1XKQA

Crystal structure of short-chain dehydrogenase/reductase of unknown function from caenorhabditis elegans with cofactor
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
272
structure length
272
Chain Sequence
b'PRFSNKTVIITGSSNGIGRTTAILFAQEGANVTITGRSSERLEETRQIILKSGVSEKQVNSVVADVTTEDGQDQIINSTLKQFGKIDVLVNNAGAAIPDAFGTTGTDQGIDIYHKTLKLNLQAVIEMTKKVKPHLVASKGEIVNVSSIVAGPQAQPDFLYYAIAKAALDQYTRSTAIDLAKFGIRVNSVSPGMVETGFTNAMGMPDQASQKFYNFMASHKECIPIGAAGKPEHIANIILFLADRNLSFYILGQSIVADGGTSLVMGTQAHDV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords short-chain reductase family member (5D234)
publication title Crystal Structure of Short-Chain Dehydrogenase/Reductase of unknown Function from Caenorhabditis Elegans with Cofactor
rcsb
source organism Caenorhabditis elegans
molecule tags Unknown function
total genus 104
structure length 272
sequence length 272
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1xkqA00
3UUWA 1LXCA 2Q4BA 2Q4EA 4J91A 3P2OA 4DC0A 4CV3A 1T25A 2VWHA 4FW8A 3ZN2A 3RBVA 5BT9A 1BXKA 1R12A 4D41A 3WBFA 2Y0CA 3QVTA 1SPXA 3TFOA 2XPCA 1JU9A 1VPDA 1D1TA 4RLSA 1EQ2A 3IP1A 4MIEA 2VTEA 3PYLA 3WR5A 4Q3DA 3OEWA 1JVBA 3CSDA 3JD2A 4F46A 1K2WA 4UUNA 3H7AA 1C1XA 3E03A 1DIGA 2R00A 4QECA 4FB5A 3VC7A 1SOVA 1HRDA 2HUNA 4W4TA 1E1KA 1YXMA 2GASA 3JQAA 4O5OA 4U6SA 2PGJA 2DT5A 2YYYA 3OBBA 4NK4A 5F5NA 2H1SA 4E31A 3RC1A 4ALIA 2X9NA 4RGBA 2P4QA 3LK7A 4KQXA 1YRLA 4Y6SA 4BNYA 4PG6A 1M6WA 3KM0A 3HG7A 1FDVA 3JD1A 2O3QA 4XQEA 1JKIA 1LUAA 4AJPA 2NM0A 1P1IA 3DHNA 4PN3A 3ZH2A 2JHFA 2J3KA 3GGGA 2Y1FA 3DAPA 1NNUA 5EJ2A 5A04A 1JVSA 3Q3CA 4RZIA 4BKOA 4CUJA 2G5CA 1H5QA 4FDAA 1I30A 3PZBA 3UAGA 5KVCA 4BGIA 2VNSA 1LLQA 1I3LA 3ZWVA 5KVSA 2Q1UA 1C1DA 1ULUA 3PDJA 3GEMA 9LDBA 2DTEA 4BNWA 4MO2A 1SO8A 1ENZA 1V3VA 2C5AA 4MVJP 3Q11A 2Q45A 3WJ7A 1XG5A 2X58A 2D5CA 1ONOA 1B8PA 2VRCD 2O3JA 1M66A 4LVCA 3DZKA 3L07A 3QVXA 3WGOA 1NPYA 4A03A 1Y1PA 3GAFA 2CMDA 3HFSA 4PZEA 5JBIA 3WMXA 3HB4X 1QLHA 1QYDA 2CZCA 1CF2O 3F47A 3RUHA 1OI7A 2JAHA 3ZU3A 5C37A 2NVBA 2WDZA 5TGDA 4EJ6A 3BAZA 4F6LA 2I5PO 3H3FA 3I83A 3WNVA 1GTMA 1TVEA 1NBOA 3RCBA 4R68A 3ONDA 1DOHA 1M67A 1ZSVA 1EE2A 1D3AA 4GX0A 1AN9A 4H3VA 5JYEA 1N5DA 4BKRA 1PGNA 1Z45A 4RF5A 3QWHA 2X5KO 3NT5A 4WLVA 2EWMA 3PHIA 4WCFC 3OJ0A 4NQZA 4YCAA 5EQFA 2O2SA 5GMOA 4EDFA 4YT2A 2X23A 3QWBA 3AUSA 2TMDA 1I01A 2C5EA 3SC6A 1GU7A 1F06A 4UVHA 3OP4A 4MVJI 4P38A 3L4BC 2Y1CA 4QX6A 3WWYA 4BO4A 1ORRA 4EUFA 3ANMA 3INRA 4OGWA 5JYDA 2IXBA 2UAGA 1Q0QA 3LF1A 3BMQA 3GNTA 1CYDA 4IQ0A 3MTJA 4AJOA 5ILOA 3BMOA 4Y67A 3RUDA 1E7WA 3I5MA 1ADFA 2LDXA 2WWRA 3H3JA 1OAAA 3EGOA 1Q7CA 5A1TA 1H9AA 1F8GA 3DZIA 5A03A 4TKLA 3ZZNA 1NHWA 3JQGA 4IINA 3U4HA 3F46A 3PQEA 4AJ4A 4QXMA 2NU8A 3ZWNA 1UP7A 1YKFA 4BGVA 4O0LA 5DBFA 2PZLA 4CMHA 1DC4A 4XYMA 3GN1A 4ZRNA 3PHJA 1ADCA 1GPDG 1CQJA 1U8FO 1UDAA 1WMBA 3A06A 3RIHA 1XIVA 4QSMA 1U3WA 5A3JA 4BGUA 3IJRA 4WECA 1ZK3A 3UGKA 3ICCA 3FTNA 3MWDB 3FR8A 3H5RA 1BGVA 4E3ZA 2NU6A 1BSVA 1ZXBA 4IJUA 4N5NA 3H9UA 4XGNA 8LDHA 5JCXA 3JYOA 1HEUA 4Z0HO 1T1SA 2JD1A 4IIVA 4LSMA 4A5OA 3W8EA 4CM9A 3CEAA 2YV1A 3WMWA 1DBVO 2GN4A 1DFIA 3DONA 4ND1A 3QSGA 4XYGA 5L7WA 5EN4A 5H81A 4BO6A 3WYEA 2PFGA 5L4NA 1YDEA 4PRLA 3O4RA 1W8DA 4W82A 2ZYAA 5DP1A 4B3JA 5DDIP 2PNFA 4DIOA 3AUUA 3I4CA 1NVMB 2X9GA 1PJBA 4KDFA 4ALKA 1WVGA 2NU7A 2J3JA 4RVSA 4W7HA 4C7JA 1DO8A 4CQMA 3RU9A 1R0KA 1CDOA 2A9FA 3ZWBA 1EUDA 1Q1NA 1X1TA 4WLEA 3RKRA 1DDOA 4DGSA 5AOVA 4BMVA 2D0IA 2ZCUA 4P22A 1ZXLA 1F8FA 2FOIA 3UCXA 5CDSA 4GGOA 1SZJG 1FDSA 1HDGO 1RM3A 2PZMA 4GVXA 4Q39A 3ZHBA 2VWQA 5IZCC 3WG9A 4CM7A 1R0SA 5J23A 1A27A 2V6GA 3OA2A 4PLGA 1KC1A 2C0CA 4CMEC 4YAKA 1A7KA 3O8QB 5GZ3A 3U4CA 3EMKA 3K8ZA 3PIDA 1JAYA 2ZKLA 2GN6A 2XXJA 4BNUA 4TQGA 4R1SA 1K89A 3S2FA 3DXFA 3OJOA 1PQPA 4URFA 2DPGA 4Y6RA 3NDRA 3EYWA 3GZNA 5IXSA 3SVTA 3WWZA 1FF9A 4HP8A 3VZSA 5IDWA 1N8KA 2GSDA 1NFFA 2FSVA 4RZHA 3RWBA 1IOLA 4FJ0A 3MJ4A 2P68A 3PQDA 2CVOA 3L9WA 3I9KA 3RUEA 2WD8A 4H7PA 2VT2A 1WAMA 2GNAA 2DFDA 2EXXA 1JWAB 1QYVA 4IJKA 4KDEA 3ROPA 1ULSA 3EZLA 2VRCA 1P3DA 3ZWAA 2FPPA 2P91A 3B1KA 1GD1O 3GMDA 1VJ1A 1ZVMA 2LDBA 2GZ1A 3L6DA 2PKQP 1YDWA 4WOJA 1N92A 2Z5LA 4GVLA 3PJEA 5BNIA 3H2ZA 1PL6A 2ZTMA 4H16A 1T4BA 3QV1A 4BO0A 3ZWYA 1R6DA 1EEHA 1U3TA 3LT2A 4OJNA 3IUPA 4EZBA 3ZNNA 4E2XA 3U4IA 3TF5A 1TT5B 4CLOB 3GH3A 4KWIA 4FFLA 2VZ8A 2NTVA 1WWKA 1CIVA 4L4SA 4N5MA 3VVBA 3MZ0A 1ONNA 3GK3A 3TRIA 5BSFA 1V9LA 3BHMA 3K9QO 4S3MA 5JY6A 3I23A 4NBWA 4NFSA 3OF2A 3AK4A 1NP3A 5LC1A 3DMTA 1NTOA 4ILKA 3UW3A 4EYEA 2Q46A 1ENOA 1UAYA 5L7TA 1OZAA 1KVTA 1BDBA 2C7VA 2PD3A 1LDNA 3K5PA 5CPBA 4INAA 4W99A 5COBA 4J1NA 4Y8VA 3ZV4A 4AJIA 2GYYA 4UVDA 3EK2A 1G0NA 4LW8A 3SLKA 1ZK4A 4XDYA 3NT4A 4L75A 4GLOA 1V0JA 4Q3AA 1H9BA 3NTOA 3ETEA 4BNXA 4E12A 1O5IA 4J49A 1NR7A 1TB4A 1R4MB 1UDBA 1YGYA 2JCXA 3PQFA 4IM7A 4R01A 1LU9A 1YVEI 1MLDA 1Z6ZA 2SCUA 4PFJA 1UR5A 2D4AA 1V3TA 5HRUA 2JD0A 4PGFA 5KVQA 1ZK2A 1ISGA 3RC9A 4CR6A 2I3GA 3NDIA 3NT2A 5HWSA 3AM5A 1LSSA 5L40A 3U09A 2QX7A 3EUWA 1J5PA 3DTTA 3PLRA 4M8SA 4E32A 4HKTA 2OGUA 2VYVA 4DVJA 1A5ZA 5FFFA 4BO8A 4WJZA 5I7EA 3O03A 4BKQA 4RPGA 2B35A 2IZZA 1X13A 5I9NA 1H2BA 1NQ5A 1MC5A 1WPQA 2FHSA 