4BYMA

Structure of phaz7 phb depolymerase y105e mutant
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
342
structure length
342
Chain Sequence
LTCGTNSGFVCKGTQTQYAGGFAPGVGYGGFGGGSCTATKTPVIFIHGNGDNAISFDMPPGNVSGYGTPARSVYAELKARGYNDCEIFGVTYLSSSEQGSAQYNEHSSTKYAIIKTFIDKVKAYTGKSQVDIVAHSMGVSMSLATLQYYNNWTSVRKFINLAGGIRGLYSCYYTGYANAAAPTCGSQNYYNSYTFGFFPEGWYYGVWVSNPWTGSGSTNSMRDMPAKRTAVSFYTLSAGFKDQVGCATASFWAGCDSAAKFASTTSNVKAQINVGAGSNATQADYDWADGMPYNAGGGDTTNGVGHFRTKTNTGAIIQRMLLTTCTGLDCAAEYTTGPKAAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords PHB DEPOLYMERASE PHAZ7
publication title Biochemical Analysis and Structure Determination of Paucimonas Lemoignei Poly(3-Hydroxybutyrate) (Phb) Depolymerase Phaz7 Muteins Reveal the Phb Binding Site and Details of Substrate-Enzyme Interactions.
pubmed doi rcsb
source organism Paucimonas lemoignei
total genus 128
structure length 342
sequence length 342
chains with identical sequence B
ec nomenclature ec 3.1.1.75: Poly(3-hydroxybutyrate) depolymerase.
pdb deposition date 2013-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01674 Lipase_2 Lipase (class 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4bymA00
5EGNA 1G66A 3AINA 2X8BA 4GEGA 2WIJA 2C4HA 1VJ5A 1EB9A 5T4FA 3EQ8A 1UFOA 1QE3A 5AOBA 1ZI9A 5BWBA 3ESCA 4GI1A 2HIHA 4U2CA 5CXXA 4CCYB 2H7CA 5AK3A 5JARA 4MYDA 2WIFA 3M81A 1ZIXA 1HDEA 3BDVA 3SC2A 4EUSA 4OUKX 3IUQA 1R4ZA 5EHQA 5LZ9A 2JGJA 1JI3A 1GKKA 2EDCA 2V96A 4L3WA 4KRYA 1MAAA 5JYCA 3H04A 1XZDA 3B3QA 3V48A 5FUMA 1KU0A 3AFIA 4EB0A 1DX6A 3O4IA 3QPDA 2B4KA 4J7AA 5I8PA 4MWTA 3H2IA 1Q83A 3HJUA 3IULA 4BAZA 2QS9A 4RE6A 4TGLA 3PUIA 1I6WA 5C8ZA 4GBGA 4FDMA 1C7JA 3W04A 3C5VA 4Y2SA 1VKHA 3OG9A 4B6GA 4AO7A 2XUFA 5I9IA 1JT2A 3NGMA 4F0JA 5FPQA 1USWA 2HA3A 3WL5A 4Q82A 4Q3OA 2OXEA 1M33A 3GZJA 4J0IA 3ZV7A 5JD5A 2V97A 3FYTA 1LGYA 1CUFA 4A23A 5IVDA 5KBYA 4FMPA 4FLMA 4PQEA 4ZV7A 5AM4A 3AZPA 1FFAA 2NW6A 1A8SA 5AIBA 4BAUA 2GZRA 4P92A 1YB7A 1QIIA 3E0XA 3CN9A 4RPCA 3VISA 1W75A 2XQGA 5K3CA 2X76A 4Y2VA 3R3YA 4M0EA 1YA4A 3ESAA 4O08A 4PSDA 4DYHA 1K5PA 1QFSA 3STYA 2ZYIA 1ACLA 2DSNA 1DWPA 1X2BA 3G8YA 3PFBA 4NZZA 1QJ4A 3C6ZA 5AI8A 5ALHA 2WG1A 1FFBA 4BVLA 3WK8A 4XJVA 1DX4A 4FLEA 1W1IA 2HA7A 1G4HA 2HU8A 4AX4A 1XLWA 1XQWA 3H19A 4ETWA 2B61A 2XQKA 3WQHA 4UFOA 3RLIA 5K3FA 4K6KA 4X92A 4DMKA 1QIFA 3KWJA 3O0DA 1U2EA 3G02A 1ZGBA 4JH0A 4IQ4A 4OYYA 1VXOA 1ZJ4A 2HU5A 3MGAA 1JU3A 2QXUA 4H7EA 1YAJA 1QIJA 1N8SA 4HRXA 2O7RA 5CBKA 1Q0ZA 3FLEA 5ALUA 3D59A 4FFWA 5DYYA 5ESRA 1WHSA 2OCIA 4G8BA 4J3JA 4I19A 3VJKA 4F21A 1L7QA 2XLCA 1T4MA 3IUJA 2HM7A 4BB0A 3D2BA 5K3DA 1P0IA 4H77A 3I1YA 1QOZA 2J4CA 1VA5A 2ZSIA 5BWCA 3A70A 1DINA 1DWQA 3GFFA 1NU6A 5KWJA 4DNQA 4UHFA 1E5TA 3IB3A 4EZIA 3N2ZB 3D3NA 3QMVA 4QDTA 3HYSA 1FFCA 1H2ZA 3K6KA 5AP9A 1HBJA 5HZGA 3QITA 3D2AA 3O9VA 2G63A 4EY6A 4AXBA 4JEIA 3V1KA 1ZI6A 4J0DA 4BC1A 4CIBA 2QJWA 1QIEA 2QTBA 1BE0A 1WOMA 3EBLA 2WHPA 4FTWA 2YASA 3AUKA 1NX9A 5AKYA 1HL7A 1THGA 2WQZA 4W9RA 2BUCA 1QGED 5CT8A 2C7BA 3PICA 3D7RA 3H2GA 3G0CA 1TRHA 3H0CA 3N0TA 1YA8A 4DM7A 1ETHA 2WM2A 4RGYA 4CCYA 3A2MA 1CUDA 1IZ8A 1XFDA 3DD5A 4AZ0A 1XRQA 3FSGD 2BUBA 5JAPA 2ES4A 4QDOA 3PUHA 4BDSA 2WJ3A 4LXGA 4WY8A 1R9MA 2XE4A 4KE6A 2Z3ZA 4L0CA 2PL5A 1VLQA 2GBFA 3FNBA 3GA7A 5ALZA 2WFLB 1IUOA 2R8BA 1XROA 5CT5A 4E46A 2XMDA 3O4GA 2PPLA 1ORVA 1VXRA 4Q1VA 2C58A 4WDQA 3C6XA 2BKLA 3BF7A 1AGYA 1XZKA 2HL6A 2GZSA 4B0PA 4BYMA 3HZOA 5HKAA 2QOEA 4B81A 4EY4A 4C89A 1CFJA 1XZMA 3FYUB 5LZ4A 1O6GA 4H7IA 3H1AA 5HCUA 1CUAA 5FDFA 3I2IA 4OU5A 2WJ4A 1Y37A 2OQIA 1DU4A 2GBGA 3ANSA 1SOMA 2YYSA 1MNQA 4IH4A 3JYHA 5EHZA 4J03A 2P8SA 3ZLUA 1YASA 5KWIA 2WHRA 4WDRA 4ZV9A 3HI4A 2E3JA 4S0XA 2Q0XA 4W1SA 5EIEA 5D3KA 1HPLA 2XUQA 5E4TA 1MNAA 5ALRA 2XUAA 5HKBA 5IVKA 1UWCA 2WIDA 1XLUA 3E1GA 1AQLA 5ALKA 3H1BA 1T2NA 3L1JA 3WJ1A 5SYMA 1ZD4A 4UHDA 1XKTA 4UBOA 5FP0A 2PSFA 2I03A 4D9JA 4UBLA 4JNCA 4Q3KA 3HEAA 3F97A 4EA6A 1CR6A 1UKAA 2VT6A 2V98A 5E4JA 5JANA 4FHZA 3UMJA 3LIPA 3VXKA 4RE5A 4G9EA 4QLAA 4GDMA 2GBIA 3AZOA 5J3JA 2H9YA 2HRRA 2OAGA 1G42A 3FOBA 1MPXA 4B80A 1EX9A 1CUXA 5DJ5A 4B85A 1TAHA 3MUOA 4MWSA 5AIAA 3RARA 3WK9A 4WCVA 2IITA 1OILA 2PUJA 2BCEA 2JGEA 4ZXFA 4N5HX 3W9UA 1CUWA 2QR5A 5AHXA 1GQSA 5JALA 1A88A 4DIUA 5FXMA 4QLOA 4L9AA 1ZD3A 3HRHA 4Y2YA 3ZLTA 1JMKC 3WL8A 4U2FA 4UBMA 4RNCA 3HLKA 4ARAA 4DNFA 4YPVA 1QIDA 3R3XA 4XWGA 5ALSA 2ECFA 1AURA 3DYIA 5AM0A 4ARBA 4I3FA 4QEKA 3I2GA 3ZPXA 3S8YA 4BVJA 2RGUA 4C4YA 2WILA 2PU5A 5CW2A 4KAAA 4IH9A 3EQ7A 2HA2A 4DNOA 5DNWA 5C81A 4QE3A 5JZ9A 2JEYA 1A8UA 5AKHA 2WJ6A 1EVQA 3AIKA 1CUYA 3QMWA 4KAJA 4UHCA 3FBWA 1ODSA 5HF9A 2C5FA 1U8EA 4OSEA 4FLFA 4QNNA 3LIIA 1E89A 1Q0RA 1FFDA 2AJ8A 3T52A 5C8VA 5LP1A 1XZHA 3DQZA 2CJPA 3QPCA 4BRSA 1H2XA 4C01A 1AKNA 3KD2A 1EHYA 2RONA 4GW3A 5ALGA 1H22A 1YAHA 4HTAA 2XLBA 3BF8A 3H2KA 1QLWA 4H7DA 5JAHA 2JBWA 4KYVA 5EI5A 4J0HA 5AM3A 4UBNA 4BP8A 4A5SA 2WUDA 1LPAB 5HFNA 3SWWA 5CT6A 2XMSA 3I1IA 5AKLA 1NU8A 2ZYHA 4W1PA 4DSAA 1LPBB 5IKXA 4PF1A 2IIVA 4P08A 5EIAA 3W06A 5JIBA 5ALYA 2XDWA 3WKCA 3U0VA 5DNUA 5JADA 1E8DA 3DL4A 1BEEA 1F8UA 4NS4A 2Y6VA 2CKMA 2PX6A 2XMBA 2WTMA 2JGKA 5E4YA 4Q34A 5HF8A 3FAKA 2VJDA 4G4JA 