4RA9B

Crystal structure of conjoint pyrococcus furiosus l-asparaginase with citrate
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
128
structure length
128
Chain Sequence
HMAVLVIKLIPGLSGDIFRAAVELGYRGIVIEGYGAGGIPYRGSDLLQTIEELSKEIPIVMTTQAMYDGVDLTRYKVGRLALRAGVIPAGDMTKEATVTKLMWILGHTNNVEEIKVLMRKNLVGELRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-asparaginase
publication title Structural and functional insights into an archaeal L-asparaginase obtained through the linker-less assembly of constituent domains
doi rcsb
source organism Pyrococcus furiosus dsm 3638
molecule tags Hydrolase
total genus 43
structure length 128
sequence length 128
ec nomenclature ec 3.5.1.1: Asparaginase.
pdb deposition date 2014-09-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.40 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ra9B00
2OCDA 2D6FA 5K45A 1WNFA 2JK0A 3NXKA 5HW0A 5I48A 1WLSA 4NJEB 4PGAA 2GVNA 4R8LA 1JAZA 5K3OA 1HG1A 1JJAA 2P2NA 2HIMA 1HFWA 1DJPA 3NTXA 1HFKA 1JSLA 1HO3A 2WLTA 5F52A 1DJOA 1ZQ1A 5K4GA 2P2DA 4ECAA 4RA9B 1AGXA 1O7JA 1JSRA 4Q0MA 1WSAA 5I3ZA 5I4BA 1ZCFA 4R8KA 5DNDA 5DNEA 1HFJA 2HLNA 5DNCA 1IHDA 3PGA1 2WT4A 4RA6B 5K4HA 1HG0A 3ECAA 5CBPB 1NNSA
chains in the Genus database with same CATH superfamily
2B1QA 1M2HA 1D8TA 1MOSA 1WVMA 3R41A 2VPQA 3BKXA 5FR1A 3WL7A 2ZM5A 2GKSA 4B6EA 3RVDA 4YHBA 4B3RB 2HYDA 3CYFA 4AKHA 1PLKA 4R0MA 1C9YA 2YMPA 3VR4A 1SFRA 5AKZA 1CE8A 5JZVA 1K5GA 1YO6A 2X19A 2VXCA 2IHVA 1BXRA 3NTXA 4NYJQ 4PCVA 3VGJA 4Q5IA 2K4MA 3SS9X 3TAHA 5K5EA 1MABB 3R24A 4O4LA 3J81A 3RANA 2IEAA 2LCQA 4BQIA 2A0UA 2PM8A 2PU5A 2OAGA 2QVCA 3PJFA 5LZ5A 3KSRA 2OYCA 1J20A 4FOSA 2PIAA 3QXSA 4RY9A 1GUFA 1HE5A 4GZ3A 3TSZA 3O8CA 3UKDA 2BPOA 1LZLA 3NHSA 4L0DA 1HDRA 5TR9A 3ND8A 1KHTA 4TYWA 2ZTUA 5COBA 1I4OA 4BC0A 4L4UA 1AIPA 3A3KA 3DC7A 4I08A 5KHLB 1U9IC 4C88A 3TXXA 3NXKA 5TY0A 4K6HA 1RLMA 4FYIA 4PLPA 1EWKA 3GELA 2XNKA 3CF4A 2IEBA 1HXHA 4UDNA 2F00A 2IODA 4NCJA 5I7UA 2R87A 2HU2A 2P3LA 3PVZA 5CT4A 1D07A 2P8SA 1K7YA 2IL1A 3UATA 2DH5A 4YBZA 2Y6VA 1I10A 3GLFA 1SOAA 2GRUA 1XJ0A 2OO7A 1E5QA 1G3UA 1NIPA 4B3FX 2GJAA 2IX9A 2J3JA 3DO5A 4YJKA 5IHXA 4YP6A 5K7SA 1RWPA 1MGOA 2CNWD 1Y9EA 3I76A 1PX2A 2QEQA 1TD1A 3JZMA 4D46A 4G01B 3D3KA 5U9CA 3D02A 3S44A 1C50A 1GEEA 1SCDA 3SZGA 3MBOA 4XVRA 2BSXA 4C05A 4M49A 1KSFX 3LOQA 1CJMA 6YASA 3BOSA 3EIUA 3FNEA 3BFVA 1NF9A 1Z4PX 5EZ6B 4FB5A 3LU1A 2OAQ1 2EERA 5DXJA 3MF4A 1ZLXA 3MGBA 4O1IA 3JAMA 3M4ZA 4M0LA 4EUNA 1U2GC 3IXLA 1HFKA 1M6VB 4EI2A 1TM3E 1BX0A 5I9TA 4EQ6A 3OZAA 2OZLA 4IO1A 3A1VA 5EJFA 3B6MA 1YV9A 4ND4A 1KK2A 2KHZA 1V25A 2NSLA 4W1RA 1W88B 2X2EA 2YVQA 3FGPA 2Q0QA 2I7CA 3GDWA 2GPBA 3QEAZ 3R8FA 2JGKA 3EMKA 3L6EA 3HLTA 3HACA 4WCFC 4BB0A 3A9RA 3HCFA 1JH8A 3DOHA 1ZOOA 3HVKA 3IDOA 2R1ZA 4RHYA 5DLDA 5FBHA 3RGWS 3SBEA 1M10A 4D0NA 4E0BA 5HJ5A 3AR8A 4F2PA 4FE4A 4EENA 1WXQA 4XYLA 3IXQA 3PFWO 4AG5A 2ZPAA 1Z2CA 3UTCA 3QW2A 4L4ZA 1X1EA 1DJPA 2YZ7A 4U0JA 1XRPA 3BHNA 2WDZA 2A1IA 5CDSA 4KIJA 3UJNA 1OHHD 4RIFA 4JVSB 4MUAA 2OFPA 3PXXA 5IH7A 3HU3A 1FYDA 3DMGA 4UEKA 5EE5B 1PO7A 2B1RA 2GBPA 2PUEA 1UQRA 2GN6A 2QZPA 1PQPA 2YYSA 1Q6YA 3H0EA 3KB6A 4R8SA 4DLNA 2JI4A 4CM9D 4R1LA 3K5HA 1ONPA 4KPUB 1IULA 1JQLB 3HYTA 2NLOA 3NEAA 4AUEA 4PG8A 3TNDA 1T10A 3MD9A 3W7VA 3VKGA 1ZU5A 1N7GA 2V9CA 5EWJA 1NMXA 2P27A 3P19A 1QNLA 4CUKA 1ZI6A 2Q07A 2VUTA 1TUBA 1C41A 1ULBA 2CW5A 2BZ0A 4HGNA 1BYUA 3QEMA 3PXGA 1MC4A 1DKOA 2DZDA 3GGGA 1DAKA 1G5TA 1NC1A 1YR2A 1ZN9A 2VJKA 4LY9A 5G40A 1L5KA 3V7YA 3WGNA 4UTPA 2AW3A 1X3LA 4PLCA 4JVLA 4R1UA 4LE1A 1N2GA 4W5RA 3AVWA 1DG3A 1X94A 5K3FB 1Z07A 1AZTA 1WO8A 1WKVA 1XN4A 2QMQA 3KKLA 4MQBA 2OFOA 2BMWA 3GD5A 4JOQA 4MWZA 3GPIA 4TT3A 5HFNA 3FTFA 3TRDA 8OHMA 3VBCA 2I7TA 1YSCA 5KVSA 2JEYA 4LVUA 3KU1A 3QGMA 4GX2A 4AG6A 5BT8A 3NYIA 2F55A 2Y0BA 3ASUA 3PGVA 3UAZA 3FB1A 3PKIA 5K6TA 3GIDA 2W90A 3BB1A 4HLNA 2WTUA 4M8KA 3OQBA 4QATA 2OBMA 4FT4A 221PA 1CY2A 3G2KA 3A4TA 1G4AE 4B33A 2CUKA 3B51X 3V7WA 5DO9A 5BV1A 9GPBA 3PHIA 3GNLA 5GONB 3N53A 4JOCA 4IRUB 1RI1A 2W70A 3DXXA 1SXJC 4YJ3B 4DILA 2Q5FA 3GW8A 2R1UA 2RMKA 3VMFA 1A8SA 1DIHA 1NP7A 1WKCA 1XFAA 4L6CA 3PTZA 4LJKA 1NNLA 3I30X 1LPAB 2BVNA 1DQNA 3NTQA 3UAWA 5HW0A 4GOXA 1YA4A 1F2TA 3D7RA 3QTTA 4WL0A 1MV8A 1XA4A 2WA2A 5EQTA 4BRUA 1GRVA 1R3UA 1R0RE 4J0CA 4MV8A 3OESA 3IJPA 3NH9A 5TSDA 4RS3A 1DELA 4MEJA 4WCFB 1JIUA 5EHIA 5HF5A 3SICE 3VSBA 1O5OA 2Z5VA 2V97A 2P65A 5ALWA 4H3HB 4B7ZA 5LPNA 1HYGA 3AC0A 4DZZA 3GGDA 1H8ED 5DNDA 2FDRA 2GHTA 2I76A 2LZ0A 3AY3A 5A4KA 1HFJA 1J5PA 1JTEA 2EXXA 4CIXA 4YP9A 1GT91 4IHJA 2WHXA 1MJFA 1X80B 3RFUA 4D96A 4EH1A 1NTOA 3EF1A 5F9HA 1KYIA 4X6XA 4WX2B 2QRPA 4PGHA 1J1IA 2QLNA 2ZE5A 3G13A 4B6OA 2LPMA 3LG2A 4S04A 1IHXA 1P1JA 3F7TA 2D5IA 3W3AH 2E0IA 1JQEA 1QVAA 1TEVA 3KIPA 3DLBA 2QL5A 1NJ1A 3B3GA 1XRLA 3KOYA 3PHBE 5DHTA 3FIJA 3QLTA 5C34B 1BRTA 5C18A 3W2GA 1ODLA 5CIWA 3PDJA 5JMPA 2C88A 5KJFA 5LUAA 4A8PA 2WUWE 3WVNA 1ZN8A 1TYZA 2Z9BA 2AUNA 3AUAA 1HYQA 4G8BA 5G4KA 1C3JA 3SJ7A 1QP4A 2DH6A 1C8KA 1G64A 1K3TA 1WMDA 1I51A 4FSXA 2REQA 2QE7D 2G1JA 3EGVA 4JXKA 4WEQA 1DRVA 1W0CA 2GJ8A 1CY7A 2IOHA 3PNKA 4M83A 4NCIA 3T4EA 3Q8MA 