4RA9B

Crystal structure of conjoint pyrococcus furiosus l-asparaginase with citrate
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
128
structure length
128
Chain Sequence
HMAVLVIKLIPGLSGDIFRAAVELGYRGIVIEGYGAGGIPYRGSDLLQTIEELSKEIPIVMTTQAMYDGVDLTRYKVGRLALRAGVIPAGDMTKEATVTKLMWILGHTNNVEEIKVLMRKNLVGELRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords L-asparaginase
publication title Structural and functional insights into an archaeal L-asparaginase obtained through the linker-less assembly of constituent domains
doi rcsb
source organism Pyrococcus furiosus dsm 3638
total genus 43
structure length 128
sequence length 128
ec nomenclature ec 3.5.1.1: Asparaginase.
pdb deposition date 2014-09-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.40 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ra9B00
5DNDA 1HG1A 4PGAA 5K45A 1JAZA 4ECAA 5DNEA 1DJOA 3PGA1 1O7JA 5DNCA 2D6FA 3NTXA 4NJEB 1JSLA 1WLSA 2P2DA 1JSRA 2WLTA 2WT4A 1JJAA 4R8LA 4R8KA 5CBPB 5I3ZA 5I4BA 5K4GA 5K4HA 3ECAA 1HG0A 1IHDA 2HIMA 2JK0A 1WSAA 4RA6B 1AGXA 1WNFA 1DJPA 2GVNA 5K3OA 5HW0A 4RA9B 4Q0MA 5I48A 2HLNA 2P2NA 1ZCFA 3NXKA 1HO3A 1HFJA 1HFWA 1ZQ1A 1HFKA 5F52A 1NNSA 2OCDA
chains in the Genus database with same CATH superfamily
1E3SA 1A9TA 1SUFA 1XWIA 3G0GA 5KNCA 2EGGA 4RCYA 1UEXC 1V47A 4CDGA 4EX7A 4IW3B 5EJ4A 3BEDA 3W7VA 3ZHUA 1US8B 4LKOA 5A03A 3QEAZ 1D4ZA 1MC8A 4AT1A 1GAWA 2V7QD 2I4LA 3UHAA 1B6SA 3VR4D 3R1IA 2QZPA 3QEJA 8ADHA 1E1KA 4TX1A 3EXEA 4DUGA 2NUTA 1Z4NA 4BQPA 1A9RA 1YCHA 1XUOA 5TT1A 1SXPA 2OV8A 3URMA 521PA 4C2TA 2WIDA 4GBMA 3IVMA 1YZNA 2KHZA 4MGYR 2J41A 4F3KA 2IODA 1T5IA 2ZUCA 4DC9A 4Y6RA 2MWMA 1Y9JA 1Q74A 1GOTA 5ARCA 1LFDB 5TMBA 4BN0A 4DBZA 4EHBA 4DJJA 1O5IA 1Y8RB 3AHFA 3RIYA 4HRAA 4I4TA 2XADA 3GGCA 3UQZA 3I30X 3UN1A 3WNVA 4CYMA 1E62A 3GWZA 3K5HA 4OXNA 3U0BA 4JT2A 4XM1A 3UGTA 3HKEA 1T6NA 2VUIB 3DDNA 5BSRA 2EP5A 3FCUB 2QYSA 4X93A 4XUDA 5CX1B 5ITSA 3ESZA 2HAEA 2FSIA 2D62A 3WQQA 3FUCA 3QV1A 4FNMA 1WO8A 3CLVA 3L43A 4YV1A 5KWEA 3AJRA 4GYKA 1G21B 4K5QA 3LSYA 2GBIA 5LXTB 3I23A 1YZGA 2QVZX 3CXUA 2RK4A 3B7GA 3KUUA 3ME5A 4PAGA 1DELA 3IV7A 4Q24A 3T95A 3V2IA 1D5WA 3TW8A 3VVCA 5JMTA 1LVUA 1F51E 3F6BX 2ZJ4A 4GZ3A 1HDCA 4TV9A 3TLGA 5IK2A 1JLKA 2WBLC 4QG3A 2WJAA 3GGGA 3WVNA 5HP4A 1JQ5A 1Z0UA 3I04A 3GFFA 3I6BA 3ZN2A 2VNKA 1U1CA 3RRZA 3WLLA 1P39A 1IN8A 3B2EA 4K9NA 1BIFA 2QT0A 3JALA 3T5AA 3CVJA 1SBQA 3CLHA 3NR2A 1DIOB 1QQ5A 5EWLA 4PNPA 1PG5A 4QULA 5DP1A 5EHIA 1RXIA 2JBHA 3RVDA 4K2HA 1ZM7A 4PQRA 4N12A 2J0QA 1J22A 1W1WA 1EDBA 1W88B 1CULC 2GZRA 4JGGA 1KAGA 1YZQA 2QHXA 4A8JA 3L01A 2M98A 4R2MA 2ZT7A 1E1QD 1I1NA 1XROA 4YRMA 1Y3DE 3CNHA 3KEMA 4RBNA 1Z39A 4QL3A 2AMVA 3C98A 1UKZA 2HF8A 2PAAA 2GNOA 3B1VA 3AR9A 3D3EA 3DC2A 4LQ4A 4M98A 5JHHB 1F8YA 3CU5A 3AH8A 3OCZA 3QVUA 4U8GA 2CN1A 2CMGA 4I9HA 4MROA 2B6HA 1QK4A 3H7IA 4OYRA 3DBRA 1IATA 1A5ZA 3RS7A 4UU0A 3WRXC 4D4LA 3EIFA 4MRMA 1Z34A 1C9EA 4XUEA 2D8MA 5C3UA 3PXDA 1LDEA 4J4TA 3AIIA 2Q21A 2V5VA 4PGHA 5E6SA 2AOUA 3QX7A 3VDQA 3TQHA 1FJ2A 4D0LB 2QUJA 2MSDB 3Q8LA 1SRQA 2XQFA 3ZWPA 4BNDA 4CMGA 4GPZA 4RK5A 4D26A 3LUFA 2CDAA 2F4VB 2E4VA 2ZRFA 3FGZA 1EFPA 4K9OA 5DYYA 1TVMA 1XZFA 3DLAA 1GILA 1ISRA 4P34A 5KTRA 1F17A 4FFSA 2VK1A 1PFYA 1Z16A 2D0DA 8LDHA 1G60A 1ZNXA 2V4MA 1E2GA 2ZYIA 3DBIA 3IPXA 1KU6A 3NANA 1BD3A 4HS9A 3PYMA 1P80A 1WCIB 4P4SA 4XTCS 4YRNA 3IMGA 1AH2A 3IULA 4KFSA 1T8YA 1O4VA 3RVOA 2C2KA 4BBPA 3JZMA 2JAXA 4AY5A 3MINB 2QRKA 3W8RA 5A2QA 1VZ3A 1Z08A 4V0MA 3CUVA 3HVKA 1XB2A 2J3LA 5KBYA 2Z09A 3FKQA 4BC0A 1GGEA 4BVHA 1YBMA 2XZPA 3D6UA 3N53A 1JVNA 1JHMA 4M36A 3N8IA 1RRPA 4PRKA 2J0UB 4IXDA 4ZRNA 3EJWA 1YBVA 1PFQA 3BSSA 3Q3IA 1JR3D 1T29A 5M7EA 4AS3A 1Z6XA 3H8VA 4H6VA 1E2QA 1QZUA 1T6YA 2QRLA 1TT5B 1ZN2A 5JXGA 3FWHA 1PLLA 1DAIA 1BQ3A 2JK0A 4KGXA 4BAUA 4KNYA 1DBPA 3THXA 5JNWA 3KJQA 3TTVA 1IDN1 4WV3A 3E03A 4DT1A 1JJBA 4M0MA 1Y6RA 1XQ6A 1N2SA 4RM2A 2R1UA 3EVCA 4CMIA 3KOWA 1XEAA 3B3QA 3QLJA 5HBRA 3GYGA 3I72A 3LC2O 1GGJA 4LYFA 3UTCA 1X1AA 4X66B 1QVZA 2GPWA 5E3HA 3R0QA 4D97A 1P8JA 1C3VA 2RC5A 4R1NA 5EJIA 1U2ZA 4XDGA 4DC1A 1E2MA 3L1UA 4UUQA 4F6LA 3K5IA 1JLLA 3CF2A 4OI4A 5CAEB 1CDDA 4AY4A 5JMPA 3K9GA 4XSHA 2ZJFA 3A36A 1M34E 1J99A 1VJ0A 4LX8A 1E5TA 2JCXA 2RGBA 3D0RA 1Q3KA 1BE6A 4GLFA 4W8GA 3O8OB 2K6GA 2I03A 4Y1EA 1Q2XA 4HNGA 4CF7A 3GCZA 4LC9A 4EFMA 5IJWA 2E0IA 2P40A 5F2NA 5AJWA 3BBLA 5KI6A 4YCLA 5E8RA 3WB9A 1RIFA 3W78A 1WB9A 2C98A 2LGJA 1FS5A 4MINA 1ZD4A 3J81k 3SVLA 2M32A 1TM4E 2H31A 1BXKA 2GS9A 3M2TA 2VKTA 4KC0A 1KR5A 3QE3A 5KTPA 3MAAC 2Q5LA 1LC0A 2DTXA 4BDSA 1GAEO 3PCXA 5CFRA 2VNAA 2ZTVA 3DEKA 5T3UA 1PIWA 1Z25A 4EVSA 1GNPA 3CISA 1JVSA 2IDZA 3U44B 4JLJA 2XKKA 1EP1B 1W19A 2GLTA 4MIKA 4A10A 3TBFA 4I4LA 3VPXA 4ZKEA 1T2VA 3SC4A 4NBWA 1A69A 2JASA 1JDTA 4TS3A 4ARVA 5JWOA 1S89A 2WYUA 4CL8A 2DUUA 1CFZA 1BS1A 2W6ID 2C7RA 2VJPA 1XLTA 1QV6A 1EP3B 4F12A 2AC7A 1ZRSA 4FGUA 1E5DA 2VRBA 3PEEA 4FLMA 2VWPA 4M3NA 2BDEA 2QL6A 4ECAA 1XZLA 1KZ7B 1NQXA 3RLFA 1G0NA 1IM5A 3U6KA 2OHVA 1SXJA 1W73A 2VBFA 5AVOA 3R3UA 1CZKA 3TLCA 2Y67A 2VN8A 5HX7A 5JI2E 1ADBA 1Q17A 2FP4B 3TVYA 4PZUA 1NQUA 2BGMA 2CL0X 5JBIA 4IZIA 4MKRA 