3SU8A

Crystal structure of a truncated intracellular domain of plexin-b1 in complex with rac1
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
178
structure length
178
Chain Sequence
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Apoptosis/signaling protein
molecule keywords Ras-related C3 botulinum toxin substrate 1
publication title A Dual Binding Mode for RhoGTPases in Plexin Signalling.
pubmed doi rcsb
source organism Homo sapiens
total genus 47
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2011-07-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3su8A00
4N0EA 1NG1A 2R6GA 4DCTA 4C0JA 2ZJ2A 4GOXA 1EFRD 2DHRA 4B32A 1JEDA 1YZNA 3GLHB 1U9IC 1MO6A 2G88A 4E5UA 4HLDA 4X8LA 3TBKA 1TMKA 3CUEF 4C30A 3O8RA 1A7JA 1FZQA 3U3OA 5L3SB 1KKMA 2GCNA 4V0OA 5KSOA 1NNEA 2ZYTX 4I99A 3KQHA 4BZXA 3K0AB 3L0OA 3NG1A 5CJ2A 2UZIR 4D4LA 2GA8A 2ZI7A 4M9XA 1V43A 2YWGA 2O0HA 4TWZA 3LAWA 3AGPA 4LHWA 1N6OA 2G0TA 3WMGA 4G1UC 4ASUA 2ZRBA 1FP7A 2GEDA 2V4ZA 3B1XA 1SVIA 1ZNZA 2WICA 1U94A 1G18A 5DYIA 2RGEA 4C7OA 2IHYA 4PTLA 2YINC 2C9YA 4Q21A 2ZJZA 3GLGA 4V02A 4GI7A 4Q9LA 3B1YA 1COWA 3GJXC 1ODFA 3N5CA 4TYNA 2ATXA 2EFGA 1E2HA 2JLUA 1I2DA 5DSZA 5JS8A 3CF2A 4DLVA 3B7GA 1VG0B 4A0GA 4V0NA 4QHTA 5E7MA 4NYMR 3B1ZA 2FZ4A 3CRMA 2QAJA 1AS0A 4Q48A 2W0SA 4Q00A 1EK0A 4BLTA 3PEUA 3UMRA 5BYJA 1Z63A 2J45A 1DAGA 2CLCX 5A5GA 5JFGA 1UBEA 3SJZA 4WXRA 4R2HA 4C0SA 3WHLA 3D8BA 5CLQA 3DMNA 4ZIRB 4TTRA 3M1IA 2QEQA 2CHQA 4LC1A 4Q1BA 5FTKA 4NZYA 4IFEA 5JJKA 4S2EA 4ASUD 4GSYA 4PC1A 4QNMA 1XMSA 4AI6A 1GRQA 2FF7A 3F5FA 4Q02A 3KXKA 2ODNA 3CZQA 1J2JA 3U7HB 1NSFA 1N25A 2F1JA 1KSFX 1E98A 5DIFA 1D2EA 4NYIQ 5FBVB 1COWD 5L3QA 4PAMA 1VIYA 1N0WA 4MH0R 3VX3A 3GEHA 3AF4A 3L82B 1ZUHA 2VO1A 1N6RA 2OLKA 4K46A 4DLZA 4KVGA 4TTQA 2NIPA 2ORWA 3KKQA 4DLRA 4MGZR 3QKUA 4TSFA 2MSCB 2CEAA 2H92A 3EPKA 4DDTA 4L16A 3U7EB 4DCNA 1RIFA 4JIMA 3UATA 4MDEA 1KYIA 1U0LA 1IQPA 3ADDA 5B57C 3EPLA 2QTFA 1KNQA 1EESA 2GZHA 4POAA 2QG6A 3CO5A 1JNYA 1T4GA 1T0HB 2AXNA 2Q9BA 2AXPA 1X3SA 2ORIA 2R65A 4RFSA 3SZRA 2P6RA 1KK1A 3AVQA 1XCPA 3WNCA 4AURA 1ZNYA 3VHLB 4KO8A 2QY9A 4O3MA 2QBYA 1D6JA 1VIAA 1KJZA 1M2OB 5E7IA 1T3HA 1HQYE 4JL8A 4B48A 3QJYA 2GXSA 1P2TA 4A1FA 3OFNA 1CTQA 1ZINA 3I92A 3CRRA 4IXNA 5CYOA 5EP3A 4CEJA 1KO8A 1W0KD 1N5IA 2XEXA 4DRZA 1NMYA 2J46A 2FEMA 4M1OA 4O25A 4C0HA 4GBMA 5TARA 5JLJA 3CKLA 3BWDD 3N2EA 1IM2A 4L9WA 3AV0B 4TSFD 3D31A 3SS8A 5CJPA 4DBLC 2ZXUA 1N0VC 1XJ0A 2D4HA 5K8IA 4HUQA 1CIPA 2D2EA 3JZAA 1ZU5A 4YONB 5J40A 1WB9A 3LW7A 3CX7A 3M4YA 1F3OA 4IEIA 1W5TA 5FPHA 3EC2A 5SZHB 5J4HA 1U8AA 3AP2A 1Q20A 4MA4A 3ONWA 4HB2A 4J0QA 4KITB 2R6FA 2CHVA 3ADBA 4JL6A 2IBMA 2B6HA 1TL7C 3VHXA 4R9UC 5FH9A 1E2NA 5LPNA 1TQDA 5CDFE 1JBKA 3SQXA 2AD1A 1R0YA 4D4KA 4MUAA 4LC0A 1Z2AA 2W58A 5EQTA 1XZQA 2ZI9A 5FUXA 1N6KA 1CULC 2BVNA 3T61A 1S9HA 1ZU4A 2HDNB 2XXAA 4AWXA 2ZR9A 4PHTA 1NF3A 2N1BA 4A6PA 3K09A 4Q7JB 1TAGA 2J87A 1II9A 4OKSA 1HE1C 2VPPA 3AF1A 2W6JA 4QBIA 4ZKEA 4KFRA 2QM7A 4CEIB 2EW1A 2BMEA 3RRMA 4CEHB 3IEUA 3VNVA 3U6KA 3MMPA 3QG1A 3ICQB 2ZUDA 1XMJA 5JMTA 4BFUA 1Q21A 2JATA 3DM9B 2J7KA 5DH9A 1YVDA 1JQJC 2OEPA 2V6IA 3AVYA 3WBJA 4KXFB 2FE4A 1IXZA 1OFHA 5EXSA 4RZUA 2JIZA 3O8CA 1W4RA 3G5UA 1FFHA 3ZVMA 2ZAOA 3U3RA 2FGKA 4Q4HB 3IHWA 1BYIA 2QP3A 3X1WA 1KZ7B 5K8UA 4TLEA 3PVSA 4US0R 3ZZUA 4TMZA 1P2SA 4ZDIA 1L4UA 4TLAA 4Q66C 4A0FA 4M21A 4PPNA 2H57A 2HLDD 3O8BA 3IQWA 4Q18A 1PUJA 2EFCB 3P4YA 3Q9LA 1BS1A 2NQ2C 4Q7MB 3W5IA 3LXRA 3PUVA 4MYCA 5DN6D 4QJ3A 1QDEA 2ZRFA 3RABA 4P0TA 4AD8A 1ESMA 3QXSA 2J41A 3AEZA 2CL0X 1KDPA 1TU3A 2W6JD 3DMDA 3EWAA 5FTNA 2BKUA 3RWMB 1GNPA 2XB4A 3THWB 1M7HA 2GK7A 5CB8A 3FKSA 2GXQA 5B64A 1ZNWA 4PC6A 3H4MA 2ZPTX 2GTPA 3LV8A 2ZYUX 1C1YA 2VBCA 2FU5C 3BC1A 1NN1A 3EASA 3FYHA 5EUQB 2AFHE 5GVRA 5HCNA 2JLSA 3FHOA 4CZ2A 1DO2A 2BJVA 2R62A 2RGNA 3WP1B 1PV4A 4MITA 1E2MA 1O3YA 3TQFA 4Y0VA 1XMIA 3SC3A 4LJ7A 4B47A 2Z4SA 4CF7A 2CLSA 5KO2A 1K8RA 1SZPA 1XXHA 4S35A 2ZROA 3BGWA 1AM4D 4NTZA 3BS4A 1XEXA 5CYPA 2RH5A 3AF3A 5KDOA 2O8FA 5E7JA 4DZZA 5KSZA 2QRZA 1E94E 4B6FA 2OFWA 1XZPA 3OEEA 2XITA 3VR5A 1QHXA 4MRSA 3DVLA 1TUEA 4FMCB 5FPYA 1CRPA 4TL8A 3CRVA 4ZI2A 5EZ5A 1OV4A 3QKSB 3W6NA 1GZSA 1QZXA 1QHIA 3VR6A 1OB5A 3FWYA 3KB2A 3K0FA 4EPYA 1IAQA 3QOFA 3B78A 4NCKA 1WBDA 3SFVA 1KZGB 4FIDA 4HUTA 3RRNA 1NG9A 5JJIA 4G5RA 3AKCA 2XTZA 3RSOA 1XCMA 2C98A 3GD7A 5K8TA 3DZDA 2ODEA 5IT5A 3QPUA 3LWNA 1WXQA 4RY2A 1U0JA 3KTAA 4B43A 1LVGA 3CPEA 3W34A 4OI4A 3TKLA 4RKEA 4CT5A 2PCLA 4G3XA 2FJUA 5FBWB 3A4MA 1G1MA 1ZP6A 1NVWQ 2W2VA 5M04A 2TMKA 3EW9A 4DHEA 1M74A 2J9RA 1IN6A 4JZKA 5HKKA 4YMVA 3QF7A 4DB2A 121PA 2ECKA 2FSHA 2W0MA 1ZIPA 2GJ8A 3KUCA 3RANA 4M1KA 3NEYA 4V0KA 5CIWA 1KO5A 1GNRA 5DI3A 1YRAA 5FTJA 1P72A 3CZPA 5TV2A 4NBSA 4C0KA 4C4PA 3I72A 3AGQA 2QAGA 2V8OA 4II7A 4LJ4A 3R8CA 1MH1A 2RGCA 4HLCA 5FFMA 4EAQA 4PO9A 4XVRA 4GDFA 4DDVA 4A92A 1XD2B 1XU4A 3R20A 4DCUA 2GXAA 1J70A 1A2KC 4C3ZA 1Q0UA 3BFXA 4C2TA 1C4OA 4TQ9A 2RGXA 3Q7PA 3SFZA 4OI0A 3B2EA 1MKYA 2WJVA 1VG1A 3OIYA 3W9YA 1N5KA 1FQJA 1S8FA 3E5HA 1UKEA 3ZDQA 4M1YA 3SYNA 4JLPA 1SVSA 4AIIA 2NTYC 3R9XA 2F7SA 4JKIA 1QG4A 2VF7A 4Z8XA 