4LS3A

The crystal structure of helicobacter pylori ceue(hp1561)/ni-his compl
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
302
structure length
302
Chain Sequence
QEVKVKDYFGEQTIKLPVSKIIYLGSFAEVPAMFHTWDRVVGISDYAFKSDIVKATLKDPERIKPMSSDHVAALNVELLKKLSPDLVVTFVGNPKAVEHAKKFGISFLSFQEKTIAEVMEDIDTQAKALEVDASKKLAKMQETLDFIAERLKGVKKKKGVELFHKANKISGHQALDSDILEKGGIDNFGLKYVKFGRADISVEKIVKENPEIIFIWWISPLSPEDVLNNPKFATIKAIKNKQVYKLPTMDIGGPRAPLISLFIALKAHPEAFKGVDINAIVKDYYKVVFDLNDAEVEPFLWK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Helicobacter pylori periplasmic receptor CeuE (HP1561) modulates its nickel affinity via organic metallophores.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Transport protein
molecule keywords Nickel (III) ABC transporter, periplasmic iron-bindin gprote
total genus 105
structure length 302
sequence length 302
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01497 Peripla_BP_2 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 4ls3A01
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 4ls3A02
2XH8A 4WZAB 5HDQA 4WZBA 1G20B 5I4KA 1M1NB 3MD9A 4UTOA 4HMOA 1MIOA 4HMQA 3HH8A 4GICA 4TKVA 2OGWA 5AFSA 4XPIA 4CL2A 4MO9A 2O1EA 4NNOA 4NNPA 4WN9A 4PAGA 3U7QA 3AETA 3AEUA 4HMPA 4MLZA 3MFQA 4OXQA 4LS3A 1G20A 1H1LB 4FNAA 4IRMA 4UTPA 1L5HB 1QH8B 2AFIB 2XQVA 4K3VA 4FI3F 5B58T 3UJPA 5CX1B 5M3BA 3LHSA 2QI9F 4XPIB 1N2CB 1TOAA 4G09A 3TEFA 2PS9A 2Q8PA 2M6LA 1M1YA 4INPA 3CX3A 3ZK9A 5M29A 1H1LA 3ZTTA 4BBPA 5KOJA 1EFDN 3AESA 3PSAA 3R5TA 4UDOA 4WESB 1L5HA 3G9QA 2YNMD 3AEKB 4HN9A 1PSZA 4ND8A 5BVGB 1QH1A 1N4AA 4DBLE 3MINA 1ESZA 2Q8QA 3AEQA 2YNMC 3MWFA 5M2QA 3NU1A 5BVHB 1KAHA 5JPDA 4TKUA 2AFHA 1K7SN 3HXPA 5JJ5A 4MX8A 4WNAB 5JOQA 1K2VN 4OVKA 2X4LA 2ETVA 4UDNA 1KARA 2XDQB 2OSVA 1M1YB 4B8YA 5CR9A 1M1NA 3TLKA 4MDYA 4WN9B 4LJSA 4WZAA 1XVLA 4FILA 5FLYA 2XUZA 2PHZA 1G21A 2WHYA 3LI2A 3GI1A 4N01A 4M7OA 1QH1B 2PS0A 2PS3A 5KOHB 3PDIA 2R7AA 4TKVB 5BVHA 5GGXA 1N4DA 3AERB 3EIWA 2WI8A 2RG7A 3ZKAA 4WNAA 4G07A 2PRSA 3AESB 4WESA 4H0FA 1N2ZA 2MINA 1K75A 1QGUA 3ZK7A 5M34A 3U7QB 1M34B 1N2CA 1K0FA 2OV3A 3EIXA 1FP4A 3R5SA 2AFHB 4WZBB 3BE5A 5KOHA 2XY4A 1PQ4A 3MWGA 2XV1A 4FKMA 4ND8B 5BVGA 1KAEA 5CX1A 2MINB 3BE6A 3AERA 3K1AB 5HX7A 3MINB 2XDQA 3PSHA 5JG7A 3AEQB 1FP4B 3AETB 3AEUB 4TKUB 2R79A 5KOJB 3HJTA 1MIOB 3TNYA 4PM4A 3AEKA 1G21B 3ZK8A 2OV1A 1QGUB 1QH8A 2AFIA 4INOA 5KHLB 3PDIB 1M34A 4OXRA 5GGYA 2M6KA 3K1AA 4H59A
chains in the Genus database with same CATH superfamily
4OI2A 4CV1A 1W93A 1M0TA 2WHPB 3DEIA 3WMXA 1AGRA 1SU7A 3MIIA 3R41A 4ZT2A 4CMHA 2JLCA 3AW8A 1E9AA 1IZ7A 4PYLA 1BHSA 3KALA 4BB0A 4FMCB 4BNHA 1W4RA 4RACA 3T0FA 3ZWQA 2JIZA 5DHQA 3AJRA 3PYMA 3QVSA 1TZBA 4V0RA 3IMEA 3C8DA 4ZODA 3H8WA 1OU0A 3LWZA 4DIDA 4OXQA 3PV0A 2HF2A 1NJGA 3DC7A 4J16A 1E0KA 2C04A 3IT2A 4LK2A 4QFCA 4UEJA 3VOTA 2OO5A 3A31A 4FXOA 4NE2A 4K3VA 5EIBC 2IF2A 2CD9A 2VZ0A 2GAFA 3DH0A 3AI7A 1RYNA 3QV1A 4IDDA 4QODA 3AIOA 2I33A 1ANKA 1DIBA 4J43A 3TXXA 1AKVA 1KEVA 1VCHA 2PYZA 1OR8A 3RABA 1V7CA 2Z56A 2Y67A 3K0SA 2IYTA 2DMRA 4ARIA 4OH1A 1BVHA 1EWRA 3GDHA 3A1UA 4G5RA 4WCFC 4BYGA 3OX2A 3FRJA 1X80A 2P6NA 4Q3CA 3TAXA 1EA5A 2CMFA 2FOIA 4OB7A 3G17A 3K8ZA 3NHUA 1GPJA 3I9KA 3TRHA 1PK9A 2FK8A 3PZBA 4DBLE 3ADOA 3S99A 3IE1A 3INNA 4C2UA 1JXQA 1TQ2A 4EAAA 3ADCA 3F7TA 3D8BA 3P2YA 1Y8QB 3TXAA 1GAXA 5CHYA 1E3SA 5BPHA 4QXQA 4H6PA 3T99A 5A03A 3OQVA 1OJLA 5CFLA 5KNCD 2IYEA 2WLSA 3FPCA 3LFTA 3M5CA 1FXSA 2QMYA 1EUDA 3DLCA 4WUVA 1NC1A 3FDXA 1C7JA 1N2OA 3D7RA 1V6CA 3ECSA 2VK4A 3LCMA 4QUHA 1QE0A 1RZ3A 2CMHA 4HB4A 2J6CA 3L7CA 1U3CA 3DVQX 1N2CE 3DLPX 3DOOA 3IB3A 4PW0A 3R75A 1FB5A 4CN8A 2AFRA 1DOZA 1TL7C 5FLYA 4TWAA 2E0IA 3HMQA 3SSAA 2RCNA 3A36A 2ZRAA 1SU6A 4N7BA 2YN0A 3UM9A 7AT1A 5AI0A 3A70A 1AGYA 1DJPA 3WB2A 3CEJA 4YJ2A 3ITDA 4FOPA 4JBIA 4EKYA 2ZAMA 1RWKA 1LDNA 4MLCA 1NRXA 2Y27A 5JS7A 3KTFA 2FPPB 1JSCA 5JRZA 1T2AA 3ILSA 4XB1A 4RHCA 4Z0NA 3CUTA 3IT3A 1QO9A 1Y6FA 4M1YA 1ESCA 3NW9A 2YWRA 4X90A 3V4RA 4LXIA 1PD1A 3FCCA 2OXFA 2QOEA 2QR2A 3FHCB 3TSZA 4YUYA 1OOEA 2HK9A 3B9RA 4EG7A 1TD1A 5A4IS 1E5XA 3BULA 4BL5A 4P4SB 4PAMA 4MGYR 2HCTA 5ELMA 1RHQA 4QTZA 1PS8A 2HK8A 1ARZA 4YPOA 4ZZ3A 3SU8A 1XZNA 5JJKA 3ZLTA 3IQGX 2R7LA 4MYRA 4N3NA 2WY2D 1ZLXA 4RBNA 3NIFB 3TLCA 4U0KA 1J0CA 3RC1A 2RJNA 2QTMA 1ORIA 2IZ7A 2NVOA 2V7PA 2HLDA 3IOMA 4B73A 3A3YA 4EJ2A 5E7IA 4QM6A 4YRPA 1E6EA 4V0ME 4FFRA 4CG1A 1M9NA 2B8WA 3EXIB 1WMEA 4L8FA 1N1EA 3FFAA 4RZSA 2IHJA 4XVRA 4BU1A 3KQMA 2LWIA 4LVNA 4BTLA 3G1UA 5SY6A 4YCCA 3ZCRA 1M2GA 1AQUA 2RHHA 1SVOA 1NYLA 3I5MA 5DBIA 2BMVA 1QRAA 2IXGA 3GFVA 4DSOA 3TRIA 1ZCBA 3HJFA 1G63A 3WIOA 1JHVA 2I8AA 1RKBA 2C2WA 2GRAA 1FZQA 2BPOA 2Z8ZA 3B38A 2FZGA 3B6KA 4KXVA 3VKGA 3DLBA 4JA2A 4NYMR 1RFGE 2HMTA 5IW8A 3P94A 3ZE9A 5A9SB 2FZ5A 3NHZA 3M2PA 5ALPA 3BH7A 2PMEA 3TJMA 3PPVA 1E5LA 4FC7A 1PT5A 1XB2A 4PIPA 3TW6A 3HN7A 3ZEIA 2KE5A 3IAFA 4NFYA 1JEQB 3T3EA 4CLEA 3AM1A 2ZIEA 3M81A 4OHFA 1U6JA 2FSGA 3D2CA 4M36A 7ABPA 4ZAYA 5C80A 3PRYA 1QH8B 2FPLA 4TLLB 3T7RA 1Q6ZA 2IY8A 4EW2A 1C0EA 2O1SA 3NWEA 4MWBA 4BP1A 4CRWB 4IXDA 1Q17A 3G8DA 5KX5F 3QYFA 1AIPA 4BLVA 3KYJB 1IY9A 2Z9CA 1EHYA 4RWEA 4BN4A 3KXDA 