4Y0AA

Shikimate kinase from acinetobacter baumannii in complex with shikimate
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
179
structure length
179
Chain Sequence
PSKAFETLPNIYLVGPMGAGKTTVGRHLAELLGREFLDSDHEIERKTGATIPWIFEKEGEVGFRTRETVVLNELTSRKALVLATGGGAITQAPNREFLKQRGIVVYLYTPVELQLQRTYRDKNRPLLQVENPEQKLRDLLKIRDPLYREVAHYTIETNQGAARDLAQKILQLILSNKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of shikimate kinase, an in vivo essential metabolic enzyme in the nosocomial pathogen Acinetobacter baumannii, in complex with shikimate.
pubmed doi rcsb
source organism Acinetobacter baumannii
molecule tags Transferase/transferase inhibitor
molecule keywords Shikimate kinase
total genus 65
structure length 179
sequence length 179
ec nomenclature ec 2.7.1.71: Shikimate kinase.
pdb deposition date 2015-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01202 SKI Shikimate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4y0aA00
2ZJAA 2ZIAA 2OFWA 2EU8A 3CRW1 3WYAA 2I1VB 2OG2A 2W6IA 2ZRBA 4IHQA 1XCMA 3ZVMA 1J8YF 4YMUA 3ADKA 4UJ5A 3AP2A 5CM9C 1CS4C 1SVLA 3TUJC 4XWOA 3GLGE 2VHQA 2J41A 3RS2A 3K0SA 1DTSA 2MMGA 2BM1A 1A82A 4M8NE 4OJQA 5EZ5A 3QF4B 4WZBE 4OHXA 4CDGA 1W4BA 3L43A 4ZKEA 2ORIA 5HPYB 4MGYR 1YKSA 1JB1A 4A9AA 4RD1A 2OXRA 4HDQB 4MKGA 4KHZA 1ETUA 3TKLA 1TQ4A 2AKYA 3U6KA 1OH8A 4DRZA 2QBYA 2IHBA 1ZJ6A 2J0UB 3OE7A 3FWYA 1XWIA 2DR3A 1BS1A 1XFAA 2JCSA 3PUYA 4FMCF 1XMVA 3WRXC 5BWMA 4DKXA 2OAQ1 1W36C 2HT6A 1E3MA 2WOJA 4I1VA 4TTQA 3ZD6A 4C2UA 2IHYA 1KGDA 3ECCA 3QF4A 2J59A 2PEYA 2WHXA 3TUZC 4XSGA 3TQCA 2BIFA 4B6EA 3I3SR 1T8UA 4B32A 1P9NA 3K0CC 4NBSA 5KDDA 3LQRA 4C0KA 1SXJD 4Y0VA 1JQJC 1VCIA 4F7WA 2YINC 4WZAE 1H65A 3FDIA 2CNWA 4GDFA 1XTIA 4MUAA 2C99A 1J70A 1KO7A 4KAXA 2P3SA 4ERNA 3CUEF 1ZBDA 3IIMA 4PAOA 1FPMA 2XB2A 4LBZA 2B7BA 2H17A 4OHZA 3FVQA 1ZYUA 2OE2A 2FPKA 4H1VA 3MWLA 2V4ZA 1N6OA 4NE2A 4Q03A 2OSBA 2DYKA 1ESMA 1GIAA 1NMXA 3OFND 2ONJA 2HUPA 3R20A 3TH5A 5DGXA 4R71A 4M53A 2ZRFA 1VECA 4Q66C 5J4KA 1FOEB 4C0AC 1KMHB 2PEZA 1F2UB 3GLFA 4LJ8A 2CLSA 4NONA 1E2KA 1TQ2A 2REBA 4OHYA 3BBPA 1FMJA 1YZLA 3I92A 5H8WA 1KNXA 2ASEA 3S1AB 1US8A 1SXJA 4LY6A 1AN0A 3OIWA 4N3NA 3DOFA 4IJMA 4L16A 4Z54A 5EP4A 1SGWA 1MV5A 1NLYA 2GXUA 5SZHB 1S1CA 5AJWA 2WJVA 3IHWA 4N0EA 4P32A 2F1HA 4IW3B 3EA0A 4FMBB 2BMDA 3NC1C 2PCLA 4ARZA 4TT3A 4OI4A 1SVMA 1G8PA 1LV7A 1ZMXA 4ZI3A 3I62A 1E1RA 4LJ4A 1N0UA 2REOA 2GK6A 4PQFA 1ZIOA 2F43B 4MKHA 1E9RA 2H5EA 1XJCA 2FEOA 3GJ8A 3PG5A 3U3JA 5CDFE 5EUQB 3PIRA 4ITRC 4EQ6B 5KO2A 2XOKA 1WQ1R 2FPMA 1GUAA 3LBHA 1EFUA 4QGHA 5FBQB 1UAAA 3B5JA 2DPXA 2X2FA 1XJ0A 1EXMA 3CX7A 5AUQA 2BV3A 4IVPA 2EVWX 1XDBA 2R6AA 1UKVY 3NDBB 3AVVA 4MGKR 1AQUA 4BFWA 4WIAA 4DT1A 1G7TA 1P2VA 1R2QA 3CPEA 1SHKA 4Y0AA 2GZDA 2DHRA 4HAUA 3O8DA 5E4FA 4C30A 2KBFA 1NKSA 3GJ7A 4TL6A 5CK4A 3GFOA 1EFRA 2JGNA 4HUTA 2AR7A 4HB0A 4QBHA 2Q3FA 4D80A 4CEJA 1E2EA 2C77A 3R8CA 1XEFA 2GJKA 3GJXC 1N6KA 4S2EA 1CR2A 3RS5A 2DFKB 2EFCB 4JLOA 4LHZA 2F55A 1GZSA 4KLZA 3L2OB 2FN4A 2LKCA 1XMSA 1D9XA 1E9DA 3UATA 4LCBA 3TSWA 1BKDR 4JZKA 4PPGA 1SXJB 5JJKA 2RGNA 1R5NA 5KNDA 5FBWB 4PQRA 3A8TA 1I2MA 1XCPA 1G3RA 4DT1B 1UPTA 2GXQA 1SQ5A 2A5JA 1NNEA 3W90A 2BJVA 1M74A 5D3QA 2QN6A 2BEJA 3K70C 2ZYVX 2XSZD 4JBYA 2A9KA 3WXMA 2NGRA 5TARA 1OIWA 5CJ2A 5JCPA 1N6PA 5FR1A 1VIYA 4L9SA 4B43A 1T0HB 1W0JA 2UVQA 2H8KA 3ZGXA 3U5ZB 4OYHA 4DBLC 1WBDA 3CPHA 2B8TA 3BB4A 4ESVA 2RKOA 2VSOA 4I1OA 3QF7A 5KNBA 4GP7A 3MUFA 1QVRA 4AKHA 1VG1A 3S1AA 4JVSB 1YVDA 3AVUA 4BLRA 1T8TA 1MABA 2NO6A 4QBFA 4N0DA 4G5GA 1R5BA 4M1KA 1E98A 1ZU5A 1N25A 3GP8A 1KK1A 3QIAA 1KI3A 2C9CA 2AWOA 1HY3A 2PZFA 3NIBA 5JEDA 3EZFA 5K8LA 5FOWA 2ZJ2A 1U0HC 1G8GA 4J0QA 2I4IA 3A1SA 1RZ3A 1UBFA 1ZNZA 2F1RA 4OL0A 1N5JA 3RS4A 4HATA 2VLIA 4DCTA 2FE4A 2WWWA 2AFHE 4V0NA 1HV8A 2H18A 2F43A 4FCVA 2EWWA 2IEZA 1N6NA 1KZGB 1DO2A 4RZUA 4M21A 1Z29A 3A4MA 4LYFA 3CIOA 5JRJA 2FFHA 4DDWA 5FPHA 4OQXA 4M22A 3VTKA 3X1XA 4LPSA 1XD2B 3CZQA 2QU8A 3B82A 4PAMA 2R6GA 4AI6A 4CRWB 1KK0A 1P2UA 2V6JA 1OH7A 2J0VA 5FPSA 1YZKA 3TGPA 4NKRA 4JL6A 2PCJA 2ERXA 3THXA 3ADCA 2D3WA 2PX0A 4O3MA 2WZQA 3C8UA 4XIGS 1Q57A 3DKPA 1NN5A 4V03A 1G41A 1NRJB 4TLDA 3TR0A 1GWNA 2VHUA 3LH5A 2ZRNA 2ZRJA 2WJGA 3EIQA 2J1LA 4TL7A 4XJXA 1S1MA 3EPLA 2C04A 4TYYA 1H8ED 1OKKD 1QHGA 4PPQA 1EFCA 1SXJE 4JBXA 4F4IA 3TQFA 2YOFA 2JAQA 3AH8A 4R2IA 1CLUA 2FV8A 1IN7A 2CJWB 3F5FA 4HI0E 2P0EA 2GCNA 4QRHA 1E2DA 2IWHA 1CP2A 2D7DA 1Q1BA 1U99A 2XJ9A 4FI3C 2J9RA 5IT5A 5G3YA 1G7CA 4Z8YA 1P5ZB 3SBDA 4CZ2A 4II7A 4QGFA 2JLZA 4L4UA 2QT0A 2IX3A 1XX6A 2G83A 3W8RA 4CYMA 2DCUA 1OV4A 4Q4AA 2GRJA 3MWJA 3M6AA 4P4SB 3BFVA 4LJYA 4XD7A 3SJCA 5E7MA 4Q4LA 1T9HA 5CB6A 4KJZA 4TTPA 3DOEA 5M04A 4HDCA 4ZI2A 1F2TA 2R6CA 3GLHB 4NL4H 1XTQA 1E2PA 2B92A 4D0NA 3A1TA 1Z0JA 4DLRA 3IIJA 2J0QA 3B1VA 2L0XA 3KJHA 4XVRA 4Q4JA 2BWJA 3NEYA 3FKSD 4HB2A 1MO3A 1G3QA 4B74A 2V55B 3SHFA 1E1QA 3BXZA 3TUIC 3QEJA 1NY6A 1UM8A 4G5RA 2IXGA 5TXGA 1DAIA 1J2JA 1GOTA 3TVDA 4WXRA 4ZCIA 1E2IA 4LGMA 2ODNA 3SEAA 1ZC3A 4EPYA 1U8AA 4RSGA 5FOTA 5JS8A 4QBGB 3FMFA 1H8HA 3K9GA 4L5BA 3T5GA 1ZIPA 1EWQA 2DFLA 2PLFA 2QRNA 3PEWA 3TLXA 3ZZUA 1B0UA 4JBWA 4QGAA 4DVGA 1E79D 3H86A 