3SU8A

Crystal structure of a truncated intracellular domain of plexin-b1 in complex with rac1
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
178
structure length
178
Chain Sequence
b'MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-related C3 botulinum toxin substrate 1
publication title A Dual Binding Mode for RhoGTPases in Plexin Signalling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis/signaling protein
total genus 47
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2011-07-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3su8A00
4PANA 3C14C 3B13B 5EXPA 3EIHA 3PCRB 5J4KA 2QN6A 1F60A 1KI4A 2ONKA 3B8HA 2OCYC 2KWIA 3UWOA 4DSNA 4F38A 1RZ3A 1E2IA 5JSZA 2FU5C 5JBQA 5EZ6B 3KKMA 3LX5A 4V0ME 3VNVA 4P31A 3GFOA 4EAQA 3FKSA 2VPPA 3E2IA 3WY9A 3CRMA 2QM7A 1JECA 4NBSA 721PA 4BPBA 5JRZA 1HE1C 5K8LA 2EVWX 1QVRA 3QI2A 4MYCA 1TF7A 2OSBA 1XD9A 4I4LA 2FOLA 2P2LA 2PJZA 1GRQA 4ZDWA 3SDZA 4DVGA 3U7GA 1XXHA 2IUTA 3DKVA 2O8CB 4O25A 1IY2A 2XXAA 3CX6A 3TR0A 4A2WA 1F2TA 1E9FA 3CM0A 2CJWA 2EFHB 4R98A 1KI1A 2GA8A 1RC8A 1QZXA 1IXRC 4QJ4A 3ND8A 3RC8A 1WE2A 4AY2A 3RS2A 4YDHB 2G83A 4AG6A 4B2PA 4Q4AA 5KU1A 4KXFB 4I81A 3ZQ6A 2IC5A 4O2RA 3I92A 3REFA 1N5KA 4DUGA 2YOGA 5JHHB 4W5JA 1G21E 1Z0DA 4OI2A 1GSIA 3WMFA 1E2JA 3W3AA 3GJ3A 4Q4HB 1P7CA 3ICQB 3TQCA 3GLFA 1TUEA 3WBKA 1OF1A 2OV2A 4HLCA 4A9AA 1R0XA 3QG5A 3ZVMA 2QPTA 1KIMA 2WJHA 3KL4A 2R9VA 1A2KC 1W47A 2ZRDA 1UKZA 5FTJA 1E0KA 3S1AA 2QY9A 3KXLA 1NMZA 5HCNA 4B74A 4LV8B 3AKDA 2BBWA 1KDPA 1OFIA 2OG2A 4JLMA 3GPLA 3G5UA 4UNPA 3SYLA 1QBKC 4DHEA 5H1YA 5F2EA 3MUFA 4D25A 1SXJD 3DZ8A 1JR3E 3QEJA 4OHZA 5CITA 5TDHA 4NL4H 3PQCA 2D7DA 2J41A 3AUYA 3W8NA 3CKLA 4JKIA 1RYHA 3O8CA 1FQJA 2V6JA 2VBCA 2XZPA 3QE0A 4J0QA 4BLTA 2MSEB 1OIXA 2ZS8A 4BE7B 2Q21A 1WBDA 4DZZA 4LV5B 1Z0KA 3AP1A 2BKUA 3HPQA 4HLQB 2QE7D 1NLZA 2J45A 4KFUA 2IBMA 1UBGA 1JAHA 4JVLA 1ZCAA 4BASA 4V03A 2WZQA 3EA0A 2DY1A 2PZEA 3NBFA 5KUTA 2WWIA 1P72A 2ZYVX 2A2ZA 1ODFA 3PENA 1UDWA 3X1WA 3QKRB 2AFIE 1SKYB 3WMEA 2N46A 1CP2A 2JJ8A 2ZS7A 3NWJA 1P62B 1KOFA 2FV8A 4TL9A 1NSTA 4Q1FA 3HU1A 3GLIB 1KTVA 1CJVC 3K9NA 3LD9A 1YR9A 3BXZA 1IN8A 4Q02A 1YVDA 2HXYA 2EFCB 3GCGA 2R65A 2W6IA 1OKKA 2HLDA 1FP7A 1U0JA 1FX0B 1IN4A 2QSZA 4IHQA 2WJVA 4TQUS 3DHWC 2GJKA 3GEHA 2EYQA 4JBXA 2WPDD 1E0SA 3RNLA 4ITRC 4KVGA 3U6KA 1AKYA 4Q1BA 5FL7A 1KJZA 2C5LA 4PPFA 4AKEA 2OBLA 1F48A 3B1ZA 4HSEA 1SQ5A 4BFSA 4D82A 1GDDA 3ZIAA 2ZROA 3TGPA 4JJZA 2A9KA 3ONWA 4DCNA 5AUNB 3ND9A 3FVQA 1D6JA 2I1VB 4CEIB 2DB3A 2GK6A 2IYZA 3U7EB 1UKVY 2ZIAA 3KQNA 2JJ1A 4Q9JA 1VCNA 2ZUDA 1MO3A 1UM8A 4HUQB 4XVUA 2PJRA 1G7TA 4KFRA 4URXR 1G7RA 3SN6A 3THYB 2GCPA 1E2DA 1M1YE 1SHZA 5AUQA 4DC9A 1LS6A 1F3OA 2P0EA 1N6NA 4EUNA 1KAGA 3DM9B 4L5BA 2O0HA 4Q4HA 4M22A 1N0WA 3IPYA 1XEWY 1WB9A 1LW7A 1VG1A 5FPHA 1JR6A 1ZC4A 2IYUA 4OHXA 5LBIA 1GNPA 1EXMA 2HF8A 3MG9A 2ZM5A 4TZ6A 3IBGA 1EFCA 2IYYA 1Z47A 4AG5A 1ZUIA 4OBEA 1Q21A 1N5JA 4LHWA 3QBTA 5IT5A 4C2UA 1HT2E 1UADA 4XWAA 2YKGA 2QZ4A 1ZM2A 3Q8XB 4JLPA 2NMVA 4BFZA 1TTTA 2C8VA 2XSZA 1EFHA 4RZUA 3WMGA 3C16C 1UAAA 1DVRA 4XSGA 1D2NA 1ESNA 4X8LA 5A5GA 4TMXA 1CR0A 3TKLA 4YC7A 1W49A 4S35A 2IW3A 2GEVA 1G3MA 1NVUQ 3NBXX 2V54A 3ADBA 4BLPA 2X19A 4OI1A 4KBFA 1JNYA 1U0HC 3BORA 4YQFA 3CLVA 4B75A 1G8YA 5BN5A 4HB2A 2XJ4A 3QKRA 3PUVA 3T12A 5E3HA 1YRAA 4LJ4A 2WVJA 4TYPA 1R4AA 1VIYA 4MA4A 2K5UA 3CUEF 5HKKD 3GLIA 4PO9A 4B2IA 1JAIA 2QI9C 3O8BA 4OYHA 1ZRHA 4LC0A 1GKIA 2R6DA 3IO5A 3JZMA 1BOFA 1FX0A 2ZI9A 1KYIA 1XMJA 2D2EA 3OF5A 5AJXA 1W4BA 1PJRA 4W7SA 1DBSA 3UIEA 3NDBB 3EASA 1R0ZA 3QPWA 4MUBA 1XEFA 3IBYA 2VEDA 4JBYA 1RIFA 4Q18A 3R7WB 2BBTA 2FPKA 1GP2A 1E4YA 1YR8A 3U44B 5DN6A 2JLXA 3T1OA 3IO3A 5DYGA 3GD7A 3X1XA 5EP2A 2OHFA 2CL7X 1LF5A 4MKFA 1DTSA 1NVVR 1QDEA 4TTPA 4CEIA 4ZKDA 1RKBA 2ZE5A 2DHRA 2D3WA 1XEXB 1NVVQ 1Z6AA 4HUQA 3T5DA 4C9BA 1R8SA 1W0JA 4EPRA 2Q3FA 2FGKA 3THYA 2ZI5A 2A5FA 4ZO4A 2IEYA 1G3UA 1HV8A 1E79D 4B3CA 1F2UB 3FKQA 2P6NA 1AA9A 4DXAA 1H8EA 1E1QD 1NKSA 4LJ5A 3NIBA 5FUXA 1VG0B 1CS4C 2ANCA 2AN9A 4BEBA 2GDJA 1CRPA 1R6BX 2IYSA 1SKQA 3UK6A 1A4RA 3A4NA 1S1CA 4LK2A 2FGJA 4G5RA 2PLFA 4QFMA 5CDFE 4QGAA 1COWD 2EWVA 4A92A 1GRRA 5DIFA 5AUPB 4TT3D 4Z54A 4NMMA 1OXXK 2R62A 3SQXA 1R8QA 4FN5A 4A15A 2IUUA 1TNDA 4Q4LA 2A5GA 4FCTA 5AK0A 2QUZA 3KKNA 5DSZA 1IAQA 2IYWA 4B3GA 2ZUBA 2AFHE 1XTSA 2W2VA 3EZ7A 4RY2A 5BQ5A 4CGZA 2ODBA 4ARZB 4B43A 1ZD9A 1FNMA 5J4VA 4P0TA 1SHKA 1JQLB 4TL7A 1JBKA 3SZRA 1JJ7A 2F1RA 4G5GA 3CRQA 3PUZA 4MRSA 4H1VA 4P3YA 3R9IA 5E4FA 2FZLA 5KDOA 3WRYC 2ODNA 2Y8EA 1IY1A 2LCFA 1V5WA 4N1AA 5H8WA 1LF0A 4AYTA 4BWYA 2OCAA 3KUCA 4G01B 1FOEB 1P75A 2VQSA 5B58C 5FBQB 1BH2A 3I62A 2J87A 5AR1A 2O8EA 3LVRE 1YRBA 3OIUA 3KFXA 2G6BA 1KMHB 2OBMA 1G291 4CEHB 1YR6A 2FSFA 1FFHA 4UJ3A 3R8CA 3R7WA 4DSOA 1OH6A 1ZNZA 2VHTA 2ZJBA 3A6PC 3NBYC 3U44A 1M74A 2ASEA 2O0JA 5EXXA 1S0UA 1UEIA 3I73A 4GBMA 4LBZA 4PQYA 4M1WA 1KJYA 1BIFA 4NYMR 1MR3F 3SBDA 3W6OA 2JEOA 2G88A 4Z8XA 4ZV4A 5J47A 2IT1A 5CIWA 5ELXA 4NYMQ 4WBSA 4P4UA 1G6OA 3Q5DA 1G4AE 1XEXA 1KO5A 2QORA 4KYIB 3EG5A 3NTUA 5JECA 1KI9A 2KBFA 1R5OA 5FR1A 3B78A 3GLHE 4JBWA 4C0LA 2NO6A 1OIWA 1U9IC 