2GM5A

An activated, truncated gamma-delta resolvase tetramer
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
127
structure length
122
Chain Sequence
ALFGYARVSTSQQSLDIQVRALKDAGVKANRIFTDKADRKGLDLLRMKVKEGDVILVKKLDHLGRDTADMIQLIKEFDAQGVSIRFIDDGISTDSYIGKMVVTILSAVAQAERQRILERTNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Implications of structures of synaptic tetramers of gamma delta resolvase for the mechanism of recombination.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Recombination
molecule keywords Transposon gamma-delta resolvase
total genus 42
structure length 122
sequence length 127
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-04-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1390 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2gm5A00
5C34B 2RSLA 3LHKA 2GM4A 4BQQA 3G13A 1GHTA 1ZR2A 2MHCA 5C31A 2GM5A 3ILXA 3BVPA 3PKZA 1ZR4A 5C35A 1GDTA 5C32A 3LHFA 1HX7A 2R0QC 3UJ3X 3GUVA
chains in the Genus database with same CATH superfamily
4JJ4A 3UNXA 1UQUA 2CNWA 1WAMA 2EJWA 5DPMA 1EM6A 2WHRA 1R0BA 4NAHA 2BAGA 4QHYA 3T12A 1A3CA 2WVGA 1Y4SA 3QF7A 4MVJM 2VJKA 2DQSA 1UM9A 2ZJ4A 4RA6A 1K3FA 3KZ1E 2Q9BA 2JBAA 1LZKA 2VP2A 3MM4A 3NBMA 3OZUA 3U4CA 3PHGA 1YZKA 4B87A 5KYYA 4RTMA 3KVYA 5D86A 1Z8NA 1VL1A 3L9XA 1YDHA 1EBFA 1TUBB 1XT6A 1Y6GA 3A05A 4LJ6A 2JGNA 3ORSA 3CGGA 4ZHQF 1R27A 5AJTA 3PRJA 4XA8A 5IT4A 2BD0A 3AVOA 4ZQGA 1WULS 4O2BA 4DIMA 4JUAA 4D25A 3F2VA 4M0LA 1HDXA 3AKYA 1YD7A 4KNVA 1BNCA 3ZW7A 1TZBA 3QBEA 3HKEA 4TM8A 1J8MF 2C7QA 3ZY2A 1U2ZA 1HQKA 3OLVA 1T2UA 5FYQA 4ZJZA 5HTOA 3AR6A 1U99A 1L7OA 2VQ6A 4P08A 5COAA 2P7HA 3HN6A 1FJHA 4J0DA 1WVIA 4HNQA 3RGWS 1WX1A 2XB9A 2P5YA 5DSXA 2N42A 5DIFA 3NAZA 3HY6A 4M86A 2IIQA 3WNBA 2DX7A 4FOPA 1TQ8A 5K3SA 3VH3A 2RKWA 3IESA 4AZVA 1M67A 1NW3A 3N7UA 4LHXA 4W7HA 4E3WA 5AHXA 4WNIA 3KVOA 4EHFA 2JLVA 3UJ8A 4OGGA 3HMQA 3CPSA 4JJEA 1GLNA 4AULA 1XWWA 1YACA 4L27A 5EVCA 1ZHFA 4EM6A 5SY9A 5KX5F 1H8HA 5TDHA 1YDEA 2JFFA 1OLSA 2WD7A 4BO5A 1B16A 1YBFA 3FZGA 5D3KA 5EFOA 4G0UA 2D1TA 2Q5QA 3O47A 2R85A 5I9NA 2E85A 3OY2A 1SD2A 1ZGCA 3DEHA 1IG0A 5ICEA 3GEHA 3IULA 1O95D 1EHCA 2CZCA 2QP3A 2UVPB 3KSMA 2XMZA 4HX9A 3NHSA 1KDVA 1QG0A 2X19A 3ZQJA 1O9BA 2ZIXB 1DTWB 3ZX4A 4GD3Q 3HU2A 5GIPE 3MFYA 2O2HA 4BQSA 5CJ2A 4MB0A 4G0ZA 3GJ4A 4BFVA 1E1RA 1FNBA 1TVKA 2WMDA 4DGQA 1SVKA 3O03A 3UB2A 3GLHB 3BK7A 3FDZB 1PHPA 5CG1A 4WOCA 3WVNA 2VAXA 3OZVA 1NQVA 3BD8A 4LSGA 3CR8A 4HLNA 4UQLA 3H4TA 4DXDA 4PINA 3M33A 4XWWA 5T8KC 4RMNA 1M8JA 1TXGA 2XOEA 2OK7A 1LPOA 2PX3A 1S3FA 3HKDA 3K1YA 3WISA 5C8YF 1SD1A 4EFLA 4Q15A 4M1SA 1TTTA 1K8XB 3LHSA 5CEEA 4W5WA 3LTNC 1CE8B 3LG2A 4QLAA 3EGVA 4M1WA 4GZMA 3ZVRA 3ZWAA 3E5HA 2EIXA 5E6SA 4L50A 5M04A 2ZIAA 3GEDA 4JL8A 3R7BA 1OGJA 4EWLA 5JJLA 4OMCA 1AGXA 4QNRA 4FFVA 3PUIA 1FEZA 1B7GO 2N75A 3C3AA 3LO8A 4OB8A 4QXOA 4CF6A 3ICEA 2XRMA 1CS0B 4KE8A 4XOIA 3RRXA 2MCFA 2LDBA 1WW8A 1JHPA 2OFXA 5FD8A 5FWXB 5CFLA 3ZKWA 4MB2A 3MVEA 4ZQCB 2WICA 5GMOA 1N5OX 2QRNA 4NBTA 3A6DA 1UXJA 2P2DA 2VJNA 1P2DA 4GHWA 3CCFA 2QUKA 2F48A 4OA8A 3SHVA 4ARAA 3DZDA 3R8XA 2X4IA 1I5RA 3CLSC 1XHFA 2GASA 4KO3S 2ZI5A 2K6GA 3A4VA 4LPKA 4RMHA 8ADHA 2R8XA 3NBAA 1BX0A 2QPLA 4PSCA 5AVKA 3NWOA 4YMSA 1A50B 3GOHA 5JLAA 2D62A 1XMVA 3CVUA 2OV4A 1OBCA 3HRIA 5D7BA 1QPBA 1U3DA 3GBSA 4QTYA 1B15A 3IUYA 3QU9A 5HWSA 5AK0A 1PQYA 5CAEB 5EZ6B 5FL3A 1F20A 3ZGNA 2VAVA 4QDUA 3U3ZA 1U8CB 1QAMA 1U2RA 3BORA 4KIFA 4M8NE 2HCJB 4BFTA 1GLGA 1HYBA 2R8ZA 3GD5A 3PGVA 5FF9A 1PG2A 3H1TA 1L1FA 4F6RA 2WAOA 4UVEA 1JDBB 5J2TA 1SELA 3DD5A 1TKRA 5A6SB 3BICA 1MEEA 1NVKA 3W7BA 3PV0A 4FEAA 4TOIA 3GUYA 3P0JA 4OF4A 3V4OA 2FPUA 5FXMA 4NJMB 3K31A 4XVUA 1W25A 2FP4B 1ZN7A 4MO2A 2ABWA 1BJRE 1MNAA 4P5PA 1PZMA 3L0PA 4RABA 3W5SA 1A5AB 3U3OA 1PS8A 1AY0A 2XYGA 3LP5A 3AVWA 5KNBD 2PZFA 2QJRA 4R4JA 4FMCB 3FNRA 4W5JA 3V1KA 3EIUA 3TUJC 3MWGA 1KC1A 1XXHE 2UYOA 4G1CA 1V1MB 4X1YA 3F49S 4KJXA 4Q3NA 2XWBF 3TIIA 4F5YA 1EFKA 1DCMA 4DMRA 3T8YA 4FOOA 3RSCA 4F7DA 1NMXA 4JXKA 1MO2A 3RD5A 3SQMA 3WYEA 3ZDBA 1QTNA 3JQ9C 1BDBA 2WC1A 1NAIA 1NV9A 2WJ4A 3OCUA 3SBEA 3SZGA 2OYCA 2IIPA 2AOUA 2QYSA 4JSTA 5BWOA 5CDHA 3LXXA 4UJ3A 4ME6A 4WADA 3UOGA 5C2JB 4IKOA 2G5PA 4AY3A 2WTBA 3JARA 3RYHB 2O2XA 2H9IA 2NX2A 3BH0A 5HE9A 1TM2A 5CGZA 3LUPA 1X0VA 1RPZA 1AJEA 4K40A 2J3KA 3EGEA 4EQ6A 1E1QD 1WG8A 3TO5A 2RC6A 3BVPA 1VPDA 2M6RA 3M8KA 2ZZNA 2GEBA 3D3QA 4C7BA 2YWRA 3R0ZA 2GEJA 2A3RA 4UNRA 4ZODA 4LAFA 1E1QA 4NC9A 5M7EA 1PNRA 4R7TA 4UNPA 1SXJB 2A4KA 4OUDA 5IDYA 5CPFA 4U7DA 1KI2A 3R6DA 4RKYA 2X0NA 1MA0A 1JIUA 2Q3FA 1T2DA 2PFKA 2W6QA 3V4PB 3B1XA 3TLJA 1G3IA 1YRBA 2IYZA 1RWWA 1NKSA 4IVQA 4PC1A 3WLLA 1E64A 1O94C 3REFA 1SBCA 3EDOA 1LI4A 4E2FA 4CM9A 1DFHA 4G4IA 5F64A 2G9QA 3AOEA 4NU5A 1NJ5A 5FORA 3X1YA 1NNI1 1ONPA 3LDUA 5LWQA 3KQWA 5CRIA 1NZDA 2N47A 3SFTA 4C3UA 3WYBA 4UHEA 4CFZA 1FFCA 2UYHA 4AB1A 2J59A 1M2NA 4KYIB 1Q0UA 3NOOA 2HN9A 2WF9A 4IDBA 3C97A 3GB9A 1T35A 2G28A 1DOHA 4FW8A 4JOCA 5EPUA 5FTWA 2C07A 2DXIA 1WQ4A 3LK7A 5F5NA 1XP8A 1K66A 1FX0B 3ZQKA 1XQ6A 1P72A 1SN7A 2A5DA 3MJFA 4XYLA 2PXAA 3FMIA 3JWIA 4LUCA 4H1WA 1TDJA 4HTAA 5DNYB 4J0IA 1MAVA 1ZBDA 1ZMOA 2G71A 3QU7A 