QXMA 2W8ZA 3JQ9A 4WLVA 2ZTVA 1PL8A 1IZ9A 2YQ5A 5AXAA 5IXYA 3IAHA 3F3SA 4RVSA 1TXGA 4E32A 1QYCA 1HYGA 4YWJA 3GVPA 4YT4A 4M86A 2LDBA 1EMDA 5DNAA 2E4AA 1QRRA 2W98A 5DT9A 4BKQA 1MA0A 3PI7A 1WDMA 4RGBA 5B12A 1AN9A 4KTVE 2HK8A 1OZAA 1K89A 2R2GA 4R68A 3TL2A 3QV1A 1DOHA 3D3WB 3LVFO 4J4BA 3ZHBA 4CMGA 2C7VA 1ZNQO 4RF2A 3Q11A 5JDIC 4GSLA 5F5NA 2YV3A 2NVWA 1LNQA 2JKVA 4ZD6A 1X0XA 3HDQA 3GAZA 3PHGA 5EPOA 1HDCA 3TDKA 3AUUA 4E6PA 4AJ2A 1JQBA 2J8ZA 2CMDA 3PQDA 1WAMA 3E9NA 4BNZA 4HBGA 4R3WA 1RM5A 5I7EA 1VRWA 1KVTA 5A1TA 4JJGA 1FXSA 4UEOA 5A9TA 2D5AA 1XIVA 4IJVA 1KY4A 1U7HA 3JYLA 1ZJYA 4L74A 3ZDFA 4WJZA 2WDZA 1T25A 1VSVA 4GGPA 4CR8A 1P1KA 1A27A 1IOLA 1FMCA 1R37A 4XDZA 1EEHA 3OA0A 3O38A 4XQ9A 4GKBA 1E0DA 1HSZA 2YY7A 1GV1A 4CM4A 4BNHA 5CPBA 2Q2WA 1O6ZA 3F9IA 2VHWA 2VUSA 5TJHA 1SEVA 5JBIA 2BF7A 3RROA 2I6TA 4GMGA 2GDZA 2WD7A 1H94A 2X5JO 1C0LA 3HHPA 4E2WA 4B79A 4CLRB 8ADHA 3PK0A 1NM5A 1NPTO 2A4KA 3KRTA 4KUEA 1TI7A 4H3VA 3S2GA 1U3WA 3JTMA 2ZB4A 4II2A 3QWAA 4R4JA 1ZZEA 2BGLA 3CUKA 4BNFA 3IC5A 1Y8QB 4ZVVA 1X0VA 2O23A 5COAA 1NAIA 1Y6JA 4CLOB 3KVOA 3AWDA 4YJDA 3QWIA 4RZHA 3WIEA 5JCJD 3AM4A 4R5HA 5KTKA 3W8EA 4GVXA 1Q0HA 1Y8RB 2ZTMA 1NAHA 2EGGA 1E3SA 5TJ9A 2BH9A 1BVRA 1IE3A 5HWSA 3BYZA 1AHIA 2VNAA 3Q1LA 1AXEA 1Q0LA 3DOJA 3M6IA 3VKVA 4MDHA 1GQ2A 2AQ8A 4D3FA 1YJQA 3GF4A 5G0UA 1LLDA 3ETGA 4MKZA 1QYVA 4DLBA 2HJSA 2E48A 2Z5LA 3HN2A 4MP6A 1X14A 4BNUA 4E5KA 1NVGA 4YJFA 4RLSA 4IIUA 3GZNA 5K9ZA 1PQWA 3ZWAA 1PZFA 4EUFA 3PYMA 1IULA 1ZK4A 1C1DA 3VH2A 1O9BA 2VZ0A 3QVXA 4BB5A 1JKIA 2Y1OA 4WKGA 4XDYA 4IQGA 2IXBA 3I9JA 3OM9A 4BGEA 2OHXA 3IIEA 1VL8A 2QHXA 3DONA 4ZRMA 5ES3A 4IDBA 2F1KA 3V8BA 1B15A 2E6UX 3ENNA 2GNAA 4BNNA 4BO3A 2Q1TA 2HO5A 5KWEA 1YDWA 4BQPA 1QG6A 3GEGA 3KZVA 4ZQFA 3R1IA 3WX0A 4PLCA 2ZJ1A 2BFMA 4XQCA 5TC4A 1B0AA 2Q2VA 2VCYA 4YR9A 4Q3AA 3D64A 3F5QA 3G79A 2Q45A 3JD2A 1E1KA 4PVDA 4LRTB 5T67A 1I3NA 2X0JA 3AW9A 4ALNA 5CDYA 1VL6A 3JQCA 3L4BC 5T8KC 3ZV6A 2Y93A 1B3RA 3BZUA 4CODB 2PK3A 3OJOA 3TZHA 1RM3A 4N5NA 4XJTA 4XR9A 3CIFA 2QRJA 3JQAB 3U4HA 4DLLA 4FFNA 2CDBA 1PJQA 1WNTA 3A28A 4KWIA 2IZ0A 2FSVA 5IXSA 3VOSA 2EGHA 3AJRA 2VOJA 1CDOA 4DIOA 2HRBA 1P1HA 4TRRA 3TWOA 2Y1CA 3DBLB 3BTSA 1Y7TA 3RBVA 4C7KA 4FFPA 4Q3CA 1YBAA 1DC4A 1MG0A 3QE3A 4KWHA 3I9LA 3LC2O 1GUYA 1ENPA 1ISGA 3V2GA 4K6FA 1N7GA 2BI8A 4CJXA 1ZW1A 2G76A 1UR5A 3BMNA 3GH3A 3Q9NA 4BQRA 3C1AA 4DVJA 5A05A 1YOVA 3KB6A 2YDYA 2EXXA 2IE0A 4MIEA 4YJGA 2J6IA 2ZCUA 5DBIA 5JDIA 4EJ6A 4NNJA 1LDMA 2YYYA 4GX0A 3E82A 1B16A 2GZ1A 4RCVA 4PG8A 3GGPA 4DGSA 4J1QA 1DIGA 3W8DA 1YDEA 1GFSA 4PLYA 2Q4BA 4EEXA 3GY0A 3PJFA 4QTZA 3ZWCA 4WPGA 5IN4A 1UH5A 2HMTA 1PWZA 5B4TA 2W2LD 1PR9A 1CIVA 3MCVA 4I8XA 2PZKA 4YT5A 2CFCA 4D0RA 3LT2A 2FN7A 5TRTA 4E31A 4JP3A 3N7UA 4CR6A 4O6VA 2D2IA 3GNSA 4BO5A 3UCXA 5KJEA 1JAYA 5JS6A 3LT1A 2WEKA 4UVEA 4ZICA 1UP6A 2DPGA 5T57A 2PV7A 2OZPA 1VLLA 2VUTA 6LDHA 2X9NA 3S1LA 5T64A 5KOIA 2EKLA 4FDAA 4CL8A 4F45A 1ZIDA 1G0NA 3GAFA 1J49A 2C5EA 4J9VA 4F46A 3PWKA 1NR7A 1P9LA 3OICA 4CQLA 3T7EA 2JCVA 1S7CA 3W1VA 4RVUA 1DFIA 1IPEA 3OF2A 3FNGA 4MP8A 4WECA 3DHNA 3D4NA 2GD1O 2TMGA 2WM3A 3FR8A 4YPOA 1R4NA 5FI5A 2Y1GA 3K96A 2A92A 5DOZA 2BGKA 5JYEA 3VH1A 2OFPA 5AQ1A 4G81A 3L4SO 2D8AA 2P91A 3KEOA 1GQQA 1LDNA 3OHSX 3EC7A 3ORFA 