1DO0A 4GT1A 3ZVRA 4D6PA 1W2GA 3KFXA 1Q1ZA 2IYRA 3R7WA 2HCJB 4H9GA 3AF4A 2CCGA 4EJSB 5EE3A 2EYUA 2OCPA 1CJMA 4QNRA 4B33A 1Q3HA 2E9SA 1VYUA 4A82A 2YZ2A 1CJKC 2EQBA 2GCPA 4GZLA 1EWRA 3PEYA 1U90A 3X1ZA 3A1UA 3K09C 2ZXUA 1ZAKA 2IC5A 1T3SA 2JLXA 1JXMA 4HLDA 4LX0A 1XEWY 1E2QA 1HTWA 4IKEA 3ZS8A 4UXHA 3W8NA 4O2LA 5FR2A 2ZJ8A 1R0WA 1R0ZA 1SKYB 1Z6XA 1Z6TA 2WIAA 2WKQA 3LRPA 2GEVA 1UBEA 5DI3A 4Z51A 1G3MA 4C0QC 2CNWD 5DE3A 2VF8A 3OEHA 2JATA 4OK5A 2JJ1A 5SZIA 1N6LA 1R0YA 2BBWA 2PZGA 3P32A 2HXYA 4PPNA 5KDLA 2WIBA 2WWYA 1NMYA 2FFAA 4Q9HA 1FP6A 2RGDA 5TDHA 2NO9A 5EJEA 2X19A 1G7RA 3ZD7A 4XTCS 4DCSA 1GAJA 5TV2A 1GG2A 3CF6R 1FUUA 1AS2A 3N2IA 4TLEA 3UK6A 3OFNA 1DAFA 2Z5FA 3IEVA 4D25A 2QEQA 1Z22A 3TK1A 2ZTSA 3KXIA 2IYZA 1W44A 3MMPA 421PA 2CCKA 1YR8A 3QPVA 4LYAA 3LBIA 2D2EA 2CLDX 1YZNA 3A4LA 5IF9A 2P67A 1W48A 4IDOA 3K0FA 3PVSA 1KAOA 1W5TA 1ZM4A 2YOGA 5KOYA 3K70B 1KNQA 4D0LB 3M1IA 2QP3A 2E1RA 1OSNA 3K53A 2JJ1D 1JQLB 1VKJA 3QG5A 1S0UA 1G6OA 4URWR 1P62B 2QNRA 1ESNA 4A0FA 4AYTA 4QKQA 3GLGB 1XPOA 4TMXA 1ZINA 3MCAA 5KYKA 1BH2A 1F2UA 2G0TA 3GLFB 2D62A 2Q3MA 4LHYA 4LJ6A 3KJGA 1E1RD 4ILEA 1SVIA 4A8JA 2PLRA 5A0FA 1KYIA 3M0EA 4LSGA 5CYOA 2ZI4A 5D3MA 1UDWA 3SU8A 1AGRA 5EE9A 2HLDA 3ZZTA 1GSIA 3QKSB 3D31A 5JBQA 3A1VA 1Z06A 2Q21A 1A7JA 2J46A 1XD9A 3EWSA 4DLSA 4YONB 4AY2A 1AZSC 1IBRA 4TLBA 3WHKA 3G5UA 3P4XA 3UPUA 3L82B 4QXAA 3QXCA 3A1WA 4CT5A 4IFEA 1GKUB 4Q1DA 1ZNYA 3I8SA 5EXPA 4ZV4A 5SZKB 4AURA 1KI7A 3GJ5A 3QEOA 3W34A 4D2IA 3TR5A 821PA 2ORWA 3U6BA 3T1QA 3O47A 5EE0A 5LPNA 3SR0A 1VMAA 2YV5A 3NBXX 2YWGA 3HWSA 5L3RA 3EC2A 2QY9A 1Q44A 4Q4HB 5J4HA 2VHJA 4RKFA 3LLUA 4NZYA 4BLPA 3RABA 4LK2A 2CBZA 4Q9JA 3LVQE 3QKRB 2P5TB 3AB3A 1OYYA 3G82C 3EWAA 4NYMR 4D4LA 4DLYA 2EFHB 4HEJA 4IOJA 2QSYA 5HCIA 4V0ME 3FPAA 2P6UA 2QMUA 4K8OA 5KPDA 1WCV1 3ZIAA 1COWD 2QQ0A 2GEDA 4JVNA 1ZNWA 4LUCA 3VKWA 3THYB 4ACBA 1L4YA 2FFQA 2QP4A 4RD3A 1E99A 1P7CA 1TUIA 1T3HA 1KZ7B 4PSKA 3O8RA 1VTKA 1YHNA 2GVZC 221PA 2ZSDA 1FP7A 2FDCA 1KK2A 2VP0A 2BEKA 3NHBA 1P6XA 4A8JB 4YDHB 5AJVB 2Z4SA 5DO9A 5B58C 4A15A 3SYKA 4OK6A 3VX4A 2QORA 1OJLA 2CL0X 1XTJA 4K81B 4EQ6A 1QHYA 1YZUA 2G88A 1OIXA 2JLSA 4C9BA 4UQOA 4GMXA 4RD4A 3FYHA 1W0KA 3DMNA 1DARA 3FGNA 2A2ZA 1QHHA 3SE0A 3Q7QA 3ONWA 3PXGA 1MR3F 3EPJA 5ELXA 4HUQB 1G21E 2ZROA 3CRMA 4ZO4A 4KITB 2AWNA 2R44A 3BERA 2V9PA 1S8FA 4JLBA 2WSSD 1EESA 1KKLA 3GCGA 2BBTA 2PZEA 4OQLA 3SDZA 1FUKA 1TUEA 3VMFA 3PEUA 6Q21A 2ZRIA 3RHFA 4BPBA 1KSFX 4PSVA 5FL3A 4QM7A 2V7QD 4EJSC 5CITA 2YNMA 4HB4A 5FBLB 5J4VA 4Q1CA 3BB3A 3AKYA 5B2ZA 3T1TA 3PV0A 5L3VA 3RLFA 2VP6A 2EW1A 4LV5B 4KFRA 1NI3A 5CLQA 1GVNB 4MRSA 1W46A 4G5SA 1ZD8A 4Q47A 5DNYB 4BFVA 2XNDD 4Q18A 2B6HA 1OH6A 3ZQJA 2HDNB 2I1QA 1FQKA 3K0FB 3K8YA 3KB2A 3LX5A 2IWRA 4B2IA 3HPQA 4BFTA 3J81k 1ZUIA 1E4YA 3F3YA 2QMHA 2XSZA 4Q7JB 3WP1B 1X3SA 4D82A 4BLSA 4EIWA 3E5HA 2OCYC 2RH5A 4PC2A 2HV8A 2QM8A 1QRAA 3CNOA 4URYR 4GI7A 1YRBA 5JSZB 3ND9A 5HTKA 3NWJA 5P21A 2QZ4A 2X8AA 2YJTD 2C5LA 3VQTA 2FG5A 4M1OA 4HLUC 1PJRA 3AGPA 3LY5A 3NEJA 1VHLA 4X8OA 1FNMA 2ATVA 1E2MA 1G20E 3FTQA 4GNKA 2D7CA 1Z0DA 1Q3TA 4A92A 1CBUA 3THYA 2VP4A 4M9XA 4K46A 1KKMA 3CPJB 5C18A 2O8FA 1M2OB 1XXHA 4NYJR 3P27A 4JLPA 1QG4A 4OJKA 2Z43A 5F2EA 4E09A 2ODEA 5HE9A 4MUBA 4QNMA 1XZPA 4FN5A 1SKQA 4GRAA 1TADA 1ZP6A 2XNDA 4US2R 1W7AA 4NCNA 2JDIA 4I1SA 4IEEA 4US0R 1RVDA 1OYWA 1DELA 1TTTA 1KHTA 1ODFA 2QROA 1P60A 1NVVQ 2XTMA 2ZS8A 3W9YA 1XMIA 4R2HA 3NBYC 4WA7A 4CEIB 2BM0A 2JA1A 5H68A 3OF5A 1E69A 2F9LA 2FX3A 4KYUA 1KK3A 3K0EA 4AG5A 2HEIA 5F3WB 2BVNA 3Q7PA 1NLFA 3SQXA 4AK9A 1ZW6A 1JBKA 1HEIA 3CRRA 4XOIA 1G5TA 2QAJA 4AD8A 5BYJA 1OT3A 3Q8XB 2C96A 2J7PD 2HJVA 4UNPA 2XB4A 2OILA 2IUUA 2ZI9A 1RPZA 3QKTA 1KI9A 2OUKA 2FMXA 3HU3A 3QSYA 4KBFA 1Q1QA 4Q1EA 4C4PA 3U60B 2XEXA 3P26A 4LV8B 4MQBA 3JVUA 3KUCA 4R98A 1UJ2A 4NMMA 1IOZA 4LBVA 1E2LA 4MYCA 3UXMA 3AVQA 5J40A 3RRMA 5JWOA 4AC9A 3B9QA 4FWTA 4BGDA 4TSFA 2HYIC 4QGGA 2F3RA 1Z5ZA 4E5UA 5JLJA 1KI1A 5DI3B 3ZS9A 3H1TA 5CIQA 3THWB 1R6BX 1Z0AA 3KTAB 2DWQA 2GJSA 3NVAA 4EPWA 2GXSA 1I4TD 1NN0A 1S96A 3VFDA 4IXMA 3PJRA 3RWMB 3IILA 3PITA 2ZI6A 5EP1A 1E2JA 3BS4A 1QHNA 5AJYA 3N5CA 1GRRA 2NTYC 1Q21A 3DKVA 4TYWA 3KQHA 3H2YA 2ZRGA 2YKGA 4LJ5A 1YZGA 4BASA 4L8GA 2PX3A 2CXXA 3EXAA 4KV9A 5DIFA 4LC0A 3GLHA 4YQFA 3IHLA 2AX4A 2WAXA 4V02A 2ZE7A 1FTSA 5L3SB 3GLIA 1M7GA 1DG3A 5CB8A 1XXHE 4XD7D 3VNUA 5H1YA 2ZR9A 3QVVA 1GKIA 4RVCA 5EXTA 5F9FA 2A5DA 4RD2A 4QHTA 1UEJA 3MSXA 2GESA 2BHRA 2VO1A 2O8FB 3SN6A 1KO1A 3JVVA 3EZ2A 4LV6A 2GZAA 4HLCA 3BJIC 2JIZD 4AWXA 5F9HA 2IA5A 4JYBA 4A6XA 4JLNA 3MAAC 5FUYA 2ZI3A 1KDOA 3P20A 1T91A 4M9ZA 2ZETA 3NBFA 1TPZA 2ZVQX 2C8VA 3CRQA 4RD0A 4CVNA 2NO7A 2OXCA 2C95A 3W3AA 5FTKA 5KPJA 1VIAA 2ZSBA 1R8SA 1LS6A 1VG8A 3OE7D 4BZXA 1HH4A 2GBLA 2ZR0A 5JHHB 3W3ZB 1CKEA 1E1QD 1GILA 1CULC 4G5QA 3AV0B 4PHFA 3IIKA 2O0JA 5C46F 1KSHA 1NVUQ 3RAPR 3SHWA 2RGAA 3JZAA 1NG9A 3WYFA 3B1XA 3GEHA 4MGZR 1G8FA 1CJTC 4URZR 2ZJOA 1E2HA 1HQYE 4IOLA 2J45A 4Q00A 1C4OA 3DZ8A 4MITA 4JMPA 5TMPA 4B71A 1XPRA 2VF7A 3KXKA 2ZJZA 3LFUA 3PUVA 3CWZA 3W5JA 2DB3A 4M1SA 4OQNA 1G3UA 3R9IA 5L8VA 3KX2A 3E70C 1Z0FA 1KY2A 2G77B 4XWKA 4B47A 1CU1A 1FW6A 2BKUA 2I3BA 5HZKA 4TWZA 