3UB4A 4O4JF 4QBIA 2VT7A 1ONNA 3GRPA 3L18A 1LZLA 2HHHB 2YKGA 1ZJ5A 4R31A 4QXQA 1Z4QA 2QMQA 1KR5A 4CM6A 3J81A 3GPCA 1JU4A 2BWJA 3LV8A 1AOXA 1LBSA 3U5TA 3ZE9A 4OMFG 4OLBA 1IVYA 3AL2A 1ADCA 3PX7A 2FZVA 2EFCB 5I7AA 4JB8A 1FJ2A 3WWZA 1PTKA 1XCMA 4Q9IA 2XEDA 2R44A 5K6AA 2GSDA 3OFND 2WU4A 1VB5A 3C6KA 1J06A 2P35A 3EXIB 5C34B 3J80A 4KR6A 1MC5A 1QO0A 3DCNA 1FS4A 1YJCA 4MUIA 4BMOB 3DE4X 4YRFA 1I8TA 3ECAA 3GROA 4MVJI 4NRDA 1VSBA 1GPUA 4TVOA 1SUEA 4IV0A 2XCUA 4K6FA 2ISSD 4L76A 3RYIB 4EG5A 3VBCA 1RMYA 1G20A 4U00A 3K8OE 3AR8A 1V95A 4HWSA 4PGFA 3IB3A 4LV5B 4UNQA 3S1AB 3H8WA 1G3UA 1U02A 1E2JA 4YMHA 1YZNA 3V33A 5KOHB 3U56A 1CJVC 3O92A 3F71A 3K3PA 5EUMA 5EIHA 3W5VA 1XWIA 4WJZA 1M2VA 3SJBA 1G8JA 4BJ6A 3HYSA 5E6RA 4QO8A 3C3BA 1T2AA 3E9NA 4OHOA 4RK7A 1QFSA 1XXLA 1RJ9A 1KZ4A 4TV8A 3R77A 3CVYA 1RQLA 3PFWO 3IX7A 2RIRA 2B8TA 1QCYA 1N2CA 2K2QB 3IVXA 4PCUA 5BN4B 4BBAA 3JAMA 2BMJA 2G7ZA 2YXDA 5F35A 3VDRA 3MLAA 4XZ3A 1WBBA 3TNFA 2RH9B 4LGYA 4XB6B 1N1EA 3JQGA 4O6VA 4QLOA 3OLXA 3GFGA 1R8QA 4DLLA 5JZSA 4GR9A 3IAM1 4E5SA 4JI4B 4BP8A 3PNKA 4AKIA 1WF6A 2C5SA 1HSZA 2Q1TA 4WD3A 1Y9DA 1JR3E 3CPJB 4KSCA 1OI3A 3HVHA 4TMWA 2R1TB 2ZTVA 3BHIA 4ND4A 3UCEA 3VR4D 1XCLA 2H92A 3E70C 3BWDD 4HTFB 1EP3B 4V0NA 5IN5A 3ECCA 1VLJA 1UKZA 1Y8ZA 1C9YA 5DI3B 2R5WA 4TZKA 4EPRA 1MAWA 1UBGA 1H1DA 1PWEA 3DDSA 3H5RA 2ACVA 3HVIA 3PUXA 4TT3A 4BCDA 1KWGA 3RH0A 4QRHA 1J09A 3I4CA 2PANA 5GQSA 4GMFA 5EHNA 2DHRA 3DXYA 3N2YA 1Y89A 3O4JA 4BO3A 3MBOA 4DDWA 3FFXA 4TTPA 5KTNA 3MGKA 4JVSB 4V1CI 4AMVA 5FULA 4RQTA 4KVGA 5EC8A 4Z3KA 1DDIA 1TQ4A 2B7CA 3FTQA 1C7ZA 4LCEA 4YWJA 5IJAA 2HGZA 1TJPB 3EQ9A 4P7JA 4PEVA 4NNJA 1AKRA 1SD5A 2ID4A 2Z98A 3DGFC 4UHCA 5EE9A 4ETIA 4YP0A 4XVRA 5LP6A 3FVQA 5IUNC 5FPHA 3A9SA 2WHPA 2HKIA 5AM2A 4D5EA 5LYJB 1DBQA 1O89A 4G0PA 4AJPA 2D5CA 3VSEA 3K0EA 4EP1A 3C4VA 1AIPA 4CL2A 1T1GA 1I13A 1OBOA 3FDXA 3WK7A 2VZEA 3NNNA 3DE7X 4DDMA 4C4ZA 1QZTA 2RI1A 4NPAA 1RNLA 3VR3D 2W6JD 3IH5A 5BPHA 2NP6A 3BCHA 4E1BA 1G18A 1OLUB 4LIPD 4YP6A 1UEXC 3K94A 2DBZA 3B1KA 1L6RA 2GR9A 5FPPA 1YU6A 4ENTA 2VNAA 4Q82A 3THXB 4IOMA 3VNUA 2XZTA 2GZ2A 2HF8A 1NUQA 1AH2A 2QBYA 2P4SA 4IH9A 3SFZA 2PT5A 1D09A 1AMNA 4UHHA 3FXAA 4RVNA 4BLPA 1IZZA 1FVFA 2ZYAA 3EA0A 3OAAD 1SZPA 1RWVA 3SHTA 3DVQX 2HEGA 4O8CA 4FB5A 4GLOA 1WETA 2GN8A 2X0JA 3LPNA 4IQ8A 3IOMA 2XCOA 3I12A 4ROTA 4WRRA 1GGEA 1KI7A 4HB3A 1WCWA 1YRAA 1GV1A 4MPTA 5IC4A 1JDBC 1KWKA 3GA0A 2PZJA 3OEHD 5KHAA 2W93A 1KY4A 3FI9A 3SXPA 1A9YA 3QW4B 5I8WA 1WIWA 3I8OA 4QPPA 3SSAA 1X0XA 3MS2A 2D1YA 2XGSA 3GLFB 4QTTB 4OEHA 4XM0A 5JY6A 2GBLC 3N8GA 5LUAA 5FTLA 3Q88A 4D02A 4LA4A 1ACMA 3AKZA 1K7EB 1NAHA 5HK8A 1XQ1A 2QRZA 4MUHA 2ZUFA 1WVGA 3KQMA 1PFGA 2H4HA 3JRWA 1M1UA 1YJBA 2GNAA 4IOKA 1PWXA 2W2NA 3ZJ4A 2P9BA 5J23A 2QBYB 2XYHA 3TQTA 2Z3ZA 3PQDA 5I9SA 1CQJA 2ZSUA 1A4RA 4ZTZB 3AVVA 4KCGA 1F0YA 3MWLA 4INZA 4RZXA 4CIDA 1J90A 2PN1A 1LVGA 3FKSA 1A9QA 4G1UC 4NFHA 2CL6X 1N6OA 1ECGA 5GWXA 1ETHA 4IQ4A 3KQHA 1ZR4A 4GEGA 4Z7JA 4B3RB 3FJOA 2WUEA 3VAAA 3RU3A 1GZ3A 2RGGA 4NONA 3FSJX 3DDHA 3X2SA 2NSHA 3TL3A 4H7KA 4HSGA 4I50B 1KZYC 2Q4DA 3O0DA 1IB0A 4KAFA 4BRWA 1L8OA 1P4GA 1FOEB 1ZH6A 4TWAA 1FYDA 4DR4B 1AK1A 3BCUA 3WQBA 2WZBA 5FR2A 3RVJA 2ZIXA 1ZOOA 4BMCA 2PUBA 4HQLA 1XD2A 2B4KA 3GRZA 4JBHA 1PFWA 4GQIA 3RYFB 3H6KA 1ZGBA 1TEHA 1XEWY 3LQYA 4KNWA 1CNFA 4HWOA 5EUBA 4WVLA 3KJGA 2YRFA 1P5FA 1CU1A 3DMYA 1V11B 2W6OA 3L07A 4LQCA 4MV8A 4EG1A 1D07A 4FT2A 1T9AA 1I2AA 1R00A 3TDKA 1INLA 2XB8A 2AMYA 2HSEA 1NQXA 2L17A 2YIVX 2HUPA 4OO3A 3L6UA 5F7ZA 1IULA 2J3DA 1RZUA 1PR9A 1YZUA 3EVTA 4B3CA 2ZJ0A 1U90A 4I6GA 1RJDA 4I5GA 3BMXA 4GE3A 3NGXA 1QR6A 4Y18A 3UJPA 5KKNB 2X5KO 1K2VN 3WMFA 1HWYA 5AM3A 4KXLA 2R7MA 2WJGA 3DLCA 3PQ5A 3RK0A 4QU9A 4E7OA 3EXAA 1U1GA 2C92A 2EJVA 5KYWB 3C5EA 2FMIA 1MTZA 4KIUA 4KQKA 4N12A 2IKSA 2V45A 4L3OA 3TD9A 5JQWA 4C4RA 1W5FA 3ND5A 1LQ2A 2XGMA 4BQFA 3WHIA 3E9MA 3A4NA 5FUXA 2A9QA 4B0OA 1E59A 1NDHA 3OHMA 6Q21A 2Q4EA 4XIJA 2YOHA 1LV7A 2FFHA 4KHPB 1QCCA 4EG6A 2QXUA 5LJIA 2ZBQA 2XLCA 4C4PA 5FPQA 3TW0A 1RIIA 1QOQB 3GJYA 5C9ZA 3Q5EA 4JJAA 2QE6A 2GK4A 3G0GA 3SEQA 4TLAA 5EEGA 5JHGB 1CZOA 2IBMA 3CV3A 3RB8A 1XCPA 2DUJA 4JCOA 1Z3IX 4LJ4A 3HY4A 5EUQB 5EE0A 1GQYA 2NZJA 1K9SA 4NARA 4QOJA 3SR0A 3OFJA 4D56A 1ZD2P 3L6BA 2BZ1A 2XAAA 1CULC 4IHQA 4IWXA 1T5DX 2QN9A 1CDZA 2XYVA 3ABRB 2W98A 4M7WA 5EXSA 4MDFA 3HDGA 3EXHB 5LZ4A 5I3CA 3F8TA 1US8B 2QLJA 3OSZA 4G9EA 2H2IA 3UK6A 2BM9A 3OESA 2A9JA 3VOBA 4LGMA 4CEIA 1LDBA 2E49A 1ZITA 3AM1A 1UWVA 4HD8A 4PFKA 2ZYTX 4R40A 4UQPA 4XEUA 2OORA 1H0RA 1TMOA 2YN0A 3FI0A 4RKFA 1F06A 5BP7A 2Z57A 3JW8A 3UXEA 4ND6A 3QKRA 4TMVA 4KYUA 3U3KA 3W8FA 3OEED 1VTKA 5KX5A 2V6GA 2A0UA 1U2DA 3O8DA 5J40A 1B6TA 2CW5A 3D7RA 1FDTA 1UUFA 2FEPA 1PJZA 2G25A 2ERXA 2FZ5A 2LIPA 2PIDA 1DIBA 3AKDA 4RKQA 3SBOA 3QVKA 3RNLA 3SZOA 4LYAA 3ZE7A 4HLCA 5JSZA 1TU3A 3PGJA 4RGVA 3OHPA 5CVJA 3RF7A 5L7TA 1V2GA 1SU6A 3A31A 3LUCA 4M1MA 3SHQA 2UXCB 2A9OA 3I6YA 4WASA 3VPFA 2XE7A 3C3JA 1S2IA 4LXXA 4ZT5A 2HMVA 3SMVA 5I3ZA 3HZHA 4DMCA 5FTMA 1PD1A 2I3DA 2BFDB 2YVLA 3NKVA 4FCVA 4N8SA 5JSFA 2WSIA 2NTNA 2VWPA 4I2NA 1OVMA 3OUUA 3KTOA 4OXYA 2HMWA 3E58A 3EZ6A 2II6A 3FCSB 3JALB 4QEZA 1GZDA 