3SU8A

Crystal structure of a truncated intracellular domain of plexin-b1 in complex with rac1
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
178
structure length
178
Chain Sequence
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-related C3 botulinum toxin substrate 1
publication title A Dual Binding Mode for RhoGTPases in Plexin Signalling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis/signaling protein
total genus 47
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2011-07-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3su8A00
4PO9A 2C2HA 1IAQA 4TQUS 3AVWA 3I1FA 1O87A 2GXSA 1UAAA 2ZSBA 5A0FA 1MV5A 3BC1A 1QHXA 1TEXA 2MMGA 4WVFA 2MSDB 2CCGA 5JHGB 2R8RA 1E9CA 4AI6A 2HJVA 2VP6A 3B60A 1XPRA 1G1MA 4K46A 3GLIE 2J0QA 2OO7A 3NKVA 3B9PA 1BYUA 3MWKA 3W34A 1TF5A 1FMJA 4L15A 2VO1A 5JMTA 4A82A 1W0KA 5A4JA 1VYUA 2VPPA 2OFXA 1GRQA 3HJNA 3ZYCA 4AYWA 1DPFA 5F3WB 4G5GA 3AKYA 3SQWA 4M1WA 1R5NA 2ZRPA 5CYOA 1AKYA 1Z08A 2F43B 3G5UA 5FTMA 4A2WA 2HEIA 1D8TA 4TT3D 5FTLA 1CJKC 3DDCA 5IHPA 3IHWA 2QN6A 3Q5DA 4XWKA 3GCGA 4GPTA 3ZLJA 4DB4A 3T5DA 5BN3A 5DN6A 4C0AC 3KKQA 3U7GA 1N6RA 3AM1A 1OFIA 5DI3B 4UXIA 2IYTA 3CX6A 1XEWY 2GBLA 1R5BA 2KI5A 2ZRDA 1TADA 4Q03A 3GLIB 1T3HA 3LX5A 1VMAA 5FTKA 3N2EA 4URZR 1HH4A 3BFKA 4HATA 4LV6A 1W4CA 4UJ5A 621PA 3FB4A 3U3MA 4O3MA 4JLAA 1RKBA 2A2ZA 2F6RA 3MRSA 5B57C 3QXSA 3RS0A 2CK3A 4HUQA 1S9DA 1FQKA 1RYHA 4G5RA 2ZRFA 4V0NA 2ZRCA 4Y0AA 1A5TA 3T35A 1ZD8A 4BFXA 4CZ2A 5K8TA 2ZJAA 4FCWA 1GNRA 2GA8A 2ZROA 1H8EA 1AK2A 1T5IA 4M9ZA 5KO2A 4A0HA 4B2LA 1GAJA 5DH9A 4V02A 1ZM3A 1SKYE 1YU9A 1AZSC 4LC1A 5C4GB 3D7MA 2YV5A 1KI4A 2C9CA 2X8AA 4GP6A 1TAGA 2C99A 4DCUA 3WNBA 3RVBA 4DCTA 4RZ2A 3W8RA 1E2KA 2W2TA 1UKZA 3K8YA 3W5IA 4W5WA 1N5JA 1OIWA 1G16A 2A3RA 3P26A 3AKEA 1BMFD 2RGNA 4YMSA 4DLVA 3GLFB 4Q1AA 2ZJ2A 3E70C 3GJ8A 1G3UA 2WIBA 1JR3A 3W5JA 2FFHA 4L5BA 2WWIA 1J7KA 2E87A 5DLQC 4WBSA 5P21A 1AA9A 2Q3HA 4Z1MA 2HV8A 5JWOA 2DY1A 4F38A 5KSPA 4NHOA 1JJ7A 2XTZA 4A2QA 1R7RA 5CDFE 1EFHA 2DBYA 1KO1A 5GADl 1YRBA 4JLJA 1O3YA 1XBTA 3QF7A 2QE7A 4FINA 4P4SA 4OL0A 3HDTA 2O8CB 2O8FB 1TQ6A 3NVAA 5B2ZA 2O0JA 1LTQA 2A7QA 4JLKA 3AEZA 1KI6B 1SKYB 3SFZA 4BFUA 1OPXA 4DSUA 4P4TA 2IWHA 5SZHB 5DHFA 1KKMA 3FHCB 4QJ3A 1SVMA 2OG2A 4PC6A 5KHOC 2AHOA 3R9IA 2Z0MA 4QM6A 2V1UA 2OBLA 3NC1C 1VHLA 3PCRB 4POAA 4Q9HA 3PXGA 3IDQA 4LJ7A 3CZPA 4HAUA 1P9RA 4LJ8A 4DJTA 3KDSE 4OK6A 5J4VA 1Z0JA 3A36A 3ADDA 1MH1A 3ZJYA 3R7WA 4GMDA 3KKMA 2JLQA 4LRWA 2DR3A 2OCBA 1GILA 1OHHA 4M1SA 1W49A 1SVWA 4U5XA 2GXAA 4AURA 2XZLA 1E2LA 1RJ9A 1L7VC 3LBIA 3K70D 1BYIA 4LHXA 2OEPA 4I4LA 2OHFA 3GLGA 3AGQA 5AUPB 1QRAA 3SS8A 3DM9B 1KI7A 1UDWA 2BBWA 1G18A 1VCNA 2C9YA 2QU8A 2V7QA 2VBCA 3KJHA 4LOAA 1SULA 4ZIRA 2A9KA 3DKPA 2GF9A 2P5SA 1JQJC 1QHGA 3I8XA 3IO3A 5JI2E 1JXOA 3EAQA 4PHFA 3QNUA 3TNFA 4LJ6A 4LWZA 4JVLA 4FMBB 4ESVA 5CLLA 1JJVA 3KFXA 4Q4JB 3SN6A 4EPRA 1ZM7A 3RWMB 3VHXA 3L0IB 2WKRA 3NH6A 3E5HA 4TLEA 4P32A 1KZ7B 5EXXA 2ZIAA 2V4ZA 3T15A 2JJ8A 4OQMA 4JVNA 1KJYA 1JPJA 1Q21A 1Z29A 2EFGA 4D2IA 1II8B 2PEYA 3LNCA 4Q1EA 1UBEA 2VP2A 1VHTA 4FMDB 4ABYA 2H1LA 2RGDA 1PZNA 4DXAA 4G1UC 4OHXA 3AUYA 5K8IA 3KQHA 1NG9A 4OJQA 1P3JA 2PEZA 2AD1A 4HAWA 4TMKA 4DB2A 2PBRA 1IJFA 2BBOA 4ZKEA 4CRWB 3EZ9A 2PMDA 4RFSB 2F1IA 3V9PA 3RABA 1OB5A 1S96A 3GJ4A 3PEUA 2ZAOA 1T3SA 1SZPA 2QMUA 1I4LD 1RYFA 1OF1A 2OAQ1 4OK5A 2IWRA 1R0YA 2C77A 2J0VA 1XD2A 2ZPTX 1ONBA 1SQ5A 4KHZA 3ZDQA 1PJRA 5HKKA 1YR8A 4M8NE 2QPOA 3EG5A 2PJZA 4Q01A 1K6MA 5JCPA 4MA4A 2B7CA 4B3DA 2AL7A 2YOHA 1E94E 3AF4A 5FPKA 2ZYVX 3L2OB 4D4LA 3RYTC 1TQ2A 3A4MA 3L8YA 4HZIA 2PX0A 4QBIA 4WXRA 1NJFA 1KY2A 2Q0HA 3Q72A 3EZFA 4OQLA 3EC1A 3SEAA 5SZIA 2FFBA 1DAEA 4TLDA 3FPAA 2R62A 4N1AA 4TYQA 4UNQA 4ARZB 4B43A 5JJLA 3DMDA 1E2JA 4G01B 1QBKC 3P32A 4O0MA 1FP7A 1J99A 3I5XA 2XGJA 5HR5A 1D9XA 4JLDA 4JBYA 4AIIA 4A36A 1S3GA 4M0LA 2LKDA 5GJBA 1NSTA 4AKGA 3T1OA 3AP3A 1GWNA 2YOFA 4O2RA 2F9LA 2VQSA 2J7PA 3SJCA 3ADCA 4DLSA 2CJWB 1R10A 2DHRA 1RRCA 2JJ1A 5JEDA 1PV4A 1S8FA 3SYNA 1W5TA 3VR4A 4MKFA 2QP3A 1MT0A 2A5JA 4AD8A 3VU9A 3VR1A 1DG1G 2HCBA 2NO9A 5AJYA 1NN3A 4BLSA 1Z06A 1Z47A 2A5GA 2REXB 3TR0A 3O47A 1P61B 1HURA 2ZM5A 4KO8A 2GRJA 1T6NA 3U4QB 5F98A 4BZPA 1JI0A 4JS0A 3DVLA 4WW0A 3LRPA 4Z51A 4OBEA 3ZGXA 5AUNB 1IHUA 3NEYA 4OQXA 2HYIC 4FCVA 3RS2A 3KKNA 4RY2A 3A6PC 2OILA 2BVNA 3EIEA 2Q9CA 1NLFA 2Y8EA 4DIEA 2FGKA 1FX0B 5SZKB 1AS2A 4E07A 1Z83A 2UZ3A 3BH0A 4P31A 1DAFA 3O8DA 2ZRNA 2ZVQX 2B6HA 2ZJ8A 2BMFA 1JBKA 2CL0X 4XH9B 3LH5A 2CDNA 1KSGA 2YNMA 3NBZC 1Z8FA 4YONB 4ZCLA 4DUGA 1E2FA 5K8LA 5F9HA 3T06B 1NN1A 4IVQA 2QROA 4A0RA 1N0VC 1TU3A 2DWPA 2JDID 1N5IA 4MUBA 5FTNA 4S2EA 3FMOB 4B6EA 4HEJA 4IHQA 4MGYR 4RD1A 3P4YA 3IGFA 2ANCA 2D7DA 4LHZA 4QJ5A 4WA7A 4CT5A 4QG7A 1YR7A 4DVGA 2GDJA 3LX8A 1NVUQ 4KVAA 2B7BA 2CVFA 2BWJA 4XVQA 2HT1A 4A0FA 1H65A 1X8JA 3WRXC 3GLFA 1ZUNB 3K0AB 4OI2A 4Z8XA 4MKHA 1ANKA 4B3FX 4BLOA 2J0SA 5JRZA 2ZTSA 3W6PA 4C0QC 2VHUA 3H2YA 3K0FA 4EIWA 3C16C 1Z0KA 4IXMA 4LGMA 1TPZA 4B2PA 2YWGA 4OHWA 1AM4D 2ODEA 3WRYC 2OUKA 3W9YA 4IFBA 1WB9A 2JATA 1RRGA 3F8TA 1LY1A 2AXNA 3HR7A 5CK5A 2NO0A 2O8FA 4FIDA 2ZANA 