4Y0AA

Shikimate kinase from acinetobacter baumannii in complex with shikimate
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
179
structure length
179
Chain Sequence
b'PSKAFETLPNIYLVGPMGAGKTTVGRHLAELLGREFLDSDHEIERKTGATIPWIFEKEGEVGFRTRETVVLNELTSRKALVLATGGGAITQAPNREFLKQRGIVVYLYTPVELQLQRTYRDKNRPLLQVENPEQKLRDLLKIRDPLYREVAHYTIETNQGAARDLAQKILQLILSNKLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Shikimate kinase
publication title Structure of shikimate kinase, an in vivo essential metabolic enzyme in the nosocomial pathogen Acinetobacter baumannii, in complex with shikimate.
pubmed doi rcsb
source organism Acinetobacter baumannii
molecule tags Transferase/transferase inhibitor
total genus 65
structure length 179
sequence length 179
ec nomenclature ec 2.7.1.71: Shikimate kinase.
pdb deposition date 2015-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01202 SKI Shikimate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4y0aA00
1B0UA 3SJCA 2VPPA 2FZLA 2QTVB 3P32A 4FCTA 3HJNA 5KSYA 1YRBA 3A1WA 1E2PA 1P4SA 1QRAA 3QXHA 3QF7A 1ZNZA 1MKYA 1W44A 1CR4A 2DCUA 5FL3A 2OEPA 1VG0B 4BLSA 2GZAA 1OFHA 1NVXQ 1OKKD 1ZNYA 3GMTA 1UBFA 3BE4A 1P9WA 1CIPA 1Q3HA 2GEUA 3CRW1 2WAXA 1XPRA 2J46A 4PZLA 4OQLA 3ZIAD 1MO5A 1TF5A 1F2TB 2AK3A 2QAJA 4ZDIA 1U8ZA 3U3JA 2V1UA 5SZKB 4Z54A 3SYNA 4U02A 1E2FA 1KY2A 2ZITA 2VSXA 1NN1A 4M22A 1VDZA 1AZTA 5F2EA 3MSXA 4LHVA 1EFHA 4KLZA 1YZTA 2AN9A 3GLHA 3F0TA 1Q1EA 2AFHE 1KO7A 2CBZA 4LBYA 5BWMA 3SOPA 1RW4A 4O2LA 2IXFA 1OXTA 4TYQA 4JYBA 1XTIA 3CNLA 1KK0A 4Q66C 4XD7D 3GD7A 5EXSA 1UKZA 5EUQB 1R5OA 1UFQA 2IHYA 1U94A 2VHQA 5DI9A 1KY3A 2J45A 4GBMA 2KSQA 4X8MA 4K8OA 1NKTA 2IXGA 1GNQA 2CK3A 4O0MA 1TX4B 3SFZA 3IHWA 2IS2A 3GJ6A 1D9ZA 3BOSA 2V54A 4IW3B 2CJWA 1ZC4A 2NOAA 1LB1B 3BFXA 2WHXA 1BS1A 3OFNA 4KBGA 2OAP1 1JALA 2IYQA 2NPIA 3OAAA 2PLRA 1J99A 3K9LA 4DHEA 3VNUA 3G0HA 3P4XA 1J90A 4KODA 1RRFA 1EFTA 3IBYA 1P3JA 4F38A 2ZVQX 3FMFA 3CWZA 3K70D 1M6NA 3AVUA 4ZV4A 1D8TA 1OSNA 4BGDA 4B43A 1XNJA 3TMKA 1D6JA 2BMJA 5AUPB 1I4LD 2GXSA 5EQTA 4CVNA 2Q3FA 5KHOC 1DO0A 3THXB 4RFSB 1XZPA 1KI1A 2A3RA 5LB2A 2QE7D 2NTYC 1FZQA 3TH5A 3VU9B 4PC3A 2IYSA 1EXMA 4TTQA 4E22A 3D6TB 3TGPA 4C0LA 1PV4A 2ODWA 3S1AB 3HYRA 2Q3MA 2VSFA 3FTQA 4PFSA 1XD2B 1NSTA 2KBEA 3OEED 5BN4A 2ZI9A 1EGAA 1II0A 2XITA 4R98A 1S9HA 3LW8A 1DTSA 1XMVA 4JBWA 2WSSD 2WWXA 3HU2A 4X8OA 2IK8A 2GF0A 3T1QA 4TLDA 1SQ5A 3FKSA 4G0NA 4P4UA 2R6DA 1ZNWA 2OG2A 4P32A 5BYJA 3ZJYA 4NTZA 4ZKDA 4TLAA 2JA1A 3W5JA 2PJRA 4NYIQ 2ZYWX 3UMFA 1N25A 1M8PA 2AKYA 1W2HA 3B78A 4ZIRA 1GKUB 2XZOA 3KKOA 2W2TA 1TQ2A 2GVDC 2ZR0A 5TXGA 4PR0A 2F55A 5JECA 3FPAA 5KOYA 4E5UA 5KPDA 4PC7A 2F7SA 4MA4A 4DB4A 1S8FA 1K6MA 1B23P 1E9FA 1QHYA 3AP3A 3JVUA 3PEYA 3R20A 1AJEA 1KNQA 4X8HA 1SVSA 3ZYCA 1QZXA 3VMFA 2J0UB 5BW8A 2ZRAA 3DKPA 3KTAB 4S2EA 4DDVA 2FFQA 1EFCA 1ZUIA 2ZUCA 1KMHB 4DVGA 5L3VA 4IEIA 3PQCA 1FQKA 1KI7A 1MR3F 1NY5A 4JLMA 2Z4SA 2RGNA 3LQRA 4A6PA 3AKEA 2ZE8A 3MWLA 1TQ6A 1GILA 1IJEA 1XX6A 3LBHA 4BLTA 4YMVA 3K70B 4GZMA 5ELXA 1YU9A 4XVQA 2R44A 4P33A 3GPLA 4JS0A 1W4AA 2E87A 3LBIA 1QHHA 2ORIA 2X1VA 2ZS7A 4W5HA 5DYGA 2LKDA 3RSLA 3UIEA 3EIQA 1BMFA 2FOLA 3UG7A 2IXEA 4I1SA 1II8B 4KXFB 1J2JA 1GSIA 5TARA 4DDWA 1Z2CA 1XXHA 3SYLA 1GTVA 3IBGA 4B75A 3S1AA 4LPSA 4IXNA 1XCGB 4D4KA 5IHPA 1XEXA 3P26A 3GLIB 1OXVA 4DB2A 3BBPA 2I3BA 3K0AA 1GKYA 1UBCA 3L43A 4BEBA 1UAAA 4ZCMA 4KYIB 4TYPA 721PA 3VR3A 1XEWX 3EZ2A 4JJKA 3THWB 5DI3A 3MMPA 2OZEA 2Q0HA 3KX2A 1G41A 4B2PA 3SZRA 4CF7A 2YWFA 2WKQA 4Q1BA 4ILEA 1E1RD 1GRQA 2DPXA 3PUVA 1W36C 4TYWA 2QY9A 4TYYA 4RSGA 3VKWA 4Q1AA 2P5TB 4XD7A 2AK2A 1N2CE 1QHNA 1U8YA 3K70C 1XWIA 4RJLA 2I4IA 3QQ5A 4JLBA 2GEVA 4MRSA 4GDFA 5DIFA 4QHSA 4C0HA 2YOFA 5FOXA 2QP9X 2F43A 2FWRA 1FP6A 3KKPA 3VFDA 1F6BA 3SJAA 1VMAA 4DLTA 1NVUQ 4NYMQ 2J0UA 3A4NA 2FPLA 1YZGA 1KSHA 2FV8A 3VAAA 2AX4A 4OL0A 