4BYMA

Structure of phaz7 phb depolymerase y105e mutant
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
342
structure length
342
Chain Sequence
b'LTCGTNSGFVCKGTQTQYAGGFAPGVGYGGFGGGSCTATKTPVIFIHGNGDNAISFDMPPGNVSGYGTPARSVYAELKARGYNDCEIFGVTYLSSSEQGSAQYNEHSSTKYAIIKTFIDKVKAYTGKSQVDIVAHSMGVSMSLATLQYYNNWTSVRKFINLAGGIRGLYSCYYTGYANAAAPTCGSQNYYNSYTFGFFPEGWYYGVWVSNPWTGSGSTNSMRDMPAKRTAVSFYTLSAGFKDQVGCATASFWAGCDSAAKFASTTSNVKAQINVGAGSNATQADYDWADGMPYNAGGGDTTNGVGHFRTKTNTGAIIQRMLLTTCTGLDCAAEYTTGPKAAY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHB DEPOLYMERASE PHAZ7
publication title Biochemical Analysis and Structure Determination of Paucimonas Lemoignei Poly(3-Hydroxybutyrate) (Phb) Depolymerase Phaz7 Muteins Reveal the Phb Binding Site and Details of Substrate-Enzyme Interactions.
pubmed doi rcsb
source organism Paucimonas lemoignei
molecule tags Hydrolase
total genus 128
structure length 342
sequence length 342
chains with identical sequence B
ec nomenclature ec 3.1.1.75: Poly(3-hydroxybutyrate) depolymerase.
pdb deposition date 2013-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01674 Lipase_2 Lipase (class 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4bymA00
2Z3ZA 2BUAA 3VDXA 2WIJA 4UPDA 4NS4A 5LZ4A 5A6VA 3O4HA 3RKSA 2HA0A 1WB6A 2PU7A 1WB5A 4Q34A 3AIMA 3HC7A 5ALNA 5CXXA 4HRYA 1EHYA 4MYSA 4N8DA 4B82A 5AK5A 1TQHA 3STWA 1UKAA 5CH5A 5CH3A 1N8SA 4CCYB 1XLUA 2JGKA 4ARAA 4UBNA 4AN0A 4L9AA 2PL5A 4X93A 3WLAA 4X94A 4TGLA 2HA7A 4FLEA 3R3WA 4ITVA 1XRPA 3C8HA 5ALFA 3STVA 1XRMA 5A71A 5HKAA 3VKFA 1XRQA 3I2JA 5FXMA 1P0IA 1PFQA 1ODSA 5K3BA 4EB0A 2GBGA 1FFCA 3MVEA 4BB0A 2C7BA 4UHHA 4DMKA 3LLCA 3I1YA 4DNQA 4IH1A 5SYNA 1CUYA 4JH0A 2OCIA 3O95A 1QO9A 4BBZA 4QDOA 4PO3X 2OCLA 3S2ZA 3W9BA 1XZGA 2PSJA 2G5PA 4FHZA 4BP8A 2E3JA 5JAOA 4A16A 4H7DA 1XZEA 5JASA 2VJAA 2GZRA 3C6ZA 4LXIA 4BVJA 4WFJA 5E2IA 2C5GA 5FLKA 2PU5A 2JEZA 5I7UA 2X8BA 4MQMA 4YPVA 3WL8A 3I2FA 3H18A 3G9ZA 1KEZA 1EDDA 1GPKA 1Y7IA 1PJAA 4WFKA 1O6FA 5AK4A 3HABA 2OGZA 2J4CA 1JJIA 3MUNA 1JKMA 4E14A 1MU0A 3LIPA 1IMJA 1QIHA 3AIKA 2Y2UA 1S8OA 1DT5A 5ALUA 3FYUA 5DYYA 3G0IA 5ALQA 4ZV7A 4DYHA 3K6KA 4AMYA 4CG1A 3H2GA 2C0QA 2WUGA 1JI3A 4HVTA 2WFLA 2WJ4A 5JD6A 5LZ7A 1XZFA 5JAPA 4J0KA 1YB6A 5FP0A 4EA6A 2DQYA 3D2BA 3FAKA 3PE6A 5K3FB 2QXUA 3AFIA 4UBJA 2ZYHA 1BROA 2WG0A 1A8UA 1DX6A 1R9NA 2BFNA 5D3ZA 2D0DA 5EHNA 2QM0A 1MX9A 4OYLA 3WKBA 2YXPX 2RAUA 1L7RA 5CRIA 1BCSA 1MAHA 1KU0A 1WOMA 5HCUA 2AJBA 2OAEA 2OLEA 4CCWA 3O9VA 2HA2A 4CIAA 3IUNA 4FNGA 1CVLA 5ALDA 3U0VA 4MEAA 3ICVA 1TCBA 3A6ZA 3R0VA 4Z49A 3E4DA 4QEKA 2O2GA 3I6YA 1XQXA 4FBMA 2WG1A 2HL6A 1DT3A 3R3XA 4INZA 4F60A 2PM8A 3I2GA 3DL4A 4PF1A 1JU4A 4F21A 4WDRA 4Y2JA 3DS8A 5AICA 3E1GA 1B6GA 4XX1A 5ALEA 5IVDA 4YK7A 3WWPA 5ALZA 3WL6A 1QIMA 5LZ2A 2XUKA 4JYPA 1EK1A 3G9TA 3H1AA 4BAUA 2VAXA 5KWJA 1QTIA 3IUQA 3DYIA 1QZ3A 3UMJA 3RARA 3FVTA 4LYEA 1CUXA 1CQWA 2DHEA 3A2NA 1Q83A 2YH2A 4WJLA 4XWGA 3G0DA 3GELA 2XQKA 1QTRA 4MYDA 3DD5A 4G9GA 5FPPA 4L3WA 4TPKA 2OG1A 3D7RA 3K9BA 4RE5A 5DNVA 5CT8A 4D9JA 4BYMA 5EIHA 2Y6UA 4UUQA 4UHCA 4GHWA 3U1TA 4M0EA 5CXUA 1A88A 1UK9A 2FJPA 2HU7A 1JMKC 2XUQA 2WTMA 3EBLA 1GGVA 1MNAA 1IUNA 4BZWA 1EDEA 1EINA 1DWPA 2WHRA 5AJHA 2ZYRA 5HF9A 2DR0A 4FMPA 4H7IA 1H23A 2PSHA 1E8NA 1FFDA 5FV4A 2QTBA 4K2AA 5D6OA 1XQWA 2QT9A 4B6GA 2R11A 1GPLA 1AURA 1UOPA 5A62A 2CBGA 3QYJA 1VLQA 3WA6A 2VQ6A 3CCBA 4QWMA 1ZI9A 5ALKA 3D2AA 1R88A 3AZOA 5LIPA 1BU8A 2CEKA 1M33A 2IIVA 1W75A 1W6RA 2ZJ6A 1SOMA 1LPMA 3JW8A 3QPAA 4PSCA 3WA7A 1THGA 3BJRA 4C4YA 4CG3A 4HXFB 5CW2A 4C01A 2CB9A 1EDBA 4W1RA 1HL7A 4MXDA 3N0TA 4Y7DA 4PSDA 2GYWA 1EI9A 2C4HA 3ZLUA 1JMYA 3GFFA 1VA4A 3R40A 3WKCA 4I4CA 1XZMA 4W1QA 4Y2TA 3F96A 3L1IA 1UKCA 2EDAA 1BE0A 3PI6A 4HXEB 3WI7A 4AXBA 5BOVA 1HLGA 1L7AA 2JGMA 2XMRA 3PDCA 1MNQA 3PUIA 3BL8A 2XLBA 4W1PA 5F4ZA 1HPLA 3ZI7A 5JAHA 5LP1A 1CUHA 3F97A 5K5EA 2WUEA 2XMGA 5AKXA 4BCCA 4C88A 3DDUA 3RM3A 2C5FA 3PFBA 2Z8ZA 1AGYA 1GXSA 4W1SA 2WUDA 4BCDA 1R4ZA 1XZDA 1AQLA 1W76A 3FYTA 3I28A 3IA2A 5K3CA 3ZLTA 1JFRA 3WL5A 1GPNA 1UWCA 4Q3OA 2HRQA 4Y2YA 1IZ7A 4P08A 5SYMA 4K6GA 5DWDA 3M81A 5AKKA 5ALOA 3R3UA 1J07A 2ES4A 2XMCA 3I6MA 4E46A 1XROA 1E5TA 3IDAA 1QLWA 1RP1A 2WHPB 1UK8A 1DU4A 1LBSA 2VATA 2EEPA 4E11A 1IZ8A 2CZQA 1ACJA 3CCCA 4OYYA 1XKTA 4A5SA 5DTIA 4B85A 1IUPA 6YASA 4HXGA 1E3QA 3O0DA 2Z3WA 1LZKA 4IH4A 5LZ8A 4XVCA 4H0CA 3E3AA 3EQ7A 3FLBA 3X3HA 3IURA 1IVYA 4QDZA 3ESAA 2B4KA 1X2BA 1G66A 1USWA 4U2DA 5ALSA 5CT4A 2XUHA 2XQJA 4CIBA 4QDUA 2GBFA 1SCQA 1C7IA 2VJCA 1CUDA 1OXMA 3B12A 4B7ZA 3G0GA 1GQRA 4KAAA 3W05A 3FSGA 3GUUA 3WK8A 5AI9A 3BDVA 1XQVA 2VAVA 1FFAA 3TEJA 4Y2UA 2QOEA 4KE8A 4BC0A 4DNPA 5K3EA 4Y2PA 3Q8WA 1U2EA 5HQ3A 1E8MA 1BS9A 1Q0ZA 4X95A 2FUKA 1H2YA 1EA5A 2PPLA 4BP9A 4BVKA 4B0PA 4B80A 1GKLA 2VA9A 5ALLA 2QXTA 3IVMA 4ZWNA 4H77A 3O4IA 3G02A 1O6GA 4H7JA 5AIBA 5AH0A 1ZJ5A 1UOQA 1N5MA 3D3NA 5JALA 3QITA 2OCKA 5CT6A 1MO2A 2OAGA 1HDEA 2GYVA 3AIOA 1EK2A 4OB8A 5AKZA 3QMVA 2G5TA 1FJ2A 3ED1A 5JD5A 4LIPD 3BIWA 1WCYA 2GBCA 1QE3A 2EDCA 3C8DA 4H7KA 3STXA 3HJUA 3L1HA 3WIBA 4IO0A 3WWOA 1UKBA 3QH4A 4OB7A 3PF8A 1G5FA 5AK6A 4CI9A 4DIUA 2H7XA 3D4LA 4DMFA 1D07A 3G8YA 3A2MA 