1N3LA

Crystal structure of a human aminoacyl-trna synthetase cytokine
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
339
structure length
332
Chain Sequence
APSPEEKLHLITRNLQEVLGEEKLKEILKERELKIYWGTATTGKPHVAYFVPMSKIADFLKAGCEVTILFADLHAYLDNMKAPWELLELRVSYYENVIKAMLESIGVPLEKLKFIKGTDYQLSKEYTLDVYRLSSVVTQHDSKKAGAEVVKQVEHPLLSGLLYPGLQALDEEYLKVDAQFGGIDQRKIFTFAEKYLPALGYSKRVHLMNPMVPGLTGSESKIDLLDRKEDVKKKLKKAFCEPGNVENNGVLSFIKHVLFPLKSEFVILRDEKWGGNKTYTAYVDLEKDFAAEVVHPGDLKNSVEVALNKLLDPIREKFNTPALKKLASAAYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords tyrosyl-tRNA synthetase
publication title Crystal structure of a human aminoacyl-tRNA synthetase cytokine
pubmed doi rcsb
source organism Homo sapiens
total genus 120
structure length 332
sequence length 339
ec nomenclature ec 6.1.1.1: Tyrosine--tRNA ligase.
pdb deposition date 2002-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00579 tRNA-synt_1b tRNA synthetases class I (W and Y)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.240.10 Mainly Alpha Orthogonal Bundle Tyrosyl-Transfer RNA Synthetase Tyrosyl-Transfer RNA Synthetase 1n3lA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1n3lA01
1JZQA 4EG7A 4XFJA 1SURA 1NUTA 2B7LA 5TGTA 1G8HA 3UK2A 3X1KA 2JANA 1Q11A 4L2IA 1ZH0A 2J4DA 4EF6A 3ZUGA 1PFUA 3DPIA 1V47A 3A05A 4KPUB 1NP7A 2PZ8A 3DO8A 5HG0A 4MVWA 1QU2A 4CDMA 3GMIA 5DB4A 2DLCX 3FNRA 4MW7A 4MAFA 5FNZA 4DLPA 3L92A 4ZT6A 2CV0A 3NV7A 1O97D 3CVVA 4YP5A 4ZCQA 4DJAA 1WXEA 2CUZA 2RE8A 1KAMA 2YWBA 4ZT4A 1I6LA 4QREA 1F7VA 1NUPA 3AFHA 1ZH6A 4MVYA 4EG3A 1PG2A 1T6ZA 1R6UA 4MUKA 3UY4A 1KP2A 1KQOA 1YI8A 4JZYA 4I6EA 2XRYA 4I6JA 3FI0A 1M8JA 1J70A 2E0IA 4S1OA 4DDHA 2CYAA 1U7XA 1K4MA 1KH1A 1VBNA 3CLSC 1N1DA 1OBHA 2D54A 1MAUA 3PNBA 1WKBA 3IUBA 5EKDA 2E89A 2A84A 3RHSA 2YY5A 3ND7A 5IJXA 1EE1A 2A1TR 3CLTD 3IVXA 4L2IB 1N2JA 2NZ2A 1I6MA 2CV1A 1QU3A 3AIIA 1YUMA 1ZUNA 5J59A 3QE4A 4MULA 1KR2A 5FO0A 1M8KA 2AG6A 1Q15A 1WJGA 4YMIA 4P2BA 2A86A 4ND6A 3CLUD 1TQ8A 5IHXA 2A88A 5LFAA 2ZUEA 3D6VA 4MW5A 3RFFA 4Q93A 2DEUA 4KR6A 2TS1A 1NYLA 1PFWA 1O95C 2PIDA 1F9AA 2CT8A 5TEWA 1O94D 1M83A 5AHWA 1R6XA 4CQNA 4MW9A 3DLAA 1OWLA 3QTBA 2ZUFA 3IOBA 1IH8A 1JIJA 3HV0A 1NUUA 4HPWA 4DNXA 3HFJA 1VBMA 3IMCA 1D2RA 1MOPA 2WQ6A 1B6TA 2Z3VA 4KR9A 5KHAA 3ZGZA 3CVYA 3ZXSA 1T9GR 1I2DA 2PXHA 3RK0A 1VL2A 2V0GA 1PG0A 5HUJA 3PXUA 1QRUA 4MW6A 1M8PA 3CLRD 4XFDA 3H9CA 2AZXA 4ZCPA 1WQ3A 1J09A 2G36A 3D6UA 3FOCA 3ZXIA 1QJCA 4MVCA 2WSIA 2DPLA 3ND5A 1J20A 2QUJA 4KKVA 1LI7A 3N05A 4WSOA 1H3FA 4H3SA 1M8GA 3CVXA 3IVCA 1VBKA 1U7DA 1CT9A 1EJ2A 4DDMA 1XJQA 2CFOA 1O96A 1COZA 3SEZA 2J5BA 3COWA 3KT6A 2EL7A 2H29A 1MAWA 1O97C 5BNZA 3ND6A 1EUQA 1KAQA 3OP1A 1M8FA 2OQ2A 2YWCA 5K0TA 5TEVA 3COZA 2CV2A 5F23A 2IELA 3FG9A 3UOWA 1GLNA 2J08A 1K97A 2CYBA 1IVSA 1IQUA 3FDXA 4F4HA 4Q16A 5KCMA 1Q19A 3KT0A 2E18A 3NBAA 2BYTA 3OTWA 4GU5A 4MWBA 3SEQA 3H99A 3HGMA 4R2MA 1J1UA 4YP6A 3GUZA 1WZ2A 2R5WA 3TNJA 1EFPA 5J58A 4K0RA 3COVA 1H1TA 2X0KA 2HZ7A 1NUSA 1GZUA 4ND7A 5LLTA 4G5FA 4J75A 3A4IA 3A04A 2A1UA 1IFXA 4MVXA 3M5WA 2PFSA 3SDBA 5HUHA 3N8HA 4NATA 1I6KA 1G8GA 5K0SA 2XRZA 3CLTC 1MBZA 4MW4A 4A91A 3FH0A 3U1VA 3CVUA 4R2LA 3I05A 1JILA 1GTSA 4G5YA 2GM3A 4AS1A 4ZCRA 2HMAA 2ZP1A 1YIAA 2DR2A 2J09A 4MUJA 4U7JA 4ZT5A 4CDNA 1N78A 1O96B 1O0BA 1QRTA 4EG8A 4EG5A 4XSVA 3RK1A 3TQOA 1NUQA 3G6KA 1LW7A 1KKUA 4DE5A 1O94C 3C8ZA 4MWDA 3KT8A 2H2AA 3IODA 1OWNA 3F3MA 4MLPA 3MXTA 2DUMA 1ZJWA 3KT3A 1U3CA 4NAHA 1N3LA 4NDAA 3UMVA 4AQ7A 2A1TS 2VTBA 1KH3A 4PBSA 4MWCA 2AKEA 4G6ZA 1HYBA 3IOCA 1EFPB 4ZCTA 4YP7A 3TZEA 5FO1A 1WQ4A 3H05A 3G5AA 1GAXA 3IVGA 3VGJA 2O5RA 3S3TA 5H7XA 4ARCA 1Q77A 2A1UB 3P0HA 1OWMA 1N77A 1A8HA 3CLSD 4MUIA 1LI5A 1NURA 3SZ3A 4QRDA 4OJMX 4MUGA 3AG6A 4JXXA 4BWVA 1MB2A 4HK4A 3TS1A 3LE8A 4KR7A 2WB2A 1K92A 3IMGA 4F3RA 1K4KA 3H97A 3P52A 4HJXA 1RQGA 3IMEA 4EG4A 2Z09A 2QTNA 1DNPA 2QUIA 4QBTA 1XNJA 2D5BA 2IJGX 2A7XA 1F7UA 3TZLA 1T9GS 3LCJA 2X1MA 4UZFA 3ZJVA 1OD6A 1JEEA 1JZSA 1NI5A 2X3FA 4I6GA 1EFVA 3AKZA 3ILVA 1GTRA 1IRXA 3E27A 3K32A 1N2EA 3HMQA 5LM3A 3HZRA 1BS2A 1G8FA 4NZPA 4RPIA 4E1AA 2GOYA 1N2HA 3Q4GA 2VTBB 3MUEA 2QTMA 3ZIUA 2WQ7A 1IHOA 1T6XA 3PNVA 2QJFA 2VXOA 3L93A 3UC5A 3X1JA 2E21A 1MB9A 4EG1A 1Y42X 2C5SA 3Q10A 1ULHA 3VU8A 3PNYA 2RD2A 1UFVA 1QTQA 3N9IA 3DV2A 3SYTA 3MMXA 1JGTA 3SZGA 4EG6A 3N2YA 4NAUA 2YXNA 3JXEA 1PFYA 2PG3A 4RUKA 4MW2A 5KWVA 3SP1A 4R0NA 4NX2A 3CR8A 5JBNA 1KORA 1N75A 1GN8A 3PRHA 2OV4A 1OBCA 3Q12A 1X6VA 4ZT2A 1V8FA 4MW1A 1JIKA 1KP3A 3G59A 1PFVA 1N2IA 3A2KA 4OUDA 4MQ6A 1TEZA 4EGAA 3RJZA 3LOQA 2NSYA 4ZCSA 1O5TA 2QTRA 1JMVA 4MUEA 4MW0A 4PY2A 3MLAA 1FFYA 1M1ZA 3CLUC 4JYZA 5H16A 1EFVB 2J07A 4GRIA 4ZT7A 5DASA 2JAXA 2X1LA 1OWOA 2QJTA 3IDFA 1WY5A 2EJCA 1FYDA 1NSYA 5DEOA 2A4MA 1KQNA 5J5AA 2DXIA 4TS1A 4ZT3A 1O0CA 1X8XA 3INNA 1OWPA 1GPMA 2V0CA 3AG5A 3FWKA 3K9WA 4YBRA 1MRZA 1TYBE 2I1LA 4JXZA 3IOEA 3AL0C 3ISJA 3P0JA 2JA2A 1J21A 1WXHA 3FIUA 1WOYA 1O6BA 2DERA 1TFUA 3CLRC 1WXGA 1WXFA 1H3NA 1N2BA 1QNFA 2D13A 3CA8A 3FY4A 4HJRA 4MUHA 3FETA 1F4LA 4PBTA 3IH5A 4MUFA 4EFKA 2HGZA 2BTEA 1H3EA 4OUDB 4KPUA 3COYA 3MLBA 2Z08A 1IQRA 2PZBA 1KQPA 4K03A 4U8HA 3RBAA 3ZJUA 1N2GA 1YULA 4WNYA 3QTTA 4PBRA 5TS2A 2GKSA 2PZAA 1JHDA 2CSXA 3HL4A 1VLHA 3BL5A 3P0IA 4MWEA 3GLVA 1EXDA 1WXIA 1TYAE 2IP1A 1T6YA 3ZJTA 4U63A 2QUKA 1QQTA 1JECA 3X1MA 2DETA 1NZJA 1JEDA 3CVWA 1U0BB 4CT0A 1IQ0A 1XNGA 1O95D 3H9BA 1QRSA 5DK4A 4UZEA 1MC1A 1G59A 2CYCA 2QJOA 1N2OA 1YUNA 3NBKA 1MJHA 4ARIA 1TYCA 1R6TA 1P7PA 1YIDA 4JFAA 1S4MA 1ILEA 1EUYA 2QUHA 4J76A 3IUEA 3FHJA 1KH2A 1JIIA 1U3DA 3TQIA 3KFLA 3VRHA 4DDKA 3ELBA 2O8VA 4X0EA 4MUNA 1XNHA 1TYDE 4FZJA 1J1ZA