4YXFA 4BZXA 1OZ0A 3AETA 3C3DA 1U0HC 4R81A 1MLDA 4BC0A 3X44A 3ZCUA 3MTAA 1GZ7A 1RS0A 1Y37A 2YTZA 1T4BA 4G41A 5KQPA 4IDEA 3UF0A 2IS1A 2NZ8A 1Z33A 3ZTWA 1HDGO 3NRBA 1AX9A 2X23A 3AB7A 3QNWA 3IVCA 1Q6ZA 4MKHA 2GFIA 4L0DA 3NHWA 1MR3F 5LZ8A 2V5VA 1P1CA 4B43A 2JFHA 1J33A 1JRLA 3HN7A 4Q3AA 4YP7A 1MQ8B 5IYZF 4CUJA 5EP1A 1AG9A 3BAZA 2C7BA 2I7DA 4OVKA 2B99A 4J76A 4RSGA 4WZAA 1OIWA 2QMUA 4WFQA 3VTKA 4N3NA 3K9HA 2VJMA 2HB6A 4JUFA 4BTVA 1NFQA 4OBXA 1P7ZA 4H31A 2JANA 3K96A 3RT1A 2OCBA 4JKYA 1O03A 3V7NA 4G85A 1I6WA 2PYDA 2O0KA 4C78A 4LDPA 1E6UA 2VNSA 3O95A 4W6QA 2A5LA 3D81A 4CIVA 4QICA 3RBXA 5ITZA 3T1HB 3IAEA 4DZRA 3MB8A 1V7CA 1NHGA 3ABOB 3G5MA 3GLFE 3BTOA 3P9CA 2OKGA 3K5HA 3JAWA 1Z2PX 1AT1A 3DMPA 1PNTA 3WBKA 1NJ6A 1Q92A 4XIFA 2Y1KA 1K0UA 4C22A 2VTKA 1DWQA 1JG4A 3VHLB 1XMQB 4JLSA 2EW1A 2HQBA 3BBLA 4ZO9A 1ZG3A 5IAGA 2XJ4A 2XXAB 1G8HA 2Y1OA 4D74A 2WSSA 5CK4A 3R74A 7REQB 1TM1E 2PRKA 1XRNA 4INOA 1MP0A 1QIJA 2Y3IA 2ZSJA 4NU0A 4ZOBA 2FWNA 3VHRA 1E4EB 2OXEA 1NLZA 4F5EA 5INTA 3VGPA 3WICA 4OJNA 1W48A 4DOMA 4CN9A 3JCZA 2QW0X 4Z9FA 1ABFA 1G1MA 2AN1A 2X22A 1NYRA 3KPUA 1ODKA 3S7ZA 3WRYA 1JVSA 5A6VA 1DWUA 1UMCB 3BMCB 2AXQA 3ZU4A 2Q3BA 2PUEA 2JIOA 3G7UA 2XUDA 4Q1CA 3BN3A 3ZS9A 1DRVA 2R48A 3BXHA 3IQGX 3SXUB 3REOA 4XGQA 3T4EA 2X6TA 4UE2A 1G21B 2C77A 1ECFA 4BJ5A 1R8YA 3M1IA 2XRZA 3QQPA 5CMLA 3ENNA 5BPFA 1SVOA 2OO5A 1U6IA 3SF8B 4Y9DA 5EJIA 5LIRA 1PD0A 1YRLA 1T5TA 4GMGA 1AGYA 2C5FA 2PMEA 3TF5A 4GUDA 2WOOA 3GFSA 1ZPDA 2VDWB 3GDFA 1KFEB 5TJHA 4IEIA 4YEDA 3OPXA 3M4YA 3A3OA 4G5FA 1XLTC 1CUCA 1E8MA 2VSNA 1SCKA 1U7HA 2P6PA 3KQTA 1IJEA 3OCJA 1G20B 5BSMA 2LUOA 1BFKA 3F6EX 3KDSE 3VOAA 1BEEA 5BSVA 5THKA 1P5JA 3I23A 3ONEA 1S8OA 2Z6AA 3I01A 4PHGA 1FE8A 2C98A 3CYFA 3RPEA 1WY7A 2VZ0A 1YOVB 2Y1EA 3CG0A 3IEXA 3KCQA 2IZ1A 4D97A 3P2IA 4LK3A 5DJ5A 1L1EA 3UYLA 8MHTA 2JGJA 3DV9A 1T5HX 3C41J 1AA6A 2OVBA 2CJFA 4QPCA 1KEPA 1VGVA 2H5IA 1LSOA 3Q0IA 2ILTA 4JS0A 3EFOA 4OG2A 4ZV7A 1XMSA 2QMEA 4LXGA 3WFJA 2WP8J 1ZMBA 4ZCSA 4BGVA 5A02A 1O54A 2AOXA 4WXMA 3H2YA 5E8RA 5ENZA 2WWYA 3LIIA 1CLEA 4M0FA 2EF0A 1LRLA 2PT6A 1KP3A 2G9ZA 3GAFA 1H9BA 2E55A 1G8AA 3IAM6 1RZVA 3A6JA 3OM9A 2B5VA 4MWTA 1DZ3A 3EEYA 4TLEA 5T41A 1N32B 3SDBA 1E96A 1R12A 5BURA 3GPBA 5E8JA 4J3FA 1JAIA 1YC2A 3P71T 4ZCPA 3P2KA 4YUZA 5LOVB 1BHJA 3RT7A 1XFAA 2XUJA 5IRCD 1XV5A 1YZTA 4GX2A 4L5BA 1NLYA 2WWIA 1JN0A 3KYIB 4YAWA 1SPBS 2QHXA 7ABPA 3ZG6A 3RO7A 3L7IA 4OD0A 4AKHA 4HV4A 3BPSA 3MGGA 2H4FA 4MQLA 3WAGA 1YJ5A 2I78A 2CVOA 3R6TA 2B4TO 2Q3CA 3A6LA 1XA4A 3AR9A 4Q6BA 1RZ3A 2GCIA 3IERA 4DLSA 1PF7E 4MWEA 4AN1A 3MUOA 2WM3A 4X20A 2W70A 2EX4A 2QI9F 2IHYA 1ADJA 2W0MA 3Q7IA 4WXEA 5EINA 4BAZA 5HQ3A 1CB0A 1DG3A 1HT0A 3FUXA 5CU7A 2C54A 1SC6A 1R8XA 1RBQA 1ZIYA 2H4ZA 2ODPA 3VPAA 2ZTLA 3KDPA 5DTRA 2P9EA 1HL7A 3OTQA 2BFCA 4W9RA 3SQXA 2WT4A 4YAOA 1C3EA 1G2OA 1L5RA 1SVLA 2C2YA 4IW3B 1ORHA 4N18A 4QYMA 4U2GA 1L5HA 4EJSC 4IYJA 2VCHA 3VMFA 3WQQA 4PZYA 3W6OA 2J3QA 2MSKA 3EQZA 3ISVA 2BM8A 1RWNA 1I1QB 1JHZA 2I2CA 3CZRA 3LECA 2CNOA 4Q7EA 4UD6A 3ZGOA 2VOEA 1IN6A 2B8NA 3F67A 2GHTA 1XZIA 4AMGA 2BBWA 3PE4A 4P92A 3WKEA 3PHBE 3G0DA 5DGTA 2BH9A 5C32A 3AF6A 1GZUA 4PHTA 5G1NA 4EI7A 5CHEA 4NEGA 2P4EA 4ZVRA 4G23A 2YR0A 4W7IA 3V7WA 2C57A 3Q5DA 1BG6A 3LF1A 3IB6A 3LOUA 5K6AC 5DM60 2YHIA 3GYGA 3DFUA 2QN8A 2X8JA 3T35A 4GLBA 5E1MA 2UZ1A 4HCJA 4GNRA 3A1SA 1LDEA 1CRWG 4I1SA 4L74A 3P0HA 3F4KA 4Z7QB 2CBGA 2DFLA 2PBLA 2LCIA 3O8OB 4G4SP 2XMQA 5B58C 3PI6A 3NHUA 5CTAA 1FMJA 3KV1A 5DCYA 2N3ZA 8LDHA 1BXGA 2NUPA 3NTVA 4PPNA 5JVDB 1X77A 1DT3A 5CCBA 2BFEA 1L5NA 2CLMB 1SUBA 1I4LD 2YV2A 3LBNA 5MHTA 2FN7A 2ZOSA 3BQNB 1I7LA 4BMZA 1DKQA 2O8CB 5F73A 1YFKA 2PRJA 3D6NB 2P5TB 2BBSA 2H8GA 5F9MA 3RYCA 5L3QA 1DQYA 4YPVA 2ONCA 1UBEA 1VL5A 1P1HA 2G5GX 2XODA 2OHXA 3CZQA 3PHIA 4GKKB 3LQFA 3DVSX 3UWPA 1ULUA 3A10A 4JVNA 2IP2A 2XWQA 1FQJA 1XKQA 3VV3A 1J49A 1E0JA 2A9RA 3QPUA 1NMQA 2VPIA 2YV4A 3HCOA 3DDWA 3V00A 3REGA 4I3GA 3OCVA 4E32A 1P74A 4R71A 5H9VA 1U3VA 4GWLA 1MOZA 1J9EA 1D6NA 1E2IA 1A4XA 1JMKC 4QGFA 1W94A 3L4SO 3LYLA 3QMVA 5IVKA 3CZPA 4C7VA 4PQRA 1SQFA 1XEWX 3A11A 1IG3A 4JEIA 5FOVA 1ISIA 1L5WA 1UFOA 1MV5A 3AJ9A 1DQSA 3D9QX 1QF7A 2ZRHA 3IP8A 4L8VA 4OHYA 2WFLB 4OK6A 2EHJA 5FUBA 4WLFA 4G4SO 1R4NB 1LUAA 2A5FA 4TPKA 5DFAA 4W1RA 5D8DA 1DKUA 3HH8A 5AHWA 3U1BA 2YDXA 4NYIQ 1KFJB 3I72A 3LQ2A 1E5VA 4EG8A 4TL7A 1N6LA 3ER8A 5DXJA 1RC0A 4BQPA 4NK5A 4YT5A 1EP2B 2VBIA 3MAGA 3CRNA 3QWBA 3S6JA 5M29A 3BAFA 3DNPA 1RYZA 4JHLA 4FZ5A 3LGXA 3N70A 2IWRA 1NQTA 3GAAA 1O9HA 2GPAA 3FNBA 1UOEA 5K4GA 3HXTA 2GN9A 3RC7A 1BA3A 3KB2A 4OP1A 1MKYA 2JS7A 2HHAA 3RJTA 2EZ8A 1FNCA 3E4DA 4HVTA 1FA9A 4LX0A 4E14A 2HU5A 4S1TA 5KQMA 5AHRA 2QZ9A 5DGXA 5TQVA 4K9QA 1RP7A 1KEEB 3BGSA 3JPYA 1MNQA 1CQZA 1YZQA 2Z4SA 4H6VA 4OFBA 3WE7A 1B8OA 1PR0A 1HR0B 2VH2A 4NCBA 3KTDA 3QRWA 4C0AC 2PUDA 1C9DB 4UFNA 2BSAA 1YKSA 3KYDA 3BFPA 3OX2A 1R37A 4W6ZA 4GWGA 3RVKA 4US2R 1NJ1A 3O8CA 1NI5A 5K0NA 2R97A 3VTAA 2ZT7A 2O8VA 1SXJD 3EYWA 3E82A 1X70A 4R1UA 4DG8A 2W2LA 4RL6A 2QXTA 5CX4A 3P5SA 4MUGA 1KHTA 1MABA 5TPWA 4BNDB 3EN0A 3EEOA 2G0AA 1YB5A 5EXEA 2DBYA 3GZTB 1MVOA 4WH0A 1Y3HA 4MV3A 5HX7A 3AVUA 2FUG1 5JD5A 3OO1A 4G0VA 