2I1QA 2WWFA 3MMPA 1F2UA 3PUWA 3KXKA 3MCAA 4URVR 3BS4A 4A0HA 5KDLA 4HYYA 4AKIA 1C9KA 1G16A 1XNJA 1YKSA 2L0XA 4WZBE 5BXQC 1VTKA 4DDWA 1OHHA 2GETA 1Q44A 3K1JA 3GLGE 4GI7A 3U3RA 4BFTA 1E1RA 3FMPB 2BMJA 2OAP1 2GNOA 5EJEA 2ZAMA 4G5SA 1Z6XA 4LX0A 1VYVA 2DYKA 4KFSA 2F43A 1E2EA 4OQMA 1E9BA 4B3XA 3TUJC 5CIQA 1EESA 1AS3A 4ASUD 4C7OB 4L9WA 1CJKC 4X8MA 4JT2A 3KKPA 4ZDIA 4XIGS 3VHLB 1FNNA 4HI0E 4DBLC 4HUTA 4ARZA 4MRNA 3K0EA 2H5EA 2HUPA 5FTMA 5HCIA 4UQOA 5C4GB 1LVGA 1ZBDA 4DKXA 5L8VA 4ZCIA 1F5NA 1NY6A 3EZFA 4LUCA 1XCPA 2CK3A 2QAJA 1XTIA 2KSQA 2G0NA 1DEKA 4KVAA 5AUOB 3FFAA 4CRWB 3B9PA 2NG1A 3EC2A 3TIFA 1IM2A 3VHXA 1X8KA 3SS8A 2IYRA 2VHJA 2QRNA 1PLJA 3THWB 2LKCA 2AKAB 2B6HA 4GFDA 3K8YA 1MO6A 4MYTA 5H70A 1Q12A 3AKYA 3I72A 4C0QC 2J0SA 1RE0A 1SVWA 1HQYE 1P9RA 4M53A 4N0DA 1M7HA 3SFZA 5KPDA 1XJQA 4JLJA 1KMHA 3LNCA 3LBIA 1G5RA 2Q3HA 4CEHA 1XD8A 4Q7LA 2OM2A 4PTLA 2GVZC 3QXCA 1G17A 2FN4A 5KSOA 2PX3A 3QSYA 1E4VA 3B1WA 1Z28A 1M2OB 3NVAA 4NDZA 2QMEA 1YE8A 4A36A 1HE8B 4ZIRB 3K9GA 3P20A 2XZOA 3AB3A 4ERNA 3H0KA 1FPMA 3R8FA 2ZRJA 2W6JA 4RKFA 1IOZA 1KI7A 2E1RA 2JDIA 1TX4B 2JJ2A 5EXSA 2BHRA 4CIDA 3THOA 4Q9HA 4OQNA 4GZMA 1QHNA 3QIAA 4TSFD 1LS1A 3A8TA 1IHUA 2Z5FA 2P67A 1NJFA 2Q9AA 5G3ZA 5KNBA 1UBCA 5FTLA 4P33A 1NN1A 3KB2A 2GKSA 2V55B 3LDAA 4OHWA 5AJVB 2IF2A 4LBYA 1S1MA 5BN4A 1L8QA 3P1JA 3LBHA 4QHTA 3NHBA 5FOXA 3AGPA 1E9EA 2BBSA 4MRPA 4F92B 3AM1A 2RGNC 4IVRA 3SJCA 3W3ZB 1GWNA 4BLQA 1II0A 3FPAA 4KCGA 2RKOA 3EZ6A 3GFPA 5FUYA 4JL6A 4D4LA 5HR5A 1CF4A 2J7KA 4ACBA 1JPNA 2ZE8A 1GILA 2R8RA 1W46A 2J0UB 4B71A 1VKJA 1WXQA 2CLDX 2FSHA 3T35A 3LLMA 4WAUA 1GOTA 3A4LA 1GIAA 3I8XA 2GVDC 4KSBA 3ZQJA 1P2TA 1PV4A 4O3MA 3CX7A 1XRJA 2KB0A 2Z83A 2F3RA 5FOVA 5GVSA 1KK0A 3AF2A 3ZVNA 2IS6A 4DEXA 2IF0A 4LHZA 5CK4A 1UKEA 4OJKA 2QSYA 4C7OA 1U9IA 3L0PA 5TB5A 2GWHA 3I5YA 1ANKA 1MT0A 4OQLA 1EFRD 1RW4A 5GJWC 1OLOA 3WNBA 4R2IA 1W7AA 1YHNA 1G1MA 4B34A 2YNMA 2PT7A 2HV8A 1Z0FA 4E09A 1RJ9B 1YQTA 3BC1A 1E9AA 1SVLA 1D5CA 3K0SA 1P2VA 2JLSA 3GEEA 4YXWA 5E7JA 5EE3A 3THWA 1CKEA 1T8UA 3IIKA 3EZ9A 1E2GA 5C46F 2YVUA 1U2RA 2VF8A 1Z22A 4UXJA 1P2SA 2N1BA 2WIAA 3QXSA 1DG3A 4L4UA 5LDDC 4AI6A 2B7BA 4MYHA 2ZTSA 2BMDA 2ZYUX 4X8HA 4D2IA 1OJLA 4AWXA 4YMTA 1IJFA 2A5JA 3H4MA 1OB2A 2PEZA 4WZ6A 4EQ6B 1NMYA 3KTAB 1IXZA 4ACAA 3MAAC 8OHMA 2QTHA 1X8LA 4C0KA 4ZIRA 4LI0A 3DOFA 1BYUA 4B32A 2RCNA 4WW0A 4JLAA 2AXPA 4US2R 2VHUA 2ZETA 3LV8A 4MH0R 2H18A 4L16A 2JIZD 1E2HA 1US8B 4IDHA 3WNDA 3SI7A 1XD2B 2DCUA 1ZJ6A 2CL6X 2Z4SA 2ZJYA 5E7IA 4FWTA 4WA7A 1AN0A 2I3BA 4AK9A 2ZI4A 3MJRA 4NU0A 2AD1A 3BIFA 5KTYA 4QHYA 2CL0X 1R7RA 1N6HA 2Q0HA 3IPXA 4IXNA 1FZQA 1Z06A 5FBLB 2E9SA 4B3BA 4BZQA 2ZVPX 1Q22A 3KUDA 2XOKA 1I4LD 1A1VA 1GUAA 4QBFA 3B85A 4A6XA 5EUMA 2G9NA 4B6FA 4TMTA 3CX8A 4HDCA 2ANBA 2GAOA 1SZPA 3ZH9B 1X6VA 2J0UA 3CNOA 4N0EA 4F93B 1MRNA 2Q9BA 2RB4A 2GEDA 4BFVA 4DLSA 2CMKA 1UF9A 4MYUA 2QTFA 4QJ5A 5DHFA 3QPUA 3VKHA 3CB4A 2B8WA 2UVQA 3H84A 4Q03A 1E9RA 5JI3E 5FFMA 1Q1QA 2HDNB 2DWOA 4I1SA 4EKDA 4Q47A 2ZRFA 5FH9A 1G8PA 2F3TA 1SXJC 2BC9A 3MWKA 4DCTA 2RGNA 4B47A 1FUKA 4K81B 4M1OA 4OK3A 3TLXA 4Z8YA 1U0LA 3IDQA 2BJWA 2JASA 4Q01A 3DMDA 2DFKB 2FA9A 3BB1A 4FMCB 1RJ9A 1JR3A 3CPEA 3B60A 4DLXA 4QNMA 3PJRA 3KQHA 3NEJA 3W9YA 3VFDA 2OEPA 3D7MA 4HLUC 4PC3A 3U60B 5SZKB 1P2UA 4QGHA 2GF0A 5E95A 1TQDA 1OT3A 4EFMA 2V7QD 1ZM3A 5B30A 4CW7A 3FE2A 2VLIA 3RS5A 3OE7D 3V4RA 1X3SA 1OXVA 2CHQA 1T91A 3DKPA 3NHAA 4LDJA 1SXJB 5DE3A 3N5CA 1CJUC 1KKMA 4FCVA 1V43A 1VG8A 2GEUA 2NGRA 1HH4A 1CRQA 3OEED 4EQ6A 3M0EA 521PA 1Q3HA 2VL7A 3A1TA 3O8DA 4LPKA 3WNCA 3I3SR 2B7CA 4FINA 3EIEA 3OHMA 1AKEA 1BMFD 2WKQA 1KY2A 3LXRA 4LSGA 2ZJ8A 5FI1B 4AIIA 5IHPA 5JMTA 3KQLA 4NCJA 4P4TA 3LWNA 4PQRA 5C18A 1KK3A 5CM9C 2GZAA 5KNDA 1FMJA 1P61B 1TQ6A 4WOPA 4OQXA 1OKKD 2KE5A 1Q1BA 2YWFA 4DB2A 1IONA 2R6FA 3PEYA 2WOOA 2XTNA 4JLOA 4NYJR 2F9MA 4UXIA 1GL7A 1US8A 1XD2A 4NYJQ 3W5JA 1DE0A 3V00A 2FFAA 1W44A 4JVNA 5BWMA 1AS2A 2H16A 3KJHA 3R9XA 1QRAA 1L7VC 4QXAA 1OSNA 3EAQA 1PLKA 4IDPA 5B2ZA 3WHLA 1NLFA 1YZKA 3WXMA 2PT5A 1T4GA 2EWWA 2NZJA 1CLUA 2R2AA 4RZ3A 5G53C 1NRJB 3FHOA 4I1VA 1FTNA 2RHMA 3TMKA 1ZD8A 3SHWA 3B5JA 2VHCA 3B6EA 2BCGY 1U8AA 2IXFA 1VECA 1DAKA 3QJYA 4Q66C 1EWQA 2FE4A 3T1TA 4Q7KA 1HURA 3VU9B 1KO7A 4URYR 2OXCA 3GJ5A 2WIBA 4PSKA 1D2MA 2BKEA 2QMHA 2QP4A 3RAPR 3QVVA 5M04A 2WSSD 3FOZA 1Z8FA 1MV5A 4LJ8A 2FWRA 3W34A 4OQFA 1G8HA 3PEWA 1N5IA 2B8TA 1GKYA 3NH9A 4GNKA 1TMKA 4Q7MB 2HXSA 1KO8A 4OJQA 4QC2A 1MABB 2E87A 4TYWA 2OILA 2WICA 1R0YA 4JMPA 1UKYA 4D80A 4M1TA 1H8HD 1VHLA 3RWOA 3PV0A 1J99A 3PUXA 3VR5A 3OEHD 1XTQA 2ZSFA 4LJ7A 3SHFA 5K8UA 4MRRA 5KSZA 1F6BA 221PA 4FXPA 1KZGB 1G20E 2D74A 3ZJYA 4UNRA 4C2TA 5F3WB 1IN6A 3RLFA 1N2CE 6Q21A 5J4YA 2MMGA 5JCZA 1DELA 1L2TA 4PHFA 4A0FA 4C3ZA 5DHAA 621PA 2WMNB 5CLLA 1W0KD 1Q1ZA 4KODA 1SXJA 4CT4B 3W6PA 3NC0C 4Q9LA 4YMSA 5F9FA 4GPTA 4PAOA 5C1BA 4QG7A 4Q9IA 3SYKA 3K70D 4IOKA 2GBLC 4B3FX 4C30A 3R9WA 4W5HA 4ZDJA 2GF9A 3U3KA 2RGEA 4PC1A 5HE9A 1K5DA 1AGPA 3UXMA 2HT1A 2OT3B 4G5OA 4JZKA 3HDTA 3AF4A 5C4MA 1CJTC 2QE7A 1C4OA 3LXXA 2ATVA 1TF5A 5JFGA 1XPOA 3HP1A 5L3RA 1CU1A 2DFNA 1A5TA 2VA8A 4NTZA 1GTVA 