1N3LA

Crystal structure of a human aminoacyl-trna synthetase cytokine
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
339
structure length
332
Chain Sequence
APSPEEKLHLITRNLQEVLGEEKLKEILKERELKIYWGTATTGKPHVAYFVPMSKIADFLKAGCEVTILFADLHAYLDNMKAPWELLELRVSYYENVIKAMLESIGVPLEKLKFIKGTDYQLSKEYTLDVYRLSSVVTQHDSKKAGAEVVKQVEHPLLSGLLYPGLQALDEEYLKVDAQFGGIDQRKIFTFAEKYLPALGYSKRVHLMNPMVPGLTGSESKIDLLDRKEDVKKKLKKAFCEPGNVENNGVLSFIKHVLFPLKSEFVILRDEKWGGNKTYTAYVDLEKDFAAEVVHPGDLKNSVEVALNKLLDPIREKFNTPALKKLASAAYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tyrosyl-tRNA synthetase
publication title Crystal structure of a human aminoacyl-tRNA synthetase cytokine
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 120
structure length 332
sequence length 339
ec nomenclature ec 6.1.1.1: Tyrosine--tRNA ligase.
pdb deposition date 2002-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00579 tRNA-synt_1b tRNA synthetases class I (W and Y)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.240.10 Mainly Alpha Orthogonal Bundle Tyrosyl-Transfer RNA Synthetase Tyrosyl-Transfer RNA Synthetase 1n3lA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1n3lA01
1A8HA 1RQGA 1JMVA 3PXUA 4MULA 3TQOA 3A4IA 2AG6A 1O97C 2A84A 3HGMA 4QRDA 4ZT5A 3RJZA 3CLSC 1EFPA 3D6UA 2HGZA 4PBRA 1ZUNA 1B6TA 4NDAA 3MXTA 1ZH0A 4QREA 3PRHA 4MW7A 2QUKA 4EG3A 1H3EA 1NYLA 2OV4A 4JXXA 1JILA 3CLRD 1OBCA 3CLUD 3ZJUA 5IHXA 2CUZA 4MWEA 4MW5A 1O96A 2ZUEA 1WKBA 4PY2A 1FFYA 3TZLA 2JA2A 2PZ8A 1GTSA 4MVCA 3CVYA 1EJ2A 2V0GA 3IMEA 3DLAA 5DB4A 3IOCA 1TEZA 2HZ7A 3TQIA 3UOWA 4K0RA 4R2MA 3CVXA 4Q93A 2JANA 1U0BB 3GLVA 3A05A 1J21A 2QJTA 2A1UA 3UY4A 2AKEA 2J08A 1QRSA 2IJGX 4KR9A 2J07A 4ZT2A 1S4MA 2D13A 3OP1A 1VBNA 2Z08A 1I6KA 4OJMX 4DE5A 1YI8A 3TNJA 5HUHA 1WY5A 4MW4A 1WXHA 1Q15A 4HJXA 1G8GA 1G59A 1BS2A 2I1LA 3FY4A 4MUIA 4HJRA 4K03A 2EL7A 1YIDA 4MW9A 1YIAA 4GU5A 1O94D 3HL4A 1X6VA 2X3FA 1OWPA 3PNBA 1F7VA 3L93A 4MWCA 1N2IA 2YWCA 2QJOA 2AZXA 1NUQA 3AFHA 1O95D 4WNYA 2GOYA 1IFXA 3G59A 4ARIA 1YULA 4NATA 4ZCTA 2ZUFA 4MW1A 4U63A 2G36A 3QTBA 2C5SA 1U3CA 2X1MA 3RK1A 1ZJWA 3A2KA 2DR2A 2VXOA 5H7XA 4EGAA 2YY5A 4YP7A 1EFVA 4JYZA 2A1TS 3FWKA 4ZT6A 3FG9A 1N2OA 3H9BA 4I6GA 4MUJA 5J58A 4EG7A 4XFDA 4TS1A 1LI7A 4MVWA 4WSOA 1MOPA 4G5FA 3FDXA 1Y42X 3PNVA 1V8FA 4L2IA 3DV2A 4ZT7A 1KAQA 1KR2A 4MVYA 1JIIA 4JXZA 3NV7A 4EG4A 4KKVA 1XJQA 1JECA 5J59A 3MLAA 3A04A 5DASA 4YP5A 2DXIA 1J1UA 1V47A 3SZGA 3N2YA 1GLNA 2BYTA 1Q19A 1KP3A 3Q12A 3KT0A 3AIIA 4MAFA 4KPUA 3D6VA 1JEEA 1QU3A 3MUEA 5KWVA 3UMVA 4ZCSA 1T9GR 1TYAE 1N1DA 2DUMA 2H2AA 1R6TA 5DK4A 4MWDA 3HFJA 1F7UA 1QU2A 5K0TA 1T6ZA 1KKUA 1G8FA 3GUZA 1IQRA 4KPUB 3CLTC 4F3RA 1R6XA 2Z09A 1DNPA 1WXFA 2YXNA 1VL2A 4F4HA 4AQ7A 2QTNA 1KH1A 3GMIA 4NZPA 3INNA 3SP1A 3CVWA 1M1ZA 1MB9A 2DEUA 1EE1A 1GPMA 1O0CA 1GTRA 3JXEA 3IUBA 1JZSA 1UFVA 4EG8A 3IUEA 4MVXA 1MRZA 5HUJA 2NSYA 1KORA 1WQ4A 2V0CA 1P7PA 1T6XA 3AG5A 2YWBA 1MJHA 4J75A 4R2LA 3MMXA 1J20A 1WOYA 4KR6A 3S3TA 1PFVA 4ZCRA 1OD6A 1PFWA 4MW2A 1Q77A 3NBKA 4OUDB 3RK0A 3ND5A 4CDNA 4G6ZA 3LE8A 3KT3A 1JEDA 1JZQA 4R0NA 3M5WA 4RUKA 3SDBA 3HMQA 3IMCA 1M8KA 2QUIA 1GAXA 2EJCA 1VBMA 1O97D 2GKSA 2CT8A 3SZ3A 1K92A 3ISJA 1OWMA 3BL5A 2QTMA 3CLSD 4EG5A 1MAWA 1YUMA 1TYDE 2CYAA 3IVCA 1PG0A 4Q16A 4YBRA 2XRYA 1ZH6A 2CV1A 4XFJA 1IVSA 2E0IA 1JIJA 3COWA 1KQPA 1N2HA 3IODA 1N2JA 3UK2A 1MAUA 4J76A 2D54A 2O5RA 3H97A 1U7DA 1OWNA 4ND6A 5J5AA 4DNXA 3C8ZA 4NAHA 5H16A 1MBZA 2H29A 3SYTA 4CT0A 4ZCPA 4X0EA 2OQ2A 3IH5A 1PFYA 5IJXA 1EXDA 3FHJA 3ZJTA 4MUFA 3P0IA 1I6LA 1TFUA 4HPWA 2A1TR 4ND7A 4MLPA 1K4MA 1QRTA 2J4DA 2A4MA 5K0SA 2X1LA 4MW6A 1IH8A 4A91A 1OWOA 4EG1A 4CQNA 4MQ6A 3VGJA 1F4LA 2WSIA 4P2BA 5HG0A 1IHOA 4DLPA 1MC1A 3ELBA 1XNHA 4UZEA 3ND7A 3DO8A 1D2RA 3COYA 1QQTA 3HV0A 3K32A 3FI0A 1PG2A 3AL0C 2GM3A 4JZYA 1NUTA 3IVGA 3AKZA 3H99A 4U8HA 5BNZA 1TYCA 4DDKA 4ARCA 3CLRC 1M8FA 1EUQA 1O5TA 1N2EA 3CLUC 3N8HA 2VTBB 1NURA 1N3LA 4EFKA 3ILVA 5FO1A 3G6KA 3X1MA 3Q4GA 3X1KA 1F9AA 5LLTA 3HZRA 2QUHA 3SEZA 3VU8A 3QE4A 5TEWA 1VBKA 4H3SA 1IQUA 1WXIA 1J09A 1CT9A 3FNRA 4ZCQA 2WB2A 2CSXA 1K4KA 5LFAA 4FZJA 3DPIA 1QNFA 4MUNA 2ZP1A 3G5AA 3Q10A 3CVUA 2R5WA 5DEOA 4KR7A 1M8JA 5EKDA 1IQ0A 3E27A 4DDHA 1WZ2A 2TS1A 4G5YA 1WJGA 3COZA 3KFLA 4MUHA 4ZT3A 3KT6A 2A88A 3ZXSA 1Q11A 1JIKA 1H3NA 2DERA 3FETA 1KH2A 1XNJA 1TQ8A 5LM3A 2E18A 1EUYA 3IOEA 1QRUA 1ULHA 3MLBA 1KH3A 2PIDA 1MB2A 2J5BA 1KAMA 1FYDA 3ND6A 1T9GS 3COVA 4PBTA 4QBTA 1M8PA 2WQ7A 3ZXIA 1QTQA 1COZA 1NUSA 4OUDA 1VLHA 1HYBA 2X0KA 2CV0A 5FNZA 3PNYA 1O94C 3IVXA 1EFPB 1R6UA 1YUNA 3OTWA 1ILEA 3RBAA 4NX2A 2CYBA 1O95C 4MUKA 1NUPA 1NSYA 1H1TA 2E21A 5TEVA 4DJAA 3NBAA 2Z3VA 4S1OA 1NUUA 3X1JA 2CYCA 3N9IA 4EG6A 4NAUA 1WXGA 3K9WA 3FOCA 3IDFA 4U7JA 1O96B 2A86A 4JFAA 2B7LA 3CLTD 3ZJVA 1I6MA 3IMGA 3ZIUA 4EF6A 1J70A 3KT8A 3H05A 5TS2A 2E89A 4PBSA 4MUEA 1J1ZA 4MWBA 2A7XA 2PXHA 1QJCA 1KQOA 3QTTA 5F23A 3IOBA 2PG3A 4I6EA 2A1UB 3FH0A 3L92A 3RFFA 4MW0A 4I6JA 1TYBE 5KCMA 3ZUGA 4AS1A 3F3MA 3H9CA 3P0JA 5FO0A 1NI5A 2XRZA 4CDMA 1T6YA 4RPIA 1WQ3A 3CVVA 1IRXA 1OWLA 2BTEA 3CA8A 4XSVA 4HK4A 2QJFA 1H3FA 2WQ6A 4YP6A 1N2GA 2QTRA 5KHAA 4GRIA 1M8GA 1M83A 2DETA 2VTBA 3TZEA 2QUJA 2D5BA 2PZAA 2IP1A 1N77A 1SURA 1GN8A 1U3DA 2RE8A 1X8XA 1K97A 1N2BA 2CV2A 2NZ2A 1G8HA 4E1AA 1N78A 2J09A 4MUGA 1KQNA 1LI5A 2O8VA 3CR8A 2HMAA 1U7XA 1KP2A 1LW7A 5AHWA 4BWVA 2DPLA 1JHDA 3N05A 3AG6A 3VRHA 3ZGZA 3U1VA 2DLCX 2JAXA 1NP7A 3RHSA 3P0HA 1EFVB 3LCJA 1NZJA 3UC5A 2PZBA 3SEQA 1GZUA 1OBHA 1WXEA 4DDMA 5JBNA 1JGTA 1O6BA 2PFSA 2CFOA 3LOQA 2RD2A 3I05A 3TS1A 4YMIA 4UZFA 1PFUA 3P52A 5TGTA 4L2IB 1N75A 3FIUA 4ZT4A 1XNGA 1I2DA 2IELA 1O0BA
