2GM5A

An activated, truncated gamma-delta resolvase tetramer
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
127
structure length
122
Chain Sequence
ALFGYARVSTSQQSLDIQVRALKDAGVKANRIFTDKADRKGLDLLRMKVKEGDVILVKKLDHLGRDTADMIQLIKEFDAQGVSIRFIDDGISTDSYIGKMVVTILSAVAQAERQRILERTNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Recombination
molecule keywords Transposon gamma-delta resolvase
publication title Implications of structures of synaptic tetramers of gamma delta resolvase for the mechanism of recombination.
pubmed doi rcsb
source organism Escherichia coli
total genus 42
structure length 122
sequence length 127
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-04-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1390 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2gm5A00
4BQQA 3GUVA 5C31A 3LHKA 1HX7A 3G13A 3ILXA 2R0QC 5C35A 3BVPA 5C34B 2GM4A 2GM5A 1ZR2A 2RSLA 5C32A 1ZR4A 3UJ3X 2MHCA 3PKZA 1GDTA 3LHFA 1GHTA
chains in the Genus database with same CATH superfamily
3AIMA 1II8A 2XRYA 5DM4A 3K0BA 4BASA 2RIPA 1XTIA 4DILA 1FJ2A 1H1LA 3DTNA 2BGLA 4FJ0A 2BYTA 4ALNA 4NX2A 3DOHA 5C3MA 4XYLA 1WB6A 4EGSA 3ZGZA 3W6PA 4C5AA 3VPXA 5KTYA 3WLHA 5LP6F 5EGNA 3IBCA 4DC0A 1IY8A 2Q1XA 2VEOA 2JI8A 2XYGA 4KXFB 1RMYA 1VKJA 4RQTA 4WZ6A 2HHJA 4YEDA 4ALJA 4BVHA 2ZWIA 3G8BA 3EZYA 4K6CA 1VSBA 1MX9A 4IHJA 1H9BA 2HF7A 4D8UA 1PR2A 2C5SA 2QMYA 3GEBA 4XVQA 3WGQA 3SQMA 3NEPX 1BQ3A 4MVJF 3SQOA 2IHTA 1E6EA 1CJUC 1BJKA 3PJFA 3PIDA 2AEMA 4MAAA 4UM8B 4DT1A 3W90A 1ZVJA 4MITA 1U4NA 1QDEA 3FVQA 4KJXA 4L0MA 1F2UA 5SY4A 3IAUA 1MG0A 1NVGA 1XEFA 2PFGA 3CR7A 3ML1A 3KETA 3AB3A 4DTIA 2HWXA 2OMKA 5JBNA 1U2ZA 2X6QA 2VOEA 3E53A 2D4AA 1XHLA 2JAXA 3F8TA 2EBUA 5FWXA 1T3SA 1IZZA 1ZR2A 1TW3A 2QU7A 2XB2A 1ORHA 2ZIXA 2PRJA 2ZRQA 4FYJA 1P3Y1 1MRZA 3RS7A 3N2IA 3EIXA 1B1CA 2Y27A 4MWDA 1N2JA 2VCEA 2X5OA 3I4FA 3O31A 3GEPA 4NNJA 5DTMA 3TQTA 3QJYA 1EDDA 2BFPA 1EWTA 2BM0A 2OG2A 2YJ4A 3HWSA 3L6UA 4LJRA 3MJVA 5ITZA 4N6NA 2YBEA 3F97A 2WD7B 1GZSA 1UQTA 2D62A 3RC2A 4U2GA 5PNTA 3CFYA 4YYZA 1WXFA 1R2QA 2PSHA 3QKRA 4IZIA 2ZI4A 3ORSA 2LWIA 4FHEA 5IAGA 1M72A 2ZS9A 3HKCA 5ALMA 2EU8A 4OLJA 4R1TA 4G01B 5ERGB 1SD5A 2XWQA 3DPUA 3KT8A 3DTVA 1L5HB 4JCCA 2O8DA 3B2EA 4FFBB 2CDBA 3W3AD 2IQ5A 1GTMA 3O8OB 1GUAA 1R18A 3K92A 5K0BA 5DBEX 2RK3A 2WF8A 2WIJA 3IBTA 4QUEA 5C52B 4QHSA 4OUDA 1U9YA 3DLTA 4EF5A 2QZZA 1TQ6A 4CODB 5DMXA 3NC0C 4ZEXA 3LQ4A 1ADYA 1C29B 1JR3A 4KBFA 1GPKA 4EG5A 2J4CA 3HRIA 3C6YA 3ZJ4A 4DG9A 1UBEA 2R44A 2W22A 3S68A 4XDGA 4YUVA 1WB4A 3IUYA 5E4YA 3GD5A 3U37A 3V8NA 3NWEA 1T4BA 2EL9A 1NMEA 4NDNE 3DGFC 4KQ2A 3T9BA 1F3LA 2IGTA 2H2AA 3G5MA 1APBA 3RK0A 5EVCA 3G68A 3RT9A 2VZEA 1T91A 5FUVA 3DMPA 3WBKA 2I66A 4YR7A 2JCYA 2BI8A 3KZXA 3R8XA 5L40A 1XMQB 4EJMA 3TNFA 4IBOA 1ID1A 1Z33A 1ESNA 3A1VA 1M6VA 2CFOA 4AY2A 2YJGA 1JDNA 2SECE 1UK9A 3NRBA 2VATA 3EGOA 2FR1A 2QR5A 4E3ZA 1IBMB 1TF2A 1VBFA 3GUYA 1SQ0A 4DMRA 3I1JA 4W7IA 1KY2A 2O2EA 4YJKA 4XGRA 5EKTA 4YQFA 2FKAA 4UM9D 2FLKA 2PGIA 3DLBA 1VIVA 5JYEA 4PTYA 3CMCO 4O8CA 4E5VA 4GUAA 3ZDEA 2BI4A 2XLCA 4EI7A 3AESB 1BU8A 3C5HA 4IFBA 1Z0ZA 5CDTA 1N0HA 4MRSA 3ZQ4A 1O97D 3FRIA 4BAGA 1V43A 1W85B 1DO2A 2PN1A 4N40A 3SC2A 5FUMA 5IKEA 5LOVA 5M29A 1V2GA 4GVLA 1EZZA 3IT0A 4MKGA 3M6LA 3B1VA 2C8VA 1OI3A 1WF3A 3DXZA 3MINA 1SC4A 4HNRA 2BF4A 4UEJA 5IZ4A 1XZGA 1GSOA 4LXQA 3RAFC 5KC9A 2YZ2A 2YWDA 1K7XB 2QAGA 2RJ3A 2GPNA 3LC1O 4X0EA 5CGZA 3X1WA 3AQ4A 4A0FA 3SWWA 2O14A 3IVXA 4RV9A 4ABYA 4BKUA 1DGQA 2HZ7A 1XF1A 4BQNA 5BV1A 1L5LA 4RORA 4WE3A 1TL7C 1EFAA 1ZGCA 1UXOA 2ZJ0A 3VYWA 3NOQA 3PGXA 3GZNA 3W8RA 3CVVA 2YJ3A 1UC4B 1OXSC 3I1YA 1E64A 3MTQA 2IEYA 2Z1DA 2VXBA 2B9VA 5DM70 4K1LA 4G0WA 4HG2A 1MC8A 3DO5A 4KQWA 1X80A 4OFWA 5F7XA 2DXIA 4ZALA 4NE9A 1OYWA 1N8NA 4TTPA 4JU9A 4QXOA 4X6XA 1EYZA 4DEVA 4QJ5A 4P4LA 2Y2VA 5HKAA 2AFVA 4G0OA 3QTTA 4CF7A 1ESEA 4KUHA 5KB3A 1RC1A 4IGKA 1R6AA 3C87A 4GOKA 4MX8A 4C88A 2PNFA 3A4YA 3C8MA 1XZ8A 3ILYA 2PNJA 2GD6A 3ASZA 3WO0A 2P2ZA 2JVJA 1XD8A 4U7GA 2UAGA 2B99A 2HDHA 4OQMA 5AW4A 1YDEA 1COWD 4FYWA 3F74A 3ZKWA 4E2ZA 5F1OA 4FK8A 1HPLA 3AT1A 2EBFX 3ZJYA 1FA9A 1OROA 1WU7A 4D5GA 1D2CA 3A3PA 4ZKDA 1E9SA 1P4JA 3B2QA 2X4DA 2Z9DA 5DM1A 1KMNA 4HDKA 3M9LA 1HZZA 3QI2A 4GBJA 1KYZA 3RTGA 3WRYA 3BFVA 1YVDA 1L1EA 1NBHA 3HVKA 4QUGA 4YXWA 2R00C 1DX6A 1ZGJA 4GGPA 4Y6LA 1CR4A 4P4SB 2HMVA 5D5PA 3A4TA 1ENPA 1U1GA 2XF8A 1GT6A 3RYFA 3AOEC 5DEOA 4EPTA 1HQKA 3H13A 2CVOA 2EEZA 4D9CA 1QHIA 2OKCA 1I3OA 3PLAE 1TAUA 1WABA 3JASA 3PIRA 3TBKA 1FBNA 4Y6OA 2F43A 3D4IA 4O5OA 3RVBA 4D9NA 1OX4A 3EN0A 4JS0A 1JMYA 3RTAA 1LFDB 4ZN6A 2VUUA 1WW2A 1DC7A 1S9HA 1OHHD 3HGMA 1OB5A 4JLOA 4HQOA 2F9MA 4IFEA 3F9IA 4ZJYA 4N1AA 2X8LA 1M2JA 3DDOA 3PKIA 1SOMA 3R41A 3C8UA 3IAM1 4FFPA 4TKUB 2VJAA 3EJ6A 5DBHX 2VSFA 1O0BA 4F4DA 2VJMA 3NBKA 4TLMB 4P32A 1YR2A 2FDXA 3RROA 3TQIA 1W4ZA 1JYFA 2NG1A 5J5CA 2ENUA 5EXSA 1Z73A 1CP3A 1J4AA 3H84A 3NPAA 4MUYA 4RPCA 3QV1A 3W7BA 1SD2A 1CLUA 1T3ZA 3IS3A 4QUAA 4EPYA 1NIJA 1IN1A 4FNAA 4AJLA 2G7MC 4N7RA 1ZIOA 5I9BA 4MO2A 3PDIB 2R9VA 4U6QA 3SZUA 3T35A 1IVNA 3D8BA 3GJQA 3K1YA 3DNMA 3MTDA 3HCWA 2P2CA 1NQUA 4OP1A 4OBWA 3WRWA 3W78A 