4OFWA

Crystal structure of arabidopsis thaliana dj-1d
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
387
structure length
387
Chain Sequence
b'NSRTVLILCGDYMEDYEVMVPFQALQAFGITVHTVCPGKKAGDSCPTAVHDFCGHQTYFESRGHNFTLNATFDEVDLSKYDGLVIPGGRAPEYLALTASVVELVKEFSRSGKPIASICHGQLILAAADTVNGRKCTAYATVGPSLVAAGAKWVEPITPDVCVVDGSLITAATYEGHPEFIQLFVKALGGKITGANKRILFLCGDYMEDYEVKVPFQSLQALGCQVDAVCPEKKAGERCPTAIHDFEGDQTYSEKPGHTFALTTNFDDLVSSSYDALVIPGGRAPEYLALNEHVLNIVKEFMNSEKPVASICHGQQILAAAGVLKGRKCTAYPAVKLNVVLGGGTWLEPDPIDRCFTDGNLVTGAAWPGHPEFVSQLMALLGIQVSFH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein DJ-1 homolog D
publication title Stereospecific mechanism of DJ-1 glyoxalases inferred from their hemithioacetal-containing crystal structures.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Lyase
total genus 131
structure length 387
sequence length 387
chains with identical sequence B, C, D, E, F
ec nomenclature ec 4.4.1.5: Lactoylglutathione lyase.
pdb deposition date 2014-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01965 DJ-1_PfpI DJ-1/PfpI family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ofwA02
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ofwA01
1PDVA 2ZUWA 3OT1A 1QVVA 4PXYA 4RKWA 2FEXA 3PQ6A 2GK3A 1GGEA 4B40A 1P7YA 1G2IA 2VXOA 4OJYA 1P81A 4P35A 2YWDA 3UJNA 1OX4B 3D54D 3NONA 4OGFA 3EFEA 1GPWB 4P2GA 3ZR4B 1CS0B 3CY6A 4P5PA 3CYFA 5JZOA 3NOVA 1CE8B 1Q2UA 1QDLB 4ENWA 4B2YA 4BIMA 1PV2A 4L78A 3CZAA 1IZYA 4BTEA 1KEEB 4ZDJA 2ZUTA 1KWGA 1KWKA 1QVWA 2AB0A 1OY1A 3F71A 3TTYA 1QF7A 4GUDA 2GHRA 2RK6A 4K2HA 5BV2P 1WL8A 1U9CA 4L7QA 4ENQA 3UGJA 3NVAA 3PQ3A 1KXJA 1I7QB 4WINA 1CF9A 1VCMA 3CNEA 4Y1GA 4MTCA 4OGGA 4UOQA 1OI4A 1JDBC 4L8FA 5DFAA 4D1YA 3F5DA 3SF8A 3WFZA 2ISSD 4B5KA 3PQ7A 2LXNA 2R1TB 3NOOA 3R75A 5SY4A 4N0MA 2AD5A 3PQ4A 3RHTA 3MIIA 2D7JA 3B38A 1I1QB 2ZUUA 2VRNA 2R1VB 3FSEA 4ZDIA 1ONSA 1GG9A 3EZGA 1OX4A 2VPIA 3UK7A 4E08A 2WJZB 4UNIA 4WXYB 3TTVA 4GE0A 4AUEA 4MNTA 3N7TA 3PQ8A 4E5VA 2OR3A 1I7SB 2V4UA 3P9QA 4R7GA 4BFLA 1SY7A 2A9VA 4AJ9A 4S0ZA 3OT1B 4HCJA 1N57A 4OFWA 4ENTA 3NOQA 1T36B 3MGKA 3TQIA 4B31A 4ENSA 1GGKA 3TTSA 3P9PA 3BHNA 4N12A 4Y1FA 5JZMA 1J42A 2YWCA 1FYEA 3SOZA 1QVZA 1SOAA 3ER6A 3ZJ4A 5SYAA 3FIJA 1Q7RA 1M6VB 3L3BA 3UMMA 1T3TA 3KKLA 1FY2A 1OX5A 3L4EA 4OQ4A 4ENVA 1GGJA 1GGFA 4L95C 4P36A 1PE0A 3PQ2A 3L7NA 4LRUA 3TTWA 4Y1RB 2R1TA 1O1YA 3B3AA 1UCFA 1T0BA 3EJ6A 4QYXA 4MGHA 4ZGGA 1P80A 4I4NA 2RK4A 2R1VA 2ZUVA 1QWSA 4JQSA 3UOWA 4I2NA 4RKYA 1BXRB 4AULA 3R74A 1IPHA 4I46A 4AUMA 4ENPA 4XLLA 3ZJ5A 4P34A 2RK3A 3P9RA 3PQ5A 1VCNA 2ZUSA 3TTUA 1S1MA 1K9VF 1VCOA 2VKTA 3EWNA 1OX6A 4OIFA 4UZSA 5SY6A 2W7TA 3BWEA 3GRAA 3B36A 4QYTA 4ZDKA 3CZ9A 2VDJA 5E9AA 4L8YA 1VHQA 2XF2A 3NORA 1C3OB 1L9XA 5SY9A 3R76A 4Y1EA 4B7AA 3M3PA 3SF8B 4AUNA 3VU3A 1A9XB 2NV0A 2R1UA 2YWBA 1GGHA 1PDWA 4LGYA 4ADSG 1GPMA 4ENUA 3TTTA 5K4AA 4L8WB 3L18A 2H2WA 3EN0A 4UOZA 2YWJA 1JVNA 1KA9H 2NV2B 1IZZA 4Y0NA 1P5FA 2ABWA 4Y1RA 4UCFA 1R9GA 2IUFA 5LIRA 4GE3A 4ENRA 1C30B 5IP5A 1P7ZA 3TTXA 3P9SA
chains in the Genus database with same CATH superfamily
5JUWA 2CVZA 4LCJA 4NE9A 3ZYZA 4A82A 1Q0ZA 3WGOA 1WB6A 3ECCA 1P81A 3U26A 1DRKA 1C4XA 1BJTA 3NONA 4K8OA 1SCUB 3SJ7A 5JOQA 3PHGA 1ZK1A 2Y0BA 1DLJA 3BRSA 2ZBVA 3QOYA 4Q6WA 4UASA 3U48A 4A8HA 2HA5A 4ZCTA 3DE3X 4BU1A 4MYSA 2D1TA 5LBIA 2P2CA 2X1HA 3UWPA 1U0FA 3PL1A 4PEVA 2ZI6A 1SO8A 2GBCA 2FQQA 4DPMA 5TJHA 4BJ1A 3AXSA 3KJQA 4DQDA 1Z15A 1NLUA 1BEEA 4D42A 4GUDA 4AUKA 4RTMA 3HA3A 2QP9X 3PWSA 4A8PA 1UBKS 3AJRA 2HQBA 4RFVA 2UV8A 1KH2A 2DULA 5HJ2A 5F52A 3RVJA 2OCKA 4QXMA 5CLQA 5HK8A 4JBIA 4NEGA 1SHJA 3WMRA 4ZQIA 1RWNA 2HL6A 4RU1A 3G68A 1CJVC 2POQX 4WZZA 5DKFA 1OPRA 1X7XB 3FOAA 3FGZA 1DZIA 4IWXA 2ROQA 4P7GA 5KNDH 3W9BA 4LKRA 3EIQA 4GECA 4P5EA 3RJ5A 5A7FA 1A97A 2E4AA 1F5SA 5D3ZA 3ND8A 4WGFA 3E2IA 4H4DA 5TQ2B 1QONA 4H7IA 2IV7A 4BX9A 4F85A 2QUZA 3DAFA 3KZKA 4PYLA 1SCIA 4HCJA 1XT6A 1CR4A 2NADA 2Q3CA 3WIVA 4ZEVA 4H1VA 4MWCA 3ZS9A 3Q7SA 5L3RA 3TPCA 4EF4A 3F5QA 5AW0A 4TKMA 4MYUA 1A5TA 3HJFA 4HFMA 1M7BA 2RJ3A 1BN7A 2OHJA 4GXQA 4E13A 1T35A 2ZRJA 1OKKD 2SCUA 3RBZA 5FBZA 3W8DA 5J4HA 2IEDA 4HRYA 1E8DA 1L7XA 1B8PA 4G89A 4X3PA 5KTKA 1AD2A 5HM6A 2BDUA 1PTKA 1XQYA 3LI2A 3MN1A 4ESVA 2WKQA 1OFIA 2FZ5A 1ZJJA 1L5WA 2FR0A 2VP0A 4BIIA 1ZISA 3MF4A 4KPUA 1F4LA 1QFZA 1FQJA 3FTNA 4HMQA 5LA6B 3T4XA 4XM2A 2QRQA 3LPDA 4BWVA 3OZSA 1CEYA 2PH3A 2PXCA 2VQDA 5J5AA 2VOEA 3NXSA 4ZQCB 5JPDA 1SOWA 2WT4A 2I4IA 2QHXA 1K97A 2ZIAA 3OJLA 4Z7NB 1B8VA 3M1YA 2ZLBA 5A3SA 1JEQB 1J8YF 4D9NA 5KINB 5HCNA 5JSKA 5IYZF 1ZG3A 2WF6A 3UV3A 1DBVO 4IG4A 3WJ2A 5LZ9A 4GGPA 2WLSA 4MVJP 4RYDA 1USIA 1YH3A 3WWYA 5JADA 1HNXB 5HM8A 2V9PA 5FP0A 1BHO1 4B6JA 1EK6A 4FMPA 2BE7A 4RK7A 5EFZA 1FX0B 2BUBA 3BL6A 1RZRA 1SG9A 3DC2A 2DPMA 3AEUB 3Q7PA 2E87A 3MYYA 3MMZA 1KBQA 1I1NA 1WXDA 1ZGBA 3Q6IA 2HNBA 4LA4A 3GJZA 4DLAA 4EABA 1AHIA 4HGOA 5I9BA 3QFCA 2WUGA 4QXQA 3RBVA 1SA0A 1QYDA 5BQXA 4X1OA 4F6LA 2Z57A 1Z2PX 1D09A 3A31A 2FUEA 3OPXA 3B1XA 5B7NA 4U6SA 4D3SA 3MTJA 4BVGA 1QP4A 2AN3A 1K88A 2UVQA 4GQAA 1YDGA 4TT3A 3FB4A 1XU9A 3U4HA 4MRMB 3JWJA 3LUDA 1N5RA 3P0FA 2A84A 4OFZA 2C31A 4IG9A 4QYWA 4ZC1A 2B69A 4ER6A 5AW6A 