chains in the Genus database with same CATH superfamily
2RHWA 2GLUA 4KAFA 3LGAA 3E4CA 4MULA 1VKJA 1Z36A 3RS4A 1Q0TA 1GP2A 3MYYA 4W5QA 3TZKA 5DTIA 1INLA 1DBRA 2QLFA 2GM5A 4LGCA 2XQJA 3LWZA 4MQ5A 1H5UA 2FU5C 4IJUA 4PBRA 1EJ0A 1GFIA 1LTQA 3D1JA 3Q1KA 4EPVA 1CUCA 4TWJA 1FLDA 1P7CA 1T9HA 1N2SA 5AJXA 2IOYA 5F9HA 3CRRA 2PGOA 4YK7A 2IEIA 5JAMA 3L7AA 3HPQA 3VI3B 1GGVA 4D8YA 5DLPA 3HO8A 4G85A 1RAGA 3EWIA 5I4BA 3CCFA 1NR7A 3UXYA 5ALDA 4N65A 5TS3A 3ADBA 3HKCA 4EJSA 4LZZA 1RM5A 1A4XA 5KHOC 3OLYA 3E23A 2RGGA 4BP1A 3SC6A 4V0SA 1WUKS 1Z7YA 4CFSA 2H7CA 2WU8A 4HDRA 4G0NA 4RVNA 5I7VA 2WFMA 1VE7A 2FMKA 1RHKA 1DZIA 2X5XA 4G0ZA 4I3GA 3SS9X 2JIDA 1MVNA 2YJ4A 3SIXA 2AG0A 3EOAI 4X8LA 3HKCB 4EJSB 1EWKA 3JRXA 3LX8A 5HJEA 2VYVA 2XQGA 3I5AA 4XD2A 3WBKA 5CCBA 5H1YA 4GH5A 4HDRB 3G2HA 4BCBA 3A3KA 1E2LA 1TW2A 3D64A 2J07A 4QPPA 4A1FA 4FS3A 3E3MA 1KNXA 2HRQA 4MV0A 2FPXA 4WLVA 1QVAA 1W2GA 4TN1A 4U9HS 1TMKA 1I6KA 5JSKA 4OQQA 1BU8A 3STXA 4EUFA 1PQ4A 5HF6A 1DPGA 3BWCA 3LLMA 1WY5A 1ZKMA 2ZUUA 3KTAA 4FYMA 4HDMA 4TXNA 2BEUB 1AGRA 2RBEA 3H1PA 1LLDA 4UJ5A 1V8BA 4LY9A 4WA8A 6YASA 4BNIA 4TV8A 4DQDA 2WUVA 4PNPA 3T7TA 2CNLA 4QDUA 5KOIA 4MUIA 5C34B 5DCUA 1M7BA 3HDQA 2VP6A 4RD0A 1ONPA 2HO4A 2WJIA 3ISVA 4XQ0A 4YO8A 3GJ7A 3TXYA 2J67A 2ZANA 1YASA 2DOKA 3O83A 3UZUA 3D4OA 3KEMA 3KTAB 3HB7A 1HDEA 2VT7A 4DCMA 5AVXA 2JI8A 2VJMB 3GX1A 2OHHA 5H3LA 4GKVA 1T0BA 3O1JC 3FUWA 4TLDA 3B7GA 1NWHA 1YDMA 2WWGA 2H06A 1KSFX 5D6NA 4CW7A 4DEYA 1KJNA 3C3YA 2A9KA 4ZP1A 4CTJA 5BOSA 2SECE 4C05A 3MCUA 9GPBA 5KTPA 4OFZA 1SOWA 2G36A 1IXZA 2ZE8A 4N01A 1UBTS 4EA8A 3OAAD 1JR3D 1WSBA 1JJ7A 4BFSA 4DSNA 3V7YA 2QSJA 2VXOA 3UJ7A 1RLIA 4FDVA 5I4IA 4GEGA 3O26A 4JYZA 2BBWA 3O7MA 3R76A 1ABEA 1LDNA 2QGFA 2ZPUA 4IZIA 3IPYA 1PW7A 5J58A 4J7AA 1AHNA 1WDMA 1ZUIA 2BBSA 2ZBQA 3L8YA 3OFSA 3OIUA 4OQFA 1I2CA 4N7MA 1LI7A 3SZLA 4MS4B 1R0LA 2C4UA 2JLRA 3JAWA 3U4GA 1VCIA 1Y1KE 2ANBA 2QD1A 4J6EA 2LVBA 3I37X 1U8YA 3HVJA 3ZY4A 4QDOA 4W8GA 1FDOA 2HJWA 3GT3A 2OFXA 1QYIA 1CZNA 2OFPA 3WHLA 3IAS6 4PYOA 1TKRA 4ZVKA 4ZMSA 4X92A 4M3NA 3E9MA 4P98A 4L8WB 3DDZX 4A0FA 5IABA 2JW5A 3CQ9A 4M1TA 2AOUB 5GVSA 1XLTC 3V8RA 1ZJZA 3BJMA 1OX6A 1SQ6A 2PLFA 3PDJA 5AHKA 4YP5A 5HEKA 4E33A 1V47A 1ZN2A 3HA7A 5F51A 4GE3A 2DY1A 1UBUS 2YHBA 2ZT5A 1X8KA 4XD7D 4RJTA 5CGQB 4HNTA 4WK6A 4WOBA 1RPAA 1FE8A 3F6BX 1QK5A 1YDEA 1P5HA 4X7BA 3DULA 1A7AA 2KS6A 5EZ6B 3MUEA 1AA6A 3D8UA 1VLZA 4JJGA 2D2IA 4FFBA 1YJXA 2RI6A 3HWSA 1T9KA 3A6EA 3OE7A 2QZJA 3IURA 4I5EA 3H1GA 3O8OA 4MWDA 3KDPA 2YJGA 2PLNA 4LMPA 4L6IA 1J0EA 4J0IA 3G17A 4RE5A 5F33A 1Z2DA 2OK7A 4AFNA 1VSUA 2M98A 2ZAIA 3FI9A 2ZIXA 4LXQA 4YAUA 4JI8B 5AVUA 2HT1A 2ZTMA 5DTEA 2RI0A 4Y1RB 4V3CA 4EOGA 1GGKA 2BEKA 3P4UA 5JMOA 2FG6C 4LA4A 5IP5A 3CNEA 3EYWA 4D4GA 1ADFA 1IE3A 5AM0A 3O8QA 1C0KA 3PDCA 4D6YA 3EGXB 3FROA 3T3HA 2VSNA 4DIFA 2QM7A 4C01A 2QPAA 1Y1TA 5HTOA 1TZBA 3IUEA 3IP3A 3SBXA 2ZIXB 1FDSA 2EARA 3DE7X 2RI1A 3PNSA 4TS9A 3BSWA 2JLYA 1NDUA 2Z30A 4GICA 4ND1A 5CW2A 1SCNE 2A14A 1R88A 4QOHA 5IH3A 4CIDA 3H9QA 1OX4A 4IDGA 1P7PA 2WJHA 1QUFA 3N3AC 3K73O 3OZDA 1XKLA 1YVEI 3DBLB 4OL0A 5CU7A 5EFOA 3D8NA 1FMCA 1Z68A 5CHEA 4ZQCB 4CYMA 1BNCA 2ZWOA 1WBJB 3V55A 2D3TA 5AP9A 3TJMA 5KU7A 3TR5A 2DQZA 2R5NA 2Y1GA 3VDRA 2XPCA 5KCZA 1RWWA 4LTDA 2PSFA 3S3TA 5FIUA 4X85A 2QU8A 3HYTA 1ORIA 5ECYA 1A98A 1VGVA 2KHZA 3DZ8A 4AZSA 4QEDA 1D09A 2PKCA 3QIAA 2IUSA 3DTVA 4UTPA 1I2AA 4OUDB 3U9LA 2IOFA 4XIGS 3AETB 1G9XA 2J8ZA 1Z17A 2Q3EA 7GPBA 3R8XA 4ZCIA 2ZI5A 4RK6A 5HZMA 3L9WA 3F6YA 4R1PA 4P31A 2BFCB 2EG5A 2OUIA 4I3FA 3U3ZA 2O0KA 3WGTA 5I7UA 1E3JA 1XPRA 3C5EA 1VKNA 2P27A 3GO4A 4R0VA 4WL0A 1QMPA 4UMEA 4KMMA 2W2LA 1VBMA 3HYNA 4L75A 5G0TA 1EXMA 2M6RA 2OA0A 3DTVB 2X1VA 1H2AS 2AL7A 3DAGA 3DVRX 3RGWS 1R7RA 1S1CA 2P4UA 5EHQA 1AMOA 3E70C 1PTKA 4JSTA 4AY2A 1C4XA 3U60B 3I32A 4BVFA 2R4UA 1CR0A 2AGVA 5IYZB 2GRJA 4X8HA 4H59A 4KIJA 5C18A 5HJ7A 2DKFA 1SBYA 4IQ0A 2V1UA 5FOTA 1QV7A 2FN8A 4IFBA 4IIUA 4MH0R 1T3GA 2NSLA 4NJEB 4UM8B 4A6XA 4MRNA 3U4DA 3WZMA 4H1WA 5FD8A 3CO0S 4IL5A 5KREA 2VDQB 4C3OB 4PX9A 4QUHA 4QHYA 5J5AA 2ECPA 1JQAA 3C8ZA 2Q62A 1R8SA 2ZYUX 3HJGA 4LJLA 3RNOA 4KQ6A 3X44A 4ASUA 4BFYA 3MTAA 2UZ4A 2OQ2A 2HPVA 1A9OA 4Z53A 1J0AA 2YQ5A 8GPBA 1QWSA 1Q14A 1J0DA 1E9EA 1RDFA 4NOLA 1H2HA 1IU9A 3FPEA 2AHOA 4MUFA 3EXHA 4Y8VA 2QJWA 3KD2A 4ZVSA 4D45A 2J0EA 3JZIA 3I53A 3LUCA 1JUDA 1RQXA 7REQB 3BWXA 3CIOA 4D9JA 5LXTA 5ALQA 3OLQA 4MGYR 3L6CA 1D9XA 3DP9A 3OZUA 4RHCA 4UU8A 4K40A 4A91A 5FWAA 3VDMA 2AJTA 3Q7SA 4YRJA 2O8FA 3UFXB 2HK8A 3PJEA 2GEVA 2WILA 1J25A 4RVOA 1Z4KA 2P6NA 1N8TA 3NTUA 1E61A 5FUQA 1NMZA 4FFWA 3LW7A 4JI4B 3CONA 2H1OA 3OETA 2GN2A 1ZGGA 3ER8A 4BNDA 4Z8YA 1DX9A 3QWBA 1IHXA 1RVDA 1EEXB 1U2PA 5ITSA 3K32A 3AL0C 2P8JA 4Q7KA 4EABA 