4OFWA

Crystal structure of arabidopsis thaliana dj-1d
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
387
structure length
387
Chain Sequence
NSRTVLILCGDYMEDYEVMVPFQALQAFGITVHTVCPGKKAGDSCPTAVHDFCGHQTYFESRGHNFTLNATFDEVDLSKYDGLVIPGGRAPEYLALTASVVELVKEFSRSGKPIASICHGQLILAAADTVNGRKCTAYATVGPSLVAAGAKWVEPITPDVCVVDGSLITAATYEGHPEFIQLFVKALGGKITGANKRILFLCGDYMEDYEVKVPFQSLQALGCQVDAVCPEKKAGERCPTAIHDFEGDQTYSEKPGHTFALTTNFDDLVSSSYDALVIPGGRAPEYLALNEHVLNIVKEFMNSEKPVASICHGQQILAAAGVLKGRKCTAYPAVKLNVVLGGGTWLEPDPIDRCFTDGNLVTGAAWPGHPEFVSQLMALLGIQVSFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Lyase
molecule keywords Protein DJ-1 homolog D
publication title Stereospecific mechanism of DJ-1 glyoxalases inferred from their hemithioacetal-containing crystal structures.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 131
structure length 387
sequence length 387
chains with identical sequence B, C, D, E, F
ec nomenclature ec 4.4.1.5: Lactoylglutathione lyase.
pdb deposition date 2014-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01965 DJ-1_PfpI DJ-1/PfpI family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ofwA02
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ofwA01
1KXJA 3R74A 2IUFA 2V4UA 4GE0A 4GUDA 3ZR4B 4E5VA 3EFEA 3CNEA 5SY6A 5JZMA 3M3PA 2A9VA 3N7TA 1JVNA 2GHRA 1VCMA 3PQ2A 3TTVA 4OJYA 2ISSD 2R1TB 2VRNA 4MTCA 4L78A 3TQIA 4ZGGA 1GGHA 3NORA 1P7ZA 1M6VB 1PDVA 4ZDIA 1IPHA 2RK4A 1K9VF 1PDWA 3UMMA 3L3BA 5BV2P 2R1TA 4P2GA 1IZYA 2NV0A 4P34A 2D7JA 4HCJA 1IZZA 4Y0NA 3TTSA 3KKLA 2ZUTA 4L8WB 1JDBC 4K2HA 4Y1GA 1FYEA 3ER6A 4ZDKA 1OI4A 1GPMA 2FEXA 3EJ6A 1A9XB 3NOQA 3PQ3A 4L95C 1VCNA 2YWJA 2LXNA 4I46A 1QDLB 3NONA 3OT1B 4UOQA 5LIRA 3L18A 2XF2A 3B3AA 3B36A 1CE8B 4S0ZA 3UJNA 4AUEA 4B31A 3TTXA 1OY1A 2VXOA 3CZ9A 3FIJA 4WINA 4LRUA 1OX5A 4ZDJA 3PQ6A 4MNTA 1SOAA 3P9RA 4QYTA 4OGGA 3OT1A 1QWSA 1P7YA 2VDJA 2R1VB 3R76A 4AUNA 1P80A 3FSEA 3NOOA 4I4NA 4Y1FA 3MGKA 4RKWA 3PQ7A 1KWKA 4B40A 3ZJ4A 2ABWA 2VPIA 3TTWA 4ADSG 1SY7A 1UCFA 1KA9H 2R1VA 4I2NA 4UNIA 4QYXA 4E08A 4AJ9A 4ENSA 4GE3A 2ZUWA 3CYFA 2YWDA 1N57A 1J42A 3SOZA 1L9XA 1U9CA 4B7AA 3F5DA 3EWNA 3NVAA 4OFWA 3WFZA 3EN0A 3R75A 4OQ4A 4MGHA 2ZUSA 4PXYA 1PV2A 3P9PA 1QVWA 3GRAA 4JQSA 1Q2UA 4ENVA 1OX6A 1S1MA 3L7NA 4ENRA 3BHNA 3PQ4A 4N12A 5JZOA 3B38A 3SF8B 2RK6A 1CS0B 1G2IA 4BIMA 4L8YA 4P36A 4Y1EA 1GGFA 3BWEA 4B5KA 1T3TA 3RHTA 4N0MA 4UZSA 1QVZA 2WJZB 5SY4A 1QF7A 3SF8A 4ENQA 3P9QA 1WL8A 3D54D 1PE0A 1QVVA 2AB0A 3P9SA 5K4AA 5SY9A 3TTTA 1I7SB 1KWGA 4ENUA 1VHQA 1Q7RA 3PQ8A 1T0BA 5SYAA 1CF9A 3EZGA 4OIFA 4R7GA 1BXRB 1GGEA 1ONSA 2H2WA 3MIIA 4XLLA 1C3OB 3VU3A 4P35A 2AD5A 1GPWB 2ZUUA 4Y1RB 4WXYB 1OX4B 2YWBA 1GG9A 3ZJ5A 2VKTA 1T36B 4AULA 2GK3A 1FY2A 5IP5A 4ENTA 2YWCA 3CZAA 4UCFA 4BTEA 4B2YA 4UOZA 4AUMA 4BFLA 4Y1RA 1I7QB 1GGKA 1OX4A 3F71A 3L4EA 1C30B 4L7QA 3TTUA 4LGYA 1R9GA 5DFAA 3TTYA 1O1YA 3PQ5A 2RK3A 4P5PA 2OR3A 3NOVA 4OGFA 3UK7A 1P81A 3UOWA 4RKYA 1VCOA 3UGJA 2R1UA 4L8FA 4D1YA 3CY6A 4ENWA 5E9AA 1GGJA 4ENPA 2W7TA 1I1QB 2NV2B 2ZUVA 1P5FA 1KEEB
chains in the Genus database with same CATH superfamily
1PZGA 2OK7A 2QTNA 4P5DA 3JALA 3IOCA 1AOXA 4ZV4A 2JCXA 1RMQA 1U0TA 1JDNA 4QPNA 2RAVA 3EDRA 2CL6X 4LZZA 5KYNA 1M83A 3T8YA 2VRNA 4GBMA 3QWIA 2OE2A 3ESBA 4LZLA 4TS1A 5DX1A 1Y48E 3G0CA 3GRUA 4MKZA 3ZWOA 5CDHA 2OCPA 3ZV5A 2O5CA 3I01A 2O7NA 3D9QX 4YFYA 4JYMA 5KNDA 1SK8A 4TS3A 2G9QA 4IVRA 4P34A 1DBQA 3IMGA 3KUUA 3QVKA 5FAXA 3KPWA 1V16B 4I1SA 1AHIA 5CXSA 1CNMA 1OAOC 1JDUA 2GR9A 4GYWA 4MQMA 1BVHA 4M89A 2Y4OA 3AOGA 3INNA 5LNK1 1JIVA 1Y42X 4F04A 1PZEA 5ED4A 3D6NB 1OW3B 5HZMA 1M0SA 1QCDA 1Q17A 1ZXBA 2WP8J 3E4DA 5K4HA 7GPBA 1ZESA 4AJ2A 3BD8A 1G3UA 3T1YB 3UZUA 4MX8A 4DW8A 1YTLA 3TM4A 1O96A 3KDSE 2OO7A 2ZTMA 1PDOA 5ICGA 1F2TA 1EBFA 3P9RA 3OT1A 1T4CB 4BVLA 5FDFA 5AVOA 3TUIC 3VISA 3THYB 1XRLA 3DDHA 5ADUS 4KNYA 1G1AA 1LS1A 4Y0AA 4X64B 5DHUA 4MJ7A 3MTEA 5EAIA 2BEKA 3FWNA 1DV2A 1LBTA 1F3LA 3TX2A 2PFGA 5B4UA 5FTJA 4ND7A 5FI3A 3CJQA 1PJQA 3WFIA 5B1DA 3HB7A 3BCSA 4G09A 4QGFA 3EMVA 3H2HA 4JR2A 2VRBA 2VK2A 1YS9A 3VZBA 4Q3CA 5IUJC 5FQNA 4AB1A 3U31A 3RSSA 4CRWB 5JBQA 2QU7A 2QJTA 3WK7A 3CPEA 3W2FA 1W85B 2HF9A 1KZ1A 1WUTA 3COWA 3GIDA 1PK8A 4EOGA 1GT6A 1WY5A 2YZ7A 3PTAA 1F8FA 1U9ZA 2YJ3A 3EVEA 4Q01A 3CCBA 1PFUA 2E3JA 3T5MA 5I47A 3RABA 4QUGA 1O5OA 3DKRA 4ZA2A 1GNPA 1NONA 3VDXA 4PANA 1P1JA 4ZJYA 3BA1A 4JP8A 3U81A 2V3CC 3HUEA 2BUCA 2NU6A 2OCKA 3AUTA 1JKIA 4J1TC 5LKRA 1W5SA 2H3HA 4RE6A 1E4VA 5CLGA 2ZWAA 2W2LA 2NVUA 3DEFA 4MVJP 621PA 4DV0B 2PD6A 3IUNA 3LS2A 3B6KA 4DEVA 1K9SA 4FLFA 8AT1A 1L7DA 3H1FA 2D4HA 4I8XA 4UC0A 4B3RB 1IOVA 3A1CA 2KWIA 1I14A 1XDBA 4UNRA 3THXA 5G1OA 2L42A 3EG5A 3L7BA 3NX4A 2WJ4A 5CH5A 3SK0A 4FFNA 1MTZA 3CNQS 3GT7A 4DBVO 4WLVA 2BELA 2E9SA 5HE8A 1QLWA 1W1IA 4PC6A 1G1MA 1A72A 2ATIA 5EESA 1NLFA 4E4RA 4ESHA 1V37A 3BHJA 2XR1A 2XOKA 4Y6QA 1XEWX 3LPMA 1C41A 1J0DA 2W8ZA 1T3GA 3NIBA 4KSYA 2JFNA 1KYZA 1TECE 2J07A 3F4BA 3RJTA 1QONA 4PLCA 2BH9A 2R8OA 2IY9A 4H6WA 1PGQA 1I1OA 4JROA 4TSKA 4INPA 3GEDA 4LISA 4RLQA 3NOVA 5CFLA 1NQXA 3C5HA 4Q48A 4YALA 1UM9A 4RKYA 4LJSA 4NE9A 2PO7A 4AKTA 3CUYA 1V3QE 2WD7A 4MR8B 1RI2A 1BGXT 3U60B 2AHOA 5IBCA 