2W6QA 4YCJA 1D6MA 1FDIA 1KFEB 1N0WA 2XRMA 3QMWA 3R5JA 3JQAB 2NTYC 1IN7A 5JBNA 3NS7A 1WSWA 3L7IA 5C53B 2IU0A 3C4QA 4AF7A 1JVSA 4DLRA 2I1LA 2QORA 5IX8A 2VA9A 3HDVA 1DDIA 4BS9A 3JWIA 1JVBA 3EVNA 3IHKA 3KJXA 2RCYA 3P26A 1XD8A 4YQYA 5AM0A 3NALA 9ABPA 1INLA 3TOCA 1C80A 1SWWA 2XDQA 4GQAA 5FYQA 4K9MA 4O4LF 1R9GA 5ALOA 4FR2A 3GLIA 4LDQA 1POWA 4GMHA 2EOAA 3WDMA 3K2IA 4CLEA 5CAEB 1NP6A 3ECSA 3PU6A 4GICA 3RRZA 3ZEAA 1C2TA 2VF5X 2XLCA 4B44A 3OO0A 4EARA 3PGMA 3G02A 1PIWA 1C7FA 1PZHA 3ILHA 5DGXA 3WYCA 4N0PA 3VTAA 3IOYA 1ODJA 2VOEA 5C81A 3HC7A 1Z5UA 1U0SY 1SXJB 3RKSA 1TJ3A 3UMVA 3V4SA 3FHJA 4G1UC 4OLFA 4R8MA 1KDRA 1XMPA 1ZJZA 1Y7TA 2R68A 4US1R 3VKVA 2C03A 2ATEA 1MO2A 3OUZA 3PEUA 2WZBA 4LGYA 5JYEA 1GTMA 2NXWA 4YAGA 5BN4A 3GDGA 2YUTA 3LPCA 4ZZ0A 1NSFA 3KAKA 1FX0B 3DPSA 3E3MA 2QN3A 2YDYA 4KQHA 4O29A 3R7AA 1X1AA 5GZ6A 2FDXA 1N6LA 1Y8QA 2H2DA 3PNSA 1MZPA 10MHA 3ADKA 4LZZA 3G3EA 3RUDA 1CR0A 4ETNA 3FPKA 1H2YA 1HT2E 5JTUA 1Y5RA 2VDWB 4BRWA 4DA9A 2FF7A 1C1DA 3TH5A 1VCMA 2JBAB 2WJWA 3EEBA 3K35A 2NOAA 3WK4A 5AVUA 3MJRA 4LG1A 4CZ2A 1NUPA 1ZR4A 1QLJA 2QM3A 4QJ4A 5ALJA 4A3SA 3KC2A 2N1BA 4MJLA 3ZWCA 4D4IA 1A1SA 5AJWA 2R1VB 1GZDA 2EX1A 5JJKA 4KKXB 2M2IA 4F56A 1JG4A 2Q1XA 5E4JA 3RFFA 1UOEA 1NVMB 3DJYA 5EWLB 3AL0C 4LHYA 1YAHA 1JR3A 5E2IA 5THKA 1EX9A 4X85A 3KYDA 1USIA 1KZGB 1L4GA 4DVGA 3TN7A 1Z5GA 2W8BB 2Y76A 3FF4A 4EGJA 2V0GA 2FFRA 3IRUA 5AD1A 1EFVB 4DMRA 5GJBA 2C9DA 2C4WA 2JGDA 3X1YA 3U3XA 2AW5A 4HG2A 1L4UA 4PRYA 3ZI7A 1TU3A 3T9BA 4BAGA 3FDIA 4BEVA 4F8YA 1NF3A 1Y1TA 3Q0EA 1VIDA 4JB3A 4ANFA 2HLDD 2V1UA 2VUHB 2QTNA 4F86A 2BM0A 3IOBA 3L0YA 3LCCA 1RJ9B 3NIWA 4XQ9A 5E1DA 3TPFA 5JSQA 2ZULA 2WVJA 2ORED 3AM1A 4NLLA 2LGJA 1ZCZA 4H7EA 4N6NA 5FI3A 4I4TF 4MVJA 3CJTA 4OGLA 5D3MA 3FNIA 2OD7A 2KBFA 5IABA 1KC3A 2HMYB 4GKAA 1RKQA 1PWXA 3BRQA 4P22A 1MG0A 5A9TA 3S1SA 4RTOA 2VP9A 4TLEA 3S2FA 4QHTA 4CF3A 2VHCA 1LF0A 1IDOA 1NLYA 2BHRA 3BE8A 3RDPA 3SG0A 3UICA 4EUKA 4PAQA 4Q1AA 4EYKA 1KJZA 1LW6E 2H2AA 4Q34A 4FINA 3KQUA 1DQRA 4P3YA 2GRAA 5ALLA 3N0RA 5ALFA 3U56A 2CDCA 1M8GA 1N9ZA 2AQIA 2GN4A 2PMWB 2P2DA 1IN8A 4QE3A 3WFJA 3WX0A 5TRTA 3UK2A 2IEZA 4KU4A 1JUDA 2BP7A 3R0VA 4EPYA 3E22B 1MHPA 2Q6IA 1N6OA 2KSQA 2D2VA 4LYGA 2AFIA 4H1WA 1IMOA 4S1VA 1G20A 1DEKA 2ZB2A 2W9XA 2X0KA 3H5OA 3CRW1 1V2GA 4BQPA 1MB4A 3FETA 3LUKA 4ECEA 4ZYTA 1CZRA 1UWLA 3FHTA 1PDWA 3BB4A 4B3GA 2BKEA 4YV1A 2AOUA 1ORDA 1PL0A 2Q3DA 5FNVF 2P4HX 1ZAYA 3IODA 4KXUA 3E7DA 2JFGA 5AW2A 1BMFD 1DWUA 2X1VA 1THTA 3BWMA 3IBSA 5BSRA 3TIGA 2F4VB 5EIXA 2BMVA 1MA0A 2DC1A 5E4FA 4MYRA 1JAXA 1SUWA 1IUKA 1OXMA 1GUYA 4FGKA 4MHSA 1QK5A 4HDOB 4OQEA 5AVKA 5IM5A 3ER9A 1DAMA 3IALA 4P5PA 1AKRA 4U2GA 2XMZA 1E32A 3K8ZA 4QJ5A 4MWSA 4B43A 3RAPR 1JDSA 3ZBUA 4H08A 5AVOA 3RC3A 3G2JA 1XQWA 1Z6ZA 3KTDA 3TOVA 5FPKA 3IVGA 1OLSA 2PXHA 4QFBA 5CLLA 4LVNA 4D3ZA 1KJWA 5LM3A 1HDIA 4URYR 1DG9A 2JFHA 1NF8A 4OHOA 1BNCA 5BOVA 3ML1A 4DIBA 2B94A 3BGIA 1ZONA 1ISSA 4KXMA 2WU3A 1R6VA 4Q4AB 4C0KA 2R8RA 4YRBA 1E0AA 2HZ7A 4HLDA 4YAFA 3O93A 4X54A 3VH2A 1P2FA 4F3YA 5KTPA 1KQFA 3GLGB 4E5MA 1WAMA 2C5BA 4HTFA 1EK5A 2XHZA 4UHFA 2QAGC 3TNLA 3T5BA 4D80A 3MLBA 4IMIB 1ZGHA 4LZJA 4FDTA 5IKOA 1CS0B 2B99A 4D45A 1Z4MA 4ZV9A 3FR8A 4N0MA 4QARA 2DLDA 1LLUA 2I1WA 4H17A 3TTWA 1GU0A 3I6QA 3EZFA 3RTGA 4E4RA 3ZWQA 3RVLA 2WMYA 1U6JA 3OIYA 3RUPA 3SX0A 2FFBA 1EYZA 3DE5X 2NUPA 3R23A 2HF7A 2A0KA 4IIBA 4YLYA 1NF2A 2LIPA 1DUIA 1BFKA 1OJLA 2C3YA 3DD1A 3IS3A 1PWZA 3O1LA 1UOQA 5DM1A 2O2GA 5EXEA 2Q7OE 2P2SA 4RZIA 3QM1A 1NVWQ 2J6CA 3NHFA 1HNNA 2D0OB 3P94A 1JWAB 5L4LA 4X7MA 1TJ5A 1M8FA 2LCFA 4YACA 4I9UA 4AUMA 4WNYA 2ZSJA 1KI8A 3WL5A 4U2BA 4TMXA 5LOVB 1P73A 1TZCA 1ULTA 1LPSA 4RMIA 4ZT2A 4EY6A 1KHHA 1GZ5A 5GADl 4BMYA 5TC4A 3HBFA 5FWYA 5A4AA 3KJFA 1OYVA 2JA1A 2JRCA 3ZJYA 4WI1A 1YJ8A 1EK1A 2KS6A 2ZBFA 5EMKA 2WWTA 3IEXA 1K75A 4PM4A 621PA 1OB2A 2PXAA 4JOSA 5JPDA 3GT0A 2WLTA 1R88A 2OZKA 3A3NA 3EVFA 5JS1A 3FNGA 1Y1QA 2FEKA 1P7PA 1FNCA 1BZYA 1I1HA 5T8KC 4BLVA 2O8CA 1K5DA 2FB9A 1H2XA 2WY2D 2VHVA 3CUEF 3VOTA 1Y7IA 2AWNA 2I4RA 2HRBA 1MJHA 2PY6A 3IAS1 2KWIA 5CX1B 3I2GA 2D00A 4FW9A 4ZYUA 2PKYX 4I55A 3N6XA 2KJQA 1N9GA 4FZVA 5JS2A 3U4QA 4PEVA 4ZAXA 3ZCSA 1P1FA 4UMDA 3K9NA 3QBTA 4G8CA 5LIRA 4ABYA 3JARA 4IJ5A 5LUBA 3OFKA 1XD2A 3ZGYA 1I2ZA 1VLLA 3EG9A 1O95D 1R66A 4R2IA 4C0SA 1B43A 1DKNA 4TKMA 5EINA 1I24A 3HKDA 3ZWDA 3GH3A 1CF4A 3M4JA 1BHJA 1E6MA 1RYZA 1T4CA 2H18A 3FJYA 2AH5A 2XNDD 4O63O 3G0DA 2DPXA 1VL5A 2ZIAA 1UWCA 1XEXB 2JFPA 4JELA 2ZJBA 1WXXA 2HHCA 3K1ZA 4P32A 3IQHX 3O3OB 3NHJA 4B7XA 3B38A 4KR9A 3P9ZA 1QE5A 3EUAA 4PO8A 5AOVA 4GGMX 4J1SA 4QQRA 4XB2A 1QGOA 2ILVA 1VL2A 5AK6A 2QA5A 3TIFA 1XTTA 3OTOB 2QAGB 4GKJB 3MSXA 2HWUA 1PJLA 1Z38A 1LDMA 1Z5WA 1QV9A 3GGJA 3HYCA 3TJMA 5EP3A 5CEFA 5GZ3A 3KNZA 5LB2A 2PS1A 1GPJA 4GXRA 4UEQA 1JT2A 2NU9A 4UBNA 4F4UA 1QKJA 3E23A 4WXMA 2AN3A 1SELA 2I67A 2OORA 2UU9B 4LVOA 4DARA 1IWOA 1M2WA 3VHLB 4MMZB 3R3SA 2F8LA 2VSOA 4F5WA 4IO0A 5DX8A 1E2KA 1JI3A 3I28A 5FLKA 4JJZA 2PLNA 4OO3A 3SQNA 4B3SB 1VM6A 1G9XA 3JAWA 3DVQX 1NKSA 2CVZA 1KQ3A 4PCUA 3UHJA 2F9MA 1XLVA 1QHEA 3LBAA 4I9HA 4PGAA 5JWRA 2EGGA 1MXHA 5ILGA 3KAJA 1F6DA 1TF7A 1UFQA 4DR3B 2QRHA 2HA4A 5SZHB 