4Y0AA

Shikimate kinase from acinetobacter baumannii in complex with shikimate
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
179
structure length
179
Chain Sequence
PSKAFETLPNIYLVGPMGAGKTTVGRHLAELLGREFLDSDHEIERKTGATIPWIFEKEGEVGFRTRETVVLNELTSRKALVLATGGGAITQAPNREFLKQRGIVVYLYTPVELQLQRTYRDKNRPLLQVENPEQKLRDLLKIRDPLYREVAHYTIETNQGAARDLAQKILQLILSNKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of shikimate kinase, an in vivo essential metabolic enzyme in the nosocomial pathogen Acinetobacter baumannii, in complex with shikimate.
pubmed doi rcsb
source organism Acinetobacter baumannii
molecule tags Transferase/transferase inhibitor
molecule keywords Shikimate kinase
total genus 65
structure length 179
sequence length 179
ec nomenclature ec 2.7.1.71: Shikimate kinase.
pdb deposition date 2015-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01202 SKI Shikimate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4y0aA00
2REBA 4O2LA 2O8FA 3AF3A 2RAPA 1Z0FA 2C5LA 3OEHD 4DDTA 1UKEA 2Q3FA 4QRHA 2QUZA 4KODA 4G5OA 2YZ2A 3OIYA 2QSYA 3LFUA 1SXJC 1AQYA 1Z2CA 2ZJZA 1ZUIA 3THYA 2IYXA 1LY1A 1W44A 2AK3A 3SBEA 5F9HA 1P9RA 5F9FA 4FXPA 2GXAA 1R5NA 2EQBA 3K0FA 5EXPA 3SJCA 4MYHA 1G8PA 1Q0UA 1JB1A 5EP3A 2F1HA 1NMZA 1XRJA 2CJWB 3AF2A 2JLYA 4US2R 4EAQA 2OSBA 5EP2A 4Q4HA 4CT5A 4Q47A 3T06B 3T34A 4EJSA 2XZLA 1OHHD 1VYVA 1YKSA 4JLBA 2FOLA 1R0YA 5J4KA 1AS3A 1KMQA 3SYNA 1E2HA 1NBMA 1TADA 1QHHB 3L2OB 4OYHA 4A8JA 4BLTA 3CLVA 1FQJA 3N2IA 5UKDA 1L7VC 1OW3B 4L15A 2GESA 4M21A 4P4SA 3O8BA 3VQTA 1XTQA 4ZKEA 2VSXA 4FMBB 3R7WA 3QIAA 2GEVA 4LJAA 1NVVQ 4Q1BA 3BE4A 4RZ2A 3WMGA 2EFGA 1HT2E 2MMCA 5CYOA 4LJ5A 5A0FA 4LYHA 4YONB 3KQUA 3LO5A 1LV7A 3R20A 4QGAA 1N5KA 4QNMA 4R9UC 5HKKA 3RRYA 4L9WA 1XD8A 1NVUQ 4DSOA 1A2KC 4LHWA 4CZ2A 4CF7A 1OB5A 1KSHA 4FWTA 5JZVA 1S0UA 2ZS7A 1E9AA 1UM8A 2ZRPA 3CNOA 4KLZA 2FEOA 3PCRB 4I1VA 3JVUA 1W49A 5JSZB 3B1XA 4MRNA 4M8NE 4PC2A 4X8OA 4TMZA 3EX7C 5JFGA 5JMTA 1S9HA 1HEIA 1Q20A 4D4MA 3WBKA 3TLXA 3CWZA 1G21E 3SFZA 5JSZA 2XNDA 1N6OA 1T6NA 5AWFC 2GJSA 1KK1A 3K9GA 1DAMA 2A5JA 2GHIA 5D3MA 2XXAA 2XNSA 2OCPA 3Q72A 3GLIE 2GTPA 1G16A 1N6NA 1P9NA 3MLEA 4DXAA 2IUUA 2CL7X 1U0HC 1SXJD 2J46A 4QNRA 3B1VA 1T0HB 1KHTA 1OIWA 3A8TA 3QEOA 5D3MB 1GUAA 2QZ4A 3AP1A 4W7SA 4B44A 2NG1A 3E70C 1TF7A 3DZDA 1E1QA 4LY6A 2QMUA 1Z6XA 1QHGA 1KDRA 1G8FA 1VIYA 2PZGA 2O8BB 4JT4A 3L8ZA 1JPJA 2AFHE 1G20E 1NBMD 2JATA 1W0KA 5KNBA 4N1AA 1BMFA 2F9LA 1OFIA 2N46A 2ZRIA 1ZUHA 3EPJA 2IYVA 3LLMA 3ASZA 3CH4B 1MT0A 5FTNA 3EPKA 5HTKA 3AVOA 2QENA 4TZ0A 1IJFA 2K5UA 1Q12A 2R44A 4FCWA 3WP0A 2GJ8A 2QGZA 4V03A 5HPYB 3B82A 1YRBA 2IUSA 1EK0A 4URUR 1P4SA 4XTRA 5F3WB 3KTAA 5FL7D 1KO1A 3VNVA 1E6CA 4TN1A 1XPOA 4OHVA 4AY2A 5SZIA 5G3ZA 1KI3A 4NYIR 4KAXA 1P73A 3OE7D 4IOMA 4JVNA 2YWGA 3RANA 3EW9A 5HZHA 1R5BA 3CNNA 1V5WA 2RB4A 3A1UA 2BWJA 2VSFA 3UG6A 2FSGA 3GJ4A 1ANKA 1RRCA 2WWFA 3QBTA 1IOZA 1OXUA 5DLQC 4LK2A 1RYHA 1K8RA 4N0DA 4URYR 4X8LA 2C98A 1H8ED 4JIMA 2ZI9A 1G41A 3BH6A 5H8WA 5E95A 4P4UA 4EPYA 4G1UC 3QKTA 2VP6A 2WSMA 2C04A 1D5CA 1SKQA 2BBWA 2YINC 3W5IA 2BKUA 2KSQA 3ZGXA 3CX8A 4GOXA 121PA 4KHZA 4LHYA 4CW7A 3U60B 5DE3A 2JLQA 3ZS8A 1GSIA 2P67A 1PUIA 1CP2A 1PLLA 4XOIA 4DEXA 2VRWA 3PJRA 1LW7A 4NCJA 2AWOA 1T5LA 4NYJR 1W4CA 4Y0VA 3UIEA 4PC1A 3EXAA 1G5PA 3AVPA 1W2HA 3B1WA 4OQFA 2HUPA 1F3OA 1D2MA 1CR0A 2Z4SA 1F2TB 4POAA 4BFVA 4QHSA 4OQLA 1KSGA 3NBFA 1R6BX 2ZYWX 4A6XA 1JAHA 3AVQA 5JHHB 5IRCD 4PHTA 2F1JA 4ZCIA 4BZPA 3CRVA 1NG9A 4TYQA 3I1FA 1II8B 1CKEA 3EZ6A 5JWOA 4BFZA 2JGNA 2IF0A 2DFNA 2R6CA 3LBIA 1WRBA 3W6PA 4KBGA 1BYUA 2QRZA 4JT2A 2F6RA 5TDHA 2J7PA 4BECA 1D8TA 2CL0X 2EFDB 1KK2A 3DKVA 3EWAA 3BORA 3SJBA 3LWNA 3AVXA 3HWSA 2HV8A 2Q3MA 3Q7PA 5FUVA 1DTSA 3QY0A 1G4UR 2PEZA 4W5JA 4YMUA 2W2VA 2J41A 2B6HA 1QZXA 4Q01A 3PXGA 4WBSA 2ZU0C 1HUQA 2JASA 1DAIA 3CF2A 3CW2A 2FPMA 1D2EA 3RRMA 3SI7A 4CT4B 1NJFA 2Z0MA 4DLUA 3NEYA 3NDBB 1L8QA 2IYRA 1HTWA 4YC7A 2BV3A 4PZLA 2QE7D 4LX0A 4ZDJA 2QT1A 3DDCA 1S8FA 4WA7A 5IDVA 2JJ2D 3AKDA 2FWRA 4W9MC 3AVUA 1KO4A 3PUXA 4DC9A 1OH6A 3IDQA 221PA 4RZ3A 1U8YA 3AV0B 3OIWA 3IBGA 3MG9A 4KI0A 1AK2A 4PX9A 3CF6R 5JCZA 4C4PA 1KTVA 4H1VA 1JR3D 1XNJA 4TZ6A 1DO0A 721PA 4JJKA 3FHTA 2PBRA 3GCGA 1XTRA 4TLCA 1SGWA 2QG6A 421PA 3KQNA 4HDQB 1Z2AA 5JEEA 2ZJOA 1NN1A 1JXOA 3HDTA 4GZMA 1KI2A 2GXQA 5DN6A 4HLQB 2IYLD 2IYYA 3TE6A 2DWQA 1OB2A 1KO5A 2BCGY 3D8BA 4Q1EA 4B3XA 5C1BA 4LPSA 4JMPA 1XD2B 1ZCAA 2A5DA 2C9CA 2ZAOA 4OQXA 3S1AA 2E87A 2F9MA 1W0JA 4M1YA 1MRSA 1KI1A 4GMDA 1VPLA 3RWMB 1R4AA 3GLIB 1G7TA 3K09C 1VHTA 2WZQA 2ZE6A 4XIGS 5JBQA 3K9HA 3BFXA 3QI2A 3IO3A 1UBGA 4PFSA 5E7IA 2WJHA 5IHPA 4FI3C 5EJEA 3I3SR 2YOGA 2ZPTX 4EQ6B 4PXAA 2XEXA 3AUXA 2FNAA 3GLIA 4B3CA 3K70D 3A4NA 2A5FA 2PH1A 3MD0A 2OFOA 2BOVA 3NC0C 3QXXA 5CM8B 2MSCB 1ETUA 1GL9B 1DAFA 1SQ5A 1FL9A 3CUEF 1PUJA 5E7JA 1G4AE 4AD8A 4FMCB 1TF2A 4ARZB 1E9FA 4PPNA 1EXMA 4TQAA 4CEHA 4WIAA 2VP4A 4Q9LA 1XEWY 4RD6A 2H8KA 2V8OA 1D9ZA 5FTJA 3GJXC 1JQLB 5TARA 3QF4B 5E3HA 1RRPA 1G3RA 1Z8FA 2VEDA 3THWB 2CK3D 5FI0B 4QGFA 4DJTA 4Q1AA 3R9IA 1MKYA 2IS2A 1Z47A 2IXFA 5FL3A 1YR8A 2VPPA 2OEPA 3MJHA 4KSBA 1GRNA 3WNCA 3TW8B 4A2WA 3PR1A 3DPUA 