5CA1A 3V8MA 1TYAE 3O1JC 4P3XA 1DAGA 1GCUA 4RV9A 1IN5A 3DJYA 4XX0B 3TVTA 4U5XA 5JMOA 1NXTA 1CV2A 1VXOA 2XHEA 4WY2A 3FPAA 2GKOA 4KN8A 4M88A 4J2TA 3V7FA 4CT0A 3AQ4A 1ENYA 5LC1A 3H1AA 3YASA 3BJZA 4BV9A 4ZHQB 4A2CA 4YCLA 4S1OA 5JS8A 1GL3A 3I58A 4A7PA 1DPFA 3SIRA 5C1PA 5A5VA 3KAKA 4HH4A 4WDQA 2EGUA 2VRCA 3FB1A 4X1KB 1Q21A 1FXWF 1P4AA 5CITA 3DZ8A 2O54A 3BERA 2ZRLA 4HS9A 3E7XA 3HXKA 4G8DA 4JKIA 4EKGA 2WQ7A 2RAFA 2BJWA 2B8JA 1DNPA 1NUTA 3NNSA 4QU8A 4X3CA 1U5AA 3CWZA 5C8YB 1VOTA 1NFRA 3IV7A 4V0SA 3LKZA 3N5CA 4PZ9A 5BT9A 2A0YA 5U9CA 4EUSA 1LD3A 4MJ3A 4OHPA 1P9RA 4C43A 1ZVVA 3DZBA 3GUZA 2YN4A 1RKUA 4ZRMA 1HOXA 3PRYA 1XTSA 1N5DA 3DUFB 4QA9A 3W8EA 2ON6A 4DJAA 4GNKA 2Y66A 1IE3A 2WU3A 1DXQA 1CEXA 3H4VA 2ODWA 3LTEA 4I9GA 2DCMA 2ZJYA 1KI4A 1NQOA 2Y1DA 2W5UA 3IT3A 3ROTA 2A86A 4TKVB 2I66A 4JAVC 1A8HA 3CLTC 4N9WA 1W1WA 2IL1A 4MLPA 3G82C 1Y4DE 1FX0A 4YAGA 1FDVA 1HE4A 4L4XA 4WEOA 5K0EA 5CXXA 4BBPA 1TLLA 1TCUA 4JY7A 1CRPA 1MAHA 3QX9A 2VT2A 4DQVA 4HEQA 2YHUA 4MKGA 2J5KA 3HI4A 3LUKA 5JQGA 2Q5LA 3R3YA 5D5PA 5DRTA 2AW3A 5DX1A 2V4MA 1YULA 4PZZA 2E5LB 2QV0A 2AJDA 5ALZA 1PSZA 3FVVA 3R3HA 1AK2A 4KODA 3MRXA 1DXHA 5E9JA 1MD9A 1O9GA 2ZI4A 2ZSFA 1ZSNA 4QQRA 4U7TB 3ZHUA 3FFBA 3FLAA 3L7KA 4KWHA 5D85A 1YKGA 4NHEA 3T5AA 2HSDA 1BC5A 3MB5A 2QRVB 3ENQA 1WU7A 4O3MA 2VPQA 3HC7A 1YZLA 4IOLA 3WLEA 3OKPA 3PJEA 4WESB 5AJUA 2G08A 2KBEA 3SBXA 1PJCA 4H0FA 4FWIB 1YQTA 3KP1A 4R9RA 4BKMA 1V7ZA 2Y1XA 1VJ5A 4D8XA 4R5MA 4LRUA 3ZEIA 5LZ9A 1YVEI 1XHLA 2NO6A 4H3KB 2X14A 3NYRA 5KYKA 1IQPA 4FMCF 4I99A 1SOAA 2NN3C 4QTXA 5B7QA 4ZZ0A 2E82A 4IFBA 4RF4A 3CWCA 2ZYIA 1BOOA 4YRTA 2NSYA 2L69A 5ARBA 1QTRA 4ZI7F 5AW0A 4DR2B 1SCDA 2NU8A 3E84A 3D5TA 4AYWA 4CIAA 4DQDA 4XWKA 3F6RA 5LPNA 1VHDA 1Y5NA 1F8GA 2HLNA 3HDTA 3U7HB 1CY7A 2IA5A 1RBMA 2NNWB 4JFRA 4DHWA 2FKNA 3V4VB 4BMXA 1K7CA 4QUEA 4D57A 4QDKA 5AJZA 1KYIA 4NE9A 2C2XA 1SEVA 3JWEA 2GUGA 3ESRA 1HQYE 3MSCA 2JDIA 4DSZA 3KKMA 4RHUA 4HX2A 5JYEA 2CUNA 3I92A 3T3EA 5KOYA 2VZ9A 4NX2A 4K3VA 1JPNA 3NTUA 3SC6A 1BVYF 2XMRA 3VRHA 1UJBA 2RB5A 1YOBA 1VLLA 2XADA 2Y0EA 2Y2UA 2WTAA 4I5FA 1D2AA 4HEA6 4MW9A 2ZBPA 4TXNA 5D5HA 3H86A 3VC2A 5DCLA 4A3SA 3ZCVA 4F3RA 3NIBA 5ALEA 2XUOA 4F4JA 5IKXA 1L1QA 2GUWA 2V3VA 3WMRA 4AMUA 1WCXA 2E4VA 3Q41A 4X84A 3H6HA 3SIPA 3R23A 2J32A 3NBKA 3QXSA 4LOAA 1TKAA 4IH4A 3U31A 1SIWA 2WYIA 4MUXA 5EHIA 2ZYDA 2OBYA 2IYWA 1EB8A 1A8QA 5CLLA 3RM3A 3C6QA 4N39A 1FDUA 3D8NA 3AEXA 3KG2A 2D6FA 1XAIA 3HBMA 3UENA 1TUBA 3E2PA 4YVFA 2QDXA 1BIFA 3PFBA 3SHOA 4B17A 5A5GA 1XALA 2BGLA 4XR9A 4A26A 2B4RO 4LDAA 5EGSA 2P3SA 5CT5A 4A23A 2DPLA 3HFRA 4R9SA 4Y9SA 5ALDA 1F51E 2G3YA 1JLMA 2FH5B 1WUTA 3OSUA 4PYRA 2GZDA 4U7JA 5IANA 4Y7CA 4D0LB 4ETWA 1MHPA 1TT5B 3ZOKA 4B81A 2YJ4A 5I7SA 4J1NA 4X97A 4B48A 1LQUA 1GR1A 2BF7A 2JARA 1YB7A 1KFBB 4M1QA 5LKAA 1TYDE 4LZLA 1KBQA 1EB9A 2OFWA 4YQEA 5CM2Z 3DA8A 3E15A 1TO2E 1WXFA 3TZLA 4XM2A 2ZT6A 1O8CA 5EI5A 3QWHA 1Z6ZA 3PXBA 1JV2B 2EP8A 3B3GA 4JBXA 3UHOA 2VAPA 3ZIUA 2PS0A 5IBRA 4I4LA 5D1NA 2A0WA 4C4YA 3H9JA 3G59A 3K9QO 1CUAA 2EKPA 3ZCXA 2E6UX 1DEAA 2GQ0A 3QKSA 2FUEA 3G2QA 4RF2A 3L0BA 4MQUA 5TJ9A 3OQMA 3D2BA 3ZOZA 1KXZA 1RQPA 2ZCVA 1B2LA 1WMFA 4HYTA 5JAOA 5GJCA 5A4DA 1KORA 4C2UA 1PZFA 2PWPA 2VXCA 1OAKA 3LPAA 1HYGA 2VI5A 3OP1A 2R5FA 4RD3A 4CMKA 3O7MA 2AEEA 1L8LA 1HQCA 1QK5A 2YBEA 5FHRA 5CXQA 1NX6A 3FPFA 1SB8A 4LEIA 1CZRA 3ON5A 3OCZA 2V8OA 4A1OA 6GPBA 1EDZA 3AXSA 4FGZA 2J07A 3IRVA 1P3JA 1L4NA 1V16B 1HZZA 2B2NA 3ETGA 4R2KA 1R5BA 2X1VA 4R2JA 2X42A 2VHUA 3K6SA 5AYVA 4BE4A 3IE0A 3ED5A 5AI6A 1A88A 2QTAA 1GIAA 1PIWA 1DC6A 3MJTA 2W0SA 4Y2QA 1VMKA 1NSYA 1MFZA 2CHUA 1SBIA 4W5HA 3TXYA 1OXMA 3N8HA 1K5HA 1NNLA 1R6XA 4QU0A 1KIMA 1G64A 1P0IA 3FYUC 3TRKA 1ZS9A 2XEXA 1G5QA 3CBGA 1Z7YA 2BGMA 3MUEA 4BVHA 4F8YA 1D1QA 4YX9A 5HZMA 5HKLA 1SU8A 2MR5A 4J1TA 5EESA 3KR2A 4NXMB 4HN9A 1YBVA 3I30X 3QKWA 2DB3A 1NE7A 4XVHA 5C5CA 5ADUS 1GUBA 1EESA 1YUBA 1DQNA 2LCFA 3KOMA 5TPZD 4KEAA 3GP3A 1JQBA 2JD0A 4RKWA 1QP4A 4JXZA 1V9SA 4BVFA 3E9EA 3S1SA 5AW3A 3DKKA 2W2LD 3R3WA 2RGXA 4HEA1 5JAMA 1F2UB 2BYTA 1JWAB 1JVBA 4Z51A 3RS4A 1Y81A 4GGOA 4ZCIA 3CH7A 1IPFA 3RF6A 1AMUA 3A1EA 1CQWA 3AI3A 3PFIA 1E3QA 2O14A 1RE0A 2AR7A 1VHQA 1GPYA 2PAFA 1BJKA 1FFYA 1H0HA 4L8FA 4PX3A 1GOTA 4LCBA 3Q7EA 2A8YA 1UBCA 3FBGA 1NIPA 2L42A 3GJSA 1GCOA 4H3SA 4UEOA 2OYRA 1TM3E 4DIFA 4R8LA 4G89A 5KOJB 2B37A 2IPOA 3UK0A 3DQPA 2HRCA 3UAXA 7ADHA 1IN7A 2VRBA 2RGNA 1Q91A 1KRHA 3B78A 2PLRA 4PSAA 1UEIA 5SZKB 4CKEB 3PE3A 1PR2A 1R0KA 3WL8A 2DTDA 1CNMA 2I33A 2V9PA 2YNMD 5EJGA 5C1IA 1Z6QA 2Y68A 2G67A 4ZT7A 4BKQA 1YNSA 1NURA 4PAWA 3TZQA 3EMVA 4E4TA 4N41A 1E2KA 1MIOA 3CKLA 3JVUA 2CB9A 4LJLA 1QJ4A 4P86A 1COWA 2O7NA 1I3KA 4QUKA 2EFGA 2PNFA 1D2HA 4YUWA 5JVDA 1J00A 2YJ5A 2ZROA 3WYAA 2OCKA 1PYGA 2CXUA 1V4NA 2QY9A 2C3UA 2FLVA 4W9NC 5E3IA 4PFQA 2GJAA 1D6JA 3PNBA 4R7GA 1X1RA 1QE3A 4MVJD 1HA3A 3L84A 3JATA 1L8AA 3MMNA 4UCQA 2YVUA 1YCGA 1JEOA 5I9MA 4AZ3A 1IBKB 4LTDA 1D5CA 5BYKA 1NN0A 1IUKA 4I46A 3QG5A 4KQCA 5TARA 3C3MA 2ORIA 4L73A 4LFCB 2AN4A 3P0IA 5DW0A 1UJCA 5E6RB 4ER6A 3MELA 4JB3A 5G3ZA 3D7LA 4QLBA 1XZNA 2UU9B 4ZJUA 5KS2A 4PZ0A 3AFOA 1YRQA 3ROZA 3MCZA 3I09A 3ACDA 1KAOA 