1PT5A 4DPMA 4GECA 4XCVA 4JKYA 1VCOA 2RHDA 2WFLB 3MWYW 3VR6H 3U3OA 1S4MA 2HXSA 4DLSA 4O4LA 5AUQA 1U5BA 4MVCA 1RWVA 1P0PA 3K9HA 4KEAA 5CNMA 3VO8A 2RGBA 3M6IA 1CRLA 4AKHA 3B5IA 4Z4QA 2ZETA 1XQXA 4WQMA 2WMYA 4OHZA 4ED9A 1WS6A 2AXPA 5EIXA 2W2OA 4FYMA 1DXYA 8OHMA 2IYAA 4PSDA 3JR7A 3MT8A 1WJGA 1ZXXA 1CSEE 4DKJA 2BJHA 1BXZA 1BMFA 2AG6A 1Y9JA 2ZUWA 1K4MA 1OH6A 3YASA 4CL3A 3VC1A 5KYXA 3UF0A 3LUDA 4ZMBA 1E9RA 5JISA 3OF5A 4MCAA 4ZC1A 1ZH4A 1XPOA 1Q0PA 4DIUA 5KNDH 1E1QD 2OB1A 3ZXSA 5EGSA 1FDIA 2QPTA 3S27A 5JECA 4F11A 3TECE 4L4RA 2HF8A 1JQEA 1U1FA 2EJVA 4QXQA 5TMPA 2C03A 3U7HB 1I30A 4P83A 2XGGA 1EG2A 5CFOA 1IHOA 1LEHA 5IUNC 2A1TS 2HWKA 5IVKA 5HTOA 2V6BA 4MMZB 4LDRA 3GRFA 3ETEA 2J9FB 2HDNB 1Y42X 1V16A 4W6QA 3MT9A 3R3HA 1DTEA 4NNOA 2ZJYA 1XJ0A 1EXNA 2WHQA 4OTZA 1DLJA 1K88A 1TADA 1T4CA 5CDSA 821PA 3I9V6 2A5YB 3GOHA 4ZI7A 5CU7A 3SR0A 3SHVA 4YWHA 1HE1C 4WDRA 3SQNA 1R6TA 3P2OA 4XM2A 3EGXB 5IC5A 5IT5A 1DQYA 3TCNA 1ZS9A 2ZQYA 3AM3A 4J07A 3O2JA 4PZYA 2OBNA 2BN4A 4XVRA 1ILWA 2QTRA 3AGPA 4E09A 4BMOB 2QLTA 4FB4A 4QBHA 4F6RB 4GRIA 2PV0A 4JP5A 4CHGA 5SICE 5I3CA 1AZWA 2DVMA 4GMXA 1HDYA 3IDQA 3NO4A 1VLZA 2AQKA 2HCFA 4GH5A 4KZKA 5KSPA 4CV0A 5JZ9A 1E2PA 5CBKA 3QYPA 3URKA 3ZEIA 3DL7A 4KSCA 3UWSA 4I50B 2HJRA 4J75A 2P6PA 2PUAA 3RRXA 4M88A 2P9GA 3N0RA 4QPCA 2EW2A 4IV5A 2YUTA 1Z0FA 1T24A 3SC4A 5LZ8A 2ZIZA 1KVSA 2O06A 2X77A 1FYXA 3LBFA 4KQIA 1LUAA 1YZ3A 3PFGA 3A31A 3DOCA 4MR8B 4MPJA 4XJXA 4IH4A 1RHQA 2KM1A 3RM3A 4US2R 1LSOA 3LXXA 1EHIA 1HZJA 1PI3A 4NF2A 1RR6A 3HXMA 3M82A 3A3YA 3GCGA 4HDNA 4DIEA 1UBTS 4P3XA 4QXMA 4Q1AA 2B0JA 1FS6A 3EFOA 5D5QA 1K8RA 1E1CB 1OIVA 2P9FA 3F6PA 1RLMA 3G9ZA 3KTAB 3OZAA 4I4NA 3RUCA 1J8MF 2QIPA 1ACLA 2INGX 2JKVA 1AUQA 4B83A 2O5EA 2FEWB 2V6MA 2O52A 2AUMA 3KD2A 2Q2VA 1QHHB 4Z2AA 1CYDA 4ZDKA 1FX1A 2H0AA 4M9ZA 1Y9AA 1KZ6A 5F9MA 1T6YA 1OW3B 2UVPA 1EI9A 2PXHA 3NXSA 3OZUA 4L72A 5K3AA 4GOOD 5EZYF 3C5CA 2H8GA 4BVLA 1T5LA 2ODEA 1GEGA 4DABA 4MVJA 4X3OA 1H85A 3CNOA 3U39A 5JEEA 1RYYA 1YZQA 3H2JA 2XMZA 3F7TA 1NW5A 1N5DA 2OLEA 2PCJA 3EA0A 3FPGA 4R4JA 5G1NA 3OICA 3WIOA 4E5SA 2CT8A 1YUMA 3H4VA 1KZ4A 4EYKA 1PNRA 5AVYA 3C6BA 2HU5A 4BZWA 6REQA 4FD2A 3BRQA 4NDZA 3LK6A 1PWYE 2W6PA 2JCSA 1XTTA 5DHUA 2HK8A 2I4LA 3ECAA 2VJYA 4TROA 3ROPA 1H0SA 1A69A 4UZSA 2ZJZA 2HGZA 3B3JA 1IWBB 1L7EA 1QIGA 3FPSA 4DMKA 1CD5A 4EYQA 1URPA 1ZUWA 1QIKA 2W6JA 1D8AA 2L0XA 2P4HX 2R7KA 4LHZA 3E0XA 5D3MB 4BTEA 1CJKC 3J80A 1V96A 3IMEA 4I1IA 2NXCA 5DIFA 4Y2VA 5HMLA 2OOKA 3HDJA 3OQ1A 3TFQA 4X62B 1C2TA 4FMCB 2BUAA 4K46A 2XUKA 3RVNA 4C4YA 1IDOA 2JAPA 2JLSA 2XH8A 1OI4A 2WWFA 2ZYDA 2GZ3A 3D1VA 4RD2A 2IQIA 4F97A 4LYGA 2W8BA 1PL8A 1VFPA 4MUBA 4XWAA 3VNRA 2BTQA 4B2YA 4MVJP 4E6EA 2WJ4A 5AVRA 1B6RA 3BGDA 4B81A 4MZDA 1MZVA 1G66A 1FC0A 1QONA 1UFVA 2Q28A 3IDFA 3KEFA 4HAIA 4ZODA 4S1TA 1V4NA 1NBWB 5DULA 3UMGA 1OU4A 4LZJA 4XFKA 1JHQA 2I6FA 2B78A 1USWA 2AEEA 2I2BA 2ZBVA 3CPEA 3VH2A 4ENVA 1J20A 3K05A 1S1CA 4OJYA 4TV9F 3BN3A 3B70A 4YAWA 2V6FA 3COJA 3FNFA 3KYDB 1YTLA 2GPJA 4PAMA 4YRQA 1CY8A 1SPXA 1NJ8A 2OCYC 3EVBA 4MH0R 4X9XA 4MCHA 3WKEA 3MLBA 3FTPA 4GD3Q 1YVPA 3VKHA 4DMLA 3NQ41 1ZMRA 1LBQA 3E4DA 5REQA 4A8PA 4CKEB 3WYEA 2IOFA 2O2XA 1RI3A 3STWA 4NBUA 5T3YA 1XALA 5I7HA 1IYZA 1FXWF 1EFVB 3C45A 1EDEA 3IP5A 4JJZA 1Y48E 5DNWA 3TSYA 3WMWA 1PJ2A 3V46A 3FCEA 3DT8A 4E1AA 2GB4A 1NJ6A 3CKYA 2AWOA 1S2IA 5CB8A 621PA 5I7UA 2O4UX 1V1JA 1YI1A 3ORYA 4LV8B 4RHCA 2Q7DA 4BFYA 3FLBA 1L6RA 3VXKA 2G9UA 3MVEA 3WLQA 4YV0A 3L7CA 1VLHA 1Z3IX 5DI3A 2J9YB 4XX0B 4ZVOA 1AXEA 2DULA 5AK4A 4DNFA 3ZNNA 4KNYA 3KFVA 1DG3A 4AN0A 2FSVA 4G1EB 1ODSA 2ZTSA 5GZ6A 3D5TA 2NZ2A 1ZCBA 5KYVA 1H6DA 2GX6A 3TTUA 4AIRA 4HEJA 1KWKA 4Q24A 1NGSA 3U3MA 2WHYA 2QRZA 3QWAA 4Z9YA 2N1BA 1L7MA 2IYPA 2C2ZA 5IAJA 2R8RA 5FUWA 1IBLB 3LD9A 2EKDA 3K1ZA 5IVDA 5JIBA 1NT4A 2VRCA 1JKFA 4KR7A 2LPMA 1EVYA 3HYTA 1W5BA 3I5MA 3NEAA 4X71A 3R75A 2C9YA 3GJ6A 2RGRA 1QS0A 5E1DA 4L75A 1NLUA 1USVA 3CO0S 4G97A 1U0GA 3I73A 1TCCA 2P67A 4XW2A 3QHQA 4GMHA 2VH5R 4O4JF 1JA0A 3KJXA 3W5SA 4BU1A 4L50A 2XNCA 2VPIA 4B4OA 3GLKA 1G8JA 5AI6A 5TVKA 4LV6A 1XNGA 1WD7A 2LKDA 3S55A 3K8QA 4JEMA 4OK6A 5IH3A 2ZSUA 3LX5A 1IY9A 5CJ2A 2BWJA 2R79A 3N2KA 2XTJA 1DBRA 1J8FA 1J99A 3CUTA 1P6XA 3WYFA 4Y1EA 1WCV1 2DQZA 2GPBA 5CT8A 3L7IA 2HPVA 2WG1A 2PQ2A 2IYXA 2ZSKA 3P0JA 3FGNA 4N7BA 5LUBA 3ZI4A 3EXIB 1UBHS 3RRZA 1XHFA 4UNQA 4URZR 5I7RA 5KHLB 4NOLA 3T4UA 4L6CA 2RHHA 3ZE9A 1CUDA 1I10A 5GIPE 2V3CC 4NP6A 1KDVA 2ZREA 5HZHA 3MQ2A 4GGMX 4RMGA 4BV8A 3I6IA 3HYNA 5F1YA 3UG7A 3KXKA 1K0FA 2XUAA 4RJJA 3RK1A 4EPWA 3BMOB 4E13A 4UVIA 3CS3A 3T95A 3ZOZA 1K5HA 2OR3A 1ZD1A 2GXQA 3OZIA 4YBZA 3RRJA 3S2FA 3RD5A 1B0PA 2QE7D 1M6NA 1PX2A 5AT1A 4WAUA 4YREA 2A94A 2W2MA 3N7TA 4DLZA 1V5FA 2WAYA 4LUCA 2WFAA 1ZNYA 1JHUA 1ZK4A 4Q3OA 4MYDA 4CMIA 2NM0A 2W71A 3LYLA 3O2SB 4Z8XA 1QYCA 1LTKA 3TOZA 4W5RA 2O2DA 2ZWPA 2FPUA 1R5BA 1QUFA 4KV7A 1L9KA 3EB9A 3ZU4A 1VSQA 1I1HA 1KIAA 3QU4A 1F8UA 4BZXA 3PX3A 1E18A 3DZBA 4LGYA 5K3FB 3DBOB 3FWZA 1RXCA 4RHEA 3ENKA 4AMUA 4RU1A 4F5ZA 5FR2A 3GLFA 3QKTA 2CNLA 2NVUA 5K45A 5KNBD 1FYWA 4O2AB 3ON5A 1U6KA 2EARA 4BGVA 1NBME 5KU7A 2JZNA 3KJHA 3M4NA 3M83A 2BGMA 3NHJA 3RBZA 2ID8A 