3SU8A

Crystal structure of a truncated intracellular domain of plexin-b1 in complex with rac1
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
178
structure length
178
Chain Sequence
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Dual Binding Mode for RhoGTPases in Plexin Signalling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis/signaling protein
molecule keywords Ras-related C3 botulinum toxin substrate 1
total genus 47
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2011-07-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3su8A00
4OL0A 4BASA 1XJ0A 3A37A 3HR8A 3NDBB 3ICQB 2R6FA 3NVAA 2IT1A 2ZRCA 2FWRA 5J4KA 4IOLA 4EDHA 5JZVA 1D2MA 2JJ8A 3QE0A 4FW9A 4TT3D 2OBNA 1KTVA 2ORWA 4PC3A 1NIPA 2GKSA 2AD1A 3Q5EA 4QGFA 1I4DD 3KUDA 4XIGS 2WJJA 2MSCB 1J90A 2YOFA 1EX7A 2X2FA 3K70B 2NIPA 1TF5A 2FOLA 1DO0A 5CIQA 2CE2X 2YNMA 2E1RA 3F5FA 3W5IA 3PEWA 4L9WA 3EW9A 1FTSA 1G5RA 4OHWA 5H68A 1DAIA 1IN5A 1E69A 2QE7D 1RE0A 1P62B 3BOSA 2F9LA 3GLHE 4LZZA 5FTJA 4Q48A 2O8CB 2W0SA 2JJ2A 4L5BA 2J59A 1VDZA 3CX6A 4A9AA 3VMFA 4TN1A 2QTFA 1OYWA 2ZJYA 2BEJA 2Z4SA 1YZQA 1AGPA 4NCNA 2X8AA 4IDNA 1FQJA 1VYVA 1R0WA 2WSMA 4LHWA 1NLZA 1NF3A 1S1CA 1W4CA 1FX0B 4A8JB 1J99A 2BJWA 2KWIA 4MUBA 4D4JA 3WYGA 2DWQA 3B9QA 3TBKA 1PJRA 1RC8A 1IXRC 4QL3A 1A4RA 2Q9CA 3IEUA 2W2XA 1KZGB 1HH4A 1YQTA 1E0JA 2KI5A 4Q47A 1L2TA 1P7CA 4KVAA 2ZAOA 4LJ9A 1OH8A 3CBQA 2GXQA 3WMGA 1EWRA 5EP3A 1W49A 3OAAA 3T1TA 2J87A 2XTZA 4WZBE 3U7FB 5FPTA 4FMDF 1IJEA 2VYFA 2ZE6A 4X8LA 1RVDA 1ZD9A 1SXJC 1D9XA 4PZZA 5JEDA 1XTJA 1IQPA 1GILA 3HWSA 1KI3A 4GMXA 3RVBA 3K9HA 5GADl 1PUJA 2ZJOA 2O8DA 2OLKA 1G1MA 2WWGA 3IKJA 3QJYA 1Z0FA 1VIAA 2MMGA 4IEIA 4XTRA 5KSOA 3RC3A 3SBEA 2O8BA 2OZEA 1IOZA 1T3HA 4BLRA 4K81B 4Z51A 4IVQA 5A5GA 1G8YA 2QROA 1KJYA 1Z0IA 3UPUA 3L8ZA 2ONJA 2QT1A 4LUCA 1UBFA 4HZUB 1II8A 3Q3JB 4TWZA 2PEZA 1NLYA 3DL0A 4TYWA 2AFHE 5KPJA 4GL2A 4P33A 2WPDD 2YC2C 2JJ1D 3PUWA 1AS0A 1UBGA 2J3EA 3U3MA 1IN7A 3QBTA 1XEXB 2O8CA 3B1YA 3I73A 2VSFA 2R6DA 3NBZC 821PA 3TR0A 1N5JA 4M21A 1UPTA 3RRNA 4QFMA 1U98A 3EPLA 3SFVA 1R5NA 2O8EB 1AKYA 3NXSA 5DSZA 1T8TA 1SXJB 1O87A 3P27A 1UFQA 4DIDA 4QC2A 4PHTA 1RRPA 4DLXA 1JR3E 1US8A 4L9SA 2AD5A 3M4YA 1UM8A 2OAP1 1V5WA 5L3VA 4EPTA 4QM6A 1P2UA 4AKIA 3EPHA 2QMEA 5CYOA 3JZMA 4GOKA 3O8RA 4TYPA 1WB9A 1CLUA 2ZQ5A 2HXSA 1NN5A 3EASA 1Z0JA 2YWEA 4IOJA 3U3OA 2GRJA 4B47A 4BFZA 2FFAA 3ND8A 4Q1DA 5FOTA 3R7WA 1GFIA 1P9RA 1CP2A 3QXCA 2AWOA 1CU1A 1DE0A 5FPKA 2CL0X 2QMUA 1XPRA 2XNDD 1R0YA 4RFSA 3GLIB 1TQ4A 4G5QA 2CE7A 3VX3A 1AN0A 1II0A 1MABA 2F1JA 2ZI7A 1NBME 5L3QA 4F4IA 3GJ4A 2KSQA 4WBSA 3AF2A 2DR3A 3IHWA 4Y0VA 4TZ0A 1COWD 2L0XA 3QQ5A 5E7MA 5GJVC 2NO7A 3JVVA 4LYAA 3NC0C 2R9VA 4MGIR 3A1UA 1T6NA 2E9SA 1L8QA 3THXA 4EFNA 1W36B 1FNNA 2FE4A 3KQLA 4TQAA 2R2AA 4ON9A 5K8IA 3KKOA 3MWLA 3H84A 3RRYA 1E32A 1R2QA 4ASUD 4Z54A 4MDEA 3FMPB 2FSGA 5CJPA 2JLSA 3SDZA 1XF9A 1B23P 3CRMA 4F92B 1XX6A 4LWZA 2OESA 2HJGA 2B92A 5E3HA 1F2UB 2RH5A 3FOZA 4ZI3A 1KI6B 5EP1A 5AUNB 2J0VA 5JFGA 4L4UA 2Q6TA 4W5JA 4YLGA 4Q03A 1DG3A 4Z8YA 5DLQC 3H86A 3TSOA 3PITA 4I4LA 1SVOA 4JS0A 4LOAA 1ZUIA 2D62A 3ZQ6A 2RAPA 3TW4A 2PZGA 3LRPA 5JWOA 2JGNA 5JI2E 1NMYA 1E1RA 1N0UA 1TADA 2IK8A 4DLUA 3WNCA 4E07A 2CLCX 1IHUA 2W0MA 3MJHA 2V4ZA 5FTLA 2OE2A 3OEHA 4O0MA 4U02A 1DOAA 1A7JA 3GLGE 2C2HA 4POAA 1DARA 4LBWA 4GOXA 2FSHA 3AVTA 2QP3A 1GUAA 2FG5A 3B1ZA 4XD7A 1VCMA 1WQ1R 1X8LA 4EIWA 5TARA 1U81A 3AH8A 4Q4AA 1BIFA 4UNSA 4AYTA 4B2IA 1QVAA 3MLEA 4YQFA 3GEEA 3GJ7A 3VX4A 4CEJB 3ZDQA 1SVWA 4JLVA 4BFSA 2ZE8A 4A0GA 1QHYA 2OV2A 3IILA 5SZJA 4CW7A 4QJ3A 2I3BA 4KFRA 4LV8B 4OK6A 1LF0A 2ZRBA 4ZDJA 2XITA 3EPKA 4AK9A 1G17A 4OQFA 4JIMA 4Q9LA 4A8JA 1BMFA 5SZIA 1C4OA 4V0ME 5HKKA 4MYTA 1XCPA 3FFBA 2JDIA 4RD2A 5JECA 1EK0A 1E2PA 3SJAA 1ZAKA 4Q1EA 2DFLA 2GAOA 3A1VA 4F38A 1W46A 3AP2A 5DYGA 2H17A 1T3SA 4BRWA 1OW3B 4DCUA 3THXB 3ADDA 3GLFA 1GL7A 4AKGA 2YOHA 2BMFA 4HUTA 1Z8FA 1AZTA 3TE6A 4D82A 4Q1CA 4KBFA 2WMNB 2C8VA 3IIKA 1KK2A 4XSGA 4TZ6A 2WV9A 1GSIA 4KSBA 4US2R 1F2UA 3P20A 4LC0A 2W6ID 4C30A 4HAWA 1RZ3A 4NMMA 2Q0HA 1E0AA 4V0LA 4DEXA 1NVVQ 2JJ2D 3KQKA 2GXAA 3T1OA 4LDJA 2F1IA 4PQFA 4TLDA 2WKQA 1MRSA 2AHOA 4MKHA 3L82B 1U90A 4LHXA 4V0KA 4LGMA 4F93B 2QENA 3U4QB 3KTAA 2ODWA 2EYUA 3BB1A 1WXQA 1FQKA 4RD6A 3SFZA 1L4UA 4P31A 2ZYTX 2J0UB 1AS2A 3WP1B 3AVWA 2OXRA 2Q3FA 1W4BA 3MJRA 1DTSA 4PSVA 2R62A 1E94E 2W2VA 1GNQA 1E9EA 4NCIA 4A1FA 2NZJA 1KY2A 1EFHA 4P4UA 4B34A 1OB2A 2QSZA 5CLLA 2V1XA 1W2HA 5CK4A 5KNBA 2VH5R 5JJIA 3GJ3A 3MUFA 4G5GA 1SVIA 2SHKA 4CZ2A 1JR3D 3OAAD 1UEIA 2ZE7A 2A2ZA 4BFYA 1JJVA 3KDSE 2IUUA 4TLAA 2OEPA 2PEYA 2WOJA 3ZD7A 2J7PD 1LY1A 1U8YA 1VCIA 2QN6A 3A1TA 4LI0A 2P2LA 5HE9A 2NQ2C 1NG9A 2AKYA 4QHYA 2O8BB 1F2TB 5FUXA 2FJUA 1IN4A 1WBBA 3CO5A 1G5PA 1ANKA 4J0QA 1X1RA 4DBLC 2HLDD 1LNZA 1YZLA 1G7TA 1IJFA 1SVSA 2OG2A 5GVRA 3SN6A 1R5BA 1KDOA 4OHZA 5EZ6B 1HQCA 2HV8A 2P5TB 5AUPB 1AM4D 4LV5B 3ASYA 2O0HA 4TTQA 4IHQA 2PMKA 2KJQA 4OKSA 5J5CA 4D0GA 4N0EA 4A2PA 5EXXA 5BWMA 3FHTA 5CIWA 1UF9A 2AK2A 3RABA 1JI0A 4RFVA 4XVQA 3J81k 4WIAA 2G6BA 3T15A 3GLFE 2IC5A 2YKGA 1LS6A 1ZNYA 1F6BA 3GJ5A 2N46A 