2AJLI 4X6YA 4IH9A 3R41A 3QPCA 4OU4A 5EHZA 4KAFA 2PSFA 4Y2VA 4UBIA 2JGLA 2PSEA 2WU4A 4EY5A 2OPHA 4DSZA 5AKEA 1R3DA 3ESBA 2PBLA 3C5WP 5HFNA 4BAZA 4U2EA 1T2NA 1HKHA 5A2GA 1U8EA 3WJ2A 3G9XA 4BC1A 5DYTA 3AZQA 5AM2A 2PVSA 4JNCA 3K2IA 5T4HA 1YS1X 4KE9A 2HDWA 1MX5A 5ALHA 2I78A 3BE8A 4EY6A 3NUZA 1U4NA 1ORWA 1YS2X 3BXPA 2JGEA 1XZHA 2RONA 1VE7A 4Y2XA 1A8QA 1XKLA 1ODTC 5CMLA 1JT2A 2VJDA 2G4LA 4H7HA 3ICWA 2H1IA 5K3DA 1TK3A 4FNMA 1OILA 2JF0A 4C87A 2WU3A 5C81A 2B20A 2H7YA 2J3DA 4G1FA 5HK9A 1W4LA 1KU6A 4LKOA 1OCEA 3ANTA 2BCEA 1ZIYA 1P0QA 4FBLA 5ALWA 4KEAA 1MT3A 1DWQA 4MWSA 1H2ZA 1XZJA 2W6CX 5AOCA 2BKLA 1E66A 2WJ6A 3N2ZB 1QJ4A 4UFOA 2DHCA 1WHTA 2ONCA 2GYUA 4Q3KA 4GI1A 5AM1A 5AM0A 4HRXA 1YASA 3F9CA 1H2WA 4QLAA 4JYMA 4OU5A 4BVLA 4C4ZA 4Y2QA 3MUOA 3GROA 4J0CA 3BJMA 2GZSA 2XMBA 4J0JA 3ZPXA 2WIFA 2XLCA 3DQZA 2RHWA 2WIGA 3ANSA 1EB8A 5LYYA 1P0MA 5E4YA 1NX9A 2XDWA 4DSAA 3TRDA 1A8SA 4EY8A 5AOAA 4ZV9A 4BDSA 1CUZA 2BAGA 3NOXA 5T4BA 2VT6A 2QZPA 4QLOA 1K5PA 4GXNA 3H2HA 1LPNA 3I6ZA 1E8DA 2AJCA 3SX4A 3IIIA 2VF2A 5ALVA 4RNCA 3KSRA 5JAUA 3OOSA 3D0KA 3I2KA 2AXEA 3FCYA 4MEBA 5K3AA 4EBBA 1VXOA 1CUEA 2JGFA 3R3ZA 4AO8A 5ALYA 1MTZA 3WK6A 1X70A 1Z68A 2DHDA 5KREA 2Y2VA 4TVKA 3LIIA 3OPMA 2J4FA 3NWOA 4B9AA 5ALGA 4U2GA 2HFKA 3FBWA 2ZJFA 4LHEA 5EIAA 2PSDA 3VJLA 2H7CA 1L7QA 2V9ZA 3F98A 4ZREA 2XMSA 4UBKA 3UUFA 1DX4A 4EHBA 3LS2A 3KOOA 3FYUB 3HXKA 4UBMA 4J0HA 3ZLVA 3DCNA 1EVQA 4ZGBA 4GBGA 2WFLB 4DGQA 2XUJA 3OG9A 5FUMA 2RHTA 5EFZA 1UK7A 3TJMA 4H18A 4WFIA 2CJPA 5IH7A 2R8BA 1SC9A 3L1JA 3FYUC 4QDTA 7YASA 4LYDA 1ODCA 2WHQA 4YASA 3C5VA 4AN1A 1P0PA 3W06A 5C8XA 3P2MA 1VA5A 2XUFA 4J03A 4U2FA 5DLPA 1UZAA 4P92A 5AKIA 1E89A 5I9IA 3H2IA 3ILSA 1CUAA 2JIDA 5ALXA 1JJBA 1QFSA 1UK6A 2BJHA 1VE6A 1CUFA 5AK3A 4AB1A 4YX9A 4X6UA 5IVIA 5J3JA 3QMMA 1SCIA 5EHQA 2OQIA 3LCRA 5DTJA 4RGYA 1MX1A 2BUBA 2QS9A 4JUIA 1EX9A 5JD4A 2W22A 4N5IX 1YAJA 1MPXA 1ISPA 3QMWA 5EI5A 3HZOA 2XUOA 4EUSA 1THTA 3HI4A 2LIPA 3BIXA 4BZZA 1UXOA 4AO6A 3QPDA 5FKJA 2DSNA 2J3QA 4NMWA 1XZLA 2WQZA 2Y6VA 1AC5A 1CUJA 4GLBA 4UHEA 4K6KA 2OXEA 2QJWA 3M82A 3QZUA 2WFMA 5ALPA 3C70A 1TIBA 5CT9A 4X71A 1VJ5A 2YASA 3H1BA 2AJ8A 2WLSA 4GECA 3FLEA 1I6WA 3FLAA 3KWFA 2FJ0A 3LP5A 2ZYIA 1JU3A 3IB3A 4ROTA 3WKDA 4DLNA 1CUVA 2JEYA 4KR0A 5A7HA 3G9UA 1K4YA 5DYWA 2VSQA 5BWCA 2WM2A 3JWEA 4QE3A 3O9MA 1UT6A 3DEAA 2AJDA 1SCKA 1XZCA 2XB6A 5JZ9A 5DNUA 2C0PA 2V96A 1G42A 2CMFA 4K5QA 4PNZA 2QR5A 3DOIA 1YB7A 3IUMA 1QFMA 1GZ7A 1CV2A 5AI8A 4HZGA 3SC2A 2ACKA 1LPPA 3STUA 4H35A 1WPRA 3FVRA 3RLIA 2WKWA 4EY4A 2JGJA 2B61A 2HIHA 4HTAA 1CUCA 4X6XA 1AX9A 1NU8A 5LZ9A 4G5XA 4FLMA 2ROQA 4CCYA 5CH8A 4FFVA 3AILA 3DLTA 4B84A 1ORVA 5JARA 2PUJA 4N8SA 1HBJA 4WDQA 3MGAA 3D59A 5D3KA 4EY7A 2YYSA 4HAIA 3HACA 4G9EA 3DJYA 4X90A 3WMRA 2VEOA 1FFEA 5JYCA 2BUCA 1LPBB 2XMQA 3C6XA 4AMZA 3WKAA 3WWDA 1TKRA 4AX4A 3PF9A 1ZIXA 4BTLA 4B9EA 2ECFA 4GW3A 3HRHA 5T4FA 3GBSA 1CPYA 5BWBA 4P93A 4KYVA 2C58A 3VVLA 2CKMA 4BCBA 1MJ5A 4Q82A 4KJXA 1EH5A 5HF8A 2JGIA 1K63A 2DQZA 1EVEA 1NU6A 3SK0A 4NVRA 4AO7A 4U2BA 5IVKA 5AO9A 2Z5GA 3V9AA 3R3VA 5FRDA 3AINA 3V48A 2HRRA 3OM8A 5DJ5A 1IUOA 2HA6A 1BEZA 4XIIA 3WL7A 5JATA 5LKRA 3HLKA 2HU5A 3BDIA 3FWHA 2QJRA 2WJ3A 3C87A 1Q0RA 3G0BA 4QDXA 2QUBA 3QVMA 4QZVA 4S0XA 1YSCA 1U65A 2V97A 5AKYA 1AMNA 2I3ZA 1QIGA 3BF8A 2H9YA 4KAJA 1VZ3A 4FFWA 4B0OA 3GZJA 2RI6A 2JBWA 3C43A 1GKKA 1VXRA 1W52X 5AI0A 4J7AA 1XFDA 3V1KA 5C8VA 5K3FA 2ZVDA 2WUFA 3T4UA 1QO7A 4Q05A 3VJMA 5AI4A 4ZI5A 3GA7A 2VTVA 1XQYA 1Y37A 4N5HX 1C4XA 3EIOA 5CTAA 1UOOA 3CN9A 3VISA 4W9RA 1XLWA 4K6HA 3WQHA 3VVMA 1ZJ4A 1QIEA 5DNWA 5AKGA 3HSSA 3OURA 5IVHA 1K6EA 3AZPA 5HFAA 3DKRA 4ARBA 3KWJA 5AM5A 3V1NA 3M83A 1MAAA 4G8DA 5AHXA 1J06A 3STYA 2HU8A 3T52A 4OPMA 1AKNA 2XQIA 2XQFA 2XE4A 3HYSA 4ZXFA 1YR2A 3YASA 1JJFA 4PV7A 1Y7HA 4X92A 5AP9A 5E4JA 3CXUA 5JZBA 4A23A 4M0MA 5AKHA 4MWTA 3AUKA 3ESDA 4J0GA 2PX6A 1CR6A 3QM1A 4UHDA 4WY8A 5CT5A 4BRZA 3FNBA 4IQ4A 4BE4A 1QIIA 5HQ3B 1ZGBA 4FTWA 4KE6A 5ALTA 1QIFA 1T4MA 4CG2A 1N1MA 2WIDA 1N5RA 3FCXA 4DMHA 4UBOA 5FDFA 3IUJA 4OD0A 2D5LA 2HM7A 4AQDA 4G4GA 5EGNA 1DQZA 5FPQA 5ESRA 5IKXA 4G8BA 5C7YA 5HZGA 4DNOA 1Q84A 3UUEA 2QRUA 1QGED 1EXWA 3IBTA 3KDAA 5FOQA 2P8SA 5ALJA 4AZ0A 4KE7A 4HS9A 2ZSIA 2VJBA 2UZ0A 2CUTA 3O4GA 2K2QB 5C8ZA 3I1IA 3E0XA 4BATA 1BN6A 1LPOA 4Y2SA 3WWCA 1DINA 2G63A 1CQZA 1ZD2P 2HA4A 1R1DA 3WZMA 1ZI6A 3WJ1A 1YA4A 4BDTA 2ZSHA 5D7BA 5HF6A 2O2IA 3R3YA 1DTEA 4WY5A 3WZLA 1QIDA 4F5ZA 4U2CA 2PKYX 4Q1VA 1H2XA 1F8UA 3ESCA 3WK7A 4L0CA 4QWWA 5JANA 5T4EA 4J3JA 1XZAA 5AKJA 2XT0A 4N8EA 3PFCA 5AI6A 5ALRA 2OQVA 1FSSA 3IULA 2QKYA 1QIJA 1XRNA 3VXKA 4Y2RA 3B3QA 1RYYA 4OUKX 1TCAA 3D5EA 4GWLA 4ETWA 3M3DA 2HHAA 3I2IA 2V98A 2XUGA 3QBJA 4EZIA 4C89A 4B83A 1WM1A 1CRLA 4UHFA 3VJKA 2XI4A 1BN7A 3H04A 5CBKA 5BV7A 2WIKA 3C6BA 2FX5A 3V1LA 4C4XA 5KBYA 1RWQA 4DM7A 3JYHA 5ISMA 4W63A 1ZOIA 1DWOA 4C6HA 5LZ5A 1BEEA 1CUBA 3V1MA 2RIPA 3WYNA 1ZD5A 4X3CA 2NW6A 3G7NA 4FLFA 4M0FA 1XLVA 1F0NA 1F0PA 4QA9A 4OSEA 4I3FA 3W04A 1MN6A 2Z8XA 1XRRA 4CFSA 4BAGA 3H17A 1ZGCA 1LZLA 3DKKA 2QMQA 2OCGA 4BRSA 3A70A 5CURA 1GT6A 1YCDA 3DOHA 5LKAA 4WCVA 5HF5A 3HEAA 1ZICA 4X7BA 1WPXA 1XRLA 2IX9A 3Q0TA 5EHXA 3F67A 2WSLA 1LNSA 5JADA 1LGYA 3PICA 4H7FA 