1XKQA

Crystal structure of short-chain dehydrogenase/reductase of unknown function from caenorhabditis elegans with cofactor
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
272
structure length
272
Chain Sequence
b'PRFSNKTVIITGSSNGIGRTTAILFAQEGANVTITGRSSERLEETRQIILKSGVSEKQVNSVVADVTTEDGQDQIINSTLKQFGKIDVLVNNAGAAIPDAFGTTGTDQGIDIYHKTLKLNLQAVIEMTKKVKPHLVASKGEIVNVSSIVAGPQAQPDFLYYAIAKAALDQYTRSTAIDLAKFGIRVNSVSPGMVETGFTNAMGMPDQASQKFYNFMASHKECIPIGAAGKPEHIANIILFLADRNLSFYILGQSIVADGGTSLVMGTQAHDV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords short-chain reductase family member (5D234)
molecule tags Unknown function
source organism Caenorhabditis elegans
publication title Crystal Structure of Short-Chain Dehydrogenase/Reductase of unknown Function from Caenorhabditis Elegans with Cofactor
rcsb
total genus 104
structure length 272
sequence length 272
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1xkqA00
4BO1A 3DMYA 2GD1O 3ZWMA 1UDCA 1YB4A 1K6IA 3KBOA 4GGOA 4JQCA 3GEMA 1K6XA 3PIIA 1ZNQO 2O3TA 5GY7A 5I7EA 3DHYA 3LT0A 4ND1A 3TQHA 3OIDA 4I9UA 3CEAA 2EEZA 1E7QA 1ENYA 6ADHA 4I08A 3V1YA 3ON5A 2NNLD 5THKA 3ZGYA 2CVZA 2TMGA 4WCDA 2Y1GA 1L7EA 3PVZA 3GG2A 3G17A 4UREA 2P5YA 2PH3A 3N7UA 4JBHA 2B5WA 1OZAA 1ZJYA 1ZKMA 2BHLA 2ZTUA 3JYQA 4ZN6A 1P45A 2GN8A 2PY6A 1ZSVA 2YHIB 4E5KA 1X13A 1U8XX 1MX3A 4HFJA 3EUWA 1BMDA 4O1MA 4AJ2A 4E13A 1XQ6A 1UH5A 2VNAA 4GX5A 2PGLA 1MG5A 2Y0CA 4QEDA 3FCOA 2PKQP 4J90A 1DSSG 2QX7A 4A7PA 2D59A 5F1OA 3P7MA 3PFWO 1N8KA 2H1SA 4RPJA 1UXIA 5COAA 3VOSA 1WNTA 2NWQA 2GRAA 3UICA 1QSGA 4MVJE 4A10A 4CUJA 4MJLA 3U4HA 3FBGA 4DYDA 1EQUA 3B6ZA 4UAGA 1NPDA 2DBQA 3RD5A 1H9BA 4XD2A 1JW9B 2Q4BA 3A14A 3DBHA 3W6ZA 4CMAA 1HSOA 2NU7A 1PWXA 5DF1A 2PZKA 2YYYA 1DC5A 2UDPA 2YZ7A 3EDMA 3KSZO 2VZ9A 4TQGA 3X2EA 3ZU5A 4E4YA 3BMQA 2OUIA 3RBZA 4CLXA 3C1OA 2B4RO 1IZ0A 1I24A 2E49A 5JCJA 5KJEA 1U7HA 1O9BA 5TNXA 1A27A 2FPGA 4CMHA 3PXXA 4D46A 5KJ1A 1C14A 5BQFA 2DT5A 3OP4A 2GZ1A 2J3IA 4TRJA 3WX0A 4AJPA 2VRCD 3OA0A 5A04A 2ET6A 2GN6A 3Q2IA 3PRJA 3VZSA 2EGHA 2HJSA 3R0IA 2I6TA 2AE1A 2OBYA 1DB3A 3PQEA 2Q2QA 3RUFA 2IXBA 1KY5A 3IQDB 4IS2A 3VPFA 1HF3A 3PJFA 4KZPA 3DHEA 2Q45A 2HRBA 3D5TA 1F8FA 3WOHA 4WCFC 3EMKA 5G0WA 4P8RA 2C2YA 3ONFA 3PI7A 4L73A 1EDOA 4DBVO 3U4DA 5JC1A 1K5HA 3VTFA 5IZ4A 5DP1A 1N1EA 3BXXA 3D4OA 4J4HA 1P1JA 4J16A 1LC0A 3DAGA 3IUSA 3ULKA 3WIDA 1I10A 5FWNA 3O8QA 2NQ8A 1H6BA 3L07A 3VKUA 2BFAA 4AJJA 1GEEA 4FR5A 1B16A 3I9KA 1D7OA 5U1PA 2C82A 1N2SA 3C7AA 4PZDA 5IN5A 4E5NA 4J1TA 5U9CA 9LDBA 2I65A 4UUMA 4PZCA 3BTSA 3QA9A 1NPYA 2GSDA 5DN9A 3JQ7B 5TC4A 1EFKA 5JDIC 3AY7A 3K30A 1HDXA 2IZZA 1TT5B 2JD0A 4OSPA 2AG8A 3ZWCA 4K6CA 1E6UA 3BZUA 3GAZA 4Q39A 4DC1A 1HWYA 3QWHA 1HYGA 5JDCA 3TPCA 3VVBA 2ZQYA 3HHPA 4KQWA 1QR6A 3E18A 2YV1A 1GY8A 1H2HA 5L40A 1YQDA 5CG2A 4LRSB 4NK4A 2OBNA 2O3JA 3ZW8A 4YB8A 4CMGA 2UVDA 4EITA 1SNYA 3QE3A 4EUEA 1Z45A 2HKIA 1ZJZA 3WJ7A 3KYCB 5JFOA 1H0KA 2J8ZA 3D4NA 3DAFA 1DC4A 4WASA 4H3VA 3NYWA 2ZJ0A 1IPEA 1G1AA 1N9GB 3FNGA 4BOYA 3GA0A 2X0IA 2I66A 3CZMA 2Y93A 4DIBA 4DGSA 3HFGA 5KVCA 4RZIA 1CERA 4KOAA 3KHUA 3B1JA 4HXYA 4ZQBA 3TRIA 3OIGA 2WD7B 1YO6A 3GHHA 3QVWA 4CMBA 2OP1A 3RFXA 3OEWA 5DOVA 3TL2A 3IJPA 1DIAA 3E8XA 4PN3A 5K6AA 1IYZA 2NTVA 4RDHA 4Z0PA 5ITWA 2EERA 2CMDA 4GAEA 4CODB 4NBRA 1JU9A 5IFLA 4JLWA 3K5PA 4KWHA 4R41A 2C5AA 2OXIA 4WLVA 2VHYA 4J4BA 3C3XA 3N58A 1JKJA 4BB5A 4J3FA 1J4AA 2DPGA 1JAYA 2A94A 2PZMA 3QVSA 4IS3A 3RROA 3WWYA 2F1KA 2W8ZA 1R12A 4FS3A 1YJ8A 1D8AA 3IP1A 3W8DA 1EK6A 4JBIA 4Z0TA 4LCJA 4BKOA 1GL3A 3ANNA 4YAJA 3FN4A 4HBGA 3O9ZA 4EW6A 1X1TA 1H5QA 3DEYX 4UVGA 1VKOA 4TVOA 3A9WA 3MTGA 3I9OA 3WXBA 4YRDA 3ZCXA 1ZIDA 4EDFA 4I9NA 4CV0A 1R66A 1NHWA 2FHSA 5CDGA 3LT4A 4BNXA 1ULUA 4ND5A 4YPOA 4J91A 3ENKA 1V9LA 4CUZA 4CM6A 2Q2WA 1TT7A 3IIEA 2X1HA 1T1SA 3GNTA 1VI2A 1R16A 3QJ5A 4IQ0A 3AU8A 1L1FA 4KDEA 3V8BA 3ZWYA 4JX8A 2DFVA 1LEHA 4IQ8A 5KKAA 2X58A 3K6JA 4ZD6A 2JCYA 1AHIA 1HE2A 1BWSA 3U62A 4DPKA 4NJMA 3KM0A 4K9DA 3EYWA 1H9AA 4YQYA 4NI5A 4RDIA 1ZCJA 3TL3A 3Q1LA 1MC4A 3GOHA 3RKUA 2X0JA 2QHXA 4DTIA 1R4MA 3SJUA 4BS9A 4OKIA 4XYLA 1KC3A 1SAYA 3GAFA 1PJ2A 1PQPA 2IXAA 3VZPA 1Z74A 3GRPA 3O38A 3T7EA 3VKVA 4FB5A 1IL0A 2O23A 2CVQA 2WWRA 2VT3A 3WWZA 5H82A 5F21A 4R01A 4NG5A 2R00C 3ZH2A 1GQYA 3TZHA 1CYDA 2IEBA 5BT9A 5K9ZA 3PHJA 4D79A 2EF1A 4CMCA 1EMDA 1P1RA 2NUAA 3ZI0A 4CM3A 1PJBA 4Y9DA 2Z1NA 2E4AA 3F4LA 1DRUA 3S55A 2X5KO 2O50A 1IUKA 4XWYA 2A9FA 2VNSA 1H2BA 4HFMA 4EJ0A 2ZCVA 2YHUA 3DBLA 3MWEB 3WQSB 4XRRA 3K73O 2CUKA 2GO1A 2RH8A 4XGNA 5AOVA 1H94A 3H5RA 2FRDA 5KJCA 2GZ2A 1T2DA 4FJ2A 2AA3A 3D3EA 4JCOA 1Q7CA 4CR7A 4YR9A 1LDBA 1OFGA 3D3WA 4FFRA 1IHXA 1HKUA 3PQFA 2FPPA 2QG4A 5CDYA 3VDRA 1YDWA 4B7XA 3C7DB 3JQ9C 3DWFA 3ORFA 3OMLA 1YONA 3WNVA 4YTEA 1N5DA 1UP6A 1I2CA 4DRYA 1DC3A 4DL9A 3DZJA 2EGGA 1GUYA 2ILTA 2O3QA 4Y6PA 4XQ9A 5MGBA 5TIIA 1M67A 1B8UA 3JQCA 1AXGA 3D3WB 2NACA 1B26A 4E21A 1I5RA 1B3RA 1BDMA 1H6DA 2CSUA 5T67A 4BUCA 3RU7A 2QRJA 1YQGA 3UFXA 4AJEA 4CM1A 4PG5A 4B7UA 4NFYA 4BO4A 1ZK1A 4PRLA 4DQVA 2HAEA 5A9RA 1CRWG 4YT5A 3P2OA 4RVSA 3EVNA 3L6EA 1KY4A 2G82A 5L9AA 2PTGA 2EV9A 1V3TA 4E2XA 5CHEA 3I83A 1LU9A 5CPBA 