2ZTSA 3GPLA 1W44A 2VP9A 1KAOA 1P9WA 2DYKA 5B57C 3C15C 2XB2A 4L15A 1E9SA 2RHMA 4PC2A 1T5LA 2WKPA 2C99A 3ASZA 1R4AA 1X3SA 3WBJA 4I1VA 4Q5IA 1E1QA 3N5CA 2GJAA 4BRUA 4ZI2A 3IBYA 221PA 3KL4A 4M9ZA 4JSTA 3MFYA 3OIVA 3K0CC 3MD0A 2I1VB 4R7ZA 1WA5A 2B8WA 4NYMR 1YR6A 1DAHA 421PA 2UZIR 2WPDA 2JJ1A 1DELA 2V54A 5AJYA 3UMSA 1DAKA 1GAJA 3TUJC 2ZJ2A 3GLIA 3K70C 1KIMA 1GKYA 2WIAA 4EJSC 1XEFA 2P6RA 5L3QB 1T5IA 1TQ6A 1DAFA 1XTIA 1XXHE 1S9DA 1ETUA 3SR0A 2FZLA 2QPTA 2NO9A 3UWOA 4BFTA 3QENA 2C9CA 4N0DA 5G3ZA 3NWJA 3R9WA 1KZ7B 2ZI4A 4OHVA 4Z1MA 1U9IA 4B6EA 2QM8A 5J40A 2H16A 3KX2A 4WXRA 3CIOA 4A2WA 1CJTC 1T0HB 4B75A 4E09A 2F43A 1ZCAA 5FOVA 1A2BA 1KKLA 1EWQA 3IQWA 4S2EA 3D3QA 1Q1BA 1N6LA 4LBYA 2ATXA 1ZC4A 3L8YA 5BXQC 2ZRIA 4OQMA 1E99A 2RGNC 4OHXA 5TY0A 4OBEA 4CEHB 4DT1B 4PAQA 1NJFA 3MWKA 3U3KA 2XNDA 2F1HA 2RMKA 3QXSA 4JVMA 1E2HA 3BFXA 2WWXA 2ZYVX 1W0KA 3A4MA 1U0HC 2AXPA 3B8HA 4DDUA 1KHTA 2IYQA 4BLOA 1UKYA 4YONB 2BV3A 1E1RD 1XZPA 3WHKA 2CHGA 3BS4A 3QG1A 3R9IA 1GWNA 2NMVA 3OF5A 4Q21A 1KO7A 1Q3HA 1K5GA 1PV4A 1RRGA 1E79D 4PX9A 3EPJA 1R8SA 1LW7A 1HUQA 2BMDA 2V6IA 1WMSA 4QHTA 5C46F 2PJRA 3SQWA 3UWKA 2F43B 4P4TA 3WBKA 2XOKA 3TSZA 1XD9A 1IXSB 3DEFA 3S1AA 3WMEA 2V1UA 5IRCD 3ADKA 1E4YA 3IDQA 3RC8A 3IGFA 1CR4A 5FI0B 3P26A 3KQNA 4DSUA 3CWQA 2A9KA 4M4SA 4CT5A 1QHNA 4TMKA 2VPPA 2JLYA 1QRAA 4PZYA 4PR0A 4CGZA 3BH0A 2NTYC 2ZJ5A 3VKHA 1Z2CA 2D2EA 3FGNA 5TV2A 3ZVRA 5AWFC 3B13B 4XD7D 4LJAA 3TR5A 4FWIB 1ZP6A 3UKDA 1AKEA 2X2EA 1CKEA 2XAUA 3QKUA 4TMVA 1E9DA 1KI8A 1UADA 3I32A 4CT4B 2BM1A 4CEIB 3GJ6A 3Q9LA 2G0NA 1MRNA 4IXMA 1YZGA 2AL7A 2G3YA 2CDNA 3QY0A 4TQUS 4AC9A 2C98A 1K5DA 4DKXA 1E6CA 2QPOA 2R44A 3IO5A 3HPQA 1N0WA 2OXCA 4MKIA 3VHLB 5DI3A 2IA5A 4XVRA 3K0SA 4QKQA 1CJKC 2FGJA 5HKKD 5JJLA 1CRQA 3CLVA 5JWHA 2W2TA 3LV8A 2Q9AA 1A5TA 3KB2A 2D06A 1TU4A 2R6AA 2ZANA 4NP6A 1ZM9A 3RRMA 4LYHA 3ZS9A 4MITA 2BKUA 1DAEA 2A78A 1ESNA 4URVR 4DSTA 1II9A 4NKRA 2Y8EA 2OSBA 1SVKA 4IOKA 1SGWA 2DCUA 2H92A 3PEUA 1NRJB 5BN5A 1NKTA 2ZRGA 4Q4JA 4B35A 2VO1A 3K0CA 4G3XA 3Q8XB 3N2IA 4JLAA 2RB4A 4QG7A 5A4JA 1PLKA 2O0KA 5DISB 5E7IA 3LBIA 3NBYC 2YINC 1CF4A 2BMJA 3FTQA 3K70D 3DHWC 2HEIA 1KMHA 4M1OA 3A58B 1Z6YA 2FMXA 4GPTA 1OE0A 1X8KA 4N3NA 3AF1A 1IY1A 2BKEA 3RS0A 4A6PA 1QDEA 4UJ5A 3AUYA 4M0LA 3I3SR 4OJKA 2NG1A 1AA9A 1ZYUA 4YMTA 4LJ6A 4A92A 5DGXA 4P4SA 1KAGA 4FIDA 3I4LA 2VTKA 4BLSA 1OYYA 4C0HA 1E79A 1FP6A 1GNRA 1NY6A 3AF4A 1GRRA 1G9XA 1G3UA 4LPSA 1TEXA 3N2EA 5CDFE 3ZZUA 1FX0A 2QTVB 3L0IB 3CR8A 4GP7A 1G8HA 1W4AA 1FP7A 4I1OA 5FL7A 3H4MA 1W36C 1L7VC 1U9IC 3P4XA 2GEVA 3QPVA 4DWJA 2FDCA 3OFNA 3VFDA 3GJXC 4IVPA 2QAGC 4AIIA 3GLGB 2BWJA 3B82A 4YMSA 2ZSAA 2QU8A 1FFHA 1TNDA 5BN4A 2ANCA 1V43A 5CITA 3KUCA 5KSPA 1ZM3A 1OSNA 5H70A 1T91A 3NKVA 4HZUA 2WKRA 3U2QA 2QBYA 5F3WB 1G3QA 2HLDA 2ZJ8A 4PANA 3GCGA 2E87A 3AQ4A 3B6EA 2IWRA 1LVGA 2NZ8A 4XH9B 5FL3A 3NIBA 4DCVA 3C41J 2GILA 2Z83A 2IWHA 2O8DB 3CH4B 4E22A 4CRWB 1XD2A 2VF7A 4JT2A 1HT1E 3QXHA 4FMCF 2TMKA 4WW0A 3KFXA 5IK2A 4BPBA 2ZSDA 1XMSA 3DDCA 4Q02A 3I1FA 1SVLA 2GBLA 1NN3A 1BOFA 2QAGA 2Z0MA 3CNNA 1M34E 1WDTA 1U2RA 3TRFA 4OI4A 2W83A 5CK5A 1EFRA 4HATA 5DIFA 3GP8A 5L3SB 2YZ2A 5DN6D 1SULA 3AF3A 4JSYA 2ZETA 4D25A 2C95A 2QP9X 2QA5A 4ZIRB 3IHLA 1FMLA 4FCWA 1JQLB 2ERYA 4C0KA 1GNPA 4JVNA 3CRVA 1QHXA 1VCNA 2FEOA 3KJIA 1QF9A 3C16C 4ZCLA 3RSLA 4I1SA 1BKDR 1E9FA 5EXPA 1OKKA 2YWHA 2VHTA 2WM9B 5EE1A 3QKTA 2IHBA 3NH6A 3SZRA 1XDBA 4FWTA 5LDDC 1SXJA 1CBUA 4DDTA 1RKBA 4DLRA 1GVNB 3BIFA 1JEDA 2G83A 4IJMA 2D2FA 3BD9A 4A0RA 5JCZA 2WWHA 4QBFA 2EFGA 4URWR 3CB4A 2CLSA 1UBEA 1XBTA 2WTUA 3SYKA 4XOIA 2ZS8A 1Q0UA 4LHYA 1J8MF 3EXAA 2QM7A 4LJYA 5FPYA 2GESA 3K0EA 3HU1A 1XWIA 1M7BA 4B6FA 1KDRA 2ZRPA 2OILA 4GMDA 5F98A 2GWHA 5AR1A 2ASEA 3FMFA 2ODEA 4TL9A 3EA5A 1XJQA 1B0UA 2Q3HA 1NL3A 4GSYA 3UXMA 3K0FB 3VKGA 1CJMA 3R20A 4JBYA 1NBMD 2HCBA 1Q20A 4OK5A 1OXUA 3TNFA 3ICEA 2OT3B 1JPNA 4RY2A 3N70A 4PZLA 1TTTA 1ZNZA 3LBNA 2WAXA 3VR5A 1FTNA 4FI3C 5FTKA 5L3SA 5LD2B 4AG5A 1YE8A 2EVWX 2EWWA 2VIIA 4JVSB 2ZJAA 621PA 2YV5A 2P0EA 1QHGA 4PHGA 4TL8A 3FHOA 2VHQA 2GF0A 5K8UA 1S96A 2XSZD 3RRZA 5AJVB 1I4TD 5KSZA 2G88A 3GLHA 1G7RA 4WXPA 2BEKA 3KKMA 2V6JA 1Q12A 3AGQA 3LWNA 4DEYA 3SU8A 4WVFA 1FL9A 2Q3MA 3F3YA 3HU3A 3LVRE 3LXRA 4NH0A 5EE0A 4PAOA 4Q1BA 3OE7D 1AQUA 4JL5A 1R5OA 2XOKD 3T12A 5C2JB 3L0SA 4YDSA 1W0KD 2IEZA 2ZJZA 2IUSA 3PG5A 4V02A 3UATA 4DSNA 3RS7A 1U0LA 3CRQA 4JL6A 3KZ1E 4EPVA 2PX0A 2J45A 3ZVNA 2C04A 2CJWA 3GFPA 2RGEA 3MMPA 4HB3A 4O2RA 2ZROA 4ZDIA 1KSHA 4KJZA 1G21E 1BO6A 3D6TB 4B44A 3FYHA 2GEUA 4B2PA 3HYRA 1E2FA 1D8TA 1N6IA 2EQBA 4EPYA 6Q21A 3LQQA 5D3QA 4XWAA 2VBCA 5HZHA 3DKPA 4UNRA 2P3SA 2WJYA 4NYIR 2IL1A 3GFOA 2WMOB 4GZMA 3LVQE 1T9HA 4TMTA 1A82A 4HAYA 2UKDA 3EARA 2WSSD 1N6RA 3LLMA 2IYXA 4MYHA 2DB3A 1KOFA 3KKQA 3W9YA 4C9BA 2PZFA 5ELXA 4ILEA 1P2TA 1ZD8A 2V55B 4OI2A 4C0BA 1T8UA 4M22A 3EG5A 2DY1A 3VHXA 4PFSA 1KDPA 4Q7LA 4HZIA 1IY2A 3FMIA 3UMFA 4TL6A 4Q66C 4CYMA 1Z29A 1Q1QA 4JLNA 1E9RA 4BLQA 2F55A 4JLOA 3TMKA 2O8FB 2Z4RA 3TSWA 1C1YA 1ZNXA 2C9YA 2WJHA 4ERNA 4EUNA 3T1QA 1IXZA 5FBLB 5J4LA 1LFDB 3B85A 5FTMA 2HJVA 5J4VA 2G77B 1OXVA 1YZTA 5SZHB 