2NAFA 1TA0A 1TCAA 5L3VA 2FZLA 2IXTA 3PNYA 5TF4A 3BMQA 4ER7A 3UG7A 1FXUA 1YA8A 2PXXA 2R6AA 2WIBA 3B51X 3GFRA 4RFSB 1WETA 5FWXA 2R8XA 4DR4B 2V4UA 3Q6NA 4AIRA 1ULHA 2WKPA 2E1RA 4A15A 3O2NA 1PDWA 1BOFA 2QUIA 3OEED 5FJIA 5EL0A 3GP3A 5K05A 1D6JA 2Q3LA 1GYPA 2PNFA 4LDQA 3JWPA 4BGDA 1VSVA 1K4KA 5C52B 3HG7A 2CDBA 1P6UA 2AMJA 2J9FB 2PAFA 3PVCA 5EZYB 1CE8B 4Q9AA 2OHFA 4D0SA 1JH8A 2E5FA 2PJUA 1Y1LA 3BHJA 4QDKA 1IIRA 1Z5GA 1AF7A 1TDJA 4F46A 1MT3A 5CVEA 3TAUA 3VDNB 2Y05A 3OUTA 3IMKA 1LVGA 4A7PA 4R40A 1XNRB 5I8PA 3P0RA 3X1JA 1ZOOA 1FSGA 3QA9A 3A25A 4PHCA 3QWIA 1JEYB 1DPFA 3MC1A 1HI9A 2PX5A 3KKLA 3W04A 3E70C 2QM7A 2QZJA 4UATA 5CLGA 1NVUQ 1K2WA 5LBIA 1E9RA 1DAFA 4K1XA 1FP4A 1N8TA 3GJZA 2AXNA 3TFWA 1JSLA 4RELA 1RXSA 3BAZA 2WIGA 3E9EA 5CA1F 5D3MB 2X19A 4Q6BA 4C6HA 1N2ZA 3KVOA 1FFWA 4FS3A 1RJEA 3SHFA 3TMYA 4F5EA 2XXAB 1H6DA 2A2ZA 1IJKA 3FJOA 3I04M 3ENQA 1JSCA 4EFLA 4F06A 1RFLA 3LFTA 1E1CB 2BMVA 3P9QA 1DE0A 5J1TB 2KB0A 3ZGZA 3TIVA 1XK7A 2X8WA 2QRVA 2PSDA 4Z2YA 4IVPA 5K5EA 3O4VA 3EODA 3PDCA 4NESA 1FYVA 4KCGA 1BXGA 4XLTA 4EGJA 2WV7A 1D8AA 4G0ZA 4W7SA 1W2GA 3LBIA 1UINA 3K1JA 5G2OA 2PZJA 4YXWA 1Q1QA 3OOEA 2JCVA 1IQRA 2WIJA 4G1MB 4N3BA 4HNAA 3KG2A 1B2RA 1WPRA 4M1WA 3OEHA 4JIMA 3T34A 2E48A 1L5OA 5HUHA 1QO0D 4Y9DA 4RL6A 3B12A 1SCUB 2YY7A 2ZI6A 3GLTA 4RO0A 1QAMA 2BI8A 2Y68A 1IB0A 4QGBA 1UT5A 3AEKA 2NTEA 2PZEA 5LKAA 3LSTA 3AKZA 3SQDA 2AZDA 3O74A 4G0YA 2G36A 4YRZA 2ODNA 2PS1A 5IBCA 3LX6A 1TTTA 1X7YA 1S3SA 4QTUB 1QG6A 3UCEA 3G9ZA 4ATNA 2OUIA 3EC7A 3CVVA 3T7TA 1FP2A 1SZJG 1XLTC 1QE3A 4LRSB 2V65A 3BJIC 4D8XA 2ZIEA 4DMGA 1E79D 1CS0B 2QTBA 1U0EA 1SGWA 4FPXA 4Q9HA 4A6DA 3FOBA 4W5TA 5L53A 4PN7A 3ZWMA 3M6LA 5AUPB 1UFRA 2EHDA 2ANBA 1IHUA 4XTRA 3UHPA 4EAQA 3U61B 3LCUA 1X9GA 5BWLA 3AVYA 3JXEA 3DE3X 5CH5A 2QNBA 2NACA 1AURA 2ORYA 3FD8A 1IBLB 1DJPA 1CDEA 4Y7DA 5B53A 1HT1E 4MW6A 2X8BA 3GVXA 1S8AA 2DX7A 4C29A 2BMDA 5JYDA 1FK8A 9ATCA 1CD5A 2PN1A 1BEUB 2A0WA 2Y77A 4JYAB 2FMIA 4XLZA 1BVHA 4NNPA 4MSUA 3LWDA 3TJRA 1PJSA 1OH5A 2DFVA 4O33A 4MUGA 3ZE6A 2BEVA 5IT9A 3CLUD 3E58A 4EGSA 2GRUA 1A76A 3HS3A 1MEJA 2A1UB 1XXHA 4IHJF 4IRMA 4LUCA 4ZOBA 1FJXA 3L9XA 3RLIA 3KPUA 4X45A 4ZYLA 4CKWA 5DOZA 3CVUA 1DKMA 1DC3A 1GGNA 3DMTC 4HCJA 3WGTA 3LG2A 2X7HA 2FRVA 5KINB 4BGUA 3I34X 3F5SA 4RIEA 2G1AA 1DJMA 2IYEA 3DTVB 1WD7A 1OLXA 4P6VF 4MAAA 4LGVA 4A8HA 4DBLC 1R6TA 7ADHA 2J3EA 2HRQA 4JK3A 3NDJA 1TYAE 2RHDA 1UM8A 2I7XA 2ZCUA 3I5UA 3DFIA 2ZIGA 1GTG1 4FNGA 4LBWA 4D9BA 2VJMA 4UE3S 3DFFA 3JD4A 2V7PA 4AMGA 1HOTA 5AW3A 3NHMA 4B46A 1AS2A 5KTSA 3VKHA 4J7UA 2WM3A 2R7LA 4G5SA 5CCDA 1VPLA 1NVFA 3WC4A 2OV2A 4I55A 1E3TA 4HPXB 1QTRA 1ZZEA 5LZ2A 2WWWA 2R65A 4CFYA 4Q19A 4FQ5A 9GPBA 2IH2A 1SMKA 1M0SA 1VP9A 1GAQA 2ZVDA 1FTYA 1O8CA 1SOWA 2V54A 3DCJA 4XSGA 3T38A 1O0CA 3JZFA 4N0MA 2ZIAA 4OBEA 2NO0A 2B5OA 5J2UA 3DV2A 3PEUA 5LPNA 2MYUA 1RYZA 1ZJZA 2AQHA 4WW0A 5EUQB 3WFIA 3ASYA 1ZQ1A 3EEBA 4MVJD 5EIEA 3CYFA 2NYAA 5CT4A 2LBPA 3WWYA 3A9UA 3JQGA 1CLUA 1W93A 2K7ZA 4KXQA 3IV9A 1GA1A 1ZPDA 3A05A 2RGDA 4WDRA 3ANSA 3NM5A 2OXIA 1JKFA 4IZ6A 4KPUA 1BOOA 4X1KA 1R12A 2VATA 3N58A 5BMOA 1R16A 1EXWA 1LPMA 4OPMA 3S28A 2R1VA 2WA1A 1J8FA 2BM9A 2NV2B 4CLOB 5JY1A 3E2PA 4KGZA 3KELA 4ZOQI 3K9NA 2CJFA 1G2IA 1TMOA 2J67A 2AG6A 4CL2A 3ENNA 1V7QA 3DPIA 5BYKA 5C8VA 3PQDA 1H2WA 1NM5A 3EW7A 2VCYA 4X1IA 3TK1A 2DHRA 2VPZA 2OXTA 4ZXFA 4OG2A 1ZCJA 3ESBA 5D7BA 2OK8A 2CFTA 1GGKA 1NIJA 1Q91A 3JARA 3QVWA 4IILA 3NHUA 2Q8QA 3OT1B 4KFRA 4RANA 5JCJD 2WTUA 3RAJA 3SAJA 1IBRA 5FWDA 2Y1WA 4DMLA 2GZHA 4M54A 1NULA 4QXQA 1WNTA 4PAOA 3W9YA 5FXMA 3RTCA 3D6MA 1BDMA 4J9VA 4OFXA 4ZT4A 1QIJA 1SBIA 2ICAA 4F72A 5KOHB 4U5QA 3VKFA 2G9ZA 3IX7A 1SEVA 3NXKA 1JDNA 3PQCA 4WTOA 1G3UA 3QTTA 4LZOA 2BAGA 1D6NA 5FEMA 3P5BA 4HATA 1M0EA 2C9OA 1SQ5A 2H63A 2H5LA 3AR6A 4TMWA 4L4ZA 1N3LA 2PNJA 3S2GA 2YCLA 1ODSA 4ZT2A 3Q0TA 1V5EA 2BR3A 2PD4A 3ETJA 4DV4B 1E1NA 2W6PA 2Z1DA 2GWHA 3KKPA 2O8BA 3VH2A 1YZLA 2C2GA 4Q7QA 4JJIA 1G63A 1XG5A 1UIMA 4XB6B 4YI5A 4EHFA 1Q84A 1F0YA 3K70C 5JISA 2O3UA 3GFSA 2MIIA 4RIHA 5EYPB 1Z45A 4FD3A 3LKDA 1BMDA 4MJ3A 5HRAA 5CA0F 2R1TA 2VUHB 4QPCA 2PO7A 4H1WA 3K9FC 3P9PA 1J9GA 4GBJA 4MVYA 4EMSA 1NKVA 1XRNA 2F90A 3T7KA 3VX4A 3AHIA 5MFZA 1G38A 2ZVPX 4KXXA 2EX0A 1P1IA 2GLXA 2P2NA 2R48A 2BF7A 2VPXA 3KOUA 4RZSA 5AKHA 1CVRA 5H68A 1P1RA 2R9VA 5LDDC 3ZWCA 2CVOA 3JSXA 2I4TA 5LXTF 5KYNA 2BM1A 3RVKA 5B1DA 1W49A 1WCYA 5KDLA 3QNUA 4DREA 1PT5A 3QK7A 3PD1A 3RSGA 3OTWA 3SR4A 4ZWNA 4WLNA 2BZSA 3CW8X 4E12A 2MMCA 4QGGA 2O8CA 1UBLS 4EHLA 1Y82A 3SSOA 5ULLA 1V9CA 5JDIA 3DYBA 3O94A 4B2YA 1YR6A 2V98A 1L5WA 1FX1A 3WQHA 1EK1A 1QIDA 1YB2A 1KSFX 2G1JA 2J7KA 2IYPA 3QJ5A 4IXWA 1M7GA 1RCTE 4IXNA 2NUTB 4PAWA 2D1TA 3T12A 4EY5A 5JXWA 4QGSA 5IDXA 3QVMA 2LE0A 1TJ3A 1P9LA 4HBGA 3ZVNA 1GV0A 1AT1A 4GICA 1Z28A 1K98A 3G85A 2D2XA 4GSKA 1WDKA 3O8CA 2Z2YA 3KZVA 1WZIA 3R3WA 5IM5A 2Q1WA 4GXRA 1BZYA 1PRYA 4QXOA 4RTLA 5A62A 3PFGA 3HYRA 3EUEA 2ZM5A 4NZMA 4PX5A 4PSUA 4WEOA 4I4TB 2CVQA 4N03A 1TM3E 3SQLA 4OGFA 3EQ8A 1DSSG 3LW7A 1HZZC 1KDYA 4EF6A 1SD1A 2HYIC 5DTIA 3HSYA 2B8TA 1AO3A 1IUPA 3HKEB 4JHLA 4NNJA 1B14A 4U5XA 2WWRA 5KMGA 4IVQA 3P71T 3ND8A 1I1OA 1CHNA 1JXOA 2AJ8A 1YMUA 