3UK6A 3G0HA 1NIJA 2GEUA 4NYIQ 3THOA 1UKVY 1RW4A 1NG1A 3NBXX 4UQOA 4GPTA 4AURA 2QA5A 1M34E 2ZYTX 3Q9LA 1T0JB 5CDFA 3VTKA 2G77B 1EFHA 1BIFA 3RS5A 3FPAA 4C0QC 3PITA 2X1VA 3DHWC 4RD3A 2GVZC 4EPRA 2OXRA 3V9PA 1WF3A 2WSSD 1WXQA 2GJAA 3RRNA 1IONA 1G6OA 5CB8A 3KXLA 3NC1C 4PANA 1S4QA 2C96A 3U44A 4BZQA 1CJMA 1KJZA 2ASEA 2V1XA 3SEAA 4ESVA 2X8AA 2PLRA 4V0KA 3QG5A 2CXXA 1QG2A 4AG6A 1ZU5A 1SXJB 1WMSA 2NO0A 2J5XA 3T5GA 3IBYA 2WAYA 1I2MA 4LYFA 4C0SA 1ZCBA 2A5GA 2QEQA 1A1VA 4B6EA 1UKYA 1TQ6A 2IS1A 3QOFA 4QM6A 3GFOA 5TVKA 4C0JA 4F38A 5TB5A 2G1JA 4GRAA 1T8TA 1U8AA 2D3WA 1JI0A 2CEAA 3DMNA 4HAYA 4QHTA 1X3SA 1X8LA 5FL7A 4ESHA 1II9A 3UMSA 1G1MA 2F43A 2FEMA 4CGZA 1Z0KA 2IC5A 4II7A 4RCYA 1KNXA 3MUFA 3PIRA 4DT1B 5KNCA 1NN0A 1FP7A 1N5IA 2JIZD 4KLNA 1QVAA 5GJCA 3NXSA 5EP4A 4M1TA 2FA9A 4D26A 1CJTC 1AM4D 1G8GA 1KZGB 4B3FX 3MSXA 3VHXA 3LXRA 4CEIB 1DAHA 1KJYA 1OIVA 2UZ3A 1FMJA 4G3XA 4F7WA 1AKYA 1GTVA 4IDPA 1BMFD 3KKQA 3RWOA 3AB3A 2ECKA 4URWR 4C2UA 2OZEA 1XJCA 1G19A 1YZKA 1NKSA 2BMEA 3Q85A 2ODNA 3KKNA 4ITRC 1V43A 5CK5A 3K70B 3AM1A 1G7CA 2OE2A 3PUVA 4JBXA 4TYWA 3UMRA 4RJLA 5L3QB 5KDOA 4D0NA 2IWHA 2CLDX 3GEIA 3QVVA 4I1OA 1KMHA 2ZYUX 2V6IA 3UATA 1FTNA 2ZIAA 1FTSA 1N6PA 2GAAA 4JJZA 1II0A 3VR6A 2JDID 821PA 4PAOA 2C8VA 1CULC 3CPEA 2RGEA 3K0CA 3SYLA 2XJ4A 3IKJA 3PUWA 3CIOA 1ZMXA 2ONKA 4ZO4A 2XNDD 4FN5A 3R7WB 2NMVA 1XCGB 2ZITA 1Q1ZA 1KMHB 1R0WA 4LV5B 4OKSA 3PUYA 2PJRA 2OM2A 4JVSB 621PA 1HYQA 3SR0A 3IQWA 2QPAA 3H2YA 3MWYW 3X1YA 2OV2A 2ZU6A 3ASYA 3K0AB 4Q00A 1VCMA 4NYMQ 2R62A 2NO1A 2PX3A 5TXGA 5HE8A 2XAUA 3RS2A 2V4ZA 1NRJB 4DIDA 3KX2A 5DH9A 4KXFB 1TEVA 3CRRA 1W4BA 3O8DA 3SJAA 2CHVA 2ZRDA 1JXMA 2JDIA 2QP3A 3EWSA 3K0AA 2HT6A 4FW9A 2IEZA 3GEEA 2YVUA 3PVSA 4HLDA 5JS8A 4GL2A 4ABYA 4FCTA 3I92A 1EFCA 3VR4A 2QNRA 4TT3D 1XBTA 4PR0A 3EASA 1QHXA 3ADKA 4DDWA 3LW8A 3T61A 1TEXA 2GEDA 6Q21A 4IEIA 2DWOA 2BMDA 1E79A 3WRXC 2HXSA 2RCNA 3CO5A 3TVTA 2W0MA 3PENA 1FUUA 1OHHA 1ZRHA 2ZEJA 5IT5A 4GNKA 1KKMA 1XXHE 1LB1B 2H18A 1DS6A 2PEYA 1W0JD 2CDNA 4C0AC 2J0QA 5FBQB 1BKDR 1P3JA 2WJIA 1MO3A 4DKXA 3OIUA 4G01B 5CK4A 5JJIA 1S1MA 1YZQA 3VHLB 2J0VA 2QQ0A 1A7JA 2ZRAA 5SZHB 3W9YA 1IQPA 1R5OA 3IIKA 1E3MA 4KFUA 4YMWA 2O8FB 3Q3JB 2CVHA 5JWHA 1OFUX 2W58A 3I4LA 3LVQE 2OESA 1MR3F 3KUCA 4BLRA 5HE9A 2REOA 1TAGA 1P72A 4P4TA 5FFMA 2FZLA 3L43A 4WXRA 3MWKA 2YC4C 5EXSA 2BM0A 1HURA 3JZAA 1ZP6A 5DHAA 1HY3A 2VL7A 1KK3A 1W46A 1E2GA 2BCJQ 3Q7QA 3TQCA 2GJKA 3CNLA 1P7CA 4LBVA 5K8LA 3GJ3A 2FV8A 4HAVA 3GLGE 2IT1A 3N70A 1TU3A 3SN6A 1E2QA 3ZVNA 1OH8A 4EJSB 2A7QA 3U7HB 4MDEA 4MKFA 4KFRA 4URXR 5CIWA 1Z0IA 1DG3A 3U3JA 3R9XA 2Z43A 1JEDA 2YWEA 2JJ1A 4M1SA 3CR8A 3B13B 3IPYA 4O25A 1RVDA 1E0AA 3W3ZB 3TSZA 3WYFA 1IJEA 2RGGA 4D82A 3IIMA 2WSSA 2EWVA 2YV5A 1VCOA 3EZ2A 4X8MA 3K70C 3KXIA 1Z6AA 2ZVPX 3CZQA 2ONJA 1HE1C 1VCNA 1Z07A 2QP4A 4RZXA 1JPNA 1E1RD 3HYRA 4BFSA 2DFKB 2AXNA 3W8RA 4LV6A 2QE7A 4A82A 3RS3A 1IN4A 1JAIA 3MJRA 4A8JC 3F5FA 4JYBA 2ZANA 4NYMR 3AGQA 3M6AA 2JLWA 2D4HA 2BDTA 2J87A 2PT7A 2QM8A 4K8OA 4KFSA 4LGMA 3VFDA 4UXJA 1XMIA 4Q5IA 3LH5A 3GJ8A 3GJ7A 4LBWA 4OI1A 4OHYA 1NY6A 3MMPA 4C30A 4UKDA 3LBNA 3K9NA 1DE0A 3TMKA 3EA5A 5DI3B 1M2OB 1QRAA 4JSYA 3WYAA 3RRZA 2I1QA 3OZXA 1VG0B 4Q9HA 3NHBA 5G53C 4Q7JB 3D7MA 5DYGA 1JALA 2CMKA 3PG5A 3QF7A 1CRPA 2XSZD 2C99A 3B9QA 1VTKA 2G6BA 4PSAA 2W2TA 3ADCA 3BFKA 3EZFA 4JYCA 2HDNB 2GJ9A 2GWHA 2RMKA 4TTQA 1F2TA 2BEJA 5DI3A 3ND8A 3T1VA 2ZM5A 2ZE7A 4PZZA 2CE7A 2OXCA 3EG5A 1FX0B 3V4FA 2R6GA 1MV5A 5D3QA 1NSTA 1ZBDA 2GZHA 2A9KA 3ZD7A 4HLUC 1CBUA 1RJ9A 1Z22A 4WOPA 1FX0A 1CEEA 2O8BA 1FQKA 3N5CA 3ZD6A 3FWYA 4OJKA 5BWMA 1W4RA 4DSUA 3VR2A 3PEWA 3U4QB 1IM2A 2IL1A 1S2MA 2A5YB 4KV9A 2MSEB 2WV9A 3X1WA 3K8YA 3RVBA 1L4YA 2QPTA 3AKEA 3RNLA 1F2UB 4FD2A 3WHLA 5G3YA 4KYUA 3X1ZA 1XXHB 1ZINA 3THXB 2V9PA 4DCVA 1CR1A 3TBKA 1GVNB 1X8KA 2WVJA 1NLFA 2GKSA 1GRQA 5DI9A 3U3MA 3BS4A 1F2UA 4KJZA 3C41J 4TTRA 1KDTA 3IHLA 1C4OA 1TQ2A 3KTAB 4XVQA 1P5ZB 1I2DA 1XF9A 4HLUA 5FBRB 5FOXA 4DLZA 2RGNA 2C9YA 2BHRA 1NVVR 4Q1DA 4OK3A 2GK6A 3NWJA 4S35A 4URVR 3H1TA 2ZJYA 3PEYA 5L3SA 1G291 2ZYVX 4LJ8A 3DMDA 3HPQA 2O8DB 2QL6A 1YE8A 4YQFA 2BBSA 2IYSA 4IEEA 4G0NA 1MO6A 1VYTA 4AWXA 3BXZA 3KL4A 1Z6TA 4AKHA 4QHYA 3MWJA 2CL6X 2VHQA 4LZZA 1D2NA 3A58B 2O8DA 2GCNA 2FPLA 2ZUDA 3AF4A 4RY2A 5LB2A 5KPJA 3DEFA 5DIFA 1E2DA 4DDUA 3LX5A 4OI0A 3BB3A 3WNBA 1NSFA 3BIFA 2QORA 3GLHA 4Z54A 4EQ6A 1N5LA 4ZKDA 3QXSA 4LI0A 3U7GA 1J2JA 1WA5A 3C7KA 3HR7A 1GP2A 4DLVA 2J59A 4QKQA 2BVNA 4DIEA 3HYTA 4Q4JB 3EPHA 2IYUA 3NVAA 2J0UA 2LKCA 5AUNB 1HA3A 1P60A 2MSDB 4ZCMA 4DDVA 1N3BA 2F7SA 3OAAD 2RGDA 3UPUA 4UJ5A 2DYKA 1E1QD 3EC1A 4JBYA 4ZDIA 3TIFA 4EFNA 3CWQA 1U8ZA 5FUXA 2J0UB 3NIBA 2WOJA 1G5RA 4EFLA 2OBNA 1CXZA 1NVXQ 4A0HA 1E9SA 5KOYA 2HCJB 4ON9A 3WHKA 5DNYB 2LWIA 1L2TA 1E4VA 1Q3TA 2TMKA 2ODWA 2JJ2A 2VF8A 1E0JA 2FGJA 2WWIA 2C95A 1P2SA 2IEYA 5C18A 1AIPA 2ZQ5A 1NNEA 2BEKA 2Q0HA 1UJ2A 1E2IA 1NN3A 2XTZA 3A1TA 4TSFD 1GFIA 4NCHA 3GMTA 1UPTA 2IHYA 4U7DA 2AK2A 1AA9A 3VX3A 1S9DA 3E5HA 5GJBA 2OAQ1 4UNSA 2JLZA 4Q21A 8OHMA 3NDPA 4HUQA 1OH5A 4TL7A 2GNOA 4C7OA 4DHEA 3OE7A 4XSGA 3ZQJA 2ODEA 2YNMA 2DPXA 4PO1A 1YJ5A 2H5EA 2QU8A 4F93B 1Z83A 1UDWA 3QEJA 4HUQB 