2NTJA 2ZTSA 3RTDA 4C7XA 1KERA 3LG2A 7ABPA 5K0ZA 3C3DA 1GUDA 4F93B 4KVGA 3L1JA 1YV9A 4HAVA 3ISJA 5DGCA 2YYSA 3IEPA 4AX8A 5DTEA 3M9WA 4Y2PA 4CU5A 1KWGA 4XAQA 5LP1A 1C3EA 3AOEA 1L7AA 2HYDA 4MWGA 3X1YA 3VRHA 4HDMB 1JYFA 4JU8A 2MYTA 2ZKIA 4UU1A 1RI3A 5CP8A 1XLTA 5KQSA 1ZJ5A 4R8KA 3NBFA 1YS2X 3CO0S 3KVRA 3ZC3A 2ZIWB 4BQIA 3G2LA 5EWLB 2IS4A 4IDGA 4IWYA 4P32A 5PNTA 2JRCA 3IVRA 5DULA 3I45A 4TYPA 4MVWA 1TUBA 3A27A 4E7OA 5IUJC 3E4DA 4LOKA 2ZTHA 3PUIA 4Q4AA 3U9SA 1QH8B 1U98A 1O5OA 6REQB 1OJLA 2JF0A 4HSGA 4WKNA 1BCRB 1X13A 3P45A 3W5CA 3COSA 3LP8A 2AMJA 3L6DA 3EZGA 3E4CA 4I5DA 4CV3A 2FW0A 4GE0A 4WY2A 1Z68A 4MWEA 3ZZNA 1CE8A 5BNZA 5JH7F 1T8TA 3PVSA 4D25A 5H81A 2XRFA 1UQTA 3LWDA 1U7XA 1ZSVA 4FEEA 5EXTA 3OKFA 5KWVA 3OEED 1IHYA 1X14A 3IELA 4O59O 2TS1A 4X1YA 4YJKA 2GBIA 4DMCA 1J99A 3GJ0A 2J0QA 3QYJA 4FIDA 5GMOA 3NJRA 3UB2A 1N1GA 1AKVA 4GLJA 3WMGA 3IDAA 5BWBA 2IV2X 2D5LA 3PDHA 2R6CA 2VJKA 2IS1A 2FPMA 1UBGA 3I2HA 2K5UA 2RHWA 3N0RA 3WQSB 2OK8A 4KIWA 2ZVJA 4LBYA 4YFVA 3KFVA 3PP8A 4LWZA 5FB3A 3G8YA 1K98A 521PA 1WA5A 4QHYA 4YX9A 1S2MA 4CQJA 1XMJA 5G2OA 1O7JA 2ZTMA 2YW9A 3DBHB 3QEJA 1NI5A 3WBBA 2D59A 4D0GA 1D1SA 4E88A 3NEAA 4DLLA 1XTBA 4OHXA 2JD1A 2RHTA 3AUXA 4BZZA 7MDHA 1K0FA 3OE7D 5HZMA 2Y71A 2L18A 4X41A 4EKIA 5JYCA 5EUQB 3CUTA 1A7JA 4G5XA 2RGWA 4COKA 4EMUA 4TKVA 3DTVA 3WR5A 1US8A 2R65A 4J94A 4BCCA 1YJCA 4BE9A 5IDQA 3RBXA 3MT9A 2F8SA 4TRMA 3WMXA 2QTHA 1SBZA 4LC9A 3R7DA 3RU9A 1EHIA 3DF9A 1RC0A 4ZVPA 1IMOA 3G7SA 5IKMA 1X86B 2SICE 5IXYA 2PMDA 4TMFA 3QXHA 1D8AA 5E3IA 2Z08A 1JFRA 4P83A 2HIHA 3RSHA 1X7YB 3GT7A 5FPKA 2NUTB 3I9V1 3HLTA 2ESRA 1ZCAA 3X1KA 3QG1A 2BGIA 2QVLA 5J4YA 1FRQA 3MGAA 3BAFA 2EDAA 2K6GA 1GG2A 3U5TA 2BFEB 4N49A 3P5BA 1BFKA 1P0MA 2QX8A 2IPOA 3RC1A 1J5XA 1JA9A 2IY8A 3AWIA 1XVUA 3EGWA 4UVHA 5KQRA 3GRYA 3EG9B 4A8JC 1TJ3A 1HFKA 3V80A 3PEUA 1BKSB 3WLHA 2G5TA 5T3YA 4PXYA 3TEFA 2NUPB 2YMPA 4EG1A 1BKYA 1LBEA 3MCTA 4OIMA 3RUDA 2DHDA 2BL4A 3I32A 3NAZA 1HRKA 2EVWX 3DDWA 3D7LA 4CKWB 1DTWB 2O0KA 4OH1A 4ZVUA 4P3NA 4EPWA 4DANA 3EQZA 2P9JA 1FVXA 1KYXA 4TL8A 3EYAA 1H3FA 1X8JA 3PC4A 5AKYA 5SZHB 3INGA 1XRLA 2AFIE 4D6YA 1TD1A 4MQFA 4BE4A 2J67A 4N5HX 5HJ7A 1CY1A 3WL3A 1IULA 3D7SA 4PO9A 4KO1S 3Q88A 4ZPXA 5EHNA 1ZL2A 1HH4A 3CEHA 4HX5A 1W4AA 4UOQA 5DFAA 1XCBA 3EPRA 1LVGA 2NO7A 4DXHA 4IS3A 2O0JA 3ND9A 3HXKA 4TTRA 3PUZA 3NPMA 4M9QA 1GO2A 3FDXA 4PZ0A 1DQNA 1NU6A 4QGGA 5TVKA 4GFDA 4RS4A 4XJTA 1EWKA 4I1SA 5DM1A 3L8GA 4IGAA 4CIVA 3T3NA 2JIOA 5LQJA 2BGLA 3AEQA 1QO9A 2YC4C 3N0XA 4KV7A 1RJGA 2G09A 2HSEA 4NOMA 3V7UA 3SCZA 4O0LA 2HXSA 4HEA1 2VUTA 1KJJA 5IZCA 3G2MA 1RRPA 2YJ4A 1TA0A 4FLFA 5AJVB 1CHDA 4UCQA 3AW9A 3T7KA 3KZMA 3ZGNA 5K8LA 5DEOA 3V1NA 2IVFA 2AVNA 3R0QA 3K35A 2FRVA 1V71A 2VPTA 2VQ3A 4OBXA 1FY2A 1Z28A 1ZONA 2JW5A 2WJIA 2YRWA 4EZEA 2FEWB 1WZNA 1U5CA 2EFEB 2WUFA 1AE1A 3C97A 5T6BA 5TX7A 1DCMA 1C81A 2YMLA 2ID8A 2VXCA 3PFNA 2XNKA 2ZRBA 4CLHA 1Z34A 5G0SA 4D8VA 5JS7A 4S1TA 2B1RA 2QE6A 4Q5IA 1C7RA 4ZZ1A 4LJ6A 5T6MA 1JQLB 4CZ2A 1L3BA 3AF3A 2ZI7A 2ZWPA 3F67A 4KG7A 3B6EA 1FNDA 2NXEA 2E4ZA 3ZHVA 2J5QA 3P0IA 1JA1A 5CDUA 4U4AA 1N8TA 3Q12A 2ISQA 2ZQ5A 2PX8A 4YAJA 3MJDA 5HW0A 4FGUA 2D2VA 1N5KA 3N58A 4LSWA 1N6LA 1YC5A 3A14A 3PHCA 3O9MA 2A9OA 3AKDA 3HSYA 1GAQA 1XJ5A 3OZBA 4HAXA 5AW2A 4Q48A 1TO1E 3KT3A 3ADOA 3U44A 2XQVA 5JY1A 1OXVA 5JMTA 2JEYA 1SXJC 2ZRCA 4YCSA 5K6TA 2PXHA 1E3SA 1WCIB 3BX1A 1FU8A 1A9ZA 3MTAA 4CTMA 5JAPA 1NXXA 2WT8A 4DJFC 2D7CA 3AV3A 4JYAB 2YJTD 2C9ZA 1KBZA 4GE3A 3ELUA 4K9NA 1YRLA 2VEDA 2VNHA 1B73A 3ZE7A 2UVPB 2FG6C 2OHGA 1N32B 1A8HA 4OBWA 2BLLA 1QFMA 2IL1A 1N6HA 1EZ1A 4ZVVA 3VJLA 4D96A 1Y34E 2HHHB 3QUTA 2QV7A 4P86A 2P5TB 1O87A 2KB0A 4P2GA 3TWOA 3U40A 3VH3A 5D85A 4M76B 1NI3A 1JXOA 4U6NA 4ZQGA 5C8XA 5CDFE 1YHNA 1DEKA 2C4NA 4TWIA 1KC3A 5FUXA 3F8SA 5JSHA 5D3MA 2O1SA 1JEJA 4Y6OA 4CL8A 1VHWA 3FUWA 1M1ZA 2YYZA 3G89A 1EAYA 1YQDA 3QKWA 3X2FA 3ZV6A 2BBOA 1EBFA 1G7RA 1XYYA 2F1RA 2HRRA 3N6XA 1OZFA 1AMUA 3P9XA 3EXG1 4AN1A 2QSUA 1KPGA 1NSTA 3FBTA 4M36A 5THXA 2Y4NA 3LC0A 5BYAA 1G19A 3SSAA 4UAVA 1J9GA 5E8RA 1WW3A 2Q7DA 5BVGB 1EJ2A 5DM0A 4EB0A 1DAEA 3EMBA 1WVMA 4N9WA 4EM6A 4HDKA 5AESA 3RUEA 3KUCA 4JKOA 1I5RA 1QNLA 2QZZA 3L4KA 3TX2A 3EH2A 4DRXA 2CHUA 1YR9A 1RS0A 1QKJA 2WG2A 2P9CA 4RV4A 5TPWB 5A9SA 4V1CI 2A7XA 4M9UA 4DLTA 2AE2A 4JCCA 2HMYB 3TI7A 3ZHOA 3C7CB 2XB2A 3KETA 3M34A 4HYTA 4PAWA 5AOCA 2R8BA 4BP9A 1HE4A 4EUHA 1ZGZA 2AEEA 2ZI9A 1GUZA 3HBLA 3OTGA 2PA0A 2ZRMA 5H82A 4EMSA 4BLOA 1Z7EA 4AFNA 1EFPB 1BJKA 2IPMA 4O1HA 2JIMA 3ZEIA 4YRBA 1S2LA 1RXYA 1SUEA 1DQSA 1DPGA 2WTNA 2J3JA 2FMKA 2GZ2A 4KQWA 4TV9F 1FE8A 3ZDCA 4NAUA 2WMYA 1AMNA 4TYWA 4NV0A 5AI4A 4OXQA 2BFBB 4PYRA 1MMFB 2ZB8A 1CIVA 3PQ2A 1YJQA 1A9YA 2B4KA 5ECDA 2E3JA 5F7JA 4YWHA 1ID8A 5A4KA 2KBEA 5EAIA 1EXWA 4PS0A 4J0GA 3EPKA 2PUTA 1T0BA 4MV0A 4QYXA 4HAOA 1GVHA 2PGNA 2BTQB 4O4LF 2BR3A 4QIHA 1SRQA 1W73A 2EP8A 1WUJS 4I4NA 4TTVA 4KR9A 4EHBA 5BORA 1SKQA 4HMOA 4EUKA 3GHHA 1T0JB 1JIQA 3TSCA 9LDTA 2OCAA 1BWSA 2Z2KA 4QUIA 4F5DA 3F47A 2RJOA 3PHBE 2C77A 4JU9A 3PGMA 2O7VA 4MUIA 4P81A 3DV9A 4NJMB 1PSDA 1SKYE 3HWSA 1NLYA 1IOWA 2ONCA 4GQBA 5CT5A 1QB8A 2OZLA 2DUUA 3JRXA 3SXUB 3ZNOA 3AJAA 4X20B 1WPXA 4L5AA 1N2IA 2AR9A 2UYYA 4NPCA 4KO2S 