4LS3A

The crystal structure of helicobacter pylori ceue(hp1561)/ni-his compl
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
302
structure length
302
Chain Sequence
QEVKVKDYFGEQTIKLPVSKIIYLGSFAEVPAMFHTWDRVVGISDYAFKSDIVKATLKDPERIKPMSSDHVAALNVELLKKLSPDLVVTFVGNPKAVEHAKKFGISFLSFQEKTIAEVMEDIDTQAKALEVDASKKLAKMQETLDFIAERLKGVKKKKGVELFHKANKISGHQALDSDILEKGGIDNFGLKYVKFGRADISVEKIVKENPEIIFIWWISPLSPEDVLNNPKFATIKAIKNKQVYKLPTMDIGGPRAPLISLFIALKAHPEAFKGVDINAIVKDYYKVVFDLNDAEVEPFLWK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nickel (III) ABC transporter, periplasmic iron-bindin gprote
publication title Helicobacter pylori periplasmic receptor CeuE (HP1561) modulates its nickel affinity via organic metallophores.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Transport protein
total genus 105
structure length 302
sequence length 302
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01497 Peripla_BP_2 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 4ls3A01
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 4ls3A02
4LS3A 2R79A 5AFSA 5JJ5A 1L5HA 3EIWA 3AERA 4TKVA 4PM4A 5CR9A 3MD9A 2AFHA 2YNMC 3EIXA 4OXRA 3MFQA 4H0FA 2YNMD 4INOA 3AEKB 3TLKA 2PS0A 1L5HB 3MINA 3R5SA 1FP4B 5CX1B 4WZAA 2AFIB 3PDIB 4WNAA 5FLYA 3MWGA 2ETVA 4TKVB 5KOHB 4MO9A 1M34B 5M29A 5HX7A 1KAHA 5KOJB 2RG7A 2WHYA 2XY4A 5BVGB 2PS9A 3PSHA 4WESB 1QH8B 4NNPA 4MX8A 1N2CB 4G09A 4INPA 2OGWA 3AEKA 4OVKA 4HMOA 1FP4A 2OSVA 5JPDA 5CX1A 5M3BA 3TNYA 2AFIA 5GGXA 1QGUB 3PDIA 5I4KA 1K75A 5B58T 3LHSA 3HJTA 5KOHA 1M34A 2PHZA 4ND8B 4B8YA 5KOJA 1MIOB 5BVGA 1M1YA 4IRMA 2MINB 1G21B 4WESA 3ZK7A 5M34A 1QH8A 3GI1A 1N4DA 1N2CA 4UTOA 2M6KA 3LI2A 4OXQA 4FI3F 1N4AA 3ZKAA 1TOAA 3HXPA 3AETA 2Q8QA 1QH1B 4WN9A 1M1YB 1ESZA 1QGUA 3AEUB 3G9QA 1XVLA 1K7SN 4H59A 5M2QA 1G20A 1N2ZA 2XQVA 5BVHB 4HMPA 4BBPA 2X4LA 4ND8A 4GICA 1MIOA 4FKMA 3AETB 2MINA 3BE6A 1G21A 4WN9B 3MWFA 2Q8PA 2XUZA 4HN9A 2O1EA 2WI8A 1PQ4A 1G20B 3NU1A 2M6LA 3K1AA 4UDOA 1K2VN 5HDQA 5JOQA 1QH1A 2XH8A 3AEUA 3HH8A 3AESA 4K3VA 2R7AA 1PSZA 1KARA 3U7QA 4MLZA 5JG7A 4WZBB 2OV3A 3R5TA 1H1LA 5BVHA 4UTPA 2OV1A 3K1AB 3ZK8A 4UDNA 4PAGA 3AESB 3UJPA 2XDQB 3ZTTA 2PRSA 1M1NB 4TKUA 1KAEA 3U7QB 4DBLE 1H1LB 3CX3A 4XPIA 3AEQB 2PS3A 4LJSA 1K0FA 3AERB 2XV1A 4WZBA 4TKUB 3ZK9A 4HMQA 3BE5A 4XPIB 4NNOA 2AFHB 2QI9F 4M7OA 4N01A 4FNAA 1EFDN 4MDYA 2XDQA 5KHLB 3MINB 4G07A 1M1NA 3TEFA 4WZAB 4CL2A 4FILA 4WNAB 5GGYA 3AEQA 3PSAA
chains in the Genus database with same CATH superfamily
4XEUA 1PZMA 1RHUA 2HPHA 3G5LA 4YJ2A 3ESYA 4YDRA 1R4AA 3JV7A 1HEIA 3FVWA 1M2JA 1QMPA 9GPBA 1T3HA 2RARA 4TTRA 4G1UC 2ZSJA 4N03A 3IE1A 4PM4A 2ONYA 3S2YA 3RRFA 4E6EA 2FW9A 4YMGA 1A8IA 2CMHA 5CXUA 5IKXA 4FINA 4C4SA 5EWMA 3QKIA 4NX2A 1L5HB 1DCTA 3GGGA 3LCVB 1RBQA 4N12A 4TT3D 5AKZA 1DZ3A 2Z56A 4Q3EA 3I23A 2VDMB 1RKQA 2HMSA 1AMNA 1KNXA 3DBRB 4J1QA 5DMXA 2EQAA 2FA9A 3DMRA 5I7EA 1NONA 4OMCA 2VTEA 4JC5A 3O8QB 1KERA 1P29A 1L5VA 3P20A 4DV5B 4FUTA 4O02B 1QC5B 3D3EA 1R0WA 2ADOA 2WILA 3UIEA 5DBFA 3EEQA 2V8BA 4QECA 2FY8A 4B3GA 1V8PA 2G25A 4G56A 2VZLA 2ZSKA 3A3NA 5HIKA 2HLDD 1SQ0A 3SX4A 5B7PA 1KGSA 1M2OA 1S8AA 3BRWD 3C1UA 4OFZA 3ROEA 1FP6A 4JB8A 1VPWA 2E4AA 1B6SA 4X60A 1XZAA 2DM6A 4FC7A 1Y7TA 4HZIA 1MXHA 3S5UA 1Y7HA 5F5XA 4D8XA 3T7DA 2HK6A 2B6HA 4G8CA 4L4SA 4LRTB 1J90A 4KIGA 5HQ3A 3LDGA 4AJIA 1U9JA 4J6EA 4B4WA 4G3XA 3WLPA 1VPLA 1DIOB 3V32A 3QKRB 3LFHA 4RF2A 1QZ3A 4FYXA 1MQ8B 3A9TA 3U60B 5FD8A 2AB0A 2GK6A 5BSMA 5M2QA 1UIMA 3ORHA 1CZKA 4PPNA 5BORA 1G4HA 4Y9DA 5KYUB 4PG6A 3ABSB 3BK2A 4NMXB 3T54A 5K8VA 5GTDA 1ENYA 1MIOA 1UXKA 3DULA 3ENNA 1GRNA 3P4UA 4P32A 1IBLB 1MX3A 4GX1A 3NXKA 3ZE6A 1E9SA 2RCNA 3DD1A 3C3MA 1JNYA 2O7QA 1GFIA 3WDKA 1VLVA 1U80A 3NBQA 3VNBA 5CYFA 1P7ZA 4HS9A 4OQDA 5BUQA 3G9TA 3M1YA 5FOWA 2EP8A 3ZLBA 7ABPA 4PQRA 3MTEA 3KYCB 2V0CA 4OFWA 1GRQA 3U09A 3WQQA 2NP6A 2YH2A 2AD1A 2AZ4A 2AOTA 5JH7F 3DGEC 3TUIC 1WOMA 3BOSA 3ONDA 3ZD6A 2GPTA 3AF4A 3K70D 2B83A 3WLIA 1NQ5A 3IPXA 1UAAA 4AY4A 2MSLA 3IUQA 3ZBTA 5HQJA 3AF1A 2QX8A 1L8QA 3OE7A 2XA2A 2GNAA 4ZO8A 3WHLA 4E33A 2Z2YA 4M1OA 1FRZA 4B46A 1Z2AA 1DJNA 5DZSA 1Z0UA 3VO1A 3HO1A 1WXHA 1YBHA 2GN2A 1YGPA 4WOCA 2IYWA 3ORQA 4C04A 2HNBA 3NIGB 3WTBA 2I7CA 5C7OO 5FOQA 2C57A 4E1BA 1UAGA 3KS9A 4PLWA 1TKAA 2WTEA 4O4LB 3WOVA 1D4OA 4ALIA 2NYVA 4JD5A 2ZYSA 4JDPA 4I1RA 4NQZA 2VCEA 3JSXA 4LJ4A 4XYGA 3WGJA 1YQQA 3B7WA 1OZFA 2Y3IA 1GNRA 1ZGCA 5K0LA 5LU9A 5DPMA 4L22A 4YCSA 2QD4A 3T3DA 1IBSA 3AY3A 2OHIA 1HYGA 2YIMA 1E1YA 3GIDA 2YXEA 5C3UA 2PYZA 3BWMA 2WJPA 4J29A 5F52A 4B6OA 3IOMA 3PC8A 1MPXA 4J7XA 2QRNA 3EIXA 2FCRA 4NOLA 6LDHA 4HVCA 2Z2KA 5KTNA 2R5FA 2XUQA 1FVHA 2C2WA 4Y1EA 4N0DA 2JAUA 1G1MA 3NBZC 2GAJA 3BE8A 4B09A 4CG3A 2OGTA 2CCJA 1BWPA 1LD3A 1FS5A 2BSXA 3FBGA 5JAPA 1A77A 5HSGA 2QL7A 1QFSA 2F8MA 1XPOA 3UUEA 1XTKA 4NCIA 4WLVA 1GA4A 2RE8A 5EIXA 3PEUA 2XSZA 3MMPA 2BFFA 1G6HA 1S2LA 2BMDA 1ZUNA 2QV7A 4EGAA 3RVPA 1JAHA 4POOA 3WRYC 4F8YA 5BYJA 1BMDA 3DEIA 1A2KC 1K27A 1WDTA 2HJWA 2OGWA 3RKRA 2DFDA 3OQ1A 4HMOA 4ZARA 3RW9A 2A7XA 2VUUA 1M2EA 3DH0A 1SU8A 4W1QA 4XSVA 4E5NA 3FCXA 2QXUA 3IQFA 4TYQA 3REGA 1SVUA 4QUKA 2VDQB 1WMDA 3F7OA 4WZAE 2MOKA 4OOFA 