3HPRA 5ANRB 1KI6A 2Z83A 1KY3A 1RC8A 4BE7B 1OT3A 3Q8XB 1ZD1A 2QQEA 3QPVA 2YWHA 1PLJA 4ZIRB 4XWAA 1UFQA 4R7ZA 2E1RA 2P65A 2A30A 4D0GA 1OXXK 2ANBA 4HATA 4H9GA 1U2RA 1R7RA 2P0EA 3SC3A 1T4GA 1FNNA 3CONA 4O0MA 1HT1E 3I62A 5F98A 4O3MA 4LC1A 4BEJA 4EPVA 4NH0A 3GJ6A 2RHMA 2XZOA 1GAJA 1XTKA 1JBKA 4P3YA 2B8WA 4FWIB 3NHAA 3QQ5A 3VAAA 4I99A 1W47A 2Q9AA 2WJYA 4HAUA 1GWNA 3QXCA 2DHRA 3W3AA 2GCOB 2ZI5A 4F4JA 2AX4A 2NO9A 5GJWC 3W90A 4JVMA 4PQRA 2OBMA 3U3RA 1FZQA 1Z0AA 2GAOA 2P3SA 4JLKA 3U7FB 2JLVA 4NPHA 1FOEB 3HP1A 3GLHE 2NO6A 3VU9B 3A37A 1UDXA 2ORIA 3R8FA 1H8EA 1YHNA 3CRMA 3RLFA 3K53A 1J99A 4AIIA 1P2VA 1Z0DA 4Z51A 1FPMA 3W5JA 3KQHA 4LBZA 4HSEA 1CU1A 1U0LA 1BOFA 4LHZA 2AKAB 4JLVA 2PT5A 3GPLA 4GP6A 3U3OA 5L3QA 1XCPA 1E99A 4LYAA 1P75A 3K9LA 5AJVB 3QBVA 1E2KA 4LJYA 3JVVA 3AGPA 5EQTA 1WBBA 2P6RA 1RRGA 4KBFA 5FOUA 4F4IA 2PMDA 3P4YA 5EE9A 2P2LA 4NYJQ 2YJTD 5FR1A 4XWKA 1KNQA 4Q7MB 4A4DA 3CX7A 5FPHA 4OJQA 2BMFA 4KVAA 5KNDA 1IN7A 1ZD8A 2WTUA 2WJVA 3TUJC 1CR2A 1XWIA 5J47A 1P2TA 5EZ6B 5B57C 3GLGB 4PO8A 4FMCF 2IS6A 3C15C 4PTLA 1OKKD 2FU5C 4AKGA 2NIPA 3K0SA 4MGKR 4DLRA 2X2FA 4NMMA 3M0EA 1DG1G 2AN9A 2PLFA 4GP7A 3UWOA 4R71A 4N0EA 4XH9B 4TWZA 3M1IA 3U3KA 1G7RA 4KFTA 2XOKD 1S96A 3AP2A 4GFDA 1FFHA 3CKLA 3U44B 1ESMA 3TR5A 3D6TB 5FUYA 1I4LD 1W36C 1CJVC 1TMKA 2HJVA 3LW7A 1Z5ZA 1E9EA 3ONWA 1AKEA 1SULA 2VHCA 2QGNA 4BEBA 5FBLB 1KI4A 3V00A 3P26A 5L3VA 2ZR9A 1VHLA 5ELXA 4QBFA 4OI4A 4IXMA 3ZVRA 3MFYA 4QBGB 4P31A 3VR1A 1BS1A 2A78A 2DCUA 4M0LA 3H4MA 4Z8XA 2DFTA 5EP1A 2BMJA 3BERA 1M1YE 3B5JA 1GNQA 4ZV4A 1MABA 5J5CA 2VTKA 1ZYUA 5FBWB 4CVNA 4AG5A 3SNHA 4NHOA 2W0SA 5SZKB 2ZJAA 3CB4A 4JLDA 5LB4A 2YYZA 4HZUA 2F43B 3M4YA 3BC1A 1TU4A 1XTSA 2ANCA 2FZ4A 2GZAA 3GJ5A 2XTNA 2FPKA 1QVRA 3CPJB 1QG4A 3QXJA 2ATVA 4LOAA 4TQ9A 2HT1A 1IBRA 3FHCB 3Q5EA 5TMPA 2ZRKA 4E07A 2HCBA 1RE0A 3C4JA 2CK3A 1Q1QA 2BJVA 2I4IA 4UXIA 1JJVA 3RS7A 4DLYA 3A1SA 2GF0A 1GITA 2W00A 2VLIA 1IXZA 4D4LA 1XCMA 2AR7A 2CCKA 4UNQA 1ZVQA 2ZSEA 1NLYA 1PJRA 1Q1EA 3BRWD 4RKEA 4ZI2A 4TYNA 4P0TA 4LYJA 5BXQC 1LF5A 3P32A 3ETLA 2RGBA 2X19A 4CDGA 3KB1A 2QM7A 4PC7A 4HDCA 1LTQA 3AKYA 3WBJA 4M22A 3RS0A 3B6EA 5HKKD 4TL8A 4GOKA 4C0HA 3FVQA 3WXMA 5AJXA 5EUQB 3RC3A 3OESA 5SZJA 1SVMA 4JLPA 3JZMA 2PJZA 1KYIA 2F3RA 3I73A 3LRPA 1YZLA 2ATXA 2A2ZA 3TQFA 5JJLA 1QHYA 3WMFA 3KKOA 1XX6A 2WHXA 3HU2A 5AUQA 4B3GA 1XFAA 2FFAA 1GG2A 5KSYA 1YVDA 5JS7A 1XEXB 3OHMA 1SVKA 1QHHA 3ADDA 3SBDA 2FN4A 3FKSD 3U61B 4KCGA 4DRZA 1TPZA 2Q9CA 2FE4A 3HU1A 2NPIA 4PZYA 3KDSE 3AF0A 3IO5A 1F60A 4IHQA 4BWYA 2ZSAA 1AGPA 1DOAA 1WQ1R 4TLAA 2B21A 4BPBA 2ORVA 2ZR0A 3GLFE 1OXVA 3CRQA 4BQSA 4TYYA 1M8PA 3G5UA 1XTJA 1U9IC 2V54A 1VIAA 2OUKA 5A5GA 4DZZA 1NP6A 2N42A 4IFEA 2V1UA 1CJUC 5FOTA 5FPKA 1W2GA 4MYUA 4F92B 2J1LA 3WP1B 4NP6A 3ZJYA 1M7GA 3ND9A 5AUPB 1W5TA 2GXSA 1GKUB 1XU4A 2WJJA 3SJZA 4B76A 2IX3A 2WWYA 2QMEA 1A5TA 3ZH9B 3A1VA 4FCVA 4B3DA 4IXNA 1TTTA 1M7HA 3KQLA 4KYIB 1PLKA 2QAGB 4QJ5A 2I1VB 2O52A 3REGA 1XB2A 5J4LA 3A4LA 2QY9A 3D31A 3ADBA 2B7BA 4YDSA 2OFXA 2IW3A 3TAHA 4C0BA 3I5YA 4Q9KA 4MRSA 4IFBA 1W1WA 1U98A 1E2MA 1G17A 2QAGA 2YOHA 4FIDA 3EPLA 1U9IA 2O0HA 1E32A 1EWRA 3KQKA 3U4QA 1K5GA 2WWGA 3QKRA 3HJNA 1Q1BA 2QSZA 3L82B 5H70A 4HB3A 2JIZA 2IK8A 2RGNC 3UWKA 4OK5A 1NVWQ 3UG7A 1VG9B 4URZR 4CIDA 2KI5A 3EZ7A 1KOFA 5M04A 5HR5A 4HB0A 4BFWA 2F3TA 1E9BA 3C8UA 2H1LA 4DLSA 3THXA 4KVGA 3REFA 2O8CA 2XSZA 4QGGA 3KJEA 2FFBA 4LHVA 4BASA 4IOKA 4LJ7A 4LV8B 2V7QA 5FTKA 1Z6YA 4OI2A 5GADl 3B60A 4UNPA 2W6JD 4B33A 5FH9A 5JRZA 3P27A 1E0KA 3U5ZB 2PCLA 3F0TA 1ZU4A 1E4YA 4P33A 3TW4A 4TLBA 1AJEA 1ZIPA 4A9AA 4DLTA 2G1KA 4BGDA 2HEIA 2PMKA 4Q19A 2J0SA 2ZRMA 3BBPA 3A6PC 2Y8EA 3QE0A 1TX4B 4B34A 1G5TA 4HAWA 3U6BA 4ZDKA 1N2CE 4YMTA 1N5JA 1U99A 3VMFA 4MH0R 4R2HA 3EIHA 1MOZA 4NZYA 5CLLA 3Q5DA 1N0UA 3FYHA 3SDZA 4M53A 3ZZUA 1G18A 2QN6A 1Z6GA 3I8SA 3UMFA 2ZUBA 4BRWA 4WW0A 1EX7A 1U0JA 4R98A 5DISB 4BFXA 2WPDD 5B58C 2GXUA 3GLHB 2V6JA 4C0KA 2V7QD 2G0TA 4Q4JA 2G9NA 1Z0JA 4HLCA 1F48A 2RH5A 3MAAC 2C78A 3B7GA 3MCAA 4IOJA 4AYTA 3NH6A 4NU0A 5CJPA 5DGXA 1K5DA 4ASUA 2VA8A 4DCNA 1C1YA 2E9SA 4BLPA 4D25A 1E2PA 1J7KA 1VG1A 2VBCA 1P62B 1B0UA 4RFVA 3SE0A 2OCYC 1OKKA 3WYGA 4NL4H 3LV8A 3OIVA 4Q18A 3DZ8A 1KZ7B 1WP9A 1BO6A 2GETA 1CTQA 1GKYA 2EFCB 5GJVC 1TQDA 2AHOA 4PHFA 1ZM3A 1KIMA 1SVSA 3IQXA 4Q7KA 1W36D 1UEJA 2H16A 3QXHA 1EFTA 4QG7A 4EPTA 4BZXA 1EX6A 4IRUB 1XPRA 4E03A 2J7KA 1PV4A 1N25A 5FI1B 1GRRA 1US8B 4RVCA 2XB4A 4FINA 3ZIAA 5CDFE 1XEWX 4B3BA 4Y0AA 2R6AA 4LJ9A 4PC3A 5B30A 1QF9A 3T35A 4GMXA 2NQ2C 2I3BA 4KU4A 3LQQA 2ZE5A 4M9SA 2VF7A 3NTUA 4Q02A 1ESNA 3EZ9A 4IVPA 1SVIA 3EARA 5IF9A 2CLCX 1LNZA 1US8A 4V0ME 2LCFA 1M7BA 1OYYA 2ZSFA 5EE3A 1OJLA 3MWLA 4PAQA 1W0KD 4WZBE 1F6BA 3QNUA 1XXHA 5FOWA 4ZPXA 3TRFA 4B35A 1OH7A 1S1CA 4HYYA 1XDBA 2N1BA 3ZZTA 1DAKA 1R8SA 4LSGA 4H1UA 4V0LA 4M1MA 3TR0A 5EUMA 3B78A 4B47A 1DAGA 4CRWB 2GZDA 1VDZA 1ZAKA 3EIQA 2GVDC 4XJXA 3RABA 2ZRFA 5A4JA 1DVRA 4KITB 2C77A 1XEFA 4RD2A 4MRPA 3CH5A 1ZNWA 1YRAA 2AL7A 2CNWA 4XWOA 2AD1A 5BN4A 1VYUA 1IAQA 3I72A 4ZIRA 3I32A 2ZXUA 2OLJA 4IW3B 2EYUA 4QFMA 4US1R 1XD2A 3S1AB 3FMFA 1EWQA 1QDEA 1RYFA 2JJ1D 4MQBA 2ERYA 4GOJA 3RHFA 5L3SB 4JS0A 4RD4A 