4GDMA 5AKLA 5ALIA 1CIJA 3ZV7A 1GQSA 3A2LA 5HK8A 5LLSA 2WG2A 4KRXA 3H0CA 2O7VA 2XMDA 2ACEA 2VT7A 3O4JA 1AUOA 4RE6A 3OC0A 2XUIA 3I2HA 1J2EA 2WHPA 4Y9SA 1LPAB 4UBLA 3WYDA 2XMZA 1HQDA 2HA5A 4G8CA 4PSUA 4BTVA 3W9UA 1CUIA 2HFJA 1CFJA 4UFPA 3W2TA 1CLEA 1H22A 1R9MA 3AJAA 2PUHA 4J0IA 2DFPA 1CEXA 3RK4A 2GBIA 2X5XA 1ZD4A 4PQEA 4X97A 2XQGA 2ZJ7A 1CUWA 1UFOA 3G0CA 4BE9A 2ZYSA 5AI5A 1XZIA 5I8PA 3B5EA 5AM3A 4X91A 4UHBA 5EIEA 2QUAA 3DNMA 4G4IA 4KRYA 1X2EA 2XUDA 3ZWQA 5A7GA 5ALMA 3BF7A 1DQYA 4ZRDA 2QVBA 3WK9A 3EQ8A 3WK5A 4RPCA 1XZBA 1SFRA 3D2CA 4FDMA 4E15A 2Q0XA 4XJVA 2ORYA 4V2IA 2I03A 1G4HA 4IHAA 1WB4A 3S8YA 3F8SA 1LLFA 5KWIA 4QNNA 2I3DA 2X76A 1A7UA 3OTQA 1R50A 1AZWA 1BCRA 3SWWA 5AIAA 4O08A 1ZI8A 3DYVA 2XUAA 3WK4A 1PV1A 4KACA 5YASA 5HKBA 4JEIA 4FOLA 1C7JA 3FOBA 1J1IA 1EB9A 1WHSA 3H2JA 2OGTA 4H7EA 5AM4A 5AOBA 2B9VA 4L72A 5JIBA 1CUSA 3EF3A 4B81A 3EQ9A 5H3HA 3WIOA 5JZSA 3WWEA 4FWBA 4OCZA 4DNFA 4DTCA 4DMCA 1CUUA 2XUPA 2Y1KA 4UFNA 1VZ2A 3C45A 4GEGA 2O2HA 1ZD3A 4Q3LA 3H2KA 1XZKA 3WKEA 4F0JA 1VKHA 2WILA 4MQLA 2HADA 3KXPA 1W1IA 4LXGA 1QOZA 1TRHA 4P9NA 3FSGD 5E4TA 4AZ3A 1ACLA 2O7RA 2RGUA 3BWXA 4X85A 1YAHA 2DCMA 1QONA 2BGRA 1ETHA 1TAHA 4NZZA 4G4JA 1LPSA 3CN7A 3TGLA 3KD2A 3DL7A 1VOTA 4OB6A 2HA3A 1FFBA 2BGNA 1LBTA 3PUHA 4PW0A 1CUGA 1QIKA 1K8QA 3C6YA 2WTNA 3H19A 3NGMA 2OGSA 1YA8A 1B41A 4LXHA 1F6WA 1TCCA 4J0DA 1BRTA 4FKBA 3STTA 4MJ3A 4X00A 2WFZA 2IITA 4I19A 5A7FA
chains in the Genus database with same CATH superfamily
4RQTA 3HL0A 3LUFA 4MRPA 4D5EA 3LUKA 3IQIX 3RVDA 3GWGA 4X62B 2ZUCA 3KEGA 1FQKA 4H7PA 4FKMA 1QVVA 4MTCA 1HDYA 1KO4A 2FZWA 2BUAA 3HWWA 4Y2HA 1ZCBA 2AEJA 3DAYA 2HK9A 3OPNA 4PCVA 1D5WA 2FETA 4I08A 2FZCA 2DSTA 4BNTA 1ZSNA 1OA1A 3C1AA 3FMOB 2O0LA 2I3BA 3OE7D 4RFVA 3T0FA 1LRLA 2IIPA 1WB6A 2WMNB 3OX4A 2FW1A 3SQLA 1EP2B 1UBHS 1WB5A 4V24A 5GTDA 1CT9A 2OCAA 5B1HA 5JYDA 2B5WA 4BQOA 1U3WA 4MI1A 1BHSA 2IYWA 5CXXA 5FADA 2NPFA 4TZKA 2M6KA 1UZNA 1KJNA 3UMVA 1E9CA 1I6KA 1QORA 4C3UA 1QVRA 1NF9A 4LVNA 1S02A 4Q3CA 3TRJA 4DG9A 4GOND 3DV2A 3STWA 5DX8A 5DLEA 2GJ9A 3KFXA 4AN4A 1MOSA 1UKAA 3DF9A 3RYFA 1QB7A 1N8SA 5KVVA 4H1VA 4Q16A 4YRNA 1XLUA 2JGKA 4UBNA 4W7IA 1QO0A 5EYPA 4PGAA 5IAGA 4L9AA 4BOYA 3BD9A 3HXLA 3OQ6A 4QNRA 1DUSA 4JP8A 2QGFA 2J6CA 3P0HA 4K0KB 1PJZA 3WLAA 5I51A 2HZBA 1LI4A 3OE1A 5DTEA 1G5RA 1WHSB 3WMGA 1MJGA 3H9EO 1IXKA 3RCBA 4UVDA 1JSLA 1DRWA 1OFVA 4URFA 4GOOD 1XRSB 1J0EA 2OM2A 1ZM7A 3A9VA 1L4HA 4ZAGA 4AFNA 1I5RA 3EVBA 3R3WA 3V8MA 1EAYA 4QRHA 3DBRB 1F1BA 1ID8A 3H9BA 1XRMA 2PUDA 2XJ9A 2XTZA 1Z39A 2GGSA 1K9SA 3BBPA 3DOUA 1G8YA 4YAOA 3PGLA 5IJXA 4B6OA 1EWYA 4G0UA 3LAWA 5FXMA 2XNDA 2YWEA 2R66A 3HA5A 3LK6A 1OXXK 4KN5A 4OHZA 3ZH9B 3DFIA 1NXTA 5DHUA 3WLLA 5JQGB 3A4NA 1T6BY 1TFRA 3LO5A 2JI8A 1U7HA 5DN9A 1Z29A 2IY7A 2QTZA 3EAQA 4GE0A 4U3JB 3VOBA 2IS2A 1QRTA 5JLAA 3OEED 3EYWA 2O3UA 4FOTA 3MVEA 3H8WA 3K9CA 1P4JA 1OYOA 3Q7IA 2GHTA 1J0BA 1QVWA 2BDTA 5SYNA 4IZIA 1CUYA 1FDTA 4AKSA 2D7CA 4JMLA 5A06A 1SCUA 5IUJC 2OFPA 3LNTA 2JVJA 3Q2OA 3OCCA 1WSBA 1Z75A 3LX8A 4G1EB 3R8CA 2UXCB 2BBOA 3B70A 3KTFA 4TMWA 5G02A 4Z86A 3ZLJA 3RSFA 2IYFA 4JLUA 1JQ5A 4PO3X 1M6NA 2OXTA 1X8JA 2PJUA 5EL0A 1UR5A 3S2ZA 4EZBA 5BWNA 2ADFA 2EKDA 1XZGA 3F6CA 3ISTA 1VRVA 4R7ZA 3U4CA 1YR1A 3RSOA 2YZNA 4L8GA 2RG1A 2CXTA 2IIQA 1DDIA 5KNBA 1WUTA 4DSTA 5JASA 2VJAA 2P9HA 3H05A 1UP7A 1N57A 1I3LA 4FZJA 1ISMA 1BDIA 4CKBB 1NVVR 7ABPA 1P3JA 2HRCA 5K8JB 2YMPA 4TLLB 4ZN6A 1F2UB 1SKYB 2O8VA 3O2QB 4J7UA 3QIAA 3R8XA 4JITA 1NZFA 5L8VA 1FTWA 5J2TB 3WB0A 2C5GA 5IJ9A 3RJZA 2PU5A 4XUEA 3GQVA 4YJGB 2B8NA 2DEUA 1BU5A 2PT9A 4HEJA 1QR6A 1W9MA 5A5GA 1JLMA 5K6RA 3KU4A 1OTXA 4YA6A 3G9ZA 5D8DA 2WHEA 1IJEA 1K1EA 4B79A 4X20B 1NAIA 1EFVB 3CRZA 5CAEA 2XZDA 1JSCA 5FCDA 1PJAA 2CXSA 5CM2Z 3M6FA 4WFKA 3SZUA 1UADA 1O6ZA 2CSXA 4JXJA 4DA4A 4MS1A 2C98A 2E7ZA 1RVDA 3HABA 3OMLA 2BFDA 4FYHA 4OJQA 4URYR 2OGWA 2OGZA 2VXBA 2NXCA 5EKSA 4AMUA 2Y8EA 3X1YA 1X7XA 1JJIA 3PQDA 4B46A 3MUNA 3U49A 2QROA 1X8LA 2O2YA 5MN5A 1Y6RA 5ILQA 1TC2A 4YO8A 3VOTA 3RADC 4G09A 1QDLB 3DEHA 3T4PA 1GRVA 2CFOA 1UH5A 1KAHA 3KYDB 1IMJA 4IYRA 1OB5A 2KJQA 5D85A 3DZDA 4OHYA 1X14A 4C2TA 3RAFC 4M1TA 3FYUA 2PXCA 4BO8A 4XUDA 1Z4JA 3QEJA 4ZV7A 1IN7A 4IOKA 2P0EA 3MJRA 5B6IA 3HKEB 2XTJA 3I05A 2C29D 2QF7A 4AMYA 3FDFA 4CG1A 1N6OA 4GOMD 1IJFA 2B4YA 4LCBA 3CLKA 3OKPA 2WUGA 5LB4A 4BUCA 2G67A 2O2CA 4BLRA 3PQCA 3EMBA 5A5DA 4RKYA 5JAOA 4M0PA 2DWQA 4LYAA 3TNJA 1YQUA 4OQPA 1A9PA 4K2HA 5LZ7A 1JVBA 2B0JA 4AX8A 4XUGB 3VBCA 5BSFA 5EJFA 5JI2E 5B2EA 4JLSA 2ATCA 4IDFA 5BR4A 1BMTA 3EPLA 1QYDA 1SH7A 2HUPA 3JR7A 2QM7A 3T9AA 4ESOA 3U61B 2ZCJA 5CVTA 3FAKA 3GOQA 3AJEA 2C04A 2C2HA 2KX7A 3PE6A 5DT9A 5L9AA 1PJ2A 1YV9A 2R2GA 2QXUA 1XBTA 1P1HA 2W71A 5IAEA 4CM9D 5EZ6B 2TMGA 2PRJA 1V45E 3SHTA 3LPDA 3W1EA 3L6UA 4JI6B 3WIEA 2BFNA 4BQPA 1WW8A 2D0DA 4JHXA 4TWZA 1R5JA 4DDMA 1I4TD 3L2OB 5EHNA 1EU1A 5ADWA 221PA 4R3UC 3SX2A 4TSFD 3OJ0A 2WKRA 4PONA 3GH1A 4OYLA 1NR7A 1H6DA 3LKZA 3DMRA 5CRIA 2ZUUA 1Y8QB 4ZVOA 1MAHA 3IR6A 2BFEA 1D5CA 3BTUA 4RORA 3P20A 4DDKA 2OCBA 1JUDA 4YTEA 4MRMB 4MUNA 5EPUA 5HCUA 1PJ3A 4LGCA 2IIBA 2X22A 3MSXA 3TSCA 4OA5A 1H69A 4OKNA 2D59A 1UPFA 1YJXA 4YROA 1BVRA 4RTNA 2HU2A 3KBBA 4CT4B 4LNUB 1E1YA 