4PQYA 1AKNA 2JCGA 2ZE7A 3ANTA 3OU7A 3M82A 5AXCA 3M4ZA 5EFZA 3RKRA 4LI3X 4DREA 4E5UA 3GLGB 1TAUA 2VHXA 1K3UB 2H1CA 1SFRA 1XVTA 6LDHA 1I94B 3RUPA 4D3ZA 1JIXA 3B2QA 3VZRA 1CQIA 3AJEA 1M0SA 2EG9A 2F17A 1KNQA 4UVDA 3WGVA 4YRGA 1TJ4A 2CMKA 3AZOA 4X93A 3HJBA 4EY5A 2R8PA 1FCJA 2HLPA 3DMTC 3K0KA 2X2EA 3ASUA 4UMDA 5JISA 1P6UA 2P9JA 3I9MA 3S7TA 3C87A 3SCZA 1U0EA 3L7DA 3QKRB 1B41A 3T99A 3NATA 3TZKA 4R2LA 2ZVJA 1NWCA 4BVLA 4M1EA 3CX6A 4QJIA 2Q8QA 5KQGA 3UCFA 2QUIA 3PC2A 1PT5A 2QG6A 2AOVA 2PM8A 3SC4A 2HBQA 3N9IA 4DW8A 3ELWA 3WWPA 5JZVA 3FSGD 4TS3A 1WUIS 2DHCA 1ZZEA 2JIDA 2UXDB 4DC0A 2YMLA 5KTMA 2GCOB 2VQDA 1N0WA 2B0JA 2Z4TA 4KK3A 4BQRA 1HYQA 2G5TA 3BKWA 1YJQA 2VP3A 1F8UA 1FJGB 5SZJA 1WUJS 4OXNA 5TEWA 2B30A 4X7RA 2NNLD 3Q8MA 5ALHA 2WQ6A 2C83A 2OSVA 2E1PA 3P2YA 1ZY2A 3CZ5A 1CQIB 2DQ4A 1KI8A 1U04A 3LBYA 4A5OA 4W9NA 2IPXA 5EIXA 1KS9A 2VRWA 2Z1DA 4MPRA 3U6BA 1R9MA 3UKDA 3FWHA 1M83A 4MUNA 1CIPA 2IEBA 2GAAA 3FCEA 2ECOA 3H2IA 5ANRB 3QXCA 4NENA 5AMXA 1RT9A 4C88A 2B0CA 1JFRA 3FX2A 5JCXA 1ZJWA 3J7TA 1PU2A 3ZV6A 1BRTA 4LSZA 1NSTA 1S3GA 3AUKA 3LX8A 3BXFA 3N8NA 5G41A 1Z6GA 1UC9A 2I6FA 5KHLB 1NY5A 2ROQA 1UANA 3OEEA 3C15C 3P96A 1Y3CE 3AOGA 5CUQA 4DWOA 2ZI7A 4OMUA 3VNQA 4OQNA 1KE1A 5KC9A 3PS9A 2FHPA 4M6WB 5EJ6A 2XCQA 1A7UA 4BLWA 3WNCA 3CCCA 3CNBA 3IQHX 1OH7A 4U0KA 2ZIWB 1NP3A 4ZKDA 3DKIA 1M2JA 2O0LA 2CDAA 4X1KA 2HA6A 1HKHA 3B6ZA 3Q87B 1KSJA 4PLWA 4V0LA 2CHGA 4Z1MA 3DBIA 3UJ3X 1Z36A 4D44A 4YP5A 4TMYA 4UBJA 4DADA 5FPKA 1CF9A 4FCTA 4UPEA 2Q5CA 2P11A 3LCVB 4LRYA 2GAIA 3LO5A 1FRZA 1ZUNA 3TKAA 2QSJA 3FLEA 4R8RA 3P52A 3HN2A 5EJAA 4MLZA 1X1TA 2QROA 4FJ2A 1MGPA 4E11A 1OXBB 1U4OA 1CDOA 3VAYA 2WJIA 5E3HA 4FEYA 2BEVA 4O59O 5IEBA 3LC2O 3UUWA 3ZWDA 4DVJA 3STHA 1C4OA 2Y0BA 3S44A 3HJGA 5ED0A 4RPKA 2ZRQA 5LBIA 1C8LA 5KWSA 2DSNA 3JD1A 5A7FA 2ZIEA 4UHJA 1UXOA 4ZVSA 4BMPB 1JJVA 1XDGA 3R9IA 3ZE6A 2P77A 5ALJA 1PLLA 4FSDA 4RZUA 1L5YA 2YXBA 4BO6A 2Q6KA 2VBCA 3NXKA 5J58A 1B0AA 4K6CA 3WAKA 2AG5A 4KLCA 4NZPA 3SZUA 4YREA 5FNVA 1IIRA 1SEPA 4J90A 1FRVA 4FBLA 1K27A 2Z3VA 1QFXA 4JELA 4Z4GA 5AKYA 1BXGB 1USUA 2FZCA 2PSFA 2VR1A 1Q15A 1MJGA 2HF2A 1OWMA 1W73A 3EZFA 3I28A 3PUHA 4JLOA 4LVCA 4TSKA 4U9IS 2PQ2A 4GG1A 1UDCA 1J8DA 3DXXA 3DV2A 2WLSA 3PWKA 4IINA 3FY4A 1SY7A 1ZUNB 2HLDD 3LA8A 5C4GB 4A03A 1GRNA 3BK2A 4FZVA 4GZ6A 3A4YA 2A6PA 3RSHA 4BNMA 2GTIA 5JSYA 2V1XA 4TUYB 3PFHA 4RH3A 2A33A 4B3SB 1O57A 1NW8A 2V74B 4ZALA 3N7TA 3HA7A 3IC5A 1QGUB 4CM4B 1Y6ZA 5BN4A 1FNMA 1EEXB 4OBWA 3AU9A 1P0CA 2A0FA 1Y7HA 2A1UB 1OI7A 2KBFA 3JD2A 4P54A 3B7PA 4I3FA 5LQSA 1WNTA 3TBFA 3ZYZA 3EMKA 1SKYE 8AT1A 1J42A 1DC8A 2GPTA 2PKQP 2VYVD 2YMMA 3LT1A 2P1RA 2ZRAA 4C08A 4BPBA 3GLGE 4CI0B 2PE5A 5EEHA 3AL3A 3PT5A 4ZXFA 1XVUA 3T38A 3TE7A 2BLNA 4FHEA 2JLCA 5K8UA 5AICA 4QASA 5JCOC 3ZWBA 1A5TA 2J67A 3FPEA 2ZJFA 1JFFB 2CLLB 1SIBE 2WD8A 5T4FA 4RV4A 4YTEA 1M75A 2NV0A 4LYJA 3UJ9A 4F97A 5BV2P 3A70A 2YHAA 5K0BA 1U9ZA 2HDHA 3B6KA 3FGOA 5AJHA 3H4MA 3WZMA 2EYUA 2BFBB 3ZBQA 4EO7A 4BBZA 1VJGA 2XQJA 4C0SA 4EG7A 4FD3A 2BR5A 1ADFA 3LZ6A 3VISA 3OP4A 2FRXA 1U0NA 1YQEA 2Z08A 2H51A 3P0EA 2H07A 4TSFD 1GNQA 5E2IA 5H0IA 4D8TA 1NGSA 1WE2A 2AMJA 2CXQA 3QIAA 1U0BB 4CM3A 2KB0A 4JLAA 1GCGA 3ENVA 4OYHA 1ADYA 2X0RA 3L4EA 2ODTX 3DWGA 4OQLA 5G0SA 4DRXB 1T8SA 3EIFA 2YZGA 2VDNB 3GO4A 1PL8A 2JRLA 4AZ0A 5LYJA 5E9WA 2YVAA 2ZB2A 3JXEA 3ZHYA 5JPDA 1H9CA 3EPHA 2O2ZA 2FGJA 3OOJA 2V58A 4EI8A 1QVRA 1M9NA 3WWCA 3GDHA 4I4TA 3HZZA 5TMBA 3SS9X 2R11A 2ZS9A 1GPWB 2OA0A 2H1OA 2B3DA 2IVFA 3PA6A 5KVCA 4GI2A 4UCXA 4RLHA 3SU8A 2PGAA 2O1WA 3RTDA 3TLAA 4AX8A 1DHRA 4EEKA 3G2KA 1FUYB 1ZONA 2HBRA 3ZDRA 1SC1A 1W5AA 2PT9A 1BCRA 4C1NA 1YB2A 5F12A 2QTGA 1FZTA 3T3NA 5CDSA 4U3JB 2QT1A 2DKNA 3QBDA 3IKTA 3QG1A 4GVXA 3TKLA 3F5DA 4H7DA 4OPMA 2CVFA 1NDUA 1W49A 4CHTA 4P58A 2EOAA 1Y3IA 3ZWMA 1V9CA 4GR4A 1DDGA 4E1AA 2GCPA 2NO7A 5H02A 1NF2A 4LJYA 4CQMA 1QIDA 4G01B 2GPYA 3LDAA 3LWZA 1AV6A 2WTNA 3UC5A 2CUTA 4XYGA 2IYXA 4FYJA 3NGLA 5T57A 4UVHA 3C3CA 4R6WA 4X3PA 5F23A 3LSTA 1QLJA 2B1IA 5ARDA 3TEJA 2I7VA 3I1IA 4RY0A 5T8KA 1U8YA 4NZNA 1OUMA 3IODA 3O82A 3QENA 2QF7A 2OD2A 1ZINA 1C30B 3PF9A 4N40A 5A3SA 3VX3A 3ZC3A 4PYJA 1DCFA 4XWTA 3S8MA 3TUZC 4EELA 2BR4A 3BXGA 4I3HA 3I2FA 1P5ZB 3TGPA 3ZD6A 2PKYX 2O3JA 2XOKD 2JFYA 4RF5A 3GT7A 3DTVD 1RTKA 3K73O 5MFPA 3ZE0B 2P69A 4BUZA 4OL0A 1SURA 4CR6A 1MENA 4D4MA 3PLRA 4J6FA 4LMRA 1ZSYA 5CLJA 3NIFB 4R1SA 2FY8A 3DXZA 3ZWKA 3DE1X 4WOJA 1YBHA 3EVGA 4WZBB 2FZEA 3MWKA 1DHTA 1UMBA 1L7NA 4M49A 4AZSA 4HWKA 3OEYA 1C9KA 3BIOA 1H05A 2QIPA 3X1JA 1SQ6A 1FJXA 4C14A 1USVA 2VHEA 3CUTA 4HX5A 4HAUA 5HMLA 2REOA 1JA0A 4F21A 1GAEO 4YASA 5ARCA 1MPTA 1YI1A 2IHJA 1EINA 2AZTA 4D80A 2C5HA 2QMOA 2WAMA 4P3YA 2WM9B 4XUEA 3BEOA 1OX4B 1Q7CA 2CXSA 4OHXA 3U81A 1H4SA 5U4QA 8OHMA 2QYTA 3QFHA 3FLBA 2I1QA 2Q3JA 2RK4A 2VP9A 3KLOA 4KQ1A 4XJSA 4POAA 5ALXA 1LY1A 5AM4A 1JA9A 2J3LA 3TL2A 3CBQA 1VSVA 4BFYA 3H1FA 3LT2A 2C4TA 4K8RB 1O94D 2ZPAA 4J49A 4IIDA 1PR1A 3VH4A 1JAZA 5LLTA 3I37X 4HB4A 2X9NA 1HF3A 2BGTA 2FPKA 3GGDA 3KVVA 5HVNA 1Y6QA 2ZBDA 4JJ6A 4AO7A 5HCIA 1O6FA 3OH8A 2PR7A 3R6LA 1EWQA 1KQFA 4BYMA 2QL5A 3IPCA 4HDMA 3RYTC 1A8IA 1GTZA 4HRXA 1M6WA 3A1VA 3DPUA 