3HXKA 4G3XA 3QP9A 4O59O 5C8YA 5CG1A 2YIMA 2ZUWA 2VI5A 1AUOA 2P9JA 2OBBA 3PYLA 4N3CA 3V8BA 821PA 4ARCA 3NHPA 4J0EA 2J6HA 3BE8A 2C4TA 2XUOA 4D4KA 1F17A 1V43A 2W6ID 3CJTA 5F3DA 4RPHA 4YCAA 1AV6A 2XMGA 2ZIUB 4EHLA 4UTXA 3QK7A 4RK1A 3VH2A 3UMYA 3G6KA 1UJ6A 1TC2A 5FWYA 2KLHA 5CA0B 1N6PA 1VP9A 1ESEA 2H4XA 3MMSA 5JCZA 1QAOA 2WFZA 4ESEA 3FBWA 5JSZB 1XNQB 1KAHA 3CUUA 2VRBA 2ZRAA 1OXMA 1WUTA 4K7JA 1A4IA 2X58A 4MNTA 2RHHA 4KR6A 1DJNA 5HK8A 3G5AA 3Q10A 3O0TA 2WDPA 2R5WA 3HH8A 4ZU3A 1FRVA 1FTGA 2IU4A 1NQWA 2ZRCA 2SCUB 3Q88A 3D2CA 4KBGA 5JCOC 3OP4A 3FJYA 4G5YA 3FOFC 1EESA 1E2UA 3FVVA 2PBLA 2FG7C 4FLFA 5KYUB 3PC4A 1OIVA 3ROXA 1I51A 2OO7A 4YUZA 3F6RA 3ZXSA 1R6DA 1GM5A 1EM6A 3IEVA 2DERA 3BJRA 3ZK8A 3J7AC 5E9WA 5CDUA 1E4EA 1U3FA 4IH9A 4JY7A 5JS2A 3JX9A 2NM0A 5CT9A 1LVHA 3CUTA 1DIHA 5SYNA 2A92A 5HSGA 1GTZA 4OA8A 5GP1A 2H9AA 4B9AA 4FONA 1GL6A 4IQGA 1HGXA 4IG4A 5BWBA 2J5BA 2CXQA 3QKIA 3Q2IA 4GGOA 4RQTA 1UFKA 4YGXB 4ZZ0A 4R7ZA 4DR1B 2LKDA 3R4CA 1QDEA 1JEJA 2PMKA 1QGUA 4JVSB 5LMUB 3PFHA 4RETA 4J7CA 4OI0A 1GQQA 3G2JA 4JYCA 4BQPA 5AK6A 5DGIA 3EZ2A 5JZBA 3RKRA 2PWBA 1G64A 3KYBA 5LQSA 3I5XA 2FCRA 4NESA 1QB7A 1JP7A 3RT9A 5LZ4A 3SIRA 1H2WA 4HDOB 5EWMA 4PC7A 3EH1A 4YQEA 5A4JA 1OT3A 2ORVA 3DEHA 2EFEB 1O6GA 3OZAA 4MS1B 4YIKA 3H16A 4ENUA 2UZ0A 3AUUA 3C7KA 3LIIA 3NFYA 2H4FA 2YW9A 3OIWA 4G5RA 1AKTA 4HSGA 3IAM6 4Y30A 5CA1A 2W6QA 1ID1A 2LKCA 3HN7A 3WWPA 1N7GA 3IJPA 5ALJA 5EOVA 2AFHA 2DUJA 1CVRA 4IUBS 3QX3A 2YIVX 3LT0A 4EG6A 3K9WA 1VL8A 3FJ1A 4AYXA 2GZ2A 2NZYA 4L6CA 1V4NA 2N3ZA 5I5EA 1XK7A 4IKPA 5FA5A 3AF6A 1YB5A 1RAEA 4U7JA 1BFDA 4L9WA 4GT1A 4REQA 1Z5OA 1E3LA 1ZD3A 3C14C 1ZD4A 3G13A 3IRVA 3L7CA 2QUAA 2JATA 4XOIA 1FLNA 1XZEA 521PA 5JAPA 3LHKA 4BO7A 2UUPA 1DO8A 4I08A 4KN6A 1Z38A 1OU4A 2IBMA 2HK7A 3RVPA 3AQ4A 3Q11A 2VRCD 2JIQA 3EARA 1XB2A 2WG2A 1RXSA 1A96A 4EFDA 1ZNQO 1U4OA 4Q7MB 1BMFA 4OLAA 4BLQA 4QFCA 1ML3A 2G7MC 1CYDA 4QOIA 2K4MA 3QJYA 1RBMA 2FQQA 3K1AA 2JGDB 4M87A 3WRYA 4HWRA 2GTIA 1RXWA 4FQ5A 2GN4A 2FLVA 1DUSA 3VKFA 4P53A 2HBYA 3BM5A 1NBMA 3DW1X 4ENQA 5LA6F 1XAIA 3OKPA 2VT6A 1NM5A 4CM4A 3Q8MA 4IVQA 4YRPA 4B8YA 1DEHA 2J31A 4D9BA 1HDOA 3CRVA 4R1SA 1ZHOA 5IT9A 2FP4A 2P4QA 4X5OA 4ZJZA 3ZVNA 4IVNA 4FYVA 4BO4A 1DG3A 2NYUA 2O2CA 1YR7A 1SHTX 2C94A 3G9XA 1OTXA 2Y9MB 1NQ5A 1VLJA 4KE6A 1W0KA 1OGIA 5FBLB 3R3WA 3EDQA 2NQ2C 5IAGA 4DQ0A 3NS7A 2IZ5A 3LDHA 2P6RA 4ID9A 2P0AA 3NW9A 4FFMA 3SQOA 1B93A 3VAYA 3WS7A 4CKXA 2ODEA 3C16C 3F6EX 2AOTA 2AX4A 4GRIA 1UOEA 3GRZA 4MYSA 4GSLA 4MYUA 3FUUA 4AECA 4CGZA 3WY9A 1V8OA 2ATEA 2EZTA 4JJKA 4BKPA 1AXGA 1JYEA 4TWRA 4DYDA 1DCTA 2JJ1A 4PVCA 2P6MA 1A69A 2AZ4A 3QXXA 5KBYA 3ITEA 3BCSA 5DRYA 3H9JA 2A9VA 3HBFA 4RADA 1KTVA 4W6ZA 5T4EA 1Z8DA 3G5TA 3PFFA 4ZVNA 5C7LO 5LU9A 3K16A 4JN6B 4NWIA 5AHWA 5A2GA 5HX7A 2ZJ5A 3WRXC 4P54A 5TT1A 4KWHA 1BEZA 5E2IA 1RYHA 4GMFA 2I67A 5BYJA 3HQ4O 3I2JA 2J46A 1YFJA 3Q8XB 4ILEA 2OYRA 1XJWA 5HYVA 2JAXA 2WA2A 2OK8A 4AP5A 3RHSA 1EFVB 1A2QA 4IZHA 4S1WA 4B3RB 1NZJA 3SJZA 4WACA 5LDGA 2CGEA 4B6FA 5G1PA 2RD2A 3TG8A 3VBCA 2OE2A 3NDJA 5JDIC 3QVTA 3Q0EA 2WKRA 4TTQA 3CH5A 4UTRA 2AD1A 2AFIA 5HRUA 1RPNA 1U1DA 1XXHA 3VPBA 1QHYA 4LY0A 3GC6A 3WLMA 1F2VA 1G6HA 1RRPA 3VO2A 1RC8A 1EWRA 3FFBA 1UJMA 2XNKA 2CF6A 4V0LA 3GLFE 3A4YA 2IELA 1TM2A 1J8YF 5JLAA 2DC1A 1CJUC 2F4NA 3TZQA 5L4LA 3QKUA 4A23A 1ESMA 4I81A 3ZJYA 2J7PA 3RKSA 3JQPA 1U8UA 2I9PA 4J03A 3UPDA 2XTNA 3D6UA 3ZKWB 2CNBA 2BUAA 3G7UA 3FR7A 4MVJD 2XMDA 3A6LA 3K4QA 1GU1A 4C4OA 3FFXA 4PANA 3AGQA 3DD1A 1UDBA 3ILHA 1GYRA 2G9VA 4HN9A 1XD2B 1F2TB 4MR9A 2PYIA 2RG1A 2FETA 2J5QA 2XW6A 3HGTA 3TW8B 3FTFA 5L7WA 4FGWA 3D3JA 4NH0A 1IVNA 3JWJA 4P35A 3RVDA 3V9PA 1UBJS 3SX4A 5IFKA 4EHKA 1UBHS 1QO9A 1CZKA 1OBCA 3QFCA 3DHEA 4TMWA 1FDTA 3DMRA 4D8XA 3AM5A 3NORA 1LJ8A 3BA6A 2QMEA 3MGBA 5B4VA 4HATA 4DUGA 1MFZA 3PIDA 2WMDA 4NMXB 4FYWA 1MQAA 2ZDQA 4XASA 1W85B 4DV4B 4DMGA 4A5SA 2F00A 3NEPX 2FPOA 4AJ4A 4LF8B 4R16A 1DARA 3EW9A 2ZTHA 3QXGA 4Q1CA 4RENA 3E9EA 4RS4A 1XG5A 4RD1A 3U7IA 4IS2A 5DI9A 2FE4A 2Z5FA 1ACMA 1FS4A 3LX5A 1R37A 2HREA 3CVXA 3QJGA 2C58A 2CFRA 3GZNA 4MCIA 1P0FA 3SQLA 1VHLA 4PIPA 4I9UA 1FUUA 3STHA 4BVGA 1A5TA 4OKSA 2VCEA 3RHZA 5EKTA 1QHHA 3Q7PA 1VFPA 3R5XA 4MKRA 1GARA 2Y0BA 2ZI7A 3FPSA 3NHRA 3ZDAA 1KARA 4D46A 2AQIA 1KMHA 5EQJB 3TPFA 4FCCA 2D0PB 1MEEA 2CB0A 3JV7A 3CEPB 4KQCA 2Z8YM 4PC3A 4XQGA 4S1VA 1KTIA 1U8AA 3TCXB 1N0IA 2AN9A 2XUIA 1YFKA 2WZCA 4DLAA 2I1LA 3FY4A 3S55A 1PQPA 1JTEA 1G1AA 1M34E 3QX9A 3HM9A 4J94A 4Q9HA 3K6SA 3KSAC 3ZNQA 4DJTA 4GOXA 2WKQA 3G8BA 2D0DA 2IPXA 1DWUA 3I3OA 2FFBA 4RH0A 1E6LA 5I9IA 3NQ41 1YDFA 5FI5A 2ZZMA 3GL9A 4IMRA 4KW7A 4QU0A 5H9WA 1Y9ZA 2YZGA 4LV8B 1K9SA 2PT5A 2I29A 3ZWMA 1BS1A 4MWCA 2GAOA 4CL8A 5GONF 5IN4A 3ZR4B 4KE7A 3EGOA 3ROFA 4BAGA 4F8EA 1KVUA 2NYVA 2CUKA 3OTHA 3V7NA 4JJ4A 4RSMA 1WP9A 3B3GA 4IX9A 4C7BA 3G59A 1RWMA 5CDFE 5IEJA 2ZBVA 2EV9A 3DCJA 1YULA 5JD5A 3EXEA 1BE6A 3G9UA 1E0DA 4Z4QA 3GJ3A 3RF7A 1HEUA 1FUKA 1VLVA 2I4NA 3SU8A 1NWCA 1OXUA 1SZCA 2PQ6A 3D4PA 4BEBA 4EGAA 4KLAA 1LDMA 2GGSA 2XUJA 1KGSA 2H3EA 1YZFA 4JT8A 5IRCD 3AW8A 5J3JA 1QC5B 1NMSA 2CXHA 1JWAB 3OFNA 4KB5A 1QPZA 3R5JA 2AWOA 1UPBA 3WK7A 3ICPA 4EX6A 4M9CA 3NIWA 3AJRA 3C87A 4JLKA 2H17A 4B3CA 4IJKA 