1XKQA

Crystal structure of short-chain dehydrogenase/reductase of unknown function from caenorhabditis elegans with cofactor
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
272
structure length
272
Chain Sequence
PRFSNKTVIITGSSNGIGRTTAILFAQEGANVTITGRSSERLEETRQIILKSGVSEKQVNSVVADVTTEDGQDQIINSTLKQFGKIDVLVNNAGAAIPDAFGTTGTDQGIDIYHKTLKLNLQAVIEMTKKVKPHLVASKGEIVNVSSIVAGPQAQPDFLYYAIAKAALDQYTRSTAIDLAKFGIRVNSVSPGMVETGFTNAMGMPDQASQKFYNFMASHKECIPIGAAGKPEHIANIILFLADRNLSFYILGQSIVADGGTSLVMGTQAHDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Short-Chain Dehydrogenase/Reductase of unknown Function from Caenorhabditis Elegans with Cofactor
rcsb
source organism Caenorhabditis elegans
molecule tags Unknown function
molecule keywords short-chain reductase family member (5D234)
total genus 104
structure length 272
sequence length 272
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1xkqA00
1UXKA 3ZV3A 1O89A 2QW8A 5F1KA 2YYYA 3F5QA 3CH6A 2EF1A 3H9JA 3QVWA 2WEKA 2XPCA 2VCYA 3E5RA 3V8BA 1JW9B 1MUUA 1SCUA 5BSHA 2NVUA 3M6IA 1JDJA 4ND2A 4PLHA 1VPDA 4AJHA 4FIZA 1R0SA 4KQWA 3FN4A 1U1IA 1E77A 3FTPA 4UUOA 5DNAA 2G76A 2GNAA 1GQYA 1I33A 1R0LA 2YZ7A 1LUAA 1PS9A 2VQ3A 2H63A 3GK3A 4Q3EA 4RL6A 1YDWA 2WE7A 4OGWA 4RV9A 5G0TA 1JKFA 1A71A 5KWEA 4YT4A 1LQTA 3SEFA 1Z73A 4L76A 1RKXA 4KP7A 1W6UA 3WBBA 1Z7EA 3EAGA 1ENZA 4RGBA 2FPGA 4WPGA 2Z1NA 3BAZA 4ALKA 4J1QA 3K8ZA 3AFMA 2NVBA 3PEFA 2X5KO 2OMEA 3JYNA 2WTBA 3M2TA 4R1NA 3TOXA 1IY8A 3IP1A 3HG7A 1YBAA 3GG9A 4XGIA 1KVRA 2QRJA 3Q3CA 2Y0DA 1MFPA 3DBVO 1T26A 1MXHA 2B36A 3L9WA 1RM0A 2YDYA 2C54A 4YYZA 2GGSA 3AW9A 1I0ZA 3H9UA 3DC2A 4YQZA 3I4CA 3MWEB 3KSZO 4TVBA 2GSDA 3JQ7A 4AJIA 4CL3A 2J5RA 2ZTMA 4J4TA 2EGHA 4QTZA 1T2CA 3AM3A 3JQ8B 1G0NA 3RFVA 1GD1O 3Q2IA 4A2CA 1EE9A 1O6ZA 3O8QA 3WIDA 2D5CA 3KYCB 4AVYA 4DUPA 1XU7A 4B4WA 2OOSA 3HFSA 1IB6A 1ZXBA 4U8GA 1LSUA 3GHHA 5H81A 1DIAA 2AA3A 1ZK4A 1LRKA 1EZ4A 4WLVA 5DBIA 3IC5A 4R5MA 4FDAA 4WOJA 3OA2A 1ISMA 1G0OA 3HN7A 1V0JA 3L07A 5JDIC 4CV3A 3WMXA 2DQ4A 3F46A 2X0NA 1GEGA 5LDHA 2VTEA 3BMNB 2C5AA 1KY4A 5JAQA 3A28A 2JHFA 1YH3A 2AXQA 3ST7A 3FI9A 1Y8RA 4CM3A 1C0IA 3RROA 4AJJA 4IJVA 1Y8QB 1I10A 2DFDA 4GQAA 3WLFA 3WOHA 3R6DA 4W7IA 5C5IA 5G0WA 4E3ZA 3PQFA 3JQDA 5L4NA 2FSSA 2NACA 2ZK7A 2QRLA 4RLHA 4BKOA 2DKNA 5L7TA 4J1SA 1BW9B 3S2IA 4FC7A 2D4AA 4MOWA 1NP3A 1BVUA 1SO8A 1DBVO 2X5JO 5DDIP 4K28A 4M49A 1ULUA 5CEJA 4Q3CA 4Y6RA 2WMDA 1VSUA 3C1AA 3KYDA 4JBIA 3PIIA 5L40A 3PDUA 4EUHA 2GR9A 1T2EA 1E3WB 3NT5A 1JVBA 1HE2A 3ASUA 3ROPA 4YJFA 4AL4A 5IDQA 2DTEA 3RVDA 5JLAA 2GRAA 3RBXA 1IYZA 4CM8A 3T4EA 4JJGA 3PHHA 3VZRA 4YAJA 1HE4A 4B3HA 3E18A 3AY7A 5CDSA 4AJNA 4B4OA 1EUZA 4CMHA 5B37A 2GCGA 2J8ZA 4CLRA 3E9MA 5T57A 1WW8A 4E21A 4YVFA 1SAYA 3PIDA 3BHJA 3OMLA 5DBFA 3WS7A 1XWFA 5DOZA 4TRMA 3SC4A 3RC7A 1YONA 4BNNA 4ZQGA 1K5HA 3FF4A 3QV1A 3WYCA 1PL6A 1GPDG 3F9IA 1DB3A 5JY1A 4Y67A 1OI7A 1ZCJA 3ZWAA 3K2BA 4CL8A 5DP2A 3BMOA 1MG0A 1LTHR 2RHRA 5CEFA 1WZEA 3I6QA 3OFSA 5COBA 1H9BA 4IMRA 5FI3A 2QZZA 3GNSA 3UGKA 1XA0A 1UXIA 2PZLA 3ZWMA 4BGVA 3K92A 2ZTLA 2HMSA 4R3NA 1PGQA 2ZJ1A 4R41A 1BVRA 2ZB4A 3KM0A 2GYYA 3U09A 1HDGO 4DC1A 4ZRMA 5IZCA 5TT1A 3W6ZA 1VJ0A 3DZJA 4U7WA 4ZU3A 4JX8A 2OO5A 4LRSB 1YJ8A 2C5EA 3ZZNA 2X58A 1YRLA 4TRJA 2HU2A 4XWYA 3QIVA 1E7QA 4B7XA 2EG9A 4R16A 4P22A 4AJ2A 3OJLA 4FQ8A 4RVUA 4OSOA 2RH8A 2JHGA 4MVJP 1F8FA 1UDAA 3AOGA 3BIOA 3UKOA 3CINA 1ZK3A 2BFAA 4MVJH 2EJWA 1ML3A 4N54A 4ONEA 5BR7A 3QA9A 1EE2A 4RF3A 1EK5A 3WWYA 3INTA 1JWBB 2VTDA 3DZFA 4PRLA 3N58A 1T4DA 3WSVA 3CMCO 2YHUA 4E2YA 5DP1A 4Y8VA 3NGLA 3CZMA 1C1XB 4J2HA 1O95A 2NNLD 4YJGA 2JCVA 1CERA 2AEMA 4CM9D 3ORFA 1E1KA 2HO5A 5H82A 2PZJA 1GPJA 3DMTA 2OBNA 4NG5A 5ICMA 1Y5RA 3I9JA 4R9RA 4PLZA 5C7IO 1HKUA 4IDDA 4BMNA 3GFGA 3F5SA 1HDZA 1QXSA 4O5OA 1C0PA 3SXPA 4MPDA 3F4LA 3ICCA 3VHRA 2WD7A 1LEHA 3AFNA 2DPHA 3F1LA 4YDRA 1B8VA 4J91A 3OETA 4YRDA 1DFIA 4KZPA 4NFHA 2X9VA 1YOVA 5BSGA 5G0UA 1UAYA 3IS3A 3RUAA 4YTEA 5TSDA 4BMVA 1ENOA 1DFHA 1WXDA 3IKTA 4FCCA 2W2KA 4G65A 3PXXA 2OXIA 1NQAO 4LRTB 4RPJA 3EYWA 1WLYA 2POQX 4XIYA 4QSMA 1Y7TA 4GL4A 2JAPA 4WEQA 3DOOA 2O2SA 4TWRA 4URFA 1HLPA 3ZWOA 1V3VA 2X9GA 4ALJA 3KHUA 4B8WA 1Z74A 1K89A 1OMOA 2VYNA 4RF2A 2AG5A 1I24A 4EITA 3GZNB 3AI1A 4ZD6A 3FD8A 1AE1A 1LBEA 1V3TA 2A4KA 4IZIA 5G4KB 4RO0A 3BMQA 3K73O 2NLOA 1HZJA 3M1LA 2E49A 3QVTA 1IHYA 4MDHA 1I3MA 3C7DB 1O9BA 3GF4A 3JTMA 4UVHA 4Z9XA 1DSSG 3K30A 1LDYA 4J7XA 5AXCA 4F3YA 4LSMA 1GCUA 2DAPA 4E32A 2OFPA 3U4CA 4N5NA 1BHSA 4PLCA 2O4UX 2HJRA 2HJSA 2P4HX 3NAQA 1Q0HA 1ZKMA 1IZ9A 3VVBA 4F46A 4WLEA 4BO3A 3GDOA 4CODB 5IFLA 4PIVA 5C7OO 1UR5A 4R5HA 5ITVA 2B35A 1NAIA 2Q4EA 1YS4A 1U3TA 2JD2A 4M54A 4J4HA 4A26A 1U5CA 5B1YA 3MJTA 1CJCA 1SOWA 2RCYA 4C4OA 2IZ0A 1I3NA 2IYPA 1NNUA 4WE3A 3DZKA 2F1KA 3DBLB 3SX2A 2DLDA 4BS9A 4BIIA 2D59A 5G4KA 1VI2A 3JYPA 3WYBA 1EVIA 2PH3A 4AJ1A 3H7AA 3L0DA 1R4NB 2AE1A 1BGVA 2ZYDA 3DL2A 3DR3A 3JQCA 2VN8A 3A14A 3INGA 4B3IA 4FFPA 2X9NA 3TFQA 5JPIA 1GZ4A 3BMCA 3QLJA 5IN5A 2Y1EA 4DQXA 1N5DA 4YJFB 4RDIA 1NVGA 1VM6A 1AHHA 4WK6A 3WTBA 4DGSA 1NVTA 4ALNA 2J6IA 3HZZA 4RJTA 1Z82A 5ER6A 5I9NA 4ZQHA 2IDZA 1P1IA 2OL4A 4ZRNA 1HL3A 3MZ0A 