4CMKA 2VYVD 3NTOA 2Z6QA 4JT4A 2YX1A 4I1UA 4KPGA 4N8DA 3ZQUA 2ZIUB 2VRWA 3AP2A 3W05A 5J58A 3FJYA 4K6FA 2JZOA 2XTAA 3A6LA 1NM5C 4TZ0A 2B7CA 2J3MA 1PX0A 2WAXA 3N6XA 1NVKA 3FR7A 4KO2S 1LU9A 1CQJA 1MTZA 1PZXA 4TQAA 1GGVA 3GNSA 2HTFA 4LGCA 2D5IA 3E9DA 4EEKA 1DV1A 4GP7A 1QZ3A 5HKKD 2JJ2A 1L7EA 3C14C 3B6KA 3E53A 2FJ0A 3VVBA 3G6KA 1YS7A 2C59A 3O90A 1O9BA 4ARZA 5CB8A 2CB0A 3QHQA 3MMZA 2XNSA 5HF9A 4TLCA 3ZHYA 3ZJYA 5K6AA 1PHPA 2QPOA 1OGIA 3LXRA 4XJVA 4B74A 2XWBF 1XLVA 3SSAA 1QBGA 4A8JB 1T1JA 4ZGBA 5AOBA 5IN5A 3WLQA 1T1IA 3HBLA 1KQGA 2Y66A 2QRPA 5BP7A 1S2DA 3KR9A 3QE9Y 3UB4A 4RTNA 2G9RA 2GPNA 1XA3A 3NBXX 1P60A 2LVBA 3O2SB 4B0PA 3TUZC 1NF3A 4UBOA 3ZX5A 5JLJA 1HYBA 3H9EO 4MUJA 4NWIA 1EGHA 2GESA 3OH8A 3C3XA 5A6SA 3H19A 4M0CA 4X20A 2VH2A 3KHSA 1DS6A 2IW1A 4EJFA 4W9NC 2VQEB 3LWBA 3STVA 3O1HB 4MVJG 3OY7A 1KGSA 2XT6A 4N3GA 2YC2C 4B2IA 1T0JB 4J1SA 5GM1A 1E3LA 2F3QA 3ER6A 4CQMA 2Z6UA 1T6BY 4FB4A 1ISHA 3NNNA 4OQYA 3EQ9A 4KQ6A 2JI9A 4Q6WA 3SHTA 5E6SB 1MAHA 1MO2A 4FR0A 4P54A 2VL7A 4DKXA 2AOUB 2Y1LA 3GEEA 4K46A 4ZIRB 4M9CA 3GCWA 4WLEA 3EDOA 1CNFA 1I2DA 1PYDA 2D7CA 4BNDB 4ISBA 2A5YB 3HYCA 5LZ5A 1UJMA 3HP1A 4L73A 1ESDA 1N6LA 5I7WA 4XUCA 5C53B 4BWYA 1ODLA 1TJPB 3ILSA 3DE7X 1B6TA 4LE2A 3FRJA 5E38A 4E15A 3GA7A 5FPKA 2TMKA 3D4IA 4AXBA 4RE6A 1ZVMA 5IAOA 1GM5A 1NUSA 1EGQA 3BL8A 3EVAA 4HZUB 4P4SB 1OAAA 4BGIA 5JDIC 3TXAA 4EO9A 3B36A 3LGSA 4DCUA 5DRTA 3QE4A 1B2LA 3D8TA 4JQZA 1UBHS 3GGOA 5DGXA 1PKXA 3TG8A 3C5HA 4AJNA 5C4MA 1XAIA 3ORSA 2IVZA 5CTJA 5L40A 2OHHA 4JJ4A 5F9HA 2G5CA 2JVJA 4RD2A 2JKVA 2O6LA 2PUWA 3VAAA 3SXUA 1P2GA 4UCWA 1YDWA 2XZTA 3IBYA 1GKLA 4IFIA 3I53A 5B7GA 4OP1A 4TMFA 1QIKA 1R8SA 1J2YA 3PIDA 4IINA 3Q7PA 1AQUA 2FPPB 3JQEA 3D02A 3PD0A 4PZDA 3T7AA 4KU4A 3BGIA 3FLBA 5BO5A 4D43A 1MHTA 1BMFD 1YJCA 4PO3X 2BKUA 4QGFA 3DCYA 3LO8A 1B0PA 5J5VA 1DRJA 3AR4A 2ALJA 1D2AA 1EWYA 3PV0A 3ZGXA 3KJFA 5BN5A 2O4UX 3THXB 4URXR 4DDMA 5TS2A 5CYGA 4MV7A 1L8LA 3OJXA 5ALNA 2WJWA 1QGYA 2OCLA 4UJ5A 2IZ0A 1TZJA 2AN1A 1Q2UA 3MLEA 4B85A 2ZCJA 3L6UA 5JHGB 1I3CA 5J4LA 1GNVA 5KS2A 2GKSA 3T3IA 4YI3A 4R9NA 1T9CA 2ZI3A 4BZZA 3RK4A 3LYUA 2P0AA 5DLYA 4G25A 4JUAA 1AN9A 1IZ9A 4GI3A 2HXYA 2P9EA 4WKBA 3KVVA 3F46A 1HETA 2OTCA 3MQ4A 4IYJA 4OBWA 4FJ1A 1JLLB 2BKEA 1ZM4A 1KY2A 5IZCA 4I3FA 2JHCA 4DDHA 1Z17A 2XITA 4JB3A 5EAIA 1FCJA 1LFAA 4NS4A 3S4YA 4GM1A 3B2QA 1KFCB 4PEVA 3NPMA 3L18A 2GRJA 2ZSKA 1SZCA 1VYUA 1PFVA 2OV6A 3DO8A 4JVOA 3PWSA 5K6AC 1U8EA 1EKXA 1VCMA 2Z4SA 3A26A 2Z2JA 4KNVA 4M1ZA 3BM5A 4FFBB 4IDDA 3CZAA 2GH1A 4PTYA 1K1EA 3S2EA 4AWAA 2C8JA 2PUAA 3BXHA 4RKWA 1R0ZA 1G5HA 1XELA 2IXGA 3LAWA 3MLAA 1JL3A 3PITA 2PGDA 4P83A 3VC3A 3QY9A 4C3UA 2CXOA 5JQWA 3OIFA 4IDNA 5KREA 3B1KA 5LP1A 1E7YA 4GO1A 1IM8A 3ZR4B 4BWVA 5KC9A 3OT5A 1P4SA 5HGJA 2IV7A 1RPZA 3QW4B 3UV3A 3UWPA 3CTPA 3QU4A 2H9YA 2NT4A 3LVBA 1T6ZA 3A4VA 3CT4A 4RH0A 5KYXA 4ACAA 1A1VA 4D98A 4LF9B 2FSPA 2HFKA 2W6IA 3DM9B 4TRJA 4XFDA 5FTKA 2FFBA 3MGAA 1TUBA 1FDVA 3HWSA 2QAGB 1YR9A 3K5PA 3OZBA 4NAHA 2OYCA 1MZPA 4JP1A 5TDHA 2ATIA 3NJRA 3IRVA 1EEHA 4LRTB 5KJ1A 2GKOA 1EBBA 3I12A 1NURA 4GR5A 1GL6A 4CODB 5IXJA 3NOVA 4D8VA 5KU7A 3TZBA 4EJSB 1LSSA 4DSNA 1PBNA 3FJ1A 2FSUA 4K6HA 3ILHA 3WL4A 2RHHA 4XPIA 2HPZA 4RM3A 1BN7A 2HBRA 1QRUA 2QD2A 4BMOB 4YTEA 1U3WA 1SXJB 1OX4B 1RRMA 3C1AA 3PPVA 1AQNA 3R0IA 2C5LA 4S05A 1KJ8A 4X9XA 3KQHA 2YJ5A 3EDRA 3O8QB 2QRHA 1IAVA 3ZI4A 1D9XA 1YQWA 4CDMA 4B17A 1JR4A 3JVDA 4YYZA 4KLNA 1PNRA 4PXAA 3SY8A 3T7SA 3UOGA 1AGRA 4MW7A 4R01A 4EJ0A 1RM3A 3DJFA 1TVEA 4QKQA 4ZICA 2PBFA 3L0BA 2OG1A 4OP3A 2IEZA 1NW6A 3PFBA 4BB9A 2BGKA 2B8WA 1ZVQA 2G5TA 2PPLA 4TRRA 1GKUB 4PX2A 2PQ0A 2XD4A 1KH2A 2ZULA 3CBQA 1H3EA 1Y7PA 1FDIA 2PRZA 2J9ZB 3NDRA 3FTQA 1JFFB 4HSGA 4LV8B 4KMRA 5E0KB 4ESOA 4CM8B 3FFAA 2QTCA 1OXTA 1RP1A 4MO9A 2LIPA 5C1BA 1FU8A 3R5XA 4HGOA 5LA6B 3HSSA 3AF5A 5CIQA 1PR4A 2I91A 3FCEA 1NOKA 1R9MA 3C5EA 4KGDA 1X8XA 4NQZA 2CLSA 2RKBA 4FYVA 2XUFA 4NFHA 3MYRA 1KY5A 3C1OA 1QCDA 4J9UE 4EITA 4LHYA 1L9XA 5JS2A 3UJCA 5G02A 4TSFA 3ZJ5A 5JH7B 3H1FA 1SY7A 2Q4EA 4WA7A 1FL9A 2WIFA 4CMAA 1X1TA 2YVKA 3GRCA 3TSOA 4NSNA 3ZIDA 4C2UA 1G20E 3IRUA 4KR2A 5FNVF 2C31A 1L8OA 1V45E 4EECA 1SEPA 5TPZD 2XWQA 2Y92A 5CYFA 5DCWA 4MI1A 2J0VA 4DLYA 2QE7A 1QOPB 2I65A 4H7JA 1YC2A 1KSHA 1C30A 2D5BA 1FP4B 4G85A 2J31A 3TAXA 1UIRA 4C43A 2RK3A 4IXMA 1I0ZA 2MYTA 5AW9A 2XUZA 3TX6A 1DI0A 1ZHHA 1AKRA 2EQAA 1BYUA 1ZIDA 2ZB8A 4B33A 1JXMA 5IZCC 2W43A 1V8OA 4K9PA 5B2EA 3I01A 2Q5IA 2ZAGA 4RK4A 3DKKA 4J94A 1JG7A 3MWLA 1YVPA 1T2CA 3CNOA 4FYKA 4R7ZA 4D57A 2V96A 1BXGB 5K09A 2BFDA 4HAYA 2J4DA 1XZ8A 3V55A 2YWBA 2FH5B 2FW1A 3MUOA 3R23A 4G0WA 3GP8A 4EENA 4YP1A 4C2AA 4L2IA 2EEZA 5AO9A 2WWHA 3NAMA 1LRLA 4HNAB 4MUEA 5FFMA 5TR9A 2HU5A 3A11A 1W4BA 4L8WB 5T6BA 3UB2A 1EESA 3Q12A 3LC7O 3EF0A 1PEDA 2D0OB 2ZCVA 3IPRA 2ENWA 3PKZA 4ZREA 3TQIA 5BW4A 3DZDA 4LY0A 2BMAA 2WMYA 2WZCA 2ZRLA 3H1EA 7MHTA 1U2TA 1IAQA 3AEKB 3H2YA 3K16A 3ND7A 3OZCA 4B9AA 2QN2A 3V6MA 4B47A 4F9EA 1NRWA 2YZNA 4QNMA 4X8MA 4RV4A 3S2YA 1OASA 1F4LA 1Z63A 3VHLB 1JH9A 2O8FA 4J0QA 4E1BA 1X7YB 1HZJA 1V4VA 4RABA 2GFQA 5GAJA 5LB4A 1G6OA 2C5BA 3CS3A 4L95C 4BAGA 5TXGA 1WVIA 2GLUA 4PXSA 3L7KA 4MS3A 