2RIPA 4A4DA 4B2PA 3DDCA 3DL7A 5CIQA 2I9KA 2DBYA 3IDOA 2CFIA 3USES 2ACVA 1P3DA 4RENA 4XSHA 4FZVA 2Z2IA 4PYKA 2WYHA 1J99A 1BVUA 2IOHA 3KLBA 1I2MA 3K5HA 4V24A 4NHEA 5BWCA 4FDLA 5C1OA 1WZIA 1G7TA 2J0VA 2O52A 5FUVA 2A9QA 4OA5A 4ROSA 4AC9A 3IEKA 4A91A 5JV5A 3JAWB 4I1PA 1U6IA 1KK2A 2I80A 1IFXA 1MTOA 3IEPA 2NQ8A 1RKVA 2HLHA 4DDMA 3DEZA 2W6ZA 2XJ4A 3GLRA 1W75A 4YLEA 4EJSB 4NKRA 1P2DA 3FCYA 4OQDA 4TLCA 3LWDA 1UDRA 5ER6A 3MCWA 1UBKS 1XNQB 3A9WA 1R15A 4WUTA 5E6UA 1ZM7A 4D9EA 2IPOA 2QY9A 2XXAB 4S04A 5EKSA 1F4PA 3QG1A 2PRZA 2RHOA 2GPNA 2CWWA 1GOTA 2JH9A 2HMVA 5FOQA 1RXVA 4XOIA 3L0CA 4ITRC 1LGYA 1FXWA 1PVVA 1DC4A 1LTHR 1NLYA 2BI7A 2DF8A 3M2TA 4L0DA 4M8IA 1A2KC 1K2WA 5JNVA 3PQ7A 4BGEA 2XHEA 4LV5B 3TTWA 1SWWA 3QKRA 5ER9A 3QRWA 3K32A 2V1XA 3TDMA 5EWMA 5FBKA 1KP3A 4MWDA 1SCAA 4IIJF 2LV8A 3A4NA 3ZDQA 5CX1A 3FOBA 4Q4JA 5LQJA 1AQJA 4HTFA 1IOWA 2W2MA 4BZZA 5EJAA 4F3YA 1JG2A 4Q66C 4JQSA 4ZYWA 5HTOA 1TL7C 4ZI7B 3W1VA 4HK4A 1VMEA 1X7ZB 3OZ7A 4GNRA 3ENZA 3EQ8A 2CL0X 1Z4MA 2FXIA 4Z8XA 2ZI5A 4ZZ0A 1MB3A 5LOVF 2JARA 1P3Y1 3E84A 4G81A 3BH6A 4P5EA 1UFQA 1WIWA 1O95A 3KNZA 5AQEA 3K0FB 1ODSA 2EF1A 1OQAA 3B8HA 4FI3F 1F0NA 3AERA 1AV7A 1XUOA 3CH7A 3I34X 3ILHA 4LXTA 1L4YA 5DT2A 3T3DA 5IAOA 1DMSA 1NY6A 1C3EA 4ZEOA 3LXUX 5K99A 2FZVA 2L18A 2DSTA 2OCXA 1JA0A 3KBOA 4FI3C 3HCRA 3JD1A 4DEXA 3AHGA 5I51A 1SC4A 1Q7CA 1QFXA 1GPJA 1VQ1A 3D81A 4Q4HB 4RD3A 3RJ5A 1JKFA 4PX5A 3A06A 4BV2A 5JQGB 5B36A 5CB6A 4R4JA 2C94A 2OMEA 1NG1A 4C5CA 4BFUA 3F97A 3CNHA 5K03A 2HO5A 4TV8A 4ZVKA 1DE0A 4UAGA 4I3FA 4B44A 1GCOA 1BW9B 1S7CA 4TMFA 2X42A 3WGUA 1H5UA 4OXYA 3T1HB 1T5SA 4M60A 3IPYA 5TPWB 2H8GA 1RM3A 1K5HA 4IF6A 4PBTA 3FJ1A 3WJ2A 3TSCA 3SWWA 3WWDA 2BUBA 3LF1A 4H1HA 1T9DA 1Q57A 2XCTB 3JVVA 2P35A 4OQEA 3L8HA 4HSEA 5FBHA 4M1QA 2XBUA 3MB5A 3LAWA 1B7GO 4L27A 5FPPA 1LD3A 2F3TA 3ON5A 1WSWA 13PKA 2QTHA 4JBYA 3UK1A 3TX6A 4ENPA 3O5AA 4B6QA 1ZCFA 1KEEB 4JJ7A 3G8AA 3DV9A 3LHDA 1N1DA 4EHDA 3WYGA 4MR9B 3RAGA 1UQTA 2QAGB 4TTIA 2AXEA 1HMYA 3WAGA 1F17A 3N74A 4ZCSA 4O4JF 4M0LA 4MTCA 4QARA 4ZRMA 3JCZA 3OO1A 3WQQA 3ISTA 3O83A 5CD1A 1QG0A 3LOQA 3VHLB 3EARA 2CVFA 3K35A 4F5ZA 3AL0C 4MA4A 2V0NA 3DNMA 1CUFA 5GMOA 3VDNB 3KZKA 4KWTA 2BFFA 5EZ5A 1DCKA 1P19A 2CUNA 5KNLA 2H3EA 4OTZA 2VJNA 3DDNA 2E4XA 2PY6A 2FFQA 4GICA 3HCNA 2YCLA 3O1JC 3KFXA 4ZOLA 1GPMA 1SJ9A 1WUJS 1VPLA 2WFLA 1U0GA 5IZCC 5EE5B 4BQSA 1ZD3A 3B3JA 4X93A 4S0ZA 1E4EB 3JARB 2FMFA 3BCRA 5AJTA 4AUEA 1OI2A 2XBMA 4EYGA 2QLTA 3DMTC 2B30A 1LNZA 3GLIB 3JZMA 1ISRA 2OFOA 3FDIA 3LE8A 1V5FA 2DWCA 1MQ8B 1T8TA 2RG7A 1L1QA 4XIJA 1O6CA 4ER0A 4YMSA 1UK8A 2OZLA 2C7PA 3TD9A 5HXAA 4DXDA 3RC9A 4N01A 3TMKA 3TPCA 3C7CB 1U9IA 5FP0A 1U6KA 2FPOA 3DV0B 3NC4A 2BP7B 5EFOA 5SZIA 3PUHA 2CD9A 2Q2QA 5J2UF 1KEZA 1RYHA 2AMJA 3ETLA 1K86A 5HMLA 5B3JC 1OFUX 1YVRA 1TFRA 1J4AA 3KQPA 4XCXA 1NRJB 1SVNA 1E2BA 1Q1AA 2Y6VA 1K0UA 3CJTA 1G5QA 3PZBA 4KU4A 2ATEA 1BS2A 1RPNA 1S6YA 4ZOBA 1TKAA 4Q3DA 3B38A 4BVBA 1CUIA 1OE0A 1R2QA 3RAJA 2P9HA 3OAAA 4FONA 3DF9A 2EKZA 4KJZA 1FYWA 5HF9A 4YJDA 5FJJA 1QIFA 4PSUA 3NJ4A 3X3HA 1E64A 3ZHBA 3C6XA 3UVEA 3RTEA 5AW8A 3PLNA 3CG4A 1YDMA 2JLWA 4KITB 1GZVA 3CZ4A 3TMAA 4PO3X 1ZGZA 2FG5A 4GOXA 4C89A 2W4IA 1J6UA 2GFQA 3F78A 1P6XA 2AJLI 1BXRB 1KH3A 3EAFA 3EODA 1G19A 3HGQA 3QLUA 5F4BA 3IYLW 2WQZA 3MTJA 2WMYA 2WMOB 1N5KA 4Q03A 5DP1A 2C57A 2H2AA 4WXYB 2YWBA 1XI2A 3T0GA 4ASUA 2JCBA 1TK9A 1UKZA 2A9JA 4FIZA 1CWUA 1QO0D 2R79A 2OP0A 2QV0A 1Q11A 4K3VA 3NAZA 1BC5A 4DMKA 2R6HA 5ESDA 4AZVA 5CVVA 3EZXA 1TAQA 3ZS8A 1BO6A 1GGVA 2YZMA 3QK7A 1GPNA 4L07A 5DMXA 3M49A 1GD1O 2ZULA 5EE9A 1H8ED 2X9NA 1D9ZA 4B7ZA 1VIVA 3WS7A 5I9IA 2Q49A 2XCIA 2OBFA 1QIKA 3KVYA 4UUMA 1F1JA 3L6BA 5JC8A 2RH8A 3AM1A 2JASA 4KBFA 5T57A 1EWQA 2P78A 1SQFA 5JVDA 2H11A 3EQ9A 3HKBA 1JVSA 4YJFB 2JDIA 1K08A 5AM5A 1YB6A 4OHBA 4PRKA 1R6DA 1J2JA 1E5QA 2DLDA 1XHLA 4B4UA 2C29D 1MHPA 1EFPB 3TRIA 1O4VA 2GHTA 3H6GA 2RGGA 4ACBA 5FNZA 3O73A 4NZMA 3EMBA 4E1AA 2FMIA 1P4GA 2PAFA 1J5PA 5IVDA 3H1BA 1Z2DA 4EMUA 3PT5A 1C4OA 2UVPB 3FNRA 4BVEA 3F3KA 1IZYA 3VR5D 5H83A 4BU0A 2PV7A 5T4BA 4JS0A 3ZY3A 5JTTA 3UA4A 1R0KA 4K2HA 2BJVA 4MZXA 4NL4H 1R0BA 2C4WA 3MT0A 4TUYA 4O8CA 5I7OA 1W2HA 2XITA 1J24A 1VI5A 4S1PA 1FP4A 3UG6A 3ZCQA 3E9DA 1E61A 4K5QA 3DMNA 4MW0A 1YAJA 1UBOS 1D5CA 2A1UA 4MQ5A 5JPIA 3PU6A 5EE0A 4F3NA 4HVCA 4MS3B 1AC5A 1O6BA 5K05A 4LYAA 2M1XA 3X43A 3PE6A 1F2DA 4TTTS 5H3CA 1DQZA 3ZE2B 3LFTA 4UDNA 1Y33E 3HVUA 121PA 1C2YA 3W79A 1X1CA 1E79A 1IRIA 2X15A 3RSGA 3QUAA 3SFTA 5KNBH 1SH7A 2ONZA 5H0IA 1Y8AA 3CRNA 4MKXA 4OXNA 3OIDA 3Q0TA 1U9CA 2JGEA 1ZC4A 3L9XA 4R1OA 1HLFA 2ZYUX 1ULHA 4EA9A 3HM2A 4J90A 1NW5A 3AXTA 3N58A 3U9LA 3DE5X 3NFRA 1S5PA 1T13A 1OFTA 1PBTA 1V43A 2H1SA 4LJKA 1ZOLA 5ALHA 1AIPA 3HY4A 5KHOC 1T35A 5EHQA 5B3LA 2PUBA 8MHTA 3EC1A 1QU2A 4DIFA 3I1IA 1L4HA 5CH8A 3O8RA 3TZCA 3A4YA 4LPKA 4M7WA 5F1KA 3FCSB 2Z30A 1AQ6A 1ZISA 1IVYA 2HU2A 4J94A 3EXIB 1H05A 3T06B 2EFGA 1G3RA 1T2AA 3VH1A 3WKBA 3ZQJA 3L8FA 5JDIC 4JB0A 5JMTA 5EPEA 1XZAA 5LQNA 2JFBA 1WE2A 3GH3A 3KZCA 3U7EB 4MINA 4MARA 5KTTA 1WETA 3AVOA 4UVHA 5AUOB 2Y1EA 1TO6A 4JC5A 3ZIUA 1AHNA 1FSFA 2PFKA 3ENQA 3PE3A 1ZK4A 1T10A 1YBFA 2Z9BA 1Y63A 2QZ4A 2F9MA 1T36B 4PZLA 3AOEC 1RLUA 4N7JA 3UOGA 1H2BA 1H4QA 