4Y0AA

Shikimate kinase from acinetobacter baumannii in complex with shikimate
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
179
structure length
179
Chain Sequence
PSKAFETLPNIYLVGPMGAGKTTVGRHLAELLGREFLDSDHEIERKTGATIPWIFEKEGEVGFRTRETVVLNELTSRKALVLATGGGAITQAPNREFLKQRGIVVYLYTPVELQLQRTYRDKNRPLLQVENPEQKLRDLLKIRDPLYREVAHYTIETNQGAARDLAQKILQLILSNKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Shikimate kinase
publication title Structure of shikimate kinase, an in vivo essential metabolic enzyme in the nosocomial pathogen Acinetobacter baumannii, in complex with shikimate.
pubmed doi rcsb
source organism Acinetobacter baumannii
total genus 65
structure length 179
sequence length 179
ec nomenclature ec 2.7.1.71: Shikimate kinase.
pdb deposition date 2015-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01202 SKI Shikimate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4y0aA00
2BM1A 3PUXA 5JS7A 4A8JB 3TR0A 2ZXUA 4M1KA 5FTKA 2IF2A 4OBEA 1J7KA 3CM0A 3KFVA 4PX9A 1VTKA 5E95A 4ZCMA 3UWOA 2YVUA 4Q9HA 3WMFA 3UXMA 3THWB 2DFNA 2WPDD 2YOFA 3C41J 4BQSA 1FW6A 3ICQB 2CE7A 2G3YA 3RHFA 1M7HA 5FPSA 1IONA 1YJ5A 5AJWA 1E69A 4OK6A 2VEDA 2R65A 5H8WA 3AKYA 4RD0A 1Z0FA 4JLPA 2QQEA 4PAMA 4DCUA 3KJHA 1VIAA 1CIPA 2TMKA 3SYNA 1E1QA 4A2PA 2Z6VA 1G21E 4S2EA 1MT0A 2W2VA 4C0QC 2W6JD 1IAQA 2G83A 1B23P 3KJGA 2AWOA 1S3GA 3CH4B 2VHQA 2Q3MA 2O8CA 5LBIA 2W83A 3WP0A 1ZIPA 4PSAA 5JJKA 3HPQA 4PZYA 2OFWA 3AKCA 3K0AA 3K0FB 2P6UA 4WAUA 5IDVA 2I3BA 1EX6A 2NOAA 2ORVA 2XJ9A 3EZ7A 4QBIA 1P2TA 1FQJA 5UKDA 2QSYA 3EPHA 2V7QD 4GRAA 5AJVB 4XVQA 4B44A 5EXXA 2OEPA 5G53C 4TMZA 5BN3A 1FNNA 4ARZB 2OZEA 5FBWB 3FMFA 3N2IA 1F5NA 3EA0A 3ZZ0A 4YLGA 3T34A 5F98A 2ODBA 2PX0A 2QGNA 1RZ3A 2ZJ2A 4A2QA 4HDOB 3KQKA 3A1TA 1K8RA 5JFGA 3QF4B 4QHSA 3BFKA 2WWGA 4H9GA 1OKKA 4W5WA 3TJZA 3W3AA 2GTPA 2QTFA 1OXXK 1RFLA 2RHDA 2CNWA 2XEXA 2BV3A 4PSKA 4TT3A 4MUBA 5C46F 4ZKDA 1KOFA 4M1TA 2K5UA 4ITRC 2ORIA 1AJEA 4C9BA 1GITA 3OESA 3Q85A 2WAYA 2EFGA 1N6LA 1UKYA 2BWJA 2ZITA 4EFLA 2FDCA 4URUR 1OXVA 1R5NA 1UADA 2JASA 4TMVA 3WMEA 3X1YA 2WKPA 1KKLA 1OFHA 2FWRA 3A4LA 4IDOA 4LZZA 4P0TA 4B47A 3KQHA 4KYIB 5EP3A 1P73A 1NSTA 1OE0A 2ZSEA 3AB3A 5FPHA 5LDDC 2CCGA 3IO3A 2YWEA 1JR3E 1G41A 3R7WB 1NN1A 1GL6A 1CRPA 3G5UA 1SVOA 2YC4C 5EP4A 3EC2A 4UKDA 3RC8A 3NC0C 3AH8A 1SXJD 1GIAA 2NPFA 5HCIA 2FEMA 2GCPA 1AIPA 2QMEA 3I61A 1ZUHA 2GXUA 3D3QA 2VSOA 2IEYA 2E1RA 221PA 3MCAA 1E2KA 4NYIR 1JB1A 1RJ9B 2ZI6A 3OFNA 2A5FA 1OIVA 4Q4JA 1X8JA 3IILA 2WKQA 2ZJOA 4C0BA 4DVGA 3I8XA 1UFQA 5KU1A 2ECKA 1QHYA 3BJIC 2MSEB 1TU3A 4JL8A 4KHZA 4KLNA 5CK5A 2LKDA 2GXSA 4NH0A 4EPYA 1Z6TA 1II0A 3BORA 4JMPA 2O8FB 1YR8A 2J87A 3B5JA 3TUIC 4P4TA 1WRBA 2ZRCA 1L7VC 2REBA 4FCVA 5E4FA 1NVXQ 1SXJC 1DG3A 1GL9B 1VDZA 1W5TA 3U3MA 3U7HB 4TLBA 2G1KA 4Q5IA 5AJXA 5CDFE 1P75A 4TYPA 4XJXA 1HQCA 2VF8A 4EJSB 3VNUA 4QJ3A 2V1UA 1Q1EA 4AYXA 4JVSB 1R7RA 4JZKA 3AVQA 3CNNA 5L3SB 4PC3A 3B13B 2Q3HA 2Z43A 1GRNA 3MG9A 1LS1A 2JLXA 4M53A 4LCBA 4BFWA 3MUFA 4TLCA 3ZVRA 1G7TA 1P9NA 1B0UA 5GJCA 1N6IA 2ZRLA 3OZXA 1P72A 3E5HA 4I99A 2N1BA 1D2NA 4Q7KA 4QNRA 4HUTA 3IPYA 2OFOA 5JWRA 4C0HA 1D9XA 1EWQA 2ZREA 2Z4SA 1JNYA 3LV8A 5CJPA 4C30A 1MRSA 4JLJA 1FTSA 1TU4A 2IYZA 5TY0A 3R8FA 1GNPA 3CW2A 1ESNA 1VCIA 3GLFA 2J7PA 1NL3A 2J0QA 1ZJ6A 2QAGC 2D7CA 3BH6A 1WMSA 3AVUA 4XOIA 2ATVA 4OJQA 3RC3A 5AUPB 4TMTA 4UJ3A 3UPUA 1G291 3VFDA 5FTMA 4Q48A 4B3XA 1SVMA 2OM2A 2VP0A 2PMKA 2EU8A 2V6JA 5HR5A 5AUQA 1T3SA 1Z6AA 2ZETA 1DARA 5C1BA 2ZE7A 2GZDA 3CIOA 4PPQA 3QKTA 2QP3A 4DJTA 3DMDA 2I1VB 1OIWA 5KSZA 4I1UA 2NO0A 2GBLA 1QG2A 2H5EA 2KSQA 3EX7C 2C99A 1ZRHA 1H8HA 1M2OB 2YC2C 4RCYA 4O2RA 1EFTA 4OI4A 2ZUCA 3LX5A 2J1LA 2V55B 4BFXA 4NCNA 4A6PA 1RRPA 3PJRA 2R6GA 3A4MA 3BH0A 4QC2A 2ONJA 3GLGA 1AGRA 1ZM7A 2GK6A 3TSZA 1JPJA 5AUNB 4MKFA 1ZU5A 1XEXA 4B33A 4Z8XA 4URXR 2YKGA 2QT0A 5GVSA 1T0JB 2DYKA 3OAAD 2OBNA 5GADl 3L0IB 5ELXA 3AF4A 5L3QB 2MSDB 2D3WA 3BB3A 4N1AA 1Q21A 1E4VA 3SZRA 2QGZA 2Q9CA 4L9WA 2JLQA 3L8ZA 1GM5A 2A5YB 3GEIA 3IIKA 4DLRA 3Q9LA 4NCKA 1AGPA 1NI3A 3QNUA 1Q20A 1VG1A 4ZDWA 2ZI9A 4TQUS 2O8BA 1IOZA 3CUEF 3C5CA 3LWNA 2XTMA 4OYHA 3J81k 1GILA 4D0GA 2XZLA 1UDXA 1D6JA 5J5CA 4B71A 1AZSC 2GF0A 5CJ2A 4ZI3A 1P3JA 4Q18A 4A2WA 2XNDA 1XD8A 4HEJA 2AR7A 3SU8A 1W0KD 3VQTA 1UAAA 2RB4A 2ONKA 2RGDA 3IUYA 3OEED 2PZGA 1GZSA 2XSZD 3QBVA 2JLZA 1XXHA 4KFRA 2OBMA 4OI0A 1E2LA 1HURA 1CS4C 2R6CA 1U90A 1NVVQ 3PEVA 1L8QA 4D4MA 4OK5A 5KO2A 4DLUA 4M1MA 2YOHA 4IOKA 3QUSA 4IDPA 2EYQA 4EPTA 4U7DA 2J0UA 1KI2A 3RVBA 3U5ZB 2ERYA 4MDEA 2O52A 3R9WA 1CKEA 2AWNA 3VAAA 4P4SB 3JZMA 2BOVA 1E0KA 4RZXA 4AK9A 2PLFA 4Y0VA 2YV5A 2WJVA 3RANA 1XPUA 4GOXA 4BEBA 2AD1A 3SFZA 4AI6A 4PO9A 4JJZA 2GRJA 1C9KA 1ZUNB 3K8YA 4LC0A 4OQFA 3H1TA 5DI3A 1MR3F 1ZAKA 3PUVA 3TQCA 1E9DA 3NHBA 5SZKB 2ZM5A 1E2FA 1S96A 5FOWA 4LRWA 4A8JA 2V6IA 4UXHA 2GBLC 2ZSAA 1EESA 1E4YA 1GL7A 1XZPA 2JIZA 3K0AB 3OEHD 2FH5B 2C04A 3QVVA 4HB2A 5JMTA 4RJLA 1T6NA 2X19A 1X1RA 4IVPA 3RS4A 1YKSA 4LI0A 3SYLA 5FTJA 2WIAA 3THWA 2ZS8A 3FFAA 4LBVA 1Z0DA 4B73A 2I1QA 1RRGA 2WSSD 5FBQB 3RAPR 2YYZA 1U81A 1E79A 1KGDA 1OHHA 4YDHB 5KTYA 3AVWA 3BFVA 2QA5A 3LNCA 3NBFA 1EFUA 