3G8YA 4H7PA 1QHYA 5H5JA 1GKIA 1F6WA 1E62A 5LA6F 3MGAA 4N76A 1SUDA 2AGVA 2R48A 2X1MA 1X1TA 4LJ7A 4E6PA 4AZ3A 4P4GA 3SC3A 1NVBA 1GP2A 1T36A 3BD6A 5I4BA 1FB5A 2ZAGA 3S68A 1X15A 1F6BA 2XITA 3ASVA 3AGQA 3QVLA 3A26A 2XGMA 4CCYA 2H2IA 1NKTA 3QYJA 1K8XB 4YRIA 4MVJF 2JJ2A 4DQVA 3HO6A 3UH0A 2G7MC 2X5JO 4I8IA 1OWOA 2LKCA 5TGDA 1G6OA 3EFBA 2IE8A 5HA5A 2AMJA 2J46A 3ND9A 3GG9A 4MRVA 4OHZA 4BIMA 3FOEC 3FWKA 5E1BA 5HRAA 5CD1A 1ZH4A 3PC8C 3ZU5A 3O1IC 2DHDA 4DLBA 4D9KA 1B76A 3DWEX 4TSKA 4BZXA 5KNBD 3U4MA 1LK7A 4OYRA 1TK9A 3O8LA 2GT1A 4LMPA 1JLSA 1QH9A 1OYYA 3H8JA 3TQQA 4Y1RA 4H77A 1H0HA 1IM8A 4C4SA 2ZJOA 1EFCA 4MUNA 2CFCA 4KK3A 5THXA 3O8QB 5DMHA 1JP7A 3WKEA 5JYDA 2ZM6B 4QL3A 2XVXA 4LV8B 4PG6A 2GYYA 5BNTA 4EOGA 4G0WA 3UAYA 2DULA 2YXLA 1CUZA 1VZ2A 2NU6B 1SCUA 4WLVA 5LQUA 2XEDA 3NV7A 2WPDD 1V71A 3BSYA 3MWDB 1IAQA 4G0QA 4ZQFA 3O92A 5K8TA 4I4LA 2UZ1B 3FW1A 3BE5A 4LXUA 1UQTA 2XY4A 3QBJA 2RBKA 4D4MA 1PZFA 2HJGA 1VJ5A 1L4MA 4FBMA 4IEFB 4INZA 3KD2A 2PVSA 4J3JA 5F77A 4FYPA 1DDGA 3KYIB 4U6SA 1P5FA 4MWGA 1HFEL 1PUXA 2JGMA 1ZNQO 1FJHA 3AR7A 1AK1A 3QVXA 1PZEA 3OFVA 2O3QA 1FRVA 1AKVA 4DQDA 5IHPA 1LEHA 2HWYA 4PS1A 2VDNB 3ON5A 4D8TA 2IV7A 4I7EA 3FFXA 4X9XA 1OF1A 1IOLA 1OZHA 2H1HA 4I5DA 2H1FA 1TD9A 1J1ZA 1QQ6A 2GA9A 3PD7A 1XRQA 4X1IB 5AHXA 3X1MA 3EJ6A 5KS2A 1Q0TA 1MZVA 1LQ2A 4KO2S 1FNDA 1MVOA 4IGIA 3UMYA 1CVIA 1YH3A 2P2NA 3HKCB 2XH8A 1MB3A 2OGZA 1DDOA 4OAOA 1XFDA 1T9BA 5A9SB 3BWBA 3TNJA 1PR0A 4ENSA 5HKKA 2R8OA 1L3BA 2EBHX 1Y3HA 4J7XA 5ALUA 5F1PA 4RHTA 2VCYA 1QRAA 4Y2GA 2G0NA 3EHEA 3Q4GA 1HEIA 3BIFA 1KH1A 3U09A 1SC3A 3UK6A 3ZGVA 1C3EA 1VCHA 2CVFA 2H1VA 1UPTA 3N2GB 4L02A 3RCBA 4E70A 4NMWA 3RRXA 1IXZA 2OG1A 2VHEA 1GZUA 4HTAA 1H6CA 4MQEB 2F67A 3DTYA 1XWFA 1RADA 1U31A 2A1TS 1HY3A 1LRLA 3WMGA 2G1PA 1R6BX 1P7CA 1Y81A 4UW9A 3WLPA 3K4PA 4DADA 5JZOA 2BFOA 2IJGX 5IZ4A 2MSLA 4QTUB 1ZESA 2FPPB 2YRXA 5I4KA 4LV5B 2AYZA 4BKQA 4U7PB 5AIAA 2BJWA 5EJGA 5CBKA 1M83A 2G4VA 3EISA 4NICA 4AB1A 2I9KA 3T7SA 2VYVD 4CM1A 1MB9A 3A1EA 3I2KA 3R6TA 5SYNA 1YTUA 5G0TA 1F17A 2EWWA 2G76A 2H5EA 4R8KA 5EJ4A 1HTTA 2Q29A 4KPYA 4I3FA 4OL9A 4R9SA 1N5MA 4X65B 2IIVA 1GGEA 3HPRA 2BI4A 1XELA 2YNMD 5CCBA 2HN9A 3PEVA 4JC5A 1H6DA 3QUCA 4MNTA 4ZRNA 4OGFA 1Y8CA 5KYNA 2HR1A 2VO1A 1WBDA 4BP9A 4F3TA 3Q41A 4O4IB 4Q9LA 4KGXA 4K81B 3EDQA 1PJRA 4Z9AA 4OJKA 1U5AA 1Z25A 4M8LA 3AU8A 3C3EA 3IQIX 4XM0A 1GL6A 4IGKA 4M89A 4U0KA 5B58T 1UWKA 3VU8A 2DWUA 4NCKA 3WNVA 1U9IA 1SK8A 1Y9ZA 2GF2A 1AKQA 1JEQA 5LYYA 4DCUA 2PUBA 4RZSA 3LOPA 1AD2A 3MTGA 3SZUA 3V1TC 4J2OA 1JG2A 5C51B 3K2QA 3UFBA 3ULKA 3GZNA 2I29A 2PUFA 3QPVA 1UQUA 1ELOA 1N6RA 1JLRA 1ADGA 2FWPA 2YHIB 3A4NA 4EJ0A 5BW5A 2PKRA 5H0IA 1QCYA 3C7KA 1AS2A 1T0PA 4J03A 1ZS9A 4BLQA 3NXSA 4KWIA 3N8NA 1FTWA 1PZMA 4RHUA 1M1XB 2OXTA 5CDYA 3TBHA 4AMZA 4KZPA 1EUZA 2AZXA 4I55F 1IBLB 3UYLA 3B8EA 2O9JA 2X42A 3UJ8A 5TMEA 4PR0A 4A16A 1H1LB 3JRNA 1UMKA 4QGHA 4ZMSA 2YOHA 3RTBA 4ARUA 3ED1A 3KKQA 3AVQA 2YTZA 4AXBA 2Y68A 4GPTA 4JWTA 5TGTA 3FWNA 3TLGB 4LA4A 3LHKA 7MDHA 1EP9A 2VZ8A 3KVRA 3BMNB 3GJXC 4XSGA 4MWEA 4ZWNA 4B2LA 1BE8A 4XR9A 2VSNA 1K63A 5CVJA 1FFEA 3OQMA 4GD3Q 1DXOA 3G79A 4M88A 3TLMA 1GM5A 2BKAA 3X2FA 4EYOA 2J3IA 2VXOA 5T41A 1DAEA 1D0IA 1M33A 2P3SA 1X42A 1ZJ4A 3GFFA 3DDUA 3AR9A 1TMOA 2TMYA 2O8BB 1V8OA 4OQMA 1KH3A 1OXXK 2JCBA 4R1MA 4KMMA 1GNQA 3LZDA 1MC1A 2QTHA 3QIAA 1U7WA 5EERA 1BVHA 1O77A 3HK2A 3KBBA 3HHEA 2QMUA 2SECE 4AP9A 1IY8A 2CXHA 4F5ZA 2H1WA 2IU4A 2G4CA 4P54A 2D2XA 3KKEA 5FEMA 3LIPA 3VQTA 1KO5A 1M5TA 3LLSA 1MAUA 1HRKA 2C0PA 2ID4A 4X97A 5IBCA 4GI7A 2O0HA 3M1YA 2RCNA 2J41A 2PGJA 3FCAA 3MEQA 4YVFA 4JBHA 1JFFB 4CKWB 4EITA 3RWMB 1F8XA 5FD8A 3HS3A 2V45A 1Y9AA 1KE1A 2DUWA 3SDZA 1PG0A 3HNPA 2BR3A 3UTDA 4ZP1A 5I9NA 5HUHA 3USZA 1ZD3A 2WHQA 3QENA 5G02A 2POCA 1RAGA 1IUOA 3TW6A 5ITWA 2IOFK 1FFAA 1C7QA 3CLSD 2BMDA 1XZEA 1KQNA 4BZWA 1H9CA 1RWVA 4JU8A 1TJNA 1V7ZA 2BGTA 2GBFA 3Q2OA 2PPVA 2Y93A 1G66A 4M8NE 5BN5B 3RF7A 3ZQUA 1A27A 3AP2A 4CMBA 3L02A 4OSOA 5LBUA 1KP9A 3GOQA 2YOGA 2GB4A 3D7KA 3VISA 1QOQB 2JF0A 4F6RA 2QTRA 3T5AA 1QCCA 2JNWA 4CF5A 2XCTB 1YTLA 1CQJB 2R6R1 4WVLA 5C3UA 4EF4A 5ADUS 1M76A 1GILA 3JQAA 1J7KA 3JPWA 1K97A 2JIMA 4RF2A 3U80A 1MX9A 4R0NA 2QWXA 2YR0A 3F78A 1JSZA 2PX6A 4WOCA 1YNOA 2VZEA 3AV3A 4DDHA 3ZK8A 3EK2A 1K5PA 4QFDA 2QXTA 4S2UA 4NARA 4QYWA 1HO3A 3QVJA 4RLSA 2JA2A 3LKZA 3AETA 4J16A 4XFKA 3KQPA 4ADSG 1RLTA 1I5OA 4ACBA 1WL8A 4BNVA 3LC1O 3QNUA 3VR5A 1EIZA 1ODIA 5ETJA 3WMXA 3QX7A 3ODGA 2E5LB 1T8PA 2ZI3A 3IBYA 4TVSA 2EBFX 4K8RB 2C5HA 4GW3A 2PH1A 4J6FA 5CAEA 4BNFA 3U3OA 3V4VB 3H1GA 5LYJB 4IW3B 1QUFA 4M8SA 4ZDWA 3WQSB 4BMNA 3ZJVA 2HQRA 4IDGA 3D6FA 3PQ3A 1ISHA 2GD6A 2X41A 4NPAA 5CUQA 4D82A 3VYRB 1FFCA 2XV1A 2FPGB 3CZ5A 3SE7A 5AVZA 1FP7A 3DZBA 3VMMA 1ZY2A 1SXJA 5K2OA 3ER8A 1YJAA 5F21A 3QSYA 3W9YA 3BIOA 1U0GA 3JR3A 4M37A 4LSGA 2P40A 2FEWB 1R4NA 4ND8B 5FUYA 2OMEA 3H6HA 3V8PA 3ZNQA 3MGKA 5DHAA 5JHHB 1C81A 3WRVA 1AHPA 2ZKLA 4Z99A 4UBOA 4MWCA 2P5UA 1FX0A 3PNPA 3WGIA 1AQUA 1JNXX 2LKDA 1PL7A 2OV2A 2GETA 2YY6A 2ZQZA 4DCGA 3NR2A 3R8CA 5DU2A 1E79D 1W59A 1UM9A 1N1DA 1I4DD 3GT3A 1E6EA 1S0UA 1MV5A 1TU0A 2J5KA 2MJLA 2VDWA 2IX3A 1D5CA 1JMYA 1U1IA 1NW7A 2OCIA 