1U8ZA 1OXXK 4E07A 1NKTA 4IDNA 2VSFA 4PZZA 2JLUA 4GMDA 3Q9LA 3UWKA 3KQNA 1G9XA 5J47A 1KI6B 4O2RA 2BKEA 5AR1A 4W5JA 3UWOA 5TB5A 721PA 4DHEA 1G4AE 1DEKA 4LJAA 3KQUA 3B13B 1DVRA 1WMSA 1F3OA 2R9VA 5FFMA 3IBGA 2P2LA 3IUYA 2CL6X 4OI0A 2QM7A 1BOFA 1F5NA 1E0AA 1E9AA 1KAGA 1SHZA 4B73A 2IYWA 3QI2A 3QG1A 4HZUA 2GDJA 3EZ6A 2VRWA 3Q5DA 3L8YA 2UZIR 5EE5B 1YZTA 4JLVA 1GNQA 1LNZA 1HT1E 2D74A 2H57A 3BORA 4W5WA 4B3XA 3R9XA 2RAPA 3B1WA 3T1OA 3WHLA 1Y3AA 4Q4JB 1C9KA 3CM0A 2EFEB 1JR6A 4GFDA 4EFLA 2IYQA 1XD8A 3TAUA 2AL7A 3HPRA 4A0RA 3I5YA 4AYWA 2Q0HA 1ZUHA 4UXJA 2KWIA 3HP1A 1TF7A 1JAHA 1ZD1A 1E6CA 4R9UC 4UNQA 2FSFA 2QI9C 1Z07A 3UMRA 3OZXA 3QPWA 2QPTA 1U0JA 5KSOA 2XOKD 1Z3IX 4GOXA 3VR2A 3HU1A 3X1DA 4BECA 1P2SA 4JLDA 4PFSA 1T6NA 1OFIA 4P4UA 2DWPA 2QL6A 2RB4A 3EIHA 3GEEA 1WBBA 2NOAA 3C7KA 3KKOA 4QFMA 1X1SA 3K9HA 4TL8A 4TYQA 2CVFA 3AF2A 1DAEA 1XEXA 4TMTA 4E03A 1U81A 4ZPXA 2IS2A 1E9BA 3WMEA 3Q85A 1N0VC 3TBKA 2CK3A 4IEIA 4TL9A 3ZIAD 4F38A 4RD6A 3EW9A 2QQEA 1DPFA 2W0MA 5JI2E 1IQPA 2OFXA 3FHCB 2MSEB 1G7SA 1HE1C 3KZ1E 4DDVA 4ZIRB 2PJZA 4P3YA 1KDRA 2BBSA 4GOJA 4LC1A 3FB4A 1IHUA 3ND8A 4JL5A 3AVWA 3QVUA 3GLFE 5D3MB 5A5GA 4WVFA 2HLDD 2F9MA 2VYFA 4LDJA 2IF2A 2CL7X 2O8DA 4D26A 3AKCA 5FBVB 4C0LA 4A2QA 2AN9A 4JLMA 2GETA 1UADA 2G3YA 4N1AA 4CEJB 1DAGA 1D5CA 1LW7A 1M1YE 2A5FA 2B21A 2IK8A 2HF9A 4Q01A 3PFIA 3RC8A 3U4QB 2VHTA 4BFUA 4C0JA 1WP9A 4BE7B 2GZHA 2FJUA 4QJ5A 4R7ZA 3AEZA 4F4CA 5KUTA 2AXNA 1AS0A 4KU4A 4DDUA 3E2IA 4KYIB 3DEFA 1G8HA 1Z8FA 3K0AB 5L3QA 1Z0IA 4F4JA 1NVVR 3QE0A 1JEEA 4LHWA 2RCNA 4ZCLA 3HYTA 2P65A 1IN8A 3LW7A 4OBEA 4PX9A 3VU9B 3MWKA 5FOVA 3AUYA 2ZJBA 3QQ5A 3RWOA 4JJKA 3GLHE 5EQTA 4B76A 5B64A 3DMDA 2WM9B 2C9OA 4A36A 3K0CA 1IN5A 1L4UA 2QUZA 2W2XA 5FUWA 4JVLA 1QG2A 2RGXA 4FWIB 3LV8A 1UDXA 2C9YA 2YHSA 1FQJA 4LI0A 3WRYC 1A1VA 2B7CA 1ZU4A 5FTJA 3AF0A 3U3OA 5TVKA 2QE7D 1IN4A 3FMIA 1GM5A 4TMKA 1QHSA 3B85A 5JSZA 3PEVA 1SKYE 2AD1A 1BMFA 3LD9A 3RVBA 2OLKA 2GF9A 4DLXA 3WMFA 1K5DA 4YDSA 3HYRA 2ZYWX 2WOOA 3JZMA 4PXAA 4WZ6A 2H92A 2CHVA 3VR4A 1DG1G 3QKUA 4FCTA 4QOSA 1VHTA 2PH1A 2N42A 1MOZA 2C2HA 1A2BA 1E96A 2R6DA 2OBLA 1M7BA 1EGAA 1E9EA 1FMLA 5J5CA 1LF0A 3U3RA 2O0HA 5JWRA 1XB2A 1IJEA 2NG1A 1UKZA 3TIFA 1E0KA 2KSQA 4ZIRA 2WJYA 2G1JA 3ZDQA 5EUMA 3U3MA 4DCUA 5BN5A 3ICEA 5FBRB 1G5PA 5IK2A 1DOAA 1IXZA 1XD2A 1EFTA 1E94E 4TLCA 4OQFA 2XGJA 5C2JB 4V0LA 3KB1A 2QE7A 2BMEA 2FGJA 2BMJA 4Q7KA 2VH5R 3CONA 2AKAB 2ZANA 4NCJA 1K5GA 3DHWC 4DLTA 1N5KA 3H84A 3CR8A 4MRPA 2LWIA 3VR3A 3A6PC 4JS0A 2V1XA 1W2HA 4TMWA 3FFAA 4B44A 1YR7A 1OF1A 4ZDWA 5B30A 3AF1A 3NH6A 2PMKA 4KFSA 1P4SA 2BDTA 2A5GA 1TF5A 4IDQA 4AYXA 1Z6AA 2IS4A 1II9A 3ZQ6A 3OHMA 4EDHA 2P5SA 3LQQA 4I99A 2GCOB 1WA5A 4HAVA 1L8QA 2ZYUX 2FWRA 2J7PA 3FFBA 3ETLA 1KY3A 3SFVA 1QHXA 5E3HA 2OFOA 3LAWA 2DFNA 2IYSA 2QPAA 5KHOC 1JALA 1RKBA 1Z2AA 1RYFA 2Q9AA 1M6NA 1U9IA 5EXSA 4FMDB 4TYPA 4Q48A 4KO8A 4QC2A 2JLWA 3QXSA 1J90A 2E87A 2FSHA 2ZSAA 1RJ9B 1YRAA 3SI7A 1TU3A 3EPHA 1LTQA 5JEEA 3BK7A 1KI4A 3I5XA 3DO6A 4NCIA 1NSTA 1YR6A 1SVSA 2WMNB 2JLQA 3MLEA 2WKRA 1JJVA 3HJNA 4EKDA 1CRPA 3PUWA 2PJRA 3AVXA 4M2LA 1U94A 2JDID 4ESHA 1BO6A 2ODBA 1NBMD 4XSHA 5E7JA 1Q12A 3U4QA 1SVKA 5HE8A 4GP6A 1ZNXA 4PR0A 4US1R 3REFA 2O8CB 1U0LA 2ZI5A 1X8KA 4MH0R 4YXWA 3PCRB 3C4JA 1IN6A 5JECA 2WJJA 5FL7A 1P9WA 2IW3A 3KKNA 3OEEA 4A6PA 4ZDIA 5BN4A 4TMZA 4CEHB 1AKEA 1XPUA 4KCGA 621PA 4IVRA 3RYTC 4DXAA 1E9FA 1P61B 4GPTA 1E79A 1VG0B 1ZD9A 1D9ZA 3CF2A 1US8B 3AUXA 3RS7A 4AIIA 1UFQA 1RW4A 2ZS7A 2IUSA 1CJVC 1IY0A 3CX6A 4I1UA 2QAGA 1KMHA 1UKYA 4ACAA 2IYVA 2F3TA 4Q19A 4BRWA 2O52A 2QRZA 2R6FA 4PC1A 1XP8A 5FH9A 3AGQA 2QA5A 3U44B 3B2EA 5LB4A 2V1UA 2ANBA 4URVR 2ZM5A 3LDAA 1LFDB 1OFTA 4Q02A 3O8CA 4U00A 1CXZA 2ZSEA 3ZH9B 1ZM9A 2GJAA 3GEIA 4IDPA 2OCAA 2XTZA 3Q3JB 4TLAA 4UXIA 3K09A 3CR7A 5FL7D 2IYUA 4FD2A 3CO5A 3SC3A 2OBMA 5GVRA 1DAKA 4DEYA 3OIUA 2WWXA 2AK2A 3V4RA 2W0SA 2A3RA 2Q9BA 1QZXA 3BB1A 3M4YA 3UMSA 4FIDA 1Y63A 2FNAA 5F98A 2EYQA 4DJTA 1CR0A 4KSCA 4DCVA 5CM8B 1IONA 2J3EA 3QBTA 3QXHA 1W36B 2K5UA 3K70D 3TNFA 5B57C 3LVRE 3NKVA 3EARA 2IT1A 1ELOA 2QAGC 2WSMA 3B1ZA 1KDPA 4MKFA 2WWHA 4AKIA 4XWAA 3SQWA 2AD5A 3LA6A 3HDTA 1DADA 4JT2A 2VEDA 2QSZA 4W5HA 3GQBA 4YMTA 1OB2A 2JIZA 2B8WA 3I4LA 2ATXA 5JZVA 2NO0A 1EG7A 2GTPA 3UKDA 1N0WA 2W58A 3RSOA 2ZRKA 4Q7LA 5DN6A 5GADl 2IL1A 4MYTA 1I4DD 4BFSA 1J99A 3TJZA 3LO5A 4NYJQ 4HDOB 3THOA 3W6NA 3GJ0A 2CE2X 3HU2A 2WAYA 1ZM7A 3WNCA 4C7OA 5JJIA 1X6VA 2JLRA 2NMVA 3N70A 1JAIA 5AWFC 3PENA 2GAAA 5LD2B 2NO1A 2J87A 5JWHA 3ZVLA 4RFSA 2ZRLA 2FSIA 3L0SA 2ZRPA 4BUJA 5C1BA 3C5CA 1Z6GA 5HR5A 1MO6A 2IEYA 2V54A 3T34A 2O8DB 1AA9A 5DH9A 2J0SA 2QT1A 4G5OA 4QJ3A 4NCKA 1J7KA 5FPTA 2Z0MA 4BLQA 1U9IC 4EPXA 2N1BA 1RYHA 1XTRA 4TZ0A 1X1RA 1E4VA 2X1VA 3RSLA 3B7GA 1MH1A 1RJ9A 1SULA 1FZQA 1W4AA 4GL2A 5HZHA 2V6IA 4Q21A 1VPLA 2AHOA 1TNDA 1VG9B 2JASA 1F60A 1MO4A 3H4MA 4PHTA 1XU4A 3TE6A 3QBVA 1R8QA 2YYZA 3TMKA 5AJXA 3VR6A 2CK3D 2WPDD 1JI0A 1N2CE 4IDHA 4ASUA 5AUNB 4OHVA 1TAGA 1OFHA 3BH0A 4BLTA 1X8JA 3RRNA 4Q9IA 2KI5A 1DE0A 1QF9A 1NN3A 5KSYA 1TX4B 4HLUA 1JR3A 1KI2A 4FCWA 4JLKA 4JJZA 1TQ6A 1XEWX 2D4HA 3BFXA 4DIDA 3L0OA 3NDPA 5LDDC 1A5TA 3SYLA 1COWA 1PUIA 2W6ID 