3SU8A

Crystal structure of a truncated intracellular domain of plexin-b1 in complex with rac1
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
178
structure length
178
Chain Sequence
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-related C3 botulinum toxin substrate 1
publication title A Dual Binding Mode for RhoGTPases in Plexin Signalling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis/signaling protein
total genus 47
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2011-07-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3su8A00
1JBKA 2BV3A 3W3ZB 2JLUA 3ZJYA 2CCKA 3CX8A 3KUDA 2CE2X 5K8UA 1FNNA 4I81A 4NYJR 1L2TA 2QE7D 4N0DA 4QBIA 1SKYB 1G64A 2QSZA 2VH5R 2R8RA 1DELA 4Q21A 5IK2A 4CRWB 3A4NA 4FMDB 1AZTA 4RKEA 2RGEA 3VR6A 1P62B 3U6KA 5DN6A 4WZ6A 2J45A 2ZROA 1JI0A 3K70D 3QIAA 3B1VA 3RS5A 2MSDB 1QF9A 2CLDX 2WKQA 4V03A 3A1WA 1DADA 4JLNA 4LK2A 3DEFA 1KMHB 3ZVMA 3B5JA 2O8DB 5JSZB 3BERA 1L8QA 1I4TD 2XZOA 1G3QA 1NY5A 2P65A 2ZE5A 4PC1A 3HJNA 4RCZA 1F5NA 2JASA 2KE5A 5CB6A 1E1QD 3QKRB 4ZKEA 5F9HA 3TKLA 4Y0AA 5JJIA 1ZM2A 1E2MA 1J2JA 2I1QA 4KCGA 1HV8A 4Q4HA 5F98A 4MGYR 1TQ6A 4WA7A 1XEXB 4B75A 2A78A 1CR1A 3HWSA 4W5WA 2ZM5A 3K9NA 1VECA 4JLVA 4NL4H 3ZLJA 4Q1AA 4KFUA 3AKYA 3EC2A 3DM9B 2QM8A 2ZAMA 3OIWA 3ZH9B 3EPJA 1G3UA 3W5IA 1KK2A 2PZFA 1VIAA 2IS6A 4BFUA 4Q9HA 4F4JA 1XMVA 3FB4A 1O3YA 3VR2A 2VBCA 1T4GA 4DEYA 4TYWA 1T5LA 3UG7A 3GLGB 3PIRA 1D2EA 2G1JA 4M8NE 1BIFA 5JWHA 5JI3E 1Z6YA 3SQXA 1T8TA 4Q47A 4EJSA 4OI0A 1XD9A 3HR8A 4B43A 3L0OA 3RWMB 1G7SA 1P6XA 4Z1MA 2HEIA 1Z06A 3MJHA 3W90A 3WBKA 4PPGA 1JEEA 2JCSA 4EFMA 3RRZA 1JALA 4HDOB 4DCTA 4G5SA 3EZ9A 5GJBA 5CK4A 3VQTA 2WMOB 4EDHA 2E9SA 2BMEA 4IOKA 4BEJA 1Z83A 3HDTA 3CPEA 3K70B 2VA8A 1DTSA 4UNQA 4DUGA 1U90A 5G3ZA 4AK9A 4XH9B 1KO8A 2F9MA 1T3HA 1F2TA 2QQEA 4M1WA 1N0VC 1VHLA 1A4RA 3VTKA 1JPJA 3P27A 4JZKA 4C7OA 2RH5A 1LW7A 5EJEA 1ZNZA 2HF8A 3Q85A 3TIFA 2ZANA 1N6IA 1VHTA 4ON9A 3TW4A 2HV8A 2QP4A 5FTLA 4PQFA 1PLKA 1RIFA 4YXWA 4YMTA 3A8TA 1OSNA 4UNPA 5CJPA 2F7SA 2JJ2D 5C4MA 1ZMXA 2P2LA 2WWWA 4JKYA 1RPZA 1E9BA 4RD0A 3U2QA 2OCBA 2IYZA 3M4YA 1HTWA 3IBYA 5GJCA 4IJMA 4KLNA 3HPQA 1KI6A 3U4QA 3CX7A 4GOJA 3MAAC 1S3GA 4UXHA 4LI0A 2WM9B 2EU8A 2R2AA 3P4XA 2W6ID 3DOFA 4FMCF 4OK3A 4X8OA 3TNFA 4U00A 2O8EB 2CL0X 4PPNA 1EFCA 1YR7A 3VKGA 3FTQA 3A4LA 2ZYVX 4MH0R 1Z47A 4XWOA 1Z0KA 4HAXA 2F1IA 3UXMA 5L3SB 2GF0A 1X6VA 5JJKA 2QTVB 1ZNYA 1KGDA 2HT6A 1ZNXA 3U44B 3GFTA 2ZRMA 1C9KA 4A1FA 1Q22A 2FSFA 2H57A 3THYB 3I3SR 4B3FX 3TUJC 2YVUA 4ZI2A 3L8YA 1UM8A 1MOZA 2QTFA 4DRZA 1RJ9B 2IK8A 4UKDA 4JVNA 4PHTA 1NBMD 1RRFA 5IHPA 1BMFA 5AJZA 1F6BA 2X1VA 1II0A 1SVMA 4V0ME 3WRYC 4AKGA 2FGKA 2XX3A 1E9AA 4LV8B 1OH6A 2QAGB 3G5UA 4U02A 2QSYA 4P3YA 5SZKB 3WRXC 4DBLC 2IWHA 4WXPA 2ECKA 3A1TA 4HZUA 1X8KA 3LBNA 1XD2B 1ZU4A 2OBLA 1FP6A 5FFMA 3CB4A 5JFGA 4OHWA 1S0UA 1Y3AA 4RD6A 1WE2A 4IRUB 2GXQA 3WP0A 1DG1G 4TT3A 2DWQA 2REXB 1G41A 4LJ9A 5BN4A 3U3RA 1W36C 4RFSB 4A0HA 1WP9A 2ZYWX 4B3GA 3SBEA 1GILA 3RAPR 4C9BA 5JWOA 2PJRA 3BB3A 3U7HB 1H8ED 1G18A 5TV2A 3KKQA 1CBUA 1MH1A 2FSGA 1NVXQ 1GP2A 2ZVPX 1KZ7B 2RCNA 4PO9A 2XB2A 3BRWD 4B3DA 4XWKA 3UWOA 2A5JA 2DPXA 3E2IA 2GXAA 2G88A 4GMXA 4MGKR 1SXJB 3JVUA 2GK7A 4M9XA 4MYHA 1DAHA 1IHUA 2J5XA 1TQDA 2GEVA 4IOMA 5JZVA 2BMJA 3AKEA 4BRUA 4FWTA 5JHGB 1HT2E 4HLUA 2GXUA 1KKLA 4CEHA 1NIJA 1VCMA 1M6NA 4E5UA 1GKYA 2GETA 1R5BA 2C96A 4GDFA 1IY2A 4XVRA 4ASUA 2X19A 2IXFA 2OFXA 3M6AA 2VRWA 5AUQA 4GSYA 2GKSA 1KK0A 3CBQA 4WBSA 2ZRPA 4YMUA 4F92B 5DN6D 1SKYE 2QMOA 421PA 2ZQ5A 5TVKA 2HLDA 4TYQA 3EIEA 2WWFA 2Q6TA 4M1MA 1HT1E 3BOSA 1VYUA 3SJZA 1RKBA 4DSTA 2BJVA 3CM0A 3EA0A 4WVFA 4EAQA 2CHGA 1N0UA 1W7AA 4KV9A 2C77A 5EZ5A 2ERXA 2H17A 3K0FB 1F60A 1ZIPA 2OO7A 2CHVA 3B1WA 3PVSA 4H1VA 5KU1A 1CJUC 1D6JA 2G0NA 2IYWA 1II8A 4HAZA 3RRNA 1Q12A 3QKSB 2VHUA 4ZKDA 2FH5B 4JYBA 2AN9A 4GBMA 1OXTA 2GCOA 2B92A 4B32A 3KUCA 2DWOA 2V54A 4TL6A 4EPTA 4KFTA 1D5CA 1TEXA 3L2OB 2JDID 4P32A 2G9NA 1IONA 3NKVA 2PL3A 5C1BA 1NN1A 4UNNA 1A7JA 4LGMA 2J7PA 4LUCA 2ZRFA 2D3WA 4QNRA 1G17A 4RD2A 4JLPA 4PHGA 2X77A 1DG3A 2ZJ8A 1FUUA 3R9IA 3I4LA 5KHOC 1OLOA 3GLGE 4Z1MD 1NMYA 1QDEA 3GLIE 3V00A 2ZXUA 3U7FB 2IXGA 2ODEA 3H4MA 3QOFA 3TVDA 2ZE6A 2ODWA 2ANBA 3P26A 3V4FA 4L16A 2I3BA 3KTAA 3C41J 4R2HA 4HLCA 5HZKA 1KKMA 3K09C 2IF0A 1YZLA 3T5DA 1E94E 1NG9A 2ZI3A 4B48A 1ZM9A 1X8JA 2BMDA 3KXIA 1U0HC 3IHLA 2VYFA 1KY3A 1C1YA 1KO4A 3WNBA 4JMPA 4BFYA 1NY6A 1KSGA 1FNMA 3NBZC 4AG5A 3K9LA 5CYPA 4AYWA 2Z0MA 5GADl 3I61A 1WQ1R 4C0KA 5GJWC 2XXAA 3OFNA 4JLJA 2GF9A 3LQQA 5L3VA 2VO1A 2YC2C 3MSXA 2C8VA 3H86A 3QXHA 2VP5A 2P6UA 4AIIA 4EFNA 1J8YF 1XFAA 2HXSA 1E2PA 1OXXK 4V02A 4N3NA 2OLJA 3TR0A 2XZLA 1RE0A 2WSMA 3TE6A 2OHFA 2RGDA 4KODA 1JJVA 3U3MA 4RZ2A 4YC7A 2LKCA 3Q5DA 3OIVA 3AVVA 1UKEA 4KU4A 2H1LA 2ZJYA 2OE2A 4TTRA 4LJYA 3X1XA 1IY1A 2OFOA 1FMJA 3WP1B 2A5DA 1P75A 1XD8A 2C04A 1TEVA 2F3RA 2XJ9A 4B33A 1YZTA 1ZC3A 5IDVA 3ZDQA 1JB1A 2VP9A 1RYHA 2JLQA 1UEIA 2P67A 1AGPA 4GI7A 2V7QA 4NBSA 3CRVA 3L8ZA 2P3SA 4ARZA 2DWPA 2VIIA 1RRGA 4LCBA 4HUQA 4MRVA 4DDTA 2GJAA 4NZYA 4DHEA 1HEIA 2WWYA 2WMNB 2IUUA 3DPUA 2EVWX 4XSGA 