3SU8A

Crystal structure of a truncated intracellular domain of plexin-b1 in complex with rac1
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
178
structure length
178
Chain Sequence
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Dual Binding Mode for RhoGTPases in Plexin Signalling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis/signaling protein
molecule keywords Ras-related C3 botulinum toxin substrate 1
total genus 47
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2011-07-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3su8A00
1B0UA 1NG9A 2H92A 4KYIB 1E3MA 1TADA 3LBIA 4A82A 4DCTA 2NIPA 4MQBA 2GJ9A 3ASYA 3LD9A 3A1WA 2O8EB 3OEHA 1JECA 1Z47A 3A4MA 3AF0A 4TMVA 2NTYC 4CYMA 4W5WA 1M7BA 1JXMA 2C98A 1UDWA 3KXIA 3CRRA 4NYMR 4GNKA 5FBRB 5IRCD 2IYLD 4DHEA 1Z0KA 2Q3MA 2IWRA 3MCAA 2HUPA 3K9NA 5LBIA 2Z43A 4QNRA 2RGAA 1JEDA 2VP6A 2PH1A 3GFTA 4TQ9A 1RPZA 2CXXA 2ZUCA 2W00A 2ZU0C 1HV8A 5TV2A 1ZD8A 1P2TA 2O5VA 3ZD6A 5FPKA 2O8EA 1E9EA 2BJVA 5K8LA 5L3VA 5EZ5A 4PC6A 3FKSD 4URXR 5LDDC 1YR7A 2R6GA 4DUGA 2FPMA 1YRBA 4CT5A 4LY6A 1KDPA 4Q1FA 3D31A 4PX9A 2ZI5A 1BMFD 2HXSA 3A1VA 3FB4A 3IPYA 3VR2A 1ZNXA 1TQDA 4MKFA 1AA9A 2DWPA 2PMKA 3MUFA 4NYIQ 1KK1A 1T0JB 1XCGB 3L0OA 4EQ6A 2BBTA 1AQYA 3CZPA 3RS0A 4DLSA 2IXEA 2WICA 3NG1A 5LB2A 4EFMA 1F48A 1JR6A 3DKVA 4EPYA 5EP4A 4ZDKA 2J0UA 1KI9A 1T0HB 1FW6A 5JWHA 3CRMA 1FTNA 5DYIA 3P20A 1XD2A 1T3SA 1BIFA 3QF7A 1DG3A 1XZQA 2D2EA 1KI7A 1KHTA 2HEIA 2ZJ8A 3QOFA 1KY3A 1RE0A 2CLCX 4QHSA 4ACBA 5AUOB 3THWA 3PG5A 1SHZA 1OH6A 5KPDA 1H8HD 4IXMA 2YOGA 2GK7A 1U8YA 2X1VA 1SVSA 3B5JA 3CX6A 3FDIA 2ORVA 4Q5IA 3WYAA 1S1CA 1ZM9A 2CL7X 3EIEA 5HE8A 2QAJA 4V0MA 4KYUA 2QRNA 3T34A 5H68A 4FXPA 5CJPA 3HPQA 2EFDB 1P9NA 2FG5A 1UKEA 2VP5A 2OXRA 5E7IA 3GEEA 1JJVA 3CRVA 3QF4A 1MT0A 3DO6A 4QGAA 2A5YB 1CEEA 2J0SA 3O8RA 3F5FA 1EX7A 4CF7A 1COWA 1A7JA 1ELOA 2CCJA 2IS6A 1CXZA 4CIDA 4M22A 2W6ID 4EPVA 2QT1A 1Q21A 4LV5B 4PPNA 1PLKA 2AFIE 4Q1CA 5EXTA 1UF9A 3VR6A 1J8YF 2OBNA 4IFEA 1RZ3A 4TTRA 1G5TA 4P4SB 2IHBA 4HB4A 5FOUA 3I8SA 2BBOA 1COWD 2Y8EA 5C46F 4NTZA 2QU8A 2FSIA 4NBSA 1W4RA 5SZIA 4NYJR 2IYZA 5DH9A 4FMCB 5DHAA 5CK5A 1N6IA 4RCZA 1ZM7A 2ZRBA 3WMFA 4C4PA 4Q1EA 1PVOA 3C5HA 3P32A 3KL4A 2ZUBA 1U94A 4HDQB 3NEJA 3HP1A 1R5OA 5ELXA 3Q3JB 3SS8A 3AKCA 1AS3A 1ZMXA 4LPKA 1HT2E 3W6NA 2J0VA 1YZLA 2ZR9A 1PUIA 3UMFA 2GBLA 1G18A 3BH0A 2QZ4A 4GI7A 1JR3A 1H8ED 2G6BA 2VSXA 3EPLA 3MMPA 3TRFA 2REBA 4UKDA 2C99A 4MYCA 2ASEA 3IIKA 4NCNA 2H8KA 2O52A 4JBYA 3E70C 1A2BA 1Q0UA 2ZI9A 1IOZA 2F55A 4C0QC 2QMOA 2ZPTX 1GFIA 4JBWA 4AG6A 4G0NA 4DZZA 1RYFA 3FHTA 3OFNA 4TMTA 2DFLA 3UK6A 1E9RA 3LBNA 3KQKA 2D7DA 4G5SA 2IYQA 3IQWA 4O2RA 4HAWA 3LX8A 4KODA 1M6NA 2PX3A 4RKFA 1WMSA 4ZCIA 2BMJA 4A2WA 3M0EA 2WJVA 1CULC 3GD7A 1S3GA 3OIYA 1KMHB 1TX4B 2V1UA 1XWIA 4HAXA 4G3XA 1P3JA 5FOXA 3NKVA 2JGNA 1OFTA 3EWAA 1I4DD 1FL9A 4LSGA 3K0CA 3RS2A 4BFSA 1P7CA 1YE8A 3LVRE 2YVUA 5UKDA 3NH6A 1EESA 4K46A 4I99A 3UXMA 1W2HA 3TK1A 4NCKA 2L0XA 4B3XA 4OK5A 5J5CA 2BC9A 2VL7A 3EAQA 2WTUA 3PUVA 3B8HA 3F0TA 1S3SA 4LHWA 3W6OA 2JATA 4N1AA 4KITB 3X1WA 3CONA 3JZMA 1KO5A 3WNBA 3BIFA 2V3CC 2GJAA 3SI7A 5JEDA 5JJIA 4W5JA 2ODEA 2YZ2A 2WJJA 1KSFX 4WXRA 1KJZA 5AR1A 1CBUA 2BV3A 4HDCA 1T8UA 2QE7D 3RANA 4A8JC 2AR7A 1AJEA 3OE7A 1X8LA 4Q9LA 1OJLA 1VHLA 1MO6A 4F4CA 3I5YA 1TQ2A 2G1JA 2JLXA 1ZAKA 1MKYA 2WV9A 3QXSA 1KGDA 2JJ2D 4MGZR 4PPQA 5FOSA 4Q4LA 4LX0A 3AVQA 4KV9A 2XNDA 4PHTA 1XU4A 4R98A 2KBEA 3K0AA 3K53A 3GQBA 3TSOA 3Q7PA 4PZLA 3IKJA 3NDBB 2A30A 5EXPA 4Q03A 2GXUA 3FKSA 1KKLA 3GFPA 1E94E 2GF9A 3WRYC 5B57C 5C18A 3I32A 4YMSA 4MGIR 3G82C 4MYTA 3QJYA 1MRNA 1SVLA 1IJFA 2XEXA 4MH0R 4TL7A 4JS0A 2RHMA 1MO4A 1P6XA 2LKDA 1PZNA 3PITA 4LHZA 1JQLB 3C16C 1JJ7A 2C78A 4NONA 4ERNA 1W49A 3W5JA 3QF4B 4JT2A 5L3QB 4A8JA 3GLIE 4JSTA 2RGGA 2RGNC 1J7KA 1SXJB 3AVUA 2GAAA 3K9LA 1XTRA 5SZJA 3ZS9A 1NNEA 2HYDA 3EC2A 2NPFA 3PUYA 4M9SA 3QNUA 4TT3A 2GCPA 1JXOA 4B2LA 5FL3A 3I72A 1JPJA 1QBKC 2R8RA 4MRPA 1XFAA 4K8OA 2JEOA 2YYZA 4HYYA 2CJWB 1QF9A 5CJ2A 2F1RA 2UZIR 3TSZA 1BH2A 1U9IA 1RJ9A 1KI1A 1N2CE 4QGGA 1IJEA 3KQUA 1E98A 1GRQA 1Z3IX 4YMUA 2MMCA 3SBDA 4CVNA 3LDAA 2Z4RA 3KKMA 2OAP1 3NC0C 4IDHA 2FF7A 2A78A 1B23P 1TEVA 4M9XA 3X1YA 1J70A 3TBKA 4ASUA 3BGWA 3CF0A 2OAQ1 4ABYA 1G5PA 4B34A 4XSHA 5KSZA 1QHIA 4V02A 4NYIR 4JL6A 1GL7A 2OCPA 4DLYA 1VDZA 2QP3A 1FFHA 1XTJA 2PZEA 4TTQA 1XCMA 4CEJB 2X77A 2XITA 2QAGB 2HLDD 5BWMA 4RFSA 3GLHE 3SOPA 2IYVA 3GJ3A 5EUQB 1Z63A 4B3GA 1D5CA 2IF2A 2Z5FA 4OQMA 5FUXA 2D3WA 1D9XA 3DOEA 1CRQA 5ANRB 1ZW6A 1EFUA 3CPHA 2AK3A 1RRGA 1N6KA 1UFQA 1UKVY 1U8AA 4A2PA 3U61B 4GRAA 1BYUA 1OXXK 4K81B 3EIHA 5DLQC 1E96A 1CJKC 1DE0A 2OCAA 2F1IA 2A5FA 2ZI6A 4JLDA 2ONJA 3K0CC 2IYXA 3D8BA 1F2UB 3BFVA 2FPKA 2Q3FA 2ZE5A 3C14C 2QI9C 4L4UA 4PO8A 4TTPA 5GJCA 1Z6YA 4JL5A 5CLQA 5FI1B 5HE9A 5AWFC 1EX6A 5AJZA 4G1UC 3QXJA 1G16A 4D80A 2GTPA 2O8FA 1KI3A 3B82A 1E2NA 2PT5A 1U8ZA 1G17A 1WBBA 3OEHD 1ZINA 2JCSA 1ZD1A 2FV8A 2C04A 4Q4JB 5B58C 2YWEA 4YXWA 1KYIA 1O3YA 3CUEF 3QKTA 3CKLA 4IOMA 1G8HA 4WIAA 3I61A 4QJ4A 2W2XA 2AKYA 1MO3A 5F9FA 4LHYA 3FOZA 2XB4A 3NIBA 3SU8A 4DDUA 4OHVA 