2AXPA 2YC2C 1CF4A 1XNJA 4F91B 1S3SA 2ZUCA 5KDOA 2GWHA 2VSXA 3WYGA 3GMTA 1DS6A 2UZ3A 3EX7C 5DI9A 3T61A 1OHHD 5AUPB 3IGFA 2A5YB 5FI1B 4JKYA 1W5SA 3TVTA 3KL4A 3QKSA 3RS3A 2OV2A 1S9DA 4NYIR 3G0HA 2PMDA 3RS0A 1D2MA 4ASUD 1MT0A 3KDSE 2F1JA 2IUTA 4EAQA 2HCBA 2W2VA 1W0KD 3BAFA 5LB2A 3T35A 3TSZA 4IVQA 1KDTA 4HZUB 3L8ZA 3NBZC 2NPIA 1BYIA 2YOHA 2ZU6A 2QPOA 3U7HB 5FTMA 5LBIA 1XEXB 3TSOA 3SJBA 1EX6A 4M1MA 4RJLA 4TMVA 4GSYA 2ZE5A 1G5RA 5K8UA 3QJYA 3B9PA 1NBME 4QL3A 1CJUC 2V7QA 3OESA 3EPKA 2ECKA 4UNSA 2DBYA 5JHGB 1XZQA 1A4RA 5FOUA 1BIFA 3IDQA 1M8PA 1YJ5A 4TN1A 4BEBA 2ONKA 3THWA 5K8TA 3FHOA 4I4LA 4YMVA 3GFTA 2OHFA 4B2LA 3IPXA 4BEJA 4HUQA 1N3BA 4G1UC 2ZAMA 5CK5A 3OIYA 1WF3A 2CVHA 5FTLA 5JRZA 3EG5A 2MSDB 3ADDA 1SZPA 2REXB 4MDEA 3UG7A 1KI6A 2VHCA 1UF9A 5FUXA 4TZ6A 2H1LA 2WJIA 1OXTA 2BBOA 3U7GA 2UKDA 4KVGA 4X8LA 3QOFA 2FOLA 3RDPA 2RMKA 4TQUS 4DWJA 3MG9A 1Z83A 2J5XA 3MJRA 3L0PA 1LF5A 3KQLA 3X1YA 5K8IA 3AP1A 4HAYA 4M0LA 4GOKA 2CE7A 2ORVA 4XTRA 4BWYA 2ZPTX 4Z8XA 1KSJA 4D81A 4B3GA 1LS1A 2HXSA 3K1JA 3UMFA 2FPLA 2V3CC 1AKYA 3DZDA 2C78A 4AG6A 4EPRA 3DL0A 3BIFA 4PC7A 4RZ2A 1VCOA 4L15A 1NL3A 2NZ8A 2HF8A 5GJBA 2BC9A 1EX7A 4P33A 4JVMA 4M4SA 1P72A 1FL9A 4DIEA 3T15A 3QXJA 1NVXQ 4MDFA 3FMPB 3N2EA 2KB0A 2IS1A 4D4JA 1JPJA 3R8FA 2BJWA 1Z63A 2OO7A 1BMFD 4WW0A 5TY0A 2CHQA 4TQ9A 4HB3A 3QUSA 4D4KA 4OI2A 5BYKA 3C41J 3RRZA 3K9NA 3CNLA 1OE0A 1GL6A 1Q1EA 2SHKA 1FTNA 3MJHA 3QNUA 5BW8A 1QHIA 4P31A 1TEVA 3BRWD 1UEIA 2XXAA 4XVQA 5FPYA 3T5DA 4A2PA 2ZRDA 2NIPA 5L3SA 2VP5A 3GLIB 5DLQC 2IYTA 1HT2E 4HAXA 2J0UA 3BH6A 3EASA 2H16A 4A8JC 4CIDA 5E7IA 4HAZA 5CJPA 1E9SA 3KUDA 2QMEA 5AK0A 4DUGD 4CEIA 2CLCX 3AKEA 4RCZA 2GA8A 3SZRA 1FX0A 5IK2D 2GF0A 3CH5A 1HQCA 4B3CA 4QHYA 1W4RA 1NBMA 3I72A 2ZR7A 1UBCA 3EC1A 4DSNA 2XXAB 4W9MC 1W49A 3PUZA 5KTYA 2EFGA 5G53C 4TSFD 4CEHA 2OESA 4BZPA 4YXWD 4LPKA 2GILA 1XXHB 3IO5A 1W4CA 3OEED 3UANA 4BFYA 5JI3E 4M9SA 1TQDA 3VX3A 3IQWA 1Z6YA 2V8OA 2KJQA 4LZZA 4C0BA 1N6RA 1K8RA 3ZJYA 2DFTA 4X8MA 5JS7A 3SNHA 4WXPA 2AK3A 2O8BA 2F7SA 2ZRCA 5DYGA 2QAGB 3R7WB 3IBYA 3I1FA 1W36D 1N6IA 3HR8A 4M1WA 4MKIA 5IDVA 4W7SA 4DUGA 3RANA 1F48A 3H0KA 1FFHA 1V5WA 2PT5A 3LWNA 3I32A 4C2TA 3KTAA 3BWDD 4O0MA 2O0KA 1G17A 1JR3E 1WE2A 3EIEA 1DBSA 1PLLA 4A0HA 2FZLA 1KO5A 1S9HA 2VL7A 4PZLA 4YC7A 1CR4A 2WVJA 4ZKDA 2GHIA 4HYYA 2VA8A 3A4NA 3LX8A 5BQ5A 4DSTA 2Q6TA 3DM9B 2VPPA 2ZUBA 1S2MA 4JKIA 1E0SA 3D7MA 2RHDA 4LRWA 4MGIR 1P9RA 1CIPA 3EAQA 3PUXA 4G01B 4Q5IA 4U7DA 3VU9A 1OXVA 4JIMA 3VKHA 1IXRC 1NY5A 3NC0C 5GJWC 1R0XA 4UNRA 2XNSA 4U5XA 1Q0UA 3CZPA 4OI1A 4LHXA 2ZAOA 2FF7A 3CW2A 4KSBA 1QBKC 1TMKA 1ZVQA 3D8BA 3U44A 2YWEA 4BQSA 5JJLA 1I4LD 2GBLC 1PUJA 2WV9A 4OHWA 4G3XA 1M34E 3KKQA 1YU9A 4L9WA 3CB4A 4PHGA 2O8CA 1CTQA 3FE2A 2X2EA 2W83A 4B6FA 1FNNA 5G3ZA 3VHXA 4IOKA 4V0KA 4MRVA 1AZTA 1OFUX 1P73A 4FMDF 1N5IA 1KSGA 4A1FA 3B8HA 3B78A 5A4JA 3WNDA 1MKYA 3EZ9A 1MO5A 2OBNA 1N5LA 2BCJQ 4M1YA 1YQTA 2FU5C 2VBCA 4FINA 3A36A 1ZC4A 2Z4RA 4BFXA 1IJFA 3WY9A 3MD0A 4BRUA 3I61A 1VYVA 3BOSA 1L7VC 3LXRA 4OQMA 4RZXA 3MWYW 1R10A 1MABB 1WXQA 3KQKA 1WB9A 4C0SA 4RZ3A 1GNPA 1D8TA 3B6EA 2A7QA 5JMTA 1ZCBA 4B2PA 2JJ8A 2FZ4A 2ERYA 4RFSB 2MSCB 1NSFA 2WICA 1IY1A 3DDCA 2F6RA 2BOVA 2QTVB 3IEUA 4M1TA 5E95A 3V4FA 2W6JD 4U02A 2JJ2D 3OAAD 3UG6A 1HA3A 1G19A 4Q4AB 3PQCA 2FH5B 5GJVC 3CX8A 1KOFA 1LVGA 2DWOA 3AVPA 1RRFA 2W00A 4F93B 2YVUA 5C4GB 4MYUA 4FW9A 1ZRHA 3T1VA 1LB1B 4B48A 2MMCA 1QDEA 1J8MF 8OHMA 4DSUA 2PL3A 3V00A 1RIFA 4B3DA 3ZVNA 2GCOA 3D3QA 1JEDA 3F0TA 4LJ9A 1G18A 1IAQA 1ONBA 3AQ4A 1D2EA 2O8EA 3BE4A 1XMJA 1LY1A 1GKYA 2XITA 5FOXA 5SZJA 3FHTA 4KODA 3Q5EA 1UBGA 2P6NA 1NMZA 1PLJA 3V9PA 2ZVPX 1NIPA 1ZM3A 1KMQA 4DLUA 4F92B 5KSZA 3AF3A 1G291 2GNOA 2ZE8A 4BFZA 1IY2A 4DSOA 2X77A 3C5HA 3ICQB 4LBWA 4TTRA 3THXB 2XZLA 1WRBA 2CMKA 1Q20A 2IYYA 4O25A 1Z2CA 2JJ2A 2JEOA 3OAAA 4PTLA 5DN6D 2NPFA 4I81A 4AKGA 1KI8A 4JT4A 3B60A 3IO3A 1IXSB 2VP9A 4Z1MD 2VTKA 2ZEJA 3FKSA 3NXSA 2PBRA 3KFVA 4H1UA 4NPHA 4PPFA 3VKGA 2GKSA 1HURA 2ZS9A 1X8LA 1HUQA 4C7OB 4YMWA 4WAUA 3VR1A 3KKPA 1AGPA 3GD7A 4JYCA 4DLVA 2ZUDA 3SBEA 4FXPA 3VR5A 1GRNA 4DDTA 1DAMA 1RE0A 3NHAA 4LYHA 4NTZA 4P4TA 1OHHA 5ANRB 3A58B 3UIEA 3X2SA 1RC8A 2O8EB 4NU0A 5G40A 3U3KA 1G64A 3CF0A 4JSTA 3T12A 1SVOA 5KNCA 4QG7A 3SYNA 2RHMA 1CRQA 2AFIE 2FA9A 4FMCB 1CEEA 1QVAA 1ZCAA 2Q9CA 2WWFA 2OLJA 4CT4B 4WOPA 2XJ4A 1OXSC 3KKMA 5EXXA 3W5IA 4PO1A 2ZRHA 2ZRMA 1NIJA 3REGA 3WNBA 2WTUA 2GEUA 1D6JA 2ANCA 2IXEA 2IYLD 4OKSA 3KJEA 1O3YA 4B3FX 4HSEA 1JJ7A 1GL9B 2A30A 2R2AA 3BH7A 4POAA 5IRCD 1EK0A 4JLJA 2QGNA 4KFTA 1HYQA 4IRUB 3ZLJA 2CEAA 4LJ7A 3OEHD 4QHSA 4M9QA 1U8YA 4NYMQ 4C0HA 4DZZA 1XTKA 3WP0A 3VHLB 4PC3A 5CYPA 4IXNA 1OPXA 4QM6A 3K0AA 1AM4D 2W2TA 4EFMA 2XAUA 2F1IA 3I8XA 3AP3A 3MFYA 1V43A 3A37A 3QENA 5DISB 2R8RA 3WBJA 2C03A 1AK2A 2ZI7A 4RY2A 1M7HA 2H7VA 2EFDB 4ARZB 2WMOB 3B1YA 1A2KC 4DB4A 3DM5A 4TT3D 1JNYA 2VP2A 5EP3A 4CGZA 5FOSA 4BZQA 3AM1A 1AIPA 2CDNA 5FPKA 1OXUA 3MGCA 1AJEA 4MRRA 5J4LA 4DCNA 5J4YA 3SS8A 1E0JA 4A2WA 3U2QA 4B3BA 4KVAA 2WKPA 3SJAA 4YLGA 2XZOA 3NG1A 2QP9X 1GFIA 3BFKA 4HAWA 5CIWA 4KFUA 3CKLA 4NCHA 5EP2A 4B75A 4Q7MB 2ZU0C 4V0MA 3CH4B 1Q22A 2ZREA 1VYTA 4LYJA 3NH9A 521PA 3C14C 