4R3UC 3L0YA 3RIHA 2F3QA 3TUZC 3ILSA 1XDZA 2SHKA 3Q87B 4PVCA 3Q85A 5DYYA 1E0JA 1L5ZA 1PDWA 1X3LA 4GRDA 4I5GA 2ZYDA 4GKJB 3COYA 3EZLA 4L4XA 4LJ7A 3LXMA 4YJHB 5KVQA 5BOSA 3IQEA 3K2IA 3ZHZA 2B94A 2RHLA 4H3KB 3O82A 4ZVRA 3EQ6A 4JROA 4ZHQA 1O89A 1V16A 4I3HA 4C0QC 1YF3A 3BFXA 1GTL1 3PR3A 4QLBA 3M4NA 3QTTA 4ND1A 4BNYA 2C7OA 1UOPA 2GD0A 5CX1A 3W04A 1R6DA 1G98A 2J30A 1SRRA 2A5JA 4MS4B 3RG2A 3WLTA 4CQLA 1DIGA 4XFDA 4CKBB 9ABPA 5KSWB 2PZFA 3TINA 3HUEA 2VNSA 4J0DA 3KR2A 2DX7A 2CLOB 2JDIA 4FQ7A 4YNBA 1ODFA 2B30A 4C22A 3K1YA 4NCKA 3QVSA 3IPLA 2PPVA 3H5RA 4GYJA 2HADA 4YACA 3TZHA 4FT2A 1ONNA 3OCJA 4X44A 4B46A 3V8BA 1KJYA 3N2EA 4LJ5A 2GR9A 4KPFC 3K73O 3UWKA 2Q41A 1O97C 2VCYA 2G9RA 5E4JA 1C80A 2NU8A 3TRDA 4OL0A 4DUGA 3WJ1A 3QVUA 4XD7A 4B32A 4E5YA 1N2CB 2B4TO 4DSOA 4C0KA 5L3QB 1KPHA 1Z5NA 1I14A 3QHPA 3RYIA 5DYNA 2JJ8A 5AHXA 1RVV1 1RCTE 3BEOA 4F5EA 4RPGA 1ZKDA 1P1BA 2R2AA 2ACVA 2O3UA 5IVDA 2ZPTX 5JV5A 1KAHA 5IAEA 4CF3A 1Z25A 3C3KA 1WCWA 1AXRA 1M2OA 2QY6A 3IJRA 2HK6A 4TWRA 1D2GA 2V5UA 2UZIR 3EGDA 4V38A 3ABSB 5GZ6A 4E5VA 3HGQA 1RAIA 5AK5A 4URVR 3I6MA 2OCXA 2P9FA 1KMCA 2H1OA 3V1KA 1B23P 3IXQA 2FPKA 1EQAA 2YFHA 3G0BA 4QFBA 3U60B 3CRZA 1JAHA 1UJNA 2OCGA 3NP7A 4XIGS 3Q8LA 3C98A 2X0RA 3HI4A 1QPBA 2QRMA 4H9GA 5CM2Z 2HT6A 1W87A 2IX9A 2QTVB 3K0AA 4G25A 5C18A 5LNK1 3TJMA 1MZVA 5L9AA 2UU9B 3HCNA 5BV8A 1NVAA 5IKOA 3B9RA 1QXSA 1QE5A 2JGMA 4QLAA 4M1ZA 1J49A 3LGAA 4PS1A 5HUHA 4PCVA 3A1WA 2B1JA 4N40A 2V6GA 3JQBC 1I5EA 2VJAA 4IVRA 4R9SA 1DEHA 5HZGA 1BXRB 1KOJA 1GWNA 4KI0A 3N2GA 1ZM7A 4NBVA 2I6SA 3ZK9A 3K6SB 2K7ZA 3EQ8A 5TIIA 1ADBA 2W8BA 3WL6A 4JOCA 1EFTA 3AI2A 3EXEA 4LE0A 1C29B 5D3KA 1L9KA 4DB2A 1H42A 5EMHA 1PJ8A 1AM4D 2GZHA 4J6EA 2QN9A 3H6HA 4PNZA 3A1SA 2V0GA 1CX9B 4QFDA 3UT5B 1IPFA 1UBSB 2RB5A 3FAKA 3Q2KA 4CBVA 4BXOB 4O4JA 3H9CA 2HD4A 1U6KA 1NU8A 1M2EA 4REQB 3IP6A 1JIXA 3LQKA 5F5XA 1HG1A 2HA0A 1F7UA 2BONA 2P75A 4U39A 5ANRB 2FPGB 1S96A 3ENVA 4K9LA 5AI6A 4ZO7A 5DSZA 1CIJA 4CMCA 4UMDA 4QXRA 3ZIUA 5B7GA 1J0AA 2PRSA 1WHTA 3MILA 5AJWA 4BGEA 3IL2A 3H7AA 3DFUA 1ZMXA 3QHAA 1IXZA 2WEKA 4JA0A 2X4DA 3GL9A 3LV8A 3PGXA 5F64A 3SHQA 2WKPA 1V96A 2YRFA 1A72A 5EKDA 3STHA 1IVNA 1RJ9B 5I8PA 2WDZA 1ZK2A 2H5LA 3PQDA 1E1QD 4JELA 2MSWA 3PNMA 3WO1A 1DP4A 1MR3F 4F5ZA 4ENWA 1ATZA 1CUIA 4Z9BA 4BRUA 3JQ9C 4RLHA 3E58A 4ZDJA 4GIBA 5K0EA 4MCAA 2Z3VA 3DKPA 2VJMA 2FSFA 5TSDA 3MBIA 2J0UB 4MA5A 3S99A 3SX2A 5JDIC 1JQKA 4EO7A 3GC6A 5CDHA 3U2QA 3TN7A 3JPWA 4EB6A 5FA5A 4YUYA 3CB2A 2B7LA 4L07A 2IWRA 4C2TA 1NV9A 4DZRA 2XGGA 5EZYF 4QE3A 2CYAA 4EQZA 3TNJA 1C30A 1ZYUA 3H9QA 1IFXA 4OF4A 2VKQA 2J9YB 3D4BA 1CQXA 2QXTA 1B0PA 1UPCA 3F6CA 2D7JA 2ZRAA 1N92A 4DA9A 3KUUA 4EVQA 3U1BA 2CL5A 4P53A 4LISA 4X6LA 5C7LO 3GPBA 5KPJA 3WJAA 1AUOA 1TCUA 2W6MA 4FM9A 1JDJA 3M7IA 1GA4A 4YWJA 5FOUA 1EUCB 1WV0A 3UC9A 4KR6A 4MPTA 4F8JA 5JYEA 3O1JC 2CFOA 3FFWA 4LXQA 4G56A 2C2MA 4RD0A 1LF0A 1NPTO 4TLMB 1QK4A 4E0BA 5BXYA 1VIDA 3QZUA 2C97A 1DAKA 3PJRA 2WQ6A 1NF8A 4Z4FA 1P60A 2X8WA 1T0UA 1O0CA 3DVRX 3KWMA 3KTOA 4D4KA 2PMKA 3DM9B 5BT8A 3OVMA 3CUSA 3GEEA 5FTLA 5LKRA 4I50A 1SQ5A 2IYRA 3T99A 5K0SA 4M54A 3K1JA 1LI5A 3BDIA 5EJFA 4B33A 3ZDRA 4WAUA 1PX0A 3EZ2A 4FZVA 1FOEB 2IKQA 5GONB 2WV7A 4D3ZA 3PK0A 1QZUA 1SURA 1S4MA 1N0HA 2AOWA 2GBGA 2HNKA 2QSZA 2VP2A 3PUKA 5D6OA 4HFJA 3TNFA 1PJRA 2JAPA 4BFCA 4C87A 1C9JA 3KEMA 4AD8A 5ALDA 1G1AA 1JIKA 1U2TA 4Q66C 4JX8A 1IK4A 2H0QA 1RADA 1W85B 2LIPA 3QENA 4OEHA 1ETUA 3VX3A 1SVWA 3BE4A 4QJBA 3WYBA 1Q5PA 1JDNA 2YHAA 3UW1A 3W77A 4DCMA 1EDOA 4GOOD 4QU5A 1E59A 5T4FA 1Z8HA 1O6BA 2XPCA 3T9AA 3VR5D 3X2SA 3CVUA 3LP6A 1Y7IA 3JD4A 5L3VA 1SZCA 2JZNA 3QTLA 4GNRA 4I36A 4NOLA 1P4JA 1RAEA 1W96A 1W0JD 4RWZA 1D0VA 3E35A 5EHQA 2LVBA 2ZYAA 3PEFA 1KO5A 3WGTA 4FUQA 4YMTA 4NI5A 3D2AA 2C3UA 1QC5A 4UTXA 1NONA 4URXR 4MYCA 4JL5A 2O8VA 3ZD9A 3PPIA 1OH7A 4I55B 3H9UA 1Z8DA 2DTDA 3KDAA 1P75A 4RJIA 3I09A 1DZ3A 1VP3A 4MR8A 4UJ3A 5AVJA 4CMBA 2J5XA 3ZVLA 4GI1A 1MJFA 1TT5A 2EW2A 5K3FA 5BRJA 10MHA 1XF1A 2J08A 2QSYA 3L5KA 1O0BA 5JS1A 4IDAA 1I94B 2VP6A 4HDQB 2RGXA 2QVYX 2CFRA 1YA4A 4X7MA 1OWMA 3ZVMA 1U0BB 3SYRA 1J20A 2QW0X 6YASA 3FSGD 1MA3A 2CVHA 4JQZA 4PFQA 5LA6F 2PBRA 4PZDA 1SIOA 1LVHA 2OG1A 3H99A 3OO0A 5CEEA 1YRYE 3L7OA 3T9CA 3U6BA 4MVJD 1YOBA 4PBSA 3ZDAA 2ZZMA 2X77A 4PG5A 3SWWA 1VLZA 1HMPA 4LG1A 4RK6A 4UUPA 1QYIA 2IIPA 5I01A 2GCEA 2VIIA 1MF7A 1R5BA 2JEOA 3KJNA 1ODKA 2P4QA 5FUYA 1C9KA 1I1HA 1V5GA 2P35A 4BYGA 1UPTA 4YCDA 5JNSA 3X3HA 1CFZA 2Z2YA 4IV8A 1MIHA 4K05A 3EBPA 4RTJA 1SJ9A 4OHWA 1FFYA 1NDQA 1PWYE 4WSOA 4L8FA 3BGSA 1ZOIA 3N28A 1ZVJA 3A4VA 3PC2A 1G2QA 1KI1A 5EP1A 3WV4A 4AF7A 4QULA 4MLCA 4OB7A 2OQVA 3CIOA 2Q28A 4R2HA 4EUSA 3QEMB 4GVPA 5CCEA 1JHPA 1P7PA 1QYWA 2H2DA 2OAP1 4B5LA 3FTDA 1HE3A 1P72A 3LQRA 4LF5B 2PJUA 4IIBA 5FJIA 4EHAA 4WADA 5HF6A 4MARA 4R1TA 4Z53A 1RPJA 1ABBA 1MXFA 1DAMA 1ZNQO 3MD9A 5CLJA 5J3JA 4URUR 2XZLA 4LECA 1DT5A 3K8ZA 4XASA 2OGUA 4JSTA 2IYFA 1YCDA 5FA8A 3JD3A 4RHFA 4QVGA 5KWJA 1EWYA 1QORA 4K8RB 5LDGA 4LE1A 1F1BA 2PANA 4O4IA 4TQGA 2GPBA 2X3YA 2P9QA 4YYZA 1SVSA 2H11A 5FF9A 2CLLB 2JIBA 3UCEA 4EPVA 3SBEA 5A04A 2FE4A 4JIMA 3AM3A 3OP1A 1RLJA 3K5HA 1YU6A 3PJDA 5LMZA 1DC8A 2YY5A 4DZTA 2CJFA 4YT2A 1LBTA 2IIBA 1KHHA 5KPDA 