3AUTA 2BMAA 3DZJA 4FQ8A 3DZFA 4O0LA 4XEHA 2B37A 1UP7A 1H2HA 2P4HX 4IMRA 2WD8A 3KYCA 2FMUA 4GX1A 4B3JA 2HRZA 2Q1UA 1B26A 2PD4A 1DC3A 3RKRA 3LT4A 3BTOA 1H6BA 3H9QA 4BL5A 4DL9A 1JWAB 4XYEA 3I52A 1B7GO 1WP4A 2XAAA 1QP8A 1ZMTA 2OXIA 2I66A 4U8GA 3ONEA 4OOEA 4WEQA 2CUKA 4WK6A 3WWYA 1A7KA 4J16A 5KJ6A 1T1SA 5G0WA 3DOOA 1HSOA 3CINA 1XCBA 1ZEMA 2OUIA 4Q3EA 3JQGA 3C1TA 2CVZA 5KJ1A 2PZJA 5DCWA 5JXWA 1DIHA 2FRDA 1EQUA 5BNTA 1BDMA 3TNLA 5G0SA 1H6CA 4TQGA 4YRAA 1Z73A 2VT2A 3QVSA 4FJ1A 2J5KA 5AVOA 2QQ5A 3GQVA 3HNPA 1LU9A 3H9GA 4BO9A 1P1JA 2B35A 4YT8A 5BQFA 5KVQA 4LCEA 3UHAA 5MDHA 1DFHA 3S2EA 1HE5A 4KMSA 5GZ3A 1WLYA 1YB1A 4OIMA 4U6QA 4OSOA 4ZN6A 1GEGA 1HL3A 2OL4A 2GUGA 2DPHA 1K0UA 4RL6A 1UUFA 5DP1A 3NUGA 1SOVA 3LLSA 4XIYA 1NVTA 1NYTA 1TLTA 3NTRA 3ZV5A 4DREA 3DBRB 5KVVA 3FN4A 5I7SA 3ZN2A 2E82A 3BMOB 1PZEA 2R6JA 4EDFA 3L4BA 5T8KA 4CM9D 1RYDA 3AI3A 1EDZA 3C24A 3JQ8B 3QWBA 1DDOA 3CZMA 2SCUA 3QIVA 3UF0A 4A7PA 2CZCA 1GQYA 3PQEA 1BVUA 1GAEO 3DWFA 4GBJA 1GU7A 1P1RA 3D5QA 1VE9A 1EVJA 1ADGA 3DXFA 1I3MA 4E5PA 2QYSA 1E3WB 3HJAA 3RCBA 4E21A 2V6MA 3JD0A 3HFGA 1DO8A 4YT2A 1LJ8A 3BHMA 1GZ6A 4D7AA 1UZMA 1KEVA 1E6UA 3OECA 1SPXA 2D59A 4OL9A 3EW7A 2BRUA 3GMSA 4G5HA 4DPMA 2GYYA 2IXAA 2QRKA 4N54A 4BNJA 2XF8A 2YHUA 4QECA 2FR1A 4CQMB 3DEYX 1HRDA 1CRWG 1O95A 4TVBA 3TJRA 3WGIA 1XWFA 5IJZA 5I8ZA 4XB1A 3FHLA 4BNLA 2ZJ0A 4ND5A 5KJFA 5JC8A 3TZCA 3PWSA 2FR0A 2EP7A 1ZMOA 1U1IA 1BDBA 1PJTA 5GZ6A 1UAGA 3TSCA 4AJJA 1CEQA 4NBRA 3COSA 3DMTC 3GVXA 1HLPA 3DB2A 4FD3A 3JQ7A 3I9MA 3ENKA 4TSKA 3ZWOA 5CFZA 2NWQA 4WCFC 5C7IO 4BVAA 1ZVMA 2J5QA 3NX4A 5JE8A 4NHEA 2P5UA 2Q49A 4TRMA 1RYEA 2IEBA 4MVJE 1ZK3A 2ZTLA 4U0KA 4JCOA 2GCGA 1JTVA 2VZ8A 4PGFA 3FR7A 3C85A 1R12A 4FFOA 4CM7A 4B4UA 2AXQA 1U5AA 2YHIB 3LU1A 2TMDA 1MP0A 4JBGA 2DLDA 5A5EA 4WOKA 4HUJA 4KQWA 4C7JA 1OC4A 3INTA 3GDFA 4TKMA 1GCOA 2X9GA 4MKXA 4BGUA 2D3TA 3D4PA 2VWGA 3BA1A 2B4RO 3W6ZA 4JLWA 4DMLA 4MP3A 4I08A 3V5NA 3T7CA 3QY9A 2JD0A 1VPDA 1EK5A 1ZSNA 1LBEA 4DQVA 2BD0A 3NYWA 1ARZA 3I9KA 3JQ9C 5IZCC 4FOSA 3ROMA 4DIBA 4K26A 1EVIA 3O4RA 1ZXLA 2JHFA 4U6SA 5JAMA 4RPKA 3GC6A 2BI7A 5A04A 8LDHA 2CDCA 4D43A 2NSDA 1AE1A 3RVDA 4FN4A 5KVCA 4CPDA 1AHHA 2Y05A 1ZBQA 3PIIA 2GN8A 1Q7GA 4YBZA 1XGKA 4ILKA 5KKAA 5LDHA 4I9HA 5AXBA 3SXPA 1WMAA 5A4DA 1F12A 4EI2A 4KDFA 1FF9A 5COQA 2XPCA 4W7HA 4CV3A 1QXSA 3RFTA 2QW8A 3NV9A 1PS9A 1YO6A 4LRSB 1D7OA 4BUCA 4E3ZA 1TVEA 2O7SA 4W9NC 3MJ4A 2VWHA 4JX8A 3RU7A 4NU6A 4F6LA 5BSFA 4W4TA 3VVBA 3DFZA 4IDGA 4H16A 3SEFA 2B4QA 3RSHA 3PZBA 1MG5A 1DRVA 3RC9A 3WQQA 3WQRA 1KIFA 4R51A 4IBOA 4DBZA 3I9OA 3LT0A 1PIWA 2NQTA 2O2SA 2AHRA 4JBIA 4WGGA 2DFDA 2OORA 1V8BA 4YAEA 3WFIA 1SCUA 1KEWA 2PH5A 1NFRA 2WD7B 3BIOA 3KOUA 3OIFA 4L9RA 1P44A 2R00C 5L7WA 4M55A 1QYWA 4J6FA 4EJMA 4TZKA 4WNCA 3QHAA 5F1KA 5HA5A 2HDHA 1MFZA 1DXYA 3WGYA 1N1GA 2GASA 2YFHA 1SBYA 3F5SA 4NI5A 5EN4A 1CERA 2NNLD 1HE4A 1N2SA 3RU9A 4P38A 5ENDA 4MO2A 5L9AA 5MGBA 4FFMA 2CD9A 2Z1NA 3JD1A 2RAFA 3GLQA 4NMHA 5AXCA 2HU2A 4IS3A 4R9RA 2G82A 2PTGA 3I4FA 2Q50A 3PDUA 1E1NA 3PP8A 2P9GA 4I5GA 4YDRA 3ETDA 4DWVA 1I10A 3JQEA 5ENVA 3ZU5A 1OMOA 3JQBC 3AI2A 2VYVA 1QKIA 3TQHA 1IB6A 5IDYA 4AJ4A 1GL3A 3RJ5A 1JWBB 3K8ZA 2V7PA 4BMVA 2ZYAA 3F46A 5H83A 5DOVA 2EW8A 2V65A 2BFOA 1QV7A 1W6UA 4OM8A 3VDRA 3GEDA 1XKQA 2GR9A 3H9EO 2YJZA 4JJFA 2GPTA 4CLHA 1H2BA 4YJFB 4M1QA 3DBVO 3DR3A 5FF9A 5IG2A 2IRWA 3FPCA 2DQ4A 3K92A