1WPQA 4RV4A 4BZQA 3DT8A 3BVPA 1Y1TA 1YVEI 3ELUA 5JMPA 4WKCA 3TSAA 3V00A 5DNYB 1HV8A 1KBOA 2NO0A 1W36D 4NCKA 3PZRA 4BU0A 2HA2A 1S2LA 4CQNA 2P2DA 3CX3A 3G3EA 4CIAA 3H0EA 4J7XA 1IVSA 1PS9A 5LU9A 4BB9A 1F2DA 1GHTA 3O0TA 1CVLA 5ALDA 4KQCA 2RHOA 1XL0A 3U0VA 4NK5A 5EIBD 3GJRA 3RAPR 2GXQA 1HE4A 5KQLA 1L5ZA 3GAFA 5KYWB 1LF5A 1T8TA 1TCBA 3A6ZA 4G4SO 4RZIA 4PPNA 5EC8A 3FF4A 3UPDA 2BP7B 1QHXA 3U7RA 2XOEA 1IBMB 3B8HA 1NYQA 2OGUA 4BX2A 2O2GA 1EDOA 1TAGA 1KTIA 3K0KA 1MA0A 1PP4A 1XQXA 1XDWA 2HL6A 2Z6AA 3TKAA 3S40A 1M6VA 1AUXA 5IFKA 1ECBA 3DGEC 2HEGA 4W5NA 2DUWA 1DT3A 3R3XA 2V7TA 2Z2ZA 4FYYA 4F60A 2HCBA 1JIXA 4FXOA 5K3SA 1NHWA 4BMDA 3T9CA 3F9RA 4ZGGA 1GPUA 2CXOA 4PF1A 5HSGA 4F21A 2FZGA 4WDRA 3ZTYA 2FW0A 3EZXA 3ZZ0A 2NPIA 3TZCA 5BVHA 2JBAA 3RS5A 3GUVA 4IIGA 1B6GA 4XB1A 2CT8A 3DQQA 1B0PA 4JI7B 1P9LA 1XK6A 2NO7A 1X39A 1WZEA 2DFLA 4IMJB 4YP5A 1G9TA 1N2OA 5ALEA 1LSUA 1WR8A 2I4OA 4ND3A 4RPJA 1JDPA 4JSRA 1LY1A 3L3BA 2NZWA 3GNQA 3Q0IA 4WL0A 4PZDA 3B1ZA 2OM6A 3U80A 1ZK0A 3LUPA 2XUKA 3TLBA 3NNDA 5I9BA 1XR3A 4NZ9A 1EK1A 4QPZA 1RKUA 3G9TA 2XZLA 2PZLA 1N7GA 3KKNA 3N76A 4EW2A 2IYUA 1VMDA 2VAXA 3I2YX 1EXVA 3NFYA 1L9KA 4MUMA 3N8GA 4QLBA 4PO9A 5CFNA 2B4RO 4J4BA 3AW9A 4RWZA 3DYIA 3IPYA 1QZ3A 4OGLA 1T8PA 2PQ2A 4JY7A 2DF8A 3IELA 1JPUA 3O8OB 3A1EA 4YJDA 5KNCA 2YH2A 2YWCA 4GPD1 3ZQUA 4K9QA 3G0DA 3GELA 4YJHB 3EMDA 1Z2AA 4ZU3A 4OJNA 1OX5A 4H4DA 4WVLA 5AVTA 2PGAA 1Z18A 3VH2A 1R0WA 1J1UA 2ZRJA 2EJUA 3U09A 1J25A 2QMYA 1Z4KA 1TUEA 4MYDA 2MR5A 2ZI4A 1RXYA 4L3WA 4QGFA 3TLZA 1BC5A 5DN6D 5JMTA 4ZZIA 4I8XA 1KMQA 1R6BX 2NUAA 2BT4A 2WVAA 5DNVA 3OPYA 4BN5A 4BYMA 1W9HA 3JRNA 3KKMA 5EIHA 4YJ3B 4R83A 2EVWX 2GZ1A 4I6EA 1IWOA 4NG5A 4UUQA 3AF5A 5JNUA 3FKQA 4K7JA 1BQ3A 2CE7A 3HYRA 3KFVA 3CE9A 1DRVA 4PR3A 3RTGA 2O8DB 2O20A 1JQKA 4MV5A 3IOYA 1U2GA 1UK9A 2HU7A 1KH1A 4NS1A 1H4VB 2DLCX 1ILEA 1G291 1XRJA 4P36A 4YN3A 5H16A 4DIMA 3H84A 4D0SA 3KZOA 3EBLA 1GGVA 3F7OA 3RVKA 2IXFA 5IF3A 2O8BB 3CNOA 4ZGWA 1ZNZA 3V9PA 2QP4A 1YDGA 1KEEB 2OEPA 2CHQA 4AW9A 2V6BA 3PT9A 1IU9A 2R47A 4M9QA 4P2GA 1EINA 4C0KA 3CR8A 3IT3A 4JLJA 5CIYA 1GGHA 4IXWA 2EQBA 2FEPA 3EXFA 4NATA 4A8JB 1TIKA 5DBEX 3PDIA 3T3MB 2Q4RA 2YQ5A 1N9KA 4F2DA 2CMKA 1GM5A 1BE1A 4Y1GA 2VF4X 1MORA 2ZYRA 5HF9A 3T5PA 3T6KA 4LJ5A 3X1JA 1JLHA 2YIMA 3S55A 1Y1KE 3D5QA 3EF0A 4FMPA 4H3KB 5CPBA 1ODIA 3RV4A 3ZW8A 2Z5FA 5H82A 1YU6A 3RU9A 3UANA 1FQOA 2FPMA 1AB6A 4OLFA 2QGNA 3UNXA 4OJTA 1TU4A 4BO3A 4OIFA 4XR9A 1Z0ZA 1ZNWA 3JZIA 5B7GA 4ZCIA 5FV4A 1X7ZB 4DKXA 3LHDA 1GJRA 3ADOA 2XE6A 4UAUA 2QIOA 4YLEA 3ZJTA 2IZZA 1R0KA 2GEFA 3CT6A 4DUGD 1O77A 5MDHA 5TXGA 4DWWA 3B1XA 2OBYA 1M8GA 3DXXA 3HCNA 1X38A 4YBRA 5HVNA 2PRYA 2IEDA 1PR6A 3TXYA 4KMMA 4RD4A 1PT6A 1UOPA 4NZNA 4UJ5A 2YW9A 2O8CB 4N82A 3K4QA 3VR2D 2G40A 3NHYA 1H2AS 3QYJA 1VLQA 3HM2A 4FYVA 5AXDA 5TT1A 1XGKA 3SS9X 4BX3A 4JN6B 4CL8A 4ZV4A 1GVNB 2HGSA 4TXLA 5AHWA 3CCBA 3EZ2A 4NDNE 1GKIA 3DZCA 4AS3A 2RE8A 1Y98A 4P4LA 3U7GA 5FYQA 2IELA 2ZG6A 1FVXA 4D99A 2QRMA 1ZC3A 4A2QA 1K97A 4EL5A 3IQEA 5B55A 3KV3O 4JP2A 5TB5A 5LIPA 5EWJB 2O2XA 1ICEA 1Q1AA 3NOVA 2NUBA 4R40A 4IZHA 3IERA 3NRBA 2QW0X 2EG5A 4MV4A 1X6VA 3VI4B 3ECAA 5EXXA 4A2WA 1E2GA 3UN1A 4P4SB 2PA0A 1BXRB 1Z34A 3N0WA 3VHLB 2ZJ6A 4QYMA 3K32A 1WETA 1TF5A 3R7BA 3KC2A 1NW8A 4MINA 3F1LA 1LPMA 5DSTA 4NYMQ 3F3KA 3K0EA 3RH0A 4ESVA 3FYHA 4HN2A 4IXMA 4PSCA 1JTFA 3SXUA 5DGDA 1R4MA 1RM3A 3OIUA 1ZK1A 1JEAA 2AI3A 3JQFC 2KMLA 1KI4A 1J8YF 2QL7A 3BJRA 3ORQA 5KDLA 2I1VB 1FSFA 4C01A 2FWPA 4L3VA 4V0SA 3FNRA 4H15A 4UNNA 4HP8A 4W1RA 3N6RA 5H8WA 1Y9JA 2B98A 1XD2A 2B2NA 1MF7A 2E4ZA 2RKBA 3SF8A 1M2VB 2JGAA 4E5VA 1AKMA 1FS6A 4LOAA 1F0KA 4H4EA 4NE7A 1JMYA 4YT5A 1OXBB 3LYUA 4RJ2A 4DARA 3R40A 3DTVB 3WKCA 4I4CA 1P17A 4D74A 4KPYA 4LFAB 1EVJA 4G23A 1XZMA 4QL3A 3ROKA 1QGUB 1HDCA 4INOA 3PXAA 4U8GA 4Y2TA 4CWAA 1U7XA 2B5VA 4FT2A 4LYFA 4EOGA 1A4RA 1LK0A 4FMCB 3FHTA 3KQWA 3K20A 4F8EA 2IEBA 4KBGA 2FEMA 4FOOA 5AD1A 9MHTA 4A4DA 3AOEC 1GGMA 4IL5A 3QEAZ 3I23A 1NG1A 2OV1A 1MW9X 3II6X 4HXEB 4TS1A 3LW8A 5EN4A 5FNVF 1N6KA 1N8TA 3GR6A 3SM3A 3SLKA 3QLEA 4H9GA 3FBTA 3KOUA 3BHNA 3IIMA 1JA9A 5B57C 1F9EA 3PS9A 1Y3AA 1Y6QA 4A03A 3OP4A 2YV1A 3AVQA 3PQ7A 4KGVA 1Z2NX 3DFUA 4OSOA 3T12A 4UHJA 1V11B 2XLBA 5F4ZA 1HPLA 4OXIA 3I37X 3K70B 4BX0A 4MQ5A 2WPDD 1GZ6A 2GN4A 5CCDA 1TT5B 1PQWA 3K0BA 3MB8A 4RZ3A 5JNLA 5JYEA 3F97A 1NATA 3NJ8A 2UYOA 3E5NA 5K5EA 1O96A 3QX8A 2NSDA 2OLJA 3JVIA 3P9ZA 4G1UC 2GHIA 2ATIA 2AQ8A 1HETA 3B52X 2EKLA 4KDEA 4C88A 5FPKA 3DDUA 4TSRA 3NWJA 4RK4A 2SKCA 3X2SA 4ONEA 1PSWA 3EGDA 1V1RA 2P9ZA 3D3QA 1WABA 1V47A 2B6NA 2ZYVX 2W2NA 4FSHA 1V4VA 2PL9A 4Q7JB 3ZY3A 2X5OA 1PGQA 1E3SA 3BB3A 2ORIA 2WM3A 2Y0CA 3L5KA 5EUBA 3KETA 3C3MA 3EB9A 3P0RA 3QVOA 1R4ZA 2ZIUB 3ZE8A 4DA7A 4ENTA 2QTTA 3LLVA 4ECEA 4QUBA 3TPCA 1W76A 2XGMA 1V8DA 2O5EA 2CFIA 3FYTA 4OQDA 4D4IA 5AFSA 4HT3B 1GR1A 2ZRNA 1V3UA 3TLMA 4B4KA 1N3LA 4YI5A 4D42A 3PD7A 5KS2A 1W25A 1MJGM 3NHLA 2XE8A 1NMEA 2HLNA 3EEYA 2P4EA 3H6HA 3MCTA 1VHTA 2DPXA 3TX2A 4NCBA 4ND8B 1J1ZA 3K6JA 1C9NA 4AJLA 4YGXB 4Y2YA 4BFSA 2HV8A 4MLPA 4Y9UA 5SYMA 2LCIA 3QFFA 4L6AA 5I7VA 4GOKA 3DYBA 1TKBA 3M81A 2ZBDA 3OKFA 3R3UA 3NRCA 5EXDA 1JAXA 1J07A 4QYTA 3UTCA 1AUVA 4DKJA 1FLNA 2I2CA 3HI6A 