4P3OA 4H08A 4LNHA 4AZWA 4PANA 3UOGA 1L4LA 1I80A 1ORTA 3C2QA 1GQQA 2PYIA 3HDVA 3WNDA 3SVTA 1XVLA 2CFCA 2HRBA 3O94A 2C94A 5CBKA 1NVEA 2CLSA 5H3HA 4R98A 3UANA 4JYPA 4U5XA 4OUDA 4X7BA 3RWBA 1KVRA 3UN1A 3ESCA 4UHJA 5CAEA 3FTCA 3NHSA 1O77A 3GJXC 2IOQA 1X1RA 1BHQ1 3WLQA 2C9CA 1K06A 3AR4A 3K7EA 3B6JA 1QGUA 4X45A 5IDYA 1M8FA 4TYNA 1L4MA 2WZCA 1U31A 5EJMA 2NQ2C 3GA5A 3IPRA 5FBVB 2C1ZA 3OQNA 1OD6A 2YBEA 1VL0A 4ONEA 1V6CA 2W6ZA 4EFLA 1EJBA 1KSGA 1J1UA 5WRFA 5C35A 4KFSA 3C70A 1NURA 1X7GA 1E7RA 2ADOA 2P27A 3K4HA 2VWGA 3NRBA 4U6QA 5HXAA 3NC4A 4TMKA 4JEUA 2X2EA 2IEIA 2QD4A 3FCYA 3GEBA 3JASB 1TZBA 4UQPA 1XPRA 5ICEA 3N39C 2VSXA 3TYXA 5DBIA 1ML4A 4FCCA 1FFBA 2JAHA 3OEHD 4W9RA 1UXIA 3NTXA 5JBNA 4XUGB 1VYVA 1M1YE 4DMUB 1PJ3A 3GI1A 3AQIA 4WNCA 1U1EA 2FGKA 2QBYB 3CWZA 4UUAA 4H35A 3STVA 5JZBA 1RYMA 2VN8A 5M34A 4TLBA 2VDVE 1H2RS 2ZI4A 2CT8A 5EKTA 3VKWA 2AFHB 4EBBA 3I30X 5NULA 4G37A 2I7CA 2JA2A 5CVVA 2CLEB 4MPPA 2JRLA 1SPBS 3DNMA 4WBNF 4CQNA 2IOFA 2W4QA 2D62A 3FNIA 2Q3BA 1XMQB 3ZI4A 3UMGA 3I76A 3S27A 1CF9A 4D4IA 3SLRA 1VMEA 1VPVA 3M2PA 4K7JA 1OIWA 1YDEA 3O91A 3GFRA 1ZRHA 4I1VA 4U7TB 1CQIB 4NPHA 3SR4A 3UMSA 1E9FA 3V6LA 1RCUA 1WQ3A 2WWVD 3REQA 4BN5A 3VPBA 2Q45A 4M22A 2C00A 1XP8A 5IPFA 2HU8A 1VE1A 2PH5A 2JGEA 3CRNA 3FMOB 3OFJA 4Q1AA 4EECA 2F9FA 4WD3A 4E08A 1TKCA 4OQFA 3ZXSA 1OZ0A 3FMVA 2QD3A 3HACA 5K20A 1E1NA 1M6YA 2PT9A 5THKA 4BMVA 4AJ9A 2IYYA 4D5EA 1M72A 2AGVA 4J1TA 1J0CA 4J9VA 3DEYX 1XKXA 1PJCA 1ZWKA 2IHTA 1M6NA 5DGTA 2VF7A 1PSZA 3UQZA 4QSMA 2VPZA 3GDHA 3JAMA 1NMZA 3PHLA 2Y9PB 4H0FA 4U7HA 2HDNB 2NUAB 1WHSA 3N8GA 3Q3JB 3NJ4A 4FMCB 5B58T 1KNQA 3L6CA 2G9UA 4FR0A 4DEVA 3C6XA 1SUIA 1NOIA 3QXJA 4F9GA 1PLKA 3IV7A 3GZJA 3E9NA 3PZRA 4B8YA 3MXOA 1P3JA 3ZK8A 1CP3A 2GD6A 1L5HB 4FYXA 1G6HA 2VVTA 1S2GA 1BC5A 2G82A 4C1NA 1I6WA 1KU0A 3HY6A 5EP4A 2BP7A 3ZWDA 1EXDA 2RHHA 3P9RA 5LPNA 1XL0A 3IRVA 3UUGA 3EF3A 4Y98A 3WQQA 2BF7A 2ZT6A 4UTVA 5ED4A 3HDGA 2GAFA 3EZFA 1Q7GA 4JWTA 2VRBA 4LK3A 2PT6A 2R48A 4F1WA 5C1BA 5HQJA 2J5BA 4WH0A 2QM8A 2XKJE 4P80A 5LIPA 1PWZA 1NQ5A 4HQKA 4J4HA 3CPEA 3H1PA 4YYEA 4EJ0A 3DMYA 4IFEA 1XZBA 1KTIA 1XVVA 1T2AA 4H7FA 1U81A 2GCOB 5BNTA 5KC8A 4A23A 1RHRA 5A5EA 2MCFA 1T4CB 4RHUA 4F4HA 9LDBA 3KSAC 5EKXA 4BFZA 2O6LA 1TU0A 4AO6A 2EX1A 4B9EA 5A1JA 3DONA 4L0CA 4UEQA 5IULC 3HVJA 4AF6A 3PUYA 1IEVA 5KYXB 1LFAA 4XX0A 1JKXA 5I7AA 2ZJ1A 5I6DA 1B0AA 5CIYA 2PM8A 2IZOA 1E1RA 5FLYA 3VPCA 4HB0A 1SCKA 4E5UA 3V9PA 3G88A 5E6UA 1QRSA 2AXPA 3EXG2 3AUTA 1S6YA 1HMYA 2VXOA 4DBLE 4HYQA 2ZYSA 1C3XA 3DYIA 3B89A 4FYYA 3WQRA 1N2OA 4MYTA 4XCVA 2DKOA 1QNFA 4ZTUB 1XAIA 1CZHA 3DE7X 3O4IA 3PI7A 5L53A 4WK2B 1LX7A 4C7OA 1ONBA 1V9LA 2DOKA 2QQ0A 3FUTA 4GT1A 2CK3A 3TIIA 1JHQA 2C7QA 1IBMB 3G9ZA 2VYFA 4D9JA 1ODLA 3PXCX 5K0JA 3R9IA 4PBTA 4BJHB 5J59A 5C81A 4Y2JA 3ECSA 2XYQA 3IDSA 1N7IA 3VXKA 1NNLA 1SVUA 2CMFA 3H2SA 3PE4A 2UZ0A 3O1IC 3NS7A 1OB5A 3EZXA 1I0IA 1J2EA 2EBWA 2EW8A 5JAHA 2QG6A 4J3FA 1RBMA 2H29A 3JVVA 1FX1A 1O96B 2OWEA 3EIOA 1PFYA 4FHFA 5HS6A 3A32A 4LMAA 1TW2A 1J6UA 4YPFA 1F6DA 3HCCA 1QP7A 3LF1A 1DKPA 1ONSA 1TM1E 1JV2B 3WFJA 3P2OA 4C03A 4XVUA 4QNMA 2BTEA 4Y8VA 1N33B 2MJLA 4IUYA 4R2WA 3LHDA 1BE1A 2AE1A 4X00A 2FF7A 2X8JA 2RGDA 1W88A 2ZWVA 4AL4A 4H2DA 3AZOA 4F45A 3VR1A 5HOEA 2EQAA 3IA7A 3RTBA 4JJGA 3A1VA 3BHNA 4CLXA 2WAOA 4NY1A 5I47A 1E6WA 4LF9B 1JHZA 1R66A 3HNPA 1JWAB 4MH0R 4BLSA 1S8NA 3P8ZA 1L5LA 1I2MA 3UMMA 3WK7A 3RRZA 1ZIDA 3AQ4A 3QXGA 4EMBA 4EX7A 5BPFA 4BO8A 4C5AA 1AV6A 1YVEI 2RGEA 3EYWA 5E4TA 4MCIA 5JC1A 1PR0A 3OOJA 2G72A 3UK0A 2W2OA 1JBKA 3UJHA 1GFWA 1DRWA 4RCYA 2RGNC 4UEWA 5BO5A 2Y93A 3EW9A 5IAOA 1G1MA 3DE1X 3QY9A 5AKXA 3OCWA 4RVDA 2Q9UA 2AOUB 5HQTA 4YPVA 2YBDA 3SYTA 3WRVA 1E3LA 1NE7A 4MWOA 2W6PA 4NYJQ 4OHCA 1NP6A 4GRAA 1NJSA 1CD5A 1L4UA 2VDQB 1E3IA 4K0RA 4ZANA 2JHCA 2R1ZA 4CM4B 4DM3A 5BR8B 2HCRA 2GA8A 1PU2A 2VYCA 1C0PA 1NUAA 3PC8A 4M0FA 1TF7A 1FW6A 5FPPA 1Q1EA 4GMHA 1GLGA 4MA0A 2QJWA 4L74A 2QR3A 3B8EA 3WL7A 3JAWA 4FFVA 4WHMA 3EAGA 1OAKA 1U2PA 4QWMA 4EDHA 1JJAA 1I3CA 1M10A 2BKVA 2QAJA 2RAFA 3LUAA 1U04A 1TZ2A 3BXGA 3QLUC 2WSSD 5H3CA 1FPMA 4DJ5X 3H2KA 4KBGA 2IUFA 2P68A 1EPUA 3H4VA 1IC6A 4NATA 2JIRA 3IUMA 1ABEA 4TWZA 3IOMA 2O2SA 4LWOA 3ZOKA 2YC2C 4E14A 1UBUS 2NXWA 1L8LA 3P4UA 3FOBA 3V1LA 3KQUA 4CNQA 4L6IA 2B3TA 2ZWOA 3BA1A 1RLUA 1MVLA 4XGKA 4YAFA 3EGVA 1ZJ6A 5KYNA 1SULA 4C7JA 1NJFA 2DPHA 2I6TA 3JD2A 3IUYA 3DT6A 3RPEA 1AGXA 3TB4A 5JCOA 1YVDA 3B3FA 1NWHA 1EH5A 2FDXA 1RXVA 3RASA 3LUKA 2M6SA 4FB4A 1OKKA 4HWPA 3FWNA 3A06A 5FAKA 3OJCA 2B4RO 2FSHA 3DV0B 1QTIA 1AKMA 1XZNA 3EE6A 3P0RA 4WXPA 5CVDA 3GLGA 4WA7A 5DWDA 5I5GA 3OA0A 5CT4A 3N70A 3FLAA 3ML1A 4HTAA 2VOJA 2XHZA 1KQOA 2NU7A 2O23A 3ROFA 3E9EA 3C6ZA 1T29A 1ZN2A 3I5MA 4V0OA 1EDDA 4QDJA 3FPKA 4EJSC 4IHAA 4L5JA 2R6DA 1Z08A 4ZHSA 4PCAA 2H9YA 2CV1A 4AY5A 3OTOB 4QHTA 2PD3A 2PN1A 1Y8CA 3HCBA 3ETEA 5K3DA 3V4OA 4RETA 5JR3A 5JZSA 3O8NA 3PNVA 3DEHA 3MIIA 4MVCA 5J2UA 3ZHXA 1P61B 4YCAA 3GPDG 3QQ5A 2O8EB 3MZ0A 1TFUA 2QJTA 2J5RA 3DQQA 4MWZA 5ENDA 1QGYA 2NV6A 2UYQA 4RACA 2O4CA 2IA5A 4IKOA 1UR5A 1YTLA 2FAXA 2BFCA 2ZJBA 3DL2A 2O0MA 1VDMA 4G86A 1F8UA 4IRXA 1E9AA 3R3XA 4RJKA 3FF1A 5LDDC 3WS7A 3KSZO 4MS3B 3R7FA 2BT4A 1N7HA 4I99A 1LY1A 3F5FA 3RGGA 