5HKKD 4KHZA 3GCGA 4QXAA 1QHHB 2IUTA 2Z6VA 4DIDA 3THYB 2C99A 2J3EA 5G41A 2XAUA 3KJGA 3PXGA 1WE2A 3PUWA 4BFTA 1G8GA 3HR8A 3JZMA 4MGIR 1WBBA 3RRYA 3TAHA 3MGCA 2FPKA 2AHOA 2ZS9A 1VG8A 3HYTA 4US1R 4B2PA 1J99A 1N3BA 4OQLA 4DLSA 4ZCMA 1U2RA 2QORA 3X1YA 1B23P 3MWKA 2DFNA 3QKRB 1P75A 1DADA 3CNOA 3CX8A 1NY6A 4LHYA 2OV2A 1L2TA 4DXAA 2QSYA 1Z6YA 1U81A 4IHQA 4UQOA 2JLVA 1NJFA 1XF9A 3B13B 2KBFA 4DC9A 1FPMA 3K0CA 1UFQA 1T6NA 2NZ8A 2GCOB 2QSZA 2QTHA 4L5BA 3ZZTA 2QAGC 2VF8A 2A3RA 1SVWA 1YZUA 4IOMA 2WWGA 3TUJC 1JPJA 1OFIA 2ZAMA 1TX4B 3J81k 3QXCA 4HZUA 3EWSA 2ZSAA 1PLJA 3IPYA 1HH4A 5JCZA 4WVFA 4JYBA 3AH8A 4NYMQ 4OJKA 4DEYA 4TYPA 2A5JA 3EPJA 4LV6A 3W8RA 4FCTA 4L9SA 5LBIA 5L8VA 5EE0A 2KB0A 5SZJA 4F7WA 3EAQA 4LV5B 2WWWA 3SBDA 3NWJA 3B8HA 4ZDKA 2KE5A 4NMMA 5AJYA 1KK0A 3OAAA 5SZKB 4CW7A 1E0AA 2P6UA 1Y63A 3ADKA 2BKEA 1G8PA 2B21A 1Z3IX 4Q4JB 1AS2A 3TLXA 3KKNA 1MRNA 1W46A 3KQLA 5LDDC 2IWRA 4PZZA 3LX5A 2VP2A 4A8JB 1F2TA 4H1VA 4PPFA 3L8YA 3C4JA 1XEWY 3KKPA 3GLFA 1E2IA 1NJGA 3CB4A 2FFBA 3W6OA 2IT1A 4PR0A 4Q4AB 2ZRAA 4LOAA 4OHVA 5DGXA 3C7KA 3GEEA 1XFAA 4FXPA 4PAOA 4JLKA 3RSLA 1XTSA 4QG7A 1E2FA 5EXPA 2ZU0C 4CDGA 1GOTA 2I1VB 4JVSB 4EJSA 2ZRLA 1UDWA 1UPTA 1G5PA 4P4SB 5HTKA 1NRJB 1T3LA 4NP6A 2YOGA 3V4FA 3VR1A 1YHNA 3CM0A 3K53A 3LRPA 3K0CC 2GK6A 3LW8A 2J5XA 1CR1A 2P6NA 2FG5A 2C95A 3WMFA 1W0JA 4EPWA 3D3QA 3DPUA 4PAQA 3DDCA 1DG3A 3AVUA 5DISB 3TMKA 4TL9A 4IW3B 5C2JB 1QHSA 2FPMA 4U00A 1G3IA 4M9SA 4PHHA 4L15A 2QU8A 3OAAD 2XJ4A 2GEUA 1LS1A 2X2FA 4D81A 5JI3E 1YRBA 1HT1E 5JHHB 2P2LA 1Q44A 1US8A 3ZZ0A 1E1RD 3N2IA 2VSXA 1UKZA 3W5JA 1BKDR 2JCSA 3C41J 2V3CC 4UNSA 1Q12A 3IBGA 4RD3A 2GVDC 5FTMA 3AVXA 3CH5A 4NYJR 1CR4A 4RD2A 4QM6A 2ZIAA 1EFTA 3TVTA 2ZEJA 2X8AA 3IO3A 1DARA 5CITA 1YR7A 1QVAA 3MFYA 1X8LA 1DAKA 2J59A 3C8UA 4OQFA 4TMXA 3RLFA 4BLPA 1RJ9B 1VKJA 1W49A 1WQ1R 4FN5A 3ZD6A 4KLZA 3HR7A 2PT5A 2H7VA 1QF9A 3CRQA 1CR0A 1G6HA 4RCYA 2LKDA 3IHLA 4D2IA 4LJYA 3HDTA 2YC2C 2C03A 2Q21A 5JSZA 4YC7A 3R8FA 2PH1A 1W0JD 2PEZA 4LUCA 1U9IA 3QQ5A 2BM0A 4C0LA 3U4QA 1XP8A 4YMTA 1EX7A 1ZM9A 1GUAA 3FHCB 1Z6AA 4K81B 2PT7A 3U3KA 1YZQA 4ZCLA 2FGJA 1R7RA 1T8UA 3I32A 4JLJA 3DKVA 4XOIA 2IX3A 5AWFC 1TEVA 4B3GA 4Q1EA 4OK3A 5LD2B 1CJVC 1I4TD 1KK2A 2F43A 1SXJE 2FOLA 2ZE6A 1IBRA 3U61B 4IVQA 1T9HA 2XSZA 4A2WA 4EPXA 2KSQA 1UJ2A 4XD7A 2Y8EA 4HAWA 1TF2A 1R0XA 1OKKD 3C15C 3GJ4A 3TK1A 4F4IA 1CR2A 3IKJA 4GMDA 4N3NA 1U90A 4YDSA 2OBNA 4QGFA 1LB1B 1OE0A 2IUUA 2WJIA 1F5NA 2FA9A 2Q6TA 4OL0A 4DT1A 5AJZA 4B3FX 2FSFA 5HZHA 1WRBA 1G3RA 2JLZA 1E79A 3HWSA 5CK5A 4O2RA 3VAAA 2IS1A 3TQCA 3BERA 4FD2A 1E2LA 2IXGA 2XNSA 3TSOA 1WP9A 3NC1C 1JAHA 2JLWA 4LJAA 2REBA 3CPJB 5G3YA 4LJ9A 3EIEA 2EFEB 1VMAA 2AWOA 2QENA 4HSEA 4BFXA 3B9PA 4DUGA 2IL1A 3UWKA 1W36D 4OQMA 1DAEA 2PBRA 4HDOB 1T5IA 2QP9X 3OIVA 5EP4A 3EA0A 1AQYA 3IIKA 1KMHA 2BM1A 4GOJA 4FWTA 4BLSA 5FL7A 3CF0A 1OFTA 5H68A 1II8A 2ZM5A 4GP7A 2XSZD 3C5HA 4LK2A 1S96A 3GJ5A 4NE2A 4XD7D 4G01B 4R98A 1XPRA 3LDAA 2GJKA 3PR1A 2EVWX 2HCBA 4HDQB 4BEBA 4LHXA 1UDXA 1W36C 3ASYA 2G1KA 3BH7A 4E03A 2VLIA 4LBZA 8OHMA 1G7SA 3KXIA 4W9MC 2ZSFA 1VDZA 3A1UA 3K8YA 3ZQ6A 3QEJA 3EZ2A 4JKYA 4KV9A 4RCZA 2D74A 1E79D 4URXR 3GJ3A 1IXSB 1W44A 2VEDA 3A58B 4EFLA 4KI0A 1Z28A 1KOFA 1Z22A 1T91A 2IYWA 3VKHA 1JR3A 1LY1A 3OIWA 4M1SA 1L8QA 3WYGA 1RKBA 3K9GA 2GXUA 2RMKA 3TE6A 3GJ8A 4LY6A 1TF7A 2JA1A 2ZSBA 3A1TA 2DR3A 4MGYR 3S1AA 4DUGD 3CBQA 2OO7A 4P4UA 4OHYA 2ZS7A 5LB2A 1IOZA 3DKPA 2QMOA 4RFSB 3U2QA 1VCNA 3EIQA 3FMOB 3A1SA 1E4VA 1GIAA 4PC3A 3ASZA 5CLLA 2ZUBA 3R9IA 4QOSA 4DSTA 2QBYB 5FL7D 4IJMA 5JEEA 5IF9A 2XZOA 5HPYB 2FSIA 3I8SA 5ANRB 4ARZA 3I5YA 3QKTA 5AUNB 1FTSA 1SVMA 4G5SA 4XSHA 1NMZA 3FFBA 1T8TA 3A1WA 1NVXQ 1U99A 2QMUA 4AKIA 2O8EA 1D8TA 2GJ9A 3PUYA 2ZS8A 1W4CA 4D82A 3PJRA 4R2IA 1G3QA 3CH4B 2KWIA 4TL6A 1JXOA 3ZH9B 5TY0A 2CVHA 5F2EA 1X1SA 4LGMA 2Z5FA 4F92B 4K8OA 2VIIA 2PJRA 1E99A 1GRRA 5FL3A 5ELXA 1JR3D 1G64A 1ONBA 1IN7A 3HYRA 4PPQA 4MRRA 1X86B 1RFLA 1ZUIA 4LPSA 1W0KA 4TYQA 2WPDD 2ZRMA 5EE9A 4ZDJA 2KBEA 4I1UA 1M8PA 4MKIA 3MAAC 2OAP1 5KDLA 3LBHA 4ZDWA 2HT1A 2P3SA 2QI9C 1Q57A 3W3AA 4ESHA 1MABB 1AS3A 1E32A 2IYRA 2IF2A 2ONKA 4QGAA 3SI7A 1CLUA 4RKFA 3SQWA 1OHHA 1CJTC 3NDBB 3KFXA 2PZEA 1OXSC 4X8MA 1GKYA 2REOA 1EFCA 5L3SA 1DAFA 4PXAA 4QBFA 1CEEA 1I4DD 1N6PA 3C14C 3K0AA 1W47A 2IWHA 3SBEA 1S4QA 4B73A 2P0EA 2B8WA 5D3MB 3FGNA 4Q5IA 1OJLA 4EQ6A 4RD4A 1GL7A 1DAHA 5L3VA 3EXAA 2GEVA 1YZGA 1SVOA 3MWJA 2WKRA 3NBZC 3KZ1E 5B58C 3K70D 3KQNA 2VRWA 1RYFA 3IBYA 3Q3JB 1XWIA 4P32A 1UBFA 1HURA 1N0UA 2JDID 1ZIOA 3GJ0A 3ND8A 2J1LA 3IQXA 4GRAA 3G0HA 5J4LA 2ZRIA 3U3JA 4FI3C 3RS0A 4R71A 4IDNA 2HXYA 4O0MA 3SN6A 3H1TA 1AZSC 2Q9CA 2GNOA 1R0ZA 5TMPA 4Z8YA 1D2NA 2YZ2A 2PMKA 3K70C 2CVFA 2BCGY 1ZD8A 4C2UA 5AUOB 1G16A 1NL3A 4LI0A 5DI9A 1KJWA 3PUXA 4FMDF 4JLVA 3VFDA 5GJBA 1OHHD 1E4YA 2VHJA 1G5TA 3BB1A 2HCJB 3I4LA 4BFVA 1KTVA 4Y0AA 2RGAA 3SNHA 4ZIRA 1CJMA 2GHIA 2QMEA 5FR1A 1P3JA 1DS6A 5FOUA 2O8BB 1Q1ZA 4R7ZA 5GVSA 3MJRA 3UWOA 1GILA 2WAXA 4FINA 1YR8A 2O0JA 1AJEA 1GDDA 4DB4A 3BBPA 3P4XA 5D3QA 3F8TA 1K5DA 2CL6X 2CDNA 1FX0B 2NO6A 5GJWC 3TAUA 4ITRC 3I8XA 1I2MA 1EXMA 2EWVA 4PSAA 4AG5A 