2AWOA 2ZAOA 3WYFA 3K0FB 1OT3A 3Q3JB 4DLRA 3A58B 4DLUA 2OSBA 1X1RA 2PCJA 3ZDQA 4MH0R 3U3MA 2LWIA 1NF3A 5G40A 3CW2A 2DY1A 3AF1A 1KTVA 1P2TA 4YMWA 3CRQA 4UNSA 3CPJB 4OJKA 4BLQA 2CNWD 1OYYA 3B1XA 3Q72A 3QEJA 4ZI2A 1Z0KA 4Q9IA 2ZRNA 3ADKA 3RRYA 3LY5A 3PFIA 2HJVA 4QKQA 4ZDJA 2V9PA 4WBSA 1SVWA 4AWXA 3I62A 1VIAA 1OHHD 1E2IA 2H17A 2YWHA 2D3WA 2J5XA 4DEXA 4LRWA 1OFUX 4ZDWA 1JAIA 2GAAA 1YZUA 1E2GA 2HF8A 3IIKA 3K09C 2ZM5A 3ZQ6A 4GZLA 3AB3A 1PZNA 1ONBA 3THWA 4URZR 4POAA 1NVVQ 1R4AA 4BE7B 1GWNA 4NKRA 1GITA 3B1YA 3AVQA 3MG9A 1GNPA 1XTRA 4Q03A 2C77A 2WSSA 2ZEJA 4JVLA 1OE0A 3F3YA 1G7SA 3HPRA 4LBWA 4LJ8A 2DWOA 2CMKA 2EYQA 1SVLA 2FGKA 3AUYA 2NO9A 3R9WA 2ZPTX 3BB3A 1S9DA 2WJHA 3LA6A 3M1IA 1QG2A 4PC1A 2L0XA 3SU8A 3TRFA 3GLFB 1IBRA 4LYHA 3W8NA 2GJSA 4TMKA 5EP2A 1PJRA 4ZPXA 3RS5A 1DG1G 3OE7D 4U00A 3FMOB 4F93B 1NL3A 5JMTA 1KO4A 2BOVA 2XZLA 4HUTA 4B32A 4HB2A 4P4TA 4DLYA 1ZUNB 1M7BA 1E96A 1NMXA 1SVOA 2GETA 2PZGA 2BKEA 1F2UA 5EE5B 3ZS8A 4EPYA 1E2KA 1KSJA 3H0KA 4CEIA 5DLQC 2WKRA 3T35A 5JWOA 1JEEA 1NKSA 4RD4A 1SKQA 1H8HD 5C4GB 4QC2A 1E1QA 2VHJA 2OM2A 2FN4A 4QGHA 2ZAMA 1X1SA 4ASUD 1E2EA 2NGRA 1DBSA 1XCMA 1NG1A 4QJ4A 3QIAA 1AS2A 4F4JA 2RGBA 3B5JA 4NYJR 5FI1B 3T61A 1KI2A 4TWZA 1Z0FA 1Z6YA 4OQFA 3E70C 1J8YF 4A82A 4HUQB 4LC1A 4B71A 4V02A 1R0XA 3KFVA 4C30A 4XVUA 4JLVA 5KYKA 3IKJA 1DAHA 5JWHA 4IHQA 4B73A 1E9BA 4ON9A 1XPUA 3LLUA 3MAAC 3VX4A 2YC2C 2WJGA 2OFWA 3CX7A 4UNQA 3MJHA 4W5WA 1HV8A 2QROA 1S3GA 3W6OA 2ZI7A 3KXKA 621PA 2YWGA 4TN1A 3UATA 1E3MA 3TAUA 4D2IA 2A2ZA 1JB1A 1G8FA 3C4JA 3C15C 4L5BA 521PA 1C9KA 3SHWA 4EPWA 2OXRA 1E1RA 1VPLA 3C8UA 5C1BA 3AH8A 1FMLA 3GLFA 3I61A 1FNNA 1I4DD 2JCSA 2CEAA 4DRZA 5EE1A 1UKYA 2J41A 4DC9A 4HEJA 2QQ0A 1XU4A 4BECA 2GK7A 4AYXA 4L16A 2ZIAA 4G3XA 4GRAA 1G17A 1AQYA 2XJ9A 2ZI6A 4KCGA 3ZLJA 4OBEA 1ZD8A 3A1VA 4CT5A 4KYUA 5FL7D 5KDLA 1P2VA 5CB6A 5FUWA 2EFGA 2AD5A 2WTUA 3QKSB 3IIMA 4LHXA 2GBLC 3LD9A 4MKGA 2AR7A 1E94E 1WBBA 1KIMA 4JLKA 5CIWA 2VF7A 1GDDA 2QUZA 1T8UA 3M0EA 3FE2A 3F5FA 1G3MA 2XTNA 4A8JB 2VHUA 5AJZA 3CNOA 1E69A 2H8KA 2QMUA 5LPNA 3CR8A 1Q22A 2WWIA 4B3FX 2BM0A 2CNWA 1KKLA 3U4QA 1P75A 2GJAA 1X8LA 3ASZA 3PCRB 3T1TA 2IW3A 1JPJA 1U81A 3EARA 3X1DA 4RCZA 1LNZA 2BBTA 1OHHA 2IYRA 1CKEA 3CRRA 4QBFA 1G64A 1FOEB 3LW7A 2BEJA 4QJ3A 1RRGA 4KFUA 821PA 5HE9A 1XZQA 3ZQJA 4YLGA 1A82A 2PEYA 5K8UA 1BOFA 4ERNA 1CTQA 1FQJA 2ORWA 5LD2B 2F3RA 2O52A 1M7HA 2RAPA 4UJ5A 4CEJB 1W48A 3OIVA 5B30A 4IOKA 4QHTA 1E9SA 3K0EA 1Y3AA 1ZBDA 3PUXA 4PTLA 5FTKA 2CL0X 4IRUB 2O8CB 3CIOA 4P4SA 4DLSA 4NE2A 4FWIB 3TR0A 4BQSA 4WOPA 4BFYA 1VG1A 5DE3A 1D2EA 4BASA 5DSZA 5JBQA 2B92A 3DOFA 4BFXA 3A1TA 3V4RA 2A7QA 2WWHA 4C3ZA 4FMCF 1N6LA 1KHTA 3MWYW 4DLZA 2QAGB 4TYNA 4G5RA 3DOEA 4D0LB 3EIHA 1XJCA 3OE7A 4CDGA 1PUJA 4JVSB 1JR3E 4KVGA 4Q7LA 5LB4A 3SN6A 1CR2A 1ZIPA 4D4MA 3QXJA 2FA9A 3K9HA 4Q02A 421PA 1WXQA 1RFLA 4D0GA 3B60A 3QKSA 4FXPA 5EP4A 2Z4RA 1HY3A 2EQBA 1JI0A 1OIWA 4PSAA 1CU1A 4A8JA 3BORA 5FBLB 1XEFA 2WIAA 4NL4H 2BDTA 2PCLA 4XSGA 1TAGA 1P5ZB 2GZHA 3KJEA 2H16A 4C7OA 1BIFA 1IONA 1X8KA 1XEWY 2YNMA 2QMEA 2GXUA 4LDJA 4OJQA 3BJIC 4ASUA 4DEYA 4BFTA 4MYHA 3PG5A 4Q1DA 5FPYA 3EZ7A 4CIDA 4EPVA 4H1VA 1AKYA 1N6OA 2ZXUA 2MSEB 1TUEA 1VIYA 1E2DA 1S1CA 3WYGA 2OAQ1 3TSWA 3E2IA 1G6OA 2WWWA 3TNFA 2QAGC 1CRQA 2UZ3A 3FKQA 2V7QD 4TTPA 4PSKA 2WWFA 2ZETA 1AGRA 1Q57A 2AXPA 2VP4A 3NEJA 2JLWA 1IM2A 5TVKA 2IUUA 2DYKA 1HH4A 3PUYA 2BMEA 4FCWA 3W8RA 3N5CA 5ANRB 3B9PA 3EWSA 3IQXA 5H70A 4V0NA 3MGCA 4PO8A 3WP0A 2H57A 3AF2A 3OESA 3C41J 4WZAE 4GOJA 4LJAA 4Y0VA 4KITB 4EPTA 4GP7A 5HCIA 4QBGB 4QM6A 3EC1A 3WRYC 1FMJA 3C7KA 4HDCA 4AG6A 8OHMA 5HZKA 1JXMA 3GLGE 4MRRA 1P60A 1TF7A 1YZKA 1E6CA 1KJZA 3SBDA 2X2EA 2HJGA 1HQYE 2H7VA 4LJ4A 2H5EA 5AJXA 2KBFA 3O8RA 1D9XA 1Z8FA 3BH0A 5FL7A 3THYB 3NHBA 4C0KA 4A4DA 3CX8A 1US8B 4U5XA 3K0CC 4OQXA 5CITA 3O47A 3PEUA 2ZSDA 5D3QA 1D2NA 5FTJA 4OK3A 