3U7EB 2QMOA 4RKEA 4HLQB 2QTHA 5H70A 4UNNA 3AVYA 3LBNA 4AKEA 2Y8EA 1XCGB 1R5OA 2ZYTX 3MRSA 5BN3A 2YWHA 3GJ3A 2N46A 3NTUA 4LWZA 4B35A 4XH9B 4NHOA 1RRGA 2RGGA 2XTNA 5FI0B 1RFLA 3K9LA 3FMOB 2CCJA 1GL7A 1T0JB 3ADBA 4EFNA 2A78A 1T5IA 1PLKA 1RRCA 5C4MA 4EUNA 3CNNA 4TQAA 2QENA 1NG1A 2TMKA 3KXLA 4KBGA 2FFBA 2XZPA 3LNCA 1G16A 4UJ3A 1XF9A 1QHHB 2FSGA 2JLVA 4LHVA 3CRVA 1OIVA 3QPUA 2R62A 5HCNA 2RGBA 4URUR 4DLZA 5KU1A 1W0JD 3I73A 4JL8A 1O87A 1T5LA 5IHPA 4PZYA 5BXQC 3P4YA 1YE8A 1S3GA 1TF2A 3TW4A 1U98A 4A4DA 1SXJC 3PR1A 4Q1AA 4NYIQ 3E1SA 5GVSA 2OEPA 1GTVA 2ZJYA 1JPNA 5KSPA 1IM2A 4ABYA 3GLGA 4PANA 1VDZA 2IS6A 1F2TB 1AQYA 1HE8B 5EZ6B 4A0GA 2BCGY 1FX0B 3AKDA 4PHHA 2VIIA 4BLOA 1GNRA 1N6HA 3BC1A 3VNVA 1GP2A 4P0TA 1VCMA 2LKDA 5DYIA 1R4AA 3GFPA 4KXFB 5FTNA 1EFRD 4B34A 1KIMA 1NF3A 1PZNA 1Z0KA 3D6TB 2EWVA 5G41A 2HT1A 1ANKA 5DHAA 2NZJA 4ON9A 2VQSA 4DC9A 4PSAA 5AJZA 2Q3HA 3KJIA 5EE1A 1XJQA 1II0A 5UKDA 1TEXA 2KBEA 4CW7A 2CJWA 3IPYA 5FUVA 1KTVA 5DHFA 2R65A 3TRFA 3GPLA 4QBIA 1NJGA 1C1YA 4PC6A 4EPTA 1U2RA 1WDTA 3CBQA 4E22A 1S4QA 4PAQA 3LLMA 1OH5A 1E2FA 3TW8B 3IKJA 2CHGA 1GITA 3R9WA 4G0NA 1E32A 3LW8A 3RRYA 5CDFA 4Q1BA 2BMFA 3WMGA 2LCFA 4YMSA 1KJZA 2HYDA 2WSSA 3EZ7A 3SJZA 3EA5A 1I2DA 4RCYA 2FEMA 4LOAA 4RFVA 4Q1FA 1TU4A 3ZYCA 5AUOB 2OM2A 2ZITA 3FOZA 4DEXA 4HZIA 2IXFA 4QJ4A 1CR1A 2ZJ5A 2ZRAA 2QBYB 5DSZA 3Q72A 4WBSA 2RGNC 4Q9KA 1W47A 5HKKD 3GLIE 2QGZA 1P3JA 2PT7A 1PV4A 1G8YA 2ZQ5A 4MYHA 1YR9A 2ZE6A 2KE5A 4NP6A 1Z47A 1KO8A 3OIVA 1Z28A 2GK7A 2J7KA 2NQ2C 3FKQA 3QY0A 4IFBA 1SVWA 3VAAA 4PO9A 5JFGA 1X86B 4D4MA 3W6OA 4OK3A 1EFHA 1NP6A 2GAOA 1GDDA 1II8B 2C98A 2GJ8A 4KI0A 3QXXA 3GJ4A 4DLWA 1XBTA 2G6BA 1XTSA 2WBLC 4D0GA 4NDZA 4P4SA 4ZDKA 1XRJA 3BD9A 1MRNA 1G6HA 1R7RA 3ASZA 4JLAA 1Z08A 3CLVA 4ZDJA 4MA4A 1NLZA 3L0IB 2IYXA 3SOPA 3QKRA 2Z6VA 5JCZA 3GJ6A 2QG6A 1NJFA 3X1WA 2G9NA 2Z83A 1KO4A 2OT3B 4ZCMA 1T4GA 5HKKA 5GJCA 3O8BA 1JXOA 2WJHA 2G1KA 1AS3A 2RGEA 1MRSA 2WWIA 3HR7A 4X8HA 2ODWA 2YWFA 3BGWA 3TAHA 4UKDA 3RC3A 4S35A 2GJ9A 3C16C 2WWGA 2OAP1 1NN1A 1ZUNB 1K6MA 1L2TA 4C3ZA 1II8A 1OB5A 1KJYA 4XVUA 1G4UR 1OLOA 4CF7A 1UKEA 1H8EA 1OKKA 2O8BB 1E2NA 3T06B 1T3LA 4V0OA 3SFZA 3AVOA 2ZSFA 5L3QB 1H8HD 2OCBA 4JSYA 2D2FA 2P6RA 2HJGA 2QTFA 2GVDC 4IOMA 2OZEA 2IBMA 1DAHA 1P75A 1YZQA 1G3IA 1G1MA 2D06A 1P2TA 2XX3A 4GBMA 2GXAA 3W6PA 5CLLA 2IF0A 1F6BA 1KJWA 3DVLA 3CWQA 4MRNA 4URXR 1BYUA 4EJSA 2DY1A 3IQXA 4Q9LA 3WBKA 1RRPA 3LXXA 4Z1MA 4TYNA 5LD2C 4DB2A 3AVTA 1B23P 1GRQA 3F8TA 3RNLA 1ZM2A 2WPDA 1NVWQ 2FGKA 2YC4C 121PA 2O5VA 1W1WA 1PVOA 1E2GA 2RGCA 2W6JA 3ASYA 4LBYA 1OW3B 1TL7C 1JECA 4EPVA 2JLYA 4PQYA 4KLNA 1JR3D 3U61B 2G0NA 1VCNA 4GZMA 3C15C 4PO8A 4NH0A 4Q4HA 1E9CA 3P1JA 1D2NA 3DPUA 3ZZ0A 3U7FB
chains in the Genus database with same CATH superfamily
3IBTA 2OFWA 3P4UA 3N53A 2I1VB 2OG2A 2W6IA 4LECA 5DCYA 3W04A 2LW7A 3FF1A 3UMGA 3ZVMA 1BEEA 4OA5A 1J8YF 1KMNA 4UJ5A 3AP2A 1M2NA 2CB9A 5CM9C 3OX2A 5SYMA 3DBHB 3NT4A 4N7RA 4XWOA 3JQDA 1JRLA 4J4BA 5K3CA 2VHQA 3SE7A 1CNMA 1T9AA 1CVRA 1P1RA 4AJEA 1ETHA 3U4CA 1NF8A 1W5AA 2YIMA 1A82A 4ZVQA 3SZGA 4WECA 5EZ5A 5FV4A 4UOEA 3DE0X 4MLZA 3UYKA 2D5LA 4DIMA 3UENA 2JGKA 5CFRA 2I1WA 4ZZ2A 3PQ6A 3IJRA 1GPLA 1ZIXA 2QSUA 2EW2A 2ZCJA 1LDEA 1H2FA 4KWHA 1RBMA 4M1QA 1RRMA 1ETUA 1NFQA 2V7XA 3DWIA 4KQCA 3N2GA 2P9GA 1NYQA 1VL6A 5JBNA 1OH8A 2PA0A 3R3WA 3HDJA 1C9JA 5HILA 5BV1A 1XWIA 1AUVA 1H94A 1O96A 5C81A 1XMVA 3IKVA 4NWIA 4M3NA 2WOJA 3TKYA 2H4ZA 5DPMA 4MMZB 1Y4UA 1SU4A 4INOA 5K3DA 4C2UA 3ECCA 3QF4A 4UREA 1N77A 1IDN1 2YMPA 2PEYA 2PGAA 2WHXA 3BXXA 3JPWA 1CY1A 3GY0A 4XSGA 3TQCA 3WKAA 3PF9A 2BFOA 4Z4FA 4B6EA 1T1IA 3N2KA 2ICAA 4EAAA 3D1LA 1JEOA 1Y1TA 3PGXA 4UM5A 1GR0A 4Y0VA 4HNVA 5I6DA 5FLXA 4WK0B 4KPYA 3FDIA 1XTIA 1VM6A 1YD7A 3A3PA 1OZHA 1ACLA 1KO7A 1WW3A 2XA2A 2XQFA 3L1JA 4O02B 4X3OA 5FBKA 2PGJA 1D2CA 4ERNA 3CUEF 1ZBDA 3NVDA 5GY7A 1Q6YA 1WVGA 4X00A 2CXNA 2EBUA 2XB2A 5KOJB 1E77A 1WQ4A 3F4LA 2B7BA 3IOBA 4HH4A 5B1IA 1WW2A 3FYTA 2QN1A 1L5QA 3GXBA 3H17A 1ZYUA 4OHZA 4ZYUA 3VYUB 3D3KA 3MWLA 2Q45A 1N6OA 3PQ5A 4PNHA 5BRAA 1VP3A 2DYKA 3FROA 2JGJA 1KRWA 2HA4A 3SBOA 2ZBGA 3IAM1 4BKQA 2HUPA 3PQ8A 2F3SA 4KXXA 4R81A 3ER9A 2PANA 4R71A 2WU4A 1IUPA 4CM4A 2AUTA 2D2XA 4RNDB 5DWQA 5ESWA 4D0RA 4EWLA 1KMHB 2PEZA 3MMNA 1IVYA 1KAQA 3O83A 3FVWA 3ECAA 4RF2A 4V0SA 5FULA 4LJ8A 2CLSA 3UPDA 1VP9A 3FSRA 5JYEA 2ID7A 1YSCA 1FMJA 3W6ZA 3HDGA 1KL7A 3GRAA 3AEQA 2C4MA 2CLFB 1QRTA 1Q3KA 3S29A 5K0EA 1NULA 1V1RB 5DGCA 1MA0A 3B9RA 2OAGA 2Q3JA 1TW3A 3ABQB 1P7VA 3DOFA 4L16A 4Z54A 1SGWA 1XQXA 1MV5A 5FT9A 2HOQA 5SZHB 1S1CA 2YYSA 2XDAA 3MRXA 5AJWA 3E61A 4N0EA 3UT5B 2CGEA 4P32A 2F1HA 3EA0A 4FMBB 4BGUA 4J1TA 4P4NA 5LDHA 2X9VA 3OJEA 4ARZA 1SVMA 3GO4A 1XZEA 1ZMXA 5G4LA 4I4TB 1UJCA 3STYA 4C14A 4FFWA 1GZVA 2REOA 4OXQA 4Z3DA 5JXWA 1X9GA 4DFDA 2HMTA 4L07A 4AP9A 4OREX 4RGYA 1X1EA 3C8DA 2CMFA 2GAFA 3ABZA 3GJ8A 2FW0A 3EBLA 1WG8A 4GE0A 4WNCA 2Y6UA 5T6BA 3WZLA 2W93A 2ASVA 3I9KA 1U0GA 4BMPB 2UVPA 1GUAA 1Y3BE 1LX6A 4QGHA 5FBQB 3ZK8A 4KGZA 3EMBA 2X2FA 1CP3A 4RKWA 3F4BA 4KGXA 2HIAA 3PYMA 1TGYA 4OB7A 4W63A 1SXIA 2W4QA 1D07A 3NDBB 2ZZMA 1ORHA 4FU0A 1PO7A 1SCAA 2WILA 1QFMA 3H3XA 4KIGA 1E3SA 4DT1A 4WIAA 