1XRJA 2HYIC 1E0JA 4D0GA 4Q1FA 2DWQA 4D6PA 3NEJA 1WF3A 3X1ZA 3WNDA 1E1QA 3CLVA 3NHAA 1DTSA 2FPLA 4ZO4A 1H8HD 2D2FA 2HLDA 2IF0A 1GAJA 1P2VA 1S1MA 1U98A 3QPVA 4BLQA 2QQEA 4LSGA 2OESA 2IYYA 3O47A 2OG2A 1WDTA 4A36A 1E9CA 5DN6A 2GESA 2VHQA 4UJ5A 2IXFA 3SJCA 4D0LB 1YR9A 4OHWA 1GRNA 2ZETA 3NH9A 1YU9A 1D9XA 2RKOA 1OXUA 4LRWA 1KY3A 2ZJBA 4UXIA 2YOHA 5FI1B 2O8FB 3L2OB 2QPAA 2Q3MA 4BWYA 2L0XA 3BH0A 3K9HA 2E9SA 4TT3A 1S3GA 3RRZA 4BLOA 4EDHA 3PFIA 3O8DA 1DBSA 4AKGA 5KPJA 4GT1A 5FBQB 2XZLA 5EZ6B 1MOZA 1R4AA 4D25A 3PEVA 3GLGE 1FUUA 4B6EA 3TUZC 4CRWB 2AK2A 4B3DA 1NVVQ 2XGJA 2F3RA 3AQ4A 2O8DA 4A2PA 4EPVA 4EPRA 1FNMA 4CYMA 4KSCA 3P27A 2V9PA 1B0UA 3PIRA 2IYSA 1BOFA 4NONA 1OXVA 4XJXA 2ZRHA 2V1UA 1U8ZA 1E1QD 2HF9A 1G291 4XH9B 5C46F 2AD5A 2D7DA 4ZV4A 3UPUA 3SOPA 4WZBE 1NIJA 3VR2A 4JJKA 1LF0A 2E1RA 3V4RA 1OXTA 2JEOA 1G20E 5TXGA 3JVVA 1KI6B 2ANBA 4GNKA 3X2SA 4JJZA 1ZRHA 1HE8B 2LKCA 4A9AA 4MGKR 4NU0A 5J4KA 1GKUB 4BQSA 3I62A 4QBHA 2IXEA 1DOAA 2V1XA 2ZR0A 1SKQA 3EA5A 4DSUA 4TT3D 4PHFA 4Z1MA 1KO1A 2BHRA 3FHTA 3I3SR 3TW4A 1R5BA 2XJ9A 1KI1A 3BXZA 4TQUS 3FMPB 5B2ZA 4W5WA 1GL6A 3FMIA 1JPNA 2B7BA 1VCMA 2YHSA 4QHSA 3BRWD 2J0QA 2ZRDA 1CXZA 1E9DA 1MR3F 2DFLA 4ZI3A 2KI5A 4MYUA 2RGDA 4RD1A 3GPLA 1FMLA 1GP2A 5JWOA 4KYUA 5JRZA 1VCOA 4RZ2A 2BC9A 2VHTA 4JS0A 4NCIA 4HAUA 3QEOA 4Q9KA 1JQLB 3LX8A 3B5JA 5C4GB 1NLYA 2WWIA 4C0AC 3F3YA 5EE5B 3U5ZB 3GFPA 4IDOA 1N6LA 5K8LA 1T0JB 1EWRA 1EWQA 3QBTA 2R2AA 1G7RA 3VTKA 2RAPA 2EYUA 4CEHA 4RSGA 2G77B 3CWQA 1LV7A 4TZ6A 1AIPA 3KKMA 3MD0A 5DYGA 2JJ2D 4NYJQ 3QF4B 2GF9A 2BV3A 2ATVA 4Z1MD 3JVUA 1SXJB 4FCVA 1P9WA 4M8NE 1SHKA 2R8RA 1ZD1A 1BIFA 1ANKA 2ZREA 2ZRGA 3LO5A 2X2EA 3ZJYA 4HLUA 3SEAA 2PZGA 2FSGA 3BH6A 1AGRA 2MSEB 4TQAA 4BUJA 2IEYA 3T35A 4KBGA 2AN9A 5FOWA 4MYTA 1TEXA 5KNDA 2WOOA 2BEJA 1T3SA 1UKYA 4UXHA 1ZM4A 2Z4RA 3K1JA 2QM8A 1E9BA 4NYIR 1DELA 1K5GA 3IDQA 4Q1DA 1OH7A 3AF0A 1XTRA 4TL7A 4I1VA 1GITA 1MO4A 1KHTA 2C78A 1TNDA 1W48A 5FBLB 2K5UA 1X1RA 4KJZA 2MMGA 2PZFA 2ZE5A 4D4JA 4TZ0A 2CJWB 5J4YA 1U0HC 2Z83A 1KNXA 1M6NA 1HTWA 1P9NA 2WWYA 2J7PA 3THWA 2HUPA 4YDHB 1NN5A 4Q4LA 2ANCA 1FW6A 3DOEA 2ZYWX 1HQCA 2ZUCA 1IN5A 4B3XA 2ZI4A 2CHGA 2WAYA 1CBUA 3LNCA 3DL0A 2NO7A 2O8CB 4LBYA 4TN1A 1E0SA 1P60A 4AY2A 2JLXA 1S1CA 1KY2A 3LY5A 1XJCA 5TVKA 2GZAA 2CCJA 2PX0A 4BFSA 3A36A 1VCIA 3THXA 3CPHA 2JASA 3P32A 3TJZA 1FQKA 3BB4A 3MWLA 4UNRA 5J47A 4IDQA 2F55A 2H17A 4UKDA 4LHVA 3OEHA 4BECA 5FOXA 2VP5A 4HLUC 3GMTA 2XNDA 4LJ5A 4XWOA 4WA7A 5GADl 3QIAA 2IS2A 3QKSA 3QXXA 3U44B 2GKSA 2ODWA 1G3UA 1OXXK 2J7PD 3U6BA 3FB4A 2P65A 1KI7A 2OCYC 1NBMD 2OFOA 1M7BA 2OLJA 4WAUA 2ZR7A 3TVDA 4BFYA 3EIHA 4RJLA 4A0RA 3QG5A 1YKSA 5C4MA 3EX7C 2QZ4A 2ZJ8A 2C5LA 2F6RA 1ZVQA 4P4TA 4NKRA 4WZAE 2FV8A 2NGRA 1JI0A 2WBLC 4EJSB 4BEJA 1E6CA 1GTVA 4B71A 1XTJA 1XTIA 1J90A 4XVQA 1BH2A 1VTKA 5GJVC 2IYVA 2WV9A 5JHGB 3ZS8A 1CS4C 3LVRE 1E2JA 1GSIA 2AX4A 3E1SA 3EPHA 3OEHD 4N0DA 4UNPA 3T06B 1E96A 2Q3HA 1GVNB 1KI8A 2AR7A 2YYZA 3RDPA 4ZCIA 2XNDD 4YLGA 2I4IA 2QROA 2ZANA 2BBSA 3IGFA 3GLIA 4FCWA 2C2HA 1OB2A 1US8B 1Z6XA 2X77A 3I1FA 3QVUA 4EKDA 4CGZA 1R8QA 3PITA 1ZYUA 2RHMA 4RZ3A 2IYQA 3RWOA 3X1DA 2QT1A 1WMSA 1Z06A 3AB3A 1Z0DA 5DHFA 1HA3A 2XOKD 2FFAA 4WXPA 4JBYA 4HAVA 5LB4A 4A15A 5H8WA 4QGHA 2OCPA 4QKQA 2N46A 2YVUA 1XXHE 3QXJA 5BXQC 1SKYE 2JJ8A 5EE1A 5J5CA 3PEYA 2V54A 1KI2A 1L4YA 1Z83A 2I1QA 1E1RA 1OYYA 4Q01A 1OT3A 5L3RA 1W1WA 2BBTA 5JEDA 2A5GA 4HDCA 4Q19A 1E9FA 5F9HA 2F9LA 5E95A 3SHWA 1R0WA 3BD9A 4U5XA 1JJVA 4BE7B 3Q7QA 5TB5A 5AJVB 1M7GA 5FUWA 2WM9B 1KDOA 3W8NA 3RC8A 3IO5A 4JYCA 1G17A 2J0VA 3ZVLA 3LQRA 3NXSA 3RS3A 4U7DA 4OHXA 4IVRA 2IA5A 1X8KA 2ZSEA 2BCJQ 3A4LA 2NMVA 3OHMA 3GFOA 3B9QA 1KK3A 3A6PC 3PCRB 1G8HA 3THYA 1NSTA 2BMFA 1UEJA 3WMEA 4DVGA 1NLFA 3WYAA 3R9WA 2NZJA 3B1VA 1VYUA 1YQTA 1YZTA 3BE4A 3HU3A 4ILEA 3VQTA 3VU9A 5AJXA 1YZKA 3T15A 4LBWA 2CK3A 2PJZA 5CIQA 5FTLA 4OI1A 3RAPR 1X6VA 1YJ5A 4ESVA 1Z6GA 3HJNA 2GF0A 5FOSA 2CBZA 1KDTA 2BMDA 1J8YF 1ZM7A 2VTKA 2ZI6A 2J0UB 2ODBA 3SYLA 421PA 2W2XA 2VSOA 2R6CA 3GJ6A 3L8ZA 1XJQA 4PFSA 1Z0JA 4B35A 2GCOA 5BN4A 3EG5A 1XEFA 2HXSA 1OKKA 3TGPA 2DPXA 3R7WA 5EP1A 2OBLA 3I61A 1ESNA 4HB0A 5FOTA 2VP6A 4GFDA 5FBRB 4OHZA 2X19A 2PLFA 4LZZA 4TMWA 1G7TA 2QMHA 1QBKC 1QHYA 4OYHA 1QHNA 2DBYA 5IDVA 4RD6A 2FX3A 2G6BA 2WWXA 3W6PA 4AYTA 4O2LA 3CIOA 2W2TA 3RS4A 4PC7A 5E3HA 2H18A 5F98A 2CK3D 2CLDX 2CL7X 4Q4JA 1KSGA 3KJEA 621PA 1G6OA 1HY3A 4X8OA 3CR8A 2I3BA 1KMQA 3OZXA 5JWRA 4URWR 5A0FA 1OPXA 3UMFA 1CP2A 1MT0A 3QVVA 4WBSA 3AM1A 2FMXA 1J7KA 2VP9A 1AN0A 2CE7A 1D5CA 1RVDA 2W00A 1ZCBA 3VMFA 4C7OB 3GLGB 4NDZA 3E70C 4QGGA 5F9FA 2B92A 3NBFA 4DSNA 4KSBA 2VP4A 3FE2A 1NLZA 4D4MA 2ZE8A 4P4SA 1GKIA 4RFVA 1G3MA 4W5JA 2QPTA 3C16C 4KFTA 4CIDA 2J0SA 4DKXA 1S0UA 1E9SA 2FNAA 2QGZA 3EARA 3L0SA 1EFUA 1TQ6A 4OK5A 3PG5A 4QJ5A 1QVRA 1BMFA 3WYFA 4ARZB 4DJTA 2QNRA 2F9MA 1E9AA 3IIMA 1MRSA 2WSSA 4PO8A 1R2QA 4UNQA 2IYZA 1CJKC 4BPBA 2JLQA 3I5XA 1E69A 2ZVPX 1EFHA 1KAOA 1P2UA 2IW3A 3QXHA 1TTTA 4Q9JA 2O8EB 1AQUA 1W2GA 2FZLA 2IUSA 4Q1CA 4JMPA 3A37A 2YC4C 2IHBA 1TF5A 2OCBA 5FOVA 1SVKA 3SHFA 4QHYA 4IFBA 1BYUA 1UM8A 2G1JA 1TUIA 3MUFA 5UKDA 1G8YA 