1JJFA 3ZI7A 1CUZA 4MXDA 5HQ3B 4LXIA 4Y2PA 3STUA 2HA6A 5ALIA 2WFLA 3I2JA 1MX1A 1WHTA 1Y7HA 1LLFA 1LZLA 1BU8A 2G4LA 5JAUA 2BFNA 1MX5A 4L72A 1Q84A 2FUKA 3C5WP 3ESBA 4YASA 1BCRA 3DNMA 3W2TA 2QJRA 3Q8WA 1TCAA 5ALWA 5E2IA 2RHWA 2J3QA 3TRDA 1ACJA 1EB8A 4LYEA 1K6EA 4KACA 3WYNA 1EVEA 3C45A 5AICA 1E3QA 2OCGA 3CN7A 1LPNA 1AZWA 2G5PA 3PE6A 5LIPA 2VATA 1A8QA 2B20A 2QXTA 2WHQA 3OURA 5LZ5A 5EHXA 2ZJ6A 2DHDA 6YASA 4MYSA 1HQDA 1GT6A 5D3ZA 1VZ3A 5LYYA 5AI9A 4UHBA 1DT5A 3WL7A 1QIGA 4G8DA 1UK6A 3GBSA 4KE8A 4BZZA 3BIXA 2O2GA 2IX9A 2D0DA 1CRLA 4HVTA 2FJ0A 4AMZA 4X85A 1XQXA 1UK7A 1JJIA 3PI6A 3FCXA 4Y2RA 2GYWA 2RI6A 1FFEA 4KRXA 3RM3A 3G0DA 5A6VA 4QWWA 2EDAA 3HXKA 4N8EA 4MEBA 4MQLA 1XKLA 4WFJA 4QDUA 4PV7A 2PBLA 1XZAA 4ZREA 4BDTA 2VJCA 3M83A 1LNSA 4X6XA 2O2IA 2J4FA 4C6HA 5ALEA 3D5EA 4BTLA 5JZBA 4C4XA 3O95A 4X91A 1D07A 4OU4A 1N5MA 2XUKA 2VAVA 1E8NA 5CXUA 2J3DA 1BN7A 5A7GA 2VQ6A 5ALLA 1MX9A 3WLAA 1AUOA 4JYPA 4FWBA 3OC0A 4Y9SA 2JF0A 3DKRA 4WJLA 3WWOA 3DKKA 1ODTC 4Y2XA 4BTVA 5EIHA 1IMJA 3V1LA 3DOHA 1UZAA 1UOPA 4G5XA 4JUIA 1TQHA 1IUNA 3Q0TA 5HK8A 2C0PA 3IIIA 3EIOA 1XZEA 3QMMA 3ESDA 4B9EA 4PSCA 4X3CA 3SK0A 2VTVA 1ISPA 1S8OA 3WWCA 4H0CA 2XUIA 2VT7A 3QYJA 3QM1A 2VJBA 2H7YA 4Y2JA 2CUTA 2Y2VA 4ITVA 4UFNA 1XQVA 1BCSA 4N8DA 5AKZA 1F0PA 4Q05A 4BCCA 2WG2A 1R88A 4Y2UA 1WB6A 3H2JA 1TKRA 2QRUA 3ILSA 3AIMA 1BROA 3S2ZA 4Q3LA 5ISMA 2VSQA 2WUFA 2XI4A 1DQYA 3DJYA 1GPNA 3M82A 1DT3A 4EHBA 5BV7A 3E3AA 1QIMA 4W63A 3O4HA 5EHNA 4UHEA 5LZ2A 4X00A 1RYYA 3WKBA 3RK4A 2JGIA 3D4LA 1LPMA 1XZBA 2XUDA 3WKAA 3L1IA 2UZ0A 2PKYX 4GECA 2B9VA 4DSZA 3WK7A 2OGTA 1AMNA 1K63A 1L7RA 3KWFA 4AN0A 4EY7A 4N8SA 3BJRA 1R50A 5T4EA 3E4DA 5IVHA 5AKKA 3UUFA 3G7NA 1H23A 3DL7A 3FCYA 4UBKA 3A2NA 1JU4A 2ONCA 5ALDA 3WZMA 1C4XA 3U1TA 2OCLA 4AO8A 5JD6A 1N5RA 1RP1A 4H7FA 3OM8A 1CUGA 2W6CX 2V9ZA 2ZVDA 3OPMA 4LYDA 3WI7A 5K5EA 1GKLA 5DNVA 4BZWA 2WSLA 4F5ZA 3WK5A 4QWMA 1DTEA 2WKWA 4IHAA 1W76A 2QUAA 3I2KA 2OGSA 2FX5A 4C88A 1UT6A 1EINA 1GQRA 5HF5A 4EBBA 2GYUA 5A71A 4OCZA 2PM8A 5ALTA 3FSGA 2ACEA 2XUOA 1XZLA 4CG2A 3NWOA 4GLBA 1J1IA 3CCCA 3F8SA 2XQJA 3X3HA 4B82A 2BGRA 1EXWA 4QDXA 3F9CA 2I78A 1AC5A 5K3EA 2DHCA 1J2EA 3H2HA 4TPKA 4ZI5A 1VE7A 2AJDA 2AJLI 4X7BA 1BRTA 4X90A 3BWXA 3STTA 4N5IX 2XMZA 5AM2A 4CG3A 4BC0A 3BIWA 3OOSA 2HFJA 4KE7A 5ALMA 1UK8A 2OCKA 4QDZA 1MT3A 4NMWA 3LLCA 1WB5A 5CH5A 3G9UA 4HXEB 4UFPA 2CBGA 4E11A 1WM1A 1O6FA 1WPRA 2BUAA 3T4UA 2BAGA 1W4LA 4KAFA 1ZJ5A 1GXSA 5LKRA 3DDUA 2O7VA 4FFVA 4KJXA 1F0NA 2HA0A 5FOQA 3VJMA 4V2IA 1ZOIA 5CH8A 2JIDA 1N1MA 5DTIA 4IO0A 2DQZA 5K3BA 1GGVA 1WPXA 4OPMA 1CUJA 3KXPA 1LZKA 2WUGA 3VKFA 3M3DA 4X95A 1UKCA 3R41A 3IURA 1XZJA 4X71A 5AOAA 5D7BA 4BAGA 4H18A 2WU4A 3ICWA 3PF8A 4BE9A 4HZGA 1TK3A 1F6WA 4ZGBA 2Z8ZA 1JJBA 3P2MA 2Y1KA 1TCCA 1QO7A 2O2HA 3I2HA 4F60A 5D6OA 1MN6A 3K2IA 3QVMA 3HSSA 1CPYA 2ACKA 5ALNA 3FLAA 3IUMA 3WMRA 2JGFA 1VA4A 2HRQA 2VF2A 3V1MA 3RKSA 4FKBA 5FKJA 4FNGA 2PSEA 4Y2TA 4BBZA 4G4GA 4OD0A 2PSJA 3JW8A 1X2EA 3B12A 3C6BA 2HA4A 1GPKA 4PSUA 3DYVA 4CG1A 1WCYA 2XUGA 3QPAA 3HACA 2JEZA 3BL8A 4U2EA 3IDAA 2Z8XA 1J07A 1IZ7A 4G1FA 4C4ZA 5CURA 5AKGA 3OTQA 1BN6A 1PJAA 1CUUA 3AILA 3ZLVA 3AZQA 2PUHA 2XMRA 3WWDA 5AK6A 1XLVA 3V1NA 1XRRA 1TIBA 3WJ2A 3I6ZA 4G8CA 1XQYA 3R3WA 5DLPA 4H7JA 4K5QA 3A2LA 2HADA 3K9BA 2JGLA 1L7AA 1ZIYA 1CIJA 5AI0A 3MVEA 2Y6UA 1ZGCA 1U65A 5AO9A 1G5FA 2YXPX 3GELA 2GBCA 3ANTA 2VA9A 4KR0A 2WIGA 2C5GA 3FYUC 3GROA 1UOOA 4BE4A 3I6YA 3I6MA 4CFSA 5CT4A 3C6YA 2PSDA 2WFMA 3LS2A 4X6UA 1K8QA 5JASA 5LLSA 2ROQA 1MTZA 2RHTA 3WK4A 1LBTA 5HK9A 4B0OA 4DLNA 5JZSA 2QUBA 5SYNA 2ZYRA 5AI5A 1XZIA 3I2FA 3FYUA 1GPLA 3AIOA 4AN1A 4BCDA 2R11A 1EK1A 2XQIA 5AM1A 3WIBA 4G4IA 2I3ZA 2OG1A 2C0QA 5JATA 1B6GA 1ZD2P 4BCBA 4NVRA 5A7FA 2XT0A 5FV4A 4G9GA 1QZ3A 4JYMA 1FJ2A 2X5XA 5DTJA 4J0CA 2QZPA 2VAXA 1EK2A 1LPOA 3I28A 2BJHA 2DR0A 2WU3A 4HAIA 5AKEA 4Y2QA 3LP5A 2WTNA 3G0GA 3WWPA 4H7KA 4YK7A 5ALQA 1CUHA 2XMGA 4X6YA 3O4JA 1CQWA 1WB4A 3YASA 3IA2A 1QONA 5AOCA 4CIAA 1EI9A 4P9NA 4IH1A 3WA7A 1XZCA 4XX1A 4X94A 2HFKA 2WIKA 3A6ZA 1P0QA 5IVIA 2EEPA 1QO9A 3F67A 5H3HA 4MEAA 4UBJA 4BRZA 4DNPA 4KE9A 1XRMA 4WY5A 3WWEA 7YASA 5CH3A 4XIIA 5DYTA 1KEZA 3GUUA 1SFRA 5FLKA 4PNZA 5AKJA 3STXA 4FBMA 1X70A 4Z49A 2OLEA 3C8DA 2XUPA 4E15A 1MAHA 3R40A 3WIOA 1CUSA 1CQZA 1H2YA 5AK5A 3PDCA 3WKEA 1H2WA 2HDWA 4X97A 1Y7IA 3O9MA 3WK6A 1QTRA 1EH5A 3WA6A 1P0PA 1PV1A 4LKOA 1UOQA 2VJAA 4OB7A 5AI4A 5CRIA 1YCDA 1YS2X 5ALFA 4ZWNA 3C8HA 3H18A 1Z68A 2GYVA 5EFZA 1BEZA 1R9NA 1YSCA 1EDEA 1ZI8A 3VJLA 4UBIA 4OB6A 2QM0A 2ZJFA 5AH0A 3DOIA 3F96A 5AK4A 3TJMA 5K3AA 2ORYA 4X93A 1THTA 1LBSA 3EQ9A 4AZ3A 2G5TA 3ICVA 3R3UA 2JGMA 5JD4A 3VVLA 3VVMA 1E66A 5CMLA 5ALOA 1YR2A 1MU0A 1SCQA 1J06A 3STVA 3DEAA 1JKMA 2FJPA 1CUVA 1JFRA 1GZ7A 3FWHA 2BGNA 5LZ8A 5AJHA 2VEOA 3BE8A 3WZLA 4B9AA 3PF9A 3EF3A 3G9TA 3IBTA 3W05A 5CTAA 1ZICA 1HLGA 3IUNA 1ZD5A 1JMYA 3QH4A 3R3ZA 2CB9A 1SC9A 3FVTA 3SX4A 1OCEA 5AKXA 4DMFA 2XMQA 4HRYA 2HU7A 4H7HA 1QIKA 2CZQA 4DMHA 2WFZA 5DWDA 4BVKA 4J0GA 1VZ2A 5FRDA 1CUIA 2DCMA 2RIPA 1CVLA 3G9XA 3G0BA 2CMFA 4ROTA 3WL6A 2QT9A 2XUHA 4UHHA 4J0KA 1U4NA 4H35A 3C43A 4LHEA 5AI6A 4EY8A 3WYDA 5ALJA 5HQ3A 4PW0A 2HHAA 5JAOA 2HA5A 3G9ZA 1CUCA 4J0JA 4FBLA 4YX9A 