3KKQA 1VG1A 2ZROA 5G40A 4B47A 3PV0A 2IWHA 2QBYB 1Z0JA 4V0OA 2ZRPA 1U0LA 1G8YA 1D2NA 3I92A 4KJZA 1XEWY 5HKKA 1EXMA 3CWQA 1G3MA 3O8DA 4DCSA 3KQLA 1E0AA 3MJRA 2JLSA 2NQ2C 1FMLA 1VCOA 1VYTA 4M9QA 1ZYUA 2BM0A 1HA3A 5EXSA 3L43A 4JLJA 3ZVMA 3EIQA 2IYTA 1NIJA 3WNCA 3ZZUA 1OB5A 3DZDA 4TLCA 1E2JA 2VP4A 1HE1C 1OIVA 4EPWA 1Q1BA 4B6EA 1Z6XA 3VR4A 4LC1A 2QUZA 5JEEA 1OFUX 4YDSA 2FA9A 1GP2A 1GZSA 2QA5A 4KFUA 1E2FA 4BLQA 2FZLA 3QPWA 3CR8A 2WBLC 1YZQA 4OQNA 4S35A 3CX7A 3GJ5A 2WOOA 2GILA 3ZVLA 4FN5A 2BKEA 2XGJA 3A36A 1KY2A 3B78A 3Q85A 4WZ6A 4JLMA 3SE0A 2TMKA 2ODBA 1M74A 3CPEA 4AC9A 4YQFA 3DMDA 1SVMA 3SJZA 4LBWA 3KUDA 2W0MA 4Q9IA 4B2PA 2W0SA 4LZZA 5DSZA 1OH8A 2C5LA 1GIAA 1N5LA 3QIAA 3HU3A 5CLLA 2ZSDA 3E1SA 3KJEA 1CJVC 3A4NA 3PEUA 4DWJA 4MDFA 1EWRA 5TARA 2X2FA 1OW3B 2V1XA 2H7VA 1IY1A 3EZ2A 4XWKA 5BW8A 1S8FA 2BVNA 1TEXA 2B6HA 4QNMA 3UANA 2DWQA 1RRCA 4A92A 5D3QA 1YVDA 3TW8B 5AJYA 4D4KA 4JVMA 2QAGA 2O8BA 1KJWA 2I1VB 1W44A 4LYAA 1XP8A 4JLVA 3QVUA 2DCUA 4DC9A 2E87A 5DO9A 1GKYA 1KDOA 1QG2A 2VTKA 4FD2A 2NOAA 4B3CA 1T91A 1AS0A 1JR3E 3LLMA 2XXAA 3QKUA 2W83A 5EP2A 1IBRA 1EGAA 4U7DA 3PEVA 4ON9A 2C9YA 2CDNA 4PO1A 3THXB 2IS4A 5CITA 2ZSFA 3ASZA 3QENA 1QHXA 3ND9A 4LC0A 2AD5A 3GJ7A 2GEVA 2R6DA 1ZVQA 4MYHA 4F4IA 1G291 1E2MA 4PQYA 4V0KA 3R9XA 4RKEA 4DB2A 2IUUA 3D7MA 5E95A 1X3SA 4MUAA 5CYPA 4TYNA 3U44A 1AS2A 2DFKB 3MGCA 4PSAA 2VHJA 2WM9B 4Z8YA 4ZDWA 2EWVA 1ZM3A 2IC5A 5DE3A 1N0WA 3PUZA 1DAHA 3H84A 3B1WA 4AY2A 1DG1G 3U7HB 3K0SA 3L8ZA 4Q4AA 1VTKA 4LI0A 4QXAA 3N2IA 5G41A 3T35A 5SZKB 2VPPA 4KBGA 3WHKA 1OYWA 2V55B 2BWJA 5TB5A 2I3BA 3VX4A 2HLDA 4M1KA 3CIOA 4Q9HA 5CK4A 1LF0A 1X86B 4M1SA 4NPHA 2F3RA 4QJ5A 4EPXA 1Y3AA 1W0KA 2J59A 3HDTA 3THWB 1XMVA 3TR0A 2C9OA 3B2EA 3OAAA 3IEUA 2XTZA 3Q5EA 3U3MA 2YC4C 3BORA 2CNWD 4QBFA 4BLSA 4GOXA 4AG5A 2J45A 2ZVPX 2BJWA 4G5RA 3QSYA 5HCIA 3X1ZA 4LJ5A 3V9PA 3HR8A 3RSOA 3SQWA 5J40A 3TLXA 5K8UA 1SKYB 1SULA 2OLKA 3VNUA 3CH4B 4HB2A 2GNOA 1E2EA 5KDLA 4IEIA 4N3NA 3VTKA 1S96A 2VHQA 4F7WA 1F6BA 2ZI7A 4ZDIA 4P32A 4CEIB 4KVGA 2WWWA 3MWYW 2REXB 2A9KA 5JSZA 2IUTA 3RC8A 2WWHA 3H2YA 3SYLA 3LVQE 3QI2A 2JLWA 3L82B 1EG7A 4A9AA 4CEHB 3AVWA 2GZDA 1AKEA 1AZSC 2UZ3A 1Q12A 3NDPA 4M1YA 2GJ8A 3ETLA 1YKSA 1SVOA 4HLUA 4PHFA 2YWHA 3U7EB 2CK3D 5KO2A 2QN6A 4LUCA 5IK2A 5KUTA 3ZQJA 1MR3F 4A0GA 1KNXA 2C77A 2FGJA 3T1OA 4ZKDA 2IYYA 3PEWA 3ZVRA 4DBLC 4AKGA 5JSZB 4Q21A 1N25A 4RJLA 4HAUA 4CEIA 1SKYE 1W0KD 1VYUA 3BS4A 1W4AA 5GJVC 1T5IA 2EFHB 4C3ZA 1YR8A 3B1VA 2QQEA 2PX0A 2ZS9A 4QFMA 1W0JA 2OT3B 4N0EA 3AUXA 1KO8A 2F9MA 2A7QA 2DWOA 621PA 3BH7A 4DCNA 4R2HA 4LJ9A 3CR7A 3AVTA 1YU9A 3B60A 5TDHA 4EUNA 1E99A 4CT4B 1XPOA 1RJ9B 1ZU4A 1T6NA 3AVPA 1G41A 3FFBA 1J99A 4EJSB 1N6OA 5FFMA 3K70D 1JB1A 3TGPA 4Q01A 4V0LA 3MG9A 4UNSA 1ZIPA 821PA 3U4QB 5F98A 4O2LA 2G1KA 4ILEA 2Q0HA 4KU4A 3VR5A 3P26A 3AP3A 1GG2A 4ZV4A 5JMTA 2BKUA 2N42A 2ZRDA 1OXUA 2RCNA 1LF5A 2WKPA 1KI4A 3R20A 2ZRFA 4ARZB 4GOKA 1G7RA 2OFWA 1A1VA 1SXJE 1ZUNB 3RSLA 2J7PA 4A36A 1NBMD 3FE2A 1TF5A 1Y63A 2QPOA 3BK7A 3IQXA 4AKHA 1IONA 1TMKA 1NG1A 2CL0X 4Q4HB 4Q9JA 2IF0A 4DIDA 1S2MA 2CCGA 2CL6X 4UXJA 1VCIA 1LW7A 2BOVA 4NHOA 2UVQA 4Q66C 4LJ8A 4OI1A 1NN1A 4RY2A 1KI8A 5FTNA 4C30A 2GXSA 4C7OB 1TQ6A 3HU1A 1K5DA 4GSYA 3TQCA 5JRJA 5J4HA 3THYB 3FWYA 3QKRA 3CNOA 4NE2A 4LDJA 5J47A 1NJFA 1A4RA 2Z0MA 2NGRA 4DLXA 1GRNA 4RD3A 3GJ6A 4W9MC 1ZCBA 1XEXA 1UADA 3ZD7A 4P4SA 5KDOA 2FPLA 1WE2A 2QQ0A 4PC7A 4Q18A 2YWGA 1N3BA 3LNCA 1AZTA 4RSGA 1SKQA 1SHKA 1N5JA 4Q4HA 4CW7A 2F43B 4E07A 4G5GA 2WSMA 3FKQA 2ZE6A 2JJ8A 1OXVA 3LX5A 3RABA 2ERYA 4LJ4A 1ZIOA 1M2OB 1P9RA 2IHYA 4C9BA 2QM7A 5GVRA 1R5NA 2ZSAA 1RFLA 2C96A 4JJKA 1MOZA 1Q57A 4XH9B 2GVDC 5L3RA 4EPTA 1AKYA 2JLYA 1D8TA 2OM2A 1KSJA 2XZLA 3K9GA 2V7QA 1Z2AA 2JJ1A 4Q7MB 1KSHA 4AURA 1Q1EA 4LPSA 4BFYA 3LRPA 1W48A 2FSFA 2YOHA 3AUYA 3UG7A 2FSGA 2HXYA 4B33A 1Z07A 2H5EA 1XD2B 1KO1A 2B21A 3UMRA 3CWZA 4WBSA 4GT1A 2GK6A 1E1RD 2WMOB 2REOA 4A0RA 5IHPA 3QKRB 4TWZA 3TH5A 1P75A 4M1OA 3THYA 2QENA 4D0GA 3K70C 1VECA 2ONKA 2ZVQX 3F8TA 3VHLB 2PJRA 4IXNA 2YKGA 3LW8A 2ZRKA 5HKKD 1VCNA 2QY9A 2YINC 1CU1A 4NZYA 4M4SA 1UM8A 3REGA 1RIFA 1CJUC 2H57A 5C2JB 2IEZA 3EWSA 2O8DA 4U02A 3JVUA 1ZC3A 1HEIA 3DHWC 4JLBA 5KPJA 4FMBB 4ITRC 3PUXA 4Q00A 4C0KA 1YZGA 3EZ7A 4ARZA 2H16A 3OZXA 1N0UA 4OHWA 4WOPA 1ZUHA 3KKNA 3OFND 1AGRA 5C1BA 1C4OA 3OIVA 2ZTSA 3V00A 3WHLA 1IAQA 2XX3A 5FR1A 4NCIA 4LBZA 3U7GA 2G83A 4XD7D 1IQPA 3RWOA 1E9FA 3ZH9B 5D3MA 4Q1DA 3EZFA 4I81A 1OSNA 1P2SA 1TPZA 4PHGA 3NHAA 3AKEA 1DELA 4DLVA 1K6MA 1G8GA 1H8EA 2QROA 3KJHA 4B3DA 5EUMA 3EPJA 1P60A 521PA 4OQLA 1QHHB 4KBFA 3CF6R 2A5JA 4JVLA 3IO3A 2CCKA 4FI3C 3NBXX 2DY1A 3QPUA 3T61A 3GEHA 3KXLA 4A6PA 3GPLA 4QGFA 4MKHA 4AYXA 3ZVNA 421PA 4TQUS 3WXMA 3IGFA 1EK0A 5FOWA 1XXHA 3RS4A 1JNYA 5F2EA 3J81k 1A5TA 4PAQA 2ANBA 1XCPA 2W2VA 3RDPA 1L4UA 3HJNA 4FWTA 1FTSA 4RD0A 2O8FB 4UJ5A 1G20E 4XVRA 2P6RA 2P5TB 3VAAA 5H1YA 1FQJA 3X2SA 2ZRIA 3N5CA 2PEYA 3BD9A 2BCJQ 2CHVA 3OAAD 1II8A 4QG7A 1MABB 4DT1B 1WBDA 2JDID 3DKPA 1YR6A 2FDCA 2OCBA 1KIMA 4KSBA 2GCNA 4B75A 3CNLA 4KHZA 4BFZA 3K0FB 2GKSA 3PFIA 3VHXA 3AM1A 1D2MA 1P2VA 3KUCA 2MSDB 4TLBA 