4PC2A 5EE1A 2A7QA 1Q0UA 4TYQA 3TSWA 1XDBA 3THXB 2EW1A 3BOSA 4HB3A 3TW4A 3VQTA 3WYGA 2JLVA 4KBGA 1G3RA 4DLWA 4QOSA 5DH9A 4E22A 2VP2A 2BM1A 1G8FA 5CJPA 4LYHA 1NLYA 3AV0B 1DS6A 3I4LA 4TN1A 1B23P 1T6NA 1T3LA 2ZRIA 1TF2A 2W2TA 5AWFC 4KV9A 2PL3A 1T0HB 3QEOA 2QM8A 1NJGA 3ZVLA 2UZ3A 2QT1A 3P4XA 1EGAA 2QAGC 3DVLA 2XEXA 2RHDA 4RD6A 1LV7A 1N6LA 2A30A 2WPDA 3HU3A 4V02A 5FBWB 2D2FA 2F1JA 3RWMB 4DLVA 1GAJA 3VNUA 1W4CA 4WVFA 1CJMA 3GLHB 4LBWA 3MRSA 3FGNA 1VCIA 1G8GA 3VU9A 4JLBA 3SJBA 1G7SA 1K6MA 1ZUHA 3LA6A 1GL9B 1QHGA 4NE2A 1ONBA 4QM7A 1T5IA 1KNQA 4MKIA 5IRCD 2DWPA 3LQRA 1J7KA 3K53A 3OAAD 2QMOA 4LY6A 3HWSA 4JJKA 4JLVA 2QMUA 4DRZA 1MABA 1S4QA 2G0TA 2QAGB 4M1KA 4BLRA 1N6RA 4ZPXA 4JIMA 4ZCMA 2C77A 2GZDA 3LW7A 1I2DA 2GXQA 3L8YA 3W8RA 4R7ZA 3A58B 3C15C 3EARA 3ASYA 5KHOC 5FPYA 4WXRA 4Q9KA 3SEAA 2XNDD 1NSFA 4ESHA 3VX4A 2ZXUA 821PA 4MGIR 4A0RA 1HUQA 2GJSA 3OFND 3T5GA 4KITB 1HT1E 1N25A 5EE9A 2H8KA 1Z6TA 1AQYA 5G40A 1YZGA 3OIYA 3CPJB 3RSOA 3N70A 1KI2A 3X1YA 2JLYA 3AUXA 1X8JA 4A2QA 3A36A 2C04A 3KXIA 1E2LA 3F8TA 4IFBA 4M1SA 2GCNA 1ZUNB 2WOJA 1DO0A 2ZRCA 4LWZA 2KI5A 2TMKA 1OXSC 4XH9B 5SZHB 3TVDA 3CRVA 4DT1B 4EJSC 1NIPA 3CWZA 1ZP6A 3C5CA 1DOAA 3BBPA 2RH5A 4DEYA 1RVDA 2FF7A 1VMAA 4KHZA 1YZLA 4ABYA 4RZXA 4Y0AA 5L3SB 1YZUA 3E1SA 5CJ2A 4NCNA 4DLTA 1JXMA 4BQSA 1NBMD 4W5WA 2OO7A 2CLCX 2CLSA 5EXTA 3WP0A 1G18A 5HKKA 5KNCA 2CHGA 2J7PA 2GBLA 4ZI3A 3WHKA 1D8TA 2XX3A 4ILEA 3CPHA 3ADCA 2FPMA 1GKUB 4EJSB 3PUYA 5JJIA 5B64A 1BYIA 2H17A 3FDIA 3PEVA 1T0JB 2SHKA 3QKSB 4B44A 1MKYA 2OLJA 4YLGA 1P9WA 4GDFA 1LFDB 3QQ5A 2ODEA 1JB1A 3GLHA 2F6RA 4RD3A 3UMFA 4XJXA 3KDSE 2QG6A 1E99A 1E32A 1CIPA 2WKRA 3C4JA 2C95A 3AVVA 1ZW6A 2GJ9A 4V0LA 3UANA 3SOPA 5K8TA 1EFUA 4QL3A 2J5XA 3A1WA 2IYLD 2FX3A 4A8JC 3Q7PA 2O0KA 2W0MA 3CRRA 1E79A 2QAGA 4DIEA 1A7JA 3B7GA 2FEOA 3IQXA 2BIFA 1E1QA 4TLAA 1L4UA 2R6CA 1TL7C 4LBVA 5JEEA 1L4YA 5LB2A 2X8AA 4Z1MA 1NF3A 1R10A 2VRWA 2YYZA 2ZEJA 2P5TB 4B76A 1XCGB 2ZI6A 3MD0A 2P65A 1COWA 1FQKA 4KSCA 1U8ZA 3AGQA 2AK2A 3QXXA 3EWAA 4TT3A 2WWHA 1W36D 3KZ1E 4O2LA 4YMUA 2QTVB 2CK3D 3LBNA 5JRJA 1IXSB 1MO5A 1XBTA 4BFWA 2YOHA 4Q1CA 3MWYW 2QT0A 4AYXA 1Y3AA 3GQBA 4A8JB 1E3MA 2C96A 2AWNA 3B9QA 3ZZUA 2CVFA 2ORVA 1HTWA 4DT1A 5FPKA 4KJZA 1Z63A 3U4QB 3M4YA 4II7A 4NH0A 2GXAA 3D8BA 5AJWA 5LPNA 4OK5A 2HJVA 4IEEA 4NCIA 4MGKR 4F4IA 5FL3A 2IL1A 5SZIA 4A4DA 1UBFA 3I61A 1E96A 2ZANA 1CR2A 4XWOA 3AQ4A 3QPVA 3HPRA 5L3SA 3U5ZB 2ZYWX 2HEIA 1TUIA 1ZVQA 4LJYA 4AYWA 3A4MA 1GITA 3IIMA 4QGFA 2CE7A 2MSDB 2P5SA 2ZAOA 4H9GA 4KYUA 4MQBA 3HYRA 4OHYA 2WJIA 1X1SA 4G3XA 4A2PA 1RPZA 1S96A 3T1VA 1W48A 3GJ7A 3QF7A 5B57C 5EE5B 4DDUA 2ZITA 1W1WA 3ADKA 1NL3A 2FSGA 4EJSA 1FUUA 2WBLC 1NBME 1QVAA 5JWOA 3LRPA 1KAOA 5TY0A 4LJ6A 3QKSA 5EP3A 2YC2C 3IHLA 4HZUB 2AXNA 3A37A 2QPOA 4BFYA 4URZR 3QVUA 3AH8A 3KQUA 3U7FB 1DAGA 3B1VA 1NN3A 1AQUA 1FP6A 3AF1A 4I99A 3HU2A 1DAMA 1ZNYA 4EPTA 4DB4A 1ESMA 4EPWA 2IXEA 3EWSA 1HQCA 2ZREA 2QROA 3ADDA 1MH1A 1Z0AA 2AX4A 1O87A 3Q3JB 1GL6A 2ATXA 2XITA 4RD4A 4XSHA 5FBVB 3BAFA 3IEUA 5H68A 1WP9A 2V4ZA 2F1IA 3E70C 3OESA 5KDDA 3Q85A 1ZU4A 1OPXA 3C7KA 1E0AA 5IK2A 4IOLA 2J9RA 1N6PA 3MFYA 3UG6A 1JEDA 1WA5A 2QPAA 3VR1A 1IY0A 3U7HB 4CEJB 1GVNB 1DO2A 3K9HA 2YJTD 3TNFA 4GMXA 2QP9X 3K9LA 1R5NA 2QGNA 3EW9A 1KO4A 2DFTA 1WF3A 4FMDB 3LFUA 4TTRA 1NN5A 1UBEA 2B21A 2Z0MA 3GJXC 4JLKA 3KKQA 4D4MA 2PBRA 4DWJA 1N0VC 4TWZA 2QEQA 1D2EA 4YMWA 1AK2A 1VDZA 2GK7A 2ZRBA 2IYQA 3BFVA 2CCGA 4ASUA 1QHYA 2ZS9A 4M2LA 3BJIC 3MSXA 3L0SA 1U98A 1WQ1R 4JL8A 3Q72A 2CXXA 4IKEA 4AKHA 5UKDA 5DNYB 2QQ0A 5D3MB 3U4QA 5CB8A 3AP2A 3L0OA 2W2XA 3LW8A 2JAQA 4FCWA 3T06B 1I4TD 3ZVRA 2V9PA 3CZPA 3WBJA 1FL9A 3CONA 2FSIA 1P9NA 4G5QA 2CEAA 3CH5A 3LAWA 4KO8A 5DISB 3BK7A 4RCYA 2GCOB 3RC3A 1GFIA 4IEIA 3PFIA 1OH7A 1CEEA 2C03A 3BRWD 1JXOA 1RRFA 1ZNWA 1XP8A 4HAUA 1ZNXA 4C0HA 1XMIA 4TYNA 1E2KA 4U02A 4JT4A 1MOZA 1JEEA 1AIPA 2LWIA 1SVMA 4ON9A 2V3CC 3B1YA 3EA5A 1G7CA 1U99A 5CYOA 1Q1EA 3L2OB 1UPTA 4CT5A 1T5LA 3QUSA 2ZRAA 3RRMA 4LJ9A 1AS0A 4EPYA 5FPSA 1YU9A 4M21A 3DO6A 3KJGA 1TEXA 2WSMA 4HZUA 4BGDA 4TZ0A 2HF9A 3KJIA 3CNLA 1G3IA 1YR7A 1Z2AA 5FOWA 3V9PA 4DCSA 1BS1A 2FPLA 2JGNA 4NCHA 2XOKD 1Z5ZA 4XOIA 1W5TA 2UZIR 3W90A 4LV6A 4Q00A 1NMXA 1ZM9A 2G1KA 2IYTA 3BD9A 4XD7D 3VMFA 5FOUA 2VIIA 4TMWA 1QG4A 4TL8A 4FI3C 2NPFA 3TR5A 3UATA 3KKOA 1G6HA 4U5XA 3ZD6A 3G0HA 2WWWA 3REGA 3ICEA 4GP6A 1NI3A 1J70A 4M9XA 3W6NA 3DMNA 3GMTA 2ZRHA 2QGZA 4YDSA 1EG7A 1N3BA 2V1XA 4RD0A 3IILA 4E07A 5JWRA 1J90A 4V0MA 2CNWA 1G41A 4NP6A 4A6PA 3FKSD 4BRUA 4DSTA 3IEVA 1ZMXA 1N5LA 2QBYB 3SQWA 4Q4AB 3Q5EA 3QG1A 1WCV1 4CEJA 1Z08A 2C9CA 2EQBA 1A82A 1K5GA 4JYBA 3RRNA 5J5CA 3JZAA 1YZQA 1P73A 1S3SA 1E9CA 4D0LB 4EFLA 2GTPA 1KSFX 2GESA 3K0FB 4IOMA 4US1R 4JLNA 5BW8A 1OV4A 1NG9A 2Q3MA 4RD2A 4LPSA 4D4KA 3U3MA 3KB1A 2R6AA 2REBA 2YWEA 1OXTA 1ZIOA 3O47A 1R5BA 1XCMA 2ZRMA 5FTNA 5CK5A 5FTKA 5D3QA 3VX3A 3ETLA 4PXAA 2WV9A 4FW9A 4MITA 1EFRA 4AURA 2ZJ5A 3GP8A 3CZQA 1VPLA 5D3MA 2O8CA 2RGGA 2WWXA 3U2QA 3RABA 4DUGD 4K8OA 4S2EA 5DGXA 4F4CA 1Q20A 3FTQA 4PR0A 2IS1A 1ZD1A 3SC3A 4V0KA 3EPKA 3SJAA 2PX0A 1XMVA 2GCOA 4LCBA 5F98A 4D4JA 5DO9A 1JPJA 3CIOA 