3K7EA 1LWOA 5A5GA 5TQJA 3WWDA 4JCOA 4LZLA 4ZXPA 4RVNA 5ICCA 1JQJC 3NBFA 1AS3A 4JEIA 4R69A 4CLXA 2OYSA 2Z1MA 2XMDA 4ZAZA 4DILA 3PVSA 5U9CA 3ZQ6A 7YASA 2QN3A 4JJ6A 4E11A 5IM4A 2ZWVA 4JLPA 3H42B 1OE0A 2F1KA 3WV5A 2LW7A 3SVZA 2Y99A 1PVVA 3GMIA 2W2OA 4BQRA 2JFVA 2PCLA 4WBNA 4EKDA 5J4KA 2PQ6A 3E3OA 1NRJB 2IP1A 4GOXA 2WFZA 2I6GA 4MA0A 3OQHA 1AXRA 1EU1A 5FOXA 4JL6A 1H66A 3DVLA 3LKZA 5IHXA 1ID1A 1KERA 3AESB 3COYA 1X2EA 3EOZA 1OGYA 5JSQA 2ZFUA 3REFA 3V34A 4M1EA 1XXHB 5CVJA 2ONCA 3L92A 1B8PA 2OCXA 2QP9X 4K81B 4MS4A 4CKWB 3BTOA 2P9TA 4QSMA 1EDDA 2GXAA 1C8BA 1R5OA 2HIMA 1I4LD 1LBTA 1WSAA 2PVPA 2RFLA 4J4BA 4O5OA 1PR9A 1M66A 2JAHA 2KJQA 4EVRA 1IXSB 4FGKA 4PZ0A 3C3EA 3TLMA 1OLXB 1SCJA 1W7AA 4NV3A 4US1R 1RKXA 4OF4A 4AL4A 1FDRA 1QJCA 5FHRA 5FUMA 3PI7A 1BU5A 1TVKA 4M37A 2BGRA 1MJNA 1G8SA 1TPZA 2A5JA 1URPA 2F8MA 5IAEA 4BBZA 1K5GA 1ODTC 1Q7RA 2HC9A 2RHRA 1EIWA 1LDYA 1C4OA 1WOMA 4LJ7A 1YDFA 1S3GA 2SCUA 3LFHA 3SX2A 3WYBA 1U3GA 5IAKA 4B32A 1YOBA 1QDLB 1Z4IA 5K6TA 1ZD1A 2FG6C 4KIJA 1TA9A 4MHSA 1GNQA 1SUDA 2HMTA 4I55B 4DPMA 4KI0A 4RY2A 4ZT7A 2E4XA 3DL0A 2GVZC 3OURA 5EE1A 2C1ZA 3QMMA 2ZB2A 1DT3A 1GSIA 5E4YA 5ALJA 2WB2A 1WU7A 2A9JA 3FB1A 1J90A 1CUFA 1VPVA 2AMFA 2EFYA 5EHZA 5AKLA 3O4HA 3FOEC 3AEQA 5HW0A 1NBMA 3NKVA 3UPTA 2OGZA 1XDDA 2CF5A 1FRZA 2EZTA 4TMXA 4CVNA 5ALVA 3EVBA 3DD5A 3ZWYA 1Y42X 4O0LA 1DX4A 5DNAA 5EJ6A 4RTMA 4E2WA 2QLNA 4WZBE 4FMCF 3BFXA 3MCZA 4ZARA 2CEAA 3JASA 3JQGB 1CF9A 3UQYS 1MOQA 4PO9A 2D54A 1T1GA 4X63A 4Q15A 4X1KB 3VHXA 4GYJA 3QOYA 2JG3A 2R1VB 3AXTA 3V7WA 3U4HA 3UJDA 3G1UA 5P21A 5HIAA 2B1GA 3MJDA 4BIMA 3EVZA 4G41A 4XGRA 2VP9A 2P2YA 3AUXA 3MAGA 2XUQA 2R3SA 3PC6A 4AMZA 1ZVKA 4JI3B 3K6KA 5CGZA 3QXGA 2KX7A 1HFJA 1MIOA 2HBYA 2ZJ2A 3FDFA 3UJ3X 3H0KA 1IZZA 3ROKA 4DBVO 2ZJAA 3VSBA 5JJLA 2P90A 1KO5A 3A6GA 3W90A 3Q6MA 4RKQA 4DNOA 2G80A 2YMMA 1R0LA 3MJCA 4FVTA 3TOVA 4AF8A 4UTPA 1W36B 4MKIA 4ER0A 4KN9S 3ZU5A 1KI3A 4E07A 1ZD3A 1JFRA 4OQEA 3WNCA 2P79A 1GPH1 1M8KA 4B76A 1M73E 4LI3X 3T9FA 2WG2A 4RHCA 1T3TA 2HA2A 1QFZA 2XTNA 4KFUA 5EZQA 4J0KA 4A1FA 1BHJA 4YRDA 5G40A 3JAKA 1CNMA 5KTMA 1FTNA 2EHJA 2JK1A 4WY5A 1NQAO 4CKBA 4R1TA 2AR0A 3TE6A 2C07A 2XUPA 1WA5A 2BLNA 1JQ3A 3HDQA 1SVNA 1CW2B 2BRUC 3BWBA 5JLAA 2BEWA 2VPIA 3QHPA 3SS8A 4AS1A 2VDKB 3GW8A 4W6QA 4B7XA 3ROFA 2UKDA 2OG2A 3A1FA 3LK6A 2GFHA 1HY3A 3M0EA 3RC1A 2IUEA 3FKJA 5E4TA 1E3WB 4KEAA 1ESCA 3FYHA 1MO5A 2O8BB 2GCOA 4M38A 1YRLA 4LW8A 3CWQA 2GAIA 2I2AA 4JXJA 5F51A 4BZPA 3JAMA 1R6UA 4I5FA 2I1LA 3HA3A 4CM6A 4AJEA 5F7JA 5AM4A 1FOEB 3RHZA 1ZW6A 2R1TB 5FOQA 3R9XA 2P9ZA 4QATA 2GVNA 2C1EA 3DOJA 4NBNA 2CUZA 3ODPA 4Q9DA 4MQ6A 4UFPA 3KQWA 3BX1A 3HJTA 2O1XA 1II8A 4I9NA 4YECA 5BN1A 4PCVA 4BQSA 2QD5A 1H8HA 4GOOD 3REGA 2ZTUA 4IP0A 3PC2A 3CH5A 3TZEA 2DVMA 1ECJA 1ZCBA 5KKCA 1KDTA 1XCJA 4J2OA 5DZSA 2O8CB 1V2HE 4ZYVA 1ZK2A 1USWA 3OIVA 3KC2A 3MWKA 5C80A 4K9KA 5SY9A 1WIWA 1SOVA 2BT4A 1C7ZA 2O2ZA 2PLWA 2QMHA 2WYHA 1L2TA 1QK3A 3I4CA 4PC3A 3ICPA 4MMZB 4NRDA 3K3PA 5CT9A 4AYXA 5CM2Z 1W0KD 1L6RA 4JL8A 2DBVO 1NVVR 5C8YF 2LNDA 2OEPA 3BC1A 4JELA 2NZXA 4P0TA 2FKNA 4OFZA 2JHAA 2R87A 4GZ5A 2L42A 1JDSA 3KD2A 1ZBDA 2WKWA 3GRPA 2XB4A 5BSUA 3K6SB 2OBMA 1UP4A 5ILOA 3LCJA 3S8EA 1OPXA 3TTUA 2AL7A 2IXAA 4OK5A 1RKBA 1OYOA 2IV3A 3I01M 4KE9A 4BVFA 3EIWA 3JVIA 3K72B 4N0DA 5CEJA 1J56A 5IJXA 4G5XA 1Y3BE 4HK4A 1H0RA 4RYDA 3W8DA 3I9LA 1V3TA 4AF7A 5CFLA 1ARZA 1P3Y1 3O38A 3RS4A 5JI3E 3C3WA 4IQ0A 2COUA 3QYJA 4NV0A 4X60A 4DSTA 4URZR 1YHNA 3S3TA 1KHHA 4ND8B 2P1DA 1ULSA 1D07A 1GQRA 2NNWB 3B7WA 3UGJA 1VDMA 5H80A 1F6BA 4E09A 1K3UB 3RFXA 2DWOA 5M3BA 2J3JA 1TEXA 2CEKA 3RWOA 3PHCA 2D13A 2JGMA 4DA9A 4YREA 1G291 2X0NA 1UBRS 3H5LA 3I1IA 3OFKA 5LDGA 3I3OA 2D06A 4I6EA 3EXHC 4GECA 4ZTUB 2I6SA 2PUVA 3F1KA 4GBED 4BKUA 1N6OA 3WLIA 4CTMA 2PUEA 4ES6A 2DPLA 3PSHA 3E5NA 2EP7A 5AVSA 5KNLA 3GJQA 4KXUA 5E9WA 2BHSA 4XLLA 2P4HX 1CQJB 1EPUA 2GASA 2P30A 1ZNZA 4NMXB 1XZBA 4Y1GA 2GBPA 3F5DA 2IP2A 4IDQA 1VHWA 4A2PA 4HDRB 4K2AA 1OWPA 3UT5B 3LOQA 4C2BA 2ZRPA 3TIFA 3OTGA 3SJAA 2G9NA 5C51B 1KO1A 1KH3A 1OD6A 2IHJA 2ZQ5A 4W63A 3TPZA 4RY0A 3ROMA 5KSPA 5DT9A 5C8XA 4IV0A 4PQEA 2RBKA 4C22A 1Z9BA 3M1LA 3B8EA 1OFVA 4HSEA 4KAJA 4LISA 3H1AA 5F2OA 2IOHA 3TOSA 3E4DA 2G04A 1A4XA 1UKBA 4JEHA 1VE3A 1YC5A 4ZGWA 2J3IA 1QHFA 2ACVA 3K2EA 3VC2A 1CIVA 1XZNA 2I1QA 1RYNA 1T8WA 1UXOA 4NJEA 5DCYA 5A6SB 1XDUA 1U1FA 2ONKA 3CX7A 4P36A 4WOJA 2W9XA 1OA0A 5AW5A 3CLSD 1ORDA 2I2DA 4OM8A 4AZ3A 3QEKA 1NVXQ 1UXJA 5JUWA 4Z0PA 3NVKI 2GJAA 2HCBA 2HY7A 4JLMA 2GGSA 4YH1A 3GJSA 5BYBA 3VPSA 3WXBA 3RYCA 4S12A 4FGWA 1X86B 4YRTA 1ZD2P 1KI6B 4QODA 2AHOA 1FRQA 4MUNA 2VQFB 5J3JA 2QTFA 2CWWA 2OD7A 4TN1A 4LQDA 1XN4A 3CRNA 3LHIA 1RWWA 4UBIA 1OFTA 3DZ8A 1U28A 4I08A 4RK1A 3RGGA 3GAAA 2W42A 2OLKA 2B5WA 3EDQA 3ZQKA 5J5CA 3VU8A 4INAA 4BMVA 1Z62A 5BV8A 2V5UA 4O2BF 3AUFA 1OUMA 5DRYA 1L5HB 1SR8A 1XRSB 2BE7A 2OFPA 4A2QA 4TZTA 3LBHA 3WWPA 1XZMA 5CVTA 2AWOA 3EUWA 4ZQEA 1WTAA 2BONA 4FHFA 3ZTYA 1NE7A 4JKYA 5JD4A 4ASUA 3NWBA 3IEPA 5E6UB 3WZMA 1LS1A 3LV8A 3K5WA 2ORVA 3OIWA 4H17A 1XYYA 2JLUA 1YZYA 2OENG 3H3JA 1X92A 3TVTA 1Z0KA 5AVZA 2HLHA 3IR5A 1ODJA 3PUHA 1VPWA 2WUEA 3A4LA 2VHXA 1M6YA 4CMEC 5C5EA 