1I4LD 5FPYA 1G64A 3REFA 5LD2C 2O0HA 4FCWA 1G3IA 4OQXA 1E9CA 1R8SA 4IFBA 4TLAA 5EE5B 4RZ3A 3U3OA 3W5IA 1VCMA 4II7A 1QHSA 2AXPA 3IHLA 5B64A 3HPRA 2K5UA 4DJTA 4MA4A 1UAAA 5FUYA 3ZIAD 2FH5B 2ZIAA 2AD1A 1NRJB 1KO4A 3I62A 2C03A 4B32A 5BYKA 1NVVR 4IRUB 4OJQA 2JIZA 3CRW1 3IEVA 2CNWA 1NN0A 1DPFA 1R5BA 3B1YA 1GM5A 1OPXA 1NKTA 1LB1B 2WJYA 3WP0A 1ZNWA 1TL7C 4BLPA 4C0LA 4JKIA 1UEJA 3RWMB 2B8TA 5CM9C 1E9SA 1WP9A 4PSKA 3JVVA 4EFLA 2QL6A 4Y0AA 5EP3A 3U3RA 4ZPXA 5F3WB 3UIEA 2ZRAA 4X8OA 3H86A 2R9VA 2IK8A 2XJ4A 3IILA 4PQFA 5EZ6B 4DSUA 2XB2A 3ZGXA 2QEQA 1HQCA 4NH0A 3LA6A 3QPVA 2R2AA 2KJQA 1KK2A 3FGNA 2PL3A 3SZRA 2P67A 4QC2A 2YV5A 1Z2CA 3BRWD 3TW4A 3WYFA 5HTKA 1X8KA 4LOAA 2DB3A 2RB4A 2ANCA 4IDQA 1LV7A 1FNNA 3PEYA 2GXQA 3KFVA 1U81A 2P0EA 4Q7LA 3U6KA 2QG6A 4BLRA 2ZRHA 3H1TA 2R6CA 1E79D 2ZEJA 3RRYA 3U5ZB 2XZPA 1QVAA 3TAHA 4D4JA 2C8VA 4P31A 1U9IC 2P2LA 1E2GA 1DAKA 3U2QA 1G8FA 1ZM2A 2BMEA 1QHYA 3KB1A 4DSNA 2BHRA 3K09C 1R10A 1XJCA 3BFXA 4XVUA 5JLJA 4U5XA 3NVAA 3THXA 2NZJA 3CRQA 4LCBA 3O8CA 2GRJA 3T15A 4X8MA 1SXJC 1L7VC 1XTKA 4B44A 5LPNA 3TAUA 2FEMA 2NO0A 4I1SA 4L8GA 4M21A 3FMFA 4J0QA 3B9PA 4O0MA 3A1SA 4HB3A 1Z5ZA 4BQSA 3RS3A 3K0AB 3BOSA 4PR0A 4FMDB 2D7CA 4TYWA 2GAOA 4US0R 1D2EA 1F3OA 3B6EA 4Z8XA 3ZZ0A 1YZUA 1Z29A 4LJ6A 3OF5A 1E1QD 1YZKA 4LBVA 4B48A 5IK2D 2ZRLA 2HF8A 3AGQA 4KSCA 2VA8A 3RS5A 2ZE8A 4C2TA 1G7SA 2QM8A 2B7BA 4A6XA 4BZXA 2HJGA 3GLGE 3OEEA 1SVKA 4BE7B 2QP9X 4MYUA 2QMHA 1NMZA 1OIWA 1Z0AA 3FMIA 4PAOA 4ESVA 3UPUA 1OE0A 2GZAA 4QRHA 1XBTA 1E2KA 1QRAA 1W0JD 2P5SA 1P4SA 3B9QA 1BYIA 2FJUA 1N6LA 4WZBE 4XJXA 3SJAA 2QMEA 1KAOA 1PV4A 2P6NA 1E32A 4RD4A 2YJTD 1CF4A 4O3MA 2ZAOA 2G0TA 3B1ZA 1ANKA 3MRSA 2DR3A 3MLEA 3T5GA 4DCUA 4TMXA 3AVVA 1U0JA 3A4LA 1ZJ6A 2Z83A 3T1TA 1IN7A 5JWOA 3CNNA 3B1XA 4DLTA 1XPUA 1XTSA 3DEFA 1S9DA 4PZYA 3IPXA 4DLUA 4ESHA 4MGKR 5BN4A 3VQTA 1MV5A 1U98A 4AKIA 1KK3A 2WOJA 3SYKA 1CKEA 4PFSA 4URYR 4GL2A 1G4AE 3HYRA 3QXCA 3GLGB 1XX6A 2PZGA 2IS1A 3R9WA 2OEPA 4R71A 5D3MB 4AYTA 2OCYC 1HT1E 3AVYA 2HF9A 3AF2A 4PTLA 3P4XA 3NH9A 5FL7D 1G1MA 2PT7A 3FHOA 2VIIA 1II0A 721PA 3DMNA 1TUIA 3AKDA 3K0FA 4M1TA 2FEOA 4JKYA 4HSEA 2D06A 4GP6A 4BUJA 2KSQA 1IN6A 2ZJAA 4IVQA 4LGMA 4OI4A 3LWNA 5EJEA 2V54A 3KDSE 2WJGA 3VU9B 4ZIRB 3THOA 4G01B 2KI5A 3IIJA 2Q21A 4KO8A 1NLFA 2KE5A 1SGWA 2VH5R 2ZJ5A 4JSYA 5J4KA 4LJYA 4F38A 1UPTA 1V43A 1AK2A 3AB3A 3IBYA 4IW3B 4Z51A 2Z4SA 4LJAA 5C4GB 3EC1A 4JMPA 2DHRA 121PA 1VIYA 2AK2A 1R2QA 2JASA 5KTYA 3EXAA 5FR2A 3L0IB 4A2QA 4HZUA 4TLEA 3WMEA 4BZPA 4QKQA 3T1QA 1K5GA 3EX7C 5TXGA 3IIMA 4D2IA 2G88A 4IVRA 2IA5A 2XOKD 4BLTA 1Q20A 4YMTA 1TU4A 1H65A 3V4RA 4Q48A 1IN5A 1Z06A 1KMHA 4D0LB 2FFQA 2MSCB 4GP7A 4B35A 1OV4A 3RLFA 2AFHE 3G5UA 2QMUA 4HATA 3CB4A 1LTQA 1YQTA 3LH5A 1AQUA 4ASUD 3O8BA 4HAVA 3ZLJA 4MRRA 2R65A 1P62B 1W36D 1OHHA 4QBGB 4BECA 1T3LA 1OXTA 1X8JA 3VR3A 1ETUA 3ZQ6A 1JEEA 3QKSA 1DADA 3MFYA 3BC1A 4BFWA 4DSTA 1W47A 1NVVQ 3I4LA 2DYKA 1Z0IA 2GETA 4LV6A 3VR1A 1HYQA 3BXZA 3UWKA 1ESNA 3C5CA 4ZIRA 2WIBA 1VKJA 1XTIA 3NHBA 4B74A 4MUBA 2OO7A 3DM5A 4GZLA 2ZI4A 4C0JA 3SYNA 3K70B 1KZ7B 4D25A 4GMDA 1OH5A 1A2KC 4XWOA 3SFVA 3M6AA 3Q72A 3WYGA 1UDXA 4RD1A 4YMVA 2YNMA 1Z28A 2V4ZA 3EZ6A 3WY9A 1W46A 4HUQB 2GVZC 1WF3A 1M7GA 3R8CA 1ZBDA 5JZVA 4WXPA 1T8TA 1YRAA 5DIFA 4CEJA 3A37A 4EJSC 2RGXA 2ZR7A 1J2JA 4D0NA 1E9BA 1DBSA 5FTKA 4URWR 4KFRA 1IM2A 1OKKD 4BFTA 1IY2A 4NP6A 1NY5A 5HR5A 1FPMA 2AKAB 4HDOB 1QG4A 1RC8A 1F5NA 1XZPA 3SHFA 2BM1A 3DPUA 1E79A 2PZFA 2J0UB 2QPAA 2XOKA 1JALA 1QVRA 5FPSA 5DN6A 3L0PA 2ZETA 1VG8A 5A0FA 1YJ5A 1UBEA 4Q9KA 5DYGA 3LO5A 3SJCA 1KAGA 1W5SA 3OIUA 4KLZA 4IEEA 2WWXA 4LHVA 1HQYE 1GRRA 1Z0DA 4KLNA 3X1DA 2JA1A 3BERA 5TVKA 5GADl 3GMTA 3GEIA 3TJZA 4HLCA 1WB9A 3M4YA 4RZUA 5CIQA 5IF9A 1J8MF 3W90A 4H1UA 4QOSA 4KAXA 3UKDA 5DI9A 1G6OA 2OBLA 2E1RA 3CM0A 3SJBA 4EIWA 5EXXA 3A6PC 5KHOC 1PJRA 3LXXA 1IN4A 1XMSA 1CR4A 1II8B 4RZXA 1KI6A 2R44A 3AF4A 2F1JA 2VQSA 2W6IA 3DOFA 1ONBA 2ZM5A 3AVOA 2H18A 5KNBA 3QKSB 1WXQA 1R0ZA 2PMDA 3C41J 3CO5A 4TL6A 1W4CA 1SZPA 2XJ9A 1Z22A 4JYBA 2LCFA 1Z83A 2HDNB 2DBYA 4BEJA 1XB2A 3H0KA 3RYTC 4P3YA 3AEZA 1L2TA 4DLRA 1XEXB 2A5DA 2WWGA 4OI0A 2VBCA 1XMIA 2WMNB 2WWYA 3EW9A 3NXSA 5FBVB 4AI6A 1BMFA 1LS6A 1NJGA 3I3SR 4FW9A 2MSEB 3I1FA 3CLVA 2FN4A 1R6BX 5JCZA 4GDFA 2XNDD 3KTAB 4URVR 1Q1ZA 1SQ5A 2I4IA 3RVBA 2BBWA 3ADKA 3SBEA 2NPIA 5DI3B 1I4TD 2AL7A 4Y0VA 4A0FA 1RRFA 4WA7A 5HPYB 2E9SA 1KDTA 2QP4A 3L0SA 2J0QA 1VHTA 1TNDA 1EFHA 4NYMQ 4TYQA 5BXQC 1FQKA 1JR3D 4XOIA 1NN5A 4JL8A 1LFDB 3QG1A 4E09A 2GXAA 3N2EA 3MD0A 2VEDA 1OH7A 1W4BA 4DUGD 3HU2A 3A8TA 4NCHA 3VKHA 3U4QA 3LBHA 3PIRA 2QTHA 2ZYWX 1DAMA 3X1XA 3NBFA 4GOJA 3WMGA 1RKBA 3GLGA 1PUJA 2GWHA 1LVGA 3TE6A 1GL6A 1TF7A 2ZQ5A 4Q19A 5H70A 4P0TA 1M34E 2RGBA 4UXIA 4EJSA 4U00A 1ESMA 3MWLA 1UBCA 3BE4A 5HZKA 3P1JA 4IDOA 3AQ4A 1IHUA 1CIPA 1VG9B 1GSIA 4WZAE 4TYYA 1FP7A 1FZQA 1P2UA 2Q9BA 2Q3HA 1R0YA 5EE9A 2NO6A 3SFZA 4KFSA 1DVRA 1NVXQ 4I1UA 1NKSA 4S2EA 3VFDA 1A82A 4DVGA 1ZCAA 1JAHA 3AKYA 3UATA 2F1HA 3MWKA 1GWNA 3BH6A 5KSPA 4FCVA 4L5BA 5TY0A 2F3TA 4OBEA 2BEKA 3Q9LA 4C2UA 2BEJA 2O0JA 2O0KA 4D81A 4MRSA 3U3KA 1HUQA 3C8UA 2BMDA 2VHTA 