2EHDA 4DLAA 1NFFA 3HN7A 3B70A 3PZRA 2O7QA 3F5QA 3PDJA 3HDQA 5IN4A 1J5PA 4MVJI 5KVQA 1XWFA 2HO5A 3BMQB 3ASVA 4Z3DA 3WQQA 2DVMA 1WLYA 1PJTA 3ITDA 3QWIA 3PJEA 4A0SA 2RBEA 3P5SA 1GQQA 1YH3A 1DC6A 3AM4A 3FPLA 4WCFA 4D41A 3LDHA 4ALLA 4BQPA 4OL9A 2HJRA 1J6UA 2JD1A 3DBLB 3U49A 2VHWA 3R6DA 2BLLA 1E6WA 2BRUA 1PJ3A 1S6YA 4YQZA 5EIOA 3F46A 1DIHA 4HADA 3BA1A 3JD3A 3V2UA 1JLLA 4BNMA 2O3SA 2CD9A 3PGXA 1EZ4A 3OEYA 4CV1A 2J5QA 2PGJA 4NDNE 4PLHA 4YACA 3NDJA 1UP4A 5A4DA 2X4GA 3FBTA 3MJSA 4N7RA 4ZQGA 4JBGA 1I3MA 1OOEA 2BFOA 2V6FA 5EMHA 4EZBA 2HK9A 3Q11A 3MEQA 4MP6A 4A73A 4BGEA 4YRAA 3WSWA 2D0IA 1BW9B 4TRMA 3WGIA 3NTRA 2HK7A 3GLQA 4IDAA 4MVJP 1JVBA 2V6BA 5F5LA 1MA0A 3PPIA 4NQZA 3IMFA 2W98A 4R9RA 4RLSA 2Y99A 1RM4A 5THQA 1AGNA 4TMFA 3ZNNA 1I3NA 1L7DA 2DBVO 2J3KA 2WMDA 3MJ4A 2O3UA 4ALMA 3NDRA 1UDBA 3AFMA 4GX1A 3VPXA 1HETA 5B4UA 2JAPA 2HMSA 3HNPA 4TZTA 4BNIA 8ADHA 1U5AA 2C0CA 3F1KA 4H15A 4MDHA 3FNFA 3IJRA 3M1LA 2AG5A 3BMNB 3FI9A 3TFOA 3BIOA 4XEHA 4OOEA 4UVHA 3PDUA 1ZEMA 1QG6A 4JP2A 4YJDA 1HE5A 2GPTA 1BRMA 4W7IA 4LMRA 1MFPA 4GWGA 1IOLA 3AM3A 2J6IA 4E5PA 1UUFA 3WLFA 4S3MA 1QXSA 3KV3O 3EY4A 3KYDB 1LDMA 3AK4A 3ZWVA 4L8VA 4LW8A 4E32A 4C4OA 3D5QA 3PWSA 1KS9A 4OH1A 2X6TA 2R6JA 3C8MA 3TNLA 2VUSA 4OOFA 1QYXA 1V0JA 2W4QA 5G4KB 1LBEA 4CV2A 4JNKA 3S2GA 4MVJD 2QZ9A 3SJ7A 2WD7A 5ENVA 3AOGA 3BTUA 4O5OA 1VJ0A 1VPDA 2VWHA 1IY8A 3KYDA 5L4SA 3BMOB 1UR5A 3EZYA 3V2GA 3HDYA 5A02A 3W6UA 1JWAB 2DTEA 1ADFA 3V5NA 3DFUA 4R69A 1YBMA 1Y8QB 4J2OA 3X2FA 3Q3CA 3WR5A 1BG6A 1KEWA 1NM5A 3E6AA 3ADOA 1Q0LA 1NBOA 3ANMA 3G1TA 4NFHA 5JLAA 3SVTA 4LGVA 2CF6A 3AWDA 3ZN2A 3HB5X 3JQAB 2X8LA 5I9MA 4GWKA 5B4VA 4IZIA 3JYPA 3VAZA 4AL4A 4IQGA 4R9SA 3WGHA 3PTZA 2WSBA 5KVVA 1UAYA 3CMCO 5T8KC 2HQ1A 1ADBA 2EP7A 3OH8A 3ZWNA 4NJOA 1TXGA 4P4GA 3EGOA 1EE2A 3WYCA 1E3EA 3DBVO 4OXYA 1IULA 4I5GA 4TKMA 1YL6A 5LCXA 3WDSA 4DWVA 4NFSA 2WTBA 2HMWA 1O5IA 4WLNA 3ZU2A 2DUUA 3DXFA 4F45A 4ZICA 3WGOA 2VTEA 3RFVA 2JAHA 3GGPA 1LXCA 4DBZA 4BMNA 1A7AA 3DBHB 5JY6A 3RJ9A 3ZWPA 5U4QA 4NR0A 3K8ZA 3LSYA 1VRWA 3QIVA 3CE6A 2JCVA 3Q9NA 4KTVE 2EKPA 3JQAD 2NADA 3R3SA 1T2AA 3B20A 5IJZA 4UVDA 1Y7TA 1G0OA 3FF4A 4M54A 4LSWA 5ADHA 3RIHA 2VYVA 4WKGA 1E6EA 1WZIA 1R6DA 3JQ9A 5KJFA 5TF4A 1P77A 1JWBB 2I5PO 3TSCA 2D1YA 4F6LA 1U2GA 4XYEA 3P2YA 1DFIA 4XX0A 1ZO8A 3F3SA 2GF2A 5JPIA 5JBIA 3LYLA 3DC2A 1M76A 5AQ1A 3CUKA 1T1RA 2ZB8A 3KVOA 3OJFA 3RBXA 4HWKA 3ROQA 3U0BA 1PL6A 3S8MA 4BKUA 3PYLA 3RUDA 1NWCA 3GN2A 4WPGA 2Q50A 1OMOA 7ADHA 4F3YA 1MC5A 2EKQA 1ZSYA 3WICA 1J0XO 3H3FA 4BGVA 4GQAA 4PGFA 1J49A 3ROMA 1O94A 5T8KA 2ZTVA 1N92A 1MG0A 3B1FA 1UZNA 1HDRA 2V65A 1ISFA 5A9SB 2Y66A 3EVTA 4RL6A 4XDYA 2QZZA 3WGZA 3RJ5A 1HZZA 4Z0HO 2VRCA 3LC2O 3PHIA 4DQXA 2RH4A 3WQRA 5DZSA 2VWPA 3GMDA 1E92A 3BHJA 2B0JA 5DBGA 2VWQA 4IPTA 4B4OA 2HU2A 5JCJD 3MJCA 1DAOA 3C1AA 2QQ5A 3E82A 2WE8A 4ZU3A 2GGSA 4ESOA 1BHSA 4L0QA 4MKZA 3AUSA 3Q2KA 3MJEA 4M87A 4FFMA 5KTKA 1C1XB 3PLNA 5TLSA 3FNEA 4OYRA 1PS8A 1FJHA 1E3LA 4ZQEA 3JQGB 2BH9A 3WJAA 4WLOA 4BNYA 1FDWA 1PQUA 4QO8A 1FDTA 1GV1A 1MFZA 1QLHA 3GRKA 3CTMA 4A27A 5CEFA 1BVRA 3DDNA 2I3AA 1Y9AA 3G79A 4EJMA 2B83A 2NV6A 1ISHA 3GDFA 1NQOA 3QWBA 4DMLA 4RO0A 2D5AA 3MWDB 1ENZA 2Q49A 4EJ6A 1FMCA 1I33A 3A06A 4E2WA 1HT0A 5FF9A 4XQGA 3PHLA 4CLDA 4ZQHA 5B37A 4HP8A 2BI7A 2J3HA 2UAGA 5CG1A 2GZ3A 5L45A 1JN0A 1A9ZA 1Z75A 1SB9A 4E30A 4AJIA 4UVEA 4C7JA 2B4QA 3DHNA 4R51A 3RSHA 2I76A 1I36A 3GVHA 5ER6A 3KUXA 3ZU3A 5G0UA 1G0NA 3GR6A 2EKLA 1QV7A 2Z1MA 1CEQA 3JQFC 4UEKA 2EJWA 1RYDA 5HWSA 2GERA 3H7AA 2I9PA 1Q1NA 1ZK3A 1P3DA 4PLCA 3GMSA 3QRWA 4IJKA 4PLPA 1U7TA 3WGTA 5A5EA 1PIWA 4OSOA 2Q46A 1WVGA 1LJ8A 1F14A 2A35A 4D42A 4DQUA 3I6QA 3M2PA 3RI3A 4YWJA 3ICCA 4FIZA 5JE8A 1LSOA 4MIYA 4AJ1A 2C5EA 2E37A 4DC0A 1LSSA 4CMJA 2Q1SA 4PG8A 2G0TA 3JSAA 4WLEA 2DFDA 1UDAA 4R5MA 2PD3A 1CQIA 3NT2A 1RWBA 1KVUA 5G4LA 3QWFA 2IDZA 1ISJA 3H5NA 3NTOA 4RPKA 3SC4A 4YT2A 3GDGA 1SB8A 4MPDA 3ANLA 3Q9UA 3O26A 4B8WA 3KLMX 5GMOA 4IIVA 4PVDA 1GPDG 1HDZA 3F4BA 3OETA 2YDYA 3ROPA 4S1VA 1XYGA 5IAAA 1EBUA 1GZ6A 3DZHA 3L9XA 4J7UA 2ZJ1A 1BXKA 4DREA 2FR8A 3GVXA 3F47A 3FTNA 1NNUA 4E6PA 1UZLA 1AXEA 4JGBA 5ILGA 1WW8A 4I5FA 4TSKA 3EW7A 1CDOA 4ALKA 2JHGA 1HSZA 5JS6A 1NHGA 4PLVA 4GX2A 5H81A 1XEAA 2VOEA 1Y8RB 4BNTA 3H3JA 2XAAA 2Z95A 2J5KA 5GZ3A 4BO8A 4ONEA 2RHRA 3EC7A 4NPCA 4U6QA 4PLYA 1E1NA 4H7PA 2EXXA 1Q0QA 2H6EA 4BO2A 3LLVA 4L75A 3RUIA 3DAPA 1ORRA 1P1IA 1ZSNA 2CF5A 3PWKA 2PWZA 3GPDG 5L4LA 4OJNA 4PLZA 3RUCA 4AJKA 1N7GA 4XYMA 4CJXA 3JD4A 2ZB3A 1SC6A 4Z9YA 2IEDA 4W4TA 1W73A 3AY3A 1MXHA 3ASUA 1ISIA 2NM0A 3PFFA 1C1DA 1XA0A 1B8PA 1WDMA 1TEHA 1UXKA 2PFGA 4D3DA 1OAAA 3MCVA 3QSGA 1JA9A 5AXAA 1TT5A 4Z3KA 1GYRA 4MKXA 3LK7A 4E2YA 1O6ZA 3IKVA 4OXKA 5KCZA 3D7LA 3OA2A 1OC2A 3GPIA 1XR3A 4YAKA 3UAGA 3WG9A 4PLWA 1DO8A 1I8TA 3I52A 3L4BC 1O95A 1VSVA 4WEOA 3EK2A 4LMPA 2OP0A 3WMXA 1KC1A 2DPHA 4H16A 1PS0A 4CM5A 4NNJA 3OIFA 3H9QA 1YB5A 3AI1A 3ETDA 3ONDA 4D45A 4OMUA 3PZBA 3GT0A 4NBVA 4IDCA 1U4SA 2P4HX 3GHYA 1P74A 3DZGA 3AOEA 2DM6A 2NU9A 3T4EA 3CH6A 3NRCA 3JV7A 4G81A 3ZWOA 1ZUD1 3KOUA 4BIIA 4J43A 5GZ1A 1VLLA 1X0XA 3HDJA 1JQBA 2QYTA 1D3AA 3OM9A 4RF3A 3WGQA 2FMUA 1JAXA 2W2KA 4RVFA 3RC7A 1LA2A 