3NUGA 3F47A 5ADUS 3TFOA 1FP4A 4F72A 2VNSA 1EVLA 2PUHA 5LZ5A 1F2DA 2WE7A 3AEZA 4WXHA 1JDNA 1KEEB 3HP1A 2X8LA 1KAQA 4G63A 2G9NA 2OAGA 3A4MA 1H23A 2OZEA 2ZVDA 1E7SA 3GGDA 5ECWA 3AR9A 3HCEA 4UUOA 4Y2XA 3HCFA 1UT5A 2OC4A 1F8XA 3I0ZA 4WK0B 1GEEA 3DUWA 1NQAO 2VA8A 3VBEA 3W1VA 1TKAA 2EWMA 4ZOAA 5J63A 1RI3A 3TD6A 5IG2A 1Q1NA 3BEDA 4ALLA 3SD7A 3WL6A 3RVNA 1G18A 4YRKA 1L1QA 1DIRA 4JDPA 3IPAA 3P94A 5IWAB 1LLQA 2FPGA 1CS0A 1VM6A 2CDAA 3BXZA 1YZHA 4BKOA 5L51A 4PW0A 1CQIA 2IP2A 1E5DA 2G04A 1E62A 2P2YA 4RIFA 5BSTA 3KPVA 2AI3A 1PYGA 5JZSA 1HQDA 1T6ZA 2B21A 2FPUA 5M34A 1GG8A 2YFHA 2VYCA 3I52A 3QVUA 2PSSA 5IJWA 3QMWA 3RFUA 1OLSB 3CLTC 4ECAA 3BXEA 4RPLA 4DMRA 5DNWA 1DJLA 3DOIA 2VTEA 1CS0B 4PN7A 4CEHA 2MYPA 4NCXA 1ZXBA 1GJRA 1KH1A 2K7ZA 2AEJA 1BD4A 4FZVA 2I65A 4AJHA 3RRJA 2V0NA 3HUUA 3W7BA 2JKZA 1Y3CE 1WHTB 3V7WA 1NN5A 1UKYA 4UHBA 5CHYA 3JSXA 1QZUA 3DDSA 3R3YA 2QI9F 2YVAA 4PYJA 5EIXA 1DRKA 4DLKA 16PKA 3DDCA 4NULA 2ZRNA 3IAHA 4HQRA 3W9BA 1R64A 2HBZA 3C39A 2B1JA 3L7YA 5IF3A 2HA5A 3EWSA 1JFFA 2P9HA 2XITA 3AKEA 3PEWA 1B00A 2NZWA 2JHFA 2QV7A 3BFKA 2IYNA 4MVJM 1SBZA 2BEWA 1OD6A 1Z8FA 2QIOA 4JEHA 4XJTA 3WLHA 1D6JA 4R8KA 3OQOA 2Z56A 1QVWA 1D4ZA 1XLWA 1ZUD1 1KPIA 1JSCA 3NDRA 3LE8A 4JUDX 2DPMA 3WGJA 4OYHA 1OYYA 3GROA 1RHRA 3R0XA 5IJAA 1JFFB 1ESDA 3F2IA 4B17A 1R4NB 3CZAA 1E2KA 2WF8A 2ZQZA 3DOEA 3G88A 1P18A 3C8UA 1OB2A 4G86A 1B6GA 2HA2A 4RQUA 1A7JA 1GGJA 4DHWA 2ZCJA 1O9GA 3NCTA 1K9VF 4Q4AB 4ZHQB 3DKIA 1FX0B 4ROSA 3VDQA 2XDQB 1S6YA 2EERA 2IIPA 3KWJA 4EG5A 2EDCA 3ENVA 4N39A 4CCAA 4TMFA 2UDPA 1UOQA 2BEVA 2Y2UA 1WABA 1BDHA 2EGUA 1JXOA 4MIEA 2GJ4A 2BFNA 3F9IA 2NVOA 2Y68A 1KHHA 1D0IA 3IODA 1YZKA 2NXWA 2E4AA 3BX1A 4BWFB 2CBXA 4TRMA 5KNBD 2GEDA 1OWNA 1Q0UA 3TZBA 3B2NA 1OV6A 5FR2A 2BEVB 2EL9A 1KK1A 2JGIA 3P0RA 2PR2A 3DBHA 3HDJA 3IAUA 4P08A 3TNFA 4HWGA 1GPUA 2R96A 4IH1A 1SBQA 4BNUA 5JPCA 5LQKA 3MHPA 3OQPA 3WTBA 3HACA 3BFXA 4N41A 4O4JA 3GPCA 3HLKA 3S81A 3P0IA 4CQJA 3KPWA 1TFUA 3ODPA 3U09A 4UE3S 2PUGA 2BGJA 2XZTA 3R3SA 2W8ZA 1Y8ZA 3PPVA 3TLYA 1EQUA 2HRDA 1USWA 2QVLA 3P2KA 4GWGA 4QA9A 3TB4A 2LXNA 1B8VA 4O4LF 2QLLA 3R0IA 4R5HA 4TRNA 3Q85A 4NFHA 3A3PA 3UA3A 2OSBA 3W6NA 4HDKA 2H8KA 3VOTA 2AC4A 4MMXB 4E22A 4JQZA 1Z2OX 2PGNA 2Q1XA 4MX8A 2OCBA 3H17A 4Q9AA 5ALLA 3RUFA 1EA7A 4DLPA 4GOND 3W2IA 1Q0HA 1G8YA 2WTMA 5AKEA 1A77A 4G37A 4BVEA 4YFVA 3T4UA 1FDUA 1E3WB 4LZPA 5EJMA 3SZOA 1SU6A 1W5FA 3CINA 2AJDA 3DO8A 3L2OB 5ED4A 4G5GA 5EKXA 3MELA 2NTVA 3KWFA 1QGOA 2I03A 2DECA 2ZE7A 3KYJB 3KO8A 2OCDA 4KFUA 2Q50A 5SY4A 5HS4A 4HDKB 5CH8A 3LQRA 4EDFA 3B51X 3RARA 3STVA 4C22A 2OBFA 2XH8A 1U7PA 3CLRC 3DO5A 3R77A 4IPTA 3SS7X 1N2EA 4JNKA 4N12A 1ZU5A 3OZWA 3PUVA 1MABB 1XTRA 4GMDA 4D9CA 4QUKA 4PC1A 1E9DA 2A5YB 2YVLA 3KDSE 4RIGA 3BXPA 1JX6A 5GTDA 2RHJA 3T0IA 1TO2E 2QTVB 3IUQA 2IPMA 1A88A 1E94E 1JDUA 3L7DA 3ANYB 3OX2A 3Q4GA 2G6TA 4H27A 4OQXA 4C3UA 5IJ9A 4P82A 1O4VA 3L77A 2ZPAA 4DJ5X 3AOGA 4KL8S 4CLOA 1WZNA 4O4HA 4H3SA 1Q0ZA 2ADFA 1PNVA 1G8MA 1EK0A 1VB5A 4ZCQA 1J2RA 1KIFA 3OZEA 1KI4A 2PZJA 4X20A 4OQNA 4XWOA 3P9XA 4CFYA 1Q74A 2WINI 1F4VA 5EKDA 1ZMRA 3D6MA 1PWHA 1KJJA 3IUSA 2Z5GA 3NGLA 4R7GA 3CMMA 3UW1A 5KSZA 4P32A 1UKVY 5FNVA 3COZA 4CG3A 3VAZA 3PXAA 5BV0A 1RT9A 4NFSA 4Y2UA 2CLSA 4JC0A 4NYMR 1N5IA 1OH5A 4C43A 3PQ3A 1SHZA 1B3RA 3KJNA 5K0JA 1N3YA 2Q6IA 4X20B 2LV8A 1U4SA 5I3ZA 4DJFC 4UKDA 1EUYA 2P9GA 1SBIA 3QLUC 3MLBA 4S12A 2WU4A 3AI2A 3CZCA 2QX8A 4P4TA 4UBLA 3T06B 5IJ0A 2F4VB 3OCJA 2QE7D 4BEJA 5BR4A 2NSDA 2WQ7A 4QBTA 4RTNA 1LK7A 1TU3A 1ZOIA 3EVZA 5AJUA 2GO7A 5DTJA 2GAFA 3GRRA 2IYWA 2MSDB 1WV1A 1Y82A 5EUMA 4D4LA 3O1LA 4M9RA 3S7ZA 3WVNA 1XAHA 3ENZA 5KMGA 3D7NA 3EPPA 1GNSA 4BZPA 2PJUA 3AHCA 1RIIA 1VRWA 1XR3A 3LI2A 3NC0C 3PQ4A 5FNZA 2VK4A 1E1NA 1YVUA 3N8IA 3VR6D 1VHTA 2IYRA 4RIHA 4IHJB 5FLXA 3DM5A 2QNRA 2IXAA 4ONEA 4OHMA 5JJCA 3MYRA 2H63A 1LC3A 3UMBA 2AMFA 4ARZB 3HVKA 2G71A 1P73A 1SA0A 1JXAA 4J4HA 4F3YA 4DJAA 4DW8A 2Q9AA 3NONA 9ABPA 2CWWA 2X3UA 4X7RA 2G07A 3HCBA 3HEMA 1CW2B 5DGTA 3GT4A 4GKBA 1AKVA 3UICA 5K99A 2YQ4A 1DKUA 5BQOA 3S1AA 4YYEA 2EJVA 1UKZA 1H2ZA 1BXRA 4NC9A 1NW3A 2CD7A 2C83A 4GWKA 3PK0A 4DMCA 5DIFA 3VKHA 2LCFA 1DTEA 2B7LA 1GQFA 1I2BA 3HXMA 2FPKA 4C5BA 3RK4A 5F4ZA 2WJWA 1J2JA 5IX8A 3UHJA 3T3IA 5CB0A 1RLJA 3GNTA 1C41A 1I32A 2W2MA 3MMZA 3QPBA 2QN9A 3S1AB 1W73A 3WZ2A 1PWXA 2B37A 4BIIA 3I1FA 5T3YA 3DA8A 3R7WA 3ZTWA 5HDBB 1Z45A 1FRFS 1ZVVA 6NULA 4U02A 3H5VA 1TLLA 1EJBA 3GT7A 1G2OA 5BORA 4OM8A 4N8SA 4Y2PA 3UOAB 4QPDA 4BGDA 2O7NA 3CG0A 3UB4A 4Q39A 1FFWA 3NHYA 1I2ZA 4MW0A 3ZGLA 1Y5IA 3HP4A 3FMIA 4INPA 4BMPB 4TUYB 4WY5A 2R2GA 2YWFA 4W1PA 3VU0A 4AX4A 3MCVA 4YV0A 3R7WB 5HZKA 3UB2A 1OREA 1PFQA 3KXPA 1KEVA 4NCNA 3UMCA 5CEJA 3VZQA 2C5LA 3C3AA 2FVXA 1RMTA 4HG2A 4K28A 2I9KA 3PQFA 4F3CA 2B1GA 4LXYA 3CA8A 3TPCA 5ALOA 5HOQA 2ZBEA 4UVHA 5TMEA 1ENZA 1V5IA 5CMLA 2V7PA 1GUFA 3VPHA 1JIUA 2BDEA 1AG9A 1ODLA 2ZT7A 4GO1A 3M4YA 1D8AA 3PPXA 6REQA 1YQUA 1XFAA 2QNIA 2R6ZA 1TQ6A 3WHIA 2PZAA 3RIGA 2ICAA 4EENA 3WI7A 5AOBA 1FPMA 1GN8A 4V0QA 3WLPA 3A1NA 1ISFA 1YA4A 1FX1A 4COOA 1HKHA 2GJKA 2NVBA 3DHWC 3VPGA 4DJDC 2IY7A 1WPRA 1K5GA 2CLFB 1FFGA 4CF6A 1ODIA 1ZM3A 4MYHA 3SKYA 4L02A 4UEKA 4HAUA 2XCLA 2OCIA 1NNUA 3DFFA 