2OD2A 3BTSA 3KKNA 4BO8A 1W48A 5KU7A 1M0SA 2J4DA 1HE8B 1I2CA 1Y8CA 2WC1A 2UXDB 1WPRA 4KXNA 1URPA 4X8OA 4C05A 4GMXA 3PFHA 4UDOA 2E4VA 4RS4A 2JFYA 3MMXA 2IWHA 2XUOA 5HJEA 7REQA 4ZCLA 2UVPB 3AEQA 3EH2A 3KDSE 4FCCA 3E5NA 3NLLA 3Q1KA 4UM9D 4XDGA 2I80A 2RAUA 4YH1A 4PYMA 4YT5A 1GU7A 4M86A 3LIPA 5DMXA 2ZE8A 2V65A 3GELA 3CZRA 2MIIA 4L50A 4BC0A 4CL0A 3IR6A 4YJGB 1TQHA 1Z2PX 1P75A 3EFEA 2ZKIA 2OHXA 1SULA 4EYSA 5C4MA 3IKVA 1KYIA 3DPIA 1AHIA 1U3VA 5C34B 3PJFA 3LQFA 4NICA 4QIHA 4G2NA 5WRFA 4Y9DA 3IUPA 1DKRA 3FUWA 2YJ6A 2ZT6A 3CZPA 2AOTB 3GWZA 5DSXA 2GUGA 3HFJA 3PS9A 3RHZA 3VU3A 1B1AA 1RYEA 1CY8A 2VKTA 4WGFA 1BWRA 2RG1A 5AKYA 5B1YA 2RK3A 3C8HA 3S2UA 4DA9A 1LS1A 3I9JA 2HC9A 1JX6A 5AVKA 1SR8A 2DHQA 4KUHA 3F5MA 4W9RA 2O52A 4HT3B 1GUFA 5BV8A 1F2VA 4C76A 2J31A 2FI1A 1IB0A 1F8XA 3WKBA 2HJWA 2ZDHA 2XXAA 3LL7A 1QPZA 4EEZA 2PZBA 1JPNA 1KY5A 2HA5A 4R05A 4U3JA 2DAPA 4Y2QA 3RT9A 4F7WA 3A1DA 1LPNA 1JJBA 2BFOA 1LWOA 3BZBA 2VUSA 4IIJA 4MKFA 1W88A 2XVZA 1KQGA 4JJEA 1Q5PA 2X1HA 3DZHA 1VPLA 3QNUA 2HX1A 5F77A 3HDQA 4GGMX 4ARUA 1H2YA 4UXHA 3FDZA 3AUTA 2KHZA 4U9HS 1V4BA 3JD4A 4EHDA 1XQXA 4WBNB 2BWJA 5BVGA 1X6VA 2DGDA 3GRKA 2QB5A 4QLOA 2Z04A 4D4GA 4EYQA 5J3JA 4YQEA 1NQOA 1XJCA 4QGHA 4MW9A 4D0LB 3RVJA 1D0VA 1FXWF 1VBNA 5AUOB 1PV4A 2A88A 2TMGA 1NVVR 2OPHA 1B8OA 2F4NA 2W00A 4IHJF 4B0OA 1C5KA 1IZ8A 1M1UA 1OX4B 3V3TA 1I3NA 2W48A 2NSJA 2W2KA 4RD2A 3K8YA 1QRSA 1E58A 1CUVA 2FLKA 3BJRA 1H9BA 2WICA 4HDAA 1U8EA 4DDHA 5AW1A 4A6EA 1VSBA 1J7JA 2C20A 2VH5R 2PD4A 1NOIA 2FPKA 4F2DA 2ZEJA 3KQSA 2D0IA 3KQVA 4KFTA 1GQFA 2CSUA 2G6TA 3LU1A 3PHHA 3O2NA 4U2CA 4B79A 2XKKA 1AB6A 2NO5A 2R66A 4R40A 4ZZIA 1BNCA 3G0CA 3PWTA 3UAYA 2WWRA 1W59A 5JBIA 4R31A 3K70C 1FDIA 2K2WA 2ZJ7A 1Z18A 2G36A 3V97A 4C7OA 3OJLA 4RAQA 3T4EA 2F8SA 2W2LA 3QG5A 4IKPA 1F1BA 2A0UA 4EGQA 1E2BA 3C3JA 4P35A 4D9JA 3KJFA 2CYBA 1CY1A 3WV5A 3RYTC 3WYFA 1GPBA 2TECE 2WYHA 2PKYX 1C0PA 1CF4A 1DEAA 3ZLUA 1RKUA 3IP1A 1TFUA 2YYAA 4X65B 3UMSA 1JU4A 3LUKA 2WYIA 1WRBA 2AR9A 3LUJA 1PL0A 4MYSA 1O03A 1G9TA 1ISFA 5BV0A 5F4BA 1Z8DA 1E8DA 1OH6A 3T0GA 5LQDA 1PTKA 3L4BC 4IFTA 4EF6A 1RWMA 4GXRA 3VNVA 5E3HA 4CV0A 1TQ8A 1C41A 3ENVA 5ADUS 3N1UA 2MMCA 4NOKA 4G5QA 3X0DA 1EX7A 3MWFA 4RHXA 4MVJE 1FXWA 1RRKA 2I5PO 4CZ2A 5K7SA 2IHZA 1X1RA 4HAWA 5KUTA 5LP6B 5B7QA 1SKUA 2B1GA 2YBEA 2XEDA 5BSTA 4G5YA 1J49A 4WCDA 4F71A 3S8MA 1F6WA 1QFZA 3RI3A 1WKCA 4AQYB 1IDN1 5F9FA 5GJCA 1W96A 2P6MA 5CA0F 4PQRA 3U4AA 2ZBVA 1CUAA 3CVVA 3DE2X 1MF7A 1LC3A 4P4NA 4PZ0A 2EX1A 1C7ZA 4X84A 1PJBA 3RWBA 1RLUA 3WL5A 3O8DA 4GBJA 4LMBA 4IJVA 1V39A 4XQCA 4YRSA 2PT6A 4AQDA 4LZWA 3WRVA 3G02A 5JSZA 1VHLA 1H3EA 2XVXA 4OQYA 1N36B 3PJEA 1RHUA 1S3FA 5AW3A 1P4AA 5LB2A 4B3BA 1R9NA 2FMXA 4XDHA 5HNKA 3CEAA 3K70B 3G8AA 4HTFB 4EHHA 2QBYA 3PC2A 1OWOA 3FVQA 2HREA 3AZQA 2EX4A 1UFQA 3KO8A 4LYYA 2HIMA 1HUQA 2IZ5A 3Q1LA 2ZVQX 2B21A 4PZAA 4EHKA 3QU4A 3B3QA 1PNOA 4YV0A 4PHCA 5BR7A 1PDOA 1XZHA 1H2HA 2RGWA 1C7QA 2L19A 3AF1A 4UTVA 3TUZC 3JYPA 4PLYA 3QA9A 1CFJA 4RESA 3TZKA 5HKAA 5EESA 4OK6A 4E0BA 2GSDA 1X9GA 3QXXA 3AYZB 3AOEA 4YMGA 3ZCUA 1FFDA 2HO5A 1C3OA 1HTBA 3C4QA 3DT6A 1P1HA 2WUEA 3IJRA 3N59A 4JOCA 3EZGA 4KKXB 4PONA 5DM2A 3WB1A 1DIGA 2AC4A 4U2DA 4C0BA 1GKKA 1RHMA 1PO7A 5ELLA 4Z1MA 4UM5A 5JZOA 1EWKA 3K6SB 4LVCA 1EE2A 3ML1A 5EIEA 1IY1A 4D0NA 3IR7A 3OP1A 3DD5A 2RBKA 5ARCA 2LUOA 5HIIA 1Z8NA 2EJVA 1PJ2A 5KVSA 3GR6A 4MPDA 3LNTA 5CJ2A 1A2QA 5CBPA 3WGQA 4TMFA 1OZAA 2H1IA 1C0LA 4M9ZA 2Q27A 2GPYA 1C9EA 2J32A 5FKJA 1HT0A 1FLAA 2KM1A 1E9DA 3GHYA 3ADDA 1QNFA 1F9EA 2IOFK 5CH3A 4UNNA 3FD8A 4OQMA 1KFBB 1SVIA 3D5QA 2H92A 4NV3A 5E6SA 2XNCA 1E62A 3LVQE 1KMHA 3H2BA 2B4YA 3EULA 1H1DA 1MUUA 1OLXA 2XOEA 4RD6A 4F11A 5KQPA 1IDOA 4FMDF 3RT1A 5LQUA 3SWWA 2H65A 4HWKA 4RGBA 4TMVA 5FBWB 2HQRA 2BEKA 3BM5A 3SR4A 3NB0A 4DYHA 4IOKA 2B8EA 4BLOA 2V9ZA 3FSJX 2QNBA 4RD3A 3OA0A 2GD6A 4Z2AA 1I3LA 1V1JA 3AB8A 3MJVA 1JXOA 3R74A 2KBFA 1YA4A 2X5NA 3HZRA 3I4CA 2A3NA 2VUUA 3MHPA 5H16A 3KC2A 4Q9KA 3ZTTA 4BBZA 4MUYA 4G8DA 1G21E 2WE7A 4PFJA 4G0UA 3G9QA 3SBEA 1QMGA 1HKUA 1SB9A 1L4YA 2ZSAA 5DWVA 2J7PD 3GD7A 1PLLA 4EMUA 2VVTA 4R2KA 1VXOA 1EIWA 4FYWA 2GD0A 3M1IA 3QPDA 4BLWA 2WFAA 4ZVTA 2BAGA 1G17A 2CVZA 3AVWA 3R3SA 1UXOA 3V34A 2HT1A 1VPTA 4A15A 2Z2JA 4RYDA 1Z37A 3GN2A 3H42B 4PU0A 1A4RA 1M1YB 3L0DA 1LWNA 1DWPA 3B9QA 3ONWA 3TD2A 4WZAA 1EK6A 3GBVA 1M7HA 1I7NA 1R6UA 1RBQA 1NIPA 4ZOLA 3GCDA 2G9NA 1SOWA 4MDFA 3QRWA 1CT9A 1IOLA 2V6JA 2X5KO 4JSRA 4KLNA 4WOPA 2OCDA 4ZQBA 1PHPA 4W5JA 4YWJA 5CK4A 1HO3A 3RHFA 1QZ3A 1II0A 5JXIA 3CG4A 3EZ9A 4N54A 3Q0TA 3VO8A 1PAUA 2XQIA 3QWHA 2QNRA 1NQTA 3R0JA 5TVGA 1QH9A 3RPEA 5E7JA 5DNCA 2D6FA 4F3RA 4JJKA 4WNYA 4OXNA 4ZOLB 3S1AA 3MCUA 2EG9A 2Y1WA 2C78A 1OB5A 2DRIA 2H08A 1O89A 1IQUA 1R0KA 2XMGA 1AXRA 5JDCC 3UCEA 4KFRA 5K01A 3LTNC 1CTQA 2BW0A 3LSTA 3VU9B 4BATA 2X0DA 2C59A 3LQKA 3KV1A 1V47A 3IP8A 5FOQA 3FWPA 2DFPA 3AHCA 1MDFA 3L9WA 4QTTB 1VCOA 2V7TA 3WKCA 1VP9A 3WLKX 4EG4A 3SE0A 1KVQA 1KZ9A 4IIEA 4QL3A 4URHA 2IH5A 2BFWA 1YL6A 5HK9A 3JV7A 2Z6QA 2Z2XA 4BCDA 2I7DA 3F96A 4I8IA 3TQRA 5AKJA 2HRZA 2F00A 1REQB 1I80A 2IU3A 1U2QA 2WNIA 3GLGA 4H7JA 5FOUA 3AETB 5JCJD 2ZM6B 5C4IA 5G0VA 1YU6A 4WKGA 1FSPA 3EWIA 3CBQA 