2JI6A 3KVOA 4RLSA 5FT9A 3VR5A 3ODPA 4X24A 5JD4A 1XJ5A 1IHUA 2UZ3A 1G60A 3A14A 4MW5A 5M34A 4IKOA 1VLLA 3A4MA 4OI2A 3R9XA 4UU7A 1RYYA 2HT6A 1DADA 1DRJA 4RK6A 4JT2A 2F4NA 4URXR 1TCVA 2VT3A 5JMOA 3H2IA 1QHHA 3IBYA 4LUCA 4CMIB 4LIPD 4E14A 1XXHA 1YJ8A 4LDZA 3MS2A 2QUBA 4RKQA 5E6SB 3BH6A 1L1FA 4AQ7A 4DNQA 4AU1A 4BBPA 1PF7E 3TIVA 3DZHA 4MUFA 1WSDA 3SD7A 5JQGA 3QPVA 3K6KA 4Y2HA 4IJUA 2C3MA 2W42A 4F06A 5GINE 3ZWYA 2V7TA 2FW0A 5T4HA 5AJTA 3HUDA 4A0HA 1T2NA 2C42A 3AUUA 4YXWD 3E8XA 1T5TA 2IY7A 3KM0A 3AUJB 1D6SA 2W37A 1HT1E 3ZNPA 3OIGA 4CGYA 1DTWB 1QTRA 3PIRA 3T15A 4PTYA 2J3LA 2JFBA 4TUYF 3Q9SA 1T3GA 2R6DA 4ZYWA 1SC1A 1XZNA 4XD7A 2LCQA 4A26A 2WG0A 4QYSA 2BGGA 1XL1A 1R74A 2VTKA 4ASUD 5JS6A 3OPYI 5K0FA 3KEOA 4LJ7A 2UZIR 3UMFA 2OCGA 2I4TA 3TW4A 3O2JA 1UMBA 4X84A 1EIZA 3GEDA 1RHQA 1GKKA 3QX8A 4IS2A 4ZTBA 4EHBA 5IJZA 5K7SA 2PFKA 1DAOA 4UVDA 5ALNA 3QYPA 3Q15C 4LNUA 3NT2A 4MWBA 4RCYA 4X6YA 3SN6A 4JELA 1UK7A 4NCKA 3ES9A 2WZCA 3QPCA 5ES3A 4A2WA 4B71A 1WBDA 2IWHA 1RQRA 1LBHA 2YZ2A 3O90A 4MQEB 3FPBA 3UICA 4A8TA 2G0TA 1C8KA 1QRDA 4K87A 4G01B 5HBRA 1W0JA 3RM3A 1ZOLA 4G8BA 4KXLA 1YC5A 1EM8B 2MT9A 3LKDA 3KXIA 3EF3A 3U7JA 3QEMA 5BRJA 3LAWA 4ERXA 1YUNA 4ZV4A 4RMIA 3CEAA 5C18A 4ER3A 1T43A 2H1CA 1X2EA 2FMIA 4DUGD 3Q8LA 4NECA 1W5EA 2C84A 4HHEA 3SJCA 2JIRA 4PPYA 4EW1A 3MRSA 4P54A 3GZNA 3L1VA 4Z7NB 5J63A 5HIMA 4B87A 5JAOA 2ZRGA 3EGWA 3QKWA 4LDAA 4R81A 5FJJA 5CHYA 3U31A 3X2FA 5AW0A 1JSCA 4OL0A 2B4RO 5DHTA 2H0QA 1D1PA 4B0OA 3K30A 1UFKA 2RG7A 5IAOA 5K8TA 3WL8A 1KMHB 2IL1A 3DO8A 1XQXA 3Q98A 4GF5A 3K9GA 3M9LA 3MJEA 2R87A 1E7YA 3K9QO 5E7IA 3GLFE 3UW3A 4YR9A 2AN5A 1U5AA 1B00A 1ITZA 1Y5MA 2BKUA 3HYCA 3QBJA 2PD3A 4O08A 4IEIA 3QVMA 4UOEA 1NXQA 1SIWA 4P53A 4EHKA 2AK3A 1LVHA 1JLRA 4GXTA 4IXWA 5GZ3A 5DI3B 4B76A 2DWCA 2YMPA 4V0QA 3HZOA 3RU7A 3F0TA 2H5LA 2ZBQA 3LCMA 1G2QA 3IUNA 3W9UA 3CLRC 3KJNA 4U6QA 3R3YA 2I7VA 3EXEB 2HEIA 3M70A 3OPXA 1UC5B 3DHVA 1N6NA 2P9JA 1E4OA 1DC5A 2JLBA 1M1YB 3L8CA 2QQEA 3IQHX 1GG5A 4ZAWA 2XMZA 1PJ8A 1QMGA 3HJUA 3FWKA 3LWNA 3JQ7B 4Q1AA 4DARA 3RYFA 1Q3HA 1RWNA 2ERCA 3QVTA 4K5QA 4AY6A 4GO1A 1Z25A 3NTQA 4JVOA 4B6PA 3HXQA 3MAJA 3HDQA 3Q8WA 2PUGA 5ECDA 1WU7A 2IXBA 2BTOA 3H3FA 4N54A 4DCVA 4RESA 2OCIA 2C92A 4LQDA 4ZOLA 3C7KA 1JQDA 1Q92A 1TMOA 2W71A 4UDOA 3NC4A 2BFAA 3RGWS 3UJCA 5KREA 1Q0TA 2D4HA 1W85A 4MSUA 3T3EA 5JV5A 1FSFA 1A95A 1OOEA 2G1KA 3FNEA 3W2EA 4BQPA 1AG9A 1F6WA 2ZYDA 2C8JA 2R8RA 2C7OA 4HOYA 2QYHA 5GADl 4PW0A 4I08A 3FOBA 1PNVA 2QVZX 3EUAA 1IEXA 3B1YA 3DB2A 3UFXB 3JD1A 3IT2A 3OMLA 4U2FA 2L69A 2XCOA 1M1NB 2FJPA 1SHKA 2YFQA 2AFIE 2GFHA 2CKMA 1UWLA 2XDAA 2XRYA 3OLCX 3ELDA 3GBPA 3ISVA 5K6RA 3NP7A 1OKKD 1PEYA 5KWJA 1R9NA 1K6JA 4GR5A 4B2IA 2NO6A 4KJXA 1XTIA 2ZJ2A 1BHJA 4G8DA 4XQ9A 1EESA 3LY5A 2FPKA 2VF4X 1N3YA 4TVSA 2ZDHA 2GXQA 5AI8A 2AS0A 1SQ6A 3LC0A 3QW2A 4R05A 5CT4A 2G5PA 3ZHTA 3DDOA 3ZHXA 3L7OA 1Z2CA 1MO3A 1K7FB 2XGSA 4J91A 4WA8A 2A5YB 3L2OB 4IR7A 5CH8A 5FWDA 2MYPA 1HQYE 4J0CA 3RK0A 4DIBA 5DISB 3ESZA 2QSZA 5I47A 2ZYGA 5G4KA 1GCOA 1YZFA 1L3BA 5F77A 4ALJA 4BIMA 5C8DA 1ZL2A 4ND6A 3WLOA 2DUJA 1FNCA 2J6CA 4G36A 5BUCA 1QPBA 2Q07A 2VN8A 4YRQA 3RQIA 1ULHA 2AHOA 2CMFA 2DTXA 1MB9A 2G63A 3L0ZA 4FHZA 4X1OA 1BG6A 1DJLA 1LTKA 1BS1A 2NXJA 1N7IA 4JFAA 1E3WA 2IOHA 3OURA 4X54A 2H7YA 4HAXA 4HLUC 4KAJA 5K3FA 2C9YA 3VTAA 1Q57A 3RT1A 4CYMA 4O5OA 4IFTA 3HVKA 3UN1A 1D2RA 1YDHA 2I67A 1V48A 5L6MB 1KO7A 2A84A 2RKOA 5J59A 1OILA 2DOKA 9LDBA 3CS3A 1SK8A 4NF2A 2QMYA 4X7RA 3HO6A 4ZVNA 3ZXUB 1KRXA 2JLRA 3GDWA 1FDSA 4MHSA 1GXSA 3UMJA 1OBFO 2QUIA 1RR6A 4CM8A 3CZAA 3N70A 4GI3A 3EX7C 4GZ3A 4DJTA 4AZ0B 1BYUA 1PR2A 3AZPA 3C85A 2E5WA 4P3YA 1JH9A 2JNWA 1UKAA 2UXBB 3R20A 3CKYA 4X62B 4ZI3A 1KS2A 5B5SA 2Y9MB 2I2XB 4X1YB 5LQAA 3CF2A 3BHNA 4N65A 5HF9A 4UW9A 1KYVA 5COBA 3VI3B 1ZO8A 1J0DA 1U3WA 4RS4A 4JIMA 4Q1BA 2AD5A 2GHRA 3O6VA 4WBNA 4Q6BA 4WESA 2FJUA 1G5IA 2VP6A 4U3JB 3RVMA 5I4IA 5BSKA 1KVTA 3B38A 2GD2A 4GZMA 4ZQGA 1Z2NX 4FIDA 4D45A 4EHDA 4ENVA 1OU0A 3GEHA 3D43A 5G4LA 4D9HA 3KOWA 2CN1A 1A4XA 4HDNA 4DC1A 1ZCZA 3MWEB 1O4WA 3O4JA 5FUMA 4RSMA 2HRRA 1UZLA 4V0OA 2QJOA 1V35A 1A9XA 1JL3A 3TM4A 2R1VB 2NUTA 4E7PA 4KU4A 4P4NA 5ESDA 2PKEA 4HGNA 1NNEA 1XDZA 1Z8DA 5DMHA 4BFTA 5B7GA 1JPUA 3WWZA 5I9IA 3IBCA 4G9EA 4OQEA 1U7TA 3K05A 2GCNA 4FLEA 1KFJB 4ISCA 3KYDB 3DVLA 1HNWB 2Z57A 1JDBC 1WHTB 2HDHA 2EBUA 5DBHX 4RZUA 2V98A 5DSTA 1L4NA 2EFDB 2ZEJA 2Z8YM 4FFSA 4D4GA 3KQKA 1HO3A 5KJ6A 1X1DA 4P2GA 3RLFA 3IOBA 2RSLA 3PNVA 4L0CA 3VU1A 3QOXA 5EJ7A 2ZJ1A 2XVZA 3DL0A 2V6FA 5JJLA 1NUTA 3A1UA 2OXCA 4XCXA 2XCLA 1O9HA 1PS0A 1QE5A 3RPEA 1RWVA 5C1OA 4JNKA 2HTEA 2Z5LA 1OH7A 2DQ4A 4DLBA 2JBAA 2OQ2A 2HHLA 4JJ7A 2VHUA 2GM5A 1I01A 1CUDA 1GITA 1UFOA 4B4KA 2IU0A 2Y77A 2J5QA 3LYLA 2XDYA 2COKA 4MWEA 5KYWB 1K8ZB 1USIA 1IMJA 1Z82A 4C0XA 3NKFA 4KQGA 2IT1A 3ABIA 3R3HA 5H4HA 4CKWB 3TTWA 3B1ZA 4JVNA 2E5FA 3FDZA 4TQ9A 5GP1A 4RULA 1YRHA 4NABA 5CUQA 1BSVA 4KQEA 4R31A 1L5LA 1TM2A 2LD4A 4QYIA 3OQOA 2P5UA 1OXMA 1Q0UA 1VC2A 3B82A 4TWIA 5FORA 1G8AA 1UOQA 1RWKA 3PHGA 3I53A 2RH8A 2QL5A 1AB5A 2GLXA 1CR4A 3BJEA 3PJGA 3AFMA 3PNSA 5ED0A 3RSFA 5CDYA 1T5LA 1XEAA 3BIOA 5FTMA 1GPUA 2YNMD 1JDJA 1EK5A 4NESA 3P0IA 1CP2A 2AVDA 