2XX3A 1N2CE 5FUVA 2CNWA 4AG6A 2AKYA 2HF8A 2PCJA 1UBCA 3P20A 4HAXA 4YMSA 3BAFA 4M4SA 5JS7A 1E9EA 3NDPA 3GLIE 3KUDA 5CM8B 1M1YE 4B3BA 1M34E 1RJ9A 5L3QB 1OW3B 3M6AA 4DEXA 1G8FA 4A8JC 3BB3A 1IN4A 4IRUB 4B75A 1NVUQ 4M1WA 4AYWA 4X8HA 3SU8A 3PEWA 1N6NA 821PA 2QPOA 2OCAA 3KX2A 2VHUA 2P67A 4BASA 2PX3A 3CRW1 2CCGA 4HLQB 4D0NA 2W6IA 4TLBA 4QRHA 1BMFD 1D2MA 2ASEA 2WVJA 1Z0KA 2WSSD 3KL4A 4QFMA 1YR6A 3ADCA 3X1XA 4KFUA 4FMDB 3GQBA 2WPDA 4LJ8A 2A5DA 1PUIA 3H84A 3Q5DA 1HV8A 3CNLA 1CRQA 3GLFE 2JLRA 3BK7A 4EQ6B 4FWIB 4IEEA 1QG2A 1A2BA 2QA5A 4B44A 2XB2A 4I4LA 1R8SA 2DCUA 2WIAA 3MWYW 3QENA 4RD0A 2AWNA 1JB1A 2CNWD 3DZ8A 2N42A 4PHGA 1Q1EA 4ABYA 1IY1A 3T34A 2A78A 3VR4A 2DFTA 1AZTA 4KBFA 4YQFA 5C18A 4P3YA 2IS4A 2B7CA 2ZTSA 4I1SA 3UIEA 2YWEA 4JLAA 4CEJB 1LNZA 1NN0A 3FTQA 3KJIA 3KJHA 4V0MA 2G83A 4LHZA 2VHCA 4LPKA 1W2HA 1XNJA 2WWHA 4IXMA 4JSYA 4TLDA 3UG6A 1KJYA 5EUMA 5CB6A 3FDIA 2IYUA 1KI4A 2IC5A 2JDIA 5HE9A 3TNFA 1F2UA 3Q8XB 1FOEB 2W6ID 1VG9B 3RYTC 1HUQA 3LVQE 3BFKA 3QNUA 4HUQB 3AKEA 3LA6A 4JLOA 2ZJOA 4CVNA 2ORVA 1DVRA 3B60A 1CKEA 3NTUA 2ZYVX 4H1UA 3UANA 1ZJ6A 4I81A 3CNNA 2JGNA 2RB4A 5E4FA 3MSXA 3ZGXA 4JL5A 3PUZA 2P5TB 3SE0A 3H0KA 2LWIA 2OM2A 3HU2A 4QJ4A 3GLHA 5KTYA 1N6IA 3CWZA 4LDJA 3LXXA 4AC9A 3NC0C 1UADA 3B1WA 2H16A 2ZSDA 3LLMA 4F93B 4MDFA 3BOSA 5KHOC 4EPTA 2DFKB 4F91B 2XXAB 1FUKA 1PZNA 4TTPA 5EJEA 5LD2C 4NCHA 3OE7A 4Z51A 1OH5A 3AVVA 2LCFA 2WJJA 1H8EA 4M1TA 2A5FA 2GZDA 5DLQC 1TQ2A 5KOYA 2JJ1A 2H1LA 4IOKA 1RW4A 4KODA 1AA9A 1LTQA 4ON9A 4PANA 4GZLA 4BRUA 4BZPA 1YE8A 1Z8FA 1AKYA 2BDTA 1Z29A 4Q03A 3REFA 1H8HA 3ZVNA 2GAAA 3LFUA 4DCVA 3ZYCA 4PX9A 2Q3FA 2EFHB 2F1RA 2OAQ1 1DE0A 1FTNA 2V55B 3NBXX 4OJQA 2Z0MA 3U3MA 5KNCA 1GNQA 1RYHA 1VHTA 1OH8A 4M0LA 3B85A 4Q7LA 4A6XA 2GRJA 4LWZA 1GFIA 4WOPA 4JVMA 3ICEA 2O8DB 2GDJA 3D7MA 1E3MA 1XTKA 2F1HA 3SYKA 1C9KA 2A2ZA 4MRVA 1DEKA 4DWJA 1ZW6A 4BZQA 2VYFA 1A4RA 2HT6A 1Z0IA 1VHLA 3MCAA 3K0SA 5BQ5A 5H70A 1R5NA 1QHGA 1Z47A 3WBKA 3OE7D 5JJLA 4NHOA 1UKVY 2FH5B 5CM9C 1KI3A 2C04A 1H8ED 2BWJA 1DAMA 3IIJA 4QM7A 1PVOA 4F4JA 1JECA 4JLDA 4URZR 1ZC3A 1T5LA 1P5ZB 1AGPA 2JJ1D 3ECCA 2IK8A 1KSJA 2F1IA 4BLRA 1UBGA 1G19A 4CT4B 2BIFA 2OE2A 4OQXA 3NVAA 3LD9A 1PLKA 1W5SA 3KXLA 3AUYA 2ONJA 3IEVA 1IONA 1IHUA 4XWAA 3T5GA 1NY5A 2XTMA 3L0PA 3FOZA 5F3WB 1MABA 1SVLA 2ZE7A 2ZQ5A 3BIFA 3P1JA 2Q0HA 1PJRA 1E2PA 1XXHB 1DAIA 1SKYB 3HPQA 4HB4A 4HZIA 1XEXB 1DG1G 4OI2A 1G7CA 2FWRA 2IYXA 3A1VA 3CR7A 4TLCA 3WP0A 1LF5A 5DO9A 1SULA 2GETA 1DO0A 3OFND 5AUPB 1Z5ZA 1XMVA 1MV5A 2XTNA 4JVNA 4QNRA 1VECA 2VSFA 5D3MA 4IVPA 3WRXC 5EE3A 1E0KA 2QTVB 4D26A 1JR3E 2XZPA 3P26A 1J8MF 1E2GA 1G5RA 1N6HA 4DLWA 2UKDA 3GEIA 1R5OA 2MMCA 3WNBA 2ZRCA 1Y3AA 2NPFA 3SJAA 3KKOA 1E2EA 2PL3A 1K6MA 3K0FB 4JBWA 2UZ3A 4TYYA 1Z07A 4LYJA 4W7SA 1JAIA 3EZ7A 3ZS9A 4TMTA 4B33A 5JBQA 1GWNA 4JT2A 2DWPA 4ACAA 4DSOA 2H8KA 1UEIA 3VNUA 4MKGA 4JVLA 1IJFA 4LYFA 3AVOA 1IN8A 4MKFA 4F38A 3DM5A 2QRNA 3KB1A 2Q9AA 5GJCA 1F60A 4FW9A 4M53A 2OHFA 2OUKA 3AP1A 6Q21A 2BMJA 3NIBA 3TR0A 2JJ2A 3M0EA 3U7GA 2YOFA 3KTAB 4IKEA 1NMXA 1Z0AA 1TU4A 2G9NA 4TYWA 1EG7A 2OXRA 2R9VA 3KDSE 4V0ME 3U60B 4HYYA 2O8BA 2GBLA 5FUYA 3B6EA 1E9RA 4RVCA 1CF4A 2V6JA 2QGNA 3HU1A 4DDUA 1IXRC 1UAAA 2ZJ5A 1G21E 4IOJA 5JRJA 1IY2A 4MRPA 4Q9IA 1XB2A 2KJQA 4KCGA 1FX0A 2EQBA 4JLBA 4M9ZA 2D06A 4B34A 4W5HA 5G53C 2BJWA 1W4BA 3VX4A 1Z08A 1P4SA 3RVBA 4ZKDA 4L8GA 4PZLA 1KIMA 2A30A 2AK3A 1KSHA 1AK2A 2G0NA 3FFAA 4BGDA 2BEKA 1E2DA 4PPGA 2GILA 2D3WA 3K09C 5DI3B 3CONA 4P31A 3Q72A 1KI9A 4KU4A 3GLHE 2R6AA 4A2QA 4Z54A 4WZ6A 5EP2A 521PA 2QAGB 5JECA 5BYKA 2AFIE 2YNMA 2JIZD 5FPSA 3TSZA 2NO0A 3FKQA 2ZVQX 3LQQA 2DWOA 4CEIA 5BN5A 1RE0A 3SR0A 3THXB 3A8TA 2OZEA 3QPWA 3MRSA 2EU8A 1Q22A 3I73A 4LYAA 1W4AA 1JALA 2O5VA 3WY9A 3ZD7A 4NH0A 3REGA 1A1VA 5KNBA 1P7CA 2ERXA 5DE3A 3FPAA 1ZMXA 1Z0FA 3DEFA 3SJBA 1EGAA 1E2KA 4DLUA 5FR2A 5HE8A 4LCBA 5IK2A 2CCKA 1EX6A 3RS5A 3VKWA 4PZYA 4HAZA 3LH5A 2W83A 3EZFA 3FMFA 4Q4HA 3E2IA 1KAGA 2OFXA 4E07A 1ZM2A 5HCIA 2JAQA 1ZAKA 3L43A 3ZIAA 1I4LD 1VYTA 1N5LA 3FKSD 2GBLC 4DDWA 4E22A 1XD8A 2E87A 2QE7A 2Z43A 1OSNA 3NKVA 5AJWA 3ZQJA 3PENA 3THOA 2CE2X 1Q3HA 1QRAA 3KFVA 5SZIA 2FEOA 2ZRJA 3NHBA 4KLNA 3ZLJA 1GL9B 1NKTA 1KKLA 3T12A 3TSWA 1KI6A 4EFMA 2GJAA 2H5EA 3BORA 2HEIA 4B76A 1Z2CA 4OBEA 2X1VA 1JR6A 3MJHA 4XVUA 1NBMA 1R6BX 2MSDB 4RZXA 2YV5A 2ZJYA 1ZUNB 3VKGA 4NCNA 2FFQA 2GCPA 3OEED 2RGNC 4IOLA 4M9QA 1CJUC 3OESA 3WHKA 4AK9A 2OILA 2WZQA 3AUXA 4NL4H 3H86A 1Q3TA 1U8YA 5AR1A 5CK4A 5IK2D 3Q85A 4DLTA 4DLYA 1P62B 4IDHA 4Q9HA 1VPLA 4HZUB 3GLIB 2WTUA 1FMJA 2FFHA 2A5YB 3OIUA 2HV8A 4G5GA 4YMWA 3L0IB 4FMBB 1A5TA 3RS7A 3ZIAD 4HI0E 4B2LA 2QL6A 2WJGA 3LLUA 2O0KA 2A9KA 3RS2A 1SHZA 2VH5R 2REXB 2QE7D 4QBGB 3ZVRA 2RGBA 3ND9A 1NKSA 5JWHA 1OFUX 4M2LA 2WOJA 1ZD9A 2V7QA 2VQSA 3MLEA 5AUQA 4LX0A 4HAYA 4DLXA 2B8TA 4UXJA 2QP4A 4LV8B 1F2TB 1NIPA 1MO5A 3VR3A 3TH5A 3AKDA 3QF4A 3GLFB 2XOKA 1LW7A 1G41A 3D6TB 1SXJA 4P33A 1JJ7A 1GG2A 2HJGA 1G9XA 4GP6A 5EXXA 4JT4A 4B3CA 4V0LA 5DNYB 4KYIB 4NPHA 1XCGB 1RRPA 2IEZA 1LS6A 2A7QA 2NO1A 1UF9A 2PMDA 5KYKA 1JXMA 3A4NA 4JLMA 3TW8B 1DPFA 2EYQA 3NBYC 3T1TA 4C9BA 4FMCF 4GMXA 3GP8A 