1CUBA 4E14A 3D0KA 5YASA 2H1IA 3KSRA 1XRPA 5DYWA 2OPHA 4CI9A 3JWEA 4I4CA 1XZFA 2Z3WA 2DFPA 5ALVA 4DGQA 2Z5GA 5ALPA 2W22A 2WLSA 3KOOA 5IH7A 4M0FA 3KDAA 2PVSA 2AXEA 4U2DA 2OQVA 4P93A 1OXMA 3F98A 3AJAA 5A62A 1CUEA 3CCBA 1RWQA 1EDDA 1R1DA 5T4HA 4W1QA 5HFAA 1SCKA 3ED1A 2WG0A 2ZSHA 4CCWA 5A2GA 2DQYA 3CXUA 4UUQA 5KREA 2Y2UA 4MJ3A 4Y7DA 4AB1A 1CV2A 1KU6A 3MUNA 4U2GA 4BP9A 5AKIA 1PFQA 4LIPD 3W9BA 4DMCA 3C70A 1W52X 1E8MA 3L1HA 4AMYA 1TCBA 1DWOA 4MQMA 4B7ZA 4DTCA 3FVRA 5LKAA 4XVCA 1B41A 3R0VA 2AJCA 3TGLA 1FSSA 4WFKA 3STWA 4M0MA 4OYLA 3V9AA 1K4YA 3UUEA 4INZA 4KEAA 2PU7A 4BATA 1MJ5A 4K6GA 2YH2A 1YB6A 4HXFB 1CLEA 3QZUA 5CT9A 4K6HA 5C8XA 3H17A 4K2AA 5I7UA 3B5EA 4FOLA 4U2BA 3ZWQA 3NUZA 1LPPA 2OGZA 4LXHA 5F4ZA 5BOVA 2LIPA 4AQDA 2CEKA 3G0IA 3VDXA 5A7HA 2QVBA 1XRNA 1R3DA 1CEXA 4AO6A 2PSHA 1W6RA 2XMCA 5FPPA 3HC7A 5T4BA 2I3DA 1DQZA 4TVKA 3PFCA 4GXNA 2RAUA 1QTIA 5HF6A 4OB8A 2DHEA 3FLBA 5K3FB 4ZRDA 2D5LA 4QA9A 1IUPA 4HS9A 1IVYA 1MO2A 2H7XA 1C7IA 1XRLA 3R3VA 2XB6A 1A7UA 5LZ7A 1YS1X 4GWLA 2K2QB 4GHWA 4C87A 4FNMA 4UPDA 2AJBA 4A16A 1UXOA 5C7YA 1BS9A 1HKHA 1ODCA 1UK9A 2ZJ7A 3DCNA 3BJMA 1AX9A 3DS8A 3DLTA 2ZYSA 3QBJA 1VOTA 3LCRA 4WFIA 1QIHA 3D2CA 4B84A 4EY5A 4QZVA 2XUJA 3C87A 4W1RA 3TEJA 1ORWA 2WUEA 1QFMA 1EA5A 5ALXA 4B83A 1VE6A 2QMQA 2QKYA 3BXPA 1SCIA 3BDIA 1LPSA 3WKDA 1UKBA 1XZGA 2XQFA 4PO3X 3NOXA 3HABA 4HXGA 1P0MA 2WHPB 3IVMA 5AM5A 1EDBA 2OAEA
chains in the Genus database with same CATH superfamily
4HQRA 3GLTA 4AY2A 4G5YA 5JDCC 1EFTA 2NU7B 3ED5A 1TQ6A 3AINA 4C78A 2HSEA 3S8EA 2I99A 1JR3A 4HP8A 4J1SA 2WIJA 3NT2A 1L5GB 5L7TA 3DZJA 3UJHA 3VOAA 2X2FA 1J70A 1Z4IA 1C1HA 2EOAA 2PUVA 1GG8A 2CZGA 2B4YA 3IVXA 4JKYA 3ZBUA 2PV0A 3PSAA 5B37A 4MPTA 2Y0CA 3D8HA 4PR0A 2R3SA 3VDNB 1FRNA 2D1FA 2BOVA 4PIMA 2WSIA 3VM6A 3UMMA 4JLDA 3D6JA 3VTFA 4EB3A 1I5EA 1T2EA 2VWQA 2X0FA 1YR9A 2OBLA 4ZEOA 2D2FA 1UAGA 4GI1A 5DBIA 1AN0A 1RZ3A 2HIHA 1Y8QB 4PIPA 1L7OA 3ZHTA 4F1JA 4MROA 2VNKA 3Q8LA 3NC1C 4KXYA 2ZRFA 2AR7A 1OR8A 3D8BA 3PZRA 1QCYA 3GRAA 1NYQA 3CRMA 4D6YA 4H60A 3I9V6 5K8TA 1O96B 4LYFA 1XR3A 3LPLA 1MRNA 1NJ6A 2Q1XA 1KNXA 1OBCA 2BFPA 1M6HA 3M81A 3WICA 4FX5A 1HNNA 1K7XB 1KJWA 2HMAA 1X42A 3GH1A 2BKXA 1C50A 4JU8A 3I8OA 1F14A 4ME6A 4NIMA 1QCZA 2XB8A 2ZSEA 3JR3A 4HI0E 4F71A 3VU1A 5A4FS 3SYLA 2I71A 4YMGA 3I01M 4JJ6A 4REOA 3DDWA 3C3PA 4QGHA 3UH1A 4BQSA 4DVGA 1UP6A 4J8PA 1QGOA 1GKKA 1V1MB 2EDCA 1O08A 2QAGC 4JR2A 4R5HA 3UAYA 4BNYA 4EATA 1MAAA 1Z6PA 3PA8A 3RB8A 1XK7A 3SICE 1T4CB 1JAIA 1DDOA 1XQ1A 3WRWA 1TVMA 3TSCA 3RUCA 3ZCSA 4BX8A 2HSGA 2CEAA 2PL1A 1VI6A 2QTMA 3GLHA 4DXDA 3NHPA 2CLHB 5ILOA 2OSBA 4D92A 3U49A 3T0GA 4MWTA 3W79A 2XDQB 2QIOA 1CEEA 5CNKA 4CTKA 3HADA 3HJUA 4FQ8A 2NUAB 1Q1QA 4GPD1 3IULA 3FMFA 1Q0LA 2CC2A 1YQXA 1XDWA 4KGVA 4ADSG 4O0MA 1PJ3A 5J4VA 1MB3A 3RUAA 5BXQC 3P2EA 5DN6A 4FFNA 4UQLA 3WGUA 4TVBA 4XPIA 3UK0A 2QUZA 3KE8A 4GBGA 5C8ZA 7REQA 3WAKA 1GZDA 4FONA 2MDTA 1WXEA 2E89A 2QMYA 1NP3A 3C5VA 1LNZA 3DE0X 1XD2A 3KHTA 3LUGA 3EXEB 3OY2A 2BLLA 1I3LA 4TT3D 1VKHA 1VMEA 2OXFA 2FYTA 4H4CA 5DM0A 4I4IA 5CHEA 4IJVA 2E48A 1RAEA 2XUFA 4GBMA 5DCLA 1JT2A 3NGMA 4BX9A 4F0JA 3KLOA 4B8WA 1CY2A 2JNWA 5T7BA 2HUNA 2HA3A 2PAFA 1K5GA 1V5GA 4RM3A 2O14A 2G08A 1I2MA 5LMNB 3ZK8A 1XHLA 2OXEA 1XI2A 5ER9A 2C97A 3AM3A 4TVSA 1OB5A 3ODGA 5E4FA 1MJFA 4K28A 4XR9A 1LGYA 2JBAA 4OI2A 2FXIA 4FMPA 4CT5A 1NMQA 3NJ4A 4Z0HO 4ZV7A 5J2TB 4G24A 4MWCA 4MPDA 1FFAA 4MYCA 2YINC 1BMFD 2AOUB 2QM7A 2X3FA 3S68A 4ZYUA 2RGRA 4HDSA 4DLWA 4RDCA 1PL7A 5EGSA 3ETNA 1GPUA 3H1FA 2GZRA 2CVPA 1P5RA 5K6TA 1Z6TA 5F9FA 2RG7A 4JD5A 1QIIA 1UMDA 4JITA 1LI4A 4XM0A 1PD0A 1EWRA 2NV2B 3C14C 3FRHA 2JCGA 5D1HA 4YMTA 4GO1A 2XQGA 4E2ZA 3LPNA 1KRXA 3VPHA 1JA1A 1XCBA 2FTKE 3R3YA 5JLAA 3ZNOA 1VLMA 2GBPA 3F7OA 3GH3A 4RMHA 1R4MA 5A2QA 1YA4A 4LISA 1NRIA 3KELA 4RX1A 1T5BA 3HXTA 3W90A 4AF7A 3AK4A 4O08A 2CGEA 5REQB 2GKSA 4PSDA 3TNJA 2WNSA 4DYHA 5AW0A 5CLJA 3BERA 4R8SA 3C7CB 4W99A 3S2FA 4OY3A 1QFSA 2J45A 1G3QA 1TO2E 4MQEA 1XVVA 3CWCA 2ZJ2A 1F4LA 5ICSA 1W87A 1R27A 3EQZA 4RIFA 1X80A 2RG1A 5A9SB 5KMGA 1R0CA 3OJWA 4HDNB 2OTCA 1M8GA 1PKXA 4OFXA 8GPBA 5KCZA 3OKAA 3IVGA 4G1UC 3A9RA 4YLEA 3VR5D 3IEXA 1KRHA 2AR0A 2CXOA 4Q39A 5DGHA 3FOZA 5I9BA 2PUFA 3H83A 2AZDA 1W5EA 4P3YA 2QE6A 1UODA 4Q3CA 2HTEA 2COKA 3T7SA 4UCWA 2I4TA 4YCMA 1A9TA 1ZVVA 5CDUA 1OV6A 3EYAA 1X86B 2FK7A 4YRJA 2WG1A 1V8BA 4BFYA 4G07A 1QFJA 1U2GC 2F3SA 2W58A 3I34X 2CNBA 4BVLA 4DIKA 3QUCA 3RTAA 4D5EA 3D1JA 5A4IS 4UQPA 5BW8A 4M76B 4P82A 1QO0A 2WSSA 3GX1A 3F5FA 4AX4A 1ZITA 1E2GA 4PZCA 5TX7A 3LI2A 4PAMA 1ULAA 1V7PC 1EQUA 4BWFB 2VQSA 2O1SA 1M67A 3EAFA 1YV9A 3GBVA 4L08A 3K1TA 4RVCA 1LQUA 3L93A 5K3FA 3NJRA 4O3MA 3L8EA 1XV5A 1ZO8A 3FMPB 2IHUA 3KWJA 1VSVA 3W5AA 3S3TA 4M3NA 3O0DA 4BNVA 1RS0A 2Q0HA 3KHUA 2BHTA 1JVNA 3DA8A 1SZJG 1HT3A 1XJ5A 2JJ2D 2WJJA 1U2EA 4PO8A 3V4LA 2FMKA 3NBQA 2IYRA 1RNLA 4IJ5A 2AXNA 2GARA 2WTXA 1VGQA 3EF1A 4IQ4A 4ZT3A 1VXOA 2DT8A 1T29A 5IPFA 5AUNB 4TTSA 4YRRA 1E5DA 2QQGA 4CF6A 4D9FA 1HEUA 1JU3A 3ZDQA 1ZGGA 3L4JA 4H7EA 3UGTA 2XXBA 3LYAA 4CMBA 5DXFA 2H48A 3LDHA 1ZMOA 1Z29A 4HRXA 4K2HA 2IU0A 3WHPA 4BNXA 1M1UA 4C6RA 1RI4A 3B52X 1PJZA 3N0XA 2IEDA 1FXUA 3TVDA 4G23A 3PX2A 3ZBPA 1R6AA 3JRNA 