3K0EA 4QM6A 2GBLC 1TU3A 5FH9A 2EFCB 3ADDA 2JLVA 1XMJA 1MH1A 4OJKA 4Q1AA 1Z6AA 4NCJA 4EAQA 2UKDA 4JVSB 4I1VA 1NVWQ 1GOTA 1G9XA 2D2FA 2JJ2A 4FIDA 3UMSA 3BFKA 1QHGA 1OLOA 5AUNB 2AWOA 4PXAA 3M1IA 4TSFD 2I1QA 2QBYA 3ZDQA 3K9HA 1G19A 3BB4A 3NBYC 3NWJA 4D26A 4IHQA 2LWIA 5FOVA 1NBME 5A4JA 2VYFA 5AUQA 1CLUA 2OUKA 1AM4D 1WRBA 3C7KA 3GJ0A 3BWDD 2IYWA 1U90A 2AN9A 2EYQA 4PHHA 2P65A 1KKMA 1ZC4A 1UEIA 3K1JA 3U3JA 4B6FA 4QBHA 4Q4JA 2OILA 2J5XA 1UJ2A 1D9ZA 5JFGA 2ORIA 1GKUB 4PC2A 1JQJC 1XD8A 2VHUA 4DEXA 5CB6A 4ZO4A 3AV0B 1FMJA 3O47A 3KXKA 1FUUA 3OE7D 1OKKA 2VF8A 4XD7A 4P33A 2G9NA 3VKGA 2CEAA 4I1OA 3KZ1E 3VX3A 4C0BA 2VP9A 4PC1A 1G4UR 2J3EA 4I4LA 3TSWA 5L8VA 3RNLA 2JLQA 1F2TA 1WQ1R 2QSYA 1MO5A 4IOLA 1P73A 3A1TA 2GHIA 1OF1A 4ZI2A 2YWFA 3PUWA 4M0LA 5IT5A 1E0KA 2V6JA 3A1UA 2CMKA 1N5KA 2IXFA 3EARA 4B3FX 4QL3A 2QSZA 4QJ3A 2XTMA 3EZ9A 3QXXA 2GESA 4JYCA 4Q02A 3U44B 1Z8FA 2ZAMA 2IX3A 1N5IA 2J46A 1KI2A 3EA0A 3S1AA 3PXGA 5G3YA 1GTVA 3DL0A 3FYHA 3MJHA 1XNJA 3TKLA 1AGPA 1R0XA 2CE7A 4RD2A 4B3BA 1CTQA 2ZSEA 4FMDF 4PC3A 1IY0A 5DGXA 1WDTA 4EKDA 5H8WA 2DPXA 4BFVA 3QE0A 4KFTA 2HJVA 1W2GA 1NIPA 2P6UA 2RGNA 2W58A 3FHCB 5EE1A 2IBMA 1XXHE 2JIZD 3WNDA 5P21A 1N0VC 2IYUA 2PLFA 1KJYA 4PQRA 3GLIB 3S1AB 2FFBA 2VRWA 4US1R 3FTQA 4M8NE 5JI3E 4BFXA 4MDEA 4UNPA 3KQHA 2EVWX 3R8FA 1UKZA 4BGDA 4BZQA 1DS6A 2QAGC 4V03A 1BS1A 1Z08A 2AX4A 1QDEA 5SZHB 5FUVA 4OKSA 1MRSA 3GLHB 2FOLA 5AUPB 4H1VA 5JS7A 1P72A 3P4YA 4TL8A 1N6HA 2Z6VA 2EU8A 2PLRA 5B30A 1E2LA 1PLJA 3GJ8A 4NMMA 1R7RA 1W1WA 5E4FA 4A4DA 4LWZA 3SN6A 4HUTA 3WP1B 1G5RA 3B7GA 1JAIA 3FFAA 2ZANA 2ZJZA 4EFNA 5JRZA 5J4VA 1YR9A 2V6IA 3TUZC 4URZR 1CS4C 1WA5A 3OHMA 2WJIA 1G3UA 2RKOA 4OQFA 4YC7A 1KK0A 3PVSA 3W8RA 3SC3A 4OHZA 4BWYA 1S9HA 2FZ4A 2GCOA 4CDGA 4QHYA 1HH4A 2AHOA 2Q9CA 2EFEB 3MSXA 1JBKA 3H4MA 3NTUA 4F92B 1CJTC 1U2RA 4JVNA 2VLIA 2JLZA 3QXHA 4KCGA 4MKIA 4R2IA 4PSVA 4R9UC 4LJ7A 4V0ME 2IXGA 2IUSA 2ZE7A 2RGCA 3A58B 1DAFA 1GILA 1SVIA 2ZUDA 1TQ4A 3TMKA 1M1YE 2IS2A 4IJMA 5DHFA 2Q9AA 1XD9A 4Q4AB 1E2DA 4DEYA 4TT3D 1I2DA 4RZ2A 4A15A 3RRZA 4GFDA 4CGZA 3AH8A 3KKPA 1ZNZA 3W3ZB 4MRNA 3RHFA 5G3ZA 4LV8B 1DOAA 3MAAC 5EE3A 4POAA 4E22A 2A3RA 3HR7A 1T4GA 1KMQA 4NL4H 4E5UA 1NMXA 4RFSB 4ZI3A 2PEZA 3QBVA 1C9KA 1AIPA 2FX3A 3EA5A 4YLGA 1DARA 3GLIA 4DLZA 221PA 4DCVA 2CHQA 1TUEA 1KTVA 2FWRA 3FMPB 5DN6D 2H17A 1DAGA 3C15C 5JWRA 1LS1A 3PCRB 1XF9A 5CDFA 2CVFA 3QY0A 2XXAB 1M7HA 1NBMA 1JPNA 2ZI3A 3BAFA 3LAWA 5A5GA 1RYHA 2C95A 2HT6A 2QNRA 2NO1A 3Q5DA 2IT1A 2WSSD 4ZKEA 4DIEA 2RAPA 3EG5A 4LBYA 1E6CA 3BB3A 1G3RA 1ZM4A 1L4YA 1TAGA 1CR0A 4IDNA 4GMXA 4DDTA 4UJ3A 4UNNA 3CX8A 1DO2A 5GJWC 5L3SA 2IW3A 2F6RA 4PZZA 2P3SA 1QZXA 2BCGY 5K8TA 2A5GA 1K8RA 2B7CA 4XTCS 4YMWA 3U6BA 1OFIA 4BEBA 3GP8A 4YDHB 2OESA 4N0DA 1R8QA 4JBXA 3MWJA 2CE2X 1DTSA 4QM7A 3ADBA 1BKDR 2WZQA 2SHKA 4KVAA 5TMPA 3OIWA 4P4UA 2ZJ2A 2VF7A 3N70A 4JIMA 1US8A 2ZJOA 1YZTA 4XVQA 2WJHA 3CF2A 4PANA 1E2IA 2PJZA 5FTJA 3EASA 4LYJA 4GZMA 4LHXA 4L15A 3K09A 5KSYA 4WW0A 2ODNA 2ZSBA 5E7MA 2RGDA 4M53A 4AYWA 5JCPA 3WRXC 4M2LA 1FX0A 4NDZA 4LRWA 5DI3A 4DKXA 1YHNA 2HT1A 3CW2A 2KWIA 4BRUA 2GJSA 4HB0A 5EE0A 1I2MA 1NLYA 3PENA 3B13B 4XIGS 2OXCA 4RFVA 4TL9A 1AN0A 1Q22A 5AJVB 2FFAA 4CRWB 5CB8A 1S0UA 1ODFA 4URUR 3QEJA 3RAPR 4D4LA 2JDIA 1X6VA 2R62A 1E1QA 2YHSA 3IUYA 2ZJYA 1F60A 2GEUA 3ADCA 3W34A 4JLOA 5BQ5A 1CR1A 4HLDA 5FPTA 3I73A 2J7PD 5JECA 4XSGA 2CJWA 5JJKA 3QBTA 1G3QA 1LNZA 3FVQA 2ZRMA 1XRJA 3NEYA 2R6AA 4JLNA 3W6PA 2RMKA 2A2ZA 2EW1A 1NSFA 2EQBA 1P5ZB 3DVLA 2V8OA 3AF1A 2CLDX 2B8WA 4HUQA 8OHMA 5JHGB 3FMOB 1BO6A 4D6PA 5K8IA 4DLWA 4BPBA 3EPHA 3U7FB 1H8HA 5CYOA 4US2R 1XEWX 2FGKA 3DM9B 4A1FA 3SDZA 4A8JB 4IOJA 1TF2A 4AWXA 1E0SA 2HCBA 3R7WB 4DSOA 5AJWA 3V4FA 2JJ1D 4MRVA 2ODWA 1NL3A 1HTWA 4QGHA 2HYIC 4FWIB 5B2ZA 2OBMA 2F43A 3KJGA 3NBZC 1NP6A 4TZ6A 3TQFA 4B43A 3E2IA 4TLDA 2X2EA 4IOKA 4NKRA 2ZRJA 4M9ZA 5J4YA 2EYUA 1Q3TA 2QGZA 4DDVA 2PCJA 1L8QA 2RHDA 2QTFA 4JLPA 2NMVA 2F7SA 1M8PA 1KO7A 5FBLB 1ZUIA 3W9YA 1OYYA 2ZJBA 3BB1A 3D6TB 3W8NA 1G21E 1FP6A 4IKEA 5JBQA 4D82A 1J90A 2CVHA 1GNRA 5JJLA 4A0HA 4JJZA 3AGPA 1KZGB 4HZUB 4EQ6B 2NO9A 3LXRA 4B2IA 4C7OA 4JLKA 4TZ0A 3LQQA 3L8YA 4B76A 3DDCA 3LQRA 1RVDA 1OXSC 1EWQA 1NSTA 4FMCF 4MGYR 1SXJD 3IBGA 3WBKA 5KSOA 1UKYA 2VP0A 2X19A 1HY3A 1N6RA 1KOFA 2QRZA 4C0HA 3PQCA 4W5HA 1R0WA 1OT3A 2JLRA 4HAYA 4TMZA 1US8B 4H9GA 4F4JA 4HI0E 4RVCA 1PLLA 4W7SA 1KDRA 2VP2A 1GUAA 4RCYA 3D3QA 1E2HA 4Q7JB 3KJIA 4QBIA 3TUIC 4CEHA 4XTRA 5JS8A 1E2PA 1Z6GA 1X1RA 1X1SA 2WVJA 1EFRA 1C1YA 2W6JD 5J4LA 4D4MA 4M1WA 2QT0A 2CHGA 4PPGA 4C0SA 1ZU5A 3T5DA 1GNQA 5KYKA 3QQ5A 1G7CA 3Q7QA 4B73A 5LD2B 2ZRNA 2ZS7A 3G0HA 3B85A 3GFOA 3KTAA 3CZQA 3GJ4A 1GKIA 5FPHA 1IXSB 2MMGA 2GEDA 3T06B 2GA8A 6Q21A 2ATVA 5KOYA 2QTVB 3VKWA 4HEJA 3LV8A 2WHXA 4WVFA 5C4MA 3C4JA 4HLUC 2O8CA 4GBMA 2C2HA 1VMAA 2CBZA 5FBWB 2VSFA 4LK2A 2XNSA 1E4YA 2ERXA 1D6JA 3LFUA 3VNVA 2IYRA 1UBFA 5FTMA 4L9SA 2N46A 1U99A 4OL0A 1HE8B 2OV2A 4DRZA 1Q3HA 2FNAA 2W2TA 4GPTA 3TNFA 5JHHB 2JLUA 1CP2A 3QG5A 3AVXA 3EPKA 1FNMA 1Q1QA 2WIAA 4DXAA 1KI6B 2ZRGA 2BIFA 4G5OA 5IDVA 4L16A 2ZR0A 3HWSA 2H1LA 3VU9A 1TTTA 1U0HC 2N1BA 