4BYMA

Structure of phaz7 phb depolymerase y105e mutant
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
342
structure length
342
Chain Sequence
LTCGTNSGFVCKGTQTQYAGGFAPGVGYGGFGGGSCTATKTPVIFIHGNGDNAISFDMPPGNVSGYGTPARSVYAELKARGYNDCEIFGVTYLSSSEQGSAQYNEHSSTKYAIIKTFIDKVKAYTGKSQVDIVAHSMGVSMSLATLQYYNNWTSVRKFINLAGGIRGLYSCYYTGYANAAAPTCGSQNYYNSYTFGFFPEGWYYGVWVSNPWTGSGSTNSMRDMPAKRTAVSFYTLSAGFKDQVGCATASFWAGCDSAAKFASTTSNVKAQINVGAGSNATQADYDWADGMPYNAGGGDTTNGVGHFRTKTNTGAIIQRMLLTTCTGLDCAAEYTTGPKAAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHB DEPOLYMERASE PHAZ7
publication title Biochemical Analysis and Structure Determination of Paucimonas Lemoignei Poly(3-Hydroxybutyrate) (Phb) Depolymerase Phaz7 Muteins Reveal the Phb Binding Site and Details of Substrate-Enzyme Interactions.
pubmed doi rcsb
source organism Paucimonas lemoignei
molecule tags Hydrolase
total genus 128
structure length 342
sequence length 342
chains with identical sequence B
ec nomenclature ec 3.1.1.75: Poly(3-hydroxybutyrate) depolymerase.
pdb deposition date 2013-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01674 Lipase_2 Lipase (class 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4bymA00
3R3XA 2DHCA 4EUSA 4P93A 3DL7A 4ZV7A 4A5SA 4AB1A 3DQZA 5LYYA 1MT3A 1SC9A 4UPDA 4Q3LA 4QE3A 4ZI5A 3VVMA 3H2IA 3G0CA 5JZSA 4U2CA 3W04A 2WU4A 3CCBA 1YAHA 3A70A 4YASA 4JH0A 2WJ6A 2ZYSA 5AKJA 1W76A 3PICA 2JEYA 3WL7A 1BRTA 1SCIA 1WM1A 3V1MA 1G42A 4BP8A 3C70A 4N8DA 1R4ZA 4J0GA 5AKKA 3I1YA 4L72A 2HU8A 2WHRA 3EQ9A 1CUDA 3W9UA 5DLPA 1VXRA 3D3NA 2FUKA 2WUFA 5ALDA 4BVKA 3O4IA 4MWSA 1QO7A 1YAJA 3FLEA 1R50A 1UZAA 3E0XA 1MX5A 4C89A 3OM8A 4E46A 4RGYA 2XUKA 3H17A 4C01A 4BCCA 4W1SA 3WA7A 4DMHA 4G1FA 3DKRA 4MYSA 4AO7A 1DQZA 3W06A 2HA6A 1KEZA 3D2AA 3FYTA 4Y2TA 1E89A 2XUFA 5D3KA 4DM7A 4C4ZA 3WYNA 3Q8WA 1A88A 2Y2UA 5JIBA 1XQXA 2FJPA 1CR6A 1WPXA 1XZBA 2GYUA 4BATA 1J07A 3STWA 5FLKA 4QDTA 2DR0A 3T52A 1XZKA 3GROA 3ICVA 3WJ1A 3WWCA 2J4CA 3L1HA 5KWJA 1F0PA 5AK5A 4DNPA 3C5WP 4N5IX 1NU6A 2XQJA 2QUAA 1OILA 2BKLA 2HRRA 3WL5A 2VATA 2RI6A 4UBJA 3M82A 2XI4A 4C87A 5EIAA 3N2ZB 1ZI6A 5EHNA 3FYUA 4EY8A 3DJYA 4WFKA 3UUFA 4B84A 1QIEA 4UHBA 1XLVA 3DCNA 5K3AA 4DNFA 2OCIA 4H7FA 2BJHA 2QTBA 5AM1A 2PSDA 2V98A 4BZWA 3D4LA 3LIPA 4KE7A 3WZLA 2VT6A 3GELA 4H18A 2PSEA 3BDIA 3A2NA 5EIHA 2HRQA 4H35A 1B6GA 3FVTA 2C0PA 4JNCA 3BDVA 4OUKX 4H7DA 3C6BA 1QO9A 1XZLA 1XZJA 5J3JA 2XUJA 1XQYA 1C4XA 2CJPA 3AIMA 2XMGA 5IH7A 3G8YA 1TAHA 4N8EA 3IVMA 3I2IA 4DYHA 3ZPXA 1W4LA 1BCRA 5DYWA 4GI1A 1UK8A 4QDUA 4UBNA 5F4ZA 1XZMA 4LXIA 1E8DA 4AXBA 5JADA 5T4EA 4AN0A 4CFSA 1PFQA 4QDXA 2AJLI 3LP5A 4IO0A 4CG2A 2PVSA 3WMRA 3BE8A 1BEEA 3R3UA 2RONA 5ALPA 4TVKA 4W1QA 1K4YA 4I4CA 1DU4A 1E5TA 3O9VA 2QZPA 4Y2UA 5K3EA 1NX9A 4OYLA 3I1IA 2EDAA 3KOOA 4KR0A 1MJ5A 1EDEA 1VA5A 5C7YA 3BIXA 5FPQA 4HRYA 2OQVA 5HQ3B 3FVRA 3QZUA 1AUOA 1SOMA 2WG2A 5HQ3A 2WHPA 3PI6A 4IH4A 4XWGA 5AKZA 2VEOA 3VDXA 2HU7A 2QKYA 5HK9A 1LZKA 7YASA 2JGLA 1FFAA 1QGED 4PSCA 1ACLA 5K3DA 1EX9A 1DT3A 1W75A 1KU6A 3I2KA 4H7JA 2OGTA 4M0MA 4OB7A 3KWFA 1MX1A 3R41A 4WFIA 1QOZA 4B82A 4L0CA 4PV7A 2QVBA 1QIKA 1ZI9A 4LXHA 2YYSA 4UHFA 3C45A 3F9CA 3I2FA 5EI5A 2RGUA 4LHEA 1THTA 3DDUA 4QZVA 4U2FA 4L9AA 1PJAA 3F98A 5AM2A 2OCKA 1K5PA 4B0OA 3AFIA 2AJBA 4F5ZA 4U2EA 2JGKA 2VTVA 1AQLA 2XUGA 1BS9A 2V97A 1ZI8A 2BUCA 2WIJA 1ISPA 2AJDA 4B0PA 5LZ4A 5CH8A 2Q0XA 1RP1A 3C43A 2WHQA 4BE4A 3AILA 5JD4A 2B20A 3IB3A 1HDEA 1YS2X 3C87A 4CCWA 4LKOA 1EH5A 2C4HA 2QJWA 3SC2A 3FLBA 2ZJFA 5A7GA 3GUUA 3YASA 4Q3OA 4ARAA 2GZRA 1Q0RA 5ALTA 1H22A 1CUXA 2Z5GA 4DNOA 1E3QA 3WK9A 4OB8A 2C5GA 5JZ9A 5JAPA 3OOSA 1GT6A 1EINA 4W9RA 2BCEA 2W22A 4KYVA 2XMBA 1MPXA 4HS9A 3DYVA 4AMZA 3FSGA 4K6HA 4EHBA 3FBWA 1VXOA 1E8MA 1LNSA 3G0GA 3PE6A 3I2JA 2GYVA 1UWCA 3QMWA 3C6YA 4FKBA 4ROTA 1XZIA 2PSJA 1YSCA 2WG1A 4Y9SA 4KE6A 5ALSA 1USWA 4OU5A 1U8EA 3QITA 4CIBA 3E1GA 2PUHA 1XRPA 2C0QA 1L7RA 1EI9A 3BWXA 4FLFA 2ONCA 2J4FA 1VE7A 1P0IA 2CB9A 3OURA 3QMVA 3DD5A 2BUAA 5C81A 1F6WA 3EQ7A 5JATA 2XUQA 1AMNA 2QXTA 5EHQA 1M33A 1UKCA 1YASA 3AINA 2PL5A 3Q0TA 1QFMA 1T4MA 5JAHA 5JD5A 1ETHA 2WJ4A 1N8SA 3KWJA 2WQZA 3HYSA 2HL6A 3STTA 3F96A 5JYCA 2CEKA 2VAXA 4INZA 5DTJA 2GBCA 4YPVA 1AZWA 4PSUA 3KD2A 1DX6A 3WKEA 2XQFA 4PO3X 3V9AA 3I28A 4OPMA 1TQHA 2XUAA 5LLSA 3FCYA 3IDAA 4RPCA 5EGNA 3CN9A 4FNMA 2JGMA 2XMZA 4DGQA 1ORWA 1AX9A 1GQRA 4BC0A 3MGAA 1FSSA 3STXA 1YS1X 4EY4A 2RAUA 5DJ5A 4Y2VA 4X3CA 4BVLA 3VVLA 4HRXA 5K3BA 3BL8A 3BF8A 2AXEA 3MUOA 3WJ2A 4LXGA 4FBMA 3IA2A 4B9AA 5DTIA 4BTVA 5K3CA 3S2ZA 5CBKA 1XKTA 1FFDA 4RE6A 2VQ6A 2QM0A 3EF3A 1CRLA 4CG1A 5BWCA 1IUOA 1LLFA 1ZICA 3R3YA 3P2MA 4GW3A 3W05A 2WIGA 2XUDA 4QDZA 2VSQA 3BXPA 1XZCA 5FKJA 4MJ3A 1W6RA 4BBZA 2JGJA 1UOPA 2QJRA 2XT0A 4QNNA 4G4JA 4XIIA 3V48A 4FMPA 4KEAA 3HEAA 4AZ3A 1K63A 1B41A 3STVA 4FLMA 1JMKC 5AM3A 1LBSA 1SFRA 3UUEA 5I9IA 3JYHA 4ARBA 4X85A 2JGEA 5D6OA 2ZJ7A 5AI5A 1CUZA 2DCMA 1QONA 4K6KA 2K2QB 2Z3ZA 4DSAA 2PU7A 4WFJA 4V2IA 5AI4A 1CUYA 1DWQA 3N0TA 1JU4A 2QRUA 5HFAA 4X92A 4J03A 1G66A 4U2BA 1ZIYA 4GEGA 3MVEA 2HA4A 3KSRA 3DL4A 4MQMA 1CUJA 3ANTA 4RE5A 1H2WA 2WIKA 1QTIA 1CEXA 3ESCA 4FBLA 2QOEA 3WK8A 4Y2SA 5ALOA 3AIOA 