3KTDA 4GGPA 4YJ2F 4TTPA 3CMCO 4KFCA 2HW8A 5ICMA 1A2BA 4IMJB 4RHXA 2Y1EA 2WFLA 3AHFA 2CFSA 2ZULA 3EA5A 4JYPA 5JAQA 3SCZA 3U7RA 3GLIE 3L18A 1CCWA 1TTQB 1U2RA 2I3DA 5ICSA 1QHEA 3UMMA 1WZUA 3UWKA 4ZDJA 2EFHB 3LU1A 1ISIA 4QJIA 5JXIA 5I7RA 2ZSHA 1H9BA 4IGEA 3H5OA 1QRAA 2RGYA 3LNCA 2E48A 1G5IA 4WBSA 221PA 1GT91 1D2EA 3D0QA 3HL0A 4BMNA 3WQSB 5T57A 4CKZA 2DBRA 1XI2A 3WKEA 1GQSA 1JQEA 2IKQA 3EF0A 5EMHA 4BO9A 4QT0A 3HGMA 2D2VA 3LPLA 3BIXA 1YK0A 2IU3A 3LUGA 2G0NA 1N2XA 1P6UA 2JAQA 4IKOA 4JBXA 2Y1XA 4W5WA 8OHMA 4FYYA 2PUVA 1OH7A 4XVRA 4L4YA 4ZARA 2F3TA 4CNQA 1KQFA 1WL8A 4J0DA 3ZCXA 1ZUNA 4OJKA 4C0JA 1JQ5A 5E9AA 4WA7A 2WD8A 4KXUA 5JMPA 2YXEA 3SQMA 3D31A 5KNDH 1CJMA 1LVUA 3F4BA 2I2AA 1JJBA 1DG1G 5A0VA 2YYSA 3CFYA 4Z86A 1DAOA 1QKKA 3N0RA 4G0QA 4XCXA 1J2EA 4XYMA 4EB3A 5MN4A 3ZD6A 3ROQA 3IGFA 1U2SA 2B4KA 1RD4A 3DDWA 5L3SB 2Q5JA 3BXGA 3G9TA 1O96A 2NP6A 3LW8A 3C6ZA 4R8RA 4WLEA 2VHVA 5C5EA 4QECA 1VJ5A 3HKBA 3GLQA 5B3KA 3TZLA 3S2ZA 1KI6A 4BV3A 4C0XA 5HCUA 1WD7A 4P6VF 3GJSA 4WY2A 5CLHA 4W9NC 3TAHA 3QF4A 4G36A 2BSAA 3FCXA 5U1PA 1SNYA 3CUVA 3ZCUA 4MUBA 4Y1EA 1Z83A 1NT2A 1E20A 2AW5A 2QN1A 2WD9A 3CE9A 4PAGA 2JANA 4N5IX 1TVEA 3PFGA 3HKBB 5EXEA 1REQB 2AKEA 2J08A 3FNFA 4C3VA 5B6PA 3IP6A 4HT3B 2BMWA 3IDQA 4M88A 1HZZA 1OGJA 2YW2A 4CL0A 2GCGA 1S4MA 1KJYA 2JGMA 3IPLA 4QXPA 4DIBA 3GLGE 4CDGA 1TIBA 2Q1YA 3TPZA 4OJMX 5EJ4A 4DE5A 1TT5A 3MWJA 5F2OA 2HPHA 4LZWA 3TNJA 3OCWA 4RAQA 1DQNA 1QKIA 1ZIPA 2X7XA 1RMQA 1TM3E 2Q46A 3JYLA 3ZI7A 4H4CA 3WGGA 1U8EA 4RZQA 5F4BA 4ER0A 2QVBA 1ID8A 4HJRA 4N9WA 5BQ3A 1SCUB 3EIQA 1EJ6A 4AXBA 4DYHA 2G08A 2AB0A 1V26A 1XDWA 3ZXYA 4KMSA 4M38A 4B81A 2ZRMA 1G0NA 5IYZF 4KTVE 2G4LA 2GN9A 1CJTC 2XUQA 4FGKA 1QM5A 2O8DA 1RWQA 3NPAA 2P79A 5DCYA 1Y7TA 5JUWA 1YVPA 1OWPA 2FFRA 3RFCA 2XSZD 1K3UB 4O08A 5SZKB 4D9KA 1NW9B 4YV2A 3ZWYA 1NVAA 1RNLA 3EF1A 4S1NA 5TDHA 3GLFA 1A9SA 3AFHA 3EVEA 3Q7IA 5IJZA 2GOYA 3U31A 3VVMA 4KYTA 4F96A 2JFZA 4ZQHA 2V3CC 2ZITA 3ZWCA 4EH1A 1F5SA 3A9RA 5JDCC 1BH6A 3GT0A 4J0HA 2QRVB 3DZBA 1VLQA 4XPIB 3QBTA 2DR2A 3OAAA 3MCAA 1TA9A 3NIGB 3M49A 4Z4CA 3GJQA 3OI7A 1MOZA 3CV3A 4O0MA 1M2VB 2H08A 4QTTB 2VNIA 4KU4A 5T4BA 1KY5A 2YS6A 4LNUA 1FRNA 1SOAA 3ZY2A 2WJ4A 2XIQA 2H5EA 2Z57A 2GCEA 4I6GA 5KYXB 3L05A 1N3BA 1QE0A 3HKDA 3RVLA 1NX6A 4TS1A 1UIMA 1AOXA 5F5XA 3S2FA 2ZYVX 3GAFA 3HBAA 3KVVA 2ZI4A 4J2HA 2Z1DA 3E81A 3FKSD 1B41A 1ZISA 3K6JA 3OZFA 2VAMA 3ZZNA 4ZYZA 3M9WA 4ZFNA 1QH0A 4AQYB 4TLMB 4ARAA 4B4UA 1XU7A 1IPEA 2VS1A 3ZBPA 1AKMA 3BT7A 5IFLA 3CGWA 3A1TA 3ZDZB 4ANFA 4I5GA 1XF1A 1OI7A 1YL5A 3DD5A 1N2CB 4GC5A 4IHKA 5DM4A 3TOCA 4PG8A 4I3HA 3UNXA 2IS4A 3PLRA 2DFTA 3JWHA 3QUBA 3EPJA 3OHPA 2Q21A 4P4SA 3X2SA 4BBJA 1Q16A 3SHQA 1KP3A 1STOA 3Q12A 4M1YA 4M1SA 4MAFA 5K20A 4XVUA 4XD7A 3TLKA 4R68A 4BU1A 3FGPA 1GPLA 5TGZA 1YKFA 3EISA 5SZHB 1AHHA 1E0SA 4UNQA 1FNBA 4O2BF 2O2EA 2XE4A 3GEBA 3C3CA 4JLNA 3VZCA 4OVKA 2AXNA 1SGWA 2FEWB 3QENA 1UPAA 4F4UA 4ZDKA 3FTEA 3LX6A 4B83A 1TD1A 4Z6KA 3JYNA 4FJ1A 4N1AA 1NVFA 1Z47A 1G8FA 2H0RA 2OM2A 2V9ZA 3A36A 3R41A 3L5OA 3PDWA 5F9MA 5HTKA 1M2KA 1SKMA 5U4XA 1R6XA 5MF6A 2RGNA 1CKEA 4Q34A 1K7CA 3LKDA 2YXDA 1V6AA 1CVIA 3PGVA 4OY3A 4U9UA 2QTFA 4PXYA 3SE7A 4AQ7A 4ZAWA 1NU6A 1OV4A 1BFUA 2X4LA 4MRAA 1MB9A 4BATA 4C78A 5I9LA 2C07A 3ME5A 4CT4B 2HU5A 3LFHA 1QGAA 3I04A 1M34A 2G5TA 3EH2A 3FUXA 4G8JA 3CRMA 4FE3A 1KDVA 1CUUA 3DTNA 1ODCA 1CR4A 3WGUA 2VOEA 1E9FA 1YBVA 1RE0A 1PT8A 3GDWA 4MUXA 5H81A 5KAMA 3LYAA 3WLLA 3LWNA 4ND8A 2WE8A 4TLLB 3RSOA 4BNLA 2QG9A 2XOXA 3RUPA 2AK3A 2FEPA 5L4SA 2AOXA 2DM6A 2PKRA 1CJKC 5F12A 1D3AA 2GKOA 1ODKA 1W4ZA 4QHSA 5CDFA 1NHGA 1UBCA 4HN4B 5D5PA 2WBLC 3KRTA 1R1DA 3LAWA 1ML4A 4L0QA 1XU9A 1A9ZA 3EGIA 1E8DA 1T4BA 3U81A 4RV5A 4EVIA 4ZCRA 2VK1A 2PRSA 3HVUA 4WZAB 5HUQA 3DYIA 1DDOA 1YE8A 3GUUA 4FQ7A 1JZQA 3D4LA 3F90A 3LKZA 4RVCA 1J9GA 5B2ZA 4BO5A 4QGFA 5CRIA 2OG2A 2E87A 4IO0A 3K70D 1NG1A 1NJ1A 2OBYA 3GGOA 3FPBA 3HXTA 3GI1A 1MPXA 2YHSA 3GLRA 1GSAA 2Q5OA 5F73A 5TARA 2YWHA 3DWEX 1ZCJA 3A2NA 3I12A 4WE3A 5LP6C 2NU9B 5ES4B 4W9MC 4CEJB 1VQ1A 4UTNA 3KEOA 2GA9A 5DNYB 3AVYA 4RGVA 5A7FA 1C9JA 2N9UA 4L3VA 4JWKA 4MRVA 3HXPA 4JWTA 3B85A 4XJSA 1OPXA 3M6MD 3CW8X 4JHLA 5KTKA 3Q8WA 3ZCTA 2W0MA 2EIHA 3N58A 3O4FA 3QEAZ 2D54A 2HD4A 1UT6A 3BDVA 3GAMA 3ZWXA 4H08A 4LYHA 1PS9A 1VMIA 1HETA 3SYTA 3UENA 4L50A 5KYTA 5EMJA 4W5RA 1FW8A 2JFOA 3AIMA 4I5IA 2H1CA 4L9RA 5B1HA 2Q5QA 3RS5A 4DCPA 3HYSA 4I7EA 5EP1A 3TOXA 3TCKA 4DIKA 4Q3CA 4ER5A 1YK1A 1WEKA 2BLLA 3KQQA 4UHFA 4DSTA 5AXDA 4F21A 2QT1A 4AZTA 1QAMA 3LLSA 3R3UA 5AD1A 2VDVE 1GKKA 1YCFA 5EKUA 1DINA 3DWFA 4I1UA 4AD8A 2NTYC 2V7UA 4BVLA 4DIOA 1K8ZB 4WH0A 3LV8A 3DVLA 2B2XA 3U6KA 2ONZA 5L7YA 1F6BA 1SBHA 2C2YA 4TQ9A 4IWNA 2ZATA 3LUBA 1XN4A 5ITZB 3G7NA 4RZXA 1ISMA 1Z6QA 1XLUA 2V3VA 2XVYA 3MOGA 4FBLA 4URYR 3U39A 4O5OA 1RLUA 1JALA 1HRKA 1GFWA 2LR0A 1GPWB 2WIKA 5GGYA 3SN6A 1X7ZA 2E4YA 1LTKA 1J4AA 3CZ9A 4KV9A 4KXFB 4OL9A 4F2GA 1KDYA 3GZJA 1V9CA 5A1TA 4L57A 4HTFA 1RVV1 4N7BA 3AESA 3M2PA 3R5HA 1UZNA 4LK3A 4U2EA 1O6ZA 1EUQA 5CXUA 4K9NA 1GPJA 1M1YE 2W48A 4JIGA 4Q15A 4X1YB 5IAOA 3E05A 2XZOA 5HJ5A 4BMXA 3AEUA 4BNJA 1B43A 3UJPA 3X1MA 1NBWB 3QVGA 4EFLA 5LNK6 1KZYC 3DSRA 1WSAA 4I1SA 1JAHA 1VG8A 2H00A 1PR4A 