1K3TA 1ZBQA 2PKQO 3VHRA 3BAZA 3LT2A 3FSRA 3NTQA 4TZKA 1IPFA 1SMKA 3OSUA 4TRRA 1NXQA 1XU9A 1LNQA 4DLLA 3H2SA 3I9MA 5DCUA 3RUHA 4II3A 1E5QA 4CM9A 4WUVA 1UXGA 2B35A 2GYYA 3PJDA 3HSKA 1GQ2A 3BHMA 3CKYA 5COBA 4GSKA 1U9JA 3AW9A 2UYYA 3BMOA 2YY7A 4U6SA 2O4CA 3GFBA 1BVUA 2NVBA 2ZYGA 3F1LA 1Y8QA 3JD0A 4WOKA 4WGGA 3HFSA 3K96A 2AQIA 2VYND 5CDUA 3GQVA 5AXBA 3ROKA 2PV7A 4AJLA 3KRTA 4FOOA 4Q9NA 4YBZA 1BDBA 1MP0A 3GC6A 3GGGA 3KTDA 1LLQA 4DXHA 2P5UA 5A3JA 1ZEJA 2O48X 4PG7A 2A92A 1ISGA 3OJLA 3TZQA 2J5RA 3DOCA 1KEVA 4G5HA 3WFIA 1XCBA 5AYVA 3B1KA 4X54A 1IE3A 4M8SA 5I8WA 2UUOA 1IB6A 3GUCA 4RGBA 4AJ4A 1KBZA 3OJEA 3HWRA 4J6FA 1E3WB 5C7LO 1ONOA 3MJVA 4LCEA 1PGPA 1U4OA 2GN4A 3MZ0A 4GKVA 4XKJA 2Y0DA 1ZK0A 4OKNA 1P33A 5EESA 1NFQA 3QVXA 5B4TA 2ZYDA 1HLDA 3AFNA 4AFNA 4RVHA 5IF3A 1EEHA 1P31A 4L4RA 4WK6A 4PCVA 5JAQA 4CQMB 1I3LA 4F46A 4P38A 2X9NA 4BNZA 1ZH8A 1M2WA 1QV6A 5JXWA 1DLJA 2HDHA 4WJZA 4HX5A 4YJHB 3OQ6A 2YFQA 4M49A 2NQTA 1EFLA 1CF2O 1GZ3A 2CZCA 4FOSA 2W2KB 4ND4A 2FP4A 4DLBA 2G17A 5F1KA 5L3ZA 3ZNPA 1YB1A 1EQ2A 1DJNA 4B4WA 2IZ1A 3VPGA 5BNIA 4IDGA 1X15A 1XQ1A 1KVQA 2JCXA 3C1TA 1K89A 5IDWA 4N5MA 5DNAA 2OHXA 3JQFA 1FDUA 4PLTA 1P1HA 5BSEA 4RVDA 1ULSA 1W8DA 3JQGA 2YHIA 3I9LA 5A06A 4W99A 4YXFA 1PWZA 3ENNA 4Z9FA 5FI3A 1F06A 3RQSA 3ZV5A 4P4NA 2FN7A 3HZZA 4U0JA 4B3JA 3JD1A 3IP3A 4ZVVA 5L7WA 5A05A 1P0CA 1Y9EA 3GNSA 3SEFA 4MP8A 4XR9A 4RJTA 1X1EA 1LQUA 5LC1A 3QWAA 4O0LA 2EG9A 5JYDA 2SCUA 1HE4A 1MV8A 2X0NA 4YJFA 3AY6A 1F0YA 4XGIA 5EINA 5TRTA 1W0CA 2O2YA 3ETEA 4U8GA 3UH1A 4BO6A 3MOIA 2E6UX 5BSHA 1DXYA 4QSMA 2E48A 2WYVA 1DIBA 2FR1A 3I4CA 4FJ1A 2WYUA 5IZCC 3WGYA 2V6MA 1P1FA 4QTZA 5IDXA 2OOSA 1DLIA 2DC1A 3OQBA 1GUZA 1GCOA 5CFZA 1HL3A 2AQHA 5JDIA 3F6YA 2AEJA 2QYSA 3CIFA 1HDYA 3GUYA 1I30A 4GLLA 4PVCA 4DPLA 5KOIA 2B4TO 4BV9A 2D4AA 3D64A 3A28A 1JTVA 4QX6A 1UJMA 2CNBA 3E9MA 4IGFA 2ZATA 2LDBA 1H6AA 3RC2A 4NH4A 4LVCA 4NHEA 1U2DA 3C85A 5CDTA 1ZMOA 3DMTC 4GL4A 2C07A 2OL4A 3GFGA 4NZ9A 3IC5A 3HQ4O 1XDWA 4EI2A 4J4TA 4KTTE 1F8GA 4IINA 1ADCA 1DFGA 1QYCA 5T5QA 4CM8B 5AXCA 4CM4A 1Z6ZA 4LN1A 3I5MA 5GZ6A 5TJHA 3L0DA 4J9UE 2AXQA 5A9TA 5LDGA 1BXGA 3AUTA 3ZNOA 2PZLA 4WEQA 3PYMA 5CAEA 2YQ4A 1XU7A 4RPHA 3SLGA 4U7WA 3ZDFA 4DIOA 1QORA 4OO3A 4NU6A 3DBRB 4BKPA 5KIAA 3G0OA 5JC8A 5L7TA 1T25A 4OM8A 3MTJA 1KEPA 5ER9A 3KB6A 5DBFA 4L4XA 1DEHA 1VC2A 2YJZA 4CMKA 2HRZA 2H63A 3DB2A 2G76A 4NBUA 1SBYA 4FDAA 4EEXA 1PGOA 3DTYA 4AICA 4MVJH 2EW8A 1BXGB 2GASA 3U9LA 4FW8A 3KETA 5L4NA 1RM5A 2WJPA 3LC1O 4M55A 1Q7BA 4E2ZA 1SEVA 4XZ3A 3NEPX 1FK8A 1WZEA 3OECA 3WYBA 4CLHA 5MDHA 1RJWA 1N7HA 4BL5A 5A03A 2JD2A 2VYNA 5BSGA 4D3SA 3INRA 3WIEA 1B2LA 2Y05A 4WNIA 4RF4A 2ZQZA 1GZ4A 4DYVA 2C59A 3VZRA 4Y6SA 1KERA 1V3UA 1ONPA 1XIVA 2P9EA 2Y67A 3C24A 3LVFO 4NK5A 2JFGA 2C54A 1EDZA 1YBAA 2OFPA 2Y1DA 1O0SA 4LISA 1OBFO 1PL7A 2Q1UA 4AG3A 1NAIA 1AN9A 3IOYA 4BO3A 3FRJA 4XQEA 3ZZNA 3Q6IA 1CETA 1DAPA 5HS6A 2IZ0A 3K92A 5A9SA 2EWMA 1P44A 2NSDA 5JSFA 1ONNA 1HDOA 1R4NB 4FFPA 4PG6A 4BNFA 3JYLA 3RBVA 4IUYA 3VTZA 3JYNA 4QO7A 5A3VA 3ZV3A 5AVOA 3JQBC 3K31A 4GX0A 4P4LA 4FC7A 1LDGA 1U5CA 2CDBA 1MUUA 3EHEA 3PLRA 1E3IA 4RQTA 1XGKA 1KVTA 4E12A 5TGDA 2HMTA 3QV1A 3ZWWA 4QFDA 5L7YA 3RVDA 4BO0A 1NTOA 4MVJM 3UKOA 5DCYA 5JW6A 2AQ8A 3JYOA 2G1UA 3I4FA 5J23A 4BNNA 4ZQFA 1E77A 1YQXA 4JROA 1XSEA 4P22A 4U0KA 4XRGA 2CVOA 1XKQA 4CMIA 4CLRA 3QVTA 3KSUA 1QMGA 2VWGA 2BD0A 1KYQA 1ZXBA 1YL7A 3FR8A 3NGXA 5JMPA 3UVEA 1RKXA 3S2EA 4CM9D 2PH5A 4MVJF 3AUUA 2XF8A 3FWNA 3FNHA 4WECA 1SPXA 1EUCA 2BKAA 1VM6A 2DQ4A 2FPIA 1T2CA 3GG9A 3O8QB 4B3HA 2D8AA 4WLUA 4CLRB 4J7CA 3W8EA 5IG2A 1HZJA 3VVCA 4I5DA 3SLKA 4EBFA 2DU8A 1KVRA 4BKRA 1RPNA 4Q3DA 4E5MA 4OQZA 5JAZA 1WMBA 4XIJA 3V1TC 2AEMA 4CMEA 3I23A 2VN8A 1BGVA 1U28A 4CUKA 1M6WA 3MOGA 4KUGA 3SBOA 4FGSA 4DPMA 4GSLA 5JAMA 3RWBA 1R15A 3H9UA 5DBIA 5G2OA 4YT4A 4ZRNA 3GZNA 3G1UA 4NJMB 1K0UA 4OGWA 1GCUA 5EN4A 4B8ZA 1WAMA 1UAGA 2VRBA 3LQFA 5TJ9A 3NT5A 1ZVMA 1ZXLA 1R4MB 4UVIA 4I1IA 5T57A 1V8BA 5L53A 1OI7A 1WDKA 4XJSA 4KWIA 4PG4A 1KEUA 1C0IA 3QY9A 4YVFA 5EERA 4URFA 1DFHA 3H2ZA 3L6OO 3UW3A 1LDYA 4QXMA 4B7CA 2PR2A 3M2TA 3JQDA 3VC7A 5BNTA 5I9LA 1YWGO 4TRNA 4BO9A 2X22A 2FSVA 3GEGA 1NYTA 1WWKA 3H5AA 4N18A 4YCAA 3RC9A 4E31A 3D1LA 1PQWA 3TOZA 4D3FA 3N74A 4ND2A 1NAHA 3NX4A 4XB2A 4ID9A 4IDEA 1GDHA 4RVGA 1QYDA 2FY8A 2VOJA 4YEDA 2VUUA 1LDEA 1PS9A 4BO7A 1C0PA 4CQMA 1E1LA 4L76A 4R3NA 2ZYAA 3DONA 4I8XA 4R16A 3HN2A 2P91A 4KMSA 1HLPA 2VHVA 2YQ5A 2ZTLA 1PJQA 5IXYA 4K1LA 3R1IA 3BYZA 2EJVA 4BGUA 4YT8A 1P0FA 2F00A 4ALJA 2R2GA 2XXJA 2ZCUA 4Q3NA 5FFFA 4FFNA 1N1GA 3AUAA 1GYQA 5JAIA 4MVJG 3NUGA 3UF0A 4BNLA 1RM3A 1XELA 2Q2VA 3BHIA 2E82A 1WP4A 1CQJA 3IL2A 2UUPA 1P9LA 4E3ZA 1T4DA 1TLTA 2BFMA 5IDYA 5JMWA 5KVSA 2YV2A 4XCVA 3QVOA 3JQAA 2NU6A 1KVSA 4MOWA 5G4KA 1FXSA 3NGLA 4CL8A 4RLHA 2FWMX 3LC7O 1ZMTA 1LTHR 2EP5A 5TQVA 2GLXA 3GZNB 3UCEA 4J0FA 4YJGA 1VJTA 4TKLA 2I3GA 4RPGA 1LLCA 4J49A 1HE3A 4JJFA 4UUPA 4RF2A 2VTDA 3AM5A 2Q4EA 3E48A 4JK3A 3RUEA 5EQDA 5F1PA 4ALNA 3LT1A 4PZEA 4YYZA 1DJQA 1Y5MA 5ICSA 3OJOA 2VCYA 2WD8A 1YBVA 5CEJA 3PJGA 1FDSA 2R00A 2GDZA 3RAJA 3WTBA 1YOVB 5BR7A 1LRLA 4EEZA 4A5OA 4RF5A 3ZW9A 4MKRA 4J7XA 2Q1TA 2B69A 2DUWA 