1JJBA 4UBIA 3DOHA 3WWDA 3STUA 4AN1A 1R3DA 4EY6A 4AX4A 3A6ZA 3NUZA 3WL8A 1C7JA 5ALLA 4F60A 1GQSA 5E4TA 4FHZA 2ECFA 1SCQA 4HXFB 4IQ4A 2DQYA 3AUKA 3PF9A 3WK7A 3IUJA 4FOLA 3I2GA 4ZREA 2FJ0A 3RKSA 1CUAA 2OXEA 2QUBA 4OB6A 4X7BA 1QZ3A 2FX5A 2XQGA 3ED1A 2HA2A 3ICWA 4G9EA 2I3ZA 2H7XA 4FNGA 1FFEA 1H23A 1Y37A 3BJRA 4EY7A 1BCSA 1GKLA 1H2YA 4F0JA 3WLAA 1HKHA 3DEAA 5AP9A 1ZGCA 1XZDA 3IIIA 1KU0A 2CZQA 3WA6A 2AJCA 3ZLVA 1ACJA 1CUVA 3PF8A 4N5HX 3D7RA 3WL6A 1CV2A 5ESRA 1QFSA 4KRYA 3IUNA 4MEBA 2VJCA 5ALUA 4LIPD 4B81A 3CXUA 4MXDA 1QIGA 2HA0A 2RHTA 2OGZA 1HL7A 2ACEA 1HBJA 1VOTA 1WPRA 4BP9A 4EA6A 3EBLA 4N8SA 3FYUC 2IITA 2JGFA 5CMLA 2P8SA 1UOQA 3AZQA 3QPCA 3DKKA 3QYJA 1N5MA 5T4HA 4FDMA 4MWTA 2GBFA 3O4GA 4ITVA 2HA5A 1X70A 3PUIA 3OC0A 1GXSA 2ZJ6A 4Q82A 5K5EA 1ZD2P 3NOXA 4QWWA 1QIDA 1RWQA 1YB6A 4IHAA 1N1MA 3K6KA 3H2GA 1BN7A 2B9VA 3WK5A 3AZPA 1EB9A 4L3WA 3VXKA 5ALMA 5ALGA 1WCYA 3QMMA 3H0CA 1HPLA 2JGIA 3G02A 3LLCA 1ODSA 4IH9A 5LIPA 5FOQA 1ZD3A 3C5VA 4OU4A 4UFOA 3PDCA 4GWLA 2C58A 4G4IA 2VAVA 1ZJ4A 1XZGA 5A2GA 4X6UA 5AIBA 5ALHA 1GPNA 2Y2VA 1U4NA 2WUDA 1OXMA 2XMSA 3G9UA 2J3QA 3H18A 4U2GA 2BGRA 3DLTA 4H0CA 1A7UA 1CQZA 4WY5A 1UKAA 1WB5A 2XMQA 2IIVA 3ZWQA 1BN6A 2X8BA 1BU8A 4Y7DA 2OPHA 4BB0A 4XVCA 3OPMA 1SCKA 1YA4A 3ESDA 4Y2XA 2OCGA 1VZ2A 5LKAA 1ZD4A 1D07A 4ETWA 4QLAA 1UKBA 2R11A 1H2ZA 4F21A 3AJAA 1VZ3A 1G5FA 3R40A 1TCBA 5ALKA 4CCYB 1JI3A 3IBTA 5FUMA 5LZ2A 3RK4A 3E3AA 4CCYA 2WLSA 1XZFA 3KDAA 3VJLA 4KACA 2Y6UA 3L1JA 2B61A 3EQ8A 3TRDA 1IUNA 1XRRA 5ALXA 3VJMA 5CTAA 1AURA 2ZSHA 4EB0A 4DTCA 1O6FA 2CBGA 3H2JA 1TCCA 4YK7A 3WKCA 5AK4A 5AKXA 3HJUA 5DYTA 5JARA 2OQIA 3O9MA 5ALZA 5CXUA 4CI9A 3HI4A 4GECA 3G9ZA 4OCZA 3A2LA 1JT2A 5C8XA 5IKXA 5IVKA 2UZ0A 1CUSA 3B12A 2XUHA 5AKEA 1E66A 1VE6A 1P0QA 4BAZA 2PSFA 5CT5A 5JASA 4J0HA 2WTMA 1EVEA 2Z8ZA 4X00A 5AI9A 4BDTA 4NVRA 4LYEA 4QEKA 2CKMA 3G0DA 1MTZA 5HZGA 3WKDA 1CFJA 2DHDA 4AZ0A 4KJXA 4OYYA 4U2DA 5LZ7A 1U2EA 2WKWA 5EFZA 5T4FA 3AZOA 4QDOA 5ALVA 3CN7A 5ISMA 3FLAA 1EB8A 2WIFA 3IURA 3R0VA 5HF5A 3F8SA 5AOAA 3EIOA 2HFJA 4DMKA 2DSNA 4G5XA 4P9NA 3V1NA 2XQKA 4UHCA 4H7EA 5HF6A 2C7BA 1HQDA 4BZZA 4Q05A 3VJKA 1XLUA 4DMCA 5AK6A 5AKIA 1BEZA 2ZYRA 1XRMA 5I8PA 3WYDA 5EIEA 4P92A 1IZ8A 3U1TA 3TJMA 4BCDA 3OG9A 4Y2QA 2JIDA 5ALQA 4Y2RA 4KAAA 4I3FA 5AI6A 3RLIA 3G0BA 1OCEA 3C6ZA 1Q0ZA 1JFRA 2QXUA 1NU8A 5LZ9A 4FWBA 1CQWA 4FFWA 1MU0A 5JALA 3C8DA 2GYWA 4GLBA 2PM8A 1UXOA 2GZSA 3I6ZA 2QMQA 3ZLUA 1CPYA 4DSZA 5AK3A 4B7ZA 1ZIXA 5A71A 4QA9A 2H7YA 3DYIA 4BTLA 3VISA 3WKAA 3IULA 3E4DA 3F97A 3BJMA 3HABA 3I6YA 5CH5A 1I6WA 1XQWA 2HA7A 3C8HA 4Y2PA 5HKAA 1R9NA 2DHEA 1LPOA 1W52X 2OLEA 4K6GA 4BAGA 3SWWA 3QPDA 5IVIA 2DFPA 2ACKA 2HM7A 5FV4A 3M3DA 4BCBA 1DT5A 1QIMA 1XROA 3G0IA 4Q3KA 1Y7IA 1XZEA 3X3HA 2WIDA 4M0FA 4UBLA 3FSGD 2WFLB 3WIBA 1Z68A 1EHYA 4HTAA 3TEJA 1K6EA 4J0JA 2WFLA 3WI7A 4ZRDA 3WWEA 5ALEA 5BOVA 2XUPA 5AOCA 1ODTC 1ORVA 5IVDA 4ZXFA 4OSEA 5AM0A 5A6VA 1J2EA 2XE4A 2CUTA 2V9ZA 5AJHA 5SYMA 1XFDA 5CURA 4C88A 5C8ZA 4AO8A 4E15A 5EHXA 1J06A 5CT9A 4QLOA 2HA3A 1UK9A 4EBBA 4JYMA 1UK7A 3JWEA 1UOOA 3LIIA 1R9MA 4KAJA 2GBIA 1G4HA 2XDWA 4UFNA 3QH4A 4KE8A 4IH1A 1LPBB 2WFZA 2VA9A 3DNMA 1LPNA 4G4GA 1UK6A 3WK4A 2QR5A 2C5FA 3WQHA 4UFPA 4W1RA 5FXMA 1QE3A 3F67A 5AKGA 2QT9A 1X2BA 1FFCA 2G5PA 1LZLA 1IVYA 3JW8A 5ALIA 1S8OA 3G9TA 4HZGA 5FPPA 1EK2A 1HLGA 3D5EA 5CH3A 3H1AA 3O4HA 2IX9A 3B5EA 1LGYA 1VLQA 2HIHA 4ZV9A 2G5TA 4GHWA 5AICA 1CUHA 1GPKA 1CIJA 1EK1A 4G8CA 4CG3A 2JF0A 5AHXA 5HKBA 4X95A 4BYMA 4J7AA 1CUEA 1QTRA 1YR2A 4WY8A 1YB7A 1L7QA 3D2CA 2W6CX 1ZOIA 5AKLA 3BF7A 4X90A 1A8SA 5CXXA 5SYNA 1DX4A 1IZ7A 3C6XA 2J3DA 1XRQA 1EXWA 3PFBA 2ZVDA 4OD0A 5E4JA 3NWOA 1LPMA 1MNQA 3FNBA 2HFKA 4KE9A 2HDWA 3G7NA 3V1LA 5LZ5A 2B4KA 4A23A 3ZI7A 2PUJA 6YASA 1GKKA 5A62A 2I3DA 5JD6A 3H2HA 5AKYA 4G9GA 4S0XA 1CUFA 5KBYA 4BVJA 4B85A 4CIAA 2XLBA 2XUOA 4DLNA 3L1IA 3U0VA 4PSDA 4W63A 1FFBA 3B3QA 1WHTA 4X6XA 1LPAB 3HSSA 4MYDA 4A16A 4GBGA 2HHAA 3FYUB 4HAIA 2WILA 3OTQA 3QM1A 2WJ3A 5JANA 1W1IA 4D9JA 4BAUA 1MAAA 3ESBA 1XRNA 4MQLA 3GBSA 2O2IA 5DNUA 5HFNA 1CUIA 4UHHA 3I6MA 4UHEA 3IUQA 3WIOA 4KRXA 3W9BA 4EZIA 1X2EA 1TIBA 2G63A 4JYPA 1T2NA 2RHWA 2LIPA 5I7UA 3BIWA 2CMFA 4UUQA 3MUNA 3QBJA 1K8QA 2VJBA 5BV7A 5LKRA 2BUBA 1L7AA 4X97A 2BGNA 3HC7A 1TCAA 3R3WA 2JEZA 5LZ8A 4BDSA 4BE9A 3FWHA 3G9XA 1CUBA 5ALYA 1WHSA 1XLWA 5CT6A 1BE0A 4G8BA 3KXPA 1DQYA 2D0DA 3M83A 5LP1A 3QVMA 5K3FB 2RIPA 4G8DA 5K3FA 4O08A 2WUEA 3HRHA 3VKFA 4B83A 2GBGA 3AIKA 5ALFA 1CVLA 3HXKA 2Z3WA 1JMYA 3PUHA 3ILSA 1ODCA 4FFVA 5DNWA 1J1IA 3QPAA 3NGMA 2ZSIA 3HLKA 1VA4A 2PBLA 2EEPA 4PW0A 2OGSA 1JJFA 1H2XA 3FCXA 3I2HA 5JZBA 4WDRA 2WHPB 1GGVA 1LPPA 1F0NA 2PX6A 1XQVA 4J0KA 5AIAA 2XMCA 3WWOA 4BRZA 4X93A 1XZHA 1CLEA 1C7IA 3R3VA 1DWPA 1IMJA 3D59A 3V1KA 2VT7A 4UBKA 4PQEA 1QLWA 5JAOA 4MEAA 4B6GA 4LYDA 1EDDA 1CUCA 1QIJA 2YASA 2VF2A 5AH0A 5CT4A 5ALJA 3ZV7A 2HU5A 5ALWA 1U65A 4TGLA 5HF8A 2D5LA 4GDMA 3K9BA 3STYA 1WB4A 2VJDA 3FOBA 4XX1A 1XRLA 2PU5A 4UBOA 1AC5A 1TKRA 4H7IA 3O4JA 1O6GA 1JJIA 3ANSA 4NMWA 5KWIA 1EDBA 5T4BA 2PSHA 1ZJ5A 5AM4A 4NS4A 2XLCA 3ESAA 2OAGA 4AO6A 3S8YA 2H1IA 2ZYIA 2O7RA 1WOMA 1DINA 1R88A 2O2HA 4X91A 5AI0A 5DYYA 4KAFA 3O0DA 2BFNA 1N5RA 4ZWNA 1GZ7A 1LPSA 