4RA9B

Crystal structure of conjoint pyrococcus furiosus l-asparaginase with citrate
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
128
structure length
128
Chain Sequence
HMAVLVIKLIPGLSGDIFRAAVELGYRGIVIEGYGAGGIPYRGSDLLQTIEELSKEIPIVMTTQAMYDGVDLTRYKVGRLALRAGVIPAGDMTKEATVTKLMWILGHTNNVEEIKVLMRKNLVGELRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-asparaginase
publication title Structural and functional insights into an archaeal L-asparaginase obtained through the linker-less assembly of constituent domains
doi rcsb
source organism Pyrococcus furiosus dsm 3638
molecule tags Hydrolase
total genus 43
structure length 128
sequence length 128
ec nomenclature ec 3.5.1.1: Asparaginase.
pdb deposition date 2014-09-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.40 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ra9B00
2OCDA 5K4GA 4ECAA 5CBPB 1NNSA 5K4HA 5HW0A 5I48A 1HFWA 5K45A 5DNDA 2D6FA 4R8LA 1WLSA 1HG0A 1WSAA 1JSLA 1HG1A 1ZCFA 3NXKA 4NJEB 1HFJA 1HFKA 4R8KA 1WNFA 5DNEA 2P2DA 2HLNA 2WLTA 1ZQ1A 1JJAA 3NTXA 1DJOA 1AGXA 1IHDA 4RA6B 3PGA1 1DJPA 5I3ZA 3ECAA 4Q0MA 4RA9B 2GVNA 1JSRA 5F52A 1O7JA 4PGAA 2WT4A 1HO3A 2JK0A 5K3OA 5I4BA 5DNCA 1JAZA 2P2NA 2HIMA
chains in the Genus database with same CATH superfamily
1TYBE 2C5SA 3OX4A 3P2IA 6REQB 1W4RA 1YB2A 1XO1A 5H3LA 4ZXPA 2VKTA 1SOAA 2ONKA 5AKXA 1H1LA 4YRRA 5GGXA 2W2LA 4ZYTA 5EPUA 2CVOA 3DDUA 3DO8A 3P7MA 4PYLA 4PHFA 4CMBA 1LBEA 1N9GA 4IGKA 1A9OA 4MRPA 3UQYS 2PT5A 2VUHB 4YAWA 5DXAA 2D62A 1PCXA 1I3MA 2H0RA 3SFVA 5DBFA 4PNZA 3RR2A 4G0VA 1ODTC 1I36A 3PXUA 4WBNB 1LB1B 2A30A 2VK1A 4MVJF 3N3BC 4HO1X 5D00A 3G5UA 5CVTA 1FYVA 4ETMA 2VDPB 2XOKD 1QIMA 3LHFA 5CA1A 4FJ1A 2OENG 2YYYA 4O2AF 1J06A 2HIMA 4Q3CA 2HA6A 3LU1A 5BNFA 3X1JA 3NTOA 3QUTA 4C2AA 3QOWA 2IZ1A 3ZU2A 4R0MA 2I6UA 1KY3A 3ZWMA 1Q83A 4J16A 3CVVA 3IT2A 1QPGA 1BMFD 4X1IB 4JLMA 2OXTA 4HG2A 1KDRA 4CKEA 3D4LA 2XJ4A 5CB4F 4K9MA 4V0SA 3QOFA 4TLMB 3QTLA 4AP5A 3LFTA 4J1NA 1IEWA 4UQLA 5I9LA 4WZBE 1OY1A 3KETA 4EPYA 2JLSA 5HF9A 5F64A 1SKBA 1DS6A 5KTSA 3GH1A 3WDLA 1CZRA 1B3RA 1QRAA 3QU9A 1YDHA 1H9BA 2FJ0A 3VZSA 5JBQA 2WJGA 1H6DA 2J0VA 5F2OA 3BBPA 4ZCLA 1GA4A 1Q7RA 2OKGA 4M99A 3KOYA 3BHJA 3C8DA 1VJGA 3UXYA 4MRVA 3RUCA 2HIGA 5ALOA 2UYHA 4KXYA 3I3SR 2AD1A 2BF4A 3OFND 4QDUA 4WQMA 3DFFA 4I4NA 5FWYB 3ZLJA 2BP7B 2OAEA 2Y1XA 1M8PA 1C9MA 3AJ8A 4XVUA 2PEYA 1NNEA 4WOKA 1L9XA 5C3UA 3VISA 4CTMA 2D2IA 5U9CA 1K4MA 2OLKA 3PWKA 4YJFB 1W6RA 7YASA 1V2HE 3O8DA 1QZZA 3VTAA 1U8CB 1V3VA 5HJ2A 3TSWA 4BIIA 4TKUA 2WQ6A 1JG1A 2EARA 2FE4A 5LXTF 1WTAA 5KREA 1T1SA 4QT4A 2AX4A 3UKJA 2JH3A 4C6SA 5BNIA 5I8WA 2Q3JA 3TL6A 1E1CA 5LQAA 3G85A 5JS6A 3NKLA 1GTRA 4HDKB 1GG9A 1RP1A 4JB0A 4OB8A 1OUMA 3WWEA 5A04A 3JU3A 3BIOA 5HOQA 1XCPA 4Q34A 2NP6A 1EK0A 1SQGA 2BFEA 3LUHA 4WK6A 4BFVA 2XT0A 3A27A 5H3CA 3JQEA 3AM5A 3NUQA 1IZ7A 4V0OA 2BTOA 5ADHA 2F48A 4AMGA 3V4PB 5PGMA 1P9NA 5DCUA 3WWZA 3JRNA 3K1YA 1H2YA 1IBKB 2R6DA 5E6SA 3EXFB 3MBOA 3Q7IA 4IIJB 5FTMA 1H9CA 3ZDBA 1YXMA 4R9SA 1YJBA 4KMMA 3IVXA 5KSOA 3LLVA 1M3SA 2GVNA 4XASA 3KSRA 4G5OA 3HXOA 3VRHA 3E9DA 3ZHOA 3KQNA 3SHQA 3MTBA 1IXSB 3HKBB 4F0JA 4KBFA 1TT5A 1V6AA 1IRIA 4MIYA 3KVVA 4WSOA 1F06A 2IIPA 4YRDA 2IYTA 3A3PA 5B55A 4IMJB 3VKHA 4JGIA 1FNNA 1AKNA 1G8YA 2VHEA 3VYSB 4XPIB 4K87A 4MW1A 3PITA 4PRYA 1USWA 3KAJA 2D2FA 5JCZA 4PZUA 4M8SA 2X9NA 3CGGA 3HSSA 5CBPA 2D1FA 3HVRA 1G2QA 1DKLA 3PBKA 4ZJPA 1DWPA 2Y1LA 4JVMA 1PL8A 1J8YF 3H04A 4O0MA 3Q12A 2II6A 3QE3A 3TQSA 1K08A 3RT1A 4LISA 2ZRIA 1ZI8A 1VJ1A 3K9BA 4GOMD 3R7WB 5GVRA 1YGPA 3TBFA 3DVAA 3LP6A 1DIAA 3TGWA 3NWPA 3WJ2A 4LCBA 5ALHA 5EQFA 5LQMA 1GQRA 2BEVA 2RBKA 3KVYA 3I6QA 4V02A 1WXHA 2YJ4A 2J0UA 5SY6A 2VDUE 4ZVNA 3U81A 2FWAA 1A8HA 3NHAA 1RSZA 3FZNA 1CJSA 3QW2A 3HDHA 4B79A 2YNMD 3JD0A 1E3EA 1MV5A 2PKWA 2CLLB 3CG4A 2QY9A 3KHTA 4GP6A 4HZUB 3DE6X 5FPPA 5KDLA 3ZY4A 3ZW9A 4B7ZA 1VE3A 1DV2A 1K88A 2QSUA 3FMOB 1PHRA 3HZHA 1TA4A 3GN2A 2I5PO 3H2ZA 2NU6A 3ONFA 1MNQA 1FP7A 2DBQA 1N2GA 2WMDA 2KLHA 2YL2A 5TSDA 1KIMA 2QRGA 1YB1A 5TNXA 4MWEA 4AUEA 2BGWA 1QM5A 1JNYA 2B5OA 4CKBA 4Y1GA 2C78A 2PO7A 3DOOA 2IDJA 4Q7EA 5G1NA 4MWZA 3N6XA 2CMKA 3W34A 3PRJA 1R66A 2H9YA 1T2CA 4MV5A 2V45A 3CU5A 3QY0A 3THYA 3OCWA 1RLTA 1OYWA 1EFUA 1R37A 3F8WA 4KAJA 5HKBA 5I9IA 1ZMBA 3I3OA 4FZ3A 5FTJA 4IIBA 1UKYA 2BFBB 2VYNA 3OAAD 4CU5A 3TXAA 1G3IA 4IP0A 1BDIA 2PLNA 3B6KA 2IHZA 1MD9A 1KI4A 1RWQA 3U1TA 4NXMB 1ZJ5A 3IAM1 3CO5A 5D1NA 3KXLA 3DMNA 3CURA 3WFZA 4COOA 1RWVA 4MEJA 3IODA 5E2BA 3SEQA 3W1WA 3AESA 4RA6A 3EQZA 3R23A 4X44A 1AZWA 3RIMA 2KW5A 3W5AA 3C7AA 1Y1KE 3EY4A 4OPMA 1X8KA 1OBCA 2YXEA 1MOSA 1NGSA 4A0FA 3BA6A 3HR4A 1PNTA 2BC9A 3I9KA 4YT5A 4QJ3A 3ZE0B 2EQBA 4IUBS 4K6FA 2ODEA 4HFNA 3K1AA 3WLTA 2XVXA 1GJRA 5DNDA 3THXB 3L8EA 2ZGVA 1DKRA 3EJ6A 1E5TA 5EIFA 5TPZA 3VO9A 1WOYA 3GVXA 3L8CA 4B48A 2YRFA 2JB9A 4B5KA 3DMYA 1DRKA 1QRSA 2O7RA 2VJQA 4ZHQA 5CT4A 4YP5A 4U6NA 3RSCA 5HG0A 5F12A 3LO5A 2FEMA 3VGJA 5JDCA 2CFCA 4XUCA 3U9TA 2R8PA 4OYYA 3RYCB 3PVSA 3FPKA 1V35A 4YQFA 1CY7A 1TQ4A 4GX2A 4OEHA 3AIMA 4F9EA 1WXGA 1Q3TA 2E4XA 2Z43A 3UKDA 1VHLA 2ONYA 3DAFA 4LRUA 4OGWA 4P82A 1PJZA 1Q92A 5TX7A 1NSTA 