3FPGA 3HB1A 3W2EA 3B1YA 3I9KA 3OO0A 4MVJM 5DI3A 4F2PA 4EA6A 1JIUA 1KZ6A 1I6MA 1G3QA 4Q1CA 3W3AH 1U0LA 1FUYB 3MMSA 2XYVA 3RVLA 3ANNA 1YBFA 3SXUB 1J0BA 1EAYA 1X87A 2O50A 2WUFA 5AK0A 5E1BA 1C8LA 1S3FA 2XRFA 3IFSA 5I9SA 2VZ9A 2QMQA 3BJRA 2EW2A 4OJKA 2NO4A 4KWHA 4RF3A 3ST7A 1AQYA 2WKQA 4DDWA 1RKUA 2JLRA 2WWIA 2FV8A 3OZXA 4JJAA 1A2KC 2ADFA 2WLSA 2QMEA 2YWHA 4MQFA 4PRZA 3WYGA 1RW4A 4DA4A 4CEJB 3AFHA 4BFTA 1O95A 4QOIA 1PZHA 1D6MA 1M7BA 4DV5B 5D87A 1I2MA 3KJXA 3L6RA 3WA7A 3KQUA 1OAOA 3NWPA 1YFLA 1IMOA 2Z9CA 4C06A 3FRHA 2PH5A 4G1FA 4OVKA 5G1NA 4UFNA 1DFHA 1JG4A 2Z8XA 3DXYA 2YIDA 1HTWA 3OICA 5HYVA 1FZTA 2Q07A 1VECA 3AF4A 4U1RA 3MXTA 1F9AA 3MZ0A 3NCHA 2VSQA 4NCJA 4QARA 3CC8A 2V58A 1NY6A 3T7CA 4BKRA 1DKRA 3IO5A 2O07A 4OHRA 1CQXA 2WOOA 1UQTA 1Z5NA 3NDIA 2I62A 5HZGA 4BMSA 1ZLXA 1WTCA 1FA9A 2XA9A 4MEAA 4X1YA 4C30A 4RHFA 3ZDXB 1HE3A 1ZMXA 2BN4A 2F3RA 2XIJA 5AKEA 2A0YA 5FULA 3G2PA 4NZYA 4QTTB 5CDSA 2NMVA 5CT6A 1U8ZA 3N8HA 2DG2A 1RABA 1NMXA 3QSGA 1R1DA 4AU1A 3KB8A 3LUDA 1A7KA 3R9IA 1EHYA 2IPXA 1ZIXA 2IIPA 5KTKA 1EINA 3ETCA 3UK6A 5CHEA 3AB3A 2PX4A 2Q1XA 4CFZA 4CQNA 4HB0A 4W99A 2DFPA 2G88A 2TRSB 1CQPA 3GT7A 3QVKA 4Q37A 1EX7A 1TKBA 1R8XA 1UOOA 1RM4A 4ABTA 5B7NA 5LZ7A 1ZNWA 4K6CA 2W2NA 2E2WA 4W5WA 3L49A 3T0IA 3N70A 4HQLA 3CZ4A 4MLPA 5FBVB 1OYYA 4OHMA 4L85A 1MG5A 4N0QA 4R9VA 2QTTA 5DI9A 1ODIA 3W7BA 4LCEA 5BURA 5IDQA 1X1RA 2Q8PA 3HBNA 4LCBA 3KLPX 4ABYA 3VR2A 4HDNA 4ND3A 4XD7D 1Y6QA 2AI2A 3BWCA 5C7OO 3FY4A 3EZXA 2ZAYA 3GJTA 3NHLA 3OKPA 3AVPA 3QJYA 3KDSE 4GPIB 4BMCA 4D7AA 3AJ9A 5FCDA 3KOMA 1UT6A 1TUBB 2NYUA 3ZLUA 3IOBA 3K53A 3T41A 1HEYA 1W8DA 2G71A 1TZKA 3DO5A 1YRHA 2RONA 4BRWA 3GV0A 4BX2A 3RYFA 2OCDA 3ZIUA 1DGQA 3C3MA 1N32B 4YLYA 2IY8A 3ZBPA 5JRJA 3KPJA 2DEUA 5AYVA 3KYCA 1U28C 4TWIA 4Q21A 1J8YF 2G77B 3D3NA 5J47A 5A4JA 2GF9A 3QOWA 1A88A 4XPIB 3NTXA 1QH0A 5JNTA 1L5QA 5TMPA 3F0TA 2GPBA 3BFKA 1OKKA 2JEZA 2VDLB 3D4OA 4MRVA 1BEEA 1V8DA 3E18A 3LHDA 4W8HA 4BCCA 5KX5B 3MT8A 4RAQA 1T2FA 1VE6A 3FSJX 4IPTA 5KO2A 4NS1A 1NN0A 4IIFA 3RUCA 5GV8A 4ZV7A 3A1EA 2IC5A 1LJLA 2C3MA 4YUYA 5KNDD 3L4BA 3FVTA 4YDQA 3BCUA 3CR7A 4I2NA 2FP3A 4E03A 4TTSA 1P62B 2ZSAA 1AK2A 5EKUA 3AUYA 3UNXA 4XIIA 3A06A 1J33A 4EB8A 2CHFA 3GEHA 5FUQA 2BJVA 3SWWA 2F3UA 4XAQA 4ID9A 4R8SA 4LXXA 3GRYA 3K9WA 4BHTA 1TF7A 5EN4A 4ITUA 1WY7A 2V3VA 1JG3A 3C24A 4JOBA 4YMSA 5JYEA 4JVNA 4F4HA 2IY7A 2XUDA 3EIUA 2YIMA 3HYLA 4M7WA 4R6XA 3F7TA 4FI3C 3UFXA 3WQSB 1D09A 5LJIA 1YJXA 2BI7A 2P6MA 3BHNA 4C88A 1DOAA 2ZTSA 3IXQA 3LBFA 2GD2A 4E21A 3AR2A 3B9QA 3IQZA 3MWYW 4FB5A 1YE5A 1GD1O 2R8RA 2OXEA 1KEPA 2AZ4A 1FDTA 3GROA 1OC2A 1C9NA 3L1HA 4DSOA 2ZUFA 4QLBA 3ELWA 1VMKA 3GRZA 3LECA 3KL4A 2O54A 4ZOLB 1ML3A 1OAOC 1TQDA 3PGKA 3S68A 2PBZA 3WR5A 3TTYA 3I8SA 2ASEA 3RADC 2BBTA 2HK9A 2P4SA 4JLBA 2H2WA 3B48A 3T1OA 5JS8A 1Y4AE 3FMOB 3RVJA 5CR9A 5LM3A 1C30B 3KXDA 1I4TD 3E4CA 1Z5WA 4GHWA 4GLOA 1TYBE 5TPWB 2HUPA 2J4CA 4C78A 4CKXA 1EUCA 5HTKA 5EMLA 3HGTA 4NR0A 5ED0A 3TOCA 4JN6B 2RGRA 1ENPA 1UDXA 4DHWA 3P20A 3ZWNA 4DMMA 2IH4A 4AKGA 2LUOA 5T4HA 5CEEA 2A3RA 1H22A 3T9DA 1E0AA 3B1XA 3SPXA 3BILA 1SHUX 2XA2A 1NJ6A 3NYIA 4P5EA 4R1MA 2ROQA 5EP4A 3WKDA 1PL8A 2FQ1A 3ITKA 2IHBA 4CJXA 5ITVA 4XKJA 4CE6A 5CLFA 2BFDB 3LL4A 4GDFA 2P65A 3HBFA 2HA5A 4IL5A 2VAPA 3HFJA 2FPUA 1CY2A 4O4LF 2VJCA 2ZATA 3A8TA 3LW8A 3LQFA 4Y0VA 3URKA 2WP0A 4TOIA 3K8QA 4L2IB 3MJSA 1FFHA 1I4EB 3IH5A 3LTEA 3QUTA 5CYOA 1U7HA 3B9PA 4RVCA 1DRVA 4WCFA 5AK3A 1RC8A 5HCNA 4OLAA 3T99A 2HQBA 4L0DA 2VXCA 4ALLA 2Q4RA 4DWWA 2O5CA 5AMXA 1DG9A 4OQZA 1RIIA 3DE0X 3FMGA 4KJZA 4ACBA 4YCMA 1NDUA 3COJA 4ZCTA 3B6IA 4FC6A 1V48A 1D03A 2R8YA 2I6FA 1P5HA 3QF4B 3GJ7A 3NIFB 4TMYA 4F56A 2I0FA 3BMCB 3DWGA 4IWYA 2F8SA 2ODQA 3K8ZA 3QW2A 4YCSA 5K8UA 1PE0A 4AVYA 1Q44A 2CCGA 2OLEA 3DMPA 1J5EB 1D0SA 3TF5A 2O6HA 5FTNA 1Z22A 3C6KA 3OZFA 5LZ8A 4F6RA 1U0TA 4MR9A 1M8JA 4HNVA 1M8PA 2NXWA 3HXMA 2WFLA 3Q3CA 4I99A 2JGDA 2VH1A 3WIUA 4WE3A 4KO3S 4J2HA 1LBSA 4RHEA 2H2DA 3TPCA 4D8WA 3EVFA 2Q7DA 3TRFA 3O3MB 1PJ2A 1XRPA 4QXRA 1JIKA 2EFGA 3I8XA 5BSTA 2C84A 2ZI9A 5ESDA 4DCJA 4L4YA 6PFKA 5LR6A 3G79A 4IHQA 1G64A 1W59A 3DP7A 4CMEA 4EH1A 4F7DA 1NUTA 3EA0A 1F48A 2DH5A 3TJZA 4NEHB 1BJTA 4WKOA 2C78A 3V7FA 2AN9A 1T4BA 4EATA 3WSTA 5I7EA 4C0SA 4UXHA 2OVFA 4WN3A 3JU3A 1X9IA 4IIGA 1V43A 2LCQA 1J2EA 1GPAA 3C3KA 4IQ8A 4WBXC 1EI9A 1XRJA 5FF9A 3FDZB 4KBYA 4LSGA 5IYZF 5KHAA 3V8VA 5A2GA 4MS4B 4UQLA 4L0QA 3LP8A 3L0CA 2P9JA 2VWQA 4M0FA 3UMRA 3WK5A 1LTKA 1I3NA 1NXOA 4M55A 3GFBA 1B6GA 3GO4A 1U63A 1A04A 4DFDA 4XM2A 3RAEC 1HE8B 5ALZA 3AEUA 4AG6A 4OH1A 2ZIZA 3H5NA 2BTQA 1MDBA 1D2EA 2DT5A 4YVFA 4YYEA 4ALNA 2OBYA 5DM1A 5BOVA 3V48A 1G21E 4EGCB 2EBHX 1QF7A 2R68A 1T9BA 2P9FA 3O73A 4EMBA 5LL6P 1NVGA 3G0OA 3WRYA 3KT0A 2SCUB 1KQOA 1W52X 2R4QA 3LGXA 4I8XA 3L7NA 5EE9A 4RK7A 3FVQA 2SKCA 1BN6A 2DP4E 3PX2A 3F5FA 4GM0A 4J76A 4U9IS 5HS6A 2OHGA 2UYCA 5TX7A 2A57A 2QQFA 2WU0A 5COQA 3GY0A 4UKDA 2ZBEA 3BL6A 3B9RA 2FUEA 4IUDS 3WGHA 3HEMA 2NVUA 3WLRA 3ZHOA 1OTXA 1C80A 5EMMA 1D2CA 1ESNA 1G5IA 2AOWA 3A1TA 4AICA 1W5TA 5LQUA 1V71A 3AEQB 3BXEA 4HAZA 4JUIA 4A0SA 5BMVA 3ZJTA 1DOZA 2WM2A 1COWA 3QX8A 4FDUA 4Z7QB 3O3NB 1JT2A 3TRHA 2HMVA 