5JZVA 3ZLJA 3TUIC 2VSXA 2A3RA 4US0R 1VG9B 2JA1A 3TH5A 3X1DA 4QNRA 1AM4D 1ETUA 3IIJA 3PEUA 2YV5A 2DR3A 1EFTA 4HZIA 1KI6B 4JKYA 2RMKA 3PG5A 2NO9A 5JJLA 2YOFA 3CH4B 3ZYCA 3WRXC 2ZSEA 3C5HA 4IOJA 2O8FB 4MGYR 4U7DA 1JI0A 1RRCA 1UJ2A 4FMCF 3RANA 3UMRA 1KI3A 1OE0A 2ERYA 5LD2C 3X1ZA 3PITA 2OCPA 5KSYA 2FMXA 4AC9A 3LH5A 1NY5A 3RRZA 2JIZA 1VYTA 2VH5R 4NONA 3GJ4A 1TADA 4RFSB 4JVMA 2H1LA 2IHYA 4FIDA 2UKDA 3BH6A 1SVOA 2VO1A 1LNZA 1G4UR 4M0LA 2P6UA 1J2JA 2VP6A 3QBVA 4TLEA 4ZCLA 4PZZA 3KTAA 2YZ2A 4BEJA 1I4DD 2IXGA 4PC6A 1KMQA 1OFTA 4IVQA 1KHTA 3N2IA 4BFXA 2J0QA 2ECKA 2OFXA 1KDRA 2JCSA 4M1MA 3MWLA 4D0NA 1FW6A 2ZRKA 2WWYA 4MKGA 3VKWA 3CR8A 2QBYA 4PHGA 3AVTA 2ODWA 4E5UA 5BYKA 2W6ID 2FEMA 2HLDD 3L0IB 1EK0A 2RGAA 5LD2B 3P26A 1XJ0A 2WMOB 2O8DB 1K8RA 3AKCA 3Q9LA 3GJ6A 3K0FA 5EP1A 5A4JA 2HJGA 5FL7D 1VIAA 4I1OA 3AVUA 1YZTA 4PO8A 4GMDA 2QQEA 1IN7A 3GFTA 1E2PA 3ZIAD 2ZSAA 3ECCA 1DADA 2JLUA 2IYVA 3H1TA 4QJ3A 3B82A 2V8OA 4TQ9A 5CM8B 3K70C 1XXHE 1KK1A 2PCJA 2JJ1D 2BCJQ 4B48A 1KI8A 1LTQA 2XTMA 4EPVA 3WYFA 1KSJA 1QF9A 2HCBA 2XNSA 3PVSA 4GL2A 2NZ8A 4B73A 2YINC 2F55A 4ZI2A 2XB2A 3L8ZA 1CULC 5CLQA 1P60A 2JATA 3AF0A 4FD2A 2EFDB 2Q9CA 2V7QA 3BE4A 3NBZC 3SYNA 3OE7A 1DG1G 4IRUB 4G1UC 3BH7A 1PUIA 1XF9A 2F9LA 2IS2A 1NG1A 1NN0A 1KI6A 1CR4A 5DI9A 5FUVA 3K70B 2OXRA 3GLFE 3CRW1 2W58A 4OI4A 3OEEA 1P3JA 1KKLA 2CE2X 2OFWA 2VP0A 2CCKA 3TJZA 2ZE6A 4UKDA 2JLRA 4DLYA 3RYTC 1GRNA 5TARA 1SGWA 1BMFA 5TV2A 2O8FA 4GT1A 2XSZD 3J81k 4LRWA 2ZU6A 3TSZA 3H86A 3R20A 4BLSA 4E03A 3QKTA 1Z0IA 3AVPA 1DAEA 1E2QA 1N6IA 2WM9B 1XTKA 5TXGA 4DLUA 2IS4A 4KLNA 5CB6A 1WRBA 1VHTA 3FMOB 4XWKA 3T1QA 4RFSA 5JHGB 2Q6TA 5L3QB 2OLKA 1QHXA 4MDFA 2AR7A 4UJ5A 2ZI7A 3SE0A 2O8EB 1DAFA 2H7VA 2QA5A 4HAZA 4TMVA 2CHVA 2RGCA 1M6NA 2WJYA 4Q48A 3DL0A 5GVRA 3VR2A 3IQWA 1Y63A 4GOJA 1CR1A 3CR7A 3LY5A 5JS8A 3BH0A 4HLUA 3MWJA 5KPJA 2JLZA 2BVNA 4F7WA 3K09C 1TQ2A 1OB5A 2OUKA 1G19A 4XVRA 3JVUA 3F5FA 4JS0A 2BEKA 2O8DA 1NNEA 1JQJC 4QKQA 4RD1A 1ZM4A 3AVOA 4JL5A 2PMKA 2C78A 4NCKA 3UG7A 3VKGA 3FWYA 5DN6D 1Z83A 2J59A 2JLWA 4LHVA 2WSSA 3NKVA 3I1FA 4M9ZA 1ELOA 2W00A 5TMPA 4KU4A 1WMSA 1KDOA 1ZIPA 4IXMA 2OBNA 1OYYA 2BMEA 1KY3A 4QBHA 3RSLA 4LYAA 2AWOA 2DFLA 2CBZA 2EU8A 4I1UA 2XZLA 4GOXA 1W0JD 1H8HA 2IHBA 4LHXA 4TMZA 3OEHA 4GRAA 3RS0A 2QL6A 2A5YB 1S8FA 3T15A 1DAHA 2GJAA 4OK6A 1II8B 4RSGA 1X86B 2F1HA 2LKDA 1H8ED 3FMFA 1N6KA 4PHTA 4JVSB 3OZXA 2V6IA 2IUSA 4XVQA 4W9MC 5GJBA 1MO4A 4BZXA 1KNXA 2CDNA 4PPQA 3KJEA 2VSOA 4C0JA 3B2EA 3QF4B 1SXJE 3Q7QA 1W0KA 4G0NA 5EUQB 4GSYA 3GLGB 1XTRA 1W2GA 4KAXA 2XGJA 2FJUA 2ZE7A 2BMFA 1J8MF 1TQ4A 3CNNA 3HR7A 5GADl 5CDFA 3CBQA 5GJCA 2X2EA 3WYAA 4DLRA 2J1LA 3EZ2A 4WXPA 2IWHA 4V0OA 3TQFA 4LC1A 2MMCA 3N2EA 4HAVA 4PZLA 1J8YF 2GILA 1XX6A 4HLDA 4IDOA 2ZRPA 4C0SA 2O8BB 2Z4RA 2QU8A 2GJ8A 1XZQA 3P32A 3UPUA 1W2HA 3FHTA 4BUJA 4IDQA 1W5SA 1R0WA 1C1YA 3CW2A 2J7PD 4JSYA 4LGMA 3AVYA 1IBRA 4WIAA 3L43A 4EIWA 2FDCA 3CO5A 4LYJA 2ORIA 1FTSA 5EQTA 1T3SA 4AKGA 5HE8A 1WBBA 4TTQA 421PA 1S3GA 1S9DA 2NTYC 1TEVA 4FMBB 5L3QA 4H1UA 1II9A 3IKJA 3ZGXA 4DCVA 1GNRA 2FFHA 2O5VA 3DZDA 2BBOA 3BWDD 4UNQA 1TU4A 3AKEA 2VHQA 2ZUCA 3AVQA 3FB4A 5G3YA 1TU3A 2H57A 3BB4A 1G5TA 1OH5A 4JLDA 1Q57A 1E2NA 4C4PA 5DYIA 1PUJA 2G1JA 2NPIA 1WDTA 3CF6R 3K0AB 1Z07A 4N3NA 1NIJA 5FR2A 3TE6A 3VR6A 1UEJA 5JLJA 2ZJZA 2P3SA 5K8IA 4KLZA 3U61B 1A2BA 4B6EA 5FI0B 1U94A 2OAQ1 1XPRA 2R6GA 3QENA 1SKYE 3BB3A 3THXA 3SU8A 3B1XA 4RCZA 2A5DA 2QENA 2ZI3A 4BFUA 3FMIA 3GJ0A 3VTKA 4MRVA 5J4LA 5LB4A 3GLIE 4M8NE 2XTZA 1UDXA 4RFVA 3X2SA 2ORWA 2PZGA 3KQKA 3ZZ0A 4A1FA 1Z0JA 3ZS8A 4Q19A 4Z1MD 2C99A 1AZTA 4BRWA 1W36C 1NP6A 3OAAA 3K0CC 3UMSA 1HA3A 3TUZC 4R2HA 1XPUA 4IFEA 4HAWA 3FYHA 3T61A 5JEDA 1G3QA 3ZS9A 2J0VA 2Z43A 1G64A 4URWR 1NVXQ 1XU4A 1T8TA 1ZAKA 4TLDA 1OH8A 1T3HA 2GZHA 2AHOA 3A1UA 4A82A 3ZZTA 2F43B 1X1RA 3K09A 3PIRA 1KJWA 2B92A 4BECA 1II8A 2D4HA 2QRZA 2ZQ5A 3TSOA 5BN3A 4PO1A 2HCJB 3CWQA 1NVWQ 4TLBA 2BDTA 2IYXA 2XNDA 3BFKA 3OFNA 1XJCA 1OHHD 2NOAA 1HYQA 3NC1C 3QXJA 4NPHA 4P32A 3RVBA 3QF4A 1W36B 2BEJA 3DDCA 3GLGA 1E1RD 1QHHB 2WKPA 3QY0A 4JYCA 4UNNA 2BM0A 4QBIA 2WWGA 2XB4A 3P4YA 1EWRA 5JS7A 1G9XA 2REOA 2AL7A 5HTKA 4DCUA 2RGDA 1RRPA 2IX3A 4Q7JB 2VP9A 2O8BA 3QNUA 3M1IA 4PSAA 4DIDA 4KFTA 2NIPA 4D81A 2X2FA 4ZKEA 2MSCB 3F0TA 1QHSA 5KOYA 3AEZA 1CBUA 4CF7A 5JCPA 2IA5A 1LY1A 1B0UA 4NHOA 3SJZA 1OYWA 4PZYA 3C8UA 3NXSA 3LQQA 4HDOB 4L15A 2G3YA 5FBRB 1BO6A 1Z6YA 2IEZA 2GXSA 2C9YA 2ZYTX 5HZHA 5KYKA 3C41J 4ESVA 3AVXA 1NBMA 1RRGA 2H92A 5FPTA 5KO2A 2EFEB 5FOTA 1IJEA 2VSFA 3MJHA 1IN5A 3U3JA 4GOKA 1XTJA 5A0FA 4EDHA 2RGXA 1PLLA 1AGRA 3SBEA 4HB4A 1QHIA 4PAMA 4V0NA 2Z6VA 1S9HA 3IGFA 3K0AA 4IVPA 2OCBA 4PPGA 5ANRB 2VP4A 4FWIB 4RZ2A 4MGZR 4HATA 4PHHA 3JVVA 2J46A 3RRYA 5DI3B 3SR0A 4PFSA 4D6PA 4DLZA 5SZJA 3A1VA 3E5HA 4P4SB 4EFNA 1D9XA 1AJEA 4D0GA 1U90A 3U3OA 1TPZA 2QNRA 3I32A 4YMVA 2YC4C 3NDPA 1E69A 3W5IA 4UNSA 4X8OA 3FHCB 2HT6A 1ZM7A 1SVSA 2AD5A 3KFVA 2XAUA 1SVIA 5JWHA 3TK1A 4Y0VA 4QGGA 5IK2D 2ZRGA 4D26A 5JJKA 3OIVA 4F91B 2GHIA 4AD8A 1E2MA 2A78A 2W6JD 1E9SA 2VP5A 1E98A 2JDID 1Q3TA 2JJ2D 4HAYA 4OKSA 5FUWA 5F9HA 4QRHA 1JALA 1VCMA 