1ZD5A 1CUWA 3WK6A 2Y1KA 3DS8A 5BWBA 3M81A 5A7HA 1DWOA 5KREA 1THGA 4J0CA 5CRIA 2WM2A 2X76A 4Y2JA 1VKHA 5E4YA 3ZLTA 3LCRA 3IUMA 2OG1A 4EY5A 1AGYA 1JU3A 3TGLA 2JBWA 2I03A 4DNQA 1AKNA 2WTNA 1MN6A 2XQIA 2O2GA 4H7KA 2QS9A 2X5XA 4Z49A 5AM5A 1A8UA 5HCUA 4X94A 1TK3A 2R8BA 5HF9A 1WB6A 3GFFA 4AMYA 4UBMA 5C8VA 4PNZA 4C4YA 1TRHA 2WSLA 5A7FA 3SK0A 2E3JA 3H04A 2XUIA 2WFMA 3A2MA 5CW2A 3WWPA 4X71A 4C6HA 5FDFA 1IUPA 2WG0A 4GXNA 3H1BA 4M0EA 5D7BA 2Z8XA 2PPLA 3RARA 4HVTA 2EDCA 5IVHA 4K5QA 2O7VA 5ALRA 2H9YA 5AOBA 2V96A 4B80A 4FTWA 1YCDA 3O95A 2OAEA 3T4UA 2AJ8A 2OCLA 4K2AA 2NW6A 3SX4A 4B9EA 2I78A 4P08A 3FAKA 1BROA 3CCCA 1EVQA 3W2TA 1RYYA 4JUIA 3R3ZA 2WUGA 3HACA 1QIIA 1E8NA 1QIFA 1GPLA 5HK8A 4E11A 4X6YA 2ZYHA 1MX9A 3D2BA 2WU3A 2H7CA 4PF1A 5H3HA 1CUUA 2Y6VA 1P0PA 4WCVA 1QIHA 4NZZA 4JEIA 3H2KA 5YASA 5E2IA 2ROQA 4BC1A 4H7HA 2ES4A 4Y2YA 3D0KA 3GA7A 4YX9A 4DIUA 1QJ4A 5AO9A 4BRSA 1Q84A 1PV1A 2XB6A 5AKHA 3HZOA 5CT8A 2HADA 4WDQA 5JAUA 4FLEA 4HXGA 3RM3A 4E14A 4Q1VA 4W1PA 2YH2A 4UHDA 4HXEB 1CUGA 3WKBA 3LS2A 3DOIA 4C4XA 2DQZA 4H77A 1FJ2A 3K2IA 2XMDA 1DTEA 4I19A 1LBTA 1UT6A 4Q34A 1XZAA 3GZJA 2BAGA 2ORYA 1ZGBA 1MAHA 1Q83A 3H19A 5AI8A 5ALNA 3UMJA 1UFOA 1XKLA 4AQDA 1VJ5A 1EA5A 4WJLA 2VJAA 1Y7HA 4J0DA 4J0IA 1P0MA 4TPKA 4QWMA 2YXPX 1R1DA 1JKMA 1MO2A 5D3ZA 1MNAA 1F8UA 1YA8A 4RNCA 4XJVA 5DWDA 3WZMA 5FRDA 2G4LA 3PFCA 1A8QA 4DMFA 2PKYX 5FP0A 5DNVA 2XMRA 4J3JA 4ZGBA 5EHZA
chains in the Genus database with same CATH superfamily
3UG6A 1N8NA 2DPMA 2VPYA 4CXMA 4EPXA 1KERA 4EFDA 4EUSA 5CB4B 4P93A 4AB1A 4P98A 1OVGA 5LYYA 1V9CA 2P90A 5DPMA 5H4GA 3LQKA 1SC9A 4UPDA 4CV1A 2O8VA 3F2VA 1ZQ1A 2GA9A 3RS0A 4NH4A 4ZI5A 4N5LA 2UZIR 4TKVB 3HZHA 3I6IA 2Q5IA 3PGJA 5DEOA 5A4IS 4QJBA 1WLSA 4CT0A 1YBHA 3DUFA 2OV6A 3H2IA 4DPLA 4ARIA 4C29A 1Y6QA 2X13A 4NONA 1Z29A 2YZMA 3IH5A 2J6IA 4BLQA 4OMUA 4U7PB 3H5TA 1Y9ZA 3K0EA 3KKZA 4U2CA 5ELMA 1PZEA 2WU4A 1BQ3A 4I08A 3TR5A 1Z07A 2A0KA 1T8PA 1AGNA 4N6GA 1VL2A 4PE5B 1QC5B 3TX2A 1TQ8A 4UCXA 1EESA 1ZL2A 3AVTA 2TRSB 3A9RA 2CFRA 2W2NA 7MDHA 4LQDA 2WJ6A 5AW7A 5AKJA 1W76A 3OE7D 4EW1A 2JEYA 4EEZA 2CHVA 3G79A 3L02A 1HDZA 3CWZA 1RI1A 5CLIA 2NZXA 4BP8A 3GPCA 2ZQZA 3C70A 1FDUA 1T0JB 5CK4A 1DKLA 1ST2A 4D3SA 1SELA 2ECOA 1E7YA 5DISB 1B4DA 1R4ZA 4I4TF 4CQLA 1P0FA 3A4LA 4F4DA 3VSBA 3A4IA 4J0GA 5THKA 2WSSA 1LC0A 3AL3A 4PO8A 3T3EA 2R96A 1K7EB 1LI4A 2QM7A 4JEMA 4KLNA 2OYSA 2PE5A 1DIRA 3WGLA 1UQUA 3EQ9A 3O8QB 4M49A 4OHPA 4YWJA 5JEEA 1OA0A 4HWPA 2IVZA 2V7EA 4RV5A 4CODB 1CT9A 1WV0A 2BE9A 2VRNA 3KKLA 3RWBA 5CXQA 5KNDH 3U44B 5BN3B 2WUFA 5ALDA 4REOA 2EAUA 4M6WB 1UMDA 4NJMA 2PZFA 2PEYA 3ASZA 3F4BA 5KOHA 5F35A 5FR2A 4XI9A 3CH7A 5AW4A 1ZD8A 3A1UA 2Q5OA 5GV8A 3CNOA 2AGVA 2GBPA 1CS0A 2C95A 1FMCA 2XNDA 2XUKA 3GRKA 3VR4D 1XNRB 2ZWMA 4C01A 4V0MA 2BYTA 5ED0A 3SZMA 3OKFA 2B92A 3WA7A 3WBBA 5I9SA 4JA2A 2VHYA 1JT9A 1NUUA 1HFWA 4QGHA 4AO7A 4WT7A 3QUTA 3OEHD 1NXSA 2EW1A 2AT1A 5DXAA 4NFSA 5JNSA 1T1EA 4EK9A 3DLAA 5C7OO 2IW3A 1XR3A 3EZ2A 5FBHA 2GCOB 3CGWA 5AXBA 3ZWNA 1PJ4A 2C4MA 1KI6A 4MCHA 4EHNA 2ZPUA 5FO1A 2D8MA 4Y2TA 5B7NA 3QE4A 1PEKE 5BV2P 5D3KA 2AQKA 2YFYA 3COWA 4OQPA 4Q4LA 4XJSA 1V6AA 1YE8A 2O3JA 3O84A 1L8LA 5BOSA 2PANA 3Q8WA 3ZIAA 2WD9A 3PC4A 4J6EA 1Y8CA 3KEQA 5C9ZA 2OM2A 3AWDA 3HYRA 1YFJA 2QX4A 4HRAA 1IQUA 1C1XB 1EVZA 1CR6A 3SC4A 2D3WA 1I24A 4TOIA 1T2FA 4XX0B 3E23A 1NQWA 4IIEA 4I50B 4QVGA 2J09A 2ZUTA 1JR6A 3A14A 1HE1C 4L8VA 1XTBA 4IJWA 5LWQA 4MPRA 3EZLA 1G17A 3MFYA 5F7JA 4ECAA 3WJ1A 4F38A 5D01A 4LSGA 4B4VA 1N5KA 2E49A 2ZVJA 1D8AA 3E9NA 2DG2A 3GGOA 1RT9A 4PGMA 1E61A 3LCUA 1WCWA 1VJRA 1DC5A 1L8AA 2E87A 4DCPA 4TTSA 4Z4FA 4AICA 5C32A 5ADUS 2ZRFA 5DTRA 3VUEA 1KP3A 2NU7B 3EMVA 4US1R 4S2UA 3Q2OA 4TXLA 5ILGA 4DNPA 4INOA 3LE8A 2VJYA 3ORHA 1NU6A 1OU4A 1KSFX 3IQHX 1BX1A 2FR1A 2HRRA 4DBLE 1CD5A 4DJJA 1I3NA 1LQ2A 4L75A 4BV8A 1ZA2A 3DCYA 2VBGA 4UBJA 3D3KA 2NYAA 4I1RA 3BORA 1VBNA 3A26A 3L1VA 4MS1B 4QIHA 1E1KA 3RJ5A 4AROA 1QBGA 1R0CA 3M82A 3QWAA 1T1IA 2XWBF 3W2HA 3N8HA 1X77A 2BSAA 2BGKA 1XVLA 3KNZA 2ZGVA 3Q0EA 2H57A 3BH7A 4MUNA 3UFXA 1SKMA 5LUBA 3HKEB 3KSUA 3P4XA 2XRFA 5JDCC 5LIRA 2VWQA 4MVJI 4RBNA 4EVQA 3DJYA 5E9WA 3E27A 3NOVA 1W36B 3G0HA 1BXRB 1KZ6A 2P6NA 1PBNA 4WFKA 1QIEA 2I9PA 2E82A 4XLLA 2GNAA 4IIJF 3UUFA 1YOVB 1U2GA 1XLVA 3FRJA 4UHBA 1E6UA 2WA1A 3DCNA 3KTFA 1PG0A 3HJHA 3P0IA 1HTTA 5K3AA 2CLCX 4N01A 3UENA 4R51A 2FPKA 2DGDA 1JLKA 4WD3A 3FUCA 1ESEA 4PCVA 3HPQA 2FFRA 2QN9A 4GGOA 1WXEA 4RH0A 1ZO8A 2FEMA 2V98A 1JEEA 3NQ41 4E13A 3F3YA 3GBPA 1TPZA 4JXKA 1ZIOA 4MV8A 4ZOAA 1NE7A 2HBRA 3LIPA 5HE8A 3VR4H 4D9FA 1JE1A 3EVNA 2I0FA 1J90A 3GT0A 5LPNA 2H31A 3AF3A 1YJBA 4TKUB 4R3UC 3DTNA 4UHKA 5B5SA 4ESOA 4RJJA 3TW4A 4RTMA 2Z5LA 3UJDA 3W3AA 1VCIA 4G0WA 1NVVR 1LBQA 3PJGA 4QOGA 4H35A 2IWRA 2FSPA 3FVTA 2Q9CA 3INTA 4O5OA 4W5QA 3KQKA 3EY9A 4LDPA 5IC5A 1F4PA 4OKSA 5KYGA 3AOEC 5TQ2A 2OO5C 4JNCA 4OXXA 1FIUA 2O2JA 2JJ1A 3LRPA 1JSXA 1XZLA 1VSBA 1P74A 2GAJA 2YHIB 3P2KA 1II9A 4KHZA 2O6LA 5DCLA 2BEWB 4BFTA 4S1WA 1C4XA 5LOVA 1ZS9A 2KYRA 5IH7A 1EZ4A 4N8EA 1NTOA 3BCRA 4GLOA 5A4KA 2ZIZA 2GBLA 3DZJA 4HH4A 5WRFA 4JUDX 4YCAA 1H42A 2P9CA 3EWSA 1GRQA 4UBNA 1OD6A 2CJXA 5TE9A 3A06A 5K8CA 2B35A 2P68A 2R2GA 4H2DA 5TS3A 4C6SA 