1RWWA 1LSOA 2NSJA 5FWAA 4FFWA 2C8KA 2ZPUA 1IY2A 1T9ZA 1WHSA 2OCIA 1K4KA 2Q5CA 3QEMB 3RUEA 1IEWA 1YI1A 2BL4A 2O19A 2OB1A 1KKMA 4UNSA 4F21A 5AW8A 3EXAA 4X65B 1L7QA 1DQRA 1XFAA 2RIRA 4OLAA 1QVAA 5JXGA 3ZU5A 1N2CB 1U2DA 2ZRGA 3KD3A 3OA0A 3LF2A 1HG0A 1E1RA 2DAPA 4Q4DA 3EMKA 5EMHA 4B6JA 2GN6A 1SIWA 2PJDA 3HVRA 3M3HA 1KZ7B 2VJMB 2YHAA 2NUPB 4J90A 1Y34E 3DFFA 1UWLA 5CGQB 4H17A 1AXGA 4X8OA 2J4CA 1YCGA 2I1WA 2A0WA 1JSLA 1G3MA 1HDOA 5TV2A 3R9KA 1JG1A 1FBNA 1Q11A 4CJXA 5BWCA 3QLTA 4TYNA 1MVOA 3OT1A 4NJMA 3T3HA 4WZZA 3GLFA 2XYQA 3V6LA 4YRLA 4DNQA 4EKEA 1GVHA 1K6MA 2ATXA 2CNWA 3E15A 2IXGA 2WAOA 3PPYA 4GXQA 4UHFA 5CDSA 2H06A 4M87A 3ZVNA 1H2ZA 1XJ0A 3OEHA 3QTBA 3Q8KA 3ZG6A 1HBJA 4E3WA 4QFBA 2WPDA 3M0EA 1KDZA 2W6ZA 4URYR 4ZDJA 2CXNA 3BXEA 1TIPA 2G63A 1D04A 2OFXA 2PLRA 3F74A 4TLCA 3KQPA 4EY6A 4F93B 5KOHA 3RS8A 4EJSA 1W44A 2DH6A 5I8WA 4IFBA 4MA5A 4J0DA 2HSDA 1E64A 2WEKA 4FILA 4LXUA 3CNOA 1G6KA 1ICEA 3DP7A 1YF3A 1TADA 3VR6A 2QJWA 5JFTA 1BE0A 3R2JA 3BMQB 5B2ZA 1H5QA 4FQ7A 4HB2A 1QV9A 3LV8A 3EBLA 2W83A 2PX8A 2VAMA 4FTWA 5BSGA 1NATA 4A15A 1DCMA 1EFCA 3ZE1B 2VBCA 3GLRA 1NX9A 3SZ3A 1BRMA 1BE6A 4JEMA 2QRKA 2R7KA 2WE7A 3H9GA 1GGJA 5DXJA 1X1TA 3PCTA 4N82A 1Q1EA 1QE5A 3N70A 4JUFA 4P3XA 4W9RA 3VSCA 3ZXXA 1ABFA 1PR5A 1QYWA 1VHQA 3PICA 3D7RA 1P62B 3H2GA 4QICA 3UBMA 3UQYS 3O8LA 5JH7F 3D6VA 2JB9A 3HCAA 3A32A 4TSKA 3TTYA 3V4PB 2XW6A 2FPOA 1G17A 3G0CA 4L22A 2NADA 2XECA 3N0TA 4EA9A 2B7CA 3DPIA 1Z28A 4EPYA 4FZRA 1RMQA 1ZJYA 4MCIA 1JAZA 2ADMA 3AVOA 4PZUA 1E3EA 1J00A 2GXAA 3HJTA 5J9FA 1PBNA 2I1QA 3JAKA 5FBQB 4AZ0A 2DKFA 1XRQA 2W8ZA 1XAJA 4TXNA 4BB9A 3I9JA 4EB8A 2RD2A 2FSHA 1TPZA 1TJPB 1JQDA 3UO8B 1N75A 1Y4ZA 2SICE 3EVEA 1P7CA 5JAPA 2YXDA 5BPHA 4BDSA 4WOPA 4LXGA 4WY8A 1RWBA 1TUGA 1NDUA 4OREX 1FX1A 2PV7A 3QNUA 4UUBA 4EHLA 5BRJA 3C8UA 5H3LA 3U1VA 4BVBA 2P5TB 4G85A 4L0CA 4D8UA 2IOFA 4YMLA 3N0WA 1WSDA 1SOAA 1YIAA 2J5BA 3BWMA 3O4RA 4GP9A 3VVBA 2HF9A 3SP1A 1OX4A 5IS2A 3JQ6A 2GBFA 1LK0A 5IDYA 3GCGA 1SVLA 5BQPA 3A3OA 5T3UA 1QK5A 1OXUA 1XALA 1Y63A 3K92A 4F2HA 2QN1A 3O1LA 1GUBA 4UNIA 4YI5A 3UMYA 5JFOA 4JI0B 3A1WA 2R8BA 1YWGO 3WBJA 3L7IA 5CT5A 5LOVA 4RQUA 2FB9A 2ID7A 3WV5A 4E46A 1ELOA 3QE2A 2A58A 3U3XA 1ZA1A 4FN5A 1R0ZA 3W7AA 5IT0A 3KUCA 1GJRA 1N2OA 4IDDA 3D8RA 4ZEWA 5LCXA 5HKAA 2GZDA 4RORA 3M70A 3QFHA 2PZBA 3PNVA 3NAGA 4HAWA 4C89A 3WXMA 1T3ZA 3UHFA 1XZMA 2JCSA 3PGXA 4FIZA 3X1JA 3ZX4A 5KNBD 4YP7A 1NBOA 4L50A 4OXQA 1V9CA 1QGZA 1VIDA 3FNIA 4H7IA 2IZOA 4DCUA 2V8OA 4KVZA 1U3VA 4RAQA 2XCOA 3CEAA 1DOZA 2I4MA 1BWPA 1DBIA 2QN2A 1NW5A 4FYKA 1QGAA 1TI7A 2Q21A 3MRVA 5ES3A 2HCFA 1G41A 1Q3KA 2VNSA 3A3KA 1J6UA 3EY9A 3IAXA 3WOHA 3GJQA 4TWRA 3AP3A 2HH9A 4EJ2A 1MNQA 4IH4A 3AL3A 5JI2E 2BWJA 3LHIA 3QVGA 5EHZA 5KOIA 3SYTA 4EJ0A 2A3NA 3HE3A 3S7TA 3OU6A 5CYPA 4UHKA 5EJ7A 4AUMA 1V43A 3CCFA 3TIVA 3EEBA 2A5GA 4MRVA 2ZR9A 4HC4A 2NQ8A 1OKKA 2FWRA 5C46F 5JSHA 2WHRA 3CUTA 5D6NA 4ZV9A 5CEEA 3ADPA 3H84A 1HGXA 3AW9A 5EIEA 1MB2A 3BD9A 2JLQA 2C0CA 5D3KA 1HPLA 1GZ6A 3MJCA 3SS7X 2XUQA 2NWQA 2GLTA 2P9YA 4QATA 5D5QA 3GRPA 3L1KA 3M5PA 3C7DB 5E4TA 2B0CA 1KMIY 2LP4Y 3N53A 2C59A 1Y9JA 4FDUA 1XNGA 4M0KA 4I6JA 3OFND 3ZOZA 2YOHA 2CJYA 1OZGA 1XD9A 4ZA2A 3WTBA 3ZHZA 4R41A 5E1OA 4CM3A 5GIPE 1L4HA 3ND8A 3MYRA 2JJQA 5DM2A 2HUPA 2R87A 1UWCA 5ITWA 1B4DA 2BMAA 2Q3LA 1AQLA 5EKXA 2PKEA 4U5QA 2JLXA 5IAGA 4M1KA 4KYTA 5KDOA 4Y8VA 1M2FA 1T26A 1R6DA 1PUIA 3KP1A 2XODA 4PZEA 3CUKA 3RYHA 2GEBA 1X8KA 3HPRA 3I3OA 3V6MA 4BMXA 3TZBA 5FPKA 4RZ2A 3PENA 4UHDA 2IK8A 2OV4A 5JD3A 2PSFA 5K4AA 4XIFA 2I03A 4R1SA 1FFXB 1VKOA 1GNQA 2QWXA 1W25A 5G0WA 5F98A 3O4VA 4JNCA 4O4LA 4Q3KA 4US0R 3T7EA 3ENVA 5CA0F 2GPNA 1P4GA 2YBDA 4JEUA 1FLDA 4UCQA 1MIOA 1CR6A 4CM1A 4EA6A 3PUYA 2PUGA 4AWXA 5I45A 4JJFA 1EWQA 3K70D 1P5JA 1R9JA 1XEXB 4EARA 2ZVQX 4N3NA 4ZAWA 1CERA 4UD6A 3EZXA 1K8ZB 1RXUA 4G37A 3EASA 4X84A 4DG5A 3F5MA 1MUUA 1SXPA 4QLAA 1N5OX 2H2DA 4YV1A 5FI5A 3K9GA 3H1TA 4RESA 4JNKA 1FY2A 1QHHB 1P75A 5M29A 3O94A 2X0EA 4R1UA 1D4OA 4LDPA 5HTKA 3BB1A 3VU0A 2HRRA 3HCEA 2OAGA 3HKEB 4IJMA 3B5IA 5JUWA 1TIKA 3LRTA 3SEQA 3RSSA 5JJBA 5JWRA 1CUXA 2VCHA 4WD3A 4CF4A 1GAQA 2BM0A 4BQNA 1U63A 1V6SA 3USCS 3KSAC 1ZXBA 2QTRA 3AESB 4MWSA 4TL8A 4YXWA 4RPKA 4OHZA 3F49S 3EQ6A 3DULA 4GMKA 4C0BA 2A9RA 2AX3A 2RE8A 3K9CA 4NU0A 5HKKA 1U2PA 2EWVA 2YFQA 1NI4B 1JDNA 4WCVA 4LCEA 1AQYA 2ZAYA 4NSNA 2G1PA 1LV7A 2ZIGA 2ORIA 4GPTA 2FA9A 3C6MA 3PXBA 4ZXFA 2IV3A 1E60A 2BGLA 2R0QC 1GQSA 2BFAA 4QBKA 4L5JA 1TJYA 4LX8A 3AGPA 4MV3A 4DIUA 3NG1A 3W8NA 1GLVA 1YB4A 5MHTA 1J2RA 1YR8A 2I8CA 2ZB7A 3HZRA 1QK4A 5K0GA 4FGLA 2OA0A 1ZD3A 3M4YA 3ZLTA 4QEZA 3IP5A 1ZCBA 4E94A 1JMKC 3CX6A 2IOHA 1EZZA 4B34A 4A3SA 3FCCA 4HX5A 1SU7A 3IOBA 1T5DX 3NP7A 4GUDA 4FR0A 3CNLA 3IJ5A 4I81A 2DQSA 4QPJC 1J0DA 4RNCA 1YC2A 1FNCA 4KW7A 4N7RA 2EFCB 5DWVA 3RASA 4ARAA 1GARA 4MH0R 2VH1A 3UGKA 4YPVA 2A9PA 5BUQA 5HOQA 5IJXA 3PE3A 5BOSA 2UZIR 3KVRA 2W2XA 3SX0A 4REQA 3DYIA 4MIEA 4C03A 2CL7X 1DC7A 2GVNA 3N75A 4JP2A 4LV8B 3RRXA 4YAWA 3I2GA 4IWNA 1A9QA 2GK7A 4LBWA 3ZPXA 1UXJA 3OJEA 4FHEA 3WISA 4BVJA 4C4YA 4NE7A 2WILA 2B1IA 1SIBE 3T12A 2YUTA 3E2IA 1U7PA 4RJIA 4JP3A 5H7XA 3KQYA 2V7WA 1JU9A 1VE3A 1IPFA 1Z82A 2C82A 4LOJA 2A9VA 4DNOA 5AW7A 