chains in the Genus database with same CATH superfamily
1ZK1A 4HN2A 2J0UA 4OY3A 2SHKA 5IM5A 2DHDA 1I0ZA 4BQNA 5MN6A 2I76A 1PVDA 5DSZA 2PX4A 4IEEA 1ECPA 1U1DA 3HKCA 3K2QA 1ECLA 1INLA 2UUOA 3C8UA 1WAMA 3G23A 4R4JA 4FIZA 4HLCA 1A71A 1D0IA 1U0RA 4YRDA 3DPIA 1ZUHA 5A3QA 5JPDA 3V97A 1Q0LA 2ZJZA 4P3PA 3N8IA 2B4TO 4IZIA 1CULC 4HUJA 4KV9A 1Y8QA 3M0EA 3LT1A 5AK3A 2FPLA 4OLJA 3GMIA 1LD3A 4FW8A 1EJ6A 2PGDA 2OOSA 3TSYA 2ZSUA 1FF9A 4RZUA 1RXUA 5EL0A 4HQLA 4MVJI 3KYDB 5U4QA 4BMDA 4Y9SA 2ZIXA 3L92A 3MELA 3PCRB 1KDZA 5MFZA 1YZGA 4PRLA 2YIDA 3NV7A 4G65A 1Z37A 1Q0PA 1DJMA 4ZCQA 4ZARA 5GPBA 1G6KA 2VL7A 5KIAA 3P7MA 5EJIA 1CE8A 1C0PA 2REXB 1KAMA 2VK8A 2NW6A 2YWBA 4RVDA 4ZT4A 4B83A 3DDWA 5KREA 1NMYA 5GWXA 4YO8A 1KBQA 4OSOA 2GZHA 2IU6A 1LJLA 1HT0A 2R8XA 5CIQA 1PJ4A 1X7HA 4IXDA 3WYFA 2HXGA 5FWAA 1G7SA 2C57A 1T3HA 3MD0A 4F5ZA 2BWJA 4RULA 1QKJA 3W5UA 2VTKA 3LK7A 1OKKD 1RTTA 2NGRA 3PNSA 4I1OA 4WFIA 3CEJA 4BPRA 5A4KA 1M8JA 2HRBA 4Y7CA 4B6OA 1Z6ZA 1A9RA 1M6YA 1HSOA 1MMFB 4GOJA 1RLJA 5T67A 1P8AA 4EEKA 1S3FA 1WLYA 4NFYA 1WR8A 2FSFA 3LWZA 1K7XB 2CXHA 5JQGB 4E5KA 1YFKA 1QC5B 4BWYA 2J4FA 1VRWA 1C9JA 3SM3A 4LVCA 1XLUA 3VI4B 4ZHSA 5L4NA 5AVRA 3ZTWA 1SU4A 3NHYA 1Q21A 1TT5A 2P6MA 3TH5A 1K0UA 2GYVA 3OSUA 3P2MA 4A16A 4M46A 1Z0UA 4E1VA 4JVLA 2WK1A 3IUBA 4B7AA 2EW8A 2QTZA 1Z47A 1ZZEA 4MYDA 5IXSA 1TLFA 2OGWA 1E5QA 3P9CA 5E4YA 6ABPA 3IVXA 3PYXA 1F4VA 1SEPA 4KU4A 3TVTA 5KPJA 4FCWA 2ZYAA 2NZ2A 2V6JA 4CHGA 5BYKA 1L4BA 1SG0A 4PLYA 5J59A 3HR4A 4J43A 1TF2A 4WACA 5E8RA 5I4IA 3GMTA 2WLTA 2A0XA 4IM7A 3WLJA 2QY6A 1L8LA 2AYXA 3WKEA 4EJSA 4G8DA 5DTEA 2BMJA 4TL7A 1NFFA 1ID8A 3QF4A 3C3BA 5JNLA 2NSJA 5C8XA 3AFIA 4Y2UA 2A88A 4CE6A 2FUKA 3D7RA 3GOQA 1SCUB 2VZ9A 4DC1A 5KC9A 4D25A 3M3HA 1HRKA 4ZZ0A 1OH5A 4MX8A 2D1QA 2GESA 4BEVA 4L28A 3RB8A 1VBFA 2WY2D 4E7OA 2YIJA 1WB4A 2H1IA 1XDSA 4K87A 1G0OA 1QVWA 2D59A 3QOYA 3I9LA 3RKSA 2VHJA 4B43A 1JHUA 2ICAA 1JHXA 1L7OA 4ASUA 1KMIY 2EP5A 3K1YA 4D2IA 4PGHA 4ID9A 5FHQA 4X9XA 4RDCA 1CDDA 5IANA 3QEMB 1CJSA 2PKWA 3HFJA 3DE1X 2NXCA 1U2DA 3OQPA 3NWJA 1D2RA 2PKEA 2WWRA 2Z3VA 3L07A 3OPVA 4MVJG 4WA7A 3RK1A 4AUMA 3A70A 2ZBUA 4QGBA 4RHCA 2PAAA 4GGMX 4AKGA 2BJHA 5K2OA 3GJ4A 2XCUA 3E48A 1PG0A 1XMOB 5DU2A 3WYEA 3UJ7A 2P68A 4C87A 2GF0A 1NMSA 2PUJA 3EXG1 4Z0PA 1M1NA 3W3AA 5EEHA 1UAAA 1QJCA 4MVCA 4B82A 4CM5A 4KKVA 1FMCA 3IX7A 2X19A 4MVJD 3D2CA 3OU6A 4JL6A 1LRLA 1IAQA 1NQUA 3OPYB 1DZIA 2EJVA 4O0MA 1FTGA 3RVJA 4CMEC 1FJGB 5DNCA 2VP0A 1J90A 4ZHQF 4KREA 5K3BA 3A6ZA 1JTFA 3DQQA 3M81A 4KYUA 1AY0A 3L0SA 1CG6A 2Q8QA 2WM8A 4YJHA 2POQX 4AK9A 1XZIA 3DZKA 3ND6A 4Z7JA 4UDOA 4MRMB 1M8FA 4BKRA 3ZX5A 1CS4C 1K9VF 4TQGA 2H4WA 3GLKA 7ADHA 5BY2A 2CE2X 3ICPA 5EHIA 2E9SA 4Q05A 4BP9A 4NYMQ 1P4GA 1UPTA 1QIKA 3BIJA 5FXMA 3WHIA 5HIKA 1B73A 4OM7A 1IQUA 3FDXA 1RPNA 4PX3A 5AKIA 3KT0A 2JASA 2RH8A 3GVXA 4BBPA 4LHXA 3I9V6 3OX4A 3ABQB 4DMGA 4IWYA 2I7XA 3H83A 4OJKA 1U28C 4B46A 2YMLA 4GBGA 5K6TA 5C18A 1CLUA 1GPWB 3RVNA 5FUVA 2OR3A 1QCZA 3COSA 3GGGA 3P1JA 1SB9A 1AXGA 1WRBA 1P9LA 3F7OA 2ZIUB 4C01A 4IFEA 1J2JA 1KZGB 4DXDA 5HA5A 2IXTA 4K88A 3U7EB 1H2ZA 3H13A 1S2OA 5ALKA 3LHDA 5K3FA 1C0LA 2NYAA 3IPYA 3PBKA 3QWFA 1AO3A 3VZPA 3BRWD 2EKLA 1CB7A 1TRKA 1DXHA 3RS4A 2JI7A 4NG5A 4W6ZA 3AGQA 5FF9A 4HNTA 1RHKA 4JX8A 4CIDA 4LCJA 5I8WA 3Q98A 2X3UA 3Q9UA 5C5EA 1THMA 2XF2A 1YR3A 1KPGA 3BGVA 1WZUA 5KX5F 1MBZA 2QQGA 3OZXA 4F86A 1T0HB 2QRNA 4V1CA 1HOXA 5K0EA 1X1RA 3HR7A 2Y3IA 3FH0A 3IYLW 4QUGA 2E48A 4RY9A 2LWIA 4TWJA 1G291 4UU1A 5B2ZA 1L7MA 1N2XA 3UN1A 5BQ3A 4CKYA 2W2OA 2REOA 4PHTA 3EZXA 4CODB 2VHQA 4G5YA 5DTMA 1L5MA 3L18A 3DGFC 2EKQA 2J09A 3QLUC 2Y1WA 3G82C 1H93A 2G88A 1CKEA 2OV2A 4U7WA 2V4MA 5AVTA 3GG9A 4A6DA 1JB1A 2XH8A 3OKFA 5AKXA 1HETA 2ZQZA 1JPUA 3QPUA 2G5GX 2AMYA 3RU2A 5EJ8A 4AXXA 2B4YA 2BY4A 2Z8XA 2NO1A 2XKJE 4Q3EA 1ZEJA 2QYOA 2HF7A 3D8NA 1QANA 2V7QD 3Q8WA 2R8OA 1JRLA 5AI0A 1SIBE 3OUZA 4J7AA 3N3AC 3ZI4A 2VJAA 1X7DA 4BX2A 1KWGA 1Y1LA 1PEKE 3A25A 3GXOA 3EPLA 3LOPA 1NRXA 2XLBA 1DBSA 3TLEA 4B5LA 2ZBRA 3DMRA 4LJLA 5JADA 4IOLA 4HDMA 5AH0A 2V97A 4WINA 4EW3A 2IHUA 3LCVB 1WPXA 4EHKA 4Z4CA 3SWWA 5CM2Z 4V0MA 3HDYA 3EA0A 3DWGA 1QFMA 1GNTA 4YP7A 4D9IA 1KU0A 1W48A 4ECEA 2PVCA 2EYQA 1BN7A 2CMKA 3BMCB 3ZG6A 2O5RA 1HG0A 1MA3A 1ZIXA 5F98A 3UF0A 2FWIA 3TW8B 4RDXA 2I8LA 2ZAOA 3TRKA 1XMSA 4HEJA 5FOUA 2VP6A 5E7QA 3GJ8A 2EGHA 5AM1A 2BFCB 1GVHA 2B4QA 3VZBA 5KEIA 2EV9A 1TKBA 3TRFA 2IYWA 4JJ4A 1A88A 2PS9A 5EMNA 4PZCA 1CYEA 4GECA 3V46A 3CT4A 4MPJA 4LRXA 3UT0A 3GNSA 2LUOA 1ONPA 5CLQA 3FHTA 2BI4A 1QB8A 3WLRA 1E9RA 2AFHB 3MNFA 4RXTA 1LFAA 2WSMA 2IV7A 1DV1A 1WNTA 5JVDA 1I30A 4AG5A 4HTFB 1DHTA 5CDGA 2BFEA 4LNUB 2JIMA 4M1KA 4OREX 3EZYA 1XQWA 3UB2A 3UJ8A 4Q4CA 4K9OA 5M34A 1Z3CA 4ZU6X 5IJAA 