2FPPA 3G5MA 4J0IA 4PZUA 1KQNA 4UNRA 2JAHA 1IQRA 1JDNA 5B4TA 4KLAA 2ECPA 3RVQA 4D96A 4RK5A 3PCXA 3T9FA 3QFCA 4IXNA 4BVHA 5KOHB 2FWBA 1NN3A 5JLAA 4PLGA 4DF3A 1JB1A 3LHKA 3VNUA 3DE7X 3ONWA 4NMWA 2HBRA 3IMKA 4BX8A 4DR5B 3L40A 1OXVA 1U63A 3Q3JB 3GXOA 3U3MA 3MBOA 2C3UA 4KPUA 2BT4A 4IZOA 2A7QA 1E8DA 2WC1A 2Z4SA 1EHYA 4Z99A 4F8JA 1VIDA 5BSHA 1QIIA 1Y9ZA 4TV8A 3UOAB 1VFPA 4Q24A 2EW8A 3LX6A 3PGVA 1KVSA 1VYTA 4F11A 1PT7A 2RH4A 2QP9X 3LYUA 4R0NA 5IXYA 3RVSA 1RAGA 4DYHA 3MWDB 3AIKA 3U4QA 3WQBA 1C0EA 1BU5A 1QB7A 3EK2A 1D04A 2LRHA 3AQIA 3IBFA 3CRQA 3NBYC 4GT1A 3PC4A 3UQYS 3WKAA 4BFYA 1MAHA 4V0RA 4ZAFA 6GPBA 3C6BA 2ZU0C 3EA0A 4WNYA 2P5YA 3G9UA 3Q1LA 3CTPA 4ZQFA 2C2GA 1U0FA 1P8JA 2HCBA 2JATA 1UMKA 1WCXA 3INGA 1D7AA 4FGUA 5EVCA 1L7DA 2YQ5A 3K5PA 4I1OA 1IG0A 3ZE9A 2ODQA 1LLUA 2X4GA 4NBKA 5GIPE 4CTNA 3DZBA 5F4ZA 4JC0A 3CH7A 1P2VA 3HJHA 4ZYZA 5JSZB 3HC7A 4JJIA 3TG2A 4PONA 4AI6A 1TEHA 2UZ1B 3RIMA 2QN6A 1P61B 4XW2A 4GBED 3CHYA 3M6AA 3S2IA 4C3UA 4CIDA 4YHHB 4RD4A 1ZK0A 2X77A 4OQNA 1L5SA 4F21A 5EIFA 1PQ4A 3F8WA 3LRXA 4EHFA 1CUHA 4N3CA 5ITVA 3COSA 2B1GA 1IY2A 1RJEA 4JOCA 4RJTA 3B1XA 3ROTA 1V8ZA 4PG7A 3SQXA 1OE0A 1Z5WA 2NU7A 2Y1KA 4L4ZA 3AUXA 4BU0A 3BT7A 5GJBA 3IP5A 1I1NA 4L75A 2E49A 1O89A 4NYIR 1QM5A 1MVNA 1AC5A 2NZXA 5GVRA 4MR7B 3PBKA 3A1NA 1X80B 2QJWA 3E1KA 2ZCUA 1J8VA 3VZRA 2EFJA 2WJAA 4LSGA 1VE9A 4BIIA 4F5WA 2HCRA 4HQKA 3I0MA 2PA3A 4LBVA 4YEDA 2ZJ8A 4R2WA 2VPQA 3I2YX 3VNQA 2O2HA 2R8XA 3U19A 3GLFA 1PT9A 3HGQA 3I5MA 2FP3A 4IIYA 4DCTA 2JKYA 3LZDA 1MB4A 2CLLB 1QHNA 2C20A 2YWHA 3FTEA 2Q62A 3W3AD 3NETA 2HIAA 2DH5A 1K3TA 2BSAA 1E9BA 2PWZA 2IHJA 5BWLA 1VI6A 4PLZA 4DEVA 5IPFA 1DUSA 3KD3A 2OQRA 4IHJB 3DBLB 4GUAA 1YDMA 4URHA 4B3DA 4I81A 5HNKA 1N9ZA 3O3OB 3C48A 3OZCA 4B3JA 1Z3IX 5I5GA 4KPFC 1CR1A 1RHJA 2P9ZA 3QGMA 2XPCA 3CY6A 3FPJA 2QP3A 5H80A 3AH8A 4M8KA 2XCUA 4JY7A 5CDTA 2VP4A 4YALA 3D0KA 4LISA 5TPZD 4EJFA 2Q3DA 3ZDAA 5J4VA 4JK3A 5A6VA 1NJ8A 3W0LB 1Z12A 4S12A 3MFQA 2DU8A 5LD2C 4IIFA 3CE9A 3CZ9A 2XWPA 4ZO7A 1SIUA 3PC8C 3UOWA 1SCQA 5INTA 4RNCA 2XXAB 2KLBA 4MQUA 3DOOA 4WLFA 3QITA 1E5DA 1LS6A 2RGNA 3PXEA 3UWMA 4DGQA 5HK9A 3OO0A 1SKYB 1TF2A 2C1XA 2VXOA 3FPCA 4NC9A 3SU8A 2QGZA 1WNFA 2MYNA 2X0EA 3LUBA 5CW1A 5TDHA 1OFIA 1EB9A 4G1VA 3FPSA 2F8SA 3O1HB 1C30B 3H17A 2X2FA 3K2QA 4IUBS 4KO8A 2RGRA 1PEKE 5J1TB 2XTJA 4D43A 3RVRA 1E2PA 2HPAA 3CT4A 3TAUA 3COPA 4AWXA 1P4JA 4EFLA 1CQXA 2AFIA 5JRZA 3NOVA 1WBBA 3H5WA 3LUCA 3NB0A 1QQ6A 1N5OX 2P69A 3OPVA 4C29A 3ZR4B 1VQ1A 2C1EA 3T9CA 2QK4A 2R1TA 5DXFA 3TOXA 3LBFA 1RRCA 3SZLA 1ZKDA 1BQ3A 4MKFA 3WLLA 2JA1A 1LWNA 2OAP1 4ID9A 4K6KA 2EWVA 2OZPA 3NBAA 8ADHA 1I7QB 4RTMA 4HSGA 1CD5A 3ZUGA 5EXEA 1XHEA 2VWQA 4QNRA 5ED4A 4QWMA 1KAGA 1YDGA 4ZXPA 5EJGA 1O0SA 2C5EA 3HBAA 4M0KA 2PUJA 3DYBA 4IGAA 3BS4A 2J5KA 4Y0AA 3TZKA 2GCOB 3L1IA 2BUBA 4MGIR 3AXSA 1D4FA 3PQ7A 4OQFA 4PQYA 4RL6A 4P34A 2C88A 2P8JA 1F8UA 4J90A 4EKEA 4HNUA 1N7GA 3OJCA 4K2HA 4DREA 4B3SB 3U4AA 3VZSA 4I5FA 5A05A 5CDSA 5JDIC 3ESXA 4Y2PA 5DBOA 3ZU3A 4BWVA 4JI2B 2H2HA 4GKVA 3RF7A 4DIUA 4BECA 1W581 4BV8A 1ECCA 3WLSA 4CM1A 2XJ9A 2AQ8A 2EERA 3GNTA 4HNSA 5DDIP 5LXTB 1JDTA 1IVSA 5I3CA 2BEVB 3AEZA 3AV0B 3IL2A 1QGDA 4MUHA 3QBTA 4TSRA 3U4GA 1CPYA 4N40A 4IDFA 3BGVA 3I6ZA 3R4CA 4GVLA 3HFJA 3M4YA 2O3TA 4AUNA 1GOTA 3OESA 3D3QA 2N42A 5CM2Z 5P21A 3O93A 2QUJA 4KQMA 3C0KA 1T9BA 2ZRMA 3TQHA 1V1MB 3RSLA 4EBFA 1LF0A 1L4HA 1Q7GA 1CZHA 4CCSA 1E2NA 2RMKA 4AFNA 3O9VA 1GD1O 3Q8XB 1CDEA 1E2IA 4UHEA 2DZDA 1Q50A 4I0WB 1DELA 5FF9A 1JG7A 2NLOA 1M5RA 3OQPA 4DJEC 4RHXA 3OC6A 1UKVY 5LOVA 4E5SA 3KRTA 1G55A 1SIOA 1JYSA 2JASA 2NZ2A 5AJWA 1YS7A 1FDVA 2GZ3A 4HRAA 4N3NA 3UB4A 2BAGA 2ZUSA 4R69A 3NALA 2ERXA 2H5EA 4U6SA 2ZRCA 2XF2A 3N2IA 1GPJA 1JXOA 4MVJI 2P9CA 5KPDA 1ZEMA 1Z4QA 3DXYA 3OT1A 3FI9A 3QWHA 3LF2A 2Q6OA 1POXA 2FPOA 4E4RA 1T9GR 2VZ8A 1P39A 1T6NA 2CV1A 1U3GA 3H9UA 5JNVA 2CMKA 3V46A 3AEYA 4TT3A 1Q16A 2IXAA 3O8LA 4QNNA 3V8MA 1NY5A 1AK1A 1DPFA 1VA5A 3CF6R 2UVPB 5JRJA 1BA3A 1C1DB 5KAPA 4M8NE 1ZD4A 4WQMA 4Q7EA 4UASA 5GY7A 2G3YA 5BWMA 4P4SB 3KJFA 1DU4A 4O63O 1QYIA 1MT0A 2A4KA 4OY3A 2BSQA 1ZJ6A 3GCGA 4RPJA 4ODIA 4P22A 2I6QA 2JJ8A 5AJYA 1MVOA 2WU3A 3QVSA 3ZZMA 5GQSA 1QQAA 1TCBA 2A0WA 2YDYA 1YTUA 1LV8A 4MW7A 4O4IF 4MS3A 1A98A 1EAMA 4P7JA 4DSZA 4I8XA 5BV1A 2VVTA 4RTNA 3B9RA 4M6WB 2EBFX 4JP3A 4ZYYA 4YP6A 4KFSA 4I99A 3OJXA 3VOSA 1W87A 4L9SA 3JRNA 2ECKA 3U9LA 1I1OA 1G7CA 5EE3A 1NVDA 3DHNA 1G98A 4AZ0A 2VEOA 1RLOA 4UUMA 4B3HA 4BLOA 3FHTA 1ORHA 3LXMA 4LHEA 3LQ1A 1PLJA 3JWEA 5BQ5A 3H6HA 3QWIA 4N5MA 1WY7A 2HU7A 2HYIC 3CXUA 4BQSA 3A31A 3MLBA 3ASYA 2UYOA 2I99A 1A71A 1CS0A 1BS9A 1I94B 1U2GC 1GARA 4F0JA 3D6TB 4J2TA 4FFRA 4TRJA 2KI5A 2WE8A 1P62B 3GG2A 4CEIA 3C5HA 4TXNA 2PZMA 1VG0B 5JY1A 2FQXA 1MO2A 1GCAA 2AC4A 4L2IB 2O59A 1NXPA 2OZVA 4MRMB 4Q1EA 1Z0FA 3H1EA 1ZVKA 2YVKA 2CUKA 2J0SA 2QOEA 5DGIA 1R64A 1NBIA 3EY9A 1PGJA 4MVJM 3WLAA 4C43A 5J2UA 2VJKA 2D7DA 4I4CA 1FNBA 3GFBA 1XF1A 2QHXA 3I37X 3LYAA 2WIJA 3LV8A 7ADHA 2IHUA 4C07A 3T8YA 1GQYA 4PR3A 3IQGX 1DBWA 1U0LA 4WKCA 3LOUA 2R65A 5F4BA 3D7LA 5MFPA 1NXVA 2YJ6A 5JZVA 4AS1A 2IY8A 1X8XA 3I01M 1T9ZA 3FUTA 1H2WA 2V7GA 3N7TA 3AJAA 2R3SA 1Y1PA 2R8YA 2J0UB 4NI5A 3FJYA 