3D2BA 5DK4A 5AW8A 3C97A 1QH8A 1KPGA 3F5DA 4XARA 4O5AA 3H86A 1FS6A 2C98A 1KK0A 4LYHA 1VGVA 3VTAA 4CMIB 4HWPA 1J2RA 4JNKA 5HYVA 3I4FA 1V8OA 4UCQA 2WINI 2NTVA 1HGXA 2R2GA 4ITUA 1BTOA 2G4VA 2G83A 3IEUA 3QFCA 1QHSA 2C1XA 2Y1LA 5FNVB 1DTEA 4UE2A 3E70C 4QXMA 3V7NA 1FPQA 2V0CA 3ZHSA 2FY8A 3AR4A 3GLRA 4YPFA 2ZJZA 4M9QA 4BB9A 5DHAA 5IABA 1PD0A 3E18A 3RSQA 1TZ2A 4D9NA 1NY5A 3WQRA 4E88A 3P5SA 2D8AA 4K03A 3IPLA 1ZSVA 4MLZA 3VPFA 4TZ6A 2X0IA 1KEUA 3LT1A 3BQMB 4D9IA 4K0KB 1T9DA 3N8HA 3TRKA 1V8ZA 4QPZA 4NXNB 1OXVA 5LOVF 2WTMA 4NOLA 2W8BA 2C42A 4MAMA 3S2YA 3RWOA 2O3UA 1P9NA 3LHSA 3DOJA 3IAAA 4HGPA 4N0PA 5BT9A 3VHXB 2HZBA 4LBYA 5KTKA 1ZN7A 2B2NA 1HNWB 3DA8A 1GZVA 1I32A 3R0QA 5I3ZA 1S2DA 4JC8A 2QS9A 5HM8A 2Z2IA 1TX4B 1FVXA 1AHPA 2ECFA 1Z3CA 4OHYA 3K32A 1VIDA 4DCJA 4YAUA 3IQZA 1Y4ZA 1RXYA 5TQ2A 1QF7A 1SOAA 4M9SA 4ENTA 1DLJA 3Q3CA 2L42A 5JH7B 2WYOA 3WR5A 1FJXA 3E0QA 3MCAA 4RA6B 4Z0PA 3V2GA 4B2IA 3DEZA 3OO0A 5E8JA 1MOQA 2E3JA 4H4CA 4TWRA 3BJEA 3E05A 2OYRA 4OMFG 3P19A 2J3JA 4TLMB 5C81A 2GPBA 2O6LA 3UWDA 2I1VB 4Q7KA 4E2FA 1CUJA 3PLAE 1NT4A 1UMDB 3A37A 2ISQA 5FTLA 2FPGA 3THOA 4E4TA 2XUZA 4F3KA 5K0CA 1E0AA 1EGQA 1JFFA 1N1MA 2WWGA 3QFHA 3UJHA 2PYDA 2PD3A 2CY0A 1NATA 1NOJA 5KOHB 1FYVA 2Q0HA 3PDIA 4DBLC 1RPNA 2KLHA 1FYWA 1QSGA 4RTSA 2ZM5A 4X1KA 2JF0A 2G63A 3VDMA 3TGLA 2ZRKA 3PTAA 1N33B 2J5RA 3H18A 2H1SA 4ZRDA 4A82A 1KC1A 1OT5A 1XHEA 4P0PB 2VZLA 3FNHA 3OE1A 2WVGA 5H9VA 4IHQA 3MHTA 1A04A 1EUCB 2X6TA 3GJYA 5TEWA 4H0CA 4QUEA 1J07A 3MWEB 2XUIA 2AZTA 5I9IA 4OTZA 1FP4A 1G7TA 3G23A 5FWAA 3RVRA 5K09A 3X1YA 1J8VA 1Z3IX 2C3MA 4FS3A 2R4QA 3TX6A 3WZ2A 2DPMA 3EEYA 4RTLA 1TJPB 2CDNA 1G20E 2W2TA 3GP3A 4A8JA 2K2QB 3O1LA 3KE8A 4KXMA 1UOOA 2O0MA 2GZ3A 4YHHB 2O2EA 5EFOA 4I50B 3V33A 4B33A 5K2OA 1GN8A 2IXFA 1FP4B 2O0HA 2VUTA 4O02B 3JYLA 4UASA 1HY3A 1ZL2A 3R3WA 1I4EB 4KSCA 4PHTA 1QHYA 1E77A 2YV2A 1CEXA 2BISA 4A8JB 1TYEB 1PT7A 4MW4A 1MA0A 1ZAKA 2FP4A 4M98A 5F33A 1FC0A 4PX5A 3O8QA 3ZCXA 3N86A 2Y1GA 1R4ZA 2CXQA 2ODBA 3EEOA 4U6SA 2NZVG 4QQFA 1SURA 3IVXA 3IDZA 2XUFA 4DCTA 1RRCA 4OY3A 4W6ZA 4LK3A 3E9YA 3SSNA 3UV6A 4LF7B 2OXEA 3G9XA 3TI9A 1DS6A 1NDUA 4F9GA 3U48A 2NYAA 2R1TA 1FOEB 3QF7A 1YRQA 3LK7A 3QNMA 4KWCA 5EUMA 1RYMA 4E51A 4HQFA 3A6JA 1MZPA 1TFRA 3GVPA 2NZJA 1JJFA 5LU9A 5B1HA 3J80A 1NXOA 1W0KA 2HUNA 1BMTA 2ZULA 3C3PA 3S3TA 5JECA 5JVDF 4Y2XA 1NBIA 2P1RA 3TLMA 1N9GB 1THTA 3AFIA 3R5FA 4H4DA 4KOAA 3SQMA 1PFGA 2W2MA 1RI3A 5M29A 1V8DA 3OLZA 5AVZA 1AQJA 5IAGA 5FPPA 3PSAA 4KAAA 2XQKA 3ETCA 1F8UA 4R84A 5K8LA 3WG9A 4ESVA 4RABA 3DEHA 1OXMA 4U7JA 1BXZA 1A9RA 2Q8QA 2J9RA 1P0PA 2V0NA 3MWYW 4DV6B 2ZUWA 4Q9AA 4KLCA 5HBRA 4YDHB 4NYJR 2VHCA 3D6FA 1J7KA 5KAMA 2GKSA 3GEMA 3IL2A 4IEFB 3SVTA 2QU7A 5K8CA 5KTTA 4MS3A 2JCXA 1A5AB 2D2XA 2IDZA 3CNOA 2QTFA 4KWTA 1U99A 2H5JA 1E2NA 3L0IB 3RM3A 3WNQA 5K0TA 2RAPA 3AUXA 1Y1QA 2I65A 2LNDA 2ZCJA 1BE8A 4CR8A 1NJ5A 1QG2A 4TRNA 2WYVA 4H6WA 1GQYA 2YVQA 1O95C 5F52A 4C22A 1QCZA 4KX3A 1UBRS 3O8OB 4P5PA 4BYMA 1UODA 5LZ9A 3RGGA 1LFAA 2ORVA 3MTBA 4I1UA 2OCAA 3DBRA 1ST3A 2DLNA 4IILA 4PLTA 4V0SA 2QJOA 4UMVA 5E9QA 2DPHA 2I03A 2AB0A 2PKWA 3H2ZA 1QTIA 2GCGA 3LUPA 3K1ZA 1KYXA 2JI6A 3CMCO 3F5SA 1PG2A 1ADBA 2VPPA 4DLNA 1HRKA 1ILWA 1D8TA 1NF8A 3ZHQA 3T9FA 1V6AA 1WBBA 4R7GA 1U8FO 1L8QA 1KDYA 3LX6A 4HDCA 1XD9A 1PNVA 4ZO9A 1W0CA 4TYPA 1LNQA 1E99A 1M2VB 2ZUCA 2NW6A 3EMBA 3LLUA 5LQKA 2X9QA 1ZMOA 1ZD1A 2FWNA 1SUAA 2D0OB 1J22A 3I1IA 2ONZA 5EIOA 4CU2A 4QNMA 3MBKA 4FZ3A 3QMVA 3AEZA 3UWPA 2AWOA 2V7BA 2OXTA 4B3SB 2QX9A 3WWEA 4EPTA 4C3UA 1I1HA 3BMNB 2YFYA 4KR6A 5IM5A 2FW0A 1QKIA 3EXEA 1NXPA 2IUUA 4ER5A 5KOJB 2HWXA 1XA0A 2V55B 4MQFB 1EWTA 4PNPA 2EGUA 3PUIA 1KZYC 2WFMA 4RORA 3RVBA 1LPSA 1XYGA 2QM7A 3HJHA 3STWA 2WFLB 3IP9A 1UBSB 3KVVA 4LF5B 1ULHA 4YCNA 4QEDA 2I1LA 1HYBA 2HA4A 2JFUA 3OT5A 5CH5A 2FW1A 1WUHS 3HH8A 1F4LA 4GICA 4HQ6A 1EM6A 3FLBA 3IKJA 4IDQA 4XPIA 2BR5A 1RQNA 1B15A 4PF1A 1YGYA 1U1IA 2C95A 2YV5A 3VKVA 3AL2A 4FGLA 3L7AA 3G0IA 1G1MA 1H9AA 2INGX 4HAUA 3T95A 4G4JA 4U7DA 1IJEA 1R00A 2XB8A 3DUFA 4Q66C 3HUEA 5E6RB 4DM4A 4P3NA 5KDLA 1Y3AA 3OTHA 4R7TA 1I0IA 5FOWA 2HA3A 1GQOA 2FMIA 2D3TA 2V5VA 3C2QA 3ILHA 1JP7A 1CJCA 1MC4A 3O03A 4QOJA 5D84A 1GZ6A 1EXNA 1JPUA 3WIEA 1QP4A 1R9MA 3T5MA 3MTDA 3TEFA 2A9RA 4B17A 1O6CA 4LEIA 4LMRA 1QVRA 3D9QX 5MGBA 2P8SA 2XB2A 1PWZA 3KYDB 3RJ9A 3ZVRA 1NUUA 3ETEA 3GQBB 3JQGA 1HLGA 5CAEB 1ECBA 5TSDA 2BF7A 2FB9A 5E6RA 4JX9A 5LQMA 2YNMD 3RJTA 4QWMA 4HVAA 4QRIA 4XWTA 1TKRA 4OAQA 5CW1A 1DC8A 3OEWA 2VHYA 5EZYF 4A8TA 1XZEA 2FXIA 3WLIA 2ZPTX 2TS1A 1X7WB 3K5IA 4UBKA 2H0AA 2HDWA 3D1LA 4DANA 2XADA 1J2JA 3X3HA 4RMIA 2ATVA 3H4MA 4ZT3A 3SK0A 4LZOA 4TSRA 1CRWG 1SWWA 4ZGBA 2C31A 4OB8A 2DYKA 1YI8A 1KKLA 5ES3A 1BCSB 1JEDA 3R7DA 4AZ3A 4QECA 1OAKA 4WFQA 4W5TA 2Q6VA 4GLFA 4R98A 4WLOA 1NL3A 2A4KA 2O19A 1JU9A 4BKRA 2Z2ZA 3BRWD 1O97C 1T2UA 2FG7C 1P9LA 1ADCA 4DCUA 3SFTA 3C98A 4JHLA 4IIDA 4P4SA 1LTKA 2DY1A 1JW9B 2AYYA 4ILKA 4WEQA 1VG0B 5GQSA 3V8BA 1GAWA 4MWGA 5J63A 4DC9A 4MPTA 2W8ZA 3ZBPA 3K30A 3Q8LA 1Y7LA 1MAVA 1ODTC 1W5AA 2XB9A 4HNGA 3H3XA 2PFKA 4JUFA 4MR9A 4N8SA 2QMHA 4WESA 5E9JA 4B6RA 4ER0A 2R6CA 4Q1DA 4Y2PA 1JG2A 2NOAA 3A4VA 1R4NA 1V95A 2FSPA 3FCUB 3EDMA 