4F5WA 3Q9SA 2IE8A 4PYNA 5K0LA 4YROA 2FG6C 1PUJA 1Z82A 4I55F 1TFRA 3P9XA 1ZK1A 3INYA 3CT6A 3UJHA 3BMCA 4YGXB 4UHFA 1LBQA 1ZOLA 2PX6A 2PO5A 4OGKA 3PU6A 4EDFA 5K8LA 4K9NA 1J7JA 1OWNA 2WM2A 1CJBA 3A6HA 2R6ZA 3OZ7A 1ZMXA 5KI6A 3TQOA 4Q18A 4ZO8A 3H1EA 4DCSA 1OWOA 1QHGA 2L18A 1DB3A 1V5IA 2VF2A 3QNUA 1C4WA 3WS7A 4CKEA 1NTOA 4RELA 4QDOA 3TLXA 3CUKA 1W93A 4KAJA 1W76A 2RCNA 4TTIA 3SR4A 5KYXB 3HPQA 3Q0EA 4R0MA 1R18A 3O73A 3MINA 3ZNOA 4ZZIA 4TZ0A 3T7CA 3IMGA 2EU8A 3JQCA 1A2KC 4OI0A 3Q3GE 1RQ2A 4N49A 4PNHA 2X0IA 2XUKA 3FHCB 4KO4S 3GXOA 2QMZA 2WIFA 2BHNA 1HMPA 3QMMA 3H5TA 1S9DA 4V3CA 1XA0A 4IQGA 3N7AA 1F2TB 1SG9A 3PTZA 3P2JA 2O2GA 4Q9LA 1XG5A 3PXDA 4F2GA 5JD4A 2EW8A 1U8ZA 3AKEA 1K97A 1XMPA 4ZD6A 2LE0A 5CFPA 1UBLS 1B93A 2VK2A 4O2RA 4KV7A 4BNJA 1T4MA 5DX8A 1V4BA 2C9BA 5LSAA 1R64A 4F7WA 1QXSA 3HVRA 2WEKA 3V34A 4K6HA 4EKYA 4XQGA 2CL0X 1QO7A 1M1YA 3IXLA 3WL6A 1FLDA 4FXOA 1Y8QB 4M0KA 1OFIA 3D02A 3KVNA 3RUEA 5ALGA 4X66B 1NMYA 3BZWA 4GRAA 2UAGA 4Q16A 5HIMA 4EKEA 2C04A 3V5NA 3D1VA 5AIBA 4AICA 1ZJ6A 3KOXA 3DJFA 3PQ6A 4BVKA 3HCWA 1QHYA 3AEYA 3I2HA 1G4HA 4IKPA 5LZ7A 1ZIXA 5LOVA 1RYMA 5A1TA 4UNNA 4E1VA 1DG1G 2R8YA 3I2KA 4I81A 3I4LA 3QHPA 4JOQA 1W36C 3NBZC 3IQWA 4UVIA 4KDFA 1Q19A 1U0RA 4MQEB 2UUBB 4C0QC 3PP8A 4POOA 4Q1VA 3NRCA 4M83A 3QF4A 4XJXA 2C2ZA 5D7NA 4BS9A 5ITWA 2FSUA 2AJLI 1BMFA 3KU4A 1C9EA 4GOXA 5EKSA 3RRFA 1KDRA 3W3AH 3RSSA 1P17A 5FA5A 3U1TA 4O1IA 4A2WA 4MUEA 4NCHA 3MQFA 4PPGA 2BZSA 4F56A 4KACA 4AP6A 3TQRA 2WOJA 2FCRA 3QJYA 1GEGA 4EHNA 1USIA 3VPHA 3IPYA 1S1MA 1H1TA 3KS9A 4NTZA 1Y8QA 1ZH2A 2HFJA 2VP6A 3N2KB 4MVJH 1UC5B 5EMNA 1Z22A 1VMDA 5LQAA 4U7WA 1DRJA 3HKEB 3UH1A 3GC6A 4YAJA 3PQFA 2HHLA 4P1ZA 3OC6A 3LRTA 1SQ0A 4M55A 5JS6A 2PWBA 4CLHA 4DA6A 1JFSA 3W3AA 5FOUA 1VG9B 2HPZA 4GI1A 2ATEA 2B1GA 1U0JA 4INPA 3OQIA 2I54A 5JSKA 5K99A 1TEVA 5B6IA 1XDWA 3EOAI 4JA0A 5KYVA 2Q2NA 2KS6A 3S2GA 4UEQA 3RRZA 4AJHA 5GINE 4C0BA 3K92A 4MLCA 1W0KD 4EHBA 4BQOA 2WF6A 4J75A 1M8GA 3A6EA 4FC6A 5GV7A 1UT6A 2E18A 4OB7A 1QLHA 3N2NA 3OZXA 1A9ZA 1M8KA 1T5SA 2B7BA 2ZJ5A 3QELB 3RIHA 3L92A 1BD4A 2YFQA 2V0GA 4JI5B 5BUZA 1V3TA 5K3DA 4IUBS 1ISPA 5B1HA 3G79A 3T5CA 1RAIA 1CR4A 4DSOA 5FAKA 5LQCA 1L5MA 3EPPA 4PBRA 4A73A 4NG4A 2H08A 1F2UA 1A71A 5H5JA 1H2EA 1QKKA 4PRLA 4L75A 1JYEA 2BEUA 4QTZA 2P9HA 3TG8A 3WNZA 3P4UA 3A1FA 2VK8A 1DTSA 2PUGA 2V6FA 3TRDA 2PUAA 4RWEA 4XPIA 5AVYA 5DGDA 4NMWA 3QXJA 1DIRA 3AKCA 4CKWB 1I6LA 1K6MA 2ZS8A 3DFKA 1TVKB 1H6CA 1EVEA 4NY1A 4PBSA 3DLHA 5IVDA 1KH1A 4I4IA 5GVSA 2EEPA 3AVTA 1YVRA 1SKYB 2OXCA 3MTJA 1GU1A 5H59A 4K0RA 4J29A 2VDWA 4L0QA 1MRSA 3NTRA 3SDSA 4RY8A 2IBTA 2W9XA 1MBZA 2PR2A 1IYZA 1XO1A 2B25A 3CN7A 1N3LA 3OCCA 3ZCSA 1TZKA 3ABQB 3Q10A 1DIHA 1T10A 5SV2A 1JXQA 5CA0A 4F3KA 1GXSB 5FL7A 1NF9A 4DQXA 1KP9A 4UTZA 3VKWA 4CR8A 3EFHA 5F33A 2MT9A 2D8MA 2HMTA 1RBZA 2ODAA 3I05A 1NDQA 5BR4A 2WE7A 5HUHA 4M0DA 2IPMA 3VZDA 3E81A 5CDTA 1RFLA 1EVZA 3MIIA 4PYOA 2V6MA 3DBVO 4Q66C 2IZOA 5LBUA 2R6DA 1LBTA 5K0CA 1M1ZA 1T15A 4L7QA 1CS0A 1OB2A 3Q3VA 1BXRA 4OKSA 2IE0A 2WIKA 4KU4A 4KGDA 1Z7WA 3CX3A 5LQDA 2FUG6 1G4UR 1QZUA 3OQHA 5BYAA 2FF7A 2VKQA 2A1TS 1NBOA 4F46A 5BRJA 1YR2A 3L1HA 2IUTA 5GY7A 4KV9A 1U94A 1TVMA 5G0UA 1J2JA 1Z5UA 1ZESA 3GJQA 1WRBA 4OI2A 4PLYA 3RASA 1BEUB 1JDTA 2TYSB 3Q85A 4W4TA 3AONB 4Y2TA 2OG1A 2I7CA 2QY6A 3KJQA 2QRMA 3RARA 2F8LA 3DF7A 1NBHA 4HK4A 3VC7A 5I7FA 1M1YE 5JFGA 1NXSA 5CD9A 1V8DA 1P4JA 1W44A 2Z30A 1FMFA 1C2TA 1Y63A 5AUPB 1KTVA 4HGQA 3T5TA 1G8GA 5IKPA 4MW1A 1W4BA 2BTQB 3IJRA 4Y0NA 4MW4A 5F21A 1HTBA 2HXGA 2XNSA 1J0DA 4F91B 1VIDA 3ME5A 4MV0A 1K5PA 2WKRA 1YS6A 1U2GA 1D03A 2KJQA 4QRIA 3TAXA 3U7FB 5A4IS 3KFLA 3I8SA 3I04M 1BXRB 4M1OA 2H31A 4KO1S 3RRMA 3IYLW 4OIFA 4KHZA 2VP4A 3E0XA 5CIYA 4B76A 3KM0A 2WTEA 2GGSA 3WJAA 1IJBA 1ULAA 3CQ9A 4NOJA 4P81A 1XC7A 2HWXA 4RX1A 1R1DA 1NT4A 3C45A 1QNFA 4FS3A 3VSBA 2I9KA 1CUZA 2GCOA 3E5NA 4CXMA 1ZR2A 3IXQA 1HRKA 3CXUA 5AKKA 1UZNA 2EJTA 4CLOA 2WF5A 2P40A 4R1PA 4PTLA 5DEOA 5ES3A 4PQGA 2XGJA 4BLQA 2Y77A 3IA7A 1RAHA 3D8UA 2GM4A 1H1LA 4RJKA 1ZL0A 3D7MA 3D6UA 4FYPA 4MR9A 3W2IA 3RC9A 3PKJA 5KB3A 2P6UA 1X1AA 3EF3A 1I3NA 2PX2A 2FPWA 1ZGGA 2X86A 3MJRA 3F1KA 4QQ8A 4UDYX 3ZWPA 2Q7OE 4BNVA 2XUIA 4TKUA 2RHTA 1X1SA 3B82A 3ROMA 2CLOB 4N0QA 1WLSA 3EULA 2OZKA 1PHRA 4TS1A 1WEHA 3EJWA 5A06A 5JASA 5CURA 3KETA 1DJNA 1GU7A 4D41A 3PLAE 1KERA 2ZBFA 5F3DA 3JYQA 1JEJA 3HCDA 2HCRA 4FCCA 4LYEA 3ZIAD 2V97A 3JZDA 1WZEA 2VG8A 3KJHA 1JU3A 1HNWB 1I14A 3BRSA 1DP4A 1Z7EA 3FCXA 1I2CA 2ZSKA 4MS1A 4MK4A 1DZIA 1TPZA 4U3JA 4DWJA 1YKFA 5BQFA 2Z8YA 3QEOA 3A6GA 2RD2A 4JLKA 2GEKA 2J6BA 3NPAA 1DV1A 4QHTA 1SCBA 3NHMA 4NCKA 4C6TB 4HWPA 1K63A 2VUIB 3FA2A 1L7BA 5HUJA 1KP2A 3BJIC 3N59A 3JWGA 4Q9AA 3HA2A 5A71A 1Z0SA 1GUDA 1HEUA 2BFAA 4KAAA 4IFTA 4LRXA 1QBKC 3TCKA 3G2IA 4JYPA 4NMMA 1QUFA 3LGAA 3UK2A 1LSSA 4HNHA 1ZK2A 3GLHA 3OTGA 3ZN2A 2ZG6A 4YR9A 4UMEA 4ZIRB 3H9EO 4V3BA 1W2WB 1JSZA 1JXOA 1MX1A 2B20A 4LJAA 4UMFA 1IRIA 3GFTA 1W581 2BIFA 2G83A 2WJZB 1F4VA 2RGWA 1LBHA 3HCPA 2XPCA 2X9LA 2RHCA 2PUTA 3TBKA 3R7SA 1IDN1 1GKUB 1XTZA 1ZMRA 1RJEA 1EUDA 2JGKA 3BXPA 3M6VA 1E3DA 3ND7A 4JASB 4R2XA 5EQDA 4IZHA 2QA5A 1AN9A 3NS7A 5HZKA 5EMKA 