1EVJA 4AP9A 1J1IA 5DBIA 2F48A 2AG0A 2REQB 1Y6FA 3F90A 3UC9A 4BLQA 2OFWA 1IDN1 4U00A 2P3LA 5L3SB 1UBGA 3HKCB 4FX2A 3HSKA 2J7PA 4IH9A 1ZUNA 2YQ4A 4BNHA 4TMXA 4EPXA 1BX0A 3PXUA 3PWKA 1RLOA 4IOJA 1CY0A 4AS2A 3NYQA 3FFBA 3K30A 4AKIA 2QORA 4HVTA 1RLTA 3MJHA 3ZDXB 4DB4A 4Q9AA 5LMUB 2FSHA 1Z4NA 3ER9A 4BNZA 1K27A 2WAXA 1WV0A 1N2XA 2X0KA 3U49A 3M1LA 1OBVA 3O7MA 3R5SA 5JASA 1COWD 1YZUA 4AECA 5AVTA 1JPUA 4JC0A 3WSWA 4BO0A 4D7AA 2QL6A 4X60A 5JXGA 4BMVA 4AO6A 1CUXA 4FR0A 1VZ3A 2UYOA 2ZB4A 1CQIB 3PP8A 2IITA 2XHZA 3RC3A 1KMHB 3MWFA 5KAMA 2BSAA 3PI6A 1X9IA 2VP5A 3KWJA 1E0JA 3OU6A 4FR2A 4GWLA 4HPJB 4P54A 3RVMA 4DG8A 2BEUB 3BRWD 3IBTA 4E0BA 2AK2A 5JH7B 1U2GC 1ZJZA 4R3UC 4QVGA 3ROZA 3ER6A 3CA8A 3ZPXA 2OKGA 1I5OA 1YAHA 3C7AA 4P93A 3GJ0A 3GV0A 1NX9A 2VOEA 3GP3A 5BORA 5K0JA 1OT3A 2Z6AA 2VDRB 1M2KA 3I1YA 3DLAA 3EXAA 3UYLA 5TMDA 1FX1A 3EW9A 4UM8B 4KE8A 1N1EA 2Y6UA 1SOAA 1E6UA 3EVNA 4NY1A 4HT3B 4TVBA 3SX4A 1JG6A 3GXBA 5G2OA 4OHYA 1GKIA 5DISB 4Z6KA 3WIOA 3BB4A 1E7RA 3N59A 3PRYA 1Z5NA 4Y2YA 3MYYA 3OJXA 3QVGA 5DE3A 4ZEVA 2X58A 5BMVA 1U2PA 3AR6A 3W2TA 4DR1B 4NS4A 4NZOA 4EYSA 9MHTA 1D07A 3GRKA 5G0UA 1WXEA 1P8JA 3EWNA 2RHGB 4D9JA 1XNHA 1N3YA 4JLOA 4LAFA 5H3HA 1W36B 2P2YA 3MOGA 4FD2A 3H4IA 2C2GA 4P4NA 2WJJA 5FWXA 3WGLA 3GAFA 1EJ6A 2FPKA 3VV2A 4UBIA 4E33A 3LT1A 3JV7A 4E88A 4MKIA 1U4OA 4UPDA 4JXJA 1U1DA 4NU8X 3KETA 3OQVA 3L1JA 3WGIA 5LZ7A 1HNZB 3BB3A 3VHRA 2LKDA 2D6FA 2FTKE 2B5VA 4H3SA 4B7XA 2WTMA 5AW0A 1WM1A 5GOZA 3K1ZA 1C29B 1Y1RA 5BQPA 4D6PA 3OX4A 3TN7A 3C1UA 1YS1X 2PFSA 4BMDA 5CA0A 2OWEA 3KOZA 2PR2A 3X0DA 4NV0A 3SKVA 4E7PA 3DHYA 3RVSA 3ZHXA 5DGCA 5A5EA 4WERA 2IWHA 3G68A 1KJYA 4JK3A 4I4TA 1DQYA 2ZIUB 3X1JA 3N9IA 2HCFA 1Z6PA 4TVOA 5BN1A 3QFSA 4DLSA 4PEVA 1AKWA 1Y9EA 4FC6A 4R8VA 1IQ0A 3EVAA 4LSGA 4W8OA 5DRYA 4RMHA 4HNUA 3INGA 3DPSA 1QIEA 1NI4A 3B9BA 2AC7A 3BB1A 2F00A 4J7XA 4NBUA 2ZIEA 4MHOA 5J9FA 5IVKA 1XV5A 1V6AA 3HKDB 4RJKA 1RP7A 1ZD9A 2DLNA 3MS2A 1DEXA 5CVTA 2HNBA 1LLDA 4BB9A 2AHRA 2GBGA 5KI6A 1ZSYA 1CUHA 3VC3A 5DT9A 2OQIA 1UDWA 1YQ9A 1ZVQA 2BHRA 1AQLA 2C92A 3DZ8A 3IV6A 3ZZTA 1GQFA 3BFVA 5EUBA 1WA5A 3PJFA 2EFYA 1HDYA 1MF7A 4CI0B 1YRAA 2XCOA 1BRMA 5FBLB 4TMTA 3FUCA 3ZKWA 3HTXA 4NTZA 4R2XA 5D8DA 1FVXA 4CE6A 4RMIA 4I55A 4Z3KA 1GTSA 3CCCA 1TMOA 5EGNA 4DZTA 2R00A 3R3HA 1DU4A 2PNFA 3TRJA 3JQAB 1V25A 2Y1GA 3D4BA 4PG5A 4P22A 3W9BA 1A82A 3JRWA 5SICE 3IOBA 2HPZA 2MSKA 4PLVA 5IJWA 2JVJA 1VBNA 1YB5A 2P5UA 2VQ6A 3OLQA 4UDYX 4ZZ3A 1YZTA 4FNMA 4YR7A 2Q2WA 1SC9A 3GRFA 421PA 4F6RB 3PEWA 4ARIA 4BB5A 1MNAA 4FT4A 3R09A 4TV9A 4JBWA 5A3VA 3SLGA 4A0SA 2X1HA 3B12A 1EBBA 5CNKA 1V4VA 2WJ6A 2DPYA 2VVTA 3EGXA 3OE7D 1KJIA 4CM8A 3RLIA 1TB4A 3PENA 4MW7A 3VPCA 4Y9UA 3KVVA 3FIJA 3UH0A 2Y1DA 2I2DA 3P52A 3AUYA 3LY8A 5C8DA 5JYEA 4YRLA 3OJLA 1XDUA 3IA2A 3PNPA 2CFRA 2IHNA 2TMKA 3KOUA 2EIHA 3CH4B 3GP5A 4WGFA 1ACMA 4BFTA 4ABTA 3WNZA 1BXZA 3ZCTA 2AQ8A 5BRJA 4LJ9A 3BMOA 1EFRA 3A1VA 3C2QA 2QL9A 4FBLA 4RU1A 1UPTA 5C1DA 4O4LA 4C01A 1NVXQ 1MO6A 2XQKA 4R2KA 3EHEA 1I3LA 3AY0A 3OZDA 3ZHOA 5HM8A 2FETA 4HGPA 2GYVA 3IDSA 5HNKA 4OKIA 5JU6A 3ZDBA 4YY3B 4DR2B 2ZRFA 4RSRA 1Q44A 2QVXX 4G0ZA 3WK8A 1EA5A 1LRJA 1DJQA 2P2DA 2XGMA 3KG2A 1YZHA 4YMUA 4L0MA 4YRFA 4TRJA 1S8OA 4QD3A 5DXFA 1NFRA 4UNSA 4YR9A 3SXPA 3FW1A 5JRDS 4IMPA 3F6EX 3NTOA 4R84A 4WTOA 2P2NA 3TYXA 4KR3A 1V26A 3C16C 4FCVA 4OFXA 3ZVKA 1LZKA 3B1YA 3MS4A 1L1FA 1MOSA 5JC1A 3T54A 1XNRB 3UHOA 3GDOA 1E3MA 2QSUA 5L3RA 5DH9A 1ILWA 4F38A 3NUZA 2XA9A 3MRXA 2C2XA 1MX9A 1J8QA 4Y9SA 1DBPA 3S1AB 1XJWA 1OGIA 2ZE7A 1IU9A 2ZQYA 5L53A 2BVNA 1WXXA 3JXEA 4Q37A 5ALPA 1SXJD 2NZJA 2Z98A 1VJTA 2DKFA 2R85A 3EYAA 2ZIXA 5IN4A 1IXZA 2D0IA 4ZPXA 3TW6A 1SXJC 3BSYA 4N5MA 5KMGB 4CTKA 4XWGA 2ODTX 3K09A 1H66A 1DX9A 3KWMA 1B1AA 3QLTA 4LHWA 4KXFB 3SQWA 5FI5A 3KUKA 1TAUA 3PFWO 3FZYA 1BCRB 3ZNQA 2JKZA 3MGAA 2B9EA 5F51A 4DWWA 2O8DA 3CS3A 4MMXB 1SHJA 4OJTA 3ESZA 4LS3A 1P5ZB 4R6WA 4URWR 4HN9A 3TOCA 4OCZA 3IEMA 2JJ8A 4UTPA 4E3ZA 4EYKA 1YB7A 3LL7A 3RODA 3N07A 2BFPA 2ZYDA 2ZJ2A 4P7GA 3U4IA 5JCJA 4QICA 1NIPA 3CXRA 4KBYA 5LN1A 4I1IA 4DJJA 5KYUB 4HRYA 4K9NA 1JG1A 2PZEA 5AHOA 1SBYA 4CW7A 3ZJVA 1M10A 2Q6VA 3DYVA 2DXIA 1FYVA 3CGGA 1P9WA 1CQJA 1P62B 3EZ6A 4C0BA 8ADHA 4IYRA 4HGOA 2VNJA 3DHVA 2XD9A 2XVZA 1AG9A 2HK9A 3EFBA 4PFSA 1B4DA 4AM8A 2WUEA 5D87A 3SJZA 1KI4A 3GFTA 2NVOA 4ND8A 5BV2P 1VBKA 4M22A 4EVRA 4LF9B 1JWBB 4KPUB 1TO1E 1UH5A 2PRJA 3WX0A 2CV0A 1LSUA 1DZ3A 2CNNA 3HR4A 4EI9A 4Z4CA 3UK6A 3OBIA 4KO4S 2P4UA 1N34B 4C2UA 4Y1GA 3A6KA 3M2PA 1TF2A 2NSDA 4CMBA 3FNQA 1P9RA 4L95C 2UVDA 2VWHA 4QFBA 5B2ZA 3RK4A 1Y7TA 3IAS1 3COYA 3MBIA 2H4JA 1ZM2A 3THSA 1C1XA 3NM6B 3EVFA 3CZPA 4DHWA 2X22A 1A9XA 1ZR4A 5ALQA 4EEXA 3ZK9A 1P4SA 1ZHOA 3VBCA 1ZYUA 3I45A 2D4AA 1UC9A 2WF7A 5DP2A 5DZSA 5I7EA 1OIXA 5K20A 1HT2E 1T1IA 2AWNA 2XY4A 3IUQA 1OIVA 2A5FA 3O8DA 3QJYA 5EIHA 3R5JA 4UREA 3P0EA 1WNFA 2B1GA 3E9EA 3G13A 5DB4A 1GZUA 3ED5A 4BCBA 3PZRA 1G18A 4C43A 1RHRA 2AEEA 1PQPA 1LDGA 2C3PA 2QZZA 2YMLA 3W5AA 2IEZA 2P7IA 1AB6A 2E87A 3DFKA 2ZBEA 4GLFA 4PNPA 5CJ2A 5AJWA 3HHPA 5JWHA 4RTMA 1Y1PA 5K8UA 3DUFA 1NSFA 1PT9A 3QKSA 4G37A 4HNTA 1ULBA 5E4FA 1XHFA 1CRWG 2WF6A 3Q9UA 1WCIB 2PCJA 5HA5A 2WJPA 4O3MA 4M9CA 1MJNA 1P0PA 2I2WA 2IOQA 