3QX8A 1MX5A 1HG0A 5TPWB 4J2HA 3UTCA 3WGHA 1TCCA 3QU9A 4DY4A 3G0HA 3OO1A 3F4BA 3NO4A 4WA8A 1RWQA 4YJHB 5IPFA 2CNBA 3BE5A 4KFSA 3UUGA 1CQJB 4ZOAA 2EFDB 4OI0A 1PP4A 3ZVLA 3MJRA 4CPDA 3CZCA 2FVYA 3KDAA 4Z3KA 5T4HA 5KNCH 2AN3A 4Q16A 1TUEA 5CP8A 4P98A 6Q21A 2JIDA 5K99A 1MZVA 2W2VA 3IOEA 4N5MA 2YOGA 3R3JA 3WL6A 5LDDC 5JH7A 4EVIA 2ZWAA 1QGAA 3LGXA 1FNBA 3ZTYA 1F20A 4MUFA 3CVUA 1Z0ZA 3GPLA 3SIXA 5G41A 4ZKDA 1SXJB 5HSGA 2ZYSA 3RVSA 1P9WA 1T13A 1GCOA 3OX3A 5BO5A 5BYKA 1F7VA 3I2GA 2G76A 2OVFA 3C8ZA 3QKUA 1E1CA 2Z5GA 4HUQB 1GKIA 3U7IA 4ZMBA 5FWNA 4MZXA 2EP8A 1EVKA 3JD3A 4LRYA 3GH1A 4BGEA 3O31A 4WADA 4LMPA 1NONA 1CUYA 3NYWA 3DEJA 1RLMA 2I2WA 2WF5A 1F17A 3UMVA 4GBGA 2FEPA 3TX2A 2IYWA 3GZNA 4NULA 3JQ7B 4O5OA 4X41A 4XEUA 1Y33E 4UMFA 1P77A 2A8YA 3FLMA 5DEOA 4HOYA 3A1EA 4LUCA 5I4CA 4OKIA 5B37A 2VBIA 3EQ8A 3K9QO 1EBFA 1R10A 1WIWA 4NE9A 4NF2A 4O3MA 1H2BA 1UK8A 1FVFA 1J8QA 1JSXA 3LE8A 3SJAA 4DZTA 1Y34E 2E89A 4OU4A 4HXGA 3MF4A 2I9KA 1BXGB 1V43A 3EGWA 2ERCA 2CUTA 3KQHA 1PWXA 2QPTA 3A6LA 4RJTA 3CCFA 4E7OA 1UAAA 3DM9B 1FFBA 4AJPA 1X8LA 4OL9A 1ZPDA 2DG2A 4GS5A 1IBLB 2Q5HA 3OPMA 2OVBA 3FNQA 3AUUA 4EVSA 5JLJA 3TBHA 1LLUA 1MX1A 1Q12A 4DCCA 2ZVPX 5HIMA 1JR3A 3TDMA 2QTHA 4RIFA 4LDZA 2W4QA 1VL6A 2VPYA 3IDAA 3LHDA 2H06A 4XGKA 4XTCS 3OZFA 1XHLA 2PO7A 3A58B 2IYYA 1GZSA 4JDUA 1SN7A 1WEHA 3GAAA 4RSGA 4DB2A 3EZNA 2CFOA 4GPIB 4UUMA 2AI1A 1MG0A 3BIWA 4J3JA 2EZ4A 4AKSA 5A7FA 4B47A 5JMOA 3ME5A 3KD2A 1Y3CE 4YAJA 3EWNA 5THXA 1KR5A 1N6IA 4G0QA 4LC9A 3EIFA 4S1TA 1LLFA 4IIYA 3GYBA 1N5RA 2FR8C 5FA8A 4BKOA 4B9AA 2AN1A 4DR6B 2R47A 5KAPA 1QLWA 3N05A 5FYDA 2GDJA 1B2RA 2QZSA 4RVUA 4BQEA 2PTHA 4L4YA 1KERA 1P74A 3NH6A 3ZW7A 4CIBA 1ZVVA 5JW6A 3ZY2A 4FOTA 1JHQA 1HT3A 2VPQA 4US1R 4NOMA 4I4TB 4J75A 2WDPA 3EIXA 1X94A 2IYLD 4XCXA 1VG1A 2Y1DA 3TLKA 2GAAA 3GT7A 4EB6A 2AQKA 1YFZA 3IDSA 4HX2A 3ZHTA 1B2LA 3IMCA 1V41E 4LHVA 5AW9A 5DCUA 3WGYA 4F8YA 3E8MA 3WGUA 3EPRA 4TYWA 1QVZA 3UKOA 1J20A 4HWOA 4YIHA 3L4JA 1J1ZA 4BMZA 1I9CA 2XMSA 1M75A 4RX1A 2P41A 3F4LA 5BUSA 2C99A 3IO3A 1WCIA 5K2MA 1ID8A 5F7ZA 3COZA 4BO2A 4DABA 2HRBA 2N1BA 4PPFA 5KTSA 1BWSA 1JGTA 4OQZA 4XXHA 2WM3A 2AJCA 2QRVB 1IZ9A 2H9AA 3DZGA 3L02A 4OYYA 4BC1A 2VQFB 2QTLA 4ZAWA 3AVVA 5J43A 2CZQA 3MELA 3PD0A 3V8QA 3QTTA 5JR3A 3GFBA 2AUMA 3K1TA 4BU0A 1UBHS 2E4YA 2M6SA 3NP7A 3PICA 4TSFA 3STXA 4F1WA 1G8KA 2WWIA 4Z9YA 1NG1A 1TMGE 4ZQCB 1CK4A 1ISRA 1EVYA 1G0OA 4MP3A 3WTBA 5AW7A 3V55A 3TG8A 2YJTD 4MUGA 1ZH6A 4X44A 1U1FA 3TSOA 5F2KA 3FPKA 4R3WA 4MROA 4EG1A 4KNYA 1E3MA 1GKYA 4LXGA 4RLFA 1AK9A 1O94D 3DEYX 3JCZA 2PH7A 2MSNA 4S0ZA 3W9SA 1CJKC 2R4UA 3VYVA 2HV8A 3MXTA 3EGIA 3K8QA 5EY5B 1ISMA 3JQ9C 3NBFA 3MTGA 1PNRA 4H31A 5FNVF 1CCWA 1TA0A 1M8KA 1YZUA 2ZFUA 2JVIA 3HACA 2Y05A 1O0CA 8ABPA 3ORFA 4RK1A 4R9VA 3HM9A 1XJ0A 4HRVA 4JASB 1YJCA 3DR5A 1WZEA 4TL8A 2P2YA 4ZARA 4DQVA 4E2WA 2W4IA 1W5SA 1NVXQ 1QK5A 1R8YA 1ACMA 8ADHA 4FFOA 2I99A 1GRRA 4Q4JA 1YMVA 4GUDA 1Y37A 3HB4X 4M1WA 1FP7A 2XNDA 4J0KA 2XYGA 5B4TA 2HMSA 2D8MA 4PO3X 1Z63A 3N5KA 2QW0X 3V1TC 2Y4NA 2VDNB 1T9CA 3BA1A 5ENZA 1B23P 4OYRA 5BWBA 5B4VA 1FDTA 3IX7A 4N7RA 1HEIA 4KPGA 3KT8A 2O0KA 2PZKA 1L4BA 1CZOA 3NV9A 1YDHA 2F3UA 2I6QA 1NQUA 1WQ1R 2ZUDA 4D92A 4YV2A 1JILA 4L9AA 1E3QA 4CM8A 3ADPA 3GB9A 5JADA 2OGTA 4AN4A 4MARA 3UC9A 3HUUA 3BEDA 5F76A 4MVYA 5CNMA 1I13A 1XYYA 1FDWA 3DCIA 3EWAA 3V9AA 4D4KA 2ZJ0A 2RI1A 1EWYA 1Z4PX 1GPDG 2H11A 1X74A 2VF5X 2W42A 4CKWB 4AY6A 1T6XA 1U2SA 3O4FA 3PNMA 4OQNA 1DAGA 3L05A 3CV3A 3CNLA 4ZREA 1KJZA 5EI5A 5BT8A 4R81A 5D86A 1GL6A 1MJGM 1N2CA 2WMYA 3REFA 1IZZA 2B4KA 1RYFA 1ABFA 1EP2B 1MP0A 1NBWB 1K5DA 2HGZA 2Q28A 2YYZA 4M8SA 4R6XA 2PNFA 1IQ0A 2GCOB 4WZBB 4D43A 2J0EA 2G3YA 1QIJA 1D6MA 1VHQA 5CGQB 1HTWA 4K9PA 2EHJA 3W3ZB 3K15A 3QBJA 4Q1CA 4YMSA 2WIBA 5DPMA 3S28A 1XC7A 1FYEA 4UBNA 2ZE5A 1FEZA 3WBJA 1QO0D 1UJBA 1QCDA 2A58A 3TDKA 1D1PA 1PZNA 2DCUA 3UTDA 1J8DA 3Q7SA 2PA3A 2ONCA 2W6JD 4YFYA 3H83A 4Z4GA 1A88A 5FOVA 3ER9A 1TUGA 5FFNA 1T25A 3KM0A 4DCGA 1JAHA 1X1CA 1ODIA 1OC4A 2OLEA 2WHXA 4ZYUA 3Q8KA 4P36A 1M2KA 3O0DA 4HAIA 1NYRA 4NATA 5HF5A 4EW6A 2VWHA 1T3HA 3A32A 4Q00A 4M7RA 1ZX1A 1IHOA 1L1QA 3COPA 2BGLA 2EF0A 3EA5A 4IICA 3IKLA 2B7CA 1GXSB 4JBGA 3CY6A 1JBKA 2C2KA 2WABA 4F2GA 1JDBC 2XNSA 2ZATA 1X7WA 2NSHA 1E2EA 3C7DB 3QPWA 2Q49A 4MQFA 1XI2A 1R0XA 4IIBA 2JHGA 3CE9A 1L9KA 1TK9A 5KYXA 1N7HA 3V9PA 5IDXA 4KPFC 4MP8A 1PT6A 2I76A 4J3FA 2I67A 5GZ1A 1Z74A 4UUBA 2P27A 5KPJA 5B6JA 4BNNA 1MT3A 4LE2A 3W5CA 4FHZA 2O2JA 1DFGA 3KJQA 4FKBA 5LP6C 2I4LA 1KO8A 2VJYA 3BXHA 2G1AA 4EY8A 3CR7A 3NMUF 2MHCA 1XRLA 3DXYA 1WZCA 3PC8A 3D4NA 4M99A 1XKLA 5BNFA 5BVHB 4TXJA 1E1DA 1DOHA 1XZBA 3V4FA 5FOSA 1WCWA 5IP5A 4NJOA 2VDVE 4MPJA 4UARA 4JGBA 4KVZA 5U1PA 1CUBA 4MKZA 3FZYA 2WIAA 3JQ8A 4LTDA 4MJ3A 2Y1KA 3PDCA 4YONB 3E4CA 5T4FA 2YICA 1CUUA 2YJZA 1O08A 4RA9B 2PH1A 1AG9A 1V2GA 3F73A 2JFVA 3NJ4A 3C48A 2XUKA 1NN5A 4PC2A 4MEAA 4A9AA 2PMBA 4WT7A 3KJHA 2LW7A 3ROMA 1WM1A 3EARA 3KS9A 1EFRA 2VC2B 1NVDA 5IAAA 1JB9A 2PGLA 2YS7A 4AJEA 3THYB 4J94A 3CIFA 3CX4A 1IXZA 1QFXA 3LPNA 3N2LA 4R7ZA 4IS3A 1AKNA 4IH9A 1Q7EA 3L8CA 3NGMA 1NKTA 4FU0A 5JYCA 2GJ8A 2ES4A 4PIMA 4RQTA 5IC5A 2G70A 1P45A 3M4JA 4B5LA 4EB8A 3AZPA 