1VCOA 4DWJA 5JI3E 4Q9KA 3NTUA 3NXSA 2R8RA 1VYVA 1NLFA 4LBZA 2IWHA 3VTKA 2PL3A 3PUWA 1ESNA 4EJSB 4TZ6A 1U90A 3UMSA 1ANKA 5KNCA 2FSGA 1SXJE 3TVDA 3B2EA 2IL1A 1NVWQ 1M2OB 2HXYA 2HF9A 2RGDA 4G01B 3RC3A 5GVRA 1J7KA 1OYWA 4Q5IA 2FMXA 2XXAB 1XRJA 121PA 4GMDA 2Q3HA 2ORVA 3GJ8A 4A0RA 1EX7A 2Q9BA 3ASYA 4BFSA 2IYYA 1X86B 3TE6A 2GK6A 3MRSA 3I92A 4FW9A 4KFRA 3ZZUA 2QTFA 1Q1BA 3VKHA 5FBVB 2IUSA 2RMKA 5AUQA 221PA 5K8IA 4QBIA 4YXWD 2A5YB 3KXLA 1S1MA 3W9YA 2ZS9A 5JCPA 2IBMA 2ODBA 4IFBA 2W0MA 4TSFD 5TV2A 3I32A 2G83A 2FFBA 3HYTA 1NMYA 2D74A 3TUZC 3GEEA 4ARZB 1MH1A 1XFAA 2WIBA 1MT0A 1FX0A 5FTLA 1GM5A 1MOZA 2CHGA 4DDTA 5C18A 2ZU0C 1OIVA 2ZR9A 4QOSA 3NBXX 1S4QA 2ZR7A 4NYMR 1YZQA 4GP6A 1NLZA 2KWIA 4RCYA 3WRXC 4EDHA 2IYVA 3AVOA 3AVPA 4IVRA 4RD1A 4AK9A 5JS8A 3THYA 2BIFA 5EZ6B 1US8A 4MGYR 3HWSA 3LVQE 3SBEA 4XWAA 1NI3A 4AKGA 2XJ4A 3QKRB 1SVMA 5IDVA 3CKLA 3WY9A 5FFMA 4R2IA 1E0JA 1N5LA 3B1ZA 1OV4A 3FWYA 3P4YA 1IY1A 1P62B 5JI2E 1OB2A 4EJSA 2O8FA 1H65A 3CR7A 1VCIA 4LGMA 4IDNA 3WNDA 2OV2A 2GWHA 4NP6A 2Z5FA 1GZSA 4B34A 1KAOA 3KQLA 5TDHA 4DSNA 4KFSA 2D62A 3EAQA 3N70A 3QG5A 3LXXA 4DT1B 3BWDD 3IEVA 4ITRC 2GZDA 5C46F 1YKSA 1G8PA 3KQNA 1EFRD 1W49A 2CCKA 5FPKA 2V7QA 2AHOA 4OI4A 1NIJA 4O2RA 3AGPA 2ZJ8A 4M4SA 1NVVR 1F3OA 3RLFA 3QE0A 4RFVA 5DN6A 3SQXA 3I72A 2PT5A 4CEHA 5FTNA 1W5SA 1CF4A 2IUTA 3FHOA 4C2TA 2QP4A 5JRJA 3SE0A 1K5GA 4I1OA 1J8MF 4LHZA 1SZPA 2OT3B 3EPKA 5HZHA 2ECKA 3W3ZB 2DFNA 2JJ1D 2RHDA 5FOTA 4D26A 2F1IA 3AKCA 4ARZA 4M1TA 1KMQA 5J4VA 2WZQA 2YV5A 3QBVA 4ZCIA 4DJTA 1IQPA 1P7CA 5A0FA 4BRUA 2CXXA 4Q47A 3UPUA 1KDRA 3L0SA 1W36D 2E9SA 3GJ0A 5P21A 3EG5A 1E0SA 1Q0UA 2JEOA 2OHFA 1VYTA 1Y63A 1KYIA 2QN6A 2Z83A 2OLJA 2VF8A 2JGNA 2Z43A 3KUDA 5DHFA 2RGGA 4DUGA 2PX3A 1G5RA 2ZE7A 5BN3A 4DSUA 3SJBA 1JNYA 1UDWA 3QSYA 1GP2A 1L4YA 4Q48A 4IJMA 1X6VA 1F2TA 3DZDA 1OXSC 1Z07A 4NBSA 5FOVA 3UANA 4M9XA 1NBMD 2QRZA 2GTPA 2NQ2C 2X19A 3K1JA 2BCJQ 2VP0A 1CP2A 4UKDA 4OI0A 5JEDA 1IN4A 2XTZA 4JLPA 4XOIA 4PPQA 2B7BA 1GFIA 4R2HA 4XH9B 4RZ3A 4LK2A 1XB2A 4EPXA 2YYZA 4C0JA 1NSFA 3IEUA 4HSEA 1W46A 1ZP6A 1M1YE 4PHTA 1R5BA 1WBDA 4PO1A 1TQDA 1ZCBA 2XSZA 3CPEA 3RYTC 3ZVLA 1XTQA 3DMDA 2QQEA 4AYWA 4JLDA 1E9DA 2P6UA 5L3QB 2VO1A 4Q9JA 1FP7A 1AA9A 2C04A 3DM9B 1W47A 2W58A 2A5DA 1JPNA 1N6KA 3QBTA 4G1UC 3OZXA 4KO8A 6Q21A 5B2ZA 2P3SA 1DAKA 3X1WA 4TSFA 4G5SA 2JLSA 2P67A 4B3CA 2UVQA 3KKMA 4DLXA 2IEZA 4PZYA 2C95A 1IY0A 3CPHA 1M34E 3P20A 1E2MA 4BZPA 2X8AA 3NBFA 3CM0A 4TQAA 4PAMA 2A9KA 2PZEA 1PLKA 3LVRE 1J70A 3K53A 4K46A 1XF9A 1W36B 1S0UA 4C0BA 1N3BA 4D81A 2D7CA 2R6FA 4PHFA 1ZJ6A 3L0PA 5CDFA 1E2JA 3GLHE 5KDDA 1F60A 3TJZA 1Z0DA 3KXIA 2GJ9A 3THXA 5EZ5A 2W2VA 4RFSA 1OKKA 4A0FA 3KQUA 1E9RA 1S3SA 1ZAKA 1T3HA 2F1JA 4UXJA 5JHHB 1AKEA 2B6HA 3BH6A 3VU9A 2QBYB 5FR2A 1CR0A 3WMGA 1XJQA 3ZIAA 4UNRA 2IC5A 3FHCB 4OKSA 3IGFA 2JDID 3CRVA 3O8DA 4LV6A 4URXR 1R6BX 1XD2A 4NHOA 4BFZA 1UEIA 2ZJOA 4I1UA 5F9FA 4NCIA 1P6XA 1V43A 2IF0A 3U7EB 2YOGA 1UPTA 4EQ6B 4HAUA 1JEDA 4C0SA 5FUYA 1JR3D 2F9LA 3L8YA 4IOMA 2XEXA 3NIBA 4GNKA 1VKJA 4ZO4A 1E2NA 3GJXC 3IPYA 3X1ZA 4KV9A 1ZYUA 3T1OA 2YOHA 4GMXA 4MYCA 1CBUA 1GG2A 4AYTA 4AG5A 4L15A 4B76A 2R6GA 5HKKD 5TMPA 2QA5A 1E2LA 3PENA 4OHWA 1XP8A 2ZRFA 2PZFA 4Q7MB 4V0KA 3RVBA 2ZJBA 1KOFA 1IXRC 1MABB 3EA0A 3HDTA 2FE4A 1U8AA 2EYUA 3KTAA 3REGA 1YVDA 3A4MA 3NBYC 3TUJC 4A0HA 1YR6A 2BWJA 3BFKA 1G3UA 1KMHA 2CDNA 4MYTA 5KU1A 3NVAA 5AK0A 1JAHA 4BLPA 2A78A 3FFAA 2FDCA 4G5GA 4I4LA 3ZGXA 1CJKC 2JLUA 2EWVA 5KSZA 1AGPA 4W7SA 1ZU4A 4B3DA 4M1WA 4JVMA 1ZUHA 4HAZA 1V5WA 3BFVA 4MGZR 3X2SA 1F48A 1CULC 3KJIA 1KJYA 1NNEA 2BMDA 5FR1A 3NC1C 2V3CC 5HE8A 4DCNA 1FTNA 4BWYA 1E9EA 1WB9A 1QDEA 1KSFX 1RKBA 4Q21A 1NN0A 1II8A 4NCHA 3IDQA 3WBKA 2QBYA 2JLVA 2D4HA 3KKNA 3PV0A 2IHBA 4YMSA 2QE7A 3JZMA 4YC7A 3OIWA 2JLZA 3GLIA 1OH8A 1JQJC 3BIFA 5EXTA 1OJLA 2G3YA 2GVZC 1OW3B 3I3SR 2XZPA 4GFDA 3I1FA 1NBMA 3CB4A 