3SFVA 4DDVA 1P2UA 1KDPA 4B2PA 3KZ1E 4US0R 4P0TA 3KQHA 3FPAA 5A0FA 3IKJA 5J47A 3QG5A 4RJLA 4Z8YA 5JHHB 4ZI3A 1ZM4A 3CF2A 4D4LA 1P4SA 3ADKA 1OYWA 3NEJA 1BMFD 3PG5A 4A2PA 4LBWA 4V0OA 1KO1A 2ZR7A 2RGCA 5L3QA 3BS4A 5EZ6B 5CDFA 1OV4A 3MJRA 3T1OA 1TU3A 1F2TB 2ZRDA 4K81B 1UKVY 2Q9CA 4RZUA 3WBJA 5CLQA 5EXXA 4GL2A 1X8LA 3EZ7A 3BORA 3FMOB 4IEEA 4MKIA 1QVAA 5E95A 3TQFA 4KHZA 2KBFA 4C4PA 1DAMA 4UXIA 2ODBA 2P5SA 1W36D 3REFA 2EWWA 1SVWA 2JLSA 4PQYA 2NZJA 3TBKA 3DO6A 3NWJA 5KNCA 2IXEA 2NQ2C 1KI6B 3U4QB 3SS8A 4PC3A 2YNMA 2BIFA 3KB2A 1KI2A 1M74A 2XJ4A 2TMKA 4KBFA 4JT2A 3C4JA 4KFRA 4OBEA 5E4FA 3UANA 3RSOA 4Z8XA 2IF2A 2IYYA 3T15A 5LPNA 1WMSA 3FYHA 3LWNA 3Q3JB 1Z0IA 1HQCA 3LBHA 2YV5A 2DCUA 4CGZA 3B2EA 2IYSA 1SHKA 4IW3B 3I92A 3VMFA 4E22A 1SXJE 2JEOA 3MFYA 2N1BA 1R5NA 2VP6A 1HH4A 1OW3B 5EE0A 3WHKA 1Q1QA 3IQWA 2HCBA 1JXOA 4A2QA 2CXXA 4FN5A 4OQFA 4DDUA 2GILA 4ASUD 1KAGA 8OHMA 1KZGB 4DT1A 1EX6A 2EW1A 2HDNB 3E70C 1S9HA 1P61B 4A8JC 4BEBA 2AHOA 1G4AE 1N6OA 5FI1B 2VQSA 3IPYA 2GVZC 4A8JA 4EQ6A 4KSBA 2HLDD 1JAHA 1Z08A 4B6FA 4LYJA 1VMAA 3AVQA 4Q7MB 1R10A 2BM0A 3ETLA 4TQUS 2F1JA 4HAYA 4JJZA 1XTRA 2Z4RA 2RGXA 1XB2A 3QBVA 2W6JA 2J0UB 3AM1A 4TQAA 5LDDC 1ZUNB 2PLRA 3PJRA 2FPKA 1M7HA 4K46A 4Q9KA 3SZRA 4AG6A 1EFRD 4PPQA 4IHQA 2ZREA 3SYLA 3H0KA 1VDZA 4Q66C 1G6OA 4NCJA 1P9RA 5HKKA 1W36B 4Q9IA 4A6XA 1GNPA 4QNMA 1Z2AA 4FXPA 1J7KA 1ZUIA 3EIQA 3NH9A 1B23P 3EPKA 1CF4A 4P4UA 1GKUB 2IA5A 1Z63A 3THXB 3LO5A 4IOLA 4JVLA 2LWIA 1KI9A 1AKYA 2ZRAA 3CH4B 5D3MA 2CL7X 3I8SA 2IT1A 2J7PD 4KVAA 4QJ3A 3SI7A 3NG1A 2IYRA 4JLBA 1CKEA 4LBYA 1ZD1A 3RDPA 2RGNC 3DHWC 3RS3A 1R7RA 4ERNA 3LRPA 4TYPA 1G3MA 3KQUA 3C5HA 1OIVA 3UK6A 1QHIA 4QJ5A 5DGXA 3K53A 4HAUA 5EP2A 5GVSA 1TQ4A 3VU9A 1XMJA 5SZJA 1A5TA 2WWIA 5BYKA 5J4HA 3B1YA 3EXAA 4H1UA 2C99A 4ZPXA 4ZCIA 3NBFA 4GZMA 4LX0A 1VG9B 3A1VA 3ZQJA 1Z3IX 1HY3A 1QZXA 1KHTA 3KJEA 3AVPA 2YWGA 5L8VA 4KYIB 4MRPA 2XNSA 5EUMA 2WIAA 2OEPA 2JJ8A 3KJHA 1R6BX 4KLZA 3D7MA 2ZSDA 1TL7C 3RS2A 3BWDD 5LB2A 4ZIRB 1WDTA 1MRSA 2UVQA 2ZI6A 4A0FA 1U0LA 4UXJA 1S1MA 5B30A 4Q01A 1QHGA 1XTKA 4RFVA 2GBLA 2QMEA 2Q3FA 1P7CA 3B82A 1II8B 4TZ0A 3BC1A 4BLQA 2LKDA 4L9WA 5HR5A 1DAKA 4BECA 5DYGA 1U99A 2NGRA 3KB1A 5G41A 4B6EA 5KTYA 3FVQA 1CEEA 1E9CA 2GCOB 3NIBA 4XIGS 4D80A 4PSAA 2BHRA 4LOAA 2OBMA 1KY2A 3IEUA 2ZE7A 2CK3D 2ZS8A 4JS0A 4NE2A 3GEHA 4QFMA 2FSIA 2PBRA 1N3BA 5TXGA 3MLEA 4QHSA 4D0LB 1G8GA 4XWAA 3IBGA 1EESA 4Q1DA 3VHXA 4KSCA 2ZUDA 3VR3A 3AEZA 3NH6A 2J0QA 1NP6A 2V7QD 1U9IC 4MKHA 5KPDA 2QBYB 4ZV4A 1JR3D 5FBRB 3UWKA 3B13B 3CRRA 2QP3A 1NVWQ 2N42A 2W2VA 4KAXA 5AR1A 1CR0A 3K0AB 1XEWY 1GRNA 1T8UA 3IIMA 1XXHA 2K5UA 3HU3A 1QRAA 3R20A 1XCMA 3LX8A 3MWKA 1W4RA 1OH7A 2JLVA 1TADA 3FE2A 3U7GA 5GVRA 3ICQB 2OXCA 3SE0A 2JIZA 2GJSA 2AX4A 2Z4SA 3CZPA 4Q4JA 2PLFA 3RSLA 4NU0A 3CRQA 5DIFA 5JS7A 4OL0A 4PANA 1GM5A 4V0LA 1Z8FA 4PC6A 4QL3A 1J8MF 1TAGA 4DZZA 1M8PA 3NVAA 1IQPA 3IIJA 3VNUA 2IS1A 1PV4A 4DLTA 1LVGA 1I2DA 1G9XA 5KSOA 1K5GA 4FIDA 3WNDA 3F3YA 3RLFA 1KAOA 2B21A 2WAXA 3CRMA 4QOSA 2QA5A 2GZHA 4G1UC 4P31A 4C30A 1G5RA 2AR7A 4OHZA 4AYXA 1ONBA 6Q21A 2HUPA 2QT1A 2ZJBA 1CLUA 1E9RA 4C2TA 2GWHA 3PENA 2VPPA 2GRJA 2NO6A 2VSOA 2Q3HA 3GLFE 1T5IA 1LF5A 2WWXA 1KMQA 1WBDA 3HP1A 1U8AA 1WA5A 1G21E 3RC8A 3FHTA 1AS2A 1E2KA 3EA5A 1C4OA 4TMWA 1AZSC 4QBGB 2WJYA 2IYVA 1I4DD 2Q9AA 4TLAA 3QEJA 4M9ZA 3SU8A 5EE9A 3OE7A 4D0NA 1G8FA 2WJHA 2ZIAA 2DBYA 1XP8A 2ZR9A 2EFEB 3EG5A 4C0QC 1AS3A 1DOAA 1N5KA 4A82A 4D0GA 1WCV1 4ITRC 4X8LA 2QMUA 4Q1EA 4LJ7A 3SJBA 1GL7A 1Z6TA 4LC0A 2OM2A 5CITA 1NLFA 3QF7A 2QPTA 4HI0E 2ZI5A 5FPHA 1JNYA 4R9UC 4EJSC 5DHFA 1RVDA 1XZQA 2ONKA 1G1MA 2PZEA 1MO4A 3W3AA 4QHYA 3F0TA 1IAQA 1QHHB 2CCGA 4G3XA 4B47A 5F3WB 2NZ8A 5FTKA 1Z5ZA 1EGAA 2EFGA 4TSFA 4E03A 2D7CA 4U5XA 3B78A 4EPWA 5BXQC 1M7BA 2HJGA 3Q72A 3WY9A 4QGFA 4AC9A 2ZU6A 3AKDA 3A37A 1N5IA 3MMPA 4NMMA 4M22A 2NIPA 3UMRA 4CYMA 2HCJB 2FMXA 1YZUA 3D31A 3QE0A 2X2FA 4LPKA 3IO3A 4X8HA 4JSYA 4O2RA 2A5FA 4C0BA 5HKKD 2JJ1D 3L0IB 1EK0A 4QRHA 1SGWA 1TMKA 2AXPA 2FFAA 4IDQA 4TMZA 4E07A 2Q9BA 1E96A 5JRZA 3AP1A 2H92A 1N6NA 4NYMR 5J5CA 1E4VA 3TSOA 3WXMA 4ILEA 5F9FA 1RYFA 1UBEA 5DHAA 2I1VB 2ONJA 4DIDA 4PAMA 3QQ5A 2ZITA 4WIAA 1F3OA 1W2HA 3K9HA 4Q18A 3BH0A 5IF9A 5DNYB 1VTKA 3GJ5A 3B8HA 3OEEA 1XJQA 3GEEA 3MCAA 3B85A 2IYTA 2CNWA 4RD3A 3RHFA 1Z28A 4HUTA 2ZJZA 3FDIA 4BZXA 1CR2A 2A9KA 2O5VA 1S96A 5KYKA 1E2JA 4DT1B 1OFUX 5FL7A 3ZYCA 2WICA 2YZ2A 1AQYA 1EFTA 3I73A 1GIAA 3LBIA 4W5JA 1U81A 2ZRLA 2QMHA 4A8JB 1GDDA 3LXXA 4NTZA 4LV5B 5HCIA 2JLWA 3U5ZB 1FX0A 5HE8A 2ZJAA 2CCJA 4MITA 4OK6A 1YZGA 3W8RA 4H9GA 4MQBA 4OQMA 4ZCLA 1KOFA 1K5DA 2VHTA 4QM6A 4JBYA 5E7MA 5BN3A 3L0SA 5E7JA 3QPWA 4CEIB 4HEJA 2GCPA 3M1IA 1EX7A 4ZDWA 2NG1A 2ZAOA 4TMKA 3ND8A 1Q1EA 2WVJA 4TLCA 5DO9A 3T12A 3ZS9A 1YU9A 2VP4A 1YVDA 3TSWA 2R65A 1Q44A 4ZDJA 3QXSA 4F4IA 4MUBA 3GMTA 1QHYA 1ZUHA 1H8HA 1Z6AA 1CR4A 2P6NA 1GOTA 3NXSA 1KSJA 2BOVA 5C2JB 3FKQA 1CIPA 3W9YA 2IBMA 4WXRA 5AUPB 2RGGA 1OIXA 1G3IA 5DLQC 4EFLA 3C16C 4DCUA 1WBBA 1N6LA 3BK7A 4IDHA 1Z0JA 1UBFA 3PITA 4A9AA 4WZAE 4ZO4A 4URVR 5EE3A 2WV9A 4BZPA 2ATVA 4I1VA 1EFHA 2WKPA 2NPFA 4BPBA 1ZCBA 3CW2A 2IYUA 