4FHFA 3FGNA 5F3DA 4CLOB 1PS0A 3MG9A 1EUQA 1LSOA 5U9CA 3WDSA 2GASA 3EVDA 4RHFA 5HR5A 4GQIA 3B60A 3DWIA 3L0BA 3U0VA 2DPXA 5FFFA 3FMOB 3TRJA 3ASVA 1JHRA 2C92A 1S3IA 3EIEA 4NZOA 1HBJA 4U7WA 2ECPA 3HLYA 3ULKA 4C7MA 1FFSA 4WZZA 3B53X 2QRHA 2HY7A 3MT8A 1ZD4A 3B1YA 3RBZA 1G5PA 2B3TA 2FW7A 3GH3A 3LWNA 2E18A 3NNSA 4RIGA 4JP2A 4V0LA 1LPAB 3DE1X 3TUJC 4B3JA 5CA1B 2HEGA 2AWNA 2HPAA 3AL3A 3GZNB 2JKVA 4L2IA 5CB4A 3GGPA 2CUNA 1MHTA 3MYRA 4J4TA 4K6GA 3MGKA 4N47A 2RHMA 1C1DB 4AJLA 1YK0A 1F51E 4IJQA 4INOA 1UKCA 4TLBA 2IODA 4EY7A 5HILA 2EERA 4TYNA 4P92A 2YRWA 2PXAA 4RZQA 1YI0A 3OZ7A 2GEJA 2YDXA 1AKWA 1Z2AA 1VZ3A 3MGGA 1JECA 4DDKA 4MKRA 4CR6A 1M1NB 1C3LA 3AY6A 1W5TA 4WLEA 3W8NA 1T9GS 4ARAA 1JTEA 1I2MA 4X1YB 2JNWA 1L9XA 3BRWA 4NU0A 4O59O 2QRQA 3H5NA 1QU3A 4P3PA 1UIRA 3R7BA 1UWLA 2FX2A 2QL5A 3NAQA 1LX7A 4JWKA 1YFKA 2AG1A 5BV7A 3ZDQA 3D81A 5CEJA 1D1SA 2F3PA 1YZ3A 5DIFA 4G0MA 2QG6A 1CJMA 3BT7A 5EERA 2C57A 3JVEA 3S29A 5KTOA 4I66A 4JLJA 4OREX 1FSSA 5IBQA 1MV5A 4UHDA 2VYNA 3SQDA 2CLHB 1LJ8A 2B2XA 2IPAB 3P5BA 4Q3LA 4IOMA 1FFXB 1Q7CA 3K9GA 1NKVA 1A72A 4ZAFA 1SQ0A 4J0HA 4MGHA 4TWBA 5EUQB 3BTUA 1QRTA 1GDDA 2QTGA 3LRTA 3P8ZA 2DBQA 3W5DA 4B3HA 1SZDA 2GF0A 1T3LA 4N6OA 1WP9A 3TR0A 3ZPXA 3HB9A 1XMVA 2P91A 1U1EA 4UZFA 1E7RA 3PFNA 1LW7A 4CFZA 1JLMA 4Z9FA 2MSEB 3SLRA 2XOXA 4G0XA 1JA0A 2JLBA 1N8NA 4JBXA 2J85A 1SOMA 1TE2A 1XZKA 5EG5A 1XCGB 4K8OA 4IWYA 3UJ9A 5I47A 1QQAA 1VHDA 1KZ6A 1YOVA 2WF7A 4HNAB 3PVCA 2R25B 3OFND 1CFZA 2WFLA 3UXHA 3RS7A 5J2TA 3N8NA 3UH0A 1CC1S 3CX8A 5B57C 1DXHA 5E9AA 4YAGA 3QFSA 3EB9A 1KMIY 2VRNA 1Y63A 4UU7A 5J4KA 1FMFA 4NFLA 2EKPA 3EIQA 1JHZA 4A03A 1I7PA 5DHTA 3NHJA 4M7OA 1O9BA 3OF3A 4Q3BA 5DF1A 5JUWA 2HMVA 3GRYA 4G37A 4G86A 4HK4A 4RKRA 1BIFA 1UK6A 1VMEA 3ZWAA 4CTJA 4Z1OA 4PAWA 4JK3A 5JCPA 2Y2UA 4B40A 4CEIA 1T0UA 4L5CA 1L3IA 2JL1A 3T7JA 1WDKA 1CY4A 1KYQA 1WF6A 5CDGA 2HSJA 2DVMA 4D4JA 1BROA 1MNQA 2P90A 3DFKA 3OT1B 1W4LA 2YW9A 3CH4B 5DCWA 3PEUA 1GITA 2YZKA 3AHFA 4J3NA 4BX9A 3U7FB 1J1UA 4O63O 2G5TA 3V8RA 3LVFO 3U1VA 3MM4A 4MRMB 1TAGA 1U0EA 2P6RA 2JGLA 1NVKA 3L8YA 4KKVA 3IBCA 5GVSA 4DG9A 2AOVA 1D2EA 2C5HA 3FCEA 3EISA 3KXIA 5L3SB 1X1EA 3OTWA 1FW8A 3VV2A 3HFSA 4HRXA 1RWWA 2BBWA 2IPXA 1JDUA 2NPIA 2Y76A 3KJZA 3LO8A 1WZIA 2ZQ5A 2DWPA 1WXXA 1Y1SA 1QVVA 1TZMA 3B2QA 3M9XA 4L02A 4TTQA 1Z7YA 3ZV5A 3PEYA 4J0QA 2EKZA 4ZJZA 1YC2A 5T3UA 1E79A 2DPLA 4OM8A 5FPTA 3HBFA 3E9EA 1I0ZA 3NR2A 1LQ2A 2QMZA 4XOUA 4QASA 4XA8A 1VMDA 5KDDA 1UJNA 2FPWA 2JANA 3T1OA 5A4MS 4KL8S 2GF9A 1F14A 3QOXA 4TKZA 3VPXA 3FHTA 2NO6A 1J8FA 4GXNA 4AUEA 2PV0A 4CHTA 3HUDA 1SBCA 2V7QD 1AXEA 1NXVA 5I7EA 3IQFA 1EFRD 4YT8A 2ZR9A 2ATEA 4JB2A 2ZVJA 2ZRLA 1X1QA 4U39A 4JXKA 4WA7A 5CBPB 3A9UA 2GVZC 4JVLA 3VRHA 4DMCA 1K86A 3ZD7A 2PN1A 3HXTA 3WYEA 1SQFA 1CQZA 1D7AA 3E3OA 4NTZA 4CQJA 1L7BA 3Q8XB 5C5EA 1LPOA 1L7XA 1NVTA 2QTVB 3WDKA 4ZVVA 5JEDA 4ND2A 3CF0A 1A98A 2YVLA 3SBXA 2QRVA 3OQIA 1OA1A 1H6AA 5ALXA 1KMHB 3WLFA 4OJNA 4Y0NA 1NU8A 4LE1A 4B2LA 5HTOA 1DJOA 3C3EA 9ABPA 4QJBA 2C2XA 1E1KA 1DBQA 1QC5A 3NAGA 2DM6A 3NBAA 4L8YA 5JXHA 5IXYA 1T5SA 4CM9A 1WSDA 3U4GA 2G7ZA 3A1NA 1VG9B 1PS9A 3FCSB 3ID6C 4ND8A 3LJKA 4M6WB 1ISSA 5FIUA 3F71A 5A4DA 3KEMA 3Q3GE 5LXTF 2BE9A 5H80A 3NHFA 1N9KA 1RZVA 2W6OA 4KYIB 4GVPA 1DIHA 1GQRA 1LNZA 1O8BA 4FD2A 2Z83A 1Q50A 3IHKA 4ND6A 1P7VA 2Q6LA 4IQ8A 4I99A 1MVNA 2VP3A 3U56A 2IX3A 1S3SA 1WCIB 3EXHC 3IMKA 3BPSA 1KZ7B 3L8GA 4K6MA 5DNEA 2FSUA 8AT1A 3UB2A 3UJBA 3K1JA 3LOQA 3WE7A 4BJ3A 3SOPA 2EWWA 1A8SA 1KOGA 5FYQA 4LJSA 4HWSA 4RTRA 1O2DA 4Y9TA 3PGLA 1BYIA 4EMSA 3O1HB 4WIAA 3GRAA 1ABEA 5AD1A 2WU3A 4JZYA 1Z5UA 3E9DA 1F3OA 4BNLA 1T0BA 2VWGA 4ARSA 1NP3A 1CJBA 1LTQA 4G84A 3R8XA 2VRCA 1HDEA 5HOQA 4KQMA 2MR5A 3JZDA 4MHOA 3GCWA 4PRLA 5JJCA 4M1EA 3GRUA 3NAZA 3PR1A 2VDJA 1RKVA 4M0FA 4F6RB 2QJFA 4L07A 1U98A 4MS1A 2XVAA 4QOFA 2GBGA 1LBEA 5KYUA 5ILOA 1UKAA 2D62A 3C6KA 3PL1A 3ZVNA 3U1BA 2OBBA 2PQ0A 3ETJA 4O2BF 1ZVMA 2V59A 3GRZA 5A9TA 2QDXA 5IVPA 1KRWA 3KT3A 1E1NA 1D4OA 4Q01A 3QU5A 4R01A 2J3EA 1LVGA 1SB8A 4BBAA 4YJ3A 1MB0A 2XT6A 1OGYA 1SVWA 2PMKA 3SY8A 13PKA 3T1VA 4EHNA 5CPBA 3F6RA 1Q0LA 1VPDA 2AK2A 5BRAA 1NQAO 4FBMA 3LZ6A 1DMSA 3T9CA 4DGSA 2I8CA 4TKUB 3ZD9A 3DEKA 4A5OA 2VTBA 2PQMA 3O2QB 4OQDA 4RF5A 3PF8A 5GIPE 3ZK8A 2VRWA 5EMMA 5CX4A 1PWEA 3ZQJA 3PDIB 4EQ6B 4PLGA 3FUXA 1FYFA 4ALMA 4HY3A 4MYTA 5ALWA 2XBLA 3B78A 1VRVA 1NR1A 1VLQA 2CLLB 1YKFA 3AVOA 2XH8A 3DLIA 1B6TA 5IWCA 4K40A 4WDRA 3L6UA 4WZBA 1JBEA 2EJCA 3ZWYA 3GRPA 4F1JA 2I6GA 4B4VA 4KO4S 3ZJVA 5DI3B 4GQBA 4KQHA 5FNZA 1JDTA 4QBTA 5CT6A 4OIMA 2OORA 1HI9A 2KW5A 4OM7A 4FINA 4MGIR 3OPYI 1Z5OA 2IOYA 1KY2A 2WEKA 3LMKA 4IIFA 4D3DA 5KTNA 3BHIA 3C3AA 5C2JB 3WDLA 4BDSA 2ZRBA 4YAFA 4B80A 1NDHA 2EC5A 3AUKA 3LX8A 4UVIA 1YFLA 2OFOA 1NBAA 5CJJA 4AKGA 1PR1A 5LJLA 1ISPA 3NWJA 1WNTA 1CF9A 4MQEA 3E1SA 5P8WA 5CB8A 1ZRMA 2H17A 1AU9A 5AM4A 3JASB 4WDQA 1M0EA 4MCJA 1XWWA 1WWKA 3U5TA 1FTGA 4GPEA 3A27A 1O8CA 4N82A 4DIFA 1ZOSA 3NHWA 2XUJA 2RK4A 1YIOA 4MHTA 1FFHA 1QYRA 5EE0A 1CVLA 2R00A 1ORHA 5B55A 1I5OA 3DB1A 2Q1XA 3AFGA 4E09A 2X1LA 1UM8A 4LWPA 1KEKA 2JGDB 3CUUA 2QVXX 3F9IA 4C7XA 4Z7JA 3MUEA 4V0QA 3M3DA 4E03A 2VQSA 3PUZA 2H2GA 4LJ8A 4QHYA 3ZUPA 4CEJB 