chains in the Genus database with same CATH superfamily
2QTNA 2VT3A 3GDGA 4KN8A 2B36A 2PRIA 3QEMB 4ONEA 2GRJA 2EBHX 5IAJA 2J9YB 1A7JA 1KI6A 2PFSA 1EBFA 5TR9A 1MH1A 1WDLA 4MA5A 1Z4JA 2ZT8A 3L93A 4PGGA 1ZLXA 1LS1A 5KVSA 5DBGA 3EZLA 3EODA 3NXKA 4RJKA 4DG8A 3IAM1 4C30A 1WZEA 5CVTA 4MQBA 4L15A 3HDTA 5ALXA 5AM2A 2P2GA 1Q7RA 3URMA 1LA2A 2CK3D 1BMQA 1AK9A 1DRJA 2VTVA 4IDQA 1LBIA 2ZRIA 3UIEA 4P7KA 4Q7JB 4RK7A 4REQB 5TB5A 1KAHA 4EWLA 4HRVA 2DBZA 4HZIA 3FMVA 1JZTA 1A2KC 3LDGA 4AB1A 1P0CA 4RZXA 1GD1O 2BT4A 3AJAA 3IKJA 4M54A 5EXXA 4C05A 2VTBB 3AF5A 3KPJA 5AKLA 3BG5A 4RENA 3VPSA 4C0QC 1SCBA 3K1ZA 3RSSA 3ZJ5A 2EKQA 4B75A 1PP4A 5EXDA 4FK8A 1UBKS 4R69A 1JI0A 4OHCA 1Z82A 5FOQA 3W5DA 3PC6A 1ZNXA 3VUEA 4D9IA 1J1UA 4PZEA 2DBVO 1XLVA 2EARA 5EESA 3CZRA 5JUWA 1X9HA 3WAGA 4FIDA 3IELA 4JQZA 1K0FA 2ZOSA 3K31A 4EB6B 5TX7A 3O8CA 1C3JA 3BBPA 5JSFA 2W2PA 1E3LA 4I1IA 5BOSB 1K5DA 2HXSA 4KR6A 1NASA 3GT4A 3GFFA 3U26A 3WMGA 5AVRA 2R84A 5KHOC 2QTAA 4WASA 1MZPA 5TNXA 1KSHA 3HB7A 1C0EA 4DR1B 2IPLA 1CWUA 4JYBA 1JNYA 3H0CA 3BMNB 2A9QA 3SC4A 1AS0A 3ILYA 1DHTA 4MKIA 5A3JA 2PZGA 3GGSA 5JY6A 2WOJA 1KC1A 5HRUA 4BLVA 1UFQA 2AG5A 4RC9A 1P9NA 4DQXA 3NWPA 4IKEA 1OXUA 5IAAA 4BV2A 1AV6A 1DC6A 3CWZA 3N2LA 2XMSA 2BZSA 1K7FB 5JLAA 2HK7A 4OMFG 1EG2A 3IVGA 5EP1A 4KQKA 4UQLA 2X7JA 1NF9A 1E1MA 2Q9BA 3BVPA 1NG1A 3L18A 3QOXA 1OASA 3CR3C 4H1VA 3VJLA 2GVDC 4BX3A 4FEAA 2G67A 3MJHA 1V5GA 4W8HA 2XF2A 2LKCA 1RW4A 2UUPA 1U6JA 2LXNA 2YJ4A 3I2FA 3NBXX 3DCNA 1YTLA 1NXSA 1L3IA 3EGVA 4NXMB 3VU3A 2I3GA 4PX2A 4UUBA 4PZDA 3UUGA 3CYFA 1WVIA 3CCBA 4DG5A 5KQGA 4QQFA 4JQCA 5DYTA 1CNEA 3PENA 4UPEA 1N36B 1GGKA 3OZEA 4EA9A 2GPYA 2GESA 3U3KA 3MS4A 5IDQA 3QU2A 2QX9A 4MVJD 4O4HB 4ZCIA 4WH0A 3QMVA 1QZUA 4TQUS 3PB3A 3T0GA 1E79A 5HGXA 2FEKA 3GNQA 1UK9A 1W85B 1A9OA 1SIOA 2NZJA 3IVXA 3K0FB 1KO4A 3L8HA 3OTQA 3QSGA 4UVHA 5BV2P 1IATA 2PO7A 3G0DA 4QFBA 1TDJA 1RPJA 2GPWA 2PXAA 1DHRA 2R1TA 3IBYA 4ZQHA 5EWJA 5J3JA 1PFUA 1TCBA 5BOVA 1EESA 1UDBA 3OMLA 1CFJA 3C4JA 4AM8A 1R4NB 2QJWA 5C8XA 1JSLA 2W90A 3OFVA 2H2IA 4L9SA 3NATA 5JS1A 2WU0A 1AD2A 4O4LF 3R3WA 2IELA 1DU4A 2C59A 3DSRA 2JDIA 2IQ5A 1LCIA 1Z0UA 3IP7A 4MGYR 4Q47A 4Q6BA 2D1YA 3WA7A 1IL0A 1P7CA 1B8PA 4E2ZA 4Y67A 1P31A 2V6GA 2DULA 2VLIA 4UBJA 3UMJA 1BHJA 4ECAA 5CAEA 1UMCB 4RH3A 1J5PA 2BWJA 4ZRDA 3SLKA 1SRRA 3TQQA 2HHLA 2XB9A 3QUBA 3ZHSA 3W34A 1M1NB 2NV6A 4DM3A 3E4DA 4ZVUA 4XA8A 4QJ5A 5D51S 5IYZF 5K0NA 4CCYB 2EKDA 4FD2A 5C8VA 3U60B 4JJ7A 5DGTA 3EWIA 5J1TB 4PVCA 4G3XA 1ECJA 1VFPA 1GPJA 4RK5A 3BCRA 5JS7A 3KT3A 4YI3A 5IVDA 4EG7A 3LOUA 1T6NA 3DYIA 4X24A 3IJ5A 4YFVA 4KODA 1KDVA 4KWTA 1ISRA 4OHKA 4QYSA 4JKIA 1U5BA 2G77B 4LXXA 5DIZA 3WJ1A 3RYCB 3JQGB 1HY3A 1QPGA 1XCPA 2GDJA 3FTEA 4C87A 3EYWA 2FFJA 2PS9A 1B6SA 1M6VB 2JI8A 3HKEA 1ZK2A 1GLGA 1CUJA 3RFXA 1FFXA 1C9YA 2XMQA 2E37A 3AF3A 3ESDA 1HRKA 3IR7A 1DRUA 4JN6B 4PZZA 1CZOA 5DEOA 4YRGA 1ODJA 1TA9A 1UOOA 3HMQA 1JG4A 3VOTA 3T9CA 1TQ6A 3ZZTA 1VDMA 3QW2A 2R1UA 2BC9A 1VJ0A 4LKOA 2WWGA 4WUVA 3RFUA 1CULC 3GVHA 3TX6A 3R09A 5K0GA 1JDUA 1V7QA 4Z7NB 3EAQA 2QT1A 2V8BA 3OAAA 4XVHA 3HA5A 4J0EA 4O0MA 4HWKA 5C1IA 4FYYA 