1U3FA 2B21A 2QZSA 3HH8A 3PYLA 4F3NA 3U19A 1P7YA 1Y6FA 5EC8A 1A4RA 1ZRHA 4UEKA 2JEYA 5AKHA 1WCIB 2WJ6A 3AEUB 5L3RA 1U1CA 3CUSA 3E3LA 3GLQA 3NHMA 3AIKA 4DBLC 4E7PA 5JQGB 2C4MA 3QMWA 5GQSA 1SB8A 2C7PA 1FL9A 2JAOA 4KAJA 1SXQA 1N7IA 3EARA 3H0KA 1C0PA 1XUOA 4TV9A 1FOEB 2CE2X 5A0VA 1N7HA 2OM6A 4IDQA 2C5FA 3BGDA 1CULC 4OSEA 5EHGA 4ER7A 3O3OB 4U39A 2ZYUX 1QQ5A 2PUBA 4QNNA 4G0QA 3FPJA 3LIIA 4IDEA 3L0ZA 1PQ4A 4CKEA 1E89A 1WCV1 4NI5A 4R98A 4URWR 5AHKA 5G1OA 5AW1A 3AJRA 4QUGA 4PNPA 3GVCA 5CBPA 1MFPA 4LPKA 3SKXA 3KOUA 3MHTA 3PCRB 3ETEA 5LP1A 1D2MA 2WVHA 1ZP6A 1M1YA 3EVBA 3HXPA 3VH1A 4P5EA 4B2PA 4G0VA 2PX5A 3QPCA 1RQ2A 4WN3A 3RVSA 3SJCA 4JJEA 4C01A 1YVPA 2WZDA 3KXLA 1V8PA 1INLA 3IH5A 4LG1A 2ZXUA 4P3NA 3FSEA 4DJDC 1H22A 1N2XA 3C8MA 2BGKA 3EISA 2P35A 4HUJA 3WDMA 4ZYVA 1P77A 4XIIA 1EIWA 1XWWA 1TAQA 2FR0A 3KQMA 4HTAA 2W2OA 4TLEA 4TKUB 2XLBA 1Z7BA 2E4ZA 3DMRA 3LQ1A 4PINA 3M5DA 3SBOA 1YJBA 2EQ5A 2ZXFA 1YUMA 4ZD6A 3V32A 1KJZA 2RHGB 4B3SB 3IDSA 3VPCA 3HB9A 2CXPA 3A1TA 3U2QA 2VPXA 3BX1A 1ARZA 3E27A 4B2LA 1FDWA 1S6YA 4DVJA 1WSWA 3D8SA 5AT1A 1IQUA 1N7JA 1NQ5A 1ZK1A 4A5SA 1YGYA 4V39A 3B8EA 1IC6A 3MCZA 4U00A 1FTGA 2PS0A 4LQCA 4A1OA 5HFNA 4GVXA 5JXIA 3VVCA 1A76A 4QVIA 5ESDA 4XSGA 5CT6A 3RRFA 4DS3A 3GFGA 4LBZA 3HM9A 1IZYA 2GDJA 1XZQA 2YXEA 3ONFA 3I1IA 3TQSA 3WB1A 5KYYB 5K03A 1NU8A 2QLMA 2O3RA 1RQXA 2RGDA 1UPCA 4JC4A 4W1PA 4BE7B 2GCOA 4CR8A 4ND3A 2BPOA 1D0IA 1QVVA 1CZNA 1R8QA 3RNLA 2DY0A 1KI3A 2V7PA 3OX4A 4DV4B 1X1EA 3QELA 3V4VB 4RHCA 3THOA 3UYLA 3KJHA 2ZWMA 1X1RA 3ZD6A 5CLQA 4UD2A 2ODAA 7AT1A 2EWMA 1G18A 3CPSA 1V45E 1X9HA 3AM4A 1EUDB 1UQTA 3WKCA 4XB1A 2Z2IA 3U0VA 5TARA 3FSJX 4LCBA 4J2TA 1KOJA 4ECAA 2XMBA 4ZAFA 3UFBA 1EFAA 2DXIA 2COUA 1Y3IA 3MT8A 1EESA 3L7KA 2WLTA 3GRYA 1C0IA 4E5UA 2JGKA 4RKFA 1SCJA 2WSYB 3RFTA 1Z6GA 4BNDA 1F3LA 4CEIA 1YI8A 1K7SN 1RSZA 1DARA 2GTHA 1BU5A 1GGMA 3R3SA 5GZ1A 2RHHA 2GVZC 3DOUA 3ZI7A 1CUZA 1Q14A 1XJCA 5HQ3B 2H8GA 5JWHA 5LP6B 3OKFA 1M9NA 2NSYA 2Z83A 4RJJA 4UDNA 4EG7A 3QUTA 4KPGA 2O20A 2WFLA 3I2JA 5E7MA 4D79A 3HO1A 1WHTA 3RUPA 3OSZA 1G0NA 4LZPA 1NVAA 1Z0SA 1YKSA 3UIEA 1LLFA 2ZDQA 1O0SA 4AS2A 4EGFA 4D74A 1LZLA 2PR7A 3LBYA 4RTNA 3O5AA 1IU9A 1ZQ9A 2BSQA 1PDVA 3PT9A 3UBTA 2HMUA 1KKLA 1WW8A 2Q1WA 3PTAA 3LGSA 4BKOA 3UK6A 4KFUA 1P2TA 3TDMA 3ZCQA 2BGTA 2EZ4A 1ESMA 1O9BA 4W7SA 5CB4A 1LJLA 1Q84A 3KYDA 3PS9A 3ESBA 4YASA 4RKEA 2FFJA 4NARA 1U8CB 2AG5A 4KP7A 5A1JA 4NL4H 3LTEA 2F3TA 1ACMA 4MRMA 3QIVA 5E6UB 4RPHA 2IYFA 1BDJA 3DNMA 3Q8WA 2KBEA 3VUFA 1J21A 2BONA 1ZSVA 2KQUA 3QVLA 2RMKA 4Q4JB 4RD1A 2EJCA 2RHWA 5EOVA 4TOIA 4ZQFA 2B2CA 1E96A 3OZXA 1KL7A 1Z36A 3RWBA 3TTTA 2VF7A 1KY5A 3CBGA 4U9UA 4U7DA 4M9RA 2PGNA 2WJPA 5M04A 1H05A 4LYEA 3EEYA 4DCOA 3GR6A 4EIWA 3IT1A 2X0NA 4IIDA 2JI9A 4HDKB 5LXTB 1GM5A 3VPAA 3F1KA 3DZCA 3C45A 4CMEC 3S1LA 4DIMA 2XTAA 5HILA 1JSCA 2AZMA 1L1QA 2H63A 4IR7A 3L7CA 4WMLA 3RSZA 3TRJA 1LPNA 2Q2QA 5I47A 3BIJA 3GG9A 4IJWA 3FUUA 2DERA 1O8BA 3LHSA 1A8QA 3FOCA 3GAAA 3JQQA 3T41A 4A8PA 4Q9DA 4ZJUA 4G5FA 4JROA 3RG2A 2Q5FA 3RJ5A 1AZTA 4J0EA 1N5DA 4H1WA 3IAS1 3QBDA 2PKRA 4MRAA 2ZB2A 5SZHB 6YASA 2DFNA 3ZGLA 5A0TA 2F7SA 1ADJA 4LJ9A 1UIMA 3PEEA 4LXXA 2Q3FA 2LPMA 3I5AA 2W93A 5BYBA 1AQNA 3ASVA 2I3GA 4KPUA 2EFDB 4RSHA 1VSBA 1OVMA 4UHBA 4CLXA 4D02A 1D6NA 1VPLA 4G1CA 1RQPA 5A1TA 1J25A 3QRWA 1XTIA 1L3IA 1UK6A 4BZZA 2OOKA 4YV0A 2DYKA 2M9MA 1ZVKA 4RUKA 1Q0UA 3D7NA 4RPIA 2IX9A 3M6WA 4HVTA 2G1AA 2WJHA 1CT9A 2FQYA 2NSLA 4OI4A 1HYEA 4AMZA 1W94A 5ARCA 1D3AA 4IUBS 1II9A 4MB0A 1X3LA 3M49A 2FX2A 5HIJA 4BKRA 2HBYA 4F4DA 1H6AA 2HLPA 4DM3A 1ZINA 3LKDA 1HLDA 3PI6A 4Y2RA 1OT5A 3H16A 4GKJB 3GPDG 4MW7A 4X7RA 5M7EA 4I1RA 2RI6A 1FFEA 3KYIB 3WBBA 5A6VA 1ISHA 2H0QA 3E58A 4KWEA 1I80A 3I04A 3RUDA 4PHFA 1HDXA 2VSFA 3G5AA 1DAMA 4J76A 3K4PA 2MWMA 3RHZA 5H9VA 3TLYA 4EHDA 1L7MA 4EYGA 3PGA1 5KX5A 4OA5A 1T2FA 3T9CA 3U81A 1XKLA 4A03A 1DB3A 1J22A 4QDUA 3NEPX 4PV7A 3VR4H 1VQ1A 4H1UA 3PRYA 2E49A 5IAJA 1V1JA 5KHAA 3ZXYA 2VT2A 4C2UA 2VG8A 2FGKA 1ML3A 1OGIA 3QVJA 2J0SA 3I30X 1DIBA 1XZAA 1JR2A 1GKUB 1V6CA 2D54A 1QKKA 2ZUSA 3AM5A 3R5KA 1O94C 4P3KA 2VJCA 3EB9A 2YHIA 3W0LB 1KOGA 4WCFA 3U7JA 1TM2A 2CWWA 3ELDA 4F2WA 3TZEA 2Z4RA 3WLMA 2C2XA 2O2IA 3JZDA 1YTUA 3GO4A 1R8SA 4UC0A 5ALEA 3SG0A 4WLOA 3DM9B 4E5MA 1KK0A 4C4XA 3PEUA 3F8TA 3OF3A 4Z9XA 3ZY3A 4BJ6A 1P72A 5ED0A 2J0UB 2OOSA 3LX6A 5KYXB 1Q0SA 1Q16A 2QVYX 3ZWWA 2H07A 2JH8A 2CHFA 2HPAA 3JWIA 3KJGA 2JJ1A 4JB0A 4OU4A 1ADFA 4UDOA 3HP1A 5AVOA 2GH1A 3AKCA 5CXUA 2V03A 1DTWA 3PL5A 5JJCA 4PG4A 3W8RA 1NVXQ 3AR7A 3B9PA 1OLXB 1L4MA 3E5NA 3FKSD 5EP4A 1BD3A 3D4PA 4ND2A 1JG3A 2QNIA 2VQ6A 4LHYA 3JZFA 3MS4A 1JG6A 2DUNA 4R2HA 2H0RA 5T67A 1P5HA 1SRQA 1MENA 2GS9A 2FZ5A 2GILA 3IXLA 3UPTA 4CQLA 2EW1A 1UXIA 1O89A 1W0JA 2CXTA 2ZYTX 3UAOA 2LWIA 4FB5A 1WZUA 2ZSFA 3IT0A 3RR2A 1TYDE 4WJLA 3M6IA 3WWOA 4UDXX 5CEFA 2JD1A 5IXSA 1G59A 3PGMA 3TUZC 2IHZA 2BFCA 2WIAA 4C20A 2C5HA 2PGIA 2A4MA 3IAM6 1IMJA 3WV4A 3DOHA 1UZAA 1IJKA 2J9XB 5E1BA 2R6GA 1P7VA 2H4HA 1TQHA 3TFQA 1U7WA 3ZI0A 1IUNA 3Q0TA 3VR3A 1T1RA 5B3JC 1U8XX 3JQFC 4Q15A 1U6IA 4WT7A 3ZCTA 2VQDA 4C5BA 3QLUC 2CLOB 3BXHA 4ZVVA 4RTJA 1KY3A 4AY6A 4U3JA 5TY0A 4BXOA 5E2IA 1QKJA 2QZ4A 1X1AA 3GJ3A 4I5FA 1G8PA 