3M5CA 1P2VA 3CPEA 2Z56A 5TQ2B 2OZLA 4F3YA 3O8DA 1Y1LA 5E4FA 1NKSA 3GJ7A 3LZ6A 3PIDA 3AWDA 4TL6A 3CSUA 4JODA 5EHNA 4HUTA 1YDHA 2EZ8A 2HB6A 2H1CA 3W7AA 4BL5A 4LFAB 4CEJA 4D80A 3DDNA 3QK7A 5LP6C 3GJXC 2GJKA 3HC7A 4UDYX 2QOEA 3D4BA 4HDSA 3DPSA 3WQQA 2EFCB 4JLOA 4LHZA 4NMWA 4KVZA 1ULHA 3UWPA 2FN4A 2LKCA 4V1CB 1PDOA 3V8VA 5HRAA 3SM3A 5JHHB 1R0BA 1BKDR 3P2OA 4JZKA 1EB8A 5TMDA 2RGNA 3V1LA 5FBWB 1SC9A 5HOQA 3A8TA 1G3RA 2FPIB 2G5TA 2Z57A 2GXQA 4OBXA 3RYCB 1T3TA 1Y8QA 5DTRA 3NHRA 1JFSA 4TV9B 2BJVA 4BBPA 1UBNA 3NMUF 3FZNA 2PZJA 3RBVA 2Q2VA 1I6WA 3HN6A 1XMPA 4GRIA 4KQHA 4NPCA 1MQ8B 1KDYA 3SAJA 4ETIA 4PZDA 3RFTA 1JQ5A 3BGVA 3IXLA 1VIYA 5FR1A 4FDMA 2QYTA 4MWTA 5IUKC 1DC7A 5DRTA 1GRVA 3RC9A 3P0RA 4D6YA 3LTNC 1M67A 1TM4E 2V7GA 3EQ7A 1CZLA 1KETA 3CPHA 3LVFO 4Z53A 1IZ9A 1ORWA 2FY8A 1NZDA 2RKOA 4FKMA 1Q0LA 2WJAA 4GP7A 5EIHA 3LK6A 4E94A 2VDQB 1N2CA 4AKHA 1A4XA 1VG1A 2H1FA 3QWAA 2X2OA 3AVUA 4N0DA 4FT2A 3OT1A 3ZY6A 1EAYA 4FFLA 3FFTA 4KQ6A 3QIAA 3AHGA 3NDJA 3ZLVA 2C9CA 3NIBA 2AWOA 3OQHA 3H9JA 4JJAA 2CLIB 5GM1A 4UE2A 3AC0A 2X8BA 5CLGA 5IT9A 2EZUA 4Q3BA 1C0IA 1EUDA 5FOWA 1XROA 2GNAA 1G8GA 2ZJ2A 5LJIA 5AIAA 1UBFA 1HC7A 1IYZA 5DF1A 2IDKA 4LKOA 3RS4A 1HX7A 5JFGA 3Q1LA 1RJGA 3KKKA 4V0NA 4E2YA 5K03A 2H18A 4FCVA 2X6QA 4OLJA 2ZVDA 2FUG1 3ZW7A 4MPPA 5JNSA 1N6NA 3I34X 2IU3A 3L9WA 1I6MA 5HS6A 3NV9A 4M6WB 2VJBA 3LF2A 4QSHA 5DZSA 1LEHA 1MORA 4R68A 4O5AA 2YRFA 3ER8A 1OZFA 2W6OA 3KOZA 1O94C 5JRJA 4IUBS 1YH3A 1DKMA 2FFHA 3K0BA 5DHQA 5FPHA 2Z30A 4OQXA 4M22A 2C5FA 3CTMA 2LGJA 4LPSA 2ZT6A 1PR1A 5I7EA 3PNMA 1J8FA 3RODA 2WP0A 2CHFA 3PWKA 2O7SA 2FN7A 3M7IA 2V6JA 1OH7A 1QCDA 4QTZA 3MXTA 5FPSA 3NWOA 1ODCA 1UINA 2CN1A 5EHQA 1PJ3A 1VKZA 4NKRA 1AY0A 3NHKA 3PFBA 3DZKA 2QVZX 2PCJA 4XWYA 4DNPA 3RAEC 3THXA 3ADCA 3K2IA 3ZE8A 3FNQA 2WFMA 4JBGA 3VGPA 3C8UA 3H87A 1M6EX 3ICPA 4Z2AA 3DKPA 4B8YA 4K86A 4P86A 3PWTA 1JE1A 1WMDA 1HDOA 1NRJB 4HN2A 5DHUA 1P6QA 2QJFA 3BVPA 3LH5A 1KYZA 5TT0A 1JLHA 2WJGA 3EIQA 2MCFA 3EPLA 1USIA 4BJ1A 4F5WA 1QHGA 5PNTA 5CGZA 1KE2A 2H4WA 4EITA 5FFNA 3AUKA 2PRJA 5BR1A 1Y42X 1PU2A 3UICA 3TQFA 4F4IA 3AH8A 4H6WA 4LYYA 1CLUA 4ZYXA 1YFLA 3F5FA 4A0SA 4HI0E 4U7HA 4WOJA 4WUVA 3B2NA 3I4CA 4N65A 1SKBA 1Q1BA 4XPIB 2Q5OA 1E66A 4FI3C 2J9RA 3E23A 4PNZA 1P0PA 4UCWA 5A6VA 4Z0NA 3KPJA 4J0HA 3QLVC 3MBIA 4TTIA 2PO7A 4RMHA 3F1LA 2QX6A 1S6YA 2ADOA 1QHEA 4KH0A 5JJ5A 3W8RA 4I14A 4CYMA 1EM8B 2PUWA 3AM3A 2IX9A 1RMTA 2HU5A 3M6AA 2ZK7A 2XNKA 3BFVA 3KZXA 3B51X 2FWMX 3LSTA 2E0IA 1QE5A 4K26A 3KSMA 4QE3A 4XD7A 3IPLA 3QSGA 5FQNA 2PA3A 4IO1A 4Q4LA 3T9AA 5CB6A 4J8PA 3WGVA 4JYAB 4TTPA 3H5RA 3VSDA 5CFNA 5I9BA 4HDCA 4ZI2A 3KRTA 3RHZA 4A73A 3GLHB 3V48A 4RAOA 3ZHBA 2VPYA 1PTJC 4J91A 4DLRA 2ONZA 2JFNA 3RKUA 5ALOA 1Y4DE 2L0XA 4UEOA 5B3AA 1PBTA 1JR4A 2P69A 5BN4B 4C7XA 4Q4JA 2BWJA 5JS1A 1V7PC 4XDZA 4RIGA 2J48A 3HDYA 4B74A 1XYGA 1JAYA 1FU7A 1U80A 2AQHA 4BVFA 2OKGA 3EH1A 5I9SA 5ADHA 3TUIC 1C9MA 2GWRA 4FN4A 4X92A 2UAGA 3WWZA 1CDZA 2WIKA 3IT3A 1J2JA 1GOTA 1TKAA 4KN5A 1L5MA 4EHNA 1CERA 2ODNA 1CETA 1ZC3A 2FPUA 3BGDA 3SEAA 3UK7A 4EPYA 3HWRA 4GWGA 4RSGA 3DDUA 4DLBA 2VPWA 1V4NA 4JQSA 1YMVA 3EXEB 3RV3A 3DB1A 4UE3S 3F74A 2Y1LA 3HM9A 2WD7B 1EWQA 2DFLA 2C8LA 3G5MA 3Q3CA 1YZYA 1UP4A 2VTEA 3HZRA 3WIVA 3KVYA 1INLA 3DDSA 2HA5A 3OPXA 4QGAA 4FZ3A 3T3EA 4HXEB 3R3YA 4DVGA 4F46A 3PEFA 1DO0A 4G23A 4GT1A 3ZVRA 3KFXA 1D4ZA 5MFPA 2NU6B 1KOGA 2HK6A 1ZA2A 4M49A 1UAYA 5DSTA 1K8YB 3K2QA 2CCGA 1KY5A 1JBQA 1YIAA 4QXQA 1V8PA 1VJ1A 4JP8A 3CUWA 3BK2A 4QNRA 3HZHA 4D57A 2HF2A 1ZONA 1EK1A 4LKRA 1UDRA 3BWCA 3NTXA 4XDYA 3ADOA 2YJNA 2AB0A 4Q1VA 1CYDA 2IBTA 4ZCPA 1BFUA 1VI5A 1E1CA 2G80A 5DM2A 2OBXA 3NC4A 1AKTA 4NMXB 5JH7F 1WDMA 1YR3A 2QG4A 3O4VA 2ZXUA 2JLXA 1JXMA 3HFGA 4QFCA 3GDHA 3FSJX 1E2QA 4XCXA 5DGTA 3RARA 3ZHXA 1L8XA 1T5HX 3QNWA 3MIZA 4ENTA 3W8NA 2HK8A 3SE0A 1R0WA 1SKYB 2WIAA 1Z6XA 3CLUD 4QUJA 5AM5A 3L4JA 3LCMA 2Q2WA 1UBEA 4C0QC 1U3UA 5AVWA 1RM4A 2GFHA 3X44A 4EUSA 2G5CA 3L84A 1R0YA 2BBWA 3P32A 3GWGA 3NHPA 3W2FA 2VQFB 4MW5A 3PQEA 2FFAA 5EC8A 2GSWA 2WDPA 3H18A 1VPDA 3R6GA 2A0UA 2EJCA 5TDHA 1GZ5A 2HCRA 2X19A 4IJ6A 4AO6A 5EJEA 1XAIA 4KZKA 1WDKA 4B7CA 3T5BA 5B4TA 5I3CA 5KX5A 3FI0A 2L82A 5KKCA 1XL0A 2JARA 4PZAA 4LWOA 1IZ7A 1GAJA 5TV2A 1GG2A 1LVUA 4HEA1 5CP8A 4C7MA 4K88A 5HVNA 3KLNA 3AL0C 1DAFA 5JQGF 3IEVA 4Y3UA 3I39X 3A05A 1Y33E 3KXDA 3HZOA 2VF5X 3C48A 3H2HA 4OQDA 1L5LA 3CXUA 4CMJA 3BYZA 2ZTSA 5GV8A 5AVYA 1W44A 2GTIA 3G2HA 3MMPA 3U31A 3DHVA 1YR8A 3LBIA 4A03A 4HTFB 1CQZA 4BY9E 1DAOA 2IYOA 4KR9A 2LZ0A 3HWX1 1D7AA 1JG4A 1W48A 4IDOA 4N0PA 1U2GA 3U37A 4HAOA 3DEHA 3PVSA 3OE5A 4MPTA 3WOHA 4UOZA 1ZM4A 2YOGA 3EXHA 5A2GA 4D0LB 1CRWG 3M1IA 3FM9A 2QP3A 2E1RA 2FUKA 2WHPA 1QIGA 4NNJA 5JAZA 4DF3A 1Y3FE 2H4JA 2ZDHA 4OM8A 5M7EA 3BAZA 1VKJA 3OQIB 1S0UA 4HMPA 3ZX4A 5HIAA 4DLPA 1W8IA 4WJLA 1U2GC 3W06A 1NBEA 5E6RB 1S2LA 4Q3KA 3MHPA 4RF4A 5J2TA 1Z35A 5KYKA 1KGSA 1XZDA 5IAGA 1BCRB 3GLFB 3G9TA 3AUJB 3T7CA 1EQUA 1PFQA 1VLHA 4K6FA 1BA3A 3KJGA 5DLDA 4YRRA 3COYA 1BWSA 5DK6A 1SVIA 5A0FA 2E6UX 4HNQA 2VHEA 4FYMA 9LDBA 1SH7A 1VMDA 3TZ6A 3OJXA 3SSAA 2ZT7A 4REMA 5D3MA 1XQYA 3UHFA 2B4TO 3IAAA 3VPSA 3RUHA 3ETHA 1AGRA 5EE9A 3ZZTA 3COVA 