3AR9A 4C7MA 1ZLYA 3F5FA 1NU6A 5DCLA 1MT3A 2F1HA 3WRXA 1GR1A 2BMAA 2I2FA 3G2OA 3QLVC 1I3OA 4CPDA 2G77B 4DUGA 2BH2A 3B3QA 2O3TA 3ZDFA 3NRBA 5C8YB 1KQPA 1EVQA 3PRJA 3VYVA 2X6TA 3AFOA 2KI5A 3C3AA 3FUVA 3OZIA 4H7IA 1YVPA 3QVSA 3AI1A 3BK1A 1EWKA 1RRPA 2LPMA 3V4LA 4UTVA 3E0QA 3GJ5A 4GYJA 4MV6A 2BGUA 4JBXA 1QS0B 3M81A 3GGCA 3DMPA 5AI6A 2YHUA 4IUCS 5D86A 4CXMA 1QRRA 5EIXA 3K1YA 2QRNA 3G7NA 3GRYA 4IXWA 3T5AA 2XVAA 3L92A 4QXAA 2P9ZA 3O0TA 4RD4A 3SC2A 4AP6A 1UWCA 1RWQA 5MDHA 5IVIA 1I8TA 2B9VA 2IT1A 2IYYA 3K0CC 3B9PA 1DZIA 3ZY5A 4X62B 1Z33A 1A5BB 1RBZA 1KQGA 1VG8A 4OHCA 4OMCA 4H3HB 2WOOA 3C1OA 4NNJA 5KNBD 4H31A 1T2EA 1GSIA 3ZU2A 4XDZA 3HB5X 5BRNA 3KL2A 3NV7A 3ZEAA 1EE2A 2MINB 3IBGA 3LUJA 3ETNA 1Z2NX 2RHRA 1QHXA 4P82A 1I0LA 1S96A 2BI4A 1FVOA 1LBSA 3LO5A 3N7TA 1OXVA 3PRKE 3TOSA 5LXTB 5FI1B 5I01A 2BGGA 5AW5A 4I50B 3VOSA 3V6MA 2HD4A 3EOZA 1JYFA 1BTOA 3GFOA 3LDUA 4QJIA 4TTJA 4WOKA 3HVHA 2IP2A 1UKVY 3SMQA 4CR6A 2LVBA 3FIUA 1YJAA 2HHHB 2LDXA 2P4HX 3PD7A 1GVHA 1DCFA 2QLNA 2RI1A 1T5BA 1TEHA 2NU9A 4MVJA 4YP9A 4JMPA 3T4XA 3FVRA 3DJFA 3NOQA 1U11A 2IDJA 3HU1A 1P77A 2X6QA 1KI9A 3LX4A 2FPMA 3ZC3A 5IZ4A 5M3BA 2QNBA 3M70A 4YJGA 3KYDA 4JUAA 4Y2HA 4PYOA 5CBKA 5CNIA 2IIPA 4LRUA 2D06A 5IT5A 5ALZA 1ICIA 1U7WA 1W59A 1A97A 3HXKA 4M0MA 4UUOA 3TIVA 4TWJA 2WTAA 5LD2B 4C0XA 1A04A 3EW7A 3SNKA 1OLXA 1X74A 1GRCA 3T1NA 1LI7A 1H4SA 2R48A 4KFSA 4DNFA 1XTBA 3DZCA 4M7OA 2J9FB 3PHLA 4NFLA 2HYIC 4PSAA 2FFRA 3I83A 2OZKA 4EI8A 4UTNA 1URPA 4EMSA 1SR8A 3J81A 2OO3A 1NNEA 5E3IA 5BT8A 2F3SA 4OL9A 4F8EA 3KB8A 3D64A 4WL0A 1W4LA 3OTHA 1JU4A 1C0IA 4FMCF 3BL8A 3WTCA 4JT8A 3KB6A 3U13A 1DKQA 1IBLB 3BOSA 4H4CA 3N8GA 5BV8A 3AYZB 2OHVA 1ATIA 2NT3A 3E48A 3GNQA 3L41A 1E1QD 3FGNA 1GZ3A 1XXHB 3FNGA 3DZFA 3HABA 3KVOA 3MWEA 4IDEA 4XTCS 4M54A 5HCNA 4FVTA 3ICWA 4U7GA 3L4SO 3R9KA 2J0UA 4O2AA 5KJCA 4BZWA 5KPJA 3PCRB 2ONKA 1OXMA 2XWBF 4IOLA 4C07A 2WB4A 4OHXA 1RYEA 1XF9A 4J07A 3W8NA 1T0BA 4N65A 4BYMA 1Z08A 3M8KA 5THKA 2BDEA 1A7JA 3WQBA 3Q88A 3VAZA 3SDSA 1XEWY 2Z2KA 2WWWA 2P2ZA 1U94A 1ZNQO 1TT7A 2XMCA 1NJFA 1IBCA 1WCV1 3B7PA 4MVJG 4MRSA 5T8KC 1GSHA 1NW9B 3VPBA 2W22A 1KC1A 5ALSA 2AZDA 1IEQA 1IWOA 1NDUA 4GX2A 1CDZA 3D0QA 3IIJA 4Y1RA 4G86A 2ZQ5A 4JLAA 5I7FA 1E6EA 1KMMA 3CTMA 2ONYA 4EFLA 1VB5A 1Z3CA 1S2DA 4H08A 4CHTA 1W9HA 5LPNA 1JEQA 1HA3A 2Q5CA 1IG0A 3ZXXA 2JJ2D 1EH5A 1UJMA 1DUIA 3PE4A 3ZGXA 3D7RA 5LDDC 1A9PA 4PCLA 2QRMA 3KT8A 3UF0A 3ZHCA 4IS2A 3GLGB 3WLOA 3TZQA 1SVIA 3TK1A 3QVTA 2JHAA 4HWKA 1MX1A 4RK6A 2QD1A 7MHTA 1BCSA 4FFPA 1PG0A 2QYHA 1QRSA 3Q6MA 4DCVA 5IDXA 3OUUA 3PFCA 2VDQB 1E9CA 3RUAA 4U39A 3VAAA 3TQHA 2MYNA 2G6TA 2V7QA 3DTTA 3WHLA 2O1EA 3MB8A 1KK0A 4Q9JA 4X94A 5IYZF 1T2DA 3A6ZA 4B6GA 3V48A 3AJ9A 1FNCA 4NH0A 1Z5UA 5ITZA 4BZQA 5JI3E 1BN7A 2BDTA 1W1WA 3CPSA 1E8DA 4X3PA 3B2NA 6PFKA 1QIDA 2QXTA 4AJPA 2R6ZA 3EGOA 4LDJA 2EKLA 3UWDA 1OY1A 3HU5A 1E7SA 2CKMA 3I76A 3WK4A 4KO3S 4N0EA 2HMYB 3W0LB 4J0DA 4HYEA 1H1DA 4F5EA 1EHCA 5EA2A 4KI7A 1QTNA 2XGOA 3QPBA 3HZRA 5DCUA 3V32A 3TJMA 1T0IA 1ZS9A 3GAAA 4MUMA 2Q5FA 4DMCA 4HV4A 3H2GA 3OQ1A 2NYAA 4ZMBA 4D8WA 4D26A 1FUIA 4MWSA 4HQKA 3DNPA 2GRJA 4HZUB 5FRDA 5DYIA 4BO9A 5CEFA 2IZ6A 2P1DA 2GFHA 3D8BA 2NG1A 2P2SA 3LUKA 3WFZA 2GASA 2Z8XA 1QGDA 3M6IA 3FCAA 3N5CA 3O7WA 4KQMA 3I2KA 3DHEA 4IX9A 3IVMA 4RPJA 2XQIA 1NXOA 3QU5A 5BUSA 2PX2A 2OV6A 4IO0A 1AQNA 2IGBA 5HJ7A 2J3MA 2BKUA 3HBMA 4ZO4A 3K1AB 3SBXA 5ADHA 5AKHA 3ZGZA 2Y1OA 3DEIA 4OK6A 3HFJA 2PVSA 1U1FA 2CBXA 2LZ0A 4CF3A 4L5YA 2W6CX 1C3XA 2OBMA 5LZ9A 3ANYB 3EWSA 3GZJA 2QN6A 3E9QA 3ZHTA 4AJHA 3VYRB 1USVA 1YI1A 1ZH8A 1E5TA 2WABA 3EZGA 1P0IA 5E95A 1AT1A 3FPLA 1GTZA 3C87A 3LVQE 3NWPA 2RH5A 4K1LA 2Y1FA 5BQ5A 3ASUA 3WLIA 2DH6A 3KDAA 4DDHA 4INJA 3R0ZA 2JIZD 2C8VA 2XW6A 4PN3A 2VZ8A 6REQA 3EIWA 1SVLA 1MIHA 4FEGA 5C8YF 3R3ZA 4B2YA 3I1JA 1I7QB 3E5NA 1P4AA 2P1RA 4Z51A 3CE6A 1G4HA 4XIIA 3RS3A 4EBBA 3CUEF 1FRFS 1E2JA 1UXHA 4R9SA 2ZYVX 5A02A 1NUAA 3W90A 4PSKA 4HNRA 4Q7MB 2V9PA 1TW2A 3SKXA 4DBLC 3G5UA 4MUIA 4AF6A 1T8PA 2Y67A 3KU4A 2CL5A 3C3DA 3LX5A 4KKVA 5FTNA 3X2FA 3EUFA 5EERA 2ZRLA 1MG5A 1WKVA 4Q24A 3TSZA 2W2KA 2C2MA 4C0HA 1RQPA 3D3KA 2BEWB 3IE0A 1OT5A 1U8XX 2FZWA 3KKNA 4DQXA 3BAZA 2HA0A 2I6SA 3B8EA 2PXHA 3O2QB 4AJ4A 4RZ3A 5JALA 2OILA 3R5XA 3UJBA 3VYSB 4B71A 4ARSA 2IOFK 2HRBA 1FS6A 3ZD9A 4P9NA 3MQFA 4C7KA 2FVXA 4F9TA 5EIWA 2NU7B 3FI9A 4N0PA 4HGQA 4L08A 2XVXA 3TZKA 1U3UA 3PB3A 1XG5A 4L3WA 6CHYA 2YVKA 1VA5A 4JH0A 2E4UA 1U0RA 1GL3A 2B8TA 3OICA 5F78A 1QUFA 3DAYA 1RJWA 3ZE1B 1FYEA 1GZ4A 3WV5A 2C4HA 1G8AA 1HKUA 4ND1A 1AZLA 2FG6C 3RVRA 5AJYA 2CLSA 2VP0A 3AFIA 3C8HA 3OQBA 4HBGA 2GAOA 3P71T 1NI5A 3RGGA 3B3AA 3T9EA 4RNCA 4G1CA 1PGNA 2J6HA 1TT5A 2WYOA 2EZTA 3U3MA 3PX7A 1UMDB 3SAJA 2JZOA 4YAWA 3IXMA 5DEOA 4DCTA 1N0IA 3R76A 3U7FB 4UXIA 4CUJA 4DMRA 3NBUA 3DWEX 4K9DA 4P53A 1PTKA 2CV2A 3DBLA 1XLUA 4YYZA 4WZBA 1KVSA 3MK31 1Q91A 4K86A 1ZBQA 5EXPA 1FNMA 3L1IA 1FSGA 2DFLA 1WEKA 5BUQA 2FMHA 2A5DA 4PS1A 2XCLA 3WLKX 1H2RS 5TARA 2GJSA 4OHZA 3D4IA 4XJSA 3KLOA 1ZRNA 4DLLA 2I76A 4CLOA 1HNXB 2DFKB 2MYUA 2QHXA 4X9XA 1DRWA 2KBFA 4H1TA 4LOAA 3HUTA 4Q12A 2RAPA 4MTLA 3GEHA 3H5LA 3R9WA 1VRWA 2VK1A 1K66A 4HDAA 1XCLA 1XKQA 5TPZD 3HCBA 5K0GA 3IT0A 5H8WA 3ZE9A 5AJVB 