2VDRB 2J87A 4QBGB 1HMYA 5LP6A 2RJOA 3VMFA 5MN4A 2UUPA 4P8RA 1QMPA 3CS3A 3JQRA 1T8WA 3VC2A 2VTVA 1IY9A 1ISPA 2CLLB 2O0MA 5FLYA 4JJIA 3AWDA 3LXUX 4NP6A 2J5XA 3OZWA 4H0CA 4IDHA 4HD8A 3JQAA 4N65A 3D6NB 2HIGA 2IODA 2OXCA 3CZPA 3AQ4A 2IC5A 1Z2EA 1T9KA 2A86A 3NKFA 5G40A 3U7RA 3EX7C 4UARA 1I6KA 1WP4A 2ILVA 5MN6A 2V6BA 4KWTA 5BW6B 3KKQA 2G5GX 1M2NA 4HAOA 3HCCA 4OVKA 3RJZA 5L6MB 1ONSA 3IAAA 3TR0A 1Y8RA 3ZE8A 1JNXX 4E30A 2QENA 2VP6A 2Y2VA 1YQEA 2WYUA 1DKRA 4GR5A 5GJWC 4BLUA 3NFRA 4PYNA 1VB5A 5DX1A 2FFRA 3WGGA 2I5PO 3AHJA 4J1QA 2AFHE 3HPQA 2CLMB 1QNLA 4TM8A 2RGNA 1TB4A 3QOWA 3N8NA 4IM7A 3NT4A 3KUXA 1TNDA 3DZFA 4KSYA 4PHCA 1BX1A 4F3CA 1TKRA 5DFAA 5IJ9A 2ZJBA 2H1VA 2QRUA 1GQOA 2WABA 3NKLA 1KEEB 2RJNA 3KCNA 5CX1B 1NLUA 3VBEA 3AIMA 3ZJYA 3NM6B 1R15A 1NC3A 3GG2A 4Q1EA 3ZC3A 2VFAA 3OQ6A 1ULBA 1JG2A 4PXAA 4Q3LA 3JQBA 4QJBA 5AUOB 5ISMA 2AOVA 1YVRA 4AN4A 5FBLB 2R68A 4TKVA 1Z88A 2QMOA 3B38A 3ZDFA 2XI4A 4KH0A 3OU7A 1DQYA 3QVSA 1MGPA 3DJYA 1GPNA 3GLSA 3M82A 2Q4DA 2FWPA 3PHJA 3Q9SA 2AMYA 4LOLA 3TINA 2HGSA 3KLBA 2E6KA 3E3AA 1QIMA 3FA2A 4O8CA 2DHRA 5D00A 5EA2A 3TDNA 4C76A 1QC5A 3AB8A 1COZA 2CFOA 4QEDA 1U2SA 2PX3A 4JLNA 2C9CA 2F43B 2WT9A 4UHEA 1AUQA 2ZKIA 4IGAA 4TS9A 4W5TA 1X13A 3V8MA 5FQNA 4DIBA 3DBRA 4B8ZA 2CN1A 1TL7C 5AD1A 4ATNA 4AI6A 1AD2A 1EAYA 2RHLA 3C5HA 3OE7D 5BN4B 3UV6A 3WKBA 4PCUA 5ELXA 3FPHA 2SHKA 4QC2A 2ZRIA 3RC1A 1S8NA 1Q6ZA 3CNQS 1M0SA 1CQPA 1N6KA 5KYVA 3SM3A 2BFFB 2C2MA 4FOOA 621PA 5HR5A 2NO0A 3LH5A 2WAYA 4LY6A 2AC4A 3UAZA 3WKAA 4RMGA 4DY6A 2B9VA 3E0QA 3OEWA 5LP6C 3WK7A 1AMNA 3UMRA 1L7RA 3TAHA 3PTZA 2IZZA 3EH1A 5A5GA 4N8SA 2F1RA 1JQEA 2VHYA 4S1TA 4RY2A 3DZDA 4PZ0A 1KGSA 1JQLB 3E4DA 4P3OA 4TTIA 4IJUA 3N39C 3A3NA 3OOHA 1WE2A 4JGIA 4BNNA 4ER0A 4MJXA 5L4LA 1FRZA 1UDBA 1Z5VA 3I45A 4RJKA 4V1CB 1B23P 2OCBA 1M2JA 5GJBA 1YRWA 3MJ4A 1K7EB 1CQIA 5GAJA 1RXCA 1Z7EA 2VDOB 1XZNA 2Y1XA 1GHTA 2OKGA 2Z95A 3ZX5A 3EC2A 1AK9A 2XNHA 4ND6A 4DLZA 4F3RA 3ZCPA 4QU8A 1UDCA 3MINA 2AYZA 3DXXA 4G0NA 1C4XA 3H6GA 2V5AA 3MMNA 3L0YA 3QFCA 3EEFA 1V7CA 1LTHR 4M8LA 4MLDA 4Y9DA 4NS1A 4AO8A 4HEA1 3DGFC 4ER6A 4ZEVA 5IC4A 3N8DA 4L15A 5SY4A 4H7FA 2CDNA 3KZXA 1ZHHA 4O59O 4HQFA 4EG1A 4HUTA 3NOVA 1Z0JA 4D82A 3NAZA 4PLVA 4X5OA 1PLJA 4DRZA 4X45A 2Y71A 2GGSA 2PWAA 1MEJA 3EFOB 1NXXA 3KPVA 1WIWA 3WI7A 1XDSA 4A2PA 3EPJA 1EP2B 5J1TB 2D06A 3DHYA 2KSQA 2CT8A 3VYRB 5F7OA 4RU1A 2WHXA 1TTTA 1P9LA 1ULSA 3KZOA 2GESA 1U8YA 1I94B 2O2CA 2CV2A 3GZNB 3HBMA 4HDRB 3A6LA 1R0XA 2NTNA 3WK5A 4F5ZA 4YCJA 1QYRA 4ZMSA 2V7QD 4JVNA 4QWMA 1N4AA 1KEWA 1Y1PA 3D0OA 1VBMA 3O2QB 3OUTA 5HIAA 4DUZB 4N03A 4IHAA 3DZBA 4QFCA 4QG3A 2OV8A 2OYSA 5AJVB 2ILTA 4XJSA 5JSKA 1H1LA 1W76A 1Z5ZA 5I5GA 2QRVA 2RAFA 1W49A 4R1TA 3LSTA 4K05A 1AKYA 5H83A 4N9WA 1G2OA 3K5WA 4IUYA 1UJ2A 2O5RA 4UM7A 4S1WA 4GM1A 4E51A 1QR2A 4OHXA 4PNHA 4CCAA 1E5LA 2IHKA 3AHCA 4RY9A 3W5DA 3PFHA 4OXXA 1UXGA 1ZN2A 5I7OA 1QS0A 4QASA 2QL5A 1MVLA 5HF5A 3N2IA 2XVMA 3ZVKA 1E4EB 2R96A 2XRFA 4MGYR 3M9LA 2FF7A 3HMKA 4HMPA 4PWZA 4IL5A 3FSGA 1B8UA 1G5HA 1KAEA 4HVLA 1AKWA 3D7MA 3MFQA 1X7HA 2HRZA 2ZI6A 1I8TA 1Y4SA 2VQFB 1L5LA 2PFGA 1BVHA 1GQYA 4HLNA 3UM9A 3E7WA 3GGOA 4R2KA 3H11A 2HDOA 4M7OA 4LFCB 2EBHX 2FMXA 3M2PA 4BP1A 2G77B 4DWWA 5BRAA 1L9KA 4D4IA 5HM8A 2QSYA 3BXXA 3T1VA 2JLYA 1BWRA 1CQJA 3O47A 4S12A 4L85A 3ROEA 3S55A 5K3EA 1GL6A 3P2YA 1T5SA 2GKOA 4RVOA 4C4AA 3ER8A 5KKAA 4UNNA 5HM6A 2DHCA 3W5VA 4Z4QA 2BFWA 1XMXA 1V3UA 1H3EA 1RAGA 5TQ0A 1J2EA 2FQ1A 1A9XB 2WKRA 3H2HA 4QECA 2CDCA 1WW2A 3WLLA 4MWOA 1XEWX 1YQTA 4ZI5A 1Q7EA 3P27A 1QRAA 2PEYA 1MB9A 4TT8A 5EWMB 1YDWA 5E2BA 1QSGA 2FW9A 2CXQA 1J7JA 3SAJA 5JSZA 4TRNA 2ZRMA 4TQ9A 1Z15A 4X90A 1D2NA 2O3TA 3QUBA 1CJMA 1KJIA 3MZ0A 3RAEC 1USGA 2JC3A 3EPKA 4CKWA 1DEKA 1VSTA 5IANA 3SR4A 2BBWA 2J9YB 2XMZA 4WK4B 3NTXA 5AM2A 5HRCA 5KQSA 1X7YB 2IYTA 3C1UA 4BV2A 4Q6WA 4DC1A 4NCAA 3OJOA 3ZLJA 1EM8B 1I3NA 2Q9CA 4LXTA 4XGIA 3K20A 1Q95A 3I9MA 2JFUA 1IH8A 5E9JA 2VOJA 5ALMA 2WIBA 4D3DA 3EW9A 5DB4A 3F4BA 2PFSA 4EW6A 1UFVA 3KOZA 2FW1A 1DBSA 1MT3A 3C74A 4L7VA 4N40A 4YRQA 2PGDA 4EHNA 1SUPA 4LOHA 3KOMA 3LLCA 4XR4A 3T15A 1EVKA 4UFPA 5I9TA 1SHKA 4F97A 3HBLA 3SVTA 1QRTA 4WK6A 4F86A 2JA2A 3OO0A 4KHZA 4JV5B 2FW8A 4WL0A 1REQA 3OT4A 4YGXB 4II7A 3ZDEA 1PT8A 4N01A 5ARDA 4ZJYA 4Z5XA 2G9NA 4QJIA 5FPSA 2EFGA 3K9FC 2QTHA 4ACBA 4D8YA 3F46A 2XGJA 2C8LA 1C8KA 2CBXA 4BLVA 4PHTA 1IEXA 4EENA 4HH3C 4KR9A 3WLKX 3T5DA 1TYCA 3AKDA 3Q10A 4YV2A 2BAGA 5T6MA 4KG7A 1KYIA 5ITSA 2IXBA 5E1DA 5CA0A 1CU1A 2RHCA 1X7WA 3UG7A 5I4BA 4D8XA 1QFXA 4NMXB 4OV6B 1F1BA 3BGIA 5FPYA 4AIIA 1BHO1 1K9VF 4KXNA 5D84A 3UOWA 1UZNA 3DDUA 2O7VA 4L4RA 3PC8A 2XWQA 2DF8A 4KB5A 4ND4A 1TDJA 3VPXA 3J81A 2HA0A 3BILA 2IEAA 3NAMA 4ZU3A 4LBYA 3HJCA 1PBTA 1VGRA 1RRMA 3AVPA 2B30A 1PSWA 4V2IA 4BVHA 3ZU3A 1ZN9A 5CH8A 2XJ9A 2C1ZA 3L06A 1XYYA 3U39A 2RH8A 2ZBVA 2JIDA 4LEIA 2CXHA 2DQZA 1UEXC 5AVZA 4R2LA 4ZCTA 3OP1A 3IUSA 3IMEA 4TLAA 4UTNA 1MR3F 1ZXXA 1CJKC 1OZFA 2OFOA 2OFWA 2PUWA 1Y33E 1XT6A 3ECSA 3IR6A 4L4ZA 3O2JA 4Y1RA 1RIFA 4ITRC 5F1OA 2IPLA 4N5DA 4YCSA 4X95A 4YDQA 2ZWIA 1T36B 1XZJA 4BNZA 3WYGA 5LYJA 1H42A 5L3QB 4X71A 4IFTA 3WB9A 1W88A 1RWOA 2Z5FA 3KE9A 4A0HA 1X7XA 4FS8A 4S24A 3AM1A 3FRJA 2HBZA 3FWYA 