4HAWA 4Q3DA 2DPXA 1N6NA 4W6ZA 1HNWB 4GKJB 2NP7A 2Q4OA 4BMPB 4ALJA 5F35A 5I45A 1JAXA 5L4SA 5TV2A 1D1PA 3WDMA 4E1AA 1RZRA 4W63A 5F1YA 4D82A 2JI9A 1O8CA 1AHNA 3DFMA 3TL3A 3V4OA 3NBKA 4DSNA 2BM0A 3GFSA 3M1IA 4YCNA 1RFGE 1BTOA 4IJMA 3NGMA 4KQCA 2VUIB 3OUUA 3EZ6A 1NOJA 1E2LA 1NT2A 2CXNA 1RYMA 3E8XA 5C1BA 5HUHA 3H0KA 2PCLA 2X2OA 3LKVA 2JLQA 5IJAA 5J23A 3BWEA 4LOAA 4A82A 2PANA 4X85A 4OXQA 3A6LA 3W2EA 2OPHA 2CJWA 3IJEB 1Z5UA 3FWKA 3O8DA 4XQ0A 2D2VA 1YF3A 1K8RA 3WK9A 3GUCA 2PLFA 5FLXA 1KDOA 1U3TA 3ZK7A 1LRLA 2Q0XA 3IE2A 4CMJA 2VJQA 3KPUA 2V7WA 1T43A 3B5IA 4NCKA 3BMCA 4N8DA 3K73O 3C8HA 2RGEA 3GL9A 2BZGA 1SBNE 1BO6A 1HDIA 1WABA 1KDRA 4YRCA 5H59A 1OF1A 3ZU3A 2FSFA 4CKBA 4Z49A 5ITZB 1UEXC 1BJTA 2FMHA 3ADKA 4CL0A 1JH9A 2PYDA 4IHJB 2OZEA 2BGJA 5SYNA 4OI2A 4IFTA 5HBGA 1C9KA 1FU4A 1KRWA 3JQAD 3E5MA 1PJ4A 2F43B 4G36A 4TV8A 5C1OA 4JL6A 1KU6A 1JH8A 2YY5A 2VDKB 2K7FA 2PUAA 4B71A 3NKFA 3DEKA 2C4WA 2PGIA 4HYTA 4WLOA 5KDOA 1QP0A 2ZSJA 3ZWKA 1CQPA 1Z6QA 2P9YA 5K05A 3LFUA 1QSGA 5CP8A 5CNIA 1JN0A 1WIWA 4RVHA 2EW2A 3WYCA 1ADBA 2ZRFA 2BGUA 2GI4A 1XTQA 2V97A 3R6GA 2ZU0C 5ESXA 3R6LA 2XXAB 2CLIB 2NAFA 1M1UA 3KTAB 3SC2A 2FJ0A 4IIBA 4Q34A 1DUVG 2YW2A 1N5DA 1PVVA 4DNOA 1E6LA 4WOPA 3ZLJA 4B2YA 4MWCA 1LZKA 1GRQA 2W6IA 5CU7A 1QQBA 1TQHA 2OCXA 2YN4A 5EQFA 5B1DA 3TM4A 3A6ZA 3L7YA 1KAGA 4AURA 1OH6A 2J3IA 4GU5A 2MSKA 1M0TA 4UQPA 2Z04A 3VSBA 4CMEC 3ZGOA 2QLJA 4F6CA 3E27A 2QKYA 5HZGA 2J5XA 4URZR 1WCV1 1G5HA 1ECGA 2FFRA 1U7XA 5FBQB 1IY2A 4DCUA 5KQRA 1R0XA 2ZG6A 3CN7A 4CEHB 1JALA 1CKEA 1IB0A 5IUKC 3CHYA 1N4DA 2AXEA 3KG2A 1L4MA 1PV2A 2EYUA 2W70A 2DM6A 4HGRA 1UBUS 2IEGA 4X6LA 1P61B 3PE6A 2X1HA 2FF5A 3G2NA 3KZMA 1U02A 1D6NA 1F2DA 4KQ1A 4XVCA 2SHKA 5JCJA 3KE8A 1KR5A 3LSTA 4JNKA 2AR9A 1B2LA 2ZJAA 1NR5A 2JF0A 3MTJA 1PR0A 1PDVA 3V6MA 3CWCA 1E6KA 5HMMA 3ZIDA 1F3LA 2VK1A 4OKNA 2Y6UA 3AQIA 4D8TA 1UKYA 1IYZA 1LI5A 4GMKA 3U9SA 2OBXA 4BC1A 3EISA 2QW1A 4BV9A 1NOKA 1ZOPA 1WVMA 4KIWA 4YMGA 4RZQA 1N0UA 2CWWA 3KKPA 1PGPA 1W0KA 3B20A 3I73A 4QT0A 3VISA 1IY8A 1S96A 3WLEA 2PT7A 2X8JA 1MIOB 2XMDA 5EJEA 4KHPB 4DYVA 1IU9A 2FW8A 2Y0CA 1BX1A 4ICIA 4MCJA 4AJLA 2QRGA 5BSGA 2Q9AA 1U9JA 3ICWA 3V4FA 3NEJA 2C9BA 2UKDA 1I4DD 3B1KA 4R01A 4O5AA 3D2AA 4JJKA 4EG4A 3DZ8A 2DWQA 2GA8A 2ZJ3A 3MAGA 4CIYA 2HRCA 1NQOA 2HLHA 5FA8A 1OXMA 1NMXA 2Q5JA 2Q5LA 1XMIA 2M2IA 2QIPA 2QIOA 3FWZA 4PLTA 4DADA 2BN4A 5IXJA 3AB8A 1U8ZA 4OUDB 2X4GA 4DCJA 3FW1A 3BORA 1HDRA 3QTBA 1C8LA 4LMPA 3HB9A 4MVJF 4MVJM 4JLKA 4KV9A 5FYDA 3RT1A 3TUJC 3CZCA 1Y4AE 4FPXA 4LZAA 2QTVB 1CS4C 3HFRA 2I2WA 3C3JA 3B89A 3WY9A 3KQHA 1LRKA 4JLSA 3COJA 5MGNA 3G7SA 4G0MA 4MZXA 1BJKA 4CTJA 3HI4A 1ISHA 4IOKA 3A26A 1IXSB 4HUTA 2B0JA 1NUTA 2H2WA 4GKVA 1EI9A 4YCMA 2QL7A 5BPHA 4X3OA 3PUIA 1G8JA 1QAOA 4UNRA 3A6FA 4RDCA 4Z9XA 5MFPA 3X44A 5A71A 1AKNA 4RY2A 3DZBA 1U3VA 1SCUB 3LHDA 4LYAA 4UU0A 4QEZA 2DTXA 2NUAA 4QNNA 4WKPA 2WWFA 1CCWA 2EV9A 4TKLA 2B1IA 4NZMA 4YCLA 4AKGA 4EHAA 1VXOA 5AXDA 2GF9A 3M0EA 3ZHTA 2IDJA 1RYNA 4B32A 2X2EA 2YJGA 5GONA 2FJPA 4BBZA 3JASB 4FHCA 2NAPA 1Z8HA 1J20A 1G18A 1CETA 1HLDA 5BSKA 1MAHA 3B36A 1ZWLA 3BE5A 1T0UA 2G1AA 3DDNA 1FEZA 4QOJA 4Y2RA 1T6XA 3KVYA 4KKXB 1C80A 4A2QA 2WJPA 3HBNA 3GPBA 4YRPA 5EEGA 4K0RA 3GRRA 4KZKA 2MSEB 3W90A 1RRPA 4L02A 