2QQ0A 1CU1A 4V03A 3T5DA 3B82A 4EUNA 1LFDB 5IRCD 3W90A 2ZRNA 3EZ6A 3VU9B 1XPOA 4MUBA 1G4AE 2EWWA 1X8JA 5FI0B 2VL7A 3T1QA 3TR5A 4PSVA 2CJWA 2ZI3A 2ERYA 2FDCA 5G40A 2V7QD 3UMSA 2DYKA 4OQNA 1TQ4A 3C5CA 4JSTA 5KPDA 4PSKA 1NN3A 2UVQA 5BWMA 4KVAA 4N1AA 1N5JA 1MO3A 5TDHA 3RHFA 2C77A 3T1VA 4Q1AA 3EC1A 3ETLA 3AVTA 1RZ3A 1SGWA 2IYTA 5KSPA 3QI2A 1P73A 3TRFA 2QN6A 1OF1A 4KAXA 2WMNB 1NP6A 1SXJD 1OIWA 2NPIA 4GZMA 1HYQA 2AKAB 3QY0A 3R7WB 4EFNA 2O8CA 1S9DA 1SQ5A 1FP6A 2WMOB 3HP1A 3UKDA 4YMUA 3CX6A 3IILA 5C1BA 1NVVR 4URYR 4M1MA 4U02A 1WA5A 1IJEA 2SHKA 4HATA 1FNNA 1XD2A 5KUTA 2G3YA 1ZM3A 1KDRA 2P5SA 1F48A 4HEJA 5EXTA 3F0TA 4ERNA 1P6XA 3U7FB 2DY1A 1G4UR 5B30A 5JSZB 2QT0A 1SXJC 3H2YA 3UK6A 4TMVA 3QUSA 3QE0A 1OYWA 1HEIA 3WRYC 5JZVA 4IDPA 2IYLD 2C8VA 1O87A 2OBMA 5J4VA 1ELOA 3U4QB 1E2QA 1XTQA 4ZPXA 5JCPA 2ZI5A 3FVQA 2D7CA 4D80A 4HB3A 5G3ZA 1WCV1 2GAOA 1H65A 2HJVA 4JLNA 3T1OA 1OLOA 3PQCA 4DCSA 4WIAA 3U44A 1W36B 2YJTD 4LYHA 4QL3A 4A82A 1QHHA 1F6BA 2PLRA 4XTCS 5FPKA 2F43B 3V00A 5BW8A 2WSMA 5H1YA 3Q5EA 4E09A 1Q1QA 2NO9A 4MYHA 2BBOA 2RCNA 4PQFA 3CW2A 1S2MA 3V9PA 1L7VC 2JLYA 2C9CA 3TIFA 4AYXA 1II0A 4LBVA 3AP3A 4JBXA 4C0BA 3MG9A 4OK6A 3SDZA 2GVZC 1RRCA 3QKRA 2DB3A 4XWKA 4TMKA 3N70A 1JEEA 1KGDA 5HR5A 3QBVA 1IY0A 4MKHA 2ZRKA 2YWHA 5DHAA 4BFWA 4DT1B 2YKGA 4MQBA 1TADA 3KQKA 1ZCAA 4Q47A 1Q1BA 1RRGA 1XPUA 2AL7A 4UNNA 4URUR 1AKEA 2OXCA 3W3ZB 5AK0A 5A4JA 4I1OA 4H9GA 2R44A 3DOFA 4LJ6A 1V5WA 1XD9A 1D9ZA 2WKPA 1NBME 4PC2A 4KFSA 2BBWA 2ZITA 1PLLA 2VP0A 1RPZA 1ZC4A 2QUZA 2ZRPA 4M22A 1BO6A 1KMHB 1II8B 2WKQA 3UXMA 4PQRA 4G5OA 4URVR 4AKHA 5HZKA 5JI2E 4GOKA 4UJ3A 4C0QC 2PEYA 5KU1A 1R10A 721PA 5IHPA 2VA8A 4YXWA 2YWFA 1OIVA 4BFZA 2WJHA 3LBNA 5FPTA 3BJIC 3K9LA 3GJ7A 3WXMA 4A8JA 5KSYA 2IS6A 3RC3A 3NH6A 3LBIA 2D62A 1W7AA 2GJSA 3PV0A 5P21A 2WJYA 2CMKA 4Q4AA 2RHDA 3KQUA 4GPTA 1KO4A 4XTRA 3AF2A 2ZU6A 2O52A 1ZBDA 1XDBA 2F3TA 3EZ9A 1VYVA 4PQYA 4EJSC 3GFTA 2ZJAA 4L4UA 4NCJA 4B74A 4A4DA 3S1AB 2HYDA 5BN3A 2BOVA 4BRWA 1A82A 1P9RA 1EFRA 221PA 4WW0A 1TPZA 3IPXA 4DIEA 1NI3A 3HPRA 4Q7KA 2WIBA 3CF6R 3UG7A 4XSGA 2WWFA 4EIWA 3AVWA 2GWHA 2OT3B 1OIXA 4GL2A 1OH6A 3RNLA 2R6DA 3BFVA 3K0EA 1ZNXA 3AKYA 3K9NA 4YXWD 2RGGA 2J0UA 2C96A 1P61B 1YZLA 3TUIC 2CXXA 4G5QA 4B2IA 1Z6TA 3IUYA 3QSYA 1RRFA 3K70B 1S3SA 4MRNA 2WHXA 1FL9A 1HT2E 2EFDB 2C9OA 3DO6A 3AVPA 4G0NA 5KDDA 1F2UB 2NOAA 1ETUA 2FN4A 2OSBA 1RC8A 1XEWX 3DHWC 1KO7A 4US2R 4QC2A 3G82C 5CDFA 4F4CA 1GM5A 3OF5A 4A0HA 1XX6A 4AKEA 4PO1A 4XIGS 2NG1A 1XBTA 4ACBA
chains in the Genus database with same CATH superfamily
3QTBA 4N0EA 5LOVB 2OHOA 1ZSVA 5EKUA 1CF9A 2WJPA 4ZT2A 3VNAA 3LWZA 2OVFA 1ENZA 5FOQA 2XRMA 4GOXA 1QE0A 1Y8AA 2IPLA 4MWCA 2VYND 5DNDA 2ALJA 3KNZA 2C5GA 4RMNA 3IALA 1TYCA 4KXWA 2DPHA 3IHTA 4A0QA 1VLQA 4P81A 2LDBA 3JQAB 2AUTA 1DG9A 3LC0A 1TM4E 4FHEA 5AVUA 1F8XA 3BWCA 1PRYA 2V03A 3ST7A 1SAYA 1WZ2A 2C0PA 2ID4A 1IY9A 4V0OA 3TEFA 1F7VA 3GFGA 5IMSA 2H2AA 4INOA 3TNJA 3O38A 3T5AA 4K6CA 3KVNA 3HXKA 2GA8A 4N7RA 4KR3A 4P7GA 2ZI7A 4O4HB 4P08A 3IB6A 5FADA 3GRCA 3ICOA 1N6OA 4PNPA 1DFGA 3RRXA 4Y6RA 2JFGA 4K3VA 2JKVA 3GOQA 3TZBA 1RBZA 1FP7A 2V4ZA 2C5EA 2JBWA 1SVIA 2IUEA 3B1XA 1U0OC 1G18A 4ZRDA 4R1TA 2IHYA 2BGRA 2ID7A 2C9YA 2YINC 4IGEA 1X3LA 4TRNA 4L3VA 4V02A 3VTAA 3GLGA 4Y7DA 5CNKA 3SEZA 3KU4A 2IZ5A 1FSZA 3G7SA 4BNTA 3IB3A 1F12A 5DCYA 3B1YA 5K4HA 2PUGA 3VJRA 4X1IB 3GJXC 2YCBA 1KYXA 1OX4A 3ESBA 4N0PA 4IDEA 2OXTA 5EKSA 2E5LB 2ATXA 4MYSA 2EFGA 2JLUA 2GHTA 4N39A 1DT3A 3F5QA 5HBRA 3U4HA 5KU7A 2Q6KA 3CF2A 2PRSA 1OZGA 4BHTA 1VG0B 3F4KA 4DV7B 3PDHA 3N1UA 1SCAA 3CE6A 2DTEA 3E15A 1ZEMA 4OM8A 2OAEA 2W0SA 4Q48A 3VZQA 1EK0A 4JWTA 1PFWA 3LCRA 2GZSA 2OHIA 1V26A 3FBWA 3LS2A 3VI4B 3UMRA 1NBIA 2NVUB 2ZUVA 1MJFA 2OGWA 1K6IA 4GOOD 5JFGA 3SJZA 2DBRA 5G4KA 1FK8A 1YDGA 1GADO 2CNNA 3C74A 4CMKA 2E6UX 1SG0A 3O6VA 3PF8A 1DJOA 2NYAA 1YA6A 2HRZA 5K05A 2WSYB 1YBAA 3I58A 1IWPB 1LTKA 1XQVA 3LHIA 4LC1A 4Q1BA 2IDZA 2JI8A 3D1LA 3NORA 4IFEA 5TSDA 3GWGA 1UC4B 3QE9Y 4K7JA 4NJEB 1V16A 3WDMA 1LJLA 4HWTA 3A26A 1XMSA 3DD1A 2E5WA 1ESEA 3FSGA 3K1YA 4Q02A 4BNDA 1B93A 3UHOA 2Q4TA 3WK9A 4BKRA 4B84A 4DXHA 4E51A 2NV2B 1NSFA 3LZCA 3PXEA 4E94A 1EFAA 1YJAA 3AONB 3HEAA 5FBVB 1K5HA 2YQ5A 5L3QA 3AC0A 3DTVA 3DBHB 2MYTA 5DFAA 4MH0R 1A50B 3FHLA 4OJYA 2AZMA 2QKYA 2C5FA 4XIIA 4RTKA 4K46A 1GA4A 4DLZA 2PR7A 4KVGA 1ODCA 3AUUA 4MIYA 3ZKWB 1NXWA 4MHOA 3GZTB 5JJ5A 1LDBA 1B3RA 1T4CB 1CWUA 2CEAA 1WD7A 3VDQA 2H92A 2WTEA 3M2PA 3EPKA 3OEYA 4CG1A 2DUWA 3CJTA 3GUHA 3V8MA 3ZBUA 4DDTA 5LOVF 4L16A 4BJHB 4PRLA 2AZTA 3LUCA 1RIFA 2N0SA 5DGTA 1IQPA 4KQFA 4QARA 5IX8A 3NGMA 4FVTA 1AKNA 3T0FA 1VMEA 4IZOA 3M49A 4PSUA 4CM4B 4B3MB 4KIWA 3T3DA 5CTAA 1KVUA 3NHWA 1V25A 2QG6A 4ED9A 1T4GA 1XELA 1T0HB 2BUBA 2Q9BA 2O4UX 2ORIA 2R65A 3DVRX 3IELA 3SSMA 3SZRA 3ZDRA 4BX2A 4YRTA 1EM8A 1YRHA 1ZNYA 1SB9A 3COPA 3P5SA 2PUCA 1H3EA 4UUAA 1IQUA 4L6AA 1M2OB 1VBMA 4YUZA 5E7IA 1JG3A 3D2BA 1Y9AA 1RLOA 3M3DA 1HQYE 3AO0B 1G59A 1UZMA 2WKSA 4FN4A 2FUCA 5I4KA 2GXSA 3CEAA 1HI9A 3ROQA 1P2TA 1JIJA 4BS9A 1U1IA 1CTQA 1I0ZA 4H31A 1PJCA 2EJCA 2CNKA 4QXMA 1W0KD 2CY0A 2Y4OA 1N5IA 3AJAA 3C5EA 3G49A 