2HK6A 4MRVA 2X9GA 3LK7A 4RS3A 1WW2A 2V1UA 4U1RA 1VSTA 4WVFA 4D81A 2B2NA 1X87A 2EJCA 4YJ3B 1B15A 4UZSA 3SI7A 1I7PA 4YAOA 4OI0A 4Q9DA 3OCWA 5JIBA 3E4CA 1BE6A 3PUVA 4JLMA 4XJTA 4YI5A 4O0LA 2VQFB 5IS2A 2XWQA 3GEMA 3P2JA 1S02A 3E58A 1OV4A 2ZR0A 3GPDG 3PUIA 2WJAA 1E2DA 2C03A 5ALMA 4W5HA 1UODA 2H2WA 3SC6A 2GN4A 3SQMA 3R7AA 4MRMB 1Q6YA 1GCGA 2V0CA 3D6HA 2WWXA 4N6OA 2ST1A 2DHDA 3B48A 4HTAA 2YHBA 1P4HA 2ZRNA 3DO6A 3S2IA 1EB8A 2F8MA 4TL8A 4Q7EA 1DG1G 2WWHA 3ND8A 1XA0A 3LA6A 1RJEA 3OZAA 3IHLA 2H1CA 9GPBA 1S4MA 5CDFE 1KO8A 1F12A 3UT5A 2G5PA 2WAOA 2R8RA 4QUBA 1UANA 3LBYA 4ITVA 1PNRA 1CS4C 4HC4A 1U63A 2AX4A 3NYRA 1MRNA 3DAFA 2NUTB 3PD0A 5HFAA 4N18A 3PXCX 1CBUA 1P81A 1RTTA 4QC2A 2P75A 3O4VA 5AM3A 1NOJA 4YJHB 3L6CA 4YP5A 3ECAA 5JLAA 5LZ8A 3ZOKA 3HVRA 4HF7A 4UVIA 1UT8A 1B00A 2BONA 1NOKA 3F0TA 4KQ1A 5EXTA 1T1RA 3FPKA 3ECCA 3HA3A 4C0LA 1JEYA 2EL9A 3K9NA 4FYKA 3CR3C 4B3SB 4G4SP 1JR3D 5JXWA 2QU8A 2R4TA 2O3UA 4XYLA 2CF5A 4CMIA 2DUWA 4Q9KA 4MQFA 1GQYA 2YXNA 1WZCA 3VR3A 4CKEB 3DOFA 4YPFA 2WWIA 1DOZA 4RD1A 2BPOA 2GZ3A 3LT2A 4D2IA 1SQ0A 5B57C 2I6TA 4HGYA 1JMKC 1KKUA 1R8SA 1W4ZA 1Y3HA 2ZYGA 3G9ZA 3RUCA 1KEPA 3SG0A 4GSLA 2L19A 2WTNA 1OVMA 2GD0A 2OM2A 3CUVA 3KQTA 5AK5A 4X8LA 1L7PA 3H05A 4LY0A 4XVUA 1LQ2A 1W8IA 3H8JA 3WHIA 1PD1A 2W93A 1MJGA 3IESA 1UOEA 1U0HC 2FCAA 2ZP1A 4M88A 4E14A 2GQ0A 3HYSA 4QVIA 1QPGA 2NZVG 1G41A 1RIIA 1Z8NA 2BL4A 3HYCA 2RG1A 3GUCA 1HTBA 3BXPA 4XSGA 3KSMA 4ZAZA 5CG2A 2R1ZA 4AX4A 1C2TA 1Z0UA 1L5YA 4GNKA 1L5NA 1HG0A 3Q9SA 4YRSA 1IQUA 1T9GS 3VU9A 4Z4GA 4EGAA 3SSNA 3KZNA 3PUJA 3WRYA 3B85A 5COAA 1J07A 2M1ZA 3ND6A 1AK2A 3PV0A 5HKLA 3TM5A 5B4TA 4PBRA 4GQIA 2PKYX 4K46A 4OUKX 3OCXA 1FA9A 1THTA 3QU9A 2GPYA 1HY3A 3SIPA 2YIDA 3MWYW 1XQWA 3DOOA 1MU0A 4MEJA 4EHAA 1MZVA 3HNOA 2ZUSA 5CYPA 3UMRA 1JFLA 1PV2A 1JT2A 5K8JB 3TDKA 2YWRA 1ODKA 1Z4PX 2A0FA 3CLTD 3I9MA 3QJ5A 4L5CA 3RYIA 3WDSA 4QUAA 4C4ZA 4ZICA 2I34A 3B1KA 2ZJ6A 3AEXA 4OK3A 4V02A 5JZ9A 2CZCA 3H2BA 3UW1A 1WB4A 4BO1A 2YYZA 3CLTC 3SX0A 4QHSA 2ORVA 4LXGA 5CP8A 2C3OA 2BR4A 2BMVA 2DVMA 4FJ1A 4G4JA 5J1SB 3KR9A 2I6UA 4V3CA 3OETA 5EJ5A 2VHEA 3WO1A 4BEWA 4Z49A 3CHYA 2WE8A 2Q3MA 3QVOA 4J43A 4M0CA 4JLSA 3S2FA 5A9SB 4AY2A 1OLSA 2LRHA 3RIXA 1K8QA 3OE1A 4QGGA 5C5DA 4URHA 4Z3DA 3QU4A 2XNCA 3TQTA 1RXIA 1GPWB 4TX1A 5E8RA 4BFSA 3CE9A 3QFHA 2FPUA 3C3JA 2OGWA 2I6QA 3KJXA 3VR0A 2PRIA 3WGGA 5IDWA 1QGOA 5KWEA 3D0RA 4HDSB 4JU8A 1RWWA 4OOEA 1UXOA 3LCMA 1L7XA 3MJEA 1KSFX 1K98A 4ANFA 4CF4A 5GADl 2ZREA 2QW0X 4KYVA 4QJ4A 3JWPA 5E2IA 4M21A 1QYDA 2VG8A 2C82A 4Y67A 5HKKD 4PLYA 1T6XA 3QW2A 3VNVA 2NSLA 4FKMA 4IVQA 2MR5A 1XA4A 4BUCA 3CX8A 2DBVO 3J80A 2VQSA 3C8DA 2HSDA 1XEXA 2QW1A 3FR8A 4D4LA 1S9DA 5HOQA 5JNWA 1NTOA 3DWGA 3IT1A 3LSYA 2DAPA 3SOPA 2EP5A 1FDWA 4NE7A 4LNUB 1N9GA 1P5FA 1T9AA 4DCCA 4IKEA 4OGWA 2AWOA 5JMWA 4G4IA 4NLLA 4GC5A 3WQSB 3T52A 2WAMA 3I30X 3LBIA 2HF7A 1R8QA 1T9GR 2WF9A 3UWSA 4PC3A 3K9LA 4ZGGA 3GCZA 5E4YA 5BV7A 1MFPA 2AFHA 3T38A 1VCHA 1BVYF 5HX7A 4ISCA 3RSHA 2XZLA 1E9EA 1H0KA 5CH3A 5IBPA 3RC7A 1U80A 3TLBA 4A26A 2XCRB 4IBOA 1OR8A 5AUNB 1JJVA 4OAOA 2XXJA 3WVNA 3RIGA 4DLVA 1ESEA 1SXGA 4EMBA 2FSVC 4ZIRA 1X15A 2X8WA 4Y0NA 2GESA 3KWFA 4URUR 4F12A 5J4YA 2CNDA 3D8TA 2OBBA 4GOLD 1SCJA 2CMFA 3HRIA 5DCYA 3PYMA 5KO2A 2BHNA 3R2JA 5L3SA 4X85A 3B36A 4FD3A 4J16C 4XIYA 1XR3A 1BS1A 3OM9A 2PGNA 4GSYA 4I6JA 1JI3A 1F2VA 4NCJA 4QQRA 3RYFB 4ATNA 2DPXA 2OCAA 2HKIA 2WVAA 3L05A 2LNDA 4F3TA 3COVA 1PHRA 2Q1UA 1XKTA 4OGGA 3CINA 4PO9A 5DSTA 1F7VA 5BN4B 2J5RA 4XD2A 1U0NA 2OHOA 3FPCA 4BLUA 5LYJA 4A73A 4Z7OB 1NTRA 3TL3A 2WSYB 1VHJA 1FP2A 2VF2A 4GYYA 4L9WA 1K8ZB 3LKZA 4UHBA 5D3QA 1W2GA 5DOVA 1PLJA 2R4UA 1GTL1 2JIQA 1H23A 4PXAA 4NYMR 2J5BA 1UXIA 1XRQA 5AM1A 1G8YA 1V1MA 2DLCX 2GI4A 3OKAA 4D74A 1D8AA 4BN4A 4JEUA 4FW8A 3R8XA 2FPIA 2Q28A 3GGGA 3IAHA 4AZ3A 2VHQA 2NYRA 2QNIA 5JDCA 2WWYA 4L76A 2H63A 1SXPA 4BJ5A 3IDQA 4L51A 3TIGA 3D6TB 1FYDA 3TLAA 1YIOA 2B92A 2QM3A 1OYYA 4DQKA 1GM5A 1HDOA 4KACA 4HMQA 1GCAA 3V4FA 1HDEA 1U0OC 1ANKA 4JJ6A 4NAUA 4FSXA 3RFTA 4II7A 5D1NA 2YN0A 3CN7A 1I7NA 3QH4A 3L6EA 4S2UA 4RTJA 2W5UA 4FMDB 2WHYA 2QRPA 5JSQA 3L02A 3QFFA 1XZ8A 2O8NA 4IINA 3EVGA 3WTBA 4EVQA 4G0MA 3B6EA 3MILA 2HBZA 4KIGA 5EPOA 2ZYAA 4HQOA 4IQ4A 4TXHA 1U9YA 5IKPA 1ES9A 1NATA 5AKLA 1YMVA 4GOOD 3I6YA 3F3SA 3A37A 2VWGA 1IN8A 1M34B 2E21A 1FL9A 5CJPA 1BAPA 3D6FA 2MCFA 4YPVA 2ICAA 3EPPA 2XCUA 1CJMA 4ZAGA 2KSQA 3VTKA 4TN5A 4BMZA 4JFAA 2C1XA 1O89A 4LGVA 3RS8A 2G0AA 2H06A 4OB7A 4YO8A 4BAZA 1AB5A 3FF1A 1OMOA 4CM9D 3KE9A 2ZJ3A 2PXXA 3GA7A 2CMHA 5EYPA 3KPUA 4J0JA 3O4JA 4RVDA 2XUKA 4YDRA 5FWYA 2WT9A 3J7AC 3GRRA 4WDQA 3UAGA 3H1EA 3ZNOA 1B0ZA 3MYRA 4NICA 2BTQB 1LB1B 1BKSB 1FFHA 1M1YB 4DZZA 5FBVB 2VTKA 4KAAA 3R8FA 3L6DA 1EHYA 4KVGA 1AGYA 4GUDA 4X63A 3V5NA 1OYWA 3CX3A 4HDCA 4EKEA 1L6IA 2J85A 1N8KA 2F3RA 3A4MA 4GH5A 1NBIA 5HOEA 3PKJA 2I2XB 3NG1A 4G0PA 2CJWA 2ZRPA 4I5FA 4YH1A 1V7CA 2GPJA 1WZ2A 7YASA 3FMOB 4CM3A 2PKQP 4RK1A 3QHQA 1AZTA 2NUAB 1G5FA 2J3LA 4PLFA 5IXJA 5TC4A 4MUHA 4X8MA 3ORHA 3QXHA 5AHXA 2V4MA 4W5RA 3OEEA 4PGMA 1YS2X 1W5EA 4OHKA 3SPXA 3A9VA 4X24A 4QATA 1WMFA 2W2LD 4C30A 2D5LA 2DFVA 1SIWA 4JJGA 1LRLA 3JTEA 5IWCA 2ZB7A 3TKLA 4O5OA 4AJ1A 4BV9A 3OSUA 1N2IA 4Q4AA 1LK5A 