1R0XA 2VP5A 3FDIA 4Q66C 2PL3A 4JL8A 1A2BA 1A82A 1JR3A 4XD7A 3SOPA 5J4VA 1G6HA 1Z28A 2G83A 2WWHA 3FFBA 4G5SA 3IILA 4MRVA 3W8NA 3WMEA 3GD7A 3AEZA 2RKOA 2Z6VA 5HZKA 2AWNA 2GRJA 4DUGD 2KE5A 4HDOB 4DCUA 3X1DA 1KGDA 2W6ID 2VH5R 1XMSA 3AKCA 4JLMA 2IBMA 2ZRBA 4BUJA 2GCOA 2GBLC 3IUYA 1Z08A 4IDHA 4U00A 2NPFA 1DELA 3QG1A 2EFEB 2CHQA 2FG5A 1CIPA 5J4YA 4NCKA 2Q3HA 4JL6A 3DO6A 5JJKA 4YXWA 2B7CA 1WB9A 3IHWA 3KKMA 1R10A 4Q1FA 3O8CA 3GFTA 4RCZA 2R6DA 4FMDF 1E2LA 3QF4A 5K8IA 1Z3IX 4EKDA 2R6FA 1OXTA 1NIPA 4MYCA 4BLSA 3RS4A 4XVRA 3A4MA 3OEEA 1ZM4A 3QPWA 1QBKC 5EE1A 3KXKA 2VHJA 3LA6A 1W36B 1T3SA 2XITA 4NBSA 4UJ3A 4ASUD 4TSFA 4IVQA 5BN5A 4GI7A 1VG8A 4LUCA 3MGCA 3ZVLA 2WKQA 3NG1A 5H1YA 1G3MA 1SZPA 2ZROA 2UKDA 4MA4A 4HI0E 1NLZA 2G0NA 2CCGA 4QJ4A 4G5QA 2EYQA 1ZJ6A 1NKTA 4OL0A 1CF4A 4A0RA 4DEYA 3QKSA 1F5NA 1ZW6A 2YHSA 2ZRJA 2IUTA 2WBLC 2ZREA 2C2HA 4E5UA 3TUZC 1XPUA 3DL0A 4JZKA 1NI3A 1WDTA 2QTFA 1HQCA 2VP2A 2VYFA 4NKRA 4M1KA 4YLGA 1YZNA 2JLXA 2FSFA 2ZETA 1GILA 4TMKA 1W48A 4D80A 4EPXA 2CE2X 1J8MF 1G3IA 1Q3HA 4JLAA 3PEVA 5FR2A 5JEDA 1RFLA 1TUIA 2HF9A 3K0EA 4BLQA 5KSOA 3L0PA 2IF2A 4OK6A 4D4JA 3KJGA 1ZM9A 1T9HA 1X8JA 5GVSA 1LS1A 2FSIA 2J9RA 4IDQA 2B8TA 1MO5A 3KFXA 4PPFA 4F4CA 3TNFA 3G82C 4PSKA 5C4MA 1N6RA 4L9SA 5JCPA 1UEIA 1AN0A 2ZJ2A 2P5SA 3BH7A 2O8EA 3J81k 5HCNA 4ZDWA 2XGJA 1UF9A 3BAFA 5C4GB 3AH8A 1CLUA 5B2ZA 2VP9A 2XZPA 1KSJA 1OF1A 3DOEA 2FJUA 1D9XA 2W6JA 2WM9B 4EIWA 5DSZA 3K1JA 1UKZA 3I61A 1ONBA 4M4SA 1GZSA 4B75A 4DT1A 2O8EB 3T12A 4NCIA 1Z63A 4CEJB 1JJ7A 4Z1MD 4QL3A 3D3QA 4NE2A 3NBYC 4OHWA 3BGWA 3P4XA 1IXRC 3RAPR 1HQYE 4ERNA 1UBEA 1GOTA 5KO2A 1FMLA 5CJ2A 1KKLA 2HYIC 3ICQB 2RGAA 1A4RA 1ELOA 1XMJA 2Z5FA 5EZ5A 2D62A 3DOFA 1K6MA 1DPFA 1Z06A 3VKGA 2BBOA 4WXPA 1OE0A 3SZRA 3DKPA 1VMAA 1EG7A 4BRUA 4EJSC 4E22A 3BH0A 2NGRA 1EFRD 3QVUA 1T91A 1EFUA 3B1ZA 2DWPA 3KJHA 5P21A 3THYB 3OFND 1AQUA 4OQNA 4WZAE 1ODFA 4HB4A 3K0FB 1D6JA 4L8GA 4DUGA 3B2EA 2PZFA 3RDPA 1ZC3A 1IN5A 5TY0A 2ODBA 2D2EA 4LC0A 4CEIA 1E2NA 1DADA 4JBWA 3SU8A 5DN6D 4M9QA 3CPHA 4Q4HB 1R8QA 2EFHB 3VR5A 4Q9IA 5LD2C 5TV2A 5FBVB 5KHOC 2NTYC 2GILA 1Q22A 4IDOA 3K09A 1I4TD 4JKIA 4KSCA 4B74A 2ZUCA 1KO8A 4PAMA 4JVLA 5G40A 4C3ZA 4M1OA 4TLEA 4A8JB 1JR6A 4P4SB 2DBYA 1OFTA 3C16C 1ZM7A 4D81A 4QM7A 2D7CA 3PQCA 2AD5A 2EVWX 4X8HA 4LHXA 1XEXA 4MDFA 4DLWA 1YZTA 3BB1A 3O47A 4AC9A 1ZIOA 1OSNA 3FB4A 2XTMA 3CBQA 3NH9A 2OO7A 2ZRCA 2VO1A 1GM5A 5JI2E 2HLDD 4LCBA 3K0CC 2WWXA 1LF0A 5K8TA 2R8RA 3UKDA 3B8HA 4IJMA 2DB3A 2ZRNA 1P61B 3TK1A 1XMVA 2BBTA 5AJWA 1G64A 2AXPA 4TMXA 1WE2A 3H84A 4MUBA 2RHDA 4I4LA 1GDDA 2EU8A 3QUSA 4M9XA 1J70A 1KJWA 1MRNA 2CVFA 1Q57A 3ZIAD 3AVVA 1RRFA 2F55A 2JA1A 5AR1A 4A36A 1X1SA 1MO4A 2BKEA 3GJ0A 2BJWA 2XXAB 1BYIA 4HB2A 4DCTA 3WRYC 2WMNB 1J90A 3TSWA 1AS0A 3CX6A 1CJKC 3HU3A 4MUAA 2XOKA 5JWRA 1RZ3A 5BW8A 3ICEA 5JECA 1W5SA 2FSHA 2C9OA 2SHKA 3W6OA 3W34A 4ACBA 1YZGA 3SHWA 2IYTA 2KWIA 1JR3E 3HR8A 4IVRA 5JRJA 4TT3A 4EPWA 1EGAA 1T5IA 2J7PD 3TAUA 4A2QA 3GEHA 4MYTA 4TMTA 4RKFA 4MGYR 1W7AA 5AK0A 1GIAA 2ORWA 3ZDQA 3BWDD 2ZR7A 4TYPA 4MKIA 1NMXA 2L0XA 5EE0A 3F3YA 1YZUA 4YXWD 4M9ZA 3QKRB 4QGHA 5CITA 2IS4A 2UZIR 3FFAA 3H86A 2H57A 2O0KA 3CM0A 3AVWA 1JECA 1R2QA 2CNWD 3L0IB 4W5HA 3VX4A 2OCBA 5FPTA 3TH5A 2ZRHA 3WY9A 4U5XA 3I8XA 1YQTA 5DO9A 1O87A 3MRSA 4EFMA 2ZE8A 2WKRA 4LJ6A 2O8CB 2HJGA 1YR7A 2IHBA 4GT1A 2W2XA 4V0MA 2WOOA 3FMPB 2CJWA 2X77A 4L5BA 5E7MA 1KDOA 4WZ6A 3T1TA 3RC8A 2H92A 3ZLJA 3AVTA 1P2UA 4NONA 1M74A 5DHFA 3PFIA 1BH2A 2D74A 4JL5A 1JEEA 3FOZA 1H8HA 3ZZ0A 2V3CC 5DYIA 1OV4A 2WPDA 2BIFA 3B1YA 2QT0A 4DSNA 4B73A 2IYWA 1TNDA 4PPQA 1SKYB 4B2PA 1T8UA 1N0WA 5L3RA 4O2RA 4JLJA 3ZYCA 4AYXA 1J8YF 5CIQA 1GL6A 2Q21A 1E69A 4AK9A 2D7DA 1N6IA 5AJYA 4GDFA 5FOSA 5LBIA 3U7EB 3OFNA 2G88A 5E4FA 1JNYA 1IN6A 3BK7A 3LD9A 4BFYA 4DB4A 2REXB 3U2QA 4B71A 4V0OA 2FX3A 2F1RA 1XJQA 1KY2A 2FMXA 4WVFA 5C2JB 1G3UA 2DFLA 4B43A 1G8HA 4A6PA 1SVLA 2XJ9A 3UXMA 3IEVA 3EA0A 3LLUA 1W4AA 3FTQA 4DCSA 1SVWA 3LNCA 1KDPA 3LXXA 1KK0A 2QMHA 2B92A 3H0KA 1G9XA 5CYPA 1ZD9A 2QMOA 1OFHA 2VSOA 1VKJA 1YR9A 4M2LA 3LVRE 4UNNA 4B2LA 2P6NA 2QP9X 2VP0A 3C5CA 3IIJA 2G3YA 4PC6A 4Q1CA 4Q4LA 2GF9A 4QBHA 1IY1A 2ZJ5A 4V02A 5BN3A 3GLFA 5CB6A 4DBLC 2WIAA 1CS4C 4YDHB 3TGPA 4C0LA 1N6KA 4AKIA 3CRW1 4I81A 2BC9A 3OEHA 1RJ9B 1ZNZA 2WICA 1C9KA 4K81B 4JSTA 1WBDA 1HV8A 4F91B 1FNMA 3GLFB 1II8A 1IY0A 4MKHA 4EDHA 2D2FA 1P6XA 3SYKA 4A0FA 3V4RA 1G7SA 4TL9A 1KI8A 4XVUA 5FUWA 1S3SA 2DY1A 2HYDA 2HF8A 3LX8A 4HEJA 5JHGB 4EUNA 1KI7A 1G8YA 1QHIA 2O0JA 4N3NA 3SHFA 4B2IA 1P9WA 5C46F 1PZNA 2OLKA 4MRRA 5KPDA 3CF0A 4AKEA 5J4HA 2QAJA 2ZJ8A 1NF3A 4PO9A 1FW6A 2ZVQX 1ZC4A 3TUIC 5J40A 4R2IA 2Q6TA 3FHOA 4B48A 1TL7C 3GFPA 2OCAA 1IHUA 4PQFA 1H65A 2ZI4A 1DBSA 1AGRA 1UADA 5F2EA 3T1OA 1M6NA 4LRWA 3AF1A 1GKIA 2QPOA 4G5RA 2QROA 1B23P 2ZS8A 3IPXA 1GL7A 2QI9C 5KSPA 2ZRLA 3IEUA 4RD0A 2D06A 2IYQA 3N2EA 5KDLA 1KI9A 5KDDA 1E2JA 1E2FA 1FUKA 2V55B 4RZUA 1E94E 3FE2A 1COWA 3SQWA 2WMOB 4Q4AA 4TLDA 2VHTA 2RGXA 5H68A 1E9DA 3QKUA 4M1WA 1AZSC 3EIEA 4MGIR 4Q7LA 3TSOA 1AS2A 2VHUA 2P6UA 4ILEA 3T15A 3OEED 3QENA 3LBHA 1YU9A 1SVOA 4ZI3A 3R8CA 3NBZC 1X1RA 2ZI7A 4Q4AB 3CZPA 2ZAMA 2EW1A 3B85A 1O3YA 4A15A 3ZQ6A 