3VC2A 5HILA 3TMKA 4E46A 4Z2YA 1XROA 1FYEA 2DETA 3SBEA 3TTSA 2WYUA 4F2WA 1RP1A 4BEJA 5GIPE 3D0QA 2VRBA 3D31A 3Q1LA 5C34B 1EFRD 1LBSA 1T4CA 1J9ZA 4P0TA 1FPQA 3H97A 4UEQA 1MIOA 3A6JA 3MW8A 2CZGA 2FMUA 1I4DD 5E3JA 1Y9ZA 5JY1A 3BYZA 1KMIY 1TQ2A 4GI3A 1P31A 1VPVA 1ZSYA 4RSRA 4MK4A 3GO4A 3PNOA 4FOSA 3HP7A 1SBYA 2CNNA 4IKPA 3WNVA 3DEZA 2QYHA 5CB4B 5LJIA 2PYZA 2WSBA 4HXGA 1E3QA 1OXTA 1KOFA 1WMDA 3KYJB 4L8LA 4E21A 3GPIA 2XOKA 4ZQCB 1RRFA 1C2YA 3SIXA 1ODLA 3BGVA 5CDFE 3SE0A 3AR6A 3KOZA 5B58T 5LZ8A 3UMYA 1L4GA 3HKBA 4LUCA 4LZLA 1F4LA 1X0VA 3E3AA 4PINA 3B53X 3TFQA 4S1NA 3PPYA 3MS4A 2XXBA 4TTPA 3B3FA 2JARA 3LYHA 4CMGA 3AOGA 3LQFA 3ESAA 4UOEA 1Y4SA 1X2BA 1OI7A 3T5GA 2KBEA 1PJLA 3G6WA 1YO6A 4BNDB 5KHLB 3A04A 3CYFA 4KQEA 5TIIA 2JJ8A 1P4RA 1OY1A 3IKMB 1U7TA 1GUFA 3A9UA 1GVHA 1D6MA 4U2DA 4AJ4A 2Q8NA 1H3NA 3PPIA 2OUKA 3PC8C 4FC6A 4DLBA 4ZICA 1H5NA 3S99A 3C98A 4MWOA 5KVAA 1J0DA 2GBPA 3LHFA 4RHXA 4QDUA 2GBFA 3EODA 4IQGA 4IZOA 1PZXA 3ER8A 3DVSX 3MPOA 1CUDA 1NQTA 3NV7A 3JATA 1O95A 3ZOKA 5IZ4A 5E3HA 3IQXA 3R5TA 1GQRA 4KAAA 3LGAA 4F4FA 5EUCA 1YZYA 4NEQA 2NGRA 3GUUA 1HYQA 4BU1A 3L8GA 1TQDA 2M1XA 2BKAA 5AI9A 2FU5C 3T35A 4KO3S 2V7VA 4F5DA 1N34B 2ZUSA 4B2YA 4RD1A 1S5PA 3HKDB 1BD4A 3UWOA 3P7MA 1R66A 1XWWA 5C18A 3IEKA 2QOEA 4IHJB 4KE8A 2WJWA 3TFWA 2CY0A 4MQEB 3DLAA 3SC6A 4DNPA 1TEZA 4RVHA 5HQ3A 1U2EA 2MSDB 1BJKA 1BMFD 1U9YA 3H5IA 1TJNA 4D8VA 3W5CA 1H05A 1T34A 4KTVE 3O8DA 4CE6A 3TYXA 3NTVA 4BVKA 4C06A 1GQFA 2IUUA 4GI2A 1I0IA 3SVLA 1TYEB 1D03A 1XB2A 5E4FA 1KXJA 1NMZA 2BE7A 2QD3A 1DAPA 4H77A 1WMFA 3CR3C 5KI6A 1UOQA 3WTBA 1P5FA 1E98A 1U8TA 1UBRS 2VNJA 2YNMC 2R25B 5HS6A 2Q1UA 4M8LA 4KU4A 3W6NA 5CT6A 2L0XA 2AG8A 3ZDEA 1G17A 2QAGC 4CKEB 2FTKE 1WZIA 2CSUA 4TVBA 3R0XA 5CVUA 5BRAA 4GMFA 1N6RA 3KPVA 5JWRA 1P1BA 2JLQA 4BNYA 4CCSA 4NJEA 1I8TA 4YJ2F 5C1BA 2FLVA 2P78A 3SE7A 1Z5WA 2G5TA 2O05A 4L5CA 4Z8YA 2R6JA 1FJ2A 2D4HA 3C2QA 3ED1A 3N2LA 3E2MA 2B8EA 3CJTA 3EG5A 1SAYA 1WIWA 3FD8A 4QTXA 5JD5A 2X1LA 1JSRA 2ZBFA 1Q0HA 3ONWA 1HNWB 1UBTS 2GZHA 3I09A 4Z1MD 2YINC 2ZE5A 3NAQA 2VA8A 1RI1A 2KSQA 4G5GA 5IBQA 1B8VA 3WRYC 3G5AA 2WINI 5IUNC 3FA2A 3FX2A 2EAUA 4Z7JA 3WAKA 1UWVA 3WYEA 2DR3A 4M9UA 4IVNA 2Q7XA 4ZVTA 4L73A 1ZGZA 2WU0A 3WWOA 2FZ4A 5B1IA 4N6NA 1W0KD 2FPGB 4XSVA 1IXZA 5KVQA 1RPJA 4K9OA 3CSDA 2WZQA 2PUFA 2WMYA 2ECKA 2R00A 1GILA 4F1WA 1O0CA 4CF4A 1WZCA 2IUSA 2RGRA 2VP4A 3G8YA 4EUKA 1NN5A 4CKCB 1UPBA 4Y6QA 3R41A 2DTXA 4BQNA 4D3SA 1NX6A 5A5FA 1T15A 1ZC4A 1A7KA 3MILA 1ZMOA 4KAFA 4X3OA 3GU3A 5EHZA 2X1VA 3L49A 1JHYA 1QQAA 1VQ1A 2PSFA 3T5CA 1CY1A 4Y2VA 5G40A 3VZDA 4H4CA 3L46A 1Z6QA 2E21A 3SDSA 2IODA 2AFHA 2WU4A 2KW5A 3LG2A 4AF7A 2OPHA 1RXCA 1STOA 5FQOA 1R3DA 1NVAA 1TB4A 4R8KA 3WLOA 3GZNA 1JZQA 3QJ5A 3UB2A 3UCEA 2CXUA 4BAZA 2EYUA 3H0KA 4IV5A 1A77A 3FCSB 3ZZNA 4K8OA 4U2EA 1T2NA 3EGCA 1XEAA 1HKHA 2H92A 1Q2XA 1KO7A 1RYHA 2H48A 3NASA 3WJ2A 3F5FA 3T5DA 5A4IS 1Z13A 3G9XA 4XA8A 2V6IA 4FHFA 4YBZA 4BC1A 3G89A 5AM2A 2NADA 4JNCA 2H63A 3D4IA 3QUCA 3K2IA 4B3CA 3OI7A 4XM2A 3Q9NA 1XMVA 2C0CA 2HDWA 5T6BA 1K5HA 2J7PA 3IBCA 4P4NA 4Q1AA 2P9QA 4IXNA 5ALHA 1ZFNA 1SCBA 2I78A 4I4TB 3BE8A 5FV7A 4KREA 4R1PA 5U4QA 1IZ9A 1RAFA 1CJSA 3E15A 4JP1A 5T67A 5CHYA 2F43A 2XDYA 1NVEA 3BXPA 4JBNA 3HCRA 3PIDA 1KPIA 1H85A 1XZHA 2HH9A 2IEYA 3AEQB 3CKLA 2I5PO 5A9SA 4QATA 2RK4A 1GSAA 4JOSA 121PA 1VE7A 3ROXA 3VH4A 3W7BA 1H2RS 2ZJ3A 1D7OA 2R6DA 1UBJS 2VJDA 4H7HA 3ELYA 2RK6A 1JH9A 2Z83A 2X9QA 3PNMA 2IYRA 3E9QA 4BLSA 2VRNA 2DRIA 3JD3A 1XXHA 1DG1G 1RE0A 1RYDA 3FI9A 2JF0A 2H85A 4RESA 3FIJA 4V0KA 2WB2A 1KOGA 5REQB 3G82C 5KPDA 2H7YA 1P9RA 5B58C 4HQOA 2ZYAA 3CY6A 3OZIA 5HK9A 1CY0A 5HKKA 1U3VA 2RK3A 1W4LA 2EKBA 3R6TA 4C0AC 4NCAA 5GVRA 2YWDA 1OCEA 3ZU3A 5IAAA 2BCEA 2Q5EA 5BWOA 4IIJB 4MWSA 2DERA 1NMXA 1FYVA 1NULA 1Y1PA 1H2ZA 1E7SA 2EFDB 1AZLA 2IOHA 2QTCA 1Y5NA 2ZE8A 4ES6A 1BE6A 1R8YA 3MRSA 1KS2A 4XOIA 4LSGA 2YVLA 5EMKA 2VOJA 3GPDG 6ABPA 1JHZA 1XZJA 2ETXA 4QASA 3BAFA 1T9HA 1ENPA 1O0BA 2EW8A 2QHXA 1OVMA 1DLJA 4KXFB 2PMDA 1G5HA 3RVPA 3LWZA 4MARA 1NSTA 1MAUA 2JIQA 3S2FA 1AQNA 1L4UA 1HFEL 2LIVA 2DPGA 4X24A 2ICAA 5A4DA 3EDRA 5AJZA 4DT1A 3DLPX 4LQLA 2ONCA 3OTOB 4BNHA 2B37A 3GBPA 3LC7O 4Q3KA 4F1KA 3ZDCA 4GI1A 2VNKA 3JPWA 1M6YA 3X1ZA 2DAPA 2JI6A 3EDCA 1XU9A 2MINA 3B7GA 2IYVA 4QUJA 3KZVA 2YOHA 4B45A 1H6AA 4KQ1A 3T7RA 5AW4A 4YUWA 1QCYA 2CXQA 2ZTHA 4DXDA 1T25A 4RK1A 3ZU6A 2DBZA 3HY3A 3DJFA 4OU5A 2YVUA 3OM1A 4OF4A 3WZ2A 4BVLA 5FQNA 1OZGA 2EIHA 2OYCA 3UK2A 2W2KB 1WTCA 2RB4A 1UXKA 3CUEF 1QP8A 3ET4A 4AS1A 1GN8A 2F3QA 3AMVA 3BJMA 1T4DA 3ZBPA 2IYAA 4X6LA 5B6PA 1RJ9B 2C7VA 2WIFA 3AF4A 4GX0A 2XLCA 3DQZA 5E0OA 4H6PA 3RAEC 1U5BB 5AJVB 1JHVA 1PZFA 1UKYA 3RVRA 3EG9A 5LYYA 3HY4A 1G63A 4IS3A 4XDGA 3U19A 4KXVA 4MVJD 3NEAA 2QQEA 3L6CA 5E4YA 1NX9A 4LC0A 2DZDA 3S5JA 5CIQA 3ZS9A 2I7TA 4LF5B 4RQUA 3UCXA 2IY8A 1MGPA 3CPJB 4YWJA 4BDSA 1LLQA 3D6UA 4MUJA 1N7HA 521PA 3AVYA 2CL7X 1RWMA 3NOXA 4BJ6A 1XNJA 3SEZA 8OHMA 2JGNA 2GK7A 3DOEA 3P19A 3PHBE 2VTEA 4L8VA 5ICFA 2ZAOA 5ADHA 4RD6A 1DDOA 2V7QD 4MGHA 1G59A 3MQ4A 1P73A 3RS7A 5IZCC 2P2ZA 4GX2A 1SELA 2H5EA 3H2HA 3RI3A 3OU2A 4JL5A 1SC1A 1TJYA 4HDCA 2D0OB 3SZRA 1E8DA 4UXIA 3LT1A 1X3LA 2C1XA 2PFKA 4IGIA 3I45A 1YQEA 