4BZPA 4MRSA 5FUYA 4D4KA 1RRCA 1M1YE 3FKSD 1Z63A 5E7JA 3X2SA 5KSYA 1P60A 1UAAA 4O3MA 3U61B 5C1BA 2P5SA 4RD1A 1OJLA 3M6AA 3PVSA 4NBSA 3DVLA 2WJGA 3QKSB 1BYIA 2ZU0C 4E03A 4DDWA 5JRZA 5K8TA 3H0KA 4BFUA 4R2HA 3VR4A 2O52A 2QAJA 3HU2A 3TH5A 4B32A 1KGDA 3G5UA 2DFNA 4W7SA 1VYUA 2FNAA 2ZRLA 4QXAA 4BUJA 2IYTA 3ZQJA 1OH5A 2MMCA 3O47A 3NHAA 2GXUA 3GEHA 4A4DA 1W5SA 4BEJA 2PLRA 4QRHA 2ZREA 1N5LA 1P61B 4GDFA 1VTKA 1J70A 1E0KA 4EJSB 3H2YA 4JMPA 1ESMA 4LBVA 1DO2A 1H8HA 2D3WA 5EJEA 4MYUA 2CK3A 2HYDA 2VF8A 4EPRA 1D9ZA 2F3TA 4M8NE 4CEJA 3V4FA 4JJZA 4JZKA 4UNNA 3TW8B 5FL7D 2ZI3A 1GKIA 1XEWY 2BCGY 2H18A 1W1WA 2NGRA 1HY3A 1ZIOA 3AVOA 3HJNA 3AGPA 1I2DA 1E2NA 5GJWC 3CX7A 2GTPA 1YVDA 1KI4A 2HCJB 2CCJA 2ZS9A 2FPKA 2O8FA 3LLUA 1Y63A 2GJ9A 4NE2A 3E2IA 4F91B 1X6VA 2GBLC 3AEZA 2YC4C 2H8KA 2H1LA 1FZQA 3RHFA 1O3YA 3K1JA 4U7DA 1XTKA 3QKRB 4RJLA 2CXXA 3SNHA 3DKVA 3TK1A 2PCLA 4NCKA 2ZSEA 4UNPA 2JIZA 4KU4A 4EJSA 3P32A 1G7SA 3C5HA 3EIHA 2OFXA 3GFTA 5EXTA 3WRXC 1WE2A 1QHHB 4XVUA 1GL9B 2ERXA 2FH5B 4LYFA 3TIFA 1KNQA 4R71A 5C18A 4P32A 3DZ8A 3C5CA 3BBPA 5LD2C 1NKSA 2VHUA 2P65A 1Q1EA 1XP8A 3ZZ0A 2XX3A 4QNRA 3QEOA 4Q9KA 2ZSFA 1SHKA 1YRBA 3OEHD 1Z08A 1II8B 1W4RA 4TMWA 2XGJA 4BQSA 4PXAA 4JLMA 5BYJA 3IO3A 4LJ4A 3EZ6A 4ITRC 1FMJA 4KI0A 2GZAA 2R65A 1QG4A 3CRW1 2JEOA 3CW2A 5CDFA 5JRJA 3B1WA 4DLTA 1W7AA 3QKRA 4MGYR 3SYLA 4C0JA 3X1YA 1QHSA 3A1WA 4FMCB 3VKWA 3PUXA 3T5DA 3O8BA 3NG1A 1SXJE 2QI9C 3D7MA 2O8EA 3IBGA 3E70C 2NO0A 1NN1A 5GJCA 3PXGA 4HI0E 2GJSA 4A0FA 2Q21A 3RSOA 2UZ3A 2V9PA 4XTCS 2XTNA 4LBZA 4F4CA 3SQXA 4LCBA 3CKLA 2R6GA 1F5NA 2OCYC 4R98A 1G16A 3WRYC 4PC1A 3K09A 3C14C 5F9FA 3W3AA 4XSHA 1BYUA 1BS1A 4Q9JA 4JL8A 2BHRA 4PHHA 4YMUA 2JLZA 1KKMA 4DXAA 3R7WB 2HT1A 3IPXA 4LRWA 2JLQA 2RGAA 3AVQA 2IHYA 3GLHB 5HR5A 2QL6A 2RGNA 1NVXQ 2PT7A 1SXJD 5FUVA 2IXFA 4NYJQ 2WJVA 2IYYA 1X8JA 1G18A 2J41A 4Q7MB 1FPMA 1D2NA 4HLUC 1PUIA 3PENA 3QPWA 1NBMA 3NTUA 1I4LD 2D74A 2XZPA 3BWDD 1E9CA 2IS2A 2AN9A 3IPYA 5TVKA 1E98A 2GVDC 4B2LA 4JLKA 4KFSA 4YXWD 1Q22A 4CIDA 1COWA 3KQUA 1YR8A 4HDCA 2X19A 4ABYA 3MCAA 3NHBA 4JLDA 4KCGA 4PAMA 2HXYA 1ZD1A 2GK7A 1ZCBA 1K6MA 1ODFA 2QEQA 1AGRA 3RWMB 3RYTC 5JLJA 2P6NA 2HYIC 2RGDA 1J2JA 2A5FA 2V7QD 4R2IA 5DO9A 4F4JA 3REGA 2RGGA 4RD3A 1P6XA 5JS8A 1G3RA 4Q9HA 4LK2A 1DPFA 5KPDA 1TQ2A 2FGKA 4MUAA 5K8LA 5FOSA 3Q5DA 1G8FA 4RZXA 1R8QA 5C4GB 1JR3A 1Q1ZA 1S9HA 4TMXA 3LD9A 2WWWA 1XPUA 4D4MA 2NPFA 2HF9A 5FTNA 2ZRKA 5J4YA 1XNJA 3QF4B 4HDOB 1IAQA 3QOFA 4EAQA 2W58A 4KYIB 3BFVA 3MRSA 3QVVA 2KBFA 4E5UA 1PZNA 4MKGA 1ELOA 3Q85A 5F9HA 3HR7A 2EWVA 1TF2A 3SJBA 3FHCB 3I8SA 4MQBA 1R0ZA 1XMIA 1YU9A 4Q4AB 1Z5ZA 1WF3A 5AJWA 5KTYA 1HV8A 1N0VC 2ANBA 5EE9A 4AD8A 4GOJA 1UKVY 5AJXA 2CVHA 3B2EA 1NJGA 1ZM7A 2BCJQ 3DOEA 4KAXA 2CL7X 4G5SA 4TLBA 1KDTA 5KDLA 3EA0A 3KXIA 1OHHA 2CCKA 1ZJ6A 2MSEB 4IKEA 5TB5A 1KJZA 3CF6R 4G01B 3A1SA 2C5LA 4JBWA 1VPLA 1KMHB 1GZSA 2J46A 3K0AB 4EQ6B 1Q57A 4LC1A 4DIEA 4AKHA 3RDPA 1Z06A 2BDTA 2QY9A 4QBIA 3RAPR 1YZKA 4AYXA 4QGGA 3AB3A 3X1ZA 5BN3A 2DPXA 3U7EB 1G4AE 3U3JA 1L4YA 1Z0KA 4G5OA 5JHGB 3U7HB 4ACBA 4P4SB 3DMNA 3F0TA 4GP6A 1E1QD 2ZPTX 3U6BA 4JLJA 3C4JA 2RKOA 2D7CA 3K8YA 2PT5A 3L0PA 4HUQA 4U5XA 5JS7A 4C0SA 1DEKA 2OFOA 2J9RA 4NYIQ 5KYKA 1SHZA 4URYR 1JQJC 1YKSA 4W5HA 4ZDKA 1CJVC 4UXHA 4DCTA 2IS1A 5ANRB 1N6HA 3AVVA 2ZI5A 5CYPA 2ZM5A 5CB6A 1M74A 121PA 3U60B 3AP1A 4MKFA 4HLCA 3BFKA 5TDHA 4NYMQ 3BC1A 2GAAA 3LQRA 1MO4A 3K0AA 4EQ6A 1VHLA 1W47A 5M04A 3QG5A 2O5VA 3RNLA 4B3CA 2QT0A 3IUYA 2GETA 3U5ZB 2CHVA 5LB4A 1SVMA 4YXWA 4B33A 4AKEA 2KE5A 4M9SA 3E1SA 3P4YA 1FOEB 1VCOA 2A30A 1NIJA 1HQYE 3U44B 1OFIA 1XD2B 3HPRA 4KODA 1XTSA 2OHFA 2CNWD 1E96A 2PH1A 4LX0A 4ZCIA 3AKCA 4KFUA 4ZKDA 3D31A 4KXFB 2BBOA 4AI6A 2VLIA 2FPLA 3WNDA 1E3MA 3UK6A 3I5YA 2GJ8A 3UG7A 3VNVA 1E2QA 4GBMA 3MSXA 4WZAE 5KDOA 3UANA 1F2TA 1NG1A 3VR2A 3ZVMA 4QBHA 1G19A 2JASA 1Y3AA 3B9PA 2WWYA 2OO7A 5JJKA 3FB4A 3TUZC 3CNLA 2J0QA 2FN4A 1LS1A 1E2JA 2ZI9A 1GKUB 3B7GA 4D26A 2HT6A 5LB2A 1C9KA 4NHOA 1VMAA 3QI2A 3SEAA 4ARZA 1TL7C 5DH9A 5B30A 2CK3D 4OK3A 5JSZA 4L16A 1LB1B 4WA7A 3ADCA 3A6PC 2C96A 1R7RA 4US0R 2CMKA 4V03A 2PMDA 3PCRB 2OLJA 1OFTA 2QPAA 1E9AA 1S8FA 1P75A 2ZSBA 1S4QA 4DCSA 2A7QA 4ESVA 4Q01A 2B6HA 1G3MA 4PO1A 1EFCA 2F1RA 4L8GA 4LPKA 2R8RA 1N25A 4B3GA 1XMVA 2QRZA 3AVYA 1AQYA 2QP4A 1G4UR 1YR7A 3K9NA 2ZR9A 1UDWA 4DLWA 1TPZA 2WOOA 2GCOB 1DBSA 1SQ5A 1XB2A 4IXNA 1Z3IX 5DNYB 1GM5A 2A5JA 4RKFA 3SJZA 4RCZA 4BEBA 2IEYA 3MGCA 1A1VA 3SOPA 2ODNA 3CONA 3WXMA 2FU5C 4BGDA 1ZU5A 5HPYB 5JCPA 2G9NA 4K8OA 2IW3A 2REBA 2PJZA 2ZUBA 3WYFA 1ZM4A 1FNMA 4HAVA 4RZ2A 4BLTA 4D0LB 1DVRA 4KFTA 3K09C 5GJBA 2YOGA 1HE8B 1QVRA 1KK1A 2W6JA 2PBRA 2ZIAA 4KVGA 4CEHA 4OI0A 1EX6A 1YZNA 5BW8A 2BC9A 2IS6A 1AIPA 1G5TA 4MH0R 2BM0A 3EZ2A 1MOZA 3LXXA 2VP0A 2VEDA 2ZS7A 1FW6A 2ZJBA 3PFIA 4UQOA 3Q7QA 2QNRA 2Z6VA 3SE0A 2CEAA 2FFBA 2YYZA 3IQXA 2IF0A 1CEEA 3AV0B 2XEXA 3AF0A 2GCOA 1XCMA 3BXZA 2ZXUA 1XEXA 2A3RA 3ZVLA 1GP2A 1M7GA 4TT3A 1NN0A 3OFND 2ZAMA 4PPGA 2OUKA 1MR3F 1KSJA 1JECA 4H1UA 4H1VA 4DZZA 3T61A 4URXR 2XZLA 3AVUA 4RFSB 1XD8A 1RJ9A 1TAGA 1MABB 2QQ0A 4DT1A 1E0SA 4C2TA 3I92A 3PR1A 2V7QA 3QPUA 1US8B 