3EZ6A 2O8CA 3TGPA 1J70A 3UK6A 2VHJA 1IN5A 1L2TA 4LPSA 1KI6A 2F1JA 5C1BA 3G82C 2V8OA 1QVRA 3QKTA 5SZJA 5HZHA 4LBVA 1W0KD 3SQXA 1FTNA 4QNRA 3N5CA 2O5VA 1GP2A 5UKDA 4EJSB 2OLJA 2WWWA 2FPKA 3EA5A 3B1WA 4AC9A 1TUEA 1YHNA 4NH0A 5FUVA 5LDDC 3EPJA 3ASZA 4YDHB 4X8MA 2WAYA 3BORA 2FE4A 3A1TA 5DN6D 3CRMA 3IQXA 4M9SA 2H18A 5FUWA 2HUPA 1CTQA 4YDSA 5CDFA 3SJZA 4EFNA 5IF9A 1X8LA 4ESHA 1TQDA 2FX3A 1BOFA 1B23P 4Q19A 3H1TA 2ZJZA 3AVUA 3AB3A 3QKSB 4Q47A 1ZIPA 4DLWA 1YQTA 3AQ4A 2CK3D 1U9IC 4XWOA 1VYVA 1GNPA 4MKGA 3TQFA 4B76A 2VIIA 2RGAA 2ZYTX 721PA 2OBMA 2QORA 3I8SA 3VKWA 3SHFA 1H8ED 1OT3A 1LB1B 4H1UA 4HAVA 2IYWA 4MYCA 2DFTA 2FSHA 3RLFA 1GTVA 4UNRA 2KBEA 1KI1A 3ICEA 4KJZA 3BRWD 4RZ3A 1OH6A 4R9UC 4DDUA 1XTKA 2P0EA 1M6NA 2R9VA 4EJSC 4D25A 1Z0IA 1WF3A 3U7HB 2AN9A 1II8A 4DCSA 4P3YA 1CBUA 1U2RA 4LI0A 1XEWX 2XAUA 4ZCIA 1N2CE 3KQKA 3KFVA 4TYNA 2C98A 2JEOA 1IN7A 5DYGA 3UIEA 3UWKA 1JR3D 1VCMA 2ECKA 5CYPA 5FTJA 2WSSA 1X3SA 3GEHA 2XXAA 1W36D 3SBDA 4Z1MD 2N1BA 1YKSA 2IYSA 1XMVA 4PC1A 2PJRA 1G17A 3AF2A 1Y3AA 4R98A 1F5NA 5JS7A 5JZVA 3I62A 4L9SA 2QE7D 3AF3A 2EWWA 3KKPA 3EPKA 4KV9A 1G3MA 4B75A 2R2AA 4MQBA 4S35A 3NBXX 1UBCA 2FN4A 4TL9A 4JJKA 2IYYA 4XVRA 4GZMA 1ESMA 1DOAA 3VX3A 2WTUA 3ZZUA 4M9XA 3GEIA 4LYJA 2W6IA 3Q3JB 4PQFA 1M74A 1BH2A 3FWYA 4TMZA 3A1SA 3H0KA 2CLDX 3TVTA 3FTQA 1N6LA 1KTVA 2ODNA 3TQCA 2VA8A 1NVWQ 2P5TB 2R6CA 2WM9B 3AKCA 4Z8YA 5EJEA 5JBQA 4ARZA 3FE2A 3QI2A 1E2QA 4DLRA 1Z07A 1HA3A 4GDFA 1C1YA 4JYCA 2XOKA 3O8BA 3GFPA 3B85A 3CRRA 2GZHA 4FXPA 4OI0A 3K09C 2ZVPX 4Q4HA 4IDOA 1NLZA 1DVRA 1OHHD 1XWIA 2W2XA 2ZRHA 2ZRMA 1QVAA 4IEIA 3WMEA 5CIQA 2J9RA 1NL3A 5FOTA 5KPDA 1Z0FA 2ZJYA 1AZTA 2FSFA 2V6IA 4TL8A 2NPFA 1GOTA 4BZQA 2MSCB 1A2KC 1W5SA 1Z63A 2ZSFA 2V7QD 2WJIA 1RRFA 4DLTA 2JLUA 3QIAA 3TSWA 3HPRA 4Q4LA 2QA5A 2AK3A 4AY2A 5EQTA 3A4NA 4EFMA 2FSIA 4ZDIA 2CL7X 4PAMA 2W0SA 1KK2A 3X1WA 3MWLA 2VF8A 4MKIA 2OCPA 4CDGA 3U4QA 3FHOA 2ERYA 1F48A 1IN8A 2YWFA 2ZS8A 1G64A 3Q5EA 5G3ZA 4DEYA 1R0WA 2BKUA 4A4DA 2IEZA 2R6FA 3CW2A 3ECCA 1XTRA 2QP9X 3Q8XB 1RC8A 3TSOA 221PA 2JLSA 1Q0UA 3MGCA 2ZUCA 3RRYA 3RC8A 5EE5B 4B2IA 3M0EA 1X1RA 3D3QA 4OKSA 1IQPA 1FNNA 1E4VA 1FX0A 1FL9A 3QKRB 1TF7A 5IK2D 121PA 4DZZA 2ANBA 1G21E 4EPYA 1KO4A 4PHGA 3EZ2A 5GVRA 2RH5A 1HE1C 1XJ0A 3MMPA 2OSBA 2BKEA 3L43A 4KLZA 3ZVMA 3THXB 3ZS8A 5B64A 1XTQA 1GVNB 3CZQA 4HB0A 4NE2A 3MUFA 5FI1B 3TKLA 4US2R 1G5TA 2GWHA 2VP4A 2ZRKA 4N3NA 2GAAA 1F3OA 1XB2A 1FFHA 2ONKA 2NO6A 5EE0A 4NYJR 4JSTA 4MYUA 3SR0A 3C4JA 4LZZA 3EX7C 5HKKD 1XMSA 3ZVNA 4IOJA 4JVMA 4C0KA 4M53A 4XWAA 4M4SA 3SE0A 4UJ3A 4XSGA 2QNRA 3KXKA 3PQCA 1NJGA 3TW8B 2X19A 4R2IA 4M9QA 3NH9A 2O8EB 4M21A 1E98A 3AP1A 4PFSA 1MO5A 3KB2A 1KNQA 2QL6A 4WOPA 1P62B 1XTIA 2JGNA 1ETUA 1GL7A 2PLFA 2AFHE 3N70A 3NDPA 3GJXC 1E9SA 1LFDB 1U9IA 3ZZTA 3EWAA 5BYKA 821PA 4KI0A 2RGXA 2WWXA 4Q18A 2IS4A 1QHYA 3PITA 4LC0A 3A1VA 4Q5IA 1GUAA 1YJ5A 2KE5A 3P27A 3K0CC 4Q7KA 1H8HA 1JEDA 1KGDA 5JWHA 3SYLA 4ERNA 5BWMA 5JI3E 2ZYUX 4HAXA 1DAKA 2YJTD 3K9GA 4ZDKA 1DELA 4EAQA 3QBVA 2AXPA 2J7PD 4GL2A 2GEVA 1FPMA 4EUNA 4KSBA 3GD7A 3RS3A 1QZXA 1NMYA 1ZM9A 1E4YA 3W3AA 3UWOA 5DIFA 1N25A 1Q22A 1KJWA 1NN0A 3WHLA 3B1XA 4CGZA 4I1SA 1VG0B 3PVSA 5HCIA 2FV8A 1ZD9A 1CXZA 2IHYA 2DPXA 2XZOA 4MRVA 2BIFA 2LWIA 1NG1A 1WQ1R 2RGBA 4LPKA 5HE9A 4C4PA 4IDNA 2BEKA 3TVDA 1F2UB 2CNWA 4PO8A 4BFZA 1E2MA 1VYTA 2WJHA 1ZNZA 1QG2A 4P4UA 2JLYA 4JBXA 1M8PA 4PR0A 3CO5A 1HQCA 3I4LA 4MRRA 1NI3A 2D06A 4PX9A 3PUZA 2Q3FA 2NPIA 4URUR 3QKSA 3KQLA 5DYIA 1R4AA 1IXSB 2VSXA 1VECA 4JLNA 4D80A 2PZEA 1WE2A 2NMVA 1RIFA 4KODA 2IYVA 3A58B 1KDTA 1VG1A 4TZ6A 2CCJA 3GJ3A 3LW8A 3REFA 5KDLA 3F0TA 4W5JA 3NXSA 1J2JA 1P7CA 5CM8B 1G5PA 5TMPA 1W0JA 3CH5A 1GKIA 4LCBA 2GESA 3CF0A 1HQYE 4Q1FA 4DUGD 3PV0A 3IIKA 3HU3A 2ZI9A 2WSMA 4D81A 1Q1BA 1CJMA 4YC7A 5DSZA 1E0AA 1LNZA 2CMKA 3EIHA 3HPQA 4D4JA 3K53A 2FA9A 4R7ZA 2CHQA 2V54A 1ZNXA 1KKLA 3KZ1E 4YXWA 3OESA 3K09A 4AYTA 3THYB 4QJ4A 2DWQA 3RANA 1U8ZA 3MLEA 5TDHA 3C14C 4LJYA 3J81k 1Y63A 4MYTA 2ZYWX 5FUYA 2ODBA 1XPOA 1J90A 1WMSA 3BB4A 1Q1ZA 2ATVA 1VDZA 3LW7A 2FSGA 1WP9A 1SVSA 1E2EA 3RSLA 4F93B 4C2UA 3OIVA 2PMKA 2ORWA 4IKEA 2X1VA 2YC4C 3CKLA 2O8BB 1J8MF 2J59A 2RMKA 5DISB 4DSOA 4HB3A 2NOAA 1KO5A 2QPTA 1P4SA 3VAAA 4OHZA 1AS3A 4LUCA 4Q7JB 1C4OA 1MO6A 1D6JA 2R6GA 3NDBB 1AIPA 2ZRJA 4FCTA 5C18A 4QFMA 3QOFA 2RAPA 4KFSA 2D62A 3WP0A 4U00A 3UATA 3OF5A 3LWNA 2I4IA 4D6PA 2CL6X 2ZRBA 2GCPA 2GCOB 3OZXA 1N6HA 3OEHA 3R20A 4OHYA 1XEXB 1YZGA 1WBBA 1W46A 4OI4A 3LXRA 1ZM2A 1XRJA 5FOWA 2QRZA 4A6PA 4ASUA 4E09A 2IXFA 2FH5B 3FOZA 2PLRA 2IS1A 5EP4A 1OKKA 3B82A 3UKDA 1NBMA 1YZQA 3QUSA 2JIZA 1X8KA 4PC2A 1UKYA 5LB4A 3NHBA 4V0ME 4IRUB 5EZ6B 1SXJA 2FU5C 2WWYA 3QBTA 3QSYA 4Q66C 3CPEA 1ZVQA 4LJ5A 3VFDA 3FYHA 4UNSA 1E79D 1CU1A 3EIQA 2HXYA 4NYIQ 3ASYA 4DT1B 3P20A 3CH4B 1FNMA 4ZKDA 4NYMR 4QKQA 5J5CA 1TUIA 4TN1A 1TTTA 3FFBA 2OFWA 1Q44A 1D9ZA 2IL1A 4QC2A 2F1RA 1NKSA 3BXZA 4Q9JA 1HTWA 3SI7A 1ZD1A 1PLJA 4DIDA 3GJ5A 3K9LA 4E22A 5L3SB 4R71A 2XTNA 2ONJA 4EDHA 3MFYA 1BO6A 1QHSA 3K0CA 4BFYA 5JRJA 1Q1QA 3ZD6A 2FJUA 1DAHA 4D4KA 4CEIB 5FOUA 3PUVA 3THXA 2WSSD 1Q20A 2IX3A 2BJVA 3CONA 1SVIA 1KI2A 