2PANA 1DI0A 1VHQA 3FPHA 2VF2A 4D6PA 3JQ7A 4RNCA 2GPSA 2VT3A 3L0ZA 5D51S 1C8VB 3KSRA 2AG5A 3GUCA 1IOLA 4HDRB 1J9EA 3TZBA 5JAUA 3VKGA 3A8TA 4YJ2A 3ZZUA 5E38A 2NZXA 4MLZA 1AN0A 1JB1A 3AI3A 3FB4A 3HYNA 5CK5A 2X0FA 5KMGB 4R54A 3QK7A 2ZU0C 1E2IA 4KYTA 4LZOA 2LCQA 1VP3A 1OIWA 2AKYA 2RGNA 1NKTA 3HR8A 3LHIA 1VMKA 4KI7A 1O9BA 1QFJA 2IYOA 3OHMA 5JDIC 4NJOA 3NKFA 3OHPA 1T13A 4FEYA 4IDGA 4PLYA 1EUQA 3D6FA 3HG7A 3L7IA 4DXHA 4Q24A 2F8LA 4WRRA 1Z68A 2XCOA 4AQYB 5ADUS 3AT1A 2Y2VA 1T2DA 3O8LA 4JV5B 4E5KA 1NYTA 4AJEA 3DTVD 2V55B 3ASYA 1H0SA 2Q5IA 3I5YA 4E94A 2O50A 4Y9RA 2V7EA 4JI1B 1PTJA 2RHJA 3CRRA 3NWOA 2Z2YA 4EUHA 3M49A 4CQMA 5TQ0B 1M1ZA 4DLKA 3WGQA 4LI0A 4EEZA 5ALGA 2Q6LA 5BV1A 2HFKA 4MLDA 1NT2A 1PJTA 2FPPB 2ZJFA 3CIFA 1K06A 3F71A 3I3OA 4HPXB 4P81A 3VJLA 1BX0A 3FF1A 1OV6A 1B93A 4HQNA 2Z9CA 2NAFA 2PGDA 5C0OE 5TDHA 4NJMB 1EZ1A 1T9GS 4ZAVA 3UHPA 3D6MA 3H3JA 4ZVUA 4EKEA 4ZU1X 3MOGA 4IX1A 2GN0A 3WNBA 1X77A 3EWNA 2OBFA 3ESZA 4KNWA 1U31A 2I2AA 3NBAA 4M22A 4M6WB 4OHCA 4OHPA 2JAUA 4IY1A 3RS8A 4A82A 4I9GA 3QW4B 4B2LA 1DP4A 2QE7D 4Q7LA 1P4GA 4CI0B 3IO5A 1YKFA 2HJHA 3PSHA 1J20A 3QQ5A 4D92A 3T0IA 2ZUEA 2FH5B 3TK1A 4JJ4A 4A1FA 1JTVA 3DPIA 4IIEA 4CKCA 4WASA 4XXHA 4PHTA 1Y3CE 1P62B 2OBMA 2OL4A 4GQIA 4OQXA 3VGJA 2OT3B 3PLAE 2C3UA 1ZU5A 2PUEA 1Q3HA 4FYMA 4XUCA 4D79A 4YMHA 1W0JD 4RAQA 4E1BA 3GJ0A 2CLDX 4IFEA 2XUJA 4CRWB 3BQMB 5K0TA 1GOTA 2FXVA 2V5UA 2L17A 1DKPA 3K2EA 3QX7A 4XM1A 3H5RA 3TJMA 4YCNA 4JI8B 3ODGA 5BP7A 3FCUB 1LX7A 3BXZA 5JUWA 3K0CA 5KSWB 1RRMA 3HL4A 4GRIA 2JK1A 5IM4F 1J5EB 2X41A 4YPFA 1W5TA 4KQHA 3NM5A 7ADHA 1Z8HA 1G38A 3B1YA 4PY2A 1OWOA 1N5DA 1RAAA 1U1IA 2LXNA 2QVCA 4LYDA 5GPBA 3AI2A 3I4CA 3INGA 4N7RA 1YQ9A 2VI5A 1I2BA 2WHQA 1NQWA 4YO7A 3ZU4A 4EIWA 4DDUA 4AN1A 3H7IA 2RI0A 2VDKB 4JHLA 5C8XA 1YRWA 4EYKA 3E3LA 2XUFA 4AKGA 3CUVA 1BCSB 2WDZA 4G5OA 3OUUA 2CCGA 1U2QA 1YU9A 1GIAA 2ORVA 5HM8A 1K92A 1E89A 2EBWA 3URMA 1GYRA 1RS0A 3CGWA 2PUGA 1CUAA 3FGOA 5ALXA 5HG0A 3GUHA 3JALA 3O84A 1I5EA 4UM7A 1MO5A 4H1HA 1LXCA 3U1BA 4M9CA 3NBKA 1VE6A 4BWFB 5CUQA 2FEWB 5AK3A 4OGFA 4X6UA 2NG1A 5IVIA 4F1JA 3EGWA 5AYVA 4TWIA 4IDDA 4D3YA 1JE1A 5H9VA 3MWYW 1Q5PA 1DEXA 1SCIA 2JASA 2VWHA 3BMNA 1UFKA 2BM8A 3KQYA 3ORHA 3W7AA 2ZSEA 4JXZA 5COQA 5IC6A 1RWKA 2OQIA 2Y3IA 4XI9A 5JO9A 2W6IA 1CDOA 2CUNA 2C4TA 2A9PA 4RGYA 3ZW7A 1WBBA 1F48A 3IDOA 3ZHUA 1UC8A 1EX9A 1T5HX 2CLFB 4JLPA 2Z2KA 4Y0AA 4FN5A 3TLJA 4HB4A 5JSUA 1GUZA 1FU8A 4LG1A 3CZ5A 2XW6A 4UD2A 1P2VA 2I2XB 1MC5A 2EKPA 4FILA 2GXSA 1MPXA 3VO2A 4DTIA 2GD2A 1P7PA 3D3KA 5EI5A 4YP7A 4YRJA 1CDDA 2QRVA 1L5GB 1DVRA 2QTFA 2XUOA 3DM9B 1XE3A 3LUGA 2O9JA 2LIPA 3GEHA 1A27A 4PSKA 1E99A 4R1QA 1JWAB 4BZZA 5K0FA 5KSZA 3DWIA 2QJFA 3LC2O 3MOIA 4A73A 2FG5A 3QY9A 5KQGA 2J3QA 4NMWA 3W5DA 1Z4OA 3H86A 2EX1A 3O8BA 3FMVA 3LWNA 2PGIA 1AC5A 4Z9FA 1CUJA 1K8RA 2GZDA 2I2DA 1YCHA 5B1EA 4HLCA 4B3MB 2PWYA 3ZJUA 1OPXA 2ZKLA 4MKIA 2E6KA 3WWYA 1MB2A 2OXEA 3DQPA 4J43A 1KMMA 3IKVA 4MQFB 2PQ0A 4EX6A 1RYZA 1HLPA 4EY3A 5L45A 1T1EA 2FSGA 4IXDA 1XN1A 1VJ5A 4M8SA 4X71A 1GO2A 3ZCUA 2WLSA 1EFPB 2QLNA 4GECA 2QUIA 2BN4A 3MCAA 3QKUA 4U8HA 1NOKA 1PR5A 2YNMD 3WQBA 4F9GA 3HBMA 3WYBA 1XA3A 5JFOA 4BVFA 1HH4A 5TARA 2XF2A 3MFQA 3MBOA 1NVDA 2ZYIA 4TV8B 4UU0A 1AA6A 3CS3A 4UEWA 1GPMA 1C80A 5KYTA 1TU0A 3AL3A 2V8BA 3LQKA 1EE2A 2P0YA 4PRYA 3FHJA 4Q93A 2DG2A 3G9UA 1W8DA 1K4YA 4O1IA 5DYWA 5J59A 4P54A 4E4RA 5BWCA 2BSAA 4M21A 3W34A 1RHMA 4TYYA 1MMFB 1Z2OX 5FTKA 4JR2A 5FHQA 3CO5A 3JX9A 4XLZA 3O9MA 3MGGA 4Y6OA 3DAHA 3D5TA 2JA1A 1UT6A 3N2KA 3TLAA 2FPSA 1PZMA 3EGEA 1MQAA 2AJDA 4XZ3A 5IT0A 1OIXA 4UVEA 3DOCA 3AJ9A 2XB6A 2QRNA 4V3CA 3WGYA 4TKMA 5KOJB 2HJ9A 3QVJA 4KBYA 2C0PA 2VS1A 1HA3A 2DT5A 2ZRAA 1NW9B 2LDBA 4YQEA 3EIFA 2A5JA 3SCZA 4RMJA 2JIMA 3MT7A 1Y63A 1V8FA 1YGPA 4R1TA 621PA 2DU8A 4V3BA 4Q1CA 3DOIA 1BFUA 1GCGA 4FINA 1U99A 4GX1A 3EX7C 4HQ0A 1YB7A 1MPTA 5FPTA 5T7BA 3CVUA 2C2YA 5KQRA 3W5IA 5E9JA 1GZ7A 1FL9A 2QTRA 2YFYA 4OFZA 2RAPA 4RVFA 4RHEA 3RYCA 1Z5GA 4JJKA 4AY4A 1DOHA 5HJ7A 5KYUA 1Y8RA 4HZUA 3ZE7A 4K9LA 2ACKA 5CJJA 1QFYA 2HAEA 5D01A 1Y82A 3PL5A 5IS2A 2WICA 4AAYA 3ANMA 3DDSA 3GXBA 1R6XA 5H3CA 1KDPA 4X44A 3IA7A 4YMTA 1E2FA 2BDUA 3A7EA 1QBKC 3RC7A 3R6DA 3QG5A 3GFBA 1QAOA 2PWBA 3PVZA 3BTSA 2GN1A 2GBLA 4DQLA 3NDBB 1WBDA 1SZDA 3EXG2 3ILVA 3EW9A 3F6YA 1NN3A 2BGIA 2RHCA 3FTNA 3KOMA 4HTAA 3UJ8A 2BEKA 2QG4A 3P32A 4X6XA 1V9SA 1DIHA 1NU8A 2WJGA 3M6MD 2QIPA 2ZBPA 3DHYA 3M4YA 4RZ2A 4UU1A 3X1DA 4BQSA 2QAIA 4G5XA 4EYQA 4FS8A 3SHQA 5CA1B 1C9YA 1IBLB 3AB8A 4DA6A 3IT1A 4QXPA 4CCYA 5JZOA 3RF6A 1ECFA 3FUWA 4TLBA 1LNZA 4ZCRA 1JR2A 2VCYA 2IOFA 5HIMA 3VHRA 5JRJA 3ONFA 4GMKA 2TMYA 5EXEA 2DFDA 4BP3A 1E79D 4V0OA 2ODNA 2Q5FA 3DLTA 4B84A 5LM3A 4FM9A 2ASEA 2BMVA 5D3QA 3RU7A 3RUAA 3H99A 4GIBA 2IHNA 2W98A 1EHIA 1KI2A 2DWCA 1LJUA 2P69A 3M9XA 5E1BA 1H4TA 4U7TB 2OB2A 2YYSA 2YJZA 3OVMA 2CNWA 4O2AA 3W7VA 3MUFA 1CRZA 4G9EA 3DJYA 4OAQA 3DC2A 5G41A 1OI2A 2IBTA 4Y6LA 3O38A 2VEOA 3ZGOA 5I4KA 5KDDA 1CZLA 5EMLA 4DCOA 2LKDA 1AUPA 3Q7RA 4ALJA 2O3TA 1FFEA 2G71A 5IM4A 4LFBB 1TI7A 4I3HA 1C1HA 4Q1DA 4CFZA 1LPBB 3QWFA 4RF5A 2D7DA 1KAMA 3IOBA 5I9LA 1MABB 3U3DA 4KGXA 5BOSB 4L74A 4KWHA 1Z4PX 5EZYF 4ADSG 1QAMA 2YHIA 3LWDA 3V32A 1XEXB 3WWDA 