4QBTA 2OT3B 1SHTX 1NXXA 2QLNA 1AIPA 3GUVA 3O82A 1NVKA 1KYYA 3DV9A 3GRPA 4GMFA 3AY7A 5HYVA 3A14A 3LT4A 1GLVA 3CLKA 3LPCA 3DFIA 3Q11A 5KYXA 3L77A 2HMWA 2BKXA 3C6XA 4GXQA 1EFVA 4HYYA 3V4PB 4BFCA 4Y1EA 4TN1A 3MTJA 4YWJA 4DWVA 3FSGD 3STHA 4CQLB 3QEAZ 1B7GO 2VT3A 3I04A 3MWKA 5DIZA 4IIJF 5BW6B 5A6SB 3RVPA 3LF1A 2JCBA 4PSAA 4DUPA 2DQZA 2YRXA 3MJFA 4DUYB 4ZJYA 4DJ5X 3R5FA 1M34A 2N1BA 3USZA 1TMGE 1I1HA 2Z2YA 4BN4A 4DREA 2EIHA 1FXWA 2VZ0A 3G2JA 3MA0A 3DUFB 3MEQA 2O7RA 5BSFA 4PZYA 1GM5A 2PO5A 5JMWA 3NIDB 5AW1A 2E21A 1XC7A 3KSRA 2XBLA 4OOEA 1K8RA 5DN6D 2AXPA 1EB9A 2YZGA 2G1UA 4NBNA 1V8OA 3LDAA 4OF4A 1OGIA 3DE5X 3JAWA 5EG5A 2FPPA 1G2OA 1WXXA 3KJNA 2WWHA 4PGGA 1APBA 2QAGA 5T6BA 5KKAA 1C0KA 3AOGA 3WLIA 3EC7A 1DRJA 1VCNA 1AA9A 1OAOC 1VPLA 3RRXA 2JAUA 2CNWA 2GPAA 1AGRA 1U3VA 5JSKA 5C81A 4JHXA 5B55A 5B7PA 3SBEA 2JFXA 5HUQA 1U7WA 4H3KB 4MCIA 3ZV7A 4N39A 4YCBA 3DOCA 4AICA 2DAPA 2X41A 1N3YA 2PFKA 4GLJA 1X86B 2BGJA 4PLWA 1FMTA 1MDBA 2V7GA 3P5BA 1KP3A 1KAGA 3ANYB 3DP9A 3DWIA 1AUOA 3KO8A 1NMQA 4Q1VA 1BHSA 4LV6A 1ZM7A 3O8QA 5ERYA 2UXBB 4MV1A 4FHFA 1PK9A 2E4YA 2OXTA 1A4IA 1SQ0A 5LB4A 1AVTA 4LDZA 2QUAA 5HZKA 3TQFA 5GMOA 1JHYA 2GILA 3K9CA 3ZE0B 5EVCA 1WULS 2HCTA 2L0XA 3HM2A 4LECA 3ZLJA 1KYTA 1EXWA 3I72A 3OHPA 3AL2A 5FJJA 4FGUA 2F9LA 4RJLA 1ORVA 3PFCA 3IT0A 4HAYA 3ZBUA 1TVMA 1XNQB 2AJTA 1TPYA 5DEOA 3TDNA 1OH6A 1RJWA 5F3WB 1POWA 3SMQA 2OLJA 1LK0A 3RUDA 4HWRA 2HQOA 3NBFA 3G1TA 4EKNB 4BOYA 3IP5A 1QO7A 4QOJA 1TECE 4BNZA 2PQ6A 4CLRA 3P97A 4R69A 2GPBA 1XVLA 2XGGA 3ZLTA 3G3EA 1MABB 3WOVA 1RWNA 3M1AA 2F67A 4K6HA 3KDAA 4FI3C 5K9ZA 3OMWA 1I13A 3T1HB 1H9AA 2H52A 1L8QA 2J41A 4L78A 721PA 2Q0HA 3K05A 2Q4EA 2ZXEA 3IVAA 5IXYA 2ZR8A 5AJZA 1MVLA 3PSHA 4F38A 4LZJA 1WXFA 4DQKA 1FUUA 3ZH9B 1C7EA 3PC3A 4RTSA 5CLFA 3FPBA 5E1MA 1HQDA 1AQIA 3WLNA 1B15A 2ERXA 3ZXUB 4AWBA 4P54A 4BEWA 2Y68A 3EA4A 1YZHA 4MJ7A 3GJTA 4H7EA 1SELA 1ZBDA 3RYTC 2I4IA 1U3GA 5B3JC 3DMGA 1MH1A 1BS1A 4L8LA 5IBCA 1L5LA 2E4UA 1JEQA 3WLPA 3RYHA 4BKQA 3EOAI 3RAGA 5JZVA 3EHEA 4GZ6A 2X77A 1P0MA 3MC1A 2P79A 4IXTA 4Q4AB 5LQUA 1PNQA 2HI0A 2QTVB 3VOAA 3NHJA 3VR5A 2LV8A 3U7IA 2JFNA 4RD2A 5I9NA 4WFKA 2RGEA 4BO9A 4JKIA 2Q5JA 4BRSA 2P6NA 3ST7A 1BOOA 3ELDA 4I5EA 5JUWA 2YFKA 4W1QA 2CLOB 4MNTA 4A8HA 1DKLA 3HL4A 3C43A 3TSCA 4RQAA 4RXUA 3TTVA 5EWJB 3Q6IA 3WLAA 3T34A 3V7YA 4KPEC 2ZSFA 2QI9C 3SBXA 3RVLA 3INRA 3REQA 2VP2A 1F5SA 1MB4A 4RQTA 3OSZA 4Q3NA 1CX9B 3ADBA 4ZU1X 1SQFA 4YP0A 3L9XA 1YKFA 3WNDA 2C7OA 3FWZA 5FL7D 2R751 3F7NA 4JSTA 1EX9A 3I4FA 2J9ZB 2QD5A 1XDGA 2O7VA 1SHLA 3PLRA 4ZEWA 3TLBA 1XZLA 3C3XA 1JAIA 2F7SA 1TYCA 3VPFA 1Z7WA 4FHZA 3VSCA 4HDRB 3M9XA 4ZWNA 1LBQA 3U17A 4YUWA 3ONFA 4TS3A 5BR4A 1ILEA 1KMCA 1GZ5A 2JFHA 4QT4A 1O58A 4FZ3A 1V4BA 2PJUA 4P38A 4KVFA 2AZDA 1V1MB 2B1GA 2BF4A 2W37A 3OPXA 4OQXA 3PYMA 4ZDWA 2Q45A 3ADCA 1BQ3A 1Y6RA 1O8CA 1SK9A 2P9EA 2PCLA 1RQ2A 3CFYA 4O08A 3VSBA 2X8JA 3TX6A 1Z8FA 3AESB 3Q2OA 4MIYA 4UC0A 1FFXB 3CZAA 3L0BA 1FMLA 2C9ZA 1ZJYA 3EXFA 4O4HB 1YL5A 2GI4A 4EG7A 4FU0A 2Z98A 4HGPA 1DOHA 4J9VA 4U3JA 1G4HA 3FWPA 1K8QA 4PSUA 1JA1A 2IPXA 4CF3A 4YS6A 4A0QA 5KSPA 2QUZA 4R71A 4V02A 1EM8B 4X3CA 3OCWA 5T4EA 1JKXA 3AKCA 4ZVQA 3MN1A 4FYYA 1S3IA 1K63A 2XNDD 3RROA 3EZ9A 3E9ZA 3GJQA 3EWSA 3F5DA 4CMEA 4ENSA 2QOEA 2P78A 1P1RA 3N7TA 2A5GA 2FG5A 1I2MA 1U7OA 2BMVA 5EXDA 5J4LA 4AJEA 1I3LA 4DLPA 2I6UA 4BGEA 1XTKA 2VJOA 5LZ9A 2ZKLA 4RFVA 4PC1A 2QF7A 1VQ1A 4WBXC 2IUUA 1LVHA 4IHJF 2FUG6 4N0MA 3TXXA 1IBLB 1OXMA 2BEWB 4LJ4A 3K0SA 4RTMA 1G6OA 3WLSA 1EVJA 4ERNA 1SUBA 1PG2A 1RRCA 3I01A 4PHHA 3UT5A 1GFIA 1GGFA 2PQ2A 2BGIA 3K0BA 4CKCB 4ZAYA 3THRA 1ESEA 2JIPA 3OCYA 1EE9A 2C5LA 1F8YA 2ZW9A 2OO7A 3UV6A 2Z43A 4QXPA 1CEYA 1U28A 1DBIA 4PGFA 3V6MA 4DR1B 1V2GA 3FYUB 2Y0CA 5K20A 1BXRB 1AHHA 4O0LA 3VKHA 3E5MA 1L5NA 3C5VA 3K6SA 4EY7A 1YS2X 3DL0A 3ZDDA 1N1DA 3T95A 2HQ1A 5LM3A 4B4DA 4B71A 1E3MA 1HYHA 2Z3ZA 2R1VB 3C3EA 3RQSA 2F90A 1EVIA 1J6UA 4QXOA 3JVEA 3WK7A 3IP1A 4D46A 1G5QA 1XWFA 4MPRA 3LT2A 2JEOA 1CYDA 3URKA 2A1IA 2PKCA 2VJKA 2IOQA 4U9IS 1I2AA 1QSGA 1YQUA 4XW2A 3RUCA 3S1AB 5HZHA 4IKOA 3E84A 3MQFA 1C80A 1DJPA 1BCRB 3U4HA 3LX6A 5EIOA 3SC3A 2DYKA 2M1ZA 3L7NA 1U1EA 1YBVA 1G16A 3W6ZA 4YRGA 2BR3A 2I66A 1EUCB 2WE7A 3LCUA 3QLUA 3E8MA 2Q2QA 3R5SA 4P4SA 4TLEA 4IIYA 4XD7D 2GXUA 1PU2A 1DAIA 4NEQA 4WFQA 2HA6A 3UMSA 3THXA 1YRBA 2AQIA 4HR7A 1IAVA 1NYLA 1PG5A 1E7SA 3HO6A 4TV8B 2XUFA 4EB3A 5JATA 4LJ9A 4PFQA 3E5HA 5ALXA 2P2YA 2P3LA 4OU4A 5GZ3A 1GFZA 3B9QA 1M83A 3HA5A 5AHWA 5G4KB 3RQIA 3T7TA 2VF5X 2ATIA 4DCTA 2CVQA 4HLNA 1OWLA 2AX3A 4HQRA 4QRHA 3S27A 3TLGA 3H5NA 4CTKA 2DE0X 3C6YA 2YFYA 3CR7A 3I9FA 3M9WA 4URXR 3P9KA 4CL2A 1BWSA 5JYBA 2OVBA 1RM0A 5K01A 1NTOA 3BILA 5CFLA 1UXGA 3IVRA 5EA2A 4QLAA 2MHCA 4XVHA 1LTQA 1XJ5A 4WASA 3ZGZA 4DNOA 1GA1A 3R2JA 2NO7A 4L5IA 3WISA 3AONB 3QKRA 2KE5A 1N6LA 4UPDA 5F1PA 2ON6A 4V0SA 2GHQA 3IMKA 1KIMA 1IJEA 1AQUA 4L0QA 3H9CA 3OJ0A 2B3TA 4TTVA 3A1VA 2GBLC 3T7SA 1JR6A 4AJ2A 1YHZA 4TT8A 4YDRA 1U8YA 4CG1A 2DPLA 3HN6A 3K4PA 4RL6A 2QNIA 4RW0A 3PF8A 3FNGA 1JA9A 4XIJA 1GWNA 2YC4C 1Q20A 2WUGA 4MV3A 2D5IA 5A4DA 4UCXA 2H2DA 1KXZA 2R65A 2YWHA 3BMOB 4H3SA 3UUFA 4M9XA 4EABA 5J2TA 5I7OA 2XNCA 1E5TA 1NW4A 2CSUA 3BB3A 1HLGA 4JH0A 