4RH1A 1E3IA 1VZ3A 1RE0A 5TQ0B 2AJCA 4XUGB 3OIDA 4X20A 4NJEA 1OKKA 2CHEA 2H0RA 3AERA 4PYKA 5FR2A 4A6EA 4BASA 3KWMA 1SXJB 4ZGGA 1W4AA 4HGZA 5CUQA 1D0IA 4R5MA 3R7FA 2BFFB 5C3MA 2I87A 4UXHA 3PGLA 1EFDN 1MX3A 3V1LA 1YFJA 1G5PA 5D3KA 5KYYA 1VYVA 1L3CA 1DEKA 4WADA 2VG8A 2WKWA 2IYOA 4EA8A 1GZVA 1T9CA 4PONA 4C5CA 4WWHA 3I2GA 1TB4A 4MDFA 2OV4A 1NNUA 3R74A 2AQHA 4LRWA 4N82A 3GRCA 3LCVB 5B55A 2LBPA 1VGRA 2V7GA 3EQ7A 4LHWA 4CF3A 2REQA 2YJTD 1Q15A 2ZUCA 1GHTA 5IULC 3EGEA 1IZ7A 1U0NA 2QI9F 2GKSA 3N5CA 3ZBUA 4JI0B 1A9YA 5J58A 4B7UA 3II6X 2WNSA 3ZCVA 2YQZA 3JAKA 3KR9A 5BUCA 5LP6F 2AE2A 5AKHA 1JKXA 3NBZC 3VYRB 3EMDA 1QHFA 1DV2A 2OWDA 4TRJA 1VDZA 2QTWB 4K3UA 1EE2A 1V3QE 3TQCA 4RHXA 5HM6A 2DLNA 4WCFB 1OBHA 4HNQA 3OF5A 5LZ9A 1A50B 4ZYVA 2IHBA 5FDFA 1LC0A 1XDWA 4FC6A 3SZRA 3F97A 1HURA 1JDBC 1F17A 1RD4A 3BS4A 3DFUA 2AN1A 3MJCA 3OLVA 2PLAA 1ZUIA 3PQFA 4AROA 4LHSA 1VLZA 2PBFA 3T94A 4A1OA 2QG6A 2KYRA 5IN5A 4CMEA 1OT3A 5TMBA 3ZWBA 2VYND 3NCTA 4FFDA 2BMJA 1NJGA 2GT1A 5K3SA 5IKEA 1BWQA 1LBSA 2X40A 5IWCA 3Q6NA 3ROKA 1LPSA 1R6AA 2ID9A 3B13B 4IUYA 4QTTB 2JFNA 3IP8A 2R65A 4HH0A 1CLEA 5TDHA 2XA9A 3G1TA 1KMHA 5FV4A 4RDHA 2CV1A 4DWOA 4YMUA 2I33A 3ULKA 2HCFA 3MJRA 2ODTX 4MUNA 3D3EA 2B8TA 1IG3A 3D6FA 1EFAA 3EDYA 4BRUA 1PGJA 2FV8A 4TWJA 2ZBVA 1P8AA 4IQ8A 3LK7A 1UXGA 1YDHA 2DAPA 2J87A 4S1TA 2WNIA 1V8DA 1THTA 3NM4A 3OQ1A 5FD8A 2YWJA 3WKEA 5AJVB 1ZVVA 3R0QA 5CT9A 1VIAA 4O4IF 3PL1A 5CFNA 2PT6A 1WS6A 4IDAA 5D2CA 5HK8A 1JX6A 3QELA 2ZWIA 3EVZA 3IKLA 3SJAA 1I4OA 2XZDA 5GVRA 4KPFC 1UDXA 3ZVNA 1W36B 3HA2A 2X1LA 1K9VF 1SCDA 3O0DA 2DR0A 2VBIA 3DDSA 4G6ZA 1C9JA 3SJUA 1G8GA 2JGDB 2LNDA 1J4AA 1XRRA 1QIMA 4YGXB 5FORA 4A8HA 2G25A 2X3UA 5SZKB 1EFLA 3DE5X 1U5CA 3MCUA 3VAZA 2IU3A 4LCBA 4QYTA 4TT3D 1QFSA 4E4RA 1FFAA 3NBAA 4PLHA 1NP6A 4EKDA 1OH8A 1T2AA 1U1DA 3LO8A 3VBCA 4PYQA 3RNOA 3VYSB 3L2OB 2O52A 4X54A 3I62A 1MJHA 4QYIA 1XK7A 4UNPA 4AWBA 1OGJA 4KUGA 4NBWA 1COWD 2PFKA 4KEAA 4U4AA 4M1ZA 3H4TA 2ZK7A 3FCYA 2XDQB 3DFIA 4WTOA 2ZSHA 4R0VA 2RGWA 3KALA 5LZ7A 1AKMA 2PL5A 2PRJA 1R9GA 4S0ZA 1GN8A 5HGJA 1YR8A 3NXSA 4Q6WA 3R4CA 5CEJA 4QE3A 1RAEA 2RIPA 1ZCBA 5HTKA 4KR3A 2IBTA 2JASA 3LSYA 3FLMA 2R85A 4O4JA 1KVUA 1L4HA 3JWHA 5K3BA 2A33A 1SVNA 1L7PA 2JEYA 3IVAA 4BB0A 4BMNA 2HSWA 3B2EA 2RGDA 5ALKA 3BXOA 5EVCA 2XSZD 3TI9A 4YRMA 3LCUA 3MWGA 5HIMA 2ANBA 4CM9A 3RWBA 4N7RA 2FPOA 2Q2QA 1E6WA 4C4AA 1QLJA 4QBKA 5B1YA 1R4AA 2F1HA 4RDIA 4ND2A 2DG2A 1TVCA 5ALUA 1NPDA 1N5RA 1SCJA 1VCMA 3UWDA 4ZMSA 4X00A 5G0TA 3GOHA 3K8QA 3Q7EA 4EYOA 1IRIA 1MOPA 3J7AC 2GZSA 3VNAA 4DJFC 3DBHB 1FP4B 3E9RA 1ECBA 3EMBA 4BOYA 4QUDA 2OZVA 4I9GA 4P9NA 5H3LA 3KHUA 3THWA 1E18A 4KK3A 3OWXA 1V47A 4NFLA 4R9UC 3UT5B 4BWVA 2JBAB 3RQIA 4LOKA 5FXMA 5I9LA 3V48A 4C6TB 2HFKA 5CCDA 2C9ZA 4KI7A 4B2IA 4D9MA 2QTTA 4QTUB 3ZHXA 2HCRA 1I2AA 2QN6A 1KI9A 3O5AA 1VJRA 3IQZA 4EIWA 3IOMA 1XA0A 3QOYA 3SSNA 3WNDA 1OGYA 1RWBA 5E1DA 1VKJA 1WOMA 1Z2NX 2QRLA 4C06A 5IEJA 5L4NA 3TZBA 2NVBA 2PEYA 4Y9UA 1AJEA 1FFCA 1EFVA 1FYEA 1XTTA 3OSUA 4YRSA 1TU0A 4DKXA 1TMYA 4HNGA 1BOOA 1YHYA 2Q8PA 1FFWA 2B8NA 4LWPA 4OSPA 1M1XB 3MRTA 4OF4A 1HA3A 3RUDA 1G19A 4J0CA 4M0PA 2UUOA 4F04A 1RU3A 3MFQA 2XMPA 1EWTA 3IT3A 4XVRA 3O8QB 4UBMA 1NU8A 1NI4B 2X0KA 3PLRA 3OMXA 3BWXA 5EP3A 1J33A 