3DL0A 3HU2A 1FW6A 2GVDC 2QQ0A 4YQFA 1FUKA 3A4LA 1XFAA 1KIMA 3HR8A 3RS4A 4FWTA 1T3LA 2XITA 2QEQA 3KQNA 3KXLA 1Q57A 1ELOA 1NVVR 1TMKA 3T1QA 1VKJA 3IQWA 5G40A 5FPTA 2HCJB 3AVTA 4RZXA 4C7OB 3LLUA 5L3QB 1G9XA 4HZUB 2J0UB 2W6JD 1AKEA 4F91B 4TYPA 2W6ID 3VR3A 2Q21A 1GFIA 2ORVA 3L0PA 4P0TA 5KPJA 5G3YA 3U6KA 2O8EA 2BV3A 1XPUA 3BH6A 2OAP1 2XNDA 1P9WA 1ZMXA 3K70B 4M2LA 4C30A 3ONWA 2YC2C 4JIMA 4PZYA 2XOKD 4Y0VA 5F2EA 5TY0A 4KSCA 2IW3A 5JECA 3S1AB 4A6XA 2AX4A 3SNHA 4DHEA 3A37A 2QBYB 3ICQB 2H7VA 2X2FA 3KB1A 3W8NA 1OXSC 1XZPA 2TMKA 4BE7B 4QHSA 4EPWA 4GP7A 2BBTA 1E2HA 1MABB 2VSOA 3C5CA 4RSGA 3SDZA 1QDEA 1WBDA 4C0JA 5FBVB 1KDPA 4D4MA 1QG4A 1WXQA 4Q9IA 1T0JB 1CKEA 1S0UA 4UXJA 2C8VA 3RWOA 2ZRAA 2XJ4A 1W7AA 2FNAA 4FMDF 3THOA 1UKEA 4JL6A 3M1IA 4RCYA 2WIAA 3T5GA 2IHBA 1KI3A 1XD9A 2AKAB 1XCGB 1FP6A 3GLHE 2QPAA 4KFTA 2VLIA 1AJEA 1G7CA 3QY0A 2O0KA 4HDOB 1FMLA 2VHTA 1P9NA 3C15C 4XJXA 3ZVRA 1OJLA 4GBMA 4Q00A 4Q21A 1G7SA 3QEJA 4ZI3A 1KK1A 1IY1A 1D2NA 3W6OA 2WV9A 2BOVA 1ZP6A 4KAXA 1ZAKA 1E9RA 2F1HA 4B33A 3H86A 1U8YA 3K70C 3TUZC 1D2EA 3ND8A 2F43A 1KOFA 4PO1A 3TK1A 2AWNA 3B9QA 3SHWA 4TTPA 3GJ6A 2HF9A 1G7RA 4C2TA 2XB4A 4XSHA 3VNVA 2FOLA 3BFXA 3B1ZA 3QF4B 4B44A 5KTYA 4BASA 4IEEA 2VP5A 2ZR0A 4IOLA 1W48A 2L0XA 1P5ZB 1ZUIA 5DI3A 3EC2A 1NVXQ 4LHYA 2ZEJA 3RC3A 3TSZA 1KHTA 1FTSA 1OH7A 3GLIA 1HT1E 1BIFA 2AR7A 4OHVA 3HP1A 1J8YF 2BHRA 4I1OA 2ZSAA 4J0QA 5EZ5A 3T1VA 5EUQB 2EFDB 5HTKA 1ZNYA 4QBGB 4QGAA 1NMXA 3TUIC 1EXMA 3RS5A 1YVDA 2WJYA 1UF9A 1ZCAA 4B71A 3U3KA 1P2TA 2W83A 3ADKA 5JFGA 1E32A 2IA5A 3TR5A 4MH0R 2IYQA 4NDZA 1XTJA 1KMQA 1KDOA 1PUJA 2OXCA 1II0A 4E03A 4KFUA 3VR5A 4NMMA 5BQ5A 4XD7A 1U8AA 3FVQA 2Q9BA 1JALA 2HT6A 1ZBDA 2P65A 1MO3A 4GSYA 4C9BA 4LJ4A 4M1MA 1XXHE 4V0LA 1H8HD 3DHWC 2CCKA 3KTAB 3PENA 4HUTA 5JHHB 2P2LA 2O8BA 2ZJOA 4LJ9A 3KUDA 4Q4AB 5J4YA 2ASEA 2IK8A 1ODFA 3PJRA 2FF7A 1NF3A 1TL7C 3BWDD 4JSYA 2W58A 1R2QA 1JQLB 3K0EA 5BXQC 1N0UA 1ZC3A 1GZSA 1Q3HA 2G77B 1JECA 1OFUX 2J41A 2DFKB 1Z2CA 1E9BA 2GF0A 2OXRA 2WBLC 3RNLA 1JNYA 1LS1A 2GZDA 2G6BA 5L3VA 1GNQA 2OFOA 4PAOA 3T34A 2GCOA 1XNJA 4QXAA 1IOZA 1I4DD 2Z4RA 5L3RA 4AKIA 5K8UA 4LHWA 5D3QA 1XEXA 2ORIA 2IF2A 2NO7A 1SVOA 2CNWD 1PUIA 2EQBA 3LXXA 4A0GA 4CEHB 2AWOA 1OFTA 1U81A 2FZLA 4JLVA 3R8CA 4HLQB 1VIAA 4C0LA 1TQ4A 3OFNA 1VTKA 2XSZA 4RVCA 2G0TA 2Q3MA 1S1CA 4LJAA 1AGPA 4NL4H 2YWEA 3D6TB 4CVNA 3NG1A 4DCNA 2J3EA 2QTFA 1KAGA 4WZBE 2ZI3A 2IEYA 3WBJA 2I3BA 2WAXA 1N0WA 4MDFA 3RSOA 1W0JD 4B6FA 3QEOA 1G7TA 2F7SA 4M1OA 5B30A 3WYAA 4IOKA 4DT1A 5CITA 1KK0A 1U0LA 1E9AA 3DEFA 1TNDA 5ANRB 1G8YA 3TE6A 5AJZA 5EXTA 1M1YE 2P67A 2ZRIA 3EASA 4PTLA 2H57A 1HEIA 3TIFA 1GRRA 3O8RA 2K5UA 2XTMA 2BDTA 1YR6A 1EK0A 2JASA 4YXWD 5L3SA 1DEKA 5JJIA 4ZDJA 1R5OA 3IILA 4Q9KA 4XOIA 5G53C 3G0HA 1GRNA 3C5HA 1Z3IX 5AJWA 4CEIA 3DO6A 1CRPA 4L4UA 4Q4JA 5JLJA 2HLDA 2Z43A 4PAQA 4JL5A 4CIDA 2IYUA 4RFVA 3WYFA 2WKPA 2WKQA 1LVGA 3FMFA 5HZKA 1DO0A 1E2NA 4AYXA 3KJEA 4JVSB 2QMEA 4PHHA 4X8HA 1DE0A 1U94A 3W3ZB 1A7JA 4I81A 4WAUA 1G20E 2D2EA 4JYBA 3WP1B 2I1QA 4C7OA 1S4QA 4TL7A 5HCNA 1AN0A 3SBEA 3TH5A 2J0UA 5IT5A 1G4UR 1TF2A 4DC9A 5KSOA 1Z0DA 3BB1A 2CHGA 3QXCA 1OIXA 2VHQA 2WZQA 4NCNA 5AK0A 4G0NA 6Q21A 4RFSA 2QY9A 3IUYA 3REGA 5FBRB 5H1YA 3WMFA 4W9MC 3AVVA 4B32A 1JR3E 1ZJ6A 3CR7A 2F9MA 2WJVA 1AQUA 2GEDA 1SHKA 3OEHD 4WZAE 4FMCB 4XTCS 1KI9A 4HUQB 2PH1A 1NRJB 3K9HA 3VX4A 1NN5A 1UJ2A 4H9GA 3S1AA 2ZE5A 4BLPA 5AJVB 5CB8A 2QENA 1Z6AA 3HU1A 4Q1DA 4TMXA 1CF4A 4ASUD 2QBYA 3OIUA 2IF0A 5JEEA 1ZUHA 1G8FA 4URVR 3W6NA 4JKYA 1Z2AA 1OKKD 3ZZ0A 3TJZA 1MABA 2HF8A 4KYIB 1NBMD 2H17A 3VKGA 2NGRA 3CNOA 2CLSA 3PFIA 2JIZD 4AKEA 4KLNA 3UMFA 3UMSA 4RKFA 4RKEA 1SXJD 5BW8A 1NNEA 4L9WA 4WIAA 2WOOA 3QJYA 1HV8A 4BFSA 1I2MA 1MOZA 2J7KA 2DFNA 2RHDA 2RKOA 3QXHA 1ZC4A 4GI7A 3EPLA 2GJSA 2QAJA 5JCZA 3OE7A 5IDVA 3TMKA 4BRUA 4LYAA 4E5UA 5BN5A 4JLPA 1K8RA 2GJ9A 2WICA 1X1SA 3ZQ6A 4F92B 1UBGA 2CJWA 2QTVB 2RCNA 4TTQA 2O0HA 4F4CA 5C46F 5FBQB 4B3CA 1CP2A 2CE7A 1T0HB 3FDIA 2IYZA 2GZAA 3LDAA 3QPVA 2NTYC 2H16A 3VQTA 3X1YA 5KNBA 2HYDA 4HI0E 3GLGE 3AGPA 4JMPA 2BCGY 4EQ6B 2QRNA 2G9NA 1IY2A 4IJMA 5KUTA 1I4TD 1QF9A 2G1JA 3WXMA 1OW3B 3BAFA 2JLXA 5EE1A 3KJIA 1DADA 3VR6A 4QGHA 4TLBA 3LO5A 4IXNA 4K81B 1CJUC 2EYQA 2C95A 4TLAA 2B21A 4C0SA 1ZNWA 3FKSA 2QAGB 1G8PA 4IDHA 2HJGA 5AR1A 4IW3B 2KJQA 3R7WB 1T4GA 4QNMA 2V3CC 2VYFA 4BUJA 4H1VA 2NZ8A 2QSZA 3NBFA 4PANA 2RGNC 1E1RA 2GJKA 4MRNA 1XJQA 2WPDA 4ZO4A 1IONA 1PVOA 4CEJB 4II7A 5TARA 2YWHA 1B0UA 2XNDD 1HY3A 1YZUA 3KX2A 4LYFA 1G8GA 5AWFC 1P6XA 3LY5A 4GOJA 2ZI6A 4FWIB 3PUYA 2J1LA 3BB3A 1G41A 5DI9A 2EWVA 3IEVA 5E7JA 3LLMA 4CT4B 1US8B 4LBWA 4LBYA 5DNYB 3U44B 4F4JA 421PA 5GJVC 4B35A 2XZPA 2R6AA 2BCJQ 1OYWA 4Q4AA 4GFDA 1YZNA 3LQRA 4U7DA 1XEFA 1DBSA 3K0AA 3IBYA 3QXXA 3MD0A 4HSEA 4JZKA 1Z0AA 3T61A 1HE8B 1E2PA 5DO9A 2UKDA 1VCOA 2FMXA 1DS6A 5FL3A 1IBRA 1EFRA 2ZU6A 3QQ5A 2DFLA 2WJGA 4LV5B 2AKYA 4QBFA 5KOYA 2KWIA 2QAGC 3I73A 4X8OA 3PIRA 4IVRA 1Q1EA 2WJJA 2WWHA 5FPSA 1G5RA 1L4UA 5J47A 4CEHA 1JAHA 4K8OA 3C8UA 4MGIR 3RDPA 5DGXA 3A1UA 4TSFA 2JJ1D 4EJSA 5C4MA 2QQEA 1OXUA 1UPTA 1GITA 3BERA 3JVVA 3WMGA 2XEXA 2QSYA 4QOSA 