1P4SA 3D3QA 3IHWA 5CYPA 4HEJA 4TQAA 1ZC3A 1KZ7B 5EP4A 4GP7A 1E94E 3D31A 3IUYA 1XZPA 1OXUA 1Z29A 2GXUA 1W4AA 4WZAE 4CDGA 1SULA 2ZVQX 1AZSC 3L82B 1PVOA 1N0UA 2ZSDA 2FH5B 5DLQC 4DJTA 3AVWA 5EZ5A 2RGBA 3PXGA 1FMLA 2P6RA 4LOAA 3PR1A 1RYFA 5J4HA 4M4SA 3AF3A 4PC7A 4Q1DA 2VTKA 1VCOA 2RAPA 3RHFA 1LB1B 3T34A 3K0CA 1QHHA 2O52A 1GM5A 1YJ5A 1OIVA 4NZYA 1OFHA 2FFQA 4RKEA 2WHXA 3VAAA 5JI2E 2YWGA 1PZNA 1RFLA 4CZ2A 1XWIA 3EX7C 2PMDA 3V4FA 3HYTA 3DM5A 121PA 3HR8A 2KBEA 3NH6A 4QHSA 3DOEA 4QM6A 5BYJA 2N42A 4PQFA 3TAHA 1KGDA 4URUR 3HJNA 2PH1A 3QKUA 4PAQA 2ZR7A 2V1UA 3D6TB 1EX7A 2WAYA 4F4JA 2ZRNA 4U00A 4Q4JB 2J3EA 3NEYA 4B3DA 1CTQA 2GRJA 5TVKA 2D62A 4FMDF 1XMSA 3MGCA 1CXZA 4A8JA 4O0MA 3DEFA 2JLQA 5AJZA 1GZSA 3LX8A 2KJQA 5FOSA 2AK3A 4YXWD 1KSHA 1DAIA 3OIWA 4Q5IA 4YONB 4CVNA 2DPXA 4IW3B 2VF7A 4DDVA 1ZYUA 4QBGB 2FZ4A 1XB2A 2ZJAA 4Q1EA 4OL0A 4PX9A 4MKHA 3UWKA 1W4RA 5DI3A 3BGWA 2ZJOA 3G82C 3I5XA 4P4SA 1YZNA 4LHYA 4LJAA 4A0GA 4B35A 3AP3A 4Q1AA 2W83A 3CF2A 2PZFA 1Z3IX 1ZU5A 3KX2A 3EIQA 4GZLA 5J40A 2G77B 1P5ZB 2NO0A 2HYIC 1M34E 3EPJA 3TW8B 3RS7A 1U81A 4M9QA 1SVKA 2CNWD 1KDTA 5EE0A 3WP1B 2PLRA 3ASZA 4TL6A 4HB0A 3FFBA 5IDVA 4B33A 1E9DA 1G5PA 1KK2A 1Z6GA 3GEIA 4R9UC 1UFQA 4B2LA 4OI0A 1U8YA 2C9OA 2EFGA 4HAXA 1R2QA 3VR3A 5G41A 1E2FA 3EPHA 2BV3A 2ZR9A 1HY3A 5L3VA 3RDPA 5JSZB 4XTCS 1KSGA 2X1VA 5HPYB 1TAGA 1M7BA 2BJVA 2NQ2C 2OESA 2ZSBA 3RS3A 1BKDR 3EXAA 1E6CA 4CYMA 2ZJ2A 2ZU0C 2FG5A 1DARA 3GJ8A 5IF9A 1NKTA 2CVHA 1VYUA 2BOVA 4C0AC 3NG1A 4NKRA 3TBKA 4TSFA 3RS4A 3F3YA 4M1YA 1XFAA 1ZINA 1XXHB 2XXAB 3U6BA 4IDNA 2QP3A 2BWJA 4PPNA 3H2YA 2FFBA 1JJVA 3O8RA 1F2TB 3TVTA 1QG2A 1DPFA 2CJWB 1O3YA 2ZRLA 2OE2A 3DPUA 3CF0A 1GG2A 2WAXA 2HYDA 1T9HA 2ZPTX 4MUAA 4RJLA 5GJVC 4NYIR 2PEYA 1M7GA 2FNAA 2IWRA 4DDTA 5C2JB 3ZD7A 3TRFA 1P6XA 2GAAA 1MRSA 1HEIA 3EPLA 3LO5A 4NYIQ 3LVQE 3BERA 4K46A 2VYFA 3A1SA 2NO7A 4Q4JA 3GLFB 2F7SA 2OFOA 4OHVA 1KO1A 4Z51A 4RVCA 4TLCA 1N6OA 3EC1A 4MDEA 1JR3D 2I4IA 3BFXA 3UKDA 5AJYA 3ZDQA 2PCLA 3TAUA 2OZEA 2WJGA 1XEWX 2AKYA 4LZZA 2D7CA 4LYFA 1H65A 2ZR0A 3QOFA 3S1AB 4BLOA 3MLEA 2XJ9A 2CCJA 4TMKA 2C98A 5P21A 4KI0A 2C2HA 4R71A 4M9SA 1Z2CA 1ZCBA 4DSUA 2ONJA 1S2MA 3LLUA 4UXHA 1E0JA 1OFUX 2R44A 2DBYA 2IK8A 4C0BA 2NO1A 4JSTA 2WJJA 4HDQB 4EPXA 2WTUA 4PSVA 1EX6A 2D06A 2ERXA 5HZKA 4ZDKA 3M6AA 5E7MA 3VR4A 3I8SA 4IJMA 2X77A 1GNQA 1M8PA 2W0SA 4BZPA 4Q21A 1D9ZA 4TYYA 4L9SA 3P27A 1IQPA 1I2MA 4XD7A 2DWQA 1OW3B 2EYUA 2YHSA 2YWHA 2REXB 4XTRA 5KSPA 3SNHA 4L8GA 3SFVA 3QXHA 4POAA
chains in the Genus database with same CATH superfamily
2VT2A 5A2GA 3B13B 5EXPA 3EIHA 1SU7A 3PCRB 1VHWA 3VH2A 1M66A 1MFZA 5I7OA 4BO1A 4DBLE 1BRTA 2X7XA 4X54A 5EGSA 5A3SA 3ZXSA 3B8HA 4JIGA 3P9XA 4IH1A 2KWIA 3RRFA 1K0UA 2CKMA 1GEGA 2BFEB 3HL4A 3UWOA 2PR7A 4U4AA 4EHLA 3ESDA 5ITZB 4R1QA 5JBQA 5LN1A 9MHTA 2P0AA 3KKMA 4BZWA 1FMFA 3FKSA 4IZ6A 3E2IA 3CRMA 2QM7A 4C4YA 2LXNA 1IVYA 3G5AA 1QG0A 4Y6LA 5K8LA 4TV9A 3FVTA 4UQLA 1GU0A 3ND7A 3GB9A 3BMNB 3QI2A 4IIYA 4MYCA 3K8OE 5IMBA 7MHTA 1Z7GA 4DY6A 1LQUA 4HK4A 4KFCA 1IHXA 2WHPA 1ST3A 4CUJA 4LE0A 1YOVB 4WVLA 1IZ9A 1V7PC 3SDZA 4DVGA 3U7GA 1C1DA 1XZAA 3DKVA 4DBVO 1IY2A 4EECA 3PJDA 3LUDA 1RHUA 3HKCB 4D9NA 4LYDA 4OH1A 1DV2A 1L5VA 2D1YA 1F2TA 1L7MA 4X0EA 5LNK1 2ROQA 4JH0A 3OIDA 4R98A 4ZPJA 3IHTA 1HZJA 4ZVLA 1XAHA 4WCFC 4KIFA 3F98A 2OL4A 1P74A 2IITA 2UYOA 3ND8A 3RC8A 4AY2A 3RS2A 4YDHB 2G83A 4G0MA 1U2ZA 3HFSA 3NAZA 2QK4A 4M9RA 4Q4AA 4AG6A 3K9FC 2GAIA 1PFUA 5FNVB 3SC6A 3QPAA 1N5KA 3O84A 2XF2A 4DUGA 5LSAA 1NU8A 3GYGA 4QYTA 1T26A 4W5JA 4IINA 3H5TA 2GRUA 1R27A 3HJGA 4F4UA 3Q2KA 2XE8A 5IJ9A 4JX9A 2VXBA 3E7PA 1ZESA 3EA4A 4II3A 4U2GA 4XPIB 3ROFA 3W3AA 3ZBUA 2A9RA 4Q4HB 3DEJA 3VU3A 3TQCA 9LDTA 2J33A 2PUJA 4IUBS 4HLCA 4QPCA 4A9AA 4QLBA 1L5YA 1R0XA 3VOSA 5BR7A 2QPTA 4JBNA 4XM0A 3OTGA 5KTPA 2WJHA 5CA0F 2C7PA 1RBZA 3DEIA 5ERXA 3ASUA 4O6VA 3TXAA 1UKZA 2I34A 1QAMA 4S1OA 5FTJA 2FR0A 4NZNA 4B7ZA 4NDAA 4U63A 4ATNA 4HOYA 1DBVO 3HXPA 4Q3OA 3N8NA 1WW3A 5DBOA 3VVLA 1ZY2A 3WJ2A 3IBFA 5ITVA 5CFLA 5LP6B 4D25A 2JJYA 4LDAA 3TIGA 3LCJA 2ZATA 4OA5A 3OM0A 3TD2A 4BX2A 4QYXA 3OEWA 1IUPA 1NAHA 1A5BB 5ES3A 3UYKA 1RQLA 1M2VA 5CDUA 1T0UA 3IUBA 5DMXA 4J2HA 2MSEB 1Y3FE 1OIXA 1T5DX 2UZAA 4RJJA 3HCNA 1B26A 4GLOA 2PSDA 5K3AA 3TN7A 3NV7A 1Z0KA 4OHRA 3QPDA 1Z8DA 5KOJB 4BWVA 1DBWA 5TMDA 4WCDA 1W75A 3BWBA 3OIGA 2VK4A 2O48X 2IBMA 4CM4B 3Q1LA 3B6JA 4V03A 4EB6B 3ZCTA 4GR5A 4MVXA 2A2ZA 3PENA 3CVUA 4FQ8A 1GRVA 3M81A 5LA6F 4C87A 1RPNA 1HDOA 1W4LA 1SKYB 2EBHX 5FEUA 3NV9A 3NWJA 3I9LA 3WJ1A 2JAHA 4TL9A 4KDFA 1T9GS 2GUWA 3LQKA 4G5YA 3RTCA 1KTVA 1CJVC 1SEVA 3K9NA 3G2LA 1YR9A 3ETCA 1IN8A 2OHXA 4E70A 2DPMA 2HXYA 4S05A 4HEA1 2R65A 2VJAA 3P97A 4RF3A 4WXHA 3E35A 4LF4B 3DEKA 4BBAA 5JAOA 2HLDA 4XCQA 4Z0TA 1L9XA 2P0YA 2QRMA 3JQBA 4OHKA 2QSZA 3E8SA 1RNLA 2I67A 2MJLA 3HA2A 4IMRA 5EIHA 5TGDA 4TQUS 4JBXA 5JSKA 1WMFA 4ZQBA 2ZT7A 3RNLA 3U7JA 4UE2A 4CDNA 4UU1A 1KJZA 5DCUA 2IPOA 4PPFA 2ORED 1F48A 2ID7A 4L8WB 1V16A 3ZE8A 2GNAA 3N7AA 3H75A 4HWRA 1JDZA 4X3CA 2O8EB 3ZIAA 2ZROA 4YV0A 4C7VA 3TGPA 1CZUA 4DCNA 5AJTA 1RADA 2JANA 3AR9A 3COVA 3FVQA 5EJ6A 1UINA 4CEIB 2GK6A 