2PR2A 4FIZA 4NPCA 5ILGA 1UXHA 1ZO8A 2BFAA 2F1KA 3B6ZA 1F12A 3GVXA 1YL6A 2O48X 1GYQA 1HDCA 4HY3A 4J1SA 1SBYA 2X86A 4WEOA 1I33A 4JQCA 3WQQA 2PH5A 4PG8A 1KETA 4I5DA 3BZUA 4NU5A 5FI5A 5TLSA 1J4AA 4JP3A 4KWHA 3UH1A 5JO0A 4ZA2A 1XCBA 4GX5A 3WGQA 5JLAA 1PR9A 5AXBA 5K9ZA 3IL2A 1H0KA 1X14A 5DF1A 2JKVA 3F1LA 1FMCA 1Y6JA 1T2FA 1Y5MA 1EDZA 3Q2IA 4U0KA 1GCUA 4D0SA 1C3VA 8ADHA 4IGFA 5LDHA 4E5YA 3K73O 4ZD6A 4YAJA 3UN1A 4R1UA 1E0DA 4MVJH 4AJHA 2P5YA 3JCZA 1QXSA 1XWFA 1DPGA 5KKAA 1ZEJA 3RBZA 3ULKA 1PR3A 3V2HA 3KYDB 2ET6A 2HSDA 3KXDA 4CMKA 1LLUA 4FFOA 4BNKA 5CHEA 1W0CA 4J1QA 3JD3A 3OIDA 4Z6KA 5ADHA 3SX2A 4WLUA 4K6CA 1PJ4A 2VZ0A 1XLTA 4DPLA 5KJEA 1N7HA 1WZIA 1E7QA 3F9IA 3VPHA 3NX4A 5G4LA 2Q1TA 5KJCA 2GN8A 3H6KA 5I7VA 3JQAD 4ZVVA 4M49A 4W9NA 2J5KA 1DRUA 4GKVA 2WD7B 1VM6A 3FSRA 2B37A 4YJFB 1YB5A 4YJHB 4D43A 3GT0A 1HYGA 1U1IA 1ISJA 1WP4A 2ZK7A 5I9LA 4O6VA 3O26A 1VL6A 1K6XA 1ZFNA 3NEPX 1I8TA 3R0IA 3UF0A 5CEFA 4PCVA 1I5RA 2IXAA 1EVJA 4FOSA 5KNLA 3UCEA 1HYHA 2O3RA 1ID1A 4KMSA 3O8QA 6LDHA 4FR5A 1JW9B 3JYNA 3WJAA 3ZW8A 4GAEA 1G6KA 3D64A 4E6PA 1C0PA 5IZ4A 5CG1A 2FR8A 1DIRA 3DMTC 4B3IA 3GR6A 4LRTB 4O63O 3T7EA 3BMNB 1RPNA 3UOGA 1WXDA 1JTVA 1SB9A 2DBRA 4EBFA 3DZGA 2YV3A 1ZBQA 4DQVA 4DL9A 3SEFA 1PL7A 5IN5A 3ZNPA 4YQZA 3IQDB 2G76A 3ENKA 4GI2A 1GQYA 4BUCA 2VOEA 2CUKA 3BTVA 1HDYA 2YDYA 3WOHA 2RH8A 4W7IA 3WSVA 4DYDA 2I65A 3JD0A 1BVRA 3QVSA 1ZH8A 2AW5A 3R6DA 3TZCA 4I5EA 3QVOA 1MP0A 4AFNA 2Q2WA 1N9GB 2WE8A 5T64A 1PWZA 1CWUA 4M55A 4BO5A 1PZGA 3H9GA 1EFKA 3JYLA 4MVJG 4DYVA 1UP4A 3ANNA 3GDOA 4BMNA 1DC6A 1BTOA 5TIIA 4OKNA 1FK8A 3KLMX 3JQEA 1R66A 2J8ZA 1TT5A 4BNHA 1PGQA 4CLRB 2HRBA 2CFCA 4J4TA 4R54A 4CLOA 3HWRA 2O23A 1H6AA 2NADA 2NQTA 3E5MA 2V6FA 3ZNQA 4D46A 5IAAA 1X0VA 4L76A 2J3HA 3ZWWA 1DJQA 2DUUA 3FWNA 3WQRA 3RUIA 1PZHA 3LYLA 3U62A 4B8WA 1SEPA 2NWQA 4R3WA 4IY1A 3INTA 1IPEA 3B1FA 5A5EA 1A72A 1LDEA 1H6DA 4HFNA 1SCUA 4RL6A 3W4KA 5ITVA 2C2XA 3AU8A 4BNNA 1YJQA 4AJ1A 2JJYA 1UXKA 1G1AA 3D5TA 3AM3A 3QLJA 1E1LA 4IDGA 4N18A 1KS9A 2Y68A 4JIGA 3DAFA 3PLNA 4JP2A 4AICA 3WGZA 4AJLA 1I32A 1Z7EA 2EW8A 4ROSA 1DEHA 2NTJA 4U5QA 3BYZA 1XYGA 2UYYA 4FFRA 4XJTA 4A0SA 2NVWA 1GUZA 3HE3A 2XXBA 3OH8A 1R4MA 4JBHA 4E21A 1UXIA 4Y98A 1WZEA 1TEHA 4D79A 3AFMA 1BDMA 1IYZA 1JN0A 3E82A 3F6YA 1U8XX 1J49A 2HRZA 4RQTA 4RPHA 3RKUA 3VHRA 1I2BA 5ES3A 4ND2A 2BGLA 4ONEA 3KUXA 4QEDA 2HMSA 1PEDA 3I1JA 1IUKA 1J6UA 3KSUA 3KYBA 5I7FA 4D44A 2VHYA 3NTRA 3RFTA 1TLTA 5CDUA 1NFRA 2WYUA 5DCWA 4GX2A 3VH4A 5F21A 3U0BA 1GYPA 3VH3A 1NWCA 1RM5A 1I24A 1HSOA 2VT3A 2AQHA 2HMUA 2PD6A 4UEOA 3TZHA 5MDHA 4OO3A 5A02A 1NAHA 1KOLA 3PK0A 5FI3A 1R15A 2YQ5A 4YT5A 5AXAA 5JXWA 1IHXA 2NTNA 4NG5A 2FN7A 2HK9A 3GDGA 1FDWA 5A4DA 4XWYA 4PIVA 4GPD1 1GZ4A 5EPOA 5F3RA 3TL3A 3VPGA 4BO1A 4CM9D 3IMFA 3INGA 4XRRA 4RPJA 1DAOA 5JSFA 1UXJA 4MJLA 3F3SA 5B4VA 3WFJA 1E1MA 1RYDA 3OQ1A 2EGGA 1FXSA 4J4HA 1AHIA 1SMKA 1YH3A 4CMJA 2YQ4A 1VKNA 4HFMA 1H6BA 3GC6A 1O9BA 1E92A 3AU9A 2H63A 3LF2A 5JDIA 3FF4A 2CF5A 4CR7A 1NQTA 4CQMD 2FP4A 2OHXA 3PI7A 1DRWA 3MJVA 1Z7BA 4MKRA 1B3RA 4JBGA 2X1HA 3WDSA 3R3JA 1KVUA 3VPFA 1A71A 1BG6A 4XB1A 5BR7A 4MVJD 5AVOA 1AGNA 1XA0A 1Y7TA 1Y8QB 4JBIA 1EVYA 4JROA 2G17A 4BO7A 3IKVA 4NBRA 4B4WA 4RLHA 2E82A 3GGOA 4P4GA 3G79A 5ICMA 4FQ8A 3VZPA 2YDXA 3OQBA 2Y1DA 1IZ0A 3KETA 3IS3A 3AM4A 4ALNA 4EGFA 2GRAA 4AG3A 1BXZA 4R51A 2ZATA 1EUZA 1LLCA 3COSA 4UULA 4YBZA 4BKUA 4BMSA 1YQGA 2BMAA 1P74A 1U4OA 3UXYA 4ITUA 2A92A 3TFQA 4MP3A 4RF4A 2CF6A 3D5QA 2W2KB 4L0QA 3D3EA 4DLAA 4RF2A 3WIDA 1CETA 2WD7A 4FJ2A 1LBEA 1OFGA 1Y5RA 4YJFA 4KUEA 2DLDA 4YJHA 3D4OA 5A9SA 4YYZA 4ZQFA 2YUTA 1C0KA 2YV2A 1MA0A 2EF1A 3BMCB 5L3ZA 2J5QA 1DAPA 5K0ZA 4PLTA 1AHHA 1JDJA 4OXYA 2AQ8A 3GQVA 2D3TA 3IAHA 1HWYA 2IYOA 2OP0A 2VHZA 4UVGA 4XZ3A 3EVTA 4DBVO 2GN9A 1HKUA 3H5NA 3I52A 2QHXA 2YZ7A 2EJVA 4XD2A 2QRJA 5G0TA 1GDHA 2PK3A 5CPFA 1B26A 1QP8A 3OETA 3PFWO 4IDCA 2YJZA 1Z73A 4CM3A 4PLFA 3M1LA 1YB1A 2Y66A 3BMNA 4M89A 4BS9A 3S55A 1MX3A 2JAPA 3ZWOA 4ZQGA 2I9PA 4QUKA 4WLFA 1PS8A 2WM3A 4LGVA 4FBGA 3W4JA 1ZMTA 2ZYGA 4DRYA 1EUCA 1Y9AA 5HBRA 2X5JO 3FPCA 1P31A 1U2DA 5KOIA 5G0VA 4R4JA 1H6CA 1E5QA 4Z9XA 3VOSA 4J9UE 3E18A 1N7GA 1VRWA 1AUPA 1N9GA 2E48A 3HHPA 5B1YA 1IPFA 1NQAO 3OA0A 2JFFA 5IXYA 1VL8A 3LLVA 5BSGA 2B5VA 1PL8A 3GRPA 4BKPA 1X0XA 2WEKA 3G3EA 4OIMA 1P1FA 1XKQA 2B5WA 1B7GO 3NTQA 3L6EA 4FC6A 1R37A 3G49A 3IIEA 4QO7A 4R5HA 1CQIA 4UUOA 4CLRA 4OSPA 3MOGA 3GFBA 3Q9NA 4HV4A 3M2PA 4YJDA 2X6TA 4ZQHA 3DFZA 4NH4A 1HDZA 4MKXA 3WX0A 4YAGA 1DFHA 5FF9A 3RFVA 4CV0A 1IB6A 4CL3A 4LMRA 4JNKA 3PHGA 3EC7A 1NWHA 2B69A 3P5SA 3DTYA 1DC3A 1T1RA 4B7XA 5F5LA 4B7CA 2VYVD 3VZRA 5K6AA 4DQXA 4NJMB 1QG6A 5JCJD 5TS3A 4FGWA 2IRWA 4WLNA 1JKJA 1VKOA 4B79A 4EUEA 4BO3A 1U9JA 1C0IA 1UZMA 4U0JA 2E4AA 5LDGA 2CDCA 4HFRA 2DTXA 3PVZA 4Z3KA 2BI8A 4K9DA 3OECA 1E6UA 2Q50A 3MCVA 1KVRA 4CQLB 3GVHA 4BGEA 1I36A 1PJ3A 3M2TA 5BNTA 4M1QA 4OOEA 3AW9A 3ZV5A 4HUJA 3FRJA 5JDIC 2IODA 1VI2A 4CMAA 2PZJA 2R00C 2AA3A 1NHGA 5CG2A 1Q7BA 4J43A 1KVQA 5CAEA 1E7MA 3ZHXA 4KQWA 5IFLA 1LSUA 3D4NA 2OXIA 1LSOA 4NFHA 3DBRB 3HZZA 4A73A 4RVUA 1T2DA 3PJFA 4JN6B 2DVMA 4R1NA 4PZCA 3ZI0A 4EITA 4B4UA 1PZFA 1E3SA 4OXKA 1BXGB 4IGEA 