3NC0C 4MRVA 4NZYA 4TMVA 2VBCA 1W2GA 4EQ6A 3M4YA 1WQ1R 3OEEA 1MO6A 1AZSC 1QHSA 1BKDR 5UKDA 1I4TD 1G3RA 1KK1A 2IEYA 4D25A 2I1QA 1UEJA 4DCTA 4D4LA 2CL7X 2FZ4A 5IK2D 4ZDKA 4TMWA 4AURA 3MCAA 1G19A 4Z8XA 2W6JD 3CX6A 3RHFA 5AR1A 3UK6A 1COWD 3VX3A 4DIEA 4MQBA 1NJFA 2A5FA 2VP6A 3DKVA 3O8BA 4H1UA 4DIDA 1FW6A 3ECCA 4OK6A 4XWKA 1MABA 2WPDD 2BJWA 1IN5A 3K09A 2IYXA 2REXB 2R6AA 4PQFA 2EVWX 1VECA 3TVTA 4B48A 5J4KA 3KQHA 3EX7C 1ZW6A 3KZ1E 2W2XA 2PX0A 4LBVA 3ICEA 1DAFA 2TMKA 3K0FA 1XXHE 2FNAA 1E99A 2RH5A 1UBEA 1KI9A 4FINA 3L82B 3VQTA 4B6EA 1U0LA 1SKYE 4HAYA 4BFVA 1KNXA 5AUOB 4YDSA 1W0KD 3FOZA 1ZD9A 1A7JA 1KDTA 3LDAA 2BC9A 3JZAA 1SHZA 2P65A 4FCVA 4AKEA 4TMXA 2GCPA 4D6PA 3LLMA 2VP9A 1G7RA 1GL7A 2WVJA 2ZJAA 4JL6A 2P6RA 1IAQA 4C2UA 1XCPA 1IN8A 1IXSB 3QPUA 4IOJA 5CJPA 2HDNB 2WKPA 5TY0A 2G1JA 1DEKA 4E09A 3BK7A 4Q7JB 1ZC3A 2BV3A 3RANA 4OI1A 3AEZA 4LY6A 1OH7A 3CF0A 1L2TA 4JT4A 3H86A 3D8BA 3B7GA 1FPMA 1KZ7B 1A1VA 3C5HA 2AD1A 4B2LA 4US1R 3TQFA 2RHMA 2ZRGA 3RWMB 4U7DA 1WA5A 2C9YA 2O8BB 3NEYA 3UWOA 1E98A 3GLGB 3SR0A 2N46A 4OQNA 1S96A 5JEEA 4PC6A 1G3QA 4MDEA 3LQQA 2X2FA 4LUCA 4N3NA 2J7PD 4DBLC 5FBWB 2J3EA 4UXIA 1TEVA 4E07A 1RJ9B 4PANA 4RD3A 3EXAA 3WHLA 3LNCA 2PH1A 4HAWA 4DKXA 2ZRPA 3L8ZA 4HLDA 4CEIB 4YQFA 2WICA 4QBHA 2QNRA 4Z51A 2OILA 3QXCA 4HATA 3U6KA 3JVVA 1UADA 1LFDB 1RC8A 2HYIC 1LV7A 5H1YA 2W83A 2VEDA 1R0YA 1XD8A 2DBYA 3AP2A 5HKKA 3SQWA 2R62A 2REBA 4IVQA 2QGZA 3BD9A 2Z6VA 1Z0JA 1A4RA 3DL0A 1E0KA 3N2IA 3C16C 5GJVC 4D4JA 2J0VA 2YZ2A 2ZUDA 2AFIE 4I81A 5K8TA 3REFA 1NN3A 1QHIA 2XNSA 1ZU5A 2R65A 2HXSA 3X1YA 2GXAA 3TK1A 2ZJ5A 3H84A 1TNDA 4DZZA 3M6AA 4DSTA 4JSYA 2D2EA 1XDBA 2JAQA 2GESA 4KBFA 4HDQB 2DFLA 1M74A 3CH5A 1N5IA 1AM4D 4M1SA 2C96A 1NIPA 3AKYA 4DCVA 4F4IA 4MITA 5B57C 3ETLA 2WAYA 1HUQA 2NZJA 2QORA 2ZE6A 4Y0AA 5IRCD 1E32A 4HUQA 2P5SA 2XX3A 5GADl 1Z47A 4LJ7A 3AVTA 4KHZA 4MRPA 4AI6A 5EJEA 3UXMA 3PEWA 2MSCB 1H8ED 4DCUA 2F9MA 3KB1A 4KFTA 2ZI5A 2GXQA 2WJIA 4XSHA 2XGJA 2GBLA 2OXCA 4ESVA 2ZRJA 1G291 4W5JA 2PBRA 2JLYA 2O8BA 1IHUA 1FFHA 1XMIA 4JYCA 2QT0A 2WWGA 4HLUC 4PPNA 3Q7PA 3GLGA 4G5OA 1KI8A 1YR9A 2GCNA 5HPYB 1XMJA 4XWOA 1SXJC 1UBGA 3RRZA 2DB3A 3R9XA 2OCYC 1U9IC 5F98A 3RRNA 1O87A 1PLLA 1RJ9A 4RKEA 1DG3A 1QBKC 1A5TA 1M7GA 3AF4A 3DM5A 1FUKA 1Q20A 2O0HA 2VRWA 3FYHA 1L7VC 2V55B 5E95A 1DPFA 2CHVA 3SJZA 4FI3C 3QJYA 3TKLA 3UG6A 2Q9AA 3L2OB 2GA8A 2ZANA 5IK2A 3KB2A 1TL7C 2CLSA 4Z1MD 5JHGB 4RD0A 5E3HA 3GP8A 2W6JA 3Q5EA 4DXAA 4IEEA 1COWA 1Q3TA 2CCJA 2QT1A 4JLAA 1OIXA 1WE2A 1HEIA 1X8JA 2SHKA 4NMMA 1CLUA 5FUXA 2OO7A 4PO9A 2BHRA 3FGNA 4IKEA 3GJ7A 4NCKA 1JJVA 2WPDA 1EFUA 4JBYA 4MKHA 3TIFA 3BH7A 2N42A 5DISB 1X3SA 1UF9A 3U3KA 3AQ4A 3BGWA 1C1YA 1C4OA 4R7ZA 3E1SA 1MO4A 2ZRCA 3ZD7A 3EPHA 4AIIA 3HU3A 1Z22A 1OB5A 2OESA 4X8LA 1JXOA 1EWRA 4URUR 5FOSA 1YR8A 4UQOA 4IVPA 1I2MA 3LH5A 3A4LA 3U7GA 1H8HA 2QL6A 1W0KA 1DAEA 3KUCA 4D80A 1RYHA 5KNDA 2VQSA 2QP3A 3EZ6A 4GOKA 2V6JA 3SDZA 4DDUA 1IY2A 4LX0A 2O0KA 4L8GA 2CHQA 1TF2A 2IF2A 2WWYA 2QPTA 1VCNA 1R0ZA 3RAPR 1KO1A 2ZUBA 3A1UA 3CH4B 3PUZA 4RZUA 4L9SA 4LSGA 3PR1A 1KO8A 1T0HB 4KAXA 3TAHA 1P9NA 3W6NA 1BYUA 1W4CA 3DHWC 4TZ0A 4LOAA 3TQCA 2IYUA 4V0ME 2OBNA 3DVLA 2VIIA 1AS0A 4R9UC 2FEMA 5CLQA 2VP5A 5CIQA 1FTSA 4WVFA 5DH9A 4QGGA 2PEZA 1AK2A 4CEJA 3ND8A 3PVSA 4FWTA 4BFWA 3ZVRA 4QGAA 3LBNA 2J7PA 4E03A 5JFGA 2O8CA 1XTJA 1DAGA 1ZNXA 2YC4C 3QENA 2ONJA 5J4HA 1CXZA 1AN0A 3AKDA 1UKVY 2ZRLA 2ZYVX 3T34A 1HT1E 3ADDA 2IS4A 4BLRA 5A4JA 2JJ8A 5EE0A 4PSVA 3W3AA 3HP1A 4AC9A 1YZNA 5J47A 2ZSFA 4PQYA 4Q01A 2QAGA 2OFXA 2YJTD 1CR1A 5H68A 5J4YA 2C99A 2XB4A 3CRMA 1YZLA 2GRJA 5JJKA 4RD2A 2FPMA 5CLLA 1KGDA 2WMNB 2IYLD 5JLJA 1DS6A 3G5UA 4G5QA 3OAAD 5JZVA 4OHXA 2ANCA 2ZU6A 3ICQB 4LHWA 4LJ9A 3W34A 4EFLA 1ETUA 2CLCX 2F1RA 2IYWA 4LWZA 1UKEA 5B64A 3CBQA 2G0NA 2G9NA 3FFBA 2HEIA 5E7JA 1JR6A 2VTKA 5GJCA 3VHXA 1TMKA 4EAQA 2VYFA 1UM8A 1R8SA 4A2QA 