3ZZ1A 3G23A 3L8FA 1XD2A 3ZPXA 4BB9A 1IBLB 3M6MD 1FDOA 1JBQA 1MQ8B 3A9TA 1O5IA 2BMFA 2GXAA 2NO5A 4MLDA 4A23A 4N7MA 3CVXA 2ZR9A 3WIBA 4GOMD 3EAGA 3FTNA 4QRIA 3P0RA 4GE0A 1M34E 1IG0A 4AZ0B 2C2YA 1HDOA 1Q77A 3T54A 1BRMA 1E9CA 1D4OA 1XN4A 4H0NA 1SZJG 3CTMA 3LKZA 2ZYIA 4MPDA 3QENA 4I4IA 3PL5A 3WMXA 5GGXA 1I3KA 2CLKB 4IQFA 5JH7F 4OAQA 2OCDA 1WW8A 1UWLA 3U4MA 2DR3A 4RU1A 5JI2E 5D5QA 1Z74A 4D97A 5JXGA 1FTSA 1RYHA 4FT2A 4KLCA 4LTMA 2H0AA 3IJPA 5E3HA 4XRGA 5JS8A 2OFWA 1RPZA 1BE0A 1B93A 4Y2PA 3C87A 4N03A 4WEOA 4N5MA 5IVHA 2HHCA 5KNCD 4RMJA 5KWJA 2P6MA 1E32A 1FRZA 2ZSKA 2IEZA 5AKIA 1K3TA 1VM6A 1UWKA 3VR6A 1R10A 4A0HA 4BU0A 1NIPA 3RAJA 1W9HA 2NTNA 3TLAA 3AIOA 1GPUA 1C9NA 4UOQA 4YRDA 3NQ41 2PD6A 1XJQA 2AOWA 3C48A 2H59A 4LCJA 4FINA 3WLFA 1F3OA 2NU8B 4DTIA 2PZFA 4IEEA 3BTVA 3KV1A 4EG0A 1VPWA 3TEJA 1P9RA 4N5HX 1TOAA 2BCEA 4CMCA 2XLCA 4XB2A 1MFPA 1Z12A 3CX3A 2B69A 1K08A 5AOVA 3LX4A 2QRPA 2XCLA 3EUWA 2Y92A 5EHNA 2FWPA 1Q17A 3AIIA 1L7EA 2QXYA 4RKQA 4B6RA 3KOXA 5JBQA 1H9CA 2Y1DA 1Y4DE 4Y6OA 3R8XA 4ZIRB 5JSZB 1CZUA 1KRXA 4CDNA 2OTCA 3UJ9A 5F76A 4HH3C 2PCJA 3OKCA 2QMZA 3PNBA 2G9UA 2I99A 3GJSA 4JKYA 1SC9A 1X3LA 1TZBA 2GGSA 4LOLA 5C1DA 3P9XA 4FW8A 1UPUA 1Z7EA 2B4KA 2HCJB 3PRJA 1MXFA 2W6QA 4JUDX 2JFWA 1N5LA 2OGZA 2P4UA 2VZLA 1MR3F 3IEIA 3PQ6A 4GYWA 4KBFA 2FX2A 4O2AA 4PINA 5KX5B 3Q8MA 4OHRA 1VHTA 4FE7A 3L4EA 2B5VA 4QUBA 1OQAA 1PBNA 2JGMA 1IN5A 3AUJB 2BHLA 2PY6A 3AESA 3IP5A 3V8RA 1CUVA 2VXOA 1IUKA 1GTZA 2G1PA 2IUTA 2Z2XA 4I19A 4OGFA 1MZVA 3HCOA 3IUEA 4ZRNA 3FHCB 2JGLA 3AHDA 4I9UA 1TTPB 1HXHA 4AG6A 1NNI1 3QMMA 4YJHB 4YAGA 3W5CA 3UFBA 2H08A 1ZZGA 3BGIA 3COPA 3B6MA 5CLJA 1CY8A 1OREA 2PZBA 3O92A 1NJFA 2V6FA 3D31A 1YASA 3IUYA 3L6OO 4S24A 1NX6A 4TTSA 4Y1EA 5E3JA 4BNMA 1MN6A 4XXHA 4DPKA 1MGPA 4NJMB 4DT1B 3KKOA 4XPIA 2G6BA 1K7XB 2JRCA 1AH2A 4KXUA 5U1PA 3PNPA 2B20A 3OIGA 4D45A 4PLWA 5IKXA 2V74B 1KBQA 3BCSA 3R44A 2CF5A 4NHOA 1GTL1 2AIRA 4YJ2F 2FG5A 4H4CA 3NU1A 4DV0B 4EMTA 1M66A 3DLHA 5AVTA 4M99A 4CIAA 3E2PA 4HGPA 5KOHA 2F3UA 1TL7C 2D0OB 4W6QA 4MB0A 4ARUA 2ZYVX 2FOIA 5CGZA 9LDTA 2GSWA 2FYTA 2BKEA 3NIGB 5KOYA 2EQBA 2PX8A 2VKTA 3GP3A 2AI3A 4Q05A 3AOEA 2VNSA 2R1VA 3GR6A 4M1YA 4O08A 4NCNA 4YRBA 2DPLA 1SU6A 4G67A 1C3VA 4JXJA 2PBZA 4Q9HA 1DWQA 1I2CA 1WB5A 3EXAA 3M5WA 3O6VA 4B4OA 4Z3KA 4NAUA 1DFGA 3UOAB 3P2EA 2OYSA 2W6CX 4OHUA 2OBYA 4DA4A 5FUQA 1FSPA 1R6TA 4UAVA 1VHWA 4GRIA 3AVYA 2HSJA 4R2XA 4MVJH 5C53B 4KRXA 5AKYA 1YS2X 3DEFA 3A06A 3L6RA 2GEKA 2IBMA 1VI6A 1NQAO 2EBUA 2BFNA 1RWPA 3LE8A 3STTA 4CQLB 5TQ2B 1T8SA 4M88A 1BW9A 1YHZA 4C78A 4DRXA 3FUTA 3ZUPA 1ISPA 2QRQA 3FDXA 3REOA 3COWA 3RYIB 4KH0A 4AJHA 5F2NA 4Y2GA 4ZAYA 4LRYA 3LBYA 5LQSA 3VR2A 3QHQA 5J4YA 2XOXA 4NTZA 1FDVA 3FSEA 1R15A 1T2UA 1CTQA 3E6AA 4BE9A 3HV2A 3GNTA 2Q2NA 1YZGA 5BSWA 1YTUA 3RYTC 2VI5A 2RK3A 4M9SA 5JALA 2NVOA 3PXUA 3ZGZA 1ZK0A 4HDKB 4MUMA 4WGFA 1UBEA 4XM2A 5A7HA 4F1WA 3WDLA 1REQA 3OQIA 2A9KA 1JG2A 1Z6ZA 2B7CA 1OU0A 4LQ4A 4B4VA 2PR2A 3MCAA 2AFIB 3FF4A 2J46A 3ZQUA 1X7YA 1BMFD 3RC3A 1S8FA 4KLZA 3K70D 3C14C 2DRIA 5BN4A 2JI7A 1X1CA 2YYSA 2WJZB 5IH7A 2FDCA 4QM6A 2Q99A 2HJ9A 4QC2A 4F4DA 3DV0A 2MU1A 1MVOA 2B2XA 4BQIA 3BWMA 4ARVA 5KSWB 1JRLA 1UAAA 3WP0A 3NOOA 1Y3FE 3JTEA 4FYMA 2GM3A 4Q4AA 4AN1A 2JGIA 