3RS7A 1NJGA 2C9YA 2WZQA 2QU8A 4Q4AA 5FTMA 1TX4B 1US8A 2HYIC 2NO9A 1T3SA 4Q1BA 3KFXA 2GEUA 1OFIA 2G77B 1Z2CA 2PCLA 2ZI7A 1AQUA 3TGPA 1XRJA 2JLZA 1NN3A 3U61B 2GVDC 4C0AC 3S1AA 3W6PA 2JIZD 3D3QA 1ZU5A 3GJ6A 2FNAA 5HCNA 2R6CA 4HLUC 1MV5A 1D9XA 4LHYA 3ZD6A 5EXSA 3W6OA 3EARA 5DSZA 1MABB 4M1YA 4ZDIA 3Q9LA 1NJFA 1ZM7A 2MSCB 1LNZA 5FOTA 1ZBDA 4QM7A 1RC8A 3AF0A 2UZ3A 1HYQA 4LZZA 2WAYA 4JYCA 2D2FA 3GLHB 4BWYA 2C03A 2D4HA 4G0NA 4EPRA 1E6CA 5IK2D 3QXCA 1ZINA 4KVGA 4QKQA 1SVLA 1TTTA 4B3BA 3BD9A 1SQ5A 2DB3A 1OKKA 2IEYA 1CULC 1TNDA 4DCNA 4M0LA 4CF7A 2J0VA 3D8BA 1BS1A 4L4UA 3TAHA 2DY1A 3CIOA 2IYLD 2XTZA 1VCIA 4LY6A 2GJ9A 3TLXA 4MRRA 2VHQA 3ZVLA 3GP8A 4A0GA 2PT7A 3DKVA 5HTKA 4Q7LA 3WNCA 1G20E 1YRAA 3KJIA 1UEJA 4Q5IA 3UMSA 5KSYA 1KIMA 1L7VC 3O47A 3ASYA 4P4SB 1KI8A 2BBSA 2R9VA 4U7DA 2OBNA 3AF4A 2CMKA 2QAJA 4CEJA 1G8PA 1D8TA 1OFTA 3ZQ6A 3BE4A 4FCVA 5FOUA 3OE7D 2FZLA 4M4SA 4D4KA 1VPLA 1NMXA 1ZC4A 3THOA 4FMDF 1E1RA 1WXQA 2G6BA 4M2LA 3UATA 1QVRA 1JR3E 2CVFA 2KWIA 5JRJA 1XXHB 4M21A 2BWJA 2EFHB 4MDFA 3RC3A 1DS6A 2C98A 2H5EA 3LLMA 1RFLA 3UPUA 1NKTA 4BQSA 2O8BA 2P5TB 4V0MA 2PMKA 1SULA 2V8OA 5K8LA 1VG8A 2E1RA 4DDWA 2BBTA 3LVRE 4Q4JB 3CWQA 4PZLA 1IM2A 2CLSA 1W4AA 4M1SA 4QGAA 4R2IA 4XTRA 2ERYA 3MWYW 1ESNA 1OXVA 2AK2A 3KL4A 2BKEA 5G3YA 4WOPA 3LA6A 1UFQA 4B35A 4TSFD 3BAFA 4LJ8A 4LSGA 5M04A 3SQWA 3U3KA 5CK5A 4NYMQ 4O0MA 4OI4A 3GFOA 1UJ2A 5DI9A 3QVUA 2R6GA 4TTQA 4J0QA 4AKEA 2VTKA 3KKPA 2V6IA 4MKGA 3BIFA 4CZ2A 1IN8A 1YE8A 3EPLA 2J0SA 4HAVA 1GL9B 4OI2A 1FTSA 1HURA 1N6HA 4HZIA 4DUGD 721PA 3FWYA 3QBTA 4FINA 1P73A 2YWHA 4URYR 1JQLB 1CJMA 4YMVA 4E09A 1GNRA 5P21A 5EXPA 4Q48A 4Y0VA 4II7A 2O0HA 4P33A 2RHMA 3ECCA 1X3SA 1XTSA 3T35A 3K9GA 3VAAA 3PUVA 3GJ8A 2V1XA 4ACBA 1E2EA 1HA3A 1CP2A 1DPFA 1N6KA 2FSHA 3RS4A 4ESHA 4UNRA 2OZEA 3B1ZA 3ZVNA 2W83A 4CDGA 3VKHA 4OQXA 4HSEA 4XD7A 4Q4HB 2CBZA 221PA 3ADCA 4YXWD 4GMDA 2V4ZA 4W7SA 1XWIA 2PH1A 1MO5A 1E2DA 3ND9A 1E3MA 1V5WA 2CNWD 5KO2A 1JR6A 4M9SA 3AF1A 1Z6XA 4BFZA 2PT5A 1NF3A 1YR9A 4G01B 2BKUA 2DFTA 1B0UA 2PJZA 3OAAA 3GJ4A 3MGCA 2ZJ5A 1KI1A 4LJAA 2C5LA 1NIPA 2VL7A 4UQOA 4EJSB 5B2ZA 3IPXA 1CRPA 4MRSA 2QGZA 5JEDA 5KDLA 2GCNA 1IBRA 1R5OA 3CPHA 2EWVA 3AH8A 3QPVA 1KMHA 1HUQA 1G6HA 5JSZA 4DLSA 5H70A 1ESMA 1ZYUA 2G83A 3AGQA 1OHHA 1NVUQ 1NVVQ 1E0SA 2A2ZA 2XNDA 4OHYA 4B44A 2QORA 4I1OA 4V0NA 2ZUBA 2FFBA 3QKRA 3KX2A 3DMDA 2V9PA 4Q1CA 5G53C 2YYZA 1F2UA 2OILA 4IFBA 1XEXA 4BASA 4AWXA 3NBYC 1O87A 1JPNA 5ANRB 1K8RA 4C0JA 1H8HD 5FOWA 4C7OB 3SR0A 1YHNA 4MKFA 1DO2A 1T0JB 3O8BA 2J87A 4TT3D 3TR5A 2G1KA 4DSNA 1M34E 1S8FA 1E0KA 2FEMA 1A82A 4FD2A 4GZLA 3RRYA 3GLGA 3GLIA 5TARA 1CJTC 1E2NA 1P2VA 3N70A 1EG7A 1VG0B 4LHWA 1XPRA 1XF9A 5K8TA 1LS6A 2ZSBA 5FPSA 1KJYA 1U94A 2DFLA 4B71A 4URUR 2G0TA 2J1LA 2BCGY 3BXZA 1XEFA 1N5LA 1CTQA 3A4MA 3IEVA 2QE7A 1G16A 2V1UA 5AUOB 4KI0A 1W4BA 4HLDA 5AK0A 3U7EB 1W4CA 3AVYA 5H1YA 3TH5A 3LXRA 1OPXA 4C0HA 2O0KA 1R0WA 1SVSA 1WB9A 2RKOA 1FX0B 1W5TA 3IIKA 2OFWA 3TQCA 3QKUA 2LCFA 3BBPA 3IUYA 4LYHA 3LY5A 4RZ3A 2IWRA 2ZRBA 4EPVA 2WHXA 2WKRA 3OZXA 3NHAA 3SJCA 3HR7A 3P32A 1COWA 1VIYA 3IQXA 1G4UR 2YOHA 4YMSA 2F9LA 1E1QA 5KOYA 2ZSFA 5SZHB 2E87A 4JVMA 3RNLA 3GLHE 4NDZA 4O2LA 1NBME 4Q7JB 1ZD8A 2HXYA 2VEDA 5FBVB 2GAOA 1YQTA 3QF4A 4HZUB 2P6RA 3WHLA 1G19A 1N6RA 1FP7A 3QUSA 2Q3MA 4PO1A 5FUXA 4DLYA 1OXUA 2WJVA 1VCNA 4S2EA 3QKTA 1UDXA 3MUFA 2A5YB 4PPFA 2IS2A 3MD0A 1FQJA 3UG6A 3H2YA 2AXNA 5H68A 4B2LA 1FPMA 4IOJA 4NKRA 1E1RD 5FL3A 2D7DA 3BH7A 3HU2A 5L3SA 4C2UA 1DAIA 4ZDKA 4DCSA 1LF0A 3KKNA 4CIDA 3U44A 4BFWA 1TF7A 4NCIA 4NP6A 4Q4AB 2BMFA 3TW8B 1BH2A 2IEZA 4OQLA 2Q21A 4AY2A 4KYUA 1UAAA 4DWJA 3NHBA 3WMGA 3ZGXA 4LHZA 4HATA 1RJ9A 3O8DA 1IXRC 4MYTA 4PXAA 2A5GA 3JZAA 4KO8A 1MR3F 5E7IA 1DEKA 4IXNA 5CYOA 2QAGA 2VP2A 4RCYA 1GG2A 4CEHB 1BO6A 1U98A 3SFZA 1AIPA 3WYFA 1UKYA 4FMCB 1OIWA 4TLBA 1XD2A 3B9PA 4D25A 4Q4LA 3CR8A 2FEOA 1EFUA 1M1YE 1FQKA 2FU5C 3FHOA 5IT5A 2BC9A 3X2SA 1ZVQA 2A3RA 3LLUA 4DB2A 3RS0A 2DYKA 1TPZA 2DHRA 1W1WA 5KNBA 2OCPA 2FFHA 2F43A 2RHDA 4URXR 2NPIA 3QSYA 1FW6A 3EW9A 1IY0A 1LY1A 3CF0A 3CWZA 4IVRA 4TTPA 1NSFA 1IN5A 2ZRGA 1Z22A 4MUAA 4RKFA 2QENA 621PA 4TYNA 4MGZR 1J70A 2R6FA 3W5JA 3AVUA 3I72A 3OFND 5FR1A 1YR8A 2GBLC 1P5ZB 4PO8A 3SYKA 5FPYA 1KDTA 5C18A 4TYYA 3OESA 2CVHA 2W6IA 4CEJB 1XTQA 2ZYTX 3ZVRA 5FTNA 3X1DA 1LFDB 4EPYA 2NMVA 1SXJA 4RD1A 3AP3A 4XD7D 3ADBA 2J9RA 2FJUA 3K1JA 5EE1A 1JJ7A 1I2MA 1N0WA 4CW7A 1OH5A 2QT0A 1CS4C 2IHYA 5LBIA 4TMXA 1XEWX 2N46A 5LD2C 3EASA 3QXXA 5B57C 5IRCD 2R6DA 4F93B 2ZU0C 3W6NA 1E9DA 2VHJA 1W0KA 2GNOA 1PZNA 5FPKA 1XCPA 2JGNA 3MWJA 521PA 5FBQB 3C8UA 4QBFA 3OAAD 1XPUA 1GNQA 1KI3A 3PUZA 2J59A 1AS0A 4B76A 2R62A 4JL8A 2BEJA 2ZI9A 2V6JA 3GD7A 4BFSA 3R9WA 4NH0A 4AKHA 1OB5A 3HYTA 5CM9C 2Y8EA 2ZRNA 1W46A 3G82C 1Q21A 2H7VA 2EFDB 2I4IA 3C15C 1DARA 1UBCA 2GK6A 3DL0A 2D2EA 3F8TA 5JCPA 1G5TA 3AGPA 4JL5A 2PX3A 4CT4B 1XMIA 3K0FA 2ZE8A 4YLGA 2W2XA 1Z29A 3KTAB 4LV6A 3GQBA 4Z51A 3OHMA 1JEDA 3HU1A 5TDHA 4JLKA 5AJVB 1G7CA 2W00A 3PR1A 1UADA 5FBWB 2JLXA 3LQRA 2JAQA 3OF5A 3Q5EA 1QHXA 4KFSA 1XTJA 4A36A 1K6MA 5CLLA 4B3XA 1Q20A 1KDRA 2XXAB 3IILA 1VG1A 1S1CA 