1WLYA 1IUNA 1G3QA 4R1SA 4RQBA 5HF6A 4AKHA 1KIAA 3O3CA 4Y2GA 4Y2UA 2UUBB 3ZI7A 2RKOA 4RZQA 4TLBA 2RFLA 3MMPA 3QBDA 4YMGA 5AQ1A 5AXBA 5ALXA 2POQX 1Z07A 1ZJJA 4HQ0A 4S1TA 2LIVA 1ISGA 2VJDA 3CQ9A 3HU3A 3DAOA 2ZI9A 2BHTA 2IHZA 5H9VA 5TF0A 3ANNA 4B3FX 4CR8A 4D79A 2O8EA 2XOKD 3AHCA 5CXUA 4LF5B 4FHFA 3SQDA 4TQGA 3I01M 1E1LA 2PMKA 4JI3B 1P61B 3FHJA 4FILA 4D4IA 1E3IA 2YWDA 3I52A 1TCBA 1XJQA 3G2JA 4KIJA 1TK2A 1RWXA 4I4IA 2R7NA 1OH8A 2C9BA 2EKQA 2VNIA 3B5EA 5CAEA 2ZXFA 1K7FB 1H3FA 2Z57A 5F7OA 4JP5A 1L4BA 5AICA 2ZTSA 3UKOA 3VO9A 3KEFA 1DQPA 1RABA 3EF1A 5HILA 3TOVA 4RULA 1EWRA 1VOTA 3L43A 4MIOA 2E7ZA 3L6UA 2AJDA 3JQFA 3TG8A 2QTAA 1HYHA 4MUJA 3GGOA 4BX0A 3GVPA 3BMCA 1WF6A 4OM8A 4RVNA 4Q3EA 5ETJA 4PONA 1JHPA 3GCWA 1YFLA 1MR3F 2REXB 4O3FA 1K8XB 3ECSA 1V9SA 3N8NA 4I3GA 5JWOA 3R9IA 1NMZA 2ACEA 5INTA 3ZWMA 3V1UA 3W2IA 4MVJE 2VP6A 4JX9A 4BNJA 2Y1CA 4PVCA 4IWNA 3TFOA 4CJXA 4V1CI 4CEJA 3CLKA 3EZ9A 1N32B 1RXUA 1UWVA 4XDHA 1PAUA 1QIMA 3SVTA 3NJRA 4ZVRA 4XB2A 1B2LA 4PZPA 3KSBC 2J59A 1LSSA 3PHIA 3IAXA 4YQZA 1KZHA 4OSOA 3GN2A 4OQZA 4I1UA 3RJ9A 1B42A 2A2ZA 2R5NA 3PKIA 1KARA 4O29A 3N70A 3S2UA 4XX0B 1K6MA 4V1CB 4YXWD 1FRNA 1E2LA 2L2QA 1FPQA 2WA2A 3HCFA 3I6IA 2WHPB 2WIGA 3IQIX 3OT4A 4LYDA 3GPBA 4XFKA 1YMQA 2OOKA 4BGDA 1JJBA 2UAGA 5J5CA 3ENKA 4JLWA 2EKDA 3BHMA 4RAOA 3VZQA 3ODPA 3H7IA 2JI7A 3WB0A 2WKRA 2D2XA 3CNLA 4BVAA 4W1RA 3MUFA 1WOYA 3ZS9A 3W9UA 1JILA 3WV4A 2HM7A 3LPAA 3G8CA 2GVDC 1XB2A 2ZGVA 3H2IA 3O9VA 1RHJA 4IGKA 3F6SA 4EKNB 2GO1A 4KSCA 2WU8A 5U4XA 2AKEA 2R8ZA 4DNQA 2I8LA 4WY2A 2O4CA 4D0LB 1IIRA 2OO5A 2PL3A 3L49A 5LP6B 1XPUA 5EHNA 1VI6A 3PFFA 1NNI1 2Q3EA 3IQXA 4LJ8A 2W2TA 4NMHA 2B4RO 2OB2A 3GAZA 1EVKA 1AMNA 2VWQA 3V2GA 1VJ5A 1LTKA 1YL7A 2YR0A 5DW3A 3S27A 4F3KA 2DFDA 1BMFA 1GR0A 2DFNA 3RKSA 1XMXA 1Z75A 4L8WB 4YAKA 5A4IS 1ZVKA 3KJFA 1E1CB 4UOEA 1R6XA 1RHQA 2AGVA 2FWAA 4MGZR 4BVKA 2ZBVA 2RGUA 3GLSA 3VNUA 3CLVA 5IULC 3KKEA 1Z4OA 3C7DB 5LQSA 1BXKA 1SD5A 2XF2A 4PAGA 2BZGA 5C5EA 2G76A 1DG3A 2K87A 2C7OA 4BO2A 3HP4A 5GM1A 1TQ4A 1HDGO 2V65A 4UQPA 5TB5A 4EYQA 1X7WB 3NIFB 4Q9IA 4R98A 1KP9A 4GKKB 3FSGD 4YUWA 3C7TA 4EGJA 4YUXA 2P69A 3MJFA 1IHUA 2E4VA 3N8DA 4HADA 1HZZA 5DM60 5DI3B 2HA6A 1KH2A 5DLDA 1VL8A 1RC0A 2C59A 3IA7A 1MO4A 3AR5A 1CEYA 1G98A 3B52X 4PSDA 5FL7A 1LJ8A 4EA6A 3PWZA 5A4AA 4JJFA 1P7PA 4OHWA 2OVBA 4N41A 4MYUA 3HNPA 2I62A 1QVWA 4UQLA 2BFEB 1GAEO 2ZAGA 2CZGA 3K1TA 4NVRA 2QXUA 3DAPA 4BFWA 4DSNA 2FFAA 3Q40A 3OZRA 4A03A 4XQ0A 1YI0A 4BQPA 1R4MA 3SP1A 3MAJA 4C0JA 1YVUA 4E6EA 1QTQA 2QP3A 4KDRA 4CIYA 4B3TB 4WZ6A 2W90A 1SU7A 4A8PA 4IY1A 2LDBA 2HA5A 2JRCA 1JU9A 2MIIA 1UFKA 4U9UA 1MDBA 2W9XA 1LPBB 3CB2A 2WZBA 3ZLBA 4B0OA 2HL6A 3FVTA 3LX6A 1SCUA 3M4XA 3PFNA 1IHPA 5DNAA 4QOJA 5ALJA 4O4HF 1QH1A 3CBQA 3CW2A 3C48A 4KNWA 3QEJA 3T3HA 3WZ2A 3WL5A 3WGVA 4RMJA 3Q7EA 2DFPA 1FQKA 2DH5A 1D2MA 3NTXA 3PUXA 2AW3A 1JXMA 1MORA 3MVEA 4XLTA 1UJ2A 2CLKB 3NYIA 1GPLA 1MP0A 3HDTA 3Q85A 1AQYA 4XX1A 5L45A 1IUOA 3IT3A 1Z39A 3QF4A 2W6PA 3DH0A 2Q8QA 1UMBA 1X80B 4B73A 1U8TA 4MV5A 2C99A 4G1MB 3PF8A 4LGYA 3RUPA 4EY3A 4EHIA 1AN9A 1PLLA 4C4AA 4GBGA 4BB0A 3C3YA 4JLBA 1FFBA 2GVZC 4YI3A 3Q12A 3IODA 3CX4A 5LJLA 4U2GA 4B9EA 2K5UA 3T9CA 2AG1A 4NNPA 1SFRA 4AS3A 3KS9A 1JUDA 2GCEA 1LQTA 2G36A 1M1NB 4ZDWA 1LEHA 4QGHA 4R1NA 3QOYA 4JGGA 2C8JA 1ISPA 3FPGA 1R6VA 1WO8A 5JJKA 5GZ3A 4DHEA 3KKPA 3HLKA 1BXGA 3U5TA 1GUAA 4GI3A 2VTEA 3GT3A 1IOZA 3LFHA 4N7BA 4B7CA 5U9CA 3NO4A 3BBPA 1EK5A 1GU7A 1K3UB 5HVNA 4INZA 3OAAD 1JMYA 5DO9A 5G3ZA 3IELA 4LPSA 1KKMA 4RA9A 1E1KA 1IULA 1N6HA 3IAUA 1U7HA 2BMWA 2R8XA 1PV1A 2UVQA 1RPTA 3AUXA 2WM9B 3IAAA 1NJ8A 1Z0DA 2HIHA 4BFZA 1NE7A 2QK4A 3DD5A 4LVNA 1A5AB 1NQAO 2ROQA 4HS9A 4N6NA 4UBLA 4R8KA 1HWYA 3HDQA 4OQPA 5ENVA 4B47A 1S4QA 3JSXA 4QYIA 2ZRQA 4K9QA 5KTPA 4RL4A 5DNUA 3JQBA 1YBAA 3SCZA 5JI2E 3ND7A 4BKUA 1PZNA 1NUSA 4X3CA 3W5IA 5GJBA 5JHHB 3QLUC 2XOEA 1GG8A 1SU4A 4ASUD 4DIMA 3QKUA 2N46A 4EHHA 2CN1A 3KJZA 4C6TB 1HSZA 2OLKA 4D41A 3C45A 1WD7A 3RBZA 4R54A 3WWZA 4CM5A 4EIWA 3W8DA 2XE4A 4PFQA 4EG8A 1UWLA 1TA9A 2O0LA 4UUNA 4QECA 4XUGB 2FF5A 5CDYA 1MX5A 1JHDA 1KE2A 5IARA 2R1VA 2QAJA 4YMHA 2CFSA 4G8JA 1JHXA 1K8RA 1SZDA 2Q1TA 2FKNA 3FYHA 1UK7A 4MSUA 2AZMA 3NM4A 4RH0A 3IURA 4Z0PA 5FPSA 5C34B 1L5FA 1T8SA 2XGGA 2PK3A 4EYEA 3O4IA 4JYAB 4DOMA 4QBKA 1EG2A 4H7DA 3M5PA 4WSOA 5EG5A 1GKYA 4Q4LA 4G0YA 4KWIA 3NMUF 1YB1A 3L7NA 4E5YA 2PMFA 3A58B 2IYTA 3OOYA 5SV2A 4GPBA 2JDID 3RIMA 3SHTA 5FFMA 1UC8A 2HQRA 4JY7A 3ZBUA 4ZI2A 2HW8A 2BF7A 3A1EA 1TJ4A 3LQRA 1N4AA 3CEHA 2Y0PA 2JK0A 4DR3B 4P38A 1A76A 1O8BA 2H59A 4Q4DA 4JP3A 1JB1A 4RBNA 4BWFB 2QQGA 3RG2A 3GLIE 3WHKA 1FTSA 5AVYA 2K2WA 5LA6B 1QC5B 3ZDYB 2XLCA 3NZEA 2P3SA 3KFVA 5HFJA 3BTUA 2XTNA 4LUCA 1CF2O 3TCNA 2HTEA 4TT3A 1J8MF 1SULA 2IX9A 4IH4A 3EPHA 1AS2A 4AUKA 4H0FA 3RBAA 4TQAA 1EZZA 2FWBA 2GNAA 4G1EB 4NF2A 4DB2A 2XD4A 3NHFA 1T9KA 4NCAA 3ZZ0A 3Q7RA 1K7EB 2QMEA 3EGDA 3FYDA 1NXWA 2W43A 4QDTA 2CLDX 3K9BA 3OQHA 4UD2A 3RK1A 3N0XA 3LW8A 1AX9A 1Z6XA 1U7XA 1KY3A 4L73A 4RZIA 4L9AA 5KVVA 3UXMA 2QTTA 1GU0A 4RZ2A 6YASA 3D7KA 3QKWA 4O2BA 1WMEA 1M8FA 2G83A 1OJLA 2EZ8A 2P4QA 4WZBE 5EXXA 1J0EA 2VP9A 2VPYA 3VJLA 4JI0B 4HFRA 2XDAA 1EDOA 5BSTA 1G66A 3QKIA 2C54A 4OXXA 1N0WA 