3CSUA 3BDVA 2J46A 4DRZA 1ADGA 1JNXX 4IZ6A 4OXXA 2NUAB 3EXFB 1KYVA 1DIHA 4S0XA 4D3YA 5JLJA 1PR2A 2O1EA 3BWDD 2BFWA 2Q6LA 3KJNA 2G5GX 2H52A 1BDJA 2IUFA 3AV0B 4TSFD 1PBTA 2D1SA 2HNKA 5KTOA 3W5VA 4D0SA 1N0VC 4M54A 5JR3A 2B5VA 3MNFA 2D4HA 3OQJA 3T54A 4EYKA 3GDGA 5JTTA 2A9QA 1OI7A 4YONB 5IXJA 1YDMA 1FFWA 3CX7A 2AN4A 3M4YA 1DKPA 1T0IA 1W5TA 3CKMA 2DUUA 1U3FA 3VU0A 5JH7A 4QDXA 2Z8XA 2X7HA 3L1UA 4KV7A 3TOXA 4Z2AA 2YL2A 3AP2A 2ZBQA 2MHCA 4OSOA 2MDTA 2R6FA 1U7DA 1KH3A 2CHVA 3NT5A 4JL6A 2IBMA 2Q0XA 2B6HA 4R9UC 4ZVVA 2FYTA 2C9BA 2VK1A 4B46A 1BWQA 5HUQA 5LPNA 3CRZA 1TQDA 2PUAA 1JBKA 1HFJA 1R8JA 1UXOA 4R8MA 5THXA 1JS1X 4JQOA 3V8NA 5JAHA 2BVNA 3T61A 1S9HA 4ZO8A 3FYSA 3QTLA 5COAA 4PHTA 4UHKA 1X9IA 5DKFA 4AVYA 2N1BA 4IS2A 3C6MA 3JYLA 1UOOA 2ZWMA 1SUCA 2IYFA 2AOVA 2VRCA 1XK6A 5LA6B 4NV0A 3MGKA 1U2ZA 4KFRA 2EW1A 5KWVA 4CEIB 1XCBA 1ATIA 2Y1OA 5CCXA 2HSZA 2Z2XA 2JA2A 3AEUA 2X15A 4DG8A 2Y0BA 3T41A 3ICQB 1LK7A 2R3SA 2CUNA 1SU4A 1XZBA 2EJWA 1B16A 3EVZA 1DTWA 3WGNA 4BFUA 3HS3A 2C4WA 1BE0A 1UK7A 4TLLB 2V6IA 1CFJA 3WWOA 1PNOA 2DBZA 4LHEA 1S2NA 1JA0A 4QFDA 4YB8A 1UIMA 2FE4A 4MVXA 1GZ7A 1K2VN 5K1ZA 3SKVA 1IBSA 1G0NA 1X74A 3GIDA 3C3CA 3OA0A 2QP3A 4BVLA 3X1WA 5AMXA 2F8SA 3D81A 4US0R 3AEQA 2YXEA 3A28A 5ALZA 3GCXA 1HQKA 3KAKA 1SBHA 2R5WA 2QTAA 4KSYA 3UTDA 4ZGWA 5LMNB 4AKSA 5IYZA 3R0QA 1GGNA 5HQJA 4PPNA 1E0DA 1ZGJA 4S1VA 1QCYA 2HLDD 4GI5A 1QF7A 1KE1A 3JPYA 3VYWA 1PUJA 4ZQGA 1N9KA 2NQ2C 4KWCA 3PUVA 1CK4A 1DRKA 3M89A 2E4XA 3FH0A 3EEOA 1SCIA 2J41A 3AEZA 2V0NA 4DV1B 2CL0X 1KDPA 1W75A 1YJXA 2C3PA 3D3WA 4RX1A 3ECSA 1VE9A 3FKSA 4R9SA 5DHSA 1P4AA 4C6HA 2GXQA 2JRLA 5B64A 4M6WB 4FYYA 4IIVA 4ENRA 3LV8A 3K5HA 1O58A 4DTIA 3R9KA 2AOTA 3BC1A 3EASA 1PVVA 1WPXA 3H6GA 2AFHE 3I2JA 3R6WA 4YT5A 3IA2A 5EUQB 4YRPA 3TAXA 1KXZA 1VHQA 2DU8A 1E2MA 3C6QA 3KJXA 3QLUC 3SHTA 3PFKA 1IBMB 3BMNB 4FZ3A 4LJ7A 3VVMA 2CLSA 1H4QA 1K8RA 1PTJA 1GGEA 1PO7A 3NEPX 5BRAA 5JATA 5MF6A 2HHHB 4TLMB 4YCSA 5BSVA 3BS4A 5ED4A 2X0JA 4WTOA 5CYPA 5D86A 4IGFA 4QEDA 1V3VA 4I3FA 5DSTA 1IUKA 2LUOA 3CMMA 3PQ3A 5TGDA 3IE2A 4DZZA 5KSZA 4CTJA 2QRZA 1JHMA 2ZXEA 4DARA 4XE5A 2OFWA 1XZPA 1UAYA 2VRBA 2XA1A 2YXBA 4UC0A 3ZY4A 2XITA 3V1LA 1QHXA 3GLVA 5CH8A 4X6XA 1HYBA 3IQZA 1TUEA 4OHMA 1T2CA 5DBEX 5KMGA 1LU9A 3ZHYA 1Y98A 1GSOA 1VKOA 1QR6A 2Y1LA 1RXWA 1NTOA 2FWMX 2W48A 1U2QA 3GFBA 3LY7A 2YBEA 5T67A 2JCYA 3VZSA 5IVPA 1F5SA 2A4MA 4KPEC 4UBIA 4A6EA 1AUPA 2J3LA 1DHTA 3FRHA 4ROSA 1XHEA 4V1CA 1RWXA 4PTZA 4DV6B 4PS1A 1IDN1 5D01A 4R8KA 3YASA 1P1KA 1YCHA 3FWYA 3K0FA 5IM4A 4BYMA 1IAQA 4AQDA 4MUJA 1C8VB 3OC0A 5CR9A 4G2TA 2HPHA 5BSFA 3P2MA 4ZT7A 3TRKA 3F97A 4NF2A 5AK4A 1AH2A 2JIMA 1IHYA 2H4XA 3LDFA 3VH1A 4PY2A 3WE7A 1RWVA 4PZPA 2EAUA 4DIFA 4LCJA 1PEAA 3DZDA 2XB8A 1B15A 2COUA 5K8TA 3AQIA 1GU0A 3QEAZ 1DC4A 5E1DA 3P9XA 3KTAA 4B43A 4CQJA 4DPMA 1B7GO 1WUHS 2YYYA 3E1KA 4QYSA 3NFRA 3W34A 1UR5A 4X95A 2Q1WA 3RT1A 3TKLA 4RKEA 2HLHA 3JRNA 5GTDA 2X22A 1EFVB 4LXGA 1L4KA 3AJRA 1YHYA 4WK4B 3SZ3A 3IAEA 3A4MA 3IAFA 4EJ2A 4J1TC 5G0WA 4D79A 1SU8A 1ONOA 4D3FA 1E6UA 2NM0A 3AHEA 3IR7A 4IMPA 1SUAA 5HKKA 4NV1A 2DQZA 2H5LA 4B7UA 4DB2A 4JR0A 4GO1A 5HS4A 2ECKA 3QI7A 2W0MA 1JLLA 4O0LA 3ZY6A 1JKJB 2QK4A 3K6JA 4CLOB 1NR5A 3FROA 4FT2A 3HFJA 5BRNA 1EE1A 3NEYA 3RANA 3VR6D 3TFWA 4Q6WA 3PD7A 1T1RA 1GNRA 1GPDG 4V3BA 1YRAA 4QULA 3CZPA 3DZFA 5AI6A 5TV2A 5BXYA 2P9HA 4H59A 1AUQA 4CN8A 2JI4A 2W2KB 1MH1A 2VDWB 2WG0A 3LCJA 4HLCA 4UHJA 4CUZA 3L1IA 1EK5A 3EZNA 4E2ZA 3LK7A 1SN7A 1A9RA 5LP6C 3HJBA 1H22A 1YO6A 4QSHA 4QOFA 5AQ1A 5ITZA 1FY2A 2GXAA 1MH9A 1A2KC 4C3ZA 3I28A 2IXTA 2O8DB 4NFHA 4I1PA 1UPAA 2RGXA 3Q7PA 4KXVA 1QTRA 3H13A 3T9BA 2WJ3A 3MINA 3PPXA 2C84A 3OIYA 3ZK9A 1N5KA 2P9TA 2HKIA 3E6AA 2OC9A 1G0OA 1YS9A 3E9MA 4Y6SA 4HGNA 4M1YA 5REQB 3ZDQA 1C4KA 4ZMSA 4BDTA 2PUDA 2WYVA 5DM4A 1ML3A 3STWA 3R9XA 4QNNA 4CQMD 1RM4A 2VF7A 1E1NA 2DQKA 4A23A 2ERCA 2EL9A 1Q2UA 3GCGA 3RRJA 4QXAA 2IUTA 2PAFA 1GT6A 1LC3A 3KYJB 4YUVA 4Y1RA 2J3EA 3THYB 1T0UA 2RG7A 2C7OA 3OE1A 4FFMA 4NZPA 4KN6A 4J3JA 3W1WA 4BFTA 4F2HA 4DUPA 1I10A 2XCLA 4MIEA 5FLKA 3UJDA 3W77A 1KGSA 4MGIR 1QUEA 2VTVA 3RRYA 2LIVA 4TUYA 4IJUA 1Y5IA 2FPKA 1V6CA 2PS3A 3QMVA 2AHOA 2ZS9A 3AVYA 2Z2KA 5AO9A 2AEMA 4P9NA 2HPAA 3TPCA 4WMLA 2QORA 1W4LA 3MD9A 3PXCX 2DFNA 1Y82A 1Z34A 4CWAA 4DIOA 3G2KA 3CX8A 1NY6A 1O7JA 5LDGA 3IE1A 2OV2A 3IVGA 5F1PA 3V1NA 4Q3BA 1Z6YA 4UQOA 1AUVA 1NU6A 1SUBA 2JLVA 4MO9A 4N65A 4ZA2A 3G85A 3VSEA 5SYMA 4DC9A 1N9GB 3PBKA 1ZKDA 3K0CA 3ZWMA 1B2RA 2GASA 2VWPA 4LIPD 5CX1B 2I22A 2GCOB 2QTHA 2VH1A 3G2JA 4ECEA 2VF8A 1N2CA 4XEHA 3TBHA 1YZUA 2XNKA 2P30A 2WWGA 2N47A 1JPJA 2PU7A 2ZAMA 2E85A 4U7WA 2R7MA 5ECGC 4EGCB 3PUHA 3MUEA 3OSUA 4WRRA 3QZUA 1SG9A 5A9TA 4HZUA 3J81k 3JWGA 3C4QA 2ZSAA 4EB8A 2Z9DA 4BZWA 4G0PA 5FNZA 4HEA1 3RADC 4MX8A 2JHCA 4ND3A 4KREA 3ONNA 1TLTA 1EXWA 2AXQA 3UHPA 4YRGA 1Q7CA 1EGHA 4ZMRA 1O9HA 1UQUA 5H83A 4Q24A 3A2MA 2PH7A 4TYPA 4U1RA 1Y6RA 2A5JA 3AM5A 3DV0A 4LV6A 3EPJA 3KKZA 2ZSHA 1R3DA 4U7TB 5SZJA 4KWHA 3N58A 4G07A 4R40A 2HU2A 3UC9A 5AJYA 1RQ7A 5SZKB 2GYVA 4OGGA 3ADKA 1P5RA 3WKBA 1GYRA 3LYLA 4OX9B 5D87A 4PRYA 4ETMA 4L76A 1U7WA 2YMMA 3E1GA 3VNSA 