3C14C 4QHTA 1PJRA 2CJWA 5EQTA 1Y63A 4KJZA 2FWRA 3EZFA 3PUWA 1KSFX 5FOSA 4LHVA 1MO6A 2VLIA 4IVPA 2SHKA 4PZYA 2OT3B 1E2LA 4LJ6A 5DI3A 4Q03A 3SEAA 5K8IA 5ELXA 2W0MA 2C95A 3WMEA 3FKSA 2J7KA 2UZIR 3H84A 4B74A 1IJEA 4M9QA 2GESA 4UJ3A 1PUJA 2CDNA 3FGNA 2D06A 1XJCA 4I99A 4Q9LA 2R44A 4HB0A 4W5HA 5BQ5A 1EXMA 4JSTA 3PUXA 4RVCA 2WIBA 2OLKA 2EYQA 1JXMA 3A36A 2FFQA 2XZPA 4PQRA 4DC9A 1Z6GA 3AB3A 3PUYA 2ODNA 4R7ZA 3U60B 2YKGA 2AFHE 3JZMA 4JLAA 3T1VA 4PC7A 4R98A 2WWGA 4HB2A 1XU4A 4QC2A 5A4JA 4ARZB 5BN5A 4D26A 4HUQB 1VYVA 3I32A 4F4CA 2AD5A 3BH6A 1DAFA 2KI5A 3VHLB 3LAWA 1TF2A 4DEXA 4YDHB 1XX6A 2IHBA 3T1QA 4RY2A 2C9CA 1UF9A 2BVNA 1BOFA 4G5OA 4JKIA 4P4TA 1ETUA 1COWD 2FPLA 2ZRHA 1QG4A 2GTPA 2EQBA 3TJZA 1E2IA 1R0YA 1EWQA 1OF1A 1SHZA 2C9OA 4PHHA 1S3SA 3QNUA 1F2UB 3AQ4A 2QQ0A 5L3QB 1WRBA 2PCJA 1P2SA 3N2IA 3BB4A 3PCRB 3SYNA 4O3MA 1F48A 1GZSA 3VNVA 2QGNA 3AP2A 5EE5B 1W5SA 4DSUA 3EX7C 1AKEA 2JDIA 3RRMA 3QI2A 3HYRA 4GRAA 3CNNA 1I4LD 5EP4A 2VP0A 2W6JD 2H16A 3L43A 2JATA 4ABYA 4F38A 4Q1FA 2FGJA 4MRNA 2XITA 4L15A 3TUZC 2QN6A 1SVKA 3PEUA 3QENA 1NRJB 5FUWA 4A2WA 3GLIB 2IL1A 1T9HA 2CL6X 1ODFA 2WJJA 2CE7A 2ZRCA 4FCTA 2CHQA 3K0CC 3DDCA 3LFUA 4IDOA 5E3HA 2O8FA 5CB8A 3K0CA 3LH5A 4XJXA 4C0SA 1MT0A 2H8KA 3VX4A 5C4GB 3KDSE 3NC1C 1UPTA 1OYYA 4ACAA 1E9FA 4POAA 2PX0A 1LTQA 4XVUA 4BE7B 1L4YA 1XJ0A 2QL6A 4IFEA 3FFAA 2QUZA 3B9QA 1BYUA 2NTYC 1PLJA 3TSZA 1FUKA 2IC5A 1KO7A 2JLYA 5AWFC 3GJ7A 4N1AA 5FBLB 1N5JA 2BEKA 5DISB 3B7GA 2JLRA 3WYGA 2ZSAA 3AVWA 1E0AA 4DLUA 1Q3HA 4NCKA 4URZR 1LV7A 3SHFA 3EAQA 4AYTA 5B58C 4I1SA 5EP3A 4DB4A 2YINC 4JVSB 1E32A 1OFHA 4BLSA 1X1RA 3AUXA 3X1WA 4EKDA 4LPSA 1AM4D 2RGBA 4EQ6B 3GLFA 2OESA 4ESVA 2F6RA 1D2NA 2GDJA 2QY9A 4TMTA 3RANA 3WMFA 1FFHA 3QF4B 4BFXA 3O8CA 1KDOA 4DIEA 1UBGA 2FZ4A 1AJEA 2RGAA 2IW3A 2VF7A 5FOVA 4KITB 2WWHA 4HB3A 3PQCA 4MYCA 3KXKA 4JIMA 3REGA 4OJKA 5KDOA 3BFXA 4OHVA 1E0JA 3DOEA 5B64A 1E2FA 1GAJA 2W58A 3R7WA 2W0SA 1JAIA 1VCOA 2B7CA 3CX6A 4YQFA 3TAUA 3X1YA 1SXJD 5FTJA 2YHSA 1DBSA 1E2GA 4OKSA 3VFDA 3M0EA 2QM7A 2WPDA 3VX3A 1KYIA 2YWEA 4PSKA 4IXMA 4DLXA 2EFCB 1D2MA 1GWNA 4M1OA 4MGIR 4RZXA 2ZS9A 3EZ2A 4LBZA 1Q0UA 2XOKA 5D3MB 1S4QA 1W0KD 3H1TA 1XPOA 1ELOA 2AKAB 1NVVR 3AKCA 4PZZA 5DH9A 1TUEA 1SVIA 2WOJA 2YOGA 1PLLA 3LW8A 4PAQA 2XSZA 2O8CA 1TF5A 3ZZ0A 5H8WA 4B2IA 5L3RA 1DAGA 1GFIA 4AD8A 3B1XA 4DLRA 2F55A 4A0RA 121PA 2BCJQ 1NN0A 2OAQ1 4EIWA 5J4YA 1T3LA 2HYDA 3VU9B 3IDQA 4M53A 4TL7A 1CJKC 821PA 3I62A 3CF6R 1E2HA 3GJXC 3V9PA 2J0UA 1G3RA 1E99A 3I1FA 1U8YA 1YRBA 3L82B 4BLTA 2B8WA 3PV0A 3IGFA 4FCWA 1T91A 1SKQA 3SDZA 5TY0A 3CONA 4NYIQ 2F43B 2YJTD 1MO3A 3ASZA 5BW8A 1YR6A 4BZQA 4URWR 4OHXA 2V3CC 3AF3A 3BB1A 4FWIB 1ZNWA 1KSHA 1QHNA 1DO0A 2FG5A 1P9WA 4M1KA 3CR7A 4PAOA 1FL9A 2J41A 1V43A 5JJLA 2CLCX 1Q1ZA 1R8QA 3THXA 4NYJQ 3DZDA 2REBA 2PMDA 2BBWA 1HE8B 1E4YA 4BLOA 4BLPA 3EIHA 3QVVA 2Z83A 4QJ4A 3K0SA 1XTIA 1ZRHA 2A7QA 1TU4A 4LJ5A 3FKSD 4GOKA 5EP1A 4BFTA 2MMGA 2Z6VA 4IEIA 3BFVA 3R8FA 1LS1A 2NO7A 2YC4C 1BKDR 2IUTA 3DVLA 2QPOA 4BGDA 1NN5A 5J4KA 2PEYA 5LD2B 1S2MA 3OIUA 1R0XA 2ZR0A 3IO5A 4XSHA 1NKSA 5KUTA 3LD9A 5KDDA 2O0JA 2GXSA 1XDBA 3ZZUA 3KKOA 1DAEA 1JQJC 3P1JA 5KNDA 2AKYA 3ZD7A 3KFVA 3AF2A 2QROA 4TLDA 1U8ZA 3CKLA 4V0KA 4HB4A 5DYIA 2IS4A 5J40A 1NLYA 3KXLA 3UKDA 2QNRA 5HPYB 2B7BA 3B60A 5DE3A 2OCYC 3GJ0A 4ZIRA 4PFSA 1IOZA 1P72A 1S9DA 4JLOA 4PX9A 4A6PA 1EFRA 3DM5A 4YONB 3NTUA 1G7TA 1KI4A 4G5GA 1GVNB 4PC2A 5FPTA 4CVNA 1XNJA 4JL6A 5C46F 1AK2A 1KTVA 1WF3A 4D2IA 3L0PA 1E79A 3KJGA 3THWA 4A4DA 5CIWA 2WSSA 3T1TA 5JMTA 2QTHA 1Z07A 1FMLA 4L8GA 5CDFE 1Q3TA 1W0JA 2CJWB 4PR0A 1GITA 3TUIC 5D3QA 2ATXA 5SZIA 3PEWA 3T34A 1CXZA 3QY0A 4DLZA 4DXAA 3ADDA 5DI3B 1AGRA 2ZTSA 1IN7A 5TMPA 4D81A 3QPUA 3TMKA 4L5BA 2QBYA 4AKIA 2ORVA 2ZI4A 4DLWA 5JCZA 5LB4A 3CUEF 4UJ5A 3OIYA 4WZBE 2RB4A 1FOEB 2C78A 2O52A 2WBLC 4NCHA 4NONA 4RD4A 3K0AA 1A2KC 3SN6A 3ICEA 1M2OB 2L0XA 2AK3A 1HQYE 1YJ5A 4B73A 4ZCMA 4O25A 4I4LA 3CNOA 4A92A 1ZAKA 3AVXA 3GJ3A 3LNCA 4IDNA 1E98A 1Z0DA 2WJGA 3K09A 3F5FA 3CNLA 3NEYA 1G8HA 3LW7A 2W2TA 2QEQA 4I1UA 4LDJA 4DSOA 1Q57A 4BUJA 1NSTA 2FN4A 3OEED 1KNQA 2QZ4A 1OH8A 4TN1A 2F1RA 2KJQA 3Q7PA 2R6AA 1R2QA 3OEHA 2REOA 2MSEB 5JECA 1KJWA 2FX3A 3VR5A 3B6EA 3A1UA 3FHCB 1T0HB 1GKIA 1YKSA 4CT5A 5FL7D 3KKMA 4BFVA 1W2GA 3SOPA 2GJKA 1GRRA 2GEDA 2NOAA 3GEIA 3BGWA 2ZPTX 4OQNA 4OYHA 3CPJB 4KXFB 1P60A 3RABA 2ZVQX 3SJAA 1NG1A 3SBDA 1OB2A 2F1HA 4HDCA 3E5HA 2CK3A 4R71A 2BBOA 4G5RA 5AJWA 5EUQB 2Z5FA 1FZQA 3U3JA 4D4JA 2O8DA 5HE9A 1G8YA 3ZIAA 4QBHA 1TQ2A 5J4VA 3NBXX 2J3EA 5BYJA 2AD1A 3JVVA 5FH9A 4US2R 3R9XA 1MKYA 3LV8A 3LVQE 4JBWA 1JR3A 1GL6A 3U3OA 1XZPA 3K0EA 4LHXA 1GSIA 2WPDD 3QEOA 2F3TA 2AL7A 2VSFA 1KJZA 1ZM3A 2O8FB 4OJQA 3LX5A 1IN6A 2VHCA 5FOXA 3W34A 5AUNB 2XOKD 3VR4A 3CLVA 1Q1BA 4LBVA 3T06B 5JWRA 3EWSA 4LRWA 4EUNA 2ZUCA 2WOOA 3EC1A 4OK5A 4QG7A 1R8SA 1X1SA 2XSZD 3IHWA 2VF8A 4C3ZA 3BFKA 3PXGA 4DKXA 3EWAA 3U6BA 3N5CA 3J81k 3DMNA 1BYIA 1QHHA 3VR1A 4JLMA 1NLZA 3DKPA 1NNEA 4LWZA 1P3JA 2OAP1 1G5PA 1YZNA 4PSVA 4GPTA 2V55B 4FI3C 5JS8A 4TZ6A 1X86B 3KQNA 1HE1C 2FV8A 2GA8A 2ZYUX 4D6PA 3K70C 3FMPB 4LYFA 4LJ4A 4AURA 2FDCA 