4K1XA 3QA9A 4ZEXA 1X7HA 3EMDA 3MWYW 4HVAA 1HI9A 4IIEA 3TYXA 3U09A 2AJ8A 3HUFA 1P1IA 3I39X 1RD4A 1OGYA 5L3SB 1R4NA 3VR4H 4R5HA 1Q5PA 2DUUA 2X15A 2XW6A 4U1RA 5FUWA 4BTLA 4EA9A 5LVAA 3SXJA 1I01A 3EEIA 4QO7A 2UZIR 3IMCA 1SZJG 3DOIA 3FETA 4ZVTA 1MCZA 3W6UA 4CMHA 1HXHA 3L6DA 1E92A 1T9CA 1IXZA 2ZKLA 4ZI7B 1I33A 1BA2A 3NP9A 2ORVA 1UKVY 1XELA 3A37A 4DR5B 2RGDA 3HSYA 3I5XA 1KRWA 1Q3HA 3EHDA 3K53A 5DHSA 2YZMA 4JT9A 3NKFA 4FOTA 1COWD 3BWBA 3OZAA 4GPZA 3DM5A 3MJ4A 3PNYA 1AB5A 1XDZA 2BGUA 3PXCX 4DABA 1TTPB 2A0KA 3Q3CA 3ANXA 1G20E 2A9PA 3K0CC 1I7DA 2NQ8A 3BILA 4DJ5X 3IAS1 3CZMA 4F1JA 1L4LA 2W43A 1T0IA 1UIRA 3K4HA 3SF0A 4ZZ1A 1O87A 3AR5A 2PSHA 2I03A 4TM7A 4IGFA 2G80A 1KEUA 3G88A 1JXMA 1Z75A 1KO1A 3OLYA 4V0MA 1C9MA 3H3XA 1F2DA 2QSUA 3QVMA 1C0PA 3WLPA 4ADSG 4KQFA 2O5RA 5SZIA 4XPZA 1M2OB 1ZCFA 2QR2A 4WKCA 2ODQA 1Y48E 4FM9A 5JROA 4NEQA 1JX6A 5BOVA 2REQA 4Y2JA 2IW1A 3I4FA 1WXXA 1OFHA 1V71A 3DEFA 1RAAA 3KO8A 1ZXXA 5ALTA 4GLFA 3DS8A 1U9IC 5FPTA 4TTQA 3F6CA 4BQIA 4OQDA 4Z4CA 2HQ1A 5DO9A 2IF0A 1A8UA 2BEJA 2GZHA 5FR1A 2ZRPA 3WGZA 1J22A 1I10A 3W79A 3RC8A 2GILA 3R5JA 2QRJA 3D7SA 4ZYXA 1ORRA 3T4PA 4EENA 1P80A 3MWEB 3WA7A 5AKZA 1MAAA 1Z0KA 1U2EA 5FRDA 4ZK2A 5L4NA 4B44A 1H42A 5DYTA 5I8PA 1AUVA 1Q17A 5JXIA 4YS6A 3R09A 4BB0A 3B7GA 4Z9AA 2JAHA 4C7OB 4K9KA 4P3OA 4EGFA 4V1CA 1PEKE 2A94A 4LECA 1WZ2A 2IS2A 1E61A 1JJAA 3PXUA 1DS6A 1I2BA 1LTQA 1RKVA 3MJEA 4DRXA 3WI7A 5AXAA 2O0JA 4G4JA 1ZH8A 4QYWA 5LZ2A 1WP9A 4W8OA 4WUVA 2ZUEA 1K7YA 1N0VC 3NDPA 1EFCA 1QVAA 3CLUD 2GESA 3V1UA 4M37A 2QZZA 3FTCA 4MDYA 1D4FA 4CV0A 4TTRA 3X43A 3AWDA 5LQUA 4KR3A 4LBZA 3T4UA 2EL7A 2WJHA 4E5YA 3PX3A 3WWOA 3GG9A 1XU9A 5SY6A 4EB6A 5HKOA 5KNCH 3R7WB 4LZWA 1TK2A 2O8NA 3LVRE 3ROPA 4C5BA 5DKFA 1HE2A 3QX8A 5TMDA 3W8NA 4EG4A 5F2KA 2VWGA 2VDLB 1V8ZA 4QODA 5BR8B 2IOYA 2P27A 5B1IA 1KQGA 4KFTA 2Z83A 2GCGA 3EVEA 1XTPA 5BOSA 4PHFA 4KO2S 1X9GA 4RDIA 3D3NA 1KJJA 1E1DA 2VF8A 4LHYA 1JZSA 1QSGA 1WZUA 1WO8A 2QNIA 3GT4A 4QFMA 3UGQA 1D2RA 2NSDA 3H87A 3D3WA 3QUQA 4AJNA 1J0AA 3KLMX 4CV2A 4RANA 1RXSA 2QTNA 4DPMA 4ER3A 1FNSA 2FWIA 2MSLA 4K7JA 1UWKA 2WG2A 2ZRNA 3PB3A 1SVUA 1EDEA 5CDYA 5JQGB 4AN4A 1KJIA 3C5CA 2VKTA 2G70A 3TZ6A 5JNTA 2FZGA 4Q03A 1GQQA 3A9RA 3GRAA 4IXNA 4MDHA 3R9WA 1YQXA 2D3WA 1WF3A 2O9JA 2I80A 4HG2A 1G3QA 4ED9A 3L6EA 2ARKA 2Q6TA 3K6SB 3BH7A 5LB4A 5BRNA 1GZVA 4Z9XA 5KCMA 4E7PA 1U28A 1XN4A 1CWUA 4ZCTA 5C3UA 2QQ5A 3JQPA 3MF4A 2AJCA 4R1OA 1NVDA 1X19A 4W1SA 4YT4A 5DWVA 2UUAB 3FTDA 3EVBA 1XOIA 1Z2CA 3EUEA 3IAS6 3O75A 4YLEA 4PYLA 4ZGWA 4FI3F 3RREA 4MCAA 2W11A 1QHXA 4KXXA 1RMQA 5IN4A 1T3HA 1X7ZA 3CF0A 5BSHA 5G2OA 4IILA 4ZHSA 4WFIA 1M33A 1XR3A 2J5QA 4FFBB 3AZPA 4Y3UA 4CG1A 3STWA 3L0OA 4EATA 3Q8KA 2DRIA 2TMKA 5FJIA 3K70C 3EHEA 2P1DA 4ECEA 1OAAA 3GFFA 5DHPA 9LDBA 4PWZA 1JH8A 2CXNA 4ZT2A 3R5TA 3BT7A 4BHTA 3FWNA 1ZM7A 4LQ4A 1UMBB 3NHRA 4XDGA 5JANA 1RHQA 4G1EB 5DN6D 4FOSA 2RBGA 5JATA 3S99A 3V32A 1GQSA 2HQSA 3VR2A 3CZCA 4TL8A 1COZA 1WA5A 3USZA 1YDMA 5IG2A 1F0KA 3WLSA 2HF7A 2SECE 1BX3A 4DCNA 3GLHE 3LWBA 2WMNB 1E7RA 3NI2A 4EFKA 4YRZA 4XSVA 5JJCA 5IASA 1AE1A 1DAMA 4G36A 4NJOA 3MMSA 3QBTA 1C7FA 1VMIA 1JUDA 2HFKA 1X7ZB 2EGHA 3I0MA 4QBKA 5K0JA 1SHTX 1X7WB 4KITB 4Z4IA 4IIGA 5J1SB 2J0SA 2BI4A 1LRJA 2RSLA 3QUBA 3QZUA 4GQBA 2A1IA 1LDMA 1ZM9A 3K0CA 4DCOA 2NO5A 1RXWA 2WSSD 5HM6A 3CSDA 1JB9A 4HAXA 2C7PA 5IAEA 2FX3A 1U8FO 1GWNA 2H3HA 2V7GA 3O5AA 4BKUA 4MWOA 4RTLA 4JI1B 2VH5R 2Q5HA 3IBFA 5TT1A 3UKOA 1R9GA 4R01A 5IFKA 1DJLA 1VHLA 4CQJA 5JH7F 1VKZA 3UHPA 1PJRA 2ZSHA 3IKLA 3IUBA 3R3UA 4RH1A 1XD2B 1ICIA 3NV9A 4GPAA 1NR5A 4H9GA 4IJUA 4RK0A 2UYCA 3THYB 3NASA 1AS3A 2OLKA 2JFUA 3B7WA 3DPIA 3WB1A 4B8WA 3HDQA 3EGOA 3HP7A 4J0CA 2PX0A 4NYJQ 3M1YA 1T8RA 3BL5A 3NJ8A 5LWHA 2VTEA 2G88A 5H83A 2HTFA 4YA6A 1U7PA 5ELMA 2VDKB 4G97A 4JC4A 4LPSA 5EXTA 3KOZA 2HBZA 3BGIA 2P9QA 1M6VA 3PC3A 1M1XB 3IQEA 1X86B 2O2CA 2C61A 4I4CA 1PUXA 3FOCA 4WAUA 4QQKA 5IJXA 2IV3A 5BMVB 2EJUA 3QOWA 4DZTA 3IUQA 1KMQA 4D4IA 4MYCA 5K4HA 2R7AA 1CZKA 1OBVA 4LY0A 4FDLA 4FDVA 1ZVMA 1RQNA 4KFSA 1I3MA 2IZ0A 4RQUA 1UJ6A 3VR1A 1LLQA 4B6RA 3N58A 2XQFA 1FRFS 4BFXA 2BTEA 3WHLA 3MPOA 5FFFA 1XRSB 4AF7A 2UV8A 2GJ9A 2I6TA 2JBAB 1E0SA 4HNTA 3DG9A 4N5NA 3GG2A 3QFTA 1PR6A 3L4KA 3VR5D 1M10A 3CE6A 1ZFNA 5LMCA 3BIXA 1OI2A 2CEKA 3B52X 4PVDA 4HDKA 3HUDA 2AVDA 2OQRA 3KPJA 3TRIA 2AYYA 1FXUA 4WCFB 3UAOA 4D9BA 2GERA 3KJFA 3FTNA 2NVWA 4G63A 3RVOA 3TMAA 3UB3A 4F72A 1THMA 5LP6B 1EBUA 3IUSA 3O4IA 4PLZA 4F6LA 4FGKA 4PQFA 1SZDA 3LUBA 3Q7SA 4RIHA 2VA9A 2QOEA 4Q24A 2Q27A 3SZRA 4DLUA 4DJDC 1U81A 3ID6C 3CUSA 1Q77A 2B35A 1NOJA 1C7RA 2R1VB 4UM5A 4QPDA 2QDKA 4V0QA 3LA6A 1E0KA 4INAA 1UKAA 1L8QA 4X60A 1N4AA 4NYMR 3ZZMA 4EHKA 1EFUA 1Y1RA 1G5IA 5AOCA 5ISMA 4HRAA 3B9PA 4ZOLB 1C1YA 3B5IA 3FCCA 1B3RA 4G9GA 2O06A 2CY0A 1GPKA 3LFUA 3QU4A 5KBYA 1P9NA 4X1YB 2J0QA 2HH9A 4KLNA 5ALRA 1GGMA 5KQSA 3AY7A 1BOFA 4LWZA 4P82A 1G5PA 5L4LA 3THWB 2ZRJA 2EYQA 4EYQA 3OX3A 3GWGA 5AQ1A 1NM5C 4B74A 5BWCA 3NHZA 5AKIA 1QK3A 1TNDA 1YE3A 2CJYA 3E3AA 2XUAA 1O0BA 3MMZA 2OB2A 1ONBA 3KCNA 3OE4A 3OJWA 5IX8A 1GM5A 5AJWA 2PRYA 3U80A 1KO5A 2WZDA 4EJMA 1K75A 1OLSB 2XVZA 3F6SA 4FXPA 1U63A 1H6AA 1YCFA 