3D6NB 3UJAA 2G72A 2XTNA 4L72A 2W6IA 3R0ZA 1KI4A 4WQMA 4R2LA 1B6TA 3RPEA 4E33A 4P83A 2P5TB 3R5FA 3MT7A 5F3DA 5IARA 3WNDA 2R1VA 4Q6BA 1N33B 6CHYA 1XQ1A 2GEBA 2V7XA 3A27A 2J3QA 5BRJA 1P4SA 3I5UA 1AQNA 1QONA 1DPFA 2GZ1A 4GECA 1GKKA 5DW0A 3E18A 2OHGA 1JZTA 1Z6XA 5L3RA 3WLEA 4AZTA 4DQ0A 2XVYA 2W8BA 3X43A 2ZUUA 3KZVA 1SULA 3KE9A 1EFVA 4EUFA 1N1MA 1R4AA 1G17A 3D3NA 2CMDA 3MRTA 2R5WA 1P60A 2X3UA 3DOUA 4RH3A 3Q9NA 1XF1A 5T4HA 3B53X 2OV1A 3TCKA 3FVVA 3U3RA 2H9IA 4O8CA 4XUGB 5BR7A 1RJ9A 3DCJA 1LF5A 4Z7OB 3U0VA 1NNUA 1DXHA 3UUFA 1A4IA 3DDWA 2CJYA 3E3LA 5JUWA 1YZYA 1YI8A 3QF4A 3I39X 4ZOLB 3D43A 2HMUA 1ORRA 1E4VA 2JHCA 2QJFA 4PVCA 1KC1A 2AJBA 3I64A 3M7IA 1ZCFA 3ONFA 4FOPA 4PQEA 2VJPA 3OLVA 1M2OB 5NLLA 1OI4A 2IS1A 4MB0A 1XMSA 4LXYA 4CKEB 3C3PA 5A3SA 1WY7A 3AY6A 3PQ5A 4AF6A 4RTPA 3GLKA 2FP4B 4NOMA 2C78A 3DBHB 3DW3X 4ZVVA 1Q7EA 2BW0A 2G6TA 4Q4CA 2NVWA 2OXEA 2ZWIA 3G7UA 3GV0A 3LDAA 1D2CA 1EGQA 4BQQA 2PO7A 2JFOA 1VSQA 3PQ4A 3OF2A 1J8QA 3QFTA 4LV6A 4A7PA 3DCNA 4XARA 3NC0C 4B4UA 5FWDA 1YASA 1VFPA 1RQLA 3I3SR 4JKIA 5IJZA 2CXSA 3SVLA 3HYSA 4JKYA 3GO4A 3L07A 2F3QA 4KVFA 4NZMA 5KNDH 3OBIA 1NZDA 1JS1X 1QF7A 4JBNA 2KYRA 4KDEA 3C7DB 5A02A 2MU1A 2J7PD 2YHUA 3E9CA 3C45A 4FHZA 4MYUA 4EW3A 3HLYA 1ZEJA 3SE0A 3URMA 1OFHA 1E1CB 1P2UA 4HPWA 5T5QA 2ZYWX 5KWJA 2BEJA 1T5LA 1VJ0A 2B6HA 3AGPA 5JEEA 1C0EA 1Y1RA 4R01A 3JPYA 3WNZA 1CEXA 2QTMA 4RIIA 4AG3A 3MNFA 1ZNWA 1BROA 3MLEA 1SBIA 3LP5A 3OQIB 4IH9A 4U7TB 7REQB 5JZ9A 1C3XA 4UNIA 3H5TA 1QR2A 1UKCA 1ZCJA 3HFJA 2D1SA 3C7TA 3JYLA 5CU7A 5HIIA 3Q6IA 1T3SA 4K0RA 1UMCA 1BDJA 1QGYA 4CJXA 5DX0A 3GGSA 2UXBB 2OYSA 1WU7A 1ETUA 2O3SA 4HH0A 4JA2A 1C2YA 4PHTA 4LNUB 4TL6A 4KN9S 4NHOA 4TMYA 5CFRA 4X7BA 5DE3A 3NBUA 3O95A 2Q8PA 3LQ2A 1XLWA 3EAFA 4MGYR 4XCVA 2CLIB 2A30A 2YCBA 1NAHA 1EHIA 2Q5JA 2ROQA 1AKWA 2FZEA 4PXYA 4LOIA 4DMCA 2OLEA 5ADWA 2HNKA 2QQFA 4AY6A 2WKRA 4KPGA 3ROGA 4CPDA 3VBEA 4F45A 1JBEA 1E3EA 3L8YA 1Q0ZA 1WHTB 3GJRA 3DHNA 3DZDA 4EJFA 1M7BA 2HRQA 2PKQO 3KUDA 3LUHA 4GUAA 1H6BA 4NU8X 4YWHA 1KNQA 2Q9UA 3GLQA 3KZXA 2DWOA 4WD3A 1E2NA 2TSYB 4KXVA 4Q4HB 4ARZB 3PX7A 2IV2X 3OHPA 1DE0A 1FA9A 1RZUA 4JEUA 5E2AA 2C9MA 2O50A 4JY7A 4CMGA 4LRUA 5CW2A 2QZ4A 3OIVA 3F6YA 5DULA 3TW8B 3HI4A 4EPXA 1KRXA 2Q1SA 5CEJA 1GZ4A 3QU5A 1FK8A 1CS0A 3HXQA 1CF9A 1Z63A 1IY1A 2FFHA 3AB3A 1M0TA 2O5VA 4RCZA 4JASB 4ZVPA 1AURA 1YR6A 3K9WA 2XHEA 3COZA 3Q85A 3R7WA 3TB4A 1ZR2A 3BJZA 4BE7B 3O73A 1Z2PX 2WLSA 2J0UB 3C6YA 1L1RA 3KU4A 5FA8A 1SXQA 3O9MA 2ZUEA 1FMCA 4O4HB 2GXAA 3WSVA 1ST3A 3NJ8A 4O2AB 2ZSBA 3W5IA 5BWLA 4PRLA 1U04A 3ITNA 2AC2A 3HPQA 4Q48A 4KJXA 4BKOA 2VWPA 1X87A 1ZBQA 1GRQA 1M3SA 1K4YA 1P9NA 1SVOA 2O1WA 2ZT5A 1Z15A 1CKEA 2VYND 3BUSA 3HU1A 1DC6A 4JLPA 4JYMA 5K0ZA 1O8CA 2IK8A 4DJJA 5L3SB 4MK4A 1D09A 1E89A 4PLFA 3WAKA 3A2NA 3MJEA 2OV8A 1A4XA 5L7YA 3FDJA 4HH1A 4OJMX 1QFXA 3BGDA 3PI7A 3OKAA 3SR3A 5L45A 2P0EA 1DX6A 4LXTA 2B35A 2ZT7A 1UBHS 3EUWA 3RUHA 1GYRA 4JP1A 2OGSA 1JHXA 4F8JA 3ZQJA 4K9QA 2CXXA 4ZALA 3Q1KA 3KJEA 3UFXB 3D0OA 4QRDA 3T7DA 2Z2KA 1AXEA 4L5YA 2LW7A 1CRWG 1IZZA 2Q9CA 5F35A 2PLFA 1VOTA 3IQDB 1BN7A 3ZTYA 2LBPA 4YJ2F 1HDCA 4LYHA 4G5YA 3TKLA 1NMSA 1T4DA 1IPFA 1UDXA 2GS9A 2ZKIA 3LT2A 4LUCA 4R71A 4ROTA 3DMDA 2GN8A 5ALGA 4N03A 2AFHB 1AT1A 3ZDCA 2GERA 3BEOA 3IXMA 1A3CA 1CDOA 1WTAA 2GVZC 4TS1A 3RJTA 1KEKA 4C6TB 3GJ5A 3CPEA 1XZMA 3ZIAA 1P2SA 4ZOEA 1TECE 4KRGA 1JIJA 3F3KA 1KOGA 3K6SA 3VTZA 1BFDA 2EATA 4IDDA 4NYMR 1YIDA 3N7AA 4Z54A 4NCBA 2OCKA 1PR3A 1DAIA 3KJHA 2RHOA 1PEAA 3KSMA 5SZKB 1TZJA 1QHGA 1WETA 4I50A 3T0IA 4FE3A 1XEXA 5GGXA 2P9JA 3FPLA 4Q02A 3B6EA 1FMTA 2GPTA 3TS1A 1ZU4A 1D1PA 1NZFA 4YX9A 4XUCA 3VDNB 3DEZA 5LSAA 1DQYA 1VGRA 3GDHA 2X5NA 5DM4A 4JI0B 4ZCQA 4GI2A 4Y2TA 2I8AA 1WUYA 3FAZA 3PDUA 2RHDA 3Q87B 4MDYA 4CI9A 5KTTA 2A9QA 2A9RA 2QQ5A 2WSMA 4A2QA 1KTIA 3C85A 3K1AA 4TZKA 1X7WB 3FLBA 4RESA 1SIUA 3MWKA 3S1LA 1D7AA 1Z35A 1NJ8A 1EX6A 2RG7A 2QAGA 4L4YA 5F3RA 5AESA 3OETA 3PFNA 5FBRB 4GKBA 2I4IA 3U26A 4EKGA 4I6JA 1CFZA 1SGWA 4KGDA 4AO7A 1KFKB 1WXHA 1YAJA 2ZYSA 4HGOA 2ID8A 1FJGB 4G25A 1J2UA 3GXBA 3I4LA 3PJEA 1I5EA 1ZNXA 3UWMA 4BFSA 1IZ0A 1U2ZA 2F1RA 2J5BA 2RKOA 2QD5A 3B6IA 3EH2A 4WASA 4PHCA 4COKA 2BYTA 3NAMA 4MV1A 2AE1A 1N9KA 2WSBA 4HDQB 2JAPA 2XB6A 3JATB 4XGQA 4GOOD 3LQ1A 4E5VA 5C4IA 5SY4A 3KQOA 1O54A 3ZGZA 2IYNA 4EF6A 3S99A 1W30A 1ZD2P 2B1GA 2QLBA 1VL1A 3OLYA 4XIIA 4UHKA 3WIVA 2H0RA 1KNXA 3IAEA 2C98A 4K87A 2WIFA 2XCRB 1TAUA 2WIBA 2WJIA 2DUMA 1Y6FA 4IYJA 3GFPA 4BBPA 5CIYA 1Y1PA 5SYMA 4OM8A 3TLCA 2SBTA 3TZEA 3IPYA 3I92A 4TTSA 5KSYA 3QPAA 1WKBA 4N7MA 1N3LA 3RYHB 1TM2A 4QDTA 1RXYA 4Y2VA 1WJGA 3E15A 2ZYAA 1EFAA 4MDFA 4Z4HA 3CZ4A 5LQSA 5IEJA 2B37A 1NI5A 2P2CA 1DQPA 2X4LA 3BKWA 3FOWA 4JVOA 2CLLB 3LY5A 4UCXA 1XTKA 5LQAA 1GPBA 4WBNB 3PQ7A 4AZ0B 3NT5A 5BWBA 2FE4A 4W4TA 1WPGA 3V2HA 3K0AB 1YDMA 2AJDA 3V97A 3FCSB 1F2UB 1B4DA 2P2GA 4RPHA 1PS8A 3KKOA 3KWJA 3P5BA 1Z29A 4P86A 1EFLA 1RMYA 5FR2A 5BSTA 2WWHA 3U9LA 3A04A 2XDAA 3VKHA 4CM3A 3LUDA 2GZ3A 2D5CA 3DTTA 3H7IA 3LDGA 2FRDC 2Y1KA 3ZXSA 1OGJA 4QBIA 2J7KA 3U7GA 4ZDIA 2C7OA 3PL1A 3DKRA 3OF5A 2GFHA 2H2WA 4B82A 4WCVA 2OUKA 3LA6A 5CH5A 3T99A 1JFTA 4EHDA 3OLZA 4E1VA 1P0QA 3IP9A 