4M0LA 3HVIA 2DHEA 2H2FA 4FDLA 4XQ9A 4GQIA 5B3AA 4EG0A 1DDGA 2Y92A 3EGVA 4QPJC 1L1RA 4YRTA 1A04A 4DC9A 3MOSA 2PRJA 3OFND 3HWSA 3PENA 1A0OA 5GJCA 2X0NA 5CLIA 4C0XA 3MWFA 1NWCA 4J4TA 2J08A 2IRWA 1ZD4A 3OA2A 2FJ0A 4MWSA 1G8JA 4LAFA 1FYWA 3TVDA 3KSBC 2GSDA 2YJ4A 1SXJE 2AUMA 3NWOA 2VZLA 4JUAA 3IP8A 4KC0A 5ALNA 1QE5A 4FKMA 1IE3A 2BYTA 4I1RA 3WQQA 5LIPA 1UQTA 3EFOA 4HNAB 4TM8A 2X0FA 4JEUA 1YB5A 3M33A 4RTRA 3QPVA 1DPGA 4WZZA 5FBWB 1OLUA 1FFAA 4RFSB 3ZV4A 3FYTA 1BEZA 3VC3A 2C3MA 3EZNA 2CD9A 3IP3A 4R2JA 3TE6A 3WGUA 3DBLA 3PNPA 5H80A 3JPYA 2BN4A 3WRVA 5KOHB 2Y1GA 3F6BX 3FUWA 4P92A 4MKXA 1FY2A 3O8BA 3MFYA 2PFSA 1JEYB 3P9IA 1Y81A 1RACA 1N4DA 2FEAA 3U5TA 3OTQA 1V5FA 4OMCA 1BXZA 2F3SA 1TU3A 2KLHA 2OWEA 3IURA 1ST3A 4KDCA 5ALUA 2BSAA 4QHYA 1SHUX 4GMHA 3EBOA 2JHFA 2PGLA 1K2WA 2I7CA 3UMCA 5HJ5A 1VRCA 2IS2A 1RPJA 2NUTB 4GDMA 5LXTF 4GNKA 2CW5A 4AXBA 1X8JA 3FLBA 5AW6A 1OAOA 2WIJA 5MN4A 1BRMA 1HZJA 3PPIA 4NEHB 1UDCA 3OEWA 3IRVA 3WRYC 3CXRA 4Z2YA 4ACAA 2QMZA 1FQWA 4ZI7B 1OVGA 5K7SA 1NYQA 2HA0A 4ZOEA 3HA7A 1CETA 1VIMA 3BH6A 5FV4A 3Q3HA 3JY6A 4AY2A 3NTLA 1P73A 3L6OO 4L6AA 3F3KA 4N18A 5KSWB 1Y9DA 2HU7A 1W581 3ASZA 1BE6A 3DD1A 3VUEA 2E6UX 4WZBB 5K0JA 2AYZA 2WKPA 3WIDA 3JQAB 4IJ5A 1JAZA 2ISSD 4M1WA 4ED9A 3T3PB 1AX9A 3I8XA 4FR2A 4Z4EA 1J0EA 1WG8A 1W9MA 1ZQ9A 3MXTA 4CEHA 3PWKA 3RSSA 2BP7B 1SU7A 3QH4A 4LYEA 3OLZA 1DZ3A 3BMXA 1VJ0A 3ABOB 5LYJB 5T8KC 3TK1A 4PBSA 1OT3A 2XEXA 5FPHA 4G6ZA 3IOCA 2ONZA 2VDRB 2PXAA 2G71A 2YTZA 3DC2A 2OA0A 3U48A 4CKEA 3HRIA 2FFBA 3NNNA 2ZCJA 4R3WA 3RSLA 5LP6C 3F4LA 1HSZA 2ROQA 1XZQA 3VC7A 2H51A 4EHFA 3ZZ1A 1JXOA 3QQ5A 1GZ4A 5DM70 2YICA 1OWMA 4WN9A 1WE2A 4O2RA 4S35A 2Q5FA 1S7GA 3F6PA 4Y7DA 3CUTA 5JD3A 3C3YA 4H27A 2FQ1A 2ACVA 3NXKA 5HXAA 3EGEA 5HTKA 1UT5A 3R7BA 4HVCA 3R0ZA 4LRTB 4UM7A 3QYJA 1Z35A 2CL5A 4JT8A 4DKJA 3IVMA 3NV9A 2GTIA 3AI3A 1ZXXA 3ZCPA 1JQJC 2PX2A 3IIIA 2B1QA 2DTDA 4QEZA 5SYAA 5IJ9A 3CZQA 2JGDA 3WK4A 4P93A 2HZBA 4EG4A 1EA7A 1BU5A 1O3YA 2R3SA 2X5XA 4JWKA 4A27A 4CEJA 4BGDA 2I03A 1QGYA 1PYGA 3E7WA 4URHA 2RGBA 2C03A 1YCFA 1OZAA 3RYFA 4DCGA 2HU2A 2I2WA 4NPCA 3IAAA 2FWPA 1ZJJA 5IJ0B 5JNSA 4N49A 5JAQA 1TZBA 4GI7A 5B3JA 3EN0A 4RPLA 1QONA 2IVFA 2ZUCA 3KPUA 3M4YA 2YDXA 1R8QA 1T8PA 3IEPA 3OAAD 1M2NA 2ZI7A 3T7EA 2Z5FA 5TVKA 3ICEA 1PJSA 2NO6A 1IZZA 3GJRA 3O0TA 4A1OA 2HA2A 3G9TA 5FLEX 1RE1A 2WAXA 3H18A 2RAFA 1AQYA 3WBJA 2ISQA 4B6PA 4MGEA 3W9YA 1GG5A 1K7SN 1SXJD 1N2HA 1RRGA 1WB5A 1KI6B 3A6JA 4JIMA 5AK4A 4M2LA 4C88A 4A2PA 3DEFA 4C0SA 3LZ6A 2ZRJA 1O6ZA 2C96A 4OJQA 5B64A 2PIAA 4K7JA 1OX4B 1SXPA 4LN1A 2JPDA 4D99A 5FI1B 4M8KA 3ZWKA 3A6GA 1FE8A 1TCCA 2PSJA 1KTVA 4JBHA 4P0QB 1R5OA 1ULHA 4RK0A 3A4NA 4W9NC 2MCFA 1JLLA 3FOAA 4ENVA 1O03A 1NPDA 4ER5A 2R48A 4YRIA 3W06A 2IXBA 3FYSA 4OB7A 4AWXA 5DHUA 3DE0X 1UBUS 2Z2XA 1FRFS 3HU5A 1H42A 2WHQA 3FE2A 1NVFA 4CMJA 4UPVA 1R5JA 1IXYA 5A5FA 1WSWA 2PAFA 2FDCA 4DVGA 4OFBA 3PUXA 2XMPA 1N75A 3IJRA 3D3WA 1VKZA 4WW0A 3ETLA 2QNRA 4RDIA 5LOVA 2R6R1 2LNDA 3SIRA 4N1AA 1WVIA 5HWSA 1PTJC 1PBTA 2GZ1A 1KI9A 4P3XA 2EZ8A 3DBHA 2NXJA 2ZANA 1C3EA 1J2UA 1VSUA 4I19A 5EP2A 3TJZA 4D43A 1E9VA 1FDRA 2CEAA 2MSDB 3ET4A 4XGQA 3H8JA 3CBGA 1K5PA 4ZZIA 1XRJA 4X63A 4YN3A 4C2BA 4BTEA 2W4QA 3PICA 4U2DA 2LPMA 2F3RA 2XLCA 3QXSA 1HE4A 4H1TA 4Y9DA 5D6NA 4YX9A 1EJBA 3LFHA 3K2BA 5CDFA 1AZTA 3UJBA 4JYZA 1Z4IA 3CW9A 4IGFA 2LKCA 4G09A 2NU6A 3RYIB 4ZANA 1G19A 3P19A 1NSTA 4B5KA 2X1LA 2V3CC 1UJNA 5FWDA 3A9RA 3L9WA 3MMZA 3QIVA 5G3YA 4CHTA 3NHFA 4CM8B 3L8GA 3TOSA 3BD8A 1NY6A 3SJAA 2O2IA 3LPNA 3TZHA 4F2HA 1Q0SA 2I5PO 1E2NA 5HNKA 4LZPA 3S2SA 4JX9A 3DXZA 4Q24A 5ESWA 3ZHBA 3R8FA 5AW4A 2C42A 1VFNA 4TMVA 4XGKA 4RTKA 1O0CA 1ZRMA 1X8XA 4XQEA 1UKYA 3SQNA 4FEAA 4PYOA 5BN1A 1IZ0A 1OWPA 3FMIA 1OH7A 5ED4A 3AG5A 2V3WA 4CV1A 2DBYA 1XWIA 4GP9A 5KHOC 1XG5A 3BZUA 1WD7A 2FW6A 1ISJA 1P60A 4QTZA 5CUQA 5LDGA 3QE0A 2C7GA 2YVQA 4RNCA 2JCGA 4KP7A 4D3FA 1JH9A 2JHPA 2IXAA 2BFDB 1CQWA 2OP1A 2EWWA 5H83A 1E1RA 4JLWA 1X3LA 1GYPA 2XDYA 2G9ZA 4KODA 4U00A 4QC2A 1Y6QA 2QM7A 1T5LA 1VCOA 3KHSA 1PGPA 3PQ3A 1WEHA 4KXMA 3WBBA 1PW5A 2Q9AA 3SEFA 5CAEA 2Z2ZA 4Y0NA 3GEPA 3ZHYA 3N8DA 1PEAA 4RD3A 3C1OA 1E64A 4OUDB 3ITDA 5DHRA 3FTFA 5J40A 2Z08A 4INOA 4UVGA 4G81A 3RV3A 3NHUA 4OU5A 1X7ZA 4F46A 2ATXA 4QAQA 2NYVA 3WJAA 1KOFA 2IY7A 5DWQA 2EQAA 4G84A 1CQIA 3KAJA 2Q9UA 1S8NA 4HAOA 3RVDA 5D00A 3X2SA 5EKTA 4ZTBA 1N5JA 4B3GA 1SVLA 4PRKA 4BX9A 1E89A 2RDMA 4GSLA 2H4FA 1YR8A 3HXLA 4NSNA 3Q41A 2HNKA 1PR0A 3L4SO 4O2BA 4X94A 2LCQA 2MYPA 1EESA 2ZRQA 3KV1A 1COWA 3GUUA 4KXQA 2P9TA 4I4NA 4MKGA 5DXAA 4EUEA 2IGTA 3UH1A 3TLXA 4MR8A 1ZVQA 1FLNA 5LZ5A 3TZQA 2JZCA 4MR7A 5HIJA 3TL2A 3UXMA 2NVWA 2FW0A 5D6OA 3UJCA 1HNZB 3ECAA 1HLPA 4GL2A 3DCJA 4X1IA 1HORA 1XNGA 2FFQA 2W6OA 4HDKB 1EX1A 4G8CA 4HXEB 3NVDA 4R2WA 3VZDA 4DWOA 2VPQA 2EEPA 2DR0A 3GLHB 3ENVA 4IFTA 1UFOA 3IKVA 3RAJA 2PQ0A 2HDWA 1W75A 1U04A 3KSAC 5HRAA 3WNQA 1FW6A 1DCMA 5DXFA 5HMMA 4YJ2A 1LRKA 2QTAA 5DBIA 3G68A 4J76A 4Z9BA 1TO2E 1D8TA 3M4ZA 1QK3A 2B3DA 2CJFA 2WT8A 3JWGA 3KD3A 1NNUA 2Q0QA 4ML3A 4HVTA 3SNHA 2HJVA 3LRPA 3IBTA 1WDLA 3DQZA 2G3YA 4L4RA 4UTPA 1LEHA 5T7BA 3A9CA 4C4TA 5DVZA 1ADFA 3MTBA 1SURA 4F72A 2AX4A 2DR3A 3BZWA 4CMKA 5HRCA 5TGTA 1Y3HA 3CEHA 