1HE2A 1H93A 2YWXA 4PIPA 1GN8A 4E1VA 5CITA 3BL6A 3L4JA 4X71A 1Z35A 4H1UA 2JIQA 4RABA 1ABBA 2YTZA 3NDIA 1N36B 4LHXA 3DDNA 1XFAA 2AUMA 1YAJA 2OAGA 4Y6OA 4KFUA 1ECLA 2IZZA 1AX9A 3I01A 4I4TA 4J7CA 1SGWA 1XE3A 1Y6GA 2IBTA 1WPRA 4K9PA 1EUZA 3TD9A 5AVRA 1IY0A 2X1HA 4UQPA 4MUIA 5B1YA 2XGJA 4MA4A 5ALTA 3E7PA 1N5IA 3T7KA 5JTTA 2FXIA 2D4AA 3I04A 3WIVA 1IN7A 1N5LA 1W29A 2X0JA 1TT5A 2PLWA 2ZS9A 3GAZA 2D1SA 2C9DA 3D8NA 2IHYA 4M1SA 3A3YA 3VTKA 5HTKA 4DA9A 5BR7A 4US2R 2ZIGA 3GJXC 2SCUA 5EIBC 5AVQA 1JQEA 3FOAA 3EWNA 4Z5XA 1YOVA 4QHTA 3EW9A 4PPFA 5DN9A 1PZXA 4A36A 4MRPA 1F8XA 1GQSA 1J1ZA 2GZRA 3FCSB 5AHKA 3G0OA 5EKSA 4DDKA 1P5RA 5HJ2A 1E60A 1FQOA 4CF5A 4IV5A 5A4DA 2DHRA 3HUUA 2XT9A 1I7LA 1K68A 3EIEA 4I2NA 4MVYA 4URWR 1UDCA 1C9NA 5JU6A 1O6BA 1Z63A 4LF4B 3EA5A 3C3KA 1IY8A 1ZH0A 1NM5C 4OMDA 4PO9A 1YSCA 4YMTA 2XLCA 5EKUA 3V3TA 1G5TA 4P7BA 5JHGB 1E9EA 2DCUA 2HPZA 2J59A 5B6PA 4V1CB 2HWKA 1ZMRA 4MCJA 1RTKA 2OCPA 1KRWA 3PVZA 1LLDA 3IT3A 3WQHA 3W3ZB 3KB6A 4IFBA 5EZ5A 5AXAA 4DVJA 2V1XA 3DHEA 4E0BA 1O9BA 3JYOA 4JMLA 4NEHB 4XIFA 3WVNA 1K8YB 4JEIA 1X1QA 2NSDA 2VNHA 4LMBA 1QP0A 4H7EA 4ILEA 1K5PA 2FOLA 2ZVQX 4WZZA 2J0EA 3NVMB 1ZY2A 2RHCA 1UBKS 4OXKA 4RVHA 2NU8A 1PYOA 5KNCA 3E81A 4PINA 2ZTSA 4ZT7A 3TI9A 1DQPA 4LVCA 1ZUWA 4ETIA 4FHFA 4I1YA 4OOEA 3KZNA 5ECWA 2VPIA 4Q1DA 3MUEA 3T5DA 3AI3A 1FJHA 1ZIPA 2X6TA 4QSHA 1D07A 1BAPA 3HB5X 5AUOB 2Q1SA 3K6SB 1UJMA 3CT6A 4GOMD 1B4DA 3VBCA 5DWQA 3DS8A 2Z9BA 1SY7A 2CLCX 4Q00A 3CCBA 2FP4A 1AF7A 2EZ9A 4B3XA 3G2OA 3ZPXA 2JG3A 5F7OA 3VR4H 2HK7A 5DEOA 2IYLD 2JRCA 2NXWA 5H1YA 3VQTA 3VYUB 4BGUA 5ALOA 1I3KA 1Y82A 3A6PC 5F73A 3IR6A 2ZI3A 2EHJA 3HWX1 4MWZA 2V97A 1VGVA 2FSSA 2QM8A 1GYQA 2WD8A 3HUEA 3EULA 2WF7A 3KJGA 5JD3A 4YRMA 2GEFA 4ASUA 5F2NA 3U44B 1E4EB 3OC0A 1CJVC 3RJ5A 4X20B 5TSDA 1UQTA 3SQMA 4OBWA 4D79A 3HBFA 4RWZA 3VKVA 3IAS1 2PJRA 1E9VA 2YWJA 5DJ5A 4KQWA 1WZCA 2FMUA 2D6FA 4XCVA 4B34A 3KLOA 3RRNA 5BQOA 1DWUA 1ZQ1A 2CXUA 2DSTA 3QVGA 3B12A 1MABA 1ONBA 4V03A 3JARA 1VIYA 5AIBA 5DX0A 1A7JA 1JE1A 4OHKA 3AXTA 3L4EA 2XV1A 3P0JA 4HUJA 1TM3E 3GFSA 4E5KA 4EMUA 4PZAA 4IQFA 4BO1A 3K2IA 2HV9A 2QMHA 1QZXA 4N01A 3OCJA 3QUCA 3J80A 2BCEA 3BD7A 3E7WA 3Q87B 3ONNA 3ZNQA 5JMWA 4D82A 2JGDB 1YR7A 3ETLA 3WGOA 4RTOA 4IQGA 2ESRA 3H7IA 3WK6A 2O4CA 1YWGO 4QDXA 3WDMA 4B7ZA 2UDPA 1GPAA 4NBRA 1A8SA 3NM6B 4KAXA 2C2YA 5FHQA 3X44A 3S8EA 4HDRB 2JLYA 2VF5X 5T6BA 3WHIA 2NUPA 1CJTC 2VJCA 3Q5EA 1VJCA 5JDCC 4DUGA 5EWJA 3FR8A 1AS2A 1YMQA 2VAPA 3R44A 4RPKA 1K97A 1NN5A 1R4ZA 1VXRA 1DAIA 3VVMA 4BB5A 3SSNA 1VZ2A 1RHRA 1KMMA 1HC7A 5GWXA 3PC6A 4RFSB 4BYGA 2PS0A 5G2OA 2QWXA 4JKOA 3ICVA 5KMGA 2WVGA 3DFFA 3IHKA 3WG9A 3NH9A 4M1EA 3HABA 3IDFA 3WK4A 1O95C 4WK0B 5ICGA 2GYWA 4Q12A 5ETJA 3GLHB 1PNTA 4YRRA 3F6SA 4QDOA 1PFUA 4P8RA 1SKBA 5FOVA 1X42A 3HDVA 1B8UA 1XAGA 3EEYA 4G5QA 3ZXIA 2WOOA 3HWRA 3MA0A 5AOAA 1ZSNA 2R6ZA 2IZ7A 5TQ2B 2J67A 4D0GA 1TUEA 2FN8A 4L5JA 4I1VA 4RL4A 3LXUX 3QXSA 4JUBA 3ZZUA 2HR1A 1PR1A 2WKSA 1QGED 4RY2A 2X0KA 5DOZA 5F9MA 3W2TA 3KEGA 3DEFA 1GTMA 1R5NA 4MR8A 4B8YA 4FK8A 3I42A 1N7HA 2J7PA 3KT6A 4QBKA 3DOCA 1Q12A 4UJ5A 4ZDKA 4MP3A 1C50A 1RWWA 2DR0A 1B8PA 4KYIB 3GUUA 1N2JA 4LRQA 4F2WA 1KI1A 4RVSA 4W9MC 1R8JA 5ALSA 1TQDA 3AUYA 4L9WA 3NDBB 3M6UA 4L8WB 1UXIA 2BPOA 2FEMA 2GEKA 3E8MA 3O9MA 4M1TA 1K9VF 2OFOA 1QYXA 5E0KB 3OHMA 3Q3CA 3V6MA 1RKVA 3OI7A 3RF6A 4ATNA 4DY6A 4A3SA 3K32A 1ZHFA 1CUIA 2V7UA 3CPJB 1A8QA 4XD2A 5DM1A 4CV1A 1MZVA 5FJIA 4X7PA 3JR7A 3RS0A 3RVDA 5CIWA 1H0RA 5G0VA 4ARCA 4V24A 2FJ0A 4YP7A 1XPJA 2IYRA 3F1LA 2FUNB 1JQ3A 2XODA 3DGFC 3JX9A 1Z2EA 4Q3AA 4AP9A 4CKXA 4KITB 1APBA 2BEUA 3U5ZB 2BGIA 1E2UA 1G8YA 2ZIZA 4NXMB 1XA3A 2B4YA 4CKCA 3DL2A 3RRYA 1Q15A 2ALJA 2VF7A 3A4NA 3DOUA 3HH8A 3PNMA 3WRXC 4OTZA 2G5CA 1T4DA 1JR6A 3KZ1E 4PEVA 5D3MA 2OLKA 3RI3A 1SKMA 4L85A 3ENVA 4RIEA 3EQ6A 3VC2A 3LQ2A 3BZUA 2CL0X 1X7ZA 1F7VA 4E2ZA 3RUPA 1Y6ZA 1QX4A 2QN8A 2NIPA 3OLYA 4WY5A 3UWPA 721PA 1Y5LA 4REMA 4CIVA 1G21E 1KO1A 2AJCA 1F17A 1EVZA 2L2QA 3BFVA 3C3CA 3FDIA 1W52X 3JQAD 3W2GA 3V48A 4F7WA 4F4FA 4CKZA 5LP1A 2QMOA 4RDXA 1JSXA 1YULA 2DBYA 2EIXA 5TV2A 4PBSA 1MH1A 1U0JA 3MRXA 2UUOA 3ET4A 1O7JA 4TKUB 2ZLBA 3E5RA 4AUEA 5K05A 1RQLA 4XPIB 1EWVA 5LLDA 1S02A 1NYLA 1RLIA 1WCV1 4UC0A 5EJAA 3QP9A 4S1VA 3GLGA 3DLBA 2X1LA 1Q84A 2XGGA 2Z5VA 3S55A 4DNOA 4K0RA 4F04A 3RADC 1E99A 1JZTA 2HZ7A 3EDQA 4DCNA 1JYEA 5A5EA 1E2JA 2HF7A 2OMEA 2ZZNA 2WZBA 1OH6A 2ZRPA 4C5CA 5K8JB 1OY1A 1PHPA 2H1FA 1IQPA 2YWGA 2AR7A 4AKTA 1ZN9A 3E03A 3OKFA 2BFOA 1IK6A 1JVBA 3KWMA 3NKVA 4FFBB 1XJWA 3T7RA 4D9GA 4TSKA 1B3RA 1L8AA 2CJYA 3ULKA 1DFGA 1VCOA 3H11B 3ROXA 2B99A 5IH3A 4CDMA 3PD7A 1H9AA 1LDYA 4AP6A 3ZGVA 4UATA 5D00A 3OX4A 4W5RA 3F67A 2W58A 4HDOB 2H5IA 3SZGA 3VKUA 2PY6A 4IOKA 1MF7A 2ACWA 1VFNA 3BJZA 4W8GA 2Q21A 4ZMRA 2L0XA 1DQRA 4OJNA 4ZZ2A 3ZWXA 1XMQB 2W2KA 4ZO9A 4WOKA 3F3MA 4HFMA 2SBTA 3BSSA 4BE7B 2NQ2C 2WJWA 1NVVR 3EVFA 3OEHA 3RYHA 3D1JA 3B70A 2ASVA 4QXMA 3CSUA 3N7AA 3TXYA 1G4UR 3WBFA 4OJYA 2ORWA 4GKJB 2E21A 1EVQA 3CW8X 4CKEB 1P1CA 1EG7A 4DMUB 5KOJA 4TLAA 3PTLA 5FPTA 1KFEB 1SUAA 1Y80A 1JHMA 2QRMA 4CETA 3AVTA 4N48A 4LHWA 5DTJA 2XWSA 3TQCA 1A04A 2BFBB 4MJLA 5J3JA 3ZS9A 1KSJA 2I4LA 1E7SA 