3AF0A 3BH7A 2PCJA 5LPNA 1EESA 1HYQA 1ZYUA 2YYZA 2ZITA 1GIAA 3Q85A 2O52A 3L82B 3EARA 3B78A 2BMEA 5KYKA 2BMDA 3B13B 1P75A 4XIGS 3IPXA 4LYHA 3P1JA 1P73A 5CK4A 4HAYA 3RHFA 4BWYA 3OIYA 2ZQ5A 4CF7A 3AVXA 2EVWX 1NP6A 2DCUA 1G6OA 3CNLA 4NP6A 5EXPA 1EX6A 4OYHA 4I99A 2FPMA 3EW9A 3TAUA 2QTHA 1AS0A 1MO4A 3CF2A 5TXGA 1KDRA 3PR1A 5AUOB 3AP2A 1G19A 2DWOA 3CF6R 3FMPB 3SU8A 3CPHA 4HDCA 3DOEA 4JT4A 4RD4A 1RRPA 1ZRHA 1LW7A 1V5WA 2YOGA 5FPYA 2C9OA 1KAOA 1N3BA 4US1R 5CIWA 1NSFA 2JLZA 4BFTA 3E1SA 1M7GA 3LD9A 4FW9A 2VH5R 4XD7D 4UNNA 1JR6A 3R9XA 4BFWA 2KBFA 3F5FA 4KBFA 3VU9B 3OAAA 4LHVA 4YMTA 3CM0A 4MRPA 4IOMA 4O25A 1E9EA 1CR4A 4BZXA 3DZDA 3B1YA 5BN4A 1KSFX 5L8VA 1NY5A 2XX3A 3U2QA 3H4MA 2FZ4A 4TWZA 4MDEA 2UZIR 4QM7A 3LFUA 5E3HA 4HDQB 1VIYA 2ODWA 1NMZA 3WNCA 4HB4A 1NY6A 5GVSA 4BECA 4UXHA 5B58C 2P6RA 1E3MA 4N0DA 2FFAA 1XCPA 2W00A 3BGWA 4BLQA 1G291 3GLFE 4OQFA 1XMIA 1F2TB 2JAQA 3VTKA 2CVHA 4YMUA 2OZEA 3NHAA 2GXUA 3TUJC 3IKJA 4A15A 3MWYW 3X1XA 1DAMA 4LSGA 3NBYC 2IYRA 2A5DA 1WA5A 2C78A 4EPTA 3GFTA 1K5GA 1R0XA 2VEDA 3OFND 2CXXA 2J5XA 2XSZD 2OLKA 4NKRA 3VNUA 2PT5A 2RGCA 3K9NA 4NYJQ 4KCGA 2O8DB 3CUEF 3F3YA 1DG3A 3OEEA 2PCLA 5JJKA 2ZE8A 1LS6A 2QI9C 1W4RA 4YLGA 3UANA 3ZD7A 3QXJA 1TEVA 2VTKA 5GJWC 1A82A 2VHCA 2GVZC 4NCJA 4WZ6A 3FHTA 1M2OB 4HYYA 2WWGA 2BJWA 5EP3A 4B73A 2IXGA 3K0FB 1EFTA 2VF7A 3UMRA 1UKVY 4TMVA 1ESNA 2GJ8A 2J87A 2ZI4A 1P2UA 2ZR7A 3CRVA 1OB2A 3AVOA 3FMIA 1Z6YA 1ZM4A 4IDPA 1ZINA 2FPLA 2ZXUA 2B8WA 2Z4SA 1SVLA 4V0KA 3MSXA 3I61A 1KYIA 2Z5FA 3LBNA 1E1QA 3QVVA 3B1VA 5JS8A 2EFHB 2MMCA 2NQ2C 2HLDD 2AFIE 2ZE7A 4EQ6A 1MR3F 3LA6A 1U99A 1N5KA 3HYRA 1I2DA 4PPNA 3VR2A 2BMJA 2H92A 2VL7A 5AUQA 3TRFA 3DM5A 3AH8A 4PPQA 2A30A 1WDTA 1QHHB 3KJGA 4M1YA 5FH9A 3MJRA 3IEUA 3DOFA 1E2DA 4PSAA 1DAIA 2QAGA 1CR1A 1T8UA 3FGNA 3QKRA 1KO7A 1UM8A 4A92A 4DBLC 2C96A 3KL4A 5FBLB 2C03A 1JAIA 1D5CA 1IXRC 2G83A 1RVDA 2JJ2A 1DAGA 1KI8A 5FL7A 1OXVA 3VHLB 4CEJA 1V43A 1QHIA 2RHMA 3IHLA 2H8KA 1T5LA 4XTRA 1COWA 1E69A 2VP9A 3PEVA 5EE9A 5FFMA 5GJCA 4CW7A 1S3SA 4LY6A 3L0SA 3SFVA 4QGGA 5J4KA 2HXSA 1IY0A 3B7GA 4JJZA 1OFHA 2FFQA 2IS6A 4ITRC 1US8A 4KYUA 4PSVA 4Q1CA 4PHTA 4IDQA 1BKDR 4TTRA 4JLOA 4B48A 3U44A 2YKGA 4FD2A 1UFQA 5D3MB 3E2IA 4WXPA 2IYXA 1LF5A 3WNDA 1GG2A 4YMWA 2NO1A 3MWJA 2X2EA 1A2BA 4F4IA 3NEJA 3BD9A 2V6JA 1Q12A 5FOVA 2R65A 2QGNA 4MUAA 3ZH9B 4TMWA 3IO5A 3P4XA 4DRZA 3EA0A 4G5QA 4ACAA 4NPHA 1OH5A 3ZIAA 2RB4A 5IK2A 3OE7D 3NIBA 1M34E 3BFVA 2D3WA 3SJAA 4EPVA 3MG9A 1OLOA 1GSIA 2R44A 2D2FA 3I3SR 1RPZA 2XXAB 2W0MA 1IJEA 2UVQA 2YZ2A 5F9FA 4JL8A 3WBKA 1P60A 4NCHA 4PC3A 2KSQA 4B3XA 1KK3A 2FEOA 5JWRA 3KQUA 4EKDA 2D4HA 2GXQA 4I1VA 2ZRGA 1KMHB 1YR9A 3DKVA 1DTSA 5LD2B 4URYR 3UG6A 2QT1A 4TQAA 5JSZB 2GK6A 4MYHA 1T91A 1CR2A 1X86B 4W5HA 2ZETA 1IN4A 1EG7A 1EWQA 2BM0A 2VP0A 1L8QA 1UBFA 1XDBA 5HPYB 2GILA 2XJ9A 2DYKA 3NWJA 4PSKA 2GEUA 5CM9C 4RD6A 1XJCA 3EWSA 2IS2A 1M7BA 1F2UA 2ERXA 8OHMA 3L0OA 3RRNA 3U3OA 3SOPA 1NIJA 1CR0A 4W7SA 1G8HA 4PQYA 5FI0B 3FFAA 1U0JA 3THWB 2BBSA 4LV8B 1XX6A 4PPGA 1W44A 4PZLA 2QP4A 4QBHA 2WWFA 3FKSD 1W47A 3PUXA 2ZUBA 1R0ZA 2EFCB 1KSJA 2PZFA 4MRSA 1E99A 2V1XA 4PC7A 5DHAA 2W2VA 5KSYA 3QVUA 1E1RD 4Q4HB 5FOXA 2FDCA 2NIPA 1RFLA 2OCYC 2WPDD 2P3SA 1TX4B 3HYTA 1UDXA 3Q7QA 4HLUC 1II9A 2B92A 5FR1A 3ZQJA 4Q02A 1XU4A 4KBGA 2V9PA 4TLCA 1AQYA 5EUMA 3I32A 1YZTA 1N6OA 1Z28A 2FGJA 1E6CA 4B3BA 4BGDA 3PEWA 3GLHB 2VRWA 4GMXA 4ZDWA 3R8FA 2CEAA 3I92A 3WHKA 2QT0A 2C04A 5LD2C 4B3GA 1E2GA 1CLUA 2PT7A 4MGKR 3UXMA 3U60B 3MAAC 1CRQA 2OV2A 3ADBA 2ZRLA 4TL6A 3U7EB 1K5DA 4GNKA 3THYA 3LAWA 4NYMQ 2G0NA 1E0SA 4L8GA 3C7KA 4ON9A 1JPNA 5FUXA 4F7WA 1SGWA 2IUTA 5J4LA 2A78A 4KFRA 1T8TA 4NCIA 4A1FA 3VKHA 3C41J 1EFRD 4TMTA 3U3RA 1F2TA 2OESA 1JXMA 2QZ4A 1OXTA 4PZZA 4Z54A 1MKYA 2EFEB 2ZAMA 1U0HC 4IFEA 4LBZA 1UADA 2OE2A 2IC5A 4TT3A 4ZI2A 3GJ0A 3PG5A 4BEBA 4HLDA 4U02A 1W2HA 1OSNA 4TSFD 3CRW1 2IBMA 3AKDA 3KXIA 3GFOA 4R2HA 2ZUDA 2QMOA 3X1DA 2O8DA 1NVVQ 2X77A 1KO8A 4AWXA 1C9KA 4BLRA 1EFCA 2IXEA 4V0OA 1N6PA 2LCFA 3M6AA 4XVUA 2REBA 4GOKA 4DLZA 4Q9LA 5KNCA 4RD3A 1VPLA 3CWZA 3FKQA 1CULC 4DWJA 4JLMA 5HE8A 5TVKA 3DZ8A 4O2LA 4KVGA 3MJHA 5H8WA 4DKXA 3U3JA 4DSTA 4GT1A 3QKUA 4BEJA 1L4YA 2G88A 4KU4A 4A2PA 1E9DA 1G4AE 1Z5ZA 3IBGA 1XXHB 2PZGA 2WHXA 4AG5A 3HWSA 3QG5A 1E9FA 3BJIC 1N6KA 3IIJA 4GZLA 2G3YA 3LV8A 1Z22A 4M1TA 1A1VA 2ATXA 1S9HA 3U7FB 1YE8A 5EE3A 3I5YA 4A8JB 3T1TA 3GMTA 2FEMA 4AG6A 1Z6TA 2AK2A 2FG5A 1EWRA 4DCVA 2XB2A 2G1KA 3JZMA 1BMFA 3MCAA 3QG1A 5CLQA 1KY3A 3BE4A 3LVRE 4JLBA 1MRSA 2KB0A 5FPHA 3B8HA 4I1UA 2ZSDA 2WVJA 1FOEB 1R8SA 2D74A 3GP8A 1XCMA 1D2MA 5EP2A 2GJAA 1XMJA 4ZCMA 3O8CA 3OAAD 2ZU0C 2QUZA 4UNPA 3GPLA 3H84A 3A8TA 3IPYA 1N6IA 2YHSA 2Z6VA 3K1JA 3M4YA 3NC0C 1QHHA 2QG6A 3CPJB 3KKOA 5CJ2A 3SZRA 1Q3TA 1KZGB 4TYYA 3CIOA 4TQ9A 4N0EA 1N6NA 4KXFB 2Q6TA 1R8QA 4PQRA 1M7HA 3GEEA 2OT3B 1P72A 2YINC 1QHNA 4URWR 4URXR 3W90A 1ZIOA 2ZREA 5TB5A 3JVUA 4FI3C 4M1KA 1PLKA 2ZS9A 4V0MA 2J46A 4QL3A 5J40A 2F55A 4NONA 3R9WA 4NBSA 5CB6A 3BS4A 5E7IA 4RD0A 5EP1A 1GL9B 1U98A 3ND9A 4D0GA 1G3RA 4FN5A 3PEYA 1OXXK 4NCKA 3QPUA 5KSZA 1VG9B 2PL3A 3WYGA 1YZLA 4QGFA 3KUCA 2EU8A 