5ALDA 3WWCA 3PGKA 1HM5A 1RXVA 4RF4A 1EZZA 3QYJA 4OO3A 3V4SA 3I34X 4LTMA 4A8JB 4ZHQA 5CDTA 1F2TA 1U3VA 5DLEA 1Y1LA 4PPFA 3ZV5A 2W6OA 3KKPA 1DB3A 1AQLA 1NE7A 1RLMA 4JCCA 4UCFA 2FFBA 3S6JA 1DCMA 3FIUA 1ADYA 4BQPA 1KIFA 4E12A 1IC6A 4Q4AB 3EEYA 4EOGA 1Y8RA 5C81A 4OHVA 1J97A 3C7KA 4PAOA 5FIUA 1CHNA 2Q4EA 3FCXA 4IHKA 1RC0A 4GR4A 4YFYA 1GPLA 5EZYB 3U17A 4TWAA 1TOAA 1X87A 4ZAVA 3UC5A 1GQFA 3NVDA 5B2EA 1X1BA 3AL3A 4KQMA 1WL8A 5K2MA 3D0RA 2PWPA 4F86A 3ISJA 3A0UA 1H1TA 5HTKA 3ZY2A 4CCYB 1T3LA 3I6MA 4NP6A 2YOGA 3V4FA 1VYHA 3FPGA 3LRPA 4BQRA 2GK6A 1PL6A 1CR1A 3KVVA 4YPOA 2XCUA 1JDUA 1T15A 3DPUA 4PHCA 4V2UA 3VNBA 1YQEA 2GAIA 5LUAA 1ZHOA 3AVUA 2CJYA 1I0IA 3FZYA 1AN9A 4AO8A 3GT3A 4HVCA 4QYMA 1U63A 3AM4A 1L8OA 4M9SA 4PHHA 4L15A 3IEIA 2QU8A 4DIKA 2JEZA 3OAAD 2XJ4A 3STHA 1EUCB 1UANA 2O8VA 3FZNA 2F8LA 2GQ0A 2P2LA 4EHAA 1US8A 1IULA 2XADA 1YZHA 1IUNA 1XMQB 1YWGO 2G5CA 3W5JA 1MTZA 1H1LB 2AG0A 2JGAA 3BCUA 2MYPA 3DEJA 4N9QA 4KWTA 4UNSA 4DJAA 3IBGA 4JI8B 2J08A 3D6MA 3HP4A 4I3GA 4NYJR 4OLBA 4RD2A 3AW9A 2ZEJA 4R1SA 1V8BA 1OI3A 5B37A 1XE3A 2AN5A 3EMBA 1WULS 3RLFA 1PKEA 2H4ZA 3KOYA 2GZRA 4BLPA 1RJ9B 1W49A 1WQ1R 4HYTA 5B3JC 3IS3A 1QAQA 4JXZA 5FI5A 3CRQA 1QF9A 3DJYA 1CR0A 2V7EA 4Z9YA 1DTEA 1O8BA 1PT7A 2LKDA 1TRHA 3IHLA 4LJYA 3UMCA 4D2IA 3WWDA 1IJKA 1T35A 1V5FA 2C03A 2Q21A 5JCJA 5JSZA 1DQRA 5AW3A 4TXLA 4YC7A 1U7ZA 5BSKA 4QPDA 3E3AA 3EDYA 5KYXB 1OR8A 4IAOA 3KYCB 4TKUB 4C0LA 4D3SA 1ESDA 4XB2A 1NJ2A 1YDWA 1J2EA 4B5KA 1JHPA 3RR2A 4UDYX 1C30B 4NE7A 2PT7A 4EVRA 2F2TA 3WAKA 4QVIA 2F3UA 5DSXA 3F46A 4XOIA 5AWFC 4B3GA 2QXUA 3PDCA 4Q1EA 2OAGA 4J90A 2I6GA 1WKVA 2F43A 1KK2A 1YS6A 2F59A 3HNRA 5ED0A 5J5AA 3U13A 3ELYA 4UFNA 5JQWA 1IBRA 3O84A 2D0DA 3WHIA 2F17A 4OYLA 2BELA 1QWSA 3FM9A 4A2WA 4XD7A 3LECA 4MW2A 3TD6A 1TF2A 2VQ3A 2CV2A 1Z18A 2HQOA 3QQPA 1O4VA 3C0KA 1CR2A 3KB8A 1TE2A 5JPIA 3BICA 5FWYB 2OD7A 2CFIA 4REMA 5M2QA 3B6IA 3PDIA 3COWA 4L78A 1TVMA 4QGFA 4RGQA 2GPWA 5CFMA 1F5NA 2GD2A 4R81A 4OL0A 1FRNA 2WDZA 4EZBA 2FSFA 1CY2A 3IODA 5AHOA 1Z82A 2JLZA 4EYSA 5CK5A 3VAAA 1EDDA 5E38A 2RHJA 5CAEB 3BERA 3I45A 4LEIA 1E2LA 1MV8A 2R1UA 3V46A 5LBTA 4CT4B 3TSOA 4EY5A 4COKA 1XZFA 3NC1C 4Z2YA 3ZW9A 1O95D 5B7PA 5JPCA 1J0DA 1Z7WA 3LT2A 3QM1A 5G3YA 3VRHA 5LZ9A 4UUMA 3H8JA 1SIBE 2V74B 4GP9A 2P2ZA 1Q0RA 3DYIA 1VMAA 1FU4A 4HSEA 1GPJA 2YVAA 3K0KA 1Z73A 2J5KA 3ZLTA 4BFXA 5F7OA 2IL1A 5IBRA 3GH1A 5AVVA 1JQBA 4Z9FA 1DAEA 5JQGA 1EE2A 1V9SA 2ZBRA 5EP4A 4UHEA 1TIPA 3FOCA 3EA0A 4ZOCA 1AQYA 2JJYA 3LUPA 3EZYA 4GOJA 5EEGA 3LGXA 1BXRB 1OPRA 1PW5A 3JQGA 3S2UA 1V8PA 4H77A 3UMBA 3CLUD 5AIBA 4NEGA 5HW0A 1UBSB 1WCYA 5E4YA 2PZJA 3A05A 3FYUC 2GJKA 2EVWX 2HCBA 2QYSA 4BEBA 2ZIXA 3I6ZA 2G1KA 1M2GA 1OXBB 4WFJA 3F7OA 4W9MC 3ZGOA 1CPYA 1T5OA 2M9MA 3PUIA 3UK0A 3QEJA 1U2EA 3EZ2A 4JKYA 1CUHA 2OPBA 4KV9A 5FBHA 3KEOA 3ETCA 1QWOA 3C7AA 1E79D 1Z4IA 4E08A 4URXR 4HDNB 3M6LA 1EWVA 2GNPA 3A6DA 4FYMA 4EFLA 2FTKE 3KQTA 4F9GA 4UE6A 1N2BA 3ELWA 3CN7A 1JR3A 1ZN7A 3OIWA 1Q0LA 4WESA 4Y2PA 1L8QA 4XYGA 5EWJA 4F2DA 1LSOA 2ZG6A 3OCCA 2GXUA 3TE6A 2GZ1A 1NP7A 3MEQA 2GM9A 2PD6A 4X85A 1Z7YA 4Y0NA 3A1TA 2YIVX 3L4BC 3REQA 3P96A 3CBQA 3PE4A 1NVDA 2NUBA 5AVTA 2QRKA 4OX9Y 3L04A 4EY4A 3U2QA 5KQMA 2OTCA 2EG5A 2Q4BA 3A1SA 4D0RA 3PF9A 1OAOA 1RMQA 3U16A 2ZUBA 4ARSA 4BP9A 1ZK0A 4QOSA 4DSTA 2QBYB 1G20A 1K5PA 1KR5A 2ENWA 5AUNB 1E64A 2YHUA 2JIOA 4J76A 4F9FA 5JVDA 1P6UA 1T8TA 1QOZA 2O0LA 3ABSB 5LNK1 1NVXQ 1ORTA 2H2HA 3C3MA 3HA5A 4IDGA 1EINA 2I33A 1D8TA 3IOEA 2O8EA 2W11A 1Y4UA 5I9NA 2Q2QA 2OMEA 4LYDA 3D8TA 1IN1A 1AF4A 3DDSA 3TSAA 4UZFA 4X41A 1Z5PA 1M2EA 3Q9SA 4BMDA 4B6RA 2KWIA 4IJQA 5AHXA 5K45A 3NJRA 1JXOA 3ZH9B 1N7HA 5TY0A 1V39A 1T2VA 3HXPA 1MP0A 1YK0A 4K6OA 1X1SA 3P2JA 5FEMA 1ARZA 1Y1TA 1RI4A 1KAQA 1TZBA 5I48A 1CSEE 1QPGA 1GRRA 3D0KA 3QH4A 3HU5A 3BHNA 1ONBA 3NVKI 4LPSA 1W0KA 2WPDD 3PUJA 4G0XA 4FQ7A 4IDFA 4RSMA 1M8PA 1TD9A 1ZIXA 4MKIA 1E6KA 1E8NA 1WVMA 4F3KA 1A8SA 2OAP1 4HG2A 2OK7A 4MRAA 2BH9A 3JW8A 1RXUA 2HT1A 4ESHA 2IYRA 1WZEA 1M1UA 2QJOA 4INAA 4YAOA 2JI7A 2LW7A 3BJMA 2ONKA 3SI7A 4ARBA 1B43A 4RKFA 4I6EA 5AK3A 3SXUA 5L7TA 1OHHA 5J1SB 3SQWA 1YCDA 5AOVA 3KFXA 4G41A 4DVJA 4X8MA 4M0DA 1NW7A 2EWMA 2VJCA 1WSBA 2GFHA 2Y9MB 4N4AA 4RLHA 4ND5A 3K0AA 3P5BA 1XZAA 3SBEA 5H3LA 1YMVA 2W90A 1S4QA 2JFUA 5I4IA 3E22A 4KQKA 3ABRB 4NJMB 4B73A 2GM4A 3IV9A 5D3MB 3ELUA 2LTAA 3G0HA 2Q46A 1A8HA 1GL7A 4AQ7A 3PRJA 1YZGA 3DXYA 2C82A 5B58C 3KZ1E 3KQNA 2RGRA 2DG2A 4NECA 3HK2A 2C1EA 1MG5A 1L5OA 1T6BY 3GJ0A 3ND8A 1LLUA 1SC1A 1FXWA 2J1LA 2W93A 4HAIA 4IWYA 5T6MA 5TEWA 4LNAA 4D98A 2ZRIA 2I9KA 4I5IA 4OQPA 4RLQA 3BCRA 4CLEA 3S99A 2Y77A 5G4LA 2HXYA 4O0MA 3KR2A 2J07A 4YJ3B 4FEEA 1SA0A 1DIOB 1TMYA 3GEGA 3RVJA 1UEXC 1Y3FE 2IQIA 4UTPA 1IATA 3L7CA 5HIJA 1O0CA 4D9JA 4BMOB 2PL9A 4PRZA 4PR3A 4WBNF 1IEQA 1SQGA 1M9NA 2YJ3A 5BW6B 2ZUWA 2YV3A 1KJWA 4FMDF 4ZQEA 4DJEC 4JGBA 3G89A 4D8XA 3HI6A 5F1OA 2AG5A 1JV2B 2OO5C 1D2RA 4TVOA 2PWBA 4BFVA 1UDAA 1KTVA 1CDEA 3CNBA 2B8EA 3R0IA 1MAUA 4Y18A 2WR8A 2IU0A 2GHIA 1JWLA 1P3JA 2AE2A 2X1MA 1ISFA 4FD3A 4MS4A 5AKEA 1BHSA 3MJRA 1JFVA 2DULA 4B3SB 1GILA 1PGJA 3RIHA 3NMUF 2DAPA 4LJSA 1MAHA 4ZVTA 