2RBEA 3HUDA 4IZHA 2XAAA 2EGHA 2GD1O 3AOGA 1Q2XA 1I3MA 3JSAA 5G0SA 3QP9A 5FWNA 4IIUA 4K6FA 1VJTA 1GZ3A 3W8DA 5KJFA 3ZV3A 3M6IA 3BIOA 1GV0A 4E30A 3HDYA 2H5LA 1P0FA 1RKXA 2DC1A 3DB2A 2B4TO 4CODB 4Z0PA 3QA9A 5THKA 2XF8A 1BMDA 4ZGWA 4HWKA 1QMGA 4MVJA 1LEHA 2DFVA 4QO8A 5A9TA 1SAYA 2HMTA 4J3FA 5CP8A 4BNJA 5DCUA 2BFPA 2B83A 3ON5A 1UUFA 4TZKA 1KY5A 3E8XA 1HF3A 4C4OA 4PLYA 3ZU4A 2P9CA 2C7GA 1XR3A 5A3VA 5JC1A 4C7KA 1YE3A 4JJIA 4NMHA 3IOYA 2JD2A 5B37A 1U3VA 2DAPA 3HADA 5JO9A 4AJEA 4Y9DA 3RUAA 2YFHA 3PWKA 4XQ9A 4BIIA 5JDCA 2VQ3A 1RJWA 3E9QA 1E3WB 1J0XO 5TQVA 1EK5A 2AQIA 2Q1SA 2EJWA 1IL0A 1E5LA 4CMGA 1H93A 2AEJA 2I66A 2RHCA 1KYQA 3IJPA 3C7AA 3VTFA 1Y8QA 2AE2A 4J16A 4XR9A 3UHAA 3NKLA 5A06A 3E48A 1U7TA 1IHYA 3PYXA 4Z0TA 5DZSA 4JXKA 4XRGA 4WK6A 3KSZO 3RVDA 4CLEA 2NLOA 4EUHA 1V8BA 4UUMA 3IP3A 2EEZA 2O7QA 3JQFA 3DBVO 2QG4A 3I9NA 4MIYA 1SC6A 3VH2A 4BQPA 4CUZA 4TVBA 4PLVA 1NASA 3DQPA 3WGIA 3W1VA 5IN4A 4A10A 1H2HA 3PWZA 2GR9A 4BV8A 4YAIA 4YXFA 3IDSA 2IZ1A 3UCFA 1P1JA 5B12A 1S7CA 3JQCA 1Y8RB 1YL7A 3GEDA 1HT0A 2OO5A 1W73A 4BNTA 3F5QA 1VSVA 2OBNA 2B36A 2CDBA 2C07A 2J6IA 1HL3A 4P8RA 4UAGA 5JAQA 4EEXA 4QFDA 1R4NB 3BMCA 1U3UA 3LC1O 4TVOA 3RROA 4XQCA 4GGPA 2NQ8A 1EK6A 3CMMA 3GPIA 1E7YA 1D7OA 3JQ6A 4DWVA 4I5FA 4IUYA 2PZKA 1SEVA 1I10A 1WDLA 1EVIA 4WKGA 3SJUA 1HZJA 3CZMA 3FNFA 3OJLA 3FTPA 5K6AC 1L1FA 1D1SA 1S6YA 1NQOA 5EMHA 4TRJA 4XGIA 1QYXA 3AWDA 4I08A 4BOYA 1E77A 4HFJA 3S2GA 1E6WA 3SJ7A 1KEUA 2VRBA 3OIGA 4RVDA 1B15A 1ML3A 1YOVB 3NUGA 3WFIA 3CXRA 3O9ZA 3HB5X 3F4BA 3BA1A 4DIFA 3ENNA 1Y81A 3GLQA 4NDNE 1PIWA 1UZNA 4Q3CA 2WJPA 2Y93A 3ZHZA 4CL8A 1MB4A 2OZPA 4MOWA 3IC5A 1O89A 3JQDA 1GADO 2D5AA 3K30A 5IF3A 2Y99A 1DLJA 2EG9A 3FR7A 3O38A 1QRRA 4XYLA 1PWXA 1T2EA 2X7HA 3DZFA 5JCJA 2FMUA 4YEDA 3PTZA 1C0LA 4FOOA 4BL5A 2NSDA 1BW9B 3OQ6A 4I5GA 4QQRA 4D42A 1ZUD1 4XX0A 3AI1A 3RUFA 1PSDA 4WCFB 4J0EA 4AJ2A 1P0CA 3L77A 4IDEA 3PGJA 3R1IA 2PTGA 5FYDA 3S1LA 1DLIA 3A14A 4AVYA 1GCOA 1KEWA 3DDNA 1QYWA 3AI3A 1UJMA 3K92A 3JQBA 2O3UA 2QRKA 3V5NA 4CMIB 1B8UA 1DIAA 1QORA 4IMPA 5TT1A 3C8MA 4YRDA 2HDHA 4NJMA 4HX5A 4NIMA 5GZ1A 3AUAA 1YWGO 4IDBA 3EZYA 1EZ4A 3MJSA 5KCZA 1PGJA 2X9VA 2PA3A 4H15A 3ZGYA 3GG9A 3WLFA 3KVOA 3BXXA 1GAEO 2DBQA 2YHIB 1DJNA 1L7EA 2WE7A 3QWIA 3VPXA 1O8CA 3WBBA 5EINA 4CQLA 4DPKA 3W6UA 1MFZA 3V1YA 3V1UA 3VKUA 2BLLA 1MFPA 3JD4A 5KIAA 5JDCC 1KVSA 3Q2KA 1GYRA 2VUUA 1ZEMA 4MVJE 2VOJA 2GDZA 4GSLA 4HNHA 1D4FA 4RVHA 2E6UX 3SXPA 5GY7A 2RHRA 5JAIA 2TMGA 3DBRA 2D2IA 3B20A 3NV9A 3OJFA 1GQ2A 2Q3EA 1PJLA 3KZVA 4M54A 2HU2A 2BH9A 4J7UA 1K6IA 2Y0DA 1BXGA 3L6OO 4YRBA 3VH1A 4EI2A 5DNAA 3GNSA 2Z95A 4L4RA 3HFGA 4R1TA 4R3NA 5DT9A 5DBIA 4E13A 2C29D 5G0UA 1EVZA 1VLLA 4G65A 3LVFO 3MJTA 3VPSA 5A5FA 4FS3A 4OOFA 3JQFC 2AMFA 1UXGA 2AEFA 2C82A 5JS6A 1EMDA 1LI4A 1X7HA 3TZKA 3UICA 1XSEA 3EHEA 5IDXA 3C7CB 2W98A 3DMYA 2YFQA 2P9EA 2UVDA 3V2UA 1X7GA 3ADPA 4XB2A 1HDOA 4J90A 1YQDA 5ICSA 1K0UA 3OICA 1F14A 2ZB3A 3AJRA 2HMWA 4J9VA 1YJ8A 5HS6A 4WE3A 4OQYA 3K6JA 4L9RA 1Z74A 3GPDG 2PWZA 3RU7A 1Y9EA 1GEGA 1LDMA 2ZTVA 1R16A 4PVCA 5GZ6A 3B70A 9LDTA 2QZZA 3H9JA 3CUKA 4O1MA 5TF4A 4XQGA 3I6IA 3SC4A 4Q3BA 1HXHA 3D7LA 2PGDA 4YWJA 4OH1A 4ZN6A 1ZJZA 4L4XA 4GX1A 4IS2A 3DAGA 4PLHA 5TJHA 1E3WA 3E9NA 4NU6A 3F5SA 7ADHA 3RI3A 2J3IA 3TZ6A 1EFLA 3PIIA 5F1PA 5LCXA 3AOEA 5JC8A 2IE0A 3HDJA 3KSDO 4J6FA 3RAJA 3KHUA 2BGKA 1CERA 2GPTA 1I0ZA 5L53A 1A9YA 4YA6A 4IDAA 4DLBA 1PJ2A 4ND4A 4E5KA 4Z9FA 1MUUA 4PZDA 3K31A 3DBLB 3U4DA 4E5MA 1KBZA 1IZ9A 1UP6A 3W6ZA 4E2ZA 3LT4A 5I9MA 1M2WA 5B4TA 5KKCA 2F00A 4E2WA 3G1UA 2GGSA 2O4CA 1M6HA 4L73A 5T8KA 4NZ9A 2DPHA 1NXQA 3BTUA 4NR0A 3U9LA 5MGBA 2EERA 2Q99A 3KV3O 4IDDA 4KP7A 3EAGA 3H65A 3I3OA 2ZTLA 4BNLA 4CLDA 3W4IA 1Y8RA 2E49A 3VTZA 1DB3A 1N1EA 4JX8A 1HE3A 4OXNA 4I8XA 2JCVA 2EP7A 4LCEA 1W6UA 3DOJA 1T2AA 3AY6A 1R4NA 3TL2A 5JY1A 3TJRA 2ZIZA 3WTBA 1LX6A 3PFFA 4NJOA 4ZJUA 5JPIA 2Q2QA 1NPTO 1M76A 1Q0LA 4RO0A 1ZSNA 1MXFA 4MVJM 5T6BA 3PEFA 1A4IA 4ALJA 2X0RA 3KBOA 5EQDA 4KTVE 3JQBC 4MINA 4F3YA 3PJGA 4FC7A 4E33A 1K5HA 2AE1A 2GZ3A 3ROKA 1E3JA 1OOEA 3M1AA 4II3A 1WW8A 3FI9A 1F17A 1AXGA 1ZSYA 4FFNA 3FNGA 1XQ1A 3SBOA 1K3TA 3TN7A 4WLOA 3Q6IA 4RDHA 3PGXA 4ZICA 2VUTA 4DC1A 1LTHR 2E37A 3RJ9A 1YB4A 5HM8A 1CEQA 1PZEA 1YOVA 2JFHA 4R41A 4DPMA 2Q2VA 4GL4A 2VWPA 2EKQA 3NDJA 3GN2A 4S1VA 1O6ZA 4IXWA 1HZZA 1UZLA 3RBXA 4XGKA 1QKIA 3ADOA 4X54A 4DQUA 3L4SO 5L4SA 1K6JA 1BVUA 2VZ9A 4FGSA 2I6TA 2YW9A 3GF4A 3OFSA 3PHLA 2I99A 1E6EA 2DBZA 5IDYA 3WNQA 3C1AA 3D3WB 2NV6A 5TT0A 5CEEA 4CV1A 2G82A 4WCDA 3KRTA 3CH6A 4IQGA 4WUVA 3QRWA 4Q9NA 1BW9A 5AYVA 5JAMA 3GA0A 2RIRA 4KUGA 3QY9A 1TI7A 4DMMA 2Z1MA 2PGLA 4CM1A 4NNJA 1PS0A 4WCFA 2QW8A 4PG5A 4YJGB 3EDMA 5ER6A 3RC2A 4P4NA 3ONFA 4IPTA 4AJKA 1NVTA 2WSBA 3S2IA 5ITWA 4BNZA 4PRKA 1P1HA 1XELA 4ZQBA 4DA9A 3CINA 3GUCA 4W9NC 3FBTA 2BFOA 3L4BA 1FDUA 3KO8A 4QT0A 4Y6PA 1MG5A 1B0AA 4CMIA 4CLHA 1FJHA 1HLPA 1AXEA 4GWKA 2NUAA 1EBUA 1PJQA 3FPLA 1GPJA 1E7RA 3G1TA 4GMGA 2CDAA 1ADBA 1I2CA 3V8BA 2ZCVA 4G81A 1ZW1A 4YAEA 5BNFA 2W2LD 5KTKA 2BF7A 5KJ1A 3SLGA 3CIFA 2UDPA 2YHIA 3KYCB 4OQZA 3H2SA 1EBFA 1LRJA 4LMPA 4JGBA 3S2EA 1U4SA 1E7SA 4OYRA 4RJTA 1SOWA 3U49A 4BVAA 1YO6A 4YTEA 