1Z5PA 5LXTA 4OGKA 4OQXA 2NVUA 3R6DA 1J9EA 2QVXX 4MICA 4XR9A 5CDGA 1E6LA 5H7XA 3RVDA 4W5TA 4MGEA 4RAOA 4DV1B 4J0EA 3L3BA 2IYNA 3F4KA 4KUGA 3T1YB 2QLFA 3DOHA 4ZAWA 1FNSA 2VNJA 4HK4A 5C1PA 4MB2A 1XQ1A 2XCOA 4EG5A 2DLNA 2OAGA 3WRXA 4CLRB 2BI7A 2NZUG 5KVAA 2W43A 4EHFA 2H7XA 2VAWA 4GYKA 1Z7GA 1VPLA 1UDCA 1HYGA 3DD5A 1ULUA 2EERA 3KL4A 3N07A 3DO6A 3E5HA 5JSFA 2RBKA 1Y1QA 5BN4B 4CEHB 2IYSA 4PSAA 2BTOA 1H2HA 2BFDB 2E0IA 2GVZC 2JAQA 3MINB 4U00A 3HSSA 1AKEA 3NTQA 3BD9A 2YZNA 5FLEX 1GTRA 1I4DD 5BRAA 1H6BA 1WKCA 2NYAA 2B2NA 2ZOSA 4HQOA 2W7TA 2KQUA 1S3IA 4S1WA 4AMVA 5DNWA 1SWWA 1Z74A 4UJ5A 3ZLTA 4CCAA 4CKCA 2YQZA 2EEZA 3LM8A 3NHKA 4M7RA 4D9BA 1IEQA 1NXPA 4U3JB 3V42A 1AUXA 4H77A 4J91A 4NECA 1E2QA 1JB1A 3A9SA 2IIQA 4RW0A 1IY9A 1FEZA 1YBHA 3GVPA 3PDIB 4LJSA 4NV3A 3V4SA 5GJBA 3STUA 1G5FA 3IB3A 3OLYA 2YZGA 1V7QA 4V2UA 4ZTBA 1TUEA 1P5FA 3GLHA 1LB1B 4BLPA 1WF3A 2HC9A 2RHDA 1BGXT 3AHJA 1V2GA 2ES4A 3ET5A 4LVOA 2ZRDA 1GDHA 3GUZA 3NATA 4GP6A 4YDRA 5G4KB 4D6PA 3V1YA 3NNDA 1PTJA 3F9CA 4KWHA 4IDHA 2JS7A 4DDMA 3I3OA 4ND8A 1JG4A 1FP2A 2FZWA 2XGOA 5I9SA 3WB2A 2CJPA 3KDSE 3OEEA 4BQSA 4HPJB 5EVCA 2V7WA 2X6QA 4GG1A 4QRHA 4DDWA 2VXBA 3HCDA 2PKRA 2ALJA 2GCIA 3DFMA 1A7KA 4R1NA 4AX4A 1Z2CA 3HJBA 4LQDA 1M6EX 1T6ZA 3CIFA 3NHYA 4FR5A 4DSUA 1YR2A 1G21E 1IMJA 1RKXA 2PEZA 5E6SB 2KYRA 1AKQA 1XEWY 3BXOA 3C85A 1CQJA 1QGAA 2OECA 3Q9NA 4I7EA 4L3VA 3TI9A 2R8RA 1J07A 3EOAI 1GRRA 4KE7A 3TJRA 1GM5A 1HDZA 3WWDA 5B57C 5KNCD 2FRDA 2FKNA 4D9MA 4MUKA 4ARZA 5AK4A 4EVSA 1PBTA 3A8TA 1XRJA 1VCMA 2JFFA 5LSAA 1XPOA 3JYNA 3PRJA 4YLGA 3OE7A 1WIWA 3HABA 2GD2A 4YI5A 1NMEA 1QF9A 4B6QA 1AXGA 2J7PD 2YZ7A 1ZU5A 3KOYA 4NQRA 3WQBA 4XLZA 2Q5CA 1SH7A 3DDOA 2E5LB 1BE0A 3RJZA 3H86A 1BHJA 3T4EA 4DJTA 1YIAA 2CZCA 2Q2QA 4MK4A 1AN9A 2ZBUA 1JF8A 2CNKA 3I1IA 3IQFA 1S2NA 3WMEA 2QVZX 4BNKA 3EFOA 4F04A 3DUWA 1PNTA 1OAOC 4YMGA 2CXSA 1WM1A 2ZITA 4YIHA 1KJNA 2R7MA 1B2RA 2OCIA 3T95A 3VPXA 3EOBI 1FDOA 3EVAA 2EZ8A 3AYXB 1OFTA 2NSYA 1VQ1A 5A6SB 3SKYA 4MQUA 4EI9A 5MN6A 1ZD8A 2YY7A 5EERA 1ZH0A 3O90A 1RWXA 2HO4A 1AF7A 2CHQA 1NKVA 1KK1A 1CUJA 3JSAA 4MCHA 5KOYA 2ZYUX 4PO3X 2H8GA 2QP4A 2IYZA 1M6VB 4LYDA 5LUAA 3KUXA 4DQXA 1IRIA 1R4MB 3X1JA 1TPYA 4BRWA 5JRJA 2CNBA 3VNAA 1M0TA 4CDNA 4INPA 4IIHA 1WUIS 1ENYA 4HD8A 3AX6A 4MUYA 2FG5A 2ZK7A 5EE1A 2DUJA 5AW9A 4MKHA 1ES9A 4L6CA 1CULC 4O2BA 1PWXA 8ATCA 1XDSA 4GPBA 4LNUB 1JLLB 1Q74A 3U3JA 2Y1GA 2R00A 5KNBH 4AULA 2OGTA 1DS6A 3A3NA 2AD1A 4DHWA 3WBFA 4RX1A 3C6KA 2IPLA 1K9VF 1J25A 4CG3A 3DKVA 2JJ1D 3ENNA 5JECA 3BWEA 1JMYA 1NATA 2PUVA 2Q5FA 4TGLA 1IUNA 5IJAA 5K8UA 1Y8RB 4UEOA 3W8RA 1W2HA 3I0ZA 3MTBA 5CBPB 1XHLA 2JATA 3FKJA 5DHTA 4EPTA 5CW2A 5HRCA 1P3Y1 5C1DA 2ZE7A 3RHFA 5JCZA 5DBGA 4R7ZA 3WP1B 5CG1A 2W4MA 3MWDB 1TI7A 3VVBA 1MH9A 2C2WA 2H48A 2IF0A 1JVNA 2JZCA 4X91A 1W94A 5FWXA 2J87A 3QNWA 1CF4A 1VI5A 4I0WB 2JLSA 3LU1A 3G7NA 4WUTA 4G2NA 4OKNA 5K0FA 1UAGA 1NF9A 1B14A 2V3WA 4GX5A 5B3AA 1RTKA 1SZDA 2A2ZA 1O9BA 1N5IA 2W2XA 4ND6A 4PX2A 3SHFA 2X9LA 3ZU5A 3U4QB 4TQAA 1E1YA 4B4VA 5GONF 2F43B 2GQ0A 3BK7A 4F84A 3HJAA 3L4SO 1ESDA 5DJ5A 3D3WA 4FFRA 3OZIA 1P6XA 3OLWA 3T5TA 1NKTA 3SI7A 4AO8A 4RPCA 4TQ9A 2I6UA 1YI1A 1RQ7A 1Q92A 3KJXA 2MWMA 4DR7B 4WN9A 1F2DA 1JHAA 4N82A 1XTKA 3SLGA 1JFVA 3KQLA 4AQ7A 2P3LA 5EZ6B 2FMHA 1V8ZA 4P33A 4HH1A 2BW0A 1EQUA 3LWNA 5KYWA 2D6FA 3BOSA 4CR6A 3PUJA 4YN3A 3T7DA 1MUUA 4JLMA 4JBXA 4MX8A 5ALRA 3H1GA 1RKQA 4KVFA 1OBOA 4FIZA 1SHUX 1A7AA 1VIVA 2O8NA 4NU0A 1KJIA 3QJ5A 4IAOA 1NVGA 5LQUA 2ZJ3A 5K1ZA 4PG8A 1MB9A 1LWOA 1EVZA 2C0CA 4FN4A 4KYTA 1ATIA 3K9LA 4FZJA 3IPYA 5GQSA 3O8QB 2P6RA 2DFVA 2LTAA 1SK8A 2XMBA 1JG6A 3BGIA 4FW8A 2YINC 5TV2A 1U9JA 3N75A 3Q1KA 5EZYA 4EELA 3A2MA 4TPKA 4B3IA 2A9VA 3MSCA 1CU1A 4BDSA 1M83A 4BO2A 5EOVA 4EL5A 4MRNA 4LFBB 2PRJA 3ND7A 1JG3A 3I9FA 4AJ1A 1M0WA 2NVOA 1R5NA 1LDBA 4FCWA 2JLWA 3QH4A 5CB4B 1F5NA 3DMFA 1U0EA 3K5IA 1RBYA 4O6VA 2Q3JA 3A6EA 3UWMA 3U09A 5M7EA 3GUCA 4ETNA 3G2PA 3Q8KA 5LN1A 3PYLA 4FYHA 2G83A 3GN1A 2XCRB 4RH3A 4LY3A 4CMHA 1GCOA 1K3TA 2GZSA 3UWSA 1PV4A 4J2HA 4WOBA 1C7JA 4I2NA 1ZEMA 2WJPA 4GC9A 2I80A 5JFGA 4GOJA 1X8XA 4K26A 3PFKA 3WHPA 2BGJA 3ZHQA 4AIRA 1E94E 2P41A 4ZFNA 1IQRA 4G8BA 1XK6A 2VCHA 4B3SB 1J0XO 4WCFB 1XDWA 2XCSB 3PFWO 3CR7A 3LBAA 3WWPA 1FIUA 1OLXB 3RYCB 2BFNA 5L4NA 1YI8A 5E2AA 1J00A 3RK4A 3SKVA 2QVBA 1VGQA 4U7FA 1Z13A 2OQRA 1JI0A 1D4ZA 1GTVA 2V6JA 3Q5DA 2KJQA 2XAAA 1HKUA 4IQGA 3MTDA 5B1YA 3UJ8A 1QYVA 3V1TC 2I6GA 2W5UA 1U3DA 4H7JA 4ZT3A 5GJVC 5CLFA 1H0RA 5TRTA 5B1IA 4KXLA 1YHYA 4W4TA 2HCTA 3ZD7A 3UV6A 1NTOA 2OCBA 3WB9A 3LUJA 4D8YA 1NN3A 4ZAVA 3FZYA 2ZUWA 3DBVO 3VDXA 2ODPA 1XTQA 2FEXA 4ME6A 3DEFA 2QTFA 5JSZB 1RXCA 1RQGA 4A16A 3CVOA 1NNUA 4IOKA 3RSQA 2CMGA 3DVLA 3KQQA 4KRXA 5BRNA 4Z54A 2HEGA 5T8KA 3RV4A 1FDWA 4ZEWA 2H1WA 3ANLA 2A5GA 1P1JA 2B37A 1R8SA 2VDUE 3SX4A 1QRTA 2PDAA 1JFFA 2CXRA 1PV2A 1NX9A 1E3EA 2Y1WA 3IQDB 4P4GA 4UW9A 2OHHA 2WJHA 1XR3A 1YR6A 3KJEA 1WW8A 1T6NA 2DHQA 2W9XA 2NZVG 3KELA 1NQWA 3K05A 2BM0A 4CKEA 4K2HA 1I0ZA 1GFZA 4WFIA 3G0OA 4DV0B 3K9NA 1JWBB 2KWIA 1HEYA 1PR4A 3KQVA 1U8ZA 2A0XA 5DBOA 4DILA 2JZOA 3C7KA 5C34B 3W5IA 2GBLA 2VAXA 4OU5A 4C4YA 1J2UA 1JDPA 2H5JA 1UKBA 4WN3A 4P0TA 1WXXA 4KR0A 3OF2A 1KK0A 4C04A 5CXXA 