5AJXA 5L3QA 1VIAA 1NY6A 3I8XA 3GLHA 1ZNYA 4Q47A 2OE2A 3FPAA 4EPRA 5BN5A 1DAIA 1BOFA 4WAUA 2GZHA 2CK3A 2OZEA 1II9A 5FTLA 1E9AA 4MITA 4PAMA 1CJMA 1NI3A 3GLFE 3LLUA 2Q6TA 3TIFA 3ZIAA 5FUWA 4YXWD 1P9WA 4O25A 2VSOA 1W5TA 2WWFA 3CH5A 4UNRA 3KQNA 2WPDD 5LB4A 1OIXA 2X8AA 1Z0FA 1R4AA 2ZITA 2YC2C 2G0NA 2CLSA 2WAXA 2WSSA 3IHWA 2D74A 1O87A 1XXHB 3U60B 1E0JA 4OK6A 2D4HA 2V7QD 1KNQA 3K8YA 1XJ0A 1E2QA 1ZRHA 4AD8A 2FMXA 4F93B 2NG1A 1FX0B 3RS7A 1QHHA 5GJBA 5F9HA 1NVUQ 1XEFA 3JZAA 1Q44A 4OHYA 2BMFA 4AKEA 4YONB 2FSHA 1RW4A 2QE7A 4OYHA 3R7WA 2KB0A 3BJIC 5DISB 3TVTA 2VO1A 2ZYVX 1E1RA 3LY5A 5E3HA 1DO0A 2XSZD 4UNQA 3ZJYA 1N6NA 4ZCMA 2G3YA 1GNPA 2BDTA 2J87A 3ONWA 1T9HA 2F9LA 1W36C 4DDWA 1GVNB 3WBJA 2RH5A 4TQAA 1F2TB 1NLZA 3HYTA 3ECCA 3QEOA 2HCJB 5EQTA 4X8LA 4EDHA 2GDJA 1G6HA 1S1MA 3LW7A 3QVVA 4RD6A 4CZ2A 2VHCA 1VYVA 2FU5C 2WPDA 4G5QA 5L3SB 2XZOA 2OFXA 2OFOA 2QGNA 1FOEB 4TN1A 3KX2A 3ZS8A 5FI0B 1FUKA 2O8DB 1E69A 3SHWA 4XWAA 3CBQA 1GAJA 4MKGA 1JI0A 4DB4A 3SQXA 1OB2A 1ZP6A 3RRNA 1E4VA 1Z6TA 1VPLA 2OLJA 3L2OB 3GLFA 2ORWA 2WAYA 2G77B 1OFHA 4JZKA 3KB2A 2QORA 2J9RA 2OHFA 1QHNA 1E9DA 1NN3A 3IO5A 3SNHA 2C9CA 4QHTA 2O8BB 4OHXA 4JLAA 4NU0A 4BASA 4FCTA 4M1MA 4ZCLA 4FINA 2DFNA 4PO9A 1G8PA 3ND8A 2NZ8A 4Z1MD 1SVWA 4HLQB 5KDDA 5CDFE 3Q8XB 1S4QA 1DEKA 1GDDA 5EP1A 1LY1A 3PJRA 1YZNA 2EWWA 1G7TA 1IN8A 3R9IA 5BN3A 5HCNA 2EFGA 2ZYTX 2R6FA 5KNCA 1SXJA 2GJKA 5FBQB 4Z1MA 2D62A 5HZHA 2J7KA 2OG2A 2AXNA 2ZRCA 1IXRC 2NO7A 3SR0A 1W7AA 4L9WA 2GF0A 1XDBA 1UBGA 2WKRA 4R7ZA 1CRPA 2B92A 4BFUA 2ZU6A 2LKCA 4TMKA 1T3HA 2ATXA 5BYJA 4AIIA 3CPJB 2ZXUA 3W3AA 2AWNA 2GCOB 4LYHA 3ZYCA 1N6PA 4JT4A 5FOTA 4HAZA 2WKQA 1ZD9A 2FFHA 4ACAA 4IDPA 3TR5A 3SEAA 4TYPA 3ZZTA 2WWIA 3ICQB 4X8HA 4Q1BA 3RC3A 4NYJQ 1WCV1 2ZS8A 1HURA 2BBSA 3P27A 2J41A 4KI0A 1OHHD 1XPRA 4BRWA 2HV8A 2IL1A 1NF3A 4P4TA 4KXFB 4HZIA 1V5WA 1XJQA 2PCLA 4TMWA 3AF3A 1F2UA 2RGEA 2ZREA 3RRMA 1RRPA 3UG6A 2FE4A 1W36B 2OSBA 3GCGA 5CM8B 4UXHA 4UQOA 4BLOA 4C0AC 1KSGA 2QPTA 3TVDA 4Z54A 1EFRD 2J1LA 1T5LA 2W6JA 3OESA 4ZDJA 5CIWA 3IDQA 5KNDA 1XTQA 5FL7A 3DZ8A 2V9PA 4LYFA 4TSFA 5GVSA 1GL9B 1DAEA 3AP2A 2XSZA 3GJXC 5DNYB 2KBFA 3E5HA 3T12A 1MABA 4DT1A 1VG0B 4B71A 5E7JA 5M04A 4V0NA 1IXZA 1GITA 3OEED 1P61B 3I5XA 1EFCA 2JAQA 2ZYUX 3PR1A 2DFTA 3TUJC 2ECKA 5AK0A 3VMFA 3NC1C 3F3YA 3AP1A 4IVPA 4PPFA 5KU1A 4Q7KA 2XTNA 3BBPA 4OI2A 4F91B 3GLFB 2IYSA 3KKOA 2O8CB 4OK3A 2IEYA 2PBRA 4AK9A 1EFTA 2YOFA 3KFXA 3T1VA 1CR2A 5G53C 1NMYA 3ICEA 3UWOA 5JI2E 3QUSA 4E03A 2XAUA
chains in the Genus database with same CATH superfamily
1IK6A 5TQ2B 1B0UA 1PWYE 1E3MA 2JPDA 3JWHA 3LBIA 2NU8B 5EIFA 1HPLA 2GJ9A 1GTL1 4ZU1X 3DO8A 4UEWA 3A1WA 3K16A 5IBRA 4F6CA 4AXXA 4TMVA 3ELWA 4PSCA 5I9BA 2PVCA 4KR6A 4FB4A 1KXJA 2ECPA 5IVHA 4CQJA 2I2AA 4HJXA 1YUBA 3KXIA 2R1ZA 1UDWA 4MTLA 4X44A 1VL0A 4D8TA 5IRCD 1KFCB 3EGXB 5ILGA 2JAUA 3RGWS 3SZLA 1IBCA 3MCAA 2IDJA 5EG5A 5IHXA 3LM8A 3IFSA 4JJ4A 2Z43A 1E3EA 1FXSA 1JEDA 2VP6A 3KD2A 4RABA 4LJRA 2PH1A 4TQ9A 1GSOA 3OU2A 2DE0X 2ZUCA 2FRXA 2W00A 2ZU0C 3MILA 5IDYA 5AM3A 1ZD8A 2RFLA 1P2TA 2A94A 3P9NA 4LCEA 4C2BA 4KYTA 3ECAA 5FPKA 3IUEA 3H9JA 2KMLA 1KJNA 2CXNA 3OOSA 3S29A 3UZUA 5EZ5A 3TDKA 3JALB 4LQCA 4PC6A 3TFWA 3ZV5A 4P86A 2A0UA 2YWCA 3OU7A 1EM6A 1YUMA 2FPMA 1YRBA 4NG5A 5IAGA 3RYIB 2H51A 4LY6A 3ZZMA 4BWFB 4DQXA 1X8XA 4Q1FA 4JAVC 1SIUA 4PX9A 1MOQA 1YNOA 2OFFA 3FKJA 3IPYA 2VTEA 3QLTA 4ZV9A 3AFNA 3KKKA 5ALRA 2VUUA 5E6RA 4GNRA 1NF2A 4XLZA 1RLTA 5KOHB 1HG1A 3AIKA 4KGDA 4EQ6A 2BBTA 3R3ZA 2C4KA 2XYQA 4DLSA 2WICA 3NG1A 3PP8A 4ZIRA 4EPYA 5EP4A 4ZDKA 2XRYA 2MHCA 2YR0A 5HWSA 3SHQA 3MLBA 1T0HB 1IHOA 2RI0A 4JR2A 1Z2NX 3F5QA 3GLQA 3D6FA 2JBAB 4E7OA 1T43A 1AGNA 2D2EA 3ZWKA 1KI7A 2XVYA 1YU6A 3JATB 4EBBA 2EZTA 2HEIA 5CB4A 1RJGA 1N2BA 1XRSB 3W5DA 2Q49A 4ML3A 4EFDA 1RE0A 1V5EA 2AI2A 3THWA 1VJ0A 3ZCUA 1P5FA 4G1FA 4IINA 4BMDA 5KPDA 2CV2A 1CSEE 2X1VA 1U8YA 2YOGA 1SVSA 3CX6A 3WYAA 5KS2A 1OFVA 1LWNA 4DMKA 1ZM9A 1UT8A 4TRMA 3VHXB 1KEKA 1JG6A 2PA3A 2P9CA 5IJ9A 4AWBA 5CJPA 2J3JA 1G5QA 4E1VA 3KU1A 1CYEA 3BM5A 4GX2A 3DKRA 3IURA 3QFSA 2OXRA 2OYSA 3B53X 3GEEA 4FK8A 1IZ8A 1MT0A 3DO6A 1PL0A 2W2LA 1CEEA 2WU0A 3F5FA 5FA5A 4JELA 2BKLA 1COWA 1A7JA 2PKRA 2ZVDA 3GT3A 4P3PA 4CF7A 4GKKB 3ZI0A 2BGIA 4M22A 4O8CA 4XB2A 3SYTA 1JP7A 4BBZA 4UTVA 3HB7A 3NJ4A 1G1AA 2ZT8A 3JCZA 1UF9A 3IOYA 1LKZA 2Q5FA 3OA0A 4OL9A 4DCOA 3AESA 4DM3A 1FMTA 4NAHA 2BFBA 3CWCA 4UU7A 5F4BA 2QN1A 2QRKA 1TCAA 1TZCA 2XADA 5C46F 4W5NA 3GW8A 4GXNA 2FSIA 5JNWA 1DRKA 4MUFA 2C0CA 4NBSA 1QG0A 2ZBRA 1J1UA 5DH9A 2YXDA 2IKSA 3PB3A 1DKNA 3A2LA 5KNBH 4KC0A 3LG2A 3U5TA 1RP7A 2GD1O 4WK0B 2VQ6A 3P32A 3TLKA 2ZUBA 1U94A 4MWZA 1RACA 1DSSG 3HM9A 2XUZA 1BA3A 4TVOA 5E6RB 5KREA 1AS3A 2FRVA 2Z9BA 4WLOA 3HY4A 3C0KA 4J2OA 1E62A 4I2NA 1SAYA 1MMFB 1NZDA 1PUIA 3HKCA 3ES9A 3BH0A 2GS9A 2HMVA 3LUFA 2HW8A 1JR3A 2FPPB 1BW9A 4O4HF 1ULZA 1KMCA 1JQ5A 1ZK0A 1QMGA 4GZ6A 3MXTA 4H7HA 3IAAA 2HPAA 2FR0A 2REBA 4QOJA 4UKDA 2E4VA 1WUIS 4MYCA 4X64B 1UKAA 2HSWA 1NA5A 3PFWO 2H8KA 1A88A 2BAGA 4PZ0A 1KFBB 1PJAA 4P4NA 2ZI9A 4BNXA 5EPOA 5ED4A 1FK8A 3R41A 1WHTA 4G86A 4G0NA 3UF0A 3ZC3A 5HA5A 1SK9A 3FZGA 