1YQDA 3C3YA 3PHJA 4QOSA 3ZYCA 1G98A 1RE1A 2FPXA 1JEYA 2NUTB 4B84A 1JHYA 3VR4A 3UMFA 4LKOA 4YUZA 4Z7JA 4FBMA 2C4NA 3OU2A 4FNMA 1JXQA 3QG5A 2RC6A 3INYA 4N41A 4MR9B 2X9VA 5K0LA 2H2IA 5LMCA 2HMUA 1TC2A 2IXFA 1PFGA 1CQPA 4G0ZA 3H04A 4RTOA 5TMBA 4C43A 3REFA 3MJRA 4A15A 3PCXA 4JOQA 1EVZA 1I4DD 1VBMA 4IDPA 3CPJB 1P18A 3C7CB 3QHPA 2Q4EA 1SKMA 5C81A 3ZJTA 1ZL0A 1ZM4A 1UL1X 3V80A 1BWPA 1F4VA 4OHVA 4BEVA 4OX9Y 2D2VA 2GTIA 3SZ3A 3UANA 1E3WB 1WF6A 2ACVA 2PO7A 4I6GA 4MAFA 2OUIA 4UUBA 4V3CA 4DCOA 1PN3A 2EEPA 4L8WB 1YI8A 3ELBA 3CURA 1P5HA 4Y98A 1TO1E 4I5DA 1E7QA 4YAFA 3SXJA 2NN3C 3BG5A 4HDAA 4DL9A 4UDOA 2YWRA 5GONF 5TARA 1M1YE 2IHZA 4KLRA 1ZITA 2YC2C 3HNRA 4MQEA 4RE5A 3L82B 3PRJA 1WCWA 1DL5A 4YJFA 2NV6A 4ADSG 4B85A 3R7DA 2FSGA 4CF6A 5FTMA 3R3XA 3LFHA 1J2JA 4X1IB 4NMHA 3NBZC 3VZSA 1PSDA 1LSJA 1T5BA 4QODA 2OC9A 3TW8A 4WHMA 1GNTA 2PUDA 4HWSA 4FGSA 1EUYA 1YB1A 4LFAB 3B6MA 3K70B 2F90A 3MUNA 2QYTA 3ZY3A 3A4VA 4LI3X 2PPVA 3IJ5A 3BGVA 3JQFC 3OZ7A 4ON9A 3UTDA 5J63A 1JLLB 4YPVA 4ZYYA 4ZVVA 1J09A 1LPMA 4YIKA 5E3HA 5EWLB 5KPJA 2FGJA 4OI2A 4XIJA 2GK7A 1F5SA 2CLHB 4MEAA 2BMVA 1YAHA 3PHLA 1GFIA 2J0EA 5F51A 4EI2A 1NYLA 1M34B 3SHQA 2ZJ6A 4UBLA 4JI5B 3HJBA 1CNEA 4ZPJA 4M1WA 3GRCA 2EFJA 3NATA 3HCPA 1MH9A 2AG0A 3OH8A 2I03A 3OJLA 4PQFA 4OHYA 4ALMA 4HAOA 1ETUA 2R47A 3MELA 3WQRA 3MBIA 3FWKA 4OSEA 3ZX5A 1J0EA 1SXJC 3CLUD 4ISCA 3WQBA 3B7PA 2WAMA 1XLUA 2V7QD 1W1IA 4YAGA 4L57A 1C9JA 1F0YA 1KOJA 2JEOA 1P6UA 1GGNA 4Y18A 3FYUA 5H70A 4ENSA 3LA8A 1MRNA 4HUQB 4QARA 5KVQA 2EFDB 3AF1A 3QWIA 4RF5A 1KPIA 5AOVA 1DEOA 4CG0A 4HNUA 4P3NA 2OORA 1H6CA 1SA0A 1LPAB 4NJMA 2FNAA 1KY5A 2BFWA 4ECEA 4CXMA 2XE4A 4JLDA 1XZHA 3TEJA 1QTQA 3DVAA 4AP5A 5A5VA 1WZ2A 4KGDA 4ZYZA 1HL7A 3E70C 1QDLB 3L79A 2PL1A 4GEGA 3H8SA 4X54A 3P9YA 1Z08A 4A8JB 1SOAA 3GWZA 3ZBQA 4C7XA 4CKCB 5DHTA 1OLUA 2M9MA 2VT2A 4MGYR 1K5DA 2P41A 2ZLBA 3N76A 3H1BA 2NO5A 1XFAA 4YQYA 5A4DA 5BSVA 4MQFB 1NJ5A 3RE1A 2AJLI 3CZ9A 4MPRA 2HUPA 2MMGA 4L3VA 1FW8A 3KELA 2LCFA 3RNOA 1GPLA 3OLCX 5LYYA 1AB6A 3HTXA 1GPWB 2C5AA 1GTG1 2XNJA 3F98A 4KODA 4R3UC 5C1DA 4E70A 2UXCB 5FFNA 2ATEA 4HYTA 1SCUA 4HHEA 4ENUA 1IFXA 3AHIA 2P3LA 4F2GA 2YXLA 1JE0A 5DTIA 4E0BA 2JLZA 5J9FA 5EFZA 4D8WA 1KPHA 3D8TA 1EPUA 1RYNA 2H4ZA 2X76A 3L8FA 4L9AA 4LXHA 1L7NA 1FDVA 3T3EA 4N7MA 4LF5B 1RC8A 2TMYA 1DQZA 4D41A 4E08A 1Y8RA 1DKLA 4C1BA 4EG0A 4HDRA 2QIOA 4RA9B 3N2ZB 1ORDA 3F7NA 4TS9A 9ATCA 2H2WA 2CMFA 3VH4A 3S81A 3F1LA 4Q01A 4AKSA 1I80A 3E9DA 3KNZA 2XYQA 3ND7A 5KVSA 3R9XB 1QGYA 4J3JA 3W4JA 3KZVA 4RZIA 3GUZA 4Q4JB 3RH0A 4GPEA 3UZUA 4FHCA 2X0NA 4MUXA 2BE7A 1CF2O 1FVXA 1G2QA 3HKDB 3KU4A 3LFTA 3UJPA 5GTDA 2EG9A 3IUQA 3DVLA 2C2GA 4JJEA 4Q82A 5EZYA 5FADA 2R5NA 2DETA 1F12A 4IJ5A 5F3WB 2JFVA 1B2RA 4MV7A 1EM6A 1OAKA 4S2UA 1P4GA 3D7KA 3JAKA 2I33A 4ALIA 1RQNA 3AHHA 2PFKA 3AKYA 3QOWA 1RFLA 1DRWA 4C4XA 2ES4A 4YGYA 4JLKA 2RGDA 3IEUA 3HKEA 3OD5A 4XRGA 1X87A 5B2FA 2NT4A 2MU1A 3I2HA 3A05A 1X1TA 4B3IA 5A3RA 1VM6A 3GG9A 2ZUBA 3GPCA 4DLBA 1H0KA 2A0KA 5ALIA 2VS1A 4F46A 2ZTHA 1ZH8A 3K9WA 4R98A 3W5AA 3NDBB 1Z4MA 1WY5A 2ATIA 4LDJA 2PL3A 2B82A 5F2NA 2IU3A 1QIJA 1ZK1A 2WJ3A 3Q8MA 1DRKA 4UM7A 3IDOA 4U2CA 1CUFA 2E3JA 2ZT7A 4YCDA 3S5JA 3DE7X 5GJBA 4J2TA 2VFAA 5FTNA 3ZZNA 5BOVA 1G7CA 1BWRA 1ZXLA 3G8YA 4PXSA 4A0QA 4RUKA 4KE8A 1VHTA 4OQZA 4MW7A 4ZHQF 2FZEA 5FOVA 2Z57A 4TSFA 4UQLA 1K7YA 1CQJA 2QNIA 2QK4A 3IBSA 3JQAA 3USCS 3OHSX 2H31A 4HWTA 4UVDA 4BAZA 1JRLA 5ILOA 4IDOA 4J0EA 1P9NA 3REOA 2GFIA 4V1CA 2CJXA 4KN8A 1OAAA 1IHUA 3PEVA 4FCCA 4Q00A 4BDTA 2X0RA 1PYGA 1AS2A 1CERA 1NSFA 1ZJYA 4PBTA 2ZJFA 5HK9A 2RI0A 2X3FA 2EX0A 3ETJA 1N6KA 3IP9A 3R6DA 4OVKA 3MQFA 2FWAA 4M9QA 3U9TA 1XEWY 2CC2A 3U9SA 4OQEA 4TV9A 4B73A 1OREA 1PNVA 5IULC 1EGMB 2CXTA 2JJ1D 2ZAOA 5I8PA 2MWMA 2H59A 2P9QA 1O1YA 3CE9A 3I2KA 1GRCA 3VU8A 4BKPA 3EDMA 4K9OA 4LSGA 3S2UA 4ZXFA 1W5EA 2G9NA 2GAIA 1FFGA 3EDCA 4LYFA 1TUBA 1Y3CE 4BNGA 1B4DA 1M2EA 1R0RE 2W43A 3A11A 3A25A 4LXTA 5EXPA 1YJCA 4DADA 4EYGA 3RVDA 1JH9A 1FXWA 2B1GA 2JIPA 2IW3A 2ZU6A 3K6KA 4NYIR 5KJ6A 1QX4A 1R16A 4RE6A 1E2DA 5SZKB 1RJGA 2HQOA 4LRQA 3L4KA 3SJBA 3IV6A 3WYCA 2WKQA 5BN5B 3QE9Y 3OFKA 3NDPA 1IONA 3ZV5A 3UFXB 3O82A 1MHPA 3BXPA 4LOJA 3VO9A 3LUGA 5JCZA 3G82C 4DQUA 3SNKA 2PLNA 4QLOA 5GJCA 3A37A 3KVOA 3CZ4A 5EJFA 5ILGA 3GVCA 1SFRA 3C3CA 1A96A 3SZOA 2IVZA 4KGZA 4CLRA 4BXOA 3BZUA 1LNZA 5AM1A 3UCFA 1IMJA 5TY0A 4M9RA 2WAOA 4PSCA 1FNBA 2POQX 4D9GA 4MYHA 4P0PB 3LO8A 5SZIA 4JBWA 4BNMA 1AURA 2XYRA 2QGZA 2BGRA 3VMFA 1CV2A 1G6OA 3DBRB 4LMRA 4TXMA 1VSTA 1OQAA 4U63A 1UAYA 2PUHA 3AQIA 3DZGA 3SEQA 3ZHVA 5TB5A 2A4MA 1ISIA 1GYQA 4D4JA 3FROA 4A0HA 4JJ8A 3ITDA 2CFIA 4TGLA 5BSUA 2F8MA 1XK6A 4O4JA 2OFXA 2Q62A 1L7RA 5JAPA 3OO1A 4TPKA 3LP8A 3LZDA 3CNHA 4B80A 4ER7A 3AETB 3U5ZB 2GAFA 5JANA 1U2TA 3K09A 1UC5B 4GFDA 2B83A 4DLAA 1H3EA 4PC3A 3CO5A 1DKUA 2GH1A 2SKEA 2WM8A 3IKLA 5G40A 1A8HA 3ZZMA 5IM5A 1CZOA 3LVRE 1Q20A 4NYMQ 3JR3A 4JC8A 4XIFA 2OQVA 1M8JA 2ZWVA 3BMNA 3IELA 3OT1B 3MQ4A 4LJ6A 3GNTA 4CRWB 4EH1A 1X0VA 1ZD4A 2JFFA 2XDQA 4LXXA 3OESA 1CY4A 3QP9A 1M6WA 1Y3AA 4HPJB 2NU7B 2YHIB 1WOMA 3RC8A 1YBFA 2RGXA 3KJEA 4C0HA 5I5GA 3OOHA 4NCJA 1P0FA 3K0CC 2WUEA 2NU9B 