4CM9A 1KEUA 4O63O 1YJQA 1LSSA 4DA9A 4BNJA 1FDVA 2ZIZA 2J3IA 4LN1A 1L7DA 1V3UA 2HQ1A 1NFFA 4Z0TA 3RUEA 2R6JA 3HDQA 2Q1WA 4I5DA 1Y8RB 4W82A 5EJ2A 1ULSA 4IQ0A 2E48A 2YV3A 4HBGA 3OQ6A 5COAA 1DPGA 4NBUA 2LDBA 2C82A 2VHVA 3BTSA 3PJGA 4PLFA 3D4OA 5U9CA 2A94A 3JQBC 1YGYA 3I4FA 1NASA 3WGQA 3RKRA 3U5TA 3PHJA 1C1DA 3GGGA 2Q99A 4TZTA 4KTVE 2JCYA 1ID1A 2YHIA 5KVCA 3HB4X 4WNIA 4CQMD 4B7UA 1BMDA 2W98A 4PG7A 1I30A 4BQPA 2PH5A 1E7WA 1P3DA 3HUDA 3RC1A 4OQYA 4MO2A 3RIHA 2VWPA 1PJBA 1GV0A 1ZSNA 3KXDA 2Q2QA 2IXBA 3FPCA 4YJHA 3JQ9A 4JLWA 2B69A 3RBVA 3UAGA 4GH5A 1NPYA 1Y5MA 2FHSA 4BNUA 4YAIA 5AXBA 2PKQP 5JC1A 3WGOA 1F14A 4CQMB 5KTKA 4NJMB 4JIGA 4C7KA 3JD3A 3BTUA 4XDYA 2I76A 4J43A 1ENPA 4DPMA 3U9LA 4EUEA 5A9RA 5JC8A 1JQBA 1PS8A 3H9QA 3R1IA 4R1SA 1P1KA 1FDSA 2ZCVA 2NV6A 1YL7A 2B4RO 2UAGA 3JV7A 3JYQA 4J0EA 4L4XA 3LVFO 3ZNQA 1HDRA 2WM3A 3JQ9C 1E5LA 5AXDA 1PWZA 3S8MA 1ISFA 2P5UA 1ADCA 2VRCD 5JCJA 1AHIA 5KNLA 2PV7A 3OQBA 2AQIA 2EW2A 3JQ6A 1DAPA 3TL2A 1IUKA 5EINA 4J0FA 4DLLA 3PZBA 4Z3DA 5G0VA 3T7CA 2AW5A 3H9EO 3QWIA 1D1TA 2DT5A 4NPCA 3WFJA 1EUDA 1PJ3A 1WDKA 2PZMA 3JQFA 4IDCA 4JCOA 4RZHA 3TF5A 3VPGA 4FR5A 4P38A 4LVCA 1C0KA 2YY7A 4IDAA 2C2YA 3AI2A 5ENVA 4JJFA 3ZWWA 5TLSA 4U6SA 1W0CA 3GAFA 4XCVA 1HXHA 2J5QA 5DOVA 4UVDA 2EWMA 3ZNNA 2JFGA 3PRJA 1T2AA 2H5LA 1Z45A 4A03A 4TKLA 3WG9A 2YJZA 2QQ5A 1E3SA 4XEHA 3OQ1A 3NRCA 1A9ZA 5JYDA 3PQDA 4W99A 3SJ7A 1DJNA 2Y05A 1MG5A 4MVJD 4FN4A 4INAA 2CMDA 1WWKA 1OAAA 3LF2A 5EQDA 3TNLA 5CDGA 1BDBA 3FCOA 1X14A 4HKTA 1UZNA 1B14A 1NX6A 3ZHYA 1HYHA 2GASA 2WYVA 4CJXA 3IP3A 3JQ8A 1ZSYA 1EFLA 3VDQA 5I7VA 1A5ZA 3DBRB 2Y68A 3MTJA 5GZ1A 2QRKA 3PI7A 1DLIA 1VL6A 3FNEA 1XCBA 4JJIA 1S7CA 2VT3A 5CFZA 1SBYA 4E2WA 3NTRA 3O9ZA 3GR6A 1A7KA 5G2OA 5LDGA 4WGGA 2BGLA 2VWGA 3HADA 4PG4A 5CHEA 2UVDA 1YBVA 2ZTVA 2Q1TA 1P1RA 4MIOA 1IULA 4YT5A 1N1GA 3H9GA 2HLPA 1YQDA 4D3SA 1P1FA 4KQXA 1GUYA 3DTYA 3PJFA 2RHCA 3TZCA 5JSFA 1BWSA 2CFCA 2G5CA 3L77A 1GYQA 4NDNE 4D42A 2BFMA 1UP7A 2OORA 3MJCA 5IDXA 1JAYA 3NT2A 1LC0A 4NFSA 1Q0LA 3NDIA 2H1SA 2NU7A 1G6KA 1X1EA 3H5NA 1WAMA 4BNKA 2ZKLA 4XGNA 3GMDA 1KEPA 1Q7GA 2D3TA 3ZNOA 5B12A 1QSGA 1YWGO 4NBRA 4U5QA 4X54A 4BNVA 3JD2A 4I5FA 4B7CA 1E6WA 2Y1FA 3G1UA 4WECA 3H6KA 4OJNA 1E3EA 4HUJA 4EEXA 4H3VA 3WGGA 3P5SA 3OP4A 4K9DA 4XRGA 3RUFA 5BQFA 4XQGA 2O3SA 1LSOA 4YRAA 1A72A 5FYDA 4GKBA 3DBHB 4S1VA 4TRRA 3UICA 4FJ2A 3I3OA 4Z9YA 4JN6B 1AN9A 5IAAA 1NBOA 2JKVA 1WP4A 4UEOA 4ZQEA 4AJLA 3HDHA 5DCWA 4NHEA 1M6WA 4YT2A 1NR7A 4HX5A 2FZWA 2PKRA 1ZFNA 1B8UA 1Y81A 2O2YA 4L8VA 3QWBA 8LDHA 1BTOA 5IDYA 1ISGA 4UREA 3W4IA 1EK6A 2I6TA 2JFHA 1WDLA 3FNHA 3BZUA 1R4NA 3HJAA 4I8XA 4YJGB 5TGDA 1Y6JA 3KETA 2PY6A 2B4QA 4F6CA 2GN6A 3PYLA 1HETA 2NQTA 3RASA 1HE3A 2V6GA 1XLTA 1UZLA 2VYVA 5L45A 4WJZA 5TJHA 4NU6A 1E92A 1SZJG 1ZIDA 5KJFA 1YL6A 1GL3A 1P44A 4JBGA 4DIBA 2WYWA 4E6PA 5CG2A 2CVZA 4QXMA 2J3JA 5F5NA 4QUKA 1RYEA 4DTIA 3GG2A 4GBJA 1TT5A 3PK0A 1HSZA 3QWFA 1RM3A 2Y99A 4IJKA 3L6EA 1PEDA 2FOIA 5A04A 2GN8A 1ZBQA 1XQ1A 5ENDA 4JK3A 4OXYA 4EEZA 1UDCA 3WGIA 4BO9A 2FPIA 3I52A 1UH5A 5A05A 3VZPA 1MC4A 3JD1A 1P31A 2BMAA 1KOLA 4AJPA 4Q3DA 4TZKA 2YHIB 1HTBA 5THQA 4BKQA 2EXXA 2OP1A 4U6QA 1GUZA 2A92A 3SVTA 2CF6A 4BO7A 2I67A 4IGEA 3F47A 1WVGA 3W4JA 3GT0A 4NJMA 1HYEA 4YBZA 2OUIA 4Q3NA 1CIVA 4JXKA 5MDHA 4ZICA 3KZVA 2EEZA 4CLXA 3ZWCA 2EP5A 5HRUA 3LC7O 1E3JA 4XJTA 1ZUD1 3H3JA 5C7LO 3AY3A 4MP6A 5TT0A 1X0XA 4WCFB 4KDEA 4WLNA 4QO8A 1DO8A 5JMPA 2E82A 4CR6A 1RYDA 1KIFA 5IDWA 4LCEA 2Q3EA 3TZHA 2EJVA 4XA8A 2YFHA 2GZ1A 2GERA 5ILOA 3BHIA 1VJTA 4WEOA 2V65A 2WD7B 5FEUA 4R54A 4RF5A 2PLAA 4UUPA 2GN9A 3AUAA 4A5OA 2PGLA 3MEQA 2PD6A 4YRBA 1T4BA 4I9HA 1NHWA 2DUUA 4DC0A 1XELA 2NWQA 1D3AA 4JGBA 4NK4A 2Y1OA 2ZB3A 3ZHXA 1GYRA 5GZ3A 1PJQA 3H4VA 4JP3A 1P9LA 3GUCA 2UYYA 4GVLA 1SNYA 4MIEA 2FR1A 2BKAA 4LMPA 4GSLA 3ZGYA 4E33A 3E82A 4YA6A 3PTZA 2CVOA 1B0AA 1CWUA 1XQ6A 1Q7CA 4BO8A 3GPIA 2OZPA 3FTNA 5CDYA 3D3WA 1K0UA 4KTTE 1PL8A 3LC2O 5AYVA 3FPLA 4DIFA 3DTTA 4CM6A 1PU2A 4WLFA 1ZSVA 3IDSA 3GGPA 4CMEA 1YB5A 2IODA 2NQ8A 3B70A 1GUFA 1X7DA 2VHWA 2OP0A 3Q11A 1PQWA 3Q9NA 1C3VA 1LNQA 1V35A 5T8KC 2D8AA 5L7YA 1B26A 1EQUA 3R3JA 9LDBA 2PD3A 4PG8A 3VKVA 5CDUA 4HFJA 4DBZA 4W9NC 4MVJI 2YW9A 4CPDA 3EMKA 1X7GA 4QFDA 1DC5A 1FK8A 3W8DA 4R51A 2IEDA 1MP0A 4ILKA 2BGMA 3WQSB 2DTXA 4PLVA 1V6AA 5DCUA 1S6YA 5AQ1A 1A4IA 4ND1A 2BGKA 1KERA 1FMCA 1LA2A 5JCXA 2VOJA 3MCVA 1U3VA 5A03A 3JQ7B 1ZO8A 3K5PA 3PJDA 1EMDA 1H9AA 3ROKA 4D44A 1ZK0A 1EFKA 3DOJA 3K96A 1R12A 1PR9A 5COQA 3ZI0A 4FPXA 1F8GA 3C1TA 3GLQA 3UHAA 3GZNA 4IIUA 5L3ZA 2EIHA 1ISJA 2Z5LA 5JNLA 2NTJA 1WNTA 4Q9NA 5JFOA 3VVCA 2NTNA 3LLSA 1E1LA 3PVZA 3GEDA 4FJ1A 4ND4A 1FXSA 4B4VA 1ZEMA 3QP9A 3AY6A 3I23A 3FNFA 4XGKA 1O94A 4E5KA 3U3XA 4OIMA 2HK7A 2QZ9A 2NSDA 3INRA 4CLHA 4E2XA 3BTOA 4OKNA 5TF4A 4UAGA 1Z6ZA 4N5LA 2GZ2A 3D5TA 5J23A 4PRKA 3WJ7A 4CR8A 2G0TA 3D4NA 3BMQB 1YOVB 2VZ9A 2VWQA 9LDTA 2XOXA 1U7HA 1PJSA 2DM6A 3S2EA 3H5RA 4M89A 4EI2A 3NJ8A 2BHLA 4Z6KA 3ADPA 3ZU5A 4ITUA 3ZU3A 3HN2A 4II3A 3RBZA 1XEAA 2FN7A 4IDGA 3IMFA 3I9MA 2CSUA 1D8AA 2A35A 1U3UA 1Q0QA 1RJWA 3OJOA 5BNTA 3HWRA 1XG5A 3AUUA 3VH3A 1LLDA 5ER9A 1OC2A 4PLYA 5AOVA 5TX7A 4LSWA 3RSHA 5L53A 