3SMQA 1QP0A 4LJRA 2ZKLA 2V3VA 1IQ0A 3V2HA 4YPOA 2BFDA 1XPUA 1P9OA 4MUGA 5DWVA 2D0DA 3BSYA 3HJBA 3TNLA 1RKXA 4KYVA 4B3BA 1ENOA 2PE5A 3KB8A 3WLJA 2FPUA 3EVZA 3MCAA 2DLDA 4EHDA 3UYKA 4R2KA 3WADA 4DNPA 1FDSA 1II9A 1CQPA 2B4KA 2OCXA 4MTCA 3K73O 3NT2A 3PT5A 3S2FA 2DQKA 4FX2A 1NBME 4C06A 5AVRA 3SC2B 1KK3A 3G8BA 1QFMA 3DLAA 4PF1A 4FYKA 4EG0A 3CX8A 1YASA 3FSGA 3KQLA 1Y6RA 2AYZA 4IFBA 5DYWA 3ZIAA 5JJLA 4M0LA 2WA1A 5D3QA 3SHFA 4HMOA 2HCBA 1NLMA 3Q9UA 1EFPA 1R00A 4ZJZA 3LC0A 3ZBTA 5EYPA 4PYRA 4ZI7B 4Q3BA 2NN3C 4N5LA 5AJTA 3TUJC 1F2DA 3BGVA 2FGJA 1MOQA 3NYWA 5C51B 3E8MA 3NTLA 3UAZA 1RI5A 4DZRA 2JH8A 5M5BA 4ND6A 1SA0A 4NZMA 3PIRA 1J22A 2ZQZA 4C78A 4DRXA 1A76A 3HGQA 1WXWA 1QGUA 4Z3DA 3JWHA 3JASA 3LYAA 4EHFA 1N57A 1OXSC 2VYVD 3PDHA 1UKZA 1C1DA 1VGQA 3KB2A 1XN1A 5KYYA 1M5RA 4RIGA 4HOYA 4X8HA 5D84A 2DT8A 2OEPA 4QRIA 4YUVA 1UAGA 3H9QA 4BRSA 4IFEA 2R4QA 4QVKA 1FJXA 1HDXA 1CRLA 5TMDA 3OCUA 4BJ3A 3FYDA 2BBSA 2ZIXA 4OH1A 4PZEA 5CXSA 1MXFA 1EH5A 4DY4A 4Y2HA 1OLSA 1QV7A 1SPBS 1ISFA 1V3TA 2GPBA 2J4DA 3AF2A 1D04A 1D3AA 3K09A 2LDBA 1MDFA 4OK6A 4RNDB 1G5HA 1ZN7A 1SULA 1SCKA 4J03A 2Q49A 4XDZA 3EFHA 4IHJF 2FZ5A 1WY7A 1Y9JA 4D2IA 2EBWA 4TVOA 3LI2A 1RXCA 2PX2A 4IHKA 3DTNA 2O3RA 4CEJA 1E58A 2H9IA 2QTVA 4Z4IA 1ZH8A 3ST7A 2VK2A 2A78A 1YR6A 5K8CA 2EJCA 1JXMA 1JDUA 1PV2A 2OP1A 2I4RA 1N6OA 5B64A 3OUTA 2VZEA 1TAUA 1LLUA 1F7UA 3GEHA 1Y3HA 2GPAA 4IS3A 4YRZA 3K6KA 2REQA 4HDRA 3NM5A 5FTWA 1KZYC 1R64A 1Z0IA 1JDSA 5FFFA 1XDGA 1J39A 1YFZA 2XQIA 5FI5A 2WFLA 2IX3A 4ZT5A 1A5TA 2V5UA 1IWOA 3OQIA 1A0OA 1PR4A 3N7TA 1MPTA 4R1MA 5A7FA 5BR8B 3PYMA 4MWGA 3B7GA 3ZJTA 1OZHA 2C0QA 3CJTA 2VXCA 3FVTA 5DK4A 2QM0A 5G0UA 3M6MD 4YLYA 4DUYB 3WB0A 2NO0A 1Z37A 3DBRA 4L08A 3ZPXA 1GVHA 5DCLA 4D56A 4J8PA 4I50A 3CKYA 1I80A 4NU8X 2ORIA 2EFCB 3AF1A 2BUAA 3KTAA 5UKDA 1PF7E 2B61A 1CRZA 1QO9A 3A06A 2JZNA 1E89A 3N3AC 2Y1OA 5DRYA 5FUXA 4FB4A 4G63A 2R1ZA 3PGVA 1SXGA 4BWYA 4GGPA 4ERNA 3DYBA 5E8RA 3VSAA 1I7DA 2J7KA 4W1PA 2GCIA 1PS0A 2XUQA 1SBNE 4HQOA 3VSBA 2PUGA 2NLOA 4HVCA 4YUAA 1TJ5A 2WJZB 1KEVA 4MS4A 2APJA 3RKUA 4E46A 5HRUA 3ONVA 2IYUA 4G8BA 4NYMQ 1RXWA 1Q0LA 4KTVE 4O8ZA 1J1ZA 3E0XA 3KV3O 5I5EA 5ETJA 2GVDC 2UVPA 1TM2A 1APBA 1KR5A 1UUFA 1FU8A 2JAQA 1YZ3A 2J6IA 2Z2YA 4E15A 1V2GA 3D0RA 3G7UA 1XNGA 4LC0A 3P26A 1ZCZA 1DTSA 2Y0CA 2YW2A 3L4SO 3VNVA 4HXFB 2ZUEA 3MINA 1UFRA 4IIEA 1GSAA 4UZEA 2B8JA 1XEWX 4D9FA 2WFAA 3GGGA 1FUEA 1JSLA 3PQ6A 3GRAA 3RJ9A 4BEVA 4RPCA 4JT2A 3PHHA 2BMAA 3HXLA 1S5PA 3H5VA 3IHKA 4LV6A 3U62A 5AW4A 2BN4A 4KR3A 3R4CA 4L9RA 1DC8A 4DIOA 3RBAA 3TM4A 2EDCA 2NACA 3Q2KA 4NYJR 2BMEA 4PAGA 4EWLA 2J3QA 3AZQA 3DTVD 4X54A 1ZJYA 3N2IA 3I28A 5TMEA 1VCNA 4WBNA 4RD1A 2RI6A 2B8TA 1FA9A 3V80A 4ZYUA 4DEYA 4IZOA 3SM3A 2IOHA 1S7CA 1YBFA 1XTQA 1KK2A 2OD2A 1V48A 2OHHA 1YAHA 2PX5A 3GYGA 4K9OA 3WGLA 2A88A 2HMVA 3U13A 2I9PA 2FF5A 1O8BA 3C98A 4NU5A 3CUVA 1SZPA 1XWFA 2F3RA 1GTL1 2BISA 1OKKD 2JJMA 4MCAA 4JOCA 1P81A 2QMOA 2QRNA 2WRZA 3N75A 4R8KA 2HIAA 3HGTA 3EZ6A 3NGMA 5DW3A 1WUTA 4HVAA 1BKYA 4QODA 1JHRA 5EJ9A 2Q5FA 3OHMA 4J2TA 3VU8A 2OUKA 4DV3B 2WUVA 4M0DA 3BTUA 4N7RA 3TCNA 1S4QA 2RKBA 3DGEC 3AUJB 3F6CA 2HSDA 4IJUA 4WK0B 1ZXLA 3V33A 4BEBA 1H0RA 2HHJA 5K0BA 4EVIA 1KDZA 1HE4A 2H17A 4Y6LA 3BF8A 1Q91A 4XWTA 3G6KA 1SVUA 2A9KA 5T5QA 5AHWA 4CDGA 1VYTA 5M04A 4I36A 1H6AA 3LWDA 4ZJUA 4ZV4A 1NDQA 1ADJA 2LIPA 5KBYA 1GAXA 4W9NC 3LC2O 3Q0TA 4C7JA 1RBZA 1CY2A 2DUMA 4LZNA 4FS8A 1DDGA 2IYOA 2VAXA 1Y3CE 3E5MA 5G2OA 1ADCA 2C2KA 4PW0A 1CEQA 2FWPA 2W6ID 4A2PA 4CF3A 1FOEB 2BH9A 1G5RA 2ZQYA 3TQHA 3DA8A 3RQSA 5B4VA 1K3FA 3I0ZA 5FWYA 2XCSB 2PKXA 2BP7A 4NOLA 5KSZA 5KTKA 1YRBA 3NEYA 3K15A 4HX2A 1WVIA 2ODQA 3HRKA 4M60A 4R1OA 3HU1A 4Q9NA 3WO1A 4ZIRA 1YF3A 2X1HA 1JQLB 3FGOA 4TWRA 1X8LA 2BV3A 3LZDA 1VKOA 2R7NA 3MTJA 8ATCA 1RMTA 3MTGA 2XKJE 4KK4A 4KQKA 3UCFA 2GXUA 2A5DA 2JC3A 2QLBA 1OXTA 3FJYA 1JJ7A 2H1WA 3ZDRA 2FSGA 1PZGA 1RQGA 1UPXA 4RLFA 4UVEA 5EAIA 4HDKA 4IJ6A 1I32A 3W8FA 2C97A 2L0XA 2J9FB 2ONZA 1MHTA 1YQUA 4FKBA 1K68A 3UMYA 3E23A 3IVRA 4X5OA 2A0XA 5E8JA 4K6KA 1I8TA 2OHGA 1HMPA 4JP5A 3HV0A 2DFKB 5AM5A 4DQ0A 2MWMA 2QTBA 1BE1A 1JHOA 2GI4A 3ETNA 3UB4A 2HQ1A 2XA2A 1TCBA 1J8QA 4IGIA 5C31A 5HUJA 5JXGA 5DHTA 3WICA 3B6IA 2VTEA 3EXFA 4IIJA 3T61A 1GG5A 3K0AB 5C4GB 2DEUA 1JR2A 3TFWA 1X39A 4L9AA 5LQSA 5B5SA 3N2GB 1N3BA 3H3FA 4WLVA 1SNYA 1YRHA 2FLWA 2O3SA 3U48A 4EKIA 2D8MA 3PDJA 1RKBA 3S44A 1CJVC 3T3HA 1QYIA 1HX7A 1FVFA 3LBAA 1XF9A 1GQSA 1PWEA 2ZIVB 4XPIA 2CUTA 2UUOA 3DZDA 2PRSA 2ZJAA 2F64A 1V16B 5KAMA 1G6OA 1K8RA 4BUCA 3OLZA 3I45A 5EJGA 2I3DA 5EHGA 3DOHA 2ODWA 2A0FA 3KLBA 1PT5A 2CF5A 3GVPA 3WYBA 2QT1A 1J42A 1PL6A 4CV3A 1P0PA 3R7WA 5B57C 5LMCA 3PUZA 2J3MA 3MCVA 1PYDA 1ZUNA 2W43A 5GP1A 2EC5A 4YJ3F 1N2EA 1NQTA 1WF3A 1HYQA 3KUXA 3RFXA 3GFRA 2IHKA 5KOHA 1PFYA 4OXQA 1TAQA 1E5DA 1Z5NA 1Z7WA 2WB2A 2Z5VA 1OBHA 1P61B 2C9YA 3Q15C 4IDQA 1MZVA 3F6EX 2VJKA 1X7DA 1YJCA 4TTVA 2P62A 3UO8B 1EUQA 1RYFA 1CZLA 4HZUA 1Z73A 1XG5A 3DT6A 4W7IA 4NS4A 1CS0A 3A4YA 2CC2A 2EU8A 1LK7A 3LT2A 4I08A 3MWDB 4KWHA 2BUBA 4EHHA 3SX0A 5ISMA 5DWQA 3NMUF 2O2ZA 1J00A 1D6NA 1V11A 2BM9A 2QM8A 3JRWA 4MWOA 5JD6A 4WZBB 1GP2A 1JW9B 3U3JA 3FNRA 1JDPA 