4Y2RA 4AWAA 3QJYA 3WBFA 5ICMA 1E1LA 1NU6A 1R6AA 3CF6R 4MRPA 4S1PA 1GHTA 1UQRA 1UJMA 1VGRA 4TTIA 3DHVA 4CW7A 3T1HB 1WA5A 4RIHA 4Q18A 4ODIA 3RTAA 2HQBA 4CKEB 2RGRA 1DUIA 4BNZA 1KYTA 2EEPA 4ZO4A 1ADJA 1CB0A 1Y1KE 1OLXB 2BJHA 2P3LA 2X58A 4ZVPA 1U2EA 3M33A 4L16A 3UWOA 2H1LA 2Y99A 5EE3A 2BUCA 2NWQA 1ORTA 1O6BA 5LZ4A 4F1KA 3LLSA 5AKEA 1DNPA 3L8EA 1QAOA 2OHOA 2XT0A 4QU9A 3QY0A 3VR2A 3CKMA 1YL5A 3EVZA 1OU4A 2F9LA 2JD1A 3BK2A 4ZT5A 3TNJA 3WWDA 1FDVA 4DY6A 1A4IA 1SY7A 1XP5A 4CE6A 3QKWA 1TPYA 2YWCA 1NW6A 3E9MA 4U63A 4QQ8A 3U0BA 3S5JA 4FW8A 3MRVA 4W8OA 2PVPA 5FD8A 1WQ4A 1XQWA 1M34B 2RBEA 4TTSA 4RHYA 1HX7A 2GGSA 1IE3A 1PSWA 1ZQ9A 3TPCA 2IUTA 1NN1A 5GVRA 1GTMA 4OHUA 4ENUA 1I24A 3BGIA 5FPYA 2BC9A 4KUEA 3ZNOA 4Z9BA 1WB9A 1U65A 4BZPA 1G8HA 4NG5A 2JK1A 2YH2A 1K5HA 1D6NA 2HLHA 4E5NA 1W1UA 2L82A 1COZA 3T54A 1KR2A 2NU7B 2WSSD 5TE9A 1Q95A 3KJGA 3RG2A 3TZHA 1VHJA 1P2FA 2Q3FA 3S68A 2QM0A 3PQ4A 4ARZB 4QYXA 1ZUWA 1Y9DA 5CYOA 2NU8B 3SX0A 5C5DA 1NFFA 1KYZA 3AB3A 4H7IA 3EEFA 1G38A 4UBOA 1NJ6A 1DQYA 3UG7A 4OQEA 5FAXA 3GC6A 3Q10A 1DV1A 3QWBA 2PRYA 3FRIA 2NZXA 5HOEA 5C7OO 3QEBZ 1E3WB 3OPYB 3SX4A 5K0GA 4WFJA 1I2BA 4D97A 1MIOA 1UBTS 1Z34A 3DJFA 4R2WA 2QRUA 2FN3A 3IUBA 1K92A 4XEHA 4J49A 3D3NA 4IMRA 5F5XA 2JKYA 2QTWB 3IQIX 2OAGA 3FNBA 3Q9SA 1D5CA 3OURA 3JZAA 4IYRA 3R9KA 1T35A 1A96A 2WYUA 3AR9A 4O08A 3L01A 1P3Y1 4TUYB 821PA 3CRW1 4F9FA 2C3UA 3DNPA 2ZJAA 3LQYA 5BQ5A 5ULLA 5JJIA 1Y89A 2I0FA 3HHPA 3IBTA 3NOXA 2G0NA 4CVNA 3QPUA 4Q4JB 4K9RA 2GBLC 3E7WA 5FPHA 4BVGA 4GGOA 4DR7B 4TT3A 4L8LA 5DULA 3C16C 4CLOA 3C39A 2EFJA 4Y2VA 4QO8A 5BN5B 3WIDA 3ELUA 3ZK9A 2FN9A 4RD0A 2Q6OA 1JIKA 1W76A 3KWFA 5KOJA 1GN9A 4BO5A 1QONA 2BEUA 2HPZA 1HL3A 4Q4AB 4R1NA 2Q0XA 4W9NC 3JPWA 1W34A 1KVSA 2G67A 3IULA 4LJYA 4TV8A 2BP7A 2P2CA 4BVHA 2M1ZA 5BW5A 1HR0B 1TADA 1FQOA 2C1ZA 3PXXA 3ZLVA 4QWWA 4X71A 1MXFA 1M2NA 1GRCA 5CJPA 2TYSB 2W6ZA 3KJIA 5F2OA 4QO7A 1D4FA 4XSHA 1A5TA 3MFYA 2UYYA 3KZOA 2IEAA 3DOCA 2GN1A 3AKDA 4WZAE 2F1HA 4YCLA 4BE7B 3P9KA 5EJ6A 1U3GA 3AONB 3ZGYA 3QBVA 2W2NA 2JJQA 4ED9A 3LAWA 1BQ4A 1GAJA 4YI3A 3EPHA 3BSWA 1A5BB 3EFOA 2VZ9A 1ZZEA 2A9FA 1DC4A 4IDBA 1NM5C 4PC1A 1ODCA 1R27A 2R8BA 1E64A 2H9YA 1KIAA 2W90A 4RVFA 3NAMA 5LFAA 1LU9A 3FKSA 4KGZA 3H8VA 3QE3A 2OECA 4KLZA 1YKSA 5KNBH 2VS1A 1S9HA 2YHIA 3CA8A 1EFKA 2NUAA 1K66A 2OBXA 1SBIA 1NW4A 2CXHA 221PA 2Q2VA 4G07A 4M22A 4W5HA 1W4BA 3R4CA 4G23A 3WIVA 3ZDRA 1J97A 1T9KA 2AE2A 3DAHA 3G9ZA 3QOYA 5AK5A 5L8VA 3N8GA 4ZCRA 5KSYA 4EL5A 4RSHA 3FE2A 2QGNA 3H9UA 5E1MA 3SYTA 3EAGA 5J2TF 2QXUA 3F97A 5CHEA 1R5OA 5E0OA 5KJFA 3KKZA 4QXOA 4CQLB 3GLIA 5AESA 1IN7A 4HDMA 2IOHA 1GSIA 3CLUD 5DTRA 4MV7A 2B82A 1PQYA 2VPXA 1VCMA 2GILA 3ZHZA 5FWYA 3IJEB 3HDTA 2UYHA 2DLCX 1DO2A 3DC2A 1ODKA 1J0BA 4RF3A 3MMZA 1TZCA 2FPOA 4HFNA 3ZKWB 5GP1A 3FR8A 2P65A 3ZGLA 1LBTA 3UV7A 2CXUA 4FDLA 4C08A 1N3YA 5IJ0B 1KJYA 3NVMB 1FX1A 1PL7A 1USIA 3AEKA 1H0SA 4JT2A 1JYSA 3L6OO 1K7EB 1HT1E 2P4HX 4N5DA 1JQJC 2ZIWB 2FPIA 3AGPA 4M89A 4AURA 4CM5A 4HLUA 4EEXA 3I5YA 5JE8A 3FOAA 1RXSA 2VF7A 2C5EA 4MS4B 4RK5A 3BN3A 1YB1A 2GARA 3DZDA 1P4JA 4AAYA 2GM5A 2APJA 3WHKA 5HKBA 3ZE8A 2X42A 1S2LA 2BOVA 2QL9A 4PHFA 4RETA 1FTWA 5CURA 1U0NA 4J16C 5ANRB 3OLVA 5IAKA 4OFBA 4COOA 1BG6A 3U3KA 1MJFA 2M6RA 3C1AA 4EYKA 1TCBA 3W3AA 2ZRHA 4MYCA 4MWDA 4DEVA 3U17A 2FN7A 1HZJA 2X3UA 2XDWA 1EJ0A 3WL8A 6AT1A 4J0EA 1YVEI 5HIJA 1HDRA 2H1CA 4D98A 4ZVRA 2ZB3A 4PYKA 1XDSA 2CVPA 2QROA 1ZQ1A 5SY4A 2CXXA 1Y9JA 2PS9A 3MN1A 2VAXA 2QQGA 3B82A 1M1YA 1RADA 1CRZA 1NFRA 3G0BA 3IESA 5F3WB 4G0NA 4OQPA 3H9EO 1IJFA 5L7WA 2G88A 1E59A 5JTTA 2GB4A 1GL3A 1M5TA 4W63A 4KN8A 3CPJB 5DB4A 3UAXA 3VI4B 4DUGD 2YZNA 1ABBA 4Y2HA 1GM5A 1ZOIA 3CZ5A 3OFSA 4U9IS 1KVUA 1EJ2A 3OIFA 4BJ1A 1XCBA 3ICOA 1DXQA 2WQ6A 2YR0A 4KBGA 1MKYA 1NPDA 4JA0A 2YFKA 2XUPA 4LWZA 2GCIA 5CT9A 3SZRA 5FUBA 1VFNA 3GJRA 3VUEA 4JLDA 1GUAA 1VLLA 4H7PA 4KWIA 2CL5A 3C41J 1T4BA 3PPWA 3ZXIA 4KWEA 3OIGA 3L5KA 1L1FA 1QG0A 4E4RA 2BKLA 4OBBA 5CR9A 3GJQA 5BSUA 1UBFA 4CG2A 3PEEA 4J76A 2LKCA 4E5DA 5AHRA 4BO0A 3KB8A 2P9HA 1Y48E 1VOTA 1TCUA 3DR3A 3F9CA 1XU4A 4YQYA 3ZWKA 1FRNA 1QH1B 2GM4A 1MG5A 2SBTA 1PJQA 2C61A 1RLOA 2JASA 1E98A 5BUCA 1O58A 4JC0A 1PJ3A 3ORQA 4KP7A 1GGFA 5K3OA 3GT0A 4IVPA 5A6SA 1Q0ZA 4EHBA 2J0SA 1JTVA 4MA4A 4AZ3B 2QRGA 4GOND 3TRDA 3EPKA 4Y7CA 1PJAA 3FOCA 1NUTA 4LDQA 3ZQ4A 3U13A 2WG0A 3VMMA 1YJ5A 2AT1A 2HA6A 2QVBA 3AJDA 3I2FA 2IV3A 4BQRA 5IBPA 4OJTA 2YV4A 2YXEA 1S3GA 2NSDA 4LVOA 2JFWA 2J0VA 4D56A 2A30A 1FY2A 2QRLA 2REXB 1EX9A 2YWHA 4LSZA 3P26A 2VT6A 3KVYA 1BA3A 1YQWA 4B6GA 2HR1A 4DOMA 2WAMA 2J9GA 5JD4A 3R6GA 3BH6A 4KN9S 3VR1A 1LLDA 3DVSX 1CR1A 1B0PA 3IQXA 4CFYA 2GYUA 2Q46A 3X43A 2W11A 2H7VA 3W6ZA 2RGXA 4XFDA 3NUZA 5KMGA 4M9XA 3NH9A 2O6HA 5JG7A 3RV3A 2Q3DA 1X13A 3WMRA 2X0EA 3CE6A 4EFMA 1H2AS 3H0KA 5FJIA 2QJTA 4HFRA 1NNLA 3NYQA 1U7UA 3AUSA 4ZAZA 5A9RA 2AC2A 1KI1A 1X8JA 3EDQA 1Z0AA 1AK1A 1H4VB 2XPCA 3N3AC 3DDNA 1IQRA 2R87A 5JCOA 3FMVA 1DUVG 1L4MA 2QMQA 3VHXA 1OH8A 4RTOA 4KOEC 3TF5A 3RYHB 2IDKA 1ZM3A 2WAYA 3SXJA 2ZSBA 3LY8A 3DWEX 1OBVA 4AY5A 4A2WA 2AKYA 1PR9A 1IONA 1V8BA 2V7WA 4G0YA 4QGFA 2HH9A 4PQGA 1R6VA 3A25A 1Z7WA 4MO9A 2F1KA 1YR9A 2YWJA 1T8RA 4ZZ0A 