4LXQA 4O4LA 5EINA 4D6XA 1U04A 1CV2A 1SKAA 1PNQA 1UKVY 1VE1A 1T4DA 3DNPA 2QSUA 1ONOA 1QGED 3GGJA 3IPCA 4MICA 5AKJA 4F06A 2O5CA 5ESRA 3PE6A 1G7TA 2HU2A 2QRJA 4IRMA 3THYB 4DC9A 1M1YE 4DWWA 3LX4A 3RIYA 1FS6A 3FUWA 1N6NA 3U3XA 5B1EA 1NTOA 3VR4H 5KJ1A 1QUEA 2O0HA 1A76A 4ARIA 3LGAA 5DHPA 3D43A 1EM8A 1XEWY 2VC2B 4G9BA 4U2CA 2VAVA 3WLMA 1MUUA 1FU8A 1VG1A 5FPHA 3QVJA 3COWA 3OLYA 4ZXPA 2Z95A 4UULA 2F8TA 1G60A 3K1YA 3LE8A 2W4MA 5FBKA 1GNPA 1P91A 1L5MA 3KQYA 4LTDA 1DQNA 1P5FA 3LT5A 4FYPA 2ZM5A 2QR5A 4HS4A 1I3OA 3EXIA 2I7VA 1YT5A 1Z47A 5HF5A 1ZUIA 4QEKA 4DM7A 3FUXA 1JLRA 4OBEA 1E18A 2JD1A 4AG3A 2YZMA 3I58A 3V34A 2EQAA 4Z3DA 1T2EA 2BKLA 4JLPA 5KJFA 3UCXA 5SY9A 2OZVA 4EMBA 2C83A 1TTTA 3V8RA 2C8VA 2FN3A 4HEA6 3C16C 3I45A 4MQEB 3K6JA 2AEMA 4KDEA 4XSGA 1D2NA 1ESNA 1H3FA 5JCOC 5A5GA 4HH0A 3ZWDA 4AJ2A 1X1BA 1W49A 3ZGVA 3FSJX 1E9VA 4I14A 4D9BA 3L07A 4QPDA 1HQKA 1U1DA 2V54A 2HMUA 2YN0A 3MS4A 3NOQA 2B3TA 2YJGA 1FJHA 1KOLA 2O14A 4KBFA 1U0HC 3BORA 3DLCA 4AN4A 5A4DA 1YTUA 3SDSA 3EG9A 4LWOA 1N3IA 5BN5A 2RGUA 4RPJA 3ZY2A 1EFLA 1ZEMA 3KHTA 3QKRA 1NQXA 3PLAE 1OUMA 3GDOA 4I08A 4XWGA 4EX6A 1PZXA 3T12A 1WXWA 1N9GA 5B12A 3BCUA 3RYIB 1GTSA 2QMYA 1I30A 2YXEA 1VIYA 1MX1A 3AYZB 1CUAA 3OF3A 1O6ZA 5BUSA 1CD5A 5TQ0A 4PO9A 2IY7A 4B2IA 5I7EA 4IZIA 2JFXA 2R48A 3TIIA 5AH0A 2V5UA 3AJRA 4BC0A 4C2BA 2R6DA 5JCXA 2E0IA 2RHCA 3F73A 5CHEA 1FX0A 2ZI9A 3BMXA 3OF5A 4JUBA 3GZ4A 3LHSA 1W4BA 3V8BA 3VPSA 1QYXA 3LRXA 2C4HA 2BFFA 3IBYA 3R7WB 2XKJE 1DRWA 1S2GA 3AEUA 3UWMA 4F2WA 3A3NA 1YR8A 2OKGA 1QO9A 2HMVA 2WRZA 1MX5A 3CZ4A 4G0ZA 3EJ6A 5KQGA 2O6LA 1KQOA 1HMPA 3ZDXB 1YMQA 2HPHA 1UJBA 1LF5A 3JASA 4MKFA 4O59O 1Q0SA 3AEQB 3HKBB 4IS2A 4U7GA 1L5GB 2QNBA 2FWJA 3I8OA 4CLEA 3P9NA 1S01A 2WT9A 4UVHA 3WXBA 3KAJA 5D5QA 1DRKA 4B45A 2PUFA 1W0JA 1YJAA 2NSHA 3TI7A 3DUFB 5A7FA 5K03A 5CH3A 3BTUA 4X7PA 1WZUA 3JQ9C 1CY8A 1U5BB 1SCIA 3QMPA 1YJCA 1G5IA 4RSMA 4N18A 1AA9A 1NC3A 1WY7A 4B0PA 1H8EA 2H7XA 5A04A 3NIBA 4GU5A 5FUXA 1C9DB 1JX6A 1CS4C 3RK0A 2AN9A 3QU5A 3EIFA 4DREA 5KTKA 4I4TF 2FX2A 2GDJA 1ZLXA 1R6BX 2C3OA 4UW9A 3IXLA 4QUKA 3UW3A 1SKQA 2GD6A 4MUJA 1B73A 5A5FA 1V9SA 4ALKA 2X0RA 1ODLA 1O95A 1ZZGA 4RQTA 5DDIP 2FGJA 2GPTA 4IY1A 1EM6A 3RJ5A 5B7QA 5BMOA 4QGAA 4JT8A 1Y1KE 5ALTA 5DK6A 3O93A 5J1TB 4P93A 4RTSA 3D4NA 5T64A 1FFYA 3GRPA 3K9QO 1R8QA 5C8ZA 2A4MA 2TYSB 3K20A 3C5VA 5TJ9A 4Q4LA 1KBZA 3DA8A 2RK6A 1LPBB 4KQ9A 4UASA 2J3HA 3Q0TA 3D2CA 3KKNA 1RWPA 3O4JA 3S2EA 3Q7EA 3HL0A 2ZP1A 1SH7A 1XTSA 5JAHA 4AKTA 5JXJA 2X4DA 1ZD9A 1ZMRA 1QOQB 1GAEO 4IMPA 4P0TA 1MHTA 1DQYA 4ZRDA 4Z53A 3OVMA 1JBKA 2GFHA 3EOBI 3WLAA 1JJ7A 1Z0SA 4GZ6A 4WT7A 4FX2A 4H1VA 4R5HA 1A2OA 3WRYC 3EGVA 3CUVA 1KETA 2UVPB 2Y8EA 2OYCA 2QJTA 3HA5A 3BGIA 4N1AA 4KXUA 2EXXA 3A6EA 5H8WA 2UUBB 4GPBA 2FPPB 1AUVA 3H5AA 5J2TA 5L4SA 5CIYA 4ZK2A 5B58C 1YFKA 2J87A 3LVRE 1FYDA 5JAQA 4X7MA 1HWYA 1B00A 4NCBA 2O1WA 3T7AA 5BRNA 1YR6A 2HCRA 3OOWA 3NTVA 4OP2A 3OE1A 3VC1A 4D4IA 4Z6KA 5HX7A 2FSFA 1OZHA 1FFHA 4LF7B 3FLBA 4ND1A 4PFQA 3C3BA 3R5XA 4DCGA 7REQA 2ZJBA 4UTOA 3I23A 4MP3A 4AS1A 5JH7F 3T9EA 1TVKB 1S0UA 1K3TA 2CXHA 2J5BA 3I73A 1YKGA 1U7OA 2XMCA 2FPUA 3FNIA 4OLHA 4WZAA 1WULS 1XO1A 3WGHA 4RTLA 4AZ0B 3CLSD 3KOUA 5KC8A 4IVNA 1D4FA 2G1UA 1JDBB 1GGEA 1XWFA 3C70A 4JI3B 1FRNA 4RV4A 1SA0B 2PKCA 1I6MA 4PZUA 4TM7A 3TZCA 3K35A 5BWBA 2VQFB 1FCJA 2IT1A 4PGMA 4NYMQ 4WNAB 2OHGA 2ZGVA 4P4UA 3QE2A 5ELMA 1G4AE 3W04A 2X2OA 5IBCA 1AB5A 1TIPA 3HCBA 4QEZA 1SXIA 3C97A 5BN1A 2FPGA 2FN8A 3ABSB 1E7WA 3PHJA 2AHRA 3UH0A 2YRWA 3W8DA 1BCRB 5BN4B 3ED5A 4XQCA 4H77A 3WWYA 4X65B 4LF6B 5I4IA 1M8KA 3HKEB 5FULA 1UFOA 1P6UA 3KXKA 4E6PA 2GBFA 5A4IS 5C7YA 5BO5A 5JFOA 1PFYA 3GV0A 5D3ZA 1UFKA 2FZKA 2G06A 4RIFA 4PBRA 3BZWA 1GUFA 3DFKA 4MRMA 2CL5A 2VYND 4P92A 1RHJA 4B0OA 1AXEA 1NJSA 4K9SA 3TOVA 3ZU3A 4DV5B 1T2CA 3N74A 3R0QA 1CDZA 3FGPA 2ZQZA 1OXKB 1Z6XA 3HDVA 4IUCS 5DBEX 5THQA 5CRIA 3RVLA 1X1EA 2CHFA 4BLWA 1Y6RA 4EFLA 3VO8A 3QVLA 1TLFA 3JAKB 1R6DA 2IDZA 1M8GA 1YE3A 3EODA 4NEHB 4R1NA 2VATA 3UFXB 4ZAZA 4Z9XA 3TUJC 1T2AA 3EQ2A 1AS3A 4QREA 3V55A 5BVGA 1GV0A 1O9HA 4AZ3A 5HCUA 1EDDA 1JQ5A 4WASA 5BW4A 3RSSA 1CY7A 1NJ5A 2WWVD 1FFXA 1N5RA 4HZGA 3KKPA 5BVHA 3LBFA 4HGYA 4HI0E 4HUTA 2JAPA 5DM70 1LC0A 2G0AA 4PCVA 3K0EA 2H5EA 2HUPA 2OYSA 3IEPA 5FTMA 1JHQA 3GW8A 5HCIA 3D5EA 5C4GB 4B79A 4DKXA 2WTUA 1NXWA 2V3WA 3V7FA 3GPIA 1Q19A 4ENSA 1XCPA 2CK3A 6AT1A 3M5CA 5D1NA 2KSQA 3IEXA 3ZU6A 4UC0A 1VBKA 1UDAA 3KZCA 3J7AC 1XL1A 1H6BA 2JI6A 2X41A 3MIIA 2CXTA 3A32A 4R05A 1X8KA 3ZD8A 3G8DA 3PSHA 1URPA 4ALJA 5FV7A 3UUEA 5F35A 3IURA 3DLIA 2JIBA 3K8YA 4G23A 3T3PB 2FUG1 4KXNA 3WMRA 3I72A 1DAPA 3IT1A 2J0SA 1HDZA 2O3RA 1HQYE 4M53A 3JVIA 4N65A 4CKWB 1J1UA 2VPZA 2Q1TA 3LNCA 3OCVA 4GUAA 1WCIA 1P2FA 4CM9D 2X0EA 1VLQA 2XYPA 2GCGA 4RJTA 3NR2A 2GVZC 1KRWA 2R6HA 1FFEA 2FN4A 3T52A 1ORWA 5KSOA 3BXFA 3RHTA 3P52A 2XGMA 4XJVA 2IKSA 4C7KA 3SJUA 1D0VA 2R1TB 3B1WA 3HN6A 4QQRA 5A1TA 4Q7EA 3USCS 3K9GA 4OAPA 5ER9A 1VSTA 4ZODA 2X5OA 3PQ3A 1EH5A 1VL1A 2HZBA 2V0NA 3JTMA 1WTAA 1XHFA 2ATEA 1YDEA 4MIOA 4Y2GA 1RPAA 4HV4A 2BHNA 3ENZA 4RKFA 1WUTA 5BV2P 3VU0A 1HLPA 3IVCA 3U39A 3THOA 2BRUC 3N2KA 