4UM9B 3S0JA 2D54A 3SP1A 2FUNB 4H6VA 2ILVA 4AF6A 2GBGA 2P2GA 3DZDA 3CVUA 5BNTA 1P2UA 1WW8A 3K9CA 3LWDA 5FDFA 3OJEA 2J0SA 5FHQA 2F1KA 1VYVA 1QP8A 4H77A 4ZMSA 1QLWA 1V1MB 3H16A 4CUJA 4TYWA 4Y0NA 1NU6A 2FX5A 2ATXA 2EOAA 2HLPA 4I5FA 1MEJA 5I4BA 5IPFA 1WNFA 4C2TA 3O4HA 2PJRA 3RUEA 4BMNA 4B6RA 5I3ZA 4QVKA 2JLXA 2IP2A 2AW5A 1SBZA 1IPHA 2WVHA 1GZ7A 2BY4A 4YRMA 1JDJA 3PYXA 1MIOB 2R8OA 2W7TA 2QPLA 4NAVA 4N9WA 4K28A 1NVUQ 3IVCA 4MS4A 3OZXA 4JB0A 1KYXA 3L7AA 3M4JA 3NNNA 4U6SA 2BEVB 1OE0A 3GMIA 3WYBA 2YY6A 3H5AA 4QGSA 3KWLA 2JF0A 3PWKA 4Q3NA 3TSWA 2WUWE 4LZWA 1J7KA 2A9OA 2YXBA 4X1YA 1ZH0A 3U40A 4RZ3A 4DEYA 4XOIA 1LI5A 1MN6A 4BBJA 5IJ0A 5LZ2A 4CMHA 2AKYA 2PO5A 1TAGA 3IEKA 3FHTA 3ZY4A 2IZ1A 3LCMA 2XZDA 5JE8A 5A9RA 3M9XA 1Q7RA 4LG1A 4WZAA 4FDMA 1E2HA 3QBJA 2FUCA 5AJZA 3GLIA 4BQPA 4TL9A 3PEYA 1XCJA 3KYBA 4I4LA 5KTTA 3OEHA 2PZLA 2IPOA 3AI7A 2CBGA 2FFHA 4X65B 3IEMA 2LUOA 1ENOA 4CDRA 2CSUA 3H2HA 4XR9A 5FKJA 4CM8B 2J08A 1SVKA 2D3WA 3N0WA 4W6ZA 3ABRB 1NVVR 3HUFA 3VZRA 2NV0A 4W1PA 1Q1ZA 5ED0A 3H5LA 5J4YA 1YCDA 1T9BA 3DL4A 4KDEA 4ZVLA 3NV7A 1Z5OA 4JI6B 2JB9A 2XMCA 3LKBA 2DZDA 3JU3A 5ICCA 4Y2SA 1YNSA 4E5MA 1R6BX 1FL9A 1FYFA 2ZCUA 2ZDHA 4JT4A 4F4CA 5F9FA 1FP1D 3V48A 3ZUPA 4UD2A 1V0JA 1ZRNA 2QZPA 1QU2A 2QD1A 1M73E 2Q5EA 3IMKA 5IFLA 1XD9A 5GONA 3OQHA 1O94D 1TM7E 4KE6A 5ICMA 4YJDA 1OKKA 1N6RA 2V5AA 4MHSA 2PKYX 1LTQA 1R8XA 4NNPA 4KQCA 1GZ6A 5B3AA 1I51A 5SYAA 1W5SA 2YN4A 5DE3A 4YP6A 4B40A 1QLJA 2C04A 4V3BA 3SEFA 4IIUA 5A6SA 4RY0A 5JR3A 3HVRA 5TXGA 3R7AA 1TJ4A 1G2IA 2E7ZA 5ALYA 3PDCA 5CBPB 1W96A 3E35A 2DY0A 3GO4A 2JA2A 2NO7A 3HP4A 4YJ3F 5KWSA 2E85A 2DJ5A 3VC2A 1PQPA 3QZUA 4UC0A 1VPEA 1O8BA 1KDOA 1UBRS 1R6DA 1I33A 5MGNA 3I1FA 2PX2A 2ETVA 4C87A 2WP0A 5FBLB 4ETIA 5A4IS 3EH1A 2VTDA 5M5BA 1DOAA 1HFWA 3GBVA 4GGOA 4DVJA 1WQ3A 1TDJA 5AW2A 1OC4A 4O0LA 2MHCA 1U9IC 3N2NA 1EWYA 3OE5A 1G20B 2VTEA 2QZJA 3TMKA 1YRWA 2MMCA 1C8BA 3WX0A 4E88A 1AVTA 4DCNA 3RBXA 4HNQA 5JY1A 5IU6A 3PUWA 5H8WA 2JGEA 1ZLYA 1EA7A 3FSEA 5T8KC 1QIFA 3O9VA 3I9V1 4CR6A 4F4UA 3LVQE 4GVXA 3SCZA 3IJPA 1GILA 3UMSA 2X5JO 3IYLW 2OYCA 1E1RA 1JFLA 1FK8A 1NG1A 3E9ZA 1U4OA 1RAFA 3OFSA 4LN1A 5CUQA 1UDWA 2CGEA 3BILA 3EVAA 4A5SA 4OQPA 2FTKE 4BLQA 4OXRA 4O4HF 1Z6AA 1YQUA 4HC4A 4LF9B 2XNDD 3PFFA 4NCAA 1FLDA 1UWLA 2UDPA 3D5QA 4GG1A 4EY5A 2EQ5A 3FHOA 4KE7A 3ORRA 3ZHRA 4FJ1A 2AHRA 2VHJA 4E6PA 1L5WA 3DAHA 3B1KA 3GNQA 5KINB 2FETA 3O83A 1DWQA 1W76A 3HWWA 3LDUA 1YMQA 2J9XB 3IFSA 3IODA 4BYGA 4CIBA 3SVTA 1JG1A 1U2DC 2WJYA 5HKBA 1M2WA 3F7MA 3MWLA 3R7SA 4DBZA 2Z95A 5AESA 5L3SB 5JU6A 1SCJA 2OLJA 5F73A 4EPVA 2P5TB 2XCOA 4JELA 3ID6C 3UVEA 3ORFA 3HUTA 2NVWA 4GICA 3PQDA 2HBQA 1D2EA 1NC3A 1EHYA 5C7OO 2JD1A 2CCJA 2OQIA 3L0SA 2CNWA 2G9VA 3SEAA 2HXYA 4YR9A 1KPGA 1Z5NA 3CJTA 3RWOA 2VP3A 1N57A 4JVOA 1KK0A 3VH3A 5JROA 5KTKA 3REQB 4DAEA 1M1XB 2Q2OA 5LQAA 1KNXA 4DANA 2DGDA 2JBWA 4FMDB 1N0WA 4OHOA 1YOBA 2A5JA 1RP7A 4F7WA 3GCZA 3MEQA 2QRPA 5F3DA 4LC0A 3CJQA 4JY7A 3R77A 4Y2HA 3D1LA 4DNQA 3VVBA 4BO9A 4A2PA 1IJBA 2Q8QA 4ZRDA 1SB9A 2ECOA 4H35A 2FWRA 4XWGA 4BFXA 1JLMA 4ASUD 3OO0A 3ZCXA 4WKBA 3NETA 4KRXA 3Q9LA 3OIUA 4HF7A 5I9IA 3DPIA 3FDJA 4QJIA 2OE2A 4FUTA 3ZGVA 1VP3A 2AXQA 2P30A 3I6BA 4RF3A 3CU5A 1GOTA 4G5GA 3RYTC 4CCYB 5J2TF 3SF0A 2C20A 3ZV7A 5BN1A 4M0MA 1M2FA 2WT8A 3U4CA 1Q3KA 5GVRA 1FP7A 2B94A 1KGDA 4C6TA 3WHKA 5K3EA 2A14A 4IJMA 1UOOA 1BVHA 1EFRA 4QDZA 4BVGA 3HZRA 4M7OA 1ZVQA 2JCGA 3DFKA 3EYWA 3O95A 5I48A 1C3OA 4W9MC 3PPVA 4MHOA 1GADO 2P1RA 2VLIA 1E3QA 3S7TA 4AJEA 1E98A 1PD1A 5BSTA 3VTFA 2VT6A 3SX2A 3K0AA 4UMEA 3MJDA 4FYKA 1B0ZA 1SBCA 3TEMA 1T4DA 1X7HA 3IKTA 5BW8A 1TQ2A 4MXDA 4UKDA 2I2DA 1MB0A 4YBRA 4Q4AA 3CIFA 4ARSA 4OIFA 4RF4A 3GG2A 4ZYTA 1SHUX 5T4EA 3BA6A 4DZRA 4IGEA 3HN2A 3E3OA 4IWNA 4G4JA 4ZHQA 4CEIA 1E66A 3OX4A 4AXXA 4LDPA 2PMEA 1GARA 4TWJA 3FAZA 3O4GA 4EHNA 3NG1A 4TUYF 5DX0A 2QN3A 3UJHA 3W9SA 1U7DA 1XMPA 3ILXA 3CG4A 2M6RA 3SBXA 8MHTA 2M2IA 3FVTA 3F5SA 3SKVA 2OCXA 4EAQA 3KT6A 1UJMA 2RGUA 3EJWA 3KUXA 4XDHA 3SFZA 1Q2UA 3GLGA 1V8ZA 4EQ6A 4QM7A 2WLSA 1U6JA 1ZCZA 4UTZA 4XCXA 3V00A 5BSRA 1NTRA 2IXDA 2NX2A 2UYGA 2VDKB 1ADGA 1V7CA 3EZ2A 5K2MA 2XRFA 1O0CA 5CT6A 2C0CA 2VUTA 1SKYB 1H69A 2QUIA 4TZ0A 1T8WA 4JLJA 1XVIA 1CUIA 1WXGA 4YRGA 3S1AA 3O4FA 1XQ1A 3B8HA 4KHPB 2P7HA 1Q95A 3AJAA 2R86A 3GX1A 4JAVC 3RIGA 3RHZA 3ER8A 3GJZA 4H4EA 1MT0A 1UDRA 2J7PD 4ZICA 3JALA 4EPRA 2VXOA 4REMA 4K8OA 3TD2A 1QV7A 1CUHA 1XI2A 1CUSA 3UT5A 3KPYA 4IAOA 3SZGA 1MB2A 4UAJA 1PEYA 1JIVA 5LU9A 2G4CA 5JFOA 2ACEA 1C7IA 1N5KA 4JXXA 1UM9B 2ZZKA 1OLSB 1U9ZA 2VHQA 3GGSA 2BZSA 3LQ1A 4KQEA 4XEUA 1X7WB 4F6LA 1WB5A 2OO5A 4PV7A 4HI0E 3ILHA 1XDUA 3JQ9A 3C7AA 4QYTA 2CL6X 2C1EA 4ND3A 5T4BA 4D6XA 5JQGF 3WDLA 1GGVA 4HXYA 3LC2O 2PWZA 4HFJA 2PGOA 4J0GA 2SCUB 4NEHB 2YRWA 3ZY5A 3KSBC 4I1PA 3C2QA 2NTNA 4AY3A 2BV3A 5TJHA 5JLJA 1ZINA 4MUFA 1SXJE 3IL2A 1UJ5A 3O4IA 5CG1A 3U31A 1F2TA 4JQSA 5EHIA 5FULA 3ENVA 2PGAA 2I34A 521PA 3WIDA 4D4GA 2OV8A 4ZI2A 3QPVA 5DHFA 2BGKA 1Z2OX 5A4KA 1T1SA 2GEFA 3FAKA 3W05A 3LT4A 3T4PA 3II6X 3WSTA 1TMYA 4DG5A 1E8NA 1DAKA 4F92B 3O74A 1Z34A 3NXKA 4HKTA 1CF9A 3DOIA 5AW0A 2P1ZA 4TKMA 1AQ6A 2HCJB 3WP1B 2RH5A 5K3BA 4IQ0A 