2AQKA 2X7HA 1KIFA 2ZTMA 1VL6A 3G49A 4D43A 4DMMA 4QT0A 4U5QA 1E7YA 1HYHA 1B15A 2PK3A 1A5ZA 2OO5A 2DTDA 3H9EO 3PQDA 3BMCA 3WLEA 3JQ8A 1V35A 1EBFA 1PU2A 3KXDA 2QRLA 1ML3A 5CP8A 4IDBA 1SEPA 3FR7A 4IXWA 2FR0A 2FSSA 3V2HA 4EUHA 4I5EA 1Y8RA 4LVUA 5TSDA 3I9JA 5ENDA 4BVAA 3U09A 2BELA 1B8VA 5DT9A 2AHRA 4OIMA 1AE1A 1R37A 4A2CA 1EVZA 3UCFA 3RUAA 4WE3A 4B4VA 2B36A 1GAEO 4HUJA 1NVTA 2TMDA 3DL2A 4WCFB 4CR6A 3OJ0A 1LQTA 1A4UA 4RZHA 1YS4A 5K0ZA 3G3EA 3FHLA 4R1TA 5JYEA 1PZEA 1PGNA 5IDQA 1YGYA 4R5HA 4Z9XA 4K28A 5I7FA 1CWUA 2X86A 4BNKA 3JCZA 1GPJA 1LX6A 1M66A 4UEJA 3VZQA 2PZJA 1X7GA 4TROA 2NVWA 2I99A 1ZW1A 1NWHA 2QIOA 2X9GA 4INAA 4WOJA 5G0TA 5L51A 4FPXA 3RU9A 2AW5A 3K2BA 4M1QA 4BMVA 4N5LA 1E3WA 3ZWBA 3STHA 2Y1EA 4FFLA 4ROSA 1B7GO 2Y1FA 3ZU4A 5JCXA 3M1AA 1O8CA 1UXJA 1GUFA 4DIFA 4LSMA 1C0KA 3CMMA 5B12A 4GLOA 5EJ2A 3ZHYA 2POQX 1R4NA 2AMFA 2PLAA 1PGQA 1ENOA 3NJ4A 4W82A 4E33A 1K2WA 5B1YA 4O63O 4J0EA 4NBWA 3A1NA 2HSDA 4CQLB 4XDZA 3IAHA 4R1NA 1C1XA 2YUTA 1PZGA 6LDHA 3HB4X 1TI7A 4RCVA 3I1JA 1T4BA 2VZ0A 2UV8A 4IXTA 1C0LA 5JO0A 5HRUA 1T26A 4HFNA 1DPGA 3FD8A 4GBJA 4N54A 3WTCA 3TOXA 1CJCA 2BGLA 3PEFA 3KO8A 5TS3A 2BF7A 4DVJA 1P1KA 3HG7A 5TT1A 4EYEA 1GD1O 1NVGA 2RHCA 4Y8VA 4GH5A 1E3JA 4FCCA 1OC4A 1Z7EA 4PLGA 1I32A 4N5NA 4IBOA 3TFQA 5HTOA 1NX6A 2VHXA 1CIVA 3GY0A 4OAQA 1PJLA 1QKIA 2AE2A 4KUEA 4JJIA 4ITUA 3UUWA 3GDOA 3TN7A 4Q3BA 5I8ZA 3ONEA 4GVLA 4JP3A 2PD4A 3COSA 4PIVA 3ZV6A 2ZIZA 3QW2A 5IZCA 4XQCA 1KETA 3DQPA 2C20A 3PYXA 1TVEA 3GK3A 3JQEA 4Y98A 4ZHSA 4Y67A 4HNHA 1ID1A 3DR3A 2NU8A 1DRVA 3R3JA 3GEDA 4J9VA 3I3OA 1JVSA 3DOOA 3LF1A 4CV3A 4B3IA 1XG5A 3E9QA 5FI5A 1E7WA 3INGA 4O59O 3CZRA 5G0SA 4IJUA 3U4CA 4BNUA 1E5LA 7MDHA 1EK5A 4WLFA 2DAPA 4RVUA 2H5LA 2DBRA 2EW2A 3RCBA 3W8FA 4J1NA 1W4ZA 2P68A 4YA6A 1E1KA 2Y0EA 1ZFNA 2HCTA 5TT0A 1NASA 3TJRA 9LDTA 1T24A 3NDIA 4YDRA 1PJ4A 3L9WA 3PP8A 2NVUA 5KWEA 4Q3EA 1PZFA 5CPFA 1XHLA 3OQ1A 3GH3A 4QUKA 1X14A 2Y1CA 2P4QA 3UCXA 5FYDA 3I6IA 5LDHA 2GUGA 2OORA 3UGKA 2W90A 4YRBA 4HNGA 3SX2A 1A72A 1MGOA 3KYBA 3NT4A 4HFRA 4KP7A 4RV9A 2W2LA 3BMNA 2BGKA 4FN4A 2PNFA 3HE3A 4B4UA 1T2FA 1HXHA 3O03A 1HYEA 3S1LA 1HRDA 3E5RA 4BNJA 4CPDA 4D44A 1RYEA 4JJGA 1PTJA 4XYBA 1M6HA 2CFCA 4BMSA 2XXBA 3VPHA 1SOWA 2VZ8A 3QQPA 3H9GA 4YAIA 3DO5A 1W6UA 1Q7GA 5JY1A 4L9RA 2D5CA 4FBGA 4NBTA 3VPSA 4JXKA 1QLJA 1NQAO 1NPTO 1HDGO 4HV4A 3OICA 3H9JA 4FQ8A 1MB4A 4GMGA 4TVBA 3LU1A 1VL8A 3DZBA 3JQ6A 4R54A 1ADGA 3H8VA 3GGOA 4FD3A 1UZMA 1GFSA 5EQFA 5I9NA 1ZK4A 1R0SA 5FEUA 1V3VA 4YJHA 2O4UX 2C2XA 2PD6A 5ITVA 1LLDA 1VE9A 3WSVA 5F3RA 4ZRMA 3AOEC 1Z7BA 2O2SA 1E0DA 4ILKA 4TWRA 3S2FA 4BO5A 2Q3EA 3ITKA 2I67A 1T2EA 1YL5A 2EIHA 3NAQA 5H83A 5DOZA 3KLPX 3A4VA 1DBVO 3JQBA 4YJGB 4BHTA 2XOXA 4C7KA 1ZK2A 2D3TA 4IDDA 2D2IA 4PLFA 3WMWA 1LRKA 2ZK7A 3F5SA 3PWZA 4IMPA 4IZHA 3LLSA 4CL3A 4OQYA 1SO8A 4R1UA 4UEOA 3WS7A 3CXRA 1H93A 4MO2A 3GZ4A 1GU7A 1QYVA 4DA9A 3DZIA 2HK8A 3LZ6A 3JQ7A 2C7GA 2DLDA 2GN9A 1U3TA 2O7SA 2X0RA 4NIMA 2NVUB 3VDQA 4CMEC 4GGPA 2IODA 1YOVA 3ZV4A 1XLTA 1U1IA 2GCGA 2OMEA 1NP3A 5I7VA 2JKVA 5DP2A 3RKRA 2YV3A 4QFCA 1YDEA 1PZHA 2XPCA 3K9QO 5T6BA 4I9HA 1PX0A 3VH3A 3ZHXA 3U4IA 4FJ0A 1PR9A 4M89A 5G0VA 2BFPA 2H9IA 1JKIA 1VKNA 3E1KA 3SC6A 4ZGWA 1LLUA 2FZEA 4GMFA 1LC3A 2P2SA 4UUOA 1E7SA 4E0BA 4UUNA 1E7MA 2OZPA 3BTVA 3QLJA 2ZKLA 1NQ5A 3JQ8B 3Q0EA 3DFZA 1NR7A 4XB1A 3UXYA 2VT2A 3W4IA 4QECA 2JFFA 3ST7A 1MLDA 1A9YA 2RIRA 2Y1OA 2G5CA 4G65A 2DBZA 3SXPA 4D0RA 3W4KA 3PK0A 1WDLA 1FDVA 1GV0A 1Q0HA 3F9IA 1A4IA 4A03A 3ZWXA 5HM8A 2P9GA 1AUPA 1JDJA 3FTPA 3E9NA 3S2IA 3L4BA 2C7VA 4CLEA 2B37A 3JTMA 4K6FA 1GEGA 1VL0A 1Y81A 4GVXA 3ZHZA 1U8FO 3GN1A 4E5YA 2NTNA 3EAGA 3WB9A 8LDHA 5ILOA 1E7RA 4OHUA 3AU9A 3W4JA 4DUPA 1EUZA 3KEOA 3P19A 4MVJA 1DIRA 1HDCA 2X5JO 5KNLA 1A7KA 2ZB4A 3IS3A 3WFJA 4D0SA 3U5TA 1X7DA 1SOVA 1ENPA 4MINA 4PFJA 4RPLA 3GF4A 5T64A 3ABIA 4L74A 4FFOA 1MXFA 3GVIA 3I9NA 1DHRA 1LDNA 1E1MA 4FSHA 4JN6B 1NQTA 3VH1A 4Z6KA 2DTXA 1QRRA 3AI2A 2NTJA 5DDIP 1PGJA 4W6ZA 2V7PA 3K2EA 3KZVA 4AJOA 3RASA 5A5FA 3CSDA 4RQUA 1UXHA 4UULA 5KKCA 5JO9A 1HTBA 1KOLA 2IRWA 1YXMA 3ZHBA 1PR3A 1EUDA 3GVPA 1C3VA 5EPOA 1D4FA 3TF5A 1NVMB 2IE0A 1EVJA 4CLOA 2WDZA 1Q2XA 3ICPA 3EZLA 3PHGA 1GTMA 3L4SO 3UOGA 4IGEA 5HA5A 2VYVD 1E3SA 2PA3A 2WE7A 2YW9A 2P9CA 2IYOA 2Q1WA 4MP3A 1DOHA 5EL0A 3OFSA 4PRKA 1U3VA 1PJCA 1YE3A 3FPCA 2JL1A 1WXDA 4IMRA 2WM3A 3DOJA 1BSVA 2QRKA 3HADA 4NU5A 3KSDO 2GNAA 1PSDA 2V6GA 3BMCB 1YVEI 5BNFA 4CLOB 2BI8A 3ZWAA 3O4RA 1JKFA 1D1SA 1EVIA 1VSUA 3VH2A 4IIUA 3IKTA 1LRJA 1DRWA 1GYPA 4R68A 2NLOA 4ND3A 4XGKA 3TZKA 1BW9A 1X7HA 3E5MA 3WGGA 4FC6A 1EE9A 3GNQA 3QHAA 1PL8A 4IJWA 2WYWA 1Z73A 1TA4A 3RFTA 4J2HA 4KDFA 1LI4A 2VUTA 4LRTB 1I2ZA 2RAFA 2HMVA 1DHTA 1H6CA 1V6AA 2J3JA 4HKTA 4W9NA 3RC1A 4AJNA 3TDKA 1U3UA 2CDCA 2X9VA 3PIDA 1LSJA 4OXNA 1R0KA 2DKNA 3IDSA 4YAGA 5DULA 2OGUA 1YJQA 3UN1A 4D7AA 1YKFA 4KQXA 3FWZA 3H65A 2Q99A 3T4XA 3VH4A 4CMIB 2Z5LA 4BGIA 4R3WA 3DTTA 3CINA 4MIOA 1EVYA 4XIYA 4IM7A 4Y6RA 3H4VA 5JNLA 1N9GA 1U3WA 4BNHA 3WYEA 2WEKA 2FZWA 3INTA 4FGWA 4CR8A 3U3XA 1LUAA 3TZ6A 1C1DB 2X5OA 3UHAA 1Y5RA 4BKQA 4G2NA 1X0VA 3AI3A 4BB6A 4XR4A 1SCUA 2FOIA 5A1TA 4YJFB 5F5NA 5HS4A 4M86A 1I2BA 1NFRA 