3IIJA 4UKDA 4MRRA 1D6JA 4PC6A 4BFVA 5HZKA 3EC2A 4NCHA 1T0JB 3NC1C 1RRFA 5G41A 4Q00A 3ZZTA 1LF5A 2AR7A 1CS4C 4C4PA 3THYB 2F7SA 1KI1A 3DPUA 2C78A 3A36A 4TLCA 4FXPA 1W2GA 3KXLA 4QM7A 1NP6A 1OFHA 2GDJA 3PV0A 3SS8A 1JR6A 1KO4A 4HSEA 3OEED 4ZIRA 2QTHA 1WRBA 1KK3A 2VP5A 2WIBA 3Q7PA 1VG8A 4QNMA 3QUSA 4QBGB 1LV7A 3CNOA 3FWYA 1G8PA 1EFRD 4EPWA 4PHFA 1F60A 1JXMA 4LHZA 5IT5A 3S1AB 3I61A 1RFLA 4M1KA 3QIAA 4PQYA 1E9BA 3HDTA 5CJ2A 1IONA 4IEEA 5B58C 4M9XA 4QOSA 5FBVB 2P6UA 4PPFA 1G8GA 1JXOA 2GJKA 3CZQA 5EP2A 5J4HA 5DI3B 1VG0B 4CF7A 4M9QA 3FKQA 3W5JA 1KSGA 1YJ5A 2B21A 2A5YB 4PPQA 3NBXX 5KNCA 1G291 5FPSA 3ZH9B 1ZUHA 4Q7JB 4M1MA 2ZRMA 2YVUA 4W9MC 3HP1A 3TLXA 5KU1A 1JNYA 1KI6A 1GDDA 4RKEA 2ZYWX 2HUPA 3I62A 1UDXA 2GCNA 3ADBA 1GG2A 5FOWA 2BJVA 3QEJA 2XJ9A 5FUWA 1YZUA 4URUR 4V0MA 4PSAA 5DHAA 1D2EA 5FPHA 4HYYA 1HEIA 3QKSA 1EG7A 3MWYW 1JALA 2VQSA 5IDVA 4TTPA 3T06B 4B73A 5B2ZA 4ZCMA 1CR2A 4TMZA 2W6JD 4RVCA 3W8NA 3WY9A 4HAZA 4OJQA 2J7KA 3EWSA 3RS2A 3PUVA 2GCPA 4S35A 3THYA 4BFXA 1R10A 3WYAA 2LWIA 4P3YA 4JT4A 2BBTA 1TU3A 3VU9B 3KJHA 3M0EA 1UJ2A 2W6IA 3BH6A 4DCNA 2Z5FA 2F9MA 4A6XA 2CBZA 4TQ9A 3U44A 4X8MA 4IDHA 2GHIA 1NLFA 2G1KA 2ODBA 5KHOC 1Q44A 4H9GA 3ZIAD 1N6KA 5EQTA 3K53A 2QMOA 1JB1A 5G40A 1XXHB 4LY6A 5A0FA 3TGPA 3CRRA 1OKKD 4G0NA 4GZLA 4AWXA 1IN6A 4MRPA 3VQTA 2GZDA 2AFIE 1Z2AA 3GQBA 3LW8A 4M1SA 3RS5A 1FUUA 3CH5A 1E2KA 2WBLC 3D8BA 3EIQA 3ZD6A 2NO1A 1HTWA 1JAIA 3W8RA 1OH6A 1MKYA 1GRQA 5CB8A 1DAGA 1TF7A 4IFBA 4P0TA 5FR2A 1AS3A 1OT3A 2IYUA 2KBEA 1T4GA 1TMKA 4IDQA 3CPHA 4PC7A 1HYQA 2XXAA 3A4NA 2ORIA 2QSYA 2I4IA 2ZRJA 3OE7A 4US1R 1KSFX 1H8EA 2F3RA 4JYCA 5DYIA 5JSZB 1VIYA 4DJTA 1CRPA 1E4VA 5H8WA 4JKIA 4D4LA 1DADA 2BIFA 4QGAA 5EE5B 3QSYA 3B5JA 2PZEA 3T34A 3SHFA 1NMXA 2IXEA 1QHHA 3E5HA 5FOUA 5CM9C 5AUQA 1Z22A 2ZRHA 2ZITA 1ZNWA 4XWKA 3NEJA 2CLDX 2FSFA 1M7HA 1D5CA 1KO1A 4UXIA 5SZKB 1RPZA 1OIVA 2AX4A 2K5UA 3BE4A 3QF7A 3GLGA 2C03A 1SKYB 2ZUDA 4HAUA 1OIWA 4PTLA 4DC9A 5LPNA 4GT1A 4JVLA 2CVFA 4DB2A 1OH7A 2H57A 1S1MA 2D4HA 3I8XA 2QBYB 2FA9A 2QORA 5EUQB 1HE1C 3T5GA 5B64A 4Q4LA 1ZMXA 1U99A 5KUTA 1KYIA 1E2DA 1GTVA 1MO5A 4HDQB 1BMFD 5L8VA 2QGZA 2X1VA 2JDID 3PEVA 3W34A 4PQRA 5DI9A 3QNUA 1XPOA 3TQCA 2IBMA 2XTMA 3OZXA 1XFAA 2G0TA 2EYQA 3DZDA 5JHHB 3V4RA 3JVUA 1BH2A 5IK2D 1W36D 4B74A 3BGWA 3K9GA 5EE3A 5EP4A 5FBQB 1KK0A 3ZJYA 4M1WA 4D80A 2OCBA 2RHDA 2J1LA 3LX8A 4GNKA 4KLNA 4D2IA 4IDPA 3G82C 1P4SA 2FEMA 3M1IA 5DN6A 3VR3A 4BWYA 1U94A 4FMDB 2B8TA 3NDPA 4ZKEA 4IW3B 2ECKA 2KB0A 4Q9IA 1E2IA 3KKPA 2RCNA 4UNQA 1MH1A 2GEDA 3OIWA 3RLFA 4KITB 2CHQA 4MRNA 2BBSA 1NNEA 1KO5A 3BJIC 3Q72A 1KY3A 2VRWA 4RZ3A 3AM1A 1Z83A 1MO3A 2RGBA 1CJUC 4DRZA 4U00A 3EAQA 3K0FA 2ZVPX 4HEJA 3TKLA 4W5WA 5J47A 2DHRA 2ZU6A 3BORA 5F2EA 2AKAB 5G3YA 4HAXA 3FKSA 4PO8A 1DG1G 5JWRA 3EC1A 3CWZA 2PL3A 1W5TA 1AZSC 4HLDA 1S0UA 4WZ6A 5JI3E 2B7CA 3AVPA 4D6PA 3BRWD 3DO6A 1A2KC 4RD4A 3BH7A 3O8CA 4WOPA 3VNUA 3LA6A 2O0JA 3DM5A 2QG6A 1VG9B 1ZC3A 4UJ3A 2FX3A 4OQXA 3RS3A 3R8FA 2YHSA 4B48A 2J7PA 5AJZA 1JEEA 1KI2A 3OEEA 1ZINA 3PIRA 4A15A 1F3OA 1SKQA 1H8ED 3C8UA 1Z0AA 3FMOB 1N6PA 1SZPA 2ZYUX 3DMDA 5KOYA 4OYHA 2VP4A 3FFAA 2IYSA 2C77A 1E2EA 1OXXK 1VECA 4QJ4A 2BBWA 3TUIC 4CDGA 2EFHB 4IOMA 3THOA 3LDAA 1H8HD 1YRAA 5KNDA 5TMPA 4MDFA 4I1UA 5HE8A 1P2SA 1XRJA 2ZRFA 3GLFB 1R0XA 5UKDA 1G6OA 2QRNA 3PUZA 1MV5A 5CM8B 3A8TA 2ONKA 3ZLJA 1M6NA 4IDOA 2AWNA 4DUGD 1NVWQ 2IF2A 4KYUA 2FFQA 4MYCA 3R9XA 3VTKA 3PEYA 4Q4HB 2FZ4A 5HCNA 1UEJA 2GXSA 5FH9A 1CR0A 3WHLA 3KFVA 4FINA 1N5IA 4Z8XA 5H1YA 2JLUA 2C9OA 2YWGA 2OBLA 2XSZA 1ZM2A 3CF2A 5HTKA 4B76A 5CLQA 4LYJA 2NPIA 3OIYA 4EKDA 1Z6GA 4QHSA 2IX3A 1TUEA 2ZEJA 1P3JA 1G64A 3T35A 3L2OB 2GNOA 2WZQA 1Z6TA 2VL7A 4BZQA 2JLXA 5FFMA 3AKEA 4M2LA 5C4MA 3KJGA 2LKCA 4LSGA 4ACAA 3U4QA 3AVXA 3W6PA 1QZXA 1QHIA 1CIPA 3CX8A 4PPNA 2GZHA 3LW7A 1HT2E 3IIMA 4TSFD 4ZV4A 4AURA 4LJ8A 1JBKA 3RS4A 4Q1FA 1MT0A 4YMWA 4AY2A 3F8TA 4ZO4A 5FR1A 2ZVQX 3X1XA 4NONA 4TTRA 1AK2A 3BB4A 1NVVR 4Q18A 3U3RA 4DLSA 3C7KA 4OQLA 1XMJA 1CR1A 3QVUA 2IYWA 4JKYA 4OI1A 2Z43A 4V0NA 4BECA 4HUQB 1N5KA 2FSIA 1G3IA 1OIXA 2ZRAA 1FUKA 2VP2A 1XXHA 3ETLA 4ZPXA 4EFMA 3K9LA 1DAMA 3P1JA 2WSSA 3ZIAA 2WVJA 1T3LA 1J8YF 1P5ZB 2F6RA 2H5EA 4KO8A 2HDNB 4JLPA 1ZRHA 3LH5A 4RZUA 4TYQA 1OPXA 4WAUA 4YC7A 4M1YA 4PSKA 3SHWA 1X86B 1ZVQA 1Z28A 4G5RA 1EFUA 3CM0A 4FN5A 4RD0A 2RGCA 4DLYA 5IF9A 3BAFA 2ZR7A 3THWB 1W0JD 5DE3A 3LX5A 3OHMA 2PCJA 2FFHA 2IYRA 5KDDA 2XXAB 3G0HA 3LFUA 3TQFA 1S3SA 4Y0AA 5D3MA 3BERA 4PO9A 4Q4HA 1P72A 5E95A 3AKDA 2N42A 4YDHB 3B1VA 1ZW6A 2ZE5A 2QMHA 1OFUX 2EU8A 4CEIA 5BYKA 2CL6X 2JATA 4BE7B 4DLVA 3TVDA 1KJWA 1KI9A 1R6BX 2A5GA 4Q4JB 4D81A 2EFEB 4NU0A 3VR6A 3H1TA 4AYWA 1EXMA 4Z1MD 1HURA 3TVTA 2J0SA 1XJCA 5HCIA 1Z6AA 3V00A 4MGKR 2WICA 1QBKC 4QGHA 1VG1A 2JCSA 4NPHA 3PUYA 4X8OA 1EFTA 2ZRDA 4DLZA 2GVZC 4IRUB 1RW4A 2QQEA 4RCYA 1KNXA 2ZUCA 4DSOA 4HB2A 3KTAB 4OQNA 3TAUA 3TJZA 1M8PA 3LO5A 3X1DA 3NEYA 5FOXA 4LHVA 5TXGA 1X1SA 2DBYA 3QXJA 2PX3A 1XEWX 1RYFA 4GI7A 1I2MA 1NSTA 3B60A 1WP9A 3VAAA 1Q21A 4IFEA 4XJXA 2XB4A 4F7WA 4TLEA 2BOVA 2VA8A 4XWOA 2ZI6A 3EZ9A 4FMBB 1YR9A 1N2CE 4II7A 1QG2A 4Q19A 3CUEF 