6ADHA 1DEOA 5DBGA 5HDQA 3FSGD 5KHLB 4RTKA 2XNJA 3JASB 1Y9AA 2C7VA 3AX6A 4H35A 3CPEA 1GEGA 3I32A 4ARCA 2R7NA 1V1RB 3EHEA 2FX5A 2O3RA 3DNFA 4TYYA 2H4ZA 1V11B 4H2DA 4WCFC 5THKA 3M5CA 4WN9B 1Z6GA 3P97A 3EXIA 4HN2A 1QCCA 3M6FA 2WD9A 4UBNA 3WDKA 5B4UA 5LLDA 4HFJA 4I3HA 3T6KA 1YZUA 2AQ8A 2QRMA 2Z98A 3BBPA 1CCWA 3U7RA 4JGBA 4RPGA 4EUNA 5H83A 1TYZA 1XTRA 4I6JA 1MIOB 4ZI5A 3KR1A 4YJ3B 3BH0A 4NZNA 2IOFK 3ZU2A 5C18A 3LX5A 1MHPA 3C7DB 4HGRA 1WUHS 2WAYA 4JI0B 3H9UA 2G6TA 1GCUA 2P9GA 4ID3A 1G8PA 2XJ4A 1CG6A 2WF7A 1K7SN 1NW9B 3EPRA 5ISMA 2QB5A 3FH0A 5K0JA 5CM8B 4ZCIA 3S29A 5BN3B 1GIAA 2IYNA 3GRUA 1GGHA 2WF5A 2YWGA 3NW9A 4NULA 4R1OA 3W1WA 5KQLA 1CIJA 3MSCA 5H3LA 1L1RA 3FPAA 5SICE 2LD4A 2N47A 4H1VA 4MV6A 5FOUA 1U0GA 2V1UA 1UFVA 2P3SA 3KP1A 1NX6A 3ZOKA 3UW3A 2OKCA 4HV4A 4R5HA 2B25A 3JAKB 3K1TA 4RVGA 3TSCA 3ZY4A 2RBGA 2HEIA 3Q10A 4IKEA 3V4FA 1DKUA 3VO9A 4CKBB 4J75A 3WL3A 3GLGB 2C1XA 1N6KA 2J9GA 3EAGA 2HLDA 4FZVA 3VO8A 3ZK9A 3A3KA 4Z4FA 1SPXA 1P6QA 3WGUA 2B61A 1TF5A 3CSUA 2OFWA 2P5UA 1BKYA 2HBQA 2I1VB 1SJ9A 1RBZA 1U5BA 1BCSA 4UAGA 2XSZA 3OWHA 2HHCA 3TLXA 3A04A 3GMTA 3RREA 2GD1O 3LD9A 3ZW8A 2CXPA 5DGDA 1JHVA 1PUXA 1UCFA 2GCOB 3HRIA 2GR9A 4QFCA 3S99A 3SMQA 4CM9A 1AC5A 3L4KA 1RWQA 2HMSA 4FYYA 5MGBA 2JLVA 1SVOA 1E6KA 4ZCRA 3WWCA 3UBTA 5ADUS 3HCCA 2KE5A 1VHJA 2HD4A 3CF6R 1TADA 5I8WA 1HWYA 1N5KA 3EXFA 3LPLA 4CTOA 3ZDCA 4D45A 4RWEA 2B9VA 1KA9H 2GAJA 5FYDA 3NP9A 4I5EA 2C2WA 3H11B 2RGXA 2MT9A 3MILA 3BKXA 2Z9DA 2B4KA 5DTEA 2VRNA 3I73A 3NVMB 3RVQA 1M2FA 3GOQA 1WMFA 5CVDA 5AJHA 3QU2A 1JBKA 1M83A 4CKCA 1CUBA 5T67A 2BKLA 4HP8A 3ER9A 3IB3A 3HB7A 5BVHA 4FOPA 2NO5A 3LY7A 3PHBE 4JUBA 1PR2A 1XQWA 4P3NA 2PEZA 4KYTA 4FEAA 3VR6A 2QLTA 1KDOA 2NU9A 4RUKA 3EG5A 3HRHA 4AW9A 1LDBA 2HIAA 2VF2A 1HXHA 2WWYA 4BV2A 1WUYA 5DE3A 3RG8A 4I0WB 2OMKA 4N40A 3UAWA 3VU9A 2SKDA 3WISA 1UOPA 2AF3C 2ACEA 1I4DD 2XMPA 1NBEA 2UYQA 4R2JA 2PLAA 3WAKA 1UBCA 3QP9A 1CUUA 4MMYB 1KBZA 1L5KA 4GZ6A 1IQPA 1GFWA 1TA4A 2NZYA 2I3GA 1KVSA 1P45A 3FPSA 4MLZA 1GL3A 3BA1A 1Z3IX 3DLTA 5JY6A 4QTZA 4Q4AA 1JEOA 2GJKA 1PUJA 5FBKA 3RSZA 3W5JA 1KEWA 1IEXA 2ZSBA 4G01B 3PDWA 4HGZA 1P4JA 4QHTA 2CVZA 1EHIA 4OHWA 4CMIB 4KI7A 1NA5A 3RFTA 4GLBA 1Q0UA 2VK4A 3N9IA 3PSAA 4P7FA 4KPFC 1O08A 2MCFA 4D02A 1CZHA 1ENOA 5A1TA 5A4AA 1RU3A 1NXSA 1J07A 4R9UC 1KI2A 2NZJA 2VQDA 1AQLA 3RS9A 4RD1A 5FD8A 2DPYA 4QOSA 4H60A 4G5RA 1PJRA 3I2FA 3ZS8A 4BUJA 1NXPA 3FYDA 3B5EA 5J5AA 3WKCA 4A8PA 2HCRA 2VF5X 2VJOA 3A9TA 3AUSA 1BDHA 4E4TA 3OX2A 2C7BA 3V33A 1XD2A 2WMDA 4EQ6A 1LTHR 2FW7A 1KDVA 4UNRA 5B6IA 4DG8A 1T9AA 1TVCA 3IE1A 1V4BA 5CHYA 3TKAA 3VFDA 2GCEA 2NQ8A 4U7PB 2IDMA 4CL3A 3AXSA 4J0DA 1PVOA 3U4CA 2W8ZA 2CJWA 2IUFA 2Q29A 4X61A 4CG1A 1BVRA 2GCIA 2G07A 2GJ8A 2VQSA 3E15A 3GPIA 3H16A 3H2JA 4HGQA 4JJZA 1XRRA 2ZR7A 3K0BA 1GUZA 1CJBA 1U2DC 1VLLA 3CCBA 3R5KA 4H7EA 4NJEB 3FHTA 2HO4A 4CTKA 5I9BA 3IEUA 2G06A 1J7KA 3MLBA 3OE4A 4Q9KA 4TXJA 5ALQA 3U80A 3IEMA 1W2WB 1ZZGA 3AF2A 1I3LA 5D3QA 5BQPA 1T9ZA 4RY9A 5JE8A 3MWJA 2QTWB 5KQMA 5DHUA 1KRHA 3PI6A 5ALOA 4B7CA 4UM9B 2EJCA 1W1IA 3HB5X 1P5ZB 3NYWA 5BWMA 4IS2A 3IPLA 1T3LA 1E3DA 4ZAVA 2G9VA 4M2LA 5B58C 4YHHB 1QDUA 1Y6JA 1L4UA 2RH8A 2OPHA 1IRIA 4LJLA 2Z9BA 3S2UA 1Z2NX 4TZKA 3Q11A 5MDHA 2RB5A 2QUHA 2OORA 2XOKA 3ZGVA 1WY5A 1YS4A 2ZU6A 1VJ1A 3LOUA 4R8VA 2BUCA 1I33A 3FWYA 3A3PA 2RGCA 3D43A 4L28A 3KDAA 3WRVA 1H0KA 2FJPA 2OILA 5EC8A 2F9FA 4CIAA 5FAXA 2BFEB 4MKHA 1QG2A 3V4SA 1O4WA 2VR1A 3OPYI 3E7XA 3GUYA 5JSUA 2XBMA 2JFGA 4BVAA 5DYIA 2WMNB 3Q85A 4HXYA 2FPRA 1WQ3A 2H9AA 4NZOA 3AQIA 1QYRA 1V6SA 1KKUA 4Q4JA 4BNZA 4TKVA 5CDTA 4PIPA 3QEBZ 2ZXEA 3TW0A 4Z9YA 4D80A 2A7QA 3CIFA 2FA9A 3QU9A 5TQ0A 1YQQA 3M1YA 4R1SA 5DI3B 3W5SA 1QGOA 4QJBA 1EGMB 5CBPA 4B84A 4GPTA 5EP3A 2QGZA 1UZLA 421PA 4NATA 1DC4A 4WWHA 1LW7A 3Q5DA 3VVMA 5ITZB 2GILA 3BHIA 3IBCA 4ZP1A 1T0UA 3BXGA 2A78A 1FLAA 1N3BA 1YKGA 3CEMA 3RHFA 4CR7A 1P1KA 1WB5A 4UHJA 3NORA 3NOOA 4NARA 2Z4TA 3U7QB 2NO1A 1WAMA 4PONA 4YLEA 1K6XA 3QKSA 3CJRA 5CDFA 3O03A 1DAOA 1GO2A 1RZUA 4ZYWA 5ERYA 5BSGA 2PRSA 1F7VA 5IVKA 2L2QA 3IUJA 1PZEA 5FIUA 4O5AA 1WXQA 2HIGA 2VS1A 4Z0NA 2R6ZA 4XQEA 4A36A 3PFHA 1YL5A 5FPHA 4B8ZA 1NI5A 1PG2A 4WKNA 1W4LA 1NAIA 3GEDA 3D4NA 4V1CI 2PSEA 4LIPD 1OIVA 3EEYA 3UV7A 3TFOA 2UUCB 4RWZA 3Q3GE 4UNSA 5G0WA 4YUXA 3KB1A 1JHPA 3BD8A 1ZOSA 2P67A 3DW1X 1JI0A 3IDFA 3G9UA 3NTVA 1FUIA 4X1YB 3ZDZB 2WEKA 4W7IA 1K5PA 2ZYGA 4G5FA 2ZRCA 3L7DA 1L0BA 1YUMA 4I1YA 4OXQA 2B8EA 3G5TA 4UVDA 4NH4A 4C4TA 1PJQA 4LQCA 3PQ6A 1KO7A 4NPAA 1NPTO 4LFAB 4EKGA 2IYLD 3NIDB 1G5RA 1BE1A 2DY1A 1R74A 3EEQA 3FCYA 3VR4H 4CTNA 1U7TA 3ZCRA 2XCTB 1UM9A 1W94A 5LQCA 2REQB 5A04A 1GLVA 1XXLA 2WTXA 4DLAA 4DCGA 4YP6A 1XVVA 4PG8A 5B2ZA 1R10A 3CB4A 1A72A 2IYQA 4YDSA 3SCZA 5F3WB 5CNJA 3UMMA 3CLSC 4H7IA 4OB6A 4DMUB 1Z8FA 3RC7A 1TQHA 2VJNA 1RXUA 2X3FA 1EQUA 4C5CA 2NQTA 2ETXA 4DB4A 4JLOA 3ZZUA 4QQKA 4ZJUA 2ID8A 4L5YA 1TYDE 5HA5A 1HC7A 5AKIA 3CWCA 5HFJA 1C3JA 2J4FA 3UOWA 4GLLA 2CFCA 4HDNB 1TK3A 1G5TA 2C3OA 4X5OA 2FXVA 5JXHA 5KB3A 5MN5A 1VBFA 4JWTA 4GI2A 3TGPA 3RRBA 2OC9A 5HF6A 5I4KA 1OX6A 3HDHA 4B81A 2MSLA 4EI2A 4RY8A 1JS1X 2CHQA 1ZK1A 1UZAA 1F5SA 2GSWA 3STXA 2Q2VA 3PUIA 3LUKA 