5IXSA 5HA5A 1GQOA 4MGEA 2ZTMA 3U7IA 1ZY2A 3MBIA 2ZBVA 1SHUX 1UPUA 3EISA 4FE7A 1Z0IA 2DX7A 2ECFA 4JMPA 3QVUA 2FK7A 5F5NA 1H8ED 5T4FA 4EGFA 1N2CB 1P91A 3GBSA 5E2BA 3WGVA 2PR2A 2OORA 3LBNA 4EJ2A 3OF2A 1PVDA 3IBGA 1YOVA 1Z7GA 2HPVA 2HNBA 3UT0A 2XCTB 3R0JA 1RCUA 2P2NA 4YQYA 4CEHA 1EFLA 1LCIA 1T1GA 2JGIA 1KE2A 1K63A 4E6EA 3PNVA 4X1YB 4RFLA 1CB7A 2E48A 2ZREA 3BIFA 3H5LA 4EP1A 4J49A 4NVRA 3DONA 1GNTA 1JX6A 4G65A 3KQLA 1B8OA 1DTWA 1W87A 1XTSA 2CVZA 4TQAA 4XIYA 3P2OA 1U8AA 3ER6A 1L8XA 2J33A 3CVYA 1YE5A 2P6OA 5AO9A 3D2LA 5KNBH 4LF9B 3EVDA 5LP6A 4QXAA 2PDAA 3SQMA 4UE6A 3RVMA 3OM8A 5JD3A 5DJ5A 4DMLA 1CDEA 1KO8A 4I5DA 1ISJA 1IUOA 3EOAI 3G1TA 4L6CA 3UUGA 3QNMA 2W4MA 4XIIA 5AW3A 1IOZA 4CU5A 3GFSA 4FQ5A 1IPHA 3ZXYA 2X8JB 1E60A 3BDIA 3ZBTA 2QJRA 1F12A 2JFVA 2WJ3A 3Q9LA 1OXVA 5HBRA 3OFKA 4TX1A 3W3AA 3CRVA 3H2BA 3IALA 4R01A 1UBLS 4ZHQA 3QF4A 1FUEA 4QQKA 2NVUA 2MYUA 4NYJQ 4S0XA 2H1SA 2O57A 5CTJA 1YSCA 2OK7A 3KQKA 2GYYA 4OBWA 1MLDA 5DLYA 1G19A 3FHCB 1QGOA 4YRFA 4ZZ2A 1IWPB 3JXEA 2IDJA 3WYAA 4E88A 2C57A 2IU3A 5C52B 1RHRA 3WX0A 5JSFA 4MP6A 3TBKA 2JCYA 4FW9A 4PZZA 3NH6A 5GVSA 4DAOA 4JDPA 3W77A 3OUZA 4UOQA 2YYAA 3GLQA 4LRSB 3VM6A 4BPBA 1ES9A 4LMAA 5ICGA 2V97A 5FR2A 3DKPA 4O5AA 1WX1A 1RXUA 1V95A 3Q4GA 1I4LD 1AIPA 3MMNA 3Q12A 3VX3A 1PV4A 1K4KA 4I1OA 4LFCB 4UM5A 2G88A 3KCNA 4K28A 2BM0A 1YJ8A 1X3SA 2OUIA 4HAXA 1XCMA 1GXSB 1M1YA 2C4VA 5CAEB 2PH7A 2BGMA 2RGGA 4LYHA 4F45A 1RZ3A 1KYVA 3KD3A 4ZMRA 1QDUA 4ZP1A 1QQ6A 2COUA 4QBHA 4RIGA 1PNTA 1Z33A 4FFWA 3V4PB 1IXYA 3JRXA 4PPGA 3GN1A 4HR7A 5CLFA 4HH0A 1ZCFA 3FTPA 1EUYA 3GRCA 1C9KA 3P5SA 2VPXA 3SHOA 1U3GA 1RZVA 1W85B 4PC2A 2JBWA 5FPHA 1GKKA 1V16A 1NDHA 5JG7A 1XFDA 1U28C 3AJRA 2HN9A 1J8FA 1BKDR 1OLUA 1Y3FE 2CJYA 1VIMA 2GO1A 2HWKA 3RBXA 1RXEA 3CNQS 2WF8A 4RKQA 4O02B 2PIAA 5FWDA 4RF3A 3L43A 5K0JA 3ES9A 3GA7A 3VHXB 1LQ2A 4B6QA 4QM7A 2I4RA 4P84A 1M1NA 3BJEA 3GLHA 3L01A 3MBKA 3NKVA 1M72A 3V1YA 1L7PA 1BGVA 1YB2A 3M2TA 4IEIA 1Y37A 1KNQA 1T0IA 2R8ZA 4GFDA 1JDJA 3GJYA 4IR7A 4TTQA 4ZT7A 1A96A 1ADBA 2C9CA 2F1OA 4H08A 5EIAA 3UH1A 1VGVA 2Y1OA 4HC4A 4CTKA 3O93A 4OMDA 1XLWA 2P11A 2UUPA 1RP7A 4P33A 3IVGA 4KH1A 4YXWD 5IC5A 1QH1B 1WD5A 1ZJ4A 4RZSA 1TYCA 2WWIA 3VZCA 3V97A 5DNWA 4C0XA 4OUDB 4Z0TA 3ULKA 2CUKA 3HYLA 4LK3A 1RWNA 3MMZA 4PE5B 3ZV4A 4RLHA 1FW8A 4CNBA 2GM4A 1RKBA 1YJ5A 3JQAA 5DB4A 2Z56A 4D5GA 1C0KA 1F14A 3OZWA 5JNWA 4O4IA 4E1VA 1X9IA 4P53A 4PIMA 3FVVA 2J07A 3DKRA 3JAWB 3V8PA 2A8YA 3GIDA 5FJIA 1RABA 2X14A 3AY0A 1E2BA 1L5OA 2JVIA 2PD3A 4QQFA 3KWJA 4GT1A 2Q6IA 4YCAA 5G1NA 5F12A 4D43A 2KLBA 4N41A 2EARA 1DDGA 2ZAGA 3B9PA 5AW1A 3ND9A 5J4LA 5AHXA 2CNLA 1FPMA 1GTSA 4EF4A 5HUQA 4GBMA 4V03A 2PUAA 1HTBA 3MYYA 1X7YB 2PV7A 2HU8A 3VO8A 1JKXA 1A5AB 1R5NA 1U2SA 1ZHOA 2FF5A 2W8BA 3ZK9A 3M0EA 4ZTZB 2BFOA 2I2FA 5HWSA 1GRQA 1M34A 2XUZA 3B89A 1KA9H 4AY3A 1UKEA 2FSIA 5L3SB 3V2GA 1KY4A 2V6JA 1Z17A 3CNLA 1YVUA 2GEKA 1W1WA 3CRQA 4QBFA 3U26A 4TRMA 1R0BA 3DMYA 5KWEA 3ABIA 3QEBZ 2XGJA 4UVGA 1YZGA 2AYZA 4UCXA 2V0CA 5E6RB 5A5VA 3MELA 1PGJA 3SQWA 3LYAA 2JAHA 2ATVA 4BUZA 1IIRA 3T4XA 4X92A 1JJVA 3CXUA 4ENWA 5BMOA 5JZBA 3MS7A 1RLOA 4HUJA 3UHFA 2BFAA 2GHRA 5LXTA 1JEEA 1L1QA 3DMPA 4QJBA 3T5MA 3VYRB 1U8FO 2EOAA 4EK9A 1IE3A 2W58A 1ZM9A 3KLBA 4IJQA 4OGWA 2FFJA 3AUJB 3CZAA 5E7QA 3KHKA 3WC4A 3JD1A 1C29B 5DVZA 3AUKA 1AHIA 1A76A 2OD9A 2Z4TA 4TSKA 1CDZA 2YVQA 1P5HA 3I92A 3EIXA 1X1CA 5F5XA 4CL0A 2P4SA 4AF8A 1NNI1 3OWXA 5K99A 4MYRA 3TQCA 4ALKA 4KPUA 2JFWA 1Y3HA 2IYQA 4HQKA 1RRPA 3UMGA 1OI4A 4KJZA 4L95C 4FZ3A 3CVXA 1DJPA 3B9QA 3JYLA 2HO4A 1USKA 2B25A 2Q5QA 2QMHA 1WSAA 3AR2A 3NUQA 3MTAA 3AR9A 4MYCA 3I3SR 5EZYA 3UZUA 1FLDA 3IJPA 4KAXA 1T8YA 4BE4A 3KLNA 3M34A 1FP2A 1KAGA 3KAPA 1QIFA 1T4MA 1KFCB 1N1MA 2OFXA 1V3VA 2GESA 2WIDA 2XB8A 2BL4A 3FCXA 1N2IA 3IOEA 3N0RA 4HUQA 1PHPA 5G2OA 4EB6B 4XYEA 5FDFA 4HVAA 1UZMA 3I62A 2QN9A 3AUSA 3NFRA 2C92A 3F8WA 3TNDA 3UK0A 5I47A 4LCJA 4MS4B 4AQDA 5CBPA 2IS1A 4Z2AA 4HAOA 5I01A 3JR3A 1N9GA 1Q1BA 4XVUA 4ZJPA 4RIFA 4F3NA 3GJQA 2XQVA 4F11A 1I7DA 1PGNA 2GEBA 1EQUA 4LCEA 4LZNA 4Y98A 5J1TB 5KNCH 1RRGA 4JEHA 3DW3X 3F7NA 4XB2A 4DNOA 2E4XA 5DNEA 2DWUA 2C5AA 4QOFA 2GK3A 1O7JA 1QGED 1U2TA 1H8HD 1UPXA 1DAMA 1ZR2A 2P8SA 3LT5A 4JAVC 3KTDA 3KKQA 1YL7A 4AZ0A 5K3OA 2YJNA 1A95A 1U0JA 2C78A 1X94A 2VJPA 5EEHA 4RIHA 1DMSA 2JJ1D 4M9SA 5INTA 1JAYA 1LBEA 2HQRA 3I9V6 4PICA 4WLNA 5C8ZA 2AR7A 1BS1A 1MAVA 4Y1FA 3FDXA 3A3NA 3LD9A 1C3XA 2ACWA 4KWEA 3B48A 3RVJA 3QYAA 2CEAA 3M4JA 3QKSB 4EMUA 3DT9A 3B7PA 1U1GA 3PJEA 5I3CA 2TYSB 3R6LA 2GTIA 4KR3A 4Y2SA 1UP4A 3QVWA 5EY5B 1EPUA 3EK2A 1J39A 3AP3A 3OA2A 1N2JA 2H65A 2I99A 2QT0A 4FFRA 4G0NA 4MGKR 4IV0A 2I1WA 1SURA 3RU3A 1R1DA 2O2DA 3WZMA 5DM70 5SZIA 1ULHA 4CIVA 5LFAA 1SBQA 4YRLA 3A2KA 3GW8A 1P5RA 3K30A 4XQ0A 1F0YA 4TUYA 1M9NA 3L7MA 3ZS8A 4YJFA 3VTZA 2FWRA 3FOFC 3ENKA 2OZLA 3AO0B 3KLMX 4NWIA 3H4IA 4MVCA 4RADA 4TSFA 2HJVA 5FOVA 2W6ZA 2FY8A 2ZSKA 1UBKS 4PNPA 1CS4C 3NO4A 3SEQA 4NV1A 1N3YA 5GIOE 5TC4A 4LRQA 2RGXA 1CD5A 1RYBA 4QT0A 3FOZA 3GFOA 3U16A 4WTOA 3R7WB 3IXQA 2OCDA 1AGNA 4QBIA 3TL6A 5E2AA 4C0HA 1PEYA 3ZC3A 5ALRA 4PN7A 1A9OA 1XX6A 4YCJA 5DHRA 1G20A 2OQVA 1PW7A 1FSSA 3T7KA 1RI3A 3IULA 1D0VA 4B31A 3CVVA 4UUBA 4LJAA 