3IO3A 2FFHA 2OE2A 4TMTA 5AJYA 4B33A 2V8OA 4CYMA 3EASA 3SNHA 4Q4JB 5LBIA 3BRWD 3K9GA 3CO5A 1XBTA 2DHRA 4XIGS 2G77B 2PMKA 4US0R 4LPKA 1KJWA 2F3TA 2FSHA 4TTRA 1OXUA 4OI2A 3DZ8A 3AP1A 2LCFA 5E4FA 4HDOB 2ZSBA 1Q21A 1D5CA 4PPGA 5JSZB 3K0CA 2HCJB 2IYZA 2J0SA 1HE1C 2KB0A 3K0SA 3DO6A 3PXGA 3SYKA 3RRMA 3T5DA 2XNDD 5FTMA 3U61B 1XTSA 2KJQA 1BO6A 3TW8B 3FKSD 4O3MA 4B3BA 3VR6A 1RYFA 3T12A 3EZ9A 2HV8A 1KKMA 1GUAA 4FN5A 1YR7A 2FJUA 2UKDA 4C4PA 1XD9A 3VR4A 4IXMA 5FBQB 1VG8A 2NO7A 1N0UA 2QENA 4JIMA 1RZ3A 1QVRA 2BM1A 4LJ5A 2WMOB 1KI4A 1GVNB 2ZRKA 3EIEA 1KDPA 1G4AE 2GJKA 1CS4C 1TUIA 1SULA 4B44A 1R0WA 1TEXA 1GL6A 2I1VB 2O8DB 4MGIR 1G4UR 3CONA 4K81B 2EFCB 4HB4A 5CB8A 3QXXA 1YHNA 3F8TA 1TTTA 2X77A 3GJ4A 1N0VC 5BYKA 1ZM4A 1R5NA 2K5UA 1HE8B 1G20E 5JJIA 5GJBA 4OHZA 3RABA 3CZQA 3R7WB 5G53C 3ADBA 2ATVA 1DAIA 1T91A 3ZZTA 4RY2A 1W5TA 2RGXA 2IYTA 2RGCA 2KI5A 3RS4A 3RWOA 3GFPA 5CM8B 3DPUA 4Q4JA 3PJRA 1N5JA 3A6PC 1A2KC 3QF4B 4OQMA 4RZXA 2GF9A 1E4VA 2DR3A 2XXAA 1BMFD 2ZJZA 3OF5A 4RVCA 1RRPA 5JSZA 3VR5A 3U44B 4YDHB 2JLXA 2ZJYA 3B8HA 1VHTA 3BB1A 1NN5A 4QNRA 2XTMA 3OEHD 1GRNA 2G1KA 4LC0A 2IA5A 3CF6R 1YJ5A 3D31A 2ZRHA 2RGEA 4IDHA 2CVHA 1G6HA 2AWNA 5BXQC 4GT1A 5FOWA 2O0JA 4A9AA 4M1MA 2EFHB 1Z0IA 3B1VA 3LX8A 2VHCA 4PQRA 4AY2A 4R71A 2FF7A 5EUMA 3WYAA 4ZIRB 1MV5A 4KVAA 4A15A 3CUEF 3ZZ0A 4DLVA 1PLJA 5CYPA 2BVNA 1JQLB 1T5LA 2XAUA 4DLWA 4JLOA 2LKCA 4YMTA 3AVYA 2O8DA 4I1VA 3PEVA 2IS1A 3QUSA 2ZREA 3BXZA 3QKRA 3A37A 4I99A 4QJ5A 1PUIA 4JKIA 4JZKA 4LCBA 5J5CA 3V4FA 2YWEA 3ZVNA 1E2QA 2RGAA 2NPFA 3R7WA 2ODEA 1FUUA 2QPAA 2OCBA 1XPOA 1F5NA 1NLYA 1P72A 1WRBA 3NH9A 2V4ZA 5G41A 4CRWB 4LJ6A 4B74A 2MSDB 4GOXA 4YMUA 4Q4LA 4TQ9A 3FMIA 3QF4A 2BMFA 4D0NA 4KU4A 3EA5A 4TL8A 4DT1A 1QHHB 2G0TA 4PHGA 2A5JA 4TLCA 3I8SA 5KUTA 3U44A 5BN5A 4OHYA 3TSZA 1Z28A 1SVKA 2JJ2D 5JCZA 2ZI4A 3TLXA 2WM9B 1OFTA 1XXHB 3WMFA 4B2IA 5HTKA 2J59A 3QKUA 1G18A 1XEXB 2VHTA 4W9MC 3K0AB 4YXWA 1SKYB 4M9SA 5KO2A 2XNDA 4MKIA 5FOUA 1YRAA 4QRHA 4ZI3A 1OH6A 2NG1A 1Q1ZA 5DI3B 2N1BA 2ONKA 2GILA 4MRNA 1HURA 4B3XA 4BZXA 3I5YA 3R9IA 4UJ3A 5FH9A 3B1WA 1N5KA 1FNMA 4M2LA 4Q19A 4Q7KA 2RGNC 2FH5B 4IDQA 4WZBE 2BBOA 3EW9A 3ONWA 2EU8A 2QZ4A 1N0WA 2J1LA 2JLQA 3TBKA 2F6RA 1ZRHA 3D7MA 4ACAA 4HB0A 4GL2A 1EWQA 5F9HA 4MUAA 1D2MA 3VHLB 2F43B 5CM9C 4NU0A 4Q9HA 5KPJA 1LF5A 3U3RA 2XOKD 5A5GA 2FSFA 2AL7A 3GQBA 3KKQA 1DO2A 2D2FA 2OCAA 3SHFA 1ZVQA 3KJGA 3WBJA 4NPHA 2B21A 3RSOA 4GI7A 4DCSA 4IDOA 4NONA 5JWRA 3K8YA 2ZS8A 1ZIOA 3KDSE 3WMEA 2EFEB 4NDZA 2YINC 1E1QD 2QTHA 3HR7A 5DHAA 2EW1A 3IO5A 4RKFA 3I73A 3DDCA 2QM7A 3H2YA 4IDPA 4TL6A 5AUNB 5C4MA 5JRZA 2GHIA 3IPXA 1N6PA 2J0QA 1KAGA 1Z06A 1Z29A 1OXXK 3U3OA 3QVUA 2MMCA 2F1HA 4Q4AB 4OK5A 1VYUA 4M9ZA 1EFRA 4Q00A 1EESA 5CYOA 4BPBA 2FEOA 5L3QA 2AXNA 3ZH9B 3LXRA 4B35A 3OEHA 3KQKA 4GSYA 3U60B 3H1TA 4A0GA 3O8CA 4UNPA 3QEOA 4TLBA 4WA7A 5SZHB 1QVAA 3G82C 5AJWA 3HPQA 4P0TA 1DVRA 1T8TA 4US2R 5HCNA 3U6BA 3V00A 2PJZA 2HUPA 2QPOA 2J9RA 5L8VA 2OFOA 1BYIA 4JLJA 2W00A 5FPSA 5SZIA 2A5GA 2JJ1A 2GDJA 4HZUB 3ZD6A 1G1MA 3WP1B 2ZRMA 3EZFA 2V1XA 1N6HA 4C9BA 5HR5A 4FMBB 4II7A 1N6NA 2UZIR 5DYIA 1W1WA 2VP2A 2J7KA 4Q1CA 1ZCAA 5G3ZA 4QHYA 1CJTC 5CK5A 1RE0A 2WV9A 3IILA 1G9XA 3QVVA 1W0JD 3GCGA 4A1FA 1F2UB 2J87A 2VA8A 4O25A 3WNCA 3QKTA 2R2AA 2JLRA 2RKOA 3U5ZB 4ABYA 2PLFA 4XVRA 1Z2AA 1AQUA 2ZTSA 5J4LA 2XB2A 3WHKA 2BEKA 2GKSA 1EX6A 2JASA 4UNNA 2QU8A 2G6BA 4QL3A 3ZS9A 1SHKA 2WOJA 1R8QA 2IX3A 2ZQ5A 1GKIA 4F91B 4FMDF 3QPVA 5DNYB 3C5CA 4WW0A 2FPKA 2FU5C 2B7CA 3SEAA 1IN7A 4PZZA 1L4UA 4L4UA 1ZINA 4Q4AA 4NCNA 1Z3IX 3OIYA 4Q18A 3SS8A 2QM8A 3AUXA 4M1OA 1Z6XA 2JJ2A 3B85A 2P6NA 2HCBA 4KSBA 3VR1A 4B3GA 1T0JB 2BJVA 3EC2A 4S35A 2ODNA 5KTYA 4JKYA 2QG6A 4HI0E 3T5GA 2W6ID 1DADA 1CRPA 2WJJA 1IN6A 5H8WA 5CDFE 2VL7A 2ZVPX 1T3LA 5EP1A 2QRNA 3AF0A 3Q8XB 4LV5B 4LYJA 1G8HA 4V0LA 3X1XA 1ZD1A 4TL7A 1U98A 2ZRDA 1ZM3A 3RS0A 