1TXGA 2GHTA 2WSSD 1YDWA 3AF4A 3OJEA 2GBLA 2AOVA 4RMNA 1ZOIA 4ER7A 2HUPA 1O77A 2WF9A 3AT1A 1KY3A 2GM5A 3DO8A 5ERGB 4MVWA 1LLCA 3IHLA 2SBTA 4RKEA 5CPBA 4RBNA 2IT1A 5JRZA 5A71A 4DUZB 2WJVA 3HH8A 1RZ3A 3LP6A 3NJ4A 4BO1A 2C8KA 1ULTA 4RK1A 3EPPA 3U6BA 2LR0A 1JX6A 4DGSA 3NHLA 1PT8A 2Z30A 3FKSD 4G25A 5FNZA 2GMWA 3KL4A 4ZDKA 1I0LA 2GLTA 1S1MA 2GNOA 2R97A 1ZMTA 2XUDA 3KXLA 2VIIA 1QIFA 5G1NA 4Z3DA 5T4HA 1JKFA 1N2ZA 1JYFA 3WMRA 4KWIA 2YXLA 4A10A 5IX8A 5AXCA 1F7VA 3E7DA 3D3EA 3FHLA 2WA1A 1ZH6A 3DAPA 1LBEA 2Z6AA 3FUVA 1I7PA 2PSDA 3KBBA 1NF9A 3P2IA 3GOHA 3NDIA 3GJ7A 2JLVA 4EI8A 5D1HA 3KETA 3KYIB 3H5AA 5KPDA 1T1JA 2Z9CA 1DRWA 4FYWA 3OH8A 3HKDB 4RZQA 9ATCA 1OKKA 4GI1A 3ZKWA 5BPFA 4DT1A 3OPNA 1T36A 2QP9X 3NM5A 3JQ8B 3WGKA 4ZAZA 2GPNA 4O2LA 2C5EA 2GZAA 5GZ6A 1OBHA 5KNCH 1AKUA 3TGPA 1QP0A 2FQQA 1OYOA 4X61A 3EG9B 2JAWA 3BG5A 1G5IA 4F1JA 1L7DA 1P33A 4EZIA 3EAGA 3FFWA 2IF2A 4NENB 5K5EA 1DIAA 4HMQA 1I01A 3UIEA 3K16A 4IXNA 4L5CA 3EISA 3LQFA 1Z12A 4AIIA 1Z0FA 5EXPA 2QLMA 1J39A 4KE8A 4QJ4A 3QI2A 1T9CA 3QKWA 4OK6A 1XZPA 4XPZA 4MGHA 3VR2D 4BMXA 3UW1A 3PXAA 4RMHA 5KYNA 3FTPA 2BD0A 1PLKA 2JNWA 5FO0A 3ACCA 4IICA 4LYDA 2D2XA 2VPXA 3OCJA 5JXJA 1PDWA 1YDFA 1SC6A 1X1QA 2BRUC 4TXLA 5BQ5A 2QA5A 3AVTA 2CFRA 3CY6A 5LFAA 1UM9A 2A9QA 4R3UC 2JIQA 4PS1A 4L5YA 3AR4A 3VNQA 3VNRA 2UXDB 1CVIA 4I1VA 4DCVA 5GVRA 2DEUA 3K6RA 4V24A 1SKMA 2V7EA 4O4LB 1G8KA 3T1QA 4BRZA 5CDTA 5DYYA 2ZYHA 2CHFA 2QRHA 3TLCA 1DU4A 4MAMA 4A2WA 2P6RA 4WKCA 1AKRA 4J0HA 5M7EA 4R8SA 1YFJA 2X8WA 3DVAA 4RE6A 4DAOA 4FEEA 3EVZA 1A8QA 2Y0BA 3QTBA 4ENTA 4AZ3A 1EDOA 2CNLA 2VHXA 4HX2A 4O4JB 1PVOA 4YP9A 1HMPA 1F8FA 3HPRA 2V0NA 2VRWA 1X7XB 1MUUA 1Q84A 3MMPA 4KDEA 4KXVA 5JRDS 2KWIA 2VT2A 3AHFA 3UHFA 2ACEA 3PFHA 2FMHA 3OY7A 1PT7A 1HUQA 4KXNA 1C8VB 1D1SA 5T8KA 4D4GA 1C7JA 5LMCA 2B6HA 3AF3A 5EJFA 1H94A 3QPAA 2J3DA 4KXXA 3RK0A 4A8JB 3T1TA 1P0CA 2R4TA 2V0GA 1SUDA 2WJHA 3M70A 3BXEA 3CH4B 5FA5A 2DFDA 4W63A 4BUZA 1VYTA 3GB9A 2M6KA 2FZCA 4OB6A 5H8WA 3I0NA 1QK4A 2B1RA 5CH3A 5LP6A 3GYGA 4KBYA 2FB9A 1VGVA 2G36A 3D6UA 1F1BA 4JL5A 4BBJA 4ZYTA 2ZYRA 4ESVA 3ENKA 3TTSA 4QGSA 4Z9AA 4KMOA 3OZBA 4NP6A 1JQKA 2CJWA 4J16C 1LQTA 1G6Q1 1NVBA 3UYLA 4ZGWA 2FPGA 4X1KB 2I1QA 2VAVA 3G79A 1VG8A 3G7SA 3DL2A 4AZ0A 1OVMA 1FFBA 2E5WA 2QV7A 4LRUA 5IVPA 4RV5A 1ULBA 5EMHA 1Z26A 2WG1A 2PT5A 1B43A 2A9VA 3HO8A 3VNAA 5JZSA 2GJSA 1P7YA 2RAPA 4E6EA 1EGAA 1V3UA 4OAPA 2F8SA 1ZLYA 3OZSA 1JR3E 3BDAA 2ZXFA 2WOJA 3VXKA 3R41A 1Q83A 4MRSA 1DAGA 4NU0A 4WWHA 3RVRA 1BHO1 3OCVA 2FU5C 1GLNA 2GFIA 1ES9A 2VDJA 3B2NA 1C4KA 2XZDA 2ZXUA 1JG6A 4DPKA 1MO3A 4K40A 1LA2A 1TQ4A 2A3RA 3BM5A 2PWZA 3GHYA 3GLIE 4MQ4A 4TKUA 4YLGA 4D9FA 2ID8A 3IPLA 3S28A 3SEQA 1RMYA 4OHPA 3ROKA 4B8WA 3QUSA 1VLQA 2OZVA 2VATA 4UMEA 5BWCA 3NIBA 5JD5A 3C1UA 4OHMA 3EDRA 4OHKA 5EYPB 2NIPA 2XAUA 3INGA 2Z6VA 1ODKA 4BB6A 2CLIB 1T5HX 1W52X 3KNZA 4GE0A 4OHXA 4DIDA 4MEBA 2YJ6A 3DE4X 3P32A 3TQTA 3VKFA 3DV0A 3EMBA 5DLEA 1NMZA 1T4MA 1U1CA 3EGXA 1US8A 4ZVUA 1LK7A 2Z8YA 2A9RA 4O1MA 5AW8A 3BRWA 4EHIA 1W96A 2QSZA 2RGWA 3H5LA 5C8YA 5HUHA 5IM4F 3U16A 3B3JA 3CIFA 4B3XA 3LW8A 3N07A 3OF2A 1VSVA 1ZCAA 3OZGA 3QOWA 1Q92A 3WLTA 1C7FA 3MTEA 2VUHB 1ENOA 1H4SA 4MW4A 1G17A 2VJQA 4S1TA 4OA8A 2ZYWX 3GZ4A 4MI9A 5HQJA 1Z9BA 1R3UA 5AJHA 5IKOA 3AILA 4DLKA 3CVUA 4C22A 1VZ3A 2FJUA 2OK8A 4WDQA 1ULAA 4FFBA 2YYAA 1RXCA 2IA5A 3ICOA 2UZ4A 2ZP1A 4UBJA 3WGLA 2Z6QA 4ZT5A 3EVAA 2B5OA 1L8OA 2HJ9A 4G1MB 3AP1A 2O7SA 1PTJA 4Q5IA 1BTOA 1ZM9A 3FDFA 3LUFA 8ABPA 1ZSYA 1NA5A 2V8BA 1TTHA 2VYVD 3BJIC 3GNLA 1X42A 3IUYA 2HO5A 3LH5A 4XD2A 4BJHB 1LPNA 3AVVA 1KKUA 5FPKA 2ZRMA 3K0KA 5CVUA 2AQHA 3FPJA 4NYJR 3ZWDA 1EBUA 1TD9A 2H2AA 5BSEA 3IS3A 4M76B 2YV2A 3UGQA 1JZTA 1M72A 3OX2A 3GK3A 3B5EA 4NBKA 1B0PA 3GH1A 1L5YA 2XADA 3LLSA 3JZIA 1U2SA 1RMTA 2GAAA 3NYIA 4DCCA 4ZQBA 2VQSA 3H7AA 4U2EA 1Q7TA 1W0JD 4LPKA 1FRNA 3ZJ5A 2BGNA 1B2LA 1P5HA 4GP6A 2VKTA 2DJIA 2PMBA 4YV7A 2IK8A 1JSCA 4D5EA 4ESOA 4B2YA 3TTXA 2WIKA 3P2YA 1GSHA 5EHQA 4LDNA 3NTRA 3ZCVA 4MMYB 3VVBA 1ZA2A 4HNSA 1WQ4A 3HU3A 4WTOA 1PN3A 1ZX1A 4ZYZA 2VH5R 2ZREA 4BZZA 2I62A 4L9WA 5EIFA 2EBFX 4E2FA 2PA0A 3PEWA 1SVNA 1GIAA 1ADBA 2RKBA 3IBGA 3EC2A 2VJNA 1I5OA 4CUJA 3MOIA 2J0SA 1NVXQ 2PS3A 3QFFA 2MOKA 2UDPA 4QRDA 1QF9A 2BDUA 3DNMA 4QYSA 1SBTA 2DUJA 5F5NA 3AG6A 4QYXA 1AE1A 1CXZA 2JJQA 3TZKA 2WG0A 3GJXC 1E9AA 2KI5A 1NX9A 4M1EA 1Z22A 4JGIA 3L8MA 4L72A 5IG2A 3AUAA 1WL8A 3ET5A 3HR8A 3P52A 2LE0A 4XDHA 3D5QA 4QJ5A 1Z5UA 5KTRA 2IS6A 4Q3BA 5JI2E 1QS0B 2QU8A 2ZJFA 3T0GA 2O3QA 2C2ZA 2DQYA 3M4XA 1LLDA 1A5BB 1TJ3A 4IQ0A 1G66A 1M1YE 2DM6A 3EGWA 3KUDA 3ED1A 2GWRA 4X7BA 3R6TA 2QR3A 2QW0X 3RKRA 3KJIA 3V8RA 1QO9A 4V0OA 1LF5A 4YGYA 3HY6A 5J43A 1RU3A 4LF8B 3S0JA 1J5PA 2OV8A 3H2JA 3RVBA 3T3GA 1I14A 4Z0NA 1M2KA 1Y1RA 4MYRA 1ND5A 2HA4A 3I1FA 1XTPA 3HBLA 4N5HX 1UUFA 2WUEA 1KP9A 4BBAA 1THTA 5C4IA 4YMVA 3B1FA 4B3SB 3MUEA 2A9JA 2GAOA 3TNYA 4DJJA 4JOCA 2JI8A 4NJMA 2W8BB 3IB3A 1Y5IA 4ON9A 1AQNA 5DN6A 2YASA 3AHEA 2YUIA 5FAXA 4A1FA 5BW5A 1BAPA 1FOEB 3OQ6A 1GT6A 2RC6A 3ZIDA 1MW8X 5TLSA 2C2WA 3QU5A 4R0NA 3F5MA 1L3BA 1Z7GA 2WRZA 4DA6A 2IY8A 2ZRLA 1OAKA 1KORA 3B9PA 4KBGA 1DKQA 1TVKB 2EJTA 1UQRA 1CQJB 3F5QA 3IUNA 5E6SA 4JC5A 2UYHA 2WNSA 