4MA4A 1KK1A 2IYXA 2OSBA 3X1ZA 3UIEA 3GLFB 1D9ZA 2ANCA 4HYYA 1AA9A 3PFIA 3FMIA 5FUVA 5KPJA 4JT4A 1KK3A 2EYUA 3RVBA 3ZS8A 1DE0A 3CZQA 3A1SA 1EWRA 1PUIA 1GTVA 2OXRA 3UMFA 1KO5A 3RYTC 2ASEA 3DZ8A 5GJVC 4MYUA 5KSZA 1E9EA 2X8AA 3T5GA 1G7RA 2ZSEA 4TL9A 3R7WB 1P2TA 1W47A 4OI1A 1OT3A 1R4AA 2DR3A 4IVQA 5AJXA 2NO1A 1OKKD 1II9A 3TVTA 3RWOA 4DVGA 4JLDA 2OV2A 3CO5A 1IXSB 4WW0A 2FF7A 2H18A 4YDSA 1L4UA 5JLJA 4US1R 4B3CA 3O8RA 1AN0A 4DLVA 1UDWA 4DCVA 3AUYA 4WAUA 1W48A 1RRPA 4YMWA 3E1SA 2HJVA 1N2CE 2ZRKA 4HLQB 4A15A 2GZDA 2QI9C 3MWLA 3SNHA 4BLRA 1A1VA 2O8CB 1QG2A 2O8EA 2XB4A 4F7WA 1XMSA 2ZEJA 5CJ2A 4MDEA 1YZQA 2XAUA 3NDPA 4N0EA 4UNSA 2YWFA 2QRZA 5FI0B 3CH5A 3LDAA 4GNKA 1W49A 2P0EA 2AWNA 4QXAA 3SHWA 3AV0B 3NDBB 3Q7QA 5CM8B 1US8B 2HT1A 3THYA 3MG9A 2QG6A 2ZJ2A 4LC1A 1PVOA 2QP9X 4CEIA 1P9NA 1XXHE 4GP6A 1VKJA 3S1AB 2XEXA 3TK1A 4F91B 1ZJ6A 2BJWA 3P4YA 2QAGC 5CIQA 3GFPA 2JJ1A 4TLEA 2RMKA 1CU1A 2QPAA 1ZD9A 1E79D 4K8OA 1U0JA 1QBKC 2WSSD 1ZP6A 3K8YA 4PHFA 4TQ9A 3Q8XB 4IDPA 1W0JD 3GCGA 3I5XA 5JI2E 5UKDA 1KNXA 2PZGA 3QXJA 1DVRA 4FW9A 3FOZA 4GT1A 2XTNA 4XTCS 1CJVC 1ZCAA 4RSGA 3N2EA 1QHSA 1FTNA 3SC3A 4RFSA 2FA9A 1XCGB 3FFBA 3WYAA 1KI7A 1RW4A 3AVOA 2WJIA 2JJ2A 2RGNA 5TB5A 5JBQA 2XGJA 2AWOA 3ONWA 5G40A 2BM1A 2Z43A 1SZPA 2FE4A 2JA1A 2OCAA 5KSPA 2A30A 4IKEA 4GOXA 4Q9JA 2FPMA 2B6HA 1SVOA 1E9SA 4TWZA 3T61A 3PEVA 2NO0A 1SXJC 3C7KA 4S35A 3ZZTA 4W9MC 5AJYA 1OE0A 1GRQA 4LYAA 1OXSC 2AFIE 1G291 5JEEA 1GUAA 3NC0C 3GPLA 1MRNA 4BRWA 4L9SA 1IN4A 2FOLA 2C2HA 3W8NA 3QG1A 4HAWA 1NI3A 1N6PA 2KBEA 4GFDA 2KB0A 1MABA 2OG2A 4NCNA 2KSQA 3OEHD 4TL8A 5HZHA 4DJTA 2Q0HA 2O8BB 4GP7A 2CEAA 1ZW6A 2ZRIA 3GLHA 3HPRA 3CRW1 1N25A 3A58B 3C5CA 5FUYA 3EPHA 1UKZA 1NBMA 1XBTA 2GAAA 3QJYA 3KQKA 2GJ8A 1E69A 4NHOA 4XVQA 2ZS7A 1J99A 3I8XA 1R0ZA 4B34A 1A2BA 2YOFA 4C0LA 1NMZA 3TRFA 3BJIC 2RAPA 4Q7KA 3THWB 2GHIA 2X2EA 5A5GA 4G5QA 2D62A 1YZKA 1IXZA 2G3YA 4Q00A 4AI6A 4TMVA 4Z54A 3PEYA 2OUKA 1Z0FA 4P4SA 3ZIAD 4EPXA 2DFKB 1OHHD 2ORIA 4NPHA 4PTLA 2DFNA 2XNDD 4HDQB 2J46A 2IUSA 2MMCA 3P20A 3KQLA 2ORWA 5EXTA 1VYTA 1TUIA 3A6PC 2BDTA 4X8MA 3FMFA 3G0HA 1RRCA 3QKSA 1IJFA 3R8CA 1H8EA 1ZIOA 1ANKA 1U9IA 4QGHA 4D82A 5F2EA 1M7GA 4JJKA 1J90A 2ZETA 2ZJOA 1H65A 4M1TA 4Q02A 4JBXA 1OJLA 3I5YA 2D74A 1E2QA 1CRQA 5FR2A 2B8TA 2QRNA 4XOIA 1NL3A 5BWMA 2WTUA 1RZ3A 1T6NA 4D4MA 2IX3A 1U2RA 2XTMA 2VSXA 3V4RA 1W44A 2ZRJA 3D6TB 2IYQA 1Z0AA 4NYIR 1JECA 2PEZA 4Q19A 3AVTA 5J4LA 3VKWA 3MRSA 2GZAA 4KBGA 4QGGA 2UKDA 3EZ6A 2HF9A 4FMBB 1LB1B
chains in the Genus database with same CATH superfamily
4ES6A 2ID4A 5LC1A 4IIGA 1NP3A 2O7NA 1ZD2P 4MVYA 4XUCA 3KUDA 5EG5A 1A27A 3VKGA 3RAJA 1WD5A 1P1JA 1L2TA 2ZJ0A 2QE7D 4CM9D 2R1TB 2INGX 4U7FA 1L7BA 4AG3A 4BCBA 1DELA 4Q21A 5IK2A 3RHTA 5DM0A 3QBJA 2NACA 1CDOA 4UM8B 2J45A 1A0OA 1TKCA 2VDWB 3EXHA 4YA6A 3K70D 2J3QA 1ACJA 3VGJA 3QIAA 1NYTA 4FBMA 4JNCA 1LK7A 1H5NA 4LZOA 4U7WA 3RS5A 2OHJA 1HFKA 4BBZA 5BQ3A 5HMLA 1YDHA 2OOKA 4V03A 5ALIA 1DADA 1LK0A 1TKAA 1V48A 4JLNA 3ZQUA 2UXBB 2AR0A 1VPDA 5JVDB 2VJMB 3VPBA 4L72A 3B5JA 5JH7B 1JRLA 3E6AA 3O26A 5BURA 1I4TD 1KZ1A 3NTVA 4MUGA 1K8ZB 1A5AB 1RDFA 1ORRA 2ZE5A 4PC1A 1SG9A 4UTPA 4RCZA 2W5UA 5E6SA 1E1QD 3QKRB 3EVFA 3RAFC 5JG7A 3WRWA 4PLCA 4Q4HA 4KCGA 5E8RA 1VL0A 2QK4A 2VWPA 4MGYR 1TQ6A 5EJGA 4WA7A 4BX3A 4EGAA 2ZXEA 1YD7A 2JFGA 2A78A 3E9RA 5KYXB 1FJHA 2JH8A 1JQ5A 4W5WA 3JXEA 3HRIA 3K9NA 1IM5A 1J2EA 4JLVA 4KFUA 3HFJA 4QT4A 2J4FA 3LT4A 5LQCA 4GZ5A 3W5IA 1VZ2A 1IUOA 5C1OA 4EGJA 1Z2NX 2CSUA 4BFUA 2Q5HA 1O89A 4OJTA 3ETGA 3AEQB 1EZ1A 3ELWA 2JA2A 3HDYA 3JRXA 4GGMX 2FPSA 3FB4A 1U1FA 4IICA 4N3GA 5F3RA 4MJLA 3ZHYA 1QQBA 3KOMA 1MEOA 4C4OA 1LPMA 5DDIP 1YFLA 4YJGB 3WDLA 1Y3BE 1SC9A 3EXG1 1GD1O 1Z13A 2HBRA 4F11A 3HR8A 1QDUA 2AVNA 4WY2A 2EGGA 2IU3A 2C29D 2JNWA 3T3EA 1I2CA 2X1MA 2I2XB 2JFWA 3CE6A 4LDQA 3W90A 4YRPA 3WBKA 4EG1A 1DC6A 1JEEA 1EI9A 1Z12A 4M6WB 4ANFA 4F06A 3UAYA 1K6EA 4B0OA 1CNMA 2EJWA 2H11A 2O59A 3OQNA 1LRKA 3EFBA 3EZ9A 5HVNA 4YJKA 2WMOB 3DOUA 3F7OA 3H16A 1ORTA 4EDHA 2E9SA 1NZDA 2BMEA 3KQVA 3R41A 4M0CA 3R74A 1GXSB 4BEJA 3L1IA 1PJCA 4UZSA 3V8NA 3K70B 1L4BA 1QMGA 2IH4A 2RONA 1DIHA 4XAQA 3I5MA 1JEAA 1VJ1A 3GUVA 3KS9A 3OU6A 4P7FA 4JJEA 5DRTA 4ZAXA 5G3ZA 4XH9B 2WWVD 1KO8A 1ZR2A 1H2YA 1V1MA 4XYBA 2H31A 1XLVA 2QXUA 3HA5A 5IN4A 3RJ5A 1YASA 2DC1A 4H6XA 1YDFA 3RJZA 4J4HA 4E5YA 3OQHA 2WG1A 3LCRA 5E9QA 1SU7A 1PV1A 3VISA 5JPCA 4C7OA 5J9FA 3H9JA 4DM3A 1ZNZA 5TGDA 3I9NA 1N6IA 1VSUA 3EDYA 5TF4A 1AXEA 3ZD8A 3C8MA 4OB6A 4NSNA 1S5PA 4CKBB 4F9GA 1B14A 1U9CA 1PLKA 2LD4A 5E9JA 2GBIA 3LT2A 5AHOA 1HO3A 5K8JB 4UNPA 4S24A 4N5DA 4RPHA 2LW7A 3CEMA 3M2TA 4P4LA 4BTVA 4E7PA 4OXNA 1QO0A 2BFMA 4X45A 2O5CA 2JGMA 3U2QA 2IHUA 4RPLA 3TLEA 3M4YA 1LNSA 1M5TA 3PICA 1JBQA 2AFHA 3U4QA 2WJ3A 2QV0A 2MYNA 4MQ4A 2BKAA 2YCLA 1S3GA 5E4YA 5HMMA 1MBZA 3TEMA 4MW2A 5I7OA 3BXGA 4QYWA 4RVGA 1H9BA 1ZGBA 4FMCF 2DUJA 3I6IA 2CL0X 3U16A 1YR7A 5HCUA 3VH2A 4XIJA 3SZOA 1V3VA 1EAYA 1V47A 1YXMA 3A4LA 4IXWA 2ZYVX 2ZB2A 1Z47A 1ZGHA 3FPEA 4FXOA 2X41A 3UV3A 1IG3A 4PRLA 1B0ZA 1JW9B 5JFTA 5L3SB 2GF0A 2QTVB 2HT6A 5AW3A 5IJ0A 1C9KA 1CE8B 4TUYF 2ZYSA 3PVZA 1AQNA 3THYB 