3JQ9A 2DM6A 1KY4A 1GZ6A 1DIHA 3V2GA 4NBTA 4CJXA 2X0IA 4XEHA 4BO2A 2VHWA 4B7UA 2R2GA 3AOEC 1DFGA 5JNLA 2FZEA 3ITDA 3NYWA 4WGGA 5JFOA 1HETA 1Z82A 2HLPA 3KYDA 2BI7A 3ZWPA 4XYBA 3ZWMA 1U28A 4XR4A 2GZ2A 3GZNB 3HJAA 2FZWA 4R5MA 3S8MA 1XEAA 3DFUA 4R16A 1M75A 2HCTA 2ZQYA 5DP2A 3GG2A 3V1TC 3HN2A 3WYCA 5HTOA 4UUPA 5G4KB 1A9ZA 3H9QA 3VVCA 3IKTA 3F1KA 2VHVA 2DTDA 4UEJA 2X22A 1LQUA 5T8KC 2CNBA 3UKOA 4BNGA 3B1JA 3QWAA 2V6MA 4IZIA 2GERA 2HK8A 3TPCA 5F1OA 4RCVA 3WGGA 3KEOA 4J7XA 2FPGA 4TWRA 4U7WA 2IDZA 5KJ6A 3TOZA 3DEYX 4RQUA 2ZYDA 1UAGA 1O95A 1ZJYA 3FD8A 1U2GA 4D3DA 3OM9A 5IJZA 5DOZA 3RJ5A 4TMFA 4BQRA 2Y1EA 5T67A 3FHLA 4MKZA 1KEPA 4F6CA 3MTGA 2EKLA 3PP8A 3FBGA 4WASA 1HYEA 2G0TA 1KEVA 4GSKA 4CLXA 4TRNA 1PTJA 2HK7A 2JL1A 4L74A 2V6BA 5IZCA 1ZK0A 4ID9A 3JYPA 1P9LA 3K2EA 2UV8A 2IEBA 2NACA 1NYTA 4XIYA 4CMEA 3VKVA 3N7UA 3WIEA 1XDWA 2AQKA 3QIVA 4LISA 3WLEA 1DIBA 3DL2A 2X0NA 2P4HX 2VYND 1PJTA 5CDGA 3PJDA 4KZPA 3T4XA 5F1KA 1E3LA 5L95A 3DBLA 3FNEA 1QYCA 3OMLA 4L8VA 1GV1A 1TXGA 3I9MA 4CM5A 5AQ1A 5BSHA 4I1IA 2B4QA 4J4BA 4YT4A 2HJSA 3OEYA 1E3IA 2WYVA 2C54A 4E4YA 2R6JA 2W4QA 3DBHB 3K96A 1MV8A 2AG8A 3C24A 1ZKMA 3K2BA 2CVZA 2HKIA 4CM6A 1N1GA 5A05A 3LT1A 3WGHA 3WGTA 1PQUA 2QQ5A 3QJ5A 3NJ8A 3I9JA 2UUOA 3Q1LA 2W8ZA 4U6QA 5CEJA 4IJVA 2FR0A 4XA8A 5JAZA 3DZJA 1NR1A 4OHUA 1YBAA 1B8VA 1HE4A 3GOHA 3H4VA 1WLYA 3CTMA 4B4OA 1MXHA 5COQA 1UDCA 3PPIA 3GVCA 3BHIA 1I3NA 2A35A 4GWGA 4OL9A 3ZW9A 4MVJF 3BHJA 2VTDA 1P1RA 1OMOA 4CR8A 1ADGA 3RFXA 3QWFA 4RPKA 4DLLA 1DC5A 3GMSA 2CY0A 2FY8A 3QW2A 1C14A 4B8ZA 3Q9UA 3PDUA 2DU8A 1JAXA 3I9OA 3U3XA 1Q7GA 3E1KA 4LSWA 4NFYA 1EE9A 4DMLA 4J2OA 5H82A 4RVGA 2D59A 4XYEA 4XJSA 2FPIA 1WDKA 2EIHA 1GL3A 3QQPA 3WXBA 4ZQEA 4E5NA 3P7MA 3G17A 6ADHA 3NGLA 4J0FA 4IMRA 4RV9A 4ND3A 1NX6A 1PX0A 3JQ9C 1I3KA 1NVGA 2C20A 1B2LA 2AXQA 3P2YA 4D45A 1YBMA 3HN7A 3X2EA 3PHHA 4ZRMA 2I76A 3HNPA 4WNIA 3D3WA 1HSZA 5A9RA 2D1YA 4II2A 4WEQA 3WTCA 1O0SA 1KIFA 1LNQA 2HQ1A 4NK5A 5T5QA 5C3MA 3ST7A 2W2LA 4PVDA 4UREA 4F45A 3ZDFA 5I7SA 4DXHA 2P2SA 4CM8B 1U5CA 4YJGA 3D0OA 1P1KA 3JQ8B 5TC4A 1A4UA 4J1TA 4AL4A 1YL5A 4HADA 3TQHA 2GLXA 1DHTA 4TKMA 4N7RA 2WTBA 3NJ4A 4RDIA 3LDHA 4AJJA 1P44A 2QRLA 3DZHA 4R9RA 1KERA 4BNFA 1GFSA 3ETGA 4BB6A 2Y0EA 3BTOA 5DBGA 3A28A 4OAQA 5JMPA 1VE9A 2HO5A 3GVIA 4JK3A 3GHHA 3LQFA 1XQ6A 4R69A 2RAFA 1BRMA 4ZHSA 5THQA 4BO9A 4IS3A 2GCGA 3ROQA 2Q49A 3KYCA 1LC0A 3MOIA 3WICA 1QSGA 2DUWA 3DZBA 3N58A 1HDXA 1LDGA 1PU2A 1P77A 2XOXA 1GEEA 1H94A 3PXXA 3QHAA 3LU1A 5TJ9A 1T2CA 2VUSA 4CUKA 3ORFA 4DBZA 5CDYA 1B14A 4R9SA 1BHSA 1YBVA 2DBVO 2ZJ0A 1DSSG 1RM0A 3DC2A 2UUPA 4FFPA 3JQ7B 4PLWA 4MDHA 2OFPA 4YVFA 3N74A 1T24A 4EJMA 1LDBA 2I3AA 5DULA 5HA5A 2NVUB 4CM4B 3G0OA 1QR6A 3PWSA 4NI5A 2NNLD 2PKRA 5G4KA 4OMUA 4E0BA 5C7OO 5C5IA 3R3SA 2J5RA 1HLDA 1KC3A 2W2KA 2PLAA 3ICPA 5I8ZA 2HAEA 2O50A 4BNIA 3ZV6A 5FEUA 1IE3A 3H9EO 3TOXA 2PY6A 3LC7O 3KOUA 4CMCA 4A26A 1ZCJA 4PG7A 2VYNA 3LLSA 4A2CA 2EW2A 2VWGA 3LSYA 1RYEA 1RWBA 3GZ4A 2FWMX 5AXDA 4DIBA 2C59A 4RVFA 1T4DA 2PKQO 2VN8A 4BNMA 3GRKA 2EV9A 1ZZEA 1VSUA 3GVPA 1LA2A 5L9AA 3E6AA 2WMDA 4NBVA 4EJ0A 5TNXA 3KLPX 3E5RA 1AE1A 5JE8A 1CRWG 1HTBA 4MP6A 1ONPA 3H8VA 4UVEA 3QE3A 1PGPA 3WSWA 3TDKA 3KEQA 2PV7A 3GGPA 3DHYA 2GF2A 3RSHA 1ZIDA 5EIOA 2RH4A 2X5OA 3HDQA 3KB6A 1OC2A 2OP1A 4JJFA 4RF3A 1RM4A 5G2OA 1QV7A 1N2SA 3QVWA 2ZB8A 2QIOA 4K1LA 2VHXA 1GY8A 3BTSA 4Q3EA 4ALLA 4DREA 4OM8A 3OHSX 3DR3A 4E5PA 1DHRA 3F4LA 4YPOA 1YS4A 5CDTA 1NM5A 2EKPA 1DXYA 3MJCA 2W90A 2OOSA 1D8AA 3CKYA 4P4LA 3DBHA 3T4EA 4K28A 4KTTE 5I8WA 4B3HA 4TROA 1LDYA 1V3UA 3FN4A 3A9WA 3ANLA 1MGOA 2HJRA 1B16A 3KTDA 4J7CA 1SB8A 3C1TA 1ISFA 3MEQA 1JKFA 1NAIA 3DOOA 1ISIA 2NU9A 5U1PA 3ZU2A 4JJGA 4MPDA 3RASA 2Y1OA 3H5AA 4YACA 5L51A 4D3FA 1W4ZA 1P33A 1Z75A 2O3TA 4HBGA 1IULA 1WMAA 2D8AA 1YONA 3ZWCA 5TRTA 3AY3A 1ENYA 3PRJA 2FSSA 3UVEA 4LVUA 3STHA 4WNCA 3ONEA 1ZMOA 3WYBA 3CE6A 2X4GA 3FWZA 3RD5A 4RPLA 2ZQZA 3ZHYA 1U7HA 4PLZA 3C3XA 3C1OA 4WPGA 4FFMA 1LRLA 4XCVA 3ZNOA 2X8LA 3EW7A 4I9NA 5CFZA 1EDOA 4FCCA 4XKJA 1T26A 1V35A 4LRSB 3TSCA 1GUFA 2RCYA 1ARZA 1JQBA 3C85A 3X2FA 5EERA 2BELA 2OBYA 4HXYA 5G0WA 2JFGA 2CVQA 3Q0EA 4D3SA 4TRMA 1UH5A 1XGKA 2FR1A 3I6QA 4DUPA 4QFCA 4JCOA 5AXCA 3U5TA 4RORA 1P45A 4FJ1A 1C1XB 2DKNA 5KWEA 3RUCA 4JLWA 3RC7A 3VDQA 4BV9A 2C2YA 3ETDA 3JQAB 4CM8A 4K26A 1MC4A 1V6AA 1SNYA 4YT8A 3A1NA 1JLLA 3JQ8A 4PLPA 2A94A 1ZNQO 1JA9A 2OMEA 2BHLA 2BFMA 5DOVA 4EEZA 5TX7A 1GQQA 3GNQA 5KVVA 1R0LA 2IEDA 4CV2A 2AEMA 2ILTA 1WDMA 1NFQA 4BNVA 4GKBA 4LCJA 3GDFA 4HNGA 4NHEA 4W6ZA 4TRRA 5BQFA 4MP8A 4IDFA 5JW6A 3TZQA 2VCYA 1Q0HA 4TSKA 1EQUA 3ZWXA 4Z9YA 2O2YA 1U5AA 2JHGA 3E9MA 2V65A 1NPDA 4OSOA 1GR0A 3EY4A 3VDRA 1PQWA 4B4VA 1IY8A 1C1DB 3OJEA 3JTMA 5U4QA 2GUGA 2BKAA 1LRKA 1FDTA 5ENDA 4A7PA 2DQ4A 5A9SB 4UEKA 2GO1A 3OIFA 4N54A 1MG0A 2VNAA 1GUYA 4GH5A 3EVNA 4J2HA 2O7SA 4YB8A 3ABIA 1ISMA 3I9LA 2BGMA 3OSUA 1F0YA 3ITKA 3CMCO 5ER9A 4BHTA 1QLJA 2B0JA 2P9GA 3JYQA 4PLCA 3PZRA 4XDZA 5H83A 1LLDA 3DWFA 3JQ7A 2V7PA 4WOKA 3W8FA 3MWEB 1CJCA 1JWBB 3HDHA 3A4VA 1LC3A 3NAQA 1TA4A 2JCYA 2NVUA 4CM4A 1HE2A 3LZ6A 2EHDA 2ZJ1A 3PYMA 4U8GA 4GBJA 4DTIA 4ESOA 4E2YA 3D1LA 3WB9A 1YQXA 5L45A 4BB5A 1OC4A 