1G41A 3WMFA 4HB4A 3V9PA 1OF1A 3RANA 2EW1A 1TX4B 3W6OA 3GJ0A 4JLBA 3HYTA 1P73A 3MAAC 5EXSA 4BZXA 4TSFA 2XJ4A 2DWPA 2J0UA 1NVUQ 2NO6A 1P2VA 3KJEA 3LY5A 4FCTA 1VYTA 4KHZA 1OLOA 1UKEA 4A8JC 2AK3A 1M2OB 3PJRA 3TAHA 1CXZA 3KXKA 4NZYA 3NBFA 2DWOA 4LJ5A 2MSDB 1MO6A 1ZBDA 1CULC 5AK0A 2DFKB 1CTQA 4HB0A 3DOFA 3NH9A 3O8DA 4ZDWA 4B3DA 2N1BA 1VKJA 4C3ZA 1EESA 1E2MA 3R8CA 3A4LA 2GK6A 5L3RA 4B43A 3SJCA 4R9UC 2QAGB 2WHXA 2WWFA 3ZYCA 4JJKA 1VHTA 2JIZD 1KO8A 1IN8A 1PVOA 1N6NA 2LCFA 2A5DA 2JA1A 4CVNA 3CF0A 2Q9BA 4ESHA 2D7DA 4KSCA 4MA4A 4I81A 3GMTA 4IVRA 2IUTA 5FI1B 1OHHD 1GITA 4Q1AA 5EUMA 2FF7A 2DFTA 3MWJA 4HLQB 4C0QC 1E2GA 3VR1A 4EFLA 3ECCA 3X1WA 2B7BA 5P21A 2JLWA 3ONWA 3REFA 3JZAA 2LKDA 2H7VA 2QGNA 3CR7A 1XCGB 5JBQA 4C7OA 3KB1A 1J7KA 2OBMA 2XNSA 3W90A 1U8ZA 2W00A 3FE2A 4NL4H 3UIEA 1E2LA 2ZRNA 3B1XA 3GJ8A 4B3BA 2ORVA 4NDZA 3SYNA 3KQHA 3I5XA 1ZIPA 4URZR 4GRAA 1JJ7A 4NCJA 2QUZA 1UKZA 4B3FX 1PLJA 1IM2A 4G1UC 5JEEA 3GEIA 4O25A 1NSFA 2OCPA 1SKYE 1GIAA 3EWAA 2GF9A 4FD2A 2VP6A 1Z0DA 3L43A 4RSGA 3U7GA 2VHJA 2WAYA 2J5XA 4DDVA 2G1JA 4BFWA 4TYNA 2WJIA 1W48A 2I1QA 1JPJA 4FCVA 2OAQ1 1K8RA 5G53C 4ARZB 4LJ7A 1XU4A 5IHPA 3SC3A 1PLLA 1U8AA 2BMEA 2CCGA 2REOA 3LAWA 5KO2A 4BLPA 1UBCA 3UG6A 3EZFA 2IXGA 4C7OB 4C0AC 2FV8A 5LBIA 2OM2A 2IYVA 3AUXA 1Z07A 3IEVA 4GFDA 2IYZA 4V0OA 2VSOA 3SBDA 1ZUNB 2AXNA 2RGXA 3QXXA 1DS6A 4A2QA 4TYYA 3UMRA 4ASUA 2QE7A 4MRVA 1G7CA 1N6OA 1YHNA 4TL7A 1GRNA 3WP0A 3ZS8A 3AP3A 1IBRA 2P67A 1TEVA 4KV9A 5DHFA 3LNCA 1P9NA 4DUGA 4K46A 2YJTD 3RWOA 2V8OA 3FPAA 4DVGA 4KBGA 1WCV1 3W3ZB 1LTQA 3B78A 4B3XA 4A82A 3CPJB 1G20E 4A0HA 3MG9A 1NMZA 1N3BA 4QJ5A 4D0NA 2R6CA 1GOTA 1KMQA 5EZ5A 4DB4A 3T1VA 2CNWA 5GVSA 2JAQA 3GLIE 4C0LA 1WBDA 2FPMA 2JLVA 3L0OA 5FBRB 4NYJR 3W6NA 3PQCA 3QF4A 1G6HA 4M1TA 3CZPA 3ZGXA 2QZ4A 4NTZA 3EIEA 1OB5A 2ZR0A 1ONBA 3THWA 1EGAA 2NOAA 5AUOB 3QBVA 3VU9A 1XZQA 1KI7A 1NY5A 1S2MA 4LV6A 2V3CC 4I99A 4N1AA 4HLUA 3SI7A 3OIUA 4B71A 5D3MB 4A36A 4KLZA 2REXB 4JYBA 2XZOA 1RIFA 3I72A 1W0JA 1AJEA 1S3GA 4AG6A 1F48A 1TUIA 521PA 1OV4A 8OHMA 2UVQA 3FVQA 4UXJA 2YWFA 3ND9A 3KKNA 3LBHA 1H65A 2ATVA 3WNBA 2JLRA 4Q7KA 4MGZR 4EPXA 1NI3A 2PLFA 2IYLD 3EZ7A 5BQ5A 721PA 4M53A 3FDIA 2X77A 2IS4A 2OFWA 3U6KA 3AKYA 1RJ9B 4C2UA 2CJWB 5JMTA 1TQDA 1XTQA 3BB3A 3GD7A 4OHYA 1HA3A 2BVNA 1XTRA 4YMVA 1Z6XA 1ZU4A 4X8HA 3EX7C 3OESA 1GL6A 1RYHA 2VSXA 3DM9B 3BK7A 5FBWB 2OCAA 1OXSC 1Z47A 2WWIA 4JBXA 2HF8A 1Q3TA 5E4FA 1JAHA 2EFDB 1OXTA 2EFCB 4O2LA 1IY0A 3CPEA 1U0JA 4DHEA 2VHCA 2GA8A
chains in the Genus database with same CATH superfamily
2W2PA 3Q10A 4P84A 1XJ0A 4BASA 2DBRA 1XRPA 3VSBA 4DMMA 5KWEA 3SX0A 4EWLA 5G0WA 3NDBB 4J0DA 4UBLA 1ND6A 1KYZA 4A2CA 4PU0A 1VYHA 2CFTA 4MA0A 1XC7A 1QK5A 2NAFA 4FVTA 4K9RA 5EKDA 1SO8A 2FWMX 1L5HB 4BN0A 2MR6A 4DOMA 3Q5GA 4GWGA 5JZVA 3K2QA 1D2MA 3BIWA 1SHUX 2JJ8A 2OZLB 3EGIA 1A9XA 3OOJA 2ORWA 5TJHA 1DQSA 1EM6A 2VUHB 1IPHA 5D5PA 4CCYA 3MJSA 5LMZA 3KUDA 3C97A 2WJJA 4MB6A 2DUUA 2MSCB 3GEDA 1EX7A 3JQDA 3OOSA 2NIPA 3K70B 1ZSNA 2FOLA 3OQJA 4DMLA 4UDOA 3QU2A 2YNMA 2E1RA 2F8LA 1AO3A 2MIIA 3DEAA 1ZY2A 2IHUA 3F5FA 3P5BA 4FZJA 4R6XA 5DTRA 4GMFA 5KQLA 3ANTA 3D3WA 5H68A 4BX0A 1FJGB 1E69A 1AT1A 1RE0A 1P62B 2EJWA 1L5ZA 3B3FA 3GLHE 4K6HA 4KK4A 4R7GA 1ODKA 4F45A 2H9AA 3M6WA 3VO9A 4L5BA 3BGVA 4RHTA 1NNUA 4OYLA 2OYCA 5KTNA 1B3BA 2I55A 3GLSA 3HSSA 4MQUA 4O4LB 1CY1A 2QTFA 2QX4A 4TN1A 1D0SA 2BEJA 5HPYB 5KQRA 1Y6GA 2HIGA 3BEOA 5PGMA 4TM8A 4NCNA 1C9DB 2ZYHA 4QTXA 8ABPA 2AOXA 2JPDA 3B6ZA 4Y2PA 2VDJA 1LI5A 2HHJA 2O48X 1QV9A 1S1CA 2AC4A 4HJRA 5TQ0B 1NTOA 1RAEA 1FX0B 2XGMA 1J99A 3D1JA 1L5KA 2C5EA 4DR3B 3WYGA 4EABA 3B9QA 2YV1A 1M2VA 1SC4A 2HU8A 2QTGA 3HMQA 4MHTA 3PE3A 1IXRC 1XSEA 2FPOA 4NBTA 1UQTA 1A4RA 1MOQA 1SHJA 3WO0A 1QFXA 3PS9A 3MRVA 4KP7A 1YQTA 3M4ZA 2KI5A 1YFJA 1DQZA 4R0NA 2G82A 1I94B 1T1RA 1Y1PA 1RPAA 1PJCA 5JDCC 2GXQA 4GP9A 3WMGA 1KP9A 2ZPAA 4HAIA 3GT0A 1PU2A 1ESZA 2ZE6A 3GP5A 1RVDA 2ZBFA 3D3WB 4X8LA 2OV6A 4JUDX 4PZZA 2HNKA 4YRTA 3A6DA 1BS2A 2YJ3A 3PQDA 1VDMA 4GMXA 3RVBA 4MQEB 3VH4A 1PUJA 2ID7A 4YJGB 1JG4A 1RWWA 1T9KA 2MYTA 1QLHA 2P6PA 1UKAA 3DOOA 3OTQA 3ZXYA 1OLUB 1G1MA 1GPMA 1RMTA 3O4JA 5E2BA 3U81A 4KHPB 4MMZB 1AQJA 3AM3A 2PD4A 4H35A 1EI9A 3SBEA 2DX7A 4UU7A 2OECA 4E5KA 1XQXA 1IOZA 5IBCA 4XWWA 2X3YA 4Z51A 3Q3IA 5K6TA 5AK4A 2GN0A 4DDHA 2AUMA 1KJYA 1RWKA 1Z0IA 5JD5A 3L8ZA 1XPJA 2Q07A 3VHRA 1II8A 3KTFA 3FUXA 4TWZA 3RBZA 3N0TA 3T3EA 4UEOA 5LOVA 2CLIB 4TYWA 1TXGA 3HXPA 5K09A 1GPBA 1YJBA 2J32A 1HE5A 2IQIA 1GR1A 1UBGA 1KETA 1EBFA 2DHDA 2YC2C 3RM3A 4G0WA 4B6PA 1IN7A 3QBTA 1PS9A 4GKJB 1ZMRA 2VDVE 1DIRA 2X5KO 1FA9A 4JFAA 3EQ6A 3BWYA 2C82A 1JA0A 1NJ1A 2OXEA 2ZDHA 3I73A 1W1IA 4FNGA 1VGRA 4KQMA 4MV0A 4CLHA 4RLSA 1VJRA 1SCUB 3P9IA 3OLQA 4HGOA 1Z7WA 2L69A 3MTEA 4M21A 1UPTA 5B1IA 5CFPA 1XWFA 3TRJA 3NP7A 4F4DA 3A6EA 3VSAA 2H2AA 3DDSA 1V35A 2REQB 3QYFA 2P68A 3P27A 4AUEA 4DCGA 4DIDA 4DLXA 3U7QB 3LIPA 2I7VA 4EJ6A 1HNXB 4L50A 5JT1A 1FVHA 3EPHA 4GOKA 5F12A 3OWOA 4BWGA 5BT8A 4PCLA 5A6SB 1T5SA 2J0EA 4LQDA 1WSBA 1WB9A 3FZQA 2E7ZA 2HXSA 1NN5A 2ZUEA 1FP2A 3VC7A 1LVHA 2VAPA 3H6HA 5IM5A 4B47A 2QJFA 1LW6E 1NOKA 1YHYA 