4IJWA 4MVJM 1EFRD 1ZH0A 3KJGA 4CMIA 3IUQA 3SYLA 4R8RA 3H9GA 2JD1A 3RRFA 4YA6A 2L0XA 3DNFA 4P1ZA 2AB0A 5T3YA 4X92A 4Q7QA 2VI5A 2QRZA 4LSMA 3RWBA 1GLGA 4BO1A 3FWHA 4QNNA 1RBMA 1CF2O 2J4CA 2NU6A 3IHTA 3PUZA 4Q7MB 4WK2B 5DBHX 5HJ2A 4NATA 3QSGA 3UM9A 4X66B 1W581 1NQ5A 4PC6A 2R7AA 5AKGA 2G4LA 4ER7A 2BISA 2FUCA 1SQ6A 3W79A 1ORVA 2I34A 1MO3A 1O6BA 3TZCA 4OB6A 1NT4A 2IZOA 3ZTTA 2B5VA 5EHXA 3QH4A 2XB8A 4K9PA 2Q41A 4BJ3A 4Y2XA 3UWSA 2J3EA 3UT0A 4B34A 2ZUCA 1ST2A 3LMKA 2BF4A 1KK0A 3O75A 1ADFA 1SNYA 1ZH6A 4GX0A 3DMFA 4AUKA 3EPHA 2WWWA 4KAJA 2DAPA 1EFTA 1RSZA 3FN4A 3ISTA 4KQGA 1YC5A 1YBVA 2CVPA 2IDMA 2P78A 2ZS7A 3FOBA 5JD6A 4P84A 3AVVA 4EKDA 3SZ3A 2Q27A 3EXG2 4LHXA 2ACEA 2FW0A 2H7CA 2OZVA 3OX4A 3EQ7A 2RI0A 5F76A 5TS2A 2RAFA 4RHFA 3KDAA 4BIIA 1B6RA 1VHDA 4HQRA 3BN3A 2WJVA 1NU8A 2O7SA 4HDCA 4TLCA 5A9SA 1RI3A 2GK3A 2FUG6 1DFHA 2PR2A 2EF1A 5IFKA 1FFYA 1RWXA 2E4WA 3WBBA 1W52X 2FWBA 1Z0DA 2B5WA 3NOVA 4WESA 2D7JA 3AVYA 1CDDA 1V45E 2RG1A 3H3XA 4LJSA 3WB2A 5C8YB 4Q6WA 1N4DA 1DV1A 3WO1A 2DERA 2Q4TA 2GJ9A 1L5NA 4QLBA 3ISVA 2P62A 2IEYA 3ITEA 3N2GA 5AW1A 1KEEA 2BGGA 4F7WA 4Z49A 3M5DA 2WHPB 2G77B 4LBZA 5F2EA 1F4LA 1P33A 3NO4A 5TV2A 2BFCA 2QX7A 1V5GA 3T3GA 1X8XA 3ADOA 5A06A 1FOEB 3EBOA 2XMGA 1Z28A 3P2MA 4H3KB 3LCJA 2H52A 5IUNC 5F4BA 2FPPA 4MA0A 2XCOA 1Q3TA 4FUTA 4R2JA 1V8DA 1AX9A 4ND3A 4M46A 4JODA 6Q21A 1G2QA 1FUIA 3DKPA 2X8LA 4KBGA 3RTAA 2Q4OA 4JI7B 4AL4A 4EY7A 4EUHA 3I5AA 1EE9A 4X3PA 1U3CA 3RSOA 4MZDA 2QVXX 3MTQA 1N5KA 3K31A 4W5HA 2G9NA 4E7PA 5HE8A 3R76A 2QXYA 1MLDA 4YCSA 4NXNB 4I9FA 3QLUC 2HRRA 1ZCBA 3F46A 2ZJZA 3PC8A 4JU9A 1LKZA 2JS7A 2C4MA 4TVBA 4JJ7A 5DN9A 4DRYA 1NBME 5EUCA 1YXMA 2I6UA 1ADCA 2WJYA 3B1XA 3NDPA 4UFPA 1I5RA 1XCGB 2JLWA 1QGED 4HWKA 5F1KA 1IQUA 1U7HA 2YFYA 1M1NB 1GCIA 3OZEA 3D8BA 5BSWA 3S70A 1DAGA 5IDVA 4QO7A 4DANA 3EDMA 4W7IA 4ERNA 2XA2A 3DPIA 3EE6A 2WM2A 2VDLB 1GY8A 1STOA 1GAEO 3P2EA 5JO0A 1RW4A 3G0OA 3LQKA 2YWHA 4OQXA 1Q7CA 2V6IA 4DCPA 5LP6B 1G8HA 2BE7A 4Q0MA 3VA7A 5JCJA 4G65A 2VL7A 5CG2A 5ERXA 1XLTC 4V0QA 2A4MA 1J0CA 3O2NA 5KTYA 4KL8S 3SBXA 3GNTA 2FN7A 1E1MA 1NLZA 2ZDGA 1GYPA 4ID3A 4JR2A 1Q77A 4LBYA 4P0TA 4QGAA 3VTKA 1LTHR 4BNTA 1A8IA 1IN1A 2QTVB 3SXUB 3H42B 3GVXA 1EDBA 1P0MA 4IFBA 4BQSA 4A92A 5DM60 1YS4A 3FKSD 2VHUA 1E7QA 1QG6A 4H18A 5HGJA 3TNYA 2RIRA 1LJUA 2ZIGA 1RQGA 4Z9YA 3KG2A 3L6CA 2WAOA 3MLAA 2D3TA 1WF3A 4LZWA 4XD7D 1X14A 3RYCB 1KMHA 2ZRJA 3U6BA 3NUZA 3W77A 8ABPA 3WK7A 4L6AA 1TFRA 2GK6A 5HZGA 1V39A 4MA4A 4C7KA 4P3PA 4WACA 3VDXA 3VOAA 5BN3B 2PZMA 4I50F 5CVTA 2DKOA 3DUFA 1GZ6A 4Y9RA 3WB1A 1OC4A 3AYXB 1GDHA 1R0XA 4N5HX 5EFOA 1WDMA 3SF8A 1JA0A 3TEFA 1T1IA 2FAXA 4ITRC 2QU7A 4CCAA 5P21A 2XRYA 3DV2A 4WDRA 1P1KA 3VO8A 1QVRA 3JZDA 2RONA 2DFTA 2O4CA 4ENWA 1KGSA 1OX5A 3PNLA 1TKBA 4O5OA 2YQ4A 2X15A 4L15A 4L16A 2O54A 5LZ8A 2M9MA 1VKHA 1CJSA 1UBOS 2G1UA 3FNQA 3OUTA 5AR1A 2HQSA 2XQGA 3NYRA 2J31A 1MFZA 1Y1SA 1PGJA 2AV6A 4LJ6A 5JG7A 1K7CA 4NE7A 2PA0A 1YL5A 2J5RA 1S89A 2XOKD 3NWEA 4JBYA 2XXAB 2OCLA 4C76A 2NVOA 3DGFC 3F4LA 3GAZA 1JHAA 2AXQA 2GWHA 4LC1A 2EP8A 2P41A 2O4UX 1T0JB 4GP6A 5CVEA 5TT0A 2ANCA 1UJBA 3CLTD 2O7VA 4CQLB 2O2IA 4GSKA 3K1TA 2WIAA 4GX1A 3OEWA 3KOXA 4F8EA 1H8HD 2FZKA 1FU8A 1TK2A 1T8RA 4J94A 1N2XA 4QYMA 3CNOA 16PKA 5E9JA 1YUNA 3ZDRA 1EGHA 1SJ9A 1YK0A 3SDSA 5BMVB 4HBZA 1A88A 2ODTX 3IBTA 1K7XB 1X0XA 2BHLA 3OE7D 1A5ZA 4CDRA 5BSGA 1L5WA 2FPOA 1T0BA 1VKNA 1AKMA 1LU9A 2F64A 2I8CA 4RVHA 4CLRB 4EY4A 5B58C 4TWBA 4RJIA 3EXIA 5LB4A 1LBTA 2HK9A 3BRWD 3KPUA 1NVDA 1MIOB 3O9ZA 4K05A 5DYGA 4ZVLA 5AUNB 4QC2A 2R4UA 5ARCA 4KMSA 2XCQA 3CLRC 2G5TA 2QHXA 2CLKB 3DF9A 4V02A 1Z3IX 3LJKA 5CDHA 1P45A 2QBYA 1ZI9A 1TKRA 1O3YA 1HE4A 3RS9A 3SC2B 1RHUA 1ZRSA 3OTIA 2DE0X 2ZT8A 3NFRA 3ADPA 2R8EA 1CEEA 2W6JD 4FEAA 3TDMA 2HLPA 3M5CA 3H1EA 2IQ5A 1T6YA 2Z98A 4MQUA 5IJ9A 3TLXA 3DM5A 3L7MA 5AICA 1SOVA 1ND5A 3OJOA 1LVHA 4ZN6A 3AF6A 1EXNA 1B1AA 3OCJA 4B6SA 4B3HA 2C5SA 2F90A 2FR8C 2ZE6A 2ZSAA 3FSGD 1YE3A 5CGQB 5K3SA 3OOEA 3G5AA 1SCJA 1LPBB 2BTQB 4FYYA 3B2QA 4N8DA 2GBCA 5J5AA 3CX3A 3ETLA 1D4OA 3CISA 4CV1A 5KDLA 1R0KA 2C8VA 5K0LA 4WZAA 1MMFB 5K9ZA 4J0IA 1LI7A 2JIOA 3K73O 2ECOA 2GR9A 3I0NA 3PRJA 4BO6A 4EG0A 3ADCA 3ND5A 3KR9A 1BN6A 4J07A 4DDKA 5CA1A 3QXCA 1SEVA 2OB1A 3EC2A 2Q50A 3OFNA 4WNCA 5J2UA 4AC9A 4B46A 3H1TA 2EKQA 2YMLA 4X0EA 1EX1A 1NW4A 3KXLA 5DSXA 5F5LA 5KEIA 3VOBA 5M29A 3LC2O 3ENZA 4Q1DA 4NDAA 4DBVO 1PT6A 1G6Q1 4E3ZA 4URXR 1DO2A 1Q83A 3PFFA 4ND8A 2JFXA 1QSGA 1X7ZB 4AJHA 3RBVA 4RABA 4P80A 2FPUA 3NM5A 5AIBA 4P3NA 1JKFA 4F3RA 4IPTA 3DULA 2B92A 2V5VA 4Z3KA 1NZJA 4IQ0A 4JFAA 4L85A 2A78A 3EUFA 3AY0A 5HS4A 2FLVA 3SZLA 2L17A 1FVOA 3DCYA 4EHHA 4EVRA 2GBLA 3QVMA 4UM7A 3EY9A 1AZLA 1NJ5A 3M3PA 3HWX1 2VZ0A 3DBVO 4HDRA 3WMWA 2EBWA 4OKSA 2E4XA 4DDMA 1EP2B 3PDCA 3EZLA 4LX0A 4MLCA 3OQ1A 1JVNA 4IVRA 4BY9E 4MRMB 1XMIA 4GVPA 1X39A 2QRQA 1QAOA 4KQFA 1TGVA 2O2XA 1UIMA 2G67A 5FTJA 4TWJA 3ZGLA 4PC1A 1W93A 3C39A 3HVRA 1FLAA 3KKNA 1QDUA 5F4ZA 1ZVVA 3O4RA 4AVYA 4QOGA 3IBCA 3M6WA 2HEIA 1RR6A 2HIGA 4NC9A 1FFGA 3ORYA 3QI2A 3GLUA 1QQTA 2XGGA 2Z2JA 1U6IA 2ZUBA 5AM5A 3SQWA 4F72A 1U90A 2QVYX 2DR2A 4DR1B 2AL7A 3K1JA 1XAHA 3JSXA 4ZIRB 3K05A 3I6YA 