1Q1QA 5ALYA 5ER6A 3EASA 2QT1A 4FHGA 4DTIA 4BFTA 1KPHA 1XLTA 1M6YA 3PQ2A 2VSFA 2PGXA 1H5QA 3MUFA 4C4PA 3D4PA 3G59A 1HDZA 3H5IA 1C14A 1KL7A 3MJHA 5JD3A 3WLJA 4RA6A 1A8QA 5FWYB 4PZDA 3GN1A 1E7SA 5HUQA 4QBHA 1RZRD 3VA7A 5CYPA 1R0YA 1NQ5A 1BJTA 6GPBA 1CETA 1I33A 2VK1A 3LCCA 5G3YA 3JQ7A 4Q5IA 4RADA 3DAPA 4TM7A 3UXEA 1JIUA 1KS2A 2VIIA 4KIGA 1PGJA 3RU2A 5ITZB 3L07A 3VAYA 1WD7A 3B85A 4TL7A 5C18A 5KVAA 1KFEB 4O4JF 3HQ4O 3ABRB 2DFTA 3H1TA 5G0SA 1A9QA 2R8XA 5CFZA 4AS3A 5KJCA 3RVQA 3UO8B 1PGOA 1ODSA 4EFNA 4RA9A 3LWDA 3VAZA 3TQFA 5L4LA 2CLIB 1M6VB 4JL8A 3VTFA 4IXTA 2BEWA 1OTXA 2Y2VA 4MLPA 2D1SA 5T4BA 5G4KA 2H1WA 5A05A 1ID1A 3BWDD 1SQSA 4EKGA 1EINA 3DMGA 3E22B 4DRZA 4REMA 3M83A 2J67A 1BFUA 3EXHA 4D26A 2PO5A 1IBRA 3CEHA 3MBIA 1YDGA 4YRNA 3T35A 3DUFB 2ZJ5A 4WW0A 1P60A 3T9DA 3GK3A 5CXQA 4W5OA 2PR7A 1XLUA 1TUBB 4DKJA 3JAMA 1JIXA 5DGXA 1P7WA 3AUYA 3DFFA 4MUAA 2AXNA 3PTZA 1KK2A 1BDHA 1C9DB 2Q99A 2ASEA 3SZGA 1RWOA 2CJFA 4H2DA 2R8OA 3JYHA 2X8JB 2Z58A 2NGRA 3K4QA 1E89A 2VXBA 3D64A 4R8SA 4TS9A 1VA4A 3TAHA 2R1VA 1DIRA 3OQIB 2VQDA 1QQBA 2NQ8A 1HSOA 3FG9A 3NPMA 3OQOA 1Z47A 3U80A 5KYGA 2C94A 4QYSA 4PBTA 5AW6A 2F67A 2EBWA 5IDWA 4R2XA 4R9SA 1MH1A 1WCV1 2Y1EA 4YDSA 3NHYA 5YASA 3O4IA 1MN6A 2HJVA 2QTBA 4O0MA 2A1UB 1VI2A 3WKEA 3ZV4A 2F17A 2P9EA 2X8JA 4ARVA 3EN0A 1J2EA 2R5WA 2GHIA 3PHCA 2ADOA 4PX2A 3TZ6A 4AYXA 3P27A 4WBXC 3EXG2 4R1UA 4RMGA 2PUBA 2HWYA 2G6BA 3DAGA 3LRXA 4P53A 4BGDA 2OR3A 3NXKA 2OK7A 4J0GA 3WGTA 4L6CA 3HA2A 2Y1XA 2R1ZA 5C7LO 2FKNA 2G04A 4L4XA 2BMEA 4FS8A 4QXAA 2HIHA 2H5IA 3M4ZA 3TCKA 3Q15C 3U4IA 4MOWA 1KJ8A 4YJ2B 3UIEA 3KB1A 5E2BA 3BF8A 4OSPA 2G9ZA 3IAEA 2JIBA 3PKJA 3VOSA 1L8XA 1Y6JA 2QGFA 3ZV6A 1L6IA 4NCJA 4B3GA 1J33A 2ZI6A 1ZL0A 2QMOA 4HAVA 2QTCA 1TW2A 5EIAA 6REQA 1XHFA 1TVEA 1WABA 1AGPA 4M2LA 2PX3A 4MUEA 3NVKI 5A0FA 2N0SA 2O7VA 4I36A 3TSYA 3DBRB 3UH1A 5GOTA 1RYZA 4REQA 2QW1A 1FMLA 4L0QA 4ZIRB 2OD7A 3HYNA 5D1NA 1UC8A 4GRAA 2HLDD 4ZV7A 4D0RA 4AO6A 2NIPA 3JQQA 1G3QA 3UJ8A 3U7GA 2RH4A 3A6FA 4PZ9A 3R8CA 4K6CA 6REQB 5HKKA 2V0GA 5LSAA 1BO6A 1CQJA 3AVQA 3BD6A 3QLEA 4K88A 2O3QA 1UF9A 5FTKA 4RIIA 2QM8A 5FUVA 3FCOA 5BN4B 1VJ1A 4KI7A 2PKCA 3FSEA 2DULA 4O3FA 4RGYA 1TK2A 2N42A 1M72A 3BIJA 1VB3A 3PFCA 3FYCA 4KQIA 3AFOA 5CLIA 4CNQA 2AD1A 4N0MA 3H04A 2CDAA 5EN4A 1QGYA 3QTBA 1M5RA 4BIMA 1DEHA 2Z30A 3D43A 3PE4A 3H7IA 4F72A 1P33A 2FUEA 1T0JB 3V4LA 4OD0A 5DISB 3T7IA 4ISBA 1M33A 4AKHA 5MN6A 1SXJA 3LH5A 4F92B 3CBGA 1R6XA 3C15C 4FM9A 1IUOA 2RGBA 3EH1A 2MSWA 2NUPA 1X7YB 1PQPA 5DP1A 2JH3A 1J0EA 2ZWIA 3A4TA 4I1VA 2QT0A 5ALIA 5DT2A 2ISSD 1A2OA 1DIAA 1NTRA 1KKMA 1E2GA 2RONA 4D8WA 1MQSA 1RJWA 5AVSA 3Q40A 4KRFA 1T15A 1JI0A 1NR7A 1W44A 4BNDA 1EMDA 3OLXA 1T9BA 1VBFA 3L4EA 1MW8X 3L6RA 1GQSA 1XOIA 3RU9A 3UUEA 2H2DA 4AF7A 1JLHA 5KVCA 2MYNA 1NMXA 3RF7A 2CLSA 2J3QA 3AL0C 2WKWA 4REOA 3I0NA 1M2HA 2XUQA 3VTZA 2HK6A 1SOUA 3O8LA 4BIIA 2HHHB 5JAMA 3VFDA 4MV8A 1AO0A 3BMOA 2VOEA 3JD0A 2WOOA 4HBGA 1P7PA 4I81A 1PJRA 2J0UA 2CVHA 2VTBB 2H8KA 5EEHA 1TTQB 3I3SR 1TLLA 1U7WA 4PPYA 4MITA 3HRKA 3L1UA 2FZ4A 4Z9AA 4B43A 2XE7A 4J7XA 1NV9A 1UJ5A 3ELYA 2FJUA 4P82A 3ZK7A 4ZYYA 3DDHA 3CUKA 5CVCA 1CJVC 2R65A 4GIBA 4NL4H 3ANLA 3EC1A 2DERA 3GBPA 4QX6A 1JS1X 3ISVA 1W8IA 3BCUA 4LDPA 1JVBA 1OTHA 2JVKA 3ZCPA 2OO3A 3CF4G 2G77B 4MUKA 1RVV1 2JGDA 3MS7A 3W4IA 1RRFA 5H0IA 1GGKA 4GGPA 4YIKA 4ZVMA 3ZCQA 1KI8A 4DDVA 2OP1A 4NMXB 3NKLA 5LQCA 2GD2A 2P2SA 3AY0A 4LRQA 1K8XB 3DZ8A 4CKCA 1I5RA 1D6SA 2I55A 4E32A 2D54A 3PG5A 4FR0A 1Q7TA 2PRKA 4XM1A 3KEOA 1T3GA 3BZUA 2R86A 4HZUA 1E2PA 3FTNA 4EB3A 3KFVA 1Z6AA 4Q7LA 1RWBA 1U8CB 3W9BA 3LPAA 3ZLBA 2ZRQA 1ESMA 2VNSA 3N58A 1HC7A 2DH5A 2FUG6 5EE5B 4UATA 3H0CA 1T8UA 3ROXA 1UEJA 1XDUA 3IEIA 1EFVA 3VVMA 3VZSA 4B45A 2CVFA 3CNQS 3AZOA 4QDOA 2C2HA 4M1QA 1U0GA 2I2AA 2ZI7A 4KYTA 2XZDA 4IUBS 3SF0A 3N28A 1NQXA 4EUSA 3LK6A 3U7QA 3S8EA 3AU8A 3HP4A 1II9A 3B20A 1C8VB 2WB4A 3RAGA 4C6TB 1TYBE 3F67A 3INRA 3WGVA 4K9MA 2VA8A 4J7AA 3C85A 2LIPA 2WJAA 4LHSA 2Y93A 5B58T 4IUYA 4FWBA 4H7FA 2B6HA 2HTEA 4J1TA 4XD2A 4C1BA 3A1WA 2WNSA 2HM7A 2HU8A 3CUSA 3OWHA 2IP1A 4BNTA 1JEJA 5MN4A 4O29A 1UEIA 4CQLA 5C53B 2E5FA 3GLIB 1OX4A 3SJUA 3S40A 1OASA 3GDOA 3IJPA 4QOHA 4R3NA 3SOZA 5JDIC 1I7SB 4FQ7A 2A84A 4I4LA 1RQGA 4QEKA 1DQSA 2CFSA 3D6NB 4R16A 1K6XA 1SA0A 2WSSA 1MEJA 5JYEA 5KKNB 4KE6A 2IQ5A 2WKPA 3HDJA 5H70A 3TGWA 3W2GA 1LI7A 4LQ4A 1T43A 2XA2A 2F6RA 1CDZA 3FNFA 3L41A 4KGXA 1XCPA 4D9BA 3NYRA 3T7CA 3GV0A 3VDNB 3THWA 4OUDA 5H9WA 2NTNA 1U4NA 3G6KA 5LXTB 2H3HA 1SZCA 1J2UA 2GAOA 2HF8A 2SECE 4C1NA 1XG5A 3PXDA 1RLTA 3T3DA 4KGVA 4EVQA 1DC5A 3IBGA 1M2OB 1MT0A 4KO8A 1GT91 1Z62A 1KZGB 4JQSA 1JG6A 4P1ZA 1G9XA 4WPGA 2BKEA 5ALTA 2I87A 4WZ6A 3ZHOA 1UFOA 2Q41A 2EARA 3BMCB 1XYVA 2B98A 1WW8A 2GN8A 4F8JA 3L8ZA 1WAMA 1LI5A 4AL4A 2XF2A 2ZYHA 3QKSA 4KH1A 3AKZA 2XI4A 2CXOA 4K0RA 5J9FA 1XMQB 3PUJA 1U8UA 1UPCA 2EGGA 1CY6A 4D9CA 1P8JA 1A9PA 3V1MA 3OSUA 3W06A 3ZHVA 3GJZA 2C88A 2OILA 2GMWA 1OHHD 2JH8A 5DYTA 4RVSA 1T4CA 1U3DA 2XY4A 3RYHA 1IG0A 3CS3A 5AKKA 3FY4A 4DUPA 4E33A 4I1SA 1L5VA 1KVRA 1OX5A 1CPYA 2XITA 2I9PA 1PRYA 3B1XA 4KO2S 5EZYA 2Y77A 2Z98A 3CUWA 3HKDB 4D57A 4XCQA 5FA6A 2PAFA 1BX1A 1JQKA 3DNMA 4YBZA 4CDGA 