1GFZA 3HLKA 2I87A 2QLMA 3ND8A 3IKVA 4KOAA 4RK1A 3UVEA 4F60A 1GFIA 1P9RA 4YO7A 4EY6A 3I39X 1E6UA 3QHQA 3C1TA 3QXCA 3NAGA 3FZGA 2E4VA 3P52A 3EQ8A 1AKMA 4TV8F 4C4RA 5FPKA 5JTUA 3HG7A 2FLWA 3Q0EA 2QTWB 4G63A 1M5TA 2VHXA 3B52X 3P2YA 3SZ3A 4G5QA 1LSOA 5IN4A 8ADHA 1II0A 4V2IA 1QTRA 3SEZA 3NEAA 3O8NA 4F4IA 4M9RA 3KJQA 1NVKA 2VYNA 3AF2A 2DR3A 4IX1A 1VB5A 5IVIA 4BB5A 2L0XA 3AILA 4LFBB 2NO7A 3JVVA 1W0CA 3D64A 3NC0C 1CVIA 2R9VA 4MGIR 5EWMB 3JQQA 4GPZA 1A9TA 3ROTA 1KEUA 2E9SA 4C7MA 4M0DA 4CQNA 1F20A 1W36B 1CJSA 3USES 4TUYF 1VJGA 1GJRA 2OQVA 4M54A 1E32A 1R2QA 1YBVA 3C45A 4ASUD 1WABA 2INGX 4Z54A 3T3PB 2FSGA 5IAEA 1OA1A 1ZA2A 3LHKA 1B23P 2DBQA 3WC4A 4EW2A 3M6LA 2FPIA 2VRCD 3HJTA 2RKWA 4Y6LA 1E9VA 2OESA 2JIRA 4BB9A 5E3HA 3ZOKA 4MVJE 4ZI3A 1KI6B 3QFCA 5AUNB 3PJDA 2Q6TA 4Z8YA 3I8OA 4BMVA 5JDCA 2R0QC 3FHLA 2EQ5A 1Q0PA 1SVOA 2NZUG 3HL0A 1KFCB 4Y9UA 3WWOA 1D0IA 2CKDA 3M6MD 2VTVA 1ZUIA 4CG0A 1Y7LA 4G24A 3FWKA 2PZGA 3NHKA 4XPZA 5JI2E 1U4SA 4BV2A 2OCLA 1E1RA 2Z3VA 1N0UA 1TADA 3D5EA 4OFXA 4A03A 4IXTA 1EB9A 4DLUA 5IKOA 4M1EA 1RC1A 4CM1A 2CLCX 2Q8QA 3ZR4B 2YUIA 1ZGBA 1T8WA 3OEHA 2P5UA 4MPRA 5FTLA 3TZQA 4POAA 1E58A 2CZGA 2HNAA 3O2NA 3H2JA 4GF5A 2FSHA 2UUPA 4LVNA 1A95A 2W8BA 3DE0X 3V8EA 1O6GA 2JGFA 4IRXA 1JVNA 1KL7A 4RPLA 3E5MA 1EZZA 3H9JA 2YW9A 1BTOA 1V16B 1VJDA 3S2IA 4X20B 1XMQB 1T35A 1N2IA 1M6EX 3D7KA 1K92A 4B2IA 3MLEA 4YQFA 3VX4A 4LF6B 4WINA 2C4WA 4A0GA 4CIYA 3FTFA 3I3OA 4N5MA 5SZJA 4YMGA 1L4NA 3KSUA 4LYGA 1XHLA 2B98A 1LF0A 2ZRBA 3HNPA 3IXMA 3WWPA 3EPKA 3OPYI 4OQFA 4NHEA 3T5TA 3CRZA 1LBQA 1C4OA 2O2IA 4TVOA 4U7HA 3KJZA 2H65A 1JU9A 4MYTA 1XCPA 3QUAA 2JDIA 4BNXA 3ELUA 3SJAA 1VL5A 1V9CA 1ZAKA 4UTXA 3I6BA 1NQUA 4Q1EA 4AS1A 1FF9A 1FLDA 1L7XA 4MJXA 5KYXB 3GGOA 2H17A 1T3SA 4YB8A 1OW3B 3THXB 4EYQA 3GLFA 1ULUA 4BKRA 2YOHA 1VLJA 4NR0A 2BMFA 5SYAA 4HUTA 4IMIB 4R69A 5KVAA 1EVKA 4HGNA 4MVYA 1PGJA 4Q3AA 1JHPA 4C0XA 2OGUA 4XLLA 4L08A 4RK6A 2JH9A 3RQSA 4D82A 1NYQA 4MEAA 1ZOLA 4KBFA 2HF2A 2WMNB 4IGFA 2WU0A 3WLEA 1U7TA 3HVHA 4KR6A 5P8WA 4TZ6A 4RKYA 4AJEA 2Z6QA 5I7FA 4KSBA 4US2R 1F2UA 3C2QA 3P20A 4LC0A 4WBNF 5ABPA 4O3FA 3DBLB 1RZ3A 2HMAA 4D3XA 3VDRA 4DEXA 2X5JO 2PZKA 2RHTA 2IIBA 3CC8A 3IAEA 1RI3A 2GHTA 1O9HA 1Q74A 3SX2A 2AHOA 2RARA 2AMLA 3W3AD 3L82B 3Q7TA 2QF7A 4LHXA 2R86A 1U63A 2C8LA 1FXSA 3AFIA 3OX4A 3Q1KA 4EY3A 2JKVA 3CLRD 1I3NA 2I2FA 3M3DA 2J3LA 3SC4A 1FSSA 2QLJA 4EM6A 4YCJA 3BB1A 3EZGA 3WLFA 1ZISA 3JQAD 3WP1B 3LGAA 2OXRA 1GGJA 3H97A 1ISHA 4CF5A 5BUSA 1SC3A 2NSYA 2XYRA 3I09A 5BSTA 1IEVA 2R62A 5JAMA 1WEKA 3WX0A 4NCIA 3TLKA 4BDTA 1KY2A 4P4UA 1N9ZA 2R87A 2F17A 5EIEA 4ZODA 5CK4A 1N4AA 4G2TA 1XFDA 4WXHA 3GJ3A 3MUFA 5IDWA 3FLEA 3AEKA 4G5GA 1JR3D 3OAAD 3O2JA 5F33A 5AI8A 2ECQA 4KIFA 1JRLA 2IUUA 2ILVA 1IUPA 4B8YA 1K63A 3A1TA 1SQSA 3TXXA 4J0GA 2NQ2C 3HI6A 1J9EA 1VPTA 3TWOA 2GTHA 1YFKA 4NMHA 2YYSA 2W7TA 3RUIA 2H9IA 3OJOA 1G5PA 3O4GA 1M2GA 4J0QA 4M0CA 3HJGA 5JV5A 4DBLC 2HLDD 3E9EA 2TMYA 3QWFA 5LZ7A 3A32A 4UTRA 3I23A 4RJIA 5EJFA 1JWBB 3ZWBA 2OG2A 3DMPA 1NUSA 3H5TA 5GVRA 3AWDA 3TFWA 3CFYA 3P9RA 4YT2A 4ZCQA 3S4YA 3U3ZA 1G38A 2AMJA 3ESYA 1HQCA 4DVJA 5JROA 4RHFA 3VAYA 4P82A 1Z2PX 4IHQA 4UUAA 1GDTA 3JV7A 3UJ9A 2Y93A 4A2PA 4ZYTA 3SF0A 5JD4A 5CIWA 2AK2A 1OY1A 1R4NA 1H94A 1JI0A 3AR6A 3DHEA 4RFVA 4WIAA 1BU5A 2G6BA 1K0UA 4XVQA 3SJUA 2MOKA 1K2WA 4DV4B 2XODA 5EZYA 2H2DA 3DAHA 2N46A 2QIOA 3GPLA 4ER5A 3SIPA 2ZQYA 1ZQ1A 4AN4A 4OVKA 3GUUA 1S8AA 4DJFC 2QLFA 2F59A 3PSAA 4L15A 3M82A 3T7DA 3FNHA 4Y67A 4DARA 3MTAA 3ASZA 7ADHA 1FNCA 2NUTA 3HN7A 3RW9A 3DCJA 3N5CA 1M2NA 1U2DC 5JD6A 2O2DA 2R00C 3G2QA 3W5HA 4EATA 1K75A 1NR7A 1P5JA 2I4MA 3H2KA 3SKYA 1JYSA 1Y1LA 4FJ2A 4KXVA 5IJ9B 3TG8A 4RESA 3ER9A 3VNRA 2Q9UA 2I1VB 1EJBA 4ZYWA 1ICIA 4R7ZA 3N86A 4NEHB 4TPKA 2QG9A 1I33A 4B4DA 1ENPA 5DTQA 2XQFA 3ZCPA 2AFHB 1GAJA 1TM4E 2ZJ2A 4FS8A 3IESA 4EJSC 1XEFA 5L3QB 1RLOA 2AEEA 2RAVA 2VZLA 3K96A 2IEDA 1ETUA 1JFVA 4WFJA 4LWQA 3SR0A 4D4IA 1T2EA 3UWOA 4QUIA 1T24A 2PQ0A 3CXUA 5PNTA 2C9CA 1O6FA 4MS3B 1APBA 1V7ZA 3W77A 4BS9A 5J40A 2X1HA 3PQ6A 3QYJA 5ITVA 2EW2A 2ZWOA 3VA7A 3KX2A 1S02A 2F3QA 3CIOA 4A2WA 3CW9A 3MGGA 4CTNA 1Q0TA 3N2YA 1GRVA 1JDNA 3WIUA 1I4OA 4E09A 2F43A 1Y9DA 4NU5A 1ZCAA 4YECA 3BE5A 1A2BA 1KKLA 5AXDA 3IQWA 3WWZA 1N6LA 2Q8PA 2I1LA 2R7KA 4LBYA 3WSTA 1ZC4A 3ZPXA 1NQVA 3FY4A 3S2SA 3L8YA 1DC7A 4OQMA 1Z7BA 1Y3CE 3U62A 2RGNC 2SKCA 3HH8A 4JT8A 4OHXA 5TY0A 5BYAA 2X3UA 4UARA 4CEHB 4NK4A 1ID8A 4DT1B 4TXLA 6PFKA 3GT4A 3MWKA 3Q9SA 1UC5B 1DT3A 1DX6A 5B36A 3GMSA 3H83A 1A5SB 3QXSA 4UUPA 4HMOA 4E2YA 1E2HA 1XZMA 3NFYA 4FJ0A 5IJXA 3WQSB 2GD2A 2ZYVX 4K26A 4O59O 1U0HC 2WTBA 4P7JA 1I0LA 3B8HA 4PBTA 3OT1A 4PBRA 1TYBE 1X7YA 4DDUA 3JWJA 3QTBA 2BV3A 1XZPA 4D9FA 4RL4A 3QG1A 4YFYA 3D8HA 3R9IA 1KBOA 5CAEA 5JASA 2PRJA 2VNSA 2HBQA 1BX3A 4R9NA 4DBZA 1VJ5A 1LPOA 4PX9A 3RUEA 1RM5A 4J1TC 4H7JA 3WB9A 1YD7A 2VQFB 2BMDA 2VJBA 3ZV4A 4G1BA 2PJRA 1U2EA 1FFXB 4R2JA 2RIRA 3H9CA 1VGQA 4DNPA 1W34A 2XOKA 4D42A 4XWYA 1GPNA 3DEFA 2V1UA 4YAUA 4BXOA 3OIFA 5ALHA 3TBFA 3IGFA 4WUVA 4HV4A 3P26A 2AMFA 3KQNA 2HDWA 3U7RA 1JAYA 3QPAA 3EIUA 5I51A 3A1EA 3EXFA 1DJOA 1SUBA 5IYZF 1POWA 2KW5A 