3U6KA 4YMSA 2YWFA 1KO7A 4J0QA 4ZCLA 4IOLA 2JAQA 3L0SA 4FMDB 1UAAA 4GSYA 1TF5A 3LY5A 4AI6A 4YMVA 4NCNA 3P1JA 4V0NA 2GBLA 1RKBA 2PX0A 1NJGA 2C03A 2CHGA 4A2PA 5GVRA 1R0ZA 1YR6A 4QBIA 5HCIA 3X2SA 2OHFA 4DVGA 1OXSC 4OQMA 1LS6A 1NBME 4IKEA 2W6IA 4XD7D 1Y3AA 1MH1A 2MMGA 2YOFA 5L8VA 4DB2A 4OBEA 4Q9JA 1JQJC 2OILA 1XTIA 4KO8A 4DSTA 3TKLA 4QXAA 2BM1A 1ZNXA 2Z4RA 2XB2A 2CBZA 2WWWA 3DVLA 3QPUA 3VKWA 3QSYA 4PPGA 4P32A 4D2IA 3SS8A 1X86B 1LFDB 2FGKA 4NDZA 2QTVB 4TTPA 2W83A 2OFWA 4LWZA 2R65A 3PUZA 2OAP1 1U94A 2WKPA 3C14C 1UBCA 3KJIA 3PV0A 1KSFX 4C9BA 5K8UA 2GA8A 4AYWA 521PA 3DM5A 4LJ4A 5KYKA 3AQ4A 1XP8A 3GQBA 3W6NA 1NMYA 4C7OB 1E96A 1G3QA 4B6FA 4RFSA 4W5WA 2KB0A 3A1WA 2JLUA 4Q48A 2FH5B 2GCPA 1T3LA 2AFIE 2LKDA 4HAXA 3L0OA 1E0SA 4DWJA 2DR3A 1WCV1 4RFSB 3KZ1E 1XZPA 3KB2A 4OHXA 5EXXA 3LQRA 3NKVA 2CCJA 2OT3B 4PSVA 4TMWA 3BB4A 3ZS9A 1SHKA 4RSGA 1GNRA 1UBFA 3E2IA 1I4DD 1IN8A 2YC2C 4HUTA 5JLJA 2PZEA 4Z8YA 1NY5A 2IA5A 2NO7A 1DARA 1SXJE 3VNUA 3FMIA 1ZM2A 3BJIC 2FFHA 3I5XA 1EFRA 1U90A 4G5GA 1OYWA 4I1UA 3VKHA 5KSZA 1DO2A 1KI6B 2HLDA 4D6PA 1E79D 4C2TA 2ZRGA 1COWD 5AUOB 1RIFA 1X6VA 2ERXA 1E98A 4TL6A 4LBYA 3C5HA 1E2EA 2QAGC 5KUTA 5EE5B 5LD2B 5KU1A 5AJZA 4ACAA 2YKGA 1CRQA 3ECCA 3SQXA 4A1FA 2P5TB 2ZTSA 2FDCA 1QHNA 3EC2A 2GK7A 3GP8A 5FOVA 3UANA 4LDJA 1E1RA 2EWWA 2FF7A 2XX3A 2NOAA 2ZJBA 4LPKA 4US0R 2QBYA 1XD9A 2VQSA 5EXTA 3P20A 2H7VA 3L8YA 3KUDA 1QHSA 1NN5A 1U81A 4CYMA 2HXYA 3FMOB 3R9WA 4A92A 1L4UA 2WIBA 3KFVA 4BFTA 2KJQA 1E9RA 2RGCA 3E1SA 3OAAA 4MITA 1KAOA 3T1QA 3T5DA 1PVOA 2IYZA 3FKQA 2QBYB 2J3EA 1H8HD 2GDJA 3FGNA 2VIIA 2IXEA 2ZSBA 3RSOA 4XTCS 4ARZA 4D4KA 2F1IA 3VU9A 5IK2D 2R9VA 4CEHB 3O8RA 4GBMA 3RSLA 3CR7A 1OPXA 1OIXA 1Q44A 4UNRA 4TMVA 4K46A 3QJYA 4RD1A 3THWA 4JKYA 1SKYE 2X2EA 3DM9B 3VR3A 4BFUA 4HZIA 3IGFA 5BYJA 1N6LA 1LVGA 1VCIA 4PQYA 5CM9C 2NZJA 1DEKA 1N6HA 1TQ4A 3NEJA 2KBFA 2AKYA 4QC2A 4L16A 5LPNA 4B32A 3BOSA 1IXSB 2QTHA 1OLOA 1S3GA 4QOSA 3QKSB 4D0LB 4NTZA 2JLRA 5FTLA 2PCJA 3LDAA 4Z1MA 4QJ3A 3EAQA 3FKSA 2H17A 3TJZA 3B9PA 4JLNA 4BLOA 3AUYA 1RPZA 2NZ8A 4PHGA 2O5VA 4E09A 2ZI6A 4MKGA 2Q9BA 4UXHA 1DAEA 4XSHA 3A36A 3AVYA 1SHZA 4TQUS 2R2AA 4L4UA 2A3RA 2JLSA 2KBEA 2ZS9A 1GNPA 5BQ5A 4A0GA 1ZNYA 4DLXA 2FFQA 1VECA 3GLGA 2UVQA 3LAWA 3RYTC 3AP3A 2ZSDA 3TVDA 3BFVA 3OF5A 5IK2A 1XZQA 2OG2A 5JI3E 1NL3A 4Q03A 5FPSA 3ZVMA 1XJ0A 3SFVA 2WAXA 1MABB 5FTMA 1TUEA 1IY2A 1E9CA 2WJGA 1N0VC 1Q21A 4S2EA 1SXJA 4PHHA 5LDDC 4OHZA 1CR4A 5B64A 3F8TA 2OBLA 4WAUA 3BD9A 2IWRA 2QRNA 3KKPA 1HH4A 2JEOA 4IDNA 4U02A 5BYKA 1EESA 2ZI3A 2J45A 4MGZR 5KTYA 4HZUB 1FP6A 1T3HA 3X1XA 4HAZA 1Y63A 2CLSA 1ZUNB 5G41A 4CEJA 2JCSA 4JLOA 5CLQA 1KAGA 1HE8B 2JJ8A 3PEUA 1Z29A 3WNDA 2IXGA 4GZLA 4I1SA 5FPYA 1AZTA
chains in the Genus database with same CATH superfamily
2REBA 1RKVA 4F11A 2WNSA 1Y5RA 5AK3A 4LRSB 5EZYB 4HT3B 3PHBE 5IBRA 3V2UA 4G4SP 4AMUA 3BGSA 3HXMA 3OEHD 2RAPA 1Z0FA 2HQ1A 3HRHA 2WWRA 1QQ6A 3ELBA 3KYCA 2IZ7A 2B4AA 2OGZA 3UO8B 2QUZA 3ZWQA 1E1CA 1O94D 3KQVA 4G5OA 3AHFA 3LFHA 3IT1A 4EA7A 2WG1A 2QVZX 3TDKA 3EGDA 3EZXA 5CFZA 2CYBA 1ZUIA 2V6BA 2ON6A 1LY1A 2AK3A 3SBEA 2G5GX 3C7DB 3I9MA 1Z4PX 2ZSJA 3NUQA 1C8LA 2DAPA 3P9KA 5EXPA 4KH1A 4B7XA 1Q0UA 4DR5B 4MJXA 3DMTA 1JB1A 4WOBA 1XZHA 2IP1A 1NMZA 3T7TA 4YHHB 3Q8KA 3ETCA 4ZYLA 3M34A 2JLYA 2MJLA 2OSBA 3CX3A 5EP2A 4EAQA 3GW8A 4QUGA 4CT5A 4Y6GB 1B1AA 1B8OA 5ECDA 3T34A 4F2GA 4FBLA 1OHHD 5HJ5A 4ANFA 2FOLA 1KJIA 4TWIA 1I01A 2B4YA 1VKOA 2OD2A 3W77A 1KMQA 4Z4QA 1DDOA 1MB2A 2AFIB 3HCRA 1NBMA 5H9VA 4DIUA 1FFYA 3NQ41 4OYHA 3SQOA 3ZPXA 4ZCRA 3OVMA 3N2LA 1E3WB 1OW3B 1COZA 1OLSA 4BN0A 3LXMA 4P4SA 5CCXA 1P91A 1V2HE 5LA6A 1T0UA 2VSXA 4FMBB 4ZKEA 1I14A 2GEVA 2IXTA 3BE4A 2VS1A 2IDKA 5IABA 2YJ4A 3VI3B 2OB2A 1N9KA 2EFGA 1T0PA 2F8MA 1YDMA 2IU4A 1RQXA 3H5VA 5E1BA 4RVFA 5A0FA 1LV7A 3R20A 1NUAA 5B58T 1Z6QA 1JBEA 1E3DA 3GDOA 2B30A 3RRYA 1QFSA 4G8CA 3RS9A 1ESDA 1PV1A 1NVUQ 1T5DX 4KC0A 4ZGBA 1UP6A 5J58A 4CZ2A 4FB5A 1GGVA 3NMUF 3OE5A 1MP0A 2FY8A 1ECLA 2TECE 2ZZKA 2QD5A 2CXRA 4BEVA 1OXMA 5JZVA 1S0UA 2ZS7A 1UM8A 3W8FA 3CNOA 4KLZA 3AI7A 4Q4DA 4X64B 4RA9A 5JSZB 4F0JA 1UFKA 3GVHA 3SR3A 2NT3A 5JNSA 1SQSA 1PWZA 3BMNB 4Y1EA 4EA6A 4L02A 4LAFA 4PC2A 4TMZA 3EX7C 1E18A 5JFGA 4MIEA 1QS0B 1IB6A 4MDHA 4MWBA 1HEIA 4ZVOA 2CZCA 3OOEA 2XUAA 2ZSKA 3P9QA 3FYTA 1QIFA 3SFZA 5JSZA 3EQ8A 2X4GA 1UT8A 1E6LA 1T6NA 3KQMA 4O8CA 3BMNA 5DMHA 3STYA 3UAXA 3NGXA 1AOXA 1NM5A 1XTVA 3Q40A 5KHLB 5D3MA 2XXAA 3L04A 3MSCA 3HB1A 1USUA 1N6NA 3THRA 1JA9A 3O83A 4K1XA 5A1TA 3TSYA 1NUHA 4AMBA 1FUIA 3IAUA 3H8WA 4B9AA 1SXJD 4QNRA 5LQAA 3WRYA 3IP7A 2F1OA 3TXYA 1N8KA 2E5WA 1HZZA 1LJLA 2VJMA 5DK6A 3TQOA 1OIWA 3U3ZA 5D3MB 1GUAA 1RD4A 3CXRA 5JSQA 3MZ0A 4Y2SA 3KOXA 5J2UF 4KPUB 2NG1A 3ZHXA 4GECA 1Z6XA 2LDXA 5F64A 1R0RE 2JCVA 3PC8A 4E5NA 1XDZA 3ON5A 1UMCB 5D85A 1XN4A 3C7CB 1VIYA 1GPMA 3NX4A 1EM8A 4QVKA 4OM7A 2CUZA 1HOXA 3NOQA 1G20E 2LW7A 1Y4DE 2QR5A 4KPUA 3WMRA 2AIRA 2Q29A 4UMDA 1KWKA 1FYXA 5KNBA 1G2QA 1RMYA 1SK9A 2HMVA 4H27A 4BZZA 1BMFA 5BV8A 4Z4EA 1OFIA 2N46A 4AX4A 5CDTA 1M8JA 2GRAA 3LLMA 3CH4B 3LCCA 3ZWYA 5T6MA 1MT0A 1ZJZA 3DEHA 5DCWA 3QLTA 2D2XA 4R69A 1IJFA 5BSEA 4D74A 4INJA 3ZBPA 1TECE 4DRZA 1CQIA 