3BWDD 2ZRIA 2CLCX 5KYKA 1W49A 3AP2A 3A6PC 2GF9A 1ELOA 2YJTD 3X1DA 1Y3AA 1JI0A 2GJSA 2C9YA 3ZVMA 4FIDA 2F6RA 1JBKA 4HAZA 1HE1C 1XWIA 1XTKA 2OCYC 3KQLA 1XB2A 5K8TA 1KK2A 1XDBA 1IJFA 1T5LA 1KI4A 2BMFA 2ORWA 3LY5A 4POAA 2J0SA 5L3RA 2BVNA 4RSGA 3TAUA 1E96A 2VP4A 5FUXA 3AF3A 3EXAA 1G8PA 2CEAA 1RRCA 2HJGA 3EWSA 2WSMA 3EZ6A 3G82C 3KB1A 4ILEA 3RLFA 5IK2D 2XTNA 4D26A 3K70B 2VLIA 2GKSA 1WCV1 2NIPA 3ZS8A 1DADA 4TL8A 3HDTA 4MUAA 2ZR9A 2IYWA 4M21A 4L16A 4ARZA 1U8ZA 3AGPA 1ZM3A 3T1OA 1NIJA 4Q02A 2GDJA 1EXMA 5EXPA 4AG6A 3QQ5A 2KBEA 1DAHA 2JIZD 4II7A 3CBQA 1A4RA 4BFUA 3SQXA 3QBTA 3P1JA 1TF5A 1XF9A 4G5QA 3DDCA 4NP6A 3AF1A 2IUTA 4LHVA 1VG9B 5FPYA 5CITA 2IUSA 5E7JA 2CDNA 3DM9B 3O8CA 1TADA 3BK7A 3DOEA 4FXPA 1OHHD 4RKEA 4TMWA 4DT1B 3EZFA 1VHTA 4B3BA 3A8TA 3GPLA 2C8VA 4R7ZA 2QQ0A 3D31A 1UJ2A 4GMXA 3IHWA 1OH7A 2EVWX 1G19A 2ZIAA 4JT4A 3MRSA 3B9PA 4IOJA 3LLUA 4BRWA 3SNHA 1ANKA 2QM7A 2QTHA 2QRZA 4A0FA 3QXHA 1MH1A 4Q66C 1E3MA 5JS8A 1JR3D 3E1SA 1D5CA 2HT6A 4DEYA 2VH5R 2WVJA 1S0UA 3FVQA 3EPKA 2HXSA 3GLHB 2BC9A 3TNFA 1QHXA 4K46A 3RNLA 4IVQA 1QF9A 3MLEA 3T12A 4LPKA 1XRJA 4G3XA 4LHZA 1KDOA 3U7FB 4MGKR 2V4ZA 4PZZA 3HU1A 3NTUA 4M2LA 1OH8A 3WMGA 1RVDA 3P20A 4OJKA 4QOSA 2NZJA 3N5CA 1YZUA 2ZE6A 5DYGA 5EZ5A 4ZCIA 4KAXA 1XMIA 2GXAA 2VA8A 3I32A 1AN0A 1R0XA 1RJ9A 3IPXA 4MGIR 4F92B 3U2QA 5JBQA 1LF0A 1Z0AA 3TUJC 4IXNA 2J5XA 4FCWA 2EFDB 3I8SA 3T1QA 2R6AA 2IWRA 2RGAA 4MYHA 5FH9A 5IRCD 3T35A 4V0LA 5HTKA 3WBJA 4EKDA 1F2UA 1P2SA 4KU4A 3AQ4A 4PC7A 4D6PA 4QL3A 3PXGA 3AP1A 3PCRB 1DAMA 2RGBA 3U6KA 1T91A 2NO7A 5KPDA 4TL6A 2FPMA 4MITA 3ADKA 4LJYA 1E2NA 4TL9A 3F8TA 4IJMA 2YHSA 4L15A 4E07A 1IN7A 3FKSA 3FMIA 3TBKA 4KFUA 4EJSA 1R5OA 2JCSA 5CYPA 2IYUA 2BBWA 2G77B 3H86A 4XD7D 1OFUX 2P5SA 3MAAC 1PZNA 3QKSB 1QHSA 2QORA 1YU9A 5FL3A 2BCGY 2NQ2C 2VSFA 3GLHE 3KKOA 4L4UA 4RKFA 2GCOA 1H8ED 2I4IA 1JR6A 3KDSE 3KKPA 2PT7A 4HUQA 1Z6XA 3V4FA 2DB3A 3P4XA 5JCPA 4DDUA 1DAGA 5J4LA 2RGXA 4QGAA 3F5FA 4NU0A 1II9A 1A2KC 4QM6A 1KO7A 3AF2A 3QXXA 2B6HA 5JRJA 3K0EA 4FMBB 4I1VA 3C8UA 4PHFA 5JWHA 4JLBA 5FL7A 4DDVA 5B57C 5L3VA 2VO1A 4MYCA 2CCKA 1W4BA 4B35A 1F6BA 2OT3B 4GI7A 4PTLA 2QTVB 4G5GA 2RH5A 4J0QA 4JLMA 4PANA 4QBHA 3TW8B 1NVWQ 4DLXA 1JEDA 1S3SA 2C9CA 1DAKA 4P32A 1W44A 3GLGB 3AVYA 3PEYA 1J2JA 2WKRA 4DCNA 2ZE8A 2IS2A 2GJ8A 2QU8A 1XU4A 1IJEA 1WQ1R 4KVGA 1LY1A 2A78A 5B58C 4DHEA 3M0EA 2ZRKA 4G5RA 3C15C 3LAWA 3GJ6A 3SN6A 4NCHA 1OH6A 3R8CA 3JZAA 2BCJQ 4KCGA 3FHOA 1E1RA 4TYQA 2OBLA 5C18A 5KNDA 1OB2A 4M9ZA 3T1TA 4HLQB 2N42A 2O0KA 2JDIA 5KSOA 2O0JA 2WJHA 3I4LA 4Q47A 5IF9A 1XEWY 1Z08A 4LUCA 1HA3A 4TYWA 4PPGA 3TIFA 4JLVA 2ZRBA 4RFSA 4CDGA 4PXAA 2IHYA 2VQSA 3NEYA 1W36B 4GOJA 2FNAA 4M9XA 2FFHA 1E98A 1EWRA 3WHLA 3A1VA 3B1ZA 1DO2A 1KK0A 1AKEA 2IXGA 3FHCB 5FI1B 2YWGA 2WBLC 3U4QB 1X86B 1LW7A 4X8HA 4EJSC 1Z63A 2D4HA 2OCBA 4NCJA 4BFYA 4F4CA 5L3QA 3DO6A 3DVLA 1OV4A 3NG1A 2WOJA 2B21A 4MRRA 2J0UB 4OQLA 4H1UA 3GLIB 2H8KA 2BJVA 5TVKA 4R2HA 1BYUA 5CLQA 4TTQA 1R2QA 1U9IA 2VL7A 3GFOA 1N0WA 1W1WA 1S1CA 3FYHA 3LW7A 4B48A 5L8VA 3GLGE 1SVWA 4LV5B 1N2CE 1RYFA 2IXEA 5J4VA 2OAP1 3WXMA 2OAQ1 3U60B 1NN0A 1OXTA 4P31A 1BOFA 4E09A 1X3SA 4D25A 2CMKA 4M9SA 5AWFC 4NYJQ 3W5JA 4YMUA 2ZUDA 4LY6A 3FOZA 2JLUA 2CLSA 4UNNA 3NDBB 1KI6B 1O87A 5EXTA 2CLDX 3CX8A 4PAQA 1CR4A 1W4AA 3P32A 3W9YA 3M6AA 1YZNA 2EFHB 4M1YA 4DIEA 3NHAA 5CYOA 1ZNWA 2ZJYA 1HEIA 4MRPA 2G9NA 4MRVA 1KK1A 2ZYTX 3CPJB 2MMGA 4QBFA 4X8OA 1W0JD 3OIYA 4LBZA 5GVRA 4ERNA 3TGPA 3ZVNA 5JCZA 2IL1A 2GWHA 4YQFA 1ZD1A 1OFTA 4P4SA 1P7CA 4EPVA 2QAJA 2QE7A 3C7KA 2DWPA 4NHOA 1DOAA 2ZRFA 1T4GA 1CULC 1OB5A 1G6OA 1XXHE 3EZ2A 3SI7A 2W6ID 3VR4A 1YVDA 1FX0B 3QF7A 4X8MA 4US2R 4GDFA 4R71A 4DRZA 3ADCA 1J8YF 3X1WA 2QL6A 2OE2A 4OHYA 3ND9A 3TSOA 3MMPA 3GJ8A 5E7IA 1RPZA 4XWAA 5E7MA 3GFTA 4V0NA 2FV8A 1JXMA 4OHZA 1CXZA 1VPLA 4MKHA 1UBFA 4UNSA 4FCTA 3C5HA 3KKQA 2OFXA 4YDSA 3SHFA 4DZZA 3UG6A 3RS3A 5JLJA 1GFIA 2GVDC 2WWXA 4HAUA 4C3ZA 3OE7A 2ZUBA 5J4YA 4TTRA 5M04A 1ZNXA 4M9QA 4UXJA 4Q1EA 2QT1A 1JXOA 1T0HB 2QP4A 1HQYE 3B1VA 5GJWC 2OXRA 4JIMA 5TB5A 3B82A 1EK0A 5JI3E 5DO9A 4C0LA 3ZDQA 1KAOA 1NMYA 3LRPA 1LTQA 4IOLA 1OPXA 3A58B 1CRQA 1M1YE 4TZ0A 1U9IC 2WMOB 5JWOA 2VPPA 3KKMA 2PJZA 2GAOA 4FD2A 4BLQA 8OHMA 5GJBA 3RRNA 1OFIA 2O5VA 2H92A 3FKQA 4IRUB 4YMTA 1ZM4A 2L0XA 3FMPB 3LA6A 2IYYA 4F93B 2ZQ5A 1E32A 1Z0KA 1E1QD 2NMVA 4TZ6A 4DLVA 1E9CA 1Z28A 4UNRA 3BS4A 4JLAA 1WDTA 2IYLD 1YZLA 5IT5A 4ZV4A 3OHMA 1G4AE 1EX7A 1KDPA 1M8PA 4P33A 1XTSA 2PBRA 2R6DA 1ZMXA 3VU9B 4CYMA 1E2DA 3EG5A 4GL2A 5FFMA 3T61A 5TARA 3O8BA 2D7DA 1NG1A 2NPIA 3EC1A 1NVVR 3TLXA 1NN3A 4DLZA 1MABB 4TSFA 4NL4H 3R9XA 3BC1A 3IIJA 4DT1A 3CF6R 5HZKA 3NIBA 3HP1A 1G7CA 3LQQA 1IQPA 4A4DA 1N5KA 3Q72A 1SVSA 2ZEJA 1IXRC 5EE1A 4JL5A 3RABA 3G0HA 5HKKA 1EFRA 4LK2A 3B8HA 1XD2B 3NVAA 2IYTA 5KUTA 4BFZA 3JVVA 4WA7A 4Z54A 3QG1A 3B1WA 4HLDA 1NBMA 1OKKD 1R0WA 2FE4A 2CHQA 2HEIA 2VP6A 4A82A 4HAWA 4PC6A 1F2UB 2CNWD 4TT3D 1AQYA 2WOOA 2WZQA 3NEJA 4HYYA 4ZPXA 1NY6A 3BB4A 4HZUA 4EFNA 3GLHA 1JALA 4HB0A 4H1VA 4PSVA 1GUAA 5CK4A 4V02A 4BE7B 1KHTA 2JLRA 1L4YA 5H68A 2F43A 2ZS9A 1CR2A 2BEJA 2V8OA 1R8QA 3I73A 3U3KA 4ESHA 2BM0A 3TVTA 1R6BX 2X1VA 3EIHA 4RZ3A 2QBYB 