4LC1A 4HOYA 4CQNA 2WWVD 2H9AA 3Q87B 4DDWA 4FEGA 1HFEL 3D0KA 3FF1A 4AT1A 5EJ5A 5I6DA 1P81A 3OECA 1LLUA 2XCIA 1WP9A 4EG7A 4YMGA 3FUWA 4ARBA 3ZCUA 1F51E 3A1UA 1TM1E 4RPLA 5C34B 4WJLA 1OFTA 1ULAA 2UYOA 1FP2A 2IC5A 3GIWA 3N6XA 1ISGA 3V8EA 5DNUA 1OXXK 2D0OB 2A3RA 3VR6A 3JRWA 5AJHA 4EJSB 5AXDA 2V6JA 5IDWA 3CBGA 2VYVD 2WUDA 1IDN1 3EMKA 1N2CB 5HZGA 3VH1A 1A97A 3WNCA 5CX1A 1JWBB 2ANBA 4P98A 5AFSA 721PA 3GDHA 4RBNA 3PF9A 4IEFB 4LW8A 3RNLA 3FOZA 1YNOA 1E79D 4RPHA 4FX2A 4DR3B 3DKPA 3EAGA 3GPBA 4RVNA 2DUUA 2UUPA 2ZE6A 1AF7A 2RH8A 3ANTA 3DG9A 2QJRA 2YJTD 3K8YA 3QFCA 2C00A 5M04A 1QHSA 4GVPA 2B4TO 3JW8A 2W8ZA 2AE1A 3WBJA 3KBBA 1OV6A 2C07A 2GASA 3Q7PA 4HDOB 4EY7A 1XT6A 3OQNA 1PHPA 3E22A 1E4OA 1VJRA 4LZAA 3THRA 1C9EA 6NULA 4JLAA 2C7PA 1LPSA 2VYCA 4J0KA 3LLCA 1AUPA 1OJLA 4K9RA 3G2KA 2GJ8A 4Q3KA 4QPPA 3WGLA 4HLDA 1AV7A 4NQRA 5B58C 1KNQA 4G67A 1LLCA 1OFIA 3L4SO 4MICA 3AF2A 5L4NA 3GP8A 3Q5GA 1DLIA 5DT2A 2ZSHA 4F2DA 5BWMA 3C8HA 3ZN2A 2PWPA 3UKJA 4LRXA 3ZTTA 4BBZA 1A9YA 4A6EA 1YJAA 1DWUA 1ZIXA 3H83A 4RA6B 2PJZA 1QNLA 2HJVA 2XMQA 3BCRA 1UBCA 4D3FA 2H5EA 1HV8A 3SJAA 4PLGA 4EKNB 1DQNA 1W5FA 1TF5A 5JV5A 1S01A 1T9DA 2Z83A 1Y4SA 4ZGGA 1C5KA 3GLRA 4Q6WA 4ZDWA 4R31A 4WA7A 1FFCA 4M1MA 2PGNA 2UUCB 1L4LA 2FHSA 5K1ZA 3TCKA 2QSYA 3L04A 2M1XA 3PX2A 5K3CA 3KZ1E 4ZU3A 3QOFA 1XFDA 5HF9A 3OQVA 4JI3B 4KR2A 1IIRA 1IEQA 2ARKA 2RAFA 4ZDJA 2RCNA 3MGCA 1RWNA 2Q0XA 1N2OA 4C89A 1D4FA 3EISA 1E8MA 4P2GA 1WCYA 3NDRA 3K1TA 2I22A 3DL2A 1KP2A 2BDEA 1XZBA 4HQ6A 4QDXA 4RSRA 4TZ6A 4B79A 1KRXA 1XKXA 4Q9IA 2XUOA 2FE1A 1Y3FE 2HMYB 1L5YA 4ZQHA 1VYHA 1CQWA 5E0OA 3DONA 5HJ5A 3U09A 3OTWA 1QGUA 1T5HX 1P7CA 5BNZA 2R1VB 2YZNA 4M89A 2GJSA 5HFJA 1K0UA 1IN4A 5IXJA 2O8NA 2CK3A 2PGXA 3KQWA 4EKDA 1KVRA 2YFQA 3W7VA 5A02A 4Q1DA 1VKHA 3H5OA 1I4TD 1CY7A 2FW8A 3CZQA 4YJHB 3JSAA 2HDOA 3LC7O 3KCNA 1XE3A 1XTJA 2H54A 2BT4A 4FDUA 3COSA 4R9RA 2RHGB 3UENA 2H08A 4D3SA 4NTZA 5AXCA 1NPYA 4FLMA 5H0IA 1E5XA 4EDHA 3B8EA 1GA4A 4YI5A 1XZLA 1JHOA 4H7HA 3WLIA 1COZA 3D81A 4YRFA 2GJ9A 1T5OA 2HEGA 3BSWA 3OFNA 5AVJA 5H83A 3M6XA 2NU6B 3BTVA 4CFZA 5D2CA 2O5CA 4WN3A 5EKXA 1QVVA 5H02A 3DFFA 4DQ0A 2NOAA 2DUJA 4D6YA 1HA3A 1KI2A 2IUEA 4R2JA 3LHIA 5EP3A 4XIIA 3VOTA 1GKKA 2OTCA 2P6MA 2HJHA 5D6NA 5B6JA 1OXTA 3WOHA 1U7TA 2QXUA 2P68A 4P34A 5LA6F 3TX6A 4COOA 5JVDF 3IULA 4CEHA 1RMQA 3E27A 3IX7A 4QAJA 3ZI7A 1W2HA 2J0VA 5EVJA 1DRUA 3DOOA 2HRDA 4QBFA 4UJ3A 2CHGA 3QLVC 1AKVA 3IUMA 4D42A 2CBZA 5G3YA 2XOKA 2VSXA 2NYUA 1EFPB 2D5BA 4TKVB 1TLLA 1TA0A 3R6LA 1LDNA 4A2CA 4NEQA 4FHFA 1F60A 4IGAA 4LA4A 4O4HA 5KQRA 1JHRA 2DB3A 2GARA 2BEJA 3A3NA 1S2NA 1CEYA 3N0VA 1LY1A 3OCVA 1P1HA 4I8DA 4KQ9A 4H15A 2JAOA 2P9HA 2LDXA 2QAGC 3FMPB 4IUDS 3O8BA 4NZOA 4P84A 2QQFA 4CM7A 1REQA 1Y5IA 3A3KA 1UKVY 2PKRA 5DU2A 5FI3A 2EKQA 2VHWA 3IT1A 3ABSB 2Z6VA 3A7DA 1UWVA 1HMPA 1XSEA 3M5CA 2J3QA 3WYGA 2X3UA 4LIPD 3AHJA 3UV7A 3CPHA 3NTLA 2DX7A 4I5GA 4PHHA 2HLDA 5EJ2A 4A92A 2MOKA 2XWBF 1V9CA 1Z36A 2BKVA 4U39A 3T41A 1YA8A 3K6SA 2PRYA 2DG2A 4YASA 3OF2A 4M99A 3VHXA 4BFSA 1Q17A 1IHPA 2HNKA 4C7JA 3MNFA 3K31A 4KDFA 4OQNA 4DDKA 1J8QA 4ESEA 4AMZA 2C1XA 3RYCA 4IJVA 2QR2A 3KO8A 3LFUA 1QDUA 2JJ2A 3BGOS 2EF0A 3HV2A 3PXEA 1XWFA 1ISFA 1E7RA 1HH4A 5E9AA 5I51A 3FLAA 1HTBA 4Y1RB 1KIMA 1WXHA 2ID4A 2NAFA 1MQAA 4WX2B 4GIBA 1OBFO 4LRUA 3ITEA 4IH9A 5EXTA 4LGMA 5FWNA 1X7XB 1TYCA 4N01A 3ECSA 3ZDXB 3PCTA 1BDIA 2O8BA 2RARA 4G85A 4M36A 2NU8B 1UEJA 2JLAA 2VDWB 1RM4A 4REQA 4DDHA 4EY8A 3E1SA 4R3WA 1Z13A 2D2XA 2RAPA 1P73A 1HZZC 4JA2A 5F2KA 3HXKA 2YY5A 4KV9A 4IIJF 3ACCA 5J2TA 3HA2A 2YMQA 2R6AA 3NRCA 4BQOA 4ZT6A 1PJCA 2GT1A 1QF7A 4Z7QB 4ZGWA 5I7EA 5KSOA 1FUIA 2UUBB 4WDQA 3V1UA 1FDWA 4J0HA 2H3EA 3RLFA 3JAWB 2A9PA 2Z4SA 1M6HA 4GC5A 1S8OA 4GMGA 4MJLA 4OI4A 5AKEA 2YZ7A 3RC1A 5J4VA 3H5RA 2DTEA 3NCTA 5DIZA 4L08A 3WWEA 4F1JA 1Q7EA 5GPBA 4IXNA 4J6FA 3WIVA 5JZOA 1GSHA 1VLJA 3E3NA 1S9DA 2ZSIA 1H2WA 3IAAA 3SK0A 3U17A 2WD8A 3BCUA 2HMWA 4WSOA 4Z1MA 5CJPA 1A1VA 5H4HA 2GA9A 2NXJA 4IUCS 2OQRA 3G2LA 4JENA 3JQ6A 5AK5A 4B09A 4HQNA 1BA2A 4AUKA 1BEUB 4YH1A 1RBZA 2BZ1A 2FR8C 3C8ZA 2REQB 4NIMA 4P22A 4RYLA 4AZ0A 1DC6A 3HXOA 4MV8A 2HCBA 4FYHA 4RMIA 5JCXA 1N5OX 3BHJA 4IMJB 2VNHA 1YQWA 3NUGA 1VCHA 1D2HA 1MORA 4MIYA 3ZWOA 2XADA 2J32A 2QRMA 1W7AA 4TUYA 5AUNB 4F91B 4KACA 5JJKA 3VR5H 3IOYA 4MEBA 3AWIA 1ZMBA 2G67A 3ZBUA 2B37A 5FCDA 4B34A 5C53B 1Q77A 1QHEA 4GZ6A 4WZBA 2PD6A 4BNHA 1L5VA 3L8HA 4V0QA 3AUFA 4IG9A 1RQGA 1KXJA 1SVNA 2Z8ZA 4I3GA 1ZWLA 1O89A 2JFXA 5DP2A 2CXOA 3TR5A 1N7IA 5HJ2A 2P5SA 1TRHA 3LE8A 3WGIA 4EF6A 1RI5A 5GV7A 3PICA 4UFPA 2OCPA 3Q7QA 2IIPA 4JBHA 4L6AA 2CDNA 1MFPA 4MPTA 1KJWA 1GRVA 4G86A 1LK7A 2W2LD 3HB9A 4MUJA 3K9GA 3TKAA 5A9SA 4BC1A 5KZMB 4G24A 4KPEC 2OCGA 3TTXA 4CIDA 1IUKA 1RHMA 5CA1A 2ZXUA 1W35A 1QOQB 4WACA 3T5MA 1G9SA 3VX4A 3SQDA 1MPXA 2I6TA 3PYLA 5JSKA 1L5OA 4UOEA 2ZVDA 4RY2A 2Q5FA 1CKEA 5K0FA 4MUHA 4EG1A 1CQIA 1EQ2A 3QBEA 1LTHR 3OC0A 1QZUA 3UB2A 2PLAA 3GQBA 5A6VA 1RNLA 1K4KA 2CHUA 4PG8A 2V1XA 5JS1A 1EH5A 4J90A 4R8LA 2I65A 1ZM3A 4HUTA 4N82A 3ND8A 5JQGA 2WE8A 5K05A 5U4XA 3RUAA 2W6ID 1U1DA 5EHNA 4ZI5A 3JQGB 1J2UA 4TS4A 1RJFA 4X90A 1X1AA 3QW2A 1B0AA 5ULLA 3BAFA 4Z9AA 