2V65A 1P2DA 1IMOA 1TQ6A 2H2FA 3A04A 3M6LA 4A1FA 4RTKA 2EG9A 2CN1A 3IOEA 2QY6A 1P44A 1NJFA 1A04A 5GOTA 3O21A 3ZI7A 4HNQA 4J16C 2BFAA 3V46A 4I4IA 3OX2A 3CC8A 4ZQBA 3WHLA 3ZWAA 3SQLA 2JKZA 3K16A 2VYND 2A4MA 3WGMA 2B7LA 1QIJA 1N0WA 4CUKA 4V1CA 4QPNA 1K8ZB 2V6JA 1CUEA 4DF3A 4PCVA 2MDTA 4KN9S 4LZLA 4ZYVA 3KT0A 1J56A 2QXYA 3GXBA 1PR3A 1RFLA 3HI6A 3JYHA 4N9WA 1YDEA 3CO0S 2G71A 1WDKA 2MYTA 2RAFA 3GT3A 2OCBA 4H15A 4CNBA 5IN5A 2GCGA 5CEFA 3VJLA 3ZLUA 3F5DA 1R9NA 1ENPA 4A6PA 1PLJA 1VFNA 3A6GA 4P3PA 2PIDA 4FR2A 4E5UA 1RI1A 3DZIA 3ACCA 4BMYA 3SEAA 1G9TA 4F8JA 5E9WA 3C3EA 1JKJB 4WINA 5L7TA 5CNIA 3V1MA 3RFTA 1U5AA 3P9IA 2F2TA 1Q44A 4JK3A 4XAQA 2PAFA 1V9SA 1SKUA 4EY7A 3WZLA 2HO5A 1HDOA 4QEDA 1TIKA 4Z6KA 1FSZA 3C3AA 3F5QA 4XXHA 3T1QA 5L6LB 2P4EA 2OBXA 1NTRA 3Q3JB 2AZMA 1LDYA 1VXOA 1NYQA 3THXA 1ZIYA 3OIYA 1VCOA 4TL6A 4AX8A 1ZH4A 1Y8RA 2JZOA 1U2SA 2EF0A 2HSWA 4N6GA 4Q1DA 3RAFC 3WBJA 4RFSB 4R31A 4C6TB 1TI7A 1RZRA 1C0LA 3R6LA 2LCQA 1JLSA 4M9RA 4R3WA 2YZ2A 3GRFA 5AH0A 4H0NA 1AX9A 1CEYA 1IAQA 1BMQA 4TS1A 5IT0A 1EGHA 2B20A 5ES4B 3RYCA 1Y42X 4JOQA 3BXOA 4GC5A 3PK0A 4EFKA 1DCTA 2AMJA 1ZO8A 1ZY2A 2BGNA 2FUG6 2PH3A 4BVHA 4R2XA 3IXQA 4B4WA 3WLPA 2I7CA 5ALTA 4JMPA 4MLCA 1OVMA 3C39A 1YUMA 4JLOA 1QGYA 5AJHA 2ZS9A 5GWXA 4F21A 4B2LA 3LLMA 2Z8YA 4X45A 4O25A 5ALJA 1HE2A 2UYOA 2YC2C 5LBIA 2H00A 1FFSA 2YFYA 5I7UA 5IC5A 3A4TA 3FIUA 3QYAA 5CFNA 2PMCA 4BNLA 3N70A 2IU3A 4K7JA 5J1SB 2NXJA 4PCAA 2VP0A 4GUAA 3RW9A 1RYEA 3GI1A 5BUQA 2R6CA 1SUBA 1XHLA 2ZRJA 1C4OA 3D43A 2G25A 1T25A 1B1CA 3OIVA 4LDPA 4QL3A 3ILVA 2VDWB 3A37A 2HI0A 5E4FA 5CYGA 2NZXA 5AW5A 4PN7A 3EEOA 4G86A 2CDNA 2E4ZA 4W6QA 4RSHA 2EFJA 4O1IA 2PX8A 2JJYA 3MFYA 3R3ZA 4PO3X 3LSTA 1KVTA 1DX9A 3W5DA 1W19A 2RFLA 1F4LA 1SUIA 1XDUA 3SY8A 3TLZA 4EQ6A 4ZI7A 3UANA 2GWHA 5KOIA 4KVAA 2MR5A 4NYIR 3RWOA 3QI7A 3INTA 4YV1A 5JR3A 5TEVA 4NHEA 1RAAA 1U3VA 4N03A 3UHPA 4XWKA 4FQ7A 2Q2QA 4MVJG 1LLQA 3PPIA 4IV0A 3P0JA 1W36C 1OMOA 4Q9IA 4CF5A 1XCGB 1VI6A 3KNZA 1N1GA 5CT8A 1ODLA 3MA0A 4CDNA 5GZ1A 1HDCA 2EWMA 3IVMA 1MVNA 2E48A 2XWBF 3BH6A 1HI9A 1KBQA 2IW3A 3G0CA 3PA6A 4IGEA 3AR6A 4KH1A 5G3ZA 1A9SA 1FPQA 2GHQA 3SIRA 3VR5A 5A6SB 4PWZA 2GAFA 2JFQA 3IR5A 1JEYB 3JQBA 4LF4B 4I6GA 3UGTA 1F5SA 3F9IA 4YJKA 3LY9A 4KXUA 4Q6BA 4E3ZA 2N1MA 7GPBA 4INJA 4YMVA 2GCEA 5HIMA 1C9KA 5BV0A 1H2XA 1O6GA 4HDQB 2ARKA 4K81B 2CGEA 3EEFA 4EDHA 5HPYB 3EPLA 4Z86A 2D2XA 4GKBA 1I3LA 3T52A 3RLFA 2IKQA 1NOKA 4N5NA 1X1DA 1JT2A 4G0QA 3T8YA 1HYEA 4CM8A 1KJWA 1P0CA 4HYYA 3RFFA 4E88A 4ZDKA 3OUZA 4C4ZA 2MOKA 1XKXA 3CNOA 1OHHA 1UJBA 4F11A 2VG8A 3OOJA 2OGSA 2ZS8A 2DPYA 5E9QA 5CG1A 5FO0A 1IPEA 3GJTA 4G3XA 4MR7A 3UH1A 2VNJA 4LF9B 5EP2A 5C7YA 1KI6B 1E99A 5C80A 2O48X 3IIEA 3GJ4A 2QZJA 4PFKA 2IE0A 4PRKA 3H3JA 3NIFB 4DWVA 2G8LA 2HWKA 5U4QA 1L5KA 4O6VA 1E2EA 3K8OE 4L4XA 2I0FA 4Z99A 3AOEA 3QI2A 4UU0A 2UUAB 1KFEB 3SICE 5HRCA 4MDYA 4LF6B 5AICA 5A4KA 3FZYA 5C3MA 4F85A 4DHEA 1WM1A 3O83A 3EPKA 4JODA 2AEEA 1D7OA 1S9DA 4C5AA 4L4ZA 1E9DA 2REBA 3JZDA 1AY0A 3VPAA 3QEBZ 1FNCA 4BN0A 2O2DA 2Y0DA 3MK31 1YZYA 2HLHA 2ID9A 2V7EA 2XSZD 4QQFA 2ERXA 3ERCA 2XTAA 3MOIA 2CK3A 4FMDF 3FWZA 3T4UA 4EUKA 1XX6A 5JNLA 2XCRB 1Z2OX 1M54A 3G0DA 2CYCA 1B76A 4O4JB 3M6WA 3NC4A 4EFLA 2G1KA 5HJ7A 3UG7A 3BJEA 4N49A 5JDCC 4ZTUB 5MFPA 3AR4A 4UTVA 4U9HS 1E2GA 2A5GA 4AG3A 2WZDA 1B43A 3EQ7A 3R0IA 3GLIE 5JU6A 3NM6B 3L0ZA 2I29A 3I5MA 4Q7JB 5JT1A 2WF8A 4JI6B 1UMCB 4DFDA 1AS3A 1S3IA 4ENUA 1QDLB 2XMZA 2QPAA 3AI2A 3DL0A 2GEUA 3WGUA 5IZ4A 3PR2B 3U5TA 2Z08A 2W8BB 1ZC3A 1MVOA 3B82A 3O3MB 4JL6A 1P0FA 4AN1A 2IOFA 2QL9A 4JLUA 2J45A 5EI5A 1WSWA 1K98A 1LDGA 4DSOA 1AGYA 4QG7A 4DV1B 1KYYA 3EVEA 3EC7A 4JC0A 1WW8A 1B7GO 4Q4JB 2CZQA 2R87A 5ILQA 3UC9A 2VJMB 1ND6A 3FGNA 1EEHA 3HXPA 2WM3A 1CR1A 5GONB 4OFWA 1U31A 4ZXFA 5IULC 2BIFA 3EXIA 4R8LA 3GV0A 1YR2A 3N39C 2IU4A 3LQFA 1X70A 3OWHA 1G8KA 1IBLB 3KK0A 3IA2A 2H11A 4FFLA 1Z2EA 3TI7A 2QRLA 2QUBA 4YFVA 1EVQA 2ZSDA 3UK7A 4Q9LA 1L1RA 2CE2X 3BRWD 1CY8A 4JX9A 4JBGA 2O8DA 1XLVA 2WJ3A 1QUEA 4G5YA 2C7VA 4ID9A 1TT7A 1KRWA 1ZVMA 4DR2B 3DYVA 4DN6A 4KDEA 3OTOB 4DXDA 2PVCA 2JJ1A 3D64A 5JNTA 4QQKA 5E95A 3AHHA 1BMDA 1JLMA 1BN7A 3TG2A 3ICVA 1VBMA 1UF9A 1ZUWA 3IUEA 4JR0A 2IHBA 4MYCA 3VHXB 4BJ6A 1KMMA 4ENVA 2IL1A 1Q7GA 3CXRA 4TXHA 5JO0A 1TVEA 2HFJA 4A0SA 3LUGA 3PXBA 5GJVC 4P35A 3NHSA 4M89A 1TYCA 1KL7A 2VLIA 3UV6A 1RWNA 2K4MA 4G97A 2VAMA 4R83A 3A32A 3TDNA 2WWGA 3KQMA 2SKDA 3EAGA 3MGAA 2OBLA 2Z8YM 2VQSA 3PJDA 3QEMB 2AWNA 1RLOA 3TDKA 3TIIA 3W3AH 3WGZA 4F3NA 1ZOLA 1Z8HA 1NV9A 2J59A 2P3QA 3D5EA 1KJJA 3ICOA 2C8LA 4OKNA 4R9VA 3KAKA 4ZCIA 3GRKA 2QRHA 3HCRA 4GOKA 4D4GA 3HJAA 4TVBA 3FJOA 3A25A 5CYFA 5AR1A 5F5NA 4Y2GA 2BCGY 1AUVA 2QTLA 1Y81A 3K09C 3VNUA 1XZPA 5H81A 1UBOS 2HV9A 1JDTA 4D02A 3UTCA 3AU8A 1UOEA 5AI8A 1WCXA 1P8JA 4K6GA 5IX8A 2GF9A 5DBGA 4D74A 1XYVA 2OVBA 4K1XA 3X2SA 4E4RA 4DDKA 3PKZA 4JBLA 3RYHB 1ORVA 1N2BA 2I3ZA 3QKWA 5KWIA 1OLXB 2QR5A 3VNAA 3NVAA 1J0DA 1Z5WA 2AC2A 2VOJA 3MFQA 4JEHA 5FR2A 2QD2A 2FEWB 2Q21A 2PSHA 3VDQA 2V4UA 2CEAA 4NJMB 4CI9A 3SYNA 1R3UA 2QVXX 3GFOA 1NW5A 3QVJA 1N2OA 1RYYA 3L8ZA 5CD1A 1CQWA 3BD8A 3OJXA 4PEVA 3AUYA 3JQRA 2OXFA 2JFPA 1ODFA 3AIKA 4IW3B 1OLUB 