2XYRA 2V3CC 4TUYA 1YB4A 1L7RA 3VI3B 1HLPA 3JWGA 5GONB 4DHWA 2PLFA 2HRCA 2G9RA 2ZRCA 2JAOA 1X9IA 2XGGA 4D8YA 1S2NA 3G2OA 4P3KA 2CDCA 1W6UA 2BZ1A 2L18A 3D59A 3QLTA 3QWFA 4IV8A 4N5LA 5IDVA 4UTZA 1CRPA 1NPYA 1R9JA 1NUHA 3CH6A 3GPCA 2VNAA 2JW5A 5CXUA 3SC4A 2H57A 1JYFA 2SICE 1XLVA 2I6FA 4HMQA 4R1TA 5ILGA 4JVOA 4F5DA 1XDWA 2OGWA 2AKEA 1B42A 3WWCA 1N0HA 5KSWB 3OZCA 4N7JA 4D1YA 4Y67A 1ZINA 4PRKA 3A2LA 3TBKA 1H1LB 1MBZA 2O1WA 1N5MA 2GEVA 1ZGJA 4WVFA 4QQRA 3HE3A 4BOYA 1AN9A 4HGYA 5LM3A 3L1JA 2RHBA 2IEDA 5HE8A 2OENG 4FZJA 3OE7A 4AW9A 1J9GA 4LOAA 1PZHA 1SBQA 2XTAA 1BEEA 3MT7A 3I04A 2M6LA 5ALKA 1V7ZA 1QR6A 4QARA 4LOLA 3DEFA 2X0NA 2AXPA 3PVZA 4P6VF 3HNPA 1NJ2A 4JUBA 1E1RA 1RXUA 2F3RA 3NFYA 1BW9A 1BKDR 1PNTA 1NLUA 5CLLA 4C07A 4AUMA 9LDTA 5JFOA 5A5GA 1RE0A 4CTOA 4GD3Q 1FFXA 3UOWA 1YQTA 4UVDA 4LCBA 4WASA 1PJZA 1OIVA 1V1MA 4LJKA 4MHSA 2AOUA 2X9GA 3PUXA 4NR0A 4QOIA 5IXJA 1QAMA 2W37A 3EF0A 5JJ5A 2O8EA 2YN4A 1T4GA 2XBMA 3LBIA 4TXHA 2BGKA 3ZWBA 4KMMA 5IM4F 1UKBA 5IK2D 1GGHA 2P30A 2K6GA 3PXBA 4XR4A 3WK6A 3EGEA 5IXSA 4OCZA 1JHOA 1EAYA 1AGXA 1Z5WA 3CW9A 2ZUFA 2VDRB 3D7SA 1MD9A 1A9XA 1YJ8A 1VE5A 3AM3A 4EDFA 2TMDA 1FUIA 4FYYA 1XTIA 2AR7A 3O26A 1TCVA 1JQBA 1PGNA 3GEBA 3IIEA 5L51A 4DMFA 2R7AA 1KNQA 1P1IA 3A6GA 2LXNA 3I30X 2O59A 3KOYA 3DVRX 4LZAA 1CRLA 3FPEA 3H9GA 4UD2A 1C7FA 3UW3A 3OIDA 5LNK6 4EX7A 4RLQA 3EIWA 6CHYA 2VDOB 1AKTA 5HMMA 4C04A 2F43A 2EHDA 2FN4A 2RHWA 2IHKA 5K05A 1FBTA 1V9LA 2NXNA 4MINA 2HJRA 4RV5A 2HJSA 4QULA 2UUCB 5IBRA 3L4BA 4AM8A 3U3JA 4EENA 5C9ZA 3TQHA 5KO2A 1E96A 3AR7A 2Z3WA 4QHSA 3SKYA 5A0VA 2OV3A 4GRDA 3ZD6A 2Q5LA 2BF4A 4CEIB 3PJDA 4S1NA 4D02A 3IUSA 3AEXA 1W5BA 1KJIA 5SYAA 4RTKA 3B1KA 3VYRB 4AMUA 2DCMA 5K3FA 3CLSD 1IG3A 1ENOA 2AIRA 3K9CA 4OUDB 4CKZA 2NT4A 2NU6B 2P2GA 5JDIA 1NXQA 3M6WA 2VQ6A 3OZGA 5CNJA 1UBNA 3H9BA 4NHEA 1Z4QA 3ZVKA 4RH0A 4RH3A 1FFGA 2R8EA 2YUTA 3BORA 2O2IA 4FZ5A 4Q7JB 4UZEA 4XM0A 5EP1A 4BNUA 3WY9A 1WO8A 4ZYLA 3NTLA 1QGUB 1LQTA 3Q3IA 4JLVA 1Q3TA 1QGED 4BJ6A 4WXYB 4X8MA 3CZQA 5AUPB 1W4ZA 4BP3A 2IBTA 3G9UA 4GOLD 4OFXA 2NU9B 3WLNA 2JAUA 2JFXA 4GWGA 1GVNB 5E3IA 1L7PA 4CU5A 3HVRA 2EV9A 4C20A 1SUEA 2EW1A 1QYDA 1SIOA 2WJHA 4N12A 5IJ9B 1BCRA 2IIQA 5JQGA 2FGKA 2DQKA 2FWIA 1ZCJA 2WSMA 1ZIXA 3CTMA 3IBYA 1JHUA 1P0FA 3RVMA 4LZJA 4KZPA 1XQ6A 1RTTA 3DONA 2CYAA 2JIMA 3G1WA 4GI7A 3RUAA 3KYBA 3AR3A 1CR6A 2MMGA 1DKUA 2W6MA 3CXRA 1VM6A 4URZR 1FL9A 1SC3A 1BCRB 2O2HA 1FRVA 2NUPB 2GK4A 4QUKA 4XVCA 2PJDA 4QPPA 5J5VA 1L5ZA 4Y9RA 3O73A 1GA6A 4BO6A 1XA4A 4RL4A 5ALVA 2NQ2C 4EL0A 1E5TA 3F2VA 3F2IA 1Q7RA 1KMMA 1VE1A 3W1WA 4YP0A 3OQ1A 4F6LA 1L8OA 2YZMA 3CKKA 2C5GA 2JG3A 4K87A 1GOTA 1M3SA 2BTOA 1D5WA 1TK3A 1TNDA 4P4GA 4WLVA 3TTXA 3A11A 1P6QA 2EL9A 4HDRA 4IMPA 4KQ1A 4DR4B 1KAHA 1QGDA 5JATA 2NP6A 2CWDA 2J41A 3DE5X 4TKMA 2CHGA 3WK8A 5BNZA 1Q91A 6ADHA 4L28A 4DJTA 2IBSA 2DR0A 3NBYC 5LA6B 4NZ9A 3BD7A 3NJRA 3B6EA 4L0MA 3Q87B 1ZUD1 1Z6PA 3IXQA 1MC8A 1J70A 2WV7A 3B1JA 3UAOA 4JI7B 1DGQA 5U4XA 1UBEA 2VYVA 2OV6A 2XQFA 4F2WA 4L5BA 2PV7A 3TMYA 3WISA 1LEHA 3KLPX 5B1DA 1H66A 2FDRA 5PNTA 5KQGA 1WUIS 3BWMA 1U5BA 3N9IA 2JAWA 1U0RA 4A0HA 4LX0A 4N9WA 1DCMA 4QPCA 3FRHA 4JI0B 4LSMA 4NECA 1TT5B 3AWIA 3NCTA 2ZUEA 2C1EA 3AG6A 3NRCA 4W1SA 4JIMA 3SF8A 2WKRA 2A6PA 5TV2A 1P2TA 3ANYB 2BN4A 3C3BA 1UC9A 4MDHA 3VPSA 4QDKA 2L0XA 5LXTA 3A05A 1QHXA 3ET4A 3TE6A 2GLXA 1Z12A 4NYIR 2BFFB 3MILA 3KP1A 3Q98A 2ZIFA 2PRSA 1T2FA 2ODPA 4YRFA 1R0BA 4GPZA 5JZVA 1XEAA 4J7UA 5AJZA 1A76A 2B7BA 3KQYA 4D8VA 4FCTA 1JVNA 1GGVA 1YZTA 4IGEA 1AMUA 4LF8B 2D5AA 1SD2A 3D7NA 4B4DA 1CEEA 1ULBA 3LCUA 2TRSB 5JH7F 1UOQA 4RK4A 5DM70 2F8MA 4G3XA 3I42A 4R83A 4YASA 2EQBA 4TWJA 1L5WA 4Y18A 5HTKA 4TOIA 4GG1A 1A97A 4O4LA 4FQ8A 3LP6A 2O7NA 1YKGA 3VKFA 5H8WA 2YY7A 4NQRA 1EFAA 4KQCA 2BEWB 5IJZA 3LA8A 2EKBA 2F1IA 4FYHA 4R0VA 5C1IA 4HVCA 9GPBA 3DXZA 1L7NA 3HVUA 1SG9A 1GD1O 4RY2A 4P2GA 2UYGA 1Y82A 2BFDA 2VFAA 1DRWA 3DW3X 5EZYB 1L1RA 4BO3A 2ZITA 4GMHA 4X20B 3ZZ1A 5AJYA 3HVJA 1OLSA 1POXA 1SHLA 3OOEA 4UBLA 5EUBA 1K6JA 3EMKA 1T10A 3KJEA 3STHA 3KETA 4CLDA 3BXEA 3IIJA 4IHKA 2YY5A 3CX6A 3TOCA 2GDZA 1EXDA 4FX2A 3OLYA 1K68A 3E2IA 3P0IA 2V5UA 2RHTA 5DXFA 1A8UA 2WK1A 3PFIA 3R3XA 4XUGB 4EO4A 2WZDA 1C7EA 3RADC 4IDAA 2A9KA 1CE8A 3AFMA 1QTNA 3HV0A 4W4TA 4M38A 1PFWA 1Z8FA 3T3HA 4GE0A 4A36A 3MFQA 2OE2A 4US0R 4B83A 3BL6A 2VCEA 1U0TA 4WKPA 3T3IA 2RC6A 3QUCA 1SRRA 3P1JA 2EKLA 4Y2TA 3TVYA 4CCWA 1UAYA 5NLLA 1R50A 1IZYA 2XDYA 1NX6A 4RDCA 4ROTA 5DTMA 3TN7A 2BFPA 2QI9F 3CRRA 2PD6A 1NQWA 5L3SA 4AZSA 2JCVA 1OGJA 1YS1X 1EVQA 4MWEA 4PYRA 2W70A 4QBIA 3STUA 1ZP6A 3W5AA 5DGCA 5BW4A 3DE3X 4CCYA 4YB8A 5DIZA 1JKFA 3QVGB 3UCFA 4D5EA 3ICPA 4ZYZA 5DGDA 1NR5A 1U0SY 1ZW6A 3HJBA 4HWTA 4IH1A 4YT2A 4MCAA 4XJTA 5CIWA 1CSEE 1T36A 3GRVA 1G5HA 3AIMA 4QXRA 4GL4A 2BUAA 1Z0DA 4AJKA 1Z7BA 4PWZA 2E6UX 3PNLA 3RYIA 3PNPA 3LQ1A 3IODA 4JLSA 2GQ0A 3LC1O 4K5QA 1QYIA 1VKRA 3JYNA 5L95A 2C9BA 3SQWA 1X1SA 4M0EA 3NGXA 4WXPA 4CF5A 1V25A 4KQJA 5HQ3A 2IHYA 4W8HA 3QITA 1U9IC 2CUZA 4UNQA 5FEMA 3NZEA 3O3MB 3W6PA 1S8OA 2C0QA 1HQDA 4CYMA 1G64A 1KEPA 2GN6A 3KL2A 4TYYA 2BFCB 5K0SA 1J2TA 1DADA 3R7SA 1HMYA 1QF9A 2O8EB 1KK1A 5BR1A 1T4CB 1LNSA 4V02A 1ZMBA 3GFSA 1PE0A <