3IDQA 4TQ9A 4WXRA 3SJZA 2O8EB 2CHVA 1I4TD 4UNQA 3AVPA 3CZPA 1N0UA 2ZJ5A 1KJYA 2MMCA 1C4OA 2GAAA 2W2XA 1AS3A 1FMLA 2GCOB 4Q1DA 1DAIA 4CT4B 3ZQJA 2JJ1A 5K8UA 3HR8A 1TF2A 4HUQB 4LJ4A 3WY9A 1P60A 5KDOA 3T1VA 2WWHA 2AL7A 3HYTA 5LPNA 3E70C 5JSZB 3ECCA 1W2HA 4YXWA 3K70C 1KMHA 1VG8A 3T15A 1CLUA 4ZDIA 3EIEA 5HCNA 2YINC 1GWNA 2F7SA 3KX2A 4NBSA 4V03A 3OFND 4B43A 2A30A 2J59A 4I4LA 2AD5A 1I4LD 2P65A 4C0KA 4O3MA 1Z06A 3MWKA 2GJ9A 4KITB 2GA8A 1V5WA 2NO9A 2B8WA 3AEZA 4BUJA 3KQUA 1FL9A 1U0HC 2J46A 1CJUC 3QKSA 3ZVLA 1U0JA 2BBSA 4P3YA 2B7CA 4CZ2A 3LVQE 1MO4A 1E2JA 2CCJA 3BD9A 4ZI2A 2D2FA 1DELA 2QPOA 3U61B 1T8TA 2OLKA 5CIWA 4XVRA 3I62A 4Z51A 4EPXA 2BMJA 1KAGA 621PA 1OXUA 2REXB 1XJCA 3PQCA 4IOMA 2P5TB 1CP2A 2IYSA 1Z3IX 4ZO4A 4NPHA 1DBSA 1Q3HA 1US8B 4OHVA 1K6MA 1U98A 4BGDA 1UPTA 1QHHA 5JECA 4OQMA 4PHGA 5EJEA 1AQUA 4IVRA 5EUMA 4AY2A 3P4YA 1W46A 2QM8A 1W4CA 2YNMA 5HE8A 1DTSA 3UMSA 1S8FA 1SKYB 1WBDA 3FE2A 4MYUA 1E2QA 1Z07A 5F9HA 3A36A 4Q9KA 2WJGA 4U5XA 1LF5A 1MO6A 4RZUA 4X8LA 3UIEA 1DEKA 5EP1A 3ZH9B 4RFSB 4QGHA 1UBGA 4BPBA 2DFKB 1JJVA 4W9MC 4BLSA 1RC8A 2ZI7A 2ZRHA 4WXPA 3WNDA 1OLOA 1T8UA 2OCPA 4B2PA 4MGZR 4D4LA 4LPSA 1KSFX 2QROA 3CX6A 2JLYA 4KO8A 2AKYA 2SHKA 3OIWA 4CEJB 3U6BA 1CJVC 2GK7A 3LO5A 1PLJA 2OHFA 2WWWA 2IK8A 2MSCB 1GP2A 3NBXX 1EFCA 4RD3A 4NCIA 2ZVPX 2J7PD 5SZIA 3O47A 1NKTA 1VCMA 2QUZA 5TMPA 1Z8FA 2XOKA 2ANBA 2CL6X 521PA 1N6HA 3KZ1E 2IS1A 1W48A 2V1XA 2IYXA 2ZS7A 3I1FA 3T5GA 5C4GB 3MWJA 4BLOA 2W2TA 4G5SA 1GRQA 1QRAA 4ZCLA 4EQ6B 3TMKA 6Q21A 2IF0A 4C0AC 2VHUA 1ZD8A 5G40A 5LB2A 1G5TA 1E2GA 1QVAA 4TLEA 3LH5A 5BQ5A 1R8SA 1DO0A 5EZ6B 1RIFA 3DKVA 3ADDA 2J7KA 2FPKA 2V3CC 2RMKA 2Y8EA 1LS6A 1Z5ZA 2AXPA 2X77A 2C2HA 1KI7A 1KZ7B 5BN4A 4PHTA 3W5IA 2WJYA 4DLYA 3U4QA 4BFSA 1H8HD 3HR7A 1E9FA 1KSJA 4Q1FA 1TNDA 2ZSDA 3K0SA 4LHXA 4DLWA 2D2EA 2HYDA 4V0MA 3RRYA 3GLIA 4KBFA 3GJ0A 1UBCA 4US0R 3WRXC 1G8YA 3PUZA 1GKUB 2EW1A 1CTQA 2GESA 1XPRA 3BE4A 3WYGA 1II8B 2A3RA 1ESMA 1XCMA 2R44A 1GOTA 2HYIC 1NKSA 4M0LA 2J9RA 2ZRAA 4OQXA 2BMDA 1G64A 2BHRA 2QEQA 2EFEB 4N0EA 3SR0A 3Q5EA 2ERXA 1T3HA 2IXFA 1SVLA 3EASA 1BMFA 4MRNA 1KI6A 4HAVA 5BYJA 4PO1A 1ZYUA 2ODNA 3Q5DA 2G0NA 3VKGA 4WIAA 4NZYA 3B78A 4JSYA 4QJ5A 5SZHB 3TW4A 1TTTA 3U7GA 2PX3A 3ZZUA 1OT3A 3CR7A 4PQRA 2R2AA 5EE3A 5DI9A 4JJKA 4A0GA 2O0HA 2A5DA 4ESVA 4FMDF 4PPNA 1ZW6A 2QN6A 2QSZA 1GG2A 4B6FA 2G6BA 5K8LA 3K9LA 3BERA 1W47A 1TUIA 2XNDD 1FUKA 3PV0A 4W5JA 5EP2A 1W36D 3LLMA 1J8MF 1OYYA 3UANA 2VBCA 4IDNA 4JBXA 4PR0A 3SBDA 2Q9BA 2HCJB 3NXSA 2P3SA 4DCTA 1S1MA 4MQBA 1SGWA 2EWWA 2ZANA 3I5XA 4PC1A 1FX0A 4URVR 1RKBA 1Q1ZA 1G6HA 2A5JA 1A7JA 121PA 2VYFA 3FFBA 4LBWA 4DEXA 3Q7QA 421PA 4CEHA 1S9HA 3VX3A 4BASA 4JYBA 1JEEA 1J70A 1HT1E 1UM8A 2FU5C 3KUCA 3PITA 4A9AA 1W2GA 4ZDKA 4OI2A 5BW8A 1PLKA 1SXJB 3KTAB 3A1UA 4XSGA 3UMFA 1FZQA 1COWA 3L43A 4I1SA 3FDIA 2YZ2A 2H17A 5FI0B 1W5SA 1XMJA 4Q4AB 4QG7A 3TAHA 1W36C 1N6PA 1G16A 1BMFD 1P5ZB 2CXXA 2EYUA 3E2IA 4QHYA 2BIFA 4JLKA 1R0YA 1ZC4A 2OV2A 2P6NA 4MDFA 1BO6A 3ICEA 4TYYA 4F38A 4QRHA 3PIRA 1P62B 3CO5A 3U3OA 2HF8A 2KBFA 2VSXA 3LXXA 4MKGA 2REOA 4OKSA 1HUQA 1JAHA 2FSHA 2QRNA 1G3UA 4FI3C 5G3ZA 3SHWA 1FOEB 4LJ6A 1E79D 4LJ9A 1XCPA 3ZIAA 2AFIE 1N5IA 2O8DB 2QG6A 4Y0AA 3ZYCA 4PQYA 4ASUA 2FF7A 1GKYA 3M4YA 2VRWA 1Q1QA 3EZ9A 4B2IA 5F9FA 3BAFA 1KI8A 2A9KA 2NGRA 3DM5A 2XB2A 1KO8A 1Z0JA 5FTNA 2DFLA 5CIQA 4GOKA 2RGNA 5H1YA 4D81A 1ZP6A 4P4UA 4A8JC 1I4DD 1Z6GA 3WNBA 2R8RA 4PC2A 3K53A 1FPMA 3A4NA 4DCSA 2JJ2A 3VU9A 4M1SA 4NYJR 4D2IA 1P9WA 4W7SA 4Q1BA 2H1LA 3IQWA 2P2LA 2CK3A 2AXNA 1CR1A 1IN4A 1E94E 1GRRA 2DBYA 1TL7C 4RD1A 4GSYA 4DC9A 2C98A 4HZUB 5TV2A 4Q19A 1CR0A 2ASEA 5HPYB 4AG5A 4I81A 5F3WB 1MABA 1H65A 4AYWA 2IX3A 5JHHB 3ZJYA 1NNEA 2F43B 3QXCA 4NMMA 2GZAA 1CF4A 3UKDA 1Q1BA 5AUOB 1U99A 2NO6A 4B34A 1TPZA 4PFSA 5D3MA 3A37A 3EARA 4C7OB 1FNMA 4Q01A 2OESA 1SHZA 4BFTA 1M74A 1XD2A 1W4RA 3A1WA 1DVRA 2D06A 3QG5A 2JJ8A 4AURA 5FBVB 3O8RA 2ZI4A 2HXYA 1SHKA 1SKQA 4KLZA 3WYFA 1CJMA 1OW3B 1Q3TA 4WZBE 3T06B 2LWIA 2WJIA 4YC7A 1TQ4A 1KMHB 1PLLA 1Q44A 4GNKA 1U8YA 1XJQA 1GAJA 2CVHA 2VTKA 1DAFA 2H7VA 5HE9A 2FZLA 4QHTA 5FUYA 4CT5A 4XWKA 3K09A 4I1OA 4F91B 2R6FA 3EAQA 3PEWA 2F9LA 2GEVA 3IQXA 2OG2A 3W3ZB 1A1VA 4K8OA 4MYTA 2CHGA 2XJ4A 4B74A 1QDEA 2RKOA 2RCNA 4EUNA 4MKIA 1M7GA 2JLSA 2ZRGA 3F3YA 1QHNA 4L8GA 1NBME 2GNOA 1KO4A 3K9HA 1TMKA 3QPUA 3A1SA 1YZQA 3MGCA 1UBEA 4UNPA 3WBKA 2QBYA 5J4KA 2O8EA 3AP3A 5KDLA 1CEEA 4TMKA 1A5TA 3QIAA 1BH2A 3RRZA 4NYMQ 3VMFA 2HLDA 3HJNA 3IEVA 1Z29A 4Q21A 3GFPA 5JSZA 1N25A 1AA9A 2GXQA 3CPHA 2P6RA 4OQNA 4WVFA 3WRYC 3KKNA 1ETUA 1QHHB 2BEKA 3EW9A 1KI1A 1C1YA 4TLAA 2VHCA 1KY3A 5DN6A 4IEEA 3S1AB 3LW8A 1A82A 1IY0A 1F3OA 4AD8A 1KYIA 3PUWA 2A2ZA 2GETA 3VR3A 1IY1A 3LDAA 3VR6A 5JEDA 3CX7A 2FN4A 2ZAMA 3AKEA 3THYA 2FSGA 4G1UC 3IHLA 3NDPA 3HU3A 3CONA 3R20A 1MOZA 4NTZA 5D3QA 3CZQA 5KPJA 2PCLA 4HB3A 5DHAA 1YZTA 4YMSA 4BLPA 2FJUA 4JLDA 5GJVC 4HDCA 1HTWA 1ZNZA 2UZIR 3FKSD 1US8A 4Q1CA 1XTJA 2ZYVX 5DGXA 5FUWA 4D4KA 4KYUA 2GJKA 2QP9X 1MKYA 1YR7A 4WOPA 3QXJA 4YONB 1P2VA 1M34E 3FGNA 3W6OA 2JLVA 1X6VA 1YR6A 1E9SA 1F2TB 2ODEA 4XVUA 2Q6TA 3X1XA 1PUJA 2QPAA 2VP5A 2VF7A 5B30A 5F2EA 5FOUA 3THOA 