3WQSB 4I9HA 5T57A 2H9IA 2CD9A 2IZ0A 2YY7A 3GAZA 2YHUA 3GEGA 5EESA 1X15A 2PH3A 4N5LA 4Z3DA 4TZTA 1I2ZA 1OBFO 4PG4A 2OUIA 3VZQA 1XU9A 3NGXA 1WNTA 5JMWA 1X7DA 2P5UA 3AUTA 2IYPA 3D4PA 4O59O 4YR9A 4FPXA 1PJSA 1E3EA 3IUSA 1ZK1A 4CPDA 4CMBA 1O94A 1PGOA 1HDRA 3DHEA 5ENVA 5C7IO 4YRAA 7MDHA 1PJCA 1QV6A 3FNHA 3GFGA 1E1NA 5L7YA 2ZB4A 4IXTA 3ZCXA 4YDRA 3T7CA 2PD4A 2X0JA 3ASVA 4ZU3A 3BMQB 3L9XA 2AG5A 5B4UA 4NBUA 3NRCA 4GLLA 1PS9A 3BMOB 2Z1NA 1VC2A 1VL0A 2A4KA 2CSUA 2Y05A 3ROMA 3HQ4O 4M87A 4LN1A 4ND5A 3JQGB 2BD0A 2AHRA 1B3BA 3RQSA 2QZ9A 1DRVA 2WYWA 2EP5A 4GQAA 3C7DB 4I9UA 4IBOA 4IQ8A 1BWSA 3MJEA 2B4RO 3LC2O 2BRUA 2OL4A 4QTZA 5IG2A 2QYTA 3CPSA 4M86A 3TWOA 1L7DA 1ENPA 3AY7A 3AFNA 5HS4A 3TNLA 2ZTUA 1VJ0A 1TT7A 5DN9A 4XIJA 5L4LA 5DCYA 1XHLA 2Y67A 1LQTA 2Y1GA 4A27A 3GY0A 2ZB7A 3JV7A 2QYSA 4KUHA 4ALMA 4FN4A 1ISHA 3GUYA 4D0RA 3UFXA 4FD3A 4UVIA 3FCOA 5U9CA 5BSEA 3ASUA 4EW6A 2Q1WA 2O3SA 4GMFA 1LSJA 3DO5A 1XU7A 3I4FA 4AJNA 2HMVA 3P19A 4FSHA 5EL0A 1LJ8A 5IDQA 5TSDA 5C7LO 1G0OA 1HE5A 2POQX 2OORA 3DOCA 3LT0A 2FRDA 2H6EA 4Q3NA 1A7AA 3WGYA 4IJWA 3WS7A 4LK3A 4G2NA 3HSKA 4G5HA 4KOAA 1X1EA 3L0DA 3ZU5A 2I67A 5COAA 4CQMB 4MIOA 3GHYA 4D7AA 4OKIA 2O4UX 3AI2A 2G1UA 3CZRA 4YQYA 3VAZA
chains in the Genus database with same CATH superfamily
4LZWA 2BISA 3UUWA 5B57C 4FR0A 1UPTA 3PFCA 2O8DA 1DINA 2H00A 1P7PA 3F4KA 5EJ9A 1QDUA 3IP8A 4IIYA 1T25A 2VWHA 4FW8A 2Q5QA 4ARSA 4HX9A 1U6JA 4B7ZA 5JPDA 3TIVA 4D41A 1KNQA 2IOFK 3VHRA 4NFLA 3JZIA 2XPCA 1JU9A 4K6GA 4MR9A 5FX2A 1WETA 2WP8J 3TW0A 2R0QC 4BXOB 3RRNA 3DE7X 1NYQA 2PLRA 1GG9A 4KLAA 2YZGA 3IT2A 1KQFA 3K1TA 3QXGA 1GFIA 1IEQA 3AFHA 3BSSA 5F76A 1K2WA 3IPRA 2DHEA 4FDLA 4HGZA 1EA7A 1XZGA 3H7AA 3IHTA 3QH4A 5A4JA 3UXHA 4CIYA 2JGMA 5FWYA 2C5HA 1C7IA 4RMIA 1N75A 1E2PA 4ZAZA 1RABA 1HRDA 1SOVA 1Z5NA 2BFBB 2EJCA 2WNSA 1YXMA 3FRIA 3SKXA 4KNVA 4U6SA 3W3AH 4YRIA 2DT5A 3OBBA 4IO0A 3M1YA 4NK4A 4Q00A 4ND7A 1YCFA 1VMIA 4GXNA 1DO0A 5A5VA 2BSXA 3NATA 3RC1A 2IEZA 2X9NA 2P4QA 4KQXA 4M0DA 1T3TA 1YRLA 2BKLA 1RKQA 4WY5A 4Y2SA 5KTPA 3IV6A 1SXPA 2FW6A 3JD1A 3ZCQA 3TLGA 3LUBA 3ZY2A 2NM0A 4M98A 4QXAA 4EGJA 1P1IA 3DHNA 5AQEA 1CUVA 1PKEA 2P0EA 4EJFA 4FFBA 3AQ4A 4X60A 3UGJA 2QLNA 2CCGA 2QPAA 4AKEA 2FPPB 4BMZA 3ZE8A 3WE7A 5THXA 5A04A 2WNHA 3BE5A 4IWNA 3H1BA 4OMCA 4JEUA 1I14A 4RHTA 1QMPA 1WXHA 3I2IA 3LQYA 3LY7A 4FDAA 1I30A 5ALRA 4GXTA 3PFBA 4EFMA 4U5XA 1JILA 4OI4A 4Q4JA 4DCOA 3IEUA 1UPCA 2VNSA 1LLQA 4BV2A 1I3LA 3ZWVA 4JL6A 5KVSA 2Q1UA 1C1DA 3HP4A 2ZBEA 2ZWPA 3PDJA 1IBLB 4CCSA 1ZCAA 4BNWA 3WMRA 1S2IA 1SO8A 1ENZA 2XMZA 4O02B 2IXGA 3JZMA 4H27A 4P2BA 1Z2PX 2NV0A 1ZUNB 2P6NA 5K4GA 4HXEB 2JLZA 4LRWA 2P1ZA 4LYEA 4GNRA 2AD1A 2K6GA 4GKJB 3AF2A 4MVXA 2ATEA 1ONOA 1SQSA 2VRCD 3GJXC 3FOWA 3G0BA 2ADMA 4LVCA 5E0KB 3DZKA 3ZLBA 4BASA 1U0NA 4B3TB 4XARA 4Y2YA 4KN9S 2WWIA 3FFXA 4MS4B 3GDHA 1R18A 1TD9A 4FZRA 2DFLA 1JNYA 2CYCA 2C2KA 2EZTA 2OK7A 4D0NA 5I4IA 4RJ2A 4CIWA 3PQCA 3V42A 4I99A 3WMXA 2A6PA 4CKCA 4D6PA 1QYDA 2CZCA 3X43A 3ZG6A 4B3GA 3F47A 1S7GA 3RAFC 2CDRA 2VEOA 4EJ6A 1E60A 1EM8B 1WA5A 1KMMA 1OCEA 1QE3A 1TQDA 2FPWA 1K4MA 1VMEA 2N46A 4R2JA 4F6LA 1ORVA 2G5GX 3HJFA 3HXPA 2B94A 5IANA 2Q5LA 1KDRA 2BRUC 3CCCA 3HB0A 4GR4A 4QDZA 3VR4H 4U7DA 1ND5A 5A4AA 1YC5A 3D02A 3SHVA 2O6LA 2F48A 3R5JA 4OQMA 1EE2A 4RETA 1CPYA 5LBUA 5JYEA 1TC2A 4NE7A 2XE8A 3T9EA 4NJEA 1E5XA 3DF9A 1Y9JA 2Z56A 3QWHA 1EJ6A 1PZNA 1XF1A 4MUIA 1T6ZA 5DYTA 5GGYA 5GMOA 2O2SA 3C8HA 2ODAA 2DE0X 3IDZA 4YT2A 4HH1A 1G98A 3BSWA 5HF6A 5AKJA 5KOHB 2AVNA 4F91B 3DLHA 4NYJR 1EP3B 1I01A 3FIJA 2P65A 1GU7A 3SC6A 2BZ0A 3UK1A 2GJ9A 4UVHA 4EA9A 1C7JA 3L1JA 4RK4A 3GPBA 2KQUA 1JIUA 2WI8A 4G4JA 2GCNA 2Y1CA 3W2GA 1NW3A 1VP3A 2PSSA 2UZ3A 2XDQA 2Q7DA 4BO4A 5KX5A 4RTJA 2BDUA 1OHHA 4EUFA 2BKXA 5JYDA 4XM2A 3VR1A 1KDVA 3AEQB 1FC0A 1ZM9A 3G6WA 3AIKA 5AM2A 3SDBA 2ZREA 3BMQA 4IQ0A 2DT8A 2G4VA 3MTJA 2OWDA 4Y67A 3RUDA 4WFQA 3OCWA 1FMJA 3O4FA 1E7WA 2W6ID 3ZCTA 3SY8A 2REQB 5A3SA 2O2XA 5M2QA 3UAVA 1JI3A 2DBYA 3EEQA 4ZOLF 3U80A 5A1TA 1Q7CA 2HI0A 1H9AA 2Z4SA 3KQVA 3TE7A 3S8YA 2XKKA 4TKLA 6NULA 1NHWA 3JQGA 2OBFA 3NALA 4QRHA 3U4HA 4F2PA 2XZOA 2LUOA 1GAJA 3PQEA 4OI1A 4QXMA 1SUFA 2MWMA 4MUAA 4TMTA 1RJGA 1YKFA 1ZU4A 5DBFA 1Z6PA 4ZRNA 2FPOA 1JR3D 6GPBA 1U8FO 2ZAMA 1LK0A 3ABQB 2AOVA 3PXBA 4QSMA 3ZKWA 1A4XA 3SR0A 4OHVA 3Q3GE 3SDSA 4HQOA 1KQPA 3CVJA 2XUOA 3DZDA 3MWDB 4PYMA 3EF0A 5AJZA 3FR8A 4BZQA 4DM7A 4E15A 4BEWA 4DDTA 4BMYA 4TL6A 4R1PA 2IPLA 4E3ZA 1P4RA 4QWMA 4OU4A 2NU6A 1Y6ZA 3ZY4A 1QHGA 5J4HA 1WJGA 3LPNA 8LDHA 2OSBA 5JCXA 2HZBA 2O7VA 3JYOA 4BX0A 3ZLVA 1EX6A 2ZUEA 2JD1A 3SEAA 1T8SA 2PH1A 1D7AA 3UYLA 3B3QA 2C9ZA 2WA1A 2VHEA 2YV1A 3OAAA 2GN4A 5TEWA 3WMWA 3ZDDA 3TKYA 1GXSB 4A1OA 4FKBA 3PD7A 1F0KA 5EIEA 3MN1A 4JHXA 1Q83A 1M8JA 1KORA 5EJ6A 3RFVA 4E3WA 1B0PA 2K2QB 3FDZA 4RIGA 2P3QA 4TMXA 5L4NA 3IO5A 1ZRSA 3KZOA 5EMLA 5U4XA 4AKGA 3AUUA 3I4CA 3Q72A 4I4CA 4LOJA 5ALHA 3U7JA 1SRQA 1WVGA 2NU7A 4GM1A 4ALKA 4Y2VA 5EPEA 1RI3A 4RVSA 1BGWA 1BHO1 3UJ6A 4CQMA 5JHGB 1U8AA 3EBOA 3ZWBA 2OCBA 1EUDA 3AF0A 3SM3A 1WHSA 3TEFA 3LUPA 2IH2A 1QFSA 1K7XB 2Q2NA 4DGSA 2E87A 1KR5A 4GBMA 5IVPA 4GIBA 2A0UA 1VQ1A 5AW2A 1ABEA 3D0RA 2H1WA 2I33A 1RRVA 4CIBA 