3CPSA 3WNQA 3ETGA 5IXSA 5C3MA 3DMTA 1WMAA 5DCWA 3PHHA 2W2LD 1F17A 3GVCA 4ZA2A 2YDXA 3T7CA 5ICMA 1GADO 3L6DA 1PEDA 4QQRA 3JD2A 5AXDA 5C5IA 5CDSA 4WNCA 2CY0A 1B3BA 3HJAA 3D0OA 1FF9A 3C7CB 4YAEA 5L95A 4A26A 5BSFA 5C7OO 3M6IA 4IY1A 4CM7A 2C29D 3LF2A 4JIGA 1O89A 2JFHA 1UP7A 1ZZEA 4ALIA 4K26A 4XA8A 2RCYA 2PKRA 3IUPA 4L4SA 1BXZA 4GPD1 1F12A 3DZKA 1I0ZA 3TZCA 1B0AA 4R1SA 2PGDA 2LDXA 1VJ1A 4W9NC 1RM0A 5TX7A 4EGFA 3HDHA 5K6AC 2AEFA 2HLPA 1HEUA 4KUHA 5HBRA 4W7HA 2CDAA 1SZJG 1K6JA 3HUDA 4RORA 2HMUA 1R0LA 1PJSA 2BGMA 4GI2A 2JHFA 2GR9A 1D1TA 4II2A 3WBFA 1QP8A 4BNVA 4J1QA 1IZ9A 1M75A 1I3KA 3AJRA 3H6KA 1ISMA 5C37A 2BMAA 3BTOA 1A71A 4XJTA 3PGJA 2ZB7A 1IHYA 4ZJUA 1WPQA 4GKBA 3E03A 3WBBA 4BV8A 4BNGA 3QP9A 3MJTA 2YFHA 2IYPA 3KEQA 3OBBA 5CEEA 1B14A 1DDOA 4HY3A 4BQRA 3NJ8A 3D4PA 2B5VA 1GR0A 5ES3A 4MIEA 1S7CA 4B79A 4XYGA 1YRLA 4Q3CA 3W1VA 4Q3AA 3OHSX 2VHZA 3NV9A 1AHHA 4IJVA 3KYCA 4CM4B 1Y1PA 5JDCC 4LK3A 5KJ6A 5COQA 2VQ3A 4NMHA 3TWOA 4AJHA 1NR1A 4CQLA 4IDFA 1LSUA 4EUFA 3NKLA 4J1SA 4AVYA 3ADPA 3DZFA 3ZNQA 3DBRA 3L77A 1BTOA 4O6VA 4BNWA 1QYWA 3V1UA 5I7SA 2A4KA 4F6CA 2X23A 1I01A 2QW8A 2Y68A 1DIGA 1Z82A 1G6KA 4CQMD 2JJYA 3OF2A 5C7IO 4R4JA 1ARZA 2HUNA 1Y6JA 1TB4A 4CM8A 2O3RA
chains in the Genus database with same CATH superfamily
4IDPA 2ZGVA 1L5HB 3SHQA 4WN9B 1L5QA 3BEOA 4JYZA 1YB4A 3LTEA 5EC8A 5EKSA 2XTJA 3PIIA 1FNBA 2WJWA 1WIWA 1T0IA 1ZNQO 1YHNA 2XUHA 4L5CA 4AM8A 2O3TA 5GY7A 3ANTA 1JAHA 1HM5A 4EECA 4L51A 4O0MA 1E2MA 1R00A 1GPMA 1XMIA 3IT2A 4QNMA 4I9UA 3CEAA 3C15C 1BOFA 1E1DA 1E7QA 1XD2B 2F67A 6ADHA 4I1PA 4OHVA 3HYLA 3GYBA 1MO6A 1OLOA 2G25A 2WHYA 3MUOA 1EX1A 1VL5A 4MCHA 4TKVB 4ZI7B 3NVDA 1WCXA 2CLEB 3GG2A 2CUNA 4UREA 1DQSA 2ILVA 4ZAVA 2DR0A 3P1JA 4JBHA 1NMXA 3GPCA 3H6GA 5H59A 4M1WA 1ZKMA 4ZN6A 5JYEA 1H3FA 2APJA 2G83A 1E60A 3DFMA 2GN8A 4FQ5A 2YHIB 2EDCA 4Y9UA 2BFDA 2JJ2A 2W2PA 3DDUA 3LQRA 1U8XX 1ZOSA 2GRJA 3SYMA 1BMDA 2HHCA 3DWEX 3LHFA 2VDWA 1WX1A 3FE2A 1UH5A 5K8IA 3IMEA 2CXQA 5DI9A 1RBYA 2ENWA 2OA0A 1U1DA 2QX7A 3O4IA 2G9NA 2XJ9A 3H13A 3P7MA 4EJSA 5TPWB 4QEKA 4Y1RA 1LK0A 3NHRA 3N59A 4RPJA 3X0DA 1HNWB 1ZD2P 3C8ZA 3VOSA 1XXLA 2D7JA 4YHBA 2GRAA 1QGED 4K9MA 3KSMA 4MVJE 2H31A 4EPVA 1NR5A 3FBGA 5BWMA 3JAWB 2DCMA 1KAMA 3SEZA 1ITZA 2YXEA 4X94A 2Q4BA 1TQ2A 2P69A 3G2NA 3QE4A 3PNVA 3W6ZA 1TZJA 1PWXA 2PS0A 2PZKA 4LY3A 4NQRA 4EG7A 2UDPA 2VZ9A 2YZ7A 3X2EA 3ZU5A 3D3KA 3FRHA 4GE0A 5LQNA 1EGVB 1VKZA 2VDLB 3C1UA 2PLRA 3FLMA 3L1IA 2K2WA 4MLPA 4LVNA 1G6HA 4OJMX 5SYMA 1PR5A 1A27A 3W5DA 1XKLA 5KX5B 1LS1A 3AVVA 3QVUA 1C14A 1EFPA 2PMDA 2DT5A 3WX0A 1CVRA 3FVTA 3VOTA 2VRCD 1U3CA 4I55F 2ET6A 1CFZA 1NE2A 4N47A 1JJIA 3OE5A 2HJSA 2FPIB 2I6TA 2JLQA 4KV9A 4F96A 2GBPA 4H77A 4HB2A 4P3OA 2EJCA 3BBPA 2QN1A 4GWLA 4F7DA 1N78A 1H1DA 2DSNA 4ENSA 4KZPA 1WVIA 4HTAA 3U7GA 2B4AA 1C29B 5EMLA 4FEYA 3UOWA 2FPXA 1CY2A 4V02A 2CNOA 3IBTA 4YGYA 3TLKA 5I47A 3SYTA 5HRAA 2XE8A 3OZXA 3WRWA 5JARA 3EMKA 2Z83A 1ZR4A 5CLGA 5KNDA 1NP7A 1VBNA 2IKQA 1JSLA 2ECOA 4U2CA 4QSHA 1CTQA 1NVKA 2IT1A 3UPUA 3BXXA 2X2PA 2X15A 5DYTA 2CKMA 1TQ8A 4AJ9A 2MSCB 2IBSA 3IUSA 3WIDA 4IHAA 2P77A 3VKUA 4C4SA 4H17A 1QP0A 1QH9A 3QNMA 4HZUB 4FR5A 5ALWA 3G0CA 1AF7A 1WD5A 1D7OA 2YWEA 3KZCA 3R6LA 2C82A 5HTKA 2VSOA 3C7AA 2FNAA 2QTZA 5KYKA 1O3YA 2IPNA 3EGWA 1XJWA 2G77B 1A9SA 2GBGA 3NETA 4LC0A 2RB4A 3M3HA 4PZCA 3WGKA 1FMFA 3LYHA 4BFVA 4D9FA 4DMUB 4ZREA 1T6ZA 3QA9A 5E4JA 5F35A 2XT6A 1TCCA 3NVKI 3JQ7B 4ZHQA 5A1JA 3CZ4A 4MX8A 1BX1A 2D2FA 1VP3A 1ZJWA 2IZZA 1BO6A 5EJMA 1E32A 4OSPA 2Y0PA 1D7AA 1W581 1E6UA 3BZUA 1SXJD 5HGXA 2ONZA 3DTNA 2ZIGA 3QWHA 2UU9B 2XNSA 3VVBA 2ZQYA 5BRJA 3HHPA 5HUJA 3CNNA 3GL9A 3D4LA 3RG2A 1N2OA 2KBFA 2YV1A 2BGTA 1GN8A 1GY8A 1H2HA 2M1XA 4MTCA 1MENA 4NCNA 5DM2A 3DNMA 1Q6ZA 3QYAA 4PW0A 4W5QA 4EBBA 5BOVA 3S1AA 1DNPA 2NUTB 1TK9A 2D5LA 2UVDA 3WIVA 4ZKDA 4EUEA 2NU8B 1BHJA 1LI7A 5FA8A 3KYCB 1DE0A 2MJLA 5JFOA 4UPDA 1ZAYA 2J8ZA 1JNXX 3D4NA 4C6HA 5IDVA 1AMNA 1FSFA 4BNHA 2KWIA 1ODSA 1TLFA 3CJQA 4DR4B 2MSWA 3NYWA 4H3VA 3BUSA 1P17A 1EHIA 1NBMD 5CT4A 1Z5NA 1XVTA 1A77A 2DWCA 2H07A 3PFKA 1WXWA 4DIBA 4YIKA 4BRZA 1UJ2A 1YZQA 3ZDYB 5FP0A 5CT5A 4DGSA 2Z56A 4ND8A 4OQ4A 5KVCA 3QUAA 4E2FA 1OD6A 4QUDA 2IYWA 1I94B 1T4GA 4I36A 3NOQA 3OIGA 5CXUA 1TF7A 2ZWOA 1GNQA 3GHHA 5J4YA 5L6MB 3RFXA 3TL2A 4JX9A 3FYUB 3I4LA 4QBTA 2CGEA 2DUNA 5K6AA 4IVNA 4PFQA 4AO6A 4RDHA 3C6MA 4L8GA 4N48A 5ITWA 1E1RA 3JAKA 4HB0A 3SF0A 4CODB 4NBRA 4H4DA 3W3ZB 2AVNA 5IFLA 2P90A 1U0HC 1APBA 2WK1A 1OFUX 1FP1D 1VKHA 1WXGA 1V8FA 1JGTA 1SCDA 3A3NA 4JLWA 4KWHA 2VJYA 4HYTA 4X60A 5AW8A 2CZGA 3LFTA 2O2XA 2C5AA 4R41A 2OXIA 3CA8A 1TF5A 3MS4A 3QI7A 2VHYA 1TQHA 1TAGA 2NZXA 3C3XA 4J4BA 4LI3X 4DIUA 5BSWA 1A0OA 2CUZA 4EFMA 3KQLA 3R7SA 2C7BA 2GAIA 3VGPA 2ZE6A 3T12A 2OCIA 3HCRA 4UUAA 2LE0A 3QVSA 1YZHA 2GJSA 2PR7A 2PLWA 5JISA 1IN4A 1A1VA 1R12A 3OURA 3M82A 4P54A 1NW8A 1YJ8A 1TIBA 3MINA 2RAVA 1EK6A 5AKIA 4BKOA 2YNMC 1EP1B 1M1XB 4PYNA 3FN4A 4YAJA 2PXXA 4OL0A 2R2AA 1V9CA 4YN3A 1X1TA 1HMPA 1EGQA 4B3MB 1WE2A 3GROA 1RWWA 4X63A 3NYIA 5AHKA 1Z4LA 3I9OA 1RIFA 3E9CA 5EXTA 1P9OA 1TX4B 1NHWA 3A32A 4DDVA 4PPQA 3MT8A 4FFVA 4L0CA 3LT4A 3WOVA 1ULUA 4ND5A 4YPOA 4J91A 4GZ3A 1J9EA 