4IKPA 4MTLA 4BYMA 2Q6LA 3LUCA 1HG1A 3WIEA 5JBQA 2ABWA 5KQGA 2AMLA 3A1VA 4Z9BA 3SC6A 1R8JA 1Z06A 4BV8A 4O4IB 1RR6A 4WADA 4N5DA 2DJ5A 5AK4A 4DLSA 4BAUA 4AY2A 3WQBA 4YYEA 3HKCB 1K97A 3G5UA 1HE3A 3L82B 4WCVA 5G02A 1XOIA 5C5EA 2F8TA 3KWFA 1BAPA 3ORYA 4DCMA 1T4CB 2WU3A 4NAUA 4IFEA 1HE5A 4DV7B 3I4FA 4EG8A 2X58A 1SEVA 4DANA 4HS9A 2JVJA 1H4VB 3AV3A 3GJ5A 4TZKA 1P4RA 2HTEA 4I3FA 3TR5A 3VR6D 1R66A 4OMCA 4ZU6X 1E5XA 2Q07A 5EE0A 3VR2D 3SR0A 2P9FA 4PYMA 4UUMA 4G0VA 1PGJA 1PW7A 2LIPA 1WXHA 4RHYA 2XVMA 3IERA 4Q24A 4RKFA 4X7RA 4C4RA 1XK6A 4BLPA 2ECPA 1G2QA 2CBZA 4Q9JA 4XWGA 4D9IA 3LVQE 1LUAA 3AB3A 4D4LA 3EWAA 3VJRA 3H1PA 4IOJA 1PS0A 4HEJA 3FUTA 2VDLB 3DTVA 4HFJA 5HCIA 3UJDA 1UIMA 2AFIB 2P6UA 3FPAA 2QMUA 1G8JA 3GX1A 3G2PA 2WF8A 1PR2A 5AHRA 3ZE9A 3T3NA 2VDMB 4RVHA 4LDPA 2B78A 5IJXA 3S2ZA 1T10A 4YDRA 2AH5A 2AOTB 4JASB 3N8NA 2PH5A 1SPBS 2HRCA 3G2NA 4RXTA 4BV2A 4DTIA 4PSKA 3JY6A 3H0EA 3IULA 5IN5A 1MH9A 1GHTA 2FDCA 2YH2A 1KK2A 4GG1A 5IKEA 4XEUA 4UHHA 1FFEA 1OLXA 2BEKA 3WA6A 4YDHB 5AJVB 4KWCA 5B58C 1PNTA 1KJ9A 2JGAA 3WHPA 4D8TA 2CL0X 2D5CA 4LZPA 2QUAA 1PZGA 1XTJA 4EQ6A 5H3LA 5ITSA 1AKVA 2CLOB 1QHYA 2JLSA 4C89A 4C9BA 5FNVB 1Y7LA 1W0KA 3RU7A 1XZHA 1CIJA 3PPVA 3EPJA 1MR3F 5MGNA 3DD5A 2ZROA 2D7JA 3EUFA 4ZO4A 4KITB 2BGKA 2AWNA 2R44A 2FLKA 3BERA 2V9PA 3U1TA 4DZTA 1VJ0A 3OKCA 3VZRA 1JH9A 1NSYA 1ITZA 1TUEA 1ISSA 2NZWA 3BXGA 1MXHA 2BDUA 1ZUD1 2HSWA 6Q21A 2ZRIA 2WWRA 2BHNA 1NRIA 3Q98A 1KSFX 5FL3A 3ZWVA 1GT6A 3SR3A 1SCJA 4QEZA 2C1ZA 3KOXA 2IXTA 4PZ9A 3LC2O 1WCIB 1XXLA 3BMXA 1STOA 1TU0A 3CNQS 4HB4A 5FBLB 5KYYA 4Q1CA 3RYCA 4RDCA 3V1TC 3ICWA 1XL1A 3JQBC 4R16A 1KIAA 4YEDA 5L3VA 4YAIA 1WMFA 4L0QA 3NGLA 1B0ZA 2IRWA 4LV5B 5ALFA 4KFRA 6CHYA 1NI3A 2ORYA 5IYZA 2H2IA 5I3ZA 1YTUA 2NSHA 5KTKA 3A9SA 3R0VA 3K0FB 1DI0A 3KB2A 2IWRA 4GMKA 4BFTA 2WVAA 4I08A 1E4YA 1P81A 2XSZA 3WK7A 4D6XA 4J7XA 2GBCA 3UJ8A 2Z09A 2CBXA 4BLSA 3RUCA 2X1LA 3E0XA 2DLNA 2PH3A 4KEAA 4NJMA 1GGNA 1ODTC 3QH4A 4OFXA 2O48X 4ARBA 16PKA 3EYAA 2HA6A 4MK4A 1YRBA 3C97A 3EC7A 4WN9A 5JSZB 3RSHA 3NWJA 4R3UC 3MQ4A 4ZGWA 4JC0A 1SMKA 3AX6A 4RVFA 1CEYA 5M5BA 4M1OA 4ZQHA 3LY5A 2OBFA 4K2HA 1XA4A 2PHZA 1IULA 1ZK4A 1FNMA 2Y1OA 2W8ZA 3IB3A 4RVGA 1Z0DA 3IDZA 3SG0A 2BEUB 1ES9A 1CBUA 3BSSA 4MJ3A 4P53A 2VP4A 5T4HA 3PXDA 4MSUA 3WSWA 4F5YA 3HNPA 3ZZMA 1WUTA 3CPJB 4I2NA 2AOWA 1SBIA 2DE0X 2GVNA 4UMVA 4CMIB 1D6NA 2VK8A 5C18A 3GQBB 4JLPA 1QM5A 4NYJR 1W34A 5F2EA 5IHXA 2ODEA 1D4OA 5HE9A 3DS8A 4PU0A 4QNMA 1XZPA 4GRAA 1SKQA 5EWLA 4RW0A 2Q50A 4BQNA 1A9SA 2OCDA 4O63O 1Y7PA 4L6AA 3FLEA 3ODPA 1TTTA 2JBWA 4GZ3A 5D5HA 3OBIA 3ETJA 1PEYA 2K2WA 2RHGB 5FA6A 1H2AS 2XMZA 4AZWA 4ZO7A 1DIOB 1O77A 1MJ5A 2J9FA 3D5QA 2QG9A 3O94A 4CL2A 4CEIB 3R6LA 3K4PA 2GD2A 2LCQA 2BM0A 3RVQA 3AZOA 4HQ0A 3OF5A 5B53A 1T5DX 1E69A 3ICVA 4KYUA 5CEEA 1U1DA 5JVDF 3KZNA 5JTTA 1ZVKA 1IWOA 3IUQA 3K0EA 5CG1A 5K0CA 3Q10A 4ZVKA 3RJ5A 3SLRA 3HJHA 4QLBA 3SQXA 1YL7A 2UYYA 2O8EB 4AK9A 1BE6A 1JBKA 3NORA 3AEXA 4IIXA 5BWLA 1HEIA 2AEEA 2GZMA 2I7CA 2Y99A 3EXFB 4P3OA 5IFLA 1OT3A 4X1KB 2J7PD 5DFAA 1RC0A 2DPGA 1UWLA 3KEGA 3Q0EA 4FXOA 1J56A 2OILA 1UMCA 1Y7IA 4C07A 4UM9B 4YRCA 8ABPA 1KI9A 2FMXA 3HU3A 1U7XA 4TMFA 3LQ4A 1C8LA 2F3QA 1YZFA 2CZQA 2XEXA 4OVKA 4S0XA 4XX1A 2UV8A 1JJIA 3ILSA 5IBQA 2O2GA 3N6RA 4G26A 3R7AA 1PR3A 1IOZA 1KAHA 2X41A 5IZCA 1RKVA 2O2CA 4JLUA 4MYCA 4U7PB 1YRWA 4FQ8A 5J40A 3SYRA 3UXMA 4EGJA 2XNJA 4RDIA 4K9PA 1B8OA 3ES9A 3FPBA 2HYIC 4FP9A 3IEKA 4YBZA 5K2MA 4E5UA 3W2TA 1EWKA 1P3DA 5HUHA 2VDPB 3ZS9A 5JLJA 1L5VA 1R6BX 2JRCA 3MAJA 1EXVA 1AO3A 2QLJA 3R0IA 2GXSA 2YMMA 2R6HA 3KQVA 1Z34A 1SQGA 2KS6A 5DHPA 2NV6A 3D8NA 3IILA 3PITA 1MIHA 3BS4A 1EVKA 4R1NA 2QRUA 2Q4DA 5AJYA 2IKQA 2J5RA 4DA7A 3DKVA 1RU3A 1VGVA 2OAEA 3FHJA 4Y6SA 3ZLTA 3ZJTA 3B52X 1FZTA 3WNQA 1GQQA 4JI7B 5DIFA 1ZD2P 1E92A 2XYHA 2JHFA 3GLHA 3LTEA 4LC0A 5H80A 1F5SA 2WAXA 3NYQA 3TPFA 4XA8A 4YQFA 1M7GA 3A0RB 1V96A 1DG3A 5C53B 4LRYA 4E15A 3QVVA 4NE9A 1GKIA 3C74A 1L5WA 3FRHA 3ZV5A 1ZWKA 4H08A 4JDUA 3IP9A 2A9FA 2PSDA 1UEJA 3NIWA 2OB1A 3LPDA 3I6MA 1B74A 2VO1A 3JQFC 4CGYA 3VC1A 1UZAA 1YS6A 2ZYDA 4XLTA 5G0VA 1KO1A 1T6XA 1UOEA 3CUVA 3BJIC 2JIZD 5EXEA 4EO9A 4JYBA 4AY3A 5DLEA 1RLOA 1BGXT 2EIHA 4NBRA 2WIDA 4RY8A 4Y7CA 3MCTA 3NBFA 3S28A 1TPZA 1QYDA 3C3JA 2DQ4A 1V7CA 3JQ8A 4CVNA 2PGLA 2NXEA 3OE7D 1LS6A 1VG8A 4BZXA 1OFGA 1RKXA 5GP1A 5I9NA 3UPTA 3W3ZB 2XQKA 1RXYA 3DV0A 1GILA 2VCHA 2VUUA 4KQ9A 1GAXA 2PG3A 1NFRA 1M2HA 4ZI7A 1AZLA 4NMLA 4X6YA 3JZAA 4MLDA 3QNMA 3WYFA 1NG9A 3B1XA 2JKVA 2O6HA 3IJEB 3PFKA 3TL3A 3AHCA 2RK4A 3B38A 1A4UA 3ONNA 3HNRA 3P0JA 4QTTB 5KBYA 3ZU6A 4ETMA 2V0NA 3M34A 3PKIA 5BV2P 3EB9A 3R9XB 1MQAA 5C0OE 3BJZA 4B71A 4EMTA 3FBTA 3GJZA 1CNEA 4HNRA 4RXUA 3PUVA 3SIRA 4AXBA 5FWXB 3KOWA 3CWZA 4DM3A 4WWHA 1QIJA 3TRHA 1CVIA 1NVBA 2GD0A 2RBGA 2WHYA 3BIWA 1YHZA 2FN3A 3E70C 4L4XA 2XLBA 4L73A 2G77B 4XEHA 3NPMA 1PT8A 3DZGA 4BB5A 3HGQA 1C3EA 3D9QX 2HDWA 1E18A 3I5MA 1RWBA 3F90A 4MO2A 5D86A 4MS1B 2HA7A 3ZVKA 4KQ1A 1U8ZA 2SCUA 5MDHA 1LPAB 2JLUA 4AUMA 4BO8A 2REQA 2WAOA 5BSVA 3TQSA 4CHTA 3KQNA 3W9SA 1MPXA 1KI6B 1DKUA 5ERXA 5K05A 1JFFA 3VPXA 2A84A 3UWOA 1NWHA 3N0TA 1Z33A 1PL7A 4TS9A 1QGED 4QFDA 4CKBB 5HYVA 