3FMFA 4NTZA 1LDMA 2NGRA 3DDUA 3EBOA 5F12A 4BNDB 1JA0A 4HEQA 4J7AA 1RJFA 3JPYA 3KAQA 2CNLA 2PMBA 3FFWA 2HMUA 5EKDA 1F60A 4IIBA 4MCHA 3WSVA 2OO5A 3ZYCA 2XMRA 1JIUA 1RWBA 3N2EA 2VQFB 3LVBA 2W2VA 4ZCLA 2Z98A 4KQJA 3L43A 3OSZA 4IGFA 1UBSB 4J43A 4FMPA 3WP0A 3GFQA 4C14A 4DMGA 4HDMA 1T1RA 5IWCA 3A1VA 4HQRA 4ES6A 3EH1A 3N0WA 1N2SA 5J58A 4A8PA 1G20B 4JSRA 3UJNA 4W7HA 3OPMA 1YZ3A 5SZHB 4B5LA 1U5BB 1GUBA 1Y8RB 1BXZA 3QF7A 2ECOA 1U4NA 3A1FA 4HD8A 3UB2A 5GV8A 2A1UA 4ETWA 1YHYA 2H1IA 2QQFA 2X5KO 3CO5A 2C3YA 1NDHA 3GA7A 2HMWA 2QRUA 2WMDA 3PFKA 4PE5B 3JWGA 1Y4SA 4XKJA 2XMGA 4U7FA 1NR5A 1PP4A 4HSEA 3VH4A 4DYDA 4IM7A 4PRYA 3UJPA 3PL5A 3KP1A 3IEVA 4NU6A 5EHGA 3GJYA 1EXMA 2EG5A 2QP4A 2W4IA 5HCNA 4P08A 3UPUA 2IPNA 1J2EA 2WHPA 4LOKA 2DMRA 3MOIA 2A1IA 4GUDA 1Y3IA 4IZ6A 3RSOA 4G5OA 1GN9A 1WV1A 3BCSA 3DCIA 4HZUA 1LDEA 2WZDA 2ZE5A 2AG0A 5JWHA 3UK0A 5BSVA 1C0LA 4MVCA 4TQUS 1RFGE 1OV4A 1CUFA 4EYGA 1YASA 3ZDEA 1R50A 3AR4A 1UUFA 1BVRA 1A5TA 1AXEA 1GUZA 2BH9A 1MQ9A 4F46A 5C5DA 2WPDD 5C51B 4YT8A 4IIGA 3FPAA 1ZGAA 1SU7A 2CW5A 4IJKA 4MCIA 2BN4A 1CIPA 4G5SA 5BMVB 5JLJA 4WXHA 5KWVA 1YQDA 4MHOA 4F6LA 3WXMA 2GXUA 1CT9A 2FSGA 2IITA 2J5BA 3GN1A 4DUYB 5A4IS 3KSRA 5MN5A 3WGNA 2R60A 5CXXA 3BA6A 5JTUA 2FEWB 2CSUA 4BFVA 1L4YA 2YNMA 3RUDA 1SZJG 2PGAA 1X70A 3MT8A 5DNYB 4PS0A 1E2LA 2Y1FA 2ONJA 4OD0A 5DGTA 2ZR8A 1ZC3A 2NVUA 3BWXA 4BO2A 4XJVA 4NMLA 3JALA 2QN7A 2H63A 4IWYA 5LMCA 3USCS 1C4KA 4JLJA 4ENPA 5CURA 1MNQA 2AW3A 4NAVA 4HPXB 4CIAA 1DC8A 3IAM6 5D8DA 4XAQA 1J5PA 4CLOA 3P0FA 4A92A 3R5JA 3S7ZA 1NBAA 2W2NA 5EAIA 4S1OA 1LNSA 2BTQB 2OCDA 2VYFA 4C4AA 3NQ41 3IPAA 3VRHA 1L4LA 3ECSA 3GRKA 4R2LA 4DA4A 3OE5A 2B30A 4HN2A 5EMHA 3WLTA 4BNFA 2LGJA 4G09A 4TVOA 2IGTA 1P7VA 2C95A 2IXEA 3Q11A 1KKLA 3OQVA 5K0NA 5GGXA 1DKUA 3BFPA 2JHGA 3A0UA 5JJBA 4D3FA 3U16A 3VISA 4RFVA 3T7AA 4Z4IA 2A57A 2YJ5A 1AUOA 4J8PA 2ACVA 2XEXA 3AF2A 4CUZA 2CB9A 2QTNA 2HT1A 1SR8A 4G6ZA 4KO2S 1IG3A 1LFDB 2CJWB 2HSWA 2ONZA 4KV9A 1FZQA 2EARA 1DKMA 4R51A 1JDBB 1QP7A 1RWQA 4DCMA 4OHOA 3U0VA 1CULC 4QU8A 2DJIA 1ISPA 4PSKA 2J9ZB 4GU5A 1H8ED 3B13B 3KLMX 2X19A 5AXCA 2BEKA 4PC7A 4JQSA 1RKXA 3FBWA 3IA2A 4XUEA 4Z1MD 4Y6LA 2XQGA 4PX9A 4IV8A 1CEYA 1RRKA 4BNIA 2Y27A 5LLTA 1HSZA 4Y67A 1D2GA 4GICA 4GP7A 1P5JA 4AULA 2QTFA 2GUGA 5DN6D 4FR5A 3RS5A 1SELA 2D2XA 2NUBA 2G4LA 3OETA 4NFYA 1SBQA 1SWVA 4IG9A 4MIOA 4MVJH 1TKCA 4N6OA 4ZVTA 4BAGA 1J5EB 5BQPA 5B2FA 1RXWA 1BX1A 4KQHA 4QHYA 3BULA 3U62A 4AVYA 1V95A 4L5AA 2JPDA 1N77A 4K3VA 5FWXB 3WGMA 4B6JA 1HETA 3HA3A 4AF8A 3LPLA 4EAQA 1G8SA 1ZVVA 4BV3A 2ZTHA 2Q4RA 2IOQA 3NAMA 4FMBB 1JFFA 4IYRA 4XEHA 1N0UA 821PA 4G63A 1JU9A 3K70C 4TXMA 3L5OA 5AUNB 1CF9A 4LA4A 4IUCS 1ORRA 4MW6A 1N1EA 1WMBA 4AJ9A 1WX1A 1KJIA 2OEPA 4ML3A 1J0CA 2PMDA 5AVYA 2HMVA 3AI7A 1OD6A 1ICIA 1KH2A 1QANA 3IHTA 3PFHA 4YJ2B 5FPQA 2XXBA 4NULA 5HG0A 4CVNA 2NO1A 1D9ZA 4FFNA 4H35A 2AWOA 3SIPA 3OOJA 2AH5A 3QG1A 4ZTUB 3ZWDA 1EH5A 5ES4B 3KSMA 5D85A 4EOGA 1FNNA 4N9WA 5EWMB 1WWKA 2GJ8A 4QTXA 5LQDA 4J0HA 1D8TA 1SUWA 4C30A 2FXVA 4ZPXA 3RTCA 5TPZA 4ESOA 1JIKA 2G09A 3Q0IA 1PK9A 4KI0A 2NX2A 2X5OA 5C8YF 5WRFA 1Z3CA 3TNDA 3KAKA 5FPYA 1LQ2A 2BKAA 4LY0A 1M8KA 3FLAA 3KOYA 1PDWA 3MM4A 2KQUA 2Q3MA 1GZ4A 2WTXA 1I33A 2G88A 3IOEA 4OJKA 3I1YA 1PJQA 2M9MA 5ALZA 3IIIA 1THTA 2WY2D 1VG1A 5L7YA 1NX9A 2ISQA 5DT2A 4DPKA 1DBVO 1GYRA 1EFPA 1ZD9A 3L6RA 3KTDA 1J21A 4YGXB 3C7DB 3IVMA 1OX6A 3L92A 1KAHA 3T5GA 3L82B 4A2CA 3EGEA 1TMKA 2B36A 1WAMA 2V5VA 3I1IA 2ZXFA 1JAIA 2Q1YA 3KXKA 1K6IA 1E61A 3PE6A 1ENOA 2AFHE 2YCBA 3ILYA 2N75A 1IVNA 3JU3A 2Y1OA 1LLCA 1JUDA 4EIWA 2AT1A 1X1EA 1RADA 2I03A 1KQOA 3PWZA 1BCRA 2CLEB 4KN6A 3QXXA 2XYRA 5FUVA 1ODIA 1MIOB 1OTYA 1TVKA 4G24A 4X3PA 3RIYA 3EPHA 1IEWA 5CGQB 3B1WA 2Q99A 3ZBUA 3SWWA 2REBA 1FDRA 4R2MA 1XKTA 4YUAA 3HQ4O 4C2UA 5HRCA 1RXVA 3SC3A 3QVWA 4LDPA 4UQOA 3UHFA 5H3HA 2XVXA 2WWYA 2O2CA 5EVJA 1FYVA 3D02A 1IB0A 2PVSA 1P1BA 2FDRA 3IB6A 1ZR2A 2DPMA 2E1RA 1VBFA 2I34A 3EXIA 3SKVA 4IJWA 4IJQA 1TK2A 1QAOA 2AOTB 4ZVLA 4D3SA 3P0RA 3WK9A 2BOVA 4LHYA 2FKNA 4GNKA 1T9HA 2II6A 1XMSA 5CT9A 4ZRNA 5A6SB 2WDPA 5IN5A 4W9NA 4Y6RA 4QHSA 3QEBZ 1SXQA 4R1TA 2QTMA 5IDYA 2GPWA 4YQFA 4LY9A 5C81A 1DFHA 2XH8A 4NV1A 4TQAA 5JCZA 1I13A 1DEKA 1O8BA 2Y0BA 2GWRA 2QQ0A 3ANNA 3FJ1A 2ZANA 4WE3A 2CF5A 1NJ2A 1UC8A 2D0PB 1IDN1 1AN0A 1L3IA 2NU9A 3QLVC 4HL6A 1HK7A 1KXJA 2TS1A 2ROQA 3QKUA 4BLPA 2HNKA 2FE4A 4XQ0A 2WIKA 3EZNA 4PRZA 2ANCA 5EMJA 1HLDA 1U7HA 2P9YA 2BR5A 4Q21A 3TPCA 2JEZA 3FNBA 2H4JA 3U7RA 3D4OA 2QNRA 5J2UF 3ER6A 7MDHA 3H13A 4B7UA 5ALEA 5FFMA 4FW8A 5I5EA 3BFKA 3BD8A 1PW5A 2QENA 2G7ZA 3GNLA 4DV2B 5ALVA 1QH9A 3DFKA 3ZCQA 2ZE8A 1N3LA 2HI0A 2NU6A 4C87A 3WS7A 1GQOA 2JFFA 4GEGA 4OIMA 4DIMA 4HUQB 3CLVA 5C4IA 2EBHX 2PMCA 1I1HA 3Q7TA 4DG9A 3EIQA 4ZHSA 5CIYA 1LBQA 4L28A 4A6EA 2I3GA 3CE6A 5A7FA 1WVIA 1EDBA 4R1LA 4BUZA 5L40A 3PSAA 3RREA 5A5FA 4MYDA 3H4IA 4DBZA 3OBBA 3PR1A 3UYKA 4EDHA 1OW3B 3RC1A 1ONPA 2QE6A 3TW8B 1P7YA 1SD1A 2BFFB 1ZUNB 3M1IA 5ENVA 1XFDA 4J3NA 1F0KA 4HK4A 4ZAXA 1XZFA 4BVKA 4NPAA 4C3VA 4F9FA 3CBGA 2EL9A 3GVHA 3D2BA 2YJNA 3DLPX 3VI4B 4I4TF 3IAS6 4Z2AA 16PKA 5FTWA 5HJ7A 1A8PA 3E05A 4HAZA 5EJMA 3UPDA 3PVSA 4PLCA 2ODEA 3A6HA 1YI0A 1R16A 