5AW1A 5LDDC 1UK7A 4F8JA 2ZUBA 3KWLA 3O9VA 1XZDA 1CF4A 2FE4A 4LI3X 4MEBA 5H70A 1OZ0A 2C95A 2CF6A 3DNPA 2P6NA 1WHSB 3LUGA 2JBWA 2RH8A 4J1NA 3IDFA 1HWYA 1NP3A 1KTVA 3K6JA 3RH0A 1I4EB 3I2HA 1I3OA 3M89A 4INOA 4HDNA 4I50B 5EJGA 4CKCA 4RESA 4PAQA 5K0FA 1V1JA 3EXHB 3N2KB 1JLLA 5G4KA 1HTWA 1QE3A 2DFTA 1G7RA 1PYOA 4NYMR 1IZ0A 4UTPA 5LLTA 1SD5A 1RYFA 2MOKA 4KQJA 5JJCA 4K9MA 3R7DA 4MYCA 4W1QA 1T0BA 5EJ7A 5C51B 1W73A 2AZXA 4EBFA 1G55A 1IM8A 1MGOA 5LBIA 1Q0QA 3DV2A 5EXPA 4IH9A 5I8WA 2O5CA 4LJLA 2IYLD 1YZUA 3K09C 1Q1BA 4LJ4A 1ADFA 2W6ZA 2P78A 1O9HA 5TGZA 2R6FA 3BB1A 3HH8A 4HAVA 2EJWA 3AEKA 3NTXA 4MUJA 1UC8A 3WRWA 4WVFA 4S3MA 1ZO8A 2HSGA 2X22A 2XZTA 4GXRA 4C0JA 2G4LA 2Y99A 5HSGA 4UE2A 5A4AA 2YC4C 3ODPA 3MRVA 4PGAA 3N8IA 5AI0A 5BVHB 3DZDA 3H9JA 4II3A 4D3SA 3SQXA 1YBFA 5AVYA 4R8VA 4WK2B 4IM7A 1YS9A 1EFTA 3DOCA 4PLVA 4TXNA 5JEDA 3MHPA 3CISA 1FYWA 2IZOA 4TYNA 1J8VA 1CDDA 1WUKS 2P9FA 4TN5A 3JSXA 4L4UA 5I51A 3KTDA 2Z4TA 5LA6B 2IUSA 1WU8A 2XYRA 4S1VA 5T5QA 2OXCA 5B3JC 4RA6A 1MTZA 3QWFA 3ROFA 5K99A 1TT5B 1L7XA 1ONSA 3HR7A 1UZNA 1TUEA 3SIPA 4GICA 3ZS9A 3ICOA 3KJIA 3JZDA 3FB4A 5A5FA 2NTYC 4D9FA 2AOUB 1H42A 3H8JA 3KK0A 3G49A 3HYLA 1UODA 1XOIA 2ETVA 3NOQA 2VAPA 4WZBE 1IY0A 3MQ2A 4EBBA 1GOTA 1VBFA 2NSHA 1KYZA 3MMPA 2PUJA 3HM2A 3SX2A 1FYXA 3NETA 4Z7JA 2QRUA 1Z2AA 4MV1A 1E3QA 4GRAA 3QY0A 1ZU4A 1Y1PA 3ANSA 3BPSA 5DTRA 1XLTC 2PVSA 1Q0TA 4EO7A 1TW3A 2BMDA 1JSXA 3A14A 3AHCA 4D3DA 1PTKA 2AJBA 2FG7C 4KGVA 4KVZA 4NIMA 2AFHB 3S68A 3OH8A 3TMAA 3VVLA 4XX1A 1UKCA 5TF0A 9LDBA 1GZ5A 4KO8A 4X8MA 2F7SA 5IF9A 4NF2A 1H3EA 5DWDA 5FBRB 5K8JB 5DM0A 3A31A 5IX8A 2WFLB 3RJ9A 1WMDA 2X77A 5CVEA 2FG6C 4X3PA 1XMPA 1DC5A 1CYDA 1M2OB 1P4JA 3AFNA 4KMMA 4WOJA 4XWOA 2EATA 4UEWA 4J3FA 3V7YA 5C7OO 4J9UE 3R0JA 3GFGA 5DYWA 4UDOA 3SS7X 4F96A 3Q98A 4UATA 4B33A 1WCXA 4N0MA 2J0EA 1VG9B 2OBFA 3RS9A 2VF7A 4HDSA 1O94C 4FIZA 2P2SA 4M1WA 5FRDA 4HQLA 1TYZA 2JLBA 4D1YA 3OZDA 1FNCA 2D3WA 2J6BA 3BAZA 1OZFA 5FFMA 4XGKA 5CFOA 5K8TA 2P9TA 4QDXA 1MNAA 2NACA 3EFHA 4YBRA 5TGDA 3WYGA 3IMFA 4L4YA 1CRZA 4MQ4A 5DKFA 3ROGA 4CWAA 4NY1A 2X0DA 2OHIA 3NZEA 2CSXA 2GAJA 1V1MA 5KTOA 4CLRA 4QWWA 4ZOLF 3B53X 1I9GA 1RRMA 2EFCB 2YUTA 1WZCA 3P71T 3DBIA 4AMGA 2I4TA 3GELA 2WQ7A 1DG3A 1F6BA 1UFOA 3TIVA 1QOZA 3BL5A 4MWTA 2IYQA 4TL9A 2BF4A 2PGOA 2BFCA 4LY3A 4RZIA 3WLLA 1PSZA 4ACBA 1THMA 1WXIA 1Y8QA 1W0CA 1XTUA 3OLYA 3EOBI 3H5VA 4IDCA 4UJ5A 1NXQA 1T4CB 5CB4F 4GM0A 3RBAA 4HK4A 1K8XB 5B37A 1XDSA 2Z8ZA 5L53A 3TQIA 5DBFA 4KYTA 2O2GA 4B44A 5HX7A 4FR2A 4OH7A 2CNWD 3A7DA 1XZAA 4LNHA 4C0KA 5TVGA 4M1SA 3AO0B 3COZA 2O07A 2D6FA 1TLFA 1PZNA 1MNQA 4BTVA 2QM0A 2EFHB 2UZ0A 3G2LA 4IJQA 1RJ9B 3AFMA 4DBLE 4MS1A 3OLWA 4V39A 4WLEA 3V8PA 1PV4A 3U44B 4XIJA 3WKCA 4HWTA 1K75A 3LXRA 4MQ6A 2CV2A 5A6VA 3W5SA 1FL9A 3R9XA 1C1XB 1NSTA 1XNHA 2DSNA 1L5WA 1PR6A 3EGXA 4KQXA 4YEDA 3RYFA 2IHNA 4CL2A 3E9YA 1RIIA 5CA0A 1KEEA 4ZVTA 5DLDA 1YA4A 2D1FA 2QTZA 4F21A 4ZJYA 4GLOA 1B0UA 1JFSA 1O6CA 2GEDA 3LPCA 1K4MA 4TMYA 4ZT6A 3TBFA 3UK6A 2FHSA 4UXIA 4WA8A 1RQLA 4IX1A 1VHQA 3EZFA 3EG9A 3WSTA 3H4IA 5REQB 3INNA 2DSTA 4QG7A 3HCPA 3VZDA 1DDIA 3FKSD 5BSHA 5KSZA 4GMDA 4QGAA 1F8XA 1G7SA 2C83A 5BSUA 2JLSA 5CIQA 4CIBA 5EJ2A 3K9BA 3PQ8A 3AJDA 3O0TA 4U9UA 3IAS1 3ELUA 1TC2A 2Q6KA 