4QTTB 4ZYWA 3IIKA 3DW1X 5KNLA 5ECYA 2F62A 3ESBA 4GYKA 2Q9AA 1KAEA 3BGIA 3IAFA 2AOTA 5GMOA 1XD2B 2QORA 2RGYA 2Y1CA 1Z33A 4B4DA 3T34A 5FNVF 1JDBB 1Q17A 4PPGA 2J9FA 3BFXA 3T5PA 2VWQA 5T67A 4UEJA 1S6YA 1A82A 4RVDA 1W4AA 3PDIA 2DPLA 4OMDA 5C5DA 3HJFA 3LTNC 3PC4A 1S9HA 4BKPA 4EO9A 1T5OA 1A2QA 3M3HA 5CJPA 4AIRA 5K9ZA 3U3KA 4KFTA 2QX6A 3CBQA 1G20A 5EPOA 1CWUA 2JFBA 2VTKA 3AI1A 3H5IA 4DQVA 5H68A 2FVYA 4RH0A 1X1TA 3H5RA 4HP8A 1Q7CA 3PFWO 3RTAA 1R0XA 4UNQA 1PSWA 1Z2CA 2XWSA 1GSIA 1QWOA 1SHUX 2H8GA 3K0AA 5DNVA 1JQKA 5MGNA 2Y4OA 3RI3A 5I3CA 1K4YA 4NH4A 4CIXA 2NXNA 3ULKA 2EVWX 4ARSA 2FKNA 1O95A 2BMJA 3M9XA 5JAHA 1PKXA 2VNSA 4DPKA 3FDIA 2GRJA 4JLKA 4UUPA 1NWHA 5BR7A 1Y0BA 4PVDA 1VKZA 3NT4A 1W75A 4PHHA 2QQ0A 4V0MA 3OIDA 2FYTA 5FWAA 3TQTA 1HT3A 5DX8A 5D6NA 3GFPA 3P9ZA 4PLVA 1WZCA 5G0VA 1JSCA 5AXCA 5DSZA 2CNWD 1P4RA 2DP4E 4G23A 3U7QB 3VPHA 4DT1B 9LDBA 1DC5A 1HE8B 1EVLA 3CKLA 4QRHA 1DKMA 1CR6A 1QXSA 1Y1SA 2JIRA 3T99A 3WX0A 4BLQA 4N7MA 1F1BA 4QYMA 1M2VB 2FOIA 3B2EA 1FLAA 3VC3A 3O8CA 1ENYA 1P91A 1I9GA 2C1EA 2UYQA 2Z2KA 3IO3A 2QMZA 4TROA 3ZBQA 3CLRC 1K8YB 1HLGA 4MKFA 1ESZA 3GQBB 2B1RA 2Q2OA 4BUJA 1W4CA 5IVHA 4B2IA 4PLYA 2BGKA 4RK4A 1MKYA 2EX0A 3T0FA 1RRFA 3JAKB 2YFKA 2WKRA 5BN3A 2Q8NA 2ZDQA 1HKHA 4PAOA 2HWUA 4YRKA 1G63A 3OE7A 1QMGA 4W5OA 1QAMA 2CYAA 3HKDA 4WZBA 1SQFA 3EMVA 1TM4E 3M1YA 1GPNA 3I32A 3W0LB 2P5UA 5JBIA 3QNWA 1IG0A 1RYMA 1BAPA 1V43A 2ERCA 1W29A 4XJXA 1JHPA 2HHAA 2NYAA 3P0EA 4NS1A 3TWOA 3AM4A 5JZSA 3IE0A 3OEEA 4LXIA 4P83A 1OT5A 2WJWA 4K0RA 5AM4A 3ZLBA 4BQOA 2P40A 4LMRA 4I8IA 2I71A 5T3YA 4WKOA 1O03A 2ECOA 2YXDA 4E08A 5JUWA 1VLHA 2PZEA 2QVBA 4TMZA 1N9ZA 4IKEA 4UTOA 3HDTA 2HXSA 1KFCB 4WZ6A 4FDAA 3KOOA 2BZ0A 2VP9A 2GCNA 3O73A 3GWZA 4J94A 2AG5A 5D1HA 2EFEB 3CR8A 4BN4A 4EEZA 3UH0A 5BSKA 5CLJA 5HJEA 4Z4FA 5DT9A 1CDDA 2RHJA 1FJGB 2E21A 2QEQA 5EMNA 4ZP1A 3FNFA 3ILYA 5HP4A 1XLTC 1H2WA 2I2CA 5EE1A 4GKAA 2RHCA 3KO8A 1NU8A 1HF3A 3PXAA 2GBGA 5U4XA 4J2OA 3ZE8A 3S1AB 4A8JB 1TCAA 4RDHA 4C7MA 5JLAA 4MKIA 1NJ2A 2EFGA 1JSXA 2OZLA 2PUVA 1E6UA 3GUYA 4LXQA 3BWBA 4XA8A 3SR0A 2HOQA 1SXJE 3VKGA 3PKIA 1ULSA 1T4DA 1X8XA 1T0UA 1RPAA 1RQRA 2H2DA 2ZRBA 1FJ2A 1FYFA 2IUUA 3B1WA 3FWYA 3VJKA 5AMXA 5BXYA 2ZVQX 5A05A 4UM5A 1E7MA 4NE7A 2HA7A 2NV0A 3HMQA 1S1MA 2R3SA 3ZCTA 1DFIA 2KPOA 2NO9A 2QJTA 4G9EA 2O0LA 4JEIA 1G8MA 3HBMA 4RFSA 2X0EA 4G4SP 4C6TA 4EPVA 3TOVA 4D4JA 1PGNA 2ZIFA 3LL4A 2GFIA 2FX2A 3JQ7A 4GR4A 4ARVA 1SXQA 2C92A 3ZCPA 3FPCA 4OHYA 3SPXA 4QGFA 3Q3EA 4TLLB 1OAKA 3LRXA 3UJ9A 1VRVA 4MUNA 1I7LA 5AXAA 2Y1FA 1DCFA 1QFYA 4UC0A 5B3AA 1OI3A 1AO0A 1MJFA 5J2UB 1TQHA 3KJZA 3ZEIA 5E1OA 4C05A 2VXOA 4IO1A 3OCYA 1MJGA 2P4SA 4P3YA 3WRYA 1OWNA 1A98A 1V39A 2ZT7A 3M4YA 4GPEA 4EW2A 5FQNA 2HGZA 4I2NA 3OT1B 4HFJA 1QOZA 3KUUA 2A1UA 4MROA 4L6IA 2BFPA 2CV0A 2VAWA 5AVKA 1U6JA 4AS2A 1QV6A 4XOIA 2H3EA 4PTLA 4GR9A 4PTZA 3CF2A 4Q1BA 4CCYB 3CQ9A 3NVDA 5F2KA 1FVOA 3ECSA 1O1YA 3DFIA 5JAMA 3OJCA 1PUIA 5C34B 4BNYA 4F6LA 2B9VA 4HAOA 3O91A 1WU8A 4Q01A 3BC1A 3SAJA 3UT6A 4BP1A 3H16A 1PZMA 1GUBA 3H05A 4KWIA 2GAAA 2R5NA 4WCVA 2P0AA 3I0NA 4PR0A 3SG0A 2HM7A 4ZO7A 1KYQA 4LYAA 1NJSA 2QPOA 3KYCB 2AE2A 1UJNA 3DD1A 4WLEA 5AJZA 4ZU6X 2XITA 3HL0A 1JWBB 1QGED 1VDMA 1HY3A 4IDFA 1QG2A 4GX0A 3L18A 4ZVTA 5E9AA 1TA0A 1XZLA 5BOVA 5JQGB 4M87A 1TUIA 2LNDA 2LWIA 4Q18A 5IH7A 4FX5A 2O50A 1AKMA 4GPZA 4JL8A 5HFNA 1SHKA 1SU4A 1JEYA 1T3ZA 2ZFUA 3L07A 4YRPA 2PRZA 3OPVA 2NZYA 3W78A 1RTKA 1HRDA 1V37A 3T5TA 2H16A 3FBWA 1E79D 5E6UB 3THWB 1EA5A 4H1UA 5JNRA 2Y67A 5DNEA 1U0FA 4COKA 1U1GA 3M70A 1ZYUA 1E1QD 1OHHD 2AVNA 3Q85A 2YJZA 4RQUA 2NQ2C 3B8HA 1TYZA 1UKBA 1OFGA 4MIEA 2QPLA 5FL3A 1LFAA 1JXQA 1NBOA 1QRDA 3DKVA 4LHWA 4BNNA 4E1BA 5FA5A 1RC1A 2DBYA 3A9CA 3R0ZA 2I4IA 2QT9A 4ICIA 4RPIA 4TXLA 2D3TA 2RHOA 4ACBA 4RTPA 3N7AA 4UU1A 3ZDDA 5DDIP 1YDFA 2CJPA 1BX1A 3A8TA 1M72A 5F7JA 3MJFA 4GG1A 4QJ5A 3ZJUA 3NR2A 1T9DA 4C0QC 1A9YA 2WPNA 4HH0A 4KNWA 5FTNA 2Y3IA 1JHDA 1FQWA 2XDAA 4NMMA 1BTOA 2W2XA 3C41J 4KGZA 5JNSA 1QQ7A 1Q3HA 1KI6A 1WJGA 3BB1A 3KEOA 4UNNA 1PEYA 3R5JA 2XIJA 1E2HA 2UZ1B 3QBVA 3COSA 3GMSA 3O82A 1NAHA 2VC2B 4UM9B 2NOAA 2C54A 3H5OA 1T2FA 3OPMA 4FSXA 3TXYA 2X0JA 1QS0A 3VYRB 2PUHA 4WKBA 2XBMA 2J0QA 1LW7A 2FQXA 3KOZA 1S3SA 1U8AA 3AJDA 3FX2A 3ON5A 3F97A 1WXXA 4LJ8A 4LRXA 2NPFA 2CK3D 1M2JA 1Z6GA 3O8QB 4GVXA 4HD8A 4O4LA 2YWHA 8MHTA 4EELA 3PPWA 5GM2A 2I91A 1LSOA 4MUMA 5K0NA 3TTSA 7MHTA 3UFBA 5AT1A 1G3UA 2CLDX 2IUYA 2Q7XA 3IUBA 4RCZA 4R16A 1JFFB 4X41A 1ML4A 3W90A 3FLMA 3GFVA 4N5HX 3R9IA 4FT2A 3GUUA 1UK9A 2WBLC 1EFAA 1HOXA 4HPWA 3I39X 5HF8A 2R0QC 4MQEA 4O1MA 4EH1A 5DHFA 3OC0A 1SCAA 4X90A 4ZAGA 4JUIA 4O4JA 5AI0A 1A3CA 1KHHA 2ECFA 4LY6A 4O08A 4XVQA 1X0VA 1RWWA 2X3YA 4LQDA 3VTFA 3DDZX 5IJZA 3THYB 2JZCA 4MLDA 4WN9B 2B7CA 1NMZA 3WO0A 4LQ4A 1UMCA 2EW8A 1L5WA 3NBQA 5CT9A 2AR7A 1NXWA 3KKQA 5HX7A 1R8YA 5U1PA 4ZHSA 5A5EA 1RXYA 1NBMA 1H1TA 4OP1A 4EY3A 4CM5A 2W8BA 4B3TB 2HJHA 3MIZA 3F4BA 3FYSA 4ZAFA 3RDPA 5AVTA 4L50A 4H18A 4E0BA 1U0SY 2QBYB 3TLEA 1BHSA 1D07A 2JCSA 3VPBA 4CF4A 1HNXB 3R3HA 1EFVB 1UWLA 3ZHUA 3KP1A 1P8AA 4Q4JA 1Z4OA 2VJMA 1TYDE 5GONA 4QYWA 5BMVF 2NZ8A 1ZK4A 1QGAA 3C3BA 3OY7A 4EK9A 5ADWA 2CLMB 