1T8PA 3HGMA 3VHLB 1PQUA 2AZ4A 3FUCA 4LY0A 4HXGA 5ALOA 5HQ3B 3TZ6A 4YCJA 1H5NA 2ZROA 2PCJA 3EZ6A 3OQHA 3UJBA 5I45A 3VZCA 2C95A 5I9NA 4P4TA 1FX0A 2IXGA 4LJKA 2UXBB 4A15A 3W4JA 1SY7A 4Q15A 1E18A 4XGNA 2ARKA 5ALHA 3LDGA 3VTKA 3WKEA 1JE1A 2R6FA 2GH1A 3LQQA 4Y2QA 3UZUA 3OIWA 3SJAA 2XBLA 4O63O 4JUAA 2CV2A 1TJYA 3QSGA 4OHYA 3HKEB 4IMRA 1L5VA 5IT0A 1RRGA 2GJAA 3KB8A 3JVIA 3M1AA 3VH1A 4DNOA 3JRNA 2W42A 4RMIA 1JAIA 5ITZB 1YULA 2HF7A 5JXHA 3T3IA 1CW2B 1UWVA 3RB8A 3V8NA 4F56A 5ITVA 4QEDA 4P36A 3TG8A 4F11A 4FFSA 4EG0A 5KHAA 4MVJG 2VF2A 5MGBA 1ST3A 1P29A 4Y1RB 1TCAA 5GGYA 3TBFA 4IDNA 4DWWA 1FSPA 3DEJA 3UHJA 1ZU4A 2QUKA 3ONNA 4K6CA 2VT6A 3FGOA 3EXFA 2QRPA 5EMMA 4TLLB 5AM0A 5AOVA 1W49A 4IMIB 2QKYA 3RF6A 1R1DA 5KTRA 3WIEA 3L8YA 4FOPA 2BGKA 3D7NA 3ZKWA 1ZZEA 4A0RA 4ZIRA 1GAXA 4HDMA 2AHRA 2I1LA 4TTPA 1IVYA 4KQHA 5ECGC 2CMDA 5H9VA 1P44A 3IRUA 1XTPA 2EHJA 4FOLA 4FDMA 1RHJA 3QEKA 4LBWA 1EINA 1ETHA 2ZBQA 3SXJA 2RARA 4QOSA 4BNWA 3IIIA 3G5LA 3IKJA 3IXMA 4K88A 3GJYA 4Q9HA 4YV1A 1EK2A 3VKGA 1NRWA 2QTLA 2ZIUB 4I14A 3GLFA 1WEHA 4OYHA 5U1PA 3WGQA 3Q5GA 5CJJA 4J49A 2QX4A 5LKAA 1NJ8A 2KMLA 4WFJA 1Q84A 5F2NA 5IASA 1U4SA 3E7DA 5GJCA 4RDHA 2ZRFA 3SU8A 4QTYA 2W6JD 4AYXA 4RF2A 1ZR4A 3FI9A 1I6KA 1Q1NA 3EUFA 5LQDA 4M9SA 2NYUA 4FMCF 2DTXA 3TOZA 5MN4A 3STXA 1CR2A 1D6NA 2YN4A 3UA3A 1IXSB 2A58A 2EIHA 4KQ9A 3JVDA 4RNCA 4B0PA 3KQOA 5AJZA 3SHVA 3RSLA 3S2YA 3TXXA 1P1CA 5CA1B 1RP7A 3T7IA 1PT9A 1SMKA 1JG2A 3KKNA 2OYRA 3TFOA 2GZMA 3PLRA 1N2BA 2FI1A 2MYPA 2PMFA 3GARA 1MENA 1W36B 2IS6A 2JGDB 2IUUA 3PF9A 1HQYE 5HKKD 1EUDB 3FUUA 3P4XA 2PH1A 1V6SA 1YDFA 1XVAA 3EEFA 1VL1A 1QE0A 5M3BA 1LV8A 4B83A 2JGNA 5CK4A 5DLYA 2W2PA 4N5NA 1CFJA 1I1OA 1IG0A 3VYRB 2XQKA 3JU3A 4B5KA 1WBBA 1FRZA 1PL7A 3G2IA 4NFYA 1IUKA 1LW7A 2ZU6A 3TZQA 4ZICA 5JWOA 2J6IA 4Y3UA 5TS2A 1IBLB 3MWLA 3FVWA 2B4QA 3ZK7A 3HDTA 5CFPA 1SAYA 1XJ0A 2EL9A 3OICA 2H59A 1OWPA 1CJBA 1PJQA 1J39A 3E23A 3BQNB 3NALA 3QF4B 1L5KA 3OWHA 4GKKB 4DC9A 1O8BA 1GLVA 2JFNA 4N5DA 4WXHA 1E2FA 5EWJB 2YKGA 4HRVA 2VJYA 3OLZA 2LKCA 3DOOA 2P6NA 4LMRA 5CD9A 1YTUA 2FR8A 2Q6VA 3J7TA 5CVEA 3DVAB 5AVWA 5K0CA 1ISJA 4Q3LA 3TGWA 2G6BA 2ZRPA 4JB3A 5IF3A 5CYOA 1CNFA 4S1NA 4C78A 1GPYA 4CTJA 1C1HA 4ZVSA 4PNEA 4U2BA 1RZUA 3E5MA 2C7GA 1CZKA 1NUPA 1S2IA 2I99A 1QK3A 2QUJA 3PE3A 5ECYA 1RYYA 3ACDA 1S3FA 1UKZA 3AU8A 3LDHA 3QVGA 1Y1LA 1SB9A 2PXXA 3TTWA 3LA6A 2DWCA 4EX6A 3LAWA 4AZ0B 2IGBA 2Z6AA 1YD7A 4RZHA 2OXTA 2AHOA 4MP6A 3HCFA 4RMHA 1DTWA 1R37A 2Q5HA 4GLFA 5TGDA 2APJA 3TX6A 2CXNA 1XVTA 3BXEA 3CX3A 3D5QA 1GPH1 4C7KA 1IPHA 1E1QA 4XARA 5JS6A 5HDBB 4JV5B 1XNJA 2GAJA 2GASA 4LBVA 4FFDA 4MQEA 2QENA 4UREA 4MDFA 2VHEA 3B9BA 3EY9A 3KSMA 3GZNB 4Q34A 4KODA 1VHDA 3V48A 3K2EA 4PN3A 2GYUA 2Q9BA 5REQA 3GLIE 3EEYA 3UJ7A 4W5HA 3BBLA 1CUEA 3R8CA 1V4NA 3C48A 1ZXXA 3MTEA 3O21A 4IIXA 1G8SA 1RP1A 2CXHA 4G1FA 1H23A 5AVOA 1RMTA 2I7DA 4UE2A 1MO4A 2PR2A 4JKIA 5ALMA 1B0ZA 4WDQA 1F2VA 1N2JA 2Y0EA 3CZQA 5KYUB 3DWGA 1A71A 4DMMA 4PQFA 3CONA 5CW1A 3X1ZA 2JCBA 3JZDA 4OJTA 4YCBA 8ADHA 1RLTA 3LCRA 4URFA 4X71A 3PXGA 3X0DA 1Q0PA 2CVFA 3OD5A 1ECCA 1E7YA 1NM5A 1USGA 3WKCA 1Y8AA 1Z5OA 1IEWA 4XM1A 1CVRA 2ERXA 4H4CA 4Z0HO 3LWBA 1OGYA 4AYTA 5KVVA 2CUTA 4TYMA 1U9IA 4Q05A 4LZNA 5IXSA 3I1JA 1VCIA 3F3SA 1YVRA 1EE2A 2JLAA 3U17A 4OXIA 2GGSA 4P35A 3RHZA 4BVEA 1TCBA 2Q29A 4Z4CA 5FPYA 1CJMA 1GTMA 4UHKA 2X2FA 4OSOA 4JH0A 3LOUA 4F1KA 5IG2A 2QD1A 1JHVA 1PG0A 2IYLD 2C2GA 2WAAA 3C7DB 2ETVA 1Y4ZA 2LDBA 2OV1A 4L51A 1P0PA 4BX0A 2PKQP 3E22B 5EL0A 3UHPA 3WLEA 4F72A 1E2IA 4ND5A 1SOMA 4YUXA 3A1CA 4QELA 3G6KA 1WB4A 5BV2P 2QN3A 2GSDA 4YP1A 3UKJA 5EJ8A 4IXDA 1W25A 1JHUA 4GBMA 5T41A 1I7QB 5JCJD 3G82C 3OZXA 4OHRA 4OGGA 2BFOA 1QBGA 1BD4A 1U0JA 3A1FA 3B70A 3HJGA 3LBYA 1D5CA 3OQIA 4URHA 5K0GA 4DV5B 1T13A 4B76A 4NH4A 4Z8YA 2B92A 3DDNA 3HFSA 1AIPA 4IXNA 4JMLA 4Y6PA 5DYIA 5DM2A 5EC8A 1WBDA 4CEJB 2GXSA 4R5MA 2Z43A 5KHOC 1XZJA 1JALA 4A8JB 1OVMA 1Q1AA 2PSEA 5LFAA 1YAHA 3DHYA 3VR5A 4BC0A 3BT7A 1Z4MA 2ZCJA 2X6TA 1XMOB 1FFXB 4EA9A 4WZAB 1LQ2A 3MAAC 5AKJA 4LNAA 3LVRE 4Q47A 2PSDA 3A9WA 3L06A 2C04A 1JSRA 4E5KA 1W0JA 1XWWA 3VDMA 3R3JA 3RUPA 3UH1A 4Q4LA 3MTIA 3VU0A 1GKUB 1R5JA 2N9UA 3AOEC 3G79A 3GRPA 4J2OA 1WCIA 2QL6A 1HF3A 1SU7A 3PLNA 4N12A 4XQEA 3TB6A 1Q6YA 3U31A 3UH0A 1U1GA 1XLTC 2YMMA 4PZEA 3GAAA 5H16A 2JCYA 3FFAA 3DB2A 1MD9A 2GPSA 4J0HA 5BR1A 1BEUB 5F4ZA 2FZVA 4I3FA 4EF6A 2BCEA 1A96A 3GMTA 4WTOA 4URWR 4P54A 4BBAA 1JR3E 3ENZA 2FUNB 4M37A 1JFTA 2ZRLA 1O08A 2TYSB 3FSGA 4QTUB 1TAUA 2J85A 2ZSBA 1T43A 2IRWA 4GX2A 4BCBA 4CM1A 5K03A 1PZHA 3VV3A 2QZJA 4ZOLB 2ODNA 2PLWA 1FNNA 4AJLA 3NIFB 4FNGA 4EARA 5BMOA 4KU4A 1L7BA 1S1MA 4MVJA 5C8YB 5J47A 4W1SA 2WYUA 3COPA 5JDCA 2WYWA 4ACBA 1U3GA 4OBBA 4IEEA 4CN9A 2DFTA 1N1MA 1PZNA 3BZUA 3Q10A 2BHSA 2LW7A 2ZR9A 2Q5LA 3V1MA 4ICIA 1V3TA 1U8AA 3OIGA 1S01A 1B3RA 3VBEA 5BVGA 1ZD5A 4PIMA 4W6QA 5E0KB 4D79A 3PTLA 4EUNA 4OL9A 4P4NA 5J1TB 4CDRA 5JAOA 2XD4A 1L5GB 2F64A 4G5HA 3AHFA 2C2ZA 3VO8A 4MRAA 1DC5A 1V1JA 3LHSA 1FYXA 3MGGA 5H3LA 5TPWA 1R27A 1RR6A 3AVOA 3QELB 4UM9D 1DG9A 5LLTA 1WAMA 3L2OB 4W5QA 2QM7A 3P20A 1Z7BA 3LQ2A 3H0CA 4TXMA 1SXGA 2ORWA 1KJZA 4GGOA 4NG5A 3W78A 1Q57A 3VJKA 2V1UA 1PFWA 2GLTA 1GKLA 1RYHA 4W1QA 2H4WA 