3GDFA 1HE3A 1L5NA 3FB1A 2JFGA 1DV1A 4CFSA 2OXFA 5L51A 3P52A 1YZHA 1E9EA 1PFQA 4QDXA 4ZMSA 2ID4A 4GXQA 1T3GA 1MQSA 4B46A 3LP5A 5BT8A 4QXOA 3ZZMA 2CXHA 4V2UA 2NYVA 2VNKA 1P1KA 2E18A 1EMDA 2IHVA 2JLAA 2YIVX 5IEBA 1FUUA 1YHZA 3WMRA 3ZE9A 3S8EA 2EX0A 4LYYA 4D9NA 2C82A 3R3UA 1Z8NA 3WTCA 4TVKA 2EBWA 2BM9A 4N0DA 3LDFA 3T3PB 3OLVA 1QU3A 1K4YA 1UMBA 2ZS8A 3Q12A 4U9UA 2CL5A 5BVHB 1DU4A 5EKUA 5L53A 1P2FA 4I1SA 5JAQA 4MV9A 5MN6A 5C51B 2QPLA 5EJ4A 2HKIA 2PLNA 6AT1A 2VHEA 4G9BA 3V32A 2Q5FA 2J41A 1Z34A 4FOSA 4LK3A 1E5TA 4S1VA 4C4OA 3KJXA 4PZUA 4EKGA 2NQTA 4Y2UA 3VO9A 3RSOA 1UEXC 2HJSA 3UYLA 1JLLB 4DBZA 1OF1A 1YVEI 1EFDN 3ANXA 1V16B 5COBA 1VPVA 1JR4A 4OYLA 4LNUA 1WUYA 5B64A 1JEDA 1LNZA 2P2CA 1GRVA 2VFAA 2BFCB 1F2UB 2Y0EA 3VDQA 5HX7A 1RFGE 2GM5A 4KR0A 4BB6A 2VC2B 3NHZA 3TPZA 3H4VA 3NYRA 1W9HA 4HXYA 1VA5A 3WGZA 3OA2A 1K3FA 2OMKA 3BIXA 4C0QC 4Z6KA 5FPQA 2ZRNA 5G0WA 5TR9A 3SKVA 3SDSA 5FI0B 4RY8A 3QELB 3UZUA 5L6MB 2G70A 4A8JA 1RKQA 4NATA 1A50B 1HYBA 1JU9A 1OBOA 3QZUA 3D8BA 1XTPA 1YHNA 2G1KA 2PEZA 1GQ2A 4UAVA 4YQYA 221PA 4REQB 4FD3A 2MSNA 1W85B 4IYJA 3NMUF 4A91A 5DBGA 2H9AA 3R74A 3DP7A 5SY9A 4LOIA 3I37X 1HKUA 3TGWA 1VDMA 2I71A 4U3JA 3DE4X 2ADMA 3ERCA 4IH4A 3DW3X 2C61A 4AY5A 1J0AA 4L5CA 4XWGA 3B51X 3UBTA 4DR7B 1D2MA 2R86A 3A8TA 2ZYUX 2XCQA 4P53A 5LQNA 3ETCA 5FTMA 2RH9B 3PGMA 3RC9A 4BIIA 2SECE 3OPYB 4G63A 4R2IA 4WBSA 2HU7A 1SUAA 3QNWA 3QE9Y 3QLTA 3KPWA 1RLIA 3QY0A 2QE6A 4PYQA 1H1DA 4RCZA 3T5TA 3DDZX 3WO1A 2V4UA 4Y6PA 2D62A 1CJMA 4D74A 3W5HA 4UVDA 2BBOA 2QUZA 4EJ0A 1E9VA 2PXAA 1P91A 2VJKA 3D54D 4IUYA 4U5XA 5EMLA 3F5FA 3RRYA 4EPTA 2VUUA 1GZVA 2TMDA 4PSCA 1J22A 3MTJA 4DV6B 3PXEA 5F7ZA 3TLXA 5GAJA 5JI3E 4DLWA 5DBFA 3RKUA 1AKUA 1DTWB 4GPEA 1W75A 1E0AA 1WDTA 4H7JA 1MIOB 2KLHA 2WNSA 4HZUB 4O02B 4OB7A 3PWTA 1CX9B 1L5LA 1QDUA 4V1CA 3IO3A 1IHPA 2GEBA 1EFVB 1E79D 2AZ4A 3GP5A 4IHJA 4B82A 4ZAWA 1QH8A 3JRNA 1YJQA 4BMZA 5TPZD 1LLQA 2NZYA 3D4OA 1SD1A 2QVBA 2CDBA 4LF5B 1QIKA 3GFBA 4F6RB 5CEJA 1I7DA 4D4GA 3BRCA 4TVBA 3V42A 2OY0A 3MT9A 5TS2A 1MOPA 2VHQA 2WU1A 4UHFA 1EFUA 3C45A 2YQZA 4ED9A 4UTPA 1QAOA 4F1JA 5EI5A 4XJTA 4LHEA 1IWOA 1UJBA 4NCHA 5FBWB 2CSXA 3GT4A 8ADHA 1VJCA 3HXLA 3G3EA 2H8KA 3PQCA 2ZRHA 5HS6A 4IMIB 4IVQA 3T0FA 4CG0A 4JR0A 3FKJA 4TMKA 1YCHA 3F98A 1P73A 3PEVA 4DUYB 1ESNA 2ID7A 3NVDA 4CLOB 1CRPA 1F17A 3DXYA 5KX5A 1K5PA 1SO8A 4MKGA 4NU0A 2G9NA 1V5EA 4II7A 3H0EA 3GB9A 4HBGA 1PZXA 2RKOA 4QFBA 4D8UA 5BQ5A 3DVLA 5K2OA 1TEXA 4KXXA 1Y3CE 2VBCA 4U2EA 3RYHB 3OECA 1IG0A 1T6BY 2DBYA 5ELXA 1KMCA 2CXQA 2X6TA 3GEEA 1PKXA 1FDWA 2P69A 3U3ZA 1RHQA 2QAGB 4R1OA 3TE6A 1Y4SA 2PX5A 4KBGA 3W5UA 2YV3A 5JXIA 1A9SA 4H9GA 4PO9A 1TI7A 1UADA 1P3DA 2YTZA 4D26A 4HGZA 2BUCA 2WM3A 5EMHA 1JILA 4WZ6A 1ISPA 1Z2DA 3H84A 2FOLA 3DULA 1N3BA 5CVEA 4D6YA 2W8BA 1C30B 2WJJA 3ENNA 4QODA 4O1MA 2J0SA 3TDKA 1CEQA 2WAMA 1UPBA 2JAOA 1D6SA 3C3WA 5CH8A 1XP8A 4JBIA 2GCPA 2PQMA 4YP6A 1ZH0A 4GOXA 5FWYB 1GQYA 5FQOA 4MZXA 4DRZA 3U16A 3GJ5A 2FP3A 3TNYA 2ANBA 2OZPA 1FTWA 2PD3A 3AILA 4DGSA 5JD4A 1A2BA 4NAHA 4IEIA 4YGXB 5JNLA 1HDEA 3G2QA 2C9MA 3ISVA 1GP2A 2DLCX 2ZBRA 4EAQA 3IPCA 4G1MB 3DZHA 1KNXA 5AW5A 2C4HA 3PWZA 2ZJFA 3OQJA 3GUUA 3JQRA 3YASA 4EO7A 3SSNA 1Z88A 5LQUA 5HJEA 1OAKA 4ARAA 3EWAA 3NTXA 1NI4B 2QD5A 1K6MA 2EATA 1Z06A 3DDSA 1IXYA 3IV7A 3HGTA 2QG6A 3U7HB 1CUXA 1T4GA 3C4QA 3VI4B 4X1KB 3H16A 1XEAA 4O4LA 3GVPA 2J08A 4FFLA 2OM6A 3CR3C 3MBIA 3KZNA 1JWAB 3BIJA 4BQQA 4YRMA 1L1EA 5JZ9A 2C57A 1XTTA 3ZJUA 3V7FA 1A96A 1G19A 1RU3A 4EI8A 2CY0A 5J5CA 1BMDA 1N7HA 3I73A 1OI7A 3TD6A 5DI3B 4NZMA 1EINA 1GG2A 5FUXA 1WNTA 3X1MA 3RSSA 4E5UA 4W9RA 5L7TA 1SPBS 1K68A 1IYZA 1VIDA 1YZNA 2Z2XA 1YC5A 2Z9CA 4GGMX 2UU9B 2C8LA 3F5DA 4YJGB 4LSZA 3REFA 1RZRA 2Z1MA 1ZAKA 1AQIA 2MYUA 2FN7A 2B34A 2G71A 3OMLA 3TFWA 3M8KA 4LCJA 4IDCA 2P77A 4K6HA 4HTFB 2P4SA 2JHFA 1RR6A 4I1UA 1JHQA 2QPTA 3S40A 4KQFA 5DNAA 5JZMA 4RL6A 2E4XA 5EE5B 1BYIA 3HCRA 2NPIA 4NABA 1ZOOA 1FLNA 2JATA 2JRLA 1E7RA 5PNTA 5K0NA 1QHHB 1Z36A 1G21B 3QV1A 3ZNQA 5LNK1 4UDYX 3B78A 5MFPA 2JEOA 1RJDA 1YTLA 3G0GA 3PYXA 5IARA 4YV7A 1MA3A 2CXXA 2FF5A 4C30A 4KPUB 5LQMA 4JI3B 1FBNA 4MA4A 3PUVA 5KNDA 3CTMA 1KEEA 1C7RA 3LHDA 3U56A 4Z99A 1A77A 1YZGA 3JWHA 5E0OA 4CLXA 4I1PA 3GY0A 2V8OA 4OSPA 1UWCA 1FYFA 1SXJC 1MAWA 1H5UA 1CJUC 1V3VA 1PNTA 2H85A 4JEUA 4MITA 4P4LA 4ROTA 4XA8A 2E21A 2ZBGA 4KDEA 2PMBA 1AXEA 1EUCA 1O7JA 2O0HA 3A3YA 3MBOA 1OI2A 4WZBB 5A3SA 2PMEA 2YVLA 3K32A 2XTZA 2WG1A 4UE3S 2O5CA 4RCVA 1SURA 3DONA 2CBZA 1F3OA 1FYVA 5DMHA 1I6MA 2GN1A 1E1RA 1KKUA 5D85A 4ZDWA 2NZVG 5GPBA 2NU8A 2R8EA 5H7XA 2RAVA 2G04A 2B1IA 1LF0A 3PC3A 2BR5A 3QITA 3QVGA 2GJ4A 4PX9A 3TN7A 3WNBA 2O54A 3HCAA 1T9AA 4MUIA 2Y1DA 1KI9A 3WYGA 4IQ0A 3RK0A 1L7RA 1Q7CA 3TNDA 3CURA 4MARA 3FA2A 4EENA 4L5BA 2G76A 3TINA 1ZH4A 3H8VA 4L4SA 1U3GA 1E5VA 1H4SA 2CJWB 5GONB 2D1RA 1L4KA 2VYVA 1VE7A 4XD2A 2A5JA 2PJZA 3GFQA 2GDJA 3LBAA 3OURA 4AY6A 3IEVA 4K1LA 2C7PA 4MWGA 3NO4A 1CIVA 1SC1A 5C81A 3WNZA 3GIDA 2NV0A 5LSAA 2PS1A 2Q7DA 4ENWA 3EQ7A 4XE5A 4OI4A 4M9RA 2FI1A 4PHHA 2AJTA 4BEJA 5BY2A 2MSEB 1NVUQ 2AI3A 3LT5A 4GMDA 3BERA 2J0QA 4YWHA 3GCGA 4OH7A 1IQRA 1JZQA 4KOAA 4PFQA 4N3AA 1M33A 4DADA 1UKCA 1D2GA 4LY6A 3BXGA 3UK1A 3TTTA 1Z2PX 