4PTLA 3PPVA 5F1PA 2RFLA 3TIIA 4IOJA 1DE0A 4GPBA 2W4MA 4PHCA 3N0RA 2WAOA 4P4UA 2I65A 2C7VA 1ZJYA 1AGXA 2YYAA 3AUFA 3G9XA 2G72A 1P0PA 3OZTA 5TX7A 4B6RA 1M1XB 4Q02A 4BO9A 4EH1A 5ICFA 3PWTA 4KR6A 3R9XB 2F1IA 1IEQA 1USUA 1JJBA 1WR8A 5EN4A 2AEEA 1NQWA 1UXGA 2SHKA 1QHHB 3E70C 3TKYA 4BQQA 1FP1D 3EZXA 1GP2A 2IPAB 2XB8A 5DRYA 2OQVA 4BV2A 1NRJB 5AWFC 4OAPA 2YIVX 3PRYA 4F3YA 3W7BA 1YR3A 3NWJA 4MK4A 3WOHA 5CA1A 1KJWA 3VC7A 2CL7X 2PPVA 2HXGA 2P9TA 1TJ3A 3AWDA 1N3BA 4OHPA 1IN8A 2QY6A 3SBXA 2Q9CA 3OF2A 1XZDA 5BRAA 2QJRA 1ZX1A 1ZJ4A 4WN9A 1FDOA 2B61A 4HH4A 4NBSA 4P93A 4QBTA 3W5SA 1OXUA 4ZVOA 1E77A 3NS7A 2QSJA 1XU4A 2VR1A 3HBMA 4ZALA 1D5WA 3UMGA 3ZWAA 1NMEA 1RQPA 2XYGA 3FYCA 3GEPA 3R6LA 3JYHA 4Y2GA 4ADSG 4MQ4A 4DM7A 4QUDA 2MIIA 4D98A 3INRA 4QDTA 2XUZA 3IEMA 3HKEA 5EPUA 3DVAA 1KJ8A 4GFDA 2F8LA 2XECA 1I1QB 4QPDA 4G65A 4MPTA 3HLKA 3BJMA 1UMBB 3DC2A 4NENA 1KR5A 5EC8A 2AE1A 1KEWA 2EWMA 1LX7A 2GAOA 2HM7A 3CN7A 4I55F 3QEAZ 3BIFA 3PPIA 1FNSA 3ZQ6A 2YHAA 1JMYA 1QR6A 3FLBA 4Q3DA 4BRWA 5DSZA 3QTBA 2VBIA 1UBOS 2FHSA 4LNUB 4MV1A 3LIPA 4W8OA 5EZSA 6ABPA 1X15A 1KI9A 3IAFA 3W1EA 3I5YA 1GTG1 2WAAA 1VCHA 4KK4A 1T36A 3UF0A 1Z8NA 2EG9A 3ZTTA 1TJ4A 3LQFA 5GM2A 4AO6A 2REXB 4PO1A 1UXJA 4BUJA 5BYAA 3WIOA 4JV5B 4AO8A 3HVIA 2PSHA 1H65A 3SMQA 1BDJA 2FZEA 3QEMB 4S2UA 4YT5A 4YMHA 3LYHA 3QEJA 4LYJA 4WZBA 1K5DA 2VRWA 2LUOA 1I2AA 1D2MA 3LKBA 2QDKA 4HS4A 4AICA 5B36A 3GOHA 2J0QA 3D8RA 3MC1A 5E3IA 1ZP6A 4F2DA 2B3DA 5BWCA 5K3OA 4BO8A 2VT7A 1ZW6A 4FDAA 4LDJA 3W77A 4QWWA 2Z6VA 4D4KA 3I2FA 1IU9A 2YV4A 1XVIA 3EA4A 4CT4B 4CFYA 2OE2A 1EFLA 3EDOA 4IMJB 1LW6E 4N39A 3SCZA 3ITEA 2OB2A 4LV6A 1W34A 2YCLA 3FCYA 5LZ5A 1KZYC 3MNFA 2JI8A 4MV3A 2HLPA 4HAUA 1OAKA 1XD2A 1Q1ZA 4LDRA 4UBJA 5DCWA 5J5VA 3RS7A 4RW0A 1ZCAA 2O6LA 2RHHA 4BMOB 3RBZA 1CY2A 3MZ0A 2JBHA 4LVNA 1NF2A 4O0MA 4Y1FA 1N6HA 4MS4A 3WGQA 3FOFC 4YLYA 2WV7A 4JP5A 5L3ZA 2C2KA 2H18A 3BMCA 2CE2X 5LBUA 1ML4A 3ZVNA 2X3UA 5BWNA 5K03A 1Z5UA 2R2GA 3G88A 3T4EA 3BHMA 3B36A 3V55A 2FG7C 1TJPB 2WJJA 3PQ5A 1GQQA 3TWOA 3WYAA 6REQA 3FWNA 2FB9A 4NXNB 1MC5A 5H0IA 1ODTC 1Z22A 3STYA 2XMDA 4NDAA 4ZWNA 1ZM7A 4E94A 1W75A 3NBFA 4EYOA 5JAHA 4K3UA 3VYWA 1L1EA 2ZATA 3T1NA 4OLAA 4RPCA 4NYIQ 1EVIA 5C53B 4U7PB 5AT1A 3F7MA 1B26A 3L6CA 4KKXB 3RYFB 4OU4A 1EK0A 1SOWA 1USGA 3H5NA 2IEYA 2HBZA 2O7SA 1DUIA 2ZIVB 3ENZA 2YW9A 3NC1C 3MSCA 3OPYB 5KKNB 1LWOA 2H54A 4OG2A 5D3KA 4TS3A 4Y2XA 5IYZF 3M2TA 5E1OA 2QV0A 3U17A 3KDPA 4ZOLB 4DQXA 3DE0X 3ZWQA 1L5FA 5K09A 4DLKA 3U81A 1A9QA 2YZNA 2M6RA 4MVWA 1I6KA 4DDMA 5FHRA 1W85B 4DLSA 5I7FA 1CJCA 3KSZO 4Y6GB 2LPMA 4OK5A 2H51A 1DIAA 2E55A 2BEWA 3LDHA 4F3KA 1XR3A 3NHFA 5A9RA 2OO5C 3ZXYA 3SS8A 2Z4RA 3EARA 1AKUA 4H16A 1KE1A 2R7MA 3JQBA 3KTOA 4AP5A 5ENZA 2YOGA 2WKRA 3L8YA 3RU2A 3QYFA 2AQIA 4FVTA 3UJ9A 1XHFA 3VGPA 4YV1A 5JEDA 3STVA 1GPBA 3STWA 3RC8A 2V3WA 2PO7A 4DRZA 3ZLJA 4WCVA 4Z9BA 2MSNA 5DGDA 5KOYA 3BL8A 3B5IA 3LSTA 1EP3B 4WOBA 4WXYB 4YBZA 1FDWA 1LH0A 4A27A 3H83A 4Q18A 4AK9A 2F55A 4GDMA 1R18A 1KI3A 1TTQB 3GFTA 3LQQA 4LGVA 3HCAA 5LD2B 2AUNA 3W6OA 3HL0A 5G4KB 4DC9A 3SVLA 1GAJA 2CXQA 3EZYA 4URUR 4ZQHA 1RYHA 1I6WA 2Y68A 4L4RA 1FFBA 2GH1A 2JK1A 2OCLA 1GA6A 2Z5GA 1QS0A 3PUYA 1R5JA 3PFGA 2IIPA 3PGXA 2D0IA 3PQFA 3LTNC 5EJ8A 2UKDA 5I7VA 4QU5A 4YJDA 4ED9A 4UTRA 2H8GA 4RHEA 4L07A 1EHIA 4ABYA 2XB2A 4LKRA 3OQHA 4K46A 2I7XA 1SEPA 2PSEA 1IUKA 4W5JA 4C4XA 3PJFA 4ER7A 2A9FA 3IO3A 4QUJA 2GCPA 2R47A 1WB9A 3BL5A 4YUWA 1JKXA 1YBAA 3ASZA 1CUXA 4YN3A 1T6ZA 1GXSB 5FWYB 3ZWKA 1T29A 1RMYA 4RETA 1ORDA 2GN1A 1F5SA 3WYBA 1EGQA 2PANA 2YNMC 2ZJ3A 4ZP1A 1N2GA 2FUEA 3ROMA 5FADA 3SSAA 1XC7A 1OV6A 4JP2A 4KQ6A 1MCZA 3ND8A 5IP5A 2G67A 2O7RA 4LECA 4GXQA 2W7TA 3I64A 2OGZA 4WNAA 4JJ4A 4BS9A 4RH0A 2BM8A 2PKXA 3VSEA 1KTVA 1YA4A 2P6OA 4R1OA 1KEKA 3THYA 2CUTA 3HBJA 3O0DA 2R7KA 2QG9A 1CUJA 2WWHA 4A73A 2HV8A 1PR6A 1EUCA 1V5FA 3QMMA 4QEDA 2XI4A 3DZKA 4BQIA 1XNQB 4WESB 3MMSA 4QJIA 5HE8A 1YS2X 1U2QA 1T6BY 1ARZA 5FUQA 3E48A 4FJ2A 4RM3A 2Y4NA 2YDXA 4TLCA 4YLEA 4RA6A 4LEIA 1QIJA 4HDNB 1WXWA 3DV0B 3NHYA 4FHGA 1YZQA 4FOSA 4AJNA 5ADHA 1OH8A 4TTSA 1J9GA 1GPDG 3P9YA 3H0KA 3UG7A 1A9XB 2H9AA 2W43A 2X2PA 5EGNA 1FFWA 4TTIA 2QD3A 1WVMA 3O8NA 4QUGA 4D1YA 3UCXA 2EGHA 1FMLA 1UZAA 2J1LA 3EWIA 2X9LA 4OBEA 3UT0A 3VJMA 4F97A 2V7EA 5TLSA 1V16B 1P19A 4QVGA 5AKEA 3R0QA 9ABPA 3IMEA 3ROKA 1U8CB 1Z5OA 2DYKA 2EIHA 3I12A 4M86A 1OZ0A 4NH4A 4MQFB 1GILA 4UAGA 1M66A 4H1VA 2RHMA 2ZUUA 2BFMA 3DPUA 3I76A 3OZXA 5BPHA 1Y0BA 1ZMBA 1M54A 2O07A 3HXMA 2VDJA 1P9WA 3C5CA 4KLRA 4XRRA 3S4YA 4DWWA 4KXUA 1JG3A 3DWGA 1RI3A 1QTNA 1MTOA 3DF9A 5GOTA 3KKMA 1HFEL 3W3AH 3BA1A 5BN1A 1LQUA 2TMGA 1CJUC 1I4TD 4EAAA 1N0IA 1GLGA 1JTFA 1FUEA 4BNXA 1L5ZA 3WMFA 4KWEA 3R23A 4IIHA 1XTZA 2WA1A 4Q37A 4I19A 4F3TA 4TYPA 1E9FA 4E2XA 5DYTA 1RPTA 4ER0A 3FX2A 4L7VA 5F7ZA 5SY6A 2X6RA 3FAZA 5M7EA 2RBGA 3JQAA 3FDZB 4XARA 1P1RA 2ZAGA 2HFKA 5ALXA 2ATVA 3N39C 4YT2A 2WVHA 2QL9A 3M6LA 2R6R1 3S2UA 2W6NA 1ORWA 2WWRA 2PKWA 4QYIB 3T1VA 3I9JA 4X44A 1F9EA 2PL1A 5ECGC 5E4YA 2YV5A 5KAMA 2WTAA 5LDDC 1CERA 3GFOA 4UXJA 4XZ3A 3HM9A 1PWEA 2GM9A 4QFDA 2PMEA 2YFHA 4UU8A 4L3OA 2WEKA 1VG8A 3ILXA 2IOFK 3KCQA 3QE4A 4ZRMA 1SUSA 2E4WA 2OSBA 2UXDB 3FNFA 