4JL8A 4Q1EA 4KLNA 4EFMA 3AM1A 1CEEA 1SXJD 1Z0AA 3BERA 4HZUA 1PVOA 1AIPA 4BEJA 2A30A 3U7FB 3AGQA 2JIZD 1DE0A 1JBKA 2Q9CA 3CWQA 2REOA 4QFMA 5AJVB 4QNMA 1OPXA 1U0HC 2OUKA 3BS4A 3T1VA 1G3IA 3A36A 4EUNA 1DARA 4HYYA 4LYFA 4TLEA 4WIAA 3H4MA 1G5PA 1BH2A 1ODFA 1QHXA 3AF3A 3CLVA 5DO9A 4WXRA 3RS3A 1LS6A 4A2PA 1EG7A 4BUJA 2XOKA 2YHSA 3D3QA 3KL4A 4XJXA 1Q44A 1MRSA 3THOA 4PXAA 2YKGA 5FPTA 1E9CA 1R10A 4N0EA 4EFNA 1P73A 3FVQA 4MUBA 3Q85A 2IS6A 1NP6A 3VR2A 2ZRBA 3MWKA 4LHYA 3GJ5A 2IWRA 1RIFA 4TT3D 1T4GA 2CL6X 2JDIA 5FBRB 1KI3A 3AVXA 1E79D 2ASEA 4RD6A 1XJ0A 3U4QB 4MGKR 1OH5A 5KSOA 4LV8B 1P61B 1JR3A 3EWAA 3SI7A 1ZM9A 4DSOA 1GRRA 2HLDD 3IUYA 2WJVA 3KFXA 2CE2X 5L3SB 4ZKEA 2C9OA 3R8CA 4URVR 2GAOA 2PMDA 2ZSEA 4CW7A 1DOAA 5E7IA 5FPHA 1Q12A 2DWPA 3GJ3A 3KJHA 4JSTA 4A2WA 3V9PA 1KK3A 2WSMA 4ESHA 2WBLC 4A6XA 4M53A 3FHTA 1AS3A 1U99A 2ZE5A 4H9GA 1NRJB 1VHLA 1SGWA 1WDTA 2QGNA 4JLNA 3LAWA 5EE3A 1RPZA 3U2QA 3U7HB 1CJVC 2VSOA 3W90A 4P4SB 1SXJB 3PITA 4LZZA 3RS7A 3GLIE 3P1JA 3SFVA 4M1YA 1NBME 5M04A 3RS2A 1N6IA 1XMSA 4V0MA 4FMDB 4HLCA 4JMPA 3NBZC 4F4CA 3NHAA 2W0SA 2C9CA 2OBLA 4M0LA 3QPWA 1WMSA 1VG9B 1W0JA 3E5HA 5FUVA 4LJYA 2KE5A 4F7WA 4PAQA 4Q4HB 4PPFA 4URYR 1ZMXA 4IOLA 3J81k 1K8RA 1RVDA 2QMHA 3TR5A 2C03A 4P31A 3HU1A 2HT1A 1MO3A 2QI9C 3NDPA 4QG7A 2NO0A 2ERXA 4V03A 4C7OB 2PT7A 2CCGA 1G7CA 2ZSAA 1G7TA 2GEDA 4JJZA 1E0AA 1OF1A 1R7RA 1TU3A 4N0DA 1EK0A 2DWQA 2C5LA 4HZIA 3BB4A 4LI0A 3VNVA 3T15A 1KZGB 3R8FA 4KSCA 1W7AA 4Q1FA 5L3SA 2O5VA 1NY6A 2AKAB 2H92A 2C8VA 5GJWC 1Q1QA 1UJ2A 3A8TA 3K9NA 1W4BA 4WZ6A 5EXPA 2Q21A 1G16A 1P2SA 1Z08A 3GEIA 2Z0MA 3Q5DA 1SVIA 3LO5A 4BZQA 5F3WB 3AVWA 4TL9A 4B6FA 3P27A 2W6IA 3B9QA 1Z6TA 3OIUA 4M8NE 5KDOA 3AVVA 2JATA 3MD0A 3NWJA 5BQ5A 1KI6B 1G8GA 1K5DA 4IFEA 1E2HA 1HT2E 4HLUA 3RC8A 2MMGA 2Y8EA 4TQUS 4AKHA 1L8QA 4P3YA 4A8JC 4HAVA 4BFUA 2NIPA 1SXJA 1HQCA 2QEQA 5FI0B 2WJYA 1U9IA 2ATXA 4LYAA 3ND9A 1Z83A 1CJMA 4HLQB 2JIZA 2GCOB 3AV0B 3BC1A 3CNNA 4HB3A 3T06B 2O8EB 3TW4A 3QG1A 1KDOA 2OBMA 3L0OA 1HYQA 2OCPA 2H18A 5KSPA 2FSIA 2H1LA 3CF2A 1ELOA 2D7DA 2FG5A 3W6PA 1XTKA 4V0OA 3B82A 4BRWA 1LW7A 3MUFA 3LRPA 5JS7A 1I2DA 3MFYA 3Q7QA 4C0AC 1Z63A 2DFTA 3QXSA 1N6RA 2ERYA 1G21E 4CZ2A 4L9WA 4M21A 1T6NA 1ZM7A 4F92B 3IQWA 5D3MB 4Q4HA 3UKDA 1P9RA 3A1SA 3GLFE 4NCJA 5L3RA 3OHMA 5LD2C 2FFAA 2NO6A 4JL5A 2ANBA 2B8WA 2C2HA 3BAFA 4QM7A 5G3YA 1NMZA 1HTWA 2E1RA 4TT3A 2CVFA 1FL9A 4CT4B 1HA3A 1E79A 4OYHA 1JECA 2RB4A 1T5IA 1GAJA 4QGFA 1YE8A 4XTRA 4MDFA 3TSOA 2QSYA 3N2EA 5J40A 5EP3A 1IXZA 3W5IA 1T9HA 1W4RA 1GIAA 1GOTA 2HLDA 4XTCS 1TPZA 4ZCLA 4A92A 2RCNA 3PIRA 4WXPA 3UMRA 4AD8A 4J0QA 1Z5ZA 1WP9A 1ZM2A 3I4LA 2GNOA 5EE9A 1G5TA 2FX3A 1TQ4A 3FDIA 2V6IA 3NH6A 5KNBA 1KI6A 4M1KA 5DN6D 1RRCA 2EWWA 3MLEA 4MKFA 3SC3A 2CK3D 4AKIA 3B6EA 4A36A 2QSZA 1QHGA 1U2RA 3GEHA 4NYIR 4JT2A 4M9QA 4GPTA 3LWNA 3CZPA 3MWJA 2GCOA 3OFND 4KI0A 2O8EA 3HR8A 1LVGA 3QOFA 4RZ2A 3GFTA 4PC2A 4PAOA 1JJ7A 2ZI3A 5CK4A 5EXXA 1DELA 1FX0B 1NJGA 3DEFA 5TB5A 3LV8A 1KO5A 4YONB 3B13B 3DMNA 1KSGA 5AWFC 3UWKA 1O3YA 2IT1A 1DAMA 2HT6A 2NO1A 4HAXA 2R9VA 1QG4A 4EPRA 2NMVA 4JVNA 2ZYTX 2DFKB 5D3MA 2CE7A 1II9A 2CLDX 2VH5R 4QXAA 3TUIC 1WF3A 3QI2A 5B58C 4OHVA 2P0EA 3WNBA 3NG1A 4DUGD 5C2JB 4NYJQ 2ZJ2A 2R6CA 4D82A 1T3SA 1TADA 3RDPA 5LDDC 2NZ8A 3I8XA 1LS1A 2GJ8A 3ADCA 1H8EA 4B47A 2D06A 2ZRIA 2BBWA 2ZROA 3L0IB 4NH0A 1CJUC 4C0QC 2BBSA 3RNLA 1KK2A 5SZJA 2O8FB 3NKVA 3LX5A 4PX9A 1GL9B 1UDXA 2C98A 5DGXA 3NDBB 2B8TA 4FIDA 1LF0A 2P2LA 2WOOA 2ZYUX 4ACBA 1A2BA 4TMZA 3IHLA 1NG9A 2OLKA 3WXMA 4Z8YA 1OFIA 1P2UA 3LFUA 3EPLA 1Z6GA 3MJRA 1ESMA 1VCMA 3FMPB 3Q9LA 1OLOA 3GLHB 1GNRA 4EIWA 3ZVMA 3I5XA 1LY1A 5IT5A 2XSZD 3QNUA 3EPJA 2BCGY 2VLIA 2QMOA 4FMCB 2G88A 4CGZA 2Q6TA 4Z1MA 4BLOA 2BKUA 1IOZA 1QF9A 1R2QA 4MYUA 4UXHA 4URWR 5K8LA 1IJFA 5E7MA 1E4YA 4EKDA 1TU4A 1E9AA 2FGJA 3C14C 1YQTA 4N1AA 5GVSA 3VKGA 3QY0A 4PHHA 4CEHB 3IIJA 5JJLA 2EFDB 2YVUA 1MRNA 4KJZA 1U0JA 1Z6AA 1WCV1 3FB4A 3GFOA 5IF9A 2CJWB 2HYDA 1LTQA 4Q9LA 4WAUA 1S2MA 1G8YA 5CJ2A 4EJSC 2C78A 1VTKA 4JBXA 4FD2A