4I2NA 1CNMA 2I7CA 1ARZA 5F4BA 2QGZA 4PZCA 5HPYB 3B82A 3IR7A 4HJRA 1D1SA 1EK0A 1EVJA 2IUSA 4XTRA 5F3WB 3V1NA 5EPEA 1KO1A 1S8NA 3DEJA 4CV2A 1XPOA 4AY2A 4WACA 5EMMA 3R9XB 4NYIR 4FSHA 2QRHA 5K0ZA 4ND2A 1YA4A 4E30A 4DPLA 4LXTA 1BMTA 2J3MA 3ND6A 2CMFA 3NWBA 4IOMA 4XB1A 5K0NA 4JVNA 4U6SA 2NXNA 4S24A 4IRXA 1T13A 5HZHA 2GZMA 1ODKA 1ACLA 1R5BA 3SHQA 3PGKA 3A1UA 4F3CA 2OV6A 3G1WA 2YUTA 4B79A 2FUEA 1BWQA 2FSGA 2RK4A 4WBXC 2PMFA 2WWFA 3MS2A 4PYIA 2VRCA 4R7TA 3B7PA 1YONA 1QLJA 4URYR 1AMNA 3A04A 3RASA 2C98A 4Y9RA 3ZWWA 3GY0A 1TYCA 1YI1A 1VHJA 3OCVA 4RQUA 5BMVB 1NXSA 4CV0A 3KEGA 3ZJVA 1XRPA 1IK6A 1UZUA 2Q4EA 3QKTA 1SKQA 2BBWA 1Q0LA 2HLHA 4KXVA 3ANNA 1GHTA 2PZAA 4BQEA 2ZJ3A 3ZGXA 1ZW1A 5C35A 2H08A 121PA 4LHYA 3RKUA 2CHEA 2WY2D 3SNKA 2VT3A 1SBHA 1R3DA 4Z4CA 2VJCA 4IGFA 1GSIA 3M6UA 1U28A 1SC3A 4YCDA 3WLEA 3U7JA 1M2OA 3AFIA 3R41A 5KQGA 5DTMA 5JFTA 1UWLA 1MFPA 3PUKA 4JQYA 4OA5A 4HV4A 4NYJR 5SY4A 1I3OA 1W4CA 2PYDA 3UIEA 3RSFA 2RI0A 2ECQA 1Z12A 3K92A 4OYRA 2HUPA 3G2PA 3HFGA 1F3OA 3EEIA 5K5EA 1F2TB 1C7QA 2QW0X 1IZ9A 2CT8A 2XYGA 1QIIA 1JEYB 5JHHB 4HGZA 1JAHA 4N7RA 4U63A 4A6XA 4CWAA 4YGXB 3B3JA 5IRCD 4YRQA 1EHIA 3W5BA 1DFIA 2AW5A 2QYHA 1PIWA 3W6UA 2GH1A 3MJVA 2XKJE 1JT9A 1U3VA 3LPMA 1A9OA 4ISCA 3FNFA 5CT5A 1NOJA 4IHJF 4KP7A 4RANA 3DSRA 4GC9A 4FZVA 3W6PA 4P54A 2QRZA 3CLTC 2WJ6A 2VZLA 1QBGA 3MUNA 5TGZA 2G67A 3VKUA 5TDHA 1QF7A 3DKVA 3EWAA 4O59O 2NSHA 3SJBA 1LPBB 5BT8A 5J3JA 3LWNA 5HRUA 4E4YA 3IH5A 3V4PB 3IBTA 2BFBA 5FUVA 5HBRA 4W5JA 4ME6A 4FYMA 2W2VA 4RXUA 2B6HA 1Y4ZA 4K26A 4XQ0A 1Y9ZA 3LOUA 4Y3UA 3RIXA 2DLDA 3HY3A 3W04A 4AS3A 4EB3A 1TW2A 3HN6A 5I9TA 1NNSA 2C2GA 3CMCO 4G4IA 2IQ5A 3CW2A 2ACKA 1D2EA 2HO5A 4NMLA 1NJFA 4O4IA 2Q5IA 5G0SA 2IYRA 1HTWA 3O4JA 5U9CA 3WQHA 3EA4A 4XDZA 2QE7D 4LX0A 3K31A 2ECOA 4E1AA 1VFNA 3WL5A 5LZ4A 1ISSA 5ILOA 1ONSA 3PT5A 2ONYA 3S2EA 2FLVA 4RTMA 1PGPA 1OH6A 221PA 4OB7A 2UVDA 1A5BB 3D4PA 4TV9F 4FCCA 3IPRA 4NFHA 1HBJA 3O26A 4BKPA 3IDZA 1P5JA 4DIMA 4WJLA 1PNRA 1H4SA 1VIVA 4FKMA 5JCZA 4N65A 4H1VA 1V8ZA 4TKMA 3C6BA 4KE9A 3SIWA 4AWBA 2X8LA 2I66A 5BORA 4TZ6A 1A5ZA 1DO0A 2YCBA 4ZD6A 5C34B 3GCGA 5E9QA 3L92A 4AY3A 3L84A 1UM9A 2Q4OA 4PLTA 2B34A 3CWCA 3TE7A 3L1VA 1UBMS 1U2EA 1P0IA 4HDRB 4B6PA 4D46A 4CMEC 2GXQA 3JW8A 2GO7A 3EB9A 5JNLA 4KZKA 3BHNA 1OB2A 3I2YX 5CAEA 1PL8A 4B3XA 3GOQA 2NTJA 2JIQA 4LPSA 4UFOA 2C9CA 2BONA 5G0VA 3S1AA 4RCVA 5AM1A 3S2YA 2IHNA 1Q3KA 1AKUA 4M1YA 3WJ1A 5HXAA 4IZ6A 1VPLA 2BGUA 4CM4B 4J4BA 1RM0A 4G26A 2HWKA 4MUIA 3DUWA 4XIGS 2UZ0A 1NDQA 3K9HA 3QI2A 5ALZA 2Z9CA 1UBGA 1DDGA 2Z4TA 4OQYA 2YIDA 3NETA 2WJHA 4K2AA 1CUFA 4QLOA 4YP9A 3V1TC 2VSYA 5IHPA 2FEWB 3I3SR 4GF5A 4MUYA 4RF2A 4EQ6B 2PLAA 4PXAA 4MW4A 3D8RA 1P1FA 1V6SA 2I2BA 1GGMA 2PJDA 2R1UA 3I9KA 3MD0A 3QXXA 1N5RA 4LGYA 3DEIA 2FI1A 4U6QA 3LKBA 4C7JA 1ETUA 4MW1A 4NEGA 2XA9A 3CUEF 3ZUPA 3TQIA 1PUJA 4F3NA 2CJXA 4AD8A 1Z9BA 4GI3A 1TF2A 3RARA 2CSXA 1NPYA 1M2EA 1SIWA 1AGNA 1IWBB 3I28A 1EXMA 2DUWA 2QZZA 2VP4A 4Q9LA 5BN1A 1VRWA 2CZGA 4RD6A 3WJAA 1BKSB 3C85A 3IOCA 5FTJA 3CUYA 2WLTA 4FW8A 3U9LA 3TKAA 3GJXC 1JQLB 4XCXA 3GA0A 3ZQ4A 5CEJA 1OX6A 4LRXA 2ZGVA 1SRQA 1DWPA 1G3RA 2Z3ZA 3THWB 2IEAA 4EG6A 3QZUA 3DE0X 4RTOA 1MKYA 1Z47A 2IXFA 2X2PA 3BN3A 4YA6A 4Z4FA 3LSYA 3W5SA 2XHEA 1P1BA 2Y4NA 3MJHA 2GYWA 2G82A 5KVSA 3OOYA 3UCEA 3MS4A 1HYHA 5E4TA 1REQA 5A6VA 1M2VA 5D1HA 4H3VA 1NE7A 1RW4A 4UQOA 4UM7A 4CFZA 3E8XA 4M9RA 4KXXA 2QA5A 1SRRA 5JE8A 2ZYTX 3EGXB 3FR7A 2G63A 5FV7A 5H4HA 3PQFA 2G77B 3B51X 5HF5A 1GAEO 4G8BA 3PITA 3HABA 3QFCA 3R3XA 4JB0A 2EGHA 1DIHA 1NVKA 2X1VA 2Y92A 1P1JA 1Y3FE 1U3WA 4KQ1A 5ALYA 1QORA 4AJ4A 2PS1A 1VZ2A 1DPGA 1SWWA 1F9EA 1SUFA 2JH3A 4TV9B 1WXQA 2GJAA 4D79A 2FKNA 1FXUA 4DM4A 5KJ1A 1PVDA 5DGCA 3KETA 2X0NA 1ZCFA 4EYGA 1S4QA 4NPCA 4NSNA 2QLNA 4BZQA 3C3JA 3EAFA 3EXEA 3OU2A 5KINB 3HP7A 4MV5A 3ZGVA 1E8DA 5J5VA 4P4LA 2MR5A 3LS2A 1SVNA 3W5HA 4XVCA 1KJQA 1W5AA 3FSJX 2CXXA 1QG2A 3D7LA 3FCEA 4EJ2A 1NR7A 1WMSA 2YXNA 5HYVA 2J5XA 1LBQA 1ADCA 2PKXA 4QU8A 1PEYA 3PGXA 5HMLA 1H5NA 4U2EA 4BNDB 2UZ1B 1JSZA 1RAIA 2GBIA 5AVTA 1A1VA 1YUBA 2J9ZB 4H7PA 5TR9A 1RKXA 4NU6A 3QOFA 5I8ZA 3VPFA 3RIHA 1I32A 2G1JA 2OHXA 4M1ZA 4R68A 3U4GA 1P4RA 4FILA 4QO7A 4BVBA 1UXJA 1Z7EA 1SUIA 4GUDA 3DMNA 3OY2A 1X3SA 4C0WA 2BN4A 3OPYA 1D0SA 3P9XA 1XA3A 3BD8A 3T7AA 2WHEA 1L5YA 1C8BA 5ARDA 1IHXA 2FEMA 2JGIA 4ZVQA 3VXKA 4CL8A 4A36A 2IC5A 1LK0A 5I3ZA 3FTPA 3PIRA 5DXAA 3AI2A 5KNCA 1NJ2A 4A8PA 1RM4A 1TT7A 2K7ZA 4KLNA 3NYIA 2Q0SA 3CEHA 5JNRA 1ZIYA 4UUOA 3MGKA 3CEJA 3LQKA 3VHXA 3LXRA 2ADMA 5IC5A 3NYWA 1PZEA 1XRQA 3C1OA 1OIVA 3TZEA 4G3XA 4OBBA 1KOLA 1AKYA 2WZBA 4LIPD 3G17A 1QFYA 3AI1A 3KKQA 3AB3A 2JK1A 2ECKA 3M70A 3PHIA 4FFBB 1W6RA 4C2UA 1XLTA 1WM1A 4BHTA 2ZIXB 2R96A 3INTA 3NDJA 4IWYA 4PQEA 1LRJA 1VFPA 4N6NA 1K4YA 5HIMA 4TTVA 4ARAA 1UH5A 1CUHA 1QZ3A 1V3UA 3P94A 1J9ZA 3Q85A 4LCEA 5BVHA 4FFSA 3RBVA 4E2XA 3K70B 1QU2A 1G7CA 2XTAA 4TYWA 4G8DA 1JHQA 2ZT5A 5L3QB 3VR4D 2BI8A 4D0NA 1N2BA 3GEIA 5D5PA 3MMSA 4HPJB 1KMHA 2SKEA 2ZYUX 5DCYA 3UATA 1FTNA 4RVUA 4UVGA 1FTSA 4BCCA 3VR6A 1II0A 2OO3A 1IZZA 2XKBA 3F47A 4M60A 4E5DA 2YWXA 1CULC 2BHLA 1U7UA 3JX9A 3K0CA 5BVHB 3E5MA 5CFMA 3SYLA 3IKJA 3MGAA 1ZIXA 