2QM7A 2MR5A 4GP9A 4A6EA 3PLAE 1SQ5A 5DKFA 1G64A 1GUBA 1UPTA 4QU8A 3IIEA 4R2XA 5I9IA 5K01A 1UQRA 2GFQA 3BIXA 4C76A 4DDWA 3VPBA 4AECA 4N7BA 1KQFA 2AJBA 1SG6A 3OZAA 1U0GA 3THWA 1FFBA 1C4WA 4IXDA 1LEHA 4IQ8A 5KKAA 2X58A 3UC5A 2X40A 4AK9A 1JQ5A 2OZLA 1SBNE 2FGJA 3ZGOA 1BWSA 2FQXA 4DPKA 2UXDB 1COWA 3EYWA 4K9DA 4LEIA 1J2EA 1GRQA 2Z4SA 1WZNA 2BTQA 3GEPA 1ZCJA 3QVGB 4I9GA 4YQYA 4DCMA 2OCYC 3Q1LA 1KDYA 4G37A 1EGAA 1MC4A 1XEFA 3FVQA 4X1YB 3RKUA 4Y30A 1S4MA 2X0JA 2IW3A 5CFQA 4BQNA 1G98A 2GSWA 3GLRA 3U7QB 4KR3A 5TY0A 5K6RA 2XNCA 1R4AA 2Y0BA 5E7MA 3HJFA 1M2OB 1QFJA 3RVPA 2YJGA 2D1QA 2IXAA 3GAFA 3IUMA 4R31A 1ESMA 2Q5QA 4QOFA 3GAMA 4H1TA 2DJ5A 3FETA 2OAP1 3HKCA 3O38A 5NULA 3VKVA 1MX9A 5LP1A 4FB5A 1IL0A 1YRAA 3RAPR 3SQWA 3A9SA 1SXHA 3MD9A 5H82A 1QGUA 2F17A 3DOHA 4R01A 2W7TA 3E2PA 3ZH2A 1NOKA 3VX3A 3ZXXA 1NBAA 3FYDA 4EFNA 1LF0A 2E21A 1CYDA 1UM9A 3B1XA 5A4AA 2IP1A 1V8DA 2V7VA 3MLBA 1J39A 1IC6A 1CV2A 1JEOA 4FYPA 5J5CA 3PHJA 4D79A 2I9KA 1AKUA 5EY5B 1EMDA 1JHDA 5IAJA 3ECCA 3FTQA 2G08A 3KSAC 2HQOA 2EFJA 2E4AA 3KWLA 1N36B 2E6KA 3F4LA 1IUKA 2YC2C 2HXGA 4U7DA 1QH1A 2FPUA 4B76A 2A9FA 3Q3EA 3ENZA 2ZIUB 4JVOA 4B6EA 2I6GA 3BH0A 4MARA 4ZYXA 1MHTA 4TM7A 3I0ZA 1DCKA 1T29A 2V45A 1UFOA 3DBLA 4ARBA 2AN1A 1XZDA 1U65A 1PV1A 3K73O 1L7QA 1Z2CA 1U7XA 4EY6A 1SKYE 1XRSB 4XGNA 1H94A 1YRQA 4X92A 2B94A 4FT4A 2ZI3A 1T2DA 1R2QA 3V46A 2IIBA 5CUQA 4OB7A 1ZLXA 3GBVA 4Z9BA 4IV0A 4YR9A 5CIYA 1XZFA 1OFGA 3KD3A 4P3YA 1M33A 3MRSA 5J2UF 1KXJA 3FFTA 1QGZA 3GLHE 1KJIA 2F55A 2FPPA 4OHWA 4DLVA 1R8SA 1ZN2A 2MOKA 3AZOA 3I8XA 3LA8A 1AUXA 1YDMA 4B7XA 3HP7A 3N8GA 2BHRA 2ONKA 3DWFA 4G23A 4CEIB 3ETCA 1M1ZA 5BV0A 3J7AC 2B1RA 4YTEA 1N5DA 3R75A 3T5DA 4DRYA 1F2DA 4B71A 2J48A 4JLDA 3H1GA 1GUYA 3LQ1A 1E0KA 3O8CA 4ZMSA 2BMFA 4U7PB 3UTCA 2ZRLA 5MGBA 1MTZA 3H8JA 3NG1A 5KQSA 2P4UA 3E2MA 1EJBA 3PIRA 5JZOA 2NACA 1BD3A 1B26A 4E21A 2LKCA 1FX0B 5AKEA 1B3RA 1ZI9A 3FUUA 3QVLA 1L5NA 4G8BA 4XX1A 5D84A 4AT1A 1EM8B 1WHSA 2P6MA 1GL7A 5EE3A 5ESRA 1G7TA 1M6YA 3BC1A 5G1PA 3UFXA 4AJEA 4CM1A 4BE9A 4UHHA 3M5PA 2PKCA 2MIIA 5FWAA 4Q34A 2C2BA 1XDUA 1PDWA 2FPOA 5A9RA 1FJXA 3EEOA 3OQPA 1T6BY 1CRWG 1QIJA 1YI8A 2FSHA 2RI6A 4EW1A 1U90A 2AYYA 4R9VA 3PNOA 5AW3A 1TVKB 2JKZA 4HPJB 4URHA 3KR9A 3KU4A 7AT1A 2W0MA 2F3QA 1R0CA 2FRXA 4KDRA 4YUVA 5LWQA 1RI1A 5CPBA 4ZT4A 2EHDA 2Q0XA 2XZTA 1NFFA 1Z3CA 3B70A 3HN7A 1GTZA 1O94D 3D8RA 4BJ6A 4FYWA 2H2IA 1Z68A 4YJ3A 1Y9JA 2HO5A 5HGJA 3BMQB 3I8OA 3ASVA 5JCOA 5DYNA 4Z3DA 3E61A 3JPYA 3I9V1 4WKCA 5JG7A 3ITDA 3VTKA 3PJEA 1XTJA 4BB0A 4UCWA 2XLBA 5DGXA 5EZYA 4MWBA 3M0EA 4P7KA 5DLQC 4ER3A 3FSJX 3FPLA 3EPJA 3D8UA 2LV8A 4IO0A 5TPZD 4BQPA 1UPBA 1D4OA 2GEBA 2JD1A 3MWEA 3CF4G 4NC9A 1XALA 4EQZA 3E7FA 2BLLA 5EKXA 4LF9B 2ZJ5A 1JG1A 2BRUA 2WWGA 1PJ3A 1S6YA 1ZQ1A 3KX2A 3OKFA 4TQUS 5E9QA 1DBPA 2R8YA 4HADA 5KAPA 3KQYA 3K0FB 2WA2A 1PVDA 1JLLA 2WVGA 3V2UA 1M5UA 2JGRA 5HKKD 5ALDA 3PGXA 4TVSA 4RULA 4LYGA 4A0QA 1OBCA 4JUIA 5D00A 1D2HA 4JDPA 4MEBA 2J5QA 3BL8A 1OYWA 3DFIA 4Z7QB 1BCSA 1N5OX 1C9DB 5KB3A 4YACA 3UV7A 1DC7A 1XQVA 3E5NA 3IPRA 1GPLA 621PA 1KSJA 2BFOA 1OOEA 3OX3A 2C9CA 4EZBA 4D57A 4RH0A 3PRHA 2DPXA 3Q11A 3VC3A 4JBNA 4N82A 1I7SB 1W6RA 4BGEA 2XT9A 3MTEA 1BW9B 2IEZA 1L8XA 3SYNA 4W5RA 1HLGA 1V1MB 3LVBA 3V8RA 3NHBA 4JJZA 3Q5GA 1HT1E 4ZIRB 2FSUA 5E38A 4XM0A 3T9DA 4NNPA 3QUBA 1G8KA 1M2JA 3TW6A 2H51A 5JOQA 3TUJC 3ZNNA 1I3NA 1L7DA 4QRDA 2DBVO 1S3FA 2O3UA 1K8XB 3TTYA 1TU0A 1UDBA 2GTHA 3AFMA 1U8AA 3DXZA 4P2BA 3WWPA 5EJGA 3VPXA 4BV3A 3Q88A 3N3AC 1NNSA 2REBA 5EVJA 1TOAA 2PX2A 4U7GA 4XJXA 4CG0A 2P2GA 2W6IA 4L78A 2P4SA 1NUUA 3H1PA 8ADHA 5LP6A 2HIMA 2PH1A 2C0CA 1C3LA 4DV4B 1PFWA 3CG0A 4JBYA 1P4HA 4IJ6A 3CNLA 1C9EA 1DELA 2QI9F 2FMHA 1R4ZA 4Q3OA 4MTLA 3OP1A 3FUVA 1OU0A 2GHQA 4BC1A 4EHNA 4UVHA 3IHLA 2VSFA 1RHKA 4ANFA 4C14A 5E3IA 2PGOA 1S01A 1ZEMA 1NLUA 2V7XA 1QG6A 1UBGA 4MYTA 3TCNA 1AHPA 2R85A 3BXFA 4FZ3A 3EVAA 2GPTA 1JALA 2Z5VA 4ND6A 1GFZA 2KMLA 4LMRA 4YRPA 4BQIA 2C9YA 3VR5H 3R5SA 3AM3A 5JCOC 2A0FA 1GNSA 1NXSA 1NYQA 5CYPA 5K51A 2R6DA 4G25A 1A8PA 1TZKA 1WS6A 2CB0A 2NZUG 3P45A 4LWQA 3HKBA 3KYDB 4MULA 1FW8A 1WSWA 2O8NA 3AK4A 4L8VA 4LW8A 4L72A 4WADA 3THOA 4C4OA 4E32A 3PWSA 4KGVA 1T5HX 1WNFA 2WUEA 4NAHA 4C30A 1ZIYA 1BJRE 2R6JA 3EQ8A 4HDNB 2IPOA 1AKEA 1FYXA 2ZT8A 1LBEA 5G4KB 1DMRA 4UTZA 3ZBQA 1QMPA 2EIXA 3W34A 5K0TA 3DV0A 3RG8A 4B5KA 2IEYA 9ATCA 3V80A 3N5KA 1RS0A 4QTXA 1G8PA 5ENVA 3AOGA 1E6CA 5FOVA 3VO2A 1VJ0A 2XUAA 3E27A 5DBHX 4DUGA 1JDNA 3BMOB 2Q5EA 3EZYA 3E7XA 3LA6A 2WSLA 4J16C 4EUNA 4ZAYA 5A02A 1C7ZA 4RX1A 5JS1A 1AHNA 2QN8A 3PRKE 4TSFA 5ECGC 5LMUB 1Y8QB 1FU4A 3BE5A 1T4CA 5LXTF 3WR5A 3H1AA 2DLCX 1NM5A 1Q0LA 3ZIAD 5BMOA 1TZBA 2XTMA 4NFHA 2Q0QA 4H3KB 5JLAA 4LGVA 1E64A 2WUVA 5BV1A 2AC2A 1N6NA 4AROA 2YTZA 3PBKA 1G6OA 2P5TB 2GTIA 5HCIA 4M9CA 1GPKA 1AKYA 5KI6A 3VAZA 2HW8A 2W2XA 4IQGA 5F9MA 3WGHA 5ADWA 5AOAA 5FA5A 3EXEB 3ZHSA 2WSBA 2XE7A 1Y3BE 4BP3A 2AXPA 3OZEA 4LWZA 3TRDA 4P4GA 1TLLA 1EE2A 3MCAA 2QLBA 3DBVO 3B1YA 1BHQ1 3S28A 4BKMA 1IULA 3QU9A 2J3MA 3AR7A 1YL6A 5LCXA 4GI5A 4QBHA 1NGSA 2B82A 2ZBPA 3WDSA 1PV2A 4DWVA 3B85A 4OLBA 3TGPA 3FNRA 3NANA 1QS0A 1UKZA 2Z8XA 3LBAA 4RIEA 1O5IA 4OH7A 1MOSA 