2DWQA 2BBOA 4IDHA 2YWHA 3FPAA 1LB1B 1OJLA 4JS0A 1UKZA 2X8AA 4K81B 1KJZA 1RW4A 2HDNB 2IYQA 3K09C 1MO5A 5J4HA 4DSOA 1PV4A 3RDPA 3B6EA 5CB8A 2PCJA 5DN6D 4KFTA 2PMDA 3C14C 5FTLA 3CF0A 3AUYA 5FL7D 4CEJA 1G7RA 3MSXA 5AR1A 3H0KA 5ANRB 3CRMA 3CWZA 4EPWA 2C95A 5IHPA 3VKHA 4HAYA 3SJAA 2JGNA 4ZDJA 1XPOA 2GZHA 2XITA 4BECA 5J40A 1ZUIA 1VYUA 1EGAA 2Q0HA 4IW3B 2GVZC 4AWXA 2QMHA 4GMDA 4EQ6A 1VCNA 4E22A 1KI9A 3TH5A 2W6JA 3B7GA 3THXB 2DY1A 3NBYC 5JJLA 2W0SA 5JI2E 1WXQA 3GJXC 2JEOA 4IHQA 1NSFA 1E1RD 3DZDA 1T5IA 1G9XA 3OIUA 1E0AA 2ODWA 3OIVA 2J45A 3TUZC 1P61B 3KXKA 2JDID 4ON9A 4C4PA 1E99A 4URWR 2V7QA 1N3BA 4JLNA 1AKYA 2DWOA 2D62A 4LC1A 3GP8A 2FFAA 5BXQC 5FPTA 4LYAA 1Z83A 2AX4A 4G0NA 3CKLA 4B6EA 5EE5B 2V9PA 2FSIA 1UEIA 2AK3A 1Y63A 3QEOA 4RD4A 2RGEA 5H70A 2UZ3A 1KNQA 1F48A 1II8A 1LVGA 4CRWB 1E2HA 3CF2A 4DB2A 4KFSA 1GVNB 1LFDB 2PZEA 3D6TB 3MWLA 2F3RA 3U3RA 4CW7A 1VKJA 1VYVA 4GFDA 2A7QA 2GEDA 1S4QA 3CB4A 4R2IA 4CEHB 3PVSA 1HT2E 1YHNA 1KTVA 4LV6A 4V0ME 1YZKA 3SJBA 3RS2A 3GLIE 3QOFA 4A1FA 3ETLA 4PAOA 2WMNB 1W7AA 5DE3A 2RGGA 3AGQA 3HU2A 4D4JA 4DWJA 1G3IA 4FMCF 4B76A 2BMEA 3LX8A 4V0OA 3QPWA 4LHWA 4GP7A 4CEIB 2XXAB 1X8LA 2A5GA 1YR9A 3VR1A 3ADBA 2DR3A 1KDTA 1QHIA 3DL0A 3KXLA 2JAQA 4C0JA 1BIFA 2ZRNA 2RHMA 1VMAA 3T5DA 1ZM9A 1X8KA 2QENA 3CRW1 1ZM2A 2XZOA 3IKJA 2XZPA 2FGJA 2JLWA 3KJEA 1TQDA 5KOYA 4BZXA 4Q4HB 2C5LA 3WYAA 1QVRA 4IEIA 1AS2A 1R0ZA 1CJKC 1YRBA 5LD2B 4QXAA 4LJ7A 1VCOA 1SXJA 3BFXA 3KTAA 2QE7D 4MA4A 4AKIA 3KUDA 3LBIA 2ZJAA 3SEAA 1PVOA 2PLRA 4HATA 4O2LA 4DDWA 4YMVA 3B9QA 1T3LA 4AIIA 4BRUA 1IBRA 2OCAA 1U8AA 2N46A 4Q4AA 2AK2A 1R4AA 3DOFA 3W6NA 1Q0UA 1D8TA 3PG5A 5FUVA 2IS4A 3LBHA 2IBMA 4Q1AA 1UDWA 2PL3A 2ZE5A 4R98A 1EG7A 3AUXA 3D8BA 4G5OA 1ZCAA 4KI0A 2WAXA 2IWHA 1WP9A 1IY2A 3B1YA 4XTRA 4DXAA 2KWIA 2IS6A 4ZIRB 1ZNYA 4B3FX 1XBTA 4AYTA 1N6NA 5JHGB 1XZQA 2J0VA 2FA9A 3PFIA 1G18A 2O8DA 2WJJA 2JATA 2NTYC 3OE7D 2IHBA 1CJTC 1XCGB 2FFQA 2RAPA 4KVAA 3GEHA 3MJRA 2WV9A 1DAEA 4HAXA 5D3MB 4JT2A 4PZLA 2AKAB 4Q9JA 3V9PA 2EWVA 1IXZA 4V0KA 3KJIA 3HPRA 3MWYW 4A6XA 4KXFB 1G3QA 2HUPA 1KIMA 2QAGA 4HB4A 2R9VA 3AVVA 1JECA 3R9IA 1IN8A 2BJWA 1SQ5A 2ZYWX 1E2EA 4GPTA 1KY2A 3Q3JB 3U3JA 3B60A 3GJ3A 4HZIA 4L9SA 4WBSA 4DSTA 3KQNA 3TRFA 1FP7A 3CLVA 4RFVA 2LKCA 2ZJBA 1NLZA 1U0LA 3U44A 2FG5A 1MO3A 3K70D 4JVLA 2AHOA 4DUGA 1OH5A 2WICA 1E0JA 2F1RA 4B3GA 3L2OB 3GD7A 3BXZA 3UWKA 1I2DA 2ZRMA 2HT1A 1ZIOA 3ZS9A 2ZRPA 3CR8A 4C7OA 3RSOA 3OF5A 2FFBA 3QPVA 4LV8B 3ZLJA 1XP8A 4DB4A 2YWFA 2C03A 3B2EA 3W8RA 1GNQA 3WNCA 4TSFD 5FPKA 2HJVA 4LWZA 1N6RA 1NLFA 3KXIA 2X2EA 3VHXA 3VX4A 4OHXA 4DLSA 3EPLA 2BKEA 1HY3A 2QMOA 3GEEA 5HKKD 2IT1A 1EFRD 4EDHA 3CNOA 4NKRA 5C4MA 5K8IA 1P2UA 5HZHA 1JQLB 2AN9A 4M1OA 2FGKA 5KDDA 1QG4A 2ZTSA 4FMDB 5KSPA 1BS1A 4EFMA 1NBMD 1Z47A 1KO1A 5C2JB 3QE0A 4YMWA 2WTUA 4CIDA 4JBYA 5BWMA 3THYB 1L2TA 1SVIA 5FOTA 5A0FA 2NO1A 4WZAE 1XTIA 4TWZA 1DE0A 3K1JA 2W0MA 3BRWD 4G01B 1HYQA 4NE2A 1LV7A 5EXSA 4DBLC 3FTQA 3AVTA 4DUGD 2KE5A 2QZ4A 2ZRDA 1U94A 1NG9A 3MJHA 2CJWB 3OAAA 4M1WA 4PQFA 1KO5A 2Q3FA 3GCGA 4BZQA 3CH5A 3D7MA 2GILA 2IC5A 4JKYA 3RWMB 3QY0A 4ACBA 1GDDA 5B2ZA 5A4JA 3QSYA 3S1AA 4TL7A 1GKIA 4URYR 1BYIA 2OLJA 4F7WA 3ASYA 2J3EA 2Z5FA 2JJ1D 4OI1A 1VECA 2BKUA 4PHHA 4BFVA 3FHTA 1IN6A 1YQTA 3QKRB 4YXWD 1ZBDA 1W0KA 1P6XA 4LBYA 4OL0A 3OEEA 2XSZA 2CL0X 4CGZA 1AS0A 2CBZA 4RD6A 4JLOA 4WW0A 4C0SA 5FR1A 4RVCA 4US1R 2XNSA 4TYNA 3QENA 2VIIA 1UF9A 3TK1A 1I2MA 1KI3A 1NP6A 2ZU6A 2FZ4A 1YE8A 2JA1A 4IXMA 4Q4LA 4MRSA 1XEWX 1WBBA 1S2MA 3RS7A 1GTVA 5DH9A 3QJYA 2IA5A 1F2TA 2PEZA 4JKIA 3REGA 2HCBA 1S9DA 1YZGA 4DLTA 2IUUA 4FINA 4RD2A 4JSTA 2Z4RA 2DFTA 2GEUA 1E9AA 3DKPA 3W34A 3SJCA 3CRRA 5KNCA 2P67A 1G8GA 4BEJA 4PO8A 1WE2A 3IGFA 4LYJA 3SOPA 2HF9A 4URZR 4JYCA 3EWAA 3OEHA 2Z83A 2Q9AA 1G3MA 1G8FA 2E87A 4C2TA 1XNJA 5AJYA 3IO5A 4Q9LA 1G4UR 1G7SA 4QKQA 3QEJA 1KK3A 1SKYE 1D9ZA 2G88A 4FWIB 5TDHA 3TE6A 4D82A 1PUIA 2EFCB 2WSSA 3QI2A 5KHOC 3L82B 2IW3A 3K0CA 2ZAOA 1NMXA 4KV9A 1NF3A 2FOLA 3VKWA 3SQWA 4IDQA 4EPRA 1TQ2A 2ZJZA 3B85A 4B3DA 3PENA 1TX4B 3F0TA 3HYRA 4LHYA 4XIGS 4BWYA 5B64A 4GP6A 3U7EB 2Q21A 1N0VC 4E5UA 4AKEA 2CE2X 2R62A 1J99A 3THXA 1FFHA 3RS5A 3VTKA 3PR1A 3SYKA 4NONA 3DMNA 3NKVA 4NYMR 5EQTA 1AK2A 3NWJA 3Q7PA 1SVKA 1XFAA 1XX6A 3BGWA 3VHLB 4Z1MA 1A2BA 2UVQA 4LDJA 2ZSBA 3ZGXA 4DSNA 1FQKA 1JQJC 4GZMA 5DSZA 2XOKD 5TXGA 2H18A 2OUKA 4D80A 4N3NA 4F4JA 2B8TA 4NYIQ 2WIBA 3CNLA 3I5YA 5SZJA 2X2FA 3C16C 4UJ5A 1NMZA 1XMSA 5IK2A 4BZPA 3IEUA 1HV8A 4LOAA 4UQOA 1TQ6A 4JL6A 3AKDA 4FN5A 2O8CB 1P9RA 2W58A 3N2EA 4AKHA 4XSHA 3M1IA 4JBWA 2H16A 3X2SA 4Q9IA 1OXSC 1QHGA 3DZ8A 1NJFA 3TKLA 4ZKEA 4LJ5A 3WHKA 1YRAA 3K9NA 3L0SA 2AFHE 3V4RA 3CRQA 2WWFA 4KSBA 3HWSA 5CLLA 4QJ4A 1UKVY 4HLCA 1RE0A 2XAUA 2CL7X 3L0OA 1NLYA 2ZR0A 3BB1A 2CVFA 2BDTA 1RYHA 4O25A 5LB4A 3W6PA 2ANCA 3AVOA 3LD9A 2OO7A 2V54A 4HDQB 3RRMA 3GJ7A 2PEYA 4Z8YA 3KFXA 1NVUQ 3IIMA 3REFA 2FSFA 3TQFA 5CM9C 4AKGA 4LYFA 5JZVA 2VHJA 1ZINA 1NJGA 2C78A 4DIDA 4CEIA 1JPNA 1KMQA 1OIXA 2F3TA 3FWYA 2XXAA 4C2UA 4CF7A 4A92A 4BLTA 5BYKA 5J47A 2EQBA 3P27A 5FOVA 1JAIA 4LSGA 4XTCS 4EIWA 5JRZA 2GCNA 3CRVA 2H57A 1P4SA 2XTZA 4Z1MD 1VG0B 4TLDA 1ODFA 3K0FA 1E6CA 3H2YA 