2P65A 1RYEA 2JFQA 1UPBA 3OPQA 1ZNWA 4PF1A 3V4SA 3ORYA 3ZDDA 3CR7A 3KHUA 3UEOA 2GZAA 4GI2A 2IH4A 2R00C 4OM8A 2X3FA 4DLZA 3EZ9A 2IV2X 2GN0A 1L9KA 1JR3D 1UC4B 4PN3A 3TAHA 5LP6A 4GMFA 1RYNA 3HUFA 3JQFA 2RGUA 5JNRA 3I5UA 3QRWA 2HIHA 1SBCA 2K6GA 3A05A 3T0IA 4Y2UA 4IGKA 2PGLA 4YDHB 4CW7A 1ZK1A 1P4AA 1XAIA 4TV8B 3VSAA 1I6LA 4TS1A 1Q1GA 2HB6A 4R1SA 2C07A 2YZ7A 4M9XA 2CT8A 3KQWA 2X58A 4MITA 4EB0A 1VLMA 3D3KA 1YGYA 3U4QB 2FNAA 1PR4A 1KY2A 5JBIA 1OHHD 2XBUA 3N2YA 3HB0A 4K9MA 1L8OA 5E9AA 3S99A 4HATA 3U7IA 1B3BA 3BWYA 3ZGYA 3EVEA 1R10A 1J99A 2C7BA 4TXHA 3AEKA 3KXLA 2IIBA 4UM7A 1H9BA 3R4VA 2OSVA 1RXCA 1Z88A 2OD7A 3SHOA 3O8BA 3CW9A 3C3BA 1DX4A 1JR2A 3QLUA 3F96A 3TSAA 2XLBA 3AVYA 1ULUA 1SC4A 1T24A 2DQSA 2Y1GA 3A3KA 3ML1A 1IUPA 1CZLA 1G5QA 1P5FA 1XUOA 3W4IA 2QLBA 1NSYA 4BVAA 5ADUS 4HRYA 4M22A 9ATCA 4LXGA 4JZYA 3G0BA 1DDOA 1OWOA 1O97D 2WTBA 1RFLA 4IEEA 4W1SA 2Q41A 3QU9A 4U7HA 3UFBA 4QVIA 2Q2OA 1P45A 4EUFA 5LN1A 4UTOA 4OX9B 4B3RB 3P0EA 3BH7A 4KIFA 5I9SA 1C4XA 3DM5A 1J2RA 1Y8CA 2XR1A 1HMYA 3KOZA 3PNQA 3IS3A 2NU7B 4BNYA 2F1OA 1IXKA 3OIDA 1BO6A 3X43A 3NM4A 1VSUA 3V2GA 4PY2A 1JFTA 1UK8A 3P71T 1ZXXA 3NUQA 2J9FB 3IHLA 4KYVA 5CEJA 4KR2A 3VVBA 2Z9CA 1X0VA 2IELA 1WXXA 5AKJA 1NUSA 2TMKA 2G76A 2Q7XA 3EY4A 1DG3A 2CK3D 5K01A 5GAJA 5CNJA 3D7KA 1P1JA 2AE2A 3HB1A 3G6KA 3IBTA 5D7BA 1U9YA 1NJSA 1TQ6A 2B98A 4J0KA 1C9MA 3KL4A 4ME6A 4W9NC 1TZCA 3SZ3A 4AG6A 4C0JA 1VHWA 3KDSE 3LZ6A 1CV2A 4E5VA 3M4ZA 4YDQA 4MGZR 1RACA 3TRJA 3U7QA 4AJHA 4OSOA 1COZA 1R3UA 2ID9A 4MW1A 5AVVA 3NDJA 4ER6A 3THOA 4PS1A 1P9NA 4JU9A 3ZHCA 2P2SA 3QQ5A 3GJ0A 3ZQJA 1T5HX 2R66A 5J23A 2AOUA 3IP6A 1N5RA 4G23A 4BLSA 1JI0A 3D0OA 3IQDB 1ND5A 4LOLA 2W00A 4AKGA 5ARBA 3KE8A 1J07A 1Q2XA 1S2MA 1TF7A 2WPDA 3GMDA 3OAAA 4KDRA 1M1YE 3AJRA 5JCXA 1B0AA 2F1HA 5LNK6 3A25A 3SX2A 4HV4A 4KX3A 1E0SA 5EE1A 2X76A 1FXSA 4DR1B 1CZNA 1XN4A 1FNDA 1SHZA 1U8TA 3T7EA 4MR9A 2H06A 1JGTA 1AV7A 1ZISA 4AJEA 3AGPA 2WM8A 3TRHA 2GPBA 1QR2A 4M9QA 1WTAA 3PD1A 1VMKA 1J8DA 3FN4A 3OM0A 3IESA 1L5HA 4ZMBA 1RWXA 1U2EA 1FMJA 1XVUA 1UOPA 3INYA 2OLJA 3DFUA 1U0TA 4FR0A 1DV1A 1T9AA 4IGEA 4J0JA 3V8VA 4DPLA 3DBRA 5FH9A 3NIFB 1HE1C 2JFVA 1O5OA 1QGOA 3O8QA 3H0CA 3H42B 4Z9AA 1EP2B 5AKXA 3OHSX 3WNZA 3QE9Y 1ULTA 4Y2VA 4OV6B 4RXTA 1X19A 2CLOB 1XCGB 2AFIB 3KVVA 3UMVA 3EPRA 3OQMA 1GQFA 2ETVA 3KKQA 4N7BA 3VKWA 4QFBA 5DHRA 4JYBA 3ZGNA 1OXBB 2NVWA 2OV6A 4BEVA 2R1TB 1YZYA 1ZLYA 2G6BA 4ZCRA 1ECJA 2BUCA 3GG9A 3H4VA 3IP9A 4H6PA 1XMXA 2BISA 3GBVA 5ELLA 4NNPA 5ADVA 2ZAMA 4MX8A 2OD9A 4DZRA 3CSSA 1FTGA 1O6GA 4ROSA 4Q1VA 1ESEA 3N59A 4MV4A 3VA7A 3D6VA 3RAPR 1W2WB 5K4HA 3GUZA 1J56A 5C37A 3GT4A 3ZX5A 1C8LA 4MLDA 4DV3B 3HR8A 1N2HA 1PGNA 2OUIA 4MZXA 3WIDA 4EUHA 3WADA 3D4BA 4R68A 3KJXA 1Q0RA 3J7TA 4LXYA 1IM2A 3UK2A 4OMUA 4JCCA 2ZSHA 3NZEA 2IEBA 3LC2O 1H8EA 4XVRA 2C03A 4TMZA 2NQTA 2A1TS 5B30A 3Q8MA 1H9CA 3FF1A 2B4KA 1PR9A 3HB4X 5CXSA 1H0KA 4KE8A 3TD2A 1E6CA 2OYCA 3HYLA 2GUWA 5HZKA 4YMIA 1MW9X 3OP4A 3KUKA 5DN6A 4QD3A 4ZU6X 4EY8A 4DQVA 1YOBA 4LZPA 2WE7A 1DHTA 1IZYA 1UMCA 3TJMA 2BGKA 3GAMA 1U9ZA 3BE6A 1VGRA 2D1RA 2FEPA 2QLNA 5EWLA 4W5NA 4Q01A 1NA5A 4BMPB 2WSIA 1QKIA 3PWKA 4UNSA 1V4BA 2NSLA 3BM5A 4CV0A 1JHAA 5SV2A 4RZ2A 2IEIA 3TRIA 4ZJPA 4I4IA 1GTSA 3HY3A 3BRCA 1FFEA 3QVKA 3ZNOA 2CDRA 3A6JA 3SHVA 4X8HA 3E23A 4W8HA 4B7AA 3OVMA 4W5WA 2QN9A 2R1ZA 1H2ZA 1II9A 1NN1A 2H59A 5BN3A 1PE0A 3HACA 1Z62A 1V9LA 1C9YA 3A11A 1NHGA 4KMSA 3EQ7A 2VJPA 4WXPA 1CE8A 3ONEA 1QK3A 3NOQA 2G83A 2QI9C 1BOFA 2AUTA 3DO5A 4JJEA 2JIPA 4MV8A 4WPGA 4O4LA 3H1GA 3TLJA 3OT1B 2VQEB 4ARZB 4IMPA 1HKUA 1SO8A 1U8UA 1GJRA 4KVGA 3FCEA 1AHIA 5DGXA 1U3UA 3TX6A 1QK4A 1XDGA 1FQJA 3LLMA 2XWJI 4QXAA 2GI4A 1W8DA 4FGWA 1LF5A 4P33A 3WE7A 4G0NA 4G0WA 4BNLA 4JUDX 1ZESA 1LRLA 3K09A 3MJHA 3NPAA 3M89A 4H17A 5DLDA 4ZEXA 5L4NA 2B1RA 2V9ZA 4EECA 2ZULA 3ZDQA 4E88A 4F96A 5CDFE 3ZH9B 2I8LA 1EBUA 2IH5A 1T0JB 3L7YA 4YRLA 2ASEA 2WTNA 1KS9A 1V5WA 2Y0CA 2NVOA 2I1QA 3LPMA 3R5HA 4RDHA 4V2UA 4E09A 2RI6A 3ANYB 2YKGA 2FK8A 4GGOA 1QRTA 3PR3A 2WVJA 2F48A 4MS3B 4UVGA 3BMQB 4U2CA 5EGSA 2BGUA 5C5CA 1L6IA 2VHJA 3AUKA 5K9ZA 1IHOA 5AHRA 1MD9A 4CM4A 1GNVA 4QPNA 4MICA 4HGYA 4ROTA 3JYPA 2PDAA 2GBFA 5AI9A 3SC6A 2FVXA 4Q1CA 4BNVA 5K45A 3HV2A 4MUXA 1YFJA 1OWNA 2P6UA 4KXXA 1LBSA 2BHNA 2J8ZA 3T6KA 3CRZA 3TTUA 3VHQA 3KR0A 2Z30A 3OZWA 2CZQA 5JISA 4RV9A 5LA6A 2OHGA 4FDVA 4A6XA 4F1KA 2HF8A 4UULA 1AH2A 2HCFA 4QTZA 4Q3BA 2BHRA 2PM8A 4C7VA 1CS0B 3EFHA 2EHDA 4NATA 2A4MA 3E4CA 3EBPA 3GV0A 4ZOCA 1N7JA 5FUXA 4F3RA 1E1QD 1V8BA 2IC5A 4CEIB 1G41A 3IPLA 4GOKA 1NUQA 4KQXA 5H16A 5BYBA 4CMIA 1K92A 1JHQA 3ZE8A 1GEGA 1DCMA 3AW8A 5BR4A 4IXDA 4HFJA 3R8XA 1WW2A 1NBHA 2QTTA 3GJSA 4B85A 1U7OA 5AOBA 3ZKAA 4U1RA 1D0SA 5JAIA 3NLLA 2JDID 2YYYA 2Q8QA 4ENUA 2GASA 4UD2A 5I9BA 4B17A 3I2JA 5J2UB 2OM2A 1NWCA 1WPGA 4IQ8A 2P75A 4TM7A 4LJ9A 5HS4A 5CA1F 5DTEA 3K70B 4JI5B 1QP8A 1TZ2A 2B8NA 2BF7A 2FN9A 1U2RA 2QMZA 2WWIA 4G4SO 1M72A 1DTWA 3I9KA 2Q8PA 3FR7A 5EG5A 2Z2ZA 1M2WA 3BWCA 4B2YA 3SDSA 4N18A 1K89A 2G0NA 4WHMA 4R8VA 2WJVA 5IULC 1AUQA 3JQBC 1TTHA 2O8VA 4TMXA 2C2MA 4UPEA 5B1IA 5DM70 4FIZA 4GAEA 1GM5A 1OBCA 1UT8A 2PSJA 4FJ1A 1I5EA 3M0EA 3GEMA 3RG2A 3X1MA 2NPOA 3PFCA 1JXQA 