2DE0X 1W5BA 3M4YA 1EFPA 3QPAA 4H7PA 4OAPA 4UVDA 5JXGA 4I9GA 1D1TA 3UMJA 3J7AC 5EKSA 4OJMX 1Z5WA 4MQMA 4TT8A 4F6CA 4RV5A 2GLXA 2QMYA 2RH9B 1E8NA 2PXAA 2EGGA 2EFGA 2GN0A 2R7LA 1SKUA 1P91A 3ESAA 2ZS8A 3ZU6A 1KWKA 1FMFA 3PCRB 2GHTA 3RTCA 1MKYA 2POCA 4RGVA 4ZVMA 4LI3X 4E5DA 2AX4A 8MHTA 4AMUA 5C2JB 2ZUFA 4F4UA 5B58C 4GBGA 1RTTA 2BTQA 2Z4SA 1GFSA 3OZVA 3QU9A 5DM4A 3AY0A 5F9FA 1OREA 1ZN9A 3JZMA 4RY0A 5KTTA 5CB0A 1L4NA 3AC0A 4BEWA 1SXJB 3CVXA 4PRZA 1PS0A 1Y3CE 3HA2A 3JQFA 3PFGA 5DCYA 3DOFA 3OX2A 3RROA 1SK9A 2LIVA 3E9ZA 4HZUB 3QK7A 4X20A 4BV3A 1HX7A 1BW9B 1H2XA 3KYCA 1E1DA 3O3NB 4EHJA 1ILWA 2M2IA 4FOTA 16PKA 1NC3A 3NC0C 1T5IA 5ALWA 1DJPA 4FEYA 1DAHA 4DUZB 5KI6A 1XKTA 4JVSB 2ZJ6A 2NSLA 2ST1A 1QQTA 3DL7A 3O0DA 4YCCA 1A2QA 3DLBA 1QF6A 2L0XA 2NO6A 4HDRA 5AFSA 1QP0A 3L8HA 4FBLA 4FYJA 1GPKA 2MT9A 4FX5A 5JO9A 1KETA 1IHPA 4HVLA 1FP4A 3LA8A 1U4OA 3C15C 5EJ7A 4I19A 2EKZA 4RBNA 1Z5GA 4YRKA 1XCMA 1OA1A 1YB4A 3I5UA 3HEMA 2P9HA 3PGKA 2HWWA 1PNRA 1GN8A 3KFXA 5BSRA 2O8CA 1FPQA 3FMPB 3L1VA 2XZDA 5AI9A 2HCJB 5JPIA 3K9BA 3WTBA 3HB1A 3ZTWA 4IUDS 4LDJA 1X80A 1G4AE 3PWTA 1V26A 3VDRA 3OF3A 1MAUA 2WUVA 4I6JA 3OEHA 1TMGE 1VE3A 1Z0JA 1S4QA 3WSVA 4AKGA 4PGHA 1H2EA 3V55A 1PUJA 3U7HB 3R8FA 2JHPA 2E37A 4BVFA 3S4YA 1J21A 5BUQA 1GNRA 1G0OA 1RE0A 5AK3A 3W9YA 3PYXA 1TTTA 1U9YA 3AIIA 1RI4A 3L7BA 4HGYA 1RAFA 1UWKA 1THTA 2OOKA 4P7BA 1G4UR 4D4LA 2GYVA 4B3JA 1NBIA 4MV4A 2BSAA 2BR5A 1E9RA 1FVFA 1QIGA 1TVKB 1GILA 1U0GA 1Z5UA 1Y5LA 3B51X 2GO1A 3HJNA 4HEQA 5F2OA 2JLQA 3BZWA 1KMHB 2SKCA 4CR7A 4DEYA 3L41A 5IKXA 1PGJA 1B6RA 1T25A 3KSUA 3QNMA 4DMFA 5L3QA 2QW1A 1SQ0A 2FN3A 1YS7A 5ED0A 2J9FB 2NW6A 5DWVA 1ADCA 1Z75A 2I78A 1X1CA 1MT3A 4WNYA 4Y2XA 1W1WA 4BPBA 2GEBA 1KI3A 2H2IA 3HKCB 2EW1A 2YWJA 3MRXA 1Q17A 3HY4A 2VZ8A 1FRFS 1X87A 3E7WA 1X1QA 3UGKA 4XIJA 3T5AA 2YJ6A 3W1WA 1K6IA 4EW6A 3ICEA 1XZPA 3ZWKA 3L7YA 3Q0IA 4BZQA 4TKUB 2OV3A 4KXQA 1W76A 2C96A 5KUTA 1IEXA 1ZOOA 3IQWA 4LZPA 4R9UC 2QY9A 3EVFA 3GA0A 1BCSA 1T3LA 3JYPA 3OMLA 4GZMA 3T5BA 3T06B 5K8CA 1FC0A 3I9MA 3GQBB 2UZ1A 5CIWA 5BQ3A 5GV7A 3ESRA 1OTHA 3DBIA 4B3FX 5TR9A 4D8TA 1QIDA 3AHEA 3ZWOA 1KRXA 4EKNB 3GT0A 3AF1A 3TLZA 1PFVA 2MSKA 4L08A 4NE2A 4QUKA 1N6PA 5SYMA 1UMCA 3AR2A 1XPJA 2C7VA 4JT9A 3TPFA 4YROA 5LWHA 4P4SB 2RCYA 3E81A 3EEQA 3LFUA 3VR3D 1KBOA 2L69A 1QFYA 2CLIB 1AO3A 3FHOA 1CY7A 5BOSB 4GR9A 2WW8A 3TEJA 1BXRA 3QWFA 5EEHA 3DR3A 2FLWA 2LKDA 1JIVA 2VZEA 3A2KA 1U0NA 5JTTA 2LE0A 4EUEA 1OA0A 5J4KA 3K6SA 3VBCA 4B7XA 2JLCA 1P0CA 2DR0A 1FTYA 2WU3A 5HFJA 1B42A 2UUPA 2KM1A 2QM3A 5SY4A 1EB9A 2P91A 1JA0A 1E7SA 1ZI9A 3K0EA 3ELYA 3QBEA 3OCYA 1L5QA 1JBQA 2E18A 2IYQA 4Q7EA 4B80A 3H1EA 3R9XB 5DYTA 2O48X 4UNIA 4RDXA 2CCJA 4DG8A 4W5RA 1Q7BA 3TOCA 1G60A 1U65A 2D00A 3AFHA 1H8HD 3F2VA 3RW9A 2XWQA 5L40A 4BXOA 3FLEA 3FSRA 1UDAA 4REQA 4EEXA 5C4GB 2D2FA 1BMQA 2WZDA 4P0PB 2X5NA 4LFCB 1U0RA 1XA0A 2L19A 2QVCA 2YWCA 1ZVQA 1UBLS 2F1IA 4NE7A 3IERA 4Q12A 4GLBA 3GCDA 4YGYA 3RODA 3ZUGA 1W0CA 3ZU4A 4EJ6A 4WCDA 2IH2A 3S1SA 3DE4X 5K05A 3SEZA 4MVJE 3SVZA 4EKEA 1P4RA 3B1YA 4JY7A 2MOKA 5C51B 1SCBA 4HAZA 4PXAA 4QBHA 4OSEA 4OKSA 4CI9A 2Z1MA 4ESEA 2LD4A 5A4IS 3VM6A 5KNDD 4N48A 2DXIA 4QJ3A 3W8EA 3QOWA 4HX2A 1NUUA 3CRVA 2R1VA 1TOAA 3PKZA 4HNQA 3T3GA 5DNCA 5J43A 2FPPA 2JBAB 1PN3A 1WY5A 4FLMA 4ENPA 1KQGA 4A4DA 3LY8A 3MRTA 4LYGA 1EFVB 4HQLA 3UFXA 1IQ0A 3K70C 1HDGO 4IIEA 2PKYX 4KUEA 2AA3A 2I62A 2VDKB 3CLRC 1O2DA 3IC5A 4JJFA 2EBUA 2PL1A 3FWKA 5FPQA 4C76A 1T8SA 3E18A 2BEVA 4D0NA 1MORA 2HJSA 3C4QA 3DD1A 3RIMA 1VI2A 2A5DA 4RA6A 3NKFA 1W93A 2QRVB 3DKKA 2B21A 4PFKA 1TT7A 1QH0A 2YASA 3HYTA 4WOKA 1XMSA 2GVDC 2Q49A 4OKIA 2HJWA 5JCPA 1EI9A 4E46A 1IDN1 1P33A 4F3KA 3O5AA 3M2TA 3NTUA 3PR1A 2FB9A 1ZLXA 4RFLA 4EI8A 1PD0A 1CUFA 4QDXA 3L1IA 4Y6GB 1BFDA 5JWHA 4IV0A 5EHGA 5CB4F 3I1YA 4RTOA 2I4NA 3P0JA 2DHCA 3DCIA 1PT7A 2ODQA 4TKZA 4CODB 2JJMA 1V11A 1Z6ZA 3ZGVA 3ZLUA 3A26A 4R0MA 3LUFA 2O4UX 1DX6A 3GAMA 5IJZA 3EISA 3BHJA 3OZEA 2V7QD 2EZUA 1NG9A 1MG5A 1Y8QB 1Z18A 3HYSA 3N7UA 4PIVA 3NOVA 4EW2A 2GPYA 1KAEA 5ALPA 2XCLA 3B1FA 3HV0A 4YRJA 5JSYA 3B60A 5AM3A 2NP7A 3CR8A 3EGXB 3SFTA 5GM2A 3LVQE 1X15A 5CFLA 3QU2A 3T35A 1GKYA 5AWFC 3SC6A 1BEZA 3HBJA 5GONA 4MQ6A 2ACEA 4Q4HA 1K7XB 3BRQA 1TRHA 2BDEA 1X92A 1OFUA 4RAQA 5FLXA 1V37A 2QRGA 1CS4C 1V9CA 4FDLA 1QH1B 3WHKA 1W85A 1VE5A 5JS2A 4C3ZA 1TKAA 2PTGA 1TQ2A 2FPLA 2GX6A 2RFLA 4NCJA 3U4DA 1UC9A 4XSGA 3GP8A 1MRZA 4JI0B 1SGWA 3MIZA 5BSKA 1YRAA 2CLFB 3RQIA 1O4WA 1X7HA 4A27A 3SC2A 3FZGA 2HNAA 2XY4A 2WPDD 3GXOA 1KFCB 3CF4G 2UXCB 1G41A 2DLCX 2Y0PA 4D74A 2J9RA 3NZEA 2DVMA 4L8LA 3P32A 4DS3A 4QPPA 1MXHA 3IP9A 2QLJA 3VSCA 3CPHA 3ZBTA 2Q0SA 4KZPA 1T9CA 4I55A 4OI0A 5ALFA 1RI5A 4Z9XA 4MMZB 3UK1A 1G6KA 3CKKA 1T9ZA 2XEDA 3E3LA 1T3TA 1ESZA 3CT6A 1Y6GA 3WGLA 2O0LA 4KJZA 1W46A 4W8OA 3ZDXB 2WU8A 4XQ9A 2NT3A 5JQGA 5EIOA 4BUZA 4LY6A 3TL6A 3ZWMA 1R00A 1JNYA 3CLTC 2I4MA 2D1SA 3HMQA 1XQVA 1Z36A 1EWRA 4RH1A 4GL4A 1YI0A 4RSGA 4TLDA 4BFYA 3UATA 4PSCA 5DI3B 2CFSA 4ISBA 2ENUA 1JIUA 1SXHA 3UOWA 4DG5A 3KTAB 1P5HA 3IHLA 5JD5A 5KJ1A 4LXUA 3TM5A 3AUAA 3TTUA 3CKLA 4YRQA 3W2HA 4PX3A 3G9XA 1DWOA 1MJHA 3JZAA 4HUTA 3W7VA 2ZM5A 3ADCA 1U9ZA 4KKVA 4O1MA 3OZ7A 2XTJA 1L9XA 4MUJA 4PVDA 2RGAA 2OO3A 3EXIA 