4GD3Q 4WXEA 4LXTA 3GT7A 3R1IA 1R3DA 3LP5A 1ZRMA 2VRBA 1RXVA 1DXOA 5FBLB 3OOSA 2IDMA 4Y0AA 4ZEOA 3RVSA 5A7HA 2WZCA 4AWBA 4X97A 1E8MA 1T35A 1IJEA 4YP0A 1BS1A 1KMHA 3BX1A 3OG9A 4Y6RA 1XA3A 2IBTA 2C4UA 3N7UA 3AP2A 5JE8A 3RTBA 3PXDA 4OHBA 1V8BA 1DQNA 1OWMA 3MXOA 4ITVA 1FRZA 5HILA 3CNEA 2J0SA 3VHXA 4NICA 4M6WB 1M67A 1WABA 4EF4A 3P0IA 1TZ2A 4UASA 5BSFA 3A1EA 2PJDA 3QKRB 3RRZA 1P2GA 3MMZA 3RVLA 5L51A 2CVFA 2P4UA 1E1LA 1L5FA 5ALYA 5E0OA 2P91A 2B6HA 3L7IA 3WSTA 4DSTA 3W7BA 3B5IA 3CEPB 1CW2B 2Q5CA 3B9BA 3JQBC 4RY0A 1T8PA 1XU7A 1MAHA 4HAIA 4N4AA 2PXCA 2VH1A 3COVA 3KSUA 1UMDB 1GPUA 1GAWA 3KV1A 1DEHA 4NBWA 5JPIA 3UJ6A 5C7LO 4R9UC 1E1DA 2JI8A 4UHBA 1AMOA 1Y3BE 2HRZA 1UKAA 2IDKA 2WHPA 4KVZA 4WX2B 4NMWA 5CLHA 4KQWA 4OA5A 2OC9A 3JS5A 2BHRA 1UFKA 2DFVA 2ZJZA 4YJGA 3GA7A 4HN4B 2V9CA 3HY6A 4FI3F 4XD7D 2I62A 2BGMA 3RU9A 3OLCX 5JVDF 1EXMA 1OCEA 3P9XA 5A3RA 5G0WA 4PGHA 5DGTA 3G0IA 3RYHA 3SC6A 2OAQ1 3GCGA 1EE9A 1OLXA 1W0JD 2CXQA 5BUZA 1L5VA 4LXYA 4ZQGA 1UBKS 1N8SA 4OI1A 4EB6B 3MMSA 3ZWVA 1ZHFA 1MBZA 3L5OA 4TLAA 2IZ7A 5TMPA 4MPRA 5DISB 5BW6B 3STUA 3AVTA 5BWNA 3G68A 1G1AA 3QXGA 4LDJA 4B3DA 5I7OA 3H5AA 5KTPA 3AFGA 3V7UA 2PANA 1AKEA 1U5BB 2Y8EA 2YJNA 3AEYA 4LJSA 4PONA 3W9BA 1CP2A 4AURA 4DW8A 3ZE7A 4KZPA 2GXQA 4DZTA 4P3NA 1DRUA 1DJQA 2WLSA 1W5BA 4DKXA 1E3IA 1ODKA 1XD2A 2PVSA 2W6PA 1KQNA 3TTTA 3VKFA 3GLIB 3STVA 4HVLA 1MC4A 4DWWA 3ANLA 4YUZA 2I99A 1C4KA 3J81k 4YAOA 1L2TA 2H4YA 4WNIA 4WLFA 2R97A 4JHXA 4Q1AA 3VXKA 2DTDA 3TBHA 1SB8A 1GO2A 2XCUA 1YB5A 2M1ZA 1SN7A 2O3UA 3AZPA 4KQFA 2WU1A 3ZH2A 2QOEA 4RPLA 4C4OA 5TGDA 3VPXA 3BHNA 3BJMA 2JA1A 4MUKA 5J4HA 5KOJB 2AKYA 4BRWA 3TAHA 4BCCA 1QFSA 4M1SA 2VQFB 1XA4A 4RF5A 5CT6A 3WL6A 1QPBA 3P4UA 3FMIA 2B35A 3NO4A 3VR3A 5TDHA 5DV9A 5KDOA 1A77A 4FXPA 1W35A 2OLEA 3O9MA 4XX0A 4JLAA 3OFSA 2MCFA 3IS3A 4EHLA 4JP3A 4WK4B 5AK4A 5JNUA 2NVUB 3NRBA 2FCAA 1P2VA 4WOPA 1H2BA 1ECBA 1HEIA 2QD1A 3UB2A 1H6BA 3ZZUA 4C4TA 3CH7A 3PEEA 3MWFA 2BSQA 3EF0A 3B6JA 3K71B 4X9XA 4R98A 3T41A 4KREA 3KZOA 3OZRA 1R9MA 4IF4A 3ZDYB 1Y4SA 2GNAA 2FF7A 1GPKA 3A6FA 3IAXA 3AHFA 1Y7PA 5KAPA 1I4LD 3ZV6A 3VPFA 4PVCA 1EBBA 3KD2A 3D3WB 2P7IA 4DT1A 3U7QA 2DH6A 2JGFA 2JARA 1YOVA 3M8KA 3WWOA 1IB0A 4OHRA 3Q3CA 1RHJA 4GM1A 4R8VA 2K6GA 5IAEA 1XJWA 2ZWIA 1S4MA 1M2VA 3FMGA 4QVIA 2FN7A 3AUTA 2Z4TA 3R5TA 3IUJA 3L01A 3M4NA 4X0EA 5IAGA 5BVHB 2BSXA 3F46A 3U6BA 2EBHX 1T6NA 2A5LA 2GNPA 2PN1A 1HFEL 1GPAA 1SY7A 2C0PA 3HB9A 3JAKA 3N1UA 4KXNA 3VGPA 3VZCA 1EFDN 3L5KA 2JLVA 4RY9A 1J7KA 2BJHA 1L7XA 2Z4SA 3CUKA 1YR8A 3TR5A 3LW8A 1GKIA 3N6VA 5K0CA 2QLMA 3AY0A 4WTOA 1P2FA 1EGQA 4EMTA 1UKVY 2C2MA 4KE8A 5ALFA 1M9NA 5L95A 1GZ4A 1LY1A 1VSQA 2ISSD 1VJTA 1AMNA 3HXKA 4CRWB 2YR0A 4KRXA 5EL0A 4EGAA 4IX9A 2XB4A 3GMTA 4FMBB 4NJEB 2HR1A 4LBVA 5CDYA 4DJJA 3L0DA 4DCJA 2HEGA 2IT1A 2HRRA 2ZI4A 3DXZA 3EGXB 4DVGA 4CKCA 1UEIA 3WIVA 1V7CA 1EGMB 1M0WA 4FEYA 2WQZA 1Z18A 3JRXA 3LX4A 4DLSA 1I14A 3LBHA 1LH0A 4PNEA 2FMTA 1K06A 3OSUA 2F9LA 4PLHA 1W4BA 4EA7A 4C2UA 1PS9A 5CVDA 2QGFA 3DOFA 1TJYA 4OMUA 2VSFA 4NBRA 1RZUA 4M9CA 1UDXA 4DJEC 3GEMA 3TOSA 4R01A 1NW7A 1SOMA 1IPFA 1YBHA 1YR3A 3N8HA 2XB6A 1OTYA 5COQA 1NURA 2DMRA 3IAAA 1VQ1A 3S1AA 2MYPA 3GEIA 5FLXA 4R6XA 1GTVA 2MMGA 4FSDA 3KPWA 1ISJA 4I99A 5TARA 4S3MA 1CUGA 4TX1A 4UXJA 3K0SA 4GBED 1C30B 2J67A 4U7DA 1L8LA 1IJKA 5JROA 3AWIA 2V96A 3AERB 4MVWA 3L2OB 1HETA 1Z56C 2WDPA 1Z6TA 1WUKS 5HGJA 4EB8A 3SXJA 1THTA 5K0TA 2ZG6A 5EQJB 1O08A 4B6OA 3G59A 1GPDG 1I2MA 3O2NA 1V8ZA 3P0HA 4BNGA 4CQLB 3H17A 4PC3A 3V1KA 5KNCA 4ISCA 5AQEA 3P96A 5DX0A 2ECKA 2OXCA 5AVSA 4X95A 1RJ9B 1OXVA 1VBFA 2D5IA 3QJ5A 1KQOA 3IJPA 2C88A 4FE7A 4NAVA 4D0NA 3OETA 1QFJA 2QVZX 1QGZA 2MSLA 1Z74A 4AB1A 4DDWA 2AZ4A 2WVJA 2VKQA 4BMPB 4C5CA 5JY6A 3E9NA 3R44A 1QH0A 2BW0A 5JARA 1T8SA 3C6YA 5H82A 2B1GA 5KKCA 3WP1B 4HPJB 5F77A 4ZVSA 4HLCA 5JJIA 5FPKA 2ON6A 3W05A 4ROTA 3HZOA 1FVXA 1A9QA 3V4LA 4DABA 3DT8A 3U19A 1KIAA 2VT7A 2OESA 4NKRA 2YHIB 1JAIA 1PDVA 1I33A 1QLJA 4IIHA 4ZDJA 3D6TB 1SD2A 1Y8CA 4Y9TA 3VR6A 1L4GA 4FIZA 2H2HA 5K8IA 5BQXA 4P4UA 4HGPA 5A0TA 1SK9A 1TM5E 3SE7A 1YZVA 1XF1A 2VPPA 4M7PA 4NCJA 2IYZA 4J0EA 2XCOA 3A58B 1VM6A 1K5HA 2G04A 2TMKA 2FCRA 4JJEA 4GMGA 2HQOA 2B78A 1KDYA 1E2DA 4RVUA 3M6VA 3RK1A 1ZSVA 3SJZA 1BA2A 1IBCA 4C87A 4ZU3A 3BULA 1X0XA 5DVZA 3UMBA 3V8NA 5JJBA 2JF0A 2JGMA 3QELB 4A0HA 1NMXA 3DP7A 1G3QA 2BMDA 4RYDA 1IOWA 2JCXA 4F2DA 5LD2C 2ZE8A 3GZNA 3RAEC 5F98A 3DKPA 3UFXB 3P0FA 5DHUA 3BTVA 3KYCA 3IDQA 4KIWA 3OY2A 2DHRA 2EZUA 3MUEA 3LFUA 1BYUA 3NYQA 3PNKA 2QV7A 4ZOLF 5CB8A 5CHEA 5AHRA 5HS6A 4FN4A 5EJEA 4L95C 3IT0A 5JQGA 3T1TA 3M5CA 1IBRA 3PD0A 1RR6A 4Q12A 4H35A 1E2FA 5JCPA 1C0EA 2H4WA 3MS2A 4W5JA 2NSYA 1FPMA 3R5XA 1Q16A 2V6BA 2WKQA 2MHCA 4M76B 5E6UA 4DSZA 2O4UX 1A1VA 4AJLA 3VV3A 4RABA 3BFJA 2GZSA 4U2DA 2GRUA 1SC1A 2JRCA 3LRTA 1WHTB 3PI7A 5F23A 5K0EA 2C5LA 4ND2A 3F1KA 4GMXA 4NNOA 3SYRA 3BMCB 4X64B 3X3HA 1ZESA 4UQPA 1Z15A 1HLPA 4DRYA 3NIGB 4FHZA 3W4JA 3KOUA 3W9YA 4BZZA 3LUFA 3M0EA 1WB4A 2CLIB 4DLVA 4B09A 5LP1A 1D0IA 1Q11A 1JR3E 4MUAA 1RLUA 3U4QB 5K4HA 2UU9B 2FPOA 3KOMA 1RAEA 1MFPA 1M1ZA 3EXG1 1KMCA 2ADMA 4YX9A 5T4FA 1P5HA 1K63A 1K92A 1MLDA 3OOHA 1SXJB 3SVTA 