3CIOA 4UHBA 1HOTA 1ZMXA 1JIJA 1UJ6A 2ONKA 3EF3A 5KMGB 1APBA 1NF8A 4QUKA 3G7NA 3O3OB 3RPEA 3P9ZA 1KMHB 5B1YA 5CFPA 2C4UA 3KD3A 1TM5E 2WJAA 3PUYA 4HAIA 2FUG6 4JUBA 5IKMA 1HYQA 3H2YA 1WPQA 2OV2A 1DQPA 1HLGA 3ASYA 1LD3A 3K0AB 4Q00A 5E1DA 5E6UB 2BEWB 3V46A 3AYZB 3GFVA 2NO1A 5TXGA 3VOBA 2PZMA 2XAUA 3TRKA 4A0SA 5DLYA 1FXSA 4DIDA 1LBIA 5AW5A 2PKWA 1G6Q1 1R50A 3QK7A 2EQAA 3EVEA 1ULSA 4CQMD 4Y1GA 5BMOA 3FGPA 3ROKA 5I9NA 2G07A 1DQYA 3K9WA 2OHJA 5ALHA 2L19A 1U1GA 2PA0A 2VJNA 1NPTO 3HCBA 3OCZA 3N2KB 2YVUA 5LBUA 3GWZA 4HLDA 4O4JF 3HLTA 2V5UA 4TTIA 3TXAA 4GL2A 2Y66A 2PUAA 2OENG 2X9VA 2QD2A 1U0EA 4LDZA 3WGLA 4V1CB 1F20A 1NLMA 3O94A 1D6MA 2VJPA 4CODB 2B1IA 4EO4A 4QUJA 2JIRA 3WZLA 2MR6A 3TZHA 1H6DA 2HA3A 3LW8A 5EFOA 1TEXA 2GEDA 1KVTA 2YYSA 2DWOA 4IEIA 4MUFA 5E9WA 1E79A 3ZXXA 4FJ0A 3RSSA 3V1MA 1TEHA 2GD2A 3GJQA 4WADA 3CO5A 2RCNA 2ZBDA 3I2JA 5JAHA 1BE6A 1FUUA 2NP7A 2EEZA 1QK5A 1ZJ4A 5IT5A 1L7XA 2RG7A 3QHQA 1QUEA 3ZHOA 4E1VA 2H18A 3HVIA 1UK6A 4MV7A 1Z4MA 3SF8A 1P0QA 3VPSA 1G0OA 1WL8A 4M88A 3IHTA 1MO3A 1LFAA 4BVAA 4L5IA 4KO2S 5J59A 4C6RA 2I33A 4L0CA 2AR9A 1VLJA 1IQPA 1YDWA 3EEYA 4GOND 3BIWA 3HDGA 4RDHA 3QP9A 5AMXA 1ZHHA 4QDUA 1ZRNA 4WK0B 4N6OA 1Y34E 1QH0A 4OHUA 2G8NA 2OESA 3KJFA 1Q0HA 3KUCA 3FNEA 2V3VA 5HE9A 4A0QA 2REOA 4YRDA 1P72A 4P4TA 4V2UA 3MUEA 2DBQA 2VN8A 5FFMA 5K6RA 3BK1A 1E6EA 3LKZA 4DUZB 1FJXA 2BM0A 1ML3A 4LY3A 2XVXA 3PPXA 1M2JA 1PJBA 3CV3A 1FJ2A 1L4NA 3CNHA 3HWWA 4O0LA 5DHAA 2QTAA 4BNVA 1E2GA 4AN1A 2PRIA 3KZKA 1QRSA 3THSA 1P7CA 4LVOA 1FSGA 3BTSA 5HWSA 1RWXA 5T4HA 4BMSA 3QWIA 3ZCRA 2KMLA 4B83A 3QFFA 3ONEA 1T2AA 4HAVA 3DVQX 3N70A 4GMHA 3KYDA 3ZVNA 3ISTA 3U7HB 3B89A 5NLLA 3I3OA 3KJZA 3UMYA 5KQSA 3E0QA 5CIWA 1Z0IA 1PE0A 1DG3A 2VUTA 2VNAA 4JGBA 2JZOA 3L06A 2KPOA 3D8TA 4M1SA 4ZHQB 3SXJA 4IDFA 1XFDA 1NZJA 2WYHA 3DYVA 3HN2A 1RVDA 2X3YA 3TSZA 1TMOA 5CDSA 2RGGA 3Q6MA 3IIMA 4HPXB 2WSSA 3AYXB 4ENRA 5ISMA 1O97D 4PX5A 2NUTB 1YRQA 1T8WA 3EZ2A 4FP9A 4MA0A 5D7NA 3ZDZB 1I2AA 3CZQA 2ONJA 1Z07A 3MTIA 1JPNA 1E1RD 3DWGA 3HYRA 3QX7A 1ZHFA 2DFKB 4QXOA 5HP4A 1FUYB 3TG2A 2AXNA 3GMIA 3G0OA 4TM7A 3DLTA 4QX6A 4XSVA 3ELYA 2L69A 2QMYA 4OQDA 3VTZA 2AFHB 3GEMA 1P4JA 2I29A 4H08A 2QN9A 1E5TA 4I50F 4JYBA 4Y18A 4NYMR 4F72A 5BY2A 1ADBA 7YASA 2JVJA 4RHCA 4F1JA 4X62B 5EJMA 2BDTA 2J87A 2ZYIA 1M0EA 1J2YA 3K2QA 3LQYA 5C8DA 1A71A 2BELA 1WHTA 3H3FA 4UTVA 3PNMA 4KXYA 1P4AA 4JQCA 3FTDA 3LBNA 1DE0A 1IHOA 3N2NA 2CFTA 3DMTC 4HGPA 3EFHA 3TMKA 1PR9A 2R68A 3DCNA 3NRBA 5DI3B 4JSYA 5IARA 3NV9A 3FBGA 4IIDA 3SXUB 3WYAA 2YR0A 4CPDA 4YV1A 3TG8A 1VE5A 1Y80A 2I71A 4ND5A 5AKXA 2BDUA 2FZGA 1JALA 2CXUA 1Z37A 5AOVA 5K3BA 3PG5A 3GRKA 3O7WA 3QF7A 3SSAA 1LZKA 3G1UA 5IJ0A 3ADCA 3EZFA 1NFQA 5K3FA 1ORVA 5BW6B 2HDNB 2RMKA 3REQB 4G0QA 2W6ZA 5C5DA 2EP8A 3T1VA 2ZM5A 4OH7A 4PZZA 1FDWA 1NXTA 3B20A 2XT6A 4ZVNA 3RSCA 8MHTA 1J21A 3BJRA 3PXUA 3ZV4A 2XUIA 5HA5A 5D3QA 3KR2A 5BQFA 3IV9A 4FZRA 1V4VA 3N53A 2OO5C 2CNDA 3AEXA 1T4DA 4RK4A 1Z22A 1CR6A 3GLTA 4WOPA 3PQEA 2O8BA 1FQKA 3N5CA 2OO5A 3H75A 4EKYA 2H5IA 1RI4A 3EZLA 4TXNA 4B82A 2ZT7A 4GZ6A 1BTOA 1U8TA 2IL1A 4QATA 2BZSA 1CLEA 3WZMA 2W2MA 1V5EA 5CX1A 4CLHA 3L8FA 1I3LA 2WV9A 3EVGA 3IDOA 4TUYB 3K8YA 1JDZA 3DEAA 3SSMA 4HNRA 4P82A 2YWRA 5T57A 3WHLA 1DKLA 2AXQA 2EERA 2HSGA 1ZPDA 3K30A 4W1QA 1MEJA 4RY0A 4CV1A 2X41A 3X1ZA 2FP4B 3O9VA 3ETGA 1LWNA 2V9PA 3S2IA 1C9NA 5LQJA 3P0EA 4EUEA 4L08A 1FP1D 3UICA 3JSAA 5JYCA 4JI8B 2V7TA 5MFZA 4PHCA 4E14A 5JW6A 2I4MA 3U3MA 3D8UA 2WFMA 4TTRA 3JD4A 1C4OA 1TQ2A 3QI7A 1SBZA 3GT4A 5FBRB 1BXRA 4M0CA 1FDRA 1QYDA 4BO3A 3SQXA 2E6KA 4N5LA 1XQVA 3AHHA 4KW7A 4L7QA 5C3UA 1EMDA 2BHRA 3EXFB 2YHIA 5BUCA 4K03A 4S35A 4YT4A 4HXFB 3H1TA 4YJ2F 4CU2A 5TRTA 2ZYVX 3R0XA 3DMDA 4TLLB 5HKLA 1VLZA 2QL6A 3FW1A 3PL1A 4YQFA 1V7QA 6ADHA 5AQ1A 3AY6A 2IYSA 1K6IA 1V8DA 1VYTA 5JAMA 3KL4A 4AMYA 2GEBA 4FYYA 4QHYA 2VHQA 5THQA 3EVNA 4FFDA 1P3DA 4OQQA 4ARIA 2IYNA 2ID9A 4XIIA 3PNPA 2QZSA 4FYIA 5LB2A 2FRVA 4ENPA 2NYVA 4CDNA 2BF4A 1USIA 1E66A 2O50A 1ZESA 4S0XA 1YBHA 1GUBA 2HQBA 3GLHA 2IY8A 3HSKA 3NBUA 4Z54A 1H66A 3QXSA 4LI0A 1WA5A 4DLVA 3HKCA 4OSOA 5LQSA 2XXBA 1H1DA 1U0SY 1URPA 3T6KA 3TYXA 3O84A 5EIBC 3W5UA 4JIGA 1DEXA 3RU7A 3NVAA 5KTSA 3WGKA 5GTDA 5AUNB 1N3BA 3G5AA 1TVKB 3UH1A 4NENA 2P35A 2ZBFA 4WCFB 1JAYA 1CZNA 3DBLA 1SQFA 4L57A 2YVKA 4UJ5A 1TO2E 2DYKA 2AG0A 1T3GA 1GG5A 1T2DA 3EC1A 2YWCA 1K7YA 3LWDA 3MJCA 4KZPA 3K1YA 1V3QE 1V8OA 2V96A 4JOCA 4HNSA 2OHGA 4EFNA 1U8ZA 3G2LA 1YKFA 4CR6A 4MWEA 1G5RA 4KE8A 3KUUA 4WKNA 1U02A 1N34B 2GPNA 3HJTA 1CXZA 3DBLB 4CG0A 2D2VA 2VF4X 4B3TB 1QKJA 4A0HA 2HCJB 5AI8A 1YZ3A 1MA3A 3WHKA 4IGIA 3LMKA 2P75A 2JIDA 3PS9A 1HMPA 2ODWA 1M3SA 4D3YA 2Q2OA 1X1EA 5CLJA 3MWFA 3RJMA 3G9QA 1GTG1 2QLFA 5BT9A 3F67A 1YFLA 1PZHA 1EE1A 3OHSX 1E0JA 3BE5A 1P74A 2VRNA 1P2SA 4BFLA 1AG9A 3IBFA 5C18A 4ZYWA 4N6GA 4AKSA 4NBNA 3A1TA 1JYEA 2EBWA 3IAFA 3F73A 4NCHA 2ZCJA 2JD1A 4UDXX 5KC8A 3GU3A 3T7EA 6NULA 4LTNA 3ZGNA 3E3NA 4E4TA 7GPBA 2H4FA 1XOIA 1JJIA 4K9DA 1ABEA 1ICIA 3OPMA 8OHMA 3AOEC 5J23A 4HUQA 1GPYA 2ZJFA 2PVPA 2VHWA 2GNOA 4TL7A 2YXDA 4Z99A 2F2TA 1YCGA 1YL6A 1YUNA 3WWYA 3ZQJA 3FD8A 4Y6QA 4EYSA 2YIMA 1IZ8A 1YJ5A 2H5EA 2UYQA 4JNKA 5TGDA 