4TZTA 1LBHA 3KOYA 4QQ8A 3DNMA 3HR4A 2Q1SA 1GHTA 2DTXA 3L8YA 3AW8A 3S0JA 4DMFA 1MOZA 2QTFA 2OWDA 4CNQA 2PAAA 1BMFA 1F4PA 5K8VA 1LPAB 3ORSA 4V0ME 5B1IA 3WRYC 1PX2A 2E85A 3BQNB 4ZQEA 3CVJA 5K4GA 1E7WA 2QAGB 3LUBA 4YLEA 3SR4A 2D8MA 3LFTA 3BJRA 4OBBA 4GPZA 4Q3CA 3VYVA 3GZNA 1EHIA 4U9UA 3ETDA 3WRXC 4EI8A 1KH1A 3A14A 3QUCA 1VE7A 4TN1A 4EHAA 3UAGA 3VKVA 3LBYA 2PUAA 4OY3A 2QTCA 4OEHA 4U2DA 5CFZA 2QLLA 1O9HA 2OBLA 1FP6A 2PZLA 3CB4A 4I6JA 5TC4A 2QMYA 2PFSA 4PS1A 5GGXA 4J0IA 4YV2A 1GA1A 4ZI5A 2H5JA 5AVYA 4RIFA 1Y3AA 1I0ZA 1WE2A 4OX9B 2H4JA 1NQUA 2C8LA 4J1SA 3I1YA 5C1IA 3WRVA 3JQFC 2O3RA 4J9VA 5EESA 4RFSB 1F5SA 1N8NA 3SYRA 2ZYWX 1UM9A 3JQ9C 5L7WA 1I7PA 1MA3A 1OQAA 2XKJE 3AERB 3U7HB 4WOJA 5DNAA 1R50A 3FY4A 1U2DC 4Y7CA 1UMDB 2XE6A 1H3EA 4L51A 3DWEX 3HKEB 4BP9A 1CBUA 3IQFA 2FX2A 5EOVA 2CHEA 2ZVPX 3U37A 2WY2D 2RCNA 4PO9A 1QB8A 2PIAA 3BJEA 3JY6A 1LLQA 3BRWD 3SM9A 3T4EA 3MIZA 4C22A 2ORED 2IKQA 4X3OA 1DAHA 1IHUA 3OQVA 4ZAZA 4XYLA 4FWTA 2BMJA 3AKEA 2Q29A 1EMDA 4PYRA 4BRUA 2CMHA 5IT0A 1P3DA 5WRFA 3OP1A 3RVNA 4ARUA 3N07A 3EGOA 1EESA 5JHGB 1HT2E 4P7KA 4CEHA 5LIRA 3TXYA 1VCMA 3IJPA 3LXMA 4IJ5A 1XTBA 1Q91A 4E5UA 3DDHA 1P1CA 4NRDA 4BYGA 4KFCA 1AE1A 1PWZA 1R5BA 1J00A 3DR5A 3MELA 3NTQA 4LX8A 4GDFA 3JQQA 2X19A 5FHRA 5BUZA 2BFNA 2Z2XA 5FNZA 5AUQA 4GSYA 1SIBE 3OUUA 1F7UA 3EDCA 2O7VA 3SIWA 4MRMA 4BV8A 5B12A 3PRYA 1BXKA 3AZPA 3E9NA 4EA7A 4YMUA 4CKCB 3PR2B 4Y2SA 5DTMA 421PA 3TLKA 1M73E 2LIVA 3OJWA 2LCQA 3WMWA 5DN9A 4TYQA 1UBLS 2DWCA 3C3WA 4GSLA 4OVKA 4QOEA 2WWFA 1AX9A 5A04A 4M1MA 1VL8A 3N8IA 4DF3A 2BJVA 3EA0A 1IPHA 3KKLA 3CC8A 3O4IA 2QUBA 4AF8A 4HWTA 3EY4A 4UBLA 1YQXA 3V4ZA 3CEPB 2J3MA 2Q5EA 3RRBA 3FTCA 1YDMA 4R69A 2GQ0A 1FLNA 4B3SB 1QFMA 3L07A 3BSWA 1OMOA 1D6JA 1QGZA 1W1UA 2OHXA 2IYWA 4LE0A 4M0KA 4KNYA 1R8YA 4KGDA 4RCVA 2FEXA 4TKVB 1JKXA 1Q12A 3BSSA 2VHUA 3CN7A 3KLBA 5MN6A 4HGRA 4I6GA 1WUIS 1UXIA 2GSWA 4D8XA 1PF7E 4ZKDA 5A7FA 5KTPA 1BXRA 2ILTA 4YTEA 2VDOB 2CFOA 4GBMA 1WDMA 1KAEA 1O77A 5IYZF 4B32A 3KUCA 4TL6A 3TZBA 1PUXA 2F62A 4Z2AA 3CXUA 3VUEA 4A6EA 2YWJA 3KM0A 3SC4A 1YI8A 1U28A 4L07A 4Y9RA 1STOA 2PL3A 3FLEA 3O91A 3RBXA 4LGMA 4QSHA 1IY8A 4YCCA 5AKXA 3DEZA 3U39A 1CUUA 3QVKA 2D3WA 3VJRA 3PZRA 4P0PB 4QNRA 3PFCA 2WG2A 3MWGA 5K3OA 1QIDA 2WAAA 3PQEA 1NXVA 5AJHA 4LIPD 4DLPA 2H0QA 4ONEA 2QXYA 2CDRA 2EEPA 3MCTA 4OHUA 3V9AA 4F6LA 3HDGA 3QHPA 3NWOA 4QUGA 4Z1MD 2PWBA 1TA0A 1NMYA 5T6MA 3GLIE 3B8EA 1M1YB 3V00A 2IXGA 3U7FB 1NZFA 1R3UA 3QOFA 5CT5A 4DC1A 4CIYA 3EEIA 1PDOA 2ZE6A 2V59A 3CLRC 4YRAA 3LL4A 4YASA 2C61A 4BMZA 2I3BA 4BCCA 3KKKA 1BSVA 1M72A 4RVNA 4HLCA 1L1RA 1IXYA 4PYKA 5A2GA 3T5DA 3DSRA 4UEQA 2LPMA 4EECA 3U7QB 1FDUA 2C5AA 2VQDA 1SZCA 2X9NA 2BMDA 2RCYA 1A5BB 1SKAA 5CDSA 4XQGA 3KXIA 3WLLA 4TYMA 3KZOA 3GRZA 1DJLA 5KKNB 4QEDA 4JMPA 4YAFA 1NY6A 1TKRA 1KSGA 4AG5A 1XZNA 4RV5A 5CYPA 2Z0MA 1WQ1R 3L9XA 1L5FA 1DINA 3RUCA 1TJ5A 3TKYA 1MHTA 5T5QA 1VE9A 3RH0A 3N8HA 3QXHA 2VP5A 4R2JA 3UJ3X 4IJUA 1X13A 4S05A 1AKVA 1E2PA 2E4XA 4QPJC 3LDUA 4RZSA 4XKJA 5T4BA 3BMXA 2BT4A 1V9SA 1P0MA 3RK4A 3GR6A 1MQ8B 3CZCA 3GCXA 4OHPA 3NHMA 3ZHVA 3U3MA 5ARBA 4YV7A 5F21A 1SCBA 2WYIA 3DP7A 1UKEA 3O03A 2AEMA 3QE2A 4KU4A 2YJZA 3ZGOA 3ZV3A 1NVGA 4QLOA 4FJ1A 4IQ4A 1DTWA 4RTOA 4MK4A 4O4LF 1WOMA 3X1XA 2OFOA 4XR9A 1VLHA 3AQIA 3BCUA 2C4MA 3ILXA 4GI5A 3FYUA 3DWFA 4O4JF 4RTJA 2PYDA 2XJ9A 4AJEA 5CLGA 2HGSA 2JLQA 2P67A 1IFXA 4GI7A 1ZBQA 1ARZA 3UGKA 2VPQA 1UMCA 1XLWA 2D8AA 2DWPA 2WU4A 3T54A 3VI3B 4CCYB 4LCBA 3GGGA 3TM4A 1Q74A 3VI4B 5A03A 4NZYA 2XA2A 4CTMA 4BWGA 4P86A 3F6SA 3P9RA 2VQ6A 3FDZB 1KPGA 5DNDA 3KEQA 3QNMA 4RIHA 1TRKA 4X1YA 3KZ1E 3P9CA 2IHZA 3FCYA 1KEZA 2EP7A 3FPAA 1TGYA 3KV3O 1WWKA 1ZM4A 4N8SA 4G24A 3FSEA 3N8NA 2Q4DA 4N01A 4Z4FA 4D4LA 1BCSB 4MP3A 1K4MA 3ADKA 3JD0A 1Y7HA 2CXNA 3FPHA 4QJIA 1KFJB 1OYWA 2QR2A 1EXNA 4H3VA 1HLPA 1E6KA 3AHHA 3L3BA 2VJAA 4A2PA 4F2GA 5I01A 3IH5A 1W5EA 4ND6A 4V0OA 4E5MA 5KOHB 2ZR7A 5B2FA 4I50F 2FZCA 2NVUA 1TAHA 1KFCB 3DMGA 1QIJA 3MJRA 3OJLA 2XYGA 4GYKA 2O3SA 1TU3A 3Q9UA 1XZMA 1VSVA 5HKBA 2ZRDA 5CVEA 2Q9CA 4GPD1 2PKQO 4RGQA 3ZW8A 4D5GA 2OO3A 4FT2A 3I2YX 1WXHA 1QS0A 1QXSA 1PQPA 4FIZA 2RH4A 4GGOA 4M3NA 2DBQA 5CLQA 2AI2A 1YRQA 1Z0UA 5SYNA 2RJ3A 3BORA 3TQFA 1SC6A 2EQAA 3JQBA 4S1VA 2ZYGA 4K26A 2HUNA 3OTGA 1XXLA 3OZAA 2EKPA 1W36D 3Q9NA 3D8HA 1T5BA 4AJPA 3ZPXA 2GN4A 3OC6A 2JLSA 4PQYA 3J80A 3AETB 4JI8B 5DOZA 1O54A 1M2KA 4F3RA 5KNCA 4IIBA 2M2IA 4GOOD 3BGIA 2HNKA 3WK9A 3STTA 5A0TA 3H6KA 5T3YA 3FDJA 1FNSA 2XJ4A 3JYNA 3MQ4A 3C4JA 4U7JA 5A7GA 1QYRA 1RWPA 1LA2A 2NU9A 2QE6A 1ULTA 1JZQA 1UPFA 2IYYA 2ZCVA 4LDAA 4XIYA 4YDRA 2FY8A 3QOXA 3VJMA 5L53A 1QFXA 1WAMA 1Z15A 5IT4A 3Q3JB 3BSFA 1Z0IA 4CKXA 2K6GA 1EJ6A 4EO9A 2VZEA 3V2GA 4PYMA 4ZV7A 3ZNNA 4H17A 2KM1A 4OM7A 1SHKA 3PRJA 1TE2A 4E22A 5JTTA 1RQRA 4HG2A 3IBCA 3MZ0A 2N1BA 1R5NA 4QU8A 4JAVC 4JU9A 4RENA 3R0IA 3CMCO 2CBXA 2R11A 4C6HA 1RTKA 2FPIB 2WNHA 2HCBA 3LHDA 4F3TA 2CXXA 3R0XA 4FN5A 1I9CA 3R77A 5CIYA 3RT1A 2Z6AA 4G0PA 2WPNA 2GKGA 4CF4A 3BX1A 4DT1A 5C7LO 3E70C 2P9TA 2EIXA 1A9SA 1HYHA 3QLUC 4ZVKA 4GKBA 1G4AE 1E1YA 2GVZC 1T2EA 5HIAA 2HLDD 1JAHA 3I34X 3IQEA 4LNUA 1XVVA 