2GZ3A 4NI5A 5JS6A 3HHPA 4ALIA 2YV1A 2Y67A 1B16A 4XB2A 4GLOA 3G3EA 1XSEA 4OO3A 2X1HA 4ESOA 4KOAA 1YVEI 3B1FA 1XR3A 3DO5A 4FW8A 5A4DA 4NJOA 1RWBA 1PX0A 2E4AA 3STHA 4GMFA 5IG2A 3OIDA 1QG6A 4Y6PA 3IOYA 4FOSA 5JAZA 3ONDA 1OC4A 3DZHA 4IDEA 4YQYA 4O1MA 2BELA 1TA4A 4MJLA 5DCYA 2Q1UA 5TC4A 3C3XA 4QEDA 3BXXA 3NDJA 5G4LA 4UVIA 4B3JA 4GX0A 5JYEA 3FHLA 4NMHA 5IF3A 2Z95A 3GEGA 3WBFA 1N2SA 2GD1O 3B1JA 3GVCA 4TROA 4Y98A 2EV9A 3DMTC 1YE3A 4BV9A 4ZQBA 3EHEA 5HBRA 3I9OA 2O48X 3VH1A 5L9AA 1HDXA 1LLCA 4YEDA 4D0SA 4E2ZA 1X0VA 4NZ9A 3I9KA 4CMKA 4BO5A 3PJEA 4R01A 3IAHA 5A02A 1A4UA 3JQBA 3PYXA 1EVZA 4AG3A 3EVNA 3MOGA 4HFMA 1ADBA 1IHXA 3DFZA 3KSUA 1I8TA 1DFGA 2HSDA 4ZHSA 3ZV5A 4L75A 3P19A 4CLOA 4MVJF 3IL2A 2X8LA 4B79A 2R00A 5B4UA 1U8XX 1ZMTA 2ZB7A 1K2WA 3WICA 4H15A 3UF0A 1N1EA 5KVVA 4RF4A 2OGUA 3SC6A 2DVMA 3GZ4A 1D7OA 5JAMA 2JAHA 1ONOA 3UW3A 3RKUA 3G1TA 3M1AA 3MTGA 3MJSA 5BT9A 3UFXA 5C37A 5THKA 5K9ZA 3RI3A 1LRJA 2I3GA 4BOYA 4BNYA 4CUZA 3W4KA 3RFTA 5K0ZA 1KVUA 4ND3A 2B5WA 4IQ8A 1PJ4A 1SB9A 3ZCXA 4U0KA 2PTGA 3D0OA 3GVXA 2HCTA 2B83A 1ENYA 3FNGA 4UVEA 2QG4A 2AG8A 4BO2A 5L4SA 2P5YA 3GMSA 4DVJA 4IM7A 2Q1SA 3PP8A 2FP4A 4GPD1 3HNPA 1M75A 3S1LA 4RPHA 2HK8A 2FR8A 1R6DA 3PLNA 4BNXA 1V9LA 1DJQA 3JSAA 4ID9A 3ZH2A 4DYVA 3UH1A 3RC2A 4ZN6A 5A9SA 1GV1A 4BNLA 5TIIA 4PG5A 3V1UA 1E6EA 3CXRA 3FWNA 5CPFA 3LC1O 1J0XO 5JDCC 4P8RA 3GHYA 4P4LA 5I9LA 2O4CA 3H8VA 4BO0A 4M1QA 1ISHA 2IYOA 2X7HA 3WR5A 4IBOA 3NJ4A 1J6UA 1FF9A 3KLMX 3KYCA 1UJMA 3LQFA 3AM5A 4BKRA 3OHSX 3HDYA 3DEYX 2WDZA 3OBBA 2A9FA 3RJ5A 5KIAA 1UUFA 1M76A 5A06A 1H93A 2CD9A 1PQUA 3LF1A 3BMNA 4NH4A 4NBTA 3GUYA 3G0OA 2VHXA 4UUMA 3KV3O 1BXGA 1I2CA 1QKIA 5JMWA 3L4SO 3GH3A 3ZV6A 3OJFA 5KKCA 1DRUA 1GAEO 1B3BA 2X0IA 4FFRA 1FDWA 1N8KA 5CPBA 1HDCA 3W1VA 3FSRA 1WMAA 4WASA 1JTVA 4Z9FA 4TSKA 4CLOB 3OICA 3E9NA 4BV8A 4NK5A 4L0QA 4ZGWA 1ZW1A 4CMBA 5A5FA 3KBOA 1LDGA 3E1KA 3DAPA 3ULKA 2J3HA 1QORA 1YB1A 3WGHA 3ZW8A 3DFUA 4HNGA 1QYDA 1UP4A 3CMMA 1QV7A 4DL9A 4EGFA 5HWSA 4XYGA 3GA0A 4ROSA 2NTVA 1EVJA 2Y1GA 4OL9A 4ZA2A 3C1OA 3GN1A 3P2OA 4E0BA 3Q0EA 2RH4A 3PHGA 3DHNA 5DF1A 4XB1A 2IRWA 4L73A 3GOHA 2C59A 3IJPA 4BO4A 3TZ6A 2IZ1A 4AJOA 1GQQA 2EW8A 5L95A 4YAEA 3RJ9A 3B1KA 3A1NA 1O5IA 4UUNA 4KMSA 1KEVA 2HRBA 1U4OA 1H6CA 1KVQA 2I3AA 4I08A 4L9RA 3WGTA 5BSFA 5HS4A 1XDWA 1YB4A 2NU8A 1AGNA 4RORA 1T2DA 4PFJA 4NQZA 2CDAA 1QRRA 4RZIA 2VOEA 3GRPA 4E13A 1YL5A 3BMCB 2JFFA 1H2BA 5T67A 4YPOA 4DIOA 4BNGA 1U3WA 2Q50A 1PZHA 4PZCA 2HMUA 1Q1NA 5A3JA 1YO6A 5JDCA 3WQQA 4D45A 4BNZA 5LC1A 3ZWYA 3TRIA 1IL0A 5A9TA 1DIRA 4ZJUA 5JE8A 4IUYA 4D7AA 1GQ2A 4RVHA 4J1TA 4DRYA 1ONNA 4CV1A 2DBZA 3JCZA 4N18A 3BA1A 4PG6A 3QWHA 4F6LA 5JY6A 4XJSA 1J5PA 4RVGA 3VC7A 3KVOA 4EYEA 2J3KA 5IXYA 1ZH8A 3C8MA 4MVJE 4RVFA 1E1MA 3O03A 4KWHA 8ADHA 1VL0A 4FFMA 3S2FA 4BQRA 3GNTA 2HRZA 4IXWA 1QYWA 1E0DA 3RC9A 2EGGA 1WZIA 2ZYAA 2YV2A 1JKIA 1GZ3A 3PHLA 5JO9A 3OA0A 3ICPA 5GZ6A 4OM8A 4IGFA 1MX3A 4BHTA 2EHDA 2AQHA 2D5AA 3C7AA 4O0LA 4OXNA 4DXHA 1ZK2A 3PPIA 5U1PA 2C7GA 3VPFA 4BO6A 2IXAA 3D7LA 2HMWA 1ZK1A 3DXFA 3QQPA 4L4RA 1KBZA 2PGJA 3ITKA 1R37A 4FFLA 1ZZEA 5T6BA 1M67A 2E37A 4OOFA 3TQHA 3ASVA 4M86A 5EPOA 3G79A 1E6UA 1R4MA 4FFNA 1NAHA 3DZIA 4UVGA 1T1RA 1KS9A 4NIMA 1K6JA 4E5MA 2P2SA 1BSVA 5GMOA 5FF9A 4Z3KA 3S55A 4O6VA 4BB6A 3QE3A 1DAOA 5JAIA 5HTOA 2WJPA 1EBFA 1H6BA 2GN4A 2O3TA 4FS3A 4PLPA 2CUKA 6ADHA 5U4QA 1VL8A 4BNIA 2W2LA 2WD8A 5DT9A 5H83A 3ENKA 2I99A 1VE9A 4BNWA 3KO8A 5ICSA 4EW6A 1NQ5A 5I9MA 5I8WA 3L4BC 4TKMA 3EW7A 1IZ0A 2Q46A 1MC5A 1IOLA 3T7EA 3V2UA 1PJCA 1LRLA 3A9WA 3B20A 2QYTA 3L4BA 3TFOA 2WSBA 3L6OO 1E7SA 4QT0A 4YXFA 4BVAA 2BI7A 1KY5A 2GLXA 3O4RA 1OBFO 2EERA 3JQAD 2W4QA 3QJ5A 4IJWA 4FOOA 3K6JA 1NM5A 1DRWA 4HV4A 1C1XA 3OJ0A 4JP2A 4OHUA 5B4VA 1FDTA 5EN4A 3AM4A 3IKVA 3UOGA 4M55A 4D0RA 5BNIA 3MOIA 3ZU4A 1ORRA 4KWIA 4RQUA 3D3WB 1U4SA 3GRKA 3WTCA 3DHEA 4TQGA 4R4JA 2VWHA 4BO1A 3EK2A 4ZQFA 1JAXA 4FSHA 3AUTA 4HY3A 4J7CA 4G81A 2YDXA 4TVOA 3WMWA 1I36A 1QYCA 2C0CA 3NYWA 3DB2A 3QHAA 1AXGA 5DZSA 1PR3A 1JKJA 4BMSA 1CEQA 3GDGA 3DAGA 1R16A 2UUPA 2RIRA 4GWGA 1OFGA 1L7EA 2JD0A 4KUHA 3LZ6A 5GY7A 3UN1A 3F1KA 4MKZA 4IJUA 4KUGA 1A9YA 3RUIA 1F17A 2P9GA 4GX5A 4FD3A 4D3DA 4K6CA 3JD0A 3S2GA 3HE3A 2D2IA 2V7PA 3NV9A 2HMTA 3VTZA 3NGXA 2AMFA 4J9VA 1DDOA 1KEWA 1PTJA 3PFFA 4OMUA 3ANLA 3EVTA 4TMFA 5EQFA 2HAEA 1EEHA 1G1AA 4XZ3A 4I1IA 1NTOA 2XAAA 4N7RA 2AE2A 3I83A 5ILGA 1PGJA 2NVWA 2GO1A 4NNJA 4FGSA 4NBWA 5KJCA 1EUCA 3X2EA 2Q49A 4DQVA 3FBGA 1HT0A 4XYBA 4XRRA 1TT5B 4GWKA 2EKPA 2X0JA 3WWZA 4UULA 4DLAA 3JQAA 4DREA 5F1OA 1DOHA 4RPGA 4CLRB 1DIGA 2FPPA 1H5QA 4HP8A 1DLJA 2DBRA 3WB9A 4BNTA 3MWDB 2IZZA 1NR1A 1P0FA 3NKLA 4BKPA 1R0KA 3JQEA 2C2XA 3E5MA 4XQEA 3ETDA 4YR9A 4W4TA 5IJZA 4R3WA 1ISIA 2ZCUA 1PS0A 3JD4A 1E1NA 1MA0A 2W2LD 1XU9A 1NFRA 3BMOB 2HK9A 3CZRA 3KYDB 2AQ8A 4RCVA 1YQXA 3O26A 1XHLA 2IEBA 2VZ8A 5DBGA 5KCZA 2Y0EA 3D3EA 1SEVA 2ILTA 2O23A 4GX2A 2ZJ0A 1H94A 3C85A 5DULA 2O7SA 2SCUA 1LSJA 5TNXA 4DPKA 3HFGA 4Q39A 1O8CA 1ZEJA 4DPLA 3NX4A 3JYLA 4PZDA 4YWJA 1MV8A 1J4AA 4MVJG 1SPXA 3LYLA 1U2GA 3VAZA 4OOEA 1GYPA 1LC3A 2DTDA 2X86A 5JBIA 2XXBA 3ADOA 2VNSA 4B4UA 3GGOA 4QX6A 4A27A 1GR0A 5DN9A 3VH4A 