3CSDA 2G4CA 3HLYA 2V9PA 3PWZA 3ZK7A 3K09C 4UAUA 4G85A 3TDKA 1RWOA 4P83A 2EL9A 1RJ9A 4JAVC 3E61A 4C05A 2CUTA 4WERA 2QRPA 3O2SB 4YAIA 5CEEA 4ENWA 4J0FA 1CD5A 1TEZA 5E3IA 5LWHA 1Y3IA 4QD3A 4QBIA 5JLJA 4RA9A 1L1EA 3Q0TA 3CO0S 5AKKA 5EERA 1IZ8A 3B1ZA 4AX4A 1OW3B 1AKNA 4KQCA 2WKSA 3B5JA 4NMXB 5FPQA 2YZMA 3K5PA 1OZGA 1RD4A 1CNFA 1L7EA 1SO8A 1WWKA 1B8OA 1T3TA 3IRUA 2QRVB 2EFEB 1YASA 1RKBA 1N6KA 3DEHA 4BAZA 1L5QA 3F98A 3C3PA 1LWNA 4I8XA 1UBSB 4NTZA 1JYEA 4R6XA 1K6JA 3PXXA 1GPUA 5CA0B 3HJAA 1I7NA 3R0VA 1V1JA 2PDAA 3CQ9A 4DHWA 2O8FA 2VVTA 3KHUA 1BFUA 1NBAA 4QYMA 1PQPA 1CQPA 2D4AA 2B36A 3EGCA 1VHDA 3W9SA 4J7CA 4AIRA 1KL7A 1HFKA 4W8OA 5FYQA 4ARVA 3DMDA 5FQOA 3FWKA 1DC4A 1LGYA 1SKAA 4CM1A 1Q0RA 5AICA 5A2GA 2M98A 2FPIA 5I8ZA 4G4GA 4UQOA 2XDWA 1CUSA 4U0JA 1CUFA 1XD2A 2R7MA 4F8JA 4J3FA 2FGKA 4RV4A 3ZZ0A 4FCVA 5HR5A 5DGCA 2Y71A 1CC1S 3E2PA 1H69A 3N2KB 4PG6A 4XTCS 4LJ8A 5H4HA 1XDZA 4GW3A 3MIZA 3LL4A 2ECKA 4EQ6B 5IS2A 2AHRA 4PW0A 3U4QA 1C1XA 1IN5A 1QVRA 1VG0B 1C14A 3FETA 2R9VA 3GT4A 3OA0A 9ABPA 4LZAA 4OXXA 3ZGNA 1NF3A 3CHYA 1KYIA 3ANTA 4N7JA 1GNRA 1W34A 2QT9A 5D3MA 4ATNA 5JAMA 2UVPB 2HB6A 4TYPA 3MCTA 5DCUA 4BYGA 1ITZA 1NNEA 2IC5A 3F7MA 3KFXA 4RGYA 1OXTA 2FWBA 1W4AA 1TM1E 5F73A 1ZGZA 2F1JA 1PT9A 1MCZA 2X9GA 5BR7A 3HDGA 1X94A 4G0WA 4JCOA 3VPBA 4MVJH 3W6OA 2R47A 3BPSA 1SXJC 5HRUA 1BMQA 4GX2A 4MRPA 1FNSA 3NQ41 2P2ZA 3E82A 5C5IA 2AEEA 4CR7A 4CF5A 2DPHA 2KBFA 2VWPA 2Z9BA 5CFPA 4REQA 1VMEA 1AMOA 3OOYA 2BHSA 3HDHA 2BRUA 3CPSA 3TDMA 4WEOA 3TEJA 4M8IA 1NZJA 4JASB 2JJ1D 1X1AA 1RP7A 4XB1A 4YI5A 1RJGA 2AHOA 3BCSA 3HVRA 3W05A 3L4BC 4PQYA 4X84A 1U0BB 1MR3F 1X19A 1YE5A 2WHPA 5EUCA 1T5SA 5F35A 2FZ5A 4H1WA 1UBLS 1L4YA 2GPTA 3H9BA 3M5CA 2ZOSA 1L8AA 5FL7A 1FQOA 3SICE 2C04A 3SR0A 1P4JA 2CYCA 3T06B 3ZIAD 5CT6A 4OP2A 1U80A 4UTXA 4MYTA 1RM5A 3KQLA 2DT5A 1XCBA 4ETNA 3MJRA 2WMYA 3KOXA 2BFBA 1DIOB 4JKYA 3NBQA 4H6WA 3ROPA 1KI3A 4AY3A 3EARA 3LP5A 5CCEA 3FHJA 1FDWA 2H8KA 2IXDA 3AUUA 3M9LA 3D7MA 3M6LA 5KC8A 2UZ1B 1ODTC 1ZA1A 2HTEA 1XQYA 3FI9A 3HBAA 3HU1A 4KNVA 5TF4A 2QX4A 3BN3A 4GLBA 3RC9A 6YASA 3F74A 4AUEA 2XTMA 1KIAA 3VVCA 1EFCA 1RWWA 2B69A 2NVBA 2Y1OA 3F71A 1EP9A 1GRRA 5CXSA 2Z95A 5BSMA 4NEGA 1WO8A 2ZVQX 3VR1A 1KNQA 1NJGA 4QXMA 5KU7A 2BKAA 1W4LA 1XP8A 2IX3A 1K68A 1ZK3A 2VT7A 3JQDA 4MV5A 2HYDA 2H48A 3HCAA 1EB8A 3WZ2A 4IJUA 1QZXA 1Y5LA 2PWYA 4KXWA 3BQMB 5DHTA 4ZVPA 4DV2B 1QU2A 1RM3A 4RAOA 3FSJX 4WZAE 1JFFB 1RLTA 2VJLA 4J16A 5FPYA 5TS3A 2FYTA 1AD2A 1YCDA 1S0UA 1LBSA 3CLHA 2JFVA 3ZGXA 1FNCA 4RLHA 3SXUB 4GOOD 3VO1A 1YD7A 3GPLA 1I8TA 4D3DA 4TL9A 4LCBA 2P77A 4MQFA 5JFTA 5KVVA 2OB1A 4FYPA 2W6ZA 4WCFB 1XA0A 3BE6A 2BELA 1KYWA 1X7YB 1U5AA 1UR5A 1D3AA 4RH3A 4ZQIA 2NO4A 1JTVA 4D80A 4ENQA 4IJ6A 2RE8A 3FAZA 4KO4S 1ZBQA 3LWDA 3NGXA 5JVDF 1R0LA 2OORC 2PN1A 4QREA 4C3VA 5BWLA 3TG8A 1H1LA 4EG3A 1ZH8A 2I91A 3EGOA 4URVR 1UMDA 3TEFA 3KUKA 2A9OA 2JIDA 2HXSA 4QOFA 2VQ6A 1W29A 2EBWA 3OOWA 3ZCTA 5FOQA 3MCUA 5JCXA 3NVKI 4LOKA 1W46A 1Y4ZA 3DE6X 4LQLA 2YMMA 4TT3A 3SC2B 4RLQA 4D5GA 3IAXA 5FUQA 4K6GA 2O8BB 4NONA 4F2PA 4D26A 1HT1E 4YA6A 5T4BA 1V5EA 1UZLA 1ZIOA 2R6CA 3HMKA 3GLGB 1FFWA 2X15A 3WS7A 3BFJA 4QLOA 3MTGA 4CKBB 4E13A 2VA8A 1HDZA 3O4IA 1RDFA 1YS1X 3TYXA 4ZI2A 5G53C 4DG5A 3O1LA 3OICA 1YOBA 2OZKA 3G02A 1J8VA 4KQHA 1FS4A 2BH9A 1KK2A 3IA2A 4JLAA 1VZ2A 3QXCA 3MQ2A 1GG9A 4FUQA 2XZLA 3DLTA 1WUJS 4R5HA 4X93A 1F6BA 3CVJA 1Y0BA 4KN6A 5FWYB 4BLVA 1MQ8B 2GD6A 5B7GA 3K9QO 7REQA 4WVLA 2QD2A 4US1R 1NLZA 1NXQA 4GIBA 1KVQA 1XCGB 2ZK7A 1EK6A 4O1HA 1J9GA 4ZOLA 1RYFA 3DR5A 3W77A 4CM6A 1PR1A 2AR9A 2MSWA 2WSYB 3M3DA 1YUMA 4Z7OB 1Y8CA 2XY4A 3AR9A 2WU8A 1TM2A 3QLJA 2HXYA 3CISA 4JYPA 3D8TA 1OLXA 3GGDA 5LYJF 2V6MA 3CURA 4H3VA 2AG6A 4TYYA 3QTLA 4UASA 4F04A 3S8MA 3DEZA 4ZEXA 1T26A 3HADA 2NVOA 5H9WA 1Z0SA 1WV0A 4P33A 3MHTA 5C46F 2ZUEA 3RU7A 3PE6A 4EY3A 2N9UA 4A0HA 4CU2A 4XD7A 1UQUA 3IXQA 1JAXA 3NRCA 1XVAA 1HDXA 3R7FA 3ZGYA 1A9XA 1QOZA 4QM7A 4KR6A 1L5KA 2X5OA 3GF4A 2W71A 2BFFB 4WCDA 2H1HA 4LDQA 1FPQA 5TQVA 5KS2A 1QG2A 1CRWG 3U62A 1D4FA 3FVRA 3N5CA 3CYFA 3UMBA 3L4JA 1O2DA 1QFSA 1SOAA 1BMFD 3DB2A 2ZRGA 4QWMA 4P7KA 4MI6A 4BZPA 1Z6TA 5GZ1A 1CDZA 3AVOA 5LP1A 4L9AA 3JQBC 2Q8NA 4G5XA 4P1ZA 1MAAA 2QLLA 1USUA 3H86A 4PQEA 1N1MA 4FDAA 2FMTA 2BHLA 4EO9A 1Y7IA 1RABA 1WCIB 4RGQA 4IUDS 1VL2A 4JEHA 4ZYXA 3DM5A 1VKRA 2GM9A 3GYBA 4JELA 1UJ6A 1NASA 1QX3A 4BFYA 5HUJA 2C7QA 3MWYW 3P9PA 3E15A 4FGSA 4NICA 3ZU4A 3SOZA 1QRUA 1V96A 3B3GA 4FTWA 3X3HA 3NGLA 1IY9A 3IV6A 1KK0A 3PCTA 2NT4A 5DSTA 4IW3B 3J7AC 3ND5A 2QUJA 1TDJA 1YBAA 2HV8A 3KVNA 3LK6A 4L27A 4ZPJA 2NU8A 3V7NA 4K9DA 5G1PA 1T24A 2VBIA 1E0KA 2FN8A 4CTJA 2JFBA 2PKXA 2X9VA 2QSYA 2VBGA 2V6IA 3MT7A 3O7WA 1D2CA 1ODIA 3GBPA 4KE6A 4NIMA 4P58A 2CFOA 3PGXA 4CKWA 1KJZA 1QG4A 5HTOA 4EI7A 5K8CA 2D00A 1A9PA 2HOQA 4JU8A 3KT6A 2YHAA 2E87A 3PEEA 3K8OE 1EP2B 2EG9A 2C9BA 2ZG6A 3WSWA 5HVNA 2CXNA 2FW7A 1P80A 4M98A 4AY5A 4EAQA 2I1WA 3OFNA 4N4AA 1Z3IX 4OHVA 1VGRA 1X1BA 3C4VA 3PFBA 5FTJA 4RPGA 3T15A 1M54A 2WFMA 3NZEA 1W35A 3B8EA 2ZYSA 1VJRA 3GN1A 1UKZA 4ND4A 4OH7A 5DYNA 4A82A 4BLRA 4WJLA 4WXRA 2AVDA 3HEMA 4M1YA 1QV6A 2ZQYA 3C3JA 5HKLA 4YXWD 4FNOA 5AJVB 4IDQA 4NH4A 2FOLA 3NHAA 3WSTA 3HGMA 3AQIA 4LGYA 