3RU3A 3VPDA 3F49S 2HIAA 2GPYA 3BBPA 1K5DA 1YDHA 2GJ4A 4BV9A 5GJWC 1EA7A 2B35A 4ALKA 2JGIA 1G6Q1 3L93A 3CZAA 3ICVA 1RBMA 1ZIYA 3O2SB 3AXSA 2PHZA 4OV6B 4PSAA 3RBVA 4BN4A 1C14A 2I6UA 5IVHA 1WF3A 1YB4A 1NM5A 3O1IC 3P52A 1E1QA 1QFJA 2QTLA 1T8SA 1UBJS 3CLVA 1X70A 1DBPA 3SHQA 1XFDA 2HLDA 3O1JC 4YJHB 1GAJA 1GSAA 4KNYA 3RTAA 4LSGA 2IYYA 3O47A 4TRMA 2HHAA 4FSDA 5SY6A 4QUIA 3AB7A 3PQDA 2IEGA 2P68A 2FX5A 3MYRA 4UJ5A 4D0LB 2Z6QA 3P9CA 2BEVB 1Q5PA 1U8UA 4FGSA 2CUZA 1J6UA 3DQQA 4ISBA 1D9XA 2RKOA 3H9GA 4MJXA 2ZJBA 4UXIA 5FI1B 1IFXA 1JFFA 4N7JA 1TA0A 2QPAA 2P8JA 4FHFA 2I7CA 3FRIA 3VYSB 4ZGGA 4CIAA 3KOMA 4TT3A 4Y9SA 3H4VA 2I1WA 2YH2A 2R97A 4ZAWA 1OBCA 2PXHA 3M4NA 4ZVPA 1I1QB 1QQ5A 2C9MA 2YN2A 4QTZA 3U80A 4BMYA 5KPJA 4GT1A 5FBQB 3FOEC 1OLSB 2XZLA 1L5GB 4ZI5A 1KQPA 5EZ6B 3D7LA 5SYAA 4JZYA 3EDRA 3ND7A 1AKUA 1LWOA 4FDMA 2XCTB 3BRWA 3ENKA 5JO9A 2J6HA 2PZBA 3QUTA 2VT7A 4G5HA 2CB9A 2F3RA 3AQ4A 3K6RA 1VL6A 2VDQB 4N8EA 1KFJB 4DPKA 5HHTA 5LYJF 3NATA 4DYVA 4WZAA 4UAVA 2BHLA 3DMYA 3HVJA 4CYMA 4JJ7A 3BQMB 4NBNA 3MCZA 2JCVA 5LMUB 3FWPA 4NONA 4XJXA 5HEKA 5SV2A 2ZBPA 1GGFA 3N74A 3U3DA 4ZV4A 4XJTA 1KBOA 3O8QB 2E1RA 4F60A 2J9FB 3H5LA 2XKJE 1RYMA 1P9OA 1YB6A 4K03A 1AXGA 5IUKC 5KYVA 1E6LA 1KI6B 1HG1A 1P2BA 2ANBA 2R751 2UAGA 1VRWA 3QWAA 2VHYA 4G81A 5F21A 1IEWA 4JJZA 5GOTA 5C1OA 5KVSA 1ZRHA 4IYRA 2Z5VA 4FR0A 1E20A 4MGKR 5LQUA 1VE3A 4NU0A 3ZWPA 5J4KA 1C0IA 4EO4A 2Q49A 2X76A 1SKQA 4J4HA 1FDIA 2X0KA 3L6BA 3UB3A 3B3AA 1KO1A 2P9CA 3FHTA 1I3NA 3T7RA 1QYCA 3FTEA 3CO0S 3ENVA 3T9CA 3BXZA 4TQUS 4YAJA 3FMPB 2W2PA 5B2ZA 4CM1A 1ZRNA 4W5WA 4CKCB 5K3SA 1JPNA 3BXFA 4CKBB 2YHSA 1XPJA 3UH1A 4QHSA 5MN4A 1AV6A 2J0QA 3DZKA 2QJRA 4HRYA 2DFLA 4BAUA 4RD1A 4R31A 1J2TA 3GA7A 4KYUA 1K92A 4LY3A 2B4KA 3OIDA 4IGKA 2VHTA 3IQHX 5AM4A 3UA3A 2ZQZA 1YQWA 4HAUA 4NCIA 1U8EA 1RQGA 4YT2A 2X3UA 2PZAA 2MR5A 2HU5A 5C4GB 4Q15A 4NFSA 1GGKA 1NLYA 1TKRA 3VR2D 4C0AC 3F3YA 2EQAA 2P4HX 1QIDA 2WVHA 1C7JA 3U5ZB 5HM8A 2CUTA 1CY8A 2FK8A 5AXBA 3TSYA 1KP2A 1QFSA 1LC0A 1T0JB 3CUVA 3QBTA 2JD1A 3KLMX 4OSEA 3VTKA 3ZK7A 1XU9A 2FPGB 4ZJUA 5JD5A 3WLEA 1HX7A 2G77B 4JVOA 4BKOA 4BNYA 2FZVA 3KYDB 3Q7RA 4P3XA 3SDSA 1E7RA 4Q37A 2XCQA 4NYJQ 2POCA 2NUTB 2BV3A 4NESA 3WIEA 3DFIA 2P4UA 2ATVA 3C1OA 4ND7A 1GEEA 4BCDA 4FCVA 4ZGBA 5AVWA 1EIWA 3HY3A 1UMCA 2PLAA 3IAM1 3RUIA 1J24A 1ZICA 4W1PA 4D8UA 1GXSB 1PFYA 1AGRA 4TQAA 3AFNA 3RYIB 3HJCA 2IEYA 1Q91A 1QZTA 2AN9A 5FOWA 1TEXA 2X4DA 2WAOA 4QDJA 4ZOLF 2AF3C 2EJTA 2QY6A 4UXHA 4CF5A 1Q0PA 4TN5A 5JXJA 1AE1A 3LP8A 1DELA 4AU1A 1K5GA 5IM5A 4KN9S 4TL7A 1ZBQA 3NGXA 1GITA 2WF9A 1LPOA 2C78A 1PJ8A 1TNDA 1ADJA 1W48A 2Z8YM 2K5UA 4HWGA 1R4NB 3C8DA 3NAZA 1W9MA 4NHEA 2ZE5A 4D4JA 2XNHA 1U6IA 1L3CA 3B3QA 1U0HC 2Z83A 2DC1A 2IRWA 3JD4A 4P4LA 4LF6B 1KNXA 3I2IA 1M6NA 3DF7A 5FAXA 1TFRA 1DEAA 1UK6A 3ZEAA 2JW5A 1HFKA 1HTWA 3KYIB 3UNXA 1C3XA 5I7EA 2WWYA 2GK4A 3B9BA 2A57A 1XV5A 4FBGA 3UXYA 2PWZA 4Q4LA 3NALA 2XYQA 2ANCA 3KSDO 1FW6A 3DOEA 1U1DA 3DEHA 1CZNA 1HQCA 4QPJC 2IPOA 5DLYA 2LCQA 3O3NB 2V5VA 3AZQA 2P9FA 4RXUA 4ZOAA 3LNCA 3PYMA 2O8CB 4BX9A 1PJTA 1C7FA 2VYVD 3VO1A 4N12A 4IIGA 2ZR8A 4E21A 2JLXA 2UUCB 1CP3A 5TVKA 1U0SY 4TRJA 5A62A 5I01A 3A36A 2H3EA 5ALOA 2HD4A 1BN7A 1QOPB 3EWNA 1E66A 2EG9A 3FPKA 3UJHA 1ZVKA 2O6HA 1FQKA 3MWLA 5HE9A 4IDQA 4G1VA 1ZZGA 5JJCA 4P0PB 4LHVA 3ZJTA 2FHPA 2BFFA 1Z26A 4C4TA 2VP5A 4MS3B 4PYOA 3LKZA 4HLUC 3WMXA 4BNFA 5JSQA 4LJ5A 4QQRA 4WLEA 2Y1DA 2EDAA 5JMPA 1BU8A 3G5MA 1FFXA 1Y7IA 2C8KA 3A06A 4MVJE 4YGXB 2I78A 3QKSA 2IEAA 2VP3A 3DUFB 3L6DA 3U44B 1G3UA 1CQJA 2YJ6A 3M83A 4YQZA 4B3HA 4MA0A 5BSEA 3VJKA 3EGOA 3HBAA 4ONEA 1M7BA 2DJIA 2OLJA 2ZR7A 2VPZA 3GEMA 4HPWA 1EP2B 4NOMA 4Q82A 4RJLA 4JR1A 3K4QA 1T8YA 2RJOA 4GL4A 1JQAA 2HK7A 2IDMA 2PKEA 3JQ7A 4DLLA 3PFHA 4CU5A 2AFVA 1CUVA 1PFUA 4L4SA 2J9GA 3H2GA 4GIBA 1NNLA 4WQMA 1IOLA 4NKRA 2XDAA 3ZU6A 3IUMA 4ECAA 1S8OA 1K7CA 1Y7TA 2X7JA 2ASVA 3JASB 2NGRA 3HLKA 1JI0A 2WBLC 4YDRA 3SK0A 3HN2A 4KMRA 4BEJA 4QBKA 3UXHA 2ZBVA 4ADSG 3GRKA 4CKEB 4H1WA 4ZI7A 5BMVA 4JLSA 4RVDA 1UOPA 4WLNA 3I9NA 1BH2A 2JI6A 4MV5A 5EINA 5GJVC 4F1KA 3ZOKA 1OWOA 2XNCA 4UREA 1CS4C 1JILA 3LVRE 4EHNA 3E1SA 1IEXA 3VGJA 1K68A 3G5LA 3LMKA 2Q3HA 1JDPA 4ZCIA 4EGAA 2XNDD 1SXGA 2ADMA 3RC9A 4C22A 1DXYA 2WTUA 4OYYA 4ZN6A 3GLIA 1KERA 4CMBA 1MOPA 4FCWA 2C2HA 1Z6XA 2X77A 4O4LF 3OZAA 3ZU4A 1CLEA 5IJWA 3BCSA 1NJ1A 3V1TC 3NHJA 5DV9A 4BXOA 1HLFA 3RREA 3AB3A 3EFOB 3AR6A 1Y8ZA 2QV0A 1NPDA 1EDOA 1C0EA 3G9XA 3RD5A 4HAVA 5H8WA 3G9TA 1Y4ZA 3CHYA 3LUGA 2PNFA 3EFEA 4M0PA 1LX6A 4I2NA 2N46A 3QXJA 1XXHE 5JMWA 3Q3VA 3EOZA 1D1PA 2O3QA 2PPLA 4RLSA 4EG0A 3W4IA 1FQOA 1OYYA 2VNKA 4MPDA 5JEDA 2V97A 1C8LA 1E9FA 4PAWA 1W93A 2F9LA 5F9HA 1KVRA 4IDCA 4A26A 1R0WA 2B4QA 1YA8A 4MVWA 2QWXA 3RJ9A 1ZITA 3NPAA 4WPGA 3U4DA 4UBJA 5F4ZA 3RGGA 3Q7QA 4MS1B 3R5HA 2AX3A 3CC8A 2FY8A 3G23A 2RHOA 3IQGX 4JELA 2ORYA 3VGPA 3RC8A 1N8TA 2R1VA 4FYJA 2QTMA 3GW8A 4FUQA 5JD3A 3ZVLA 5EMJA 2OWEA 2RI0A 2XOXA 3RS3A 4GMGA 2H0QA 1BW9A 1X8KA 1Q7RA 2BRUA 1X1TA 2IA5A 3PT9A 4G5FA 3U9SA 3VYVA 4EI8A 3WICA 1GD1O 3KT6A 3GO4A 1HZJA 1G8HA 3N7TA 3R5TA 4Q9DA 3PD0A 1YNOA 2BMFA 4GPD1 1UEJA 1IY8A 1NQ5A