1LF0A 2CE2X 2IUSA 3IIMA 4ILEA 4V03A 4Q1BA 4A8JC 4CYMA 5L3QA 1TU4A 3B5JA 3DMNA 1OV4A 3D8BA 4HZUA 2NZJA 1G3IA 1E79A 4DEXA 1SHZA 4QHTA 2QGZA 5LB2A 3LBHA 5D3MA 5KNDA 2JLRA 3AV0B 1CJVC 3JZAA 3OIWA 3OEED 3ZVLA 1NKTA 2ZR9A 3SC3A 3VMFA 3D31A 3AF1A 1F6BA 1GDDA 5EXSA 4MGZR 1E0JA 2JLWA 1A4RA 1WRBA 4G5SA 1Z6XA 1XD8A 5BYJA 4AK9A 2OM2A 2YVUA 3K0SA 4PXAA 4OQNA 2IT1A 3CX7A 2EW1A 4KITB 3RAPR 2CHVA 1T9HA 2AD5A 4HLUA 1IN6A 2B8TA 5KDDA 4BRWA 1LV7A 3DPUA 1P2VA 3L8ZA 4BLTA 4ZV4A 2A5FA 1N5LA 2NG1A 4M22A 1KJZA 1FZQA 1ZCBA 1EX7A 2HDNB 3TLXA 2H5EA 3AVYA 2F3TA 4BFVA 1GM5A 1KMHA 1G3QA 1KNXA 2Z83A 2ZI7A 4L16A 1ZW6A 3X2SA 4D0NA 4DDVA 5JSZA 2P6NA 4RD2A 521PA 3AUXA 3ETLA 2N46A 1E1QD 3BBPA 4G5OA 2ZE6A 1NBME 2ZS7A 2REOA 2SHKA 4OK3A 4Q48A 4B34A 4LK2A 1S2MA 3EZ7A 3CX8A 1XTSA 2I1VB 4G3XA 3U61B 1BS1A 5G41A 5E4FA 4D26A 2GHIA 3SJBA 2W6JA 2RGGA 2CLCX 2OBNA 2WMNB 4DLXA 3GJ7A 1SXJE 1RE0A 5H70A 1XP8A 1W36B 1W1WA 3EPHA 1F60A 2GBLC 3THWA 4EFLA 3V4RA 1IM2A 4UQOA 1OE0A 4P4SB 4FMCF 1UEIA 4D82A 2R6DA 1CJTC 2ZJBA 4QRHA 3X1ZA 1GKYA 3ZS9A 2F3RA 3CWQA 4RCZA 1MRNA 2WMOB 2QMHA 3V00A 2JJ2D 5FL7D 3QF4A 2PX3A 1S1MA 4NTZA 4C3ZA 2E9SA 2VSFA 1COWD 1SKQA 4HAZA 1WCV1 3V4FA 3Q7PA 1W4AA 4RZUA 1G6HA 4TZ0A 4DSNA 1CIPA 4DDTA 3GLHA 2CBZA 4NU0A 4ZPXA 3GQBA 2JCSA 2IUUA 1SXJB 5AJXA 1CS4C 4UKDA 1DO2A 3PUWA 1FQJA 3CNNA 3QENA 1E0KA 3BK7A 1VG8A 1XZQA 4P33A 4RJLA 2D7CA 3TBKA 2A5YB 3Q9LA 4DLUA 4GOXA 5FBWB 1IXZA 5E7MA 1FUUA 1JEEA 2EYUA 1X6VA 2RGEA 4A9AA 1RZ3A 1EGAA 4EPXA 4YMVA 3UG7A 1CEEA 1RJ9B 2BM1A 3CR8A 3QPWA 4JBWA 2GNOA 1W36C 1HT2E 1SVKA 3N2IA 5LBIA 3GLGB 1W4BA 3OHMA 4Q7MB 2GKSA 3EXAA 4MITA 2BC9A 1E2IA 3T12A 2LKCA 4ZIRB 2DB3A 1AGRA 4LX0A 1ZU4A 2J45A 3ZIAD 2V55B 3LQQA 4US0R 1P2SA 2ZJ5A 4JT2A 1JB1A 1EFUA 2FWRA 3I72A 3KTAA 1GKUB 1E96A 2WOJA 4LDJA 4B47A 2GTPA 5IRCD 1U90A 4X8LA 3UPUA 2QM8A 1YRAA 3B2EA 4C0BA 2ZSEA 2ZI5A 3CBQA 4QHYA 5A5GA 3AVPA 4DDWA 3BOSA 5ELXA 2GETA 3LVQE 2MSEB 1OIVA 3CRQA 3U5ZB 2E1RA 1HUQA 3WY9A 4B74A 4D0LB 2JA1A 5DE3A 3SYKA 3TAHA 3TW4A 1YZKA 1SXJC 1OH8A 4HB2A 5FOSA 5TV2A 1W2GA 1Z6GA 1RW4A 3BIFA 4AKHA 5CJPA 3NTUA 1OYYA 4DLYA 3RRMA 2C5LA 4OI1A 3RRZA 1NIPA 3AVQA 2P6UA 3CLVA 2OCAA 2QM7A 4NZYA 2GCNA 2N42A 5M04A 2JLVA 5KDOA 1XXHA 4BPBA 1DARA 1PLLA 1ZU5A 4C0HA 2JDIA 1R6BX 5KU1A 4PPFA 3RS7A 1XD2B 4OJKA 5J4HA 3U6BA 4Q7LA 4BQSA 5FR2A 4ACBA 4JKIA 3B6EA 4A8JA 1VCIA 2Q9AA 4TYWA 4IVPA 1UEJA 3A1WA 1KSHA 3CB4A 1GL6A 3QE0A 1NLYA 2BEJA 2IYLD 4HLCA 5H68A 2GAOA 1XF9A 2XNSA 4NYIR 5E95A 2GK7A 5C2JB 4GRAA
chains in the Genus database with same CATH superfamily
1DEAA 4DLAA 1IAQA 3I1FA 4ZP1A 4J0CA 4YT4A 2OV1A 1I7NA 2C4WA 2C61A 4MKXA 3WA7A 2GXSA 3LUHA 1V41E 2ZSBA 3RJ5A 4BNNA 1MV5A 1KQGA 1UAAA 1RWQA 3GA7A 2CCGA 1F4LA 3CLSD 1PFUA 2H0AA 3QMWA 4UPEA 3GEGA 3PBKA 2A9VA 1XPRA 1G1MA 1NPTO 5GIPE 5LP6B 3A3KA 5F78A 4MVJH 2CY0A 2HQ1A 3NKVA 5C9ZA 2RBKA 3ZZMA 2CXRA 3C2QA 5LOVB 1Y8AA 3B36A 3V7YA 4UVHA 1DC3A 1EXVA 1GCGA 1PS9A 2IPXA 5JO0A 2OFXA 1GRQA 1Z26A 3ZYCA 2A5LA 2X3UA 3F5QA 3LCRA 3D1VA 4G5GA 4KXVA 1O6GA 1NQXA 1RHMA 4ME6A 4D9IA 1SG0A 2WQ7A 2V7XA 2F43B 5DLEA 4LRTB 1BXRA 4NATA 1KOLA 1NYTA 2PPLA 2ODAA 3HA7A 4WOKA 4UQPA 1F20A 5FAXA 5CBPB 3PWSA 3VZQA 5D5PA 3IMKA 4W6ZA 5FDFA 3IDFA 4HV4A 1NJSA 1GZVA 4IZIA 1LBIA 1EHIA 3E9MA 1JYEA 4MW4A 4R0NA 4LTDA 3U7GA 3VYWA 2ORED 3L4BC 1WV1A 1DJOA 4XZ3A 2OQIA 3NBMA 5AJTA 5JH7B 4O1MA 4UXIA 5DI3B 4EYEA 5AHKA 3QE2A 1EX1A 2KI5A 3LUDA 3WFIA 2C94A 3ENKA 3GLIB 3ICCA 1YDHA 3LX5A 1EMDA 1DCMA 2P2SA 3ACCA 2V0GA 3DKIA 4CV1A 4LV6A 5JRDS 1Z45A 3IAM6 3NYRA 3FB4A 3U3MA 2VDVE 1W88B 4OHBA 3ZD9A 1H2RS 2A2ZA 5B57C 3MRSA 3JARB 3RS0A 2CK3A 4QQFA 2MTBA 2TMDA 4G5RA 4LVUA 4UDOA 1YS9A 3ROGA 2WTNA 1X7GA 2C07A 4GUAA 4B17A 1Z4KA 5IJZA 2FVYA 2ZJAA 4FCWA 1MXFA 2F62A 3HKBA 1AK2A 1JE0A 1V1MA 2BFMA 2MYTA 3ENWA 2GPWA 4C4RA 1JZSA 1ZM3A 3HS3A 1SKYE 1YU9A 3E81A 1AZSC 1HLGA 3NOOA 1KI4A 2QI9F 1L5KA 5K9ZA 1O97D 3WGIA 2LIPA 3M8KA 3QA9A 2VK2A 2RBEA 3OCWA 4F9TA 5JPDA 2H65A 1UKZA 2B37A 3L6UA 3ZWCA 2NT3A 4W5WA 1HRKA 1N7IA 2O3QA 2H1CA 3MC1A 2BM8A 1BMFD 3DL4A 4Q1AA 1CEXA 1CWUA 3RFUA 2GAIA 1G3UA 2WIBA 2Q27A 3IAAA 3TR6A 3S5JA 3V46A 4CKBB 3N0VA 5DLQC 4N48A 5F73A 5B4VA 2DY1A 4F38A 3H13A 3HEBA 3N7AA 1AQNA 1X14A 3CVOA 4NHOA 3FFTA 1KAQA 3MQ4A 3UJ8A 4A2QA 1R7RA 3C3BA 1QYIA 2AA3A 1U4NA 3BXEA 4QXRA 3QPBA 4IJVA 3WJAA 1O3YA 4AI6A 1XLTA 3QF7A 5IH7A 4FINA 2IDJA 2O8FB 3NVAA 5B2ZA 3OD5A 2HRCA 1M0SA 3AEZA 2C4KA 4BFUA 1OPXA 2O1XA 3EWNA 3OBBA 4P4TA 3PXDA 1PSZA 3MPUA 1XTZA 1KKMA 1SVMA 2OG2A 3BMXA 3LQKA 3R9IA 3RAJA 4ENRA 3V97A 2JFNA 3BE8A 1ZA1A 3LNTA 2V1UA 2OBLA 4RTLA 1TTQB 2CLIB 1KR2A 1TK9A 1JMKC 5LU9A 5CEEA 1TC2A 1PX2A 2P2ZA 4QFBA 3K3PA 4IEFB 1D4OA 1TMYA 4U7FA 4CCYA 3DBRB 2FI1A 2OZVA 5F76A 3KOYA 3LYHA 1XUOA 3IAXA 5A6SA 1Z0JA 1MH1A 4QPPA 2FDRA 4GMDA 1QQBA 1JHOA 1K66A 1DKLA 5KNDD 2AOUB 4LRWA 3WSWA 1H2BA 4DR7B 5K6AA 2GPBA 2OCBA 4M36A 2HPVA 4UUAA 1W49A 4GX2A 1DWOA 2VNSA 3K0HA 4AURA 3ZCSA 1BJTA 1E2LA 2AG0A 4GPD1 1DC8A 2QNBA 2KS6A 1Y9JA 2I67A 2FPIB 3FX2A 2R25B 1BYIA 4I4LA 2OHFA 5E2BA 1TZ2A 3ZK7A 1PTJC 4FOOA 3SS8A 3DM9B 3IJEB 1TC1A 2AFIB 2QU8A 4H27A 1G18A 4QIHA 4BJ1A 4EKIA 2ZSKA 3BQMB 