4I9UA 1HMYA 2HPAA 4TSFD 4YCCA 5LYJA 1SBIA 3OZSA 1WP4A 4RELA 2H9YA 4WGGA 1ECFA 1XZDA 2Z5FA 1ZKDA 4IJKA 1J42A 3PFCA 3PNBA 4UQPA 2CFTA 1UBCA 3FTPA 1GL3A 2GN4A 1NN1A 3KB2A 4ZVOA 2V55B 5AJVB 4LYEA 3BTVA 1S1MA 5LU8A 1YC5A 3FPGA 1N5OX 3GK3A 3LBHA 4QHTA 3ZXXA 3NASA 4R0MA 1E3WB 4J1QA 1IBSA 4OBBA 3AM1A 5B7PA 5B4UA 1CUBA 1R5JA 4KCGA 4G81A 3D02A 1C9EA 4D4LA 2WUWE 3KLMX 2IHUA 5EWLB 1TM3E 4ACBA 3EE6A 1JPNA 1XVVA 2WUFA 1WG8A 1ZBQA 2NNLD 2OHOA 4Z0NA 2BKVA 3HMKA 1VKJA 2CLDX 2FSHA 4MDYA 4LTMA 4L51A 2PKQO 3LLMA 2XUPA 3W1WA 4BAGA 1F0KA 2XUOA 1P2TA 3NHSA 2FUG6 4BJ6A 2KB0A 3GZNB 1L5KA 1T6XA 3U5TA 2IS6A 2IF0A 1GZ6A 4KG7A 2FSSA 3F8WA 2A3NA 2RGYA 3L6UA 5CVJA 4NRDA 4XM2A 3I5YA 1FUYB 1A7AA 1N3YA 4ENPA 3ZTYA 3I5MA 1R66A 3ILYA 1YIOA 1EFRD 2I66A 2XDWA 3QFTA 1QIIA 2GB4A 5GJWC 4RDCA 1O96B 1RBYA 3UXEA 3Q98A 5CLIA 1O94A 4B34A 4H6WA 4BKRA 1Z0FA 2ACWA 1DKNA 1KYYA 1QHFA 3N0VA 4E09A 1YQTA 2Z57A 3UJCA 2H1SA 1Q0HA 4F6RA 2Q9UA 1SVLA 2JRCA 5IUJC 2Y1EA 3RSQA 1BXKA 5FWXB 4YXWA 1G8AA 2DTXA 1MVOA 2GOYA 2VOEA 3KTDA 5EE3A 4FE3A 3THWA 3I2GA 5JADA 1T8UA 3IIKA 1HDRA 3ESBA 5C31A 1U2RA 2EP7A 3K05A 4WJLA 1JLLA 1VRWA 4JJFA 1VJGA 1P2SA 2WIAA 3FAZA 1J24A 3OTWA 2R1VA 5LDDC 3MT8A 2Q0XA 4MYHA 5A6SA 2ZTSA 3T5AA 3Q0EA 2Q6OA 4IQ8A 4P9NA 1EA7A 3ZJ5A 2QYTA 4CMIB 1UFRA 5JANA 1XAIA 3AERA 4E31A 4XEHA 1XIVA 3WAGA 2ZBEA 4ARBA 3H4MA 2PEZA 2Y99A 4WZ6A 4ZCTA 1OLSB 3HCEA 4DY4A 4H59A 3MAAC 8OHMA 2QTHA 3G9XA 3JQFA 3A7EA 4C0KA 5COAA 3A06A 1JVSA 3SBXA 1FFWA 2VG8A 2G1PA 4E32A 2EWMA 2AXPA 3TQHA 5D00A 2VHUA 3JALA 1NSYA 2ZETA 4A2CA 4US2R 3LV8A 4FSXA 1AKRA 3ANSA 1REQB 3PQ8A 1CJCA 2IPNA 4M0DA 1PJ2A 2ETXA 4JI6B 1E2HA 1JHDA 3WNDA 4IDHA 3GRFA 3SI7A 1XD2B 2DCUA 3BFPA 2WSBA 1TT7A 3UT5A 3G02A 2R96A 5E7IA 2I3BA 4N6NA 1Z9BA 2OV6A 4QHYA 2C2XA 1Z06A 5DWQA 3AHEA 4JQOA 1MG0A 4P5DA 3K9WA 3IPRA 1KZ1A 2WTAA 4E6EA 2NU7B 1A1VA 1DFGA 1CJSA 4HQLA 4QBFA 1GCGA 1HG1A 4V24A 3EF3A 5B1HA 1ZNQO 4GMKA 2BFDB 2FN7A 2RAUA 2FZVA 2CJFA 2O2IA 5EKSA 5BQFA 5JQWA 1X6VA 1EFDN 1E61A 1RWQA 2J0UA 3CNOA 2PKXA 3KAQA 2C2ZA 5FHQA 5FIUA 2PANA 2Q9BA 4Y1GA 2Q6LA 4BUCA 3W8EA 4RMIA 5TQ2A 1QQTA 4L5YA 4RV9A 5DHFA 5IULC 5BNZA 3P9SA 3VKHA 5JI3E 3H84A 4QBKA 1E9RA 3MVEA 4C01A 5KJCA 4K9LA 2VBIA 1BX1A 2I5PO 4I1SA 5CT6A 3M3PA 1DHRA 3AXSA 5FH9A 1T5HX 2AA3A 2WZCA 3QYJA 2E85A 1SXJC 2BC9A 2QXTA 4WN9B 1E3SA 1IUKA 4FWBA 4DCTA 1A98A 2MTBA 2VVTA 4M1OA 2POCA 3A6KA 4OK3A 2IXDA 3RUEA 4QIHA 1A71A 1JBQA 4TS4A 4YPVA 5CX1A 3DMDA 2GBIA 5EUCA 4KOAA 5F7JA 1BXRB 2B7LA 3BB1A 4O4IB 1PYOA 3FNRA 1G8SA 3CPEA 4L0CA 3BSWA 4MV1A 4ZTBA 1Y1TA 3AW9A 4GX0A 4DLXA 3KQHA 4Q3KA 3ICWA 2RHRA 2X4GA 4AU1A 1ZOSA 3KYDB 3LY7A 1ZXBA 3V6LA 4XVCA 3IB6A 1P2UA 3UMJA 3V1UA 2GF0A 4L72A 5E95A 4F7DA 1PR6A 2IVZA 2XVZA 4X91A 2B37A 5D86A 5EWMA 2PTHA 4MPTA 3C1AA 3T4UA 4EFMA 1LGYA 4DM4A 4ZYXA 3LT2A 3RV3A 1A9XA 2A84A 3SF8A 4ZC1A 4CW7A 4F9EA 5B30A 2YX1A 3R3HA 1EFVA 4O4LF 1VL6A 3HVHA 1CJUC 1KKMA 1Y9EA 3BD8A 1Y5LA 3JQQA 3KTOA 4FPXA 4MINA 5EJGA 3ISVA 9ABPA 3PQ2A 1V96A 2JBAB 4YREA 5JNSA 2FQYA 3N6XA 4MA5A 5ALVA 1FPQA 4EQ6A 1ZXXA 3KJXA 4LPKA 4RPCA 1ECGA 1WS6A 4EOGA 2B7CA 2PKYX 2VDMB 2WR8A 3OHMA 2WKQA 4NCAA 2BONA 2X8WA 4HMPA 4ROSA 1PKEA 3JQEA 3KOZA 1JQEA 4JAVC 3RFXA 1YRHA 5CM9C 1OBCA 1XVIA 4ZWNA 1P61B 1TQ6A 4UHCA 2J08A 3LUJA 3ZDAA 2YWFA 4DB2A 1IONA 3PEYA 1UOPA 1GNVA 4XARA 2R8YA 2E1PA 4YASA 1T9DA 1US8A 2HQSA 2I80A 3PF8A 4DARA 3DQPA 2Q2WA 2ARKA 3PFKA 2E4ZA 1B6RA 5FKJA 1MO2A 3AR5A 4CNQA 5BV7A 1RMTA 3W5JA 5M7EA 1DE0A 1TFRA 1NXTA 3IP7A 1ARZA 3GHYA 4RX1A 2Z09A 1D4AA 1FYVA 5JALA 4A7PA 5FPQA 1QRAA 1L7VC 3EAQA 1PLKA 4EUSA 3WI7A 1WHSB 4AP5A 1NLFA 3WXMA 4ETWA 3EBOA 5EIEA 4RPHA 1T4GA 2C7QA 3ZX5A 2E3JA 1BJTA 3GWGA 5GV7A 1XP5A 4UBKA 3GY0A 1AO0A 3CG4A 3B3GA 5TPWA 2REQA 4BMCA 3NOVA 2XKAA 3C6KA 1ZCJA 5DCLA 2FZWA 1UQUA 1VECA 1DAKA 5JISA 1S2DA 5EI5A 2J9GA 4DR5B 5KJ6A 1JG1A 2A0UA 3FR7A 2OXCA 1XVLA 1A1SA 1YZYA 3NT2A 5IJ0B 1D2MA 2BKEA 2QMHA 4P86A 4RH1A 1P39A 1Y1SA 1VGRA 1ZH2A 2YQ4A 3K94A 4R71A 1M0SA 3HU5A 1B2LA 5FCDA 3SMQA 1IG0A 3HJBA 1C7QA 3FOZA 4OFWA 3PEWA 2EFJA 4R54A 13PKA 1F51E 3GEMA 5AM0A 5TPZA 4GNKA 5KBYA 1RKXA 1TMKA 4QYMA 1HYBA 1MABB 4MGHA 1AU9A 1YBVA 3PXDA 2WICA 4PZPA 4CODB 5T4EA 5JJBA 3PFGA 4I8DA 1GPBA 5GWXA 3OQIA 5JS2A 1MC1A 1J99A 3F71A 4XGQA 3VR5A 5JD5A 3QEMA 3A6ZA 3KVNA 4XYBA 2ZSFA 3SHFA 1Q95A 2VJPA 3MWFA 4FXPA 4MTLA 5JCJA 1KZGB 5F3WB 3ZJYA 4C2TA 2YCBA 3VPHA 2VNHA 1CNMA 1VE3A 2LP4Y 4XYMA 2MMGA 3LA8A 1U3FA 4EYKA 5J4YA 1D1QA 3R7SA 5EIBD 1L1EA 3NTOA 4A0FA 1GYPA 4CWAA 5IW8A 4LRYA 2D0IA 4E2WA 4COKA 4OQYA 1NI5A 4Q9LA 2OVBA 2KMLA 4MS3A 3C6BA 4XPIA 3SYKA 4IOKA 2D1TA 5DGHA 2IHZA 4MWOA 3GJSA 4ZDJA 4JYAB 4YCSA 1SEPA 3D3JA 4KXXA 2RGEA 1HR0B 2IGBA 3WX0A 4OSOA 4HBGA 5ALOA 2NO4A 3PIIA 3EMBA 2YJ5A 5DBGA 3RUAA 2PX2A 2Z2JA 3ELWA 5B1SA 3AF4A 2ODPA 4OQZA 2D8MA 1GFWA 1A9PA 2GYUA 1TF5A 2C7GA 2GPBA 4YAWA 5GP1A 3TTUA 3IV9A 3HP1A 4FB4A 2E5LB 1NJ1A 2VA8A 2DFNA 2WTEA 1WPRA 2WVAA 1GTVA 5EE1A 5L3RA 1R9NA 2M2IA 4B8WA 3B8EA 3IEKA 3MXTA 4TYQA 1ZRSA 5EJ4A 3BOSA 3INRA 3WYGA 3RTBA 1JHYA 4KBGA 4X1KB 4GXNA 4QOSA 1FB5A 2QHXA 1HLFA 1B8VA 4N8EA 4LYHA 1ACJA 2IDMA 5CJPA 2DQZA 3F6PA 2P9EA 