3AEXA 1VECA 3KYIB 4IEIA 2WVGA 4FNAA 3F8TA 5D6OA 1UADA 3Q3IA 4QTUB 2XYGA 2DFPA 4NI5A 2B98A 3CZ4A 3QPVA 2J9XB 2VS1A 2BE7A 1KDTA 3JY6A 1U2DA 3AG6A 1FUIA 3WGNA 2Z8XA 4BGVA 4CUZA 2HTEA 1KH2A 4WA8A 2PFGA 2Z1MA 2CXSA 2UZ0A 3D7MA 3O8QA 1O0BA 1NLUA 1GYPA 3OPNA 2Q1YA 4JUAA 4C0SA 5C53B 3PE6A 1BRTA 1DCMA 1XPRA 2GA8A 5AO9A 2I2FA 4FYJA 3QIVA 1A5SB 2Q5LA 3E2MA 3MOSA 3VDXA 1NUSA 5KNDD 1ISHA 1CY4A 1QZXA 2P6NA 5FUWA 1A8SA 3ZU6A 4DADA 1HG0A 4BVLA 5HVNA 4ND4A 5JSUA 1UBGA 2PSFA 3C5CA 4G36A 3FROA 1KGSA 4NF2A 4ZYYA 1F6WA 3CVXA 4GC9A 5CIWA 2XUOA 2CXOA 1R6BX 3MB5A 1GUZA 2ZJ1A 3L93A 4XR9A 5HGXA 1NW9B 3O92A 3ILSA 4R84A 3QE9Y 5C8YB 2ZBDA 1N33B 4X24A 4N3CA 4WN9A 3A6JA 3EA5A 3A1FA 4BYGA 2WDZA 1K5GA 3K1ZA 4KO3S 1RYBA 5ESRA 1QONA 3CVYA 4NCBA 1PR9A 1GYRA 5G4KB 1D1TA 1Z9BA 2B21A 2FB9A 2PL9A 2R5FA 2C98A 2FMUA 2Y93A 3IELA 4GI7A 2IH2A 1E7RA 4LI0A 1T15A 1R74A 2EX4A 1HQKA 1X1RA 1RS0A 3Q4GA 4G89A 5JXWA 3GFTA 5CXUA 2EZ4A 1UAAA 4Z53A 1ZJ4A 5I4IA 1EFVA 2IEGA 4UDNA 1Y80A 4FSHA 2JLWA 3AEQB 5BSMA 3IUMA 2GFQA 3G49A 3CINA 5IYZB 4RJTA 5BSVA 2VEDA 2BL4A 4YASA 4A4DA 4JIGA 2PRIA 1M7GA 3NKVA 3FY4A 3AMVA 1KVRA 2P9BA 2P77A 4JH0A 2OXIA 4QLBA 2OMKA 3DOEA 4DKJA 2HNKA 5K5EA 1AXEA 3IBSA 3MCTA 2UYCA 3LOUA 4TQGA 4JITA 3NBXX 3FUVA 4ZT7A 1BHJA 5JXJA 3HYSA 3NDJA 1G4UR 1LNQA 1U1IA 2PHZA 2R96A 2ZTMA 2A2ZA 4BBJA 3ACDA 1QK5A 3PSHA 1V41E 1BHQ1 2WOOA 4LGYA 4RF4A 4X1YB 4J0QA 4EM6A 3K31A 4JR2A 3W06A 1SCUB 2ZM5A 3L02A 1MNAA 2FZCA 4I4CA 4TMWA 1MDBA 1Y8QB 5I8ZA 4CM1A 2EGGA 1U3WA 2WMNB 1SMKA 2WUEA 2YHUA 4M6WA 3KSMA 4N0DA 5CAEB 1B42A 3T1NA 2QA5A 3QKRA 4BE4A 2PX0A 4WRRA 2CV2A 4K9NA 4RU1A 3IPYA 3KVRA 1XRPA 5BYKA 1Y1LA 2F8SA 3GJ3A 5B1HA 2Z9CA 1XTTA 2XQKA 4PHCA 2NYVA 4NDZA 3OZBA 4H1TA 1ST2A 5BQFA 1QRTA 2XE6A 3F3MA 1JAZA 5K3FA 4UUAA 4WGGA 1UMDA 3EZXA 3OZGA 1U6IA 4PLGA 5IF9A 5ANRB 4GL4A 3ABRB 2I1LA 2O8EB 2ZJ3A 1TU3A 3UENA 4HNTA 3IP7A 1L7QA 2WTNA 1KO7A 3GN1A 3PFBA 1U7HA 4I9FA 1X7ZB 5FDFA 1QH8B 2B8EA 4LFAB 2GN4A 3MMNA 1U9JA 2C5FA 2ZJOA 3C6ZA 3L9WA 2JBAA 3TSCA 2I34A 4DG9A 2ACVA 2Q46A 2QL6A 4DM7A 2P3LA 3I9V1 4BBZA 1T9KA 3MT0A 2OCLA 5C4MA 3MJRA 4NENB 4R3NA 2X1MA 4CIWA 3QFFA 1BQ3A 3IC5A 4M0EA 3FD8A 3ESRA 4XGQA 3DUFB 3M1IA 1MC8A 3JVUA 3ELWA 1QBGA 1WR8A 4CDMA 3TZ6A 5JSFA 4EB6A 3OA0A 3GPCA 4HI0E 3I5UA 4OQ4A 1YULA 4RJKA 1YVUA 1QZ3A 1BDBA 3IQIX 2ASVA 5DGDA 3OPYB 2ZXUA 1MU0A 1ZGGA 2WSSA 5D87A 3VZQA 4NBTA 1R10A 2GAJA 2LGJA 1T1IA 3WI7A 4CMJA 8LDHA 3EVAA 2BFCB 2PGJA 3S2ZA 4HDNB 5I9BA 4HQFA 4OHOA 1Z4QA 5KWEA 1JFLA 4HB4A 3CH4B 5CW2A 3QEOA 1ONOA 1AKWA 1EAMA 2C2WA 1JKFA 1JZTA 2PY6A 4GQIA 1H5QA 4LC9A 2X40A 4ND1A 4CFZA 5KNBA 2FW7A 4Z3KA 4RWZA 4PCLA 4KQJA 3VR3D 3P2MA 5IVPA 5JS1A 2P30A 4YT4A 1WO8A 5J43A 1E63A 1T1RA 3DLPX 1Y3IA 4PQGA 3BRSA 2YRXA 4W5NA 4QREA 4QLAA 5KOJA 1ID1A 1Q2UA 3KZ1E 2JH9A 2CVZA 2LE0A 4JDPA 1FDTA 1KJ8A 3LM8A 1VGRA 4QUIA 4NDAA 5K99A 2VDJA 4LYEA 3F5FA 1W36D 2BJVA 3FGZA 1C81A 4IDAA 3RUHA 3EQ6A 1FFCA 4UXHA 2I2BA 3ROFA 2PVPA 3NPMA 5M3BA 1J2YA 2IP1A 2NVUA 3F67A 3FWNA 3RWBA 3FYUB 3R75A 2DF8A 3DEZA 2QGNA 3QYFA 1WP9A 3TIVA 4B1FA 1VPWA 1PR1A 1VC2A 1JPVA 3G2LA 1MP0A 3SYMA 3LPDA 4O63O 2CXTA 3RV3A 2CNLA 3FPEA 1RYZA 5IEBA 3MILA 1KBOA 3L0OA 2VXYA 1MX5A 3GELA 1GDHA 2R00A 2IP4A 3IP3A 4FN5A 1L5ZA 3D3WA 3M6FA 3JZFA 5FI0B 2OA0A 3KDPA 3T7EA 2CXRA 1DWQA 3K6SB 2P9HA 1TO2E 2IZZA 2PV0A 2DWPA 2A0WA 5JFGA 5JHGB 1S1CA 1QMPA 2FMKA 5KWJA 3AB8A 1I4WA 3Q41A 2IF0A 2OFWA 3LQYA 3RCBA 3WLLA 3AK4A 2RHRA 2GASA 1MRZA 1FW6A 1B6TA 1JQ3A 1O94D 3T7TA 3WXMA 1J09A 4EENA 5BVHA 3KLOA 4KPUB 1G98A 3KZCA 3OZAA 4QEZA 3D8UA 4L8WB 4QGGA 4Q02A 1LWNA 3TOZA 1CT9A 2F8MA 2P2GA 4B9EA 2VEOA 4LZPA 4E11A 4F6CA 1AD2A 4I55B 4B7XA 1GPJA 4NZOA 4HRYA 3UNXA 5T7BA 1DPFA 1TQDA 1FDRA 2QAGB 4L9SA 4D25A 4KV9A 4XQCA 2CLKB 3EX7C 1NFFA 3ELBA 2EX1A 3UWMA 1KE1A 4CT5A 1DO8A 1QE0A 3RUAA 4G1MB 3X1DA 1TLTA 3E3AA 2NMVA 5L7YA 2C3UA 2VDVE 1QZTA 1VMIA 3L1KA 5LN1A 1EDOA 4QXMA 3D8TA 3DOCA 2A3RA 2YFQA 4NJEA 1DJOA 2IHYA 4JELA 4CQNA 2AZXA 1M10A 1UXIA 1V3QE 3IOYA 3T7IA 4A16A 4KR7A 4WY5A 4E70A 3B2NA 3FOAA 4Z0NA 4MVJE 4WKPA 1IWBB 3OJLA 4OAQA 4YFYA 4FFMA 4PX9A 4ZOEA 1C9EA 5KHLB 2PEZA 4U6QA 1LXCA 3BWYA 4Z0HO 1PZHA 2GLTA 1Q21A 3EE6A 3LY7A 2HLPA 1H1DA 3MBKA 3TD2A 4CU2A 5TQJA 4V0QA 3GJ6A 4FGJA 4TV8A 5IBRA 1HQYE 5KEIA 1EFLA 3FNGA 3UMRA 1TZMA 5AI6A 3GZJA 1CUZA 4HAUA 2XV1A 3QVTA 4MOWA 3BWVA 3ZE6A 4AQ7A 1N6IA 1LJUA 5LFAA 4HWOA 1TRKA 2VF4X 4HBZA 2EAUA 3Q87B 4K6OA 2QRMA 1X7HA 1C30A 1ZICA 2F7SA 5JCJD 4DIKA 1OFTA 3O84A 1JYSA 5AKHA 4MWDA 3AERA 1W88B 3V32A 3BSWA 2Y05A 3DE3X 3GXOA 4PSUA 1LPBB 4JVLA 1KEEA 4RZXA 3L1UA 5JZMA 3CPHA 4XZ3A 4G5HA 4HAYA 4IJMA 3HPRA 5HQTA 1TA9A 1QWSA 1T10A 4BO7A 2NUAA 4G8DA 1SUPA 4AKIA 5FX2A 1U9YA 2JD0A 3KRTA 4IZHA 1RJ9A 3A2NA 3CF4A 1CF4A 2AGVA 3HFRA 4WUTA 1IU9A 5LP6B 4UCFA 2I1WA 3PL5A 4CLEA 1BD4A 2WE8A 3ZXIA 5DSTA 3JZMA 4DLZA 2Q3HA 1VG9B 1Y63A 1ZA2A 3O47A 1OSNA 3WLHA 4BDTA 5AVZA 1D9XA 4EX6A 4B6FA 5J4VA 2I7XA 2XE4A 5BSUA 2W42A 3F5SA 7AT1A 1L1EA 5CBKA 4EHBA 4P58A 3LZCA 3I6ZA 4KQ1A 3ZQKA 4C1BA 1NHWA 2PYZA 1GPWB 2FPIB 4L02A 2RK4A 4RTOA 3R3UA 4V0LA 1J21A 2CXNA 3IP1A 3INNA 2XB9A 4XDYA 1NI5A 2WTBA 3RSOA 2QNBA 3ZS9A 4BQPA 1QK3A 4YHHB 3L6DA 2G9RA 