2AG6A 1AG9A 1F8FA 3UCXA 4OAPA 4GGOA 2IS4A 3HCRA 1URPA 2OWEA 1RM3A 5LN1A 2PZMA 4GVXA 2C9OA 5EKDA 1XNGA 3TMYA 2R1VB 4OBWA 3TG2A 1R0SA 2VSFA 1VBMA 3MGBA 1B6TA 3NM5A 4JJAA 2WJAA 2C0CA 1YV9A 4PNZA 2ACWA 2DH5A 3UM9A 4ENUA 5L6LB 1Z12A 4EGCB 1Q16A 3EMKA 2XXJA 4BNUA 1O0CA 1OLXB 4TQGA 3W5JA 5AVSA 4EG3A 1G42A 4R1SA 2E3JA 3TKLA 5LQSA 4CGZA 3LI2A 3LYAA 3TSOA 1TJ3A 3EYWA 5IXSA 1H2RS 2PT9A 3K0HA 1AB6A 4NCKA 3AP3A 3A26A 4KLNA 1EGMB 4PO3X 3SFVA 3A6PC 1NFFA 2FSVA 3QPUA 1JIVA 4JH0A 4OJKA 4RZHA 4TS9A 5BVHB 3PLAE 3E3OA 1IOLA 2RHLA 4ZIRB 1FVXA 5FXMA 2PS1A 4LZJA 3CT4A 3L9WA 2WJIA 2ISCA 2VLIA 3KKPA 3I37X 2WD8A 3ZDRA 1R3UA 2JVJA 1WAMA 1YIAA 2GNAA 1XMOB 1WXQA 1T36A 1JWAB 3MIZA 4IJKA 1MU0A 5EKUA 1OZHA 1TFRA 5K0TA 3GIDA 1M2JA 1N5MA 1ULSA 2YNMA 2QTZA 2YRXA 2BZSA 2QMYA 2JBAB 4WSOA 4X1YB 1YS9A 1P9RA 4Q9IA 3B1KA 1JSZA 2D5BA 4ESEA 1G7RA 4KVAA 3IIMA 1BYIA 3B38A 4TLBA 3K8QA 1N92A 2Z0MA 4ZVPA 2WYIA 1FDOA 5BNIA 2G28A 4ENVA 3G2MA 4H16A 3BSYA 2LWIA 3GJQA 5LP6F 3G0HA 3HCAA 4CE6A 2GCOB 5E95A 3ZWYA 1KWGA 1EEHA 2ILVA 4QUAA 3IUPA 4QM7A 1JFRA 2NYAA 3EDOA 5AHOA 2H0RA 3ZNNA 1P5RA 1N33B 1UC9A 4I2NA 4KITB 3AEKA 3LOPA 1XJWA 4TL8A 5LL6P 1UEJA 4IEIA 5IXJA 1NVKA 1BS2A 4KWIA 3TLYA 5I01A 3C87A 2A30A 2QT9A 1TAHA 3I92A 2BGUA 1TYEB 4XJVA 1KYZA 3C39A 5D00A 2N75A 3ANSA 4BNDB 4CCYB 1R7RA 2FW9A 4I3FA 4ARIA 3AF5A 1ZUHA 1KGDA 2WVGA 5HIIA 1FYXA 5LFAA 4S3MA 1I80A 2AC2A 4NBWA 4NFSA 5D84A 1KFCB 3LHKA 5FNVA 3OF2A 3W3ZB 1FSFA 3AK4A 1NP7A 4PONA 4LZAA 1G2OA 2WK1A 5LC1A 4UFPA 3F73A 2NZYA 3UW3A 4IX9A 2G70A 2Q46A 1DBSA 1GGVA 4G0OA 1UAYA 5ERGB 1YFLA 1OV4A 1YKSA 1DCMA 2XUIA 4GC9A 5C7YA 3VV3A 5CLIA 1O94D 1LDNA 1OVMA 2H4ZA 2IZ7A 2PD3A 4W99A 4LE2A 1U3GA 5EIBC 3RTEA 5JWHA 2GN2A 3L7AA 3UV3A 1VLMA 3Q2OA 4FE7A 2GYYA 4LW8A 4PR0A 2Z83A 1CS4C 4UDYX 3CLRD 3VR3D 3LBNA 4Q3AA 1PFYA 4J49A 4MTCA 2HBZA 1SXJB 1XCMA 4RK1A 1J07A 1TB4A 1R4MB 2DPXA 2JCXA 2YVQA 3KOMA 2AJCA 4PYQA 3T5MA 4AG6A 4RMNA 3REQA 1EK1A 4PFJA 2JK0A 2D4AA 3GFPA 4AY3A 1XK7A 4US1R 5LU8A 1TTPB 1E5VA 2DY1A 3B3JA 1ZK2A 3MTQA 4GVPA 4LZZA 2B2NA 2QTNA 3IXMA 3LDFA 1JALA 3RI3A 4LQDA 4NYMQ 3A1FA 3B6JA 5HWSA 2K7ZA 2CD7A 5EJ5A 3GWGA 5L40A 2QX7A 3U09A 3EUWA 1VJDA 3DTTA 3P94A 3PLRA 4GMXA 1SG9A 5LMNB 4MX8A 3V34A 2WWXA 4XFJA 2R11A 5F51A 3M4YA 2JIOA 5I7EA 4JC0A 4PIMA 4AZ0B 4C6SA 5CFQA 1YVRA 4BKQA 2BKUA 4ZV7A 5KOJA 1E4OA 3L4KA 1E63A 2WTMA 1PR1A 4RPGA 3ZE1B 3W2FA 1BU8A 3KL4A 1TZJA 2CHVA 2IHZA 4I55A 1NQ5A 3IDOA 2NTEA 3I58A 1MC5A 1QOZA 2C9YA 4KG7A 5AVYA 1BKYA 1OAOA 2Z3ZA 4M9RA 3LP6A 4FIZA 3RIYA 4KKVA 1YRWA 1JEEA 2VNKA 4NPCA 3S4YA 1P7ZA 4OQEA 2F1KA 2QKYA 3IOBA 3CH5A 5DW0A 1CZOA 3OX3A 1RXWA 2F17A 2IUSA 3TIFA 2O48X 3CRRA 3NPAA 1E99A 3DP7A 2HF8A 4P92A 5J5CA 3PHBE 1OI4A 3WHKA 1D03A 1FFWA 1IBCA 2J6BA 2WF9A 4JQCA 4PG8A 2IA5A 2FLWA 5H9VA 1CDEA 1B6RA 1CRLA 2H4WA 2RHOA 3BZUA 5FI5A 1B43A 5JADA 1OWOA 4ZHQB 3HWX1 1Z4JA 2WYOA 3QVJA 4X24A 1TK3A 3WL3A 4ZA2A 5JO0A 1M73E 4GX5A 4JLJA 3ZWKA 5ALUA 3WGQA 5JLAA 2V7QA 2XT0A 1JDUA 1B93A 1PR9A 3LX6A 5K9ZA 1H0KA 1X14A 1T29A 2JKVA 4O4JB 1FMCA 1Z6AA 3U9SA 3PIRA 4HXGA 3VYWA 1WG8A 2JRCA 1EDZA 2XCIA 3Q2IA 3NCHA 4NZNA 2QUAA 2KBFA 1YC2A 4RHEA 3SLRA 4YX9A 3S7TA 1KZ1A 1WXGA 1W5EA 1WZUA 2CFRA 4JR2A 1FB5A 2OYCA 4B2LA 1KRXA 2XF2A 2Q07A 4BVHA 1A9QA 4E4TA 4NECA 1QC5A 2P5YA 2E1PA 2YXNA 4JLAA 3UC9A 1VMKA 4B6FA 5JIBA 4LYDA 3HEBA 2IU0A 3VKHA 2V7XA 5KKAA 3O8BA 3ULKA 4UDOA 4DV4B 3WI7A 3V8EA 4JODA 3LH5A 2B1QA 3I2JA 3MGGA 4CMKA 2ZRGA 4XDGA 3JVUA 3TD6A 5C34B 1W0CA 4J1QA 2KPOA 4Z6KA 5ADHA 5HHTA 1C1HA 1UC4B 2R8BA 3LY8A 5AOCA 1N3BA 1PJ4A 4PW0A 1F8YA 3F67A 4R6XA 1XLTA 3TRJA 5I48A 4DPLA 2BFCB 1F9AA 3N8KA 4IW3B 1KI6B 1Z0FA 4EFDA 3IB3A 2I1QA 3E8SA 2BEWB 2Q1TA 4WK2B 1AUVA 2GN8A 3H6KA 4XGRA 1HT2E 2GZRA 4ZVVA 3RVQA 5DTEA 3UXEA 5IAJA 3UB2A 3ETJA 2WD7B 1LBIA 4GKVA 4Z53A 2AW3A 2CV2A 3MCWA 4OBBA 2PJDA 4S1NA 3T4UA 4BFSA 4YJHB 2PMFA 1XVIA 3LKBA 3GT0A 1HYGA 1J8MF 1GL7A 1WP4A 2PN1A 1DWOA 4QBKA 3FIUA 1CULC 2OQIA 3VR2A 4B74A 2B2XA 3U40A 2IS1A 4O6VA 2Q0XA 2J9GA 1VL6A 1EYZA 1ZFNA 3CGGA 1I8TA 3NEPX 3R0IA 4L16A 2CMGA 1I5RA 3C5CA 4FOSA 3HBLA 3UCEA 1SIOA 1ID1A 1GPNA 4KMSA 1UOQA 3O8QA 2K4MA 1FP4B 4KK4A 2F3TA 4WXEA 2TYSB 4ZREA 3P71T 4EKEA 1JW9B 1AC5A 2B92A 4H7KA 1SC9A 4V38A 3ITNA 3WJAA 5JCZA 4AWXA 5FOQA 2YBDA 3TRDA 2HA5A 2R96A 3K35A 1KI2A 4GAEA 4N0EA 1G6KA 3D64A 3ZW8A 1C0PA 4E6PA 2ZSJA 5CG1A 5JCPA 4LFBB 3KZ1E 2QL9A 1DIRA 1E1CB 3DMTC 4IYRA 4HT3B 2FN9A 3BMNB 1RPNA 2WWFA 4Q7LA 1JTVA 3TJMA 1NYLA 2DBRA 3DZGA 1WO8A 3FX2A 3RLFA 2YV3A 2DOKA 3HCDA 3PR3A 4XM1A 1TEZA 1KAMA 3EBLA 3CZ9A 2KS6A 1W6RA 3E3NA 3QLUC 1FU8A 2QR2A 4HNAA 3ICWA 4TLDA 3IQDB 4GI2A 3GOQA 1E8MA 3I1FA 3AV0B 2EJTA 2YDYA 2YN2A 3WOHA 3W2TA 2X3YA 2BJHA 4Q1VA 3WSVA 5JARA 1S2LA 2OG1A 3N75A 2HL6A 2J7KA 2QVYX 4PEVA 1FXWA 2H2GA 5KWIA 5K6TA 4C7OB 2O20A 2Q2WA 3RT9A 4URWR 5DTIA 3EC2A 1N9GB 1UKBA 2WE8A 5T64A 1R0RE 3FYUB 3JWPA 2YASA 4F3TA 1WTCA 3G9ZA 2P62A 5C32A 2DPYA 1PZGA 3KJZA 2YFYA 3T5BA 1KO4A 1N2XA 3ANNA 3MAAC 3NBAA 4I19A 4E7OA 3FW1A 4PAWA 4FZJA 5IM4F 1BTOA 4MV1A 2XSZA 3P0RA 4HLDA 4MJ3A 2PYIA 2Q3BA 1R66A 1Q12A 3Q3VA 4FW9A 3ZDYB 5A5DA 4BNHA 1PGQA 3I9V1 2HF7A 2HRBA 2CFCA 4NMWA 1JPUA 2VP3A 4R54A 3HWRA 3PF8A 