2PD3A 4IX9A 4TRRA 4BEBA 2WMYA 4B40A 1MFPA 3LUDA 4KGZA 5AK5A 3KXIA 2GZAA 4KFUA 2G82A 3DGEC 4DNPA 1ZBQA 2HNKA 1OTXA 4EB0A 1CTQA 3GVIA 2GN2A 3P5BA 2QT9A 1QB8A 5IP5A 3OE5A 3OUTA 4B75A 5KJCA 1MXFA 5T4BA 1L7RA 4ITUA 1BMQA 1G7SA 4MVXA 4EJSB 3H0CA 2YX1A 2P6RA 1EGHA 1BCSB 2MHCA 3T3DA 3ORQA 1DQRA 3KXDA 5KOJA 1C0EA 5CFMA 1LEHA 1PX2A 2GH1A 5KINB 4JSYA 5L3ZA 1RLUA 1ISHA 4B2LA 5FCDA 1OCEA 4I6JA 4LG1A 3HR8A 3LGSA 4HDOB 4EVQA 2C3PA 3LLCA 1CP2A 1SNYA 4WK4B 1V8FA 2DJ5A 2XWPA 3DLBA 4ARBA 4U5QA 3NJ4A 4DSAA 1J2TA 1EMDA 2HPVA 3RRYA 2R9VA 2QTFA 3FPJA 1QKIA 1JECA 1D7AA 1QP0A 4DFDA 5JSQA 1WD5A 2IHTA 3EG9B 4X8OA 3STVA 4BLOA 4RVHA 4R8VA 3OPVA 1O6BA 3WDKA 1IL0A 1PWHA 3V8QA 4B3XA 4K86A 3V1TC 2Z9CA 1B2RA 3DTYA 3HEMA 1PK9A 2D54A 4C6TA 1QZZA 3SR3A 4A8JB 2ES4A 2P78A 1AGPA 2WIGA 3KT8A 1QRSA 3KPVA 2F1JA 3L8CA 4PLCA 3NZEA 4PG7A 2QZPA 1E4YA 2ECQA 3M6IA 4ND3A 3A4TA 3GNSA 5E7JA 2FSGA 1E5LA 2HJHA 3UV3A 1AUPA 3PBKA 5LKRA 5D2CA 1CT9A 1Z4NA 3BWVA 4I9HA 2GBLA 2DPXA 1I32A 5TS3A 1IM5A 1EX1A 3QEBZ 4ENUA 2PV0A 3LLUA 2WUFA 5IWCA 1CEYA 1NFFA 2V8BA 2Z58A 3PR1A 4RZSA 2WYVA 3WJ1A 5ILGA 1E3WB 3UT5A 2FEXA 2VCEA 3PCXA 3EWNA 4IV5A 5FH9A 5LR6A 4RFSA 2VNKA 4ID9A 2BHRA 4GVPA 4E2WA 2PVSA 3CUVA 5ADVA 1RI5A 2VPYA 1NUSA 2VJCA 1JIIA 1KEWA 4UUPA 1K3TA 2VXBA 3L93A 3AP3A 2PH5A 1XAJA 3LHDA 4PRZA 4X6YA 4XLZA 2FV8A 4DUGA 4X65B 4FX2A 2VJBA 1TZCA 3D8HA 3QEMB 4OFZA 5CA0B 4DV3B 1RLJA 3BX1A 3GZNB 2CZQA 1XQWA 4X6UA 3ZHOA 3ZZ0A 4AVYA 1CQXA 5HNKA 3ZHZA 4RXUA 5K51A 4TZTA 5KDLA 3ZDZB 5HFJA 4WW0A 4ZAFA 4QWWA 2VP5A 3SZMA 5GZ1A 3AY3A 1U8EA 4OHZA 2ZZMA 2NZXA 3LAWA 5T5QA 4RJIA 4QVKA 1HLDA 4IMRA 2D2EA 2XECA 4DV0B 3BHJA 4B3HA 1A97A 1VC2A 3FIUA 3EUWA 3NRJA 1Q0LA 4JLJA 5E1BA 2DUWA 1M3SA 3VYWA 3TEFA 3MZ0A 1T3LA 3KHUA 4YRRA 1L7AA 2IY9A 4BL5A 2ZVPX 1QHSA 4QYTA 3K72B 1A72A 1UPCA 1YDGA 3CH6A 3GLIA 2DETA 4CEIB 1GUAA 4KLZA 4PSVA 3V55A 4ESVA 4DV5B 4KOAA 4D0SA 5CBPA 2QVYX 3L2OB 5AK3A 1ODTC 2X0FA 3B53X 2HA7A 3NH9A 1M2OA 4N54A 3BXOA 5B53A 2ANBA 1GFZA 1FBNA 1FDRA 3GZNA 3NVDA 3D0OA 2R1TA 2FWBA 2C8VA 4LRTB 3PE6A 1Z6TA 1R66A 1KQPA 1PCXA 2GVDC 5DI3A 3NTQA 1O0SA 5DW3A 3U7IA 2IDKA 1CHNA 2IY8A 1AQUA 1N8SA 1HPLA 2JGIA 3DZCA 3JAKA 3LHFA 2HWKA 4MV6A 2IEIA 3D54D 3F5SA 5ECWA 4WLOA 2AL7A 4DGSA 4PICA 4CVNA 2QAGB 2WRZA 3ZLTA 2FMTA 3JQ7A 4BNYA 1IZ8A 1NXOA 2FSVC 3ZDAA 3JQBA 2BELA 3FMGA 4FJ0A 3TN7A 5LP6F 1VHTA 4JB2A 1Z6XA 1ORWA 4ZAZA 4KSYA 3WLRA 2XUHA 1ID1A 2R8RA 5CDGA 1A8PA 2F2TA 1QDUA 1U6KA 4Q5IA 3B1WA 4M9UA 1ZK0A 1EWYA 2XDWA 1YDWA 4QX6A 4ZRNA 2YL2A 5HZGA 1GUZA 2P4HX 1BMDA 4TWBA 2XH8A 1NX9A 4QUAA 4S0ZA 4YI3A 5HPYB 3DE2X 4EDHA 2IXFA 4O4LF 2Z5GA 1SXIA 1KQ3A 3BC1A 3IP9A 3JYLA 4HDCA 4FVTA 3ZYCA 1JVNA 2ZE5A 4NHOA 2BI7A 3IEIA 4K6OA 1HFEL 1Z7GA 5BUSA 4B6FA 1JHUA 1LPSA 2NQ2C 2ZSIA 4CL3A 2GO1A 1SXJE 4D9FA 1P7CA 2JASA 4EHHA 1C3VA 1Z8DA 3TR5A 3C24A 1RCTE 4CMAA 3T5DA 4A8HA 3AUJB 2PD6A 3DAHA 3HR4A 3IUMA 3HU3A 3OZRA 5ALWA 2FSSA 2LTAA 3JQ7B 1K08A 4JYBA 4RW0A 1LXCA 2X9VA 5D6OA 2ZCJA 1QTIA 3SS7X 1FTYA 4XOUA 1FYEA 1I3OA 2JC3A 4FFRA 5CB0A 1PSWA 4KIJA 3F4LA 5AW6A 1JLKA 5FJJA 1XK6A 2FOXA 1IK6A 5ICSA 5FEUA 3COWA 1NBMA 1UFQA 1N3IA 1I9CA 1SXHA 4FT4A 1LRKA 2AQIA 4BNTA 5F1OA 1T25A 4PGHA 4ZT6A 4OXRA 4QDZA 2A88A 3IMKA 2OG2A 3UWDA 1BDHA 4FR2A 3FWKA 4LZNA 2Z3WA 4KQXA 1ESCA 2IEYA 4DTCA 4XXHA 4D98A 4IYRA 1QIGA 4JC5A 5C8VA 4J16A 1JH9A 2JA2A 2PKQO 4Y6OA 2IXGA 4R9NA 1KQNA 3LUGA 5CR9A 4CM7A 3ZPXA 2IP4A 3S2IA 3BGWA 1T8PA 4E5PA 5CFRA 1E9VA 5DTEA 2XTZA 5GOZA 4JROA 1PFKA 2H8KA 2F67A 2RI0A 4XARA 3C6MA 3SQNA 3UY4A 1Q2XA 1RHUA 1VKNA 1WQ1R 4QBTA 3PQ8A 2CE7A 3ESYA 1NBMD 2B3TA 4MRMB 1XMOB 4LF6B 5JJKA 1NUPA 1Z29A 1VQ1A 3RT9A 1O95C 5MGNA 2IZZA 4WCDA 5AK4A 1CZLA 1T4CB 2G8NA 2YXLA 3IOBA 3DVAA 4M9ZA 5F1PA 1JG3A 4LF9B 1XNHA 1SU7A 3C5WP 5DHAA 1GKLA 7GPBA 4IG4A 3ROFA 1WHTA 2GJSA 1Q83A 1JMYA 2YVQA 5BXYA 2EJBA 3GP5A 4RA9A 1TT7A 4AF8A 2DHQA 3F6YA 3K0AA 4TYNA 2AFHA 4LOKA 3LIPA 1TOAA 2XBLA 2YV1A 3VV2A 3V8NA 3OA2A 2NYAA 5IWAB 1GZSA 4QM6A 1TCVA 1Z0AA 2AXNA 4X1OA 3VR6A 2JNWA 3UG7A 2B8EA 1BDMA 2VEDA 1G7TA 4RSRA 3H7AA 5YASA 4OIMA 2QN2A 1VA4A 3JQDA 4I19A 1MDFA 1TRHA 3MTBA 4RU1A 3IS3A 3K9WA 3N6XA 4UDXX 2OENG 4GOLD 4XUCA 2OILA 3KSZO 2OV1A 4XCXA 4MJ7A 5BORA 1OH8A 4MRMA 3L0ZA 2WWGA 2V54A 4BKRA 2H2HA 3PJGA 4KXYA 4FK8A 5A0VA 4URXR 1DUSA 2JJYA 5HKKA 4MP3A 3U3MA 3FGNA 1FMLA 1YI8A 5J43A 2AR9A 3SJAA 1AQJA 2WIJA 5CM9C 3RIYA 1XCJA 2IDMA 4JNKA 1QH8A 5U4XA 2WAXA 3AI2A 2EFYA 3G2MA 5IAOA 3EZXA 1ELOA 2Q21A 3K5PA 1ZRNA 2FOLA 3JQ9A 4P32A 1L5FA 1TB4A 3UMGA 4HATA 1C9NA 4HAZA 4ZCLA 4CDRA 3PVSA 3TMYA 4R16A 3G1UA 1YA4A 1Z7BA 1YTLA 1RQ7A 2Z2IA 3FFAA 4IXTA 2AC4A 1F2TA 1VFNA 1E0AA 1I2MA 1QG4A 1YXMA 1P45A 1ST2A 3L77A 4HB2A 3ED1A 2HA0A 3U3JA 3TECE 4KPEC 5HJ5A 1GEEA 1E5DA 4GECA 3AESA 4ROSA 5KPJA 1YK1A 1E89A 2IZ6A 3H1BA 4E13A 1UFRA 1M6VB 5HKKD 1F1JA 2DYKA 1DAOA 4HDRA 4MXDA 4MRVA 4PPYA 1IWBB 1TUIA 2OOKA 4RY9A 4O29A 1CY2A 3GF4A 4C6RA 4TYYA 1M76A 2HF9A 3W5CA 2W4QA 4LC0A 1CUJA 1WD7A 4TZ6A 4J0KA 3KHKA 5BNIA 4Y1RB 1ZVJA 2W4IA 5HFAA 3RS5A 2ICAA 4FNOA 2Y1CA 4ZVKA 3WSVA 4G56A 3KD3A 4MMZB 4EY3A 1IEQA 3G9ZA 1KVQA 3ASYA 1TF5A 3ITDA 3ESAA 3O3MB 1PKEA 2ZUVA 2ZYVX 4FYIA 4LZZA 5FP0A 4P33A