1N6KA 1TEXA 1HH4A 1JR3A 4HI0E 5AK0A 3IBGA 4TN1A 4Q4HA 5CB6A 3K0CC 1XJ0A 2ZVQX 3VR5A 2ZSFA 5FR2A 3UK6A 1DS6A 5JEEA 1XEFA 2C96A 3AF0A 5FBLB 4A0HA 2WHXA 4L5BA 1OYWA 2FX3A 3KB2A 1RRFA 2OILA 1KJWA 1NRJB 1M7BA 1ZC3A 1SULA 5P21A 4AC9A 2ZI5A 3AVXA 2ZR7A 1KNXA 3GJ5A 2F55A 2QNRA 2XGJA 2XB4A 1VYTA 3QVUA 4ACAA 1MV5A 2ZPTX 1U2RA 5A5GA 3I92A 1XMVA 2LCFA 3VNVA 2QAGB 2PT5A 3QF4A 1E2PA 3N70A 3FB4A 3V00A 1L4UA 2XX3A 3IBYA 2D74A 5EE9A 1IM2A 2F1JA 4IKEA 1KDRA 4GBMA 3C4JA 2GJAA 2IYRA 1SXJE 2ZRJA 3EA5A 3ONWA 3L0PA 4M8NE 3AV0B 5DIFA 5G41A 4LJ8A 3U44B 1COWD 4HSEA 4IFBA 2QI9C 3X1ZA 2NZ8A 4ZIRA 5KSYA 3TSWA 2WWYA 4B3CA 3UG7A 3NH6A 2VP9A 4QGGA 5CDFA 4Q4JB 2KJQA 1D2EA 4A36A 1ZVQA 1TAGA 721PA 1IXSB 3SDZA 1XD9A 4XD7A 1E0SA 1J90A 2OXCA 5DLQC 2IEZA 3SC3A 1MRNA 4KJZA 3R7WA 4U00A 4N0DA 4LJAA 1H8EA 2GHIA 4PPFA 1PJRA 1T9HA 2NG1A 1GSIA 1N5JA 3LFUA 5CM8B 1G8HA 3ZIAD 1E2IA 3ZD7A 1CBUA 5DYIA 4ASUD 4DDTA 3UMRA 4TMXA 5JJIA 3CWQA 1VIYA 3ZZTA 4KSCA 1Z0IA 4W5HA 1JJ7A 4JVNA 4S35A 1UKEA 3I3SR 3DHWC 3NC1C 1G17A 4DSUA 1NN5A 3QKUA 1E9BA 3SFVA 1IHUA 1KSGA 2KI5A 1Z2AA 1DPFA 4QFMA 3RWOA 3SS8A 2ZYUX 2JJ2D 4KBGA 1G1MA 3WP1B 1TEVA 4HLUA 4WZ6A 1TF7A 1Z22A 2CK3D 3LBNA 2O8FA 2ZU0C 4O0MA 1KKMA 4TQAA 5LD2C 4B75A 4QBGB 3FMOB 4LYHA 4FWTA 2B92A 1FP6A 4RZ2A 2PH1A 1N6OA 4EAQA 4UXIA 5EUQB 1UEJA 2ATXA 2F1HA 4DKXA 1AZTA 821PA 1OF1A 1Z6YA 3W90A 3P26A 2C9OA 4LX0A 1R5BA 5AJZA 3GLFB 1Q12A 1K5DA 2PZFA 2QPTA 2RGNC 2VHTA 3K9GA 5L3SA 1KZGB 1E2MA 2FEOA 2QY9A 1WA5A 4KODA 1NY5A 1Q22A 1N5LA 4B2LA 5BN5A 3GJ4A 5FOSA 3VR2A 1X1SA 3B1XA 2RGCA 4FMCB 4F4IA 5DISB 4Q00A 3DEFA 4OK3A 3ZD6A 3KL4A 5E3HA 5EE0A 3PUYA 1GNRA 4RCZA 2ZROA 2IYVA 1QBKC 4A15A 5FOXA 1IN5A 2DCUA 3EIQA 3GQBA 1ZU4A 4GZLA 4R9UC 2CJWA 3BOSA 1WB9A 1CU1A 3RYTC 4IFEA 4NDZA 2BBTA 1KSHA 3NBZC 3ZQ6A 5DHFA 3AM1A 5FBRB 1O3YA 4D0NA 2F1IA 4CVNA 4TTPA 1V43A 1OSNA 2ZI3A 4BLRA 4ABYA 3DPUA 1SZPA 4RY2A 4MH0R 4Q7JB 4XH9B 1K5GA 4Q03A 3QXSA 3RSLA 4Q7LA 4B32A 1R10A 3BIFA 1XEXB 3EPJA 2HLDD 3PEUA 3LQRA 3QKRA 4QM7A 1FUUA 4QGFA 1ZD9A 1G5RA 1E9EA 3LVRE 2PJRA 3GLFE 4FW9A 2KB0A 2QMUA 4MGYR 5KNBA 4XWOA 4DCVA 3CPEA 1FMJA 2O8BB 2HV8A 4Q7MB 3TVDA 1E9RA 2FMXA 1FTNA 2C77A 2WPDA 2F9MA 3RS0A 4A0RA 2DPXA 1W0JA 1EFHA 4HLUC 4JVMA 4U02A 1G5PA 1LNZA 2YOGA 3MD0A 3UATA 1AM4D 3O8DA 2WWIA 3ASZA 1ZCBA 3I72A 4OHWA 1BKDR 4E03A 1QZXA 2E9SA 2ZJ8A 3H4MA 3ND8A 4GT1A 1ONBA 4LGMA 3BH7A 3LXRA 3BBPA 3SE0A 1XXHB 2Z0MA 4M22A 2P0EA 2W6IA 1D2MA 2B7BA 5DNYB 4QNMA 1F60A 2FPLA 1XTQA 2OSBA 1HE8B 3L8YA 3TR5A 1M6NA 2VP2A 2J41A 2WM9B 3SBEA 4D0LB 1DG1G 2DHRA 1Q57A 3MFYA 2G0TA 1Z2CA 3Q8XB 2W00A 1G20E 3W8NA 4M4SA 3GMTA 3JVUA 3H84A 3NH9A 1WF3A 1TUEA 2UKDA 1VHLA 5DI3B 1NIPA 1XTRA 2G1JA 5G3YA 1G3RA
chains in the Genus database with same CATH superfamily
4ABTA 3G8CA 3IP3A 1KEWA 1E5XA 4HDSA 3GXBA 3OMWA 4M1KA 2Q99A 1BXKA 3AERB 4DF3A 1XGKA 1J7KA 3CM0A 2HSEA 3KFVA 4YRNA 1V6CA 1YS1X 4ME6A 1IOLA 2WUVA 4OFXA 3N76A 1XZBA 4U3JA 5C52B 1X7DA 3ZCRA 4GWLA 4M6WB 4ZRNA 1EP1B 2K6GA 2I4OA 3DEIA 5E8RA 4BQSA 1FEZA 1XDGA 2CE7A 2G3YA 3AESB 3D6UA 3HB1A 3PNPA 3RHFA 4G84A 3HVUA 1U4SA 1FYFA 4IGEA 3DWIA 1J1UA 3W7BA 7AT1A 1E69A 1GPKA 4WWHA 1ITZA 2R65A 3IOEA 3AKYA 2EOAA 2RHOA 3PLRA 4RD0A 5DF1A 5KYYB 1IBKB 1JQAA 4EP1A 1PEYA 2BSAA 4KWIA 3NB0A 2CF5A 3E9EA 2J3MA 4UC0A 4MZDA 4E33A 2Z6VA 1P29A 2W2VA 4BPRA 4C4OA 1BJKA 3EJ6A 1HRKA 4W99A 2P9BA 1GV0A 2AWOA 4K03A 1H66A 1S3GA 2VHQA 3A4TA 3HVKA 5FWYA 2O8CA 4NV0A 1YWGO 2W83A 3WP0A 1DQRA 3MWDB 4RHUA 5D51S 4DE5A 5JJKA 2PKQP 3HPQA 2OFWA 3U4GA 1I3LA 1NPTO 3RBXA 4BO7A 2C5BA 2XJ9A 3DDNA 3EZ7A 3COYA 1SK8A 5JXIA 4DR3B 4XIFA 1FQJA 1H1LA 2DQZA 3T3MB 1U7PA 5KTOA 2OEPA 5GM2A 5BN3A 4WFKA 1Y1PA 3WJ7A 5JCJA 3VNSA 5KQRA 1RKQA 3KHTA 3DT8A 4JUDX 4OH1A 4FOPA 1U28C 4GPZA 3EY4A 3ZZ0A 1NC1A 2EQ5A 4CHGA 2E4AA 4J2OA 1RC0A 5LOVF 4F3NA 2ODBA 2JAWA 2QGNA 3LIPA 3HL4A 4HDOB 5EAIA 3KAQA 4RPJA 3KQMA 3R7LA 2G80A 2XWPA 3P9NA 2TSYB 1QH8A 3KXDA 2VPYA 4IIXA 2QNIA 3EGCA 4ATNA 1UZUA 5I9SA 3GAMA 3BFKA 1I4WA 3RM3A 3TJZA 4DV6B 2F3SA 3U9TA 2I3DA 1ULSA 5SYNA 3R6WA 4X60A 2WP0A 3ZHXA 4O4LF 5E3JA 4M1TA 1X7YB 2AIRA 3TXXA 4RLSA 3M6VA 3DT6A 3GDOA 4ITRC 2ORIA 1I8TA 2PQ6A 2AF4C 4JJGA 3OESA 3Q85A 1N8KA 2EFGA 2FQYA 3A6KA 2WPNA 3CWCA 4H6WA 1SCDA 4U6NA 1J8FA 3AETA 4WHMA 2WNHA 4BNDB 2FDCA 4MV0A 2XMBA 4TMVA 3WMEA 2I87A 1KKLA 5ARCA 4LZZA 5IM4A 4B17A 2HRRA 2JARA 4F5YA 4KR3A 4KYIB 2MJLA 5DASA 1NSTA 3AB3A 3OQ1A 4BDTA 3FCYA 3GRPA 3OLVA 5LQUA 1AZWA 5LDDC 3IO3A 2V3VA 4KAFA 4ZV7A 3RIYA 4TV9F 1G41A 1K5HA 3MTEA 2B5OA 2Q2OA 1LLQA 4Y2HA 3WRVA 3I2JA 1X94A 3R7WB 4YUVA 5AW0A 4X20A 1SVOA 2YC4C 1EPUA 3EC2A 4Q9NA 4RE5A 5EP4A 1UINA 1K0FA 1JEJA 2AI3A 4KRFA 1YGYA 1NVMB 1SXJD 4CXMA 3ZY5A 2XE8A 4F3KA 1GIAA 1CVIA 1IWOA 3I61A 3HJUA 1E1KA 1ZUHA 1A5AB 3IKVA 3EIOA 3JARB 2ZT7A 2QLJA 3KOMA 2Q41A 4HWRA 5AI6A 2VSOA 4EBBA 3CVYA 5J2TF 1L1FA 1PFWA 3MCAA 4J0KA 5MF6A 1YRYE 2RJ3A 3EVBA 3V4SA 1APBA 2YIVX 2XCTB 3C3DA 3KZCA 1LJLA 1E4OA 1N2SA 1JWBB 4RPCA 1SMKA 2ZBRA 2QTNA 3BJIC 3FTDA 4BAGA 1SURA 1HDZA 1TRKA 2PH5A 2PZJA 3DR5A 4UDOA 1TU3A 3DOUA 4KHZA 4L7QA 2LKDA 2GXSA 4EPYA 1TC2A 3F5DA 3PWZA 3OF2A 3BORA 4JMPA 1B2RA 1GTZA 1YR8A 3BKWA 3RBVA 4CV3A 2XKJE 5T6BA 