2VPIA 3TVDA 5EAIA 4UE3S 4ZICA 2JFPA 1F6WA 1UODA 2Q6OA 3RFVA 2JAHA 2C77A 3GGPA 4C3UA 3ME5A 3PF8A 4DBZA 5JY6A 1RJFA 1DZIA 1NVVQ 3ZS8A 2CVPA 2QT0A 3FB4A 2EU8A 2Y6UA 5LFAA 2JIZA 3R8FA 1P3JA 2I4OA 1XPRA 1MZPA 3VMFA 4EFLA 1L7NA 2EKPA 3PC3A 4UU0A 5JAOA 2YFKA 5TQ0B 3ZDDA 3FLAA 1MBZA 3SPXA 4HZIA 1YCGA 5IJZA 2K7ZA 4W8OA 1EWQA 2WYHA 1IJKA 5CA0B 2DZDA 3EE6A 2R1UA 2ZCJA 3CEHA 3S7ZA 3Q3GE 2I5PO 1JWBB 4XOIA 5CB4F 1XV5A 1U63A 5HVNA 2K7FA 5IS2A 1XQWA 4HJXA 2JLZA 1DFIA 4XX0A 3N8HA 3UA3A 2GF2A 3GFPA 1JHPA 2VJMA 4JLMA 1L3IA 2XUDA 1PF7E 2QE6A 5LBUA 3TQTA 5AQ1A 4MJXA 2XKAA 1DV2A 3ES9A 4JFAA 3G9UA 4RD4A 4G63A 4DG8A 3U0BA 2VQ6A 1GGHA 3KOMA 1I1NA 4LG1A 1Y4AE 1V5FA 3CURA 5BWNA 5JSKA 2AOVA 3GJ0A 2Q50A 1OMOA 3O92A 3TIVA 4F3YA 2VEDA 1H5UA 4NV1A 1I7LA 1MC5A 3UMCA 2RGEA 1J0XO 3QOXA 3WICA 1E5XA 2NU6B 4OQEA 4GI3A 4CL2A 2V3VA 3ROMA 1KMHB 2JDIA 1VFPA 1OWOA 2WM8A 1MG0A 1CUDA 2PO7A 3KNZA 5L3QA 3UBTA 1W1WA 1KOFA 1PI3A 2V65A 2VIIA 2SKEA 2Q62A 3NHWA 1M2GA 1XXHB 4ML3A 1AV7A 1H2AS 4PXSA 2JGAA 1RLTA 3RJ5A 3WGZA 3E7WA 5HCUA 2FEAA 2ZTHA 3X3HA 1LBSA 1QFSA 3PHIA 4NL4H 3RPEA 3WO0A 5CCEA 2P2NA 1NE7A 3GMDA 3R3HA 4C4YA 4LF7B 3CH4B 5KUTA 2SECE 1U6IA 2C61A 1S2OA 1JR3D 3JQQA 3T1YB 5KYWA 1NVEA 2VWQA 2HQRA 1H69A 3IQEA 4IPTA 1MZVA 3GLGB 4G0WA 3E15A 2ZSAA 3QX9A 3KPYA 3QM1A 2QQ5A 2DERA 1YI0A 2PUDA 2NP7A 2WE8A 4H0CA 4J3JA 5JXGA 5TVGA 2V98A 3AETA 3DVSX 3CT6A 3L1VA 4RKQA 3V42A 4OXXA 1EESA 1L7MA 3ND5A 2LW7A 4WNAA 1CNMA 2QSZA 2C0PA 3FNEA 3H17A 1FJHA 4ZQEA 4EB8A 3ZH9B 1NUAA 3ZEIA 2GS9A 4RIIA 2PL1A 3FTFA 3WJAA 4BNYA 1PQUA 2JGNA 4BTEA 1FDTA 4ISBA 3NKVA 4RD0A 3GRKA 2JLVA 5BSKA 4PU0A 3I1IA 4A27A 1BVRA 3KT6A 3LQ2A 1ZGAA 2G6BA 4OJQA 1Y9AA 2XWQA 5I4CA 3SMQA 1ISHA 4REMA 1D2EA 5JZBA 4PQYA 4O2LA 5AK3A 2B2CA 1CBUA 4RO0A 1YB7A 2D5AA 4NF2A 4EO7A 3TW4A 4ZCMA 1ENZA 3I42A 1ZG3A 3O8DA 4HAYA 4NYIQ 4YRLA 5E4TA 5GONB 5IC5A 5SY4A 3UJ6A 4E2WA 3FHTA 3DO8A 4KGZA 3PHLA 2A0UA 4IEEA 4ZQHA 2AVDA 2XB8A 3HXPA 4HP8A 5KDLA 4YJ2A 2C5GA 2UAGA 2EBWA 3KVVA 1MIOB 2GZ3A 5L45A 3CZ5A 5ALOA 2QMZA 4GM1A 1U1EA 4PSDA 4RSMA 1FP7A 3WY9A 1WXFA 3DHNA 4C7JA 1W36B 1Z6YA 1A5SB 1E20A 5BXYA 4MPTA 2I2WA 3T6KA 1YMVA 2RKWA 3AVTA 1AURA 1U7WA 2GK4A 5A62A 2EJWA 1JTEA 1K7FB 3I12A 1L0BA 2ASEA 1J42A 1HLFA 5H4HA 1Q1NA 2ZIVB 1G9TA 3LUHA 4RFVA 5F4ZA 3K70C 2Y1KA 1VKRA 2XRMA 2ZAIA 3H16A 2GF9A 4L16A 4PLPA 1Y6GA 2OKGA 4B32A 1P2VA 2BUAA 1Q0ZA 3QNWA 4G24A 2MSEB 3BQNB 1JFLA 4EHIA 3DVAA 3E7PA 1QFZA 3I6QA 1C7FA 1FTGA 1A9XB 3VSDA 4DZZA 821PA 4DT1A 2VT7A 1E6MA 1T8RA 4ESEA 5GOZA 4FIZA 4MKHA 1D2RA 1ST2A 4RA9B 4PG8A 2AFIA 1FX0A 4HZUA 1BS2A 4AXXA 3RTCA 4WLEA 4BZPA 4UZFA 4FFWA 2DFDA 2G9RA 1N7JA 1G66A 1WB5A 3GGDA 4FHCA 4YLGA 4X66B 1CZKA 2XYGA 4HH3C 4Y9TA 3B6JA 1RKUA 1ISJA 2IDZA 3H5NA 1J24A 2MMGA 3IAM1 4YMWA 3VSEA 4Z4CA 3PFCA 4YT2A 4CIXA 3CVWA 3A1FA 3JZFA 1Z18A 1SB8A 3I3SR 4MQ6A 3Q9UA 4MPDA 4F6RA 3SSNA 2IY7A 2QSJA 2QWXA 4B8WA 1Z2OX 5JZMA 2ZSKA 2A1TS 4Z8YA 3CPJB 4KAJA 1ODKA 3FOEC 2JS7A 1SUFA 2YDYA 4N40A 1QM5A 3ROPA 2JG3A 2HLNA 1E1YA 3PD7A 4W5NA 1YZKA 4KQJA 3CZPA 2LP4Y 3Q40A 2XHEA 3L9XA 1QRTA 3ZCSA 3TKLA 2ZBGA 2MT9A 3GVXA 4UFNA 4U9IS 1HEYA 2VPYA 3IILA 3M4ZA 2A2ZA 5C5DA 4JI5B 1NNUA 1Q7EA 2PWAA 4MWSA 4E6PA 1XQXA 3MSCA 1S2LA 3ESXA 4IF6A 1EINA 4UTNA 5ILGA 1YA4A 4I5FA 4KLZA 4ALKA 5JS6A 4B0PA 5EPEA 2R3SA 2W2VA 1J0EA 4RK1A 1QQAA 1PV4A 3MM4A 4E03A 2VOEA 1Y8RB 4M36A 1PZMA 3H3JA 2O1WA 5ED4A 2Z95A 2I91A 2RGNA 1X1BA 1TYEB 1G8SA 2JW5A 1N0VC 1AB5A 1VE5A 3RTGA 2WAXA 4UM5A 1I1HA 4H7PA 4CN8A 2EXXA 2P3LA 5BSRA 1QGDA 4E4RA 3DL4A 5I5GA 3T3NA 1RI4A 1O58A 4N9QA 4RHCA 4F04A 3RUIA 1USIA 1P1IA 1ZSNA 3HB0A 3PWKA 2PWZA 5L4LA 3RUCA 5CXSA 3UYKA 3FIJA 3FNBA 3HDVA 5AT1A 4CJXA 5K3AA 1YJXA 3FPBA 3PCTA 2IEDA 5LBIA 2A0WA 1C30A 2CSXA 4Q9JA 2B2XA 1U2EA 3QXCA 4BPRA 3FWPA 2ZS8A 4HNAB 5FJJA 2DSTA 1JBEA 2EYQA 1KBQA 1OAAA 2H9AA 2VTBB 1JA9A 2AOUA 1TT5A 2IOYA 2ZUTA 1QO7A 3HO6A 5LKRA 2C4HA 1Z4MA 3PR3A 4JI1B 4BWVA 1O6ZA 2BFDB 4OXKA 2BKVA 4C2TA 4ZAWA 3H5TA 2AHOA 3D7LA 5CNJA 5BOSA 2AUMA 2HMYB 1S2DA 5CXXA 4BFLA 2DETA 3OQIB 4DV1B 1FYWA 1RXWA 4HZGA 5I9BA 4PR0A 5IXJA 1Z28A 1JI3A 2MMCA 1P72A 1GTG1 2QI9C 1DS6A 2OHIA 4X95A 1OY1A 4ENTA 2IS6A 1TMYA 2WJ3A 2XTAA 1KHHA 1NW3A 1ORWA 3WMXA 2DPHA 1UL1X 1E9EA 1PS0A 1W88B 3CZ9A 3PEEA 4NNJA 1UKVY 4HGRA 4CM5A 4F4FA 4C5AA 2C7RA 1ULHA 3CU5A 1KK0A 3HKCB 2FN3A 3ONDA 2C2KA 3ABQB 3PZBA 1QVRA 2QGZA 3GT0A 4NBVA 3Q85A 1U4SA 2P4HX 2EZ8A 3OPYB 3FMGA 3AOEA 3N53A 4BXOA 2OCLA 1A9TA 1M0SA 2YWDA 1CEXA 1UK8A 2P6UA 4JOQA 3IA7A 4HDKB 4ZPXA 1JPJA 2C42A 4YUYA 1RFGE 3OMWA 3TJZA 5GJWC 3ZDAA 1MGPA 4TUYB 3UJBA 4YNBA 1LA2A 1ZBQA 2PKQO 3PHCA 5JSYA 4GNRA 2H4WA 3OAAD 3VHRA 1EU1A 3FSRA 3CWZA 3N2ZB 4WESB 3OSUA 4H6WA 4R81A 3RYIB 4CF3A 4D25A 4TMVA 1NXQA 1PDOA 5BW5A 3ORHA 5C53B 2PBRA 2D7CA 1LNQA 3TRJA 4ZK2A 1KI8A 4V2UA 1G18A 1VL2A 3ZV7A 2GYYA 5DT2A 5IH3A 3PR1A 1JXOA 4RIGA 5FBVB 2B98A 2YJ6A 4Q05A 3BK1A 3RJMA 1OR8A 4D6XA 4EY5A 4GSKA 3R0XA 2OBFA 2UZ1B 2P30A 4KODA 1DEKA 2PQ6A 5CRIA 1CNFA 2D1SA 2WJ6A 3UK7A 5J58A 3GFBA 3K9LA 5AI0A 4V39A 4K7JA 1AG9A 2J6CA 1BMQA 4WGGA 3HFSA 6REQA 2XBMA 4KJXA 3GQVA 1MO3A 1OLUA 5AXBA 8GPBA 4A8JA 1T8WA 2WTMA 1QUEA 1TC1A 1UPXA 1TQDA 1M2KA 2CJPA 4N5IX 