4FIDA 3H8JA 3FF4A 1X7DA 2DFLA 3NRJA 4Z2YA 4NZNA 4FOTA 4C7OB 4A2WA 3LT0A 3R7NA 2UYQA 3M2TA 4NCHA 5H82A 3PF8A 1GZHB 5AJWA 4M49A 4NBTA 3SXUB 3TEFA 4GNKA 4PZCA 5K6AC 2CVZA 5JPDA 3C1TA 3OU6A 3MWEA 3EUAA 4JLMA 4OGFA 4BMCA 1MXFA 3BPSA 3K9NA 4HDCA 4YAIA 4M87A 4GXQA 3NIWA 5AM0A 4EGFA 5CX4A 2PRSA 3GAZA 1T0UA 2EZ8A 4GX5A 4HFRA 5IBCA 5LXTB 5LKAA 3M6AA 4D3XA 1NUUA 1GNPA 2NUAA 1W4AA 4IQ8A 4BYMA 3D6UA 3FPEA 4NR0A 2IY8A 3R7BA 4TOIA 3O2QB 2LE0A 4PS1A 4N18A 4HXGA 4YX9A 5IJ9B 4EJSC 2PUBA 3KR2A 1RWPA 3K15A 3PXDA 2WABA 3I61A 4UMVA 2B0CA 2C92A 4L5JA 4Q1CA 4B6QA 2WJ6A 1F9AA 4GXTA 3TRKA 2NT3A 4H6XA 4DV6B 1I32A 1OTXA 2EZUA 1X8JA 4KSYA 1KZGB 3GXBA 4DDUA 1U63A 1ZRMA 2XTAA 1ULHA 1IQRA 2IJGX 4KVZA 5LCXA 3KDSE 3ND6A 1KS9A 3QGMA 1RRGA 3GBPA 2ISQA 3NM6B 5EWMB 4TTVA 1M2VA 1L4EA 3SM9A 2W2VA 4GZ5A 4O1IA 1PR6A 1TU0A 1XDBA 3KE8A 3WZLA 1RM0A 1W8IA 1R6VA 2HT6A 3CF4G 4GR5A 3LGXA 3ICOA 4W5NA 5LIRA 4DSOA 4YXWD 3K0FB 3T3MB 4NOMA 3LUBA 4FR0A 5IDVA 4DBLC 4RHTA 5KJFA 4UTOA 3G6WA 3AFHA 4LWQA 3IQGX 4P82A 1YULA 1NIPA 3ZNQA 4N48A 4MIKA 1FNSA 2ZBFA 5TPZD 1TT7A 3OX1A 4LHVA 1IHXA 4Z99A 3KB1A 1R0CA 1R66A 1QV6A 2H6EA 4NU5A 5DISB 4B3RB 2C0QA 4GKAA 5LWQA 1O6FA 4HUJA 4FMBB 4MSUA 4DCUA 2PY6A 1WNTA 3N8KA 1NVXQ 4JC4A 4X93A 4JGGA 1KFCB 2B1RA 1Z4JA 1D0SA 3FRHA 3AVUA 3OPQA 3O4RA 1ST3A 2GWRA 1P7ZA 2JJ8A 2BGNA 4PX3A 3DZJA 4UBJA 4O8ZA 4RNDB 3QELA 4NZZA 5EUBA 2HY7A 3QEMA 3KOZA 2YW2A 4RPGA 1PG0A 1G63A 1TX4B 1VDMA 3A7EA 3D6MA 3M2PA 4Y9DA 3V7NA 5C5CA 1GGMA 4BRZA 1S8NA 221PA 2QW0X 3FWYA 1E5DA 4J29A 1R8SA 1VKOA 4OPMA 3SF8A 2PXAA 4KR3A 4KR6A 3P0HA 5FBVB 3CH6A 4M0FA 3UK7A 4AJHA 1MRSA 1XZEA 5BR4A 1D2RA 2VKTA 3ITNA 3IUPA 4OXQA 3TSZA 3SFTA 4RNCA 2Q4BA 5CA0A 4GYYA 4ARCA 2W90A 2XVZA 3IPYA 2PS9A 3O8QB 1JIQA 2AK3A 1FYEA 3AKEA 4JJ6A 1UMDB 4YRRA 3U7FB 2HYIC 3B1FA 2PUFA 1P2SA 1NN1A 4IV0A 2Q6LA 3TBHA 5BSGA 2BP7A 1UBKS 3VSEA 1CY1A 2O8FA 3VMMA 3D3NA 4QUDA 5IDYA 5J4HA 1DIRA 3OQPA 3MMNA 5TNXA 5JAHA 4HX2A 5E3IA 2IDMA 3WGGA 2PX0A 3NGXA 3RVLA 2X0JA 3ZXYA 2V7XA 3GLUA 3P9IA 4YDHB 1YCGA 5JSHA 2R96A 2QJOA 3H1FA 4TZKA 1MAVA 4G8CA 4R7TA 4U2BA 4QPJC 5ELMA 5JSZA 3GRAA 4KRFA 4WW0A 4JK3A 4JOSA 2Q5OA 1BXKA 1D6SA 1GG2A 1UZUA 1POXA 3GDWA 1CIVA 3HBMA 4TT3D 4AY5A 4R2HA 2CHQA 4EHHA 1PEDA 3ZCPA 2G6TA 1NU8A 1UJ4A 5DNDA 1FP4B 1EBBA 3ABOB 1BTOA 4CZ2A 4JODA 1E92A 2CF6A 5A0FA 1KEVA 4DIDA 2XBMA 3LP5A 1AM4D 3VDNB 4PO8A 2H1CA 2QRGA 3CWQA 5AH0A 5F78A 1UC9A 4U7TB 1H2HA 2IEBA 2ABWA 3OOJA 4CV1A 3ZV3A 5I7WA 4HNGA 4H6PA 4HP8A 3FR8A 4U5XA 5ILQA 3L01A 3QMWA 4FN5A 3SHOA 4ZIRA 1Z83A 3Q3CA 1JQ5A 1FFAA 4Q5IA 4QKQA 3AOGA 1Y4DE 2L18A 2QI9F 3CB4A 3AKZA 5JFGA 4FHDA 2IHNA 1DG1G 2XTZA 3HYSA 3GLVA 3DXYA 4XB1A 1N6OA 1TYDE 1US8A 3AC0A 4U2KA 4GKVA 3PUKA 2ZRCA 3ZE1B 4EM6A 1QGAA 3TLEA 3OMWA 3FPCA 3ELDA 3TI7A 1JLSA 5JNVA 3T7RA 3R0JA 4Q3EA 4UJ5A 4Y6PA 2EX1A 3I52A 3IRVA 4QT4A 2QN2A 2CMDA 1IQ0A 2W6ZA 3IEXA 4BMSA 5LA6A 4A10A 1NI4B 2VZ9A 5JVDA 1CQXA 2BSAA 4PXAA 3ZWAA 1CEQA 3T94A 1OXMA 2IYYA 4XQ0A 4OFBA 4OFZA 1ZHFA 2BFDB 5JALA 3V1KA 4JDUA 1U28A 3EVFA 3SYTA 2IS6A 5BW4A 4BO5A 3EZNA 4XWKA 2XB8A 3DFZA 4JLBA 2OM6A 3DXFA 4NAHA 4PFQA 4WFKA 4UBIA 4BTVA 1P8AA 2G9RA 1TQHA 3P8ZA 4F3YA 3QKUA 3TDKA 3EGDB 4AM8A 2XKAA 1YVUA 3W6UA 2VAWA 4TRNA 1ECGA 2AOUA 3HU2A 3ZWWA 2WLTA 1NOIA 2DPXA 3FFBA 2JEZA 4EMTA 3EQ2A 4IXWA 5EI5A 1H4VB 1VHDA 2N47A 3MB5A 3WXMA 4G4IA 4ZZIA 2GCOA 5F35A 5AIBA 3QH4A 4A6XA 2P9EA 4A1OA 2Q0QA 3DV0B 1L4KA 3NJ8A 3ZEAA 1KZHA 3CEPB 1E89A 3HBAA 1S7GA 3G2IA 2P6NA 5J1TB 4EB6A 5IAOA 2NP7A 3TLKA 3H11B 4B87A 4CR7A 1H1DA 1XDDA 4MP3A 5CDUA 3AJEA 3B3GA 3PTAA 1KMCA 3I6ZA 1THGA 3PEUA 1XDSA 3PNQA 4R2IA 5ALZA 3TQQA 4D3YA 5GZ3A 4Y0VA 3DH0A 1K89A 4HQLA 1ZEMA 5T64A 3RU3A 1DIHA 4MVJD 4G4SP 3ACDA 3L7YA 3ZTWA 5ITVA 2J3MA 1EX1A 3DD1A 2PUGA 4V03A 1JW9B 1PV4A 1U5CA 3TGLA 3FUVA 4Y30A 1M2OA 1ZOLA 2A0XA 1VB3A 1A9ZA 1KBZA 2C98A 2FA9A 2FPGB 2GF9A 2JI9A 5ALWA 5TGZA 3AJDA 2WPNA 1E59A 1G21B 3WFIA 2PRIA 3EQZA 1T36A 2IU0A 1UEIA 3KSDO 2GEVA 4TWIA 3KVVA 3F78A 2AGVA 1Q1QA 1YRYE 2A9JA 1EUCB 3MJTA 3NAQA 3OCCA 4PLCA 4H7PA 4TV8B 4V0RA 1DFIA 1DC8A 1MA0A 1YB7A 3AVQA 4LSMA 4UOQA 2KYRA 3RUDA 4AYXA 3LKDA 4E12A 4CLOA 2Y9MB 3E7DA 1AK9A 3WWOA 4IIJA 1UXIA 3K8ZA 4BE4A 1BG6A 3STUA 2Q49A 4GQBA 5ALLA 5I45A 3HVIA 3HPQA 3OSZA 4A27A 4AD8A 2R85A 5EE3A 1IH8A 4MVXA 1Y5NA 3KLNA 3U3XA 4MP8A 1CR0A 1GPMA 3OCXA 4FW9A 3RYHB 4CTOA 4JI7B 2FP4B 2I6GA 2YR0A 2ZKIA 3LBYA 4N5DA 4Q34A 4S24A 1RLUA 1RRCA 3C3PA 4FFMA 5JMOA 1YOVA 4FKBA 4UE6A 2C5BA 3DYVA 3R9KA 1NN3A 1XJWA 3ENZA 3AVTA 1QC5A 4EDFA 3HGQA 3DBHB 6YASA 2VPZA 4V02A 4LBWA 4BPRA 1NUQA 2HPAA 2P3SA 3DHYA 3OD1A 3KT0A 4MRPA 5F7ZA 4TQ9A 5LB2A 3PQ3A 3DZIA 3WFJA 1ZVVA 2YVKA 3BWXA 4EGJA 5HQTA 1OXKB 2VT7A 3D8NA 4GI1A 1NUTA 3GLHB 4H31A 1EVIA 1DAMA 3I2JA 4WIAA 3WC4A 3IUNA 3D6FA 4LBZA 3AF4A 1C0IA 2EX4A 1YDWA 2J07A 5AR1A 1OAOA 4Y9TA 3CLKA 2W70A 1VG9B 1EVJA 1BN7A 5SZHB 3WB2A 2BBWA 4TKLA 1TCBA 1JSCA 2HXGA 4UEQA 5HDQA 3S5UA 1FVFA 3B51X 2AE2A 2OXFA 4PQRA 4W7SA 4S2EA 1AXGA 2DLCX 5KI6A 1YXMA 1CFZA 2Q3JA 4M2LA 1S3IA 1UIRA 1A76A 2BEWA 2MIIA 2PWBA 1J24A 3G2JA 1XP8A 3AR8A 1IJFA 4C0JA 1R15A 3WK7A 1U3FA 3AL0C 5CHYA 2H51A 2V8OA 2EC5A 1MNQA 2H07A 2VZ0A 4Y2RA 