3BB1A 1JIXA 1IJEA 4XDZA 2A57A 2EZUA 2XODA 1XL1A 2A8YA 2FSVA 2QVYX 3Q0TA 4G0MA 4ICIA 3UT6A 4CV3A 1WEKA 1N9ZA 2WINI 2HIMA 4P7BA 1ZXLA 2E4UA 2FEAA 4LAFA 5H16A 5JD5A 1OH5A 1KI7A 2CMDA 4R2MA 3U09A 1WQ4A 3NR2A 2D5BA 1XTQA 3N86A 4ZI7A 3L6BA 1J7KA 1UWLA 3PA6A 1P6XA 3F96A 1Y6FA 4JJ8A 3NJ4A 5JYCA 1R37A 2CEKA 5EIWA 1JHMA 1GUDA 4ZEOA 5I5EA 5JO0A 1AZWA 2NO7A 3L4SO 4XYMA 3ZCRA 2AD1A 3EZYA 3EPJA 3UW3A 3R6WA 5A5EA 2X7XA 4BNGA 1E2IA 4I0WB 3AVOA 2CE2X 3HDQA 3LUAA 2FX2A 3NGLA 4XUCA 5JWOA 3SJ7A 4BO0A 4L0MA 3IDAA 5FNZA 4RV9A 1NV9A 3MWLA 5TF4A 2Q21A 3HPRA 4ZA2A 2NUPB 1FNDA 2JGMA 3I05A 1QGOA 1ZC3A 2XMZA 3FHJA 1XV5A 4RK6A 1ZR2A 3V55A 3H6KA 3AVVA 1MMFB 2OESA 1TM7E 1UQTA 1SPXA 3KOMA 3QF4A 5B58T 3U1BA 1ZSNA 1GL6A 4FC6A 1H9AA 3L7NA 3ZE8A 1HTBA 4J8PA 4ER6A 5I8WA 4G0XA 3LNCA 4FI3C 5EP3A 3AHDA 1D2AA 2QZ9A 3B8HA 2KJQA 3MS7A 1X0XA 4J7CA 5BN4B 3VR4A 4BQPA 5A4DA 3OZEA 5CU7A 1UBRS 4TXMA 2IH4A 2I8AA 3BL8A 1IONA 3URKA 1FQKA 2AXEA 1GL9B 2A1UA 4FGKA 4UU1A 2W6OA 3WJ2A 3FTPA 2X3FA 5TT0A 4CHGA 4NYJQ 3OEHA 5BP7A 4NAVA 4LGYA 2DWUA 3CRNA 1D1PA 4BTVA 3PUWA 3VSCA 4BGVA 4IYRA 5BN1A 4MW2A 2C04A 3CT4A 4RVNA 1M8KA 1G291 1XKTA 4WCFB 4QYXA 4ZQCB 3EF3A 1P6QA 1PS9A 3TW8A 4B40A 5JMOA 2IIBA 4B2PA 2PX0A 2B7LA 2QL6A 3P8ZA 3JZIA 5C4IA 3NTOA 1IUOA 3R3YA 5KKNB 1G5HA 5C8YA 1ZOSA 4GW3A 4BLPA 5E95A 2WIGA 3W05A 4CNBA 5LA6F 1UUFA 2DWOA 3TSCA 2ZRKA 5J2UF 2COUA 5EZYB 5B4UA 1XZCA 2NT3A 2OB2A 5KYKA 2ZWPA 4PX5A 4FIDA 1SVOA 4NMHA 2ZEJA 3E9ZA 5SZJA 2ZRQA 1UOPA 3CEMA 4QNNA 2YWBA 4LX8A 4RORA 1EGMB 4R2KA 3DMPA 4G4JA 1I3MA 2H7VA 2XCUA 3LUFA 1F5NA 4KH1A 4UCFA 3K0CC 1BOOA 3I9V1 1B7GO 4XIIA 3D64A 2K7FA 3T1HB 2HJRA 4JOSA 3I04M 5HIIA 5BSEA 1T36A 3KQVA 1WW3A 3DZDA 4F3NA 5KQMA 4EMBA 1LJUA 2HMYB 3STVA 4ENTA 2VUSA 1B8VA 3R0XA 3QOXA 1UDCA 1XAHA 4Q9IA 1KAOA 5CYGA 2QUJA 3UK7A 1E58A 1LBSA 1ABBA 2O3SA 2ODQA 1FU8A 3FMIA 5LQDA 5JYBA 4J2OA 2IRWA 4TMTA 1Y7LA 2SCUA 3UUEA 4CM4B 1TKCA 3EG9A 3WRYA 1KBQA 2YW9A 5AW1A 4IF6A 3FBTA 2OYRA 4AMUA 3IJPA 1TDJA 3FI0A 2FG7C 5A2QA 4I46A 1XVVA 1L7NA 3ZLJA 1RRMA 1E9RA 2FPMA 2C5AA 3L8DA 1QKJA 5IKOA 5BMVB 1CUZA 5CBPB 4MRVA 2E4AA 4HFNA 4ZMRA 4I1YA 4P54A 2DCMA 4WFQA 3H65A 3ZW9A 3MIZA 3VNVA 2RG7A 3LY5A 4KP7A 4HEHA 1DIAA 1U0OC 3DC2A 3KIPA 3V8PA 2VTBA 4CETA 2Z3ZA 3HZRA 7REQA 4JR1A 2RBEA 1TZ2A 2XAAA 3OSZA 3EXFB 1OTHA 1K7YA 4GQBA 5GVSA 1FSPA 1UZLA 5I8ZA 1DHRA 2WU8A 1M7HA 2C98A 2H08A 4RQUA 3LU1A 1NHWA 3FRIA 1E7QA 2O3RA 2QRUA 4FW9A 4IR7A 1PWZA 2CDRA 3CKKA 1JE0A 3MZ0A 1ZIYA 2RI1A 4J03A 4AIIA 3EULA 2PUGA 1LK5A 1PR2A 1Z0JA 2HA4A 3K72B 3RVBA 2O2SA 2UYCA 4UTOA 4MQMA 1CUJA 4PIMA 2YV5A 4LMBA 4M7RA 3AEXA 2IZZA 3EGIA 3M6AA 1DL5A 1O6ZA 4RE5A 1NP6A 1KQ3A 3RVLA 2FE4A 4EB3A 1BWSA 2WJAA 3RAGA 4YJHB 2W70A 1TC2A 4ANFA 1CEXA 1B3BA 4MDYA 3ESCA 3WK8A 4X62B 1TZBA 3K05A 4Y2SA 2JGDA 1K7FB 2P0YA 1UJMA 2R8RA 1GPYA 1GRNA 2HF2A 2O9JA 2D5CA 2F8MA 4GICA 4RY9A 5KHAA 3T5BA 3VHQA 5GIOE 3PCRB 2NUAB 1AXRA 1PVDA 4UBIA 1WCIA 5BNFA 1RVV1 2NM0A 1F6BA 1OX6A 2WYHA 4IWXA 3WWDA 2Q4DA 1R3DA 3LOUA 2IEBA 4AX4A 4D82A 4BEBA 1C7JA 1Z75A 1DCMA 3UIEA 3OPYI 1WF3A 3H2YA 1AKQA 4JJZA 4O6VA 5EMNA 2JARA 4XDGA 3S1AB 4BQIA 4Z4EA 4K6MA 2OT3B 5KVCA 4I6GA 1EDOA 1CHNA 2BISA 2GK7A 1G2IA 3HUTA 4KZKA 2QP9X 4CL0A 1I7SB 2VIIA 3I4CA 3IUJA 5DK6A 4FOLA 4LJ9A 4F8YA 1F8YA 3C24A 1PJQA 3TTSA 4CYMA 3MRSA 1U98A 4JI7B 4XCVA 4HN2A 2WYOA 1BMFA 3GAFA 4FT4A 2C92A 2FJ0A 4QYTA 4B3TB 3AH8A 3RKSA 2QU7A 3B6KA 1YZLA 2QUBA 4OB6A 1L5GB 4DIDA 3IQZA 5TF0A 4RFSB 1PNRA 1ZONA 5INTA 2ZT5A 3HG7A 3C5HA 3JAKA 4JXJA 3SHWA 2DC1A 1UBOS 2XQGA 4LYGA 1V6SA 3MK31 5AJYA 4L3VA 2G3YA 1ZN8A 3ICWA 2CSUA 3PC2A 3S6JA 2QTMA 4FNGA 1II0A 1BCSB 2A2ZA 1A5TA 1AUQA 2NU9A 4O4HB 2FUEA 1Y37A 4P7JA 3IUSA 1SU6A 2QLMA 1GKLA 2F3SA 3MT8A 1EUQA 1HQCA 2QMEA 3OMXA 1X1QA 5LQAA 1HKHA 3O3MB 5EPEA 3B7GA 1ORTA 1VPLA 1ZGCA 4JYCA 3L0YA 1E94E 2J0EA 2JFHA 3EC2A 1DXHA 2OWEA 1ADJA 1DKPA 2NUBA 2RG1A 2AJCA 4QTZA 1O3YA 5TEVA 1V4VA 3BWBA 3PWKA 4L6IA 4DDUA 1CUVA 3EPHA 4Y0VA 1Z0SA 5LYJA 1G5RA 1U0GA 4ZVVA 3NV7A 1TJ3A 6REQB 4B5LA 3D7RA 5IXJA 1TO1E 3KX2A 1E60A 2R7AA 2FR0A 4KQXA 4NZOA 4P4GA 1K8ZB 3OVMA 4XM2A 5ESRA 4AK9A 2PRSA 5JHHB 1QFSA 5JBNA 2RH8A 5DLQC 1YS9A 1QFYA 1FP4B 2P1ZA 3AR7A 4FOTA 1XD2A 5H3CA 3HV2A 3RJMA 3UHPA 2GPJA 3EPRA 4OIFA 1BMQA 4RPGA 2WU0A 1EWQA 4LIPD 4B81A 3UXHA 4F56A 2P27A 5I4IA 1N2CB 1XZNA 2Q8PA 4KWHA 3WICA 1O0CA 2CFCA 3CXUA 4PONA 3T12A 1QV6A 4MXDA 4HKTA 3TZLA 3I3SR 4Z3KA 2VRCA 3ND8A 3EA5A 2OGZA 4TL6A 1X9HA 1NG1A 1PW7A 2ACEA 2ORED 3QX8A 4FE3A 2D6FA 5BSTA 4BP9A 3OQHA 4D1YA 4EA6A 1I2CA 2NU6A 4ZU1X 3W6NA 3CZ5A 5FL7A 1A9XA 1GFWA 3FYUC 1TTPB 3P2JA 5ES3A 5EKXA 5B3AA 1SHLA 2WT9A 2IITA 2ZYVX 1ZMXA 4H3SA 3QKIA 2P8SA 4CT4B 3TBHA 3QEOA 4KB5A 1TJ5A 4W9NC 1YONA 2WTXA 1BNCA 3TYXA 1GAXA 4OGWA 1V9SA 3C3BA 3EGOA 1N75A 1VKRA 4DR5B 4XVHA 1NUTA 3L8CA 3F74A 2HA5A 1N5LA 2GPNA 2VDJA 3M6MD 3ZE1B 1I7LA 2DBVO 1M9NA 4CKCB 3DFKA 1F38A 1Q0SA 1V47A 2VK8A 2ZIAA 4HI0E 4N4AA 3T3GA 3A05A 1ZD2P 2C2KA 6LDHA 4AFNA 4BASA 3W6UA 4URZR 4JHLA 1RWQA 2FE1A 3GFSA 1FP2A 3OCYA 3N1UA 1YACA 3RVQA 4IHAA 3N6VA 4YRFA 4A9AA 4JV5B 3B1JA 3K6KA 2GM9A 2OV8A 5LR6A 3WK5A 3FTFA 2XXAA 4ETNA 1XVAA 3PNVA 3VU9A 4E5MA 2Y4OA 1E1QD 3RS9A 2EX4A 1FVXA 3K1JA 1M6VA 1WUTA 2PPVA 