1YQQA 4GLLA 4KXLA 1DS6A 3R9KA 4TN1A 1UIMA 3VTAA 1S8OA 1NZDA 3QIVA 1S6YA 2PL3A 3QEOA 3GGDA 3ZVLA 2XAAA 4LDRA 1IMOA 1N33B 4FKMA 1D4OA 4WDQA 3DVLA 4GL4A 5D5PA 1V5IA 5CG1A 5A4AA 2RHDA 3JYPA 3MJFA 5JY6A 2Z5GA 3EY4A 3TBHA 2FUNB 4WI1A 4AQ7A 3I0NA 3NYRA 2A30A 3TMYA 4K86A 2C8LA 2I2AA 2OZLB 4DM3A 4NHEA 3I01M 1GAJA 2VUTA 4WVFA 1Z2EA 3F3KA 3GLHB 4J90A 1WF6A 4OM7A 3IEMA 3H19A 1P29A 3L0DA 1G8GA 3QPBA 1LC3A 4JLBA 2XZTA 4Z7JA 5AW4A 1ZUHA 4QUHA 2XW6A 3KZMA 3R77A 1ONBA 5EJ9A 2HK9A 1FXWF 1NBIA 4UOEA 3EFBA 1BE6A 1PGNA 2R85A 3KUXA 1YVRA 2QMOA 2R2GA 3LQRA 1UT5A 4MB0A 4BVFA 4EY3A 2BSQA 3FTEA 1O95D 1YS1X 2C8JA 3IBTA 4FDAA 1SBYA 2CWWA 1TM5E 4C2AA 1WNTA 4OD0A 1R8XA 3L7OA 2G0TA 3FBWA 5ITWA 5C51B 2QAGB 4M1KA 3WJAA 1UZAA 1KS2A 1XFDA 4ZCMA 4JIMA 2WK1A 5KU7A 1SRRA 2VNKA 5EOVA 2C94A 2BJHA 2KQUA 3HUTA 3LW7A 3N5KA 2GXQA 3VZQA 3W8RA 2FRXA 2P3QA 3A58B 2P2ZA 3C15C 2GSDA 3O94A 4IDEA 1CEQA 1R3DA 4M98A 5DYYA 3V2HA 5IWCA 3BT7A 1QYDA 3BE5A 4YPOA 1J0CA 4FDMA 4WXRA 5KKAA 2Y6UA 1T13A 3GCDA 1U28C 1A4UA 2ZXUA 4J4HA 2GCEA 4H16A 2AFHA 1Z33A 4P3KA 4L85A 821PA 3FTNA 2PRYA 3OFND 4IDFA 5EE9A 2JH8A 1Z6TA 4KQHA 1AF7A 1Q1AA 1AQYA 1QIJA 1LCIA 3OCZA 4Q24A 4C6TB 1OAKA 1U0GA 2C84A 3CPJB 4I8XA 4NR0A 3RE1A 4D43A 4EG1A 4ZTUB 1QH8A 1MJHA 2C04A 5EZQA 2WTXA 1JZTA 3FVWA 4BE9A 2O59A 4IFBA 3R3SA 4M1SA 4YP7A 1CUYA 3OY7A 3X1JA 3KSRA 2ZYGA 1WVIA 1CHDA 4UTNA 4P08A 4XH9B 1RXCA 4B46A 1NI4B 1NIPA 1T8YA 2FW0A 3CZ5A 3H3FA 3L4EA 3KJFA 4L27A 3UC5A 4EO7A 1U02A 2YQ5A 3DVAB 2HJHA 2FF7A 2HLPA 2ZUWA 3G9QA 3KVYA 5COQA 3WLSA 4LFAB 5E9WA 4NJEB 1SCUB 1Y3BE 3AB8A 1IE3A 4KHZA 3ZCSA 2LGJA 3AU9A 4M37A 4Y0AA 1YZUA 8ATCA 2ENUA 2PV0A 5CJ2A 2W2LD 4DLTA 4UBIA 1NBMD 2O7QA 5AFSA 1P4RA 1DTEA 2PWAA 3GN2A 2Q3CA 3HBLA 3M89A 3HLTA 1RKQA 4GHWA 1WQ4A 3BEDA 4I1YA 1QANA 3OUZA 5BMVA 1H2FA 2CLSA 1POXA 4BYGA 1G18A 3MUOA 2BFCB 3DZJA 4AX4A 5EC8A 2P9QA 2E82A 3GJQA 1BGWA 3CFYA 4RGBA 2BGLA 2TMYA 4XFJA 4FXOA 3WHKA 5GMOA 4DSZA 4NULA 5K01A 4GIBA 3CPHA 1PL0A 1GKUB 2FEPA 2FPMA 2WSLA 4EELA 4U6SA 5D6NA 3PUYA 4YRMA 5B36A 4GR4A 2ZBQA 1PJ8A 4U8GA 2FEKA 3ZHRA 5B64A 1DT3A 3VSCA 4RANA 1PR1A 4B44A 1V8OA 2BZGA 1BAPA 1MKYA 2CLHB 1S2IA 2EBUA 1ZPDA 2OLJA 2OO5C 5EYPA 3E1KA 2EIHA 1P9WA 4PYRA 2I33A 1YAJA 1LFDB 2Y71A 4WEOA 1TCAA 4XJXA 5HQTA 1CFZA 3H6GA 3KELA 3KDSE 1V9LA 2TMGA 3W6ZA 5AHRA 1Y7LA 2W70A 3J7TA 1XALA 1CQJB 3QOWA 5KMGB 2YJNA 1T1EA 3MGKA 5ULLA 1JNXX 3QE9Y 4WZBA 2WHQA 1GPMA 1DC6A 3UB3A 1ZW6A 1MENA 1TM7E 2E21A 2VNAA 4D8VA 4HDAA 4QL3A 5ECGC 2AR9A 2J5XA 2IYLD 2ZIXB 3ROTA 4ZCPA 4AWAA 5K1ZA 2FX3A 4HUJA 1KZ6A 2ZKIA 2QX9A 3JARB 1CUIA 1LJ8A 3CRRA 3VYSB 3CVXA 1NHGA 2RHJA 5JROA 3R74A 4LTNA 3IQXA 5B37A 3FRIA 3K5HA 4X1IB 3OY2A 1G2PA 4CCWA 4LBVA 1T9KA 3RSFA 1L4YA 1NU6A 3QW4B 3REQB 5LB2A 3PVZA 4QD3A 2X0JA 1KY5A 4DQDA 5JG7A 2DTEA 3PWTA 4Z1MA 1Z4JA 2AZMA 3MWGA 4KIGA 1NW7A 4ZT4A 5HK8A 1ZKMA 3AEQA 3DXZA 1LU9A 3HGMA 2ZI6A 1DAOA 4DCJA 2H1WA 4LXTA 4ZD6A 2IEAA 1F7VA 2P65A 1IHOA 1FQKA 3S2SA 5B4TA 3KSAC 4XRRA 1E8MA 3GP3A 2AK2A 1UWKA 3VH4A 4BO4A 2ZB2A 2HCFA 1I5EA 4X9XA 5LYJF 4YMUA 2HQOA 3GFRA 2QTVB 2CK3D 3FCOA 3O8QA 4LCJA 1D7OA 4AYXA 4HBZA 3GQBA 1E3MA 3B9QA 3ZZUA 4F84A 2ZTLA 1VP3A 2V45A 4YP9A 4DT1A 1UMDA 4RGVA 1Z63A 3OP1A 1P77A 4GX1A 4A91A 2DUNA 2XUHA 4IEEA 4MGKR 4F4IA 2IL1A 3FHLA 3RWBA 3ETJA 4NU5A 3QPVA 3RM3A 4AMVA 5CFQA 5HSGA 3EEBA 4LVNA 3TINA 1G2OA 5MFPA 1U1EA 3RBZA 3A9CA 2H0AA 4AYWA 2POQX 4RE5A 2XRZA 2KHZA 3MIZA 2CE7A 5HQJA 3SSNA 4MQBA 2I2DA 1EX1A 5EGNA 3HYRA 2IU0A 4OHYA 2RHHA 4MWCA 1X1SA 4G3XA 4A2PA 4DA0A 4AY4A 3DB1A 2WY2D 1BU5A 3WKBA 3E48A 2ZITA 1JFLA 3ADKA 1PG2A 4DJ5X 4EJSA 1FUUA 3K6SA 1NBME 5EFOA 2ZZMA 4C76A 5JWOA 3PEFA 1FFSA 5TY0A 5K99A 4ZP1A 1A97A 2MCFA 3GZTB 3P0HA 2YC2C 3ACBA 1XCBA 2Z8XA 1O6GA 1LSOA 3B7PA 4K9OA 3A37A 2FFJA 1NGSA 2J4DA 2G07A 2UYYA 4BFYA 4URZR 1WBBA 3AH8A 3KQUA 4UARA 3B1VA 2QT9A 1QH1B 1EX9A 3AF1A 4NSNA 3GFSA 3L7CA 5D1HA 5EXEA 5HF9A 1U2GC 3GNQA 4KAJA 4EPWA 2ZB3A 3EWSA 1HQCA 4PYNA 1M5RA 2ZREA 2VPTA 4GI1A 1EUDB 2PA0A 2QROA 3K0KA 1C8BA 1MH1A 1HFKA 4U2EA 3AUSA 3KKLA 2IBSA 4ZC8A 1BMQA 2X3UA 5C9ZA 1GL6A 3PXUA 4RD4A 5FBVB 4GPZA 4A3SA 2F1IA 1SKBA 5KDDA 1MIHA 3AM4A 3CWCA 3NM6B 5AHWA 1OPXA 3C0KA 3C7KA 5CVVA 4RLQA 3H6KA 4NI5A 1XRLA 4BDTA 2RCYA 5IK2A 4IOLA 3FOBA 5ALNA 3MFYA 1JEDA 4GOND 2IEIA 1SUEA 4YO8A 3MWDA 4G84A 1GG5A 3WB0A 3VR1A 2P79A 4ALMA 5AUOB 2FCRA 4WOCA 2GZ2A 1DO2A 2QUBA 4KTTE 3VO9A 2QVBA 3TNFA 4QQKA 1YOBA 2QP9X 4ZREA 5IH3A 2A1UA 4HP8A 2L69A 2ZAGA 1WF3A 5C1IA 2AE1A 3HVIA 2B21A 3BWMA 1WSDA 4K9QA 4HGZA 1D2EA 2H5LA 2XUFA 4QYSA 3L1VA 1WKVA 1VDZA 3OM1A 4H0CA 2ZRBA 4WV3A 5FJIA 4ZVQA 3TVYA 4DR1B 1N2BA 2IYQA 4ASUA 1XA0A 2BKAA 3TCKA 1U0NA 4PNEA 4BB0A 1N3LA 3V2IA 4KC0A 3PDHA 4BC1A 2J30A 3EXHB 2Y0EA 3CEJA 4O33A 3GDFA 2XDQB 1VE7A 5A4KA 3WQSB 2W2XA 5EMKA 2I3ZA 5B7NA 1AQNA 1FY2A 3DEZA 1EKXA 3T8YA 5GZ3A 1JYSA 2JAQA 3WQRA 1VHQA 1CQIA 2NSJA 3ZVRA 1FNBA 1JHOA 4ND6A 4QOFA 4XQGA 3MCZA 5K09A 3CC8A 4KO8A 3ZWQA 3SHQA 3O4RA 3EDYA 4DMLA 2WUVA 5HKAA 4JYMA 1FSFA 1MVLA 2GCOB 1HC7A 3DWIA 3AHCA 4TM8A 3RC3A 2DH6A 3M49A 2Z9DA 2AQKA 5AW6A 1QRSA 1CEEA 2C03A 4KHPB 2ZTMA 4N40A 3BMCB 3LHIA 3MT0A 3HY3A 1Y48E