5CA1F 1NXWA 4AMZA 2IEAA 2OD2A 1WMSA 1X8XA 3NONA 3TIVA 2CJYA 2FR0A 3IBGA 5KKNB 4BTEA 3VXKA 2A86A 1D03A 3U7QA 2NU7A 2QM7A 3CUYA 1F5NA 1E0AA 2ZWMA 1SHZA 4L1KA 3ZDZB 5K9ZA 5FOQA 4M9UA 2DT5A 3MCWA 2VRWA 2V6FA 3WLHA 4DNQA 4NXMB 5CVJA 4IMPA 3H3FA 5EE5B 1PWHA 2GAIA 1GNQA 4OXYA 3R9XA 2NYAA 4MVJF 3KLPX 4X97A 1DBWA 5MN5A 1ZJ4A 3AETB 4GI5A 2Q7XA 2R5FA 2RAPA 1I3CA 3UAWA 2ZPUA 1NATA 1VA5A 4GQBA 5IAJA 3WHLA 4MNTA 3SKXA 1S2OA 3HK2A 1PS9A 1KYTA 2PNFA 3JWJA 4D46A 4GFDA 3TLAA 4OQZA 3USES 3ZE2B 3V55A 4B87A 1GSAA 3S2FA 2HZ7A 1W35A 2AL7A 3HPRA 2WAMA 4K6KA 4W7IA 5KX5F 3T4XA 4A0RA 3L0ZA 3RFXA 3DEIA 3JYHA 2KWIA 4B6SA 4MVJH 4QOEA 4ENSA 4GXNA 1FLDA 1CY2A 2FYTA 5BNZA 5DK4A 3QOWA 2IPNA 3FAZA 3OZXA 3DBRA 3QPWA 2M1ZA 4JDPA 5H4HA 3ZDDA 2H63A 2AOUB 2RJOA 1HT3A 1Z3IX 3AEUA 4RIEA 3FDJA 1P2SA 2CUTA 4GWLA 4MI9A 4HL6A 4P4UA 3D7KA 3EIHA 1WBBA 4JOBA 4QFMA 2HN9A 3I52A 5ES4B 1UBHS 2CLMB 3VVBA 3FPHA 1XEXA 2EAUA 3QLUA 3N7TA 3CW8X 4E03A 2HMAA 3CG4A 3GDFA 3KZMA 4KK4A 1SU8A 4EEXA 1E9BA 2IS2A 1MAWA 2RHCA 2QTBA 1C30B 3D3EA 4ZV7A 3WMEA 3TTSA 2HX1A 2ZTUA 3TZBA 5IS2A 2F48A 3MWDA 3ZIAD 4FHFA 5EKDA 2J5BA 1L7BA 3DWFA 3EW9A 2QLFA 4MQ4A 1DPFA 4B9EA 2FW1A 1IQPA 1SWWA 3VGJA 2IDZA 2MSEB 4LQ4A 3WGJA 4LVOA 2QK4A 5TS2A 3HXKA 4JP1A 2PJZA 2TYSB 4MW4A 4P3YA 5JDCC 3QOXA 3NNNA 2XR1A 4GOJA 3FB4A 4XCQA 1IHUA 1F0KA 2OZKA 4C4AA 4R8MA 4MWBA 5A9SA 2OCXA 4LVNA 1G9SA 4O08A 3ZOKA 3GLFE 2NUTA 1RKQA 4G56A 4BLUA 1A9ZA 3JQAD 4D4GA 4L3VA 4D26A 1A3CA 1L1RA 2X5XA 4R69A 1NTRA 4C0LA 5A03A 1XHEA 1UR5A 1A9XB 4JLMA 5KNCD 2DKOA 1MW8X 4CTJA 2OCKA 2VQEB 2H2AA 2FJPA 1F0PA 1RYZA 3OHSX 1D5CA 1C7IA 1QS0B 5IJAA 2AS0A 4KE7A 3PFIA 2EL7A 2H9IA 3RC8A 3VTZA 2VHTA 2B4RO 5G4KB 4G9EA 1M2JA 2GZHA 5KUTA 4QJ5A 3HB5X 4TS1A 4RTMA 4YRZA 2H4HA 4I6GA 5LZ5A 1EZ1A 1XLUA 1A4IA 4DDUA 2XYGA 3E2IA 2PD3A 3SQOA 4GKKB 1G8HA 2JH3A 2DFPA 3CLUC 2P9HA 2YHUA 1V0JA 3QE0A 2X9NA 1VHQA 1W4LA 2RCNA 4GNRA 2ES4A 4YVFA 3HYTA 1V3QE 2P65A 1IN8A 2YMLA 4OBEA 4PO3X 2ZM6B 1QSGA 5FOVA 3RAFC 3O6VA 3AB7A 4KUGA 3LUJA 4WNIA 4B76A 5B64A 1VCHA 2P3LA 2V65A 4A36A 1MAUA 1X0XA 1M8FA 2QUZA 3TDMA 1LBQA 1K7YA 4BAZA 1C7EA 2XCIA 3OTHA 1SHJA 2JIOA 4FWIB 3UMJA 1UDXA 2HO4A 2WTMA 2YHSA 1EJ2A 2XIQA 4LI0A 4F06A 2FOIA 4FNOA 1WDLA 4MW7A 3N2LA 1VL8A 4WA8A 1DWPA 2KPOA 3VV3A 4C03A 1JEQB 4YAKA 4HPWA 2PWPA 3INYA 1RBQA 1VLMA 4WKPA 1GM5A 3PD0A 3ER6A 1V8DA 2AYYA 2V03A 3QVKA 3OPNA 1C8KA 2QTZA 3RVBA 2XE4A 4RMGA 4OKNA 2OLKA 2BZSA 1FUYB 1S01A 3WMFA 1XP5A 1NQTA 4DLXA 3FSGA 4RDHA 1RXWA 3HYRA 1ID8A 4Q3NA 3BRSA 4DQLA 2CHVA 1T2VA 1H22A 1TIPA 4WFIA 3SQNA 2MSLA 2N42A 5JSQA 1MOZA 1DEXA 4FYIA 5ENZA 2R6DA 3VNSA 2VT3A 1E6EA 1E9EA 1FMLA 4LGYA 3U3RA 2I5PO 1U2TA 3B48A 4BB6A 3WKBA 1IJEA 2FE1A 3IBSA 3LUBA 2CNLA 1NUHA 1P4JA 2FN8A 3SZLA 5B2EA 2DTEA 4GS5A 3EIXA 3L7DA 5CT6A 2PUFA 1FX1A 1DOHA 2WJYA 3KSZO 5LP6B 4KMMA 1JHYA 2X76A 3ZDQA 3HRKA 4QVIA 1AVTA 2ZBPA 4LF6B 4ZVMA 3LBAA 3OSZA 3PXXA 4PPYA 3SWWA 1IXZA 4RCVA 3DWEX 3OIGA 3MPOA 4CLHA 5JYBA 2XGJA 3BD8A 3RH0A 1B2LA 2QJTA 2VXCA 4Q7KA 4Y2UA 2H2FA 3LOUA 1KE1A 1G8AA 4NCJA 2BP7B 2Z9DA 4BQQA 4I5FA 5IJWA 3C6ZA 3Q3VA 1ZSNA 4DLTA 3TFQA 5IZ4A 4AJKA 3H84A 3CR8A 4MRPA 2LWIA 3GGPA 4GKVA 2VF2A 3A6PC 1NBOA 2PO5A 1UKCA 5BQOA 1YR7A 1RABA 1XKXA 1M5UA 3AF1A 3H2ZA 3K2EA 3HKCA 4KDRA 1ESEA 4KFSA 3L6BA 3PC3A 1FFBA 3T7IA 4IDQA 1Q91A 1YDFA 1TLTA 1Z6AA 1ZH6A 3KQTA 2M98A 3OHMA 2YV1A 3KPYA 4NZNA 5DHRA 3ZQ6A 1JP7A 4HAVA 3IELA 5JARA 1CDOA 4Q9DA 1EJ6A 4NE7A 1OAOA 2DH6A 3DHNA 3L6RA 1P7WA 3FFBA 5EPEA 3DMFA 3RVSA 3PE4A 5CXQA 2E1PA 1UK6A 2XUFA 3KHTA 3RVMA 1VXOA 2HMSA 3MLBA 4W82A 3OZIA 3MELA 4QXRA 1RKBA 3VDXA 3R0ZA 9MHTA 2JB9A 5EXSA 3IOCA 4TYPA 5LP1A 4HDRB 4KO8A 4MLPA 1UWVA 1B0AA 3QXSA 1FFAA 4ND8A 5LUBA 3TO5A 1RJ9B 3QITA 5HEKA 5HKOA 1LTQA 1AB6A 1SU6A 2HLHA 4GO1A 4BQPA 3I5XA 3DO6A 4OL9A 1NSTA 4R7TA 1YR6A 1S8AA 2JD0A 2Q3LA 3A9RA 4OH7A 2Z6AA 4P7GA 2WUDA 4YWJA 4E3ZA 3U1BA 3AJDA 1F12A 3WLMA 1CRPA 4IHJB 4NJEB 2SKEA 3DBVO 4EKDA 5A3QA 2PJRA 3L7IA 1J1UA 4MS3B 4PGAA 1EDOA 1WXFA 3V33A 4ESHA 5KWVA 1A88A 1GSHA 5IXYA 2R8EA 5AW5A 3WLEA 3B70A 3RUPA 2FMKA 1OGIA 1SUBA 1T0PA 4E88A 4HVLA 1E63A 3H83A 5IN4A 1ODIA 1LLCA 1TA4A 2W2OA 4UUNA 4UZSA 1O96B 1EYZA 1YU6A 2FG6C 3W2GA 2Q1SA 4HQRA 2WJJA 1P9WA 4CM4B 2XD4A 3SVTA 1H85A 4UNIA 4CEHB 1XLTC 1ZS9A 4B4UA 1XN1A 2G8LA 2P3OA 3IAS6 3OWOA 2YR0A 4GOND 3E5RA 4IVRA 4YJ2F 3WB2A 3M6XA 4AB1A 2E49A 4DXAA 2GPSA 2V45A 4YAWA 4GPTA 1AMOA 4O4LF 4AIIA 3JQGA 3WJ2A 4OJYA 2C0CA 1DMSA 1P17A 2IUSA 2W98A 3AR6A 3DMRA 3G2MA 3IOYA 1D8AA 3RTEA 4KJXA 3QX8A 5DXAA 3H6KA 2O3SA 1UKYA 3U3XA 1Y1SA 1P9LA 2ATCA 2F3TA 2P8SA 1YDEA 4YI3A 1FIUA 2W2LA 1KEPA 1DKOA 1CJBA 2O52A 5DYTA 4ZAYA 4NK5A 1EVEA 3ELYA 4EYGA 3D7RA 3WLIA 2ISQA 3TRIA 1LTHR 4Y67A 4CTMA 4JEIA 3D8RA 2ANBA 4URVR 2ZM5A 1KBZA 5D2CA 2BUAA 2OXEA 3IAUA 3O95A 4UBKA 2FMFA 5EZQA 5IPFA 2B1GA 1UXIA 1UQUA 4X6UA 4TS3A 1DIAA 1YRLA 1JA9A 3USCS 3GWZA 1CXZA 2ZSEA 3A2NA 1ZM9A 3GEIA 3Q3JB 4UXIA 4IQ4A 1LKZA 1EXDA 1FYXA 2RI1A 4WSOA 3KR2A 3CO5A 4EQZA 1KFBB 4JXJA 3TPCA 3U9SA 1YRYE 4QYIA 2B20A 4MARA 5EZSA 2AK2A 1TVCA 1AXGA 1J49A 2A3RA 1QZXA 4MVWA 1CLEA 2CVPA 3IDOA 3TX2A 2L2QA 3A4VA 1N3IA 1XVVA 4FIDA 4KC0A 4N7MA 3KU1A 3WNZA 2EYQA 3ZX5A 4AM8A