1I3CA 3BREA 3DKPA 3KOWA 4CQJA 4UEKA 2FRXA 5TPZA 3RVDA 5KJCA 3CEPB 5ALGA 3ZQUA 1WCYA 2R8PA 4EJFA 2YINC 2ZIGA 2QRVA 2NTYC 3OT4A 2C8VA 3LLCA 3MSXA 2ZRLA 4P3KA 3UC5A 3RYFB 1DIGA 3LBNA 3UWKA 1SOWA 5H3LA 2BIFA 9ABPA 3LKZA 4R1MA 1ZD3A 3OT1B 5CJJA 1NJGA 5CP8A 2MWMA 4OU4A 2BFPA 4GWLA 4I9HA 5KYXA 2C58A 1Z2NX 1NN5A 1PJBA 4BNHA 5K9ZA 1E1MA 1G60A 2DBZA 3SHQA 4Z4GA 3KD3A 3OZ7A 2AR0A 2X5KO 2XCOA 3NBAA 3VR2D 2BTQB 5LQCA 5IHXA 2GPSA 1UM9A 5A2GA 3DV0A 4EYQA 2XADA 4FGSA 1EWVA 4L8YA 1QMGA 1ZESA 3G2JA 1VYHA 2ANCA 1QP0A 1RQRA 1I1HA 1V7PC 2IYUA 3CLRD 3IIMA 1VLMA 1DFHA 4BNWA 4KH0A 3NVAA 2ASVA 1DI0A 3QVVA 1V8PA 3G9UA 1FMTA 4MIYA 1RRKA 3CZ4A 4RH1A 1KI1A 3KLBA 4LHVA 4Z4IA 2WKSA 3IQEA 3JZFA 3E6AA 3FYSA 2AA3A 2I7TA 2UKDA 5H0IA 5IPFA 2AYZA 1L4LA 5L4SA 1Z4PX 1A7UA 2VTEA 4WY5A 1ZUNB 4DCTA 4U1RA 3C6KA 3TEFA 4RHCA 1WB5A 3HADA 1ZNZA 3AG6A 3JD2A 1GPUA 5AYVA 4GRIA 4WESA 1EEXB 2PJUA 4IDDA 2YKGA 1K27A 1WV1A 3MWJA 3TQIA 3MTDA 3IXQA 2HX1A 2XH8A 3HJBA 5DH9A 3OPMA 1YB4A 4RSMA 4D99A 5I7EA 1P5JA 4Y2XA 2P9QA 1NPYA 5BYKA 5LKAA 5L4NA 2X86A 4YS6A 3C15C 5KC8A 1D07A 1DEAA 4ETWA 3FSJX 1D5CA 1G7CA 5TGZA 3PT5A 4X6LA 2ZWAA 1H2ZA 4OA8A 1AKMA 3QV2A 1VZ3A 2DCUA 2XVZA 3CMMA 2UVPA 4LG1A 2A4KA 2NXEA 3CNBA 2ZUWA 1X94A 2IGTA 1KTVA 3AVXA 2GUWA 2EBFX 2G1UA 2HW8A 2HT1A 1B3RA 2PQ0A 5JWRA 3R40A 4WA8A 5ALKA 2HJHA 1TC1A 4IMPA 3LUDA 3N0VA 5LZ2A 3NH9A 1E20A 4U6SA 3V2UA 3ZBUA 4QD3A 4WZAA 4CCYA 2PV0A 4NDNE 2H1CA 1XZFA 4BMPB 3DTVA 1U8ZA 3A28A 1U8FO 4KACA 3A3KA 4RF5A 1C9EA 5LP6C 2OP0A 1R6VA 2QTCA 2Y6UA 1DFGA 3T5DA 1ZJ6A 1O5IA 2F43B 4EKIA 2O8FA 5IHPA 4GP7A 3EBOA 1USGA 1IUNA 2X0KA 3CX8A 1EM8B 1H2HA 1H65A 4XVQA 2Y1WA 1LTHR 3ZGLA 3G2MA 3NKLA 1NBWB 4Q3CA 4F3RA 1ICIA 3G1TA 2X1MA 3JQCA 5SV2A 3MW8A 5CTAA 1ECLA 1VL1A 3V8NA 3VJMA 3KVNA 3UA4A 1K1EA 2HTEA 1O6FA 3ITEA 5BYBA 1L5KA 4YK7A 2CV1A 2ZS9A 1OC4A 4U4AA 1C3LA 2XCLA 1LX6A 4N03A 3SDBA 5LJIA 5DYTA 5DM0A 2OQIA 1AH2A 1OZAA 4EG5A 3I62A 4KN9S 3ZCSA 4ESVA 2AOVA 1DJLA 1TYDE 2ZCVA 2J5RA 2KPOA 4IIBA 5JE8A 3O90A 1DC3A 1SBIA 3LLVA 3G9ZA 4GECA 1CZLA 4OCZA 2D5AA 5AHWA 4FM9A 5EXPA 5L3RA 4UM9D 3A2LA 4H17A 2XZTA 1K66A 1H4TA 1Q14A 3WSWA 3COYA 2W6QA 3EPPA 3GDGA 3EVAA 4JFRA 2IHZA 4V39A 2XR1A 5DHPA 2YJ3A 5FOSA 3U19A 5HZHA 5DTMA 1SVIA 2XUHA 4BNDA 2YXNA 4N6NA 3F6PA 2E4YA 3WB9A 2VHWA 4O33A 5AKEA 5KKCA 2ASEA 2DP4E 3OTOB 5DM4A 4JVSB 2IYSA 4ZEXA 2AE2A 1CK4A 4B43A 2AOUA 1FDOA 2PSFA 5JASA 1HH4A 2LCQA 4Q9KA 2GK6A 1E3DA 1HURA 2QZZA 3KFVA 4EW2A 1OXTA 5A1JA 1P4AA 1ZY2A 5AI9A 3ZWBA 1JSZA 5ESWA 4NVRA 2Z30A 1UDRA 1K2VN 3GDHA 4BL5A 1ARZA 4QEKA 3CH4B 3RC2A 4UE6A 2CKMA 1WUJS 1XXHA 4IDGA 4MV0A 2OHGA 3ZBQA 4B44A 4NJEB 3RTDA 4QECA 1L5HA 2IWHA 2B5VA 2QY6A 3SJAA 4A0HA 2G7MC 3EFEA 1JWLA 2O8BA 5HZGA 4LMAA 2Y71A 2BMFA 2ZAGA 1KOFA 4FUQA 4OYRA 2O3UA 3VR6D 2DHDA 3WKDA 4BVFA 4PANA 2QHXA 1N36B 2N1MA 1SHUX 4AZ0A 1WUKS 3PC6A 2FOIA 1POWA 3C7TA 2BHSA 3LRXA 3OZIA 5EJEA 4HGOA 4UQPA 2AG8A 2E55A 3CIFA 3HL4A 3OIDA 3AZOA 5BUCA 4QDOA 4XIYA 1GG5A 3DFZA 3AR8A 3GYBA 3FLAA 3V9PA 4O3FA 2FRVA 5B3KA 1HQKA 2BGUA 2R85A 4ER5A 5BNZA 3HB5X 3M9WA 3CVJA 2VSFA 3IURA 1QZZA 3DZKA 2WZBA 3PDJA 1JHXA 3IRUA 3Q9LA 4WKBA 3TK1A 3QEKA 1AIPA 4O2RA 5BMOA 4B76A 2A0WA 3WLSA 1WLYA 3KYCB 3VPSA 4YMLA 3EIOA 2GUGA 2H0QA 5ELLA 3PSHA 4DMKA 4UTXA 1FDSA 5FHRA 4UNQA 1SBNE 2JH3A 1E4YA 4B71A 3UJ9A 3B1VA 1TMGE 3GMIA 3E5RA 2XZDA 2ZZKA 2H51A 1IM2A 5HF6A 3RSHA 3OAAD 3USES 3AEUA 1BGWA 1NASA 4UXHA 4D6XA 1HQDA 4N7RA 2ICAA 2REOA 4TZTA 4KTTE 3IAS1 4MKHA 5CVDA 3VJKA 4OHXA 2GK4A 4ZCPA 1M1NB 2HI0A 3AESA 1M0SA 2Q5QA 3GEMA 4Z3OA 3BGVA 3NNSA 3QSGA 3PLNA 1JV2B 3VKVA 2VHTA 3ZWAA 1J2TA 3W8DA 3M9XA 1N4AA 3TRIA 4V0ME 4X8OA 2V59A 5GJVC 1V41E 1Q12A 3IT0A 2G80A 3KAQA 3RYTC 1TM3E 3IHWA 3IDQA 1H0HA 4FHEA 2C59A 2Q3MA 5KYVA 2AE1A 1HO3A 3BFVA 1NXTA 3W5JA 4JA0A 2AD5A 3KT8A 5JSYA 1JQBA 5EXXA 5ALQA 4JLUA 2YW2A 3VZCA 3VU3A 4PS0A 1XYVA 3E48A 5IVHA 2Q49A 2VH1A 4ZVKA 3D8NA 1QG2A 3O2SB 1FUKA 2F1RA 2W2XA 2XDYA 3DBLB 3VMFA 2QSZA 3ESZA 3UB4A 2QTFA 4LXYA 1KH2A 4R5HA 4UUMA 1SCUB 1V8DA 5H70A 4BB0A 5AI6A 1E77A 1O89A 1V4BA 1WW2A 3GVCA 1KO1A 4PU0A 4MI1A 2GHTA 5B30A 1C0PA 4WY2A 3REOA 1E6LA 4R1UA 3RUEA 1OCEA 1ZK2A 1WETA 2R6CA 3QFTA 5F78A 1MA0A 2LNDA 1I32A 3C6ZA 3TLBA 5BWNA 1VMDA 3KL2A 2IF0A 3TBFA 4BTEA 4LJ4A 2FMIA 1JFRA 4IHKA 3IP1A 4ND2A 4HBZA 4ZIRA 4A4DA 4EVRA 4CEHA 2P7IA 3TL6A 1UIMA 1EGVB 1JNYA 3ELYA 4ZO4A 2QWXA 4AUKA 1OKKA 3FHOA 1IOZA 1Q3TA 4FWBA 3LC0A 1CQWA 3I9MA 4FFWA 4D9BA 2ZAMA 4OX9Y 2EVWX 3D8RA 2BMEA 3R0ZA 3PJRA 2WNHA 1SVNA 3VR6H 1BDIA 1FW6A 2R00A 2PM8A 2YQ5A 2I6TA 3L18A 3ZCXA 1GARA 3N8KA 1XAJA 1Q3HA 4M76B 1KZGB 1NMQA 3UAVA 3E22B 1CPYA 4IFEA 3UK0A 4BLOA 5DLDA 5DNEA 4PLYA 2BGTA 5FNVF 2OBMA 4RXTA 1U28A 3VZSA 3WLLA 3RAEC 1KMIY 4B7ZA 5JC1A 2I65A 1W4AA 1W5EA 1WG8A 1ZYUA 3JQ9A 2AFIA 1EGAA 4G25A 4L27A 4QA9A 4CKEB 5JQWA 1POXA 3IAM6 1MFPA 3D6HA 3KSZO 3J7AC 3S4YA 1Z15A 2DUWA 1XKQA 2WB4A 3ZDBA 3PTZA 3SC6A 3W2EA 3IQWA 1QO0D 5JH7B 1WIWA 5DBIA 4P4SA 2RGCA 1QVWA 5KYYA 1BD4A 2D1QA 2HYIC 3HABA 2YZ2A 3QKWA 5CCBA 1R6UA 4I9NA 1FFSA 4MAMA 1P2GA 1I6WA 5IVPA 4ZD6A 2L2QA 3FZGA 3SQWA 3BMCA 3OE5A 2KB0A 1IBCA 5D00A 3F78A 1I1QB 4WBXC 3X2FA 2HHCA 4RESA 2JASA 3PIRA 2FEXA 2Q3EA 1KZ4A 1ZRNA 3HNOA 5KWVA 1MO4A 