3KLPX 1JTFA 1NNLA 3W5BA 2ZPTX 4EX6A 3JWIA 1E96A 1X14A 5EEHA 2AIRA 1QPZA 2XYVA 4QRDA 1R4ZA 3Q2IA 2QE6A 2HZ7A 1KDOA 2A9KA 3I2FA 2JS7A 4FUTA 4N39A 3LIIA 3LBHA 5FNVB 1RRFA 1O0SA 2A9VA 2EHDA 3KTDA 4MW1A 3ZQUA 4PLZA 5JD5A 4KR6A 1D7OA 1NJ2A 5IC6A 4Z1MA 2IH2A 2X4GA 2ZSFA 1H1LB 2ETXA 1K4YA 3QJGA 4LJLA 2WNHA 3RJZA 3SEZA 4KQCA 3GLKA 2ZJOA 3DP7A 5A04A 1V6CA 1KEUA 2C20A 4GECA 3QMMA 1EX1A 3DYIA 3GD5A 2C04A 3LY9A 1ZK3A 2XTMA 1QJCA 1TFUA 5LDHA 4JGIA 1D1TA 1MW9X 3L8CA 5DWDA 4ZYZA 5CD9A 1QCZA 2PMEA 2JGKA 1KF0A 1J0BA 1KZ6A 2CHEA 3DCNA 1WHSB 1KH1A 1OF1A 4DCSA 5D2CA 2A1IA 4Q3KA 3AZOA 5B55A 1SIBE 3DD1A 3W5HA 2IDMA 2QZPA 2PZJA 4I99A 1EEXB 2CMDA 2Y1KA 4I66A 1QIHA 2CYCA 4LJRA 5ALDA 1E9SA 1OXKB 3FTDA 3M6MD 5ISMA 4B2IA 1ZMOA 3RS7A 4WWHA 2ZS8A 5I8ZA 1OAOA 1AGNA 2QTRA 4HMPA 4YBZA 2HY7A 4QBFA 4JBNA 4C7XA 2BFNA 1YCDA 3DBRA 5EKTA 3OQ6A 5JNUA 1U31A 2HCBA 2FU5C 2HLNA 1JHMA 1KP2A 1W44A 2PX0A 1FFCA 3BIJA 3L6OO 3LDAA 4TRNA 3TLEA 4DLWA 4DTIA 2ETVA 2NO1A 1AO3A 3ML1A 1QH8B 1E5LA 4F9GA 3H4MA 1MVOA 1PT5A 1VPEA 1Z0FA 1H94A 1X39A 2SHKA 3B1XA 3E2PA 2A88A 4IZIA 4UHKA 3WYNA 3ZD8A 3OQNA 4JYZA 1OC4A 3D7LA 3MCVA 3P9PA 3T95A 4DDKA 2O7QA 2WLSA 4AZWA 5C4GB 2QSZA 4XVHA 4YAGA 1NM5A 2IDZA 2V7VA 4KQ9A 4RADA 4EG5A 5AIBA 5M2QA 3U17A 2O2HA 2YKGA 4JT2A 3L40A 4DV2B 4C06A 2WTBA 1Q0SA 2HSEA 2FG7C 2YY5A 1W29A 3UUEA 1G5TA 2AOWA 2DCMA 2IZOA 2H0RA 1YRHA 3NYWA 2J3JA 1RAIA 3RHFA 2QAIA 1J49A 1UQRA 4IO1A 4UAJA 3N2YA 4IQFA 1CIPA 5LFAA 1TA4A 2P9CA 3JWJA 1EIWA 4HXYA 5DHPA 4FZJA 3CT4A 2WM2A 5FTKA 1U04A 4UCWA 3TQCA 5IABA 4U3JB 5HS6A 4MDEA 1SA0A 2DWUA 2YL2A 5CLJA 4J3NA 3ZU5A 3CKYA 4V0NA 4IHQA 5COQA 1NVKA 2J3KA 4IWXA 1WVGA 5FEUA 5E6SB 3REOA 1U2ZA 2IZ0A 2GILA 1M76A 3RVBA 1CHNA 2GEFA 4A2CA 4NQRA 4YV0A 1VL6A 4DR6B 4NMMA 1JXAA 1MEEA 4RORA 3E70C 1V6SA 3TIFA 2WUFA 5JJCA 2GD6A 4EH1A 2ZJ7A 2O8FA 2YOGA 4O1MA 4Y30A 5A5VA 4NP6A 3ONFA 3EFOB 3L4EA 5GP1A 4BTLA 4CLRB 1RYZA 4WNCA 4J0GA 4BNMA 2IHKA 5JZBA 1DAPA 2QR2A 2CGEA 2P9YA 3Q15C 1K7SN 1ORRA 3CMMA 2VIIA 4P3NA 2QL5A 3GD7A 1MD9A 3KZ1E 5CTJA 3OFKA 3P45A 2AOTB 2P1ZA 3Q41A 1OZ0A 2WKQA 3HYRA 4L8FA 4URZR 5CRIA 2YV1A 4LVCA 4EJ6A 3NCTA 2FW6A 3BJMA 2IZ7A 4MWEA 4IXNA 3R74A 2AN5A 1J39A 2OPHA 4NU6A 1DXHA 1XCGB 4DV6B 1UOOA 3DB2A 2BF4A 1OFUA 2AE1A 1R37A 3GJXC 4O25A 2JCSA 3WGYA 3KYJB 3F9CA 1LLQA 5JNLA 4LQCA 4FFVA 1GCUA 1D04A 3C8UA 3H5VA 1AZWA 2Q4TA 1R18A 4CMCA 2HDNB 3EB9A 2C5GA 3C85A 4IFEA 4MH0R 2EFCB 4BO5A 3E9CA 4EHJA 1M2OB 3CSUA 2XA2A 2A0UA 3ROEA 4EDFA 2D7JA 2YV2A 2HXGA 1RVDA 2FUG6 3AJAA 3CB4A 3F9RA 4OBXA 4XW2A 4ZJUA 5C8XA 1NN3A 1GDHA 4HFJA 4QU9A 4X71A 2YZ2A 1G5HA 4JOBA 3ZG6A 4LKOA 4FHDA 3ASYA 1SPBS 1JAZA 2WD8A 5D00A 2C5BA 2K2QB 2WIAA 1HQKA 2A5GA 4B48A 4R2IA 4WK6A 1H4TA 3KALA 1ETHA 3NTRA 4G1BA 4PSVA 3TNJA 3TRKA 2V7EA 1JHRA 1DVRA 1G8JA 1ZCZA 2ATCA 3HL4A 4XVQA 5E3JA 3P20A 3DNFA 2D1SA 3ADOA 3QKTA 4LZAA 3E05A 4J49A 1ABFA 2A35A 5A4KA 1P4JA 5LNK6 2QZJA 3FVVA 4YV1A 4DQ0A 2BFBA 5BQFA 1Y0BA 2CK3D 3LRPA 3JZFA 4IEEA 1KJQA 4TROA 2AI3A 3IHKA 1QQBA 1VKRA 2P5YA 3MWDB 1L1EA 3V7FA 5B7QA 4WLNA 5IASA 4MGYR 5LMNB 4QOIA 4I4CA 3R7WB 2WR8A 2IYWA 3ZTYA 5JBIA 3ED1A 4KV9A 3ID6C 3DVSX 2VF5X 1DS6A 1GYQA 1VJRA 1TMGE 1WX1A 1HYBA 3DE7X 4HH4A 1NVEA 4AZ0B 3N8IA 2O7SA 4MUYA 3ESYA 4Q5IA 4YQEA 1EG7A 1QGZA 3HJNA 2PS0A 3OX2A 2ZWPA 3MGGA 3Q3GE 2IYSA 6LDHA 1ZA1A 4AT1A 3OUZA 2Q1WA 5FT9A 1OWOA 4BIMA 1DDGA 2WLTA 4YAFA 1I5EA 3ESXA 3LGXA 4M4SA 1ZX1A 2W0SA 5TJ9A 1NI3A 1ZGAA 2B94A 4FKZA 1X0VA 1WDMA 3DMRA 5KSWB 2BTEA 2AFHE 2VO1A 3VTAA 1EUDA 1I4DD 3IIEA 4YP1A 2ERXA 1ISJA 1I4TD 4IIJA 1EKXA 4BUJA 2J48A 1SBQA 2GH1A 1C50A 3BRSA 1JQDA 2CJFA 3UC5A 1SHUX 2BCJQ 3WIEA 5KU7A 1GA1A 1Y8QB 4HJXA 5I7SA 1JHAA 1YCHA 1IIBA 1RRKA 1K6JA 1YA8A 1IY1A 2CCJA 2H0QA 2VTVA 1C0LA 3JYOA 3PFBA 4FQ7A 3K70C 3SS7X 5FPHA 2UYHA 3HFRA 1HO3A 3PYXA 3ZCPA 3H2SA 3CCFA 5DEIA 1H6AA 1XVLA 3FMGA 3P0JA 4RD6A 5C0OE 5LOVA 2F8SA 3MRTA 2X4DA 1NVUQ 3A1WA 4HBZA 2J4FA 2CV1A 1KBOA 1WQ4A 5LA6F 4E21A 3UMYA 3WJ7A 5DHQA 4P7FA 3ZY2A 5CB0A 1AM4D 1T6ZA 2WU4A 2WT8A 4TZTA 3ASZA 4HRVA 1XRJA 5SZJA 2YJZA 4B3MB 5F73A 3ZKAA 4UAVA 1MNQA 3AEKB 4DV3B 3CF4G 2ODNA 4C4OA 2OVFA 2W6QA 4KLZA 3L8DA 4IS3A 2Q7XA 1ONBA 1IPFA 5FR1A 4KIWA 2JK1A 1R5OA 2H5LA 2PUVA 1SQGA 3W9YA 4KQXA 1T3LA 2YJ6A 3EQ7A 4EHBA 5K8LA 5KX5B 3ZCRA 2X3FA 2BISA 5GPBA 1DT5A 2OHHA 3KV3O 3T7AA 4OG2A 3OQJA 4AIRA 4ARZA 2H1FA 4H7HA 4P4UA 4PFKA 1XALA 1CX9B 2DETA 4IFBA 4F45A 4LG1A 2PRSA 3L82B 2Q7OE 1M73E 2C2HA 3AFMA 3DBOB 1C1YA 1QZUA 1FX0B 3HYNA 5DOZA 3NRCA 3A04A 2GZHA 3NHSA 2RE8A 2ZRBA 2DJIA 1PNVA 1GGHA 1OIWA 4UCXA 2WA1A 2V97A 1G7CA 1N2SA 1SHLA 2O8VA 3JVDA 2J08A 1X42A 3UNXA 1J90A 1JLKA 3QEMB 1UDCA 2G1KA 3DVRX 4JWTA 1YDGA 4WX2B 1MN6A 5BNTA 1VI2A 1P1RA 3BWXA 3OJEA 1PN3A 3OZEA 1Z4LA 3U4QA 1IE3A 1CUGA 1WPQA 2YCBA 3D2AA 3WKAA 3U3JA 1F8GA 1OI4A 3HGTA 3H3FA 2JLYA 2X13A 1SCBA 4CIBA 1U8UA 2EW1A 4O4JA 4YJ2F 1VE9A 4NDZA 3ZWBA 1KYWA 2R9VA 3ZTWA 3UV6A 4N8SA 4CDRA 1YONA 1TRHA 4DJFC 5CITA 5JFOA 2AX3A 1YUBA 2G9UA 3D8RA 3OF2A 1M6EX 3LRTA 5EWLB 3IL2A 2A3RA 1YIDA 2Q3LA 3N2LA 3EUWA 4ND3A 3MLAA 4MROA 4M9ZA 1HGXA 1RKUA 3ZGVA 3DBVO 3K2QA 3O3MB 3O8BA 1YKGA 5AT1A 5BW6B 3QOFA 1RVV1 2ECKA 4QJBA 1W0KD 5G1NA 2CFTA 4B6SA 1B16A 4BQQA 2CL7X 1PWZA 1X1SA 2ZBFA 