3DQPA 4BUCA 4DBVO 2H6EA 5EL0A 4EDFA 1DXYA 1U28A 1LDEA 3F4BA 4CMIA 4BL5A 1UXGA 1GDHA 1HDYA 4K6FA 4OAQA 4D41A 1MB4A 2OBYA 1B8PA 1NYTA 3Q1LA 2QYSA 3EDMA 4G2NA 1TLTA 1BW9A 1I3LA 1PJTA 4NU5A 2ZQZA 3I9LA 2JJYA 4PZEA 4YJDA 1PZGA 1I5RA 4Y9DA 5MGBA 1PGNA 3FWZA 5EERA 1KC1A 1Y8QA 1J49A 1FJHA 2GUGA 2HMVA 4PLTA 3GDFA 3R0IA 4A73A 4WCFA 1U9JA 4EBFA 3DMYA 4E4YA 3PWSA 4CUJA 2BFOA 1GADO 4J49A 4QO7A 1SOVA 2Y1CA 4YAKA 1EBUA 1R66A 3FR7A 5KOIA 4CUKA 3JYOA 1SEPA 3PLRA 4CV0A 2FR0A 2I5PO 1GCOA 1NPDA 2VNAA 2Y93A 4P4GA 3RUDA 3IIEA 4YB8A 4BKUA 2F00A 3LT1A 5A3VA 1U2DA 7ADHA 1H0KA 2AEFA 4DWVA 1AUPA 4FJ0A 1HWYA 5G0SA 2X4GA 2CZCA 3UCFA 4CMAA 4CM4B 2WYUA 1VKOA 3ROQA 1KETA 3U49A 1PGOA 4AJKA 4KUEA 5CP8A 5F5LA 1N7GA 2P91A 1E7MA 2CNBA 4GKVA 4YACA 4LK3A 4AFNA 1W8DA 1I2BA 4R69A 2I66A 4CM5A 3LDHA 3TN7A 2NU9A 4A10A 3G17A 3D4PA 1UAGA 3ANMA 1U8FO 4IXTA 1DIBA 3D64A 3VPSA 3QVXA 5BSEA 3EGOA 1ZJYA 4CM1A 3RQSA 5CG1A 3U62A 1P77A 2RBEA 4PN3A 5ITWA 3RCBA 1B2LA 3IUSA 4ND5A 5I7EA 2CDBA 1M66A 2DBQA 1Y9AA 3DZBA 1PSDA 4LVUA 3WGZA 2FZEA 5ES3A 1K3TA 3UUWA 3ETGA 1DC3A 2NM0A 2B4TO 2YQ5A 4GLLA 1LDBA 3I6IA 3DOCA 4M87A 3TJRA 4MVJA 6LDHA 4GAEA 1YBMA 4NBVA 1ADGA 2GDZA 4XYMA 1HEUA 4BB5A 3KSDO 5CEEA 3QSGA 1OZAA 1D1SA 3E48A 4ZVVA 5T8KA 3LSYA 3WLEA 1MFZA 2DPGA 3GFBA 3UCXA 2C7VA 1N7HA 2NU6A 1T25A 4EUFA 2VUSA 1UXHA 3HDJA 3L6DA 3OECA 5K6AA 4CMEC 3KEQA 3C7CB 2W8ZA 4CLEA 2NVUB 4QQRA 2ZATA 2BFPA 1SB8A 1E3WA 2Z1MA 4PGFA 1F06A 5KJEA 1U5AA 5F3RA 1RM5A 1ZJZA 3PQEA 3DBHA 2JD1A 4IQGA 3ZDFA 1GZ6A 3Q9UA 3QWAA 2P9EA 1JLLA 1DHTA 4OXKA 4JBHA 3DZGA 2AEJA 2WE8A 3FR8A 3JQAB 4Z0PA 5BNFA 3EZYA 2X0RA 2VHYA 3M2PA 1GU7A 1RPNA 4LMRA 3VZQA 1VJ1A 1HLDA 4MP8A 2O3JA 1N9GA 4CQLA 3GY0A 4HADA 4M8SA 2G1UA 3IQDB 1CRWG 3ITDA 1NWCA 3V1TC 5L4LA 3LT4A 2VYVD 4YJHB 1CETA 4LGVA 3WSWA 3PGXA 2PA3A 4H16A 4PLGA 1NWHA 4W9NA 1Y9EA 3H3FA 1E7YA 1D4FA 2BD0A 5IXSA 4G5HA 3KTDA 2FY8A 4HFRA 4LISA 1QYVA 3U4HA 4D46A 4DMMA 1LLUA 1QV6A 4OSPA 3WNVA 4BNFA 2XF8A 4GGOA 4CQMA 2O3RA 1BXKA 3U0BA 4RPKA 4HXYA 3WDSA 4BGEA 2VRCA 2V6FA 3VKUA 1BXGB 1PZEA 3MJVA 5CDTA 1HF3A 3TL3A 1TXGA 4MINA 1LQUA 3V5NA 1UP6A 1X13A 3R3SA 3AU8A 5AVOA 1EDZA 4CMIB 2C07A 5ADHA 4IZHA 2PWZA 4E31A 7MDHA 2E6UX 4I5GA 5JW6A 3DWFA 1N92A 3CTMA 2O3QA 1UDBA 1DC6A 1T2FA 1PQPA 2PGDA 1QYXA 3EUWA 4IY1A 1ZNQO 3OH8A 1P45A 1I01A 2AHRA 4TRNA 4IPTA 4UEKA 1CYDA 3LK7A 5JO0A 1N9GB 1EQ2A 4CQLB 3PFWO 2FMUA 3ONEA 5T64A 3ZHBA 3OIFA 1C1DB 1MGOA 3F3SA 3JQFC 4FGWA 3AI3A 5HS6A 1PL7A 4IINA 3B6ZA 4GVXA 1PJ2A 4J4BA 3OJEA 1C0LA 4DLBA 1K6XA 4CR7A 3ANNA 2C20A 3NTQA 2TMGA 4CM8B 3HQ4O 4MIYA 2PR2A 4RQTA 1CQJA 5JDIA 3GAZA 1GFSA 4B8ZA 3F6YA 2BRUA 3WIEA 1GTMA 3I5MA 4XIJA 2X6TA 3HSKA 5EMHA 1HZZA 4J90A 1VC2A 3RU9A 1PGPA 2EP7A 4CMCA 3SLKA 4IDBA 1OOEA 5T5QA 2YUTA 3ZWNA 4YAGA 5K6AC 3H2ZA 3TZQA 4DMLA 5CAEA 3MJEA 1TI7A 2ZYGA 3VTFA 3KLPX 2PZKA 5F21A 1VLLA 1RM4A 2Q2VA 1B7GO 1F12A 4CM7A 3CUKA 1P1JA 1VKNA 4CM4A 3VOSA 1XGKA 3U4DA 3ZU2A 1NPTO 2TMDA 3JQGB 3UCEA 4E12A 3T4XA 4A0SA 1L1FA 4Q3BA 1R4MB 3D5QA 3DHYA 3CPSA 3LLVA 4J2OA 5TS3A 3PWKA 1M2WA 4C7JA 1AXEA 4PVDA 2HKIA 1HYGA 2BH9A 2CY0A 2FRDA 3DAFA 2CF5A 4ALLA 1XYGA 2X23A 3Q6IA 4JNKA 4Y6SA 1I2ZA 2HUNA 4CLDA 3P7MA 4FFOA 4WLUA 3CKYA 3O8QB 5KJ1A 4RLSA 5I7FA 4WOKA 4I9NA 2V6BA 3EZLA 3PDJA 3ON5A 1TT7A 3ZWBA 1NQOA 1X7HA 3OEYA 3GEMA 1C14A 3E9QA 4YCAA 3NDRA 2PKQO 3SJUA 1GEEA 3VZSA 1LJ8A 1B15A 2B37A 4WLOA 3AK4A 1FDUA 3K31A 1H6DA 3AJRA 3GVIA 2GPTA 1QLJA 1M6HA 1QR6A 1ZVMA 1F0YA 3I9NA 1P33A 2I65A 3ONFA 4PCVA 4PLWA 3SLGA 3WGYA 5B4TA 2VRBA 1DEHA 3QY9A 1KVTA 1E7RA 2QHXA 3C24A 4EJ0A 2VYND 1U7TA 1H6AA 1ZMOA 5FI5A 2ET6A 4OH1A 1VRWA 5EIOA 4L4SA 2C29D 3MJ4A 5IN4A 3WX0A 4D79A 1P0CA 3PYMA 1VSVA 4MP3A 5C3MA 4RVSA 2PK3A 4IS3A 4EJMA 4W7HA 4JROA 5TQVA 3CE6A 4BNMA 3W6UA 1CF2O 4GMGA 3ZW9A 1H2HA 1E3IA 2DC1A 4IIVA 4QFCA 1E3LA 4J1NA 2UDPA 1MXFA 4I9UA 3RFXA 3CIFA 4ALMA 3AUSA 1LI4A 1K6IA 1T24A 3IUPA 3TPCA 3UVEA 3WYEA 4XR9A 4WCDA 4E5NA 3PGJA 2V6MA 1BG6A 2W2KB 4GI2A 2D1YA 3E8XA 1V8BA 3E6AA 3OM9A 2UV8A 5EESA 5F1PA 4XQ9A 3AOEC 1IPFA 1PIWA 3RU7A 5JCJD 2VZ0A 2H9IA 1B3RA 4J9UE 1DRVA 3AOEA 3AWDA 3NUGA 4D43A 4Q3AA 4YT8A 4E5YA 1YDEA 4D3FA 4XYEA 4RVDA 3GVPA 4O59O 2G82A 3V1YA 2Q2WA 1QLHA 1YKFA 1ARZA 2JL1A 4K1LA 3VH2A 1HE5A 1NHGA 2G17A 1HDOA 1KC3A 1Q7BA 4R9SA 3NT4A 3KRTA 3H5AA 4J7UA 4R1TA 5IZ4A 3W8EA 1SMKA 3GQVA 2BLLA 1QMGA 4CV2A 3UXYA 3K2EA 2DBVO 1JA9A 5A5EA 4FC6A 2Y1DA 3DBLA 1EVYA 4W6ZA 3EC7A 2YQ4A 1O0SA 4AICA 4XR4A 4FB5A 4E30A 3V2HA 2EKLA 3ROMA 3Q2KA 3X2FA 5I8ZA 2AQKA 2R2GA 5LCXA 3ZWPA 1P74A 4AJ4A 5FWNA 3VPHA 3QVSA 2BF7A 4GGPA 3HB5X 2Q45A 4BGUA 3RUHA 4E5PA 1HRDA 5A1TA 3KB6A 3BTVA 1IPEA 3GC6A 3QRWA 4WKGA 3N7UA 4NFYA 3GPDG 1I32A 1NFQA 2X22A 3TSCA 4WNCA 3ZWXA 3L9XA 2W90A 3CEAA 2VHZA 3ABIA 3AU9A 3DBRA 2Y66A 3FBTA 3KYBA 4JQCA 1DIHA 2BI8A 3P2YA 1UZMA 1BDMA 4GX1A 1DHRA 5JXWA 1X15A 3OEWA 4XD2A 3LT0A 5FFFA 1ADFA 1LXCA 2UUOA 4LW8A 2IE0A 5L7WA 2P68A 1YQGA 1ZXLA 3O38A 2Q4BA 3H2SA 4I5EA 2OHXA 3TDKA 3WFIA 4AJEA 3I1JA 1LU9A 3SBOA 1E5QA 1BRMA 1MLDA 4XX0A 5HA5A 4XKJA 4NR0A 3WXBA 2ZTUA 2HDHA 2B5VA 2YFQA 3OIGA 4IDFA 4XDZA 5A9SB 2NUAA 3JQGA 1NVMB 4WCFC 5KJ6A 5KVQA 3GVHA 1TEHA 3ETEA 3PWZA 4WUVA 1X1TA 1W4ZA 