4XXHA 4Y1RB 3PEYA 1JPJA 3R3SA 4P86A 3EXHC 3I9V1 1OZHA 2Y2UA 2ATCA 4JNKA 2PTHA 2FG7C 5TDHA 2L42A 3PDIB 3LQKA 4Q18A 2WFZA 1E6EA 1NUSA 3PJFA 3NT4A 4KPFC 1WMFA 3FOBA 2OM6A 1Z28A 3CB4A 2CLCX 3GDHA 3ZOKA 2ZKIA 1BQ4A 2DQSA 3RKUA 1ZN7A 3L0ZA 3WRWA 1LZLA 2GK3A 4L8VA 1AKMA 2W6MA 1IEQA 4MA4A 4X6LA 1G18A 4BNLA 4NK4A 4QUDA 1QH8A 3GQBB 4DTCA 4DR3B 3QVXA 2XRZA 3D8HA 1EIZA 3NHSA 4EENA 2NXNA 1F51E 2JJ2D 4LJYA 5BMVA 2GGSA 2R79A 4C0HA 4W6QA 5F51A 3WGVA 3U1VA 5AIBA 5LMNB 2APJA 2EKBA 4UE6A 5FQNA 3BTSA 5GGXA 1XZKA 3FCEA 4Z51A 1URPA 3OP4A 3D3QA 2LBPA 3MWEA 3TUIC 2WD8A 3I1YA 2ACWA 2RHLA 2FUNB 5DW3A 2XCRB 2BKLA 3BL6A 3DBOB 3AJ8A 1YIAA 3QMVA 3FIJA 4NV1A 3SJCA 1QF7A 4Z0HO 5JPCA 1J42A 4U2GA 1YI0A 1PR3A 4TTRA 2P5TB 4CM4B 4RKQA 2DFPA 5FWXA 4ETWA 3WR5A 4QVGA 5HIAA 1J56A 1U2RA 4OAQA 3VYRB 1GR1A 2VUIB 2KB0A 1AK1A 4BNUA 3HZHA 5KYYB 4A92A 1OWNA 4H60A 4ODIA 4U2KA 2ASEA 1VIVA 2FPUA 2Q46A 5JS8A 3AZOA 2XMCA 3O4HA 3J81k 2TSYB 4E6PA 1X80B 3FNEA 2HA3A 2J5RA 1RVV1 8ADHA 1ZJWA 3WNCA 1P3Y1 1N3LA 3A1EA 3JR7A 2PEZA 4XA8A 4B3TB 1QPGA 3PDHA 3QV1A 2O1XA 4LY3A 4PC6A 3LDGA 2ZTHA 1IZ7A 5DSXA 2I9PA 2P90A 2QLBA 3CBQA 4PR0A 4XR4A 1JJVA 3Q0IA 3HJTA 2B1IA 1G20A 2QGFA 3KUXA 5JY6A 1CF4A 3FCSB 4MHOA 4MCHA 4U0KA 2J9XB 1Q6YA 3B13B 3DCYA 4E2WA 1GGHA 2JEYA 5TQ2B 1P6QA 3ZHQA 3F3SA 1JG2A 3SHFA 5DOZA 3D0OA 3R9XA 1F8GA 3OBBA 5CVVA 2WZQA 1P5JA 1KRHA 4JQCA 3BULA 1OIXA 3BWYA 4R1LA 3G0OA 3MGCA 4EFLA 1CEXA 2AW3A 2BZ0A 5DHAA 5IJZA 2XKKA 1M2GA 5BV7A 4I3GA 3STVA 3M1IA 4BLWA 4QUKA 4Z4FA 1UAYA 3E9MA 3ROEA 2XRFA 2EARA 1XQVA 3ENNA 2VT6A 2I87A 3ESAA 3K0AB 3ZXYA 3LQYA 1REQA 3CGWA 1RWVA 1OOEA 2Z09A 1NJ2A 4AMYA 2NSHA 1RRPA 1AGNA 5ITZB 1TT5B 1FIUA 3BWVA 2OP0A 2PQMA 2ZIGA 4OKNA 3QLTA 3RARA 2OHJA 2D6FA 2VHZA 3C6BA 2W6JD 1CUHA 3LZCA 4TV9F 1V7ZA 5ALWA 5J63A 3ZJVA 4KK4A 5FX2A 3M6XA 2PCJA 1S2NA 1UJMA 5JQWA 5J4KA 2ZATA 5HILA 4KSCA 3CJRA 4N9QA 1G2PA 2MSCB 5D2CA 2WJJA 2C9MA 2QVGA 3JYOA 4Y18A 5AVXA 4J8PA 3V8VA 5LA6B 1CK4A 3PHJA 1E0JA 5AVQA 1P2VA 1NVGA 4JSRA 4HNQA 4JWTA 1WS6A 4TMXA 3HZRA 2QRQA 4RFLA 3TM5A 4E15A 1T9AA 3OQNA 1SXJA 3ZW8A 4D9KA 1DS6A 5IKPA 3VV3A 1OLSA 4QHTA 2IH2A 3BK2A 4G4SP 3X1JA 4CMIB 3SI7A 2QIOA 2CXUA 4KLRA 3ZVKA 3SC4A 2UZAA 1QB7A 3KVOA 3SZMA 3GA0A 1Q7EA 4QUEA 3X44A 4FXPA 2G9NA 1MHTA 1OPRA 3BMQA 4IZHA 1C41A 3MIIA 4M9UA 3TWOA 1BXGA 4GOKA 3ETCA 2X8AA 3HCRA 5EI5A 5KWVA 3DLHA 3SP1A 4YMLA 2FH5B 2OXIA 4CTMA 3GJZA 3ZHRA 2H5EA 1EX7A 3Q9LA 1WUTA 3KYJB 3R3ZA 4JI0B 4MROA 4AP5A 4ZOQI 3QX9A 1U7TA 3THYA 1VLLA 3Q12A 3AJDA 1N36B 2QDXA 1X6VA 4LZWA 5L6MB 1XYVA 1CRLA 3DCIA 4MW1A 1BDBA 4DL9A 2QQ0A 3RTGA 4I81A 4M83A 4IDDA 3EEOA 4OHBA 4A03A 3OEHD 1GN9A 1C9YA 1WZEA 4IMJB 1LPSA 4V0RA 4U8GA 3ZUPA 2D06A 2X6TA 3G2LA 3HA2A 1TA9A 3N2EA 4G3XA 1R3DA 4MIEA 4R51A 4J7UA 2J9GA 5DGXA 3SJ7A 3EZLA 1ZK0A 2MSLA 2OCPA 3MB5A 4BZQA 3MLAA 2EYUA 3R3WA 5LQMA 3AI7A 2YY7A 5IT4A 1YA8A 3JD4A 4GRIA 3RRJA 3V2UA 4DV4B 4WGGA 1U2ZA 2NQTA 1QIEA 1USVA 1Y9EA 2JLAA 4QBFA 3WMGA 5CEJA 2QBYB 4W5QA 1KDRA 1FUEA 1T4BA 2OLKA 3VBEA 4ZMBA 3R1IA 5JCPA 4KFTA 3K9BA 2OV3A 3JARA 1NN0A 2G4LA 5J2TF 2A5DA 4ZREA 3GPCA 4TS4A 2Z4RA 3I0ZA 3O21A 2XVZA 4LRYA 5BN3A 4DA0A 5BUQA 1JFVA 4C0LA 5KU1A 3INNA 2JKZA 4IMIB 2RGXA 2HHAA 4KQIA 3RSCA 2RHGB 4KI0A 1GA6A 1QYVA 1G5FA 2OORA 3K9WA 1NONA 2WT9A 3NO4A 4OHOA 2I1LA 5GONA 1YZUA 3RFVA 3ZVNA 4AT1A 3D3NA 1I5RA 1IBMB 5KDOA 4UEQA 1QHGA 1DKUA 3RRYA 2IE0A 4XIFA 1WPRA 4W5RA 1TVEA 2P4UA 4MZDA 3AHCA 5B30A 2FE1A 5JG7A 2L2QA 1RI3A 2ZYTX 2B6NA 4PRYA 3NDBB 4NARA 1Z2OX 1ESNA 3UATA 4GNRA 2BAGA 1CY4A 2JGFA 2RGAA 3NOQA 4H1VA 3RUHA 1R4NA 4QTYA 4AMVA 4LE0A 1NR7A 1SC9A 2NV0A 2X7HA 4O4LF 4MA5A 4HS9A 3CNBA 5AM5A 1AMNA 3VU9B 1IN1A 2NU9A 4DBVO 4KNWA 4GZLA 2EBUA 3ZK8A 4A9AA 4FBMA 4BCBA 4Z1MD 1Z7BA 1M2VA 1RBYA 3RSOA 3RSFA 5ER6A 3MPOA 4K03A 2Q07A 5L3SA 2PHZA 4BO3A 1NW9B 1Y1PA 5K6RA 4BFXA 4WNYA 3QTTA 1T4CA 1VJCA 3I2KA 3OKPA 1P5RA 3QNUA 3OPYI 3IDAA 4JT4A 4KVGA 4IUCS 2ZCUA 3RLFA 3L0CA 1MV8A 1N0IA 2QRJA 2ZSAA 3G8BA 3A6HA 1FTQA 4MKFA 1CF2O 5FBQB 4R01A 3C6KA 2XCTB 2BZ1A 1E1LA 3PWSA 1ZIYA 4NU6A 2WZCA 1VE7A 3O94A 1CZNA 1R4MB 3PSAA 4JA0A 1VPTA 1TW3A 2P67A 3QK7A 5EJ6A 4DR7B 2NO5A 3CH5A 3FNQA 1GNLA 4NE7A 1OXUA 1SUWA 3CSSA 2WMOB 2XRMA 2PUVA 3O73A 1P91A 3JWPA 5IEJA 1OHHD 3LW7A 5DNAA 5BYJA 4X1OA 5U9CA 2ZRNA 4AZVA 3KYBA 2PUBA 4HB4A 5EPUA 1EUYA 2H3EA 4U4AA 3O4JA 3HUDA 1E5LA 5JRJA 1QDEA 5EIEA 4GKKB 1WMDA 4TLDA 1AB6A 2ZB2A 2OCIA 4RJJA 1DO8A 4MRVA 2F64A 3Q9NA 4ERXA 3VNVA 5F77A 2HYIC 2PKQP 3JQBA 2J7KA 1XNHA 1N0HA 1UC8A 5PNTA 4BLTA 4FZJA 1JZQA 1Z62A 2EGUA 2FNAA 4PCLA 2QU7A 1DAOA 2JD2A 3I09A 4XFJA 1ZEMA 3UK1A 2PUDA 1JJAA 3IKMB 3NG1A 2XXJA 3A9VA 4DR6B 1ZI8A 4BO5A 4EF5A 2R1ZA 3DOHA 3UK2A 1Z5OA 1BJTA 5JXHA 1LBTA 4WK0B 2ZWAA 2WSSA 4Y9TA 2E4VA 4KXYA 5CBPB 1SBQA 3V5NA 5BV1A 1JHVA 5HG0A 4DQDA 5KOJB 2H63A 1XYYA 3UWOA 3VR4H 3IUSA 5AQ1A 1RC1A 2YNMD 2YY6A 1L4LA 1Z07A 2XQIA 4LZZA 1PX0A 1GILA 4PVDA 4WLOA 4W1RA 3E3LA 5K09A 3WP0A 2FAXA 2B1JA 1Y33E 4MKHA 1EDEA 3HLTA 4LOJA 4MW7A 5FB3A 4YBZA 1BH2A 3FKSA 2C84A 3R9IA 3CVVA 3WIEA 3C3DA 5GV8A 4BNTA 1WXEA 2VAMA 3P9NA 5CNKA 4FI3F 5HKKD 3EPJA 1F4PA 1XROA 1UPBA 2BM1A 2F3TA 3FLAA 1EG2A 1P9WA 3E35A 4D81A 2D5LA 4ALIA 1DB3A 3WYBA 1YRAA 4O3FA 2FUG1 