3ZV3A 2I4RA 4XTRA 4IHQA 2X9VA 2EX0A 1K4KA 3T1TA 2PGXA 3LRXA 4V0ME 1JMKC 1R0CA 1YOBA 1CQXA 5DHQA 3ICVA 1JKMA 3S28A 1F60A 2YRXA 2KSQA 1FSPA 1VTKA 5KDOA 1ZH8A 2QMQA 4OMUA 3S8EA 5CURA 2ZRLA 3K9QO 2KQUA 2VPTA 1C30A 2XD9A 4GKAA 5AESA 4EBFA 1NQOA 2L18A 1HR0B 1Z6YA 1Y6FA 1KH2A 2MSLA 3GFOA 4YJFB 1RRGA 3R9XA 5DHAA 5CX1A 5ALHA 2GPSA 3A6KA 3UW3A 3WLAA 3H18A 3O9MA 1QRUA 3QMVA 1BXGA 1Y0BA 2AEFA 1PV2A 2HPZA 3NHBA 3CF4A 4WJZA 5F7OA 3R5FA 4AZ3B 3U4QB 4C0LA 3DLBA 1LFDB 3VNVA 1DO0A 1QG6A 3COVA 1ZRSA 2HFJA 5MN6A 3SY8A 1NR5A 3CU5A 1UXJA 4L7VA 2JFYA 3W9YA 2AS0A 2MDTA 5DBOA 1VHQA 1I7NA 1QIHA 2A0UA 2NQ8A 1JN0A 3GJ0A 1IY0A 3GN2A 2FFHA 4FE4A 4BYGA 3NBXX 2HIAA 3CUEF 3MS2A 4EW2A 4M21A 5C52B 4HQOA 3PC8C 5JC1A 1WTCA 4QE3A 2O7VA 1SU4A 3OCCA 1GU7A 2WJZB 3T61A 1R27A 2ZSKA 3VPSA 4A8JC 4NV0A 3ESRA 4RZ2A 1ICEA 3CSDA 1QFZA 2QVCA 1IM5A 3BHMA 3C4JA 4G09A 2WJPA 5JECA 5DNDA 1UQUA 2P9CA 3FWPA 2HTEA 4S1OA 1KJ8A 3BKXA 1ZO8A 3KVRA 1UBOS 4RK0A 3X1JA 1GGNA 1VKZA 1TB4A 3TSOA 5REQA 3RNLA 1EFLA 3GJXC 2XAUA 1QQAA 5I8PA 3LOUA 1X7WB 4TSFD 1OT5A 1KOGA 2G1PA 4YPOA 5JVDA 4PM4A 4GBGA 2HYDA 2Q2VA 2ZFUA 3K5IA 1ZHFA 1B3BA 3KELA 3KOOA 1RWXA 3PHGA 5I4CA 5HE8A 1NVGA 4JFAA 3QUAA 3ZE2B 3ED5A 3MJHA 3AP2A 3KZKA 3AF0A 3STWA 1QB8A 2GHTA 1X19A 3A4TA 5TS2A 4BMVA 4OB6A 1QVVA 4JR1A 2VRCA 3IIMA 4V3BA 5EJAA 4NCAA 1QP4A 1XC7A 2M2IA 3E7FA 3VA7A 2IYSA 2H5JA 1ODJA 1XBTA 3B1VA 3B1JA 3H5WA 4KOAA 3GVCA 1C7ZA 3MA0A 1R5JA 7YASA 4RPKA 1KMCA 5AKIA 4L5CA 3EJ6A 1Y4AE 2A1UB 4BN4A 2H11A 2LUOA 3HSSA 4K9KA 2G17A 5E7MA 1E5XA 2HT6A 1SM4A 2TYSB 2RG7A 3LNTA 4Y2JA 4B35A 1BG6A 2ZWVA 4CV2A 4WADA 3PDIB 1B0PA 5GIOE 5EWLB 1DAKA 1PNRA 4L73A 4C4YA 1K6IA 3OT5A 3ZG6A 1H94A 5CT4A 3U4CA 5ICEA 2A9RA 2N42A 1HDRA 2OGWA 5KNLA 1E1QA 3LD9A 121PA 3LZCA 1F4PA 3JATA 4KPEC 2Q1TA 1GPKA 1ENOA 1T2NA 2OGUA 4L28A 1IRXA 1DU4A 4OQZA 3VTZA 1NKSA 1Y8RA 5K3FB 2JH8A 4RF4A 3U62A 4AX8A 2XNDD 1BSVA 1U90A 1M72A 1SBTA 4G0MA 2V7XA 4KO8A 4TS3A 3O8RA 4X95A 1DRJA 5CM2Z 1XF9A 3RU2A 1PVDA 2V7VA 1E5VA 2Y9PB 3B36A 3ZCVA 5I9SA 2IY8A 2V55B 1ISSA 4UMVA 4F93B 1FJHA 3QBDA 2Z4TA 1P2DA 1YJAA 1E1RD 2Q1WA 2V7WA 1QBKC 4K05A 1Z3CA 3RUIA 3K2IA 3H04A 1OI4A 1RAIA 2OLJA 2D4AA 1ESNA 5DW3A 2W2OA 3HJAA 3OIGA 3RUDA 1HYQA 2PRYA 2H2DA 2QSYA 4Y2GA 1A76A 4QUBA 1TZ2A 3V5NA 4EY8A 2PL1A 3X0DA 2J30A 4EHFA 2O54A 1KOFA 4WLNA 3ZHOA 1ZAYA 2P2NA 3R7DA 2AXQA 3N87A 3W8FA 4AC9A 4BE4A 2WSBA 2CW5A 4UU7A 4ON9A 4BWGA 1JHYA 2ZCUA 3KBBA 3BOSA 3DEKA 5DTMA 1O5IA 1NY6A 1ZYUA 5AHXA 1T4DA 3BORA 1CF9A 1Q7TA 1VJRA 4Z1MD 5C8ZA 1ETUA 3QSGA 1Z28A 3HJTA 4E4TA 5B57C 2PUEA 3IYLW 3M6VA 3NBQA 2I6XA 3KAKA 3W2TA 4BVKA 4ZTBA 5HR5A 5JY1A 3NT4A 1K3TA 2H0QA 1DX4A 1JFRA 3ZGOA 1F2UB 1RQNA 1G20B 3PZRA 1FQJA 4HOYA 3SKVA 1E1CB 3AHIA 3AV0B 1U0TA 3EVGA 3M2TA 5CW1A 1M0EA 1FJGB 4AAYA 3RVRA 4CMIB 3RTDA 4P3NA 3GA5A 1N75A 3UT5A 4AZWA 5JNTA 1BVUA 3P9NA 3NASA 1UDCA 2C61A 4BP9A 4V1CB 2O3UA 1KO4A 4HX5A 5DOZA 1DBVO 1JMVA 3RLFA 1AZLA 5CFMA 3E5HA 2GXAA 2HMVA 2QX9A 1CUJA 2A84A 5LCXA 4KP7A 4JLWA 1JAXA 4C4ZA 2MU1A 4MYCA 3W2FA 5FUBA 5EIBD 3PV0A 3AR8A 3W8EA 4L1KA 5LB4A 4L27A 1R8JA 3UWOA 4XUEA 4RZUA 4FSHA 3MXTA 3B89A 2GAAA 1VKHA 2OC9A 4Q7EA 5AM3A 4GFDA 1PJAA 4URHA 2KMLA 3WV4A 2BUCA 1QORA 1L7BA 2UAGA 3DNFA 1QYXA 4IVRA 3GB9A 3WB2A 1L5MA 4P3YA 2BJWA 5FOQA 1WW3A 4EFMA 3GA0A 4YMTA 4FR2A 2HA3A 3DFZA 4Z4HA 5KKCA 3KKZA 1CQJB 3ZVKA 3ECAA 5IHXA 1UWCA 3OZCA 4JS0A 3P19A 3BGOS 5HKKA 4J91A 5FAKA 2DT5A 4I50B 3IUYA 2P9BA 4C0BA 3VR5A 2GPBA 3AWIA 3O21A 1KVSA 2O48X 2Z1NA 4ZOLF 1JSRA 4DR7B 1YC5A 2HWKA 1P74A 2I8LA 1IWOA 2DQ4A 2OVFA 2AI2A 3IOCA 5I5GA 2C8LA 3KXDA 1TEZA 3DLHA 2O59A 3VM6A 3RFTA 3LY5A 4IGIA 1P91A 5A7HA 1VPDA 1BX1A 1VIYA 4FBMA 4K3VA 4DRZA 3M6FA 5I7HA 3TOSA 4D1YA 3IA2A 4KAXA 4LE2A 4MR7A 3T4EA 2MMCA 2J9YB 1I1NA 1BKYA 2XVAA 1NNLA 4TTRA 4X71A 5H70A 5BQ5A 2G9UA 2GD6A 4P7FA 4FT4A 2WQZA 3PR1A 4GZ6A 5CLQA 1QIKA 2D13A 5H59A 1FL9A 2ZSDA 4Y7CA 4QTYA 1KI9A 5JWOA 1YQXA 1ZLXA 5F3RA 5FJIA 4D0LB 5EL0A 3PQCA 2OFFA 1VECA 2HWYA 5LQMA 3PENA 5G3ZA 4AICA 2W7TA 1SKAA 2QBYA 1E7WA 4MPPA 3RC1A 4OD0A 4OAOA 4ZHQF 4ZI3A 1MB3A 3GLIA 4JUFA 3VO9A 2G1KA 2OGTA 4NPAA 3BIFA 4K03A 4NHOA 1HH4A 3T5BA 2AUMA 4GUDA 4I4LA 3V6LA 5CXQA 2RGWA 2JD0A 5K0BA 3T5GA 1XK6A 1GPBA 1EXWA 1WVGA 4MV5A 2CZCA 1FVOA 5EY5B 1Q22A 4C4SA 3UCFA 4EMSA 4ALKA 2GPYA 3IKJA 5JBQA 4NU0A 3HL4A 3GQBB 2F7SA 3F5MA 1G6OA 3QVLA 4CE6A 2QBYB 4L3WA 3UN1A 1UDXA 5LIPA 3IFSA 1IJBA 2QG6A 2YWCA 1EFHA 1Z4QA 2JIPA 3AQIA 4JLJA 4A2QA 3ZHRA 4LFAB 3OPQA 4WNYA 1TFRA 2B25A 3QOFA 1TT7A 3NOVA 5CPBA 4M37A 3UPUA 5GV8A 2ZUVA 1S2GA 3F7TA 2HGSA 4O2BA 1V41E 4U4AA 3CH4B 3K9LA 4RD6A 1U3CA 2VDNB 4ZOQI 3IE1A 4KPYA 3W7VA 2X2OA 1ECJA 1VL0A 2OKCA 3NYQA 3GGCA 3OJCA 1CX9B 1IDN1 5H7XA 2OL4A 1ENPA 1OKKD 2G09A 1S8OA 1WS6A 2GB4A 1XWFA 2JJ8A 2PS0A 4J7XA 5IDVA 3V97A 5BYKA 3KJFA 4N9QA 4P3OA 4AYWA 4MV1A 2C9OA 5GJVC 5JH7B 3PX7A 1T2FA 1EFDN 1Z7BA 3G82C 2O7RA 1CS4C 5KYYB 3O82A 5IC4A 1C3JA 1II9A 4G5XA 1KDOA 4RFLA 1SZJG 1YBHA 1MX5A 2BRUA 1CUYA 2JAHA 3DAHA 3CJRA 4UJ3A 1ZSVA 1ULBA 1B6SA 2E4UA 2I2DA 2CHUA 2Y76A 4TQUS 4BNYA 2G1AA 3DXXA 1JIIA 1A8SA 4C03A 4E03A 2CFCA 3DTTA 5IANA 1ENYA 2FMFA 2C78A 2LIVA 4L95C 2XKKA 4CLXA 2Q07A 4UUNA 3SZGA 1GCUA 1MRSA 4AY3A 2TMGA 