2PFGA 3D1LA 4K26A 4R68A 4IMPA 4J6FA 2DFVA 2CVQA 1LLQA 2PNFA 3ZN2A 2ZQYA 4UEJA 4OKIA 1W73A 3ZHZA 2VUUA 3BHMA 4RDHA 1IE3A 1JWAB 3A06A 4BNHA 4HFNA 1DC4A 1BXZA 1PWXA 3CSDA 4P4NA 1WDMA 3ZNPA 4XYLA 2CDCA 1PJLA 1I3KA 2PD4A 2GF2A 2QX7A 5KKAA 4LCJA 1ONPA 3W8FA 1CQIA 4GSKA 1Y1PA 2O50A 1Q2XA 3BYZA 1A7AA 3GNQA 4OQZA 3A4VA 4OYRA 4EZBA 1SC6A 2RAFA 1LX6A 4J3FA 1T1SA 2O7QA 4DQUA 4EJ6A 2B0JA 4II2A 5HM8A 3KOUA 2QIOA 3OSUA 3RWBA 3QVOA 4A7PA 4RPLA 5KVSA 3PZRA 3ENNA 1GY8A 1JVSA 3IJRA 4DYDA 2DUWA 1R15A 3TOZA 4QECA 1LDMA 1XIVA 1EDOA 2J5KA 2O3UA 2WWRA 1JU9A 3NTOA 3RUCA 1NQTA 1YXMA 3ZV4A 3GN2A 4CMJA 1KVSA 3LU1A 2X5OA 2Y0CA 4BGIA 1TB4A 3H65A 1Z75A 1WMBA 1A27A 3DONA 4KDFA 4U0JA 3V2GA 1JN0A 3WNQA 2FSVA 2P4QA 3E03A 3QW2A 3TWOA 4MVJM 1CDOA 3KUXA 3LT2A 4MKRA 1UXJA 2I9PA 4H7PA 4R1UA 2R00C 2XXJA 3PHIA 3NEPX 2NADA 2DU8A 4FBGA 1KYQA 2ZB8A 2FWMX 1WPQA 3DDNA 3N74A 3WQRA 1XKQA 3KEOA 4S3MA 2D0IA 4MKXA 1LDNA 1Z7BA 2VT2A 3FRJA 3OF2A 3K9QO 4J16A 3VPXA 5L51A 2P9CA 4IS2A 5AXAA 3RD5A 3WJAA 3ZWVA 2LDXA 4N5MA 4HNHA 1NXQA 1PZFA 1HSOA 2JCXA 3TZKA 3VDRA 4Z0HO 1P1HA 2EKQA 4XQCA 1TVEA 3EY4A 5I7SA 5IZCC 4PVCA 3G49A 4F45A 3COSA 4L74A 4CMGA 5TJ9A 3U4IA 2VUTA 3RAJA 1QP8A 4HWKA 5TRTA
chains in the Genus database with same CATH superfamily
4Q3OA 3KQLA 4K86A 1CUSA 1UXKA 4ZRDA 3RJTA 4LK2A 1IDN1 1AKTA 2Z43A 4N39A 3TQSA 3L8CA 2GPBA 2O0LA 3CH6A 3MCAA 2UZ1A 4G5SA 3RVOA 1YNSA 5BV7A 3R9XB 1V4BA 1ATIA 3E5RA 3LJKA 4BQFA 1MUUA 2FCAA 1TTTA 3TR6A 3M6IA 1CS0A 4ND8B 3Q41A 2CWWA 3LGSA 5D5PA 2NU6B 2Y71A 1R0SA 4KQWA 1M2VB 3FN4A 4U2EA 4UUOA 3DFMA 5H3HA 4CVNA 3F71A 2GNAA 1PAUA 4H7EA 1N4DA 2I9KA 4M8IA 1I33A 1R0LA 2EATA 4BN5A 2YZ7A 2VQ3A 1LVUA 3GK3A 3NBZC 4DQKA 5JSUA 3NOOA 3AIOA 4UDYX 5DGTA 4WN9B 5H1YA 3GX1A 4MQEA 1JKFA 1GLGA 3OIVA 3VM6A 4JWTA 1TNDA 4XFKA 3SEFA 1CCWA 3D2LA 3RS7A 1JHQA 2N9UA 3BB1A 3EAGA 3QKWA 4Z9AA 5CA0A 2VH5R 2FPGA 4C22A 1RJFA 4QLAA 4XWWA 1YFLA 2Z1NA 1K9SA 2F8MA 3DVAB 4NNPA 4KFCA 1OLSA 1T3TA 4OHWA 4ALKA 1XJQA 1VGQA 4O5AA 3OM0A 3CUSA 3M2TA 1ZD3A 4HUQA 2RB5A 2ZYVX 3RWOA 2VDVE 2R84A 3IP1A 3HG7A 4DLWA 4FT2A 3TAHA 3Q3CA 3F6EX 3MN1A 4MQFA 1K4YA 1Y1KE 2YDYA 1UMDB 2WVHA 4OHVA 1QP7A 3DC2A 2LIPA 4YQZA 5CT8A 3RF6A 2WSIA 4M0FA 2XYQA 3TBFA 2EBUA 3FVQA 1RYNA 3I01A 1N2IA 1DV1A 3H84A 4CFZA 4AJIA 2J5RA 4N0QA 4LTNA 4KACA 1CP3A 4YUZA 2EHJA 2WNHA 2TS1A 1GD1O 4Y18A 4MWTA 3RFVA 4F2WA 3Q85A 1O6ZA 3O8DA 3O8QA 3PJRA 2D5CA 1P7WA 2C7PA 3RYHA 2A8YA 2PX6A 4UBLA 1JMYA 4LWPA 1W2HA 2DULA 4XUDA 3V8QA 3SN6A 4A1OA 4B4WA 3L7LA 1ZVVA 5MHTA 1IB6A 4DABA 4GQIA 1QRUA 2JFBA 3E7DA 1C2TA 3HUTA 3PQCA 4MI3A 3G8YA 4XJVA 1PR1A 1ZK4A 3EAFA 3TTUA 2QNIA 2BFBA 2I0FA 1XX6A 4AS3A 4ESEA 2YIJA 4KREA 1LK7A 4FDAA 3I39X 4RXUA 2ZAYA 2EFHB 1W85B 2P2DA 3HN7A 3ZJYA 4MYCA 4CDRA 3WMXA 4XSHA 3F46A 3SOZA 3C15C 5BW6B 4P83A 4MW0A 2YZ2A 2H48A 4Q24A 3VHQA 4RETA 2PSJA 1YKSA 1Y80A 3THRA 1E60A 2EARA 5JAOA 4L5JA 3ST7A 3CS3A 1Y8RA 1G17A 1UFRA 2Q28A 3H04A 1N1DA 2E21A 3RROA 3VMMA 1UBUS 1I10A 2MSWA 3SC3A 3VNBA 3N8IA 1DP4A 3ZHSA 4LY6A 3TSAA 5EHNA 3PQFA 4X0EA 5L4NA 3D6MA 1OHHD 1O2DA 1QIMA 2DF8A 2FSSA 2X9LA 3D3JA 4TM8A 3O8CA 2GK4A 2EWVA 5GONA 3D6HA 5FUXA 4FC7A 5ARCA 3TB4A 3H1EA 5FJJA 2X13A 3RREA 3X1MA 1NP3A 5FUYA 3OWOA 1X3SA 2P5TB 2QSUA 4M49A 2LCQA 1FDOA 2OCXA 2WF5A 3FDZA 1Z2EA 3C1AA 1NF3A 3U39A 5L40A 4AQ7A 2SBTA 3I04A 1A96A 3Q88A 3KQOA 2WU1A 1JVBA 3N70A 3ASUA 4PTYA 1K8YB 3RVDA 1U3FA 4XAQA 2GRAA 5JLAA 1DIOB 4TL8A 3TNFA 3A4IA 1ST3A 1NF8A 3QA3E 3R3YA 3R5FA 4CM8A 3PHHA 3JVEA 4YAJA 4D9CA 3AY7A 1E58A 1H2YA 1T4MA 3A2LA 3C2QA 3OLYA 4CXMA 2ECKA 4IIJF 4KAJA 3KHTA 5AW7A 3MILA 5I7OA 3DAHA 2WVGA 3CRQA 4XX0B 3AEZA 4LDQA 2A58A 2PL1A 2VEDA 3E5NA 3E9MA 5T57A 3VO2A 2PVCA 3I0NA 3RVMA 1CZLA 2XUFA 4MSUA 4MR8B 4NL4H 1SAYA 2CLLB 3PIDA 4YVFA 4TRMA 3PICA 3LOPA 3RC7A 4HRAA 1F9AA 4UD6A 4IP0A 1K5HA 3EC2A 3FF4A 3KLOA 4DCMA 4DSZA 3WYCA 5KYWB 1PL6A 1YR7A 2HL6A 3B5JA 4WAUA 1SBNE 3OE7A 1SHJA 3IT1A 1NUPA 1QC5B 1GPAA 3AFOA 3K2BA 5DP2A 5J5CA 3ZWAA 1FSFA 1MG0A 5CEFA 2RHRA 1QQTA 5KNBD 2WWXA 3BSWA 5IXJA 2K87A 5IWAB 4H0CA 2LIVA 3GNSA 3UGKA 2PZLA 1LCIA 4P35A 1HK7A 3KHSA 4EK9A 2ZJ1A 2C8VA 3HY4A 3G6WA 1J1IA 3B1WA 5LLSA 2GYYA 4AN1A 4B9AA 3RYCA 1J1ZA 1U0LA 1HDGO 4ISBA 2DP4E 1HO3A 4RTQA 5IZCA 3K0SA 5EWLB 2J33A 3SZOA 3UXMA 2N47A 3COVA 3EG5A 1MV5A 1NUUA 3X1YA 4O25A 1VG8A 1DXHA 2DQSA 3B3AA 4JX8A 4ZOLF 4BVLA 1YJ8A 2V7EA 3HJCA 1VG9B 3PKJA 3IQHX 2X58A 2M1ZA 2SNIE 1I1QB 3HFRA 3B60A 3LUPA 3RRZA 5IS2A 1E7QA 1CRPA 2AZTA 2ZUCA 2XNHA 1V7PC 2XQGA 2Z5GA 3OU2A 5AW0A 2XLCA 4KO4S 3TQTA 5CYGA 2CNKA 4FQ8A 2XB4A 3MXOA 3ZEIA 4CW7A 2RH8A 4MVJP 5ALKA 4EG1A 4GPZA 1SVKA 1TJ4A 2YXLA 3AOGA 3BIOA 4C4ZA 1WBDA 2FPSA 1FFXA 4EJFA 4EYKA 1X1BA 2VAPA 4RBNA 3IQGX 5KX5A 2HI0A 1ZK3A 4MVJH 1EESA 3WK5A 4NYIR 4MW4A 4HDSB 4GE3A 2B4AA 4YAUA 2IHNA 4RF3A 3WGJA 2HBZA 4YAWA 2C3UA 1E61A 5AHWA 3INTA 2LNDA 5HKKD 2BY4A 4NP6A 3TYXA 1BHJA 3UXHA 4FDLA 4CQNA 4C4YA 3DZFA 4PRLA 1P81A 1YAHA 3N58A 2ZSDA 1V9SA 4YMUA 4GMDA 2YHUA 5TMDA 1UJBA 2BTQA 3NGLA 4K9KA 5CH8A 3WBJA 2G80A 2NNLD 4YJGA 3ZI4A 3R40A 1CERA 4TTTS 4CM9D 4DCNA 1XQVA 2PUTA 2AOTA 5KBYA 1M1UA 1FJGB 4BYMA 2ZTHA 2OBNA 1E5VA 4BWGA 1SUFA 1HKUA 4FFBA 4O5OA 1KPHA 