1E79A 1ETHA 4QIHA 3TUZC 5F3RA 5EJMA 5LC1A 1RT9A 4H18A 2Y4NA 3FF4A 2XRYA 2AV6A 4I6JA 2X8LA 1EH5A 1T9KA 1IXSB 2WU1A 1HC7A 3CUEF 3T3MB 1QFZA 2MINA 2DQKA 4FT4A 4KG7A 4C7JA 4ZAGA 2O2JA 1XALA 3B5IA 1NC1A 2WJAA 1XEWY 5ALQA 5K8LA 5I3ZA 2AFHE 1EWRA 2RAVA 3V4ZA 4U7DA 2ZSIA 3WHPA 1YB4A 3HABA 4WXYB 3JAWB 3TZCA 4XLZA 1Q0HA 3RIEA 3HFGA 2ZBPA 3ZKAA 1XNRB 4RD6A 4RY0A 4DA4A 2IUYA 4JMPA 3OCCA 2QZSA 2DOKA 4RADA 1Y8ZA 4K2HA 2OZLA 4I1SA 3ZEAA 3CLTD 1GKUB 3L1UA 3RT9A 1R64A 1L7NA 4WJZA 1RPTA 5C53B 3EUWA 4A2QA 2X0IA 3AIIA 4BRWA 1A9SA 1WU7A 1NRJB 1X1EA 2JATA 2NU7A 2X0RA 4PV7A 4TLLB 3VR2A 2EFJA 2I8CA 4HGRA 2O8DB 4XUDA 3REFA 2BC9A 2HJHA 4IIUA 4BJ6A 2FSUA 2X86A 1N9GA 4YMIA 4F2GA 2VQDA 5JAPA 4P2BA 4L02A 1LSSA 4DIEA 4RNDB 3OPQA 2IOFK 2PLNA 3BMNB 3DOOA 3RRBA 1T0BA 3T3OA 5LOVF 4RENA 2JCXA 1YZQA 4DNPA 5KINB 3T7KA 2CCJA 1F9AA 1KSGA 3UGJA 2XTAA 1EGMB 1USIA 1VB3A 4MCAA 5J47A 1P7CA 1R6XA 1PZXA 4MW9A 4NMWA 4O25A 3VO9A 2P30A 3C5WP 4C20A 2HQBA 3UUEA 5KMGA 2AG5A 1OXXK 2FPRA 4HFMA 4JYAB 4LQCA 1NKTA 4L9SA 4FZVA 3SS7X 5HGJA 1KMHB 4L5AA 2PBRA 3ZV6A 2PPLA 3EQ8A 1L8XA 4R1SA 1QK5A 5DM4A 1WTCA 3NEPX 2I2XB 1WHTB 4IGKA 4GLOA 1XLVA 4GWGA 3WIOA 2PZFA 3PQ4A 1E9EA 4WOCA 3K0EA 3WWZA 4KNYA 1UWKA 1MOZA 1FSGA 4YQEA 5C5DA 2BR4A 2GBGA 2QVZX 2XHEA 5F4BA 5DNYB 2H08A 4NFHA 1B0UA 2W22A 4HXGA 5EZYB 2R6GA 4G5GA 5AR1A 2WYOA 2WSIA 1JHRA 4QDUA 1J20A 2R8PA 1CEEA 1W19A 4G1VA 4QPCA 1KVSA 1YZKA 1N3IA 2NTNA 4LV5B 4ZXFA 5HMLA 1F48A 2VPTA 4BNIA 2R5FA 4CIWA 2GASA 3FB1A 5IDXA 1VJ5A 3NTUA 1Q50A 4XUEA 4B1FA 3R5XA 1U2TA 2W90A 5I7UA 1O96A 1Y1SA 3G2NA 1TKRA 2VNAA 3GP3A 1G8PA 4XGRA 1WZIA 5ALTA 1BA3A 5EAIA 4N0EA 2YWCA 2CLMB 2Y77A 2JZNA 2R7AA 3DZBA 2IIBA 4L0DA 3UG7A 3WICA 5I7FA 2O8NA 5L40A 2H17A 4Q66C 4LRSB 1FFSA 2C92A 2OAP1 4KQWA 3C4JA 4DCNA 4X8LA 5KWJA 4F4HA 3O26A 1RTKA 3DXXA 2E18A 3NBAA 3FDZA 4KRYA 3T5BA 4QUHA 2AYYA 4HFJA 1A4RA 1ATIA 1YBFA 4EPVA 2AD5A 1UPFA 4P82A 3W90A 3ZNOA 4BNVA 1JKJB 1WBDA 1F3LA 2R5WA 3TNJA 3JZFA 4NJOA 3D7NA 2R60A 3IR6A 3TBFA 5IRCD 1IG3A 2KS6A 1H1TA 3HJNA 2HZ7A 3VZRA 4F96A 5TT0A 2ARKA 4CIXA 2CHVA 4UFNA 1FSZA 5H3LA 5HKOA 4RM3A 1PZHA 2WDZA 2GZ2A 5BURA 4OLAA 1KOJA 1ZOOA 2UVDA 2X6QA 1HDIA 4KIFA 2D2EA 3KSZO 3N8HA 1SD2A 4M53A 4DR2B 5G3ZA 1ICEA 4I1PA 1B8UA 4H7PA 3H5IA 5AMXA 3DZCA 4B6JA 4C3OB 1E6KA 4KTVE 2NQ8A 4IQFA 3ZS8A 4CF7A 2J5QA 5CD1A 2RGNC 1NW5A 4EVRA 1AKTA 3DMYA 4HPJB 1QP7A 2ZI3A 5HIMA 2BW0A 2IHNA 2QY9A 2CVOA 4PG7A 2VJPA 4M7WA 4QJIA 4IIBA 2JAHA 3LLUA 2JG3A 2C94A 3EF1A 4KFUA 2YV4A 5KJFA 2HBRA 5D5QA 4ZCRA 2H1CA 1YCHA 3ZWCA 2O2GA 1DMSA 2JLXA 3D0KA 5REQB 2Q27A 3L7KA 2GFQA 4ROTA 4FQ7A 3HHPA 1G8YA 1Y8RA 4F91B 3A1FA 1V2HE 5A06A 2HM7A 1VL6A 2ODWA 4I9FA 5HE9A 4C3UA 2VYVA 4CM9D 3T1NA 3NRBA 4NPHA 4RE5A 2DQ4A 2PBFA 1O87A 2DP4E 2KLBA 3WTCA 2AWNA 4GBJA 1Y7HA 4FR0A 4MWDA 4II3A 2JBHA 3MCVA 3CPEA 3O3OB 1YZTA 1TIPA 1AOXA 3OZTA 3CN9A 2MSNA 3E9YA 4JNCA 1L7AA 2B25A 3TBKA 4D8WA 5A3VA 4ZHQA 1QMGA 2J3IA 4INPA 4AG6A 4K0KB 5B6IA 3BB1A 1NX6A 2A1TS 2GAFA 1DQSA 1JU9A 2P9ZA 1W0JA 3HP1A 1XZJA 3HJFA 2GUWA 4XI9A 5LIRA 1IWBB 2JGKA 3V4FA 2PU5A 2PS0A 5CJPA 2OBNA 4UXHA 5CTAA 5ALHA 3PLNA 2J0VA 3PFIA 1R9GA 3V48A 4ZVTA 3H1BA 2QYHA 3CX6A 1T29A 3I9KA 4QDOA 5CW2A 5EMLA 5FYDA 1L4UA 1SRRA 3KZCA 4E22A 5IVDA 3O1IC 4AS3A 2BTEA 1NBOA 3ZLVA 1NXWA 4AM8A 1YRHA 3UT6A 3JATB 2OGUA 4GOND 3CLSD 4KYVA 4DPLA 4EY5A 2GVDC 2O3TA 2P9GA 3QE3A 3T4XA 3INTA 5C80A 1X39A 2P9BA 4Q21A 1HE1C 2EFCB 4GICA 3VPGA 4TZKA 3AVPA 3ZW7A 1PTKA 1KYZA 1LV7A 4IEFB 5IAAA 2P3SA 3FTEA 4LJ7A 3JVUA 2AJBA 1QIMA 4EPWA 2V54A 3A10A 4FOTA 3ABIA 1S1CA 3K6SB 1NJ1A 4J7XA 3AM1A 1SHZA 1BG6A 2DJ5A 1YACA 3VU3A 3BD6A 1MJ5A 2R6DA 1U6IA 1UMCB 4H9GA 1ZR2A 1JDVA 5A1JA 4TPKA 4RTOA 3ACDA 2AH5A 2HSJA 4XWYA 3UK6A 2WJ6A 3BHIA 2WSBA 3E9EA 4ZPXA 5KX5A 1F60A 3Q0EA 4MB6A 2VDOB 4ZRMA 2IHBA 4XEUA 3HU2A 2ADFA 5F33A 1WW3A 1XD9A 3DSRA 3RSHA 4HLUC 3U4IA 4BAUA 3PYLA 5FEMA 5A3JA 4DBLE 2ZRPA 1IRXA 3L84A 1PR6A 1UXJA 3FFXA 3P4YA 4WV3A 4NZPA 2COKA 5CR9A 1G6HA 2PMDA 1TMKA 3B2EA 3USCS 3CH7A 2VTBB 2HY7A 4BQOA 2QTMA 2B4AA 4MUYA 2ATVA 1IHOA 2ZJ7A 3GI1A 5H82A 1SVSA 2RH4A 3DQPA 3PNVA 2OCKA 4QNRA 1QIGA 3SM9A 3O8OA 2PLFA 3WX0A 3L93A 4DM4A 3BYZA 4WXHA 2YUTA 1FP4B 1QDUA 5B58C 3FTDA 4G89A 2RD2A 4OQLA 5K3AA 2JIRA 1A96A 3EWAA 4YT4A 2XXAB 4EA7A 1JEAA 2F8MA 4OA5A 4X8MA 4F6CA 4UE3S 2IZ0A 3AF0A 2VSQA 4X41A 4XARA 4KLAA 4Q48A 4B35A 4AAYA 4LOLA 2C97A 2JGNA 3IKLA 3N53A 4I55B 4S12A 4ZVKA 4LG1A 4KUEA 4XM0A 3D8UA 4EAAA 2J3JA 2XB2A 1VDZA 4MEAA 5FLXA 3MTDA 2OV4A 4LGVA 4PSKA 5IZ4A 4TN5A 2V6FA 3HB0A 4IKEA 4HZUB 2FP4A 3E9NA 2R85A 1G3UA 2Q5EA 3C74A 3NUZA 5LLSA 1WSBA 3WOHA 5KTPA 3W9UA 4JITA 3PL1A 4Z0TA 5DTQA 1YR2A 1C4OA 2Q3DA 3A7EA 5BN4B 3S70A 4UTRA 1T0IA 2QZ4A 1D04A 1A9YA 4ZQFA 3WWCA 3O9VA 3SX0A 2WJYA 2QT1A 2R8EA 3D0QA 2ZYDA 5DX0A 4EGAA 2GF2A 2ODAA 3C1TA 4MYHA 1O5TA 1RFGE 3N2IA 2AOWA 3OESA 3U39A 3ZYCA 5FUXA 3WK5A 3BD7A 2Z8ZA 3U7QA 4NYIQ 4HYQA 3WWDA 4KEAA 3CLUC 3DMPA 1DEKA 1ZKDA 4PZ0A 1MENA 4N3GA 3KLMX 1HLDA 3LXMA 4BFWA 2I33A 1SIUA 4QLBA 5LP6F 4YJ3B 4BVEA 1QCCA 1Z75A 4Z6KA 1E0DA 5E4JA 4C2TA 2WJ3A 1I2CA 1JJFA 2OHHA 3B6EA 1TZ2A 4MUMA 4UEKA 4TTQA 2IEYA 3USES 1NG9A 4A5OA 4C4AA 5IK2D 2QQFA 1SZCA 2DBZA 2NV2B 4FKBA 2ZSEA 4F56A 3JQ7A