1ONNA 1IOLA 1WBBA 2BFDB 2OLEA 3I9NA 3FY4A 2R0QC 5GONF 4QFDA 3DEKA 1C8KA 3INGA 3WQBA 3QPDA 1PIWA 1KRWA 4UQOA 1KJ8A 2CNNA 1BOFA 4IL5A 3U7IA 3U9TA 1U5CA 3WMFA 1BAPA 3AM3A 2CC2A 2M1ZA 2W2LD 3CR8A 3HKDB 4CMEC 1OQAA 3COVA 5IULC 5CPBA 1E3EA 2W0MA 4KV9A 2ZI3A 2ACKA 5FYQA 2WWHA 1NJFA 4DLXA 4RTPA 2ZM5A 2ZM6B 2O4CA 3M3DA 3CG4A 2OKCA 1DT5A 1V7ZA 1YKGA 2DUNA 3BD6A 4BNKA 3WHIA 5A4FS 1MJFA 1PQ4A 1TZKA 4Q3KA 2TECE 5HE9A 3VBCA 3HB7A 4FB4A 3CSUA 2XGSA 3CNLA 4GOOD 1OREA 4M0FA 4QUGA 3R7SA 1NVBA 3GG9A 2X8JB 2H1RA 4ZJUA 1I13A 3WIBA 1NVKA 3RYCA 1Z68A 1EHYA 1HOTA 1H8HD 3T3NA 1U0EA 1OVMA 3P2OA 2WFLA 4LHXA 4PPQA 3OQIB 4KQ9A 4UARA 4ARZB 2VP4A 5K0ZA 4D6PA 1Y1PA 4J49A 4KXLA 2F3TA 1ZZEA 3DWEX 4B6JA 1WULS 2CLFB 5E2AA 1Q1BA 1EJBA 3DVSX 3JQ8B 1Y42X 2VCEA 1C50A 1U8CB 3NAGA 1SY7A 5AOCA 2VOEA 3GNTA 4WKCA 1C7EA 4NLLA 2Y1CA 5ED4A 2OHJA 1XDBA 3WNVA 1O4WA 5IVDA 2N0SA 3A4VA 1UPCA 1Z5OA 3AB3A 2IXTA 2YC4C 4F2HA 4H27A 4IDFA 4NCKA 4OSEA 4UXIA 1EM6A 3ROPA 4BMDA 3R75A 2FR8A 3FD8A 1Z8FA 3UT5A 1J2EA 1AXGA 1DZIA 3REQB 4Y3UA 4LZOA 3CRW1 4JI5B 3WFIA 1W0KA 1GGNA 1DOZA 1GCIA 2EU8A 2PYDA 4BBAA 1IPHA 2MJLA 4NCIA 1XTRA 2BMDA 2P1DA 4LA4A 4LYHA 3GH3A 2P2DA 3D6MA 4AO8A 4E15A 5M29A 1KTIA 4C4PA 1J06A 1N2BA 1VKOA 4GVLA 4HHEA 1CQIB 3ZI4A 5C1PA 1A2OA 2FG6C 3KB1A 3TL2A 3F6SA 1G0OA 3KPVA 4HX5A 1A9YA 1RYNA 1UXIA 4B73A 1TJNA 4YI5A 1WP4A 1A8HA 4F06A 1C9KA 1GU1A 3OOYA 1G4HA 2QSYA 2ZFUA 3QEJA 2GKGA 1RLJA 3CNHA 2Q5JA 1Z5ZA 3JYPA 5LDHA 4NYJR 5HNKA 2QRQA 2YS7A 4HWOA 4U6NA 4UFNA 1YJCA 1YI1A 2YVUA 5GQSA 3GVHA 1G9XA 2B3TA 1Z4NA 3P4YA 1OAOA 5L3VA 5JPDA 1GPBA 3DUWA 4ZZ0A 5FXMA 5I4BA 3CZAA 3WP0A 5B6IA 3DMNA 4AJHA 3I01A 4QUEA 1D5WA 3A6DA 3GJ6A 2NYUA 4RKRA 4TTAA 1IAVA 4ZC1A 1ISRA 3RS8A 1SBZA 2HSJA 3F9RA 1X86B 1I5OA 5B3JC 3ELUA 4HH3C 4FN5A 1PYGA 1S2OA 4WKNA 4BO4A 1H0KA 4PNPA 1S8OA 4CKYA 4JKIA 3SZUA 4FE4A 4ND8A 1M83A 1MX3A 1NVGA 1T6NA 2HIGA 2J5XA 4OHWA 2ZSKA 4H1WA 1Y3DE 1ML4A 1HLGA 2FW6A 2Y27A 3K0AB 2QLJA 3FWZA 4X1YB 3PRYA 4O4JB 1STOA 4RK1A 4TN1A 5EP1A 2YCLA 1NJ1A 3PXXA 3GQBA 4JJEA 3QIVA 3NYWA 2HLDA 2GNPA 5TDHA 3TM4A 1QP8A 1MTOA 3WSVA 3GDWA 2DFVA 5JI2E 1L8OA 3K2EA 4YXFA 1YJAA 2DT8A 2ZJ2A 2V6BA 3GFVA 4BKOA 3D8SA 1Q2XA 1VPDA 2ADFA 2D00A 1V1RA 2ZSEA 4L4ZA 2IYTA 5C31A 1IHOA 1YL5A 4JVMA 4IEFB 5FCDA 4DL9A 4YCNA 1JDNA 4DQXA 1SEPA 1CIJA 3T3MB 4G8CA 5A9SA 1Z0ZA 3FETA 5C1IA 5HKBA 2AI1A 4MR8B 5E1MA 4CF6A 4LFBB 1LSOA 4XDHA 2B2NA 3DE5X 3K16A 5HXAA 1U9JA 2J3IA 3PBKA 3HV0A 4AF8A 2Y1EA 4R81A 2HRDA 1QTRA 1T2CA 3SYLA 3L04A 1ZXXA 2XWSA 5DNYB 2A5FA 2D2EA 2FV8A 2KM1A 3TLGB 3WISA 3H1PA 5GP1A 4E33A 1RABA 1L7QA 3D2CA 3BZWA 2AUTA 3MELA 1GGFA 3KT0A 5AKLA 1B26A 5CDHA 2P0AA 3P5BA 2OV1A 2EFDB 3R9KA 4TSFD 3TM5A 2BGLA 4YFYA 3T1TA 4L95C 3QOWA 5CXXA 1P7CA 1ULTA 1MH9A 4LC0A 3WTBA 3OOHA 4FDLA 2QYHA 9LDBA 1M75A 1SVSA 2G08A 1W5BA 2OZLB 3H4TA 2HZBA 2PD6A 3TOZA 3W1EA 3ZUPA 5SYNA 4ER7A 2IOQA 1UPAA 1B2LA 1ZUWA 5C1OA 5HW0A 3BQ9A 1C4WA 3FOCA 3HR8A 3V8EA 5CFQA 2LTAA 4PIVA 1QPGA 5MFZA 4LOJA 5E7MA 5D5PA 5KVSA 4NBTA 4OD0A 4P0TA 1GTG1 1THMA 2QP3A 1TT7A 2OMEA 3OTWA 4QASA 3PUYA 2ZRJA 3AUTA 4Z86A 4UOQA 4JI2B 4Q4JB 5C2JB 3FNBA 4Z3DA 2JS7A 1FTSA 1W88B 2HDWA 2OD9A 1FFGA 2Q3HA 4I55F 4M8LA 3VH1A 3VZQA 1NOJA 5CDSA 4JITA 3DFIA 1U8YA 3DHEA 4F5EA 1L6IA 5LZ5A 3VR2A 4DS3A 4ZHSA 5B2FA 1ZXBA 1VL6A 2PUJA 5DO9A 6YASA 1XHLA 2PIAA 3NUGA 3KAPA 5IT0A 3LY7A 4C1BA 2EKQA 4W5OA 1ZM7A 5IWAB 4P34A 2UXDB 5AKYA 3CWQA 4MWDA 2Z8YA 2VLBA 3IVCA 4S0XA 1CR2A 1IULA 1CUFA 3MTIA 3TMYA 4LRUA 4C1NA 3HN2A 5KBYA 2JC3A 1W34A 2HXYA 3LDGA 3UVEA 4EX7A 3VR0A 2J31A 3FH0A 2F59A 5AHKA 3KLOA 1AUXA 4X3PA 3P9YA 1QGDA 4ML3A 3UWMA 4DLNA 1TAQA 2RH5A 2XHZA 2XEXA 3PNOA 2B98A 1ZP6A 1YMVA 2QMUA 1RKUA 1QHSA 5HM8A 1L4UA 3FMPB 2BRUC 1QYIA 3HBFA 4KMRA 2A9FA 3RK1A 2VH2A 4A2QA 2EFHB 2P9TA 3CJQA 2WR8A 1YB5A 2HK9A 1N3IA 4DV0B 3GWZA 1Z3IX 4JJGA 2YJ4A 4A8JB 3EXIB 4YECA 4BY9E 2PGJA 2D1TA 2GPYA 3TG2A 2EP8A 2PSSA 4YEDA 2DPGA 3N2KA 4UUNA 1S7CA 2B5WA 2PAFA 2YNMD 1DXOA 3IPXA 2ZQYA 3PGKA 2V6FA 4GBGA 4NL4H 4YIHA 1N6RA 3FUWA 1HDGO 1YQXA 3K0FA 2CW5A 1XVIA 2DZDA 3FF4A 4K6OA 1U0SY 2DHQA 3GF4A 5BRAA 2VPWA 3K92A 2WILA 3ABOB 4GX1A 2XB9A 2OCDA 4ADSG 4PFSA 3OOWA 3W5IA 4EHHA 1W1IA 4Q19A 1W36C 2IS4A 5AUNB 4WLNA 1I4OA 1M34A 4LF9B 1MAAA 5HRUA 4GR4A 4G1CA 4ZTBA 3LX6A 4C0AC 4PPGA 3BCHA 2W2QA 3KQWA 3USZA 1ZD1A 2IYWA 5C5CA 3DE2X 3N58A 3VO8A 4FYYA 2O2IA 2PUDA 4LDAA 2VDUE 1CUIA 2VDQB 2BZSA 4UHHA 7AT1A 1B14A 2HGSA 3WS7A 4BP3A 2ZPTX 1YJ8A 1MZPA 1NM5C 3BXFA 1J0EA 1XTSA 3NWBA 2QGFA 3U4AA 3HN6A 4MV1A 1O96B 3IUQA 4YCCA 2O59A 3OQOA 3W9BA 4CKBB 5FHQA 2EKDA 2G63A 4LE0A 3JVEA 4OVKA 1NN1A 2IS6A 3R6LA 5ARCA 2LIPA 4QGGA 4JOQA 2ZJ3A 1SXJE 3I58A 4UUQA 3QE0A 4IZOA 1E3WB 1CBUA 2ATCA 1N2SA 3QBJA 4OLJA 3V8QA 4W6ZA 2PQ6A 5LKRA 4X8LA 5T3YA 5EJAA 1AOXA 5DXJA 3T1VA 4KPEC 2P2SA 2V54A 3DDCA 3T7SA 3K8QA 2BGNA 3EY4A 3IKTA 1N5JA 1I2AA 1FMLA 2JEZA 4AURA 3BBPA 4R05A 3SFZA 4BGUA 5HMLA 1HUQA 2AOXA 1S4MA 5L7YA 3RC7A 1DG9A 3KOYA 1BDMA 2NP6A 2QQ5A 3R9XA 4P4UA 4MA0A 4BO8A 3NASA 4YUVA 2C7RA 3CC8A 4PICA 2JBAB 3M83A 3R0JA 3QLEA 4WA7A 4HQLA 4HADA 3EZXA 1H8EA 1BS1A 2J8ZA 5FL3A 1YZTA 4GMHA 5IAOA 2FTKE 4WASA 5LP1A 4W6QA 2IDJA 2MMCA 3IPYA 2VP5A 3RLFA 4G8DA 3SVLA 1I9GA 1YDEA 