1Y89A 3GFBA 1T8WA 3KYCA 4NDZA 4YGYA 3X2EA 4UASA 4B9EA 1OX4B 2IUTA 3OA0A 2ZJ0A 1ZGGA 2FMFA 1RQ2A 3L7YA 4CGYA 3PYMA 1FDTA 4I2VA 1N2OA 1YVEI 1E3DA 3N3AC 1C1XA 1YQDA 3PUHA 1HL7A 3U81A 4IV5A 1HQCA 5KVVA 4B4OA 4CDMA 1U8CB 1Y1KE 2H6EA 4LTNA 4EHFA 5HGXA 1V11A 1KKLA 1M2OA 2KE5A 5KOYA 3FVTA 2R6DA 3LXXA 4LSZA 3HDHA 3AOEC 5SY9A 5A4JA 1XTVA 3K9QO 3Q72A 4OH7A 4J0JA 7AT1A 1YCFA 4ER5A 2ZRQA 3BQMB 1H6AA 2JVKA 3TMYA 3IIMA 3R7NA 3MOIA 4CV2A 1G59A 3CE9A 1XKLA 4RXTA 4Q21A 3VYSB 3DQQA 4NYJR 2V8OA 3SQDA 1AQJA 2GCPA 2MSDB 2YJGA 3AEYA 1NUHA 3CSSA 1XMXA 4QXOA 4WN9B 4DMFA 2ZWMA 3R4CA 2C9BA 3GLHA 3FZEA 1E9VA 3GHHA 4KITB 2HWKA 1E1NA 2K7ZA 3D4PA 1Z0FA 1H23A 2JCGA 5I45A 1CHDA 4Y9DA 1ZM9A 2GKOA 1B6SA 1RYDA 1YIAA 3U2QA 1AF7A 2MWMA 3KTFA 2YV1A 3JQ9C 3ASZA 3JW8A 3O83A 4MUYA 3OJEA 4ZEMA 4UXHA 4BGIA 3JQPA 1EK0A 1L8AA 2A7XA 4CU2A 1T9HA 1H2RS 1OW3B 2QUKA 2L69A 5CTAA 4M60A 2WTBA 2CLHB 4PICA 3BM5A 1H2AS 3UZUA 2E48A 1RCUA 2BCGY 3HFRA 5EZYA 5G4LA 4G4GA 5CBPA 1EA5A 4PAGA 1J8MF 1RWBA 3AXTA 5K3AA 2Z9DA 1HT3A 2PH7A 1VIYA 4BGEA 3AI1A 1WNTA 5DGDA 1VMEA 2P67A 4Y6OA 3W5HA 1XZPA 3GRUA 5I8ZA 2POQX 3OQIA 7REQA 5K0SA 1CD5A 1AZSC 2PMBA 5BQPA 5E0OA 3DZIA 4G5OA 4TZTA 5BXYA 4XB6B 4OAQA 1DADA 4HNAB 5TJ9A 4CMAA 3ICQB 3FJOA 4U9IS 2XWSA 1WLYA 5TQ0B 5CDTA 3QQPA 4E7OA 1XRRA 2ONKA 1RD4A 4U3JA 4YREA 3R5HA 3RSCA 3OP1A 4WPGA 4ZO6A 2EJWA 2IIBA 2LCIA 4D3FA 4L9WA 4FJ2A 1IOWA 1IHDA 4KMRA 3V2UA 2HK6A 4Z1MA 1MH1A 3TRKA 1VJTA 4NV1A 3QFCA 1CXZA 3T3IA 5BOSB 3FVWA 2O14A 3AHIA 1ZWLA 2W4MA 4MB2A 3VVCA 3ZXXA 4FT2A 2VDKB 3VR4D 1MF7A 1NM5C 1I6MA 3D2LA 4GP9A 4H6XA 2X0NA 4OGKA 2F1KA 1I3CA 2WK1A 1TQHA 1EGVB 4RF5A 1U81A 3EX7C 5IDQA 3WHLA 4RY0A 1U28C 4K28A 1T2NA 1XF9A 2ZRHA 3NRCA 4LW8A 4UBJA 4KLAA 8LDHA 1Q5PA 1PG5A 4I5IA 3DL7A 3MA0A 3A3PA 1PYOA 3SLKA 2PZAA 1PV4A 1XNJA 3C4JA 1DRWA 4JN6B 3UAGA 5TXGA 1WXDA 3PL5A 4QBGB 2V4ZA 1G9TA 1UC4B 2ID7A 3IQWA 4HAVA 1AXGA 3A14A 1XZIA 3VR6H 3DB2A 4UTVA 1XXHB 1JIKA 2XUOA 4BVBA 1LW7A 3RYIB 4BRSA 2HUNA 3EGXA 4O4HA 3N2IA 1A97A 2B1JA 4MVYA 1JKIA 3Q9SA 2QK4A 4B87A 1A04A 4Q3DA 1NBOA 5IN5A 4UPEA 4GOKA 1UODA 3T7EA 5JVDB 5L3SA 2ZBRA 3HA3A 3G2NA 3FPEA 1D2HA 4Y7DA 4BJ5A 3K71B 1YZKA 3O74A 1NG1A 1CNEA 2GYWA 2IYRA 3GLFE 5LMNB 2ATVA 3F7MA 3PWTA 4JSTA 2DQSA 3VOSA 1C3LA 4GLBA 3IEUA 2GAAA 2BD0A 3HY6A 3CG0A 1L5ZA 2G70A 4E4YA 1HGXA 2B8TA 5C35A 4OU4A 3ZDEA 5IAAA 4XUEA 5C7YA 3Q3JB 4Q1CA 4XWAA 3SU8A 1OH8A 3I45A 4N1AA 5AK4A 3WGZA 2VHJA 3DLPX 4DM7A 4A91A 4Q3OA 1FFWA 2X2FA 2OBYA 3HJCA 5DHRA 4F84A 1VIAA 1Z8HA 2GN0A 1MO4A 1N3BA 3C1AA 3FSEA 4I5GA 4PHHA 2CDAA 1QPBA 3H17A 4G8DA 4R8VA 4ZXPA 4E15A 5IWAB 4LJ8A 1R0ZA 2VQSA 5EIBC 1KP3A 1T6XA 1VSUA 3Q8KA 1BJTA 4Y30A 2FZGA 3R5TA 4AS1A 1G98A 1I80A 4X1YB 1L5GB 5KKAA 4KR2A 3II6X 3U9TA 3FZNA 1HYEA 5DK6A 3RU2A 4DBLE 3IMGA 2HJVA 1FFHA 3L84A 3QPBA 1OGIA 3ONDA 4RUKA 3M4NA 4ZYVA 5CA1F 2BKVA 4TUYF 2DT5A 5LXTA 5J2UF 3DAFA 2DG2A 4UBLA 4GWGA 1NAIA 1W73A 2OBBA 4HNUA 3P0IA 4NABA 4IUCS 3T1NA 4ZDJA 3H1AA 1QDEA 4DR6B 2Q0HA 1V1MB 4UE3S 2ZI4A 3VX3A 5I7SA 1SB8A 4PPNA 5HFJA 4X91A 2ECFA 5HYVA 1UMDB 5D87A 2WEKA 1TW3A 3FUVA 3O6VA 3IVRA 1LNSA 2OBFA 1JDNA 1L3IA 4RENA 5K8CA 2I78A 1C30B 1PDVA 2XUFA 2IA5A 4JI2B 2I99A 2IVZA 1LUAA 3BJIC 4H6WA 4BKUA 4FEEA 3GWZA 4Y1FA 5WRFA 3JVIA 4XSHA 1AG9A 4OHBA 1T35A 4JJEA 4RD0A 3W5VA 3KXDA 4M53A 1V16B 4EPVA 2C3OA 1KI6A 3NASA 2FW7A 3VU1A 2IBMA 1RAHA 3AHFA 2WF6A 2GN2A 4MVWA 3R3YA 4CM8A 2QY6A 3D3JA 3N39C 3SGLA 1TPZA 3ANXA 3C6KA 1FLNA 2HBYA 4URFA 2A5FA 5CB4B 2GDJA 2BI7A 4RTLA 1XCPA 4TT3D 4XE5A 1NLFA 2I3GA 4HB4A 4KIWA 4RDCA 4MKZA 3RVOA 5CDFA 3I05A 4RGBA 2A59A 1K6EA 4MWDA 5JWOA 2QN9A 4JBLA 2J9YB 4MICA 1VLMA 1VKJA 3L6UA 4P82A 4CFSA 1YS9A 4MQ5A 1F0YA 1M6YA 2VR1A 4E32A 3VSAA 5CM9C 2GEJA 3WWYA 5FO0A 1VI5A 3EWNA 4CIVA 2QLJA 2B6NA 3O90A 1E6CA 1GNPA 1BH2A 1H4VB 2AYYA 3PQ2A 5JPCA 2XXBA 3RG2A 4UM8B 1SQ0A 2W2LA 4CEIB 2YN2A 4BGVA 3D0KA 4MYTA 4ZA2A 2FCRA 4J0HA 4RH0A 1G8FA 4AZ0A 3GBVA 1V7CA 3IQZA 3T61A 2EHDA 2W2NA 2ZJ5A 5IAOA 1M72A 1FJ2A 4F5DA 3AM4A 2O8DB 1U9ZA 3EIFA 2VF7A 1F2UA 4ZQGA 1M1UA 2WFMA 3FSRA 5ALVA 3GGOA 1EU1A 5IF9A 1YZQA 2IRWA 1PWEA 4G23A 3CEJA 4MGHA 3V2GA 1EZ4A 4DM4A 3FFAA 4Z4CA 1VQ1A 5KMGB 2HSWA 2HF2A 4ZYWA 4G36A 1G6KA 4S24A 5KNCA 4MHOA 4MW0A 4MRPA 1SVSA 2JG3A 4F06A 4YJGA 2MR6A 3LYLA 2WICA 1IZ9A 1G55A 3MAJA 4I0WB 5PGMA 1V6SA 1KZ6A 2WFLA 3I2IA 3EZ9A 1OH5A 4GZ5A 4UARA 2GNOA 3UJ6A 4TYYA 1P7VA 3NORA 3IE1A 5LKRA 2AIRA 3V32A 5EEHA 5MN4A 5AMXA 5H9VA 5DP1A 3ZJUA 2H2GA 4D9NA 4TM7A 5FFNA 4YYEA 3AUXA 2ZT6A 5U4QA 1OI3A 3UYKA 4DNPA 1VJGA 4I8DA 5DEOA 4IX1A 3HTXA 4XD2A 1E59A 2QX9A 1BGWA 3GK3A 2J9ZB 1UBKS 3QBDA 3B36A 4U7HA 5D3QA 5EZYF 2J6BA 4BJ6A 4AK9A 3RVNA 2JLYA 4HZIA 1C7JA 5JS7A 3M0EA 3WKDA 4MRRA 2W43A 1ZHHA 1CVRA 1ECGA 3MIIA 3HYRA 5IN4A 2GLTA 3ZZTA 1GTVA 4GL4A 3CCFA 3U3KA 2C7QA 2RGAA 1A50B 1H3NA 4TZ0A 3GFVA 5KSWB 2PXXA 4HLUC 4IBOA 3KLBA 1KWGA 2ADOA 2XTJA 1JJVA 1E6WA 4MTCA 2OVBA 2WPNA 3RLFA 2Y2VA 2C5LA 4FFMA 4G4SP 3LHIA 4TV9A 1USGA 1T2VA 1YZFA 4DHEA 4O4JA 2CE2X 1P81A 3OIGA 3AKCA 1Z6TA 4DOMA 4C2TA 3BXOA 1KYYA 2NXCA 3B1ZA 4X1OA 2XUDA 2RI6A 1PUIA 3FFWA 3DL2A 4NRDA 5GQSA 1OXTA 2C0CA 2FVYA 3CF0A 3EFOA 2RH4A 4LXHA 1PD1A 5HDBB 4WJZA 