4H18A 3HVUA 1I2DA 1NJ5A 2DPXA 2WU4A 3PF8A 2FG5A 4RADA 3SEAA 4BE9A 1X3SA 4UOEA 1T5LA 4HZGA 4RKWA 4Q02A 2ATIA 1F6WA 1OROA 3R7LA 2CVHA 4ZGBA 5BNWA 1D9ZA 2HJRA 1IHYA 3CHYA 1II0A 3OFJA 1NLMA 1Y5RA 4O4JB 4QOFA 2QW8A 3ZY6A 4UPEA 2XHZA 4PGHA 1UMCA 2QRJA 2NU6B 4TYPA 4PRYA 2VR1A 4IO1A 3Q15C 1K88A 3KQVA 4NONA 1MN6A 3KQTA 1PLLA 1QRRA 5JSFA 2ZR0A 1JXOA 1R9GA 4PG6A 1THZA 1L4YA 3K9WA 1UPXA 2JS7A 3N8IA 2DU8A 5BN1A 1LLCA 4JYZA 2BEWB 4FJ1A 1JIUA 2VP4A 4YRCA 3FLAA 4M9SA 2C9DA 3GCXA 4AP9A 2HLNA 4PLYA 1HTWA 2IYAA 3THXA 2OQRA 2O8FA 1EP1B 1T9GS 2R1ZA 2XCRB 2HRQA 2B4AA 2C7GA 3MTDA 2ZUUA 2HXYA 3KKZA 4RHYA 1W8IA 2VDUE 2N1BA 1TKAA 2FRDC 1F60A 2OO5A 3HFGA 3RKSA 1YIDA 3FUVA 3K0FB 2MOKA 2GPTA 4HJXA 4R1MA 2W6OA 3MJRA 3LX5A 2V4UA 3N05A 1N2CE 5FTWA 4JVSB 2W43A 3UWKA 3G1TA 1FP4A 1HLFA 3SNHA 3FFTA 2F67A 5CM2Z 2JK0A 2CFRA 3GK3A 3OCVA 4RQBA 1DO0A 3VSAA 4R54A 1NN1A 2IYYA 4Q3BA 4BV9A 1Q2UA 3OZSA 4CM4A 4DV5B 1EX1A 2PX4A 1GPKA 1K86A 1H94A 1EQ2A 1MABA 1YBMA 1PFYA 2GVDC 4R1NA 1KAGA 2HDNB 4FYWA 1RWXA 2XUGA 3RD5A 1P39A 1ZCJA 1PW7A 1OXBB 2NO9A 4GBED 3RCBA 3OKPA 2DLNA 4IHJA 3SYKA 1L7VC 2X5JO 3BN3A 3SGLA 4C4ZA 5TJHA 4NDAA 4ZTUB 4DBLE 2H4ZA 2W2VA 3CGGA 3SHFA 4HNRA 2ZRQA 1BN6A 1D2GA 2B8JA 3AHDA 3A36A 1WWKA 1SJ9A 2XMRA 3AZQA 5AJXA 3RVMA 3GPLA 1RTKA 1VE5A 3CO0S 1XLVA 4Q37A 4R01A 5K0BA 2IVFA 5EN4A 3A6KA 2C20A 4A6PA 3WJ2A 1E2LA 1OAOA 4FKZA 3BA1A 3G23A 2H4XA 4G8CA 4M37A 2GTPA 3QKUA 3ZDRA 1RCFA 4IDNA 1SKBA 3CEHA 4FZJA 3GGDA 1SQ6A 2I22A 4LJ6A 1HOTA 4K5QA 4CMGA 3UMFA 3A2LA 1BXKA 1ST2A 1FS4A 5EL0A 4A8TA 3K9BA 1ZIYA 1U9YA 2AOTA 5J59A 4NPAA 2QU8A 1OWNA 4AAYA 3KTAA 2V5UA 1MV8A 4IV8A 2IDMA 2BHSA 1CDOA 1N6LA 2RHJA 4MLZA 3VOBA 5HZMA 4FEEA 1D1TA 3QFSA 2J9FA 1C1DA 1G5FA 2YXPX 1Q7TA 1Q44A 4IICA 1E3JA 1X19A 2AN4A 2CVFA 3DC7A 3K6SA 5I7HA 3S8MA 4TTAA 3VPSA 5EIXA 1GITA 1PTJA 2DT5A 2XWJI 1W0KA 1OZ0A 2AN1A 2MT9A 2P69A 3GROA 3ZH9B 4V0OA 4P35A 4Q7MB 2VZEA 1UOOA 1ND6A 1KDPA 3CRRA 1HETA 3ET4A 4YB8A 1FQOA 1HM5A 3AF3A 4MUNA 2D5AA 3RC3A 4C7OB 4BO6A 5JTUA 2A0UA 3DTVD 4UEJA 1SC3A 2BMEA 3C6YA 3IDQA 2NXJA 4I6EA 2YQ4A 3R0JA 1EFKA 2FWAA 3PQ3A 2RARA 4OF4A 4YRKA 4ZOCA 4FUQA 3N74A 4FVTA 2ZRPA 4I2NA 3GLGB 4X6UA 3TAXA 1K8QA 2C2HA 5JRDS 4KQEA 3AERB 1NNLA 1P33A 1ZIPA 1UADA 1MTZA 4JDUA 3WK4A 2PRZA 3O38A 4K26A 1QM5A 1LBTA 1PQPA 2J0EA 4B0OA 2PVPA 3FTDA 4JLWA 1G21A 4KXQA 5SYNA 4AC9A 2DFDA 5ITZA 3H2BA 1H2FA 3U09A 1ZN7A 1QQAA 5ESWA 3F4LA 1KFJB 1O5TA 3FYUA 1GPLA 1V95A 3RVLA 1TMKA 4BCDA 3ZU4A 1PIWA 4RBNA 2ATCA 2R8RA 2XQIA 3MS2A 2IWHA 3E22B 3F2IA 4G5HA 1PR2A 3AJEA 5F1KA 3IEKA 5JFGA 2B1JA 1XZPA 5TF0A 2AE1A 1UJBA 2ZUCA 4GZLA 2OG1A 4HNAA 1TLTA 1M5UA 2PMDA 3SOZA 5IF9A 3MWDB 1JLSA 1SHJA 3PNPA 5JW6A 2GI4A 4WACA 1Z6XA 2X5NA 1XTTA 4P4SA 4W5QA 3F2VA 4LYJA 3A14A 3MMPA 5JATA 4TWAA 3L4BC 1M6NA 3KT6A 4V0NA 1GNPA 1W36D 1J42A 4KQXA 4B6SA 3RKUA 1R74A 2QD5A 1S8FA 2YZ7A 3DWIA 2L2QA 4FCCA 4NFYA 2CNDA 5DHPA 4XDGA 1GQFA 3VV3A 2DLCX 1OXTA 2O8BA 3QLEA 2QNRA 2R00A 1UJ5A 1K8YB 3DMPA 4I4TB 2BI7A 3K8ZA 3KDSE 1JKJA 2BF4A 3B13B 3RIXA 2HNBA 4LKRA 3VAYA 2P62A 1SD5A 2C57A 3QV1A 3WNVA 3ANMA 1GFWA 5DTJA 4DRYA 2C3UA 1N2SA 2B37A 4Q93A 1HX7A 1P7PA 3RSCA 4KKXB 1P91A 1DRKA 2F1KA 2QZPA 2HY7A 2VAXA 1FDOA 2V0GA 5BW4A 2YZGA 3A3PA 1IAQA 4B8YA 1YJ8A 1YR1A 5C8YB 2NV0A 5C32A 1AQIA 1URPA 5HEKA 1CY4A 1QVZA 1EXNA 4I55A 5C31A 2WU3A 4O6VA 1L8XA 5U4QA 3PNLA 4IZIA 5AKEA 1CJCA 2VDJA 4BL5A 4UCXA 2BR5A 4NBUA 4IZOA 3RU3A 2J0QA 4PYMA 2NO6A 3LCUA 4IXWA 4XUEA 3AXSA 1YBVA 4ZU6X 3C1TA 3PGKA 3LYLA 1Q0QA 4AP6A 5KDDA 4MVYA 1OBVA 1Q5PA 4RF4A 2QUIA 4GRIA 4WZ6A 3VAZA 3WWPA 3L18A 4U6SA 4YK7A 4I3HA 4LF6B 1YRQA 4B5KA 1CNMA 2Q1TA 2QSJA 4U7TB 1W96A 3UPUA 1M34A 4CKXA 2QVXX 2Q4TA 3U62A 2XMPA 3U4GA 1PGOA 1XU9A 1TQ2A 1QZTA 1RC8A 4G4SP 1BXGA 5G53C 2KMLA 3NHBA 3OTWA 3GCDA 4C0KA 4R3NA 3W6UA 2K4MA 2Q3BA 2X8JA 1I1HA 2QPOA 1EI9A 2YVLA 4Q0MA 3AVUA 4CV3A 5DTQA 3UA4A 4E2WA 4IH1A 1M2VB 3JWJA 4X1IB 1NW7A 3T1QA 2EAUA 3LTNC 2W71A 5CFOA 3RTBA 4CKYA 1Q1NA 2UV8A 1XD8A 1IVNA 1I4DD 2F9LA 5K0SA 4TZTA 5AVYA 1WU7A 2GNPA 4WXPA 3Q85A 5EUQB 2D0IA 1EEHA 1HZZA 1N3YA 2HIAA 2POQX 3V46A 2WUWE 1TEVA 3I4LA 2GD0A 3TIIA 4YYZA 1CS4C 1KI4A 1ZN8A 4AYWA 4E5YA 2F6RA 2XBLA 3R8CA 4ZZIA 2W2LD 5BORA 5H3HA 3EZGA 4FW9A 3COYA 1B2LA 1B43A 2IY8A 2OK7A 3AP2A 1JHYA 2G9RA 3B7GA 3NYRA 3KT0A 1PJ2A 3WDSA 3WWEA 7YASA 1G2IA 3DPUA 4DCNA 1IHPA 2EC5A 2QR3A 3DBVO 4CEHB 4KJZA 3VNVA 1I0ZA 3A28A 1OFVA 2BBOA 2G36A 2IYNA 2GZMA 4N7JA 3ND5A 1Z06A 1Z33A 2AFIA 1KEZA 3HKBA 1CEYA 3R7BA 8MHTA 5B3LA 2QGFA 2VZLA 3OZUA 3L8DA 2WD7A 3FJOA 2DBVO 2ONJA 1BTOA 1PL8A 1NBME 1UFQA 3KJQA 4FBMA 1X70A 1G8KA 4RZUA 3TRFA 3ZKAA 4BIMA 2Q5OA 4Z49A 2WVAA 4G3XA 4OAOA 2XUPA 2PQ2A 3PCXA 1MAHA 3THWB 1JBKA 4J9VA 3VU9A 1CUSA 3WIOA 1RHRA 2Z2JA 1PFVA 4X62B 3EXIA 4KO1S 1H2YA 4CU5A 5EEGA 4PYIA 3A3YA 4RK7A 2C04A 4DR5B 3MGGA 4K9PA 4X97A 2MINB 3O9MA 5IM4F 3RU7A 3PLNA 2Y1GA 1VDMA 1W5AA 3NYWA 4XDHA 5EY5B 3O9ZA 2W37A 2QXYA 1C30B 4X0EA 4BMPB 1EH5A 1NQAO 4JU9A 1P0PA 1QG6A 2YJ3A 1KYXA 4WJZA 1JTEA 1K8XB 1UOQA 4QXQA 4KLAA 3ZHQA 2ZWOA 4EF4A 5E7QA 1I0IA 1SC1A 3RFUA 1GGFA 3VGPA 1YS2X 1RYMA 3ANLA 5FL7D 1LLUA 3D6TB 2Y0EA 4DCJA 1DHTA 1Y8AA 1AO3A 2OL4A 2QUKA 2YQZA 1LB1B 4DWVA 1OOEA 1AH2A 1YSCA 2KI5A 