1K7SN 3MTEA 4U7PB 2Z4TA 1ULAA 4UCWA 1AKEA 3F4LA 3ICCA 5DXFA 4KVAA 3P9IA 5CLHA 2HSZA 3OETA 1YS7A 4YRDA 3H2IA 4AY3A 4ZI2A 1EM6A 1LFDB 4CZ2A 5TGZA 4AMUA 4WXEA 2O59A 2YTZA 1UAYA 3M3HA 5G0UA 1XALA 3IS3A 3N9IA 1QGOA 3E9RA 4FZRA 4PHHA 3WNDA 4YTEA 5IC6A 3SIRA 3R9IA 1D1PA 1GUBA 1VKZA 2FQQA 4RNCA 1BA2A 2W43A 3PQ3A 4G65A 2O8CB 4G86A 4IOKA 4EHIA 1GGVA 3D2AA 4U5XA 3EYWA 3QMPA 4R84A 2AOWA 3TW0A 4JZYA 4XM2A 2POQX 5E3HA 3L05A 3VNRA 1YCHA 2HYDA 1N2CB 3BS4A 4GL4A 3GLIB 1UBHS 2YHAA 3MINB 4Z1OA 3NHAA 3ZCUA 3JAWA 3OTOB 1MEJA 4URFA 1MJFA 1W85A 3BRCA 4PC1A 1OH6A 3F6PA 2RHTA 1V3VA 2X9GA 5IVIA 4CDNA 1USVA 1Z74A 1K89A 3JQRA 4MVXA 4B8WA 4YR7A 1EX6A 2ZE7A 2WUEA 4WDQA 2DPMA 1XRQA 1I24A 1QCCA 4MCIA 3QVMA 1QDLB 3QBEA 4BMYA 2P27A 4TUYF 3AI1A 1X19A 4WFJA 1Z0ZA 3PC8A 2DG2A 4P7FA 5E4TA 4ZD6A 4ER6A 3UYKA 1K7XB 4EHHA 5LLTA 1V3TA 2WAOA 4IZIA 2QE6A 3KJZA 1JE0A 2C8LA 4EG5A 2HWUA 1BROA 4IWXA 1X94A 2NLOA 2QD1A 1CE8A 3K73O 5LU9A 3Q7RA 3QVTA 3PXUA 3PRKE 4UVHA 5H70A 1E18A 1DSSG 4M0LA 4EOGA 3NOQA 1LDYA 3F9RA 3TQRA 4LSMA 5L3QB 1BQEA 3A2KA 3O8NA 4E32A 1CW2B 3M6LA 5HKAA 3HL0A 2JJ8A 3BL5A 3U4CA 3ZOZA 4HNSA 3PWTA 2COEA 1J70A 4MR9B 3VOAA 2IU3A 3B9QA 3NAQA 2I4OA 1IZ9A 4HSGA 4CNQA 4TYPA 4QRIA 4WLEA 4M7WA 4K9SA 3LVRE 5ALEA 1KO5A 4RD2A 4KR6A 2M98A 4LY9A 4R5HA 4B84A 2B35A 1A9PA 2GJ9A 4XARA 3GJXC 5KPDA 1YS4A 1JMVA 4DW8A 5KQGA 1QF9A 4EB6A 2JD2A 5CT5A 2AF3C 4G5OA 1ZX1A 3N28A 4O4JB 1BMTA 2FMKA 3ECCA 3IODA 3ZTWA 2CXUA 2XB6A 1ORDA 5JD3A 3SZGA 3OLQA 1NNUA 2IOYA 2DLDA 1SR8A 1QR2A 1YZ3A 2W2OA 4CGYA 2JGMA 4XLLA 1WNFA 4C7OB 5G4KA 1VI2A 1A1VA 4GL2A 3IEUA 1Q6ZA 3OC0A 3FX2A 3W77A 2GWHA 4YJ2F 5BYBA 4ARIA 4RTMA 4Y2YA 2ZYDA 3MNFA 4BU0A 3WA7A 3DL2A 2PS1A 2VN8A 3TLKA 2KHZA 2P0EA 2WFAA 2XXAB 1NOKA 2YCLA 1TM4E 1SKMA 4H77A 4ZAFA 4WERA 5KU1A 3D7MA 5SYAA 5JPIA 1UFOA 1Q1BA 2Y1EA 3N8DA 4K03A 3UHPA 1C7FA 3E3MA 2PUFA 4KBGA 4PO9A 4IZ6A 1II8A 1NVGA 1VM6A 2XRMA 4WK6A 3WTBA 4BLPA 2W22A 4FR2A 1GRVA 3BGOS 1NG9A 4F9EA 2BZGA 1I7LA 5ALNA 3HDVA 2RG1A 3HU5A 3HZZA 4RJTA 3FGOA 3RVNA 2VDWB 5ER6A 1KZ1A 1C81A 1SQGA 1TK2A 2J3DA 5CDFE 4QARA 5CVJA 2HNBA 5IJ0B 4B5KA 4JR2A 2OBLA 1YJQA 3AF0A 4N1AA 4HZUA 4DA9A 1FDVA 3GLSA 1RMYA 1UINA 2J3IA 1VYVA 1XFAA 2GUWA 3Q7PA 2FQXA 2AFRA 1OLXB 4HN4B 1HLGA 1V3UA 4M98A 3U9TA 4AZ0A 4O4HB 2R6JA 5LQKA 1VLZA 1WUTA 1Y8RB 2FX5A 3TKAA 3WYGA 3DHWC 5JJIA 1U1GA 1ULSA 2Y6UA 2PXHA 1DTWB 2FCRA 3CX7A 3VHLB 3N0RA 1ADYA 3P4YA 4IWYA 1KDRA 1E9CA 1DUSA 1TAGA 1C3XA 3JVVA 2C82A 4NBUA 4Y2XA 3MMZA 1JIKA 3ZX4A 3BTSA 3LCJA 4MRNA 4PWZA 2BFEB 5U9CA 5A0FA 4HYYA 2FK7A 1V39A 3BKXA 2KI5A 1E2LA 1YGYA 2RBGA 4IX1A 1Z17A 4XXHA 5GGYA 1CFJA 5IP5A 1GN9A 5G1NA 1C1DA 1HG1A 3HYRA 2IH2A 3B7WA 4KTVE 1GQOA 1DGQA 4NYIQ 1OR8A 3B78A 2EW1A 4MA5A 2QTZA 1OKKD 1T5SA 3L8ZA 3V46A 4WNIA 2AXNA 4C0HA 2E0IA 3I1IA 4XUEA 1P3DA 3KR9A 3JSXA 4L4UA 3HUDA 2CCKA 2G67A 4RULA 3DYVA 2VWPA 1GV0A 2A0FA 5CURA 5B2FA 1H65A 3FPCA 3C3MA 2J7KA 3R4VA 3UEOA 5CXUA 5BUQA 5JPCA 1I1OA 1G3RA 1NPYA 3OZSA 4GH5A 4CI0B 1JS1X 1GGHA 1QZZA 4QXQA 3SY8A 1U0OC 4L6CA 2QZ4A 3ROTA 2POCA 4DG9A 4YAIA 2PKQP 2XCIA 2PZBA 4NJMB 1GRCA 3BTUA 4TKVB 2UZ4A 1UBGA 2RI6A 5K2MA 4RKQA 5KSYA 4LHXA 1N32B 5LZ7A 5DTMA 4QUIA 3H9QA 4NRDA 4M7PA 3PNKA 1P6XA 4F3KA 3R1IA 2GZHA 2QBYA 1YUMA 4NENA 3S7TA 4C0KA 3EY9A 1I4OA 2ZRAA 1YMQA 3HTXA 3DP7A 1YL7A 4KLAA 4ZC8A 4JP1A 5IM5A 1J42A 1VB3A 4M9ZA 3IDAA 4F1JA 1SCIA 1W0KD 1BN7A 4DR4B 2YMMA 1ISFA 4BP8A 4W8GA 3W2EA 4YMIA 1JHVA 1SELA 5KNLA 2HQSA 2ZZMA 2AQIA 3JQ6A 4LZAA 1EA5A 3NKVA 1W36D 4J0FA 5FD8A 2AC2A 4GZ3A 4N3NA 1M72A 3QWIA 3ANYB 2HQOA 3PR3A 3H0CA 1EUDA 1ZPDA 2H7YA 4IDCA 4NPCA 4BTLA 2X3YA 3V1KA 5JNVA 2WM8A 3PX3A 1M33A 1SKYB 4JCOA 4RZHA 4Y7CA 3TF5A 1LB1B 4FR5A 1H8ED 2H0QA 4LVCA 5FWXA 5IT0A 4JI2B 1ONSA 3BILA 1W9MA 4S1NA 2QD3A 3AI2A 1QH8B 2BM9A 2O8NA 2XMSA 4QJ4A 3WYNA 5EPEA 4JJFA 4HNTA 3ZWWA 1OWPA 4I6JA 1W0CA 2IKSA 3F5FA 1BIFA 3HU3A 3I53A 4GNRA 4W6QA 5EYPA 4D3YA 1IU9A 3OTHA 4YH1A 2WTXA 4J16C 5I9BA 5K3CA 4NF2A 5KYUA 3DLTA 5FAXA 1UIRA 1T2AA 4Z8YA 2I7TA 2FKNA 1A04A 1Z45A 2VDUE 4TKLA 3SGLA 3T7RA 3TTTA 4G0VA 5A71A 2GBLC 5A5GA 1BN6A 1RMQA 2Z04A 1XLTC 4CG3A 4ZOAA 4N0MA 1TL7C 2VI5A 2DFLA 5EHIA 2PYZA 3W1WA 3PQDA 3L1VA 1Z38A 2JIBA 4I9FA 3SJ7A 5HJ5A 1DJNA 2JLYA 3RW9A 3T1YB 1K3UB 2QRQA 1HZZC 1ODJA 2OAQ1 5DYWA 4ZOEA 2NP6A 2ASVA 2CMDA 1OAAA 1AMOA 4ZI3A 2K7ZA 3FCOA 1X14A 1CLEA 3GD7A 1URPA 1RAEA 4AZ3B 3DKIA 4HOYA 1AQNA 4X6UA 5GADl 5E6RA 3SM3A 3EE6A 3UJ3X 3WJ1A 1IM8A 3ADKA 2OKCA 2I3DA 3DBRB 2P6OA 1T5BA 4RGYA 3E22B 2BHSA 5IUNC 2AFVA 3EPJA 3WK8A 1VL6A 2CLDX 2H3EA 1NI5A 1RXIA 2VT3A 4G4GA 3DEHA 5JXGA 2ZIAA 4J7AA 1XTBA 4IO1A 3NTRA 2JCGA 3GR6A 1S96A 4PPNA 5G2OA 4DB4A 4RTJA 2ZRQA 4EPXA 1DEKA 4X1YA 1RYMA 4PG4A 3KJXA 1FSZA 1S2DA 2IYFA 3STWA 1QF6A 1XVUA 3WKEA 2JFVA 2Q1TA 4MIOA 3CWQA 4JLKA 1IULA 1T4GA 2JI7A 1WHSA 1GVNB 3ABZA 1MH9A 3DZ8A 3H9GA 4KK3A 1MDFA 4KQXA 2P1DA 4P3KA 1SOMA 2FFHA 2WT8A 1SVUA 2HC9A 5G02A 4W8OA 5JSFA 2AD1A 1BWSA 2CFCA 3WLTA 3A32A 3G0BA 2DY1A 3L77A 1VLMA 2MSNA 1X80B 2IVZA 4NDNE 2BFMA 2CFTA 2QMYA 3CVYA 1JAYA 4PBSA 1IY1A 4MRAA 7YASA 1ODTC 2P9ZA 2WVJA 1XCPA 4Q66C 1WM1A 1X1QA 3DWGA 2X41A 4I5IA 2JLVA 3LUKA 2HSWA 4R9NA 1WSWA 3NNDA 4B74A 3BCUA 