1F6DA 1IBSA 4AO8A 4AKTA 3G2PA 3GDHA 4YV7A 3IE1A 1K9SA 2Q5JA 4MIOA 4IJVA 1EDEA 2FK8A 5JXIA 5ADVA 2JLBA 3BRQA 2HA3A 4B8WA 2MSKA 4PNHA 3TQQA 3WWYA 2HU2A 3H4VA 3RFVA 4CHTA 2VHXA 3QELA 4ZGGA 1IYZA 1YJ8A 2IVFA 2XCLA 3GDWA 2BFNA 1KU0A 2LDXA 4MGKR 4NY1A 1CY6A 3GD7A 2ZUWA 2OYSA 1CFZA 1X1SA 4RD0A 4TYYA 2ASEA 1RAFA 5CGQB 3UFXA 4JXKA 1SCNE 4ASUA 4CEIB 4MB0A 4U1RA 1FFYA 3BE5A 1UBLS 2WW8A 3IOCA 2V8BA 3KE9A 2NT4A 2KQUA 3C4QA 4JBIA 4X3PA 5HQ3A 3L4KA 5KTNA 1FIUA 2GO7A 3PF9A 4LDZA 2G72A 2R2GA 3LKZA 2FY8A 4FKMA 4Y2SA 2V6FA 3P2EA 5EHNA 3T9CA 4D0LB 2QL7A 5DXJA 3LWNA 4RTLA 1TJ3A 1U65A 1G5IA 2O2CA 3PUYA 3B13B 4LJKA 2V5VA 5B3JA 3UAYA 1QCDA 3CTPA 1D1SA 5D3MB 1X7XB 5SV2A 3TRHA 3SSMA 3I2YX 5HIAA 1M2NA 1WHTA 2HHCA 3NDRA 2GK7A 3MPOA 2JFZA 1BHO1 2FPWA 3WAGA 4A91A 2PKEA 5D5HA 1DEKA 1J70A 2YX1A 3H2JA 4GGOA 5DK6A 1QHEA 1CUXA 4ZOQI 5J2TA 5DMHA 4KXVA 3L6OO 3LBIA 1ZL2A 2XI4A 3ICCA 3U4QA 4JXJA 4Y18A 3GUHA 3C3MA 2ERYA 3BS4A 5AQ1A 5JAPA 1RQPA 3B2QA 2FUKA 3HJUA 1X1CA 1U7ZA 1V71A 4M54A 4QUGA 3U7JA 1YBMA 4ENSA 3HN7A 1L4EA 3WYGA 1SXJA 3IMEA 4E33A 1CS4C 2CNDA 4I3GA 2AJLI 2QYOA 1II8B 3JALA 1N0IA 3K7EA 4OOEA 4P4NA 1A8UA 1PG2A 2P35A 3BWXA 4WD3A 4WZAE 4O29A 3A6PC 1BD3A 1HURA 5BV1A 4TS9A 3ZXYA 3V7WA 4JI1B 1PD0A 1JILA 4PQYA 3H0KA 3D0OA 2IOYA 1SK8A 2PSJA 3FFWA 1ZJJA 4QATA 5K03A 1M5TA 4JLNA 2YUTA 4HUQB 1WUYA 1V7ZA 1WXEA 2Z3VA 1RHKA 1Y9DA 4OQFA 5CA0A 3LECA 3ZH9B 3A9RA 4IDOA 5LA6A 3B5JA 2BBTA 4NBUA 4IDGA 3IAM6 2YMQA 1DWOA 4WPGA 1MO3A 4L3OA 4YJ2F 5FUBA 3V7FA 3C48A 1A9PA 4EI7A 5KVSA 3KPVA 2XUPA 3QV2A 5ERGB 3ZY2A 3HBFA 4PG8A 2GR9A 1DRJA 4KYTA 5MN5A 4JJFA 4CMKA 3HCFA 4EPRA 2CHVA 3CA8A 3IKVA 1PQUA 2IX9A 2ES4A 3AUAA 1TIPA 4K05A 4LSZA 4TT3A 3KT6A 2Q45A 5A5DA 5BV8A 1TLLA 3DG9A 2HADA 3QVVA 4AKEA 3FNBA 4IJWA 4C03A 4D5EA 2GK4A 4OHFA 5MFZA 1KDOA 4MH0R 2CMFA 1HDRA 4HC4A 5G4KA 3S1SA 1T4CA 3KEMA 4U02A 1USIA 3ORFA 3DM9B 2SBTA 1NN1A 3FGPA 2RGNA 4E2YA 3JQPA 3OU6A 3IQZA 2YV5A 1GYQA 4OSOA 1QE5A 5M29A 5EXEA 2H18A 4AMYA 4KOAA 3GUCA 4PS1A 4LYDA 4M9QA 5LZ9A 3AEQA 2NSDA 4U3JB 1QX4A 2G7ZA 3WV4A 3GJRA 5F7ZA 5AKJA 2GD1O 3WLEA 3NVKI 1GGEA 2INGX 1NTOA 3WKCA 3FRJA 1JECA 4NOJA 2QW1A 2BGUA 2QRZA 1VOTA 3P2JA 3OM1A 1WVGA 3RVNA 1T8RA 3C4VA 1ORRA 3RFUA 3KXIA 2ZR8A 2HNAA 4NECA 2BKLA 2A9PA 3WRWA 4NEQA 3MMPA 2QN6A 2BR3A 3A3KA 1R0SA 3AB7A 1EUDB 1PX0A 2DZDA 1GZ6A 3L0BA 3RVQA 3FCYA 3M49A 4O4IB 3VR4A 4D97A 4HNVA 3C5WP 1ZCAA 3IXMA 5J9FA 3C74A 3LP8A 1CTQA 2XECA 3TFQA 3UCXA 2Q28A 2XYPA 1SCUA 4XSVA 4B35A 2XQVA 4INZA 521PA 1QVZA 4NE2A 3SYLA 5C81A 3QJGA 4RVOA 1JWAB 1X7GA 1MO6A 3ANSA 1TAHA 2ZIWB 1Y1QA 3S5UA 1EX6A 2QVCA 1VFPA 2YXLA 3EF3A 4Q03A 1EX7A 3RF6A 3RJMA 4ZKDA 3KQVA 2VH5R 3OJ0A 4F4IA 2GEJA 2NU7B 4BGEA 4MPJA 1LD3A 2COEA 2JKYA 3DV0B 3J7AC 4YRAA 2W2PA 3E48A 1TF7A 1CB0A 4R8SA 2GHTA 2XMRA 2N42A 2OT3B 4FFPA 5HW0A 3U1VA 3A6DA 5B7GA 2NUBA 4BQNA 2G80A 4RHUA 3GRUA 2XE7A 4AFNA 4WFQA 5K3CA 3FR7A 1QVAA 1XZMA 3ASUA 3GPIA 3TZKA 2R9VA 2A94A 5FF9A 1AHPA 4EY8A 4QHYA 1W34A 4OG2A 2YWXA 1QH8A 3LHDA 3E9RA 1C29B 4FEEA 3H1TA 5CJ2A 1OGYA 3VNQA 5D5QA 3HA7A 1OX4B 2IUSA 3REFA 4NSNA 4AF8A 4DREA 1NE7A 3RJ5A 3KLNA 2AWOA 3S2SA 1M66A 4NENA 5KO2A 3FYCA 1Y7IA 1TK2A 4TGLA 1FDIA 4ZHQF 1EBFA 3H4MA 4URUR 3ZWYA 2NQTA 3CM0A 2IEZA 1SBHA 1FX1A 3WG9A 1ORDA 2YVLA 3I2KA 4UUBA 5H7XA 4GEKA 3ZWBA 1U2DC 4EARA 2JLUA 2BBOA 5KSPA 1SZCA 3QWAA 3PFFA 5LCXA 3RVBA 2M6LA 1XPJA 4XGNA 2Y77A 3ZEAA 5JNVA 3OPYA 1CVRA 1TPYA 4JQZA 4R7ZA 3V55A 1FU7A 3D2AA 4MYHA 4TZKA 1IHPA 5LU9A 1GTZA 4BO4A 1I2BA 2QYTA 3O5AA 4I5DA 2IEBA 4BFUA 3BF7A 1JE0A 2EJUA 4B17A 1ECJA 1OYYA 2E6KA 3F78A 4HDNA 1EZ1A 1G8SA 2PBRA 3P9CA 3QEJA 3R4VA 4YB8A 4CN9A 1TIBA 2EP7A 1LZKA 3E1KA 3SJCA 4F8EA 5B3KA 2QNIA 3K4QA 4ZT2A 5J59A 4G4SO 4V0KA 2DCUA 1V47A 1JHVA 1U7PA 1RQ7A 3EAFA 1T24A 3Q7TA 3H19A 5J23A 3B1ZA 3OUUA 1SCIA 3I6BA 1NZJA 4TXJA 5DOZA 5J4LA 3QU2A 4OGLA 5TJHA 2WTMA 3O95A 4UFOA 2NVWA 4GE0A 5A4AA 3LQRA 1P4HA 4G1FA 4B3GA 2WIDA 5LYYA 1DHTA 2JFYA 4GXQA 4UULA 2HQSA 3TE7A 1Z38A 4QHTA 1VXRA 4FMCB 2AC4A 1L7BA 2WM2A 4QARA 3EEBA 1XTZA 3RSGA 3TPCA 2HQBA 4P4TA 3HO6A 2FZGA 4KRYA 3ER6A 3I61A 4LJ4A 3VR5H 5JBNA 1OIVA 2WAAA 2XOXA 3MELA 2FHPA 4KH0A 4DV5B 4H3SA 2VPIA 3OX1A 3DEJA 1I1HA 5KTMA 3CX3A 4RDIA 4L75A 1U0LA 3DBLB 3IHLA 1EX9A 3H9JA 3KJGA 5EXTA 1FB5A 4KHPB 1EJBA 5B4TA 2X4LA 5H59A 5BV2P 2K5UA 4FGLA 5LOVF 2WFZA 2PGOA 4BO0A 2C1ZA 3F9CA 2QUKA 2QRVB 5ESXA 3K6SA 4JQYA 2PAAA 2WYIA 4LOKA 3AG5A 4IDHA 5DTEA 3QQPA 2D54A 2QJWA 2JAOA 4IXMA 3G1WA 3O2SB 3NTRA 1H4VB 2BGGA 2H63A 3VU0A 3ZWNA 2EKLA 3G88A 4DNFA 1BXRB 5LNK1 1XNRB 3SDSA 3EIHA 5FOWA 4S2UA 1ADBA 3C3XA 3LK7A 4JGGA 3O93A 1JEEA 1WZNA 2QVYX 1NUTA 1QKJA 4EMBA 4HJRA 5TGTA 4I55A 3RHSA 2GBFA 3A1SA 3KFXA 1G8HA 3PL1A 1ISGA 2QAGA 2HLDA 3IJEB 5IVIA 1UXHA 1ZW6A 2QI9C 1KARA 4MQ6A 2Q4DA 3TB4A 4DOMA 1V7QA 3D3KA 1OAOA 2NTJA 2AN4A 2W0MA 3CR7A 4UE3S 3U39A 3WBBA 1GQFA 3BMQA 3M33A 1NE2A 5E7JA 4R71A 3VO2A 5JSZA 2JGAA 2XNDA 3DS8A 1FBTA 1WBDA 1Q0RA 3ID6C 4K8OA 3UOGA 3FKJA 1ZXXA 4CTKA 3IEXA 1ZM4A 1TO6A 2D2EA 1CK4A 3DV2A 3P45A 5AVUA 3VZBA 2RD2A 2L2QA 2OO5A 3TJRA 3V2UA 4F45A 1K89A 3G5LA 4UHKA 5E3IA 1RCFA 4ZVMA 4G26A 5TS2A 3W5JA 4U2FA 4XARA 5K8VA 3FLBA 2G82A 4YBRA 4N39A 