3GXOA 3E15A 4P4TA 3TUIC 1WRBA 4ZQEA 2JL1A 2ZRCA 3QVGB 4EW3A 2IHNA 3SNKA 4KPYA 5ALTA 3VNAA 1VDZA 4TXJA 1OVMA 5AJTA 4B6JA 4RVHA 1GT91 1VMEA 4TLBA 4Q5IA 3Q88A 1SZDA 3SC2B 1YJQA 1HQCA 1ZH2A 2X3FA 3N7UA 4XJXA 3RVRA 4DG5A 1EGHA 4UTNA 2FPSA 3JQFC 1Q1EA 4JVSB 2QTLA 2Q1UA 4WKBA 4RPGA 4CMIA 5LLDA 3HKEA 3NJ4A 3B13B 2Z43A 1XLTC 3CF4G 5F4ZA 3QLVA 1LS1A 4LCBA 3P96A 1SZJG 4JI5B 3Q3VA 4G67A 4BFWA 1T5DX 1Y5NA 4NU6A 4TLCA 3OY7A 3L7OA 4COOA 5KKCA 1ADFA 4D74A 1P9NA 5EJIA 4DCPA 4O33A 4I5EA 3GGOA 3OE4A 1HOTA 4MWZA 5T6MA 5J23A 3EXHB 1P72A 2J09A 3E5HA 1L5YA 2RARA 3BL5A 4XUCA 5ECWA 2V7EA 5IAJA 5EJ2A 4EY6A 4YCSA 4Q9AA 4HQOA 2ODPA 1VQ1A 4Y2QA 1QRUA 3E9MA 5AICA 2DAPA 1PQWA 2OFOA 1SU6A 3NVKI 4IZIA 1RE1A 4AS1A 5KVSA 1GQOA 2ZREA 3C8ZA 4LVCA 4I8DA 4BV9A 1GA1A 3BJZA 3DLTA 3PK0A 1MRSA 4KPGA 4C30A 4EB6B 1YB2A 7ADHA 5IJ9A 4URFA 4NWIA 3WOVA 4JLJA 1PJ3A 1TU4A 2PM8A 3T3EA 3K30A 5TY0A 4XVCA 3CW2A 1VCIA 4WLOA 3G7NA 1TA0A 2FUKA 1L7BA 2YJ4A 2XZTA 3DNPA 2CFRA 3UTDA 3AVUA 2JFPA 4AF7A 3KYJB 3BTSA 5LQRA 1J7JA 5EKUA 5AUPB 3QWAA 2P75A 4GI1A 1UP4A 5F5XA 3ZIDA 1XRMA 3L49A 2VDUE 4X64B 4HK4A 5JNLA 2IIPA 2UU9B 4R54A 1FU7A 1T3SA 2ZETA 4AZVA 3A06A 2ZE7A 3GJRA 3PDJA 4KBYA 1SXGA 4PPQA 4R8MA 4ER0A 2G1PA 4H60A 1QG6A 4ZXFA 3QKTA 1U65A 1SOUA 3RC7A 4V2IA 1Z0UA 4I1UA 2DPYA 2L69A 3LPDA 5KSZA 2AUTA 1YFZA 3DTVD 1PWHA 2C99A 3TDNA 1H8HA 2P6OA 2V6FA 2HLNA 3D3KA 4QYXA 2B1QA 3T5BA 3COJA 1EFTA 1LTHR 2WY2D 3SHQA 2J1LA 2J9FB 3DGEC 2P40A 4MV5A 4W9RA 2VQ6A 1TYEB 2QM3A 1Y3HA 2ASVA 4NAHA 5FPPA 2H7XA 3BH0A 3T7SA 1DJLA 3OLZA 2FN9A 5AW8A 2XODA 1D0VA 2VC2B 4QUIA 2ONJA 2CLIB 4KPUA 1JSXA 4JCCA 4JXJA 1ZM7A 2DMRA 1UZLA 1XLVA 4QDZA 2DU8A 4FQ7A 2ZYHA 4B8ZA 4CV0A 5AUNB 2DFVA 4MKFA 5KNCH 2FLKA 4KXLA 4MULA 4ZCPA 3K9QO 1X9IA 2YKGA 5GADl 3ZWPA 4AKTA 4CIBA 1QK4A 5IAOA 1A04A 4OU5A 4G41A 3R74A 3BB3A 4IJWA 2I91A 3SYMA 1W76A 2DHEA 3MMXA 2BEWB 2JLQA 4DL9A 4Z4CA 3N8GA 2XGMA 3ZKWA 1CEQA 1J8DA 3Q9LA 4FLMA 1NI3A 4NCKA 4ZDWA 5J63A 2ZI9A 3N53A 4TQUS 2O8BA 3SIWA 3F8WA 1XVVA 3KB6A 4OYHA 2XTMA 4PO3X 4EUSA 2A33A 4BQEA 1YUMA 2IDKA 4PG5A 3TYXA 3VPBA 2XZLA 3M6UA 4B71A 5CJ2A 3DPSA 2OTCA 3LLCA 4Q18A 3BMCA 3EEYA 3OM1A 1YQWA 4HEJA 1UAAA 1RQ2A 2ETXA 3HRIA 3O2NA 4IQ4A 3VPFA 1WXDA 3OZFA 3EIWA 5I45A 3DAHA 3LLVA 4OX9Y 2KLBA 2P9TA 3QBVA 3NHLA 4G26A 2VDMB 1H5NA 3VOAA 1HURA 1T6BY 2J6IA 2R6CA 1ZH6A 3ESAA 3B6KA 3HNRA 1TK2A 3PEVA 4TUYA 2PV0A 4D4MA 2JFNA 1NR1A 3T7CA 1PS9A 4DA8A 2PTGA 1YQEA 1GEEA 2EYQA 1PJCA 3A6JA 4AJ2A 3RSGA 4EW2A 4EPTA 4U7DA 2Z56A 4OM8A 3RVBA 4CLHA 2ERYA 3DYBA 3FW1A 1CKEA 2E4VA 4E4TA 4U7HA 1BC5A 2A9QA 4K40A 4EB3A 4HWPA 4P34A 1NQWA 1E0KA 2PLFA 5CVDA 5FBKA 4DG8A 4RORA 1UC4B 5ITWA 3LWBA 5EIEA 1TRHA 2I3AA 5KINB 1O57A 1C1XB 3I6QA 3FM9A 3LUHA 1ZUNB 2PZMA 3M4NA 3MC1A 3H1TA 4OQFA 3UJNA 4ZTBA 5KNCD 3HCRA 2XMQA 3ZEIA 2BLNA 4X61A 3S27A 3NONA 4LRWA 3L93A 4J0JA 4HP8A 4UXHA 1RPJA 5KDDA 3V1LA 4DUZB 3AERA 1FSGA 1NVKA 2E6UX 1W19A 1VDMA 3STTA 2JIZA 3QVVA 3RSZA 2FH5B 5EUCA 2QLBA 4EMUA 2LUOA 4WD3A 3TNDA 4FEEA 1R16A 1YKSA 3SYLA 5FTJA 3Q3CA 4Y8VA 1GARA 1Z0DA 3R0JA 4HNRA 3VPDA 4JV5B 1CIVA 1RRGA 4QDTA 3AESA 2WYOA 1I9CA 1E79A 3WBBA 1OHHA 4YDHB 5KTYA 2UUBB 1CUZA 1QR6A 3BSYA 2JB9A 4J49A 3K05A 4JC4A 1YUBA 3OZGA 4OQYA 2BHLA 4QU9A 2VWGA 3W5AA 3IV7A 4U6SA 1FB5A 3LNCA 4HWGA 5TMDA 1TIPA 5K8JB 5IH7A 5KYYA 3LT5A 5I3ZA 2CLCX 3RJ9A 4AF6A 5MFPA 1N3LA 1JMKC 4FE4A 3AEXA 1PV2A 1KEZA 1M2HA 1Y3AA 1Q2UA 3I9KA 3HBJA 4R2LA 5K45A 1VJGA 1UJCA 2K87A 3FHJA 2RH8A 1KK2A 2BI8A 1OOEA 2AOTB 3MWDA 1Y5MA 2ORWA 4OQDA 4KNYA 4POAA 2J0SA 4L5IA 5KVAA 4F6CA 2XTJA 2BGNA 3TAUA 1NI4B 4PZEA 1ZNQO 4F85A 5BW5A 5FUXA 1UJ4A 3EXAA 3MJVA 1G8PA 1EIZA 1K8YB 2CEAA 3LUAA 1C4XA 3M49A 1RRCA 2PT9A 3HNOA 2G4LA 1S6YA 1BXRB 2HNBA 1BHJA 3FAKA 3G82C 5IK2D 3K70B 1A76A 2XTNA 3ZUGA 2GKSA 3O4GA 3ZS8A 1DADA 3ZZMA 4MW0A 4OP1A 3ZDDA 3NATA 2CXHA 4JEIA 3TLCA 1TLFA 1DBIA 2OO3A 5K5EA 2IYWA 1T1IA 4L16A 3X1MA 1EK5A 1U8ZA 1ZM3A 1AKVA 1NIJA 3LKZA 4WJLA 2N3ZA 4G9BA 4Q02A 4QEZA 5KX5B 2P4UA 4WECA 4OGWA 5EXPA 4AG6A 1DFIA 1CK4A 2HCFA 5JASA 3NYQA 1GNLA 4UCQA 5TS2A 3T6KA 3SQXA 3GDWA 2YVAA 1P7VA 3BPSA 4UTXA 5HHTA 3N8IA 4X6LA 1M9NA 2AHRA 1EFLA 5FPYA 2D1SA 2I1WA 4Q7EA 3DMRA 4C07A 5E7JA 2CDNA 1TW2A 3E0QA 4PINA 3VU0A 4FJ0A 2A59A 4TMWA 1ULHA 4JXKA 4D8VA 2X58A 5BN1A 1WVGA 3EA4A 1PU2A 4B3BA 2DUWA 1JR2A 2HLHA 4E4YA 3QYFA 1ZOPA 1XU9A 3PYXA 4ALNA 5L6LB 4R7ZA 1JHYA 4KRGA 1XE3A 2QQ0A 2LRHA 4WKOA 2VSNA 2GVNA 2WG0A 4EGAA 2HSJA 3LL4A 4ZYWA 1NQAO 4BNDA 4UVEA 5IAGA 5A6SB 4JT4A 3B9PA 4IOJA 4RE6A 3LLUA 5JFTA 3ACBA 4BRWA 3H05A 1ISFA 2QTHA 1T26A 2QRZA 4A0FA 5CJJA 4LFBB 4FVTA 1IZ9A 2GT1A 4TWAA 2HDOA 4MWTA 2FP3A 4HQ0A 1FVHA 1D5CA 1ILEA 4KIGA 4BLWA 2DM6A 2RH4A 1S0UA 1BXGB 3NXKA 3EPKA 2B4QA 3KCNA 5GPBA 2JHFA 3TNFA 2WZBA 4JASB 4K46A 3SEZA 2VRNA 2XE6A 1QF9A 4XJVA 5A62A 4ARUA 3BJMA 4LHZA 1FBTA 3C98A 3RE1A 3BZUA 3U7FB 3M3PA 3JVDA 4MGKR 4PZZA 4DV2B 3NTUA 4OF4A 4M2LA 4U63A 2Y0DA 2EFYA 2ADFA 2HY7A 1EYZA 3JARA 4L50A 4U7PB 3L4JA 2PIAA 1YZUA 5DYGA 3A1NA 5IDQA 3H9CA 5HW0A 5ILGA 3T1YB 3IPXA 3GVIA 1N4AA 1DDIA 4M87A 1J0CA 4OKNA 3V3KA 1VPDA 5AW1A 1NBIA 2J5XA 1HSOA 4FCWA 4FZ5A 1NVDA 1I6LA 2X2OA 4IV5A 2BZSA 3RR2A 3SOZA 3T1QA 4A3SA 