3OY2A 4ZOLF 3RYFB 2ZJZA 2GOYA 3H8JA 4V38A 4L9WA 1OBHA 3R75A 2UZ3A 5CBKA 3KYCB 4ANFA 2HEGA 5DKFA 5T64A 2FZGA 1R8QA 1Z82A 2Q0SA 3FZQA 4M8NE 2AFVA 1R8JA 1QV9A 1DV2A 3RUAA 2I7TA 3X1DA 4DJDC 2HNBA 2V6GA 3VM6A 1CR4A 4EG8A 1N2GA 1L5NA 1A9QA 2X5KO 2HWKA 3KEOA 3FB4A 1Z5VA 3K9HA 3LDFA 2AEMA 1OB5A 2Q4OA 1YV9A 3L4SO 4M21A 3MUFA 4J1NA 5FP0A 4IGEA 4TKLA 3D54D 1UWVA 1TO1E 4MA4A 2ZDGA 5CW1A 3OCWA 1JTVA 1KI4A 2ZRQA 3K9BA 1QR6A 3PNLA 3V42A 3HFRA 3K31A 1GTZA 1YJQA 3Q6IA 3RV3A 3R0JA 4EW1A 1K3FA 1L6IA 4D6YA 3PKIA 4IF4A 1GN8A 2YY5A 2HJRA 3UFXB 2FPOA 3L41A 1WDLA 4YNBA 4JI5B 2VO1A 3QBTA 2X6QA 2RGAA 1B7GO 4IO0A 2IS1A 4MDYA 2H06A 3MTBA 2V7EA 2X8JA 4OHUA 3UMVA 1X80A 4UBMA 5LUBA 5J43A 3NBUA 1HL3A 3LPCA 2C95A 3A1UA 3C6QA 1YNOA 4FYPA 4CT0A 1ZVVA 2ZJOA 4DV0B 5A3QA 5L3RA 2H6EA 2PANA 3HBMA 4NEQA 3KFVA 4XDZA 4XEUA 3ZBTA 1GN9A 3LUAA 3F74A 1FMJA 3PL1A 2Q9CA 3IKLA 1EEXB 4AJJA 2G70A 2WJZB 1RXCA 1X74A 2IIBA 2O2CA 4FR2A 4FZ3A 4G0MA 4JYMA 2PUFA 2XQKA 4P4NA 1UKEA 1KXJA 1DXOA 1XCLA 1W4CA 2F43A 2GCPA 2K2QB 2NOAA 3MJEA 3SR0A 3JQAA 3CZPA 4P0QB 4F92B 1DXQA 3PICA 3NHYA 2XMGA 1T24A 4ZQFA 2BFNA 4IY1A 3RTDA 2UUBB 1XO1A 1ECBA 4Z9XA 4YV2A 1EUCB 4YAWA 3H2ZA 1USKA 3OO1A 5FPPA 1RXVA 5ICEA 1M1YA 4HWRA 3DDCA 4LA4A 1YTLA 1C1DA 3H5VA 3K6JA 4XD2A 5L6MB 1GITA 2PBRA 1SD5A 1Y9EA 2O8NA 2R97A 3DOCA 5CTAA 4MAMA 3MCVA 1WVGA 3UXMA 1U65A 1BJKA 1O9GA 4QU9A 5TF0A 4NEGA 3LT1A 3L6CA 5HWSA 2ZUEA 3I9JA 1KR2A 1JQKA 4AFNA 3ANYB 2WICA 2OE2A 1DAGA 2V0CA 3L5OA 1QP4A 3ZEAA 1TIKA 1UEIA 2CXHA 2FMFA 5BYAA 1J9ZA 2HA0A 5FUYA 1DXYA 5JSFA 2C58A 4WCFB 4GMHA 1R0BA 4OHFA 4XWWA 4IHAA 1IG0A 5DTRA 2YWEA 1W25A 4QNNA 4GWLA 1U9IA 5JSKA 4R68A 1HFWA 3AHEA 1HYEA 4TRNA 1DQRA 2YN4A 4OJYA 1H5QA 3DDHA 4G67A 1E2KA 3TLJA 2B7LA 4CM4A 4TMKA 4JI1B 1FS4A 2C97A 3A31A 3EOAI 2ORED 3F90A 2VEDA 3P9KA 5SV2A 3WL8A 3L0IB 3O9VA 1JLRA 1HDRA 1D2NA 2I9KA 1HNZB 4EY6A 4F45A 3SBDA 3QFHA 4MR9B 4IQGA 5K2OA 8ABPA 1P0QA 1OW3B 1CUJA 3S2FA 3UYKA 3MTAA 1H9BA 2FWRA 1H05A 2C9DA 3QMPA 4HF7A 2VF8A 3RPEA 2B78A 3T5MA 3TMAA 3U3DA 4BFLA 1A9PA 4FFOA 4Z49A 3DVAA 3R76A 2IE0A 1QWOA 3HBAA 3K73O 5JR3A 3WHKA 1F6DA 2GXQA 1SVKA 3F6RA 1XDZA 1MA3A 1K0FA 3TLAA 2J3QA 4Q66C 1A9YA 3P19A 3V8NA 4CN9A 2GARA 3MWEA 3JTMA 2IEBA 1MAAA 1YA6A 4HS4A 4PSAA 1UMDA 3FI9A 1S5PA 2OZPA 2RC6A 1OY1A 2CFSA 3VU3A 1VRCA 2P6PA 4RK0A 3ZHXA 4Z86A 2Q3MA 4M9UA 4B6JA 3F6EX 2EJTA 4C4AA 3QSYA 3L0PA 3C7TA 1ZESA 1C5KA 5L95A 2O0KA 1NVBA 3E35A 3JRNA 2YASA 3FVWA 2WINI 2IHZA 3W2GA 2VYFA 3EWSA 5ALFA 3CN9A 2ZUTA 2PSFA 4QREA 1KH1A 1L5SA 4MR7A 4BIIA 4K3VA 2JAPA 3EZ6A 4YAOA 4UUOA 2BTQB 2HWUA 5BXQC 2ODAA 3ZKWA 1I6KA 5E6RA 1ISMA 1E0KA 2HPAA 2X13A 1JIJA 3PGLA 3IE2A 4YJ3F 1R0KA 3VUFA 3LUJA 4JJ7A 4QT4A 2FEPA 4PCAA 1CUYA 2UVDA 2ZJ3A 4BLTA 3LMKA 1CU1A 3WBFA 3HO6A 1CRWG 1U6IA 3I3SR 5L4SA 2Y1DA 2M1XA 4WJZA 3UJAA 1WSDA 1U2SA 1QYCA 1YIOA 2D4AA 3NGXA 4Q9IA 1G20A 1ZGJA 1FFGA 4KZKA 4TKUA 2BGNA 5T8KC 3SC2A 4ZHQA 5AHKA 3WIOA 4XYBA 2NVUB 4A6PA 2XF2A 5BW5A 4YGXB 1CERA 3MAJA 1KRXA 4YS6A 2D3WA 4UVGA 3MWFA 2ZROA 2KW5A 4PM4A 3X0DA 3H5IA 4ZVTA 3FSGA 1KDPA 1QANA 3NUQA 1ADGA 3PDIA 4ZOCA 3Q0EA 1GYRA 4J4HA 4MKFA 3LYAA 4YJFB 2WFAA 3IBSA 2XOXA 4ENWA 1WZCA 4G81A 3W5BA 2GK6A 4KQKA 1T8RA 1E9AA 4M22A 5L7YA 4DV6B 1YCGA 2IKQA 4IFTA 4OQNA 5HQTA 2JJ1D 1JFSA 1NZJA 1WP9A 1BHO1 4Y2QA 2PZMA 4M7RA 3N3BC 1VZ2A 2ZQZA 3LH5A 2W4MA 4RA6A 4Y2UA 2W58A 4WUTA 3EBLA 3A1WA 2PYIA 1XPOA 1VCOA 2XGMA 3B78A 3E81A 3EXIB 4BVEA 4LF6B 3OZRA 4R2HA 2HHJA 4LAFA 5EE0A 1RC1A 1SUWA 5GOZA 2AVDA 2XRZA 4F4CA 4FFMA 1WHSA 3LC0A 1X15A 4EAAA 1EVJA 1Q22A 3G6WA 5L7TA 4PTLA 2Q5HA 1DJNA 1A0OA 1JMVA 2XW6A 2Q27A 4OAOA 5I9TA 2PMEA 2ECPA 4F3RA 1D2HA 1M6NA 3L0DA 5LP6C 4P4TA 1XTJA 4HXFB 5JVDA 4G2NA 4MGZR 4YB8A 5KU1A 1JEAA 4IQ4A 3M8KA 1H8EA 1E9EA 4PV7A 3EMVA 4FIDA 5F1YA 1EM8A 1E1YA 2PL3A 4X92A 5EKSA 4H7PA 3NS7A 4Q1BA 2WYIA 3T3DA 4NNOA 2PKCA 1I4WA 2FG7C 3GELA 3BF8A 3GEIA 3OJOA 3QLEA 3QMVA 3AI2A 3M6WA 3KZMA 4HVAA 4PLWA 1R9JA 3OE7A 1F0KA 4ZEXA 3RIMA 1N0VC 2OP0A 5DN9A 3FVRA 5KYUA 4XR4A 4Z6KA 4EQZA 4XGKA 5CB6A 4DKJA 2IX9A 3EJ6A 4JC4A 3I39X 2W2XA 1XZKA 4PYMA 3SX4A 3ORHA 3I05A 3OECA 4G5OA 1HFEL 1NVEA 3JYPA 2IU0A 3AWIA 2LWIA 2RKOA 1U5BB 4PW0A 4BXOA 2NV6A 4JP3A 3JQBA 4IBOA 1QGUB 3CH7A 5TE9A 3LBYA 3MJRA 4N6NA 4ZYYA 5HJ7A 4U9HS 4FMDB 2UUAB 2AKYA 4AJLA 4Q7JB 4DMHA 3GC6A 1EFKA 1ZHFA 3H1GA 1G59A 4UNQA 1DC8A 3HNPA 2ATXA 3EGCA 1NOIA 5JAHA 1J39A 1NW8A 4OGWA 4N5MA 3Q40A 3DBVO 4G56A 5KKAA 4ARIA 1Q0ZA 2X58A 1CJTC 4WOBA 4AJIA 4BNHA 3ANXA 5IASA 1JJFA 2EATA 2J5BA 4KUEA 3RHSA 4LMBA 2XXJA 3QELA 1EX9A 3UAVA 4LJ4A 1J2UA 2AR7A 3FSEA 1R4MB 3WWEA 4EUSA 4R2LA 5DNYB 4YRCA 5KX5A 3JQ7A 5AVVA 2A4MA 1P4GA 2IYTA 1QR2A 2GPJA 4QG7A 1JP7A 2H1CA 3RBZA 2VHZA 2BZ0A 2HSDA 5HKOA 3ZIAD 5M04A 4C6SA 4RK6A 4CKCB 2B37A 3SDSA 2CLKB 4JHXA 1UC9A 1FX0A 2GJ4A 2QIPA 3FKSD 4Q4HA 2I3ZA 4RDXA 1WD5A 1UBKS 3I28A 2PYDA 1UDAA 1GU0A 1B42A 3FCXA 4AX4A 5JECA 3ODGA 2BJHA 1QVWA 4Q00A 5IEJA 3BQNB 3L0YA 1DEAA 2IT1A 4S24A 4YR7A 2DH6A 3DHVA 3BAFA 5CDUA 4YY3B 3O0DA 1PBTA 4MV5A 1ZKMA 3CG0A 4ALJA 4AKTA 2LDBA 3VU9B 2H4FA 3E8XA 1GZDA 4CKYA 1E7RA 2Q3CA 4KH0A 3IQIX 4KQIA 5TY0A 3BXFA 1NI4A 2EU8A 2VBIA 3CR3C 3JTEA 4KKXB 4MPJA 