3E7XA 2HK7A 2DE0X 2A78A 3HE3A 4E4YA 2IA5A 3MWYW 2CV2A 3HRHA 3VKFA 1CE8A 2R1TA 3QGMA 4CL3A 2GBGA 4OJMX 2ZDGA 4ZANA 4QYWA 3QKSB 1CVLA 2N75A 1KRXA 4ZHQB 2X14A 3MS2A 3OX2A 3BWVA 4QICA 4V3CA 4QPDA 1GD1O 3H9EO 2Z3WA 3ABRB 4AP6A 1PJ8A 2A67A 2O2YA 4HP8A 1KJZA 3EGCA 4KV7A 4RVGA 5IJAA 3SKYA 3WZ2A 3JV7A 1MCZA 4LV8B 1OHHD 4G0UA 4FC7A 2P40A 4JLOA 1MBZA 1ABEA 1RZ3A 3VR6A 1FLAA 1U3DA 3A04A 3EXHA 2PA3A 2YWCA 3C4VA 1PJLA 2QM3A 2V7QD 3ZV5A 1ATZA 1TYZA 3QPAA 4M0DA 5AW3A 1NQAO 2AWOA 2JG3A 2CDAA 2IV3A 1V5IA 2XDAA 1VA4A 5H9WA 4W82A 4JC8A 4O8CA 1QRTA 2EEPA 1OFVA 3RYIA 1HL3A 1JJFA 4Y9RA 3UJ8A 3U0BA 1L1RA 3IALA 3QVKA 1SN7A 2QE7A 3ES9A 1RXSA 2EW8A 3KBBA 1X8LA 1T4CB 1V3UA 2AMYA 1KQOA 2WHPB 2ZJYA 4RPJA 4Z7JA 1T8WA 1TUEA 1GDTA 4DDKA 1BXGA 4J0KA 5JJIA 2XMCA 4IFIA 4IDEA 2W93A 1W2GA 1QS0B 3IS3A 3OPQA 4F84A 5MDHA 4F7DA 2AFHE 2X40A 5B36A 1J21A 1WXHA 4EABA 1WUIS 1DWPA 1FZQA 4QPZA 4D98A 3V1KA 3UT0A 4DPKA 4EZEA 1B76A 2WMYA 1Q21A 1RI5A 2V55B 2VO1A 2IEIA 2Q45A 2VT7A 4J0FA 3RREA 1KIAA 1MGOA 4PQEA 2B78A 4G3XA 4JOCA 4LGCA 4UM7A 4UNPA 3WFJA 5FAKA 4QVIA 4JB0A 3OAAA 2OA0A 3TUIC 3CUYA 2PWZA 2D8AA 4OGFA 3OTHA 4Y1RB 5GOTA 2VF2A 3SHVA 4ZEMA 2ZW9A 5CT4A 3T41A 3OM9A 1E2HA 3RWOA 3HH8A 3LXXA 3ZBTA 1VG8A 5SYAA 2PUEA 2HU5A 3DB1A 1AB5A 1XPUA 5ALWA 1U65A 1ZKMA 3OM0A 5HF8A 1S4QA 1TF2A 4PSVA 4QBKA 5CYPA 4MGZR 4RQAA 3EX7C 1O6BA 4RCYA 2D5LA 4JLNA 3M1YA 4MW9A 3CH6A 1Z2CA 3D8UA 1LQUA 1TE2A 3OUTA 4ZVSA 4ER0A 4W99A 3E4CA 4EDFA 1TA0A 5C3MA 4WN3A 4BXOA 2Z04A 2ZT6A 5KU7A 1UJ4A 1NMXA 3PZRA 1TKRA 2NUTB 1VSUA 2X3YA 3PPIA 1Y3IA 3Q0IA 4NE2A 5KTOA 2PZLA 2R6JA 3N74A 2A5LA 4FSXA 2D3TA 5HM6A 4QT0A 4DB2A 5IMBA 4JIMA 4P8RA 4OX9B 4UASA 1QG4A 2VPXA 3ZHBA 2X0RA 2XLCA 2PKCA 2X0IA 3D6NB 2JPDA 2OSBA 2HQOA 1B15A 2ON6A 2PL9A 2ZYIA 1JF8A 4HNSA 1RQPA 1DINA 1UXJA 4C78A 5AI0A 4Q01A 4YQFA 4EFMA 2YIJA 4JGIA 5ABPA 2DKFA 2DR2A 3T7EA 1J5XA 4KZPA 1QHNA 4LCBA 4QGBA 4RIGA 1NF3A 1F14A 2C4WA 5BV8A 2F4VB 1IBRA 3KV3O 1DAOA 3O91A 2Y77A 3LUPA 5IBPA 2GESA 4AZSA 5LU8A 5H80A 2QR3A 4G81A 3UXYA 1YMUA 2PH3A 1MVOA 2OBLA 5EFOA 1ZD5A 2GVNA 3PB3A 5BQPA 4FNAA 4ZYWA 3TQRA 2Y1KA 4GC5A 4C2AA 1FTGA 4CM8A 1WXWA 1CDDA 1NBEA 2R6ZA 4MRNA 1PR6A 1VIAA 3WYFA 1DWOA 3HJNA 4CMHA 5KREA 1UT5A 2FH5B 3B52X 3ECAA 4NEGA 2WM2A 3IELA 4Q4HB 1PLKA 5CRIA 1YUNA 3CHYA 1T3TA 2W0SA 4RF3A 2X9GA 3HR7A 4LBZA 3KAKA 5FBQB 3T7RA 2YWDA 3SS9X 3ZLTA 1XSEA 2QAGC 1WD7A 3G6KA 1USKA 3LA8A 5K3OA 2HCRA 1X1DA 1XNJA 2B3DA 1JSLA 4HPXB 4H08A 3PGLA 4CMIA 2H18A 1LH0A 4M9XA 2WFAA 1QPZA 5G02A 3UHOA 3WGYA 1C9DB 2P5YA 4ZZ2A 1DBSA 1SGWA 2WTNA 4CTOA 4NZNA 4EYSA 5J63A 3HVJA 2WP0A 1QO0A 5TJ9A 4FFBA 4IDAA 2NNLD 2VF4X 1T9ZA 2XV1A 4S2EA 2WMDA 3KKQA 2PX4A 2XQIA 2BI8A 3CUWA 1PL0A 2CNKA 5IC6A 1M76A 4Y2YA 3ESQA 4BB5A 1V1MA 1E99A 1JHPA 3ZR4B 4BEVA 4PM4A 5BYAA 1YBFA 4MQFB 5DWQA 3KPUA 3WP1B 4Z49A 4DREA 1G8JA 3S7ZA 4NOLA 1F9EA 2AVDA 3P2EA 3EIQA 1BXZA 3EQZA 4BKRA 4MHTA 4LNHA 2BWJA 5IG2A 4YDHB 4Q4DA 3GBVA 4FEYA 3HN7A 3OWXA 2R8BA 1DQNA 2VAMA 3KQHA 4J1TC 3DAFA 4JJKA 3FZNA 4DCUA 3KTAA 3PNBA 3U7JA 5C8VA 4KLRA 4ZOLF 5IW8A 1KOGA 1D3AA 5A7FA 4W5NA 1PNOA 3EDRA 5DCUA 3UH0A 5CA1F 5KTNA 1FS6A 2W2LA 3M34A 5AW2A 1S3SA 3T3IA 1PQPA 3E2PA 3H04A 2XUIA 4J16C 5J43A 1QVAA 2GAAA 3KUUA 5CW2A 5ICEA 3AKCA 5F3DA 1VG0B 1LV8A 1L5FA 4RU1A 4AJOA 3O7WA 3PXAA 3E18A 2X2OA 4F4FA 1UBNA 1OH8A 4BQOA 3SIWA 5CD9A 2WWXA 5MGBA 3M89A 2YMQA 4MLDA 4YMTA 2ZSBA 3AJ9A 2DUJA 2ZBEA 3WB2A 2PO7A 1US8A 3W2IA 3U4QA 1F8FA 1TPYA 2G0NA 3GV0A 2EYUA 1N9GA 2J07A 1CKEA 2VS1A 4PYOA 2R1VA 3GRPA 4EJSA 4WLOA 2VN8A 1OC2A 2CJYA 2X4LA 1OIWA 2H9YA 3GFGA 1H8HA 3O8OA 1L4NA 1RCTE 3JRXA 4N40A 1T5SA 3QIAA 4LDNA 4FTWA 1P9NA 5ITZA 1KAQA 1LXCA 2YVKA 4AJEA 5JMTA 3KALA 3O95A 1LI5A 1IN1A 3HCWA 2OAEA 3T4UA 4JI6B 1GG9A 3HDHA 5AVJA 1IXZA 1NRWA 2HF8A 4F97A 1U02A 2J4DA 3SF8A 2R6R1 5CVCA 1U11A 3SLRA 3CRQA 4L0QA 3GJ8A 3IIKA 4RHYA 2QW8A 3FAKA 4LE2A 3E3LA 2PUVA 1XDGA 1L4EA 2RCNA 4DRXB 3UOAB 5C1BA 1HLDA 3UNXA 2IY8A 5FPSA 2VP6A 3G17A 2J3JA 3MQFA 1KL7A 2JAUA 1TLLA 1TW2A 3GG2A 1OWLA 1KFCB 3QQ5A 2WYUA 4UULA 4D92A 4X6YA 1EXVA 2QBYA 3PQ3A 2ECPA 4MYRA 4GPAA 4Q6WA 2YOHA 1E7SA 2RIRA 1YQTA 2CNWD 1MAUA 2NSJA 3ANLA 2X9VA 4YQZA 2GA8A 1PFWA 2J7KA 4L9SA 2WU3A 2A94A 3IT3A 4ECEA 3N76A 1T29A 2XTJA 4PF1A 4UCQA 4TVOA 3EGXB 5CNMA 1ULAA 2VHCA 2W5UA 3K8YA 4OIMA 2B69A 1KY4A 1HEUA 4XUGB 1XB2A 1AG9A 1QGUB 1TM4E 2Q6KA 3H2KA 5YASA 5IRCD 2TS1A 2ZJZA 3IYLW 4FE7A 2FFHA 1NVXQ 5E2IA 1P9RA 5DASA 2I80A 3U60B 4C06A 2FUG6 1WXQA 5E9JA 4HK4A 1W35A 1B8NA 3EJ6A 3QJGA 4H7HA 2VNIA 2VZ8A 3NM5A 3IDZA 1QJ4A 2R25B 3CNQS 4MR7A 3BDAA 4S35A 4G09A 1Q0PA 5AO9A 4BRSA 2PUCA 1PV1A 3G2LA 2UZ4A 3U4GA 1GYPA 3G59A 1DC8A 1BVYF 1T5DX 4F12A 2XKKA 3HGQA 2Q5HA 3RUPA 1EG2A 4L02A 4LZAA 5KPJA 2XF8A 5AKHA 5CT8A 3EGEA 4GQIA 5J9FA 1SUSA 4OQFA 2ECKA 4WDQA 3PR3A 1GKIA 1TUIA 3A37A 1UAYA 1GZ4A 4KNYA 1JG4A 2QMYA 2R47A 3LY9A 3OA0A 2DB3A 1QU2A 3ZY4A 2I4RA 2C42A 4OG2A 4A8PA 1OY1A 1BW9B 4CV2A 5H59A 2X9QA 3UTDA 4UHDA 1MZVA 1O94D 2QZSA 1CUGA 1YZKA 2AF4C 2FW1A 4HXEB 4KLAA 2FDCA 3AM1A 4MUYA 3DOIA 3MEQA 1FUEA 4P3XA 2PTHA 5B6PA 3AEKB 2VJMB 3FDFA 3DB2A 1EBFA 3LVRE 4DLSA 4OKIA 3AUAA 2IU0A 3X1KA 4C0XA 4YJ3F 3C16C 3G8DA 4QYSA 4OFWA 4HQ6A 2F1IA 4QRHA 5KNBA 5L45A