5C0OE 2QLNA 2AJDA 2R8XA 2P8SA 1ECBA 3CE6A 4LPSA 3PENA 4PO8A 4Q3KA 4L9AA 2I6QA 3B13B 4Y2RA 5FTKA 5JAQA 5B7PA 3GLUA 3AG5A 1TMKA 1ENPA 3MWJA 1BWQA 2YXBA 2WF9A 4R0NA 5BVHB 2M1XA 4K1LA 3QEMA 1T2FA 3OE1A 2I7VA 3OX1A 4U2KA 1C0KA 1WMFA 3BH7A 4GBJA 2ZR8A 3M6VA 4C2UA 1PW5A 4HNHA 4JBGA 4NZ9A 2Q8NA 2M6LA 3HI6A 2JEZA 3RUHA 3K9WA 4A73A 4J75A 2UVDA 3I04A 3ZW7A 3CS3A 4ESHA 4WESA 2GK3A 3CG0A 2XE8A 4JOSA 1XV5A 1PF7E 3Q9LA 4OQPA 1SQSA 4N03A 4EGCB 4UUBA 3BDVA 4YO8A 3C3EA 2Z56A 3FHLA 1J8QA 2PMCA 1MB4A 2VG8A 3IUBA 3MA0A 3AHGA 1N2SA 1O03A 1UFQA 4TVBA 4AZ3A 1JLHA 1XTTA 3RNLA 2GF0A 3V4LA 2BOVA 2IPAB 2ZDHA 3TLEA 2ZSIA 1YRBA 4K6HA 1KDVA 1PJAA 5B3KA 5CA0B 3F71A 1XMXA 4D7AA 5GGXA 4G4JA 3PTAA 3N5CA 4KOAA 1U28A 5LWQA 4Y9SA 1KKUA 3GB9A 1L3CA 3D3KA 3NVAA 1SQGA 2OSBA 2IBMA 2WP8J 3Q7RA 3HKDA 3ZV4A 1D3AA 1JYEA 3I1FA 2ZSJA 2OB1A 2XF8A 1W1UA 3W3ZB 3X1WA 2XV1A 3CUUA 1YOVB 3O47A 3W5AA 3T7JA 1JIJA 3BMOB 1GD1O 4NARA 2XODA 4EKGA 1U6JA 5ALSA 5B36A 4R1LA 1TK2A 3LKDA 4KVAA 1EX6A 2QD2A 2DHEA 1OBVA 3KD3A 5EYPB 5DLQC 1KE1A 3STYA 3TLBA 3U7EB 3ZWNA 2XUPA 1LDMA 4V2IA 1EXVA 4HUQA 4AUEA 1NJ1A 2WILA 2EFYA 4R7GA 1Z2OX 5EXEA 3EUWA 3O2SB 1J23A 4XIIA 2H1RA 1BFUA 2K87A 2XLCA 1H2FA 1UWLA 3DLTA 1ZI8A 1T36B 4KGZA 5DTRA 3F97A 5IH3A 2D5IA 1NR5A 3CF0A 5KYKA 3W06A 2XUZA 1MB2A 3JQ6A 1PP4A 2XT9A 4KO3S 4Z99A 1Q50A 4E3ZA 5CA1F 4NWIA 4YLYA 4YV7A 1DIHA 1JHRA 3W90A 2BCGY 2YHIA 5I7VA 1VKJA 1X38A 1UPFA 2VNIA 4JXZA 3K92A 6ABPA 1V48A 2QAIA 3QPDA 3F98A 2Q5QA 2CDBA 2FE1A 3A9TA 3PSAA 3VHRA 4PF1A 4FFLA 3PNOA 2B5OA 3K2BA 4MW0A 2OC9A 1ISPA 2QN6A 4JSRA 4AKSA 2C98A 2NOAA 4ZYYA 1FXSA 5EVJA 2H1FA 4DDTA 4CL2A 1Z0IA 2A78A 1NRJB 2EWMA 4Q3OA 3F6SA 3LRXA 2E6KA 3E2PA 3L01A 4COOA 3C8MA 4MCJA 4DZZA 3KB6A 2Y1EA 3IQXA 3KKEA 1XCLA 5KNCA 4O02B 1L4KA 1AF4A 1JAYA 1UT5A 5DM60 1HNWB 4RHEA 3U1VA 4W8GA 1XZQA 1YE5A 2A67A 1K8XB 3THRA 5K8JB 1P7VA 2YDXA 2YW2A 1QLHA 3VU9B 4HLCA 3L7CA 5F2EA 3NMUF 4TXJA 1KS2A 4PSDA 1ZK3A 1GSOA 2J7PA 5F3RA 3BJEA 2WU0A 3OP4A 3N0VA 4LYYA 2NM0A 1R0KA 2BFFA 2OUIA 3E15A 4RJ2A 4RSMA 2Q62A 2OV4A 1L7NA 3W2GA 5NLLA 1TLTA 3GRKA 5C4MA 3IHTA 4YJ2B 1LA2A 1QHYA 2VHWA 3NWPA 2XMRA 3PCXA 4KQEA 3ROMA 5T64A 4CEIA 4RZXA 5C8DA 1L4GA 4PTZA 2XWBF 2WJVA 2UYHA 1NVUQ 3KHUA 3O8BA 2W4IA 1CRPA 1I3OA 1RJDA 3D8RA 1VPTA 2OQ2A 5KYTA 1E9EA 1N78A 3AM4A 4JC0A 1F4VA 3V97A 2ECFA 3OIDA 4UVGA 4ZQFA 5G0VA 4CW7A 3WSWA 3HUUA 3K16A 4G1VA 1E2HA 2HJRA 3R3YA 2NUAA 2VP9A 4TT3D 3U19A 1BN6A 1QVWA 3DJYA 4ZAYA 3HXMA 2UZ4A 5D5QA 2FP4B 1FB5A 2OENG 3EEOA 1EK1A 4DMGA 2NSHA 2QNRA 1Z06A 2OXEA 5KBYA 3VC1A 2ZJZA 3B1ZA 1WL8A 3MJRA 4TM7A 1YNSA 2CZQA 3OQVA 2LDXA 1I2CA 2HMSA 4HG2A 4L27A 4QBIA 5AW8A 4KYIB 2WJYA 4E12A 1CHNA 2XMDA 3DCNA 5DPMA 3VOBA 2H51A 1DKMA 2ZB3A 4UKDA 3TIVA 2PG3A 1NPYA 4A92A 4BJ3A 3THXA 1XF9A 4CUJA 4OSPA 1IL0A 3UMBA 4F2GA 2JJ1A 1DJQA 2GDJA 2JA1A 4TSKA 4W7HA 3BMQA 1QHGA 1G5TA 4ZT6A 3AEKA 4YRGA 1FP1D 1NBWB 2FZGA 4BTVA 1SHZA 3HGTA 3EZYA 2YIMA 1KZGB 4BEVA 2VHXA 4JK3A 3OJ0A 3ITNA 4CVNA 3ZU2A 4K9MA 1REQB 2BBSA 2ODAA 4ETMA 5EIHA 1GGNA 4BMCA 4RD6A 5CPFA 1OXBB 2R8EA 4A2QA 5IW8A 4TKLA 1JRLA 5KYYB 3MMSA 2GXAA 4IDDA 3OESA 2Q4RA 5K3OA 1WF6A 2YN0A 1KS9A 4HO1X 4B3TB 4L75A 2FU5C 1YZQA 3ILXA 1NVKA 3CF4A 2PU5A 4PPFA 4B8WA 3JR3A 3VVLA 8GPBA 3OAAD 4C4PA 5B53A 3L1HA 4OQ4A 4X1IA 1ICIA 1MABA 1ODJA 3GDOA 4ZU1X 4F9FA 4TTSA 3JWIA 2D2EA 3PRYA 3WV5A 5CGZA 3JVEA 3Q98A 3IURA 4LF6B 5IK2D 5B2EA 3MNFA 3RSGA 2D1YA 4DUPA 5EXPA 1N2XA 5AD1A 4X62B 3BSWA 4W7SA 4CUZA 2WMDA 2K2QB 5JISA 1QHHB 1NNEA 3JZIA 4BFTA 3OFSA 13PKA 3QSYA 2QLMA 1YL7A 3Q11A 2YVLA 2IYAA 1OFGA 4D56A 4YLEA 1DLIA 2FSUA 4Y7CA 5JU6A 5KTYA 1VCHA 4I5FA 1C3OB 3EWSA 4B6OA 4S2EA 1C7ZA 1LPPA 1PZFA 2QTTA 3CMMA 1ULBA 4O33A 1OLSA 1QYCA 2EHDA 3IUJA 2X9QA 1EP3B 1JB9A 1UMBA 3ZQKA 2FQWA 3EVEA 3VSEA 4ROTA 5IC4A 1C5KA 3TCNA 3L43A 5A71A 3QWAA 3QW2A 4EA7A 1FJXA 2Z09A 2G71A 1Q83A 4FC6A 4B4OA 1N5OX 4LZAA 4FWBA 1V8FA 2GNPA 3HS3A 4RZUA 4EO4A 1Z45A 3S40A 5EJIA 4BMYA 4BLQA 3DZFA 3AI3A 4YREA 1PDVA 5T7BA 1SB8A 1F0KA 2C58A 2QE7D 4YRCA 2EZ4A 2O8DA 1SG6A 2J46A 1VFNA 4OD0A 3S2ZA 3M82A 3KSRA 4Q93A 3IVGA 4AG5A 4KRGA 5JZOA 3CZ5A 4XPIA 4JNKA 4EB8A 5FWYA 2YJGA 4OM7A 1G7TA 1QJCA 3HWWA 2F3SA 5ERGB 3L1UA 3BMCB 4NLLA 1BXGB 1PR3A 2P7HA 5I8WA 3I6BA 4CQMD 1MU0A 2V0CA 3SR3A 5C8YF 4HJXA 2GHRA 4XWAA 2A33A 3B3JA 4L7QA 4EWLA 4MLDA 2B1QA 3GT3A 2PX6A 4I8XA 1SFRA 1YRWA 1A3CA 4E5PA 1SPXA 2CMKA 4O0MA 3M4JA 4WNAB 2R0QC 4YRDA 1GEGA 1BU5A 1JDBC 1HT0A 4WK6A 1JR2A 2Q6OA 4YPOA 5HILA 3RSOA 2D74A 2C99A 2AWNA 1GVNB 4IH9A 4NS4A 4MI9A 2D0PB 4DDUA 2YFKA 1AK2A 4KUHA 3A7EA 4QU8A 4DV6B 1CQWA 3ZCXA 4WVLA 4NBWA 4FE7A 4BFSA 3UK7A 1E3QA 2FR1A 4ZCLA 3VTZA 3N7TA 4XJXA 5HUJA 3OQOA 4CV2A 1OLUB 3Q0EA 2DCMA 3BIFA 1D6JA 2OM6A 3L0IB 2FLKA 4DE5A 5JIBA 3WI7A 3TTSA 2ETXA 3AR3A 4BQNA 1HXHA 3JQPA 1VYHA 2LR0A 1SUSA 3GLIA 1OIXA 4V0QA 2ZSHA 1RI1A 3U1TA 1D8TA 4ZKDA 5AHRA 1LCIA 3UGQA 1RC1A 2AFHE 3GAFA 2IXBA 3M33A 2R5FA 3NH6A 4PHFA 1ZM3A 4JI1B 2RD2A 3EY4A 1HZZC 1ZUNA 3T3MB 3SNHA 1DXOA 4NCIA 4KR2A 1WZ2A 2IHUA 3DL0A 3OT4A 3CB4A 4ZO9A 3HU3A 3IDZA 4IYRA 3SSMA 2B4YA 2I4TA 1UXKA 2AXEA 2GN6A 4IMPA 4C5BA 4NBRA 3ZVNA 4PBRA 5DHQA 3HC7A 1QLJA 2QROA 3V8RA 3VVCA 3BJIC 4BGDA 5BV1A 4Y6LA 5TS3A 4G07A 1H2YA 3CLUD