2FKNA 3KR2A 2GZSA 1QP8A 2VNKA 2FYTA 4EG1A 1T2DA 1IVNA 2KLHA 1CRZA 3T1NA 2WYOA 4G5SA 3W06A 3X1JA 1A50B 3KQKA 2D7DA 2VT2A 4KODA 4MQEB 1UXOA 4F86A 1OBHA 2YCLA 4KDCA 2WJVA 5GWXA 2YWXA 1NW5A 2XUPA 1KMHB 1TX4B 1B2LA 2YNMC 5LMCA 2X3UA 3EEYA 5C9ZA 3LQ4A 1X1DA 1OFTA 4R2LA 3HCOA 5ALFA 5KX5F 3RS2A 4HN2A 1YE8A 3IT2A 1PWZA 4A5OA 3OSUA 4GKAA 1F4LA 3FPLA 1JL3A 3BRCA 3QM1A 4L8YA 3HUEA 4O2BA 1W2HA 5HS4A 3BL5A 4HDRB 4ENPA 4B3XA 2BC9A 4MVJH 3AEXA 5ICSA 4BCCA 2OP1A 3NT5A 4BNUA 1GCGA 2I67A 2OXEA 3NBQA 2H07A 4G0OA 4IQ0A 2NUBA 3O90A 4CKWA 4LHWA 2QLFA 1FDSA 2B4KA 4N1AA 3X1WA 2PS0A 5A0VA 1KO5A 3BIFA 2K6GA 5JR3A 2DECA 5EHXA 4BNLA 3TGWA 1KSFX 2YZMA 3N2LA 3QP9A 4M8SA 4MQ4A 1YQDA 2POQX 1BSVA 4KI7A 1QHEA 3TTYA 1IY9A 1CBUA 5I4CA 2J85A 1YT5A 4PY2A 4UM9B 3DNFA 2QE7D 3RANA 2ZB2A 13PKA 3P52A 4A8JC 1XK7A 1VHLA 3M5PA 5BN1A 4I55B 3QUBA 4L2IB 3EPPA 3QPCA 1TQ2A 2I7VA 2CFRA 4MUHA 4TRNA 1LDMA 3MOSA 1ZAKA 5I7EA 4MKRA 1HDXA 1MKYA 2WV9A 3L77A 2JJ2D 4MGZR 1RAIA 5AI4A 3ZE6A 1TE2A 4D98A 4NZPA 1JDVA 4KX5A 1Z0UA 3GLRA 5B3JC 3K6RA 4KV9A 3VOAA 2XNDA 3AUUA 3QJGA 5DSXA 1WL8A 1XI2A 1UFOA 4L0CA 1H6AA 4IJ5A 3L04A 2KBEA 4OG2A 2GSWA 5LQRA 4KIFA 4ZVOA 4PZLA 4G89A 1O6ZA 2A30A 1O6FA 4ZHQB 4PEVA 3T7IA 4Q03A 2V4MA 5HPYB 1NPYA 4UE3S 3RAEC 4W9NA 4Y18A 2Y27A 3MRTA 1FLAA 2XRMA 1W30A 1TOAA 1Y9EA 1E20A 1G5FA 3AB8A 3I32A 1Y9JA 3QJYA 5LA6F 1WLYA 3IEMA 1USGA 5F7ZA 4NZOA 2HBYA 1OX4A 5C37A 2XEXA 3D5TA 1X9HA 4KQHA 4UPVA 5B7PA 4JS0A 2JVKA 1U5BB 3G5TA 1I6KA 1PZNA 3PITA 4FYJA 3B12A 4LRUA 3JD2A 1P3Y1 1HFEL 4GO1A 3AF6A 1B43A 5C8YA 1JJBA 5IBCA 3NHYA 5BYBA 4BNVA 5L3QB 2MWMA 2RGGA 1HDOA 1GGVA 3C3DA 1XTRA 5SZJA 2PKEA 3UQZA 2FG6C 4C07A 3I58A 1K5PA 2PXAA 1W25A 5BR4A 2NPFA 4OXNA 4Y2YA 3V2GA 3FNQA 1YIAA 2V5AA 4JENA 3WAKA 1HYEA 2E4XA 4MRPA 4KN8A 3PSAA 1C5KA 5C52B 1U63A 5KTMA 4QVGA 4K8OA 1LU9A 3ZDZB 4R9SA 4MARA 4KVZA 2BP7A 4HYYA 1T8SA 1X7XA 2AI1A 4RANA 2CJWB 5CJ2A 1NQVA 2J48A 2PUDA 2UZIR 1DC4A 3L0CA 1RJ9A 3O4FA 1E4OA 4FR0A 1KI1A 2FEKA 2QKYA 4QGGA 4BKQA 4NNPA 2MR5A 2UU9B 3VAYA 3KWLA 3LYHA 3ORFA 3AW9A 3LHDA 3QVWA 1E98A 2CUNA 1RHUA 4FYWA 3I64A 4CVNA 3FG9A 2P79A 3KKMA 1V5IA 2OAP1 2G5TA 1ZIXA 2FF7A 3F7NA 4KPFC 1TEVA 1HXHA 4TWRA 4ABYA 4B34A 2HTEA 4WKOA 1SXQA 3D7NA 1O9HA 3DFFA 4NYIR 2H0QA 5TF4A 5AK6A 4CQMA 3DLPX 2AZDA 4WLUA 4BNDA 4CG3A 3D2CA 5DT2A 3L79A 2JCGA 5EZSA 3BQMB 2ILVA 1ISMA 3GD5A 4TTQA 4DRXB 4WBNB 3ESRA 5HX7A 1WKBA 1ZH8A 2QAGB 3B1KA 4QBKA 3WE7A 3GLHE 4LZWA 1TCCA 3UOAB 4E88A 3JAMA 1JZTA 3GJ3A 1Z34A 2XMQA 4TMFA 1EZ4A 2GN8A 5EHGA 5EUQB 3KYCA 4BP9A 5LP6B 3QI7A 1RXSA 4FT2A 4IIUA 4HNAA 2Z5FA 3TDNA 4D9BA 1J0AA 1YE3A 1RZUA 5JD5A 2X13A 3CPHA 1VIMA 1N2OA 5BSVA 3B89A 3MYYA 4HDNA 4A2PA 1U8AA 3E9QA 1R0BA 4D56A 3BCUA 1B15A 1W6RA 4NJMA 3O3OB 4KQWA 4K81B 2ZIXB 3ZV4A 3AWDA 3EYAA 3EIHA 3HKCB 3IOEA 1CJKC 2WSYB 3HDHA 3FD8A 3F46A 2V65A 1AKTA 2D1SA 1DE0A 1YJCA 2B20A 2OCAA 2VUTA 3IVAA 3OG9A 4FEYA 4H27A 2QX4A 1NBAA 1C8LA 5BV0A 1Z25A 1M8GA 1XXLA 2IYXA 3D8BA 4RDHA 5JSHA 1KEEA 1PYDA 4H1HA 2B1QA 4HYTA 4TTPA 4HG2A 4YJDA 4B8ZA 1EX6A 3L3BA 1JDBB 3LP5A 4G1UC 4AW9A 1D7OA 2IEBA 3E7XA 3KPJA 3PPVA 3RE1A 4DJEC 3B82A 5FWAA 3G0DA 4D9JA 3PUIA 4HKTA 2X58A 4KBYA 5ECWA 3OPQA 3OEHD 2JCSA 4JC8A 1C8BA 1WBBA 2C04A 1JW9B 5B58C 1ORWA 3RNOA 4YXWA 2O19A 4XUGB 3I61A 1EHYA 3U1TA 3NIDB 3U7QB 1BCSB 1ZOOA 3I04M 3LECA 3WLKX 4GF5A 1HDEA 3PIIA 1JXQA 2GBFA 3OJLA 4UMFA 1QCZA 3NYRA 1T24A 2BLNA 1AKVA 3LL4A 2PGLA 3PUKA 4BMSA 1LWOA 4R0VA 3KT3A 4C87A 1JFVA 4XRGA 1SU7A 3UAVA 2G5GX 2B5OA 3QEMA 1QGYA 4UM5A 3TL6A 5EA2A 5DP2A 1XVAA 1G8YA 1L5NA 1J00A 1D2NA 2AS0A 3FNEA 1NF8A 3WB0A 3I92A 2MDTA 2AJDA 4YT2A 1EDBA 3CWQA 5BR7A 3GAMA 3P19A 1G3MA 4XJVA 2K7FA 2XOEA 5BSUA 4MKZA 3ZXXA 1G20B 3VUEA 2JLSA 3E9YA 1VLLA 1FVOA 2C3UA 5ESDA 1M0EA 2ZCVA 4L4XA 4M9QA 4Y8VA 3SKXA 2PGIA 1HA3A 2QVLA 3MTEA 2RH9B 1BROA 4AF6A 3WNCA 1NIJA 4BGUA 1OB5A 3Q7EA 5E1BA 1FY2A 4UUBA 4NU5A 5CA0A 1HR0B 1A5ZA 2DKFA 3I4FA 3I1YA 3BF7A 2PFKA 4MAAA 4MVWA 4TLCA 3RT9A 5B3LA 1E2JA 1GAQA 4DRXA 4EPWA 5BR8B 1OWLA 1BJTA 2XZDA 4PWYA 3TW0A 2HHHB 4EO9A 1C30B 4B6EA 1Z6XA 2BKXA 3VR4A 1E3WB 2FW7A 3W77A 2QMQA 4E11A 4YDSA 5A9TA 1VFNA 3AU9A 5LWQA 3N2KA 3EMVA 4WINA 1GZSA 1I4OA 2QX9A 1TA4A 4ZOBA 2FZLA 2PUAA 3CR8A 1ZISA 2WBLC 3IXQA 2OD9A 2BTOA 1YZQA 1B0AA 5DGDA 1QC5B 1B76A 3OTQA 3IT0A 1RHMA 3TGLA 2WOOA 3HKBB 5IUNC 1RC0A 1TYAE 1D3AA 3RRXA 2LE0A 3DHEA 5C51B 5A4DA 5GZ1A 1QGUA 3A36A 2TMKA 1VL5A 2H52A 1NQ5A 1HDZA 2JGLA 2VA9A 2VDPB 4H17A 2G04A 2AG6A 4X1OA 4G65A 3OA2A 4MI3A 3KUDA 4YCMA 1CY0A 4X84A 3AIIA 1Z12A 3ABSB 1FNDA 4LZZA 5D85A 3RU7A 2C5LA 3OQ6A 2PL1A 5CVTA 2IQ5A 1NXSA 1UC8A 2C1XA 2IXDA 3E1SA 1C41A 3FCOA 3BSFA 3KJEA 1EWRA 3SXPA 3W2FA 4QO8A 1UFVA 1ZD2P 2ZXFA 1QDLB 2Q3JA 4J4TA 4F1KA 4KH1A 5E9QA 3O8OB 4GXRA 4XWKA 5F7JA 2NYRA 3SZUA 4CN8A 2Q4TA 4CJXA 2YWRA 4E5MA 4RXUA 4A92A 1YVDA 3F96A 4YVFA 3M82A 5IYZA 1T9DA 1O1YA 2QAGA 2BRUA 3S1LA 6ADHA 2I1VB 1AO3A 1N33B 1CYDA 1XP8A 4E21A 1WZIA 4JLVA 4UOEA 2FW1A 2ZR8A 2I6UA 3OPNA 2DLCX 3AHGA 4YCCA 5EWMA 3HI6A 1T91A 1YA8A 1AS0A 2VFAA 3LLMA 5MN5A 3QKUA 5DRTA 3OZEA 2CWWA 2HM7A 4RW0A 2F4VB 5SYMA 3THXB 2IS4A 1HWYA 1R8XA 3MTJA 1WQ4A 4MPJA 