4Y2GA 1V7ZA 4ZIRA 1SULA 2A9KA 5C1PA 1IK4A 3DKPA 5DKFA 5F2KA 4NBTA 3I8XA 4DQUA 5JI2E 1JXOA 2BN4A 3QNUA 4QG3A 4JVLA 1GGFA 2DFDA 5BORA 1JJVA 3W2EA 4C4OA 4DYHA 4MMZB 3P8ZA 4IGAA 3RWMB 2HQSA 4GMGA 4MQMA 3LVFO 3VHXA 3I01A 4D9CA 2I3AA 3QVSA 2IXAA 2UUPA 4HNHA 3KJZA 2CHEA 2VJYA 4TLEA 5BWOA 1DINA 4G0MA 5TF4A 2ZIAA 3N2LA 3T15A 3DLAA 4OQMA 4KPUB 1TRHA 3S7TA 1LFAA 2EFGA 3F1KA 2I6FA 1HYGA 3KKLA 3LNCA 4EABA 1EM8B 2D3TA 4QA9A 4FXOA 5FO1A 4E5MA 3O7WA 2VP2A 1VHTA 2WUWE 2PH5A 3BMNA 3D7SA 3G8YA 1I8TA 4FMDB 4GI3A 3T7RA 1N2JA 3DBLA 4G1UC 4OHXA 1H85A 5DBOA 1YJQA 5CDHA 2VR1A 3LHFA 4XQ0A 3N8DA 3JD0A 2WB4A 1W6RA 4BO6A 3OI7A 1ZGZA 3F97A 1U3VA 5HSGA 3WKEA 3ZI4A 1KJIA 3C8ZA 1BQ3A 2ZSHA 2VLBA 4GVLA 1MVLA 1XZBA 4RFSB 1OB5A 2ICAA 1V7CA 1S96A 5K0NA 3GJ4A 3S68A 3GT3A 1U4OA 1T3SA 3EZNA 1F0YA 1DCTA 1K7EB 4NI5A 4OK5A 3O8QB 1E66A 2BFOA 2IWRA 4ZI3A 1HT0A 2C77A 2C2YA 1M2VA 2J0VA 3EQ7A 3ZDQA 2X8BA 1PJ8A 3UCXA 1EXWA 1YR8A 1R6UA 1PKEA 1GUYA 1PRYA 2W8ZA 3L04A 4HXEB 4PZDA 3H87A 5DV9A 1WKVA 3ANSA 2JZOA 3A4YA 1JA1A 4YGXB 2Q5JA 3ZWYA 2QVZX 3O31A 3C3KA 3PC2A 2IZ5A 4BCDA 4E09A 3ZKAA 2IH4A 1RPTA 4R9VA 4ZI7B 3MILA 1MC8A 4XGIA 1WQ4A 4ZOLA 3AF4A 1SOMA 3L4BA 2ZYVX 5AM0A 5FPKA 5SYMA 3RYTC 1QORA 1TQ2A 4HH1A 4BTVA 3L8YA 4ZZ2A 2BEUA 2C2WA 2WJ3A 2EKLA 1OMOA 2EX4A 5JW6A 3RRJA 1KY2A 3Q72A 4OQLA 2CSXA 1P5FA 3EC1A 3KXPA 3PYXA 4HNGA 3RU2A 1EBUA 3RQIA 1KVQA 1RHRA 3GU3A 2FFBA 3U62A 2X1LA 3FPAA 4B43A 2O1SA 2OAGA 4GSLA 1YJ8A 4NEGA 2YHAA 1E2JA 3BL5A 4D1YA 5ED4A 2BF7A 4G01B 3FBGA 4KFCA 6ABPA 1T2UA 3OWXA 4PLFA 5LDGA 1RD4A 2EATA 2E4YA 5IYZB 4ZOQI 2I7DA 2XE8A 4NFHA 1ESZA 4NOMA 2Q6KA 3CXUA 4YJ2F 4ALIA 1S3GA 2Z98A 1WMAA 1QCYA 2R1TB 4N0QA 2YHIA 3D54D 2YBDA 3T3PB 3TB6A 5CFPA 4YCJA 3T1OA 3AP3A 2CWWA 4JEUA 5H9VA 5U1PA 3TJRA 1NNLA 4ZU3A 1EPUA 3UK1A 2NU8B 3U4MA 2VQSA 1TYDE 1DNPA 1GTG1 3BTOA 3C45A 1A2OA 4UDYX 1D6MA 1PV4A 1KORA 2JJ1A 1S8FA 2G40A 1QFMA 1KDZA 4AD8A 4W7IA 3WIUA 4OXRA 4EB3A 4DY6A 1E4OA 3SZUA 3MIZA 1Z47A 3W7VA 4JR1A 1R64A 1P61B 2EHDA 3C3MA 1DKQA 3ZD8A 4DQXA 5HIKA 3U4QB 3AFNA 3WDKA 2C5SA 3QVMA 3ZJ5A 1OWLA 1DB3A 4Y6QA 1NZFA 3G59A 1JI0A 4QRDA 1TK3A 4U2BA 1PR3A 1IZZA 4J0FA 1A5SB 3KWMA 2FAXA 4GI2A 1MMFB 3NEYA 1U2SA 5ALEA 1HG1A 4CM3A 2VNHA 3CFYA 3KKNA 2DHDA 4NY1A 3TZEA 2WF5A 3IAS6 2XCUA 4HBZA 2MINB 2H7XA 1MV8A 2QM0A 3JQFC 3LTNC 5EWJA 2Y8EA 2CLKB 1IB0A 1I1OA 3AM3A 1YL6A 3B20A 4L76A 5SZKB 1AS2A 1BROA 4E6EA 5CLJA 1QB7A 2UZ3A 3BH0A 1DAFA 3O8DA 3KDAA 2ZVQX 4LRQA 3I9NA 3WJ2A 3A6KA 3UMVA 1MGOA 2FP4B 3DF9A 2I4MA 3E84A 1GA1A 5HMMA 2LCQA 3ZGZA 3EFEA 1SBTA 4LI3X 4KBYA 4N39A 1P29A 2YNMA 1Z8FA 2QJWA 3NBZC 5K8LA 1E2FA 1WWKA 5D86A 2QROA 4S0ZA 1N0VC 2WKWA 2JDID 2Z9BA 4MUBA 4C4AA 2RHCA 4NRDA 4S2EA 5JNUA 1ZR2A 3PKJA 3ADOA 4D42A 1XA4A 2PKXA 2VAXA 3QIVA 5DASA 4EI7A 2OD2A 4RD1A 2P1ZA 1HLFA 2PRIA 2DBZA 2IIBA 1JQ5A 3TVYA 5KNBH 1GSOA 4M83A 4BWGA 4JB8A 1W96A 1RLMA 4WA7A 2J32A 3OC0A 4FFWA 3NHKA 4HDKA 4DVGA 2QVXX 1YJBA 1B43A 1B8PA 1NVUQ 4KVAA 1AZWA 2OHXA 2B7BA 2CVFA 3C6QA 3A14A 3CZ4A 4XGNA 2HMUA 4OAQA 1M8FA 1ZGBA 3CKKA 2XYVA 4OIMA 4ZTBA 4MVJP 1ZUNB 3HJGA 3RGGA 4OI2A 1M2OA 3MK31 1P1HA 4BLOA 5E8RA 1ANKA 1OTHA 2J0SA 1FDIA 4KVZA 4BNWA 3W6PA 4K05A 5JMPA 5TPZA 4C0QC 1KF0A 3H2YA 2IYEA 1XTUA 3S70A 4EIWA 1NVEA 4O4HA 1YA4A 3PCTA 5A5DA 4LGMA 1PTJA 3SCZA 5TRTA 4FVTA 4MRMA 3ANNA 3MXOA 2FZVA 2FTKE 4KMMA 4RWEA 5EY5B 2YWGA 4OHWA 3I2GA 5HQJA 2ODEA 4TYMA 4UEWA 3ULKA 1NFQA 3N7UA 4IFBA 1L0BA 1FUEA 4R41A 1K2VN 2UDPA 1U63A 2O8CA 2YVKA 3V1UA 1FFSA 3EZ6A 2QN2A 5E2AA 3TGPA 2YJ3A 1WPQA 5HWSA 3DLBA 4E30A 1P7WA 4MJ7A 3ZGLA 1GGNA 3QKTA 2V8OA 4HUJA 4PAWA 4UBMA 2D13A 4X3CA 1BKYA 1YRLA 3JQ7B 5I9MA 2OHVA 3D3WB 1U7HA 3W77A 4L5AA 1RMTA 4BBPA 5AVQA 3N59A 2XNKA 5DVZA 2BGIA 4DM7A 2YDYA 5B3LA 3B1WA 4MAAA 9ATCA 3L92A 1IZ8A 1GGJA 4FLEA 2J07A 2Y76A 3M6FA 1TUEA 2CVPA 4X71A 4ZARA 3EPJA 3JAWB 1LLUA 3CRMA 1NJ6A 3KVRA 3SHVA 2GN9A 2JLBA 4P38A 5IJ0A 4DRXB 1F17A 4HQ6A 4XLZA 2HFJA 3SS9X 4EG6A 3F4BA 3G8CA 5EJ9A 1X8LA 2P6OA 1TQDA 2FX3A 1BOFA 1HE2A 1P8JA 4ESHA 5EJ4A 1B23P 2R6HA 2G9VA 1U8CB 1F9EA 1T9DA 2UZ4A 2ZFUA 4AUEA 1GSHA 3FDXA 1ZEMA 4C0WA 3LC0A 4OHFA 3JATA 4FLMA 4LOIA 3LWZA 1MFPA 4J0IA 4Q47A 1ZIPA 2JFFA 1CQWA 3O3CA 3SYMA 4DLWA 3S2ZA 3O1LA 4WI1A 5JATA 3AQ4A 1SKAA 2CK3D 3BAZA 4K87A 4XWOA 1KOGA 1N9ZA 3QW4B 3ZCUA 1GNPA 3PDIB 4IL5A 1NXWA 1SU7A 4B76A 1ODSA 4ALNA 3EQZA 1Y8RA 3KZCA 1UJCA 1C1DA 4QELA 1L5HA 1KL7A 3HEAA 1J7JA 3UK0A 1C8BA 1GFSA 5CUQA 4JUIA 3WGUA 2FSHA 1OILA 5IAAA 3HJUA 4WNYA 4UNRA 3KEFA 1F8YA 1JDPA 1KI1A 2OCGA 4L78A 1MDBA 4QYXA 1U65A 1QOPB 2QD1A 2PK3A 2R9VA 4FNOA 3RLIA 5LQKA 2F1KA 2MR5A 3OECA 5ECGC 3U7HB 1FDUA 4DCSA 1KYWA 3PGKA 4YRSA 1PYDA 4H17A 1A9YA 3I9V1 1N7HA 1Y8CA 4Q3LA 3KQKA 1KAHA 1L4BA 3LUFA 1WW2A 4BLUA 2ABWA 2C98A 4TYNA 1IN7A 1C1XB 5L4SA 4MLPA 2CGEA 3OOWA 3RFTA 3FBTA 1OLUA 3H9BA 4UVEA 4DWVA 5FTJA 2GD6A 1X3SA 2YJ6A 2EGGA 3GEHA 3RYIA 3F5SA 1IH8A 4QXPA 1NI5A 3DUFA 1UBKS 3IJRA 5A5EA 2OV6A 5LYJB 3HJCA 2TECE 1F5NA 3KTDA 5JCJA 5JS7A 2OZLA 3ZE8A 1K27A 3G0GA 4PG4A 3AF3A 5HJ7A 5B2EA 4CKZA 1BAPA 2X5JO 3LK6A 4GQBA 3KKPA 3OX2A 1L5WA 4MQ6A 5CYFA 4QYSA 1BMTA 2R2AA 4B75A 3QVGA 1G63A 4IWYA 