2J9YB 1OGJA 2I3GA 3AFNA 1CU1A 1CR4A 5JCJD 3DUWA 1SUIA 3JQRA 4B85A 2C96A 2FR8C 2VJCA 3KD2A 1JDPA 1WMBA 2CB0A 2HRZA 1AXRA 1KC3A 1V47A 3IIKA 4I81A 1YR2A 4Q3BA 5JMPA 4DCUA 3KV1A 4R2WA 2ACWA 3TD6A 4ZOAA 1O5TA 1T2NA 1UMCB 1OFGA 1JJAA 1N8SA 4IDDA 5G4KB 1J0CA 1NPYA 1UADA 1V7QA 4OQFA 5SZKB 5J2UA 3JD3A 1G21B 2G0TA 3TAHA 1VL5A 4C05A 5JAPA 1HETA 4MVXA 3SYMA 2R97A 2FDXA 3DZIA 3O9ZA 4R7GA 1RYNA 2QBYB 3C4JA 5C5CA 4XLLA 2P90A 4WW0A 5ALWA 2H4FA 3AHIA 3OZVA 3SKYA 4AY6A 3BXFA 1F2UA 1I1HA 2EQAA 4NABA 2BKEA 3HJTA 4JSRA 3OA0A 4OV6B 1MH9A 5D6NA 2FPPB 2ATXA 2GLTA 1DHTA 1YKFA 3K4PA 1RS0A 2ID9A 3LUDA 4P0TA 4KP7A 3KEMA 2JCYA 3GXOA 3UK2A 2FSFA 2NAFA 2I1QA 3AKEA 1A96A 4PVDA 521PA 2YW9A 2F8LA 5JS1A 2RBGA 3U2QA 4HGRA 4CKWA 5IX8A 4CQNA 1M7HA 1U2QA 3IBSA 4PR0A 5FUYA 5E1OA 2HMTA 4JSYA 4K6KA 1GUBA 4W5JA 4Z99A 5LQCA 4B4DA 3H5IA 3HO6A 4PGAA 1DKOA 2VCHA 2AFIA 3BZUA 2XB2A 1YHZA 2G25A 1DCMA 3NQ41 1Y6RA 3O31A 1IHOA 3T7KA 3UXEA 1P60A 1ZIPA 5MFZA 1E3WA 1KAQA 1VMKA 1EWVA 2FPGA 2QTVA 1BFDA 3RR2A 1QOZA 1OD6A 5F35A 4R2JA 4W8GA 3E7XA 3VO8A 1QQTA 4RTOA 1Q15A 5CHEA 3R0XA 4BE4A 3L8EA 1MXFA 1YIAA 2QVYX 3I9FA 4XGIA 3MMXA 5NLLA 3KTAB 4EW1A 3NPMA 1IB6A 5EWJA 2O0HA 3JAKA 3NH6A 3OA2A 1NR5A 2IOFA 4WLUA 5DHTA 1N2CA 2WT4A 2YHAA 1USUA 5CGZA 2QUZA 5ERGB 4PE5B 3N28A 1GL9B 3ZV6A 1EXNA 1K92A 3ABOB 3S28A 2GB4A 2NPIA 3E1KA 4PYJA 2W00A 1YOVB 4UARA 1B8OA 2G04A 4RK4A 1W5AA 5EIBD 3T5DA 2CD7A 4A27A 5F21A 2ZSIA 3VX3A 4AQ7A 4OATA 4MDFA 1E1MA 1UM8A 1OVGA 2P9EA 4RVGA 4XWOA 1OI3A 1GEEA 2NNWB 4Y0VA 5EIBC 4J2TA 4HEHA 1R0LA 3DYBA 4OQNA 1HQCA 3GCDA 5AD1A 2DTEA 1EVLA 4B3GA 1A1VA 4MUNA 1FVHA 2YTZA 3AHEA 4RKWA 5CFQA 2YRWA 2MSEB 2NO4A 3P97A 5C46F 3E3MA 3ZDRA 4R2HA 3RS9A 3A6LA 4MVYA 3CVVA 5FD8A 2JPDA 5FLXA 4LJYA 2I5PO 3H11A 3QSYA 2VQ3A 3MBKA 4PPQA 1IN5A 3DTNA 4I4LA 1TKBA 4XYBA 4WOPA 4WBSA 3ZU6A 1U7ZA 2C00A 4L4UA 5JSZA 5DBHX 3BFJA 1J70A 3TMYA 1QK3A 2DBRA 2VUUA 1KMNA 3TZBA 5KTMA 2ZZNA 1BGWA 2YHIB 1QMPA 3FPEA 1Q3TA 2G88A 4HDKA 3UT6A 2H29A 2Y76A 4CTMA 1JRLA 4PG6A 4NYMQ 1TPZA 1NF8A 3LF2A 4XGQA 1A7KA 2ZROA 1D2EA 3HJCA 3RHTA 3V7YA 4JFRA 3W5DA 3OFVA 3NIWA 4P98A 3A26A 2WMDA 3K3PA 4WNAB 2O8BB 3OU2A 1PWHA 5BVGA 3P96A 2O6HA 4MI1A 1ZGCA 1SOVA 4IYJA 1FS5A 3E22A 3IPLA 3BE5A 1YF3A 3OKPA 3NVKI 5BN5B 3CVWA 1NQVA 3F3MA 3HY3A 3RTAA 1C3OB 1Q77A 3EISA 3TECE 1IZ9A 1OBCA 4PAMA 4EPTA 4AMUA 1RTKA 1TTHA 3ANMA 4NMWA 5IRCD 1SG0A 1MIOA 5B3AA 5I5GA 5HK9A 5EVCA 4P08A 1HL7A 2OOSA 4TLMB 4RFVA 3I2JA 5EJMA 2P2GA 2G4LA 2VH1A 3OHMA 1O54A 3PX2A 3MCAA 4TL7A 1GV1A 1ECCA 4D9KA 4TGLA 4ICIA 3D7SA 1KTIA 3SSMA 4PLTA 3TQQA 2QRVB 2JHFA 1XZEA 4ZU1X 1MLDA 4OP1A 4QDJA 1XLWA 1B6SA 3KLNA 3AOEA 3VH3A 3I9LA 1DJLA 3N8KA 4NZYA 5F9MA 2FRXA 2PH3A 1NNUA 5IKOA 3ESRA 4XJXA 2A86A 4MUBA 2P6MA 3SJ7A 2NYUA 2B8NA 4WCFC 3K73O 1C4KA 4ZJPA 3DGEC 4P0PB 1DWQA 1JH8A 1KGDA 1A4RA 3QUSA 3D3WA 3UIEA 3JWHA 1K3TA 3ND9A 1W25A 2E5LB 4KC0A 3A70A 5T5QA 3GLHB 1EK2A 3SZLA 4Q4HA 3RT7A 1X2BA 4ILEA 3CO0S 4BGVA 1G20B 1KIMA 3D7NA 4QU8A 4RV9A 3A6HA 4X20B 2VUHB 3BXGA 3DL4A 3BWMA 3PIRA 4RTPA 2LUOA 2NUPA 2QTFA 1G64A 1N2BA 4OGLA 3BH7A 5TX7A 3B7GA 2ZJ4A 1B3RA 2WSSD 5D85A 2PUTA 4M0UA 1JKXA 2HWKA 4NEHB 3N76A 5EP1A 4N8EA 4GWGA 3H8SA 3RVPA 5BV0A 1COWA 4OLAA 2QPTA 3AEQB 1QU3A 3QV2A 3HDJA 4WFQA 3CIOA 3LGAA 1DAMA 2NZYA 3EZ7A 7REQA 2XBLA 5AKYA 3N53A 2PBFA 3W8RA 1ODFA 1TUBB 4FGZA 4TLAA 1TM1E 4AUNA 1JLLB 3SLKA 4MV3A 4EX7A 4KPEC 1TJNA 3BRWA 1QM5A 3KKOA 4HAYA 3BE6A 3ZH2A 4MVCA 4B3HA 1KVQA 2WV9A 4HHEA 3RJMA 4KAXA 1HMPA 3F6BX 1VG1A 2CUKA 3D4OA 3NT4A 5JYDA 2Y9MB 2HRCA 4DR5B 3NATA 3QF7A 4WXMA 1ZCJA 1MG0A 3QY9A 4YUVA 2BM1A 2QIPA 3WXMA 5JECA 1GFWA 1RP1A 3I2IA 2G5GX 4MVJM 4HUTA 4G9GA 2OAGA 3NP7A 4HWTA 4GBED 4HEA1 1U3TA 3CF0A 3EGWA 3I9JA 1AUXA 2UYCA 1VG9B 1A8IA 3I61A 2ZIAA 4ZK2A 4F8YA 5JNSA 4PYRA 3WMFA 1CJKC 3F6CA 2JJ1A 2X1MA 4KGZA 2TECE 2FLKA 2BGWA 2BSXA 4FGWA 3OF3A 4MCHA 3U16A 3NASA 2R60A 2WIKA 3GLTA 4Q19A 3N0TA 1T8WA 4G5SA 1IG3A 1OZGA 2G09A 1R0SA 4RTLA 1C8VB 1N2ZA 5K0LA 4X1IB 5I3CA 2JIBA 3NKFA 4J6FA 1QP4A 2C7GA 2FJ0A 4Y2SA 3WLLA 3E27A 2C77A 1J0AA 2WILA 3OEHA 2YDXA 4INAA 1EUCA 1NRXA 4MRAA 3HXOA 2JFOA 4FFMA 4U0JA 7AT1A 2WWFA 3SNHA 3EUAA 1N6IA 4KHPB 3U7HB 5LU8A 4IHKA 4NWIA 2WSLA 3FUUA 5DHRA 1XTPA 1Z56C 2JRLA 3TQFA 3RC8A 3ZZ1A 2O07A 2ZUDA 2QX6A 3SM9A 1M0EA 1A50B 4TN1A 4MV9A 4PO8A 2DWPA 1ZA2A 4R83A 3G5AA 3ZXUB 3PS9A 5FYQA 5A0VA 2ZJZA 1GXSA 1KZYC 2I2CA 2YX1A 1NVGA 4XRRA 5CTAA 1P2UA 1Y5MA 5L3VA 1DL5A 4PGHA 4F4CA 1LW6E 1JFSA 3O4HA 1NVDA 3JALB 3U4DA 3ZQKA 3FJOA 4FYHA 3MTIA 3TW4A 2CBGA 2B8WA 2I03A 4XH9B 2KW5A 2ZU6A 5BNZA 1ELOA 3E9YA 2C8KA 4U4AA 5CBPA 4L2IA 3QUTA 3N2KA 2ZW9A 4PICA 1BH2A 1JIJA 2QM7A 1ZUWA 1UJNA 3MT9A 1IY8A 2FFJA 2ZTVA 1DT3A 3A05A 4IKPA 4Q6WA 1AF7A 2ZS9A 1FTYA 3PRHA 5HJEA 2QMUA 1Y82A 3PQ2A 3PPIA 4OLFA 1F0KA 2GTIA 2QPLA 4HQLA 4X41A 5ECDA 1TCUA 1T0JB 2I3DA 4TLDA 1X0XA 3AHDA 3GR6A 4F97A 5BW5A 1RQLA 4BXOA 4RC9A 5CW2A 1Z17A 3H17A 2Q9UA 1Y1TA 1Z8DA 1NR1A 3QA3E 1FCJA 4GP6A 5DWQA 3SM3A 4AJIA 4DS3A 1BEEA 1IVNA 3OD5A 5KVSA 4K6HA 2JLVA 1NMXA 2PO5A 4IIHA 4II3A 5AVUA 3NU1A 1JDBC 1QO7A 1MZPA 1II9A 1PJ4A 3K20A 3ZY4A 3ZHYA 4CEIA 3LHKA 2POCA 3E35A 4FS3A 2IS1A 1B41A 3WWEA 2ZKLA 2JFFA 1O96B 3H2KA 4X8OA 3O90A 1F2TB 4WUVA 3OT1B