4R2IA 3IKLA 3LUHA 3ETHA 4HYTA 2BJWA 3ZK8A 4C7MA 4RHFA 4EKNB 1XTPA 1L8LA 1Y34E 1Z08A 1RXYA 5BQXA 1RAIA 3EQ8A 2Q1UA 3PQEA 3QYJA 3EXHA 4COKA 2QG4A 3CPHA 4KUEA 2B20A 3SYTA 1DKRA 1GAWA 4Y30A 4I4TB 1NQUA 3ZGZA 4P2BA 1COWD 1WG8A 4X92A 1OASA 4YRJA 4N1AA 4ZVUA 1QJ4A 3CUYA 1QPZA 1H2XA 5ERGB 1FUKA 3HXKA 2Y92A 3W79A 4YYEA 4GQBA 4M3NA 3SXJA 2IZ1A 2ZWOA 3ZW9A 4D44A 1DO0A 4YCJA 1AZTA 2GBPA 1TT5B 1BGVA 2DHDA 2QI9F 4NDZA 1CNEA 4FNOA 3STTA 2SCUB 2V4ZA 1NVVQ 1JS1X 3L1HA 1QORA 2ZU6A 2Z5FA 3EFBA 3G85A 3TNJA 5GGYA 3A2KA 4BN4A 5KTPA 2Q5IA 4EFMA 3PCRB 2KBEA 1FMTA 4IL5A 1EJ6A 3DKVA 4EX7A 2XVAA 3EMKA 3GH3A 2OO3A 5HRUA 3C6MA 2CV2A 2FLWA 4ZU3A 3NTLA 4R9VA 3TECE 3EPKA 4EVQA 1YJBA 5E9QA 1NFRA 1ST3A 2YVAA 3L8ZA 4X8OA 5AW6A 1P0FA 1XRMA 1YQEA 2KX7A 2JD0A 2VA8A 5CJJA 5ULLA 5DK6A 3KBOA 3EGXB 4MGKR 3HFSA 3FPLA 3ESCA 3H9GA 4RSRA 3TJZA 4RAQA 4EGQA 1TAUA 1R9MA 1LSOA 2AJBA 2ZI9A 5IJ9B 3EG5A 4M9ZA 3TDNA 1NV9A 1RDFA 1PNRA 2A0KA 3G8BA 3NATA 1OBOA 4LTMA 4XRGA 4FB5A 5CH3A 1E1RD 3OEWA 1XRLA 4KZKA 4PX5A 4YRDA 4FUQA 3RYTC 5FOTA 5L4LA 2C4WA 2AIRA 2Q3JA 4BGVA 1U0NA 5LZ7A 5U1PA 1OZGA 2EX4A 2KWIA 2ZYHA 5IKOA 3JYNA 4KEAA 2QU7A 2R4TA 1PFGA 5GONF 4I55B 4C4OA 2EX0A 4R83A 3DA8A 1TEXA 2FP4B 2R6JA 4TSFA 1KKMA 5LQCA 1M1YA 3LUJA 4HX5A 4LXXA 4Q4JB 3GLIA 1MLDA 5G1PA 1Y5RA 3SC2A 3FNIA 1WQ3A 2OBLA 4CF3A 5IABA 2I4RA 4QU0A 3N75A 2QRQA 1PT6A 1LNQA 1PJRA 4IZHA 3AB7A 3CRNA 3EIFA 4GM0A 5FI1B 1SG6A 2HDOA 4M0DA 1P73A 1MENA 2PRZA 1S3FA 2PU7A 1I32A 4K40A 4WNCA 3I1JA 3ZTWA 3H5LA 4XASA 5HF6A 4D74A 1O0BA 2WT8A 1LJLA 3FDXA 1SKYE 4BGIA 1JDVA 4Q19A 1U0BB 2WSYB 4IWNA 1TIKA 1G5RA 2ZWIA 3NYRA 3W5VA 4F92B 2HRDA 1FNMA 4FFVA 1LBTA 1N92A 5CGZA 2PUHA 2BCGY 2WFMA 3OMXA 3DDSA 4XQEA 3SEQA 2WF8A 4K88A 2CDNA 5ITZA 1YRWA 2G4CA 3JARB 2DEUA 1Z18A 2WFZA 2PFSA 3H2SA 1HEUA 4PSVA 4EI7A 4PFJA 2C2OA 4I4NA 2OBYA 3RO7A 3FTCA 2TSYB 4EG1A 4QOHA 4YVFA 4YYZA 5KYKA 1VKNA 1L4BA 3WISA 2I29A 4EM6A 5KS2A 5AUQA 3V00A 5AW7A 1ADGA 1CZOA 4DKJA 4NKRA 1KK2A 1PWYE 3L3BA 4QXRA 4EMSA 5LJLA 1GPNA 1O58A 1SJ9A 1OCEA 2H4FA 5TGDA 2PTGA 3H8VA 1QG0A 1QZZA 3LW8A 4UCXA 3VZCA 4OSEA 4IDOA 4C0BA 3PGMA 4D9NA 4CF7A 1PBTA 4GL2A 3UXYA 3LL7A 3GHHA 2IP4A 2NUPB 3NHAA 2R5WA 1JEEA 4D25A 4YWHA 3IE0A 4N5HX 2IYAA 2WJZB 1LW7A 1IN4A 2BBSA 4LJKA 2ONKA 3T0FA 1NNSA 3EVDA 3PX2A 4GH5A 2VA9A 4ISBA 1O94D 5KHLB 1VG9B 1ZBDA 2DPLA 5KMGB 4WJZA 4AMUA 1J0AA 3MWYW 2WVAA 1ZKMA 4PYMA 3H1PA 4X3OA 4FP9A 4R41A 3GUCA 4J0EA 3WHKA 4S24A 1O54A 5SZKB 3L8EA 2HA6A 3W6UA 4I5DA 4R98A 5G0WA 3VDRA 3W5IA 2WT9A 1RT9A 5LP6C 4QGSA 4YNBA 3JQFC 4LOJA 1NQXA 4Y9RA 4PXSA 2IA5A 1QUFA 2EDCA 3CMMA 3ZJVA 5IYZB 1MC4A 2OC4A 4J4HA 3C4JA 5CK4A 1PL0A 3RTAA 4JUAA 4X93A 1ZD2P 2QR5A 5EEHA 2CL5A 5IAEA 3V1MA 3GP8A 4NSNA 2C2ZA 1OLXA 1WPQA 3FMVA 4K1LA 4CIBA 3RAEC 4MR8B 1DOHA 5A9TA 4Z4FA 2XY4A 3A2NA 4JZKA 4X1YA 1TYEB 1P91A 4FYYA 1DV2A 2JEOA 4GX5A 4HYQA 3I9V1 3F6BX 1Y3BE 2GEDA 2GO1A 1DMSA 1F2UA 4KIJA 1DG1G 1QCDA 2ZUVA 4GYKA 3R3WA 1Z6XA 2WNIA 1EE1A 2WWFA 2ZUCA 1WMFA 4HXGA 4EENA 4U3JA 5BW5A 4R2JA 1M5UA 2GEUA 4H7JA 2O19A 2MHCA 4FI3C 4UE3S 3BBPA 5TT0A 1GG2A 2GYYA 1U04A 1C1YA 3QY9A 2QDXA 2NACA 2OFWA 2DPHA 1HYEA 3MWEA 1RM4A 5TRTA 3PLAE 1JWAB 2HSJA 2WWWA 4MB0A 3IRUA 4J1TC 1G16A 2PZLA 4GRIA 3IR7A 4ZQBA 5IUNC 3FOWA 3G2HA 2O50A 2BEUB 4GPTA 4IDNA 4KIWA 2VHQA 2QYOA 4ZI2A 3HXPA 4JVLA 4CQMD 2PXXA 3ITKA 4RCVA 4CKCB 3R0XA 4Z0PA 2CNBA 5HZHA 2DQYA 2GS9A 3KYDA 4FE3A 2HQ1A 3VZQA 3ZY6A 1YB1A 5K6AA 1NLZA 2CHEA 4LQ4A 4M55A 3QMWA 1BE6A 1ESDA 4C7OB 1RWMA 1U0HC 1ST2A 2DVMA 2HRBA 2V7WA 2W2XA 2NYUA 4IHAA 5AI4A 4DBLC 2NSYA 3OM9A 1NW7A 2I9KA 1EX6A 1A69A 2O3UA 1Y6FA 2KMLA 3MPUA 3OOSA 2DKOA 3A6KA 3B7PA 3VYRB 3EGDB 3NH6A 5AHXA 2C4UA 2GJKA 3E18A 2C31A 5FBWB 3RK1A 1OA1A 2XVMA 3NEAA 1JPVA 1HV8A 1KOLA 3WDSA 2NPIA 3F98A 4ND4A 5JBQA 1HOTA 2XRMA 4IBOA 1KWGA 1QTIA 1YS6A 2D7CA 5CAEA 3DYIA 3THWA 2O2SA 3HCNA 2ISSD 4B2LA 5L8VA 3GLSA 3IRVA 2TMDA 3GLGB 1R6UA 3MWKA 4RORA 5H70A 4BFCA 3M5WA 4RPLA 4Z0TA 1E2BA 1RSZA 1ZYUA 3AFHA 4H1HA 4KLCA 5FFFA 3VR2D 1OGIA 5IM4F 1WP9A 3WNBA 4FDTA 4UNPA 3GCXA 3ZGLA 3MQ4A 5KVSA 4TWAA 2X13A 1U0GA 1ECFA 1XG5A 2Q2VA 4P3OA 2ACEA 3RS8A 5LUBA 5I8ZA 5AUPB 2RAVA 4HADA 3IKTA 1X8KA 3P9IA 2EKPA 2DFNA 4PHTA 3LLSA 4RVCA 3ZC3A 4A0RA 5MFZA 2PAAA 1YQGA 4HZGA 2B8WA 3TTXA 1D2NA 2ZBDA 3ZIUA 3T9DA 1B0ZA 1JI3A 1BZYA 4KO1S 3QM1A 1ACJA 4BZZA 3UTDA 4WACA 5COQA 2FGKA 4NHEA 1UL1X 4YQYA 1AZSC 1R0CA 4AYWA 1P2SA 2GR9A 3OZBA 1ULBA 3ZCVA 1QGAA 4MYRA 4KGVA 1RTTA 3DJFA 3AT1A 3LT1A 4N0EA 1JALA 5E7JA 2FWJA 4CEJB 5JSQA 3HZRA 3MF4A 3LHDA 2R84A 2P0AA 2WAMA 2O8CA 2QORA 4OHMA 4N3BA 3I73A 3II6X 5LP6F 1SCBA 1QFZA 2WDZA 5KOJB 4P98A 1AVTA 4BMDA 4PXAA 2I6UA 2WP8J 4X91A 1Q7TA 2AXPA 2Y1CA 3PC7A 1L5MA 2A78A 1P74A 4I8DA 1Q14A 2D06A 4D8YA 2JIOA 1OYOA 1FC0A 1BQEA 1KK0A 1G8JA 3GUYA 3HNRA 2C78A 3BREA 5CX1A 3TLGA 4BQRA 2BGWA 2O8NA 2B1JA 3SSOA 1KH1A 5JECA 3LHSA 3REOA 3MTAA 1VL0A 5IC4A 2GF2A 1CY1A 2IYEA 2J3EA 3BKXA 4U2BA 4WL0A 4PG8A 3ADBA 4JXZA 4AM8A 1Z6ZA 4KSCA 2H17A 4GMHA 1PJ2A 3OZFA 2AA3A 1SA0A 1UT5A 2YXDA 5CDHA 4HDMB 1V2GA 4BO4A 3ZI4A 1QB8A 4HGPA 4D8VA 4E6PA 5UKDA 3SIXA 5BOSA 3WWDA 1D4AA 4OKIA 4XJTA 3FJOA 3TR0A 1FFSA 1XEWX 3IT0A 2DFPA 4FI3F 3H9JA 1XZCA 3PE