chains in the Genus database with same CATH superfamily
1BXGB 3SJCA 2WTBA 4E1VA 3P32A 2FZLA 1QF7A 1XVTA 2QTVB 3NUGA 2A0XA 3VR4H 4E5MA 5KMGB 4Y6QA 5TQ0A 4GKBA 5JAPA 4MS1B 5FI5A 3R7DA 3W4IA 2Z3WA 1E2PA 4H3KB 2GRUA 3O84A 4OBXA 1I3KA 2HIAA 1K9VF 1THMA 2PHZA 3G9UA 2E4UA 3KLMX 4MAFA 2FPOA 5ARBA 1YNSA 3RT1A 1VG0B 4JN6B 1OFHA 3HBFA 3JV7A 1OKKD 4HTAA 3TOSA 3FGPA 3CEHA 3WRXA 4LEIA 4X3CA 3UXHA 3CSDA 3MINB 4DNFA 1A96A 2YJ6A 4GMKA 1MEOA 2F3PA 2WAXA 1LBIA 3ZHSA 4QYIB 5HDBB 1AURA 3DYBA 4P38A 1LSUA 4IIGA 5EGNA 2NV0A 5CX1B 1TF5A 1RVV1 4KQFA 1Y6FA 2C54A 1F2TB 3CLTC 2QAJA 3QGMA 3U3JA 5G1PA 4YRZA 1QRTA 1CCWA 1HDEA 3HS3A 4Z54A 1V9CA 2AEMA 3A06A 4U02A 1E2FA 1KY2A 5IZCA 13PKA 2PSJA 4CCWA 1QYRA 2OV1A 2PWAA 3STUA 3KOYA 4LHVA 1FFDA 2ZJ7A 3LL7A 3F9RA 1H0RA 3WJ7A 1G5QA 3V7YA 1Q1EA 4M89A 4BC0A 1K5PA 4E70A 3D4BA 1BAPA 2HWXA 5EZYB 1L5YA 2EP8A 1MTOA 3DP9A 1GARA 3BSFA 2VG8A 1DLIA 4DIKA 4JYBA 1XTIA 1QIKA 1NRXA 2I2FA 3BE5A 3GD7A 3WADA 3ZU6A 3T6KA 1R5OA 4H60A 5EPEA 1XZLA 2V3VA 4XJSA 2QTGA 3PU6A 1YKGA 1J24A 1XF1A 2Y9MB 4S0ZA 4ZVLA 3QE4A 1NKTA 3UFXB 1GNQA 5JO0A 4O0MA 3MGKA 4HXFB 5DVZA 4QO8A 2A9PA 2R5WA 3JAWB 2QWXA 1QZUA 2CJWA 4P3XA 1ZC4A 2JZOA 3PIIA 1QO9A 2NOAA 4AS1A 4GVXA 5CCBA 5BVHA 1L5QA 2XUOA 2Q5FA 2OAP1 1JALA 2NPIA 3OAAA 2VDKB 1CT9A 2PLRA 3K9LA 1A1SA 3P9XA 1BXGA 3BL6A 5K45A 1KZHA 5L3ZA 4F6LA 5KMGA 2QTVA 2MHCA 3A6LA 4HYQA 3OSUA 3DULA 1GGJA 3P4UA 3G0HA 1J90A 3L3BA 1UBOS 4MS1A 1P3JA 2PNFA 1QP7A 4PE5B 1ZWKA 1B42A 3T1NA 1GGKA 1Z3CA 2GCGA 2ZVQX 4UVDA 4S1OA 1M6NA 1IMJA 1EQ2A 3F1KA 1DKUA 1TYDE 1XTTA 3TXYA 1ML3A 2B4AA 2XY4A 3HCDA 3H7AA 4QXMA 4DANA 2O3RA 3BRWA 2AI2A 4B43A 4NBNA 5ALYA 3RTAA 2GXSA 3B70A 3FG9A 3OC6A 3MINA 4PLWA 2IKQA 1SXIA 1MAWA 4Z0NA 5KHOC 3THXB 5SYMA 1XZPA 3K4QA 3SE7A 1KI1A 1XQ9A 2P79A 3KQWA 3UH1A 2QE7D 4QYIA 1FZQA 2B1QA 2WG2A 1SXGA 4EHJA 6AT1A 4NNOA 5HZGA 2IYSA 1NJSA 3H13A 4MB6A 3D6TB 5CX1A 3SVTA 3TGPA 2R1TB 1PV4A 2ODWA 5K0EA 4P81A 1BW9B 3KB6A 2JIQA 2VSFA 4PFSA 4DN6A 1XD2B 4OFWA 1I6LA 3PKZA 2OGSA 4JUCA 1ORIA 1NSTA 2KBEA 2PRKA 2EKLA 4BO8A 3GGCA 3PJGA 4YV2A 1CUIA 2INGX 5ESRA 2XCOA 1E7YA 1S9HA 4R98A 1E6KA 1BWQA 2C20A 4YFVA 4OO3A 3T1QA 4AKGA 3IP3A 1HL3A 4P32A 1E7WA 3SAJA 1V2HE 4HPJB 5BYJA 4NTZA 1UBHS 4TLAA 2JA1A 3RAGA 3SOZA 3W5JA 2PJRA 4NYIQ 2ZYWX 3UMFA 1K7FB 1M8PA 1MUUA 3B78A 4ZIRA 3R3UA 3QW2A 2GVDC 4PG6A 2J4DA 5A7HA 5CH3A 4KJXA 5KOYA 3S2GA 4O63O 4ARCA 1FY2A 3M5PA 4CG0A 2AOVA 2I4TA 3QLUC 3QW4B 3DFKA 4U2EA 3UFXA 1S8FA 1K6MA 3TTSA 1KYVA 3OQOA 1B23P 2Y99A 3JVUA 2V7UA 4JJIA 4K2AA 4RWEA 1DC7A 5ADHA 2Z6AA 1SVSA 3ZYCA 5AI4A 4KXXA 1QZXA 4HR7A 4E3WA 4WKOA 5KWEA 4DLKA 4CN9A 1C0PA 1D1SA 2E6KA 3FD8A 2HSDA 3FUXA 2XNCA 3BSWA 4ZPJA 1EFCA 4N54A 1ZUIA 3UENA 4RKYA 2VNJA 4JI0B 3RGWS 4FNOA 2BLLA 5CB4F 2O2SA 3PQCA 2B3TA 1Y80A 4NE7A 3V8NA 1FUEA 1WWKA 3O0TA 2P9EA 1MX1A 3DKIA 2Z4SA 4HS4A 1P18A 4S2UA 5KVQA 3RIGA 3ZE7A 3AJDA 4A6PA 2ZE8A 2VHEA 3LBHA 4YMVA 1EP1B 1QQTA 3SF0A 4PFQA 4YJKA 4P33A 1PIWA 3L4BC 3PGA1 4UHHA 3LBIA 2ORIA 2X1VA 1BVRA 1LH0A 4FBLA 1YQEA 2BGWA 5CMLA 1WCXA 1LC3A 3UG7A 3N53A 1EUZA 1Z4PX 3N5KA 4YIHA 3EDRA 1HKUA 3UJDA 5TARA 2DAPA 2DT5A 1EVKA 3LCVB 4U1RA 1Z2CA 1XXHA 3SYLA 1GTVA 3DOHA 3IBGA 2IHVA 2HMSA 1CUAA 2W2KA 4IXNA 4HMQA 5HF8A 1BW9A 3P26A 3ZZ1A 4D4KA 3GLIB 4JWTA 2IV7A 4CMKA 1GKYA 1UBCA 1V4VA 2FOIA 4BEBA 4DSZA 1SUEA 2LRHA 721PA 4KYIB 4TYPA 1YWGO 4KNWA 5IT9A 1XQ1A 2W90A 1GZ7A 3LRXA 3KR1A 4FFOA 1FXWF 3T9DA 4AJ4A 3DLIA 3MMPA 1Q84A 2J5KA 3PFKA 1HWYA 4YALA 1UBUS 3KX2A 1G41A 4BU0A 1IEWA 4ARIA 4CF7A 4C0XA 5AVJA 3PFNA 3HFJA 1NXQA 1YH3A 2DPXA 2E18A 1M5TA 3M3DA 5YASA 2I9KA 2QYTA 5JVDB 4ND6A 4D4HA 7YASA 4TYYA 2P5TB 1ISGA 4DJAA 1JXAA 3JASB 1NMEA 1TJ5A 1LVHA 3RK1A 3EMVA 3UN1A 4FYKA 4RJLA 2GEFA 