1VE6A 1NUAA 1C30A 4MW1A 1GPLA 3ND9A 4PICA 5JSKA 2YIDA 5CAEB 2R6DA 1C8VB 4WUVA 3D4OA 3VOBA 5A3JA 2G6TA 4HTFB 4DYHA 4RZSA 3R9XA 5JCJD 1FFYA 3ZE0B 3VYUB 1O95A 4YR7A 4QWMA 3AINA 4HWRA 3D7MA 5E95A 1EGVB 1X3SA 3A9WA 2X9LA 1AS2A 3HGMA 2VHXA 4I9FA 4FKMA 4Z8YA 1Z4JA 2G72A 1DDOA 4ZDWA 2UXDB 1ZM3A 2B3DA 3L93A 1BX1A 3A1DA 4Y2UA 3B1WA 4AY2A 3O38A 1DG1G 4YUAA 3K8OE 3K0SA 3ZWCA 4J94A 4YWJA 4YN3A 2FW0A 2Y77A 3N7AA 3GBVA 5SZKB 1BAPA 1JHVA 2JVIA 5I45A 4Q4CA 1EK2A 4EGJA 4B6SA 3GGCA 3G1TA 3R3SA 3KQSA 4S2UA 4BX0A 1GG8A 2XXBA 4J90A 2G09A 1P0FA 3ANLA 3CKYA 2XDQA 2YZNA 4J49A 2EX0A 2CFTA 3CIOA 3KLOA 1LF0A 4Q9HA 4NPHA 2OENG 3D3JA 3IT1A 4QJ5A 3U3XA 5IFKA 4EPXA 4RY9A 1Z7YA 2J59A 5CRIA 4F6RA 3THWB 3QE2A 3EBOA 3L6BA 3B2EA 3U3MA 3IEUA 1NYTA 3SGLA 2Q5HA 2OGZA 1YACA 2QD2A 3BDAA 5BW4A 1SZCA 1MRZA 1GQFA 4G5RA 3PT9A 3QELA 1QIHA 5HCIA 3EVNA 1WY5A 3F7MA 3KLBA 4FB5A 1K8ZB 2B83A 3AHJA 3KEFA 1PJQA 4RVSA 2Q50A 5J40A 1SBIA 1SULA 4QUHA 1HO3A 1YFKA 1JTFA 4XASA 3GNSA 2BFEA 1E2EA 1IAVA 4P2GA 1P80A 3WGHA 4YLYA 4Q0MA 4F7WA 1F6BA 2ZI7A 3ZDFA 4H3KB 2XKKA 4P32A 4CEIB 3PIDA 3QU2A 4D8XA 1N9KA 2REXB 1N4AA 3N28A 1EUYA 5LL6P 3SYLA 5EEHA 1K6XA 5FX2A 1HRKA 1OROA 1ZH4A 3N0VA 4LXQA 1SCIA 2A9RA 4NULA 1AZWA 2UZ3A 4DMLA 1E60A 4PO3X 4DREA 1P7YA 1SVOA 1YKSA 1Z5NA 1KU0A 2YWHA 3HYLA 4X97A 5K0LA 3ZH2A 1MHTA 3DO5A 1WY7A 5DBOA 5LUBA 3V48A 4HDMB 1H0SA 3VMMA 4A0GA 2J6HA 5KUTA 4U7PB 3MXOA 2G9RA 3H5RA 3T1OA 1JYSA 5JDIC 3ZCRA 3DBRA 2ZQZA 3ZVRA 4DBLC 1ESEA 3P2OA 1J2TA 4Q21A 4AKGA 1VPEA 2PRYA 4BKPA 4HAUA 3CGWA 5IF3A 1SKYE 4WFJA 4M99A 3BMNB 3I2JA 4MLZA 5ENVA 5BSHA 2HIGA 2F4NA 4FU0A 2H5LA 4HX5A 3MOGA 4YQYA 1X9IA 5D1NA 1PBNA 2PX0A 2IVZA 1MA0A 2GYVA 2PKQP 3OY7A 2ZS9A 3Q12A 5FNVB 4JI6B 3U4MA 4B7ZA 3UH1A 3RRFA 4N12A 2FWIA 3COWA 1RI1A 1L6RA 2BFNA 3E03A 3BH7A 3GOQA 4K26A 4DCNA 621PA 4DR2B 1TU0A 4DIUA 3CR7A 2X1MA 3RF7A 3AVTA 4P1ZA 1ITZA 1P77A 4EUNA 4WY8A 1FRVA 3I6BA 1ZU4A 4N48A 1E7RA 2EIHA 1B41A 3FFBA 1YS6A 5A7FA 1N6OA 5IMBA 4M0PA 1L8LA 3GRAA 3GZTB 2B8EA 1QGED 1Z4LA 1IQRA 4X7RA 2GLXA 1OBFO 2AOTA 1ZH0A 2Y0BA 1H93A 2J9FB 2XYPA 1B93A 3MG9A 4YAWA 3PNYA 3WV4A 4O2LA 3M49A 1FDVA 2G1KA 4ND1A 1KWKA 1I32A 4WDQA 3CJTA 2X14A 3HKEA 1I94B 1NFFA 4P34A 2WJ3A 2VJQA 4I55F 5JMTA 1RMTA 4FX5A 1LF5A 2Q45A 2WKPA 1DOHA 3BXXA 1TO1E 4TS9A 2O7SA 2OFWA 3RSLA 4ZODA 2I7CA 2J7PA 2FPXA 3FE2A 3U37A 2ZATA 5HK8A 1YZVA 1NVEA 3IULA 4EI7A 3GQVA 1NG1A 4KAFA 1L4EA 2IF0A 1K3TA 5AXDA 3G49A 5EJ5A 2VH1A 3DP7A 4HY3A 4NHOA 4Q66C 3BXHA 2FPGB 4BLUA 1LLQA 1P44A 1QGOA 1U2DA 2G7ZA 3M4ZA 1NVBA 4JYMA 4OI1A 1DJOA 2TMGA 4ZFNA 3WAJA 4I3HA 2CHFA 4MR8A 1K5DA 3NEAA 4RTOA 2DP4E 1NBWB 4GSYA 2Q3LA 3TQCA 5JOQA 5JRJA 3THYB 4I7EA 1BMQA 4PU0A 3NAQA 4GQBA 4K87A 1FNBA 1ZVVA 3CF4A 1L7XA 2EG5A 3SVTA 4DLXA 1IH8A 4KAJA 2IZ1A 3BPSA 3PKIA 1Y4DE 4TV8F 4Y2TA 3UYKA 3V1KA 5TIIA 4W9MC 4IL5A 3QTTA 3ZV3A 3C3XA 2HR1A 4OBWA 4WY2A 3ME5A 3T7DA 1Z33A 4Q3KA 4XPIB 2FPLA 4FX2A 2XQKA 4XARA 1TJ4A 2WZDA 2AOUA 5DTMA 3JWEA 1N5JA 1CHNA 5DYNA 1YIDA 1UBUS 2JHPA 2JJ8A 1OXVA 3LX5A 3TKYA 3HFGA 1QFSA 2ERYA 3C3BA 3K5PA 4KMOA 4LJ4A 4ZU3A 5G1OA 4FFBB 4CM1A 1R5NA 2C5AA 4A8TA 2C96A 4QYSA 2BE9A 3IAS6 2QN3A 4XH9B 5L3RA 3UN1A 1BXRB 1PG0A 3DTVB 3V42A 1D8TA 4D9HA 2OM2A 1KSJA 2A0KA 3JRNA 2XZLA 4BX8A 3JAKA 1E59A 1DWOA 1J0CA 1F14A 1KSHA 4Y6RA 3HFRA 5DDIP 4XWWA 2MSNA 1W5BA 2QB5A 1XTPA 3AUYA 3BZWA 4RK7A 3IE1A 3K94A 4YCDA 1NW9B 1WU7A 3UA4A 1DX6A 2HXYA 1AT1A 1XYGA 1D8AA 2CFCA 1XU9A 5FLYA 5LCXA 3ZYZA 1XD2B 3JPWA 5BRJA 3LUHA 1UT5A 2XQJA 1H4TA 3EJ6A 3R0IA 3UMRA 1E1RD 1RAGA 5E38A 1X92A 3I4CA 3OMLA 2V0GA 3HC7A 4TWZA 4YUVA 3JQAA 4ZT4A 5AOCA 5EKTA 3Q2IA 3AYXB 1QNFA 1E3LA 1VECA 1SRRA 4Q37A 2AW5A 3ROFA 1FUIA 3RTDA 4BAZA 3KHUA 2IXBA 3N2KB 3RI3A 2FDRA 2Q5JA 2ZRKA 4FC7A 4YPFA 3LGSA 2JH8A 2QY9A 2YINC 4HS9A 1CU1A 1JB9A 4G5XA 4YJHB 5KTSA 1UM8A 1ZI8A 2NU6B 2O2JA 3P2MA 3O93A 4CUJA 4HH3C 4U3JB 4F06A 5KPJA 4ITRC 3AEUA 1U9CA 4ZK6A 4AULA 2ZBVA 4CMIB 5DIZA 3OZXA 2LBPA 1AO0A 1IY8A 1D09A 2QJFA 2R7AA 3OO1A 1AGRA 3QRWA 2X5OA 2FETA 1C4OA 4OXRA 3WGQA 4UU1A 3EB9A 4CE6A 5HJEA 2CDAA 5CFNA 3FPBA 2G83A 2FEXA 4JLWA 5FORA 3WLQA 4WD3A 5F1OA 2HQRA 2QPLA 3K5WA 5D3MA 4Q1DA 1OUMA 2Q3CA 1AZLA 1CX9B 4I81A 4MVJA 2JIRA 5ENDA 4XVHA 4QEKA 5IFLA 2IJGX 2P4QA 4IX9A 3WKCA 1WCIA 4YB8A 2ONYA 2VYVD 1PQ4A 1K6MA 5BY2A 2QROA 4TKUB 5AI9A 2Y1EA 4DC1A 5LZ4A 1YS4A 4P9NA 1PQPA 521PA 5AVUA 1N4DA 2O1EA 1D2AA 1GDHA 1YB6A 3HUDA 3D4LA 3HKBA 3IO3A 3PRKE 5T3UA 2WF9A 1NOKA 1GARA 3NBXX 4GMGA 2DY1A 3QPUA 5KJFA 3KK0A 5A2GA 4MKHA 3L49A 3IGFA 1EK0A 4AB1A 5FOWA 1XXHA 5ILOA 1JNYA 5F2EA 5ER9A 2YRFA 1A5TA 3PTZA 2ANBA 2W2VA 4PNPA 1SZJG 1AOXA 3HJNA 1FTSA 4FGZA 3MJDA 2I80A 3H17A 3H5VA 2P5TB 5ADHA 2KHZA 3X2SA 1V1MB 2RIRA 1KEEB 4RHXA 2ROQA 3ROZA 3SIRA 4L6AA 1R64A 1QO9A 3BD9A 4XA8A 1DGQA 4GOND 4TXHA 2R97A 1FP1D 4DT1B 2WFAA 3DKPA 1WBDA 3T54A 3G2QA 3S8EA 1YR3A 4ER6A 1BQ4A 4KSBA 3QVXA 4BMCA 4MP3A 2JHAA 4OUDB 1KYZA 4ZZ3A 5L6MB 3RH0A 2XCLA 4L73A 4QDZA 1G64A 5FPYA 5J1SB 4FCWA 5HCUA 5JVDF 1CUAA 1G3IA 1HKHA 4RTLA 4DR7B 3LF1A 4OQXA 1VJCA 2OXIA 1E9CA 5EE5B 5CEFA 1FP4A 1AMUA 2GZ1A 1QHSA 1K0UA 4CLEA 3HPRA 2K5UA 2PU7A 3TRHA 1QOPB 