1V3UA 5FH9A 3UKOA 1AMNA 4M8SA 3WIOA 1SKUA 2D5CA 4UASA 1VM6A 3WYDA 4BWGA 5K6AA 5KTKA 4BE4A 3AQ4A 3JYQA 1GRCA 2GD2A 3QUAA 4QL3A 1SOVA 5G02A 3G1TA 3ABOB 1QIFA 2UUPA 3PCRB 3QVGA 4LX8A 1U3TA 4UMDA 2FPMA 4HVAA 4YY3B 3VDNB 3OO1A 1DWUA 1RYBA 4HN9A 4X94A 4E07A 4KXQA 2Y6VA 3TJRA 5DULA 3SC2A 4PY2A 4YUWA 1Y33E 1Q14A 2NXEA 5CYPA 4R7TA 3UOWA 2IYUA 3FSRA 1RPAA 1PWEA 2YMPA 4DMCA 3H86A 4IWNA 4H6XA 4EELA 2P5SA 4ZICA 1IY8A 2XDQB 3BXHA 1QHSA 2QX9A 1KQNA 4AKSA 4QTZA 3A1EA 5I5GA 2XYVA 2BONA 3F6RA 5FL3A 3HRKA 4RWEA 1Z56C 1WR8A 1E5QA 2NQ2C 2FUNB 5C34B 3T7JA 1RAHA 1JR6A 2GCOA 1RR6A 4OKIA 1VLLA 1LXCA 2EEZA 2XD9A 5KTSA 4DQ0A 3PQ5A 3EXHA 4LRYA 3ROMA 5J4LA 5JCPA 3V7FA 4HZGA 2GFIA 1PFUA 3IPAA 1I9GA 4FU0A 2ZYAA 1ZMBA 3TD9A 4ITVA 3OD5A 1LLCA 2WJZB 1NFQA 1VLJA 4N5NA 4QM6A 3AF2A 3R3HA 4GLBA 1SKMA 2HIHA 4O2AB 3UPDA 4EUFA 3SDSA 4LZJA 4EB6A 3OIFA 2LCIA 2OQRA 4MYCA 1A8QA 2EGHA 3G0GA 1D6MA 1G5HA 3P4UA 4IILA 4X5OA 4P93A 3FMGA 4UULA 3SEQA 4BRSA 4DLXA 5KREA 1CZNA 3N28A 1W44A 3CRNA 1BSVA 1EUZA 4JXZA 2OO5C 1KJJA 4ND6A 3W5UA 1RQNA 3SEFA 1NR5A 2IS2A 2QU8A 3DXFA 4N49A 2IZ7A 3D6AA 1YS9A 1C9YA 2IGTA 3DV0B 3GMIA 3QE2A 4DHEA 4RTRA 1ISRA 1CRZA 2V7BA 4G5RA 4ND2A 3LAWA 3ROQA 4BNWA 1R50A 1OH6A 5JXGA 2PKXA 5FJIA 4TMFA 2BCJQ 1E1RA 1R37A 1Y7LA 4GOLD 4TYQA 3R5SA 3MCVA 1EXWA 1CWUA 3CZAA 5CHYA 4ZQHA 2O7QA 2Q6OA 5DLPA 5C18A 3SX4A 2B1IA 5KNDA 1A9YA 3KBBA 2N42A 2O0KA 3DMFA 1M0WA 4M38A 5L53A 1JFFB 1OGYA 5CDSA 1U0RA 3MLAA 1XZIA 2O0JA 3I4LA 3U7QA 4Q47A 2YFKA 2FEPA 2J9FA 1YS6A 3DW3X 4IINA 5H3HA 1Z08A 3OTIA 4LUCA 1KVTA 5C7OO 2H29A 1Z33A 2C5GA 4FSHA 2Q2NA 4PPGA 4QD3A 3LZ6A 3LS2A 5CGZA 2XYGA 3IBSA 3D6HA 3DEZA 4UFNA 2ECFA 4HNVA 2JBHA 1W36B 2JAHA 1FUIA 4K9RA 4F9FA 3IEIA 3O38A 5BN4B 1A4XA 2W6ZA 3BF7A 1FDRA 3W77A 1X86B 3HABA 3OT5A 4GMGA 3H8WA 2O2EA 2D4HA 5E1DA 2IV3A 3VJRA 3VH2A 2BFWA 4NCJA 2G17A 3WGTA 4HGZA 3DVLA 3A70A 2J0UB 4E2YA 2OUIA 1Y4AE 1MTOA 3GAAA 1Z7GA 4H1UA 1ZZEA 2BEWA 2ZIGA 3OZRA 4R2HA 5CLQA 1PL0A 2GCEA 2VYVA 4MQ6A 4TTQA 2YV2A 4N0PA 3GFOA 2VL7A 4F84A 2PR7A 3ED5A 1S1CA 3LW7A 4M0DA 3UJ7A 3GLGE 5F12A 2FDXA 2O5CA 3DBVO 2UZ4A 1N2CE 3LCCA 5J4VA 1Q7BA 2UYYA 4LEIA 1OXTA 4MPPA 1M0EA 4CLOB 3FOZA 2ZUDA 1EHYA 1BFDA 4UNNA 1JG4A 4XCVA 5AM5A 2OBFA 4GYYA 4GIBA 4MP8A 4PAQA 3P71T 2YJZA 1T43A 3TMAA 3CUYA 1DEHA 3U4HA 4RO0A 5JALA 4UW9A 2FSVC 3M6AA 3VV2A 2FMKA 5KNBD 2XYRA 3I0ZA 2H00A 3ASUA 2H85A 3GLUA 3SR3A 5BQXA 5HQ3B 3NHAA 4I6JA 3BDAA 1HEIA 3AI1A 4LK3A 4MRPA 2R66A 2VDJA 4QYTA 4KPEC 1VE9A 1W0JD 4ERNA 2H4WA 1V3QE 3DO8A 1ZJ5A 1QTRA 1IHDA 1H0HA 3FFXA 4OL9A 1P7CA 4M76B 4ZN6A 3C7KA 2AC7A 4NHOA 4AMYA 3P94A 8ADHA 4I2NA 2I2CA 4HN4B 1T4GA 2A67A 3RASA 4AJLA 3WL3A 5A9RA 3UYLA 3ZX5A 4DM4A 1DCTA 1G6OA 1XXHE 1C1XA 5C80A 1ZONA 1JZSA 3BILA 2TYSB 4FOSA 1O5IA 1ZUNA 3GW8A 5LMZA 3QF7A 1BDJA 2H3EA 3NIWA 4H15A 4IX9A 4ZEXA 2IP1A 3WFIA 3DE3X 5K8VA 4M0UA 2D4AA 3FN4A 5LZ5A 1OZAA 2PWYA 2QL6A 2ZQYA 5AJUA 1C9DB 4D3SA 2C92A 3K8QA 4V0NA 1IDN1 1JXMA 2FV8A 3G5MA 4RJKA 4X7MA 1CXZA 1NC3A 1VPLA 4OHZA 2P8SA 3TL2A 4AN1A 5HIAA 3C5HA 3DJFA 5AKLA 1T10A 2CL5A 1NUAA 2I62A 3KKQA 2H4JA 1Q1AA 1NOJA 3QJ5A 4D46A 4DZZA 3PNKA 4NQZA 3KZVA 3RAGA 4XGIA 1H2RS 3UG6A 1R88A 3HB5X 4C08A 1E1DA 5CEEA 3LUPA 5JLJA 5HCUA 1F1BA 3G59A 3UAWA 4FZJA 2EF0A 1JA0A 4XLTA 2UYGA 3OE7A 4WCFC 1JS1X 1C0PA 4NBTA 1KZ9A 4NP6A 3LHSA 2I6FA 4UXJA 2QT1A 1A8PA 1XNGA 1T0HB 4RZQA 2F1OA 5FWXB 3ABSB 1ZGZA 1N33B 3VAYA 2YRFA 5CXXA 1C14A 2ZT5A 4J91A 2IV2X 3C6ZA 1NBEA 2X42A 3B82A 4LOHA 5JI3E 5DO9A 1N78A 3LUDA 3L84A 4BKRA 1I14A 2G8LA 1SPXA 2JH8A 1KAOA 1GZUA 4JBHA 4L7VA 1YE3A 1NVEA 4C89A 3EVAA 2Z3ZA 4MO9A 1NW9B 3LT4A 4TZ0A 4RK4A 2VPPA 1GHTA 1JILA 3IR5A 2RAVA 3KKMA 8OHMA 4AMBA 2H9AA 2NSJA 3MCTA 2O2XA 1OFIA 1MDBA 2H92A 2O5VA 4IRUB 3SC4A 5IUJC 1LPAB 1ZM4A 4KE9A 1T2NA 3VKUA 4DADA 4POOA 4I1PA 4F93B 2QW1A 2ZQ5A 1KOLA 1FIUA 3NANA 4S0ZA 3R3ZA 3H4VA 4FTWA 3LOQA 1THTA 4GKAA 4KNVA 4DLVA 2BGIA 1GSAA 1Z28A 3PR2B 1HZZC 4Y3UA 4RYLA 2TECE 4UNRA 2GPWA 2O3TA 2P9YA 4C6TB 1LNSA 5KX5A 3HR4A 3UB3A 3IAAA 3OHMA 4HBZA 5AKIA 1M8PA 4NV1A 4P33A 3QFTA 3ZHYA 5BUQA 1SC1A 4LF5B 4BS9A 2OMEA 4GW3A 1A71A 2NM0A 3GFBA 5ER9A 4GL2A 2ENWA 2Q0XA 3D8SA 4PLZA 2HO4A 3WMWA 1NG1A 2RJNA 4EI8A 2PNFA 2I4NA 3O2JA 3QLUA 3SXUB 1TO2E 2B1JA 3PS9A 4PV7A 1JAZA 1NU6A 3JQ6A 1MABB 4TSKA 4TSFA 1MXHA 2JLBA 1WXXA 5DHQA 3QHAA 3CF6R 4RK1A 9GPBA 1NF9A 2O3JA 3H6GA 3EZGA 2JGDA 3OIDA 3S70A 2JFUA 5JMOA 5EI5A 3BUSA 5J43A 2WR8A 4NAUA 3B3QA 2ZEJA 3Q72A 1BE0A 2VF4X 5LFAA 5EE1A 5FADA 3RABA 3G0HA 1P4HA 3ZQUA 5LQMA 3BXGA 3HLKA 4LK2A 3WLHA 2YCBA 3B8HA 3NVAA 3O31A 2Q7OE 3M33A 4BFZA 3HDYA 4FCCA 3K5IA 4IV8A 4JR0A 4GI2A 5EMKA 4WA7A 5A6SA 3FPCA 3F3KA 3K1ZA 3M83A 5K9ZA 1ZH8A 4B6QA 2TRSB 4A5OA 1OKKD 1W94A 3KG2A 4HOYA 1O0SA 1R0WA 2CZQA 3W3AD 2QRMA 3QVWA 4KC0A 5F76A 1FFAA 1SWWA 1CYEA 1EWKA 4G09A 1LBSA 4ZPXA 3NEJA 3TZQA 1ECPA 1BXGA 1NY6A 3H5VA 1KAMA 1PJZA 4H1VA 2QM0A 4FN4A 4OVKA 2AVDA 2HQRA 3EUAA 4PSVA 1GUAA 4ZYYA 4V02A 3AR9A 1SUCA 4BE7B 2JLRA 2F43A 2QSJA 2ZS9A 5JFOA 2UV8A 2EX1A 3PXDA 4Z0NA 2NU6B 5EPEA 2UVDA 3S2YA 1YZHA 2WC1A 3EIHA 3H2IA 3JD1A 4RZ3A 1X92A 2Y76A 4DV7B 3L0YA 3VUEA 1NBHA 4UU8A 5AOBA 3W1VA 3OQOA 2FG7C 2MSKA 3WLOA 3ZE6A 3ZGOA 