5HSGA 5JTTA 3G68A 4UUNA 1SVNA 4Z8YA 5C8YA 4Z7JA 3NYWA 2UXCB 1RPAA 1DFGA 1W2WB 1RMTA 4V0ME 5ITSA 1IU9A 4UOEA 2IYAA 3HBLA 3H05A 3IUEA 1TZBA 3L8MA 5BMOA 1KYVA 4LY6A 4G0MA 3AUSA 4WZZA 9ATCA 1GKUB 3LFUA 3WLTA 1E7RA 3ZV7A 2W2KA 4D8XA 1RQNA 2QQEA 1RJDA 3ETDA 2DPYA 4Q7KA 3K0BA 3THRA 1UFKA 2J9GA 2LP4Y 3N7UA 3PWZA 4YMHA 1PTJC 1VJDA 1LFAA 2FGJA 1K0UA 3C97A 3UUWA 1ISGA 4G24A 4BL5A 2UZIR 3AFGA 4YRNA 3GLIE 3AFHA 1RYFA 4WOKA 2PS3A 1GGNA 3FSJX 3PPIA 4JKOA 2Z09A 4PG4A 4UMVA 4WBSA 1XZCA 3ZNOA 1MENA 4IILA 2WSIA 1GTSA 4JLDA 4DJFC 2A5LA 3U4IA 4NS1A 1TVKB 3V5NA 4X41A 1YDFA 4YI3A 3TIIA 3V8EA 2PLRA 2FRDA 2X0RA 4KYIB 2WTMA 4NH0A 3L0OA 5K09A 3R0XA 5F9MA 1WX1A 4CEHA 1YZ3A 1OXUA 2QP4A 4M1MA 3OH8A 3UV3A 1Q21A 3RFVA 5LKAA 4NBRA 1T9KA 2V98A 5FWXB 2WTAA 3R4VA 1MDFA 1R16A 3I2YX 4MI3A 5FAKA 2ZCJA 4O59O 1GL7A 3EPKA 4Z4GA 3RO7A 1OFUA 3IPRA 1WLSA 2QTAA 3SVZA 4Y6RA 3O4IA 1V9CA 2XEXA 3QVGB 3ORFA 1M5UA 3QTBA 4NK5A 4RAQA 4DXDA 4C22A 2YL2A 4A27A 3ZLBA 1EUDA 2ASVA 2PJZA 3B52X 4XSVA 1CR4A 3ZG6A 1N2JA 1SBNE 1AKYA 3BWDD 4W9RA 4HAZA 1DEOA 4HRXA 1R74A 4HN2A 4XLLA 1JR3D 1RAIA 1SAYA 1YFKA 3V42A 3L8FA 2XMCA 2HSGA 1ZUWA 1BE1A 4J9UE 3PZBA 4L8FA 5JROA 3U7IA 3OICA 1TZKA 3EVBA 1YVPA 3A6HA 3WK8A 1GCOA 3SKVA 3SXUA 2XCLA 4RV9A 1G21A 1T43A 3NIGB 4LJ9A 1CP2A 5E3IA 1C9KA 1Z8NA 4C30A 4DLXA 4P4LA 3OZTA 5LNK1 4QTYA 1EXDA 3FRIA 3H9QA 3F47A 3HDGA 4FYKA 3NC4A 2E85A 1JR3E 2YZKA 1U0FA 2FP3A 1JDJA 3OPMA 3AF3A 1YT5A 3AR2A 4EI8A 5H80A 2Q46A 3DF7A 4BCDA 5KB3A 5LXTF 2BFFB 5KZMB 3RYCA 2XYPA 5AHRA 1P4AA 2PL5A 3MWGA 1E3JA 1NR5A 4LDAA 3IQEA 3F6BX 5DBGA 4Y2PA 4H7IA 1EBBA 4FQ5A 4IEEA 4MVJD 4F46A 5JSZA 5CLFA 3D0RA 2NUBA 2Y3IA 3HV2A 4AJ2A 5BN3A 2OAEA 2PYZA 3QPUA 4C0AC 1ZVMA 1C3OB 3IRVA 5EJ9A 3LO5A 1TEHA 3SFTA 3IO3A 3S4YA 4B5KA 2GEVA 2WWGA 3A1WA 4LYDA 3HDQA 4PFQA 2QLTA 5M5BA 4I1PA 1KBOA 3HVHA 3SP1A 4MS4B 1RS0A 4ZVKA 3LGXA 4AQ7A 1TMKA 1QZXA 3EIXA 4J0KA 2EGHA 2D59A 2GHIA 4MVJE 2EIXA 1E0KA 5EKDA 2NP6A 1ZD1A 2I4LA 4N3AA 4ZI7A 1MUUA 3PBKA 3FKJA 3P9SA 4PZEA 3CS3A 1T9CA 2V4MA 1MG5A 1RAFA 4CQMA 4W5QA 1XIVA 2CNOA 2Q2WA 5FJIA 2W2PA 1WDKA 5F1YA 2REXB 1QPZA 2N1MA 2B8JA 2OP1A 4TQ9A 5EVJA 1VC2A 2XQIA 3LM8A 5KAPA 4WBXC 2UV8A 2ON6A 2QG4A 3F90A 5AW7A 1E3MA 5EWMA 3OKPA 4HSGA 2YS7A 1WIWA 3QA9A 1FJXA 5L4NA 4YONB 3R7FA 2MYNA 3SQXA 1FTYA 2OXRA 3QVTA 2HMAA 4I6EA 1SPBS 2RAPA 3GIWA 3VU9A 2JFVA 4OHWA 3QLUA 4QHSA 4WW0A 5DNAA 4FOTA 3G2PA 5B53A 4CR7A 4D4GA 5FX2A 5BMVA 2UYHA 1VLJA 2XZTA 3ENVA 5C1DA 2H57A 3ZW8A 3GDFA 3R09A 4RVOA 1YKSA 3COVA 3N2EA 3UA3A 3A1NA 2E5WA 2QTZA 3LT5A 1DCMA 1VHWA 4KDCA 1M1YE 4CLRA 3K4HA 4BOYA 1RHJA 1XJCA 1ZSYA 2YCLA 2Z3ZA 1RACA 4IG4A 4ZAGA 4CQJA 2HA6A 4K9RA 2W2VA 4MYCA 1U8AA 2ZI9A 3GA5A 5K0EA 2ZJ8A 1AB5A 4MUMA 4UVHA 5C46F 1RQPA 2V7QA 4PTLA 4XQEA 3UAOA 1QP0A 3LYAA 1Z08A 4MW4A 3A6LA 1KYXA 3T94A 1EXWA 1JWBB 2E4ZA 2Q3EA 4HZGA 1XJWA 1UBGA 2NNLD 3USES 4ZGBA 4S35A 1OE0A 5EI5A 5KTMA 2A92A 1QFZA 5HRCA 3PUVA 4KNWA 4QG3A 2FPIB 1RAEA 3NTLA 5KVAA 1QPGA 1E7MA 5DCUA 2K7FA 3JYOA 5AKJA 1XVIA 1Y34E 1ZXXA 3VO9A 2PWYA 4AN0A 3GJ8A 5IJWA 4RTNA 4MUGA 2YWBA 1MCZA 5BN4B 1KKMA 2ZK7A 3GUCA 4DPKA 3ZCUA 4HN9A 3VC1A 4KR3A 3C0KA 4YT4A 2QJOA 5T4BA 3RC7A 1IB6A 2V6FA 4NU5A 4YXFA 2EQBA 8ATCA 5JCPA 4ZKDA 1KRWA 1NXQA 4B9AA 1LVGA 1GRRA 3AILA 4ZI3A 1N6PA 1OYOA 5JNLA 3BMOB 5I7FA 1IB0A 3HN7A 3B9RA 1XTQA 3AEQA 5JNRA 1PFGA 1T24A 1SKUA 2YZ2A 3W4JA 4NY1A 4ILEA 4ZTBA 3ZW7A 4LF8B 3FNFA 3Q98A 5K8LA 4F91B 1W9HA 4RJTA 3BXEA 1W4LA 3OQ6A 4TQUS 1W48A 1CJVC 3IPCA 5EL0A 1BMQA 5K3EA 5JAMA 1KDYA 3OPYA 5TDHA 3RC2A 1Y7HA 4C3VA 5HOEA 3T1YB 3OJFA 2V74B 2EFYA 4B4KA 1XTPA 3ZDXB 5IYZB 1UANA 4FNGA 1EVEA 1VHQA 4YBRA 4KGZA 5I3ZA 3RAEC 4QIHA 1CQIB 2R9VA 2QTFA 4RX1A 4R7GA 4ZVMA 3CE6A 4QICA 2R0QC 1LJ8A 1YMVA 1FSPA 4K3VA 3OOHA 5D5PA 5TGZA 2FRXA 3UN1A 4YQZA 1T5TA 1OV4A 3G7NA 1OFVA 2G1AA 1R27A 4OATA 1U7XA 5L6LB 3GRFA 4BU0A 2IW3A 3MJDA 4K88A 2GLXA 1Q1NA 1Z3CA 1ZMBA 4TV9F 5ITZA 1TUEA 2HAEA 1JNYA 1CVLA 2ZLBA 1E63A 1KARA 2B5OA 2NO7A 4O4JF 4UHCA 1M2FA 3LQYA 3ZHZA 1Z62A 1US8A 5AOCA 1NSTA 3S8EA 1L7NA 3DBLB 4YQEA 3IPXA 3H4MA 1WXIA 1IHPA 4HDMB 4PO1A 2HIHA 3GZJA 3FGZA 4W9NC 4ZOBA 3PEFA 5DT2A 5SICE 4B8ZA 2QR5A 4AJLA 2NO9A 3TZKA 4N40A 5ADHA 5EP4A 3JQBC 3MS4A 5B1DA 4BVEA 4ZIRA 4MR7B 3AJRA 4PYKA 4ONEA 3TRJA 3BH6A 3H0KA 3EJWA 1E64A 3RAGA 1M2VA 3HCDA 3N8DA 3AV0B 2QRVB 4FJ1A 4DZTA 5IKXA 1IATA 3LTNC 3QF7A 1RBZA 3ZVNA 3EXHA 1Y5IA 1ZMOA 4FOLA 1XA0A 3BQ9A 4GVLA 3GN2A 3QMMA 3B1FA 5FIUA 4DWJA 5A5EA 5JHGB 5JNTA 4NAUA 1V26A 2EFGA 5DF1A 2J4DA 5BQXA 1FSGA 2ZYHA 4ZT6A 3PSAA 4DC0A 5I7HA 1V1RB 2OENG 1CUYA 2NUTB 3D5EA 4KO3S 3PF9A 3QFRA 5DBEX 1U3VA 1F9AA 2SICE 1LB1B 3HSYA 4B6JA 2MIIA 3ABZA 3BCSA 3WDSA 5IP5A 1UK6A 1VE3A 1FU7A 1KAHA 3GPCA 3D3QA 2QAJA 1REQA 2FR8A 5FNZA 5TB5A 1DC3A 2Z4SA 5D00A 1KAMA 4KXYA 4IZ6A 2XBMA 1G38A 1SHTX 4R9UC 1H9AA 4DLTA 2XJ9A 3PC3A 5DNUA 3W5DA 1G8KA 2NO1A 1D9ZA 1QV6A 1JQBA 3MWEA 2FCAA 4JP2A 1YCHA 3GNSA 4IXTA 1FNMA 5TS3A 4YHHB 4V0SA 4DS3A 3UOAB 5B3LA 4DIUA 1HQYE 1QU2A 5A6VA 1IMJA 3CNBA 2P4QA 1FC0A 5H3HA 4Z3DA 3IIKA 5ILOA 2XF2A 1K6XA 3O7WA 1HNWB 5HBRA 1QYXA 3JVEA 4D9BA 3V46A 2FG7C 1JMVA 3L1IA 4FDMA 3T9CA 5KVCA 5AM4A 3D6JA 4NWIA 2ONJA 2Q5HA 4WKBA 