1NURA 2A5DA 3LYUA 2HT6A 3FFBA 4G1CA 4B75A 3X1XA 1B1CA 3RRFA 1KEPA 3EOAI 4C4RA 2PZAA 2QMHA 1QSGA 2X76A 4K9OA 4LQCA 4NBRA 4PWYA 4U5QA 5B12A 5KC9A 2WVAA 3ZVNA 1QRSA 3RGGA 2ECFA 3LUCA 4DLSA 4Q7EA 2X0EA 2KYRA 4JX9A 2VBFA 1SXJD 5CMLA 4EEXA 5AVXA 5ALVA 1RRMA 1RDFA 2QGZA 5JARA 3LRTA 5BQFA 3PLAE 4GOJA 2XTMA 3HKEB 4GHWA 4YRAA 4OXQA 4FNAA 4S1VA 4TRRA 2WD9A 3V8RA 3I3OA 3DTVD 5EHZA 3K1TA 1LS6A 3FZNA 3SLRA 1G2PA 3FUXA 4UEOA 4AJLA 3WMRA 1IHOA 2N42A 1M6WA 2OV4A 3C1UA 5CVEA 3J81A 1FDIA 2AFHB 4ZCTA 1NIJA 2F62A 2Q5HA 4IOJA 3IVMA 1LZLA 2FZWA 4A4DA 2O2YA 4RYLA 4YP1A 2GCOA 2NYRA 4X3PA 5E7JA 4O0MA 3VO1A 1ISGA 4UREA 1XMPA 1A1SA 1F5SA 1HYQA 2I6TA 3DTVB 1E9BA 3FNHA 3REOA 6Q21A 2WAYA 4YJGB 3ESYA 5CX4A 3DUFA 1Y6QA 4HAWA 5D87A 5MN5A 3K70D 1SVMA 2B4QA 3ZW7A 4AMYA 1ESZA 4URHA 2GN6A 2PBFA 3WIOA 3ENZA 2NQTA 3IAEA 2DH6A 2V6GA 1XLTA 4B35A 5FA6A 3ET5A 3M6FA 2CL7X 5TJHA 2QBYB 2AUMA 1B43A 1SZJG 3N53A 5EE3A 1DAGA 5EIBD 3DOUA 1YL6A 3C8UA 5KJFA 3UAZA 3NFYA 4G0UA 2ZS9A 3KELA 5HVNA 1P2BA 4JBGA 1VPLA 1GZHB 1DAHA 5TB5A 1Q7RA 2OO3A 4HEHA 4CT0A 3OTGA 4E6PA 3B6KA 3BXEA 1OD6A 2JG3A 1YI1A 2HJGA 3TI7A 4YP5A 1GZSA 2J3JA 3EEQA 2HF7A 1FFXB 4QUKA 5B3JC 1F48A 2V7WA 3GG2A 3RPEA 4Z4HA 1PNRA 2WYHA 5DK6A 1HSZA 1RM3A 3D4IA 2Y99A 4IJKA 3KAQA 1LK0A 4QHTA 4OF4A 4OXXA 3AERB 4Y2VA 2NUTA 4RFVA 1PT9A 1Z0FA 2Q8PA 2QSYA 4LWOA 1J33A 5D01A 2R79A 2OSBA 3SEAA 4NULA 1JAHA 1N2OA 2FPIA 2W0MA 3A3NA 3PA6A 4D4IA 4D0GA 3JD1A 3MWDA 4F04A 4TT3A 1KOLA 1NBME 1VJDA 1M8GA 2D7DA 4RH0A 1DAIA 5THQA 5HEKA 2XKBA 2KB0A 2R87A 4WZAB 1PDOA 3SHWA 2A92A 4ZIRB 1C8LA 2QT1A 2JZNA 1N2JA 2REQA 2ZDHA 2VATA 2NPIA 2EKBA 3EW9A 4NJMA 4YBZA 3C70A 4FDUA 4JXKA 5MDHA 3B8HA 3MIZA 4ZICA 3U3KA 2EEZA 3NIBA 4RCYA 2EP5A 1TKBA 1T9BA 1JYEA 1T1EA 4N0EA 5HOEA 5HRUA 1BOOA 2JHAA 2FW0A 3H3JA 3O1IC 4X95A 3W7VA 4PX3A 4MP6A 3MGKA 4L4ZA 1X0XA 4MV9A 4WCFB 5EEGA 1M2GA 1P18A 2PSFA 3WGVA 5FXMA 2HSJA 4HRVA 1YZFA 3HRKA 2E4XA 5BOVA 1NXXA 3KR1A 2YASA 1VBMA 3CF6R 4FGJA 4OQNA 3MSXA 4RWEA 5FPQA 1RYDA 4BBPA 4BQEA 5CAEB 2QD4A 1KIFA 1PFKA 3H11A 1O58A 5IDWA 4MV3A 3WWEA 2WTUA 4QQFA 2YFHA 2GZ1A 3P71T 4ETWA 3RVJA 3BB4A 1YHYA 2H52A 3GMTA 3CVXA 5ALFA 3R5TA 1F9EA 2PLAA 4UUPA 1H85A 3MF4A 4YRBA 1AKQA 1DU4A 2Y2UA 3EXIA 4H4EA 5BN3A 2IX3A 3CX3A 5K8UA 2DUUA 2C7RA 2EZ4A 5IKOA 2G9QA 3GW8A 1QFZA 3QYAA 4OGLA 5KVAA 4E15A 2Y1OA 4YUXA 4JP3A 1SXHA 1P9LA 3CW9A 1SD1A 1Y9JA 4GVLA 3W5IA 5K0NA 2BKAA 4DM7A 1W5SA 1VHLA 2XSZD 4E33A 3FUVA 4YA6A 1I4TD 1J99A 5C80A 2XZOA 1CWUA 1QQBA 2ZRKA 2F2TA 3PXBA 3NRJA 1FOEB 3Q12A 2FFBA 4LZJA 1E2JA 2WM2A 3PNLA 4FMCB 1H2ZA 2FPKA 2VK4A 4YLYA 3SK0A 3D3WA 4I4IA 4Q5IA 3PUZA 3LC2O 4PANA 4DIFA 1I5EA 2RB4A 2QTGA 3DTTA 4V0QA 1VCMA 3D8SA 5EE5B 1ZSVA 1RWMA 1ZYUA 3M5DA 2V03A 1OI3A 2GVNA 1Z7YA 4Q4AB 4ZDKA 4TXMA 2H2GA 3B70A 3U7GA 1X7DA 2VDWA 2YV5A 6YASA 2OP0A 1Z4PX 3R0ZA 3ZK9A 2O7RA 3BREA 5T8KC 1CJVC 1H1LA 1N6KA 2QVZX 5L7YA 3R3JA 2IU0A 2JIZD 5JQWA 2YJ4A 4HFJA 5E95A 4RPCA 5JADA 4W9NC 2AK3A 1BKDR 1PD1A 1RWVA 2IL1A 1YB2A 3RYFB 1IXSB 4W1PA 4PYJA 1FK8A 2A1UB 5FBHA 2JH3A 1MP0A 5IF9A 3ETJA 1Z5PA 3OCWA 2BJVA 2E3JA 1U8TA 1ACJA 4L28A 6ADHA 1Y5NA 1RMTA 5DCUA 4DAOA 1S6YA 5H59A 1NU8A 1U2ZA 3V4PB 1IBMB 2ATVA 3CKMA 4FOTA 4JS0A 4ND1A 4B6OA 1KERA 3SHFA 3M1IA 2Z57A 3OJCA 4XE5A 1M2JA 3VJKA 1U3VA 4X8MA 3F73A 4EUKA 1ZO8A 3PJDA 1EMDA 1H9AA 3FBWA 1W1WA 2IZOA 5CCBA 3DPUA 4B0PA 4YDSA 3A1VA 5I7UA 2JRLA 4KOEC 3PVSA 1GQSA 4GI7A 3ZI0A 3OX2A 5LZ4A 3SBXA 3GGCA 3TK1A 1NUQA 1US8A 4QVIA 1WXWA 3EIXA 3UPUA 2IH4A 1V41E 2Z5LA 3I6YA 2VG8A 1X74A 3QI7A 1XA4A 1WNTA 4M1ZA 5A4AA 3M5PA 3LO8A 3AEQA 3G9QA 3HKCB 4C4PA 1KU0A 1Z6AA 1U2TA 4B4VA 2Y8EA 3C3KA 4ZAVA 3U44A 4KSCA 3CONA 1OLSB 2V5UA 3AY6A 2YWRA 4PSCA 2ZBFA 4OB8A 3TBKA 4HX9A 1E62A 2M32A 2MINB 3FUCA 1P1BA 2EJUA 5E1OA 1P4HA 3T9CA 2IUTA 2AT1A 1QAMA 2ESRA 3S27A 4E7PA 1IXZA 2PO5A 1Z37A 3C6QA 1XPOA 3BTOA 1HV8A 1QIDA 4OKNA 1Z6ZA 4JELA 4PAQA 4PQGA 3O8OB 1AQUA 1E4OA 1Z2OX 3PGKA 2AC4A 1MTZA 1D6MA 2QVCA 4CFSA 2G0TA 4M9RA 4C3ZA 3BMQB 4OAPA 1MQAA 2HH9A 5HFAA 1N33B 2PSHA 3BGVA 1SOAA 1S8OA 3FSGA 3EYAA 1PJSA 2DM6A 1Z63A 2HX1A 4PF1A 4IFBA 4WN3A 3SPXA 3EAQA 3I5XA 4M89A 4EI2A 5JEEA 1EJBA 2BHLA 1KTVA 5EJMA 3HN2A 1CUFA 3RBZA 1ZIOA 2EAUA 4HYTA 4CU5A 5BYAA 4NARA 5BV2P 1D8AA 1OVMA 1U3UA 2A35A 3GBPA 4EKGA 5INTA 2FSGA 4IH1A 2F3PA 3EIWA 1QX4A 3T35A 3PR1A 5ER9A 5L53A 3EXFB 2NSHA 4PZYA 4RL4A 4TPKA 3O84A 3ZDAA 5LP6C 4ALIA 1KZYC 2VA9A 4O4IF 4TTPA 2G4VA 3OLWA 4UM9B 2GD0A 1BH6A 4DCVA 3HM9A 3NKFA 4Z5XA 1MRNA 2X1HA 1U1CA 1J22A 1W4LA 1AH2A 2B20A 1RXUA 1T34A 2Q3FA 3CN9A 4XVRA 5ALJA 3HY6A 1SVSA 3MIIA 2WIDA 4NJOA 2GM9A 3ZK8A 4OKSA 1ES9A 2J0UB 2A0XA 3HXPA 2RK4A 4XD7A 5K4GA 3QPAA 5IG2A 3OIDA 4HQFA 3FG9A 3IOYA 4FOSA 3JASA 3W2IA 3M4JA 3QLUC 5JAZA 1TQHA 3JALB 1OC4A 4MZDA 2FZ4A 4YQYA 1Y34E 5HGXA 2JASA 2QM7A 2ZR8A 4XM0A 2IUUA 2BELA 1G1MA 3KD3A 4ER5A 3FJYA 2Q1UA 1OBOA 4PHCA 1OPRA 4F84A 4MDEA 2VDLB 3W6NA 4D02A 2JJMA 3WK9A 1EFPB 2HWXA 3KFXA 1KAEA 2I1LA 3CSUA 4NZZA 2Z95A 3CRVA 4IIHA 2GD1O 1DARA 2IPLA 3VR4A 2DPXA 3JRNA 1WHSB 3R7BA 2IYWA 4EW3A 2PUAA 3DMTC 1YE3A 1MA3A 1PK7A 1M34B 1RC0A 2O54A 1USWA 3LFUA 2DX7A 1PLLA 1YFJA 3FE2A 3OX4A 1NSFA 3FOEC 4AI6A 1CY8A 1E8NA 