1QIJA 4Q15A 1XRNA 1YBMA 4WLUA 3T5TA 1KZYC 3S44A 4K1XA 4M99A 3B3QA 3AKCA 5HKLA 4Z4CA 3BMCA 4LF8B 1KIMA 1LFAA 3ANLA 1TRKA 3CZQA 3RK0A 1T5SA 1NMSA 3VU3A 4OEHA 1N5OX 3H9QA 2BFFA 4UUPA 3M3DA 1E7MA 1NY5A 1F4VA 2Y76A 4R9VA 4GI7A 2IV3A 2XUGA 3H6KA 4LEIA 1OFUX 2FN4A 1GAXA 4RPKA 4CFYA 1NY6A 4MR8B 5IT9A 3DHVA 2ANCA 4QOSA 1CY7A 3B3AA 1UWKA 2ZIFA 1CQXA 1F6DA 3KJIA 4AWXA 1LB1B 4M98A 2YIJA 1DQRA 5FWNA 3ZGXA 5C2JB 2FX5A 5TS3A 5KBYA 1HT1E 1W2GA 3CEAA 3FZYA 3RJ5A 1AGPA 1Y9AA 1YK0A 5HP4A 2QTAA 4Q4AB 5C80A 1ZIOA 2I67A 2PX5A 3W6UA 1JDSA 2AW5A 2ZGVA 1W29A 1ZK4A 1IATA 2ZXFA 4MGZR 4DCVA 3CF2A 2J5QA 2Q3BA 4MI3A 2QLLA 4AJHA 3A4TA 4DG5A 5LZ5A 3C41J 3AGPA 4YRDA 5DP2A 3ND5A 3CONA 4V1CB 2VP2A 2RIPA 1QKKA 1KO5A 4KCGA 4A27A 3S3TA 1J0XO 1V5GA 1MBZA 2PMWB 5C3MA 3OICA 3WRWA 2BPOA 1JKJA 4CETA 5CDTA 3L4JA 2UAGA 3KTAA 4Z7NB 1IEVA 2O23A 3FDIA 3JASA 4Q9HA 3KE9A 1THZA 1GG9A 5CCBA 1MVOA 3SR3A 4OSEA 5EJ9A 4KHZA 1EHCA 3MQFA 4IUCS 1T9GR 1MN6A 1WHTB 2HO5A 2XA2A 3H8JA 5K4AA 3DLHA 1E3MA 2AZ4A 1RLUA 1P1CA 1XRRA 1ZD9A 3OKAA 1Z6AA 3ZDAA 4YRMA 3DBHB 3PKIA 4MUAA 2QE6A 3HZZA 2YC4C 3W78A 4E2WA 3DKIA 2J0EA 4UEJA 4F6LA 4Q3BA 5JQGF 2QMQA 3A6DA 4HDMB 2DB3A 5AVRA 1L4BA 3PEFA 1FP1D 2EF1A 3Q98A 4X5OA 1N0HA 2IHUA 2HJRA 1GUBA 3NU1A 2ZVQX 4AJ1A 3RS9A 1ZICA 3GNSA 1WTAA 4Z9AA 1WPXA 3FKJA 2IX9A 1KH2A 4S35A 4YGYA 2P7IA 5TEVA 3QE3A 4JBHA 1JLLA 1CY4A 3DM5A 3LL4A 3EGOA 3L9WA 2F3PA 2GAIA 2Z3VA 4DRYA 5T3YA 4V38A 2X8AA 3B6EA 4R8VA 2ILVA 3MJVA 3G68A 5IN5A 1U0BB 2KYRA 1M6EX 4CLRB 1UEXC 1GTRA 5LQCA 2WSLA 3IAFA 4K46A 3ABQB 3WGMA 3EH1A 2O6HA 3SFZA 4CW7A 4NU0A 4DDHA 2ZIXA 3FTFA 1UDWA 3P9KA 2NXNA 2OOSA 5C9ZA 5JADA 4OFXA 2YJ6A 3PICA 3MSCA 1NNLA 1V48A 4GDMA 5EHGA 4D44A 5AKLA 5ALIA 3URKA 3ZWVA 3GEEA 2YMLA 1XQ9A 3I04A 1SRQA 1GQSA 1TVEA 1J00A 1TQ6A 3R6WA 4IIYA 2AZDA 3WICA 3HNOA 4YT8A 3LZDA 4RTKA 3O26A 1GNSA 4GYJA 4DEXA 1HURA 2ZQZA 3NTUA 2JJ2A 1ESMA 1HTTA 3T3DA 2QZ9A 4IINA 2ZB4A 2D1SA 1FZTA 3LPAA 5IPFA 5KNDD 4ZO6A 3RG8A 2WG2A 2ZDQA 3JYOA 4KRXA 1SXJE 5JAZA 3HVRA 4AI6A 2O7VA 2XMDA 3QEMA 5IW8A 2VT7A 1CY6A 3A10A 2PX3A 1GN9A 1Q20A 3M33A 4KX5A 4CTJA 3O74A 3U6BA 3OF5A 5ED0A 4GVPA 2R8XA 3EEBA 4RE6A 1U2ZA 2R8RA 2WWXA 1OR8A 4IDNA 4YMWA 1VE1A 2GTPA 4II2A 5LBTA 3WLFA 1P45A 1N8KA 3ESQA 1GCUA 3I2HA 5FUWA 4D1YA 2FRVA 2VF5X 3PHHA 1LPAB 3DXFA 1XJQA 4IJKA 3VPCA 1R37A 3WYDA 4I9HA 3GFPA 4II7A 1NYRA 2IOFK 2NU7B 4BTVA 1Q3TA 2CK3D 3TRIA 2VAPA 2HRDA 3JVVA 2Q5HA 1MOPA 3KV1A 1CFJA 4GKAA 1XMIA 3E58A 1M1XB 5JJBA 4HLDA 4B43A 5M5BA 1NXXA 1FSZA 4P34A 5FL7D 4U7WA 2C2XA 5EQTA 1R9MA 1DG9A 2F8MA 2Y1EA 5BV2P 5GAJA 5LUAA 3U44A 2GNOA 3EIEA 3LQ4A 2IEZA 3RJMA 3VR2A 1Z6YA 1H0RA 3RK4A 5C4MA 2B30A 1RKVA 2GBIA 1BMDA 2NXJA 1P8JA 5DBFA 3KQTA 1KEVA 3GJSA 1GTJ1 4AG5A 1KKLA 3QWIA 3LJKA 4C03A 4DHWA 1L3IA 3L4BA 3PP8A 2P2CA 3U6KA 1SQ6A 3G0CA 3L18A 3CCFA 4JVMA 1YF3A 5ARBA 5ANRB 3A3YA 3AL2A 2CXPA 2ZYSA 3P27A 1G8HA 4RTOA 1QKJA 2ZI5A 4IG9A 4ZYYA 4PCAA 1XZIA 3FNEA 4L7QA 1BX1A 4FP9A 1G41A 3RC2A 2E9SA 3UW1A 5KSOA 4JX8A 3MJ4A 3OZUA 3IAAA 1R2QA 2C94A 2HDHA 3EXIB 5C31A 4MUHA 4O6VA 3DNMA 2AE1A 2BMDA 3HTXA 1EFHA 3AVVA 3K96A 3IP3A 1Z16A 3CRMA 2A84A 5IARA 3UHJA 5KTPA 3ZWQA 4PTZA 2BEWB 2C07A 4G3XA 1ZN2A 4KN8A 5IDWA 3NHUA 3LM8A 1YKSA 3KB8A 4KFUA 2HK7A 5EJMA 5FBVB 5KHOC 4RTSA 4DV5B 5LSAA 3AUAA 3WK9A 2QVBA 1NUUA 4RV9A 2Y68A 3ETLA 4BMZA 4RPCA 4F84A 4JENA 1CLUA 1DKLA 2P75A 4K9DA 4OHOA 5JMWA 1SFRA 3EHEA 3AF6A 1T1RA 5DTMA 5EWLA 4TT3A 2AMJA 3T3PB 2BMFA 1RLMA 3PNQA 4PRZA 3LQ1A 4RGBA 3LE8A 4ZO7A 3UMBA 4AP5A 2DJ5A 3FH0A 1E1RA 3QVGA 3MIZA 1NGSA 1Z74A 2I03A 3IQDB 4RA9B 2HWWA 2Q28A 4IHAA 4G37A 3SICE 3V6MA 5CYGA 2Z6QA 1WF3A 3G2LA 5KWIA 4P4TA 4EITA 1RCTE 2BD0A 2W2LD 1KSHA 2CLIB 3FWZA 4R05A 4D0NA 4PO1A 3S7ZA 3ORRA 3D8HA 4J16C 1PL0A 1WLSA 3MMPA 1S1CA 2QL6A 3E5HA 5JBIA 3ZHQA 3FYDA 5GGXA 1DOAA 4EKGA 2Q99A 5BO5A 4ARVA 1JHPA 4O5OA 4FEGA 4ZRMA 1ITZA 3A1VA 3GI1A 3QUSA 2C8LA 1R50A 1MAWA 2HJSA 3QFHA 3RIMA 3JQGB 2NUTA 1K4MA 4DLWA 4BVEA 4ALNA 5AIAA 3GLIB 2XVMA 2R65A 4EW3A 3E8SA 3DE7X 2LD4A 3DYVA 3FTDA 3G8BA 3KO8A 3F6RA 3WK4A 2VYVD 3PG5A 5BSHA 2H0RA 1OH5A 1F7VA 5YASA 3A27A 1C9DB 1S96A 3SZGA 5HKBA 4QPDA 4RCVA 5D6NA 4YXWA 4MQ4A 2P9EA 3C6MA 3O2SB 4RA6B 1V4NA 1YHNA 2VZLA 2QYOA 4M60A 4AWAA 1IG0A 1WHSA 3KLOA 3HPQA 1OLXA 2K7ZA 2GK6A 4PVDA 2OVFA 1I9GA 2R86A 2W7TA 4PVCA 2CV2A 4GC5A 1UDRA 1JH8A 1LS1A 5BN4B 5K4HA 1QH8B 2B9VA 2ZR9A 3IQHX 3U4QB 4FW8A 1JALA 1EWQA 3V4ZA 4DM3A 4W5OA 5FR1A 2Q46A 1FMLA 2B69A 3TQQA 5L53A 4YIHA 4HYYA 4LK2A 4MV0A 3UGJA 3RSSA 1AJEA 1PSDA 2JKYA 4M1MA 4PZPA 1PWXA 3EF3A 1A82A 1IHPA 1SR8A 5F64A 3DXYA 1G3RA 1YJCA 4NOLA 1DKNA 3EQ9A 4U5QA 5H3HA 3SNKA 3WWEA 1RBZA 1AHPA 1CEEA 1UZUA 2YQZA 5K8TA 5FX2A 2J3HA 5HZKA 2I8AA 5T8KC 2R96A 4IPTA 2A94A 4AS2A 4DMCA 1PL6A 3FPKA 1CUUA 5BORA 2PH5A 1B73A 3HEBA 1A7JA 4UFNA 2OO5A 4GEGA 3PTZA 5KTRA 5AQEA 1GNQA 1TZBA 3H2KA 3CZMA 1P7VA 2XSZD 1XZKA 4F86A 4UUNA 5A0TA 5DDIP 1MGOA 5JAIA 3MINB 5JQWA 5J2UB 1M5TA 3T3GA 1WKCA 1VKHA 2I7DA 1TK9A 3R44A 3WHKA 4AC9A 4COOA 3ZDZB 2GNAA 2X42A 2Y27A 4W5HA 5JZVA 5ELXA 4JGBA 1AF7A 3DVAA 5DPMA 3ZOZA 4PR0A 3JZAA 4P1ZA 1QPBA 4UEKA 5CYPA 3UTDA 3KXPA 1KC3A 1SCAA 3EQ6A 3I9V1 4BGUA 2YOFA 2HZ7A 2UXDB 4XQCA 3HXOA 1TRHA 1V41E 2HC9A