1M74A 3M2TA 3NT4A 5FOTA 3UA3A 2C20A 2DFKB 2GBFA 3ICCA 4OL0A 5DHRA 1L5YA 4D57A 2BBTA 2FOXA 2I3AA 3DE7X 1V6AA 3FJYA 3ND7A 4XGQA 2ZS8A 1S2GA 2PGLA 4RTQA 3C3KA 4S12A 3R2JA 1NX9A 3VPFA 2EF1A 3FD8A 2GERA 1N9KA 3D6VA 1LSUA 3CR8A 2DH5A 2YVQA 3M7IA 4O2LA 5DWVA 1A9RA 3RTGA 4BYMA 3QKUA 3WB9A 4PTYA 5ULLA 5AIBA 2XRZA 4G0WA 4NAHA 3SBEA 3F78A 4E5SA 1VBMA 4HVAA 3T6KA 1ZH4A 2IUYA 4NV0A 1W87A 4R1SA 2SECE 2GK3A 3MJVA 3RHZA 4S05A 3PDJA 2D13A 1KY2A 4JI2B 2P4EA 3V1UA 2Y0DA 4IJWA 3TNFA 4KL8S 1QIHA 4C0WA 3W8FA 1PJSA 3TG8A 1GPYA 4EEKA 2XI4A 3HUDA 1XQ1A 3GP8A 3CPSA 1U7ZA 3AK4A 3UFXB 2QSYA 4HFRA 8AT1A 5TT1A 2R7AA 2OK8A 2EFGA 4EB8A 2HLPA 2QENA 3C3AA 1V0JA 3B5EA 3DBLA 4RIEA 1QQ6A 5B3JA 1KO5A 3PFBA 421PA 3DPUA 3T5PA 3GD5A 1RHKA 2D74A 3MPUA 4PZUA 3VHXA 5A9RA 4ZYTA 2IP2A 5BMVA 2CFSA 2X0RA 3HUTA 4DUYB 3R5TA 4OQMA 1ZAYA 2DTEA 1Y1SA 1ZNWA 3CEPB 1H4VB 3OBBA 1G66A 2MJLA 4FDUA 4OLJA 4UCXA 4W7IA 5ALVA 3ZU4A 4E4YA 1IOZA 1ISFA 1R6BX 2A88A 1XCGB 2J5RA 2ZE5A 4KFSA 4L16A 3VVCA 4DB2A 4RXUA 4WK4B 1QIGA 1L5LA 1XLTA 4JITA 2FZEA 3FPHA 4FBGA 1AGXA 1EVLA 1DAFA 2NP6A 1XXHB 1P0QA 3CO0S 2AA3A 1XEXA 1L5SA 3PNQA 1UXKA 1KETA 1ZA1A 2QAGB 4JFRA 1KI3A 1YFKA 5CDHA 1C7RA 1NLZA 2OCAA 2G9ZA 2VSYA 1CP3A 1E58A 3I12A 4M0EA 3ZI0A 4BJ5A 1TM2A 4KI0A 3EQ2A 4NBLA 2XVAA 1U2SA 3BGDA 5EKTA 3DJYA 1ENYA 3HE3A 2CHQA 4JOQA 4NDNE 4DJ5X 4R2LA 1FJXA 3UW3A 3GPLA 4Q7KA 4N6OA 2O7VA 4OFWA 4EJFA 4DUZB 3U1VA 4JYAB 1O94A 2WQZA 3BMQB 4G9GA 5TQVA 5CA1F 2Z3ZA 1KQGA 3GLIA 3CA8A 4N3NA 3G0BA 2EP8A 1Y4ZA 2NXCA 2QQEA 4MRVA 4N7BA 4BDTA 5BUSA 5J4LA 4F4FA 1RTKA 1DPFA 4H3KB 3CEAA 4NONA 4P83A 5L3RA 4M46A 5LKAA 3ZWDA 4DZTA 4K81B 2K7ZA 2P9EA 3BE4A 1KKMA 3WVNA 5TMPA 3LXMA 5L3VA 3TF5A 1XTZA 3CEMA 5AVWA 3LA6A 1V5IA 1UOPA 5FTMA 4BMSA 3LP6A 3TOVA 1KH1A 2CWDA 1G8PA 3KBOA 3PUWA 3JVIA 4GM4A 3W4KA 4EG3A 3MUOA 1I1NA 1B8UA 3LCMA 3LW8A 1I7DA 1OROA 4AUKA 3C8ZA 2VRCA 1WZIA 3OEHD 5T6MA 1WE2A 5DF1A 4H6XA 4I55A 3SC6A 3S29A 1YCGA 2C5GA 5HIAA 4Z3OA 1KZYC 4QFDA 3OJXA 5IYZB 2NT4A 1N2HA 3DOUA 1Z0KA 3LKBA 4BTEA 1U2QA 1DBVO 2HAEA 1O0CA 3HWWA 5E0OA 4YLGA 5EUMA 1FLVA 3VJRA 4D8UA 1C3OB 4OQPA 4EL5A 3G9QA 4Y2QA 2YXDA 2O05A 3V8EA 4R1LA 3QTLA 3MT8A 1E2KA 3OP4A 4Q39A 3NG1A 3IB3A 3C4QA 1I32A 3QGMA 4Q16A 1M72A 5HZKA 4DV6B 3AUSA 1OLXB 1X3SA 2X15A 3GRZA 1Y80A 1E7YA 3CRMA 3LD9A 4RMHA 4AWXA 3DZGA 4MW0A 1L5QA 1E3JA 2DYKA 2XB2A 4EUHA 3RK4A 3NNDA 4GLBA 4KOAA 4Q4LA 1HQDA 4GOXA 2WYUA 1JJ7A 3FMGA 4X64B 1PEAA 2IYRA 1QPZA 2PMKA 4PAWA 4EHFA 1RP1A 4JYPA 1ZGZA 3TJZA 5ILGA 1J39A 2YXNA 1U3FA 4BJ3A 4IXTA 1XZJA 2ZIFA 3W6PA 1F7UA 1JEQA 4U7DA 4RIHA 4Q7LA 4IDFA 4INAA 3PHBE 1TEZA 4FNMA 1UMBB 1PNOA 1MT0A 2QUKA 1YVEI 3GGJA 5AKXA 5FOUA 1DCTA 4GZ3A 1QH0A 2EEZA 4QULA 1P0MA 2QLLA 2WIFA 2G9NA 1ZN7A 1L5MA 3D3JA 4WVLA 2PZAA 2YVUA 3SF0A 4EZBA 3AH8A 1JDNA 3UKOA 1NFQA 3VDMA 1XNQB 4FHGA 2B6HA 2DERA 5CNKA 2BSXA 1IDN1 3AB3A 4KV7A 3NIBA 2HK9A 2XGMA 2XUFA 4D0LB 1QR6A 3L8ZA 2Y67A 3IL2A 2NPIA 4WCDA 4CM4B 2MINB 2XYVA 1EUZA 1D2RA 4D3XA 3N53A 3P2JA 1FVXA 2RD2A 1PQ4A 1SHUX 5IAEA 5JFOA 3PDIA 1ZIPA 1TU4A 3L77A 3N8GA 3HU3A 2WSLA 5M5BA 1NWCA 1YU9A 1A8IA 1A95A 2OT3B 2WF5A 1ZGAA 4KR9A 1UWCA 4DW8A 4AVYA 4ZKEA 3IAXA 3GJQA 4MJ3A 1Y7LA 4XM0A 3A2KA 2ASEA 1U0SY 3LIIA 1P2FA 2RI0A 4IXWA 1II0A 2JFVA 1YE8A 2R96A