4BQPA 4QODA 4B87A 1NVEA 2D4AA 1XNHA 1GQ2A 1HNNA 2F1JA 2KLHA 4HAYA 4JJZA 3UENA 1UOOA 2NLOA 3L0DA 1YS9A 2W6JA 4LZWA 3DDWA 3TBHA 5HW0A 3AM1A 3LZ6A 1NR5A 3DZBA 4H4CA 3IUQA 4CFSA 4AG6A 3BZBA 3AEUA 1ZMRA 4PPQA 5BN4B 2WC1A 4AQ7A 3KYDB 2O7RA 4CU5A 3H0KA 2JAPA 3E7PA 2J67A 1W36B 4NCJA 4NCBA 4M7WA 2ZKLA 1GNPA 1VPVA 2VH1A 1Z2AA 4DCOA 2FF5A 1PR9A 3EIQA 1ITZA 3PQ7A 4TV9A 4BQEA 3PQFA 5JASA 5JQGF 3EPKA 4NK4A 4CM8A 2IA5A 3DFZA 3UHJA 1DC5A 2JGDB 3LUDA 4D96A 2YN0A 4EY3A 3HBAA 1K3FA 2WFLB 3I45A 2CL7X 5KYNA 1C7FA 3GMIA 2IT1A 3C3JA 4NAVA 4KVAA 4UUBA 3NUQA 4TXJA 1CY1A 3SI7A 1IYZA 3SXPA 4B7UA 4JMLA 3DF7A 2WFAA 5CTAA 1CHDA 1XZGA 2Y2VA 5B7NA 1CCWA 3SHWA 3VPCA 3RS3A 1R7RA 3TQHA 3WAKA 1D1SA 4OQ4A 4GQBA 1GZ3A 1OIVA 3FOWA 4PG4A 1QHIA 2VDVE 4JEUA 3K53A 1EDBA 3N2NA 3BXEA 2P91A 4KPYA 4O2BB 5ECDA 4S04A 1NBIA 1HNWB 3OOHA 2XYRA 4IH1A 1R66A 1E1LA 2CDBA 4R9RA 3JR7A 2YN2A 1AKNA 4HT3B 4RSMA 5J4HA 3A7EA 4GIBA 4P2GA 5G0WA 1Z68A 4QO7A 1DHTA 3PNKA 3OLXA 5K01A 5M5BA 1W6UA 4GZMA 4LA4A 4NIMA 1VG9B 1ZITA 2PSDA 5FQOA 2IPAB 1W76A 4IFIA 3GDGA 3Q3CA 5B1DA 3O90A 2M6KA 3KJEA 3P9ZA 2E7ZA 2WYUA 1QOPB 4KYIB 1KZ9A 2PL1A 3EQ8A 1I4OA 2IVZA 4QTUB 2JJ8A 5IDYA 3ZLJA 3E3LA 4KLZA 1G9SA 1OFUA 2PKYX 3D7MA 3QX7A 3V8VA 4ALNA 1UWKA 1CEQA 4GUAA 4RS3A 4OMUA 5IP5A 2VHWA 3TFOA 4QDZA 2WKWA 4Q01A 1A7AA 3WLMA 4ZYYA 1V7ZA 1GCOA 3PU6A 1GLVA 2JHGA 4Z9AA 3DXYA 1O0SA 4BLQA 3RD5A 1DAKA 5T8KC 1SIOA 1AMNA 3KZNA 1UZMA 3L1KA 1SWVA 1V25A 2PAFA 2RHWA 4K9OA 4UBNA 4ZCRA 2NUPA 3RASA 3FVQA 2DUWA 3KKZA 3HVRA 4LHSA 4BOYA 3SKYA 4BGUA 1A7KA 3A7DA 4KB5A 1DU4A 4BKOA 2LP4Y 3DVAB 3ZK8A 1KY2A 3IEUA 4BMOB 5B36A 1DMSA 1NXSA 5IANA 2GZSA 1FVXA 2J5KA 1WULS 4RS4A 5LYJF 4QNNA 4KUHA 5TXGA 4D0LB 1FFXA 3OOYA 3AG6A 5EWMA 1IOVA 2J30A 3P94A 3VHXA 2JJQA 3D54D 1WEHA 2K2WA 3N7TA 4WZAB 4AZ0A 3NH6A 2J0QA 2NZ2A 4GZ6A 4KGXA 3T3PB 2V7QD 3OCCA 5KPDA 1P80A 4ZV4A 1AUOA 3ESAA 3LT0A 3PNSA 5A05A 3INGA 2P4HX 4I5EA 1GZ5A 4PYIA 1VPTA 2QUKA 1AO3A 3AJRA 4QU9A 3PCTA 2GARA 4KAXA 3X43A 5AKLA 3HBNA 3KV1A 3VVLA 2PYIA 5K3BA 2R96A 3G02A 2XWPA 5DGTA 4BUCA 1KH2A 3OC0A 4K88A 4MW1A 1S02A 3CCBA 1Y4UA 3CUVA 4PIVA 4S0XA 4X1KB 3MWKA 1W4RA 2A0FA 4IIXA 4L85A 4EGFA 1YBMA 1TADA 3FE2A 4RY8A 4WOCA 5D5HA 5FI3A 1CUAA 5TQJA 3TIGA 3A2KA 2OXCA 5KC8A 5I4CA 2Z4SA 2GJSA 3A6GA 2QX8A 3RSLA 2AZDA 3NC4A 4FE3A 5DIFA 1JHMA 2DE0X 3P97A 5F78A 3U4HA 1ONNA 2JCVA 6GPBA 5DM70 4QL3A 4LFAB 1J8MF 3CVYA 3QVOA 2G17A 3BTUA 3STUA 4ZAWA 3NVAA 3IIJA 2HRBA 2IS1A 2A9FA 2QTLA 3OZCA 4MV3A 5FUBA 5H9WA 4E6PA 3OD5A 1RLMA 4FIDA 3WNDA 1KAOA 1JMVA 5C80A 1SKMA 2CUTA 1LQ2A 2QA5A 2WSIA 4QOSA 3V8PA 5EJ2A 4DSAA 1YF3A 4OHZA 1PNTA 4N4AA 1OTYA 2ZIUB 3KT3A 4X9XA 4YRTA 5J1SB 2QT1A 2RJOA 4B8WA 1B3RA 2IPOA 3GN2A 3JQ8B 4R31A 5HBGA 1E9RA 4X7RA 3L8GA 1CIJA 2RBGA 4RVDA 4YB8A 2VPPA 4IVNA 2BYTA 3ND5A 2X2PA 2ZYDA 3PL1A 3NAMA 1LF5A 1WBDA 1X7XB 3BHIA 5H16A 4ZYXA 2VYNA 1ADGA 1V2GA 1U8AA 1M2OA 3ROQA 4Q05A 1JR2A 2X42A 5K3DA 3UJAA 3CO0S 2YNMD 1GGMA 2AG0A 3KHSA 3EF3A 4EX6A 3BK2A 1K8XB 2OTCA 1C1XA 3EA5A 5CFMA 5ALXA 5CVDA 4YMHA 2IYVA 3W2TA 2Q9AA 4CLDA 4TLAA 4M9ZA 4NVRA 3P0FA 2HZ7A 4NV3A 2WJHA 5EWLB 5EWJA 2DBYA 1XP8A 3NX4A 3HA3A 3EG5A 3PDIA 1FE8A 3PGKA 5CT6A 4C0QC 1DOAA 2FPGB 3TL3A 4LWPA 1WCV1 2OORA 2PGIA 4LAFA 4X8LA 4E5KA 4Q1EA 3UPTA 4LJ7A 1G5IA 1SHUX 1IXKA 4LVOA 3SJBA 1EP9A 1GL7A 1DDOA 1Z6TA 1KXJA 1N2XA 2HBQA 3AU9A 1NLFA 5CURA 2OXFA 1ISFA 3LF2A 4P2BA 3H3XA 1U11A 1ZD4A 2QPTA 5EXEA 4L9RA 2YV4A 2FQXA 1P8AA 4HI0E 2QG9A 1Q7EA 3K2BA 3PE3A 2CFIA 1JNYA 4R0NA 5ER6A 3T5MA 1RADA 5KTMA 4G9EA 4J16C 4LEIA 1G1MA 2L18A 3ORFA 4PXSA 2QOEA 3IESA 4X20A 5P8WA 1EQ2A 4QHYA 1LQTA 3F0TA 3JZFA 5JYDA 4G3XA 4MW7A 2NZ8A 4HVTA 1Z5ZA 2QJOA 4TSFA 1ZK0A 4RGBA 2H1SA 4E03A 1MW8X 4EPWA 3V8RA 1NUPA 2JGEA 3VBEA 5LZ2A 1BCRA 4F5DA 3NZEA 3AX6A 4PLYA 1ZKDA 2G07A 4AC9A 3TLBA 4D8YA 1ZHOA 3HN7A 3L7YA 4GECA 3MMPA 3FPFA 3UMRA 3LDGA 3VAZA 1QTIA 3D31A 2B30A 1AV7A 1PT9A 1QDLB 4YI3A 3D0KA 4NMXB 2H06A 3ZZNA 5ECGC 4X8HA 1UPCA 4JSYA 4O2RA 3S40A 5EFZA 5TEVA 1DDGA 3ULKA 4QRHA 4C7KA 4TMZA 4BQFA 5KMGA 2AXPA 2E48A 2FFAA 4H2DA 4EBFA 3Q8KA 2Q9BA 5JRZA 5H59A 2AC2A 1RZUA 3KZVA 1RYYA 2H92A 4L4SA 2CNBA 4RA9B 5F1KA 5J5CA 1K2WA 4EVSA 4LFCB 4C4ZA 3M1AA 5AKGA 1QLHA 1IRIA 1RYFA 3JRNA 1EVQA 1SHJA 3D9QX 1OC2A 2I1VB 3UFXB 1C8VB 5FJJA 1LPBB 3SKVA 2HPVA 4GU5A 4YCMA 4ZMSA 2ZITA 2JAWA 1RXIA 1M54A 1VL2A 1F3OA 3IMCA 5BRJA 5BWNA 3LYAA 1Q11A 5JSUA 3DMRA 5HKAA 1L7XA 5DNYB 2CSXA 3UT6A 3BRSA 5LJLA 3G2JA 3JS5A 4FDAA 2JFFA 2WHRA 3VZSA 3RHFA 4HUTA 1JSRA 3ZHCA 1RLOA 4UUNA 4HSGA 3O6VA 1U2GC 2ZJZA 1JA0A 3FDIA 1CDEA 2B2NA 4BZXA 1CR2A 1TRHA 3STWA 4LOJA 2CDCA 3PPVA 4ND8A 2FWPA 4HR7A 2VTVA 2YZ2A 1AQYA 2PE5A 3D8NA 3AFMA 1LBSA 3ZDXB 4CLOA 4YBRA 2ZRLA 5AW5A 1PZFA 5E7QA 7MHTA 4A8JB 3HQ4O 1WPQA 3PZBA 4NTZA 2ZTLA 4JD5A 5CVVA 5HCIA 3V97A 3ITDA 3TNYA 3VRHA 2JLWA 3BWEA 4ZXFA 1L7EA 4ESEA 2OOSA 4MITA 4OK6A 1CP3A 3OQIB 3L8MA 4L8VA 2P1ZA 1R64A 3JQGA 3H5OA 3TZLA 5K0GA 2YMQA 5DLEA 1SUBA 1OI3A 1MTZA 3K8OE 2J0EA 2VHTA 4B4KA 3PP8A 1JU9A 1NNLA 2XOEA 4KXMA 1MC5A 2PUHA 1PVDA 1EBUA 3FI9A 3GT7A 3OEYA 3AYXB 4NZOA 3WL6A 4CEIB 2GCPA 3M1IA 3CB2A 4I50B 4R1QA 2GUWA 3G2PA 