3IEXA 1YDWA 2AE1A 3LUDA 5JV5A 4WESA 4WECA 1R4ZA 2ZIAA 3O0DA 2AD1A 4CHTA 3GMDA 4FS3A 4BNDB 2C8JA 2O20A 4PLPA 4XYGA 4JC4A 3I62A 3GYGA 3H1EA 4B32A 4PCLA 2R47A 1E7SA 3I83A 4PSDA 4BP8A 4UUMA 3CRW1 2BHLA 2CNWA 5EIEA 1DPFA 3B1YA 1IXKA 2WUGA 1N3YA 2IX9A 3C70A 1QYXA 4LXHA 4FHFA 5CX1B 3BRQA 4C0LA 1OYVA 4JKIA 2UXCB 3WGZA 3ZGVA 4MCAA 2RB5A 2B8TA 3IEPA 3ZOKA 2R87A 5EJMA 5E9WA 1TAUA 2W6MA 3R5HA 4P5DA 3I0ZA 1I2ZA 2Y6UA 4L85A 4B7CA 3AJ8A 3HRKA 2R85A 3KTFA 3H0CA 4LEIA 3D6MA 5K5EA 4ZPXA 1ZN2A 2R1VA 5J58A 3BEDA 2ZRAA 3UIEA 4AQ7A 1A5AB 5F3WB 1U7ZA 5JFTA 3IILA 5EZ6B 1BDHA 4IUDS 3RIXA 1ISSA 4LQLA 1K7XB 3KTOA 4O5AA 4NH0A 3TNLA 1OZHA 3LA6A 2R2AA 2DQKA 2GQ0A 2BTQB 1T8WA 2KJQA 2PL3A 3FGNA 1Y7IA 1Z2OX 3SG0A 2DVMA 2IGBA 4WLVA 5HTKA 1SR8A 1XZAA 3F1KA 3WB9A 3J80A 4IDQA 1J09A 4EJ0A 1W2WB 2HLHA 1H2FA 1RHKA 4CMCA 1FJGB 4AMYA 3PEYA 1YJ8A 4K9KA 3ONEA 1HE2A 2WM2A 2WEKA 3BE8A 4HCJA 2QG6A 4Q7LA 5EIHA 2ZRHA 5JD3A 2EATA 4HNAB 2OCIA 1E79D 2HAEA 3U5ZB 4M9RA 2XZPA 3OTWA 3QOXA 4MDHA 3TAHA 3QVJA 3ILSA 4KGVA 1VPDA 2C8VA 3UGJA 1A7UA 3EA4A 4BVKA 3AR8A 3T3DA 8ATCA 2BMEA 1QHYA 2R86A 3E9MA 5JXWA 2W11A 3FYDA 3I6YA 1EUZA 2QUAA 3TSAA 3GH3A 3HO8A 2C54A 1MAAA 2XRFA 4S1TA 4ZO8A 1EHIA 3A6KA 4AMVA 3LZCA 1YBHA 3V1MA 2NZJA 4YHHB 2WHPB 3PA8A 3F6YA 1JHYA 3I9OA 4X8MA 1SK8A 1SXJC 1KE1A 3SXUA 3UXYA 3FZQA 4WNAA 1L7VC 1LX6A 1W9MA 3IOMA 3P4UA 3NWOA 3HL4A 4HFNA 5E0OA 3RYCB 2ZQYA 3TAUA 5JATA 2QG4A 2ODPA 2NO0A 4L8GA 4R8VA 1GO2A 2G9UA 3A1SA 4BQSA 1KZYC 2PIDA 4F3RA 2DETA 4FR5A 2AR0A 4ENTA 2Q9UA 1CUWA 1IHYA 1TZMA 2GASA 1D2EA 1Z5GA 3ZZ0A 5IYZB 2VH2A 5JXGA 1UXIA 1XDWA 2C5EA 3OFJA 4UTOA 3ZTWA 2ZRLA 1NHWA 1TT5A 1YVUA 3AX6A 2XMCA 3KQWA 3UHFA 1ZD5A 1F8UA 4C76A 2VF5X 3AY0A 2Q1WA 4W1QA 4B7UA 4F4UA 1CF9A 5IULC 4BE7B 1KEWA 3OSZA 2PUVA 4XD2A 4O02B 2QP9X 4GIBA 2AFIB 3OM9A 4H0FA 2E3JA 4FSXA 4FYXA 1H9CA 1GGEA 9MHTA 1OIWA 4M98A 3FMIA 1JSLA 4DAOA 4RZQA 4FFRA 1WJGA 1LRJA 1XBTA 2BEVB 3SEQA 4QZVA 3GVHA 2JIOA 1LX7A 3MUNA 3ENWA 2VXYA 4MIYA 1UBTS 3C87A 4DVJA 4YPVA 5EJ7A 1NC1A 1FYFA 4M7OA 5FWYA 3B9QA 1L1FA 1N6LA 3SJAA 3GPDG 4C4AA 3EXEA 4JXJA 1BGXT 1KAOA 4WK4B 3HJAA 2JFNA 1C3JA 3H1AA 4I4TA 4WEOA 5K0ZA 1EM8A 1PV4A 1KJIA 2YJTD 2X22A 1U3FA 3N7UA 1ZGBA 3EDMA 3K8ZA 4J8PA 1W6UA 2ZAOA 1XVLA 2OXTA 4CV1A 1ANKA 3CR3C 2DR3A 3MLEA 4D41A 3T5GA 1TIKA 4DCUA 2YJ5A 1NW3A 3QYPA 4TMXA 3K92A 5DM1A 1RRMA 3RVRA 3ICVA 4EHDA 1ZJ6A 2Z83A 4ZHQA 5M7EA 2CEKA 2YQ4A 4X6XA 1PRYA 1WF6A 3IPXA 4DLUA 4J1NA 2PQ0A 2JZOA 3WK8A 5BNTA 3FYCA 5BV2P 1RXVA 1NBOA 4AKIA 1KK3A 4QXRA 4YJ3A 1W75A 3GA7A 3KALA 1G4AE 3V1TC 4BQNA 4D8UA 5LYJB 2PZGA 4R54A 4TVSA 2NTJA 2YZKA 2OEPA 3L46A 4KN5A 5G0WA 5THXA 3TZQA 1Y8ZA 2OCYC 3AVYA 3L8FA 2YH2A 3A9SA 3NW9A 4YO7A 3CUKA 3WSVA 4D6YA 3ZJ5A 1W85B 1O0SA 3WQBA 3DMNA 3NT4A 4XSVA 3KG2A 2FEOA 4UQPA 3RVMA 2VP3A 4JOQA 4PW0A 1RXWA 4BUJA 4GP6A 3ZHSA 5IH7A 2ZSIA 3ETDA 3ZEAA 4LGMA 4IVQA 3A9UA 2DUNA 3CLKA 4JN6B 4MWBA 3UV6A 4EA7A 1M1NB 2GAIA 2V54A 1W5AA 1IFXA 1FBNA 2WJGA 3DL2A 3DDUA 1CJCA 3F2IA 1NJ8A 3DFZA 4G01B 4KO8A 2Q21A 3BA6A 2KE5A 4XWAA 4WGFA 5AP9A 5KYVA 3R7FA 2LPMA 1GGNA 1TFRA 2A7XA 1JHOA 3EFOB 5FNVF 4F38A 5JXJA 1UPTA 1V43A 2PAFA 2XVZA 3PJGA 4HYEA 4IW3B 4UTRA 2Y0PA 2Z4SA 1UJNA 5DM70 1DKMA 3IVMA 4J91A 2BM9A 4TXMA 1DBVO 1Z75A 3F6PA 4J16A 1M1YA 5ER6A 2ZJ7A 3WMRA 2Z30A 1E63A 2BY4A 5A7GA 4TLEA 3WMEA 2F48A 3HL0A 4K9NA 1C7EA 1RKXA 1OZAA 5IAEA 2XUFA 3BHNA 4CF3A 1UC5B 5TXGA 3FWKA 5C32A 2HSDA 2RG7A 3WK9A 2XOKD 3PF8A 4GWGA 3SFTA 4BLTA 4DFDA 4ZYUA 3NOOA 3T41A 4YMTA 5CDHA 1VPVA 2O8EB 1YL7A 1Z06A 4MJ3A 1K1EA 4Y9SA 1KDZA 1UQRA 2MSCB 5H0IA 5J1TB 3UK7A 1T36B 3RLFA 3LCJA 1EVIA 1K68A 2EKDA 3CB4A 3JVDA 1E7WA 3PQDA 3R3VA 2PGDA 3O8BA 1JTEA 2C5SA 4H15A 1L4KA 4QBGB 2V7TA 2WUDA 1U4NA 4NATA 1K9SA 4PX5A 3VR3A 1EE1A 2Q1YA 3IMEA 1L7AA 2H1CA 3MFYA 3BC1A 3PFNA 4G26A 4I3GA 3OT5A 2OK7A 2VPYA 4LDNA 4BYGA 4HXFB 5D2CA 5E8RA 4FE3A 3VR1A 1VE1A 4HSGA 3LT5A 2QW8A 1HYQA 4NOLA 4R31A 2ID9A 3C5CA 5EHQA 3UWKA 1VKJA 3AFOA 1XYVA 3DCNA 4L5YA 4F21A 5D7NA 4GE0A 3DM5A 1Z2DA 2ZI4A 1LSSA 4IP0A 3SYNA 4DUYB 1A2KC 4IH4A 4NI5A 3VYTB 3P9RA 2OBXA 1I01A 1W87A 2WV7A 1QZUA 1R88A 1Z28A 4EB8A 4YRMA 1NYLA 1ENZA 5JZVA 1ACMA 1M7GA 3V4LA 2AR9A 4AJKA 4QT4A 5DIFA 3OP4A 1O97C 4U2KA 1XHEA 1ZONA 2XQVA 1U1DA 4MS4A 1PFGA 4YR9A 2P77A 1ISJA 2Q62A 2ZR7A 2XT9A 3WYEA 4QJIA 4B4OA 4D0NA 2BFFA 5FTKA 4G5HA 4URWR 2FSVA 4TV8B 1S2IA 1X1TA 3NFRA 1PG5A 3GUCA 1ZITA 3F5MA 4XW2A 1R9MA 3E2MA 4PINA 5A1TA 2HWKA 1QG4A 3AR7A 5D00A 2LNDA 3V7UA 3DPUA 1IG3A 1E7QA 5KC9A 1XC7A 2J0UB 1VSTA 3GDGA 2BMVA 4UEOA 4YFVA 5FPSA 4IPTA 2WW8A 5DN6A 2BI4A 3HRIA 3PXUA 4R2WA 3UWPA 2ZETA 1DEHA 1U8FO 5GIPE 2Z04A 3S2FA 4BB5A 1KAGA 5DBEX 5IWCA 1SZDA 2VSQA 4IEEA 4BMYA 2EHDA 1L7RA 4B5KA 1HQYE 1GRRA 1I10A 1Z0DA 2BFFB 2JA1A 3BERA 3WLFA 3GO4A 3X1DA 2PO7A 4RMHA 1QPZA 1DQNA 2YV1A 3HB1A 4R6WA 2I22A 3GEIA 3N0TA 4L2IA 1GPJA 4D57A 5JAHA 3C3YA 1WZCA 4G1MB 1NE7A 1Q1AA 3W90A 5BN5B 4H1UA 4PIVA 1IWBB 5M3BA 4UEKA 2OBLA 3ZN2A 1DTEA 3ZXUB 3I9KA 4U0JA 4EIWA 3TXYA 2HCTA 4RA9B 2O2DA 1GG9A 4MK4A 5A6SB 5AW4A 4H7JA 4H60A 4RZXA 4G81A 4KAAA 1KI6A 2PU5A 1QF7A 3QOYA 3MHTA 1P5JA 3HACA 4U2EA 3GFBA 3VJRA 5AVXA