4Q9NA 3GC6A 4KAAA 4M0DA 4BAUA 2QZ4A 1LLQA 3EXFB 1CZLA 3C8DA 2KBEA 2C9ZA 3PNYA 3OKAA 4O3FA 4WFQA 3C3YA 4EMUA 2AD5A 1EJ0A 2O48X 3C14C 3OJLA 1ISGA 4M8IA 4PG7A 4G5HA 4W8HA 1E2LA 2L17A 1W47A 3OKCA 5CW1A 3U56A 2HT1A 1TPYA 2VJAA 1IE3A 1KBZA 2TECE 3OTQA 4MQFA 4E6EA 3HWRA 1E3WB 3NWBA 3BFKA 4DUZB 2CBZA 2GN4A 4GRDA 3MZ0A 2VQDA 3L92A 1KFCB 3K1YA 3MK31 3KQHA 2P79A 5TMEA 4UJ5A 3LDAA 3AVYA 3QVXA 4G5OA 3UMBA 2ZXEA 3CGGA 3MOSA 5AI5A 3HYTA 3NAMA 5K0CA 4BZQA 2UVPA 3D31A 4RA9A 1JQDA 5EUQB 2C3UA 4EABA 2ZI4A 1J9GA 2JF0A 3LKDA 2UXCB 3TVYA 1QV6A 4BJ3A 3TUZC 4LZPA 4MUIA 3AJ8A 2JGIA 2Z2YA 2YFQA 3CF6R 2NQTA 3OQ6A 4YJHB 1V25A 3KUDA 4PYRA 4CKWA 1CF2O 1YQQA 2AI2A 2J7PA 2CZCA 1CF9A 4ND4A 4PYKA 3L0IB 1YUMA 1YB1A 1NURA 4KQ1A 3OFNA 4B4WA 4C43A 5GJCA 5MN5A 1B4DA 1U04A 3S8YA 5DX0A 3HN6A 4MQ5A 3KR1A 3KPVA 3TX6A 3VHLB 1X15A 5LUBA 5BNIA 3I5UA 2PWBA 2EATA 5BN5A 2ZBDA 2D3WA 1ZOLA 1KVQA 2JCXA 3L7NA 2JIRA 3SDBA 1MEJA 3T95A 3UG6A 1JDZA 5DNAA 1AK9A 5EMMA 5IYZF 1DQNA 2BBTA 3B6EA 1P1HA 1E9DA 1L7OA 4RVDA 1XEXA 4DOMA 5KTNA 3U7FB 4IKPA 1WJGA 2E3JA 3I9LA 5A06A 1BXRA 1PWZA 3QLVA 1Q92A 1XRLA 2VKTA 3QU5A 4EF6A 1F06A 3ZZMA 5KREA 4LF5B 4AI6A 2FN7A 4U0JA 4B46A 4B3JA 3OCYA 721PA 2FQ1A 4IMJB 3FNQA 1JJ7A 3OOWA 3AX6A 4X20A 4M7WA 4I3GA 5TR9A 1G9SA 4CCYB 5L7WA 1XTIA 2MYTA 2B20A 3BGVA 3DWGA 3GNSA 3I37X 4R84A 2G1KA 2Q28A 1X1EA 1LQUA 5LC1A 1V45E 2UZ4A 3QWAA 3HWSA 4N76A 4JVNA 1G8GA 2DFTA 2SCUA 3PC8A 3CO5A 5EQTA 1KDOA 3L5OA 4YJFA 3AY6A 3SR3A 2Z5FA 1QTQA 3QUTA 2ZWPA 3KQPA 1EFHA 4NV0A 4KC0A 3TQRA 3UH1A 3MOIA 5JJCA 5BSHA 1W8IA 4AZ0A 3PKIA 2BEWA 3DO6A 1DIBA 3QMPA 4FJ1A 4PC2A 1OW3B 4IVPA 2X0EA 4LHZA 5FT9A 2V6MA 1WCWA 3EISA 2VZEA 4C6RA 1I2AA 3L4EA 5LQCA 1RLIA 3U3KA 3BM5A 4MYCA 4PICA 2AQHA 4EUKA 4HDAA 3SEQA 2AEJA 2QYSA 4PVCA 2B7LA 1I30A 3WLIA 1Z0UA 1XPUA 4Q7QA 1O9GA 3DLPX 3EOAI 5ALSA 1H4QA 4LNUA 4RJIA 3D64A 3GLGA 1JTVA 4MYHA 1G21E 2O5VA 3HJRA 3FX2A 1QAQA 3MIZA 4OXRA 5G41A 1P7WA 1KAGA 2LDBA 5AKYA 5EIFA 5IW8A 1KY2A 3AKDA 4MMYB 4A2PA 4DDUA 3C85A 1IWPB 3O47A 5F2KA 4S2EA 4AG6A 5CDTA 3GJ4A 2C07A 2ES4A 3DM5A 1QRDA 5D85A 1RDFA 2LR0A 4QUAA 3RANA 4A6PA 1LI5A 3WGMA 4OBBA 2YXPX 3AHJA 1DINA 1XDWA 5EEGA 5K3FB 4F9EA 4NXNB 5KWVA 4J4TA 3ERCA 4GPBA 1F8GA 5HG0A 1MAWA 3AVXA 4JWKA 3HWX1 2CLMB 1G1MA 2HCJB 2VP9A 1C5KA 1DFGA 4CM8B 2HIAA 3UC9A 5KX5A 2A3RA 4PWZA 2OD2A 1JJAA 4KBFA 4LN1A 2ZKIA 5FOSA 1J25A 3N76A 4ZT7A 3ZZ0A 2RGDA 3OTOB 4I4NA 5HOEA 1S7GA 4RABA 1GVHA 1SXPA 2RHJA 5LDGA 1BXGA 3TZEA 1QC5B 1HRKA 2AGVA 1M74A 3ZD6A 4JELA 1XU7A 1FFSA 1V4VA 3AR4A 4R8SA 1Q17A 5J4HA 1QORA 1Z0IA 2HSZA 3DBRB 4NU6A 4OO3A 4OJKA 4OM8A 4S1PA 1F20A 3HEMA 3R2JA 1KEPA 3DQQA 4K81B 5DBFA 4QOGA 2F3SA 1LJUA 2G76A 2QU7A 1NT4A 1QRAA 1SC1A 3EXHA 4KIUA 4NBUA 4DB2A 3D8TA 4EEXA 1TEVA 5ECDA 4C01A 3DTYA 4KQ6A 4KFSA 3DE1X 1RJEA 2IIVA 1TADA 2J9FA 1DO0A 1GKLA 2GASA 3OEHA 1XUOA 1CULC 1XMPA 2FF7A 2ISSD 3DDWA 2WJPA 3LC1O 3O3NB 2XQGA 3Q8LA 1NW4A 4Z4FA 4GBMA 2H2HA 4UUQA 4YUXA 1FK8A 3KPJA 1WZEA 2JGMA 1UANA 4IZOA 1BS1A 4PQEA 2NO1A 5DH9A 4RGYA 4P2GA 3ROZA 5MDHA 1DTWB 1RJWA 4OF4A 3IOMA 1F1BA 2LTAA 3EXHB 4PX2A 3KU1A 2VYNA 4BYMA 1XZ8A 2A84A 4D3SA 3RRNA 1RYNA 3KB8A 4OG2A 3M49A 1RACA 4OQFA 4RF4A 4RESA 1UBKS 3GARA 1S3GA 3IXLA 3STUA 1DDIA 1GZ4A 3KJNA 3N8KA 3SKXA 3HY6A 3VZRA 4Y6SA 1OROA 4DYVA 3C24A 1PJRA 1ONPA 1L4LA 3BX1A 4NK5A 2CNWD 2ARKA 4X24A 4JEIA 5K05A 1PW7A 1Z0ZA 2QG9A 3DBIA 4LYFA 4UE2A 4DW8A 4P08A 2BJVA 2VJNA 3E53A 3K16A 5C34B 4LISA 4V0OA 3G8DA 4JYCA 1NAIA 1AN9A 3IOYA 3VM6A 2QTCA 3O2NA 4BO3A 2ODWA 1OLSA 1MJFA 3ZZNA 4C4RA 1SHZA 2H0RA 3WYNA 1CETA 1GGNA 4KU4A 4A82A 5A9SA 3VR3D 2O8EB 2F3PA 4O4JF 4BMXA 5E9JA 2NSDA 2WIKA 3OWOA 4PFKA 5JSFA 1I6WA 4HJRA 1CIJA 1R4NB 4G1UC 4ZC1A 2XD9A 5EJEA 2A4MA 3RBVA 1KYVA 3D8SA 1VDMA 1ZLYA 4ZVSA 1ZNWA 3PF9A 3K31A 3C3DA 1LDGA 2CDBA 2IK8A 3A9CA 1U1CA 2WKSA 2C94A 1VRCA 1E3IA 1JQLB 1A9RA 3A6ZA 4ZTZB 3QV1A 3HO1A 1B6GA 3Q8KA 1L5HA 1UMCB 3NUZA 5DCYA 1Z6GA 1V5WA 1EGMB 3DA8A 3FVVA 3SIPA 3PG5A 3N05A 4ZQFA 1YQXA 3SOZA 1XSEA 4U0KA 4JJKA 2JNWA 4OK5A 1OF1A 1ND5A 1RRMA 4X65B 1ZISA 4CMIA 4F0JA 4Z51A 4YUWA 4CEHB 2ZUCA 1M34B 4N0DA 4QYSA 1OXXK 4L3VA 3X43A 1GDTA 2VWGA 4AP5A 4JR1A 3O4VA 2Z9DA 4HRVA 5HIIA 2FETA 2DF8A 4RNDB 1NLZA 3SFTA 4KH0A 3WLMA 5IYZB 4CM9D 3C45A 2NIPA 4RFSA 2GLTA 4WZ6A 4F1KA 3AUUA 5KPJA 3R4VA 1TVCA 4U5XA 3FNHA 1AA9A 2ZSEA 5HPYB 3E70C 2UXBB 2A9VA 1EUCA 2PTHA 1P8AA 3DTVB 2BKAA 2DQ4A 1UDWA 2QRQA 3DDSA 5K3CA 3WGNA 4TYQA 3RSQA 2JZNA 4CLRB 1F3OA 2QAGB 3T99A 1HZJA 3VVCA 2OFOA 4I5DA 3HTXA 3MJFA 2DU8A 1GPAA 2I4LA 1KK1A 3K8YA 4LNHA 4EBFA 2RBKA 1KVRA 2BE7A 4OQZA 5JAZA 4RVNA 1U0EA 2DPYA 4QPDA 4CMEA 1GIAA 1E66A 1XXHA 4Z99A 1BGVA 1U28A 5J4KA 1IQPA 5EHGA 3MOGA 2EL9A 3GCGA 4KUGA 3F6BX 4L6AA 3EA4A 3KDSE 3SBOA 4NNOA 3TLAA 4MKGA 2O6HA 4DPMA 2M2IA 5JAMA 1R6XA 1SUBA 3CRW1 3H9UA 4KLRA 4M76B 4YT4A 3THXB 3BGWA 1CZRA 2GWHA 2QD1A 5LR6A 2EVWX 4NJMB 5A3RA 3LYUA 3DD1A 4OGWA 4LHYA 2BEWB 5EN4A 3PUHA 1UAGA 3V1NA 5CLQA 2JFOA 1FVOA 4N0EA 2O19A 3AEKA 3H0KA 4ZZ0A 2QE7D 1RPJA 1ZUWA 3O3CA 4ZAZA 3D54D 1CUZA 5T57A 4I19A 5L53A 2QYHA 1PK7A 1UDRA 1Q5PA 1Y89A 5TMBA 4DDMA 2ZZMA 4XJSA 2IWHA 2UZIR 4KWIA 3O0DA 2I7DA 4KK3A 1RHMA 3B89A 421PA 1C0IA </