1C4KA 1M6EX 1XCPA 1Z17A 2ZIFA 4H4EA 4ASUD 3E5MA 1JEAA 3C41J 4D5GA 1X0VA 4TMYA 2HNBA 2PS0A 4F92B 3BXZA 4LJ5A 3C6QA 2DUUA 4F6RB 3WQRA 1U7ZA 1PZHA 3LYLA 4WDQA 1QPBA 2I8AA 1XB2A 2NWQA 4R3WA 3THXA 1BU5A 1VG0B 2XY4A 4LJKA 5TR9A 2HM7A 1NMEA 5ITVA 1NC1A 4DE5A 4X3PA 1E2IA 1XQYA 4A3SA 4AJ1A 1UXKA 4YO8A 2ATCA 2WZDA 3QLJA 4JP5A 1E1LA 2OZKA 4JUFA 3RYIB 4BBJA 4ER3A 4KLRA 1KS9A 2Y68A 3UMMA 2CMKA 5JZOA 3GEBA 1U31A 4AICA 3EVFA 2OCPA 1OPRA 4PNHA 2HRDA 1I32A 1KJIA 2AWOA 2KJQA 3OPYB 3QEMA 4JC5A 3U4MA 1QANA 2EW8A 4ROSA 4C4XA 2WFLA 1R0BA 5F77A 4LEIA 2O54A 3OIWA 4Q7KA 2P9FA 4A0SA 2CLOB 4OJQA 2GYVA 1P7CA 2I4NA 5EP4A 3ZK9A 3HL0A 2YZKA 3MFYA 1RHKA 3MT0A 3R9WA 1R50A 1HQCA 1V4VA 2FETA 2ZIVB 4I1OA 4LNUB 4Y98A 1N32B 5HJEA 4IWXA 3FJOA 4A91A 5BVGA 1BDMA 3KHTA 2RGRA 1DT3A 3E82A 4BAUA 2D2FA 3DXYA 4RPHA 1D07A 1ZDMA 2XHZA 4ZC8A 3IEKA 1WUHS 1FJGB 1Z68A 2AZ4A 1YZ3A 1BWRA 1YFZA 1ZD4A 3KUXA 3I1JA 1SD2A 3BEOA 2X0FA 1G5IA 1KJYA 1WZNA 3KYBA 5SYMA 4ZFNA 5I7FA 4L6AA 2XDYA 5KWVA 1RKVA 3JYHA 3SXUA 1JA0A 1SBHA 3HO1A 4AY2A 1NFRA 5EHNA 3IAM6 3KE9A 4H9GA 4MO9A 4ENPA 3VH3A 3AHIA 1T6BY 2VAVA 3CR8A 3TZHA 2Y3IA 3FFWA 1GUAA 4Q6BA 3MWFA 4OO3A 2VC2B 1NAHA 3PDHA 4K40A 2MCFA 4F5ZA 3SQWA 3SYLA 5ALXA 4YMUA 5B7QA 2QUJA 4MROA 4GP9A 4Q19A 1R15A 2LGJA 2QRHA 5AXAA 2UVPB 3N5KA 2VJAA 4OY3A 1OTXA 4KHZA 4JB2A 4PCLA 1V1RA 3GDGA 5F78A 4AZTA 1XROA 2X14A 3JAWA 4XWYA 5EPOA 1GZ4A 2APJA 3TL3A 3VPGA 3HKCA 4HWOA 2CWDA 1EZ1A 5D3QA 2C5FA 1EHCA 3PPVA 3INGA 4FZ3A 2ID4A 1L5GB 2M6SA 2FLKA 1DAOA 2VJMB 2XMRA 3VO8A 4GC5A 1WY5A 4V24A 4AG5A 1F2DA 4N47A 4ZZ3A 5K8CA 1A2QA 2C5LA 1OFIA 4UNPA 1E4VA 1E1MA 4HDKB 4Y2GA 3WFJA 3RJMA 3OQ1A 4DGQA 5DEIA 1FXSA 3PXUA 1U0SY 1JEQB 1HT3A 1X7ZB 3N2KB 5FCDA 4PSCA 5JS2A 2CBZA 2YQ4A 5ESXA 4HFMA 3W34A 4EK9A 5HZGA 1O9BA 3G2NA 1MO6A 5HDQA 3U56A 2QU8A 1P5HA 1E92A 1MEOA 3PNLA 221PA 4AROA 3AU9A 4D92A 5LYJB 3FMOB 5GGXA 2OCDA 5CVEA 1CZHA 5DM60 4CR7A 2ZI3A 2OHXA 3ZJVA 5E7QA 3TI7A 1WCXA 2DFNA 3LXXA 1WSWA 2BM9A 5IMBA 2NO0A 2OAEA 3P9QA 4FMPA 5DM2A 5FUYA 3NHRA 2FR8C 2PSJA 2PSDA 3ZBPA 3QUAA 5AVOA 5BN5B 4NLLA 3VR5D 2Q5IA 5H59A 1FYFA 1GZUA 3E3AA 4L2IB 4N0DA 3VGJA 5LJIA 4KQEA 4RLHA 5LLTA 3G79A 4FQ8A 5REQA 5ABPA 1L5FA 3E4DA 3ZTYA 3QEJA 3AM4A 5EKXA 1U2QA 3EUAA 4FNGA 4L7QA 5EP1A 4AG3A 4EGFA 3IXLA 4QJ3A 1DEOA 1LLCA 3COSA 5E9AA 4BKUA 2FSUA 2ZAGA 3QNWA 1YQGA 4WA8A 2IEGA 3UJPA 1CD5A 1D2CA 1BD3A 1KMCA 3PX2A 1WXIA 1ULBA 2YYSA 4RA6A 1HMYA 4EI9A 5FUVA 1DBPA 1K5DA 4BUZA 1JDBB 1HUQA 1M2KA 1WUTA 2OM6A 2X13A 4WK4B 3T41A 3PD0A 4B0PA 2ATVA 2WTEA 1CFZA 4RF4A 2XVAA 2IV2X 4F4FA 4C0KA 3D3EA 3G2QA 4F06A 1UMCA 2JNWA 3E1SA 2H2WA 5JUWA 4MQFB 5EWJB 4P7FA 4YJFA 1IN8A 1XRNA 3EWNA 5IPFA 5A9SA 5IARA 5K0CA 4P5DA 2QTMA 3DV2A 3TQSA 2OA0A 1YIDA 4KB5A 3QJGA 4OK5A 3ZVNA 1Y0BA 2GJSA 1T43A 1DAPA 2O0JA 4PS1A 2CB0A 3PDWA 3WLKX 4XWWA 1IQUA 2PXAA 3DW3X 4OXYA 1CG6A 3GQVA 1DAFA 5HZKA 4NNPA 1TD1A 3MQ2A 2IYOA 2VSOA 4UVGA 2ZSUA 3AEXA 3EVTA 1H1DA 2CNNA 2P2LA 4ZALA 3SHFA 1THMA 2IX3A 3I04M 2C57A 4F72A 3ZXSA 3W5BA 2VJDA 1Q77A 2XYVA 2PK3A 3G02A 4DLWA 3OETA 3PFWO 4YMVA 3RK4A 4URUR 2UUCB 3OI7A 4PX9A 1IG3A 1NDQA 1YJBA 2ZT7A 3UQZA 3WZMA 1ETHA 1E9CA 3ETNA 3S55A 1IN6A 5CD1A 2JAPA 3SC2B 2I9PA 4IJQA 1DCKA 4LGVA 2WM3A 1NLYA 2GBCA 3R0VA 5J63A 1RQLA 2CLIB 2W6QA 4BFYA 4F86A 4FWBA 2ZYGA 4JEHA 1EK2A 1EUCA 1DMRA 1H4VB 3ZC3A 2H08A 1RS0A 5HBRA 2X5JO 3QU7A 1P31A 3KEFA 4FGKA 4GM4A 4URHA 1SZCA 3VNRA 1E5QA 1X3SA 2I1WA 3IKMB 3VOSA 5BSTA 4R7ZA 3TTTA 4JKIA 2PLNA 3BIWA 4MWOA 4W5HA 4C0AC 4X00A 2IV3A 4Z51A 3CVYA 3B51X 1XXHA 1OI2A 2CKDA 3DCIA 4TLLB 3HXMA 1HQDA 1K7SN 4HDRB 1IBRA 4JI1B 3STYA 3OA0A 2P78A 5IXYA 5I9IA 3LLVA 2ZRJA 4QPJC 1OZFA 5BSGA 1E1DA 4QU9A 5CW1A 4TV8F 1T2UA 3HYTA 4HAIA 4PC1A 3S2YA 3TFWA 3A6GA 3H1PA 3K5HA 1X0XA 3K9LA 4TUYB 3CWZA 4FMBB 5HILA 4B71A 4YLEA 4YUXA 1A8UA 2R7KA 1B7GO 3NTQA 2XW6A 4FC6A 4KRXA 3G49A 1P4AA 4PYNA 4QO7A 4R5HA 1CQIA 4CLRA 4R2MA 4X7MA 2SKEA 1NUQA 4YH1A 3GFBA 3PQ8A 4ZKEA 3TGWA 4F5DA 1JVNA 1Z0IA 2BP7B 2XGOA 4J0QA 2WRZA 4HV4A 3LP8A 2M9MA 1CHNA 4PGMA 1EFCA 1VE1A 4Q47A 2XMBA 2R3SA 4HAOA 2PMDA 2XEDA 3HFJA 2FH5B 4NH4A 2WHQA 3TOCA 4YAGA 4CV0A 2R62A 4J0IA 1ACLA 1RFLA 1BMQA 1UJBA 1E64A 1NF2A 2YJ3A 3PHGA 4FU0A 1SQ6A 4JU9A 1XV5A 1V8ZA 3OLCX 2AOUB 1PNOA 2O52A 2R4TA 3AL3A 4B7XA 1GKUB 3U7HB 1AZSC 2VYVD 4R1MA 5K6AA 2YY6A 1SCNE 3NBQA 1Y82A 1V4BA 1HLFA 1MHTA 1W5SA 4QGFA 2VH5R 4EEKA 4IIEA 1P91A 4UM9B 3IPLA 4X6UA 3M83A 5K3FA 2ERXA 1MRNA 3B2QA 3PVZA 4Z3KA 1UEIA 2CNWD 2PAFA 3OECA 1E6UA 2HWUA 4RK6A 5M04A 2DQKA 1Y48E 1PJ3A 2GA9A 2CMFA 3M2TA 4IX1A 2MTBA 1EFPA 3AW9A 4XCQA 1AMUA 1UBTS 3N2IA 1SU8A 4RTNA 2YW2A 1XQXA 1VI2A 2PU7A 3C43A 4M0UA 2YWGA 4CMAA 5CG2A 4DDWA 1XVAA 5CAEA 2I1LA 2IU4A 1TC1A 1VTKA 4KQWA 3OOWA 4K8RB 5KHAA 5IFLA 4KR3A 1LSUA 2PRKA 3FHJA 2OXIA 1Q3HA 4NFHA 2Z08A 4TXHA 5D7BA 4RVUA 2EBFX 4WVFA 4L4ZA 4Q1CA 3PJFA 4X20A 2DVMA 4PZCA 3V80A 3I34X 3ZI0A 3QBDA 4B4UA 1E8DA 4H2DA 1N77A 2V5UA 1E3SA 4OBXA 3ACBA 3T9BA 1F9EA 4IGEA 4G85A 2QLMA 3OE5A 5AKXA 4BYGA 1TJ5A 4CF4A 4UTVA 2G63A 4CCAA 3LLCA 3R5KA 4QKQA 2C3MA 2Q3MA 3G9XA 1NF3A 3HKEA 3IEMA 2V9CA 3RTGA 4K6FA 5TPWB 1LJUA 5J4YA 2R25B 4YMWA 2PBRA 1DNPA 2FQYA 3M6IA 4JOCA 2E4ZA 1UCFA 