4JX8A 4OJNA 1JV2B 5L6LB 3TLEA 1OOEA 4KQEA 4AMGA 2GK6A 4PLGA 2F67A 2H48A 4WCFA 4GQBA 1JEEA 3UG6A 3TUIC 2IV3A 1YBAA 1HE3A 2IXGA 4BX8A 3LC1O 4MCAA 2HPAA 4IDCA 1HDCA 2QT9A 4XEHA 3IELA 2BMJA 2E4WA 2L19A 3N2KA 3ONNA 1TYAE 1N1DA 4IICA 1SQ5A 5IS2A 3KL4A 4XYEA 2G9ZA 3M9LA 3MT7A 5BMVA 1ZN9A 1GTMA 1U2EA 1QCZA 2C8JA 2D1FA 3GLGA 3A6DA 1C3OB 2MR6A 4LYFA 4N7RA 3E3AA 2DWUA 1Q1QA 2FK7A 1DEOA 1RABA 4V0RA 1B8OA 4Y2SA 4F3RA 1DI0A 3GV0A 1ANKA 3CX4A 1V3TA 2FK8A 4UM9D 4XEUA 3I2GA 3KU4A 1N0HA 2QTNA 5FX2A 4URWR 1P77A 3AEXA 3CVWA 4RHTA 5AK0A 4DGSA 5JD6A 2DEUA 3ND8A 5BMVB 1HA3A 5BR7A 1O0CA 3IUBA 4KQMA 1VYUA 1ZCBA 1GL9B 2IWHA 3VHLB 1LKZA 4WX2B 5CTAA 4MVXA 4O2AB 3PL5A 3ZW9A 4HWPA 5FBQB 1V16B 1AGXA 1ZW1A 1T9ZA 2J0UB 3PKZA 4Z7NB 3GFFA 4LGVA 1U8TA 4WK4B 4E07A 1THZA 2OMEA 1T6XA 1VJ1A 2ZTLA 5F2NA 2C2GA 2JIMA 3WGKA 1LRLA 1E2DA 2J9GA 4MI6A 1V3UA 2CJWA 2BMAA 3I72A 3VYWA 1BX3A 4ZOEA 3TQRA 3WB0A 2BZ0A 1NW8A 2XNJA 4NFLA 1W36D 3GGSA 5JALA 4EUHA 3K92A 3GDFA 1B42A 3GIDA 2K2WA 3CW2A 5GJBA 5COAA 1RHQA 2EJUA 3H84A 1JFVA 1O9BA 5CR9A 4FWIB 2WWVD 1FU7A 4C5CA 2G0AA 1YUBA 5EZSA 4B3MB 1P2SA 1XT6A 2CJWB 4Z4GA 3LA8A 2V4ZA 3KLPX 4UNPA 1OC4A 2VPWA 2XODA 3EVBA 1L4NA 3TIIA 1RXEA 2ADOA 3ZD8A 3COPA 1LGYA 4D8WA 5FOXA 5GZ6A 1SXJC 3I6QA 4TXHA 4TL7A 3UVEA 3A6FA 1ZXLA 1TC1A 3KOYA 4MWGA 4GX2A 3LPAA 3BL5A 4TV9F 3FX2A 4MP3A 4NDZA 1QH1B 3SQDA 1TVKB 1RWNA 1ZMOA 3FGZA 4C08A 4ES6A 3I8XA 1FVHA 3D7LA 3HN2A 1JTFA 1AQJA 4DHEA 4E7PA 1E58A 4RK4A 1YA6A 4D43A 5HVNA 1Y3IA 5KVCA 3BAZA 1N2HA 1YONA 3NBZC 4LHVA 4H6PA 1ULUA 5K3BA 4EUNA 4RACA 2FWNA 2OHGA 1JR4A 3HY3A 9LDBA 4QL3A 5FQOA 4U2CA 2QWXA 1LBQA 3BTSA 3WP1B 4BB5A 3RIXA 5KNBA 3IQHX 1O2DA 1YSCA 1Q7RA 4OQMA 5JAHA 5CLGA 1XZ8A 1R4AA 4ZVTA 3EWNA 4QGAA 2W6NA 3AY3A 3R0QA 4IGKA 1PFYA 2XMQA 5EXPA 1KETA 5EMMA 3CF2A 2EGGA 2ERYA 4IV8A 3FHJA 1LNSA 3MTDA 1GA1A 1DHRA 4AKGA 2Y8EA 4LRWA 4B32A 3LXUX 2ZYAA 1WP4A 5SV2A 4BO8A 2B20A 1G4UR 2JGJA 2V6MA 2WAMA 3BTOA 4PYNA 3O9ZA 4AMUA 5BW6B 3HDTA 4R9SA 3LSYA 3K8ZA 4NECA 3VR3A 1GRVA 3PTAA 2DPHA 4JI0B 1VRVA 2GPAA 3HCDA 2CLMB 2V6BA 1B76A 2MT9A 5B4UA 3P97A 4PZPA 1L1RA 4OYLA 5EJ6A 4RTJA 3EGCA 1ZI8A 3PHCA 4KDCA 2IU6A 1E2NA 5ERGB 2ZRJA 4OQYA 1EPUA 4NPCA 2ZS8A 1C1DA 1KOJA 1KJZA 1PGJA 2BGRA 2WKPA 3BDAA 3MQ2A 3A31A 2GCOB 4BVAA 2P5SA 1PHRA 4AMZA 4ZGGA 5JQGF 4MV9A 1X0XA 3PD0A 3RYCB 1FQOA 2QUZA 2OGSA 4QAQA 4P7BA 1T0PA 4WJKB 4V2UA 1M8FA 3EGDB 4G4GA 5I8WA 4B2IA 5DMHA 4LBYA 2DLNA 5CBPA 2G25A 1AE1A 1P8JA 4GLBA 3TTUA 1V7PC 3ZCQA 3E1KA 2JS7A 1LV8A 4PAOA 2W2NA 1RRKA 1SXJB 5EGNA 5LLTA 4GPAA 1P60A 3WQHA 1X2BA 2MTBA 1EB8A 2BHLA 3HB1A 3NRJA 2WUEA 3BD6A 4PG6A 4RL6A 4MPDA 4F38A 1P4JA 4EY6A 3NHLA 4Q47A 3SR3A 4CKYA 3TGLA 3N6VA 2PLRA 4G0UA 3QFRA 2JGAA 5KNDD 3WLJA 1E4VA 3U7QA 4BC0A 3SVTA 1GSHA 2GVZC 4Z99A 1EGQA 2O0JA 3AIKA 3MJDA 5KUTA 1W44A 4RSGA 5CIQA 1KZHA 3RJ9A 1OROA 4MUHA 5GOZA 4YCSA 2JIZD 2VUIB 3AINA 5YASA 1PL7A 3H2IA 3DTYA 3EN0A 3F4KA 4CR8A 3C5CA 2AC7A 4U1RA 4NOMA 2CVFA 1F12A 1DIOB 1XNJA 4QYXA 2DUNA 4RM3A 3NKVA 4C04A 1IEVA 1TQ8A 3U7QB 5JZ9A 4PONA 2LBPA 1NI3A 1ULHA 2QM3A 4UDYX 3CGGA 3AL2A 4FGZA 4V39A 3WO0A 3WRXA 3JQ9A 2BE9A 2QE7A 3KYDA 4JH0A 4OLHA 3OA0A 5E1OA 4ZAGA 4NDNE 2Q9UA 4JQOA 4TKVB 3DCYA 4UM5A 3AW9A 1U8XX 3K6KA 2PAFA 2QLMA 3PQ5A 3M1IA 1R3DA 2WWHA 2C0CA 4GZMA 4N0MA 1SVKA 1NI4B 5J5VA 2F48A 3TAXA 4HX2A 2C84A 1BVHA 4ZC8A 4PPGA 1O94C 2V54A 1W4BA 4QYMA 1EX6A 5THXA 1NN1A 2PXAA 2V5AA 1A50B 3JQFC 1NPTO 4R54A 3EQZA 5CIWA 4ZTUB 1E2BA 4JYAB 2FPLA 2ODBA 2IUEA 4C2AA 2R00C 4DCOA 5TEVA 2QNBA 2FSHA 2F90A 4G23A 4D5EA 1XP8A 5FR1A 3OX1A 4RA9B 4RXUA 4WTOA 3PXGA 1H9CA 3ER6A 4YJ3B 3U44A 2X5NA 2KPOA 9MHTA 4BO0A 3CHYA 4LWZA 1U99A 1EDOA 2J0VA 4BO6A 1O57A 2O1XA 1HTTA 4A92A 3X1YA 4OOEA 1AKWA 3NCHA 3SIPA 1DHTA 1PWZA 1CUXA 3JQBA 4DABA 2F3UA 4PLZA 3A70A 2FKAA 5DGHA 2XBLA 2P6OA 5J43A 1SBNE 4TKUB 4IILA 1UMBB 1D2GA 1ZNXA 1IHYA 1ZC3A 2KLBA 3TMYA 2PMDA 1M1YA 4M0PA 3E6AA 2DMRA 1DQYA 1Z34A 1Z8HA 2WVJA 4WZZA 2NQTA 4KFSA 2VT2A 2XGSA 5IM4F 5AOVA 3DP7A 3T7IA 1H8ED 2CL7X 4ZYXA 5F5LA 2R5FA 3KLNA 4MQMA 3P71T 2REQA 1SUSA 3FR8A 1U80A 1M1YB 4H35A 1GYQA 2J5XA 4FK8A 2WVGA 1CE8B 3R9WA 3AR3A 4V0MA 5EP2A 5I9MA 4UFPA 3ZXXA 2X1HA 1E6UA 2QGNA 1DOZA 4FSDA 3CRW1 2IYFA 2XMZA 1VA5A 2Y1OA 1P7VA 1QGDA 4KQWA 1GZDA 1DTWB 3PFCA 1E5QA 3UAGA 2REQB 5CPFA 4GC9A 1CULC 1OI3A 4XSVA 5TPWA 3M3DA 4M55A 5DYNA 3WADA 1KAOA 4K9PA 2QTRA 5AJYA 3GUVA 4Z9XA 2HUPA 4DBLC 3TNYA 2W4QA 5EE9A 1GG5A 2LIPA 1LX7A 4LTMA 4HCJA 3I2YX 2QRKA 1JSXA 2FW1A 3GU3A 1EYZA 3QWFA 3SR4A 2QY9A 2IP1A 5DH9A 3ZKAA 4YDQA 2P9ZA 2EYQA 2PANA 4HNAB 5FTWA 3TE7A 5A5EA 2QAGA 2IXTA 2OZKA 2W2KA 1LEHA 5HJ2A 4A8PA 4EMTA 2CV2A 1TVMA 3VSCA 2JK0A 2O8VA 2FA9A 2BR3A 1WNFA 4BWVA 5BSUA 2YNMD 4M6WB 1V8ZA 2Y6VA 5AKJA 1RJ9A 5IH7A 4TYPA 2UZ1A 1NMEA 1J90A 3R5TA 3OEHD 3DAYA 4P93A 3AU9A 3DB1A 4R1UA 3VRHA 4MRMB 5EWJB 3VU9B 2OBMA 4HDQB 4MDHA 2FQYA 3G1TA 3UUFA 3QEMA 3TZCA 3V8NA 3FGNA 3BAFA 3A9SA 3UC5A 1M2GA 2PX8A 4K0KB 2XB6A 4M36A 4RMJA 3IAS1 5IHPA 4HAYA 1GZSA 3ANMA 2I54A 4OQEA 1J5EB 2Z6UA 2VSXA 2Q6LA 2ZSJA 3LYUA 5F35A 5ELXA 3I05A 1SBCA 1YO6A 4WCDA 1B26A 4X8OA 5J23A 1SXQA 1G3IA 4L8YA 5EHZA 2F62A 2NADA 4FR5A 5EJIA 4ZOLA 3HVIA 1QH8B 3ZHYA 3F98A 3W5BA 4F7WA 4QU9A 