4D8VA 1VGQA 2QU8A 4O2BF 4I3GA 1EFVA 1Z83A 3RFCA 3WSTA 1LLFA 4Y7CA 2JIOA 3GIWA 3QEJA 1W85A 2QN3A 3HPRA 2CMGA 2X76A 5ANRB 3NHRA 3O95A 4LEIA 1HGXA 5EVCA 1OT3A 3FMGA 2HFJA 1ZD1A 3AJ9A 4D5EA 2FZCA 2BRUC 5L7WA 1NQOA 4XM0A 2JI6A 3OQHA 3ZWAA 1BAPA 1C3VA 2A30A 1MIOB 1OXXK 1YBMA 2ANBA 1U2RA 1W85B 4MX8A 1UIRA 4Y9DA 3TR6A 5COBA 4QODA 3SC3A 5I7EA 4C78A 4O0MA 1V7PC 1PRYA 3NIWA 4BB6A 1T5BA 2I5PO 3VVMA 2QDKA 5F98A 2OBYA 1UZLA 4XM1A 2NSYA 4DNOA 2WT4A 3C5EA 3JXEA 4ROSA 4TSKA 4YEDA 1KP3A 1WXGA 3JYHA 1J1ZA 2B8WA 3VAAA 1JJAA 1WCIA 1ZLYA 4I99A 2NSLA 2VHVA 4O2AA 4DTCA 4WA8A 2WJYA 3I0MA 4HAUA 1GWNA 1DINA 1W25A 2DH5A 2DHRA 2V7UA 2GOYA 4CM4A 3S99A 3UGTA 4F4JA 5ITZB 1NOKA 4JVMA 4ND7A 2G7MC 2OBMA 3PXDA 2YH2A 1FZQA 3P8ZA 5I7OA 5KWIA 4AJ9A 4NZ9A 4JN6B 3NHUA 1FOEB 3JASB 5K0EA 3GLHE 5AXDA 3VU9B 1H8EA 3PFNA 1XL1A 4JMLA 3CRMA 1HNXB 5T4FA 5TQ2B 4AF6A 4YV7A 4NDAA 3AL2A 1N4AA 4AIIA 5EHNA 4QUHA 5AI0A 1KEEB 4YCSA 1MJ5A 1P2VA 1Z0DA 5C7YA 1IOVA 1FPMA 3WLSA 4KYVA 2Z58A 1U0LA 3ZY6A 1AUPA 2G8LA 4V0QA 4I9HA 4O4IF 2W48A 3GARA 2Y1OA 1OI4A 4XYLA 1ZHOA 3E0XA 1YB5A 3R09A 1FVOA 4LYAA 3WQQA 5JQWA 1E2KA 4GX0A 3JVVA 1UK9A 3E2PA 4KLCA 1TCUA 1Z4OA 4OIFA 1JTVA 5IJWA 1RRGA 3AETB 1KH2A 1TPYA 3OTGA 4FYVA 4KOEC 1Q74A 5CPFA 1EUQA 2J9FA 3AZOA 3NOVA 2BD0A 3PGLA 4Q7MB 1X19A 3AFMA 3CX7A 4AP5A 1BJTA 4KVAA 3HZHA 3QYPA 5KNDA 1IN7A 2AA3A 3ZDBA 5T7BA 3EMKA 2WJVA 1BCSA 2O8NA 1CR2A 1DEAA 3AWIA 1XWIA 3F5SA 1ZZEA 4V2IA 3CKYA 4QU9A 4CHGA 3ZV3A 4WTOA 1RPTA 4QE3A 4F1WA 4IDAA 1JMKC 2HLNA 4NZOA 3QH4A 4MW2A 4QTTB 1U7HA 2OHHA 3C15C 4PTLA 4N3BA 3BL6A 2X2FA 3LPAA 3O2JA 4F2DA 1DG1G 1X7XB 1J0CA 1FSFA 1Z88A 2PLFA 2MCFA 4PINA 3ZTTA 3PD7A 2X86A 4R71A 2LUOA 1P29A 3GD5A 1IHDA 3M1IA 3D3WB 4KWTA 3U3KA 2EL9A 2XOKD 1PR5A 4LGCA 1ESMA 4DUYB 2EP7A 1T6YA 4OQ4A 2AZTA 1TMKA 1A88A 1TQ8A 5BXYA 4D56A 1BRMA 4DCOA 2ADOA 2O05A 5F4ZA 3MB8A 4ZAGA 4B3SB 3EXG2 5IX8A 2PD6A 3O8QA 2O2HA 4OHRA 1YF3A 1TMGE 3COYA 4IXMA 1EGVB 2BGIA 3OLZA 1A8SA 2OZLA 2Q4BA 3D6NB 1Y7IA 3L0ZA 2YJ6A 2JARA 2Y1DA 3NS7A 1K88A 1WSDA 2DCUA 3AUJB 4P31A 5EPOA 3H4MA 4BMPB 3SX2A 5CFRA 2J5KA 5CB4F 3BILA 1GZHB 3QOYA 1L4KA 4K40A 5A3QA 1M1YE 1R6AA 1MABA 3OZEA 3U39A 3C4QA 4KHPB 3RYHB 3U37A 5FBWB 5CG2A 1WZEA 1YSCA 2CLMB 4CVNA 3SNHA 2ET6A 2PUTA 4KRFA 3VDRA 3DDSA 3GUHA 3LBYA 2E2WA 2FRXA 4JLDA 2RDMA 4C14A 1I0ZA 4G0MA 4XEHA 2AEJA 3BC1A 4OPMA 5FP0A 3MWEB 1AK1A 3CPJB 3FNQA 2UYCA 4OTZA 2PNFA 2HT1A 2XR1A 3FSGD 3PNYA 1S2GA 1XRLA 2IUFA 2WU1A 3BDIA 3C4JA 4PGHA 3HZZA 4P7FA 3L7AA 4C08A 3BGVA 1UFVA 1BDBA 1WKBA 3ANTA 3KEOA 4OGWA 4QAJA 5B3AA 2W00A 4DLYA 2CLLB 2RGYA 3MTBA 5LKAA 1UKBA 1U65A 2QJRA 2VYND 3FGOA 4KX3A 1NLYA 4PICA 2AKEA 2I91A 5HDQA 4C21A 1ZL0A 1SY7A 3AW8A 1UBSB 4QDKA 4FDMA 4LYJA 4TYNA 1A0OA 3BF7A 1LF5A 4ITUA 5TF4A 3P32A 1A9YA 1V48A 1JIKA 2NV0A 3RVSA 1KF0A 1ZXLA 3OI7A 3HEAA 5TC4A 1N5MA 2ZPAA 4ZGWA 2JCBA 2XGMA 3AKYA 3I04A 4HDAA 5JAIA 1RPJA 3H9JA 2Q3EA 3FUWA 5HKKD 3VSEA 4JU8A 4MV8A 1BROA 2PWZA 3OESA 1L5WA 2BPOA 3JALA 5SZJA 5B1HA 5E2IA 1RLTA 2R6JA 3ZCSA 1KERA 1PFVA 2Q28A 4G1FA 2PJZA 1Y7LA 4PLVA 4CMKA 2CD9A 5BV1A 1C50A 3QX8A 3PFWO 3PK0A 2I6QA 4PVDA 4DQUA 5ALIA 4CKZA 5AHWA 3RC9A 1NNUA 3SKYA 4HWGA 1PS0A 4CTOA 3KKOA 1MQ8B 2WHXA 1I6LA 3I6IA 1O1YA 1W0CA 2ZBUA 1A69A 1C7JA 1FB5A 1GG2A 2FCAA 4CKEA 1P0MA 3I1JA 4HYQA 5JS7A 1SVKA 2R11A 1LLQA 3E03A 3SBDA 5DM1A 4YJ3B 2HDOA 3RO7A 1RBZA 4KCGA 1QPBA 3EY4A 1IVYA 2HWYA 3HU1A 3JAKB 1AQ6A 1PDOA 1WTAA 4S1NA 1X92A 2H0AA 3G5LA 3IO5A 3OQ1A 4IHQA 7ABPA 3WXBA 3EZYA 4G0OA 2CXNA 4PN3A 2PGJA 1DOAA 1QUFA 3WNZA 3BKXA 3EGVA 4MIYA 4D5GA 1FU4A 2NT4A 2PX5A 4IF6A 1Q92A 2O1EA 4BPBA 1BJKA 2ORVA 2ROQA 2XE8A 1DRKA 5DTEA 2ZR0A 2WM2A 3CRQA 1ZOLA 3N2KA 3IFSA 3PNBA 4OMFG 4QEZA 2XGOA 4BQSA 3ZJ4A 1U9IC 2V54A 4I2VA 4AF8A 2RH4A 2DZDA 4DZZA 1ZOIA 1NP6A 3UAZA 2E5LB 1W7AA 1U2PA 1PTKA 1SC4A 4MYUA 4F92B 1UWKA 1LC3A 2YVQA 4BBZA 5A9RA 1ZITA 1E1NA 4FK8A 4RIIA 3ZJYA 2HW8A 4F3YA 4GQBA 1VHDA 2WG0A 5T8KA 3HA7A 2GXSA 3SIPA 3DPIA 3QPAA 2X7HA 2WWYA 1N4DA 2GD6A 1BGVA 2R60A 3AUTA 1X7WB 2BL4A 4KMSA 3ZH9B 4B3DA 2Y1KA 1I1NA 4EO9A 2EG9A 3E22B 3GH3A 1NQTA 2IH4A 1YDHA 2X0JA 4UD2A 3T95A 3A4LA 1QYXA 2AVDA 2QY9A 4LQDA 3SF8B 3K9FC 4YDSA 2OFXA 1M6VA 2QLMA 4R5HA 1QLWA 3I5YA 1PT8A 3C3EA 3LPDA 4MRSA 2Q5HA 1IULA 1W1WA 4HR7A 4TZTA 1Y4UA 2PBFA 3E22A 1E2MA 1LLDA 1LXCA 3TKYA 3ZHZA 3DHYA 3LP5A 3WFZA 5JY6A 1E61A 2W6QA 5CXXA 1IQ0A 1U9IA 2VCHA 4R2MA 9ABPA 1ONOA 1G8SA 2FSPA 1B0AA 2YZMA 3WYDA 2WWGA 1QH9A 1TJ3A 2DT8A 3HJNA 1HWYA 1Q1BA 5I9MA 5B7QA 2NU7B 3FGZA 2JIZA 1IPHA 3A1NA 2H1FA 3SOZA 4BJ3A 2KI5A 3EZ7A 1KOFA 4W7HA 4HB0A 4PSCA 2WTNA 5EMKA 3RW9A 4AZ0A 3C8UA 5HR5A 3UWMA 1BD4A 3I45A 3THXA 2NPOA 2PWPA 4HD8A 2XSZA 2OG1A 3KJEA 4NJOA 2X4IA 5AHKA 4UTNA 2AUMA 2MYUA 4LHVA 1QKKA 1WZ2A 4LJ7A 4LV8B 5FO1A 5FTKA 1P7YA 4AZ0B 5FWXB 2PXXA 3IEPA 3LC2O 1M6WA 4UNPA 1DKPA 2IRWA 1X77A 2W6JD 3GJZA 3P27A 4N5HX 2PCLA 1JKJA 2P4HX 1YK1A 3KV1A 3HKBB 1QNFA 3GEPA 2DF8A 1PD1A 3T41A 1JFRA 4D42A 5H0IA 3W2HA 3PDJA 4JXJA 1C0EA 2APJA 1N78A 1K5HA 2HY7A 3EQ2A 2IH2A 5DYWA 2HEIA 2C42A 5M7EA 1TX4B 3R3HA 4B34A 2ZIWB 1N2CE 4G24A 1F6DA 1NUQA 4RV4A 3RHTA 4GZ5A 3QHAA 4YMTA 4OB6A 4XGQA 4G0VA 4NEQA 2Q5CA 3VMFA 4R2HA 1LTKA 4ZRMA