5AIBA 2BGWA 4UUAA 4OATA 3BWMA 3FRHA 3U7JA 3CZPA 5JD3A 3E9QA 5K0BA 2MMCA 2GAAA 4L0CA 3OE1A 1QSGA 4R69A 4A73A 3YASA 1FMLA 3ZQJA 3BJEA 3M5WA 1NJ6A 4HUQB 1ZQ9A 3WY9A 4DLKA 5KDOA 1LK7A 3L41A 5LPNA 1I30A 2CVPA 3AEKB 3KETA 3EVZA 4AECA 1GXSB 1KMHA 1UXJA 2I3GA 3K9CA 3L46A 3T15A 3ROFA 5BURA 3R23A 2CYCA 5K0LA 4ESEA 3OQMA 3RHZA 1GWNA 3ZY4A 5IKPA 4J1SA 4NBSA 4ZHQB 2IQIA 4V03A 3OFND 4RKQA 3HY6A 3H5RA 3JD4A 2AV6A 2WF5A 3EUWA 3NTRA 1I4LD 2YV3A 1CQWA 1GCAA 2C88A 3F4KA 3EDCA 3O73A 4QULA 4O3MA 4F5EA 1EINA 1V5WA 2OGTA 3DVQX 3AEZA 1BJRE 2J46A 1CJUC 2XDQA 1IMOA 4JENA 5C8VA 3RU3A 1DGQA 3UWMA 1DOZA 4P3YA 2P2ZA 5D3KA 1T2UA 3N1UA 3VOSA 2IKQA 4CZ2A 3NT2A 1E2JA 2G63A 3IB6A 2D2FA 3EFBA 4GBGA 3EISA 1K86A 1T8TA 5CIWA 4XVRA 5KKAA 3VYWA 3GH1A 3NHRA 3TAXA 3I2HA 2YTZA 1O0CA 3G5LA 3JWEA 5B3JA 2REXB 5DCUA 3DFZA 2P5TB 2XMZA 5IANA 3ZN2A 4JH0A 4JFRA 3RVPA 2A9PA 2DBQA 1U98A 2XPCA 1CQZA 3M3DA 1DDOA 4NMLA 2YBDA 4OA5A 1QHHA 3DOCA 5B3LA 2FKNA 4OQMA 4BGDA 4FFNA 3VPSA 1SQ0A 1Y34E 2BHNA 1NXWA 4IVRA 4O2AA 4QDJA 4AY2A 1N9ZA 3P4YA 2BR4A 1UBKS 3FRJA 5C1IA 3R7SA 1O58A 1QGUB 3ZHQA 4ENVA 1WBDA 1NAIA 1AF4A 4DJAA 1NJ2A 2YJ6A 2ZIEA 4XEUA 4QTYA 2WJGA 1FS6A 1Y3BE 1RJWA 3IBTA 3OCXA 4AZWA 4BVLA 4AQDA 4S1PA 2AW3A 3UIEA 1DEKA 2GN2A 2HJSA 3KAPA 3RVLA 2Q4RA 2UXBB 3P19A 1O8CA 3B48A 4I8IA 4BN4A 5AK6A 4ZMBA 4HDKA 2WWVD 1JJVA 4W9MC 1IG3A 2ZI7A 2ZRHA 3WNDA 1B6SA 1T8UA 4FFDA 2IXDA 2Z8YA 1D1SA 2HJRA 3ZDZB 1KSFX 3WWYA 4D4HA 4UTRA 1A9PA 1HG1A 2JLYA 1M2KA 2H0QA 3A9TA 3DV0A 4YJDA 2SECE 4LY0A 4A0QA 1QF6A 3GLTA 3LO5A 1PLJA 1ZVMA 4ZALA 4ITUA 1ZLYA 2IK8A 1AQJA 1GP2A 2R11A 3FG9A 1EFCA 5BYAA 1RC1A 1LGYA 1LLUA 3TEMA 4FHZA 3TLKA 3QLVC 1ORRA 3O47A 2C00A 1PBNA 5KQPA 1Z8FA 1C8BA 2C07A 1JFFA 521PA 3KZ1E 3PKJA 2EJBA 4FHDA 2IS1A 1N2OA 2D59A 1R12A 2ZS7A 1GPNA 2VR1A 4MV9A 1GAQA 4DA4A 1BS2A 6Q21A 1GRQA 1I7NA 4MQEB 5IVKA 4R3UC 2IHVA 4EI7A 1EBFA 4ZRMA 1G2QA 2A4MA 4GGPA 1WPRA 2VCEA 3ADDA 3DKVA 2CFSA 2Y8EA 2AXPA 3ET5A 1JQDA 1W6UA 3OZVA 5BN4A 4IEFB 1GTSA 1W85A 1Y7HA 2A94A 2WJYA 3QKWA 4PPYA 5ALFA 3C3YA 2HHHB 3HR7A 1HRDA 4N7MA 1T2AA 3HSKA 5HGJA 3K0SA 2VTBA 3V4OA 4DLWA 3RRYA 5FYQA 4KBFA 3QEKA 4MVCA 3H11B 1E61A 1C7QA 2EW1A 1CTQA 2VZ9A 3BE4A 1Z5GA 1UAYA 3AEQB 3AUAA 2HREA 4XJSA 2A3RA 1ESMA 2UYOA 1GOTA 5LSAA 1NKSA 3EHEA 1L7PA 2C57A 1SIOA 4IM7A 3WISA 1ADGA 2W7TA 3A05A 3KLMX 2BMDA 3OZCA 4KIJA 4LXGA 4YJFA 4Z9FA 5BRJA 4N0EA 2EFEB 3SR0A 2Y27A 3Q5EA 5CUQA 3GPBA 2PWPA 2ERXA 3JQEA 2ZXFA 4CLOA 1NBAA 2QV7A 1XZCA 5A02A 1BVYF 4TTTS 1BMFA 4I9FA 3UT6A 3AFHA 1D2GA 3W6UA 1SM4A 4QYIB 2JEYA 3IUBA 1SO8A 3Q5DA 1YQ9A 1DKUA 1NXXA 1T9DA 3JQAA 3JR7A 1SEPA 3JQPA 2EHDA 5K3SA 1FDSA 4QJ5A 4UDXX 2PX3A 2CMGA 4O4JB 1SUEA 3CR7A 2XCUA 3R3XA 4JJKA 5FD8A 4A0GA 4ESVA 1DBQA 4TXMA 4PPNA 1ZW6A 1QRTA 6ABPA 2HMVA 1R9JA 1OQAA 1MB9A 4LRSB 1UMBB 5GY7A 1OFUA 5K8LA 4OOEA 1ODLA 3ZOZA 5I7FA 5CX4A 1TUIA 2XNDD 3O4VA 1NUSA 1L4EA 1SC9A 3BWEA 5A7GA 4UTVA 2NADA 4PR0A 2B4RO 1HEYA 2HCJB 3NXSA 4G1EB 2YX1A 2QR5A 3A9WA 3PFBA 1YGPA 1S1MA 2J30A 2ADMA 4MQBA 1SGWA 4JX9A 4KV7A 1YFKA 4XFJA 3DAFA 5T3UA 1YAHA 2O50A 3G2PA 3RTEA 1QU2A 3NW9A 5BNZA 4RKWA 3QOXA 4N8SA 2UYCA 3F6BX 4FS8A 2F8LA 4FBLA 1QAQA 2I29A 1SFRA 2A9FA 1B26A 2C0QA 3VX3A 4BASA 4II2A 2YFQA 1J70A 5CIYA 1UM8A 2JNWA 2EERA 3UJ9A 1W2GA 3L8DA 1U3DA 2J0EA 4C4SA 1GNTA 1SXJB 1YDMA 3H0EA 1KC3A 1KKUA 2JGMA 4XSGA 2VDOB 5FULA 3BA1A 3B6MA 6REQA 3A11A 4BVHA 2BM8A 1VSTA 2UAGA 3DCNA 2W2LD 5D6OA 9ABPA 5JAIA 4O2BF 3FDIA 1O97D 3H2GA 3DD1A 4XKJA 2RE8A 1FFCA 1PD0A 5D6NA 2X6TA 2M2IA 2VWQA 2B4KA 2HBZA 4QU0A 1K06A 5IJZA 3CGWA 4GYJA 5IUNC 1VRWA 2WFZA 2PUHA 4AO6A 3L7IA 2DECA 4X97A 1NZDA 4JLKA 2OB2A 4HLNA 1RYDA 3I0MA 4XRGA 4J8PA 3GCDA 1U4NA 4FQ8A 3ICEA 1P33A 3AM3A 4F38A 4O02B 3PIRA 2C3OA 3U3OA 3EDOA 3JQGB 2KBFA 4MKGA 5EJGA 4OKSA 4EYGA 1OBFO 1UJ5A 2Q5IA 1FOEB 1U2PA 2E55A 2QD5A 2OOSA 4LJ6A 5E6UB 3ZWBA 4C3UA 5IBPA 2AYXA 4UBMA 4OREX 1CUHA 2WU3A 1OTXA 1TVKA 2O8DB 3N6VA 3JQBC 3IAM1 3ZYCA 3FWNA 5A4KA 1Q7RA 2FF7A 2J6BA 3HP4A 3LXMA 3B36A 4M83A 1ZD4A 4N9QA 4Q3LA 4FFBB 5ECDA 3EZ9A 4AS3A 3BAFA 1KI8A 1K3TA 1V11B 4I46A 1FNDA 1RXWA 3ZDAA 2PK3A 4GOKA 4OXQA 5AHXA 4D81A 3UXHA 1ZP6A 1AC5A 3FVWA 5JATA 4JB3A 3BMOB 4GG1A 3Q9UA 3EB9A 4RS4A 1WB6A 2VK1A 3A4NA 3GRYA 2RHGB 4NYJR 4L27A 5DKFA 4CFZA 4D2IA 4DNQA 5HYVA 3TD2A 3N86A 2OGUA 2BM9A 1MVLA 1LEHA 1K6EA 2H1LA 4R6XA 4ZYXA 1WDMA 1IL0A 2DBYA 1E94E 1TL7C 3HU5A 5FA6A 1W9HA 2QTGA 4GSYA 5EGSA 2RGWA 1MAHA 2J4CA 4BV3A 1KS9A 1RYNA 2XR1A 5C32A 1D1TA 1W5EA 4Y2PA 1ODTC 3KKLA 1MABA 5F3WB 4UU0A 4KUHA 1QPBA 3CUVA 1MN6A 4RYDA 1QC5A 4XDHA 3ZJYA 4QLOA 4NMMA 3L6RA 3UKDA 2BZ0A 4DCGA 1P18A 2PFKA 2XZDA 3ENQA 3ETGA 4RJJA 1JH8A 3EF1A 5DBIA 1I51A 5BVGB 5BRNA 5IULC 2V0CA 5CXQA 4C7OB 4LWOA 3MQFA 1FNMA 2ZPUA 2OESA 4Q01A 3RFUA 1Y42X 4RVSA 5JAMA 4MJ7A 3VU1A 3O26A 1BXZA 5L4SA 3QG5A 3L4EA 4MOWA 2VKTA 1JW9B 3EAFA 1GUFA 1I33A 1Y8RB 3HKDB 2ZI4A 2HXYA 4KYTA 1SKQA 4UZEA 3WYFA 1XKTA 4WZBE 3AJAA 4Y1GA 1XJ5A 2WJIA 3IRVA 1PHPA 1WW2A 4XX1A 4YC7A 4D02A 3IVAA 4NG4A 4Q82A 4MEJA 3LBAA 1GAJA 2VTKA 3ND7A 1DAFA 1T3TA 2I76A 4WPGA 2FZLA 5HE9A 4ECAA 4ARBA 1Z35A 3QUQA 2R6FA 3EAQA 5JE8A 5ERXA 4INOA 2HDWA 4S2UA 1UBJS 1ZXBA 3IQXA 1SXHA</