2OHJA 2YMQA 4DQLA 3RRZA 1PNOA 2C54A 3RI3A 4AYTA 1WV0A 2AI3A 4XRGA 3NW9A 5AJUA 5FAXA 3EFBA 3RIYA 3B7PA 1CSEE 1O0CA 2DETA 4Z3OA 3IC5A 2ZJFA 1JTVA 3G6WA 1WDWB 1FRFS 1N9GB 1BGVA 1WDMA 1P1BA 3SZUA 3NV9A 3ZWAA 3DOIA 4WSOA 3WE7A 3F96A 4KDRA 3C4JA 3UZUA 3EIWA 2FG7C 4PC2A 5K3AA 1E0JA 1JJVA 3MB8A 1ZX1A 4JLSA 4Q19A 1B8PA 4G0UA 2Y4NA 3NBMA 1PS0A 1N2JA 4TUYA 1JQJC 1U6KA 2JGMA 1Y5IA 4OOEA 1RM3A 1HOXA 1SG6A 3W4JA 1I4LD 4OL9A 1EGVB 2UVPA 4H6WA 3I6BA 1E4OA 2IE0A 1GEGA 3HUFA 3TW4A 3C0KA 1CRPA 1UBEA 1CUVA 1VKRA 1GZ7A 2W2KB 4B6FA 4EFNA 1OZAA 1TJNA 4IVPA 1ZM7A 1BIFA 5IXYA 5EIWA 1AGRA 1JMVA 2OBBA 3MRTA 1PL6A 2HPVA 4L0DA 5AJHA 3WGTA 1YXMA 1OTHA 2QE7D 3CYFA 4OUDA 4WNIA 3WYCA 2D3TA 2I65A 3AI3A 3A1FA 4B9AA 3CW2A 1JP7A 2JJ2A 1LFAA 1GZHB 4QYXA 2XE6A 4IG4A 5K01A 1H93A 2CYCA 3T3MB 1FDTA 3IBTA 4MS4B 1UM9A 3TEFA 3SLRA 5A02A 1Q21A 4BQRA 1IQRA 3ZJVA 3FYCA 2O7QA 2C5EA 1ZICA 1M10A 4G1EB 4GE0A 4U7WA 3RREA 4RTMA 4MKIA 3O31A 3G88A 4DDKA 5T8KC 2O9JA 4MLPA 2BDTA 1HV8A 3KKMA 5EERA 4ER3A 1O95D 4P54A 2K5UA 4HPXB 4EPTA 4ZGWA 1HEYA 1LI7A 5C7LO 1HF3A 2YVAA 3INNA 3N7UA 3QH4A 2X0DA 3B6JA 4JP8A 1ODLA 3EXFB 3FDFA 3NHAA 4O2BB 4JAVC 2WM3A 2B35A 3N2GB 4YP6A 2VBFA 2DKOA 2VP2A 1CD5A 1E6MA 1SOUA 3KC2A 3DMFA 5BVGB 1SC9A 1CR1A 4BNIA 1WUTA 3FVTA 3ILVA 2YJZA 5AKXA 2XT9A 3ZGZA 1UCFA 4NX2A 3WLQA 1NW3A 1G6Q1 3F3YA 4GPBA 3HY4A 3OOWA 1ZUIA 1P7ZA 3MGKA 1M5RA 1Q12A 4IHQA 2O8DA 4DQVA 1QIKA 3IQEA 2BFOA 3DKIA 5G4LA 4EHFA 4HMQA 4ARIA 1P9WA 4BVKA 4J0GA 4RELA 5BNFA 3UFXA 2R4UA 3JY6A 5J2UA 4WY2A 2QBYB 4PLCA 4MCAA 1V41E 2E4WA 2P77A 2FWNA 1N6HA 3PNYA 4M8SA 4S04A 3P0IA 2QJOA 4W5JA 1MG5A 4AQYB 5L3SA 4INPA 1CVLA 3G0BA 1RHQA 2CMFA 3IEPA 1WXDA 2O3UA 3NZEA 4HGOA 5LDGA 5DHUA 1N2GA 2XUHA 4FP9A 5DYGA 2X2EA 5DW3A 5LP6F 5HRUA 2X2OA 3B1FA 4WLNA 2ZP1A 1K3FA 2X23A 4ZT5A 4CR6A 2O8CA 4NDZA 1WZ2A 4JYBA 4NU5A 3FDXA 3GLVA 4XFDA 1M2GA 1DX9A 3PSHA 4NCXA 1E2IA 2IP4A 4QYIB 3CFYA 3BJIC 4DMGA 4N3GA 2ZTMA 5ALJA 3OKCA 3ZJ4A 2H1RA 4EI9A 4TKZA 1Q57A 1J23A 1LQ2A 4FBLA 4FFLA 4NMLA 1CUBA 3F71A 1P4AA 1VPDA 2YVQA 1VP3A 1DXQA 3IS3A 1Z39A 5FUYA 4NFLA 5JNWA 4UPVA 3LYUA 4GI2A 4ZEMA 2YWJA 3NORA 4LDZA 1M8FA 2YL2A 4X9XA 1OFIA 3KSRA 2IS6A 1UUFA 1IRIA 1PT6A 1PZHA 2OPHA 2IHJA 2BCJQ 3GYBA 4ZI7A 4H6VA 4I4CA 3JYNA 5A03A 1PV2A 2DFPA 4ENUA 1NOJA 3VNQA 3W1EA 5ALVA 3NIBA 1O4VA 2W7TA 5E0OA 2Z5GA 4LYHA 2EGHA 1QFYA 5TC4A 1O77A 4OQ4A 4XSHA 3RJ9A 4RHUA 1SKMA 5B58T 3BE5A 3IO5A 1ZC4A 2EF1A 2HGZA 3I73A 1XJQA 3KOOA 4CKBA 5HJEA 3H8SA 3UV7A 4M0FA 4TMYA 1IAVA 3FCOA 2IZ5A 3ENZA 5LXTF 1U9IA 4YJHB 3S70A 1EZ4A 3MEQA 3ZU2A 1WUYA 1UDAA 3TTVA 1Z18A 3TKYA 2AXEA 4O33A 1ZNXA 5D3QA 4MI1A 5DBOA 2JEOA 1F6BA 1T9AA 4AROA 5DNYB 3AJAA 5L4SA 3GLHB 3W8EA 3FPKA 4R2WA 3W5SA 5A62A 4IFIA 4AKTA 2GFHA 4CDGA 1GG2A 4RTKA 3FUWA 1CZOA 3CCBA 1TX4B 1KQPA 1AF4A 2JFQA 2R25B 3N5KA 4PGGA 3ZJ5A 3HUUA 3P94A 1JSZA 3LPMA 4O25A 4M1MA 3DUFA 2IGTA 1ZH6A 2CWDA 3CZ4A 3QG1A 1GUDA 3IA7A 3IIKA 4F2GA 5J63A 5HFAA 3E35A 3H1EA 4ETNA 1SCKA 4IY1A 5C5CA 1AF7A 4GMHA 1CRWG 1XPUA 2Q1YA 1Y3FE 1NP6A 1IATA 1VHTA 2O05A 4OK5A 4XPIB 7REQB 3ABZA 3KALA 5G2OA 3CXUA 1ZK2A 3CVJA 5SV2A 4ILKA 1ZMTA 5JMOA 2OGUA 3HKCA 5KREA 1BG6A 3H5IA 4JI8B 3JVIA 3MJHA 5HTOA 1DEOA 2FSSA 3CX7A 3BIOA 2GWHA 2RCNA 4KV9A 4D0SA 4GQAA 1WPQA 5HUHA 1QHSA 4K40A 5FTKA 4ZVRA 1ECFA 2A9KA 4KK3A 2AQ8A 4U2GA 3U4QA 1QRUA 1N33B 3EEIA 2Y1LA 3PKIA 4R0NA 4ZVLA 4BP9A 5FNVA 1KPHA 3UATA 3KQOA 4LIPD 1G4UR 1TMYA 3UVEA 4A91A 4DMCA 4F8YA 3C70A 2DOKA 3ORRA 2GPSA 1W52X 3IP9A 5AVUA 2ZYDA 1CY0A 1KHHA 1KQOA 3D5QA 4TS4A 5KNBA 4RJ2A 2R4QA 1V39A 1ECCA 1P5ZB 2J6IA 2ZRBA 3BL5A 4OBEA 2I2CA 4NEGA 1FS5A 2XEXA 1D6MA 3SY8A 1GGNA 1AM4D 4HDOB 3R24A 2ZSKA 1GR1A 2EERA 1B0UA 1BDHA 3FVRA 3LRPA 4HDSB 5LKAA 4O1MA 3IP6A 1XP8A 1JA9A 2Q49A 5CNMA 2UKDA 3FNFA 5DMXA 1PI3A 2IWRA 3WO1A 1GNLA 4KMMA 3LUFA 3SLKA 2AJCA 1YZTA 1UMDB 4G81A 4BU1A 4ZZ1A 1JQBA 2CSXA 4ITUA 4LXYA 2Z04A 4DSOA 1IY0A 1XDDA 1TYAE 3M6MD 3UUEA 5I48A 4KEAA 1RJWA 2AZ4A 4BATA 2BFBB 5K4GA 1GU1A 1SU6A 3KHKA 3G8AA 1Q7RA 4MW6A 2C98A 4RZ3A 4BOYA 1G2QA 1J33A 3G82C 5GGYA 2GETA 3AUAA 5JS7A 3QX3A 3DL2A 4FFMA 4EVSA 1OQAA 3ZDXB 4MQEB 5F3WB 3ESRA 2B1RA 1ORDA 4MLCA 4AJJA 2ZKLA 5HKLA 3RVBA 3OFNA 1X80B 3GN2A 3V2UA 2JLRA 2J9ZB 1WB9A 1U1FA 3EWSA 3H17A 4D46A 5JCPA 3B5EA 3VSBA 2GAJA 5KB3A 1HURA 4GBJA 4RWZA 1ZUNA 1LDYA 3MWFA 4FS3A 4OM8A 4B48A 5JHHB 2I6QA 3FOWA 2ZAIA 4EYEA 3AU9A 5EJ9A 4C0JA 3L1VA 3T5CA 1ZAKA 4BBPA 2HNAA 4MW4A 1AXRA 1P9RA 4ZZ2A 4LXHA 1OLOA 3S1AA 5M5BA 4YBZA 3AHHA 1VIAA 3LX4A 1G1AA 2WI8A 1ZJ6A 2HWXA 3G0IA 3H9BA 4NOMA 1ATZA 1KZHA 3TQFA 4EUEA 2X6TA 4FD2A 1XRNA 4B3XA 4ZICA 3BSYA 5IG2A 1R37A 2I29A 3CLUC 4E70A 3DR3A 4KREA 1WF6A 2R44A 1XDGA 3GT7A 1RLJA 4LRTB 2Q3CA 1E7MA 4RHEA 4C7BA 5T4BA 3HC7A 4R40A 4N6NA 4CMCA 1DQZA 4ENSA 4CIYA 2JGDA 3LA6A 1B0PA 1FDIA 1B14A 3ZDYB 4BNKA 3P96A 3ZWCA 3EC7A 4BQPA 1UBOS 2NZVG 4QOJA 1RWPA 5T57A 5JEDA 3D3KA 4AMGA 1DKPA 5K3FB 4ZRDA 1ATIA 1CLUA 3GHHA 4NV3A 5BQ5A 4DV6B 2X14A 2ZI4A 4KZKA 4CQJA 4QA9A 1IUPA 2QF7A 1OW3B 4HS9A 1MA0A 3JX9A 4PZDA 3ZIDA 3AGQA 3L07A 3GZ4A 1PHRA 2WJZB 4URXR 3EVCA 4UEWA 2KHZA 4GOLD 1OXVA 4N9QA 3EA0A 4DUPA 1JLRA 1FNMA 3TQTA 2I3AA 1XSEA 1RFLA 2XB6A 1S01A 2WJYA 3HGMA 3KR0A 4BP3A 2IYQA 4DQUA