3EUFA 1A8QA 3OQMA 2ATEA 4COOA 2IITA 4E2ZA 1PFGA 2RC6A 4YMHA 3N87A 3KZNA 3SWWA 2CDRA 1VBFA 4NZ9A 1MC1A 1USKA 4TXLA 1DCFA 3QEOA 3Q7EA 1GILA 4XWAA 3I1FA 3F67A 1R8JA 2DCMA 4WVFA 3IAHA 4RM2A 4H1WA 1E1RA 1ILWA 1EH5A 3E9YA 5KYVA 2JIQA 4AG3A 4UNRA 1GDDA 3F7TA 3V97A 3EVNA 1NIPA 3E23A 3KLBA 4HFMA 1ADBA 1TZKA 5CD1A 1NVUQ 2QXYA 3DFZA 3ANTA 4ZP1A 4AIRA 3IAFA 1MHTA 1DFGA 2J3QA 1NBHA 4Z4QA 3ZV5A 4RCZA 3U9SA 3EZFA 4DXDA 5LZ2A 2JRCA 3OZGA 2ZB2A 4MRSA 3CEMA 1DJLA 1VIMA 4XLZA 1QGED 2WOOA 3RH0A 4B79A 1B8OA 1U8XX 4GXTA 4UHBA 5B4UA 1P39A 1K2WA 3MMXA 1N57A 3EZ7A 3OEHD 3Q6NA 1MJGA 2IP1A 3W05A 5CB8A 5KVVA 4TV8A 3K1AA 4BVFA 1NN3A 4HR7A 4RF4A 2B61A 5AKHA 1O0BA 1UKEA 1U2EA 5DFAA 1K68A 5HW0A 4Y9SA 3ZZUA 4GMKA 4GDMA 1YAJA 2Y0PA 4RUKA 3G2LA 2A1UA 2RJOA 3AERA 5B58T 1E9SA 2QZJA 4E7OA 2BEUA 2O6HA 3RI3A 2XGOA 2X4DA 5GJWC 2GHTA 5CLJA 5JISA 3S70A 3T3IA 5I9SA 3RFTA 4ZT2A 5ECWA 5GVSA 1GM5A 2QTTA 2Q8QA 1KVUA 1TA9A 4D9IA 5FL7A 2QU7A 2W2VA 1VL2A 5B1DA 4QXOA 3GVXA 3C5VA 2FV8A 3LPNA 1WU7A 3QTLA 4ND7A 5HNKA 2GEBA 2H9AA 1SCJA 2ZW9A 2QG4A 2AG8A 1NE7A 3B7PA 3G2HA 4BO2A 4EDHA 1T8YA 1Z12A 2C95A 3DA8A 4X63A 1K5PA 2PWPA 3MCZA 4WBXC 1JLKA 1AY0A 2A5JA 2HLDD 1UPFA 1O97D 2QQFA 3FM9A 3GMSA 3L7AA 4P0TA 4P86A 4IM7A 2Q1SA 1K4KA 4W5JA 5DW0A 5I5EA 4EI9A 4GM4A 1QGDA 1F2UA 4GPD1 1M75A 5C7YA 4RPHA 3VPCA 2CLCX 2FR8A 1IM5A 1R6DA 1C30B 2X2EA 3FMIA 3PLNA 1V9LA 1N0WA 3JSAA 2X8WA 4ID9A 5F77A 3ZH2A 3TLJA 3RC2A 1V8FA 4C87A 5AUOB 4JUFA 4YCLA 4KH1A 4PG5A 3DUWA 2J4CA 4AF7A 1DWQA 3FWNA 2HFJA 3WLPA 3S28A 3LCUA 3LC1O 1ZDMA 2C9MA 2J31A 2Z2ZA 3BXFA 4XVHA 3VYUB 4OHKA 5GPBA 2WC1A 3PE4A 5IK2A 2QTNA 3OE5A 4X3OA 1IWPB 4M1QA 4A6EA 1XPRA 4Z4GA 1Y8CA 2H1FA 1J09A 5IVDA 2RD2A 2VJNA 3MMPA 3NJ4A 5I8PA 1QZUA 2ZVJA 1YI0A 3IAS1 4HB2A 2WICA 1PK9A 4FZ5A 2KQUA 2W6JD 4BWYA 5HUQA 3F8SA 4TS1A 3GARA 3HDYA 4C1NA 2PS0A 3OBBA 2R6DA 1XA3A 3BD9A 4H3KB 3DO6A 5KIAA 1TEVA 1BWPA 3QKTA 2J59A 2JLCA 4GRIA 1QKJA 4MW2A 1G21B 3DM9B 3H8WA 5BRAA 1CTQA 5I4IA 3LF1A 3BMNA 5E7QA 1ZNXA 3BE5A 3SXUB 2JLZA 3VTAA 3CR7A 1OFTA 4BFYA 4F72A 1BXGA 3O5AA 2XUPA 1NULA 1AUQA 5FUBA 1K5GA 1QKIA 1ZMRA 3FMVA 3GH3A 3L4SO 4GD3Q 5LBIA 4AJ9A 1GAEO 4F4FA 2CXNA 2Q2NA 4AWBA 3W5CA 4TM7A 3I0MA 2Q5OA 4FE7A 1HDCA 3A3OA 4JJ7A 3FSRA 5F2EA 3W1VA 1ECFA 1KZGB 4JZKA 4WASA 4EG0A 2AX4A 1VPEA 2HUPA 4PTZA 1CEXA 2GBPA 4MS4B 4NBSA 2PH1A 4OFWA 4NCAA 4ZDWA 4BV8A 2VF4X 5CLGA 3DULA 2NZYA 3OKAA 4C3UA 1YB7A 2XI4A 1KH1A 1U04A 5A5FA 3VGJA 4GOMD 3TZEA 4LF7B 4AZWA 4ENRA 1C0EA 2G8NA 1RQGA 5T6MA 1QORA 1YB1A 3GFPA 3S1AB 2GARA 4CN8A 4EG6A 4LFCB 4OXRA 2VAXA 2CBGA 3MGGA 2G1AA 4EGFA 1M1YB 2QLTA 4LZOA 4XI9A 2NTVA 1F51E 2FUNB 3CPJB 4BRZA 1VHDA 2Y1GA 3EWSA 3ISJA 1K97A 2IP2A 2JJ2D 1UOEA 1GT91 1S9DA 3GN1A 4KLNA 2GK6A 3WFZA 1SBIA 4Q01A 1YCFA 5DWVA 1W4AA 3LCMA 4OFXA 3WXMA 1UJ5A 3ZXSA 1GPNA 3VOBA 2IXDA 1YQ9A 3GBSA 5DF1A 2NV2B 4LI0A 5JWRA 3GOHA 1S8AA 2X77A 2QQGA 2XCLA 3ERCA 5E1MA 1Q74A 1ULBA 4KI7A 4BMZA 2EW8A 1DBPA 1KEZA 1NR5A 4PXSA 1AKMA 1KEVA 1QRTA 2IUYA 1H6CA 2O6LA 2I3AA 2FSUA 3QE2A 4OB6A 4FOLA 4X1KB 3WGTA 5BSFA 1RWNA 1FXUA 1SVNA 1NVEA 3L3BA 3DCJA 4RORA 4DSNA 3ZDXB 4EYGA 1VG0B 3JZFA 2CDAA 3HGTA 4HS9A 1RWXA 5B36A 2RG7A 1DINA 2VJYA 3BMCB 1IN4A 3IYLW 3L7IA 4PYLA 5FV7A 4BFLA 1KOFA 1NVDA 1ZGJA 1NP7A 3VR4H 3CRNA 4Z4IA 3NHLA 1QU2A 5JD6A 1K86A 3A3PA 3TINA 3DE7X 3KV1A 1XD2A 4PZCA 3IAUA 4UE2A 3ZHTA 2ID4A 1SVOA 4H1HA 2JLWA 1IJEA 1F6WA 1U81A 1CUBA 4J1TC 1ZGGA 2EOAA 1GXSB 2OTCA 3HWSA 4QRDA 4LOLA 5LC1A 3KWFA 4D45A 2B1IA 4EWLA 3S8YA 4G4SO 3AIKA 4QUJA 3FDFA 2OOKA 2WJJA 4D7AA 1GQ2A 2HRRA 4RVHA 4BEWA 1IJKA 4BGDA 3IPRA 4F96A 4M9SA 4Z51A 2WP8J 3U3ZA 4DRYA 2ZJAA 1AHPA 2DBZA 2CV2A 1T1IA 1TK9A 3IBCA 2TYSB 4HQNA 4JP8A 4XJSA 4UU0A 4M1WA 4I50B 4PAGA 4TLDA 4FI3C 2B1JA 3LSTA 2XNJA 3KC2A 5BR1A 4RVFA 2Y0BA 4LOHA 3T5GA 2ODEA 5D5QA 3IQXA 3AQIA 4NFLA 3RVPA 4P33A 3SI7A 1U7DA 4C0QC 4CN9A 3IQEA 2HRZA 2RGBA 5A3RA 2VDRB 2EGGA 1MH1A 2HB6A 1JKIA 3BDIA 3JARA 2NZJA 3PHLA 3OA0A 4FWBA 3TB6A 4ETMA 2WZBA 2NZ8A 1MX3A 4BHTA 4HVLA 1FRZA 3I09A 2Z2YA 3HH8A 4N76A 1RWPA 2DT8A 4AWXA 4LOAA 2XDQB 1Z8HA 4AKEA 3D3QA 2C7GA 4LRXA 4MGKR 5F3DA 2GAOA 2IXAA 3D7LA 4OMFG 2ZYHA 3LBHA 5DM2A 3AVTA 2H29A 2X2FA 3QQPA 1LPMA 3O9VA 4QNNA 1KBZA 3WLAA 4Z99A 4G26A 1P9NA 5F7XA 1ZZEA 4OOFA 4WMLA 2F3UA 1E98A 3KWLA 4EMBA 1ZA1A 3ASVA 2B25A 2ZUSA 3CC8A 2XW6A 2FW1A 4K3VA 5EPOA 3G79A 1E6UA 1R4MA 2CD7A 3EOZA 4FFNA 1A5SB 4LRQA 1DEXA 2WLTA 1WZ2A 1M2HA 3BGIA 3LMKA 1T1RA 1NKSA 4N8DA 1GL9B 3EGDA 5LBUA 4E5MA 2P2SA 1BSVA 2XA9A 2YWXA 5GMOA 1JG7A 3BF7A 4XCXA 2RKWA 3EZNA 2B6NA 4BB6A 2FWJA 4EATA 7GPBA 5JAIA 5HTOA 3QU4A 3FY4A 3G5TA 3T41A 2XLBA 5EZYA 4RDCA 4E94A 2BEJA 2O3TA 2CHFA 2FE1A 3KU4A 2RHWA 1SUSA 1VLVA 3HHEA 1Z15A 5LNK6 3I01M 4BNIA 2BT4A 1UBEA 4V0RA 4EGSA 1WMEA 4R2LA 3ZV7A 4LECA 1NVWQ 1SKAA 5CDFA 1RYFA 3S68A 1VE9A 4JUIA 2FPOA 3LM8A 3SR3A 1NQ5A 1UF9A 5K0LA 1QQ6A 1F60A 1E66A 3AJ8A 4TKMA 3EW7A 3S99A 2FHPA 4S05A 2B2NA 2HHCA 2P6MA 1MC5A 4EHJA 1U9ZA 2JGNA 3FHJA 5C31A 3V2UA 5CVCA 1ULTA 1YD7A 1KZ6A 1ORWA 1FY2A 3A9WA 2IWHA 2WSBA 2L18A 1N7JA 4QT0A 3GFFA 5EVCA 4DKJA 4X90A 3NHJA 3REQB 1U3DA 1D9ZA 4WZBB 4FOOA 3MGAA 1NMQA 1CQIB 2XQJA 1DRWA 2F55A 1TAQA 1C30A 2HF8A