4BO6A 5JNLA 4P0QB 1AJEA 4LNAA 1DMSA 4BX2A 3SDSA 3KPVA 4JFRA 3VKGA 3RREA 3NBFA 1ZU5A 4LECA 1ONPA 3DV9A 4BLSA 3TRJA 1H2XA 4ESHA 4BNUA 1JR3E 1AHPA 1TEHA 2AZDA 4P35A 4PG5A 5B6PA 5EIOA 5EEGA 1MVOA 1Y3IA 3NVKI 1EK6A 2ZATA 5LP6B 4I1SA 1FZQA 1HE8B 3Q3JB 5WRFA 4Q18A 4RD6A 2Q5CA 4URUR 1E0JA 2QE6A 1W6RA 2J3LA 1IBKB 1KSFX 4CL8A 1TFRA 2F1IA 1N6PA 5FNVB 4C1NA 5LNK6 2JI4A 2JCBA 4Q03A 2YNMA 4F1WA 5AJYA 1EDOA 5J5AA 3R0ZA 3LTNC 2V7VA 1NONA 4ZCQA 1Q1GA 4ARIA 1XZKA 1J22A 2GM5A 3FYUC 5KAMA 4KR9A 1M1NB 3GJ8A 3EXHB 4IIHA 1CS0B 1K3FA 3TVDA 4GL2A 2R6GA 2FSIA 3EWSA 2GHQA 2BH2A 2OORC 2OA0A 3RG8A 3DSRA 3PJGA 3RS9A 5FPKA 3CEJA 2BJVA 4LZOA 3F6BX 3N39C 4PYRA 5A03A 1OLOA 1NFQA 2A35A 3PDWA 1GPUA 3IEIA 3PC3A 5JD3A 3ANSA 4GMFA 4MWGA 4C6RA 4BLUA 5KKCA 2GPTA 2HQ1A 1MGPA 4NZPA 3MJCA 1J8YF 4ZZ0A 1SXQA 2XUPA 2FFBA 5IMSA 1XCGB 4B43A 4ZCLA 2Y67A 1BCRB 2IZ5A 3CUUA 3HM9A 4D25A 3S2SA 1J1ZA 2VSQA 4D0SA 5DCLA 1E62A 1HRDA 4FDTA 1Q15A 1UMCA 2NZJA 1N2EA 1JVBA 2FE4A 2WFMA 2RGEA 2N9UA 1D7AA 1KR2A 2DFPA 3LPDA 4AULA 3AM4A 4KTVE 3G2OA 3VX3A 2QAJA 1TPZA 3UWOA 2R2AA 2NVBA 5G0WA 4G1UC 5E8JA 3WGYA 1RKUA 3P19A 4WNCA 3KWJA 3H5NA 1CZLA 3QFSA 3CX8A 4JYBA 4CV3A 4OHRA 1W47A 2WNSA 1L5GB 2K5UA 3A9RA 2QQ5A 1PFUA 1CUZA 2O1EA 1BMDA 2JPDA 3HVUA 4MV0A 3WXBA 3ZIUA 1GA1A 4PY2A 3OJWA 3ASUA 1NYTA 3QVVA 2XCRB 4UOZA 1PVOA 1SIUA 1QGDA 1XRSB 2JZCA 2XUJA 1Z6QA 2YV4A 1DFHA 5A4MS 2OT3B 1WZIA 4AKTA 1RI1A 3INNA 1TT5A 3BIJA 1XU7A 4X60A 1S2MA 3H2BA 1V35A 3ETLA 1WCIA 1FFHA 3HKBB 3VU0A 5CM9C 4HSEA 3UW3A 4MHTA 1U0SY 2QG9A 3IHLA 5JT1A 4IINA 3VDQA 3CBQA 6ADHA 3BWYA 2GN0A 3EIEA 1Z7WA 5BOSA 2WYUA 1PS8A 3QUSA 2P11A 3OQMA 1JG2A 4TXLA 5C7YA 1VPDA 2MYPA 4BO1A 1GCUA 3ZK8A 1U7UA 3WWCA 3SBDA 2CSXA 5IKMA 3GDFA 1EMDA 2BFEB 1MABB 2HSDA 3D3KA 2C95A 3OZCA 4K03A 1ABEA 4EUSA 5C5EA 4Z9BA 5MFZA 4ZV7A 3TZLA 4L4YA 3FNIA 4GPIB 1JN0A 4AZTA 5FX2A 1UDCA 1YR6A 1NQOA 2AFIA 3KC2A 1Z9BA 3QJ5A 5EHXA 1BSVA 2C2YA 2RKBA 3JATB 2GR9A 1ZNZA 2WU4A 3O3CA 4QGHA 5KNCA 3OZFA 1XNQB 4WFJA 1MOZA 4YMVA 1PL6A 4J0IA 5DWVA 1PZEA 1YHZA 1S2LA 2ZGVA 1A5ZA 3QVSA 1SVWA 4QRHA 1XYGA 2XGMA 1UKBA 4JSRA 2QM8A 3AR4A 1ZSYA 2ODWA 2HL6A 1RVV1 4FS8A 1OYYA 1BOFA 4DV4B 2O4CA 2PRZA 2CF5A 4BE7B 3RRMA 3S99A 1TQDA 3EG9B 3MGAA 1X86B 2V7WA 3L84A 1OFHA 3ISTA 4RIIA 4OB6A 3R8CA 3LLUA 3OUTA 4OLAA 3MMSA 1FFYA 3H1GA 4XQEA 3V97A 5HQ3A 4MVJG 5C7IO 4F5WA 1TA9A 5IXYA 5T41A 3TQCA 3GN1A 3L3BA 4Q9DA 3FDIA 3SD7A 1YE8A 2YBDA 3I6MA 5NULA 3E9RA 3AUKA 2Q3LA 4OP2A 4D43A 5L45A 1D4OA 4DSAA 1NASA 4KIGA 4MYSA 4HDSA 2O8CA 2X9LA 4BNLA 3ESQA 2CV1A 3OIDA 2PGJA 4RC9A 2E37A 3G9TA 5FJJA 5C37A 4V0OA 1MLDA 1Y81A 5EMMA 1I7SB 2VAMA 5FXMA 1ZGHA 4G8BA 4N6GA 5KSWB 2VSNA 4JX9A 3L1IA 2E6UX 2FQ1A 2QRJA 5FOQA 2O1SA 4OXXA 2AF4C 5AM4A 4OH7A 4GE0A 3LCJA 3TNDA 1JXOA 2GPYA 3GNSA 5JJIA 5KYWA 1FMLA 4AG6A 3ZDFA 1Z7YA 2ZJBA 1ZD9A 3ELUA 2NZWA 4HAZA 1FLNA 3EYAA 1ZY2A 2FWMX 3BWEA 1K9VF 2CXXA 4DQDA 5G1OA 3WAJA 2M6SA 2XE7A 4U3JA 3E81A 4Y6SA 1JWAB 1SUSA 5HE9A 4TLAA 2ZZMA 3L1KA 1Y1KE 2HC9A 3RSLA 3MXOA 3ZOKA 2GNOA 4FMPA 2PKCA 2YV1A 4CV2A 1EX9A 1FNCA 2ODQA 3DGEC 3KR0A 4BNTA 4ZMRA 3E58A 4IJUA 2A1UB 5EE1A 4M53A 5BUCA 1KGSA 5DRTA 3UWKA 3A27A 4JL8A 4XVHA 4CL0A 3THWA 4EAAA 2Y92A 1YB2A 3FWHA 5T67A 2ZTUA 3A2LA 5A1TA 4L02A 3IUEA 2ZDQA 4RLHA 5LB4A 1U7HA 2O3JA 1R8YA 4GP7A 5FBWB 1A88A 2IZ6A 2OZLA 2X1LA 1T6NA 2WM2A 2XRMA 3STYA 1W2WB 5L6LB 3RTCA 5IKOA 1LSUA 3FVVA 4H0CA 1MVNA 3CRQA 1UJBA 3GUCA 3N58A 4NU8X 3T0GA 1UXJA 4I99A 1W48A 1WXWA 1DWOA 1RXYA 1T43A 2VQDA 3D3WB 2XBUA 1OX6A 1YBAA 2VRBA 1K2WA 1PZFA 2X2PA 3CUKA 2XCLA 4DLXA 2VDRB 4DR2B 4I5IA 4UDXX 1K7EB 4HGPA 4G5OA 4UTRA 1PIWA 1RZUA 3UKDA 3V4ZA 2ZYWX 4HFNA 4BPBA 4EVSA 4QG3A 1CTQA 1L5MA 4YI3A 5FOSA 4HRYA 5U4QA 2YFKA 3K09C 4AF8A 4WBNB 1W581 3TE6A 1WTCA 2ZJOA 4II7A 3HP1A 5G0UA 2OL4A 4BO7A 4F4FA 1HDRA 3EGEA 3PU6A 4GEKA 4MVWA 4ZHSA 1UKAA 3COVA 2VTVA 3GNLA 1O4VA 1YZLA 1D1SA 1YIAA 3O9ZA 2V1UA 3SNHA 2Q3HA 4RANA 1CLEA 1JWLA 2VBFA 1J9EA 2IE8A 2JFYA 4GU5A 3QMMA 3HDGA 1CR6A 2VHEA 1E9CA 1F7UA 2OILA 5GQSA 1RJEA 1PT6A 4BNVA 2AMVA 3FCSB 3W5JA 2FGKA 1ADJA 1UBFA 1C7JA 5E4JA 5FL7A 1WDMA 1PAUA 2GHIA 2JS7A 4ZAYA 3UT0A 4FGZA 2G1JA 3LA6A 3DT9A 1H2YA 1RLTA 3WGOA 1NWCA 4Y2PA 4YP5A 1QRDA 1X39A 1PJAA 3COZA 4UU0A 2J5XA 4XGNA 3G5LA 4D79A 2HPZA 1GTZA 3NP9A 2ZR0A 3AHEA 1FSZA 1Z38A 2CYCA 3RJTA 2Q1TA 3AERB 2G28A 2WM3A 1QWSA 3MMPA 3GWGA 4OHPA 4D8XA 5GIOE 4BQSA 4L51A 1G4HA 4PFJA 1TK2A 3GJ4A 1T5IA 1U98A 2JGDA 3BEDA 3O8NA 1QVZA 3OT5A 1Y3DE 2HQBA 5BN4A 4YMUA 1W0JA 1KEUA 1UK6A 1EEXB 5IZCA 5J43A 1RRVA 2FZKA 3W3AH 3VSAA 4JXJA 4TVBA 1KK3A 1EE2A 1GEEA 1RJWA 1LWNA 4IYJA 2FX2A 4ZCTA 3HY4A 3ZCVA 1Z22A 4ZP1A 3FPBA 4ZD6A 3THXA 5KJEA 1JXMA 4J0QA 1DO8A 2J3EA 2P40A 3O0DA 1NJ1A 4HGOA 2GHTA 2J3IA 3L6EA 4DA4A 3K9LA 1Q0UA 4M0PA 3ZZ1A 3U4QA 5A62A 4MDEA 1Q12A 2JC3A 1KSJA 2O3SA 2O48X 1CB0A 3IIKA 2GXUA 2XD4A 3DE3X 3ZDZB 3I9MA 2PR7A 5IT9A 1M2HA 2HNBA 4KR0A 2MINA 1PQYA 3QVUA 4EA6A 4HH3C 3R7WB 1T0BA 4Y2XA 1Y6GA 2CE2X 2IIQA 5A4FS 4KXWA 5H16A 3AM5A 2XUDA 5IVIA 1NVEA 3T4EA 4LF4B 4DE5A 2BC9A 4Y1FA 4FQ7A 4IM7A 1GPAA 4CU5A 3BIWA 4NJEA 1CQZA 2FSHA 1NLYA 2OZKA 3H9BA 3PGMA 4OAOA 1A4UA 3C3JA 2IZZA 2Q46A 4KIUA 2Q1UA 