3CWQA 3VDQA 4CGYA 3ZHUA 5BNWA 5AO9A 4MIYA 4H0FA 2Z6AA 4RTMA 1LBEA 1QHNA 3ER6A 4RSRA 1DQYA 4TMKA 3WTCA 4K6MA 1XTBA 5LN1A 4L8WB 3B48A 2JLYA 1X3LA 3UJAA 4PR0A 3DOJA 4L4XA 2FSVA 3OT1B 4CGZA 5FB3A 4NK5A 3AF6A 3VKHA 4JJ8A 2D2EA 3FGNA 1DG9A 4KK3A 3TR5A 5GOTA 2PY6A 5LYYA 3VPSA 2G8LA 3IR5A 4PGFA 4NAVA 4ABTA 2J08A 1IWBB 5CFZA 3HJAA 5ER9A 4L0DA 1CKEA 5JAQA 5ELMA 1W52X 1Q91A 1E9DA 4TMVA 4WDRA 1KI8A 2HRZA 2AVNA 4DTCA 3I32A 4CT4B 3U4GA 5AVKA 4RPKA 1GA4A 4CEIB 3JRWA 1YZGA 2AL7A 2H1RA 1YONA 2CDNA 4DKXA 2LBPA 5F2NA 3U80A 3CT6A 1K66A 1U7DA 1B2RA 2UZ1A 3P0JA 5FXMA 3JS5A 1FRFS 3BMQA 3FNIA 1X7WB 4XR4A 3I9KA 1WDKA 1NBHA 2JGRA 1N1GA 2WIFA 3IMCA 4R8SA 4JEIA 3ZWYA 1EM8A 3S81A 2Y1DA 3T9FA 2V3CC 1B1AA 2FRXA 4G0ZA 3RYHA 1LK7A 1K3UB 1ZVJA 1FUIA 3HDVA 3LV8A 4MRMA 4PGAA 4HNHA 4EG4A 4OL9A 3ONVA 1J5EB 3AXSA 2O07A 4KAAA 4RX1A 2ZANA 2I66A 2VJDA 2RHGB 2AC7A 4ZYLA 1BJTA 2G4VA 4D46A 2BI7A 2VCEA 1N9KA 2BR3A 2YYAA 4CMIA 3TIIA 5ICSA 1HDGO 2II6A 5EWLA 1LH0A 1KZ6A 4E6EA 4URVR 2NT4A 1QU2A 1LRKA 4HJXA 5DTEA 3I0ZA 2DCUA 2H92A 3DTVB 5ILGA 4E31A 3ZJTA 2RHLA 1M34A 4RK4A 3EDOA 3ESDA 1UK7A 4LOKA 1UJCA 2I03A 2RB4A 3NT2A 5FI3A 5BNFA 5U4QA 4CKZA 1UT5A 2O0KA 3LBIA 1UMKA 2YVLA 3KC2A 1CF4A 1NNLA 1VL1A 3F4BA 4H6VA 1M1ZA 3WGTA 4M1OA 3GLKA 4TT8A 4WDQA 5I7SA 2YWXA 3E18A 4ZXFA 5ITWA 3AF1A 3ONEA 4PRZA 3WGMA 3SGLA 4A6PA 1T10A 1NRIA 4PRYA 3I3SR 3L7JA 3IE0A 3GEBA 3K31A 3L93A 3ZV5A 3PHBE 4AWAA 4BE4A 3WGIA 2E89A 3TNYA 4O1HA 3DBIA 5DGXA 2PS3A 4P4SA 5DNVA 1IC6A 4DC0A 3I4LA 1GD1O 1M2KA 1TJ3A 4KJXA 3FTDA 4WN3A 3MB5A 3ZCVA 4C0HA 4K6KA 4Y9SA 1VXRA 1GRRA 1G9XA 1EVLA 2Y0PA 3ISTA 4J1TA 2R7LA 3OWXA 4LPSA 1TEXA 1G2QA 3OQOA 2DMRA 3NIGB 2BKXA 5IBPA 3UJDA 2QTVB 1YKFA 3A2NA 3CR8A 3L0IB 4U6SA 1FP7A 4BATA 3E9YA 1RLTA 2XQVA 5CBKA 3OJEA 4D6XA 1POXA 4X66B 2FDCA 3KWLA 3VV2A 4ZCRA 5EJ5A 1QNLA 4AIIA 4EHBA 2D59A 1ZMOA 3DHNA 1E2BA 3NCTA 4NI5A 1ZK4A 5IZ4A 3OA0A 4TV9A 4R16A 5H83A 1T9ZA 1V43A 4WCDA 4ZMSA 3U40A 5KSPA 1G0OA 1D1QA 1OSNA 3GZNA 1ESEA 3NKVA 3ETDA 1QUFA 4XVHA 1ECCA 3DEYX 4L02A 1RHKA 4W8HA 4WOBA 3DR3A 3UOWA 3FLMA 1HRKA 1G3QA 2HLDA 2ZJ8A 4XQ0A 3SVTA 4KZKA 4PANA 1A4UA 4TSKA 1YK1A 4XKJA 2IWRA 1CRZA 3CY6A 5K0JA 5KYNA 2G04A 1P39A 3D6FA 2W4QA 1RJFA 1GZ7A 2IE8A 1T3TA 3BTVA 1KAHA 3M83A 4E33A 3RI3A 5HKBA 4KUGA 4HRVA 4JXJA 4BPBA 5ADUS 1FRZA 2ZSDA 5CEJA 5JIBA 1XMSA 3QLTA 3DDCA 4Q02A 3I1FA 5KNCD 1B8OA 2AFIB 1NN3A 2YXDA 3ET5A 3LMKA 3GYGA 4K9PA 4QQ8A 1C0IA 4RA9B 3CNNA 1SUPA 4CMHA 2CFOA 2WIDA 1E2UA 3WBBA 4GUAA 5DIFA 3GP8A 5L3SB 2YZ2A 2HIAA 1KMIY 3AF3A 3O4VA 5I47A 4RA6B 2X9QA 3GBVA 2C9DA 3QJ5A 3VC1A 1N2XA 2FG7C 3H6GA 2VXOA 2CDRA 1SEVA 1TD1A 2PN1A 4FBMA 4FCWA 2ERYA 3EBLA 4K9LA 4P7KA 1GNPA 1M8GA 3U37A 1C8LA 4BNDB 4RPJA 1DIGA 5DMXA 3KSBC 3O83A 2JARA 4NNJA 3KJIA 1Y1QA 1I51A 1QF9A 1D0VA 4TVKA 2JD1A 4ZCLA 1BKDR 3M89A 1E9FA 3L7CA 4V38A 3OD5A 2YX1A 2VHTA 2D13A 1E7RA 3GFVA 3CZ4A 3JQFC 1PGNA 2TECE 3LECA 4H3HB 3S7TA 2VJAA 2BGNA 1MG5A 3NH6A 3LXMA 1KYWA 1PJ8A 1XDDA 3W05A 3MLAA 1SXJA 4DV6B 4GDFA 3QWHA 1FSPA 4OBBA 4OHCA 2G83A 1OX4B 1WVMA 2D2FA 1U0SY 3CF4G 1Z15A 4AZ0A 4QBFA 1B76A 1OTHA 3ZTYA 1TM7E 3PZBA 3EDCA 3P2IA 3CB4A 1E6LA 4ND1A 1HGXA 4GBGA 4QXOA 4ZCTA 5KYWB 1M2FA 3VV3A 1KKUA 3H2IA 4BVEA 1R9NA 4PLVA 1Q0UA 4LHYA 1J8MF 3FYTA 4O4JF 2QM7A 2C1EA 1TT5A 4MOWA 4LE0A 2GESA 2PT9A 3K0EA 2OY0A 3N7TA 4KPUA 2XQIA 3OHPA 4EHDA 1M7BA 2VNHA 4LECA 1YB2A 4LC9A 4YJ3B 1YS6A 2WP8J 1KC1A 5GGXA 4B6FA 4BNNA 1S2OA 5EJ2A 1MA3A 1YOBA 5CLJA 2NW6A 3I9V1 2ODEA 3ZE0B 3CVJA 4XFKA 1T0UA 1Q0SA 2HR1A 4I3FA 3VTFA 1T4BA 3ANYB 1SG9A 3RC7A 3U4IA 2HCBA 3NJ4A 4G8DA 4OXQA 3V7WA 1NQTA 1H2FA 1P0IA 1FTGA 1QX4A 2GLUA 1OWMA 1JPNA 2GZRA 2IKQA 2OT3B 1HF3A 1QB7A 3A1CA 3E9RA 3O2SB 3P96A 4PZLA 2W2LD 1ZNZA 2B6NA 4IJ6A 4JZYA 4NZOA 1J49A 1MRZA 4OTZA 4M7RA 2CUKA 4WUTA 2GBCA 4EI7A 2V0NA 4FI3C 3GPCA 1XTVA 5IJWA 1YE8A 1Y5LA 2EVWX 2H1OA 2CBGA 2ZJAA 3JATB 4LF7B 2W4MA 2W37A 4RULA 5IH3A 3FHOA 1UPAA 4NS1A 6ABPA 1S96A 4FHEA 3RRZA 1N2EA 2HF7A 1V16A 2HDHA 1SUCA 3EISA 3UGQA 1D3AA 2CWWA 4DRXA 2PHZA 2NVUB 3WGVA 3GLHA 5B58T 1CUVA 4G0YA 2VDUE 3BHJA 4NRDA 2BEKA 2IOFA 3KKMA 4NESA 4WERA 3KEOA 1Q12A 3E27A 1K9SA 1FU8A 4DEYA 1U7UA 3SU8A 1DKLA 4KBYA 1YOVA 3LXRA 2CXQA 5EE0A 4PAOA 2Y2VA 2O5RA 4R0MA 2DQKA 3KPUA 2O1SA 2WUFA 4YUWA 1ABBA 1W0KD 3DAPA 1U1EA 2ZJZA 4V02A 4ZO9A 1S7GA 3E03A 1JEQB 2HZ7A 4D3SA 3VC3A 2EZ9A 4JL6A 3UHFA 1SRRA 2W6CX 4EPVA 2J45A 1OXBB 1SOVA 2KYRA 3F7MA 3IJEB 2C04A 3GFPA 5K3FA 2FUCA 5TT1A 2RGEA 3MMPA 4JXZA 4HB3A 4F6LA 1FDVA 1KSHA 5CT8A 3BGSA 4B44A 1REQA 4FGZA 2WZBA 4ZVNA 1NR5A 1RYNA 2DP4E 2EIXA 4N82A 4XWAA 1Z5NA 3ZYCA 3NTXA 1JQ5A 3BF7A 3OCVA 3FPSA 4L07A 1AXRA 4OLFA 2WJYA 1YDFA 5DEOA 4FNMA 5IBRA 5L95A 1Y7IA 4A3SA 3QLUC 4GZMA 2PXXA 2EL9A 4HNRA 1U0GA 5K6AC 3NGLA 4HQOA 1SKMA 2WSSD 3T54A 3VNAA 4MYHA 3VOTA 2NV0A 1M34B 3TE7A 3K2EA 3X1MA 4C9BA 2DB3A 1ZD8A 3PUJA 4RLHA 1H6AA 1L7EA 2O3TA 2JLBA 1T8UA 4X95A 4ZO8A 2GD1O 1J6UA 1Y6FA 2DY1A 2ECFA 4ZI7A 1VE6A 4MW1A 3Q11A 4U9HS 4ZJYA 1IY2A 2C0PA 1U11A 2FZGA 3UMFA 4D56A 4CM9D 4EVRA 2MCFA 4UVEA 2HFJA 1Q1QA 1SBCA 3NJRA 4GC5A 1ISIA 3COSA 1HK7A 2I8LA 4JLOA 3G9TA 2Y05A 2Z4RA 1SG6A 2CD7A 