3A9VA 1I01A 3EA5A 1SB9A 1VHTA 3IKMB 4OI1A 3SSOA 4CIWA 4ZDKA 4DG5A 2XGJA 5LFAA 1JHQA 3SYRA 2O19A 3P9KA 4M99A 4U39A 4ZHQB 4OB7A 5L95A 5G0UA 3WICA 4HSEA 3E0QA 3F3MA 4HNAA 4LYJA 1RWMA 1IYZA 1NUSA 1X86B 2IHUA 3AEUB 4URZR 5TQ0A 1U4OA 3I9V6 2G5PA 3IP6A 3QOWA 4KG7A 1JEAA 3V1KA 2H00A 2YXNA 1U0LA 2ZOSA 4KE9A 1T3GA 1NVGA 2B3TA 1PWHA 3TJZA 3FHCB 1Z2DA 1N6IA 3DHVA 3A25A 1SHLA 3V2IA 1U8XX 2JJ2D 2E18A 2GM5A 3GT4A 4J4BA 1JAHA 2E6UX 2DUNA 4KWCA 1IXYA 2XOEA 3G8AA 5BOSA 1SZJG 1V41E 5DNVA 3ROKA 4AIIA 3FMOB 4O1MA 2GPYA 1WB5A 3LX8A 4XJXA 3CWZA 3OC6A 1O1YA 4QOJA 3UC9A 2P9FA 3HFGA 2IFTA 1QTIA 3OIDA 4NPCA 1JRLA 1PAUA 1WHSA 4WINA 5CYPA 5BV7A 4YCNA 4JP3A 3B3AA 1KEVA 1P3DA 3IAM1 1E0SA 1KOJA 2IXTA 1IE3A 2ZYUX 3PKZA 4OG2A 4OY3A 5LBIA 5JDIC 2P3OA 1VRVA 1GL9B 2VT6A 2WSYB 2A9PA 4RH1A 4JI6B 1N2CB 1II0A 3KHSA 4NEHB 3UHAA 4F97A 1Z2AA 3A6GA 1L7EA 2C1XA 2CXTA 3OOWA 3PC7A 4OLHA 5I5GA 5FPSA 3ZR4B 5B1SA 3T06B 2AZMA 4UTNA 4Q82A 3JQGA 1OT5A 2HXSA 4BC1A 3LXUX 2XRZA 4QEZA 2Q3FA 2NZXA 3T3PB 3BMQA 1DJMA 1GWNA 2X5KO 3OY7A 3CNQS 3IV7A 4BYMA 4XDYA 5AKKA 2HXGA 5KYWA 3IEVA 2ZTLA 1GPUA 1N8TA 2B4AA 2CLSA 1GDTA 3NNDA 2F8TA 2WMOB 3AOEA 4TXNA 1XHFA 3OT1B 1LSJA 4NZZA 4BEJA 3QEBZ 1P4RA 3FOFC 1ISMA 4RMNA 1Y5MA 1ZVJA 1R12A 4WUVA 3T5MA 1HEYA 2UYYA 3GLVA 3HEAA 5CURA 2BMAA 5HUJA 1Y7LA 2DFDA 4L7QA 4LY0A 4OFWA 5JVDA 2NM0A 4BFCA 4WECA 4YJHB 1PDOA 2VTEA 4E1AA 4MKGA 1CUDA 4M1EA 4YCDA 1AGYA 1FSFA 1T8TA 2ZRLA 2SCUB 3K5WA 3EPLA 5CCXA 2JW5A 4HHEA 3THXB 3JRXA 4LHZA 2JIBA 2IGTA 3WGMA 1WB4A 3JQ9A 4DNXA 2JGNA 1DUVG 4KXWA 1KEUA 3CKMA 2NAFA 3JS5A 4NAVA 1CV2A 3AOGA 3LW7A 3P9QA 3W6UA 1L8LA 3W6ZA 1I7PA 2FSHA 2J9FB 1L5SA 5EXSA 5FOUA 1I2CA 1EVIA 5EKXA 3VC7A 5HKKD 2QJTA 3NM4A 5F3WB 3CEAA 4QGGA 2AMYA 2AS0A 2C3MA 3CV3A 3JASB 2BGMA 2QRJA 4LJ5A 3F6SA 5LWHA 2PRYA 1QYDA 4KR0A 3EF0A 1NN1A 3IP1A 3MTIA 4PFSA 1HNXB 4JI4B 5CXXA 3T9DA 4R41A 4JMPA 4N12A 3HCNA 1NNEA 3DBIA 2UYOA 5C1IA 3VPHA 2I1VB 4K7JA 7ADHA 4RULA 2APJA 3GJYA 3CX7A 1UM8A 1R6UA 1XU7A 2O2ZA 2R1TA 4OQ4A 4CMEC 4BWGA 3DOCA 3TO5A 5JQWA 5ICCA 1RJFA 1E92A 1EJ6A 2X9GA 3QWAA 4HWPA 5EJ8A 1HLGA 1I7LA 4TKZA 4EMSA 1ODSA 4HH3C 1RPTA 4LDRA 4GQIA 2WVHA 2XAAA 3PQCA 2WBLC 4D6PA 5CB6A 2Z2ZA 1ISIA 4QU8A 4DIEA 4JXXA 1R0YA 5GOTA 3C8DA 3M9LA 1T9GR 1NM5A 4NU6A 2ZBPA 2WM8A 2ECPA 4IM7A 4ZQEA 2G88A 2H9AA 3ZX5A 1QC5B 5FEUA 3MWYW 3F5DA 1NN0A 4BQFA 1CPYA 4KTVE 821PA 3V48A 1U28A 3F0TA 1IN4A 2EW1A 3RNOA 2DCMA 3J80A 3PSHA 2JASA 5CX4A 2XUGA 3AHJA 1QHSA 2B4RO 4JLBA 2H0AA 3LPNA 3NBKA 4NPHA 4R2KA 5FO1A 4G09A 3A28A 4HGYA 1RYHA 1V16A 1IZ7A 2FFQA 3GZTB 5IBPA 4C07A 4AWBA 1YBFA 4ID9A 4RGYA 1BEUB 2CT8A 1GHTA 8AT1A 2VHWA 1PV1A 2L18A 2ZTHA 1Y3IA 4ZYYA 4G86A 5CB4A 1P1HA 4X7PA 3SIWA 2A9JA 2NV2B 1KY4A 2A7QA 2B83A 3IV6A 5HZMA 1RWQA 4HAYA 3WYFA 2FSUA 3MAAC 4RK7A 4WAUA 1YU9A 2Q7DA 4RPCA 1LY1A 1RWWA 3HMQA 3INGA 3N75A 1CB7A 1YZVA 5E6UB 5E9AA 1W8IA 3SF0A 1K92A 1L9XA 1HR0B 4CVNA 2DTDA 1H22A 1Z7WA 1G8PA 2OHVA 2JC3A 2LUOA 3QMVA 2CD9A 3F3YA 3NBAA 3VNRA 4YASA 4ZJPA 1UOPA 5CYOA 3BJRA 4F6CA 1L7MA 2HD4A 3S55A 3ANMA 4JYBA 3W4KA 3LKVA 1LLQA 1U2EA 1VGQA 2A5JA 3W04A 2R7NA 1QK3A 1E4YA 2PRJA 2HTFA 3LDHA 2I7VA 2AWOA 1S6YA 3ROMA 2NACA 3PP8A 5DNWA 2PSJA 5C5CA 4OFXA 4EJSB 4LTMA 1T2AA 1LRJA 1XXLA 2TYSB 1NNI1 1U3UA 4UNSA 5FPYA 5B1EA 5KTRA 1SKAA 1E6UA 1WD7A 1CRQA 3HXPA 5GJCA 2C9ZA 4DUZB 5HIAA 2EWVA 1OAKA 3OD5A 2QT1A 4JR0A 4JFRA 4YRQA 4REQA 3L8EA 4WY8A 1X13A 2GSDA 4GDMA 2DFLA 3FYDA 4MCIA 4NMMA 1WMAA 1ULHA 1A9TA 1ZUHA 1KI1A 3M33A 3MJCA 1ZKDA 4PXSA 4BLTA 2GD1O 1U9CA 2G0TA 2N42A 3FE2A 4FUQA 3OSUA 1YU6A 1K86A 1W4BA 1XE3A 3E70C 3UGJA 3QEKA 4QT0A 1OBVA 2I6GA 3FPAA 4C5BA 1ABBA 1SOMA 1PHRA 1UXOA 1O4WA 4BVHA 3ZUPA 3PYLA 1BAPA 3W2HA 3O8RA 3ZHSA 2ZBUA 4FMPA 1IBSA 4QQFA 3FJ1A 1MU0A 2QSJA 1DZIA 5CDUA 5HJ7A 1XYVA 4NE2A 2GARA 2ZIVB 2E9SA 1Q1AA 2Y9MB 3MS7A 5JIBA 6ABPA 3M34A 3UAXA 4MP8A 2WOJA 2QPTA 3D2CA 3FG9A 3AWIA 3MFYA 1JKXA 3GJ4A 3E03A 2P9ZA 3H11A 4CG2A 4W5JA 1TNDA 1YQ9A 3RSQA 5LQRA 1HDZA 4IXNA 4X1KA 4OHXA 5TQVA 3AG6A 3M9WA 5IC5A 4BASA 4DR2B 2WUFA 1EPUA 4TLLB 1RYEA 3AZPA 1QM5A 2DPMA 2MINB 3GRYA 4V2IA 3ZPXA 4FEYA 2ICAA 1U4SA 5A3QA 2UUCB 2H5IA 4PYMA 3DVSX 4TN1A 4YT5A 3F2VA 3JQAD 3B82A 3C2QA 2FPXA 3SX4A 3U4DA 1OXKB 4BAUA 3RS4A 2XA1A 2I3BA 5B2FA 5BVGA 4JQSA 1E5VA 5B36A 4CI0B 1D2EA 1MEJA 2F48A 1C0PA 3P4YA 3QK7A 4JC4A 1NMQA 3BXHA 4RW0A 5HG0A 1E1KA 1K7SN 4EX7A 2CV1A 3G59A 1SO8A 1VCOA 1FVFA 3G6KA 4ZODA 3SC6A 2JD0A 4LZAA 4RXUA 3TSWA 3VR5D 4K6MA 4C7JA 3HXKA 3WYNA 4MW7A 1XCBA 3D4BA 1Y3BE 5GVRA 4DUPA 4FD3A 4DA0A 1BXGB 1OBFO 1Z39A 2GAOA 7YASA 4L5BA 2XB9A 5KINB 1DAHA 4ARVA 4P31A 4L8VA 1EB9A 2IXDA 2YZGA 2VDRB 1KZ9A 4WZBA 1JL3A 2ODBA 2X9LA 5ARDA 2GHRA 4LPSA 1SXJD 2NXEA 5DP2A 2Q3LA 1USVA 5H70A 5FTWA 1J97A 2ZPUA 2AN1A 3IT2A 2C7VA 3V4ZA 4E31A 1ULAA 2VT3A 2Z6VA 1JAZA 1YRQA 1AA6A 1RXWA 1VSVA 1JE0A 3H8VA 4KGVA 4L50A 1PK7A 3OJ0A 5EJAA 3WWPA 5LLDA 4R9RA 1J8YF 1XWIA 1TVKA 2HU5A 4Z0TA 1PKEA 2LRHA 4MW5A 1UPBA 1XYYA 2F3PA 3N2YA 5FI5A 4XWOA 1TOAA 2XUIA 3WAJA 4GLOA 1LA2A 3NDJA 3B1VA 1XVUA 4N49A 2O0JA 5DHSA 5B6JA 5ABPA 3VPDA 2J85A 2XYGA 2PZJA 2XYVA 4MVJI 1BRMA 1TIPA 1IQPA 1JFVA 1PVVA 2BGWA 1U2PA 1FBTA 2X5OA 2WYIA 1L7XA