4HWKA 5J5VA 1ZRSA 5IJAA 2XNKA 4GLOA 4KLNA 2MSEB 4PE5B 4RVFA 4YJ2B 2D06A 1I1QB 1QVRA 2EGGA 5BW6B 1Z6XA 3DEIA 2Y1FA 4F3TA 2WV7A 1P2TA 2B3TA 3V2HA 4WWHA 1K06A 2FWJA 5AVTA 3MFYA 4YHBA 3MGBA 2C1ZA 3OEEA 1JPJA 2GFQA 2YH2A 1AKWA 4UFNA 3FKSD 3A0RB 3HYCA 3UXHA 4BGUA 4P4TA 5EJ9A 1KI9A 2CLIB 5KYYB 4A6PA 5AW3A 1OGYA 5D6OA 5IUJC 2HA7A 1H3FA 3C3BA 2AMJA 4HCJA 4AJIA 2QRUA 4KO1S 3AVVA 1WSWA 3DMDA 3OE7A 1A0OA 1GGJA 1Q14A 1TUGA 4FBLA 1N36B 4Q3CA 2PD3A 2P4UA 2O54A 3IH5A 3WLNA 4LJYA 3I1IA 4HBZA 2GKOA 3Q85A 3IIMA 3BRSA 3VZCA 3QBDA 1PT7A 3PE4A 4P5DA 5HTKA 3PGKA 2X13A 1A7AA 1YBMA 3NHPA 2V98A 3URMA 4GR4A 3F4BA 4MWZA 3BHMA 1XDWA 3RYIB 3EF0A 1AQYA 4CEJA 1MB9A 1WULS 2BKLA 4ZAVA 1WPQA 4O2BB 4PQEA 3FUCA 3HWX1 3MERA 1JSXA 2Z09A 2DHCA 5EKSA 4CFSA 4DIFA 2BHSA 1U7ZA 2WWXA 3PNKA 1T0IA 3DXXA 4L07A 4ZV4A 1ZMXA 4WKPA 4UEKA 4QTYA 1PT8A 1B6TA 2AR7A 1U02A 5F12A 1SUPA 2HU7A 2OO7A 3VR2D 3ICQB 2OP1A 3I04M 2CLFB 4MQBA 5F2EA 5J2UB 3B38A 4XYMA 1QFMA 5F23A 3CLTD 1O96A 1W88A 2XF2A 1PYDA 3G5AA 4KPFC 3SJ7A 4MO9A 4O4IF 4RLSA 3D4OA 2UZIR 3AUUA 3IPCA 2Z1NA 3T9DA 1NW7A 5JQWA 2J1LA 3D4NA 4JT8A 2J0QA 2ZUDA 4OM7A 2KLBA 2RKOA 4BNDB 1BD4A 1P5RA 3SJZA 3RHTA 2WYOA 2RDMA 1UFRA 3HHEA 3U3JA 4XQCA 2BFCA 4I9HA 1DCMA 5D00A 1QFZA 2AFHB 3ZWXA 2HT1A 3RRFA 1XJCA 2DWPA 5BYBA 4M8KA 4XGIA 3IAFA 4C76A 4FR5A 3RDPA 3T5CA 1QH9A 3DFMA 4I50F 4UZEA 5AP9A 2PHZA 5FYQA 3VZQA 3EIQA 4ZC8A 2COUA 2WG0A 4PRLA 2YXEA 3NTVA 4Q3AA 5L7YA 1EK2A 3UH0A 4MP6A 2C8JA 3QU5A 4RLQA 1DQPA 4B3BA 1LBEA 4PM4A 5LOVB 3R9WA 3HFJA 4RJKA 5AUOB 1WP4A 2P2SA 2PJDA 3GJSA 2EDCA 3LWNA 1Z7EA 3B2NA 4RIFA 3CF0A 4DSZA 1KEKA 5ADWA 2P2DA 1IZ8A 4LK2A 1R3DA 2VBCA 5FH9A 2OKGA 1OYOA 3RABA 4IHKA 1RQXA 3I72A 1A5SB 1Q2XA 2XMBA 3C85A 3OZTA 1J2TA 4V24A 4BQEA 3KG2A 5ALVA 4LZLA 3GLQA 3KYCB 5E7JA 4D97A 5KO2A 4QZVA 4G5YA 3C4JA 3HY6A 5TC4A 4A91A 4GPD1 4G0XA 4EG4A 4LKRA 4ZOLB 4EI9A 1IHDA 2B5WA 3HBFA 3S8MA 1FRVA 4HX9A 1U2GA 1XPJA 2RHTA 3DDSA 1X1SA 1WO8A 1B2LA 3GGCA 5B58T 3TJMA 1F6DA 1R4MB 2E89A 3FYDA 3HCFA 4PHTA 5FNZA 3HLYA 4R2MA 4G0YA 3UK0A 4Z6KA 2CLEB 3ZGOA 3G2NA 2V8BA 4S35A 1M54A 3FTNA 5JTTA 5BWLA 4YV7A 1E6KA 2I4IA 3RU7A 2EERA 4G9BA 2ZAYA 3WK8A 2REOA 1WR8A 2XB4A 3AHCA 3CUVA 3LJKA 3CA8A 3LQQA 3M9WA 4HH1A 2F3UA 2V7GA 3O38A 4L85A 3ZQ6A 1A82A 1M8PA 2BBOA 2RHWA 3FZGA 3HDTA 1SAYA 5L7WA 4LHWA 3IC5A 1SVIA 1ESCA 2ALJA 4D8TA 3W1WA 4PG7A 3M4ZA 1AA9A 2WDPA 3IOEA 4KO3S 1CVRA 1NE2A 1VE6A 4JR1A 4PC2A 4TKZA 4Y0AA 3GLFE 1Q3HA 1WVGA 4ZZ1A 4JYPA 3PSHA 4QVGA 3ZC3A 5E95A 2V7BA 3T1TA 2QBYB 1B0UA 4YCAA 4RHXA 3R7LA 5EPEA 3EXAA 2WD7A 3I9FA 1OFVA 2AXNA 1ODCA 1Q57A 2K87A 1SIBE 3ADKA 3ZE6A 3C3EA 5BRJA 1RW4A 2LGJA 1ZW1A 1QQ7A 3E1GA 1XC7A 4JUBA 3RIEA 4L27A 1JB1A 5CCXA 2P0AA 2JD2A 3Q8WA 2B5VA 1LVUA 1H0RA 5K8CA 1PSWA 1L5HA 3RYFB 4EEXA 1QCZA 4FFBA 4HB0A 1ANKA 4DR5B 1QCCA 4JNCA 3O8OA 1JHZA 1PR5A 3N86A 1UOPA 1CDEA 4D1YA 3NMUF 4LOAA 2P27A 4C30A 5CCBA 3K5WA 5U9CA 5BPFA 1W34A 2B7CA 3CLRD 3RHSA 2J5RA 5JS2A 1N3LA 1X1QA 2ZIAA 2BR5A 1O0SA 2C4TA 1RLIA 5COQA 3BUSA 3OJFA 2IW1A 1SCAA 3ZWCA 4BV2A 3DW1X 1C0KA 3NT5A 5JAOA 1Z12A 4U7FA 5CJJA 2IHUA 1H5QA 1O57A 4U7WA 1AV6A 1U0JA 4K9DA 3A10A 3VNUA 5FBRB 2X8WA 4UEOA 3HJAA 3HB0A 5FPYA 3VBEA 4F3RA 1H65A 5JNRA 4DV7B 3RFCA 1FTGA 3O47A 5IANA 1RABA 1JYSA 1DRVA 5TMEA 3HE3A 2QX7A 4G26A 1GNSA 3LX8A 2B4KA 3IB6A 3AV0B 2VL7A 4TYQA 4AZVA 2FRVA 3D6NB 5B53A 3OHPA 4EABA 4W5QA 2CNNA 3K2QA 3KKEA 5K8TA 1TVKB 4GYKA 4FP9A 1AX9A 1N9GB 1BXRB 1KO8A 2XMSA 3F0TA 3RS4A 4CM1A 1EUZA 2PQ6A 4WMLA 2MR5A 3JQ9C 2XWJI 3Q9SA 3ZE7A 3DHWC 3NBYC 5E4TA 5AW9A 1TEVA 3KCQA 2DQ4A 3OT4A 4NV0A 4U6NA 5ALFA 4BX8A 3IEPA 4GRDA 3TQFA 2NXNA 5JW6A 4L8VA 2VQ3A 4S1OA 4IMPA 2MYNA 3LXUX 4QTZA 1I7LA 1QFSA 3KXDA 2ZR8A 5BN3B 4ME6A 3AINA 1PUXA 3U60B 1SVMA 1PZXA 1Z15A 3E18A 1JFSA 1JKJB 3AESA 4L5IA 3DOUA 4EENA 2SKCA 1XTUA 4L5AA 5K03A 1L5QA 1W85A 2W5UA 4ZYLA 1ZN9A 3DBIA 1GQOA 4KFTA 3N0TA 3P5SA 2ZJ7A 3D1JA 1U0NA 4FYIA 5EMKA 2GZMA 3ROXA 3WICA 1P45A 2CNWD 1KR5A 4MWEA 4ND8B 2H06A 2YOFA 4N0QA 4QDUA 3ZW9A 1A2OA 2ZK7A 3L2OB 1HEYA 3BGWA 4RH1A 5AOAA 5J4LA 1I4WA 2R1TB 3DDNA 1H6AA 4I3FA 4Y1GA 2WWYA 3PEFA 4DDMA 3FD8A 3EK2A 1A8IA 3TSAA 4NFLA 3B7GA 2AT1A 4ZAZA 1DNPA 1L8QA 3KFLA 5HILA 5A3JA 1PJTA 4B6EA 3LHDA 1C7FA 2A78A 3MA0A 1CZNA 2OXTA 2OCDA 3N2EA 1MW9X 4OLFA 1U5AA 3RC9A 3T5TA 1QIDA 3VR5A 3VYRB 2GEJA 3FHCB 2OSBA 1X8XA 4TL6A 4MQLA 2QXYA 4FSDA 3E6AA 2E2WA 3R3SA 3Q5DA 3WKDA 3TM4A 1JL3A 3A4IA 1NKSA 2QJFA 3P26A 4B6GA 4B3JA 4W9NA 2DQSA 1XKTA 5JZVA 4QQFA 1G7SA 4JLSA 3BM5A 4RZHA 4FLFA 1T8PA 4DOMA 3JYOA 3NHWA 1VJ5A 4KC0A 1K86A 5KHAA 4UBKA 4MINA 1CUJA 3LLVA 3ROGA 1DPGA 3BK7A 4FGWA 2UUAB 2QG4A 3K1JA 4FE3A 4FQ5A 3CLSC 1R7RA 1YVRA 4AQ7A 3G5TA 1UAGA 5BQFA 5K0SA 3HM2A 2BR4A 2XITA 4AY4A 1H2RS 4BMZA 2HU2A 2XKKA 2O0HA 1OWOA 1XXHE 1Y1PA 2XQIA 4KAXA 4NS1A 2O7QA 3L02A 3HN7A 1XVVA 1Z5WA 1C7QA 4O3FA 2JFWA 1JJFA 2WPDD 2C5GA 3LPCA 4G0QA 4HDQB 3DEFA 4O2AF 3WZ2A 2IH2A 4L4ZA 2IV2X 4KXNA 5EAIA 4F7DA 3S2GA 5C4IA 2B6NA 3DDUA 4EUHA 2JA1A 3W1VA 3SSMA 2ZROA 4N7JA 4P4SA 4LSWA 4ZA2A 2D2EA 1Y4AE 2QMOA 1GKUB 1Y8ZA 3T7DA 3WQQA 3BGSA 4RFSB 1E32A 3E2IA 2ZRHA 2X7HA 3M81A 2B92A 3L93A 3NALA 4LZNA 4PS0A 2PUVA 4MROA 4WNAB