3QPAA 4WN3A 2VF5X 4DKJA 3BBLA 1FU7A 2IYYA 1DOAA 4K88A 2RE8A 2VDNB 4M9XA 1HDZA 1B8OA 1NRIA 3LP5A 3DVAA 4B7CA 4LYJA 4CIVA 2VN8A 2QD2A 2UUAB 4PQFA 3GCDA 3T3IA 4KOAA 1BH2A 3FWYA 2YVLA 3H0KA 2CLDX 1CX9B 3EXFB 3L7JA 4YBRA 3JQFA 1DKNA 3FTQA 4ND2A 1EJ6A 1KTVA 1EE1A 1P80A 2FE1A 1Y4UA 2ZJ4A 3AKCA 1D0SA 4O1HA 3RGWS 1FBTA 3C6BA 2O05A 4P0QB 2YWRA 1SEPA 1C1YA 3OP1A 3IRVA 3P2IA 4J0JA 2WABA 4TV8B 3CRRA 3ORRA 4FXPA 4CLXA 4OI0A 3K09C 3H5OA 4GHWA 4IH9A 3GRAA 5AI5A 1O08A 1W4ZA 1G2PA 3K8QA 2ZRHA 3TJMA 1QVAA 3CZMA 3W8DA 2VJBA 1NL3A 5ERYA 2PWBA 3EF1A 7AT1A 4KI7A 2ZJYA 1PFVA 1SXGA 3AK4A 2V6IA 4ZVMA 3QWAA 1GOTA 3P2YA 2NPFA 1W5SA 5B1IA 2O7SA 1SOVA 3CCCA 1E1DA 2WJIA 3BRQA 1NLMA 1P1RA 3KT8A 3QIAA 4OYRA 2RG1A 5A3VA 4CQLB 4Q4LA 2QA5A 4Z49A 2L19A 1N8NA 1KFJB 3JZFA 4MS3A 1ZO8A 4HCJA 5IARA 4ER5A 2ZBFA 4TM8A 3X1WA 2VF8A 4IAOA 2BTEA 2OCPA 4L22A 3UOAB 1QIJA 2CXPA 4WKCA 1F48A 1IN8A 2YWFA 2ZS8A 3H9EO 4HDAA 3KWLA 3PKZA 5CNKA 5BRJA 2YIVX 1GUBA 1CUHA 1NHGA 2HJSA 1PR5A 3IVXA 2PM8A 4RKRA 3G0OA 4C04A 2PL1A 4YP9A 3TSOA 1RC8A 1QRSA 5JIBA 221PA 2BKAA 1Q0UA 3MLAA 2VPYA 2H9YA 3HCAA 3RRYA 4YMLA 3BTSA 3IMCA 4CMCA 1ZCJA 3NONA 3NAQA 3OP4A 4FS8A 5HMLA 1SH7A 2FR8C 1IQPA 3F2IA 1MAAA 2BUBA 1FX0A 4FGLA 2NUPB 3N2GA 3NT5A 1KO4A 3SEFA 2O2HA 4RZHA 3VISA 4DCMA 1HE1C 2BKEA 4HADA 4KLZA 2Z3VA 3NTRA 1LKZA 1XTQA 4NE2A 3TKLA 4QOIA 1KAMA 1T24A 4ZN6A 1M83A 4I19A 4TKVA 4AN0A 4P82A 3HBJA 4N3NA 5J2UB 3VNRA 3NANA 1F3OA 4NK4A 4P8RA 5HIAA 4U2DA 4B9EA 2SECE 4K9DA 2P9FA 2R7NA 3HYCA 3ZDXB 6GPBA 2VSNA 4LZZA 1GAXA 4AM8A 4ZTZB 2HA2A 1XDSA 3CCBA 4GM4A 4U4AA 1A5AB 3AX6A 4Y2XA 4IOJA 4CKEB 2PUEA 5CA0B 1FX1A 1P18A 3G2NA 4C0KA 3CV3A 4XWAA 1U2QA 3RPEA 3SE0A 1VL8A 2B25A 3CXRA 5KQPA 5EJ2A 3HUUA 4UJ3A 5IJ9A 1UQTA 5J43A 3OZCA 1IWBB 3VOBA 3TW8B 2X19A 4GEKA 4IMJB 2FVXA 2W4IA 3K9QO 3HZZA 5AKXA 1JDBC 5GAJA 4M89A 3ZHVA 4M9QA 2G09A 3CO0S 4QT0A 3LY8A 2B69A 2ZYGA 3KPVA 4M21A 1LPOA 4PFSA 4XRRA 4PBRA 2HB6A 3USES 4JITA 7REQB 4RPGA 1JXAA 3KHTA 4HT3B 3AL3A 2BI4A 3L7IA 4LXXA 4O6VA 5DTMA 4Y9DA 4Q18A 3EMBA 2WWXA 3VYVA 2IS4A 2Q7OE 2Y2UA 4UTOA 4B6OA 2CV0A 4IDCA 4KE9A 2KE5A 2RCYA 4X97A 4DMLA 3U48A 3EY9A 3AY7A 3T0IA 2Z8YM 3PXXA 5JI3E 5IP5A 2NAFA 4NIMA 5ALIA 1EE9A 4OOEA 3K9GA 2QYOA 1VM6A 4OQDA 2NZXA 2O07A 2TYSB 1U5BB 1RRVA 3OHSX 4JX8A 4O08A 1PEAA 2GD0A 2H08A 4NCAA 4GL2A 2GEVA 4EUNA 4KSBA 2Y0EA 4JBIA 3CJRA 4ARBA 3RS3A 1TI7A 1ZI9A 2CT8A 2WDZA 3FJ1A 2EV9A 2XCLA 3I53A 2QXYA 1N25A 2DF8A 4XA8A 1PI3A 1NN0A 4RMGA 2P4QA 3HC7A 4KZPA 4ZZ3A 4YQYA 4MTCA 3FW1A 4TPKA 4EGFA 1IOLA 2EJTA 2I66A 3VNAA 2VPQA 4KIUA 3UH1A 5LMUB 4CTKA 4CM7A 2CYCA 2DPXA 1K08A 4MRVA 3JQ8A 2EJUA 2LWIA 5K6TA 4N18A 1NG1A 4C4PA 2F8MA 1MQ8B 4FYVA 3PUJA 4IDNA 2BEKA 5EKXA 5FB3A 3TVDA 4EKEA 1J8DA 3U17A 1F6WA 4QU9A 1E2MA 1VYTA 5JNTA 3DVSX 3U3ZA 4JQSA 3FYTA 2WJHA 4ZO7A 2RKWA 2JLYA 3G5MA 1M8PA 2JFYA 5DU2A 1O94C 3ND5A 3FAKA 4G1MB 3HV2A 4EY6A 1UOOA 4FBLA 2D06A 4PX9A 2Q3FA 3BIXA 3C5VA 3E8XA 3QKSA 4I9HA 2H4ZA 4MLZA 3DW3X 2HRQA 3QVTA 3GGPA 4RW0A 5BWBA 1VECA 3TNJA 4JLNA 5I7VA 1TUBB 3QBEA 4KODA 1MPTA 3PDHA 5F7JA 2WTBA 1ZK2A 3PFCA 5AW7A 3C3PA 2E4ZA 3LRXA 2JGMA 3KLMX 3LW8A 4R1QA 4WCVA 2CXOA 3REFA 3T1YB 2X6RA 5KDLA 4JJGA 1C7ZA 4EYQA 1WXGA 2YNMD 1T8WA 2JGRA 3AEXA 4Q1FA 1GKIA 5CLIA 3CF0A 2POCA 2VBIA 1M8KA 1OROA 3REQA 2VPXA 3RRFA 5BVGA 3B5IA 4A16A 1VL6A 1CG6A 5CGZA 2CMKA 2H1HA 3FTDA 4DYDA 1DCKA 1SCKA 3HPQA 3R4VA 1N34B 2IU0A 3DR3A 2QTAA 3PDJA 4DA9A 3IT3A 3C85A 3NIWA 3SVTA 1AGXA 1KKLA 2B94A 2Z3WA 3KYCB 4UU0A 4YXWA 3TLEA 4CR6A 4E46A 3K09A 1GGEA 4ISBA 2AFRA 3QJ5A 2HX1A 2M9MA 1ORTA 1X1EA 4U2KA 3V1NA 1U8ZA 5KC9A 1OBCA 4EDFA 3ZDBA 1CFJA 1P2DA 2H0RA 4L4XA 4RX1A 1FDWA 1QOZA 4RQTA 5TDHA 5TPZD 2DUMA 4MHTA 1Q15A 2JCBA 1RYYA 1XPOA 1J90A 2QN1A 1YQXA 1WMSA 4NK5A 1QIHA 2AT1A 1ENPA 2QTCA 1N2IA 1XKLA 3LW7A 5I9IA 1ZN2A 1WP9A 1SVSA 1E2EA 2GO1A 2ZW9A 3H97A 3VRHA 4DDKA 5K51A 1FSPA 2D00A 3O6VA 5ES4B 5BWLA 3JWJA 3AINA 2C4TA 2PMKA 4FYMA 4BYGA 4U5QA 1TVKB 2XD4A 5FNZA 2YC4C 2Q3JA 3CKLA 2Q45A 2O8BB 2B0CA 1WMDA 4B4OA 2J59A 4DSOA 3BXHA 3NT4A 5TQ0B 4FFNA 1MNQA 1JDSA 3KSZO 2VTVA 3GD5A 3QA3E 3OCCA 3VAAA 4PFJA 4Q3EA 4HSGA 1WZ2A 4EGCB 4O02B 4EG1A 1ZH0A 1Z68A 3GLVA 4FCTA 1LPNA 5C18A 1WPXA 4FKZA 1XL0A 1GPJA 2BGLA 2RAPA 1I30A 3FI9A 3HYSA 3QOFA 5IEBA 3WP0A 4DNOA 2HZ7A 2FR8A 2IIPA 1XJWA 1LXCA 2I4IA 1ZH6A 3L01A 4AMVA 3RJ9A 4BP3A 4Y2VA 2ZRBA 1Z5PA 3CH7A 3CEMA 3I64A 1K88A 3I5UA 2XYRA 4J0DA 4U8HA 3OZXA 3GMIA 3MMNA 1Z62A 1BH6A 2BDUA 4TRMA 3R20A 1YA6A 4OHYA 1DEOA 5A04A 2QF7A 2VTEA 1WBBA 4XDHA 1WCIA 4FZ5A 4NBRA 4B5KA 1BS2A 4JJEA 2QRZA 1T9GS 2ECOA 1M6VB 1GUDA 1JZQA 2CHUA 4PRYA 4YACA 3UMGA 4MV6A 2HK7A 4X6YA 5EJFA 2PLRA 1Y42X 5E4TA 4F3TA 1QDUA 5EP4A 1OKKA 3B82A 3RFXA 3UKDA 4HFJA 5IVPA 4RTMA 1NBMA 2E3JA 5AM4A 3EULA 1GG5A 3VO9A 1QIEA 2QUHA 3HMQA 1WETA 3K32A 4KWCA 1YVEI 1SG9A 4P7GA 3NHBA 2GK4A 2AI1A 4IRUB 5ELLA 4R7TA 2MR6A 3D6FA 2AYYA 1SXJA 2FU5C 3FOWA 4ND3A 1OBFO 1OZAA 3RUPA 3S8MA 4BP1A 4EB6B 4TV9B 1K3TA 5KWSA 4UU8A 1E79D 1N33B 4I8DA 4U6NA 3GEDA 4WX2B 4AKTA 3PTZA 2HXYA 4NYIQ 5DK4A 5KVAA 1EJ2A 3CH4B 3H5TA 3P20A 1LPMA 3AZOA 1QZTA 4JWKA 2AUNA 4N6OA 1NMSA 2WHPB 4MIYA 