1XRQA 5DI3B 5DFAA 1PR3A 1YZTA 1KVTA 1TE2A 3OPXA 4WV3A 1URPA 1A97A 2B2CA 1VC2A 5LYJA 5FTKA 5LQDA 1JEYA 1C81A 1THTA 3R44A 4HNQA 5AVKA 4BDSA 4IEEA 1VIVA 2KWIA 4TT3A 1FRZA 1D5CA 1PDOA 1TEHA 2QX6A 4ZJUA 2UXBB 1XQVA 1EFPA 2PEZA 3P9CA 3U6BA 4BNFA 4C6RA 2E7ZA 4AMVA 1E4OA 1JIQA 3A7DA 3K1YA 4I8IA 2HLDD 1PK9A 5LXTB 3DGEC 3EDYA 5BW4A 3H6KA 4FCWA 2CHFA 2WT8A 4NARA 4L6AA 1VL5A 4JLPA 5C46F 1PK7A 5FXMA 3PTLA 2PT6A 3DEAA 3EXFA 1QP0A 4PS1A 1LTHR 3H11A 1H4QA 3UJCA 4JKOA 2YN4A 3C2QA 3GVIA 1IZ9A 1TD9A 4DMFA 3B13B 4OMFG 1KMNA 3AB7A 2JAWA 4WQMA 4IKEA 1GRCA 4JJIA 4BLSA 4IRMA 4HYYA 4KWEA 4ZALA 4ZEXA 3ZTTA 2TSYB 2C2HA 1P81A 4L8GA 2YICA 6Q21A 4KQXA 4K6MA 5JNVA 1UDAA 4LOKA 3IP9A 3KJEA 4GPBA 3BB3A 1GNTA 2PZ8A 3I73A 4MVCA 1EJ2A 1QE5A 1W5AA 2CXSA 1F1BA 3CISA 3OOHA 2RARA 3OSZA 4RTPA 2HZ7A 1C7JA 3THYA 2ZQYA 1T36A 4E70A 2HCFA 4UBKA 5CJJA 4FMBB 3QKWA 4HLQB 1Z2NX 2F1OA 4ZN6A 2E3JA 4DT1B 3FSRA 3GLVA 2ZI3A 3LQFA 2P77A 3T4PA 1J21A 4B40A 1W75A 5FYDA 4DG8A 5IF9A 3H0EA 3L0DA 2O4CA 4GQIA 1ZVQA 3WFJA 1RQRA 3KQUA 1EUZA 3C6BA 3BMCA 1T8RA 2NUAA 4M0MA 1ZJ6A 2OXIA 1A9RA 5BP7A 1VFNA 1Y1LA 2TRSB 1OC2A 2QRLA 2EKZA 1CEXA 2HSWA 4HGRA 2IZOA 3T9AA 4FC7A 3WQRA 5AJHA 3BJIC 2G1JA 4KVZA 1N92A 4FEGA 1T9BA 2ZUCA 3GWGA 1YHYA 2CXOA 2H16A 2XUPA 1NXQA 2NXEA 1K7SN 2NUAB 2Q6OA 5KJFA 3JASB 1H2YA 2NIPA 3K2EA 4E2ZA 5HKLA 1FMTA 4IQFA 3NWBA 4OHVA 1YIDA 3L0CA 1XQ6A 1DAGA 2DBVO 4KAAA 1XEWY 1U2DA 2JBAB 1KDZA 3EQ6A 5KTMA 3PDUA 4KIFA 4E94A 5L8VA 2XCQA 1YDGA 4IV5A 2VDWB 2PN1A 2YJZA 1N2IA 2FRDC 3EUWA 1PT7A 4JENA 4K6KA 4RJKA 4PZCA 5AOAA 4DQKA 5A9SA 5K8VA 3IP5A 1G60A 1IQPA 1R0RE 2O05A 2IKSA 4CMBA 4FZ5A 2EQBA 4GX1A 2CZGA 1RYBA 2PSJA 3HRKA 3NTOA 4MV8A 2H52A 3QG1A 5G0WA 4DLWA 4ZCTA 5AM4A 3O7WA 3E2IA 3WTCA 5EJ9A 3RTBA 4RVDA 2I2XB 4PYIA 3NKFA 2GBCA 5LOVB 1O4WA 1TL7C 2QVGA 3MMPA 4ZOCA 3TNLA 4B2YA 2BHTA 2YJNA 1TF2A 3WO1A 2FE1A 2A0XA 1UWKA 3KC2A 3GMSA 3RUEA 1RQ2A 2XHZA 3D3NA 1OVMA 4IDQA 3JWIA 2LRHA 3E8SA 3THOA 3ZZ0A 1EHCA 3V2UA 1EVYA 1JU3A 2BFMA 3EASA 4OH7A 2R11A 1IM8A 2HX1A 3ABRB 1JF8A 4MVWA 4NMWA 1KIAA 2JF0A 1K4YA 1L4FA 3FKSA 1KO1A 1NAHA 4Y2VA 3DB2A 2FPSA 4RIEA 4JI5B 5L3QB 1XTSA 2GNOA 1Z0IA 3H5TA 3DV2A 1G0OA 2C2XA 2FWPA 2PKXA 2SBTA 3LTEA 1YKSA 3NEYA 1J1IA 4AJNA 4G0VA 1JH9A 1R5OA 3JALB 4UTVA 1CP2A 1G8KA 3HR7A 3MS4A 3QFSA 4RJIA 1O8BA 1E2HA 1WPXA 4US0R 2GEBA 1X9GA 3A4LA 3MLAA 2D0OB 3BE6A 3RU3A 2ZQ5A 1W19A 4G97A 2BYTA 2ORYA 2P90A 1PFKA 1IOLA 3IV7A 1NY5A 3H4VA 5F98A 4ZGWA 3AIIA 5HFNA 1OF1A 1L8QA 3R3JA 4O4IA 2OV6A 2ZRKA 3EODA 4RA6B 4CIAA 5J1SB 1Y5MA 3IJEB 4HGPA 2LD4A 4IBOA 4B3JA 3GDHA 2H2AA 3QI7A 4GR9A 5AT1A 5LDDC 1MO3A 3HLTA 1I3OA 4RTRA 1CEQA 3ONFA 3LVFO 1CETA 4MAAA 3WJ1A 4QXQA 3ZDDA 1K7FB 4QDJA 1Y9JA 3CE6A 3QLVC 4GXRA 4O4IB 1R6AA 5HKOA 4JP1A 3NEAA 1T9CA 2ZIVB 3MTQA 1L5OA 2D0IA 2P41A 3ETJA 1B1AA 4GXNA 2JFUA 2VH1A 1W52X 1TUEA 2JH9A 4GECA 4JJ6A 4U9IS 5JCJD 3UK7A 2D5CA 2VAWA 5C4MA 5KWSA 3DO6A 3O1HB 3WKBA 5J1TB 4EW1A 2VYND 5IBQA 2CLLB 2Q4DA 4BO1A 4XCQA 1U63A 5COQA 4B47A 4D99A 2C7PA 5AHOA 1BA3A 1BHQ1 1M76A 4HDNB 3GF4A 3HCRA 2DPYA 4XWYA 1KORA 4MKXA 3C70A 3D3WB 4JAVC 3VVBA 3EEBA 3GD7A 3L1UA 1CRQA 3K9CA 3PBKA 4RY9A 1QHSA 3ZQ4A 2CMDA 1NF2A 4D0GA 4ETNA 3EG9B 4X91A 1SULA 3CX3A 1TZKA 5CEEA 4Z8XA 2WWWA 5K4AA 4EVRA 2QRNA 1J00A 2ZBGA 4IRUB 4Q3NA 1HDGO 1J8VA 2FZCA 2HL6A 3AIOA 4Q1VA 3W77A 3OPMA 4P3PA 2FQ1A 1XZGA 2RHRA 3DDHA 3ESXA 4QELA 3RBVA 3JQQA 3RUAA 4MGHA 3PDHA 2Z4RA 1H4VB 4CCSA 4P5EA 4D9IA 2PBFA 2QTLA 4DNPA 2R6CA 3QKRA 2OORC 3CUWA 2DH5A 3JVDA 4CDNA 4F4JA 4YV7A 5IASA 4JEMA 1T2DA 4BLTA 3LCVB 4AN4A 5JCXA 3UPTA 4CMKA 1KBOA 3G8DA 2IBSA 4BZQA 4UVEA 3IAM1 5G4LA 2QTAA 3AONB 2Y1WA 1ZRNA 1M8KA 2XUKA 3D6HA 2ZIZA 5FV7A 2W93A 5GADl 2R8BA 1T8YA 2NXJA 5FUYA 2Q4EA 1W7AA 2IUFA 4FD3A 1BS9A 3FHOA 2SKEA 3RSQA 5FLKA 3UXEA 2RB4A 1TYDE 4I5FA 4PLHA 2BTQA 3RC9A 1GG9A 3JYOA 5EQFA 3OCYA 2NU8B 3L79A 2QUBA 1IVSA 3EUEA 4N5DA 3A2MA 2HQBA 2HRZA 4JHXA 2QT0A 3L4BA 3K70B 1N2JA 2I6GA 1M1NB 1VJTA 4DTIA 4EPTA 1YRYE 2YC4C 4FI3C 3DF7A 1MPTA 5JQGA 2JEZA 1ZFNA 4C76A 4F4FA 3PC2A 4ND6A 2G77B 2BTQB 2GHQA 2RHDA 3CNNA 1I9CA 1XA4A 4XGQA 4DNXA 4RFVA 1SG9A 3E58A 4MV3A 4L4UA 2QEQA 3RAEC 4DG5A 1AMNA 2XTMA 4O5AA 5DX0A 1GCOA 1NVXQ 1E2JA 3CNQS 2I1QA 3RGGA 4BMOB 2PVSA 4M99A 1Q2UA 4MLPA 1H4SA 3ZC3A 4JK3A 3VPCA 1ZGJA 3RJMA 421PA 3ERCA 1FSSA 1V1JA 4JI1B 1PP4A 1MMFB 1TJYA 2BZSA 2R3SA 4N47A 3RF6A 4D3SA 3FVRA 4MW6A 4EG1A 2J0QA 5BSMA 5AK3A 4FUQA 2VAVA 2WSIA 3D8SA 1DKMA 4E31A 1IL0A 5FL3A 4YRTA 1QQ5A 3OCUA 1GO2A 3QKSA 3AUXA 1SUIA 1SXGA 2PWAA 5T4FA 4O1HA 1Z0KA 4I46A 2QQGA 4CIVA 1MC8A 4MI3A 2UZIR 3NKLA 4CCWA 2IX9A 4UZEA 1P0CA 2WM9B 2RHTA 4JGBA 2FR8C 4K6HA 4LSWA 3VC3A 4EIWA 3C5VA 3GRFA 3CRNA 1WB4A 5MGNA 5B2EA 2PX3A 5LR6A 4MS3A 1T1RA 1V7CA 4ARSA 2CMGA 3IVGA 3JCZA 3KX2A 5TE9A 5ICGA 1X7YB 3FPCA 4WY8A 2BFEA 2WIBA 2IYUA 4F6LA 1JAIA 1HL7A 3P9ZA 1UBLS 4DSOA 5IDYA 3IQIX 4XVQA 3RD5A 4RTSA 3FRIA 2GZ1A 1AGYA 3FCEA 1V7ZA 1VPTA 4C3ZA 1UKAA 1T15A 1AXEA 2R8XA 5LZ7A 2Q8NA 2FX2A 3WK5A 4FOSA 4U7HA 1OB5A 3HGQA 1C9DB 3O93A 4M0EA 5TVKA 5IK2D 2ZSIA 2EBHX 3DZIA 4W7SA 3H8WA 4JLOA 4XFJA 3CKKA 1UR5A 4ZV9A 3C7DB 3OY2A 3AR4A 5THQA 3U26A 1GSOA 8ABPA 1TM5E 4NXNB 1JQBA 2GYVA 3CH7A 2Z04A 3DHYA 4M83A 4P0QB