2G88A 4POOA 2RC6A 1CZNA 4BKOA 1SC4A 3G6WA 3GEGA 3Q3HA 4NFSA 2VQ3A 1TD9A 3WNZA 3U4MA 1SBYA 2ZRDA 5I3ZA 4QSHA 1ESDA 2HNBA 3N5KA 3HLTA 3W6UA 1ORWA 1T9AA 1ZX1A 3V6LA 3QITA 3GWGA 3DWEX 3BMOB 2IU6A 4LE0A 4RF3A 4WJLA 2JJQA 4K2AA 2O1WA 5ALPA 4D9BA 5KC9A 3MEQA 4MVCA 8ABPA 3QU4A 5KQPA 4M1QA 1DOHA 4WHMA 3U3RA 3MTDA 1J33A 3GVCA 5HKAA 4NH0A 4HZIA 3R9KA 4BDSA 3E3OA 5AOBA 1K7FB 1N7IA 3OP1A 4UXIA 1HMYA 3AKZA 3GJ8A 2OCPA 4B3IA 4XJTA 3PDUA 4B3CA 5FA8A 2W37A 1E9BA 3IDOA 5LC1A 2X0DA 5GQSA 1N0UA 2R751 1DBVO 1ANKA 1IOZA 2L69A 4QUAA 1YQEA 4QPPA 4DE5A 1K27A 1UBHS 5CDGA 1QK4A 5LP6A 2Q4OA 1ZLYA 3C97A 1O77A 2YY7A 3OZXA 1RJEA 4IFIA 1E94E 5CIQA 3I2IA 3U09A 3TCKA 1NC3A 2ZIUB 5LZ5A 3U2QA 3NJRA 5BRJA 1MCZA 1HZJA 1V5IA 2FX5A 2R48A 2WJIA 3BGWA 4ETWA 3WKDA 1GRRA 3N2YA 4WK2B 3USCS 1U9IA 4A7PA 4KQ9A 3B3FA 4AYXA 2Q62A 4IH4A 5L4LA 1B8PA 3PD7A 4A0RA 1L8QA 2O0JA 2ZZMA 4II7A 1V96A 3P20A 4YP6A 5KWSA 4X6XA 4MW6A 1JLKA 1JIXA 4KQXA 3TZEA 4LE2A 8OHMA 1WKVA 3B36A 1J0BA 2TMGA 2J5QA 3GCZA 1KKUA 4ZZ2A 4JENA 5I5GA 2CZCA 4Z1MD 1H8EA 1K7XB 2V7XA 3IPRA 2B5WA 1B14A 2VTBB 3IQWA 4C76A 4FOSA 1EU1A 3PPVA 5P21A 3DULA 1KOFA 3JQAA 2ZR9A 3T3PB 1BGWA 1YFJA 1Q77A 2IQIA 1CUBA 3D6HA 2PWPA 3HXTA 3ONWA 5EGSA 1Z4MA 3ZDFA 1GAQA 2IC5A 2NSJA 4HAZA 1K5PA 3S28A 3UHJA 3GBSA 3ISTA 4L5YA 2D5AA 1P60A 1E0KA 1A5BB 3R9XB 2IHJA 2ETVA 1CQJB 3UOWA 5CLIA 5JC8A 4CEIA 3L84A 4HBGA 1S89A 1SVNA 4FOOA 3HHPA 4FNMA 3KCQA 4AAYA 1NMYA 3DE2X 3IH5A 4J0DA 1MR3F 2EZ8A 2FSPA 2QT0A 3QLVA 4DYVA 3F4LA 3NCTA 5LQUA 2XX3A 2ZPAA 3BJZA 4UNRA 1X7XA 3NI2A 2C9ZA 3GA0A 1LQ2A 2WWXA 3F7OA 4JOSA 1VHQA 3H18A 3JWEA 1GV1A 2GO1A 2I3AA 3TNDA 1FZTA 1VDZA 2V54A 1FX0B 4OXYA 4O2AB 1TMOA 5LVAA 3ED1A 1GZHB 1MO5A 3HDVA 2R6JA 4R69A 3DDSA 3NRJA 5TV2A 3TZLA 5K8LA 2EW2A 2VUIB 4MRSA 1SXJD 3RYFB 4D4IA 1HG1A 5I9SA 1UWVA 1JIQA 4JJKA 4C6HA 5JALA 4MINA 5CB4B 1DRWA 2QTCA 1FLDA 4DDMA 3E03A 4S1TA 3NNNA 1OPXA 4L8YA 4YLGA 1K7SN 5L3RA 4IEFB 3WIUA 3AETB 5FHQA 4QQRA 1WS6A 2QAJA 4R8RA 4U8GA 3U44A 5BQ3A 2W6QA 5G0SA 3TRIA 1SRRA 1II8A 1ILEA 5JS7A 2DWCA 2A57A 1QIFA 5I01A 3BXEA 4C0BA 1ZZGA 3DEAA 5JANA 2ZUVA 2HDNB 2HA0A 2C7OA 1I0ZA 4B3HA 3DMDA 1GSOA 2PXXA 4P7GA 3MJHA 5HWSA 1TE2A 3DHYA 4DQKA 3KZNA 5A9SB 4YCBA 5C18A 3GPDG 4L4YA 3R7AA 3ITDA 1I7PA 2B5VA 4TMYA 2UZAA 1YZLA 1GNPA 4D3YA 4YIHA 4AO7A 4BO6A 1KYXA 1LPSA 1RYDA 2Q1UA 2RJOA 2ZP1A 3EGEA 3QX8A 4F97A 4DR4B 3EZFA 2J8ZA 1CQIA 4O5OA 1IUNA 3HA3A 3IE2A 2XUAA 4CTJA 3P9SA 3QVKA 3IKMB 4H59A 4OU4A 2MYNA 1F51E 1K0UA 3K9NA 3LCJA 5LXTB 4RAOA 1FUKA 3K9HA 4FFVA 1CF2O 4FNOA 3SZMA 1JG6A 2YWJA 2RBGA 1DU4A 5JSKA 1GLNA 1WETA 4O3FA 4WOCA 4DMMA 4K9DA 2VIIA 1AS2A 3LXRA 3TKAA 4AXXA 3Q7RA 1ZAYA 1VJ0A 2D7DA 3QMWA 2DR0A 2H6EA 1YJXA 1HZZA 1T2VA 2VNIA 5NULA 1EDDA 3RPEA 3W5VA 5BPFA 2WYUA 3D1VA 3EN0A 4MQUA 2AJBA 4QWWA 5LUAA 2B4YA 1XQWA 2OO7A 3PRHA 4QULA 4JXZA 5DT2A 4TYPA 4BNIA 1YAJA 4QOFA 3H83A 5IJ9B 3ANXA 1QIIA 2OG2A 1IK4A 1EDBA 1PLLA 2PMWB 3D3QA 4GOOD 5HOEA 1WHSB 1SB9A 1RI4A 5MDHA 2P65A 3F6BX 4D9IA 4ARBA 3EFBA 3MT7A 4DSAA 4UCQA 1E59A 1Z6PA 4DMFA 4U3JA 4ZU1X 1OI2A 1AKYA 4OUDA 5I4BA 2VPYA 3UPUA 4AUKA 1SVWA 2YXNA 4IOLA 3IEMA 3ICQB 5IBPA 5HEKA 4LYJA 3ER8A 4JS0A 4RD4A 1QB8A 4ZOBA 3UOAB 1E2BA 2FR1A 3T7KA 1ND5A 1AUPA 2VO1A 2IOFK 2ZSEA 4F3CA 4YXWD 5EJ5A 4I1VA 2FNAA 5AW2A 3NONA 3EWNA 4MLZA 4I9NA 1T2NA 2D0PB 2GJAA 3HQ4O 2JJ2A 2P0YA 4IYRA 4DXHA 1HQDA 3MRXA 4O4IA 3KG2A 2X22A 4B43A 1U94A 1VTKA 1CULC 1YZUA 2ZWVA 3PCTA 3N8IA 1P72A 3V48A 2B0CA 3O4RA 5FBWB 4NVRA 3KCNA 1L3CA 1C4XA 1N3IA 4H6WA 1T3HA 2D5LA 3ZJVA 3MUNA 5JI3E 4WMLA 4QX6A 4YNBA 4ZAZA 2VBCA 2WYOA 4YP7A 3E15A 1WW3A 4L74A 3EIWA 1WCIA 3GPLA 1J8VA 1CXZA 4JI7B 3AINA 2DLCX 4C3VA 3ENQA 2SHKA 3DV0A 5DXFA 4HK4A 4ALLA 2BGJA 2VCEA 1M6VB 1UDRA 5BRAA 1ARZA 1DAGA 2J09A 1E96A 4ABTA 5A3VA 1J8DA 1DTWB 1SUFA 1FFBA 1KDPA 1O87A 4JVNA 4WERA 4OXXA 5DTJA 3SD7A 4DDUA 2RJ3A 4ZN6A 2WSIA 4QC2A 3NUGA 3AR9A 5AOAA 3P9YA 4ER0A 1Y4ZA 5BR4A 4RD3A 1CJBA 5CFPA 4KI7A 3FYTA 3NQ41 2X7HA 4BU1A 1E2NA 2PKRA 1NLZA 2BEJA 1HGXA 1W5TA 3N07A 1ONBA 4R5MA 4WZAB 1LBSA 5AHKA 1MN6A 3TQFA 3WWDA 4H7IA 1YDGA 5REQA 4CFSA 4M7RA 1I3NA 1L5HB 1IY9A 2PNJA 2BVNA 2X13A 4B5LA 5BW8A 3GYBA 2NIPA 3FWPA 3LRPA 3OH8A 3VOSA 3OT5A 4TSKA 1N32B 3GA5A 4LJAA 4YT8A 1E1KA 5DIZA 5FPYA 3TVDA 1E7WA 5EZSA 5AWFC 3U9SA 1UL1X 3W2GA 4CBVA 4YCSA 4B4UA 4UE6A 3SDZA 4JLWA 4BO3A 3WGGA 4BV3A 3FPBA 4IDNA 4B85A 1UJ4A 2VPWA 4J0KA 4NARA 4ZCPA 3EBPA 3GLTA 1QHHA 1YACA 2FEOA 2Y9MB 2VHQA 3TBKA 3OIWA 1DAIA 3O3OB 1JVBA 2AEMA 2FWJA 3GC6A 1YD7A 2EBFX 4KDFA 2XA1A 2HQRA 3A1VA 5CX1B 2AUNA 2ACEA 3MGCA 2IV3A 2IH5A 3EHEA 4GR5A 2GK6A 5TQ2B 1XAHA 1HFWA 1USKA 1YNOA 2O2EA 4TTAA 2DFDA 5GIOE 1TAGA 4HXEB 2JPDA 4OD0A 1K66A 5B3LA 3U6KA 4OB7A 1FXUA 3M4XA 1LU9A 2PFSA 4FZRA 3SZRA 3DKRA 4CCAA 4CXMA 1GFZA 3EPPA 2BKVA 3RRBA 2XYHA 1FFGA 4CLOA 2POQX 4RADA 5IG2A 1MH1A 1TTHA 2OORA 4L27A 3ZJYA 4B4OA 1RCTE 4LF8B 5YASA 1WSDA 3AM3A 4LW8A 1GPH1 1TUGA 1Y7LA 1KFBB 2Q3DA 3HEAA 3ODGA 4KBGA 4AZ0B 3DVQX 3EVBA 3HM9A 1NLFA 1NC1A 3E58A 3CX7A 3HACA 1IVYA 1DC6A 1QJ4A 1OX6A 3IBFA 4MR8A 1PWXA 4U8HA 3ZD9A 1U9ZA 3KT3A 3TSZA 2CFIA 4ZTZB 4DMRA 4O4HA 4YCJA 5F1KA 4U63A 3E81A 4IYJA 2HF2A 1YQGA 4RK5A 1UWCA