2IYNA 4NYMR 4YK7A 4ZQEA 4ZV7A 5G0TA 4AP6A 1FJ2A 2OFWA 3PFBA 4WLNA 4QC2A 2NUTB 2F1RA 1NKSA 1UDBA 2PNFA 3I39X 1C7JA 5D7NA 3I45A 2Q4TA 4X3OA 2WD7B 4DR5B 2PXHA 4E5YA 3CLUD 2G70A 3SI7A 2FJ0A 3IB6A 1PLJA 5KNCH 4XGQA 1LD3A 5IJAA 3TLCA 2HA5A 2P0YA 4R71A 1LK7A 3QUBA 3C24A 1QHSA 1HT3A 3VPDA 2J8ZA 2FJUA 1DAHA 4KX5A 4CEIB 1X38A 3C7TA 1GCOA 4MQLA 5FOUA 1NT4A 3OJLA 4TROA 3ZU5A 1KMNA 2BJVA 1JSRA 2ACWA 3KG2A 5AQEA 1FW6A 3Q88A 1XDDA 2P9EA 2QJTA 1CQJB 4PO3X 3HR8A 1XFAA 5JCJD 2V58A 1HEYA 4QUBA 3UHJA 1XMOB 1DQNA 3GN1A 4JB3A 4GBED 4D3SA 4ZQCB 2W4MA 1VKJA 4ZYTA 5G40A 5FPTA 2HCJB 5IMSA 4WXMA 1L7BA 4K3UA 4RZXA 4ZHSA 1EGMB 2IHVA 2N75A 3VR0A 5CFQA 3T3OA 4PYQA 1G9XA 3OJEA 4PGFA 1WCXA 2Z6UA 1SUIA 4TOIA 3LFHA 4TYPA 3QWHA 1RIIA 5B4UA 2OVBA 4QXQA 1YBMA 3IUSA 2E85A 2JD2A 1P7YA 2OV8A 2W2MA 5IKMA 5J5AA 4MPJA 3TPCA 1O94A 4AJJA 4F0JA 1V3UA 1FA9A 2O8EA 2AC4A 2G04A 3EMVA 1EIZA 4ZV9A 1QGDA 1T4MA 3BH6A 5DM1A 5ALMA 1XPUA 1ICIA 2H2FA 4F9GA 3K70B 2DT8A 5CFMA 5D00A 3R6LA 1PFKA 1ZUWA 4TKUB 3V1YA 4ZOAA 2YC2C 2ZLBA 3DDZX 2Z56A 1BHSA 4OUDB 1VSTA 2HJHA 3E15A 5F2EA 3UGKA 5HQ3B 4FR5A 5DXAA 1XQVA 4P54A 5T57A 5JYEA 4ZMBA 3SNHA 5BRNA 5FWYA 3DTYA 1TYAE 4ENVA 5K7SA 3KB1A 3W8NA 1VZ3A 2J3KA 3C3YA 3LXMA 1E2HA 1MABB 2YS6A 5BQ3A 4XKJA 1J8VA 1S2IA 4GSKA 3GGSA 3SDZA 1KDPA 3L0DA 1YFJA 4D4MA 1QG4A 4F60A 3AC0A 3DGEC 5KYUB 5AKEA 1YE3A 3I0MA 2J9XB 3MWGA 4RE5A 2ZRAA 2B8EA 3P4UA 1AUVA 3AEKB 1FYFA 3KOWA 3VPGA 1W7AA 3P0EA 2YV3A 1UKEA 4DOMA 3WSTA 1IQUA 4HLNA 3VPCA 3M1IA 1J2RA 1CJSA 1H23A 2AKAB 3H8SA 1FP6A 2VWHA 2QPAA 1OBHA 1ZI8A 4KFTA 1DBWA 3LX6A 4K0RA 3QY0A 1ZN9A 2BFFB 2O0KA 3BMOA 2VHTA 5WRFA 4B3HA 1OJLA 3AJ9A 3T5PA 1TIKA 1YS1X 3QKIA 4Q21A 1RAFA 1W5AA 1TVCA 1L7DA 2C97A 1KK1A 3QEJA 4REOA 4K9LA 4I5GA 3WKBA 1DEXA 3EVZA 3VUEA 1ZJJA 1ZAKA 3W2IA 3V7UA 3FCOA 2I3GA 2JKVA 3FOCA 3H9QA 1YHZA 4DXDA 1DG9A 2F43A 4PO1A 3ESXA 3L5OA 3BWEA 3HJRA 1JLLA 1R0KA 1UMDA 3HI6A 4HPJB 1UZLA 3VNVA 4MX8A 4XQ9A 2PSEA 5KTYA 1GZHB 1NZDA 1C3LA 4RCVA 2QWXA 2VP5A 3JQCA 1LDYA 2ZR0A 1L1EA 3NDIA 1JTEA 4RF3A 5TJ9A 2YN0A 2L0XA 1UBRS 1P5ZB 2XXBA 2X5KO 4YP0A 4B3TB 1VE7A 5DI3A 1IWOA 2PS0A 1NVXQ 3C48A 2WAAA 1TLTA 5EXDA 4DG8A 1OH7A 4Q0MA 2X22A 4AT1A 3GLIA 1P4JA 4W7HA 2EBHX 1JHRA 1J8YF 1YRHA 2NACA 3HP1A 1ORHA 2VHYA 2RJOA 2ZSAA 4I1OA 2C5AA 5JSYA 1K3FA 3BHIA 5THXA 1W88A 3NV7A 4FBGA 5KU7A 3ITKA 4QGAA 4RENA 1NMXA 3Q3IA 3P2KA 3BDVA 1M2NA 4TVBA 4KLAA 2YCLA 3IP8A 2WJYA 2HSDA 1UF9A 2M1ZA 1Z16A 2AG1A 4FYKA 3U3KA 3W0LB 4PRZA 2O2SA 4TLLB 4FT4A 3GB9A 3ZWWA 3TR5A 4J16A 3P0RA 3SMQA 4WLUA 4NDZA 1XTJA 3OUZA 1PUJA 2OXCA 3AWDA 3F4LA 4E03A 1FYWA 1WXDA 4JV5B 4JYAB 3CQ9A 1TYEB 5T5QA 2Q9BA 5JTUA 4XSVA 4MR9A 1ZBDA 3DPIA 3VC1A 3BJRA 4IJQA 4C9BA 4CMEA 5I48A 1JDZA 5EIAA 2Z5GA 3HA3A 1PS8A 1TVMA 1YI1A 4HUTA 4X90A 5IWCA 1U0GA 3MJFA 2XB6A 2ZJOA 2Q5LA 4LJ9A 2C8JA 1Q1GA 6CHYA 1GQQA 5GTDA 4GPZA 3EG9B 3IE1A 1NF3A 3BWDD 1SCAA 4CKBA 1S2NA 4PN7A 1ORVA 1JQLB 1GZSA 1LJLA 2G77B 1JECA 1POWA 2NW6A 3VZDA 2GF0A 1E9BA 3RNLA 3WTCA 3V8EA 4QOEA 3JPYA 1E8NA 3COYA 5B1EA 4IFTA 4FHDA 3A7DA 5L3VA 3O1HB 3ISTA 2OFOA 3EEIA 5IVDA 1I4DD 5GINE 1IVYA 1L5NA 3H1FA 3V2IA 4WPGA 1XEXA 2ORIA 3F4KA 2IF2A 3A4TA 4DV4B 1SVOA 3LXXA 4JVOA 3EWIA 4XB1A 4YYZA 5L95A 2CLEB 2AWOA 3DJYA 4G8JA 3SXJA 1OFTA 2C1XA 1O96A 3KZMA 3KR9A 3C8MA 1U3UA 3R8CA 1KWKA 4HLQB 1B0AA 1N2ZA 2DQYA 3ZDEA 4E15A 5AW3A 3L8CA 3UJBA 2G0TA 1S1CA 4LJAA 2B20A 4FDMA 4CT0A 2YWEA 1ISJA 1QNLA 2R1UA 4UHCA 5T3YA 4EENA 3O4VA 2VQDA 6AT1A 3HSKA 3HBNA 1E4EA 1A71A 1KAGA 2QKYA 3SXUA 4Q34A 5I47A 4RPLA 4G1VA 3JZDA 1U8TA 2A0YA 4OATA 4E21A 4YMGA 1JYSA 2HU8A 2VCEA 2VHXA 2ZWMA 5U4QA 2PZ8A 3QEOA 4DBVO 3WGTA 3AR6A 1D07A 4IOKA 2RBGA 5IC6A 1RBQA 4KYTA 1TT5B 3OOYA 5CITA 4MCIA 5EUCA 1YIDA 1U0LA 3DEFA 4ESEA 5B6PA 1IBMB 1VCHA 2HU5A 3TE6A 1NASA 3OTGA 3WK9A 4C3OB 5BSGA 2ZRIA 2H2WA 5LDHA 3E4DA 4DJ5X 1NONA 4EF5A 1KU0A 1GRRA 5BV2P 2I99A 2BDTA 5TIIA 4DF3A 1X7YA 2JASA 3C5WP 1K7XB 4ZT4A 4YXWD 2RGUA 5L3SA 1B3RA 4P35A 4IIYA 5CGQB 4YWHA 2CFIA 5IVIA 3I9KA 3G0HA 2P8JA 3LUGA 3TIIA 3DO6A 1XNHA 4C7MA 1NURA 5GGYA 3OKAA 2NXEA 3SM9A 1L3BA 4JL5A 3DBHB 4K6KA 1YAJA 1YU6A 3JR3A 4RFVA 1RRMA 3FMFA 4CIDA 3GJSA 2BMVA 3C8DA 1X2BA 2V7VA 4EYKA 1OT5A 1RWOA 3C1UA 4POOA 1WAMA 4D5GA 1D4AA 1ZRMA 1JJFA 4YIKA 3HJFA 1TCUA 2QR5A 5FT9A 3W3ZB 1L4HA 1NF8A 2XB9A 4E31A 3USZA 1G20E 1Y6ZA 2GSWA 3DLTA 5BP7A 4JYBA 4LXUA 2MJLA 4P9NA 4TL7A 5HCNA 3SIWA 2BSAA 2ONCA 2PZKA 3MJVA 1OX6A 2H51A 3TH5A 4B7ZA 4D97A 4QVIA 4R54A 3STTA 1G4UR 1UM9B 2I7CA 2W4QA 3DP7A 2CHGA 4L0CA 4YRTA 5E6RB 5FNVF 1PVDA 3VV3A 2CLOB 3AMVA 2PSSA 3TEFA 4B8WA 1O95C 5AKLA 4YALA 4NVRA 4RFSA 3FUUA 3MLBA 5FBRB 2B82A 4GMHA 1UT8A 2RJNA 3UK7A 4F96A 5BT8A 2F9MA 2WJVA 1NV9A 4WZAE 1J9ZA 5BO5A 3T52A 4BLPA 1UJ2A 3S1AA 2ZE5A 2GPYA 3G85A 3ANYB 2JRCA 1Z6AA 3FNIA 5JVDA 4HAIA 1CF4A 2O3RA 2IEIA 1V47A 2IF0A 3AEUA 1LLDA 1Z4NA 2O57A 4JKYA 1EGQA 1QNFA 4JJAA 3CW9A 1OKKD 1A8PA 4J07A 4RV5A 5EHIA 3ZZ0A 4KYIB 1NBMD 2H17A 3CNOA 3TNYA 3A3NA 2AN5A 5AW4A 2JI7A 2YJNA 2M6SA 4YJDA 2LIVA 1ILEA 4AMBA 2ZWOA 2VEOA 3GQVA 4L9AA 3OCXA 1P3DA 3IQIX 1SBZA 2GCGA 2GN0A 1SXJD 3ETHA 3GROA 5A2QA 4L9WA 4WIAA 2WOOA 3ZDZB 2Z4TA