4GDFA 2GEVA 4MRSA 3ZNOA 4HF7A 1FDIA 2YOFA 3C74A 3UEOA 1YONA 3TL6A 1VP9A 5FOXA 2F43A 1FP6A 1AK1A 2M1XA 3KKPA 4PGHA 5DEOA 3DHEA 3GK3A 4JX8A 2R7AA 1NVUQ 2JJQA 2QI9F 4NYMQ 3RHZA 5C3UA 3NYQA 5C5IA 4PG4A 1QIHA 3VAAA 1GUDA 4BQQA 3DT6A 2OAGA 3CKYA 2Q5HA 2VYQA 1SC9A 1WV0A 2CXHA 3E61A 4MW0A 3KC2A 4H18A 1I5OA 2I22A 2OSBA 1VPTA 5DHUA 5ER9A 3ZDQA 4C5CA 4MH0R 2ASVA 2A33A 5HWSA 1CZNA 4QDJA 4BWFB 2WKSA 3CRQA 1P4GA 4ZVTA 4UNSA 1E3QA 2Z9BA 1COZA 2ZCVA 3CPJB 1NNI1 1OYYA 2CNWD 3BA1A 6PFKA 3HDGA 4ZI2A 3T3PB 3ED1A 1RRMA 3S8YA 3G68A 4IH9A 1LFAA 3RRYA 3QHQA 2B61A 2PS3A 2XYQA 3KQQA 1X74A 2XLCA 2FW0A 1SUAA 3LY5A 3V7WA 3V4VB 3KJZA 4WBSA 1H69A 5GZ6A 3ZWQA 4XYBA 3ACBA 2RDMA 1E2IA 1Z0SA 1RHJA 2D3WA 1HZZC 4NEQA 2XZTA 1KU0A 4ZAXA 5IF3A 3UJ9A 2ZATA 4IUCS 1YI0A 3TOXA 1TLTA 5B1EA 1HPLA 2B0CA 2IHTA 3B6KA 3HCCA 1E2GA 3E58A 3IIKA 3DMRA 4M0MA 3RAEC 2NWQA 3AB3A 1PZNA 3QEKA 3ZE8A 3UCEA 1R4AA 3K9BA 3BCHA 1V4BA 1WKVA 1J2YA 2P68A 1CUYA 1E3LA 2JLAA 3LT5A 4I8IA 3AVQA 3KTDA 4NV3A 4YPFA 2GM5A 4KO1S 3S2EA 1CUEA 4A8TA 4OOEA 3WK9A 3ERCA 1WVGA 3MOGA 3WLKX 1PJTA 2ZEJA 3TRDA 2LE0A 1NOJA 5JOQA 1A5BB 2IOFK 5JVDA 3HO6A 3H8SA 1A7UA 1SOVA 3HKDA 1SVLA 3O4GA 1OFUA 3PT5A 5FHQA 4I2NA 4C4TA 4JI3B 5JC1A 3LA6A 3M1IA 1Q17A 1AHIA 2YIDA 1WOMA 2GJSA 5EP2A 1PJRA 3RS5A 1YFLA 1QG6A 3OE7D 3E3LA 9MHTA 3OZBA 4F06A 3MC1A 2I6TA 2QNIA 1BJKA 4ZOEA 4B32A 3A32A 4HB2A 2V7GA 4DLYA 2OV4A 3DDZX 3IEIA 1R37A 2PZGA 1F2UA 3A10A 3WB2A 4EPYA 1E2KA 5D85A 5G1OA 2XGOA 3ISJA 4Q7EA 5IARA 3CJTA 2NUAB 3LHKA 5DGHA 4K5QA 5GOTA 1D1TA 4WY5A 2Z2IA 4ND4A 3T35A 1FNBA 1W85B 3TQSA 4J0CA 4JR2A 4IIXA 4EUHA 1SKQA 3ST7A 3NZEA 3ZG6A 3TW0A 1E3DA 2AJCA 3A2KA 3KVNA 3DMTC 2WWRA 2AG0A 2PS9A 2WMYA 2FN4A 3JQFC 4RF5A 4ASUD 1X1SA 5DDIP 4TPKA 5LZ4A 2WG0A 2ZKIA 5BWNA 5KJEA 1XCMA 3QIAA 4ECAA 3B5JA 4IY1A 4AN1A 4NYJR 3VPDA 3KP1A 2VCYA 2ICAA 1SBCA 3FBGA 3CJQA 5J2TF 3AM5A 4N6OA 1J8YF 4A82A 1MC5A 2QRKA 3E3MA 5IVKA 5FULA 4O4LB 3OJ0A 4QAQA 4FKBA 4RDHA 4C30A 3HDQA 1O4WA 1T5HX 3W05A 4QUGA 4IHQA 1E9BA 1FFEA 1XPUA 5JNUA 3PXUA 5H3HA 4X1IB 2NSLA 3U09A 3PKJA 2D5BA 3UAXA 3VX4A 3IKTA 1T15A 4KH1A 4EF6A 2CV1A 2C4VA 3MJHA 3H0EA 5H3LA 5LA6B 2FMHA 4H15A 2KM1A 4CM4B 2A7XA 3RRJA 2YJ5A 2J5QA 1MAAA 1GLGA 2QROA 4UM9B 1UWKA 1S3GA 1XHFA 2AG8A 4OM7A 4RVUA 3KXKA 1MFZA 1RAHA 4MUHA 4H59A 5E3JA 1S2LA 621PA 1E3MA 2VPXA 4D2IA 2A2ZA 4XB2A 3B3JA 3GRRA 2PXCA 5A06A 3Q7TA 4QICA 3AF6A 3QEAZ 4RLFA 5C1BA 2VNHA 1VPLA 3AH8A 4HRXA 1Q11A 1FMLA 4WNAB 3T0IA 1DRKA 4QE3A 4X91A 1WTAA 2OQ2A 1RWKA 4AMZA 2PMBA 4DRZA 5I3ZA 1ZSNA 3ER6A 4HEJA 4DC9A 3LE8A 3KE9A 2F3SA 4AYXA 2ZIAA 1YQQA 4ER3A 3H6GA 1KEVA 2Q1UA 4IS3A 4CE6A 1MDBA 3ZKAA 2FDRA 2Q3BA 5BSTA 5AOVA 1YQXA 3UC9A 4CT5A 1EI9A 2WTNA 1CUBA 2PX2A 1WW2A 1HNWB 4YJ2A 1DDGA 3WFIA 4F71A 3TDMA 1ZHFA 3OKPA 3DZIA 4Y6SA 4BGUA 3QKSB 4LHXA 4MKGA 2OOKA 1NVGA 2AR7A 3R3VA 1KH3A 1W85A 2B6NA 5E8JA 1Y8ZA 3H5IA 2L18A 4JA2A 3VVLA 2QJRA 1LQ2A 2PA0A 3EQ8A 1YGPA 2ZWMA 1E3IA 3MLBA 5K0CA 1PTKA 3CNOA 2DOKA 3JTMA 2X5OA 1OZFA 3DDUA 5E6RA 3R6LA 3I2IA 2BM0A 1LDEA 3KEFA 2KX7A 3P9KA 1KKLA 5KQLA 1XSEA 2F00A 2I71A 1NJ8A 2IPMA 2DR2A 3WLNA 3TDKA 2I7TA 4FNAA 1N2OA 1V3QE 3LYLA 1TLFA 1QIJA 2MR6A 2WHYA 5CA1B 1I32A 3EARA 3IE2A 2JHAA 2IELA 4QYWA 4G9EA 3PSAA 1O54A 2OLEA 2Z2ZA 1GRCA 2FKNA 1OHHA 2HWKA 4QBFA 3ZGVA 3DJYA 4Y8VA 5HEKA 4ZEWA 5HJEA 3ZDZB 3HRHA 3K71B 1FOEB 3UQYS 5GONF 2PXHA 4X1IA 1AVTA 1XZQA 4BVEA 2UYYA 4DA0A 1JTEA 3EVFA 2O1SA 1I14A 1Y7PA 3IMKA 4F2GA 2F3RA 3KXPA 3O9ZA 4IPTA 4QD3A 1GSOA 4IOKA 4HD8A 4YMTA 2QMZA 1SZCA 5FTKA 2CL0X 1QPGA 3JCZA 1RM0A 1FLDA 2W43A 4DLSA 3JWIA 2PTHA 4BQSA 2O8NA 2OMEA 1VG1A 2ZBDA 1MJFA 1O89A 1YHZA 2F59A 3N7TA 1FDOA 1KFJB 1X7YB 4HWOA 1PWXA 1S8OA 3FOWA 4Q24A 5DSZA 5JBQA 1DBIA 1QJCA 3DOFA 4L6IA 3BEOA 2XLBA 5F2OA 2A35A 5E2BA 3V4RA 4C3ZA 3LT4A 4FMCF 3QELB 1Y42X 3BXXA 3T3OA 1KHTA 4NOKA 4DLZA 1MD9A 4TYNA 2XWBF 3DOEA 3K2BA 4G5RA 5B3KA 