3B13B 4GNKA 1NV8A 1GV0A 4E2FA 1P0FA 1DCFA 3OZDA 4O8CA 1C80A 3ZH9B 1JH8A 5AH0A 3ZS8A 4CQJA 4QLAA 1IAQA 4FVTA 4DSUA 5THKA 4ZGWA 2RAPA 4HWKA 4EHNA 4ES6A 3D4LA 1QMGA 3GU3A 5BMVF 2DFVA 2PBZA 1X80B 3B48A 1FE8A 4DEXA 2MDTA 3EDYA 1CUSA 3L2OB 3K70C 3UBTA 2HMTA 2EFEB 1P1BA 2PEYA 5DCUA 2B83A 2C1ZA 2Z8ZA 2O19A 3ZXIA 1VPVA 2GEKA 1EH5A 3DTVA 3MT9A 4PLYA 1QP7A 3KUDA 1C5KA 2ECKA 3N0WA 5A3VA 3E2MA 5JC1A 3JQQA 1YE3A 4MMXB 3PR1A 4WNYA 1V11B 3IOYA 5F7XA 4M9SA 4RM3A 3M4ZA 4C21A 5FLKA 1SBTA 3QA3E 4Y9DA 3RUAA 4V0ME 4XQ9A 3CPJB 1KH3A 4P3NA 1JHYA 3WBJA 3NWBA 1C4XA 2YINC 4XPIB 1KMQA 4XVRA 5TQVA 3ZGLA 2AQIA 3CX3A 4Q9HA 3TLAA 3K1AA 1NW8A 7REQB 5IJAA 2ZM5A 3ORQA 4WWHA 4YRPA 1W5AA 4CG2A 2AEJA 2ZZKA 3TIXB 5K0JA 2P3SA 4YALA 1KYQA 3O3OB 5M5BA 1WCWA 4HZIA 1Y8QA 4EIWA 1O96A 5SY6A 1TVMA 2GLTA 5D3MA 2AE2A 2P75A 3KWJA 4XR9A 5JCOA 4BLRA 1XA3A 5A06A 5LSAA 1YTUA 3HABA 2I62A 3DB1A 5IM5A 4Z0TA 3U48A 1HLGA 2RHGB 2VXBA 1VGQA 4WK6A 5HKKD 1BZYA 3L6RA 3KOWA 1ODJA 3AR6A 5LXTB 3U3MA 2AJ8A 1SKBA 1V8BA 1YJ5A 5IU6A 3JVDA 4FSDA 3Q7TA 3JQFA 1D6JA 5FWAA 1FU7A 4CUZA 3NP7A 4TVBA 4U7TB 1LPPA 1U1GA 4PLVA 1H3EA 3WJ2A 3DQPA 3MVEA 4Z4CA 3EXG2 3W1VA 2VA8A 5IN4A 2VHQA 3S5UA 1GWNA 5K0FA 1H2HA 1SCIA 2Q29A 2VRWA 5F2EA 3EDCA 1SVIA 1BQEA 2JIZA 2WHPB 1JRLA 1KSFX 1S7CA 2HWKA 2Q7XA 2V5VA 2WLSA 1YL7A 5E8JA 5EKTA 5IX8A 2X1VA 3KK0A 1FZQA 2P0YA 1T9AA 4CCWA 1KI3A 1JBKA 1VSVA 2B36A 4UAGA 2J6IA 2WAMA 1HL3A 1WPRA 5JAQA 3NVKI 2YR0A 5AVQA 2X5NA 3FDXA 3RROA 2NG1A 2RH9B 3GJ3A 4GGPA 1IHOA 3U7QB 1E7YA 1NU6A 5IW8A 3BXHA 4N9QA 3WGJA 1DX4A 2PZKA 2F3QA 4KV9A 3GFVA 4F04A 4UMEA 3R75A 1SEVA 4V0OA 5JQGA 1L4EA 1NZDA 5EHXA 3TLXA 4OQ4A 5EWMB 1HZJA 1EFDN 3E9EA 3BSFA 3CZMA 1ZJ5A 1UT6A 3MWLA 3TR5A 1L1FA 2V7VA 2QRVA 4EHAA 2JJMA 1DS6A 1WV1A 2WD9A 5I47A 3HA3A 5K5EA 2AFHB 1UM8A 5EMHA 2PGIA 2Q3DA 1QYXA 4TRJA 3ZI4A 4F7DA 1ZVJA 5I9SA 3WIOA 5AK0A 3HY6A 4M7PA 4QICA 4HFJA 4N0QA 3FSGD 4O2BB 5BYJA 4GR5A 3SS8A 3D6VA 2QMOA 4RVDA 2JIQA 3ABOB 3CXRA 3O8OA 1DU4A 2JF0A 3ENNA 3DMPA 1NLMA 1R6UA 2ADOA 1UMDB 2J0EA 4NYIQ 4XD7A 5FI0B 2RB5A 3H83A 3LCMA 2VQ6A 4OUDA 3TD2A 2QRZA 2Y93A 3AKYA 4BQEA 4AKIA 3ELBA 1IWOA 5KYXB 3ZHOA 1XCLA 2AFIB 4ENWA 2D5AA 1V43A 3COPA 3K30A 1E3QA 2IL1A 1ZU5A 4X0EA 5ED0A 5IF3A 2FHPA 3JAKB 3I73A 1JTEA 4JL5A 4P5EA 2OB2A 4IWYA 4D9MA 1T2EA 5EP3A 2QAGA 2FMUA 3ZJYA 2J9XB 2OE2A 1YZYA 1H8EA 1DPFA 3FKSA 5KC8A 1QH8B 4ZQIA 3PTZA 5KNCH 2PBLA 1BW9B 1FFBA 1P60A 2QVCA 2PSHA 2BPOA 1ZUD1 3A1DA 4HI0E 4EABA 3AI1A 3ROTA 3RUFA 3G85A 3NVDA 1HH4A 2JPDA 1ZIYA 5CX1A 5AP9A 3C4VA 2QN9A 4NYMR 5DJ5A 1T1JA 4IDEA 3R1IA 5DNWA 3ZDEA 3PEWA 2PUAA 5FYDA 1RIFA 2NO7A 1DLIA 2YJ4A 3A14A 3VBCA 4RELA 5EGNA 1HR0B 1O2DA 2C2GA 3U3JA 1GNQA 1Q7EA 2A86A 2RBKA 4IHJA 1UJMA 5CYPA 4A4DA 3ISVA 2R60A 4Z8XA 1CVRA 5ALFA 4CMIB 1DIAA 4ZMBA 3WL8A 1S0UA 3ZBQA 4DY6A 1D8TA 2HDHA 4NJMA 1QTRA 3L7LA 3MCAA 2BT4A 4IDBA 1OXMA 4W8OA 4HS9A 5JSZB 1JH9A 3EZYA 2VJCA 1E89A 3C3MA 1GVHA 2Y92A 3MJSA 5KCZA 1PGJA 2X9VA 2DHDA 4H15A 3OZCA 1XVUA 3WLFA 1CZLA 1S3IA 1RYZA 1WPXA 3CA8A 1GAEO 1Z16A 3KVOA 4P7JA 5ALQA 5DT2A 3NKFA 2QE7D 1N4AA 2WE7A 3QWIA 3FZGA 1OXXK 3WBBA 1RDFA 3NC0C 3PC7A 4S1OA 4B33A 1MFZA 2TS1A 2AN3A 3EHDA 3IR6A 4JT8A 4AYTA 2BLLA 1XJQA 5I5GA 3JD4A 2Z09A 3U3DA 5KIAA 2O1SA 4DKXA 5JDCC 1KVSA 1IUOA 1NKSA 1TNDA 1IM5A 2NGRA 4I1UA 1Z0JA 1ZEMA 2VUUA 1S02A 4MVJE 3S70A 5I3ZA 3MW8A 2FSVC 4GSLA 4N12A 1ZAYA 5EFZA 4YRNA 2ZUCA 3EE6A 3OLYA 4RVHA 4R40A 3SXPA 4I0WB 4DCVA 3L8MA 5JAIA 3TAUA 2D2IA 5AJXA 4RENA 1FX1A 3RODA 2Q3EA 2H4FA 1RADA 3OE4A 2IPNA 2XKJE 5HF5A 3BRWD 4M54A 2HU2A 3P1JA 4J7UA 3P52A 4YRBA 1BXGA 3L6OO 4MV4A 4IFIA 5F98A 5EZYB 4L4RA 3HFGA 1OX4A 4CMJA 5DHPA 2ES4A 2GD6A 5IP5A 2QL6A 4G65A 3UENA 3QFRA 1ZD8A 4O2RA 2ZWVA 4Z99A 5EYPA 5A5FA 1U0RA 1OH8A 1YUBA 2AMFA 4X90A 2CV0A 2C82A 5FBZA 4Y2PA 3F71A 4RD1A 1X7HA 3UICA 5GM2A 3EHEA 2D1RA 1P29A 2H2FA 1TQ8A 2W98A 3L0OA 1A9SA 3VDXA 2P9EA 1HNXB 4J0KA 3V2UA 1AQNA 5BUQA 3ADPA 1IEWA 1QE0A 5FA8A 4J90A 4HYYA 2A9QA 4FFBB 2ATXA 4N9WA 4ZOCA 5KYUA 3OICA 3A31A 3D2CA 3IPCA 3AJRA 5JOQA 1HI9A 1GPKA 3MBIA 1KYYA 1M74A 1XI2A 1W96A 1Z74A 1L3CA 2DULA 2PWZA 4O4IB 1H1TA 3ACDA 1LDMA 1UQTA 3KCQA 3QLVA 2CNDA 2ZTVA 1BXRA 2XNDD 9LDTA 2B8JA 3H9JA 4O1MA 2NZXA 4RE6A 2JA1A 3CF6R 1U8UA 4L5JA 4LXUA 1YQQA 2XNKA 1G5RA 3BWXA 4X6XA 3SC4A 5HG0A 3G5TA 3U31A 2PGDA 4YWJA 4OH1A 1CUBA 1QZXA 2CDNA 1K8YB 4GX1A 1AQIA 2GJAA 1KZGB 4QQ8A 1E3WA 3E9NA 4CF3A 2VRNA 1UT5A 3G2JA 2NXCA 3PIIA 1G8AA 3CG0A 2DERA 1Z2AA 3CB2A 3RAJA 3HDJA 4EM6A 3GJYA 1ODCA 2BGKA 5P21A 1CERA 2YVAA 1I0ZA 2YFKA 3AEUA 1HOXA 2PRSA 1P4SA 1UJ5A 3DE6X 3GGCA 1D2RA 1Q5PA 3EXHA 3ONWA 4DARA 2V3CC 1QHIA 1I7LA 1YE5A 1JIIA 1ULTA 3EXIB 2EQ5A 1L8QA 1L8XA 1ZIOA 3DBLB 2FZVA 3CKMA 3ELWA 1C7QA 1BQ4A 3DL0A 5CH3A 5IMSA 4AXXA 2PSFA 4X91A 5E2AA 1OFUX 4AYXA 1TRKA 2NV2B 3DVLA 4Q34A 5I9MA 2IYAA 5L3SA 5LQRA 2F00A 5M34A 2C9DA 3U81A 1CY6A 3B8HA 3IOEA 5LZ7A 4WZBA 1LV7A 5H02A 5H9WA 2FJUA 4DG8A 4YCCA 4ZVTA 1A8HA 5C1DA 3GGDA 4J03A 2OAGA 4JJ6A 5MGBA 2BFFA 4IDDA 4QBGB 4YRCA 4KP7A 2F9FA 4G37A 1P73A 4A2QA 2GRJA 5AICA 3EVDA 4G8JA 1Y8RA 4E11A 1S2DA 1SHKA 2W48A 2ZS8A 2O5EA 4I8XA 1UBGA 4X41A 3RVOA 5EIWA 2R5FA 2JCVA 1HNWB 2PX3A 4NJEB 3U9TA </