3O82A 3TSWA 1H4TA 1JQBA 1YS7A 4J76A 4QQKA 4E1AA 5FYQA 5K0TA 1ZD2P 1GUZA 1NQOA 4CM8B 4FHZA 3T1QA 5J4LA 5A71A 4CTMA 3MERA 1KJIA 5FTMA 5J4VA 3R3JA 5J59A 3GH1A 1ZN8A 1RXCA 4FSDA 2I7DA 4KRYA 3NM6B 2E49A 2C3OA 2VHEA 4MRSA 1M1YE 4F11A 1QQAA 1BEEA 5C1DA 4X7BA 3P5SA 4NS4A 3UYLA 3JD4A 2P5SA 3OCYA 4MIEA 2OQIA 3DMTC 4JEMA 1QR6A 4RY8A 2P6OA 2PS0A 3O7WA 3HR4A 3ORRA 4NBSA 3G2IA 3RKSA 1H05A 3IXLA 4Q3CA 1YJQA 5JRZA 4BFUA 2XCUA 4JUFA 4CIAA 1XA0A 2O52A 3E4DA 3HU2A 3OZIA 5HP4A 4WTOA 4BVFA 5KKCA 1C3OB 2UXBB 1A9YA 5IUNC 4IIJF 3G5UA 2J5RA 3DBHB 1D04A 3H3FA 2PFKA 3FYDA 4XDGA 5JNRA 1T5OA 1Y5MA 1FVOA 3NONA 4QXAA 3N7AA 3AR7A 3TLBA 1T8PA 2MMCA 2V45A 3NHAA 4YAJA 3I04A 2F3SA 5MF6A 1WVGA 2O19A 1Y3BE 4JASB 4YCDA 4BEJA 2NU6A 2NYRA 1T1JA 4QRHA 4CIBA 5LP6B 3F67A 1O08A 1C3LA 5A9SB 4FGSA 1CVRA 4DW8A 1Y7TA 1H8HA 3C3YA 1J0DA 2CK3A 4TS9A 2RGWA 4OU4A 4BNJA 3M33A 5EMNA 1L9KA 1K7CA 2VF8A 3ELDA 4EPRA 2AMYA 4M8NE 5T3YA 5FUQA 1XNGA 5LNK1 1BE8A 1IHOA 4JJZA 4F3NA 1TQHA 1L5GB 4GOOD 5FL7D 3TW8B 3HUFA 5JXJA 3CF4A 1JSZA 5DRTA 3TNDA 1W1WA 2BFPA 2NGRA 5KOJA 3AVOA 3O91A 4HVLA 3AGPA 1SY7A 2VDLB 4IDAA 2OBBA 2ZB7A 5JCJD 2Q3JA 5LA6B 5K0BA 4U2CA 2AJBA 3CX7A 2OP1A 4ZZIA 3E7DA 1ZCZA 2JCBA 2AN5A 2CCJA 2MDTA 2H7CA 2JW5A 2O8FA 3T5BA 1Y63A 4KOEC 3OJWA 3PNKA 2GBLC 1JPVA 5K5EA 3AEZA 2H8KA 4LXIA 1FZQA 1GZDA 3RHFA 4U7DA 5JW6A 1NOIA 4D9CA 4NAHA 1XALA 3BKWA 3QKRB 3RTCA 5BW5A 1XTPA 2PCLA 3JALA 2ZYIA 4OV6B 3TK1A 2GTIA 2COUA 5FHRA 4KU4A 1ZOIA 3I05A 1IULA 3EIHA 1ZJYA 4RETA 3ZE7A 3WRXC 3GWZA 3LHIA 2WB4A 4FDUA 3DZIA 4ZJUA 4NZZA 3WGOA 1QSGA 1UJBA 4BNYA 4IO0A 4G86A 2EWMA 1KNQA 5E1BA 3ESBA 2A0YA 2EARA 4U4AA 3TIFA 1BHO1 3KPWA 3COVA 3HBFA 2VHUA 4AXBA 1Q1EA 3ZZ0A 3UMMA 1LLCA 4NJEA 4KR2A 2ABWA 3DFKA 3S8EA 1IBSA 5DX1A 1VKZA 4KLRA 4MUGA 5A6SA 1AC5A 1CNFA 4C7JA 1THMA 2YZKA 4JLMA 1VL6A 4K88A 3OX3A 4PLHA 1BCSB 1Q0QA 5JDIA 2D2XA 1ESCA 1FS4A 3HFSA 3ZXSA 3PLRA 1WHTB 2BHLA 1RPNA 4ZV7A 2R65A 3CRW1 3Q7IA 4Y2JA 4HR7A 2OHOA 4AN0A 1NUHA 2QLNA 5CDFA 4EW6A 4JITA 3QKRA 4MGYR 1WD7A 5DDIP 4C0JA 4IYJA 1SWWA 2VXYA 1LRLA 3VKWA 1V8OA 1CQJA 1AKUA 2FWNA 5CUQA 1J1UA 3CJQA 4Q16A 2O5CA 3D7MA 4AL4A 3E70C 2VT3A 1M6WA 3F71A 3UBMA 1ORVA 4A0FA 3KLBA 2YUTA 1I5EA 4WRRA 3RSOA 4IYRA 4JK3A 4LBZA 5KVQA 1BH6A 1WB5A 3R76A 1DT5A 5EEGA 1OZFA 1LX7A 2R6GA 3CKLA 3ZNNA 5LWHA 1F5NA 2CMDA 4OJTA 2CFCA 1OZAA 5EWMA 1PGPA 1I7SB 4R1UA 4R98A 3UMYA 3W06A 4PC1A 4HQLA 4DGQA 5LQKA 4BCBA 4PHHA 3THSA 4G5FA 2G9VA 1BRTA 3IKTA 4DRXB 5TS3A 3TZKA 2VOJA 2JLQA 1P4JA 2AOUB 3GLHB 5CNKA 5HR5A 1KOGA 1NVXQ 4R8KA 2IPMA 2PT7A 2W42A 4I4NA 3FCEA 2WJVA 1I01A 1Z25A 1BW9A 3L07A 3RNOA 3TZLA 1FPMA 3ILSA 4PAWA 1XYGA 1CQIA 2C8JA 1D2NA 1DX4A 3JWGA 3PENA 4KLAA 4AFNA 3QPWA 1C9JA 2D74A 4KDCA 3WHPA 2A67A 2GLXA 2ZBGA 1QONA 4FFPA 4LHEA 1T8RA 4A91A 2IOYA 2QX9A 3HJCA 1E98A 2GVDC 4Y2XA 4YXWD 1B4DA 2WNSA 1QYCA 3IDFA 1UP7A 3VBCA 5HQJA 1WV0A 4HDCA 3MCAA 5FWDA 1EWVA 1QX3A 3ZE6A 4ILKA 5J2UB 4X93A 1D07A 3O26A 3OC0A 1KVUA 1K6MA 1ODFA 1ZCBA 1MIHA 3MAGA 3RWMB 3FCOA 3CVUA 1O58A 2XYGA 5KWJA 5AK5A 4M37A 1NUTA 1J2JA 3L6BA 4H15A 4H7EA 4X5OA 2ZRQA 2AJDA 4COKA 5AVSA 2F9FA 4RD3A 3P8ZA 3GAFA 4UULA 3H2GA 4D8TA 5B3KA 5JS8A 1G3RA 5ECYA 2Q4BA 2WD8A 3M6UA 3JZFA 4L5IA 3H7AA 2FGKA 4MUAA 4QWMA 5K8LA 3R40A 3Q5DA 1G8FA 2RGYA 4QU5A 5C4GB 1PHRA 3RBXA 5AKGA 3LD9A 4GGPA 2NP6A 1VC2A 2NPFA 4WK2B 3MCTA 2FQXA 5FTNA 1B8VA 5J2TB 3QOFA 1U2PA 4HWGA 2NZ2A 1TIBA 3BFVA 3WJ2A 2P7HA 4GLFA 1LWOA 4RH0A 2KBFA 4BMDA 1BJRE 5EERA 1HX7A 2HA2A 4NVRA 3X44A 4H3VA 3OKAA 3H0EA 2ZAYA 3TRIA 3DL2A 3HR7A 4V3BA 5F9HA 4XRGA 1QQ5A 2G1AA 1YQDA 3FHCB 1NJ2A 2AW5A 3OP4A 4MHSA 1B41A 3BXOA 4Q4AB 5A6VA 1X94A 1Z5ZA 5AJWA 4I8DA 4WFKA 4Z0TA 1N0VC 4HQ0A 2ANBA 3ENQA 4MWOA 4J91A 4E32A 2P2NA 1WZEA 4GOJA 1UKVY 3M4JA 4LY0A 4UTOA 3HJHA 1PSDA 1CF9A 3B2EA 1EIZA 1A76A 4KAXA 3SC6A 5I9IA 1YKGA 4HEA1 2WT9A 5KDLA 4N40A 4JUBA 3AETA 3F9CA 4IKEA 4LVOA 1DXOA 3ZCXA 1V3VA 1EGHA 4JBWA 1YQEA 2JFQA 5IU6A 2B5WA 4BQEA 2P90A 4S12A 1QTNA 1Q57A 2GPNA 1H1TA 5KQMA 4AKHA 4RPCA 3TJRA 5CFLA 1MZVA 3PXDA 4OMCA 1Y1TA 4N8DA 2VZ9A 4GO1A 4CM9A 2H1WA 3K4HA 3NP9A 1L4YA 3OU2A 4RNDB 5H3LA 3SC2A 4JLSA 4ACBA 4F2PA 3DMNA 4X85A 3HC7A 1EBBA 3H4TA 4GP6A 3V4ZA 2VNAA 5AP9A 3A3KA 3HACA 1ZLXA 2BFFB 2ZBEA 4Y2QA 4CMGA 1C9YA 5BSFA 4I08A 1TO6A 2RKOA 4P92A 2PT5A 1OTYA 4TUYB 3RRBA 2J9RA 2A33A 2GH1A 1B0ZA 2VK2A 1DBQA 4DLLA 4OQPA 1CJVC 4ZDKA 2F2TA 2VRBA 3W5AA 1R0BA 2UUOA 2ZSHA 5L7TA 3PQEA 2IS1A 1WLSA 5LD2C 4MS1B 1N6HA 3AVVA 5I7AA 2AVDA 2XCOA 5CYPA 3MT7A 5T8KC 5CB6A 1M74A 1BD3A 1HL7A 4RTQA 2XGGA 3PX7A 4TLMB 4HLCA 1BN7A 4DC1A 1ZH8A 4AVYA 5FQOA 1YNOA 5A7FA 1A8UA 3X1KA 3K2BA 1W47A 5M04A 1WJGA 2ORYA 3OO0A 3HCPA 3MJDA 5HFNA 3VO2A 3IUYA 2GETA 5D7NA 5LB4A 1SVMA 1VRVA 1UXIA 2KE5A 4U9UA 2HFKA 2Z9CA 3EB9A 1FOEB 2A30A 1JG6A 3LCUA 1E3JA 1NIJA 2FKNA 5K0NA 3BWCA 1KH1A 4UTZA 3HPRA 1Z0UA 1J2RA 2OHFA 2PH1A 2FMKA 4KFUA 4IJKA 1DUVG 5ALDA 3B7PA 5JMOA 3BWMA 4KMOA 1G8JA 5LQCA 1O95D 4KXFB 2JK1A 1IN1A 3IP8A 1A5ZA 2NTVA 3GFRA 3B6KA 2W4IA 4ZVUA 4XM1A 2O50A 2JIMA 4MVJI 3R5JA 2RDMA 2VPIA 2AQHA 3UG7A 3UK6A 4LOIA 4CM7A 1XU7A 2IZ5A 3CLUD 2Z3ZA 4ZJZA 3Q2IA 5JOQA 1O5IA 2O57A 1FZTA