3CIFA 4PCUA 3TZHA 3PPIA 2VH2A 5DO9A 3ZS9A 1YU9A 4FR2A 1UFKA 1O94D 3ONEA 4PYNA 2VP4A 1XMXA 2IH5A 5AVZA 3D3KA 3TSWA 1Y48E 1F9EA 1WMEA 5EHNA 1Q44A 2HCFA 3L02A 1FNCA 3AUAA 1WTAA 3GZ4A 1KAHA 2VDQB 3NHZA 2C9ZA 1VB5A 3KD2A 4GW3A 4L4RA 4P34A 1L4NA 1RQNA 2AYZA 3GMTA 4IFTA 4JEHA 5JADA 2HHLA 1HE2A 2H7XA 1EK2A 3BTSA 3RADC 1CW2B 1GEEA 1V26A 2WF5A 2EL7A 3RUFA 2VNAA 3BDAA 4QAJA 4MPRA 5C2JB 3W9YA 1CIPA 5MF6A 2IBMA 1EKXA 3CJTA 1CQPA 4POOA 5AUPB 3AZOA 1BKYA 3D3WB 4D8VA 3BN3A 2BGUA 2WB4A 4YJ2F 1SC3A 2XE8A 2QW8A 1GQSA 2XCTB 2JCGA 4ER3A 5KYUB 3B6JA 1UBFA 2R7MA 4DR3B 3GFQA 4X54A 1T8YA 4WZAE 1V7QA 1GTJ1 4GS5A 1MAHA 4I1VA 1EXWA 2FPPB 3P52A 1TUBA 2BZ0A 5KQPA 1DKQA 1G8SA 1XEAA 2HRRA 4BPBA 3MJTA 3P5SA 2IYUA 4K9NA 3HKDB 4ZARA 3ZY6A 1Y89A 3R7DA 5HRUA 4BKQA 5JNUA 3DJFA 1TX4B 1ADFA 2HYIC 1T3SA 5M3BA 5JFOA 4MR7B 4CT0A 2ZI7A 3G8YA 4MPJA 3WL3A 2PRSA 1NN3A 2TECE 4REQA 4C0AC 1XVTA 2B69A 4P1ZA 2JIZD 2Q2OA 2H00A 2OMEA 5G1PA 3GJ6A 1BXGB 2UDPA 3KSDO 4ZAYA 5HCNA 4HLUC 1U8UA 4MQEA 5GIPE 1RKUA 5I6DA 1MV5A 4UMDA 1YDWA 5D3ZA 1CFJA 4Y2GA 3H1GA 3FVWA 5IBPA 2RBKA 4FDLA 1QO7A 3EARA 4HKTA 2V7UA 3VDMA 2QR3A 3KR9A 1RC8A 3LBFA 3KYCB 2UZ3A 1HYQA 4MWOA 3E2PA 4RJIA 3GLHB 4KN6A 5JZMA 1MP0A 1OI4A 3OQ6A 3WIVA 3ZUPA 1TTTA 2FUG1 4B3BA 4H60A 5ALUA 2HF7A 5G4LA 3H13A 2P9GA 4FE7A 1CUCA 1NJ2A 1N2HA 3MGBA 3DWIA 4M0LA 4TSRA 5REQA 1BS1A 3HZZA 3IP6A 4L4UA 4PLFA 3SGLA 2W2QA 2IYLD 1QYIA 1Z2DA 1VCIA 2VOJA 3VZPA 3FUCA 2GJ9A 1ILEA 5GINE 1M6YA 1WNFA 1K3TA 1KQNA 1K5HA 3DKVA 3TI7A 3HGTA 4A0GA 1DCTA 4R2KA 3FYSA 1YRAA 1JBEA 4MCIA 4P4SB 1L7VC 5K6RA 3ASYA 2PKWA 1Q3KA 2C59A 2OGWA 2PO5A 3FSJX 3L1JA 4EI7A 3AF4A 1NVAA 2BGKA 3LUCA 3BWYA 3AIIA 1G8PA 3O3MB 3BE4A 3B3AA 1KTIA 4EKIA 4FCVA 1QLJA 2MT9A 2WJ4A 1UKCA 2O9JA 3DYVA 3OCUA 1PG5A 4KDFA 3ZDRA 4D4KA 1UMKA 5CBKA 5IUJC 3MVEA 2NAFA 2P77A 3GDOA 5H9VA 4YRIA 3HXQA 2XQIA 1TM3E 1CB0A 3RQSA 4DPMA 4GVPA 4BJ6A 1XXHB 3L7OA 4ZQFA 4M21A 2FWIA 4OMFG 2I62A 3UW3A 2YZKA 4QGSA 5BMVF 3HB4X 4FFOA 3U48A 3LLMA 2G4CA 1SC4A 1G2IA 5EJ4A 4JUFA 3HCFA 1YVPA 4V0MA 1DOZA 2O8BA 4EUHA 3VR4H 1UIMA 2V8OA 2E1RA 5IVIA 5HYVA 1H2ZA 4DDWA 2CC2A 1H6CA 1M2GA 2OQIA 3NOVA 2A9PA 1W85B 4M1SA 3X2EA 1KMNA 5K4HA 3KPWA 2CLHB 4DV0B 1ESNA 2AK2A 1KQ3A 5LXTA 3GY0A 4WOPA 2V5VA 3LA6A 1UFQA 2AV6A 3RIGA 5KVQA 2HPHA 3LS2A 4LJ8A 1CRLA 1MJNA 3BMNB 2O20A 4WFIA 5M04A 3U3KA 3SQWA 1RRKA 5CK5A 2R1VA 4KN5A 1MZVA 3X3HA 3SXUB 1RT9A 2FPXA 2V6IA 1JSZA 3BIFA 4OHRA 5DGDA 3WDSA 4YO7A 3PI6A 3I01M 4J6EA 5IUKC 4CZ2A 5HOQA 4DKJA 1PK9A 3VH4A 3EPLA 3DW1X 4Z5XA 4ZRDA 4DUGD 2WM3A 4KWCA 1IEQA 4FINA 5EN4A 1BQ4A 2YWHA 3EGXA 3Q3EA 1BFKA 4C76A 1M1ZA 1XC7A 5EKUA 1UIRA 3MJEA 4YMVA 1C8BA 4E09A 5P21A 2A9JA 2EJUA 2I3AA 2VDJA 3KLNA 5EXPA 1E3JA 4INZA 1MT3A 3IDFA 4PV7A 4Y0VA 4BNTA 5HFNA 1AGNA 2O0HA 2CJYA 2VJBA 3GFBA 3ECCA 3MTDA 1BE1A 4GXNA 3ZGVA 3E9QA 3PC8C 4Z4HA 1A8PA 1WSWA 2FSHA 2QRMA 4ESHA 3GIWA 2I3GA 1GPDG 1P0PA 2OZEA 4C4AA 2VPTA 2W83A 5GONA 1XV5A 2AXQA 4OQXA 4ENRA 1AO0A 4XD7A 3KCNA 4IJVA 221PA 5C9ZA 3LLVA 3ADCA 2HKIA 5K0JA 4RX1A 1XWIA 3W5SA 1NYRA 1IZYA 3LC1O 4BQOA 4HFMA 1YSCA 1E2DA 2SNIE 1B1CA 1B93A 1UANA 3KP1A 5LP1A 1E3MA 1V5WA 1SXGA 2VNKA 3C45A 5KO2A 4B4DA 2CN1A 3LY9A 1JDZA 1Z6XA 4KRXA 3R9KA 4DUYB 2L2QA 2QDXA 3G7NA 4G01B 3FDFA 4G25A 3TQRA 5K3EA 5CHYA 3LY8A 4RPGA 4JUDX 4CMJA 1HDIA 1OWPA 2ZJ5A 4KXNA 1KI1A 4LJAA 4RA6B 5K1ZA 5IJZA 3FOCA 2VDWA 2M32A 3T9DA 1QYVA 1JG6A 1QCZA 1WXWA 1MO2A 1XYYA 2CJXA 3GGCA 2Z5VA 3IAM6 3P45A 5BV2P 1YCGA 3L1VA 4FKBA 5IVDA 1CS0B 3GNQA 3HVJA 4LXTA 5JEDA 3GROA 4RF5A 2GCNA 5KDLA 5LCXA 3CPHA 3PXAA 1X9HA 4BXOB 3UW1A 2EWVA 1BWRA 4MLCA 3ROGA 2VJMA 5JVDA 3DOCA 2WILA 5JH7A 3QWFA 4OQYA 2G83A 1WZUA 2A0XA 2I7TA 3K1YA 4FDMA 5FKJA 3ZJUA 2QORA 4I1OA 1COZA 1RQ2A 1OLXB 1TIBA 2X8JA 2KQUA 4FLEA 3QKRA 5HJ5A 3CCCA 4Q1CA 3BAZA 4ZJZA 1KS2A 1E5TA 5BSHA 5E2IA 1GCAA 4NFYA 3BMCB 4HWKA 5AT1A 4R9NA 1Q84A 3NBYC 4MVJI 1LC0A 3LVFO 3RKUA 1QRSA 1Q17A 4G86A 2I3ZA 2CY0A 2B2XA 3D6VA 1RC0A 4L5IA 2J32A 4AMUA 4P35A 1YA8A 4X65B 4ECEA 1P3Y1 1TCAA 2VT7A 1DO2A 3F6BX 3M9WA 4WLFA 5BO5A 5MGBA 1EUYA 5E3JA 1VLQA 4TT3D 3N8GA 2G1KA 2V9CA 3N74A 3F2IA 4Q3DA 2C7BA 3RK1A 3U26A 2EFJA 5DYYA 4DSNA 3S2YA 4BJ3A 4TXMA 4NG4A 3GLIA 4WZZA 1ZH8A 2HDOA 3RU3A 5C81A 1E2NA 1R5JA 1Z4LA 4BLWA 4R7GA 4CKWB 1VG0B 4LHWA 2P7IA 2ZSUA 5FPSA 1B8OA 4B71A 2GRUA 5ICSA 4URUR 1SUFA 2G0TA 2FWJA 2YNMC 4LTMA 2X7HA 1QTRA 1TC2A 4L73A 3ZWBA 3B3QA 2QE7A 2JFQA 1G16A 4ZGBA 4QDKA 2E4VA 4EZBA 4KI0A 5AUOB 3ITEA 4EENA 1K6XA 3JATB 5DMXA 1OPXA 1W2WB 1GXSA 5BWLA 1R0WA 1KMMA 1SVSA 2NV6A 1WB9A 4C1BA 2Y3IA 4CR8A 5L6LB 1WW2A 2Q1UA 3RT7A 1W5TA 1M0TA 1XLTA 2HSJA 2OFWA 3IIKA 3VJKA 2GA9A 1MPXA 1KORA 2ISCA 2VR1A 5HHTA 1C30B 1DUVG 2LCFA 3G8BA 4DR4B 3WIDA 2IWRA 2PU5A 2ZRBA 2WHXA 1S89A 1XF1A 1SA0B 1NQ5A 2WKRA 1BFUA 1DQNA 5D6NA 2B4TO 3CVWA 3ON5A 4DABA 4UHEA 4WKBA 1CVLA 2WWTA 3K6RA 3SQNA 2GLTA 1COWA 2QD1A 3A27A 3CW9A 3IUPA 4WTOA 1G4UR 4EB3A 3TIVA 5KOYA 1Y6GA 1E1QA 1QKIA 2YL2A 1AB6A 4H0FA 3HCCA 4BUZA 2C7QA 4XFKA 4G8BA 4I5IA 3EEQA 2PLNA 5D00A 1VQ1A 3WIOA 4CKBA 4Z6KA 4BV2A 1VL5A 1YIOA 3GLHE 5C31A 4MDHA 1H3NA 4TTVA 2P0YA 3IVRA 2IUEA 4BQQA 1S6YA 2X0IA 4Q7JB