1NFFA 5KQRA 1X19A 5I4IA 3DL2A 2QLBA 4LJ6A 2HYDA 5JNLA 3PHJA 3HU5A 1ENYA 2GD0A 1JB1A 1UBOS 2Z83A 1PZNA 3USZA 5LOVF 1OLOA 3L7JA 1NN5A 3PFFA 3K1AA 2UYGA 1DAKA 3EZGA 3LY9A 3HCAA 3GJ3A 3IUYA 4PWYA 1OFUX 4I6GA 3QTBA 2FEAA 2X0KA 4MZDA 1XKLA 1VG9B 1O6CA 1KYXA 4BQQA 3WADA 4TKMA 1M54A 5HKAA 5KNBD 2AK2A 1GZVA 2CXSA 2H3EA 4FIZA 2IWHA 3ZVRA 2ZTLA 2ZYAA 1DJOA 1H5NA 3W9BA 5DDIP 1GQQA 4EKNB 2PHZA 4A1OA 1VI5A 4M9RA 1HE4A 1YD7A 2GZDA 4EG7A 1N2BA 3MIIA 1T5BA 4MEBA 1OV6A 3VKVA 2FDXA 2WHPA 4X41A 1E2PA 2FLKA 2W5UA 4EQ6B 1XD2B 3JR3A 4A9AA 2IYFA 4XFKA 5IPFA 1XA0A 1HLFA 1R4ZA 1YIDA 2UVPA 3CGGA 3CRQA 1DVRA 2BLLA 1SXJE 4OUKX 3R3VA 4IX9A 2LPMA 4PWZA 4TQUS 4L57A 3MHTA 3GG9A 4JI6B 3F98A 4NBRA 1AKTA 1O94A 4ETNA 1E5XA 2C7PA 1FDSA 1W5SA 1UMCB 1Z6YA 3MWGA 4BVKA 1GVHA 1EUZA 1I0IA 1QP8A 1R6DA 2JIPA 4GR4A 5IDWA 2EFCB 1R2QA 4HN9A 3BWVA 2CJWB 4S0ZA 2F1JA 1M2HA 4L4XA 1CUIA 1WUIS 3NETA 4EZBA 3GLKA 3RVRA 2NIPA 3KZNA 1SUIA 4GGPA 3C8ZA 3MEQA 1N33B 2UZ1B 4DXHA 4BRSA 1LI5A 3CZQA 1VA5A 4I66A 2BCEA 1SD2A 2Q45A 2ZP1A 3QRWA 4GP9A 2GXUA 1NGSA 4XX1A 1RZRD 2Z2XA 4MVJH 3JQBC 5DLEA 4BEVA 3JQFA 2DR3A 5JPDA 3SJUA 3CFYA 4C0LA 5B1YA 2E1PA 5C31A 1BFDA 3JD3A 1G4HA 3OZ7A 3TI7A 1LZKA 3KOXA 4C03A 2JI4A 4DG5A 2QX8A 3TYXA 2PMFA 2BGWA 1UMBA 2DT8A 3HB4X 1T3HA 3LUBA 2JLWA 4F1KA 1M76A 2QGNA 1ZIOA 3LHSA 4FXPA 4TTRA 2GD6A 3O26A 4BKPA 1Q0QA 3AP3A 4DQVA 2ZT5A 4B4UA 1RI5A 2IEDA 1X1BA 4FZJA 4DIBA 4ADSG 3G0CA 2OOSA 1WXFA 2DCUA 4D9EA 4UPVA 1J2RA 5K0GA 2OK7A 2PH1A 4D25A 4E6PA 1EUDA 4ERNA 2R0QC 3UMCA 2FR8A 4D44A 2X5XA 3PC8A 5E2AA 3ZBUA 1L8AA 5EG5A 3VDRA 4J0HA 1UJCA 4HL6A 3G13A 4FU0A 2FPIB 1TEVA 2QVBA 5KJ6A 4L4SA 4Q4JB 3THRA 3RT7A 5HM6A 1DAPA 2Q4BA 2GK7A 2D5LA 1F8FA 3P0IA 3HWRA 4ZCMA 4DLRA 2QYTA 2ISCA 4LV5B 1V95A 3RTBA 3AZPA 1PR5A 4EO7A 4MVCA 1MVLA 1YF3A 4DWOA 2PXAA 4JB0A 4FYWA 4IGAA 3UOAB 4GI5A 3H1BA 4O4HB 1P9OA 1EFRD 4IIDA 1AV7A 3M4ZA 2HRBA 3U7JA 4P82A 4MWEA 5K4GA 1A9SA 3A0RB 1EM6A 3BHMA 1L7AA 1GU7A 1SCDA 1UBSB 1KQ3A 1V7CA 2GPSA 1P7PA 4CT5A 3KFLA 1WBDA 3HVRA 3MCAA 2WTBA 2VXYA 3HWWA 2VT7A 4KV9A 4PHHA 3C87A 5FBZA 4EHHA 3DTYA 1E6LA 3AI7A 1HMPA 4URFA 5AOCA 5K2MA 3X1WA 3QKSB 4ARUA 3BE5A 2HUNA 2ENUA 5EMKA 3LCRA 4QFMA 3QXCA 5DM4A 5K0TA 3PXEA 4KE8A 1GTJ1 3ZUGA 2I3DA 4ZI3A 4RW0A 2Y1EA 1OLSA 2EV9A 3O8DA 1R27A 4LSZA 2AGVA 4O1MA 5LZ9A 3L9WA 2BBOA 1N8SA 4AJ9A 4UU7A 1LQTA 3A3YA 2P75A 2B1QA 3Q3EA 721PA 4XIFA 1RXEA 2P8JA 4QU5A 1VMDA 3EVDA 4PSKA 4M9XA 1FVFA 4XGQA 4HMPA 3WGQA 4JX8A 5JU6A 1K7FB 2GHRA 4GSYA 2EZ9A 1N8NA 4IIJB 1RAIA 1BRTA 3WMFA 5JFOA 2QBYA 3VPBA 3VR3A 4XA8A 1AS0A 2RJOA 3I76A 2RG1A 4L8VA 1ICIA 5BRJA 5KVVA 5IUJC 3E82A 4UVIA 5E3IA 3RCBA 1IY8A 1JGTA 2HHHB 4F9FA 2G09A 3GLSA 3Q98A 4G63A 2C3YA 3BMNB 4NCKA 3U3KA 4D96A 2GBLA 3GGSA 5C1DA 5LQDA 2WMOB 2IGTA 1ZA1A 2DULA 2VNJA 4KXYA 1O7JA 1XDBA 1UQRA 2XBUA 3N2LA 5JIBA 1YB6A 1NR7A 5AXAA 4PZPA 2CVHA 4JBIA 5I9NA 3HA7A 4G0PA 4KR3A 2NU6A 1GUFA 1GL9B 4TYWA 1XCGB 3AV3A 3OF2A 4ND4A 1FQJA 1S2LA 4E5PA 1I1QB 3CA8A 1W29A 5I3CA 1VOTA 4M1OA 4LVCA 4NBSA 4RGBA 1YTUA 1N7JA 3DFKA 3JQFC 1E89A 2P91A 4H7FA 4P38A 4DRXA 1I3MA 2XVYA 3SDBA 4PE5B 3OHPA 1OH8A 1ATZA 5B1HA 3EPHA 3VAZA 1F5NA 3DAOA 1E3QA 1Q21A 3FBGA 1IN1A 2PUJA 1YVRA 3DBOB 1E94E 3WX0A 1I2AA 4BECA 4IEFB 2QN9A 1XL0A 1NMZA 1E2FA 1DXHA 3FTCA 5LQJA 1E66A 1FQWA 2E5WA 3PUXA 1PJ3A 1QHGA 1RYYA 4ND5A 1T3ZA 2AXPA 3EA5A 5EJ5A 1WHTA 3ZWAA 1C14A 2EX4A 3FWNA 2H07A 4GMDA 2AJDA 4GNKA 4MQ5A 5E7QA 3YASA 1VKHA 1AB6A 1ECCA 4YEDA 2E4AA 3G5MA 5A71A 2NU8A 1A5AB 5JMOA 3ZV4A 4JVSB 1BE0A 1BWSA 2F9LA 3DTNA 4MKZA 3Q7TA 2Q0QA 2ZUDA 4NVRA 2QMZA 2X1HA 1PSZA 4FINA 5BT8A 1ZH8A 1CJKC 5BWCA 2KBEA 4CLRA 2MYPA 3PWZA 4WIAA 4E1VA 1JKIA 2I29A 2WNHA 4CKZA 1IHYA 3TCXB 1XTTA 4FDAA 5DBHX 2GAAA 3JD1A 5L4LA 3HM9A 1NT4A 2YFQA 4ZMSA 6LDHA 3U1BA 1QG4A 2ZDHA 2KMLA 2Q41A 2YL2A 4MQUA 4D2IA 3VNSA 4CIDA 2HJGA 1EXVA 2IZ5A 3SKXA 4EKYA 3FYCA 1MQAA 3R5SA 3OZTA 1U2GA 2NUBA 1N3YA 2W22A 2YHUA 5ALYA 1ODCA 1J9EA 2R6JA 1X80B 1VIDA 7AT1A 1TQ4A 1KAMA 4G0XA 4YWJA 4S1NA 3RBAA 4CRWB 1N25A 1EA5A 1H2ZA 3MBIA 3KZ1E 3N2GB 2YZGA 5C5IA 3GRKA 2CL5A 2RCYA 4K26A 3T1QA 1JYFA 4P92A 2PH3A 2QN1A 1K68A 3RVNA 3O7WA 1RRGA 2OZEA 2G72A 1M1NA 1QFSA 3UANA 5CRIA 3VR5D 5KQSA 2F43B 3V32A 1DTWB 4YX9A 4PSDA 1SB8A 4YO8A 3JQAB 1PO7A 3E3AA 2ZJBA 4ZDWA 4HNTA 1G98A 1TMKA 4LRQA 4N5DA 4P0PB 1IJFA 3F3YA 5JNUA 1OLUA 2FW9A 1KJYA 2LXNA 2QVCA 2ZANA 2V6BA 1RP7A 1Q3TA 2P9BA 3RE1A 3ETGA 1NPYA 1M1YB 2JGLA 3VZBA 3KWFA 3WICA 1OH7A 1C1DB 1PUIA 1RHUA 2LIVA 1DUSA 1FSFA 4KWCA 1P1BA 1X70A 2AG8A 5IH7A 1NONA 4YCDA 3G9QA 5BSEA 1JDPA 1HNNA 2X4GA 3IVXA 3PNMA 4RIIA 1YQUA 1RWVA 2GBLC 5AI8A 1H0HA 4BV9A 4CGZA 4R3UC 1NOJA 1WZUA 4RTRA 3QVSA 4HLDA 4P5PA 4PYIA 3WTCA 4QUGA 3BORA 1NE2A 4KACA 1FYDA 1U8XX 1PS9A 4PRLA 2OECA 4WXEA 4KXWA 5F3RA 3QY0A 4DNPA 4EKEA 1PX2A 3H6GA 1O6GA 2BJWA 2HQRA 4RORA 3AKDA 2QX6A 3C7CB 4RLHA 1TECE 1UBGA 3COPA 3MCUA 4NENA 2ZYDA 3F47A 2I1WA 4PLGA 2FLVA 3DW3X 2DM6A 3UJPA 4ENTA 3K0SA 3IQEA 3BMOA 3HP7A 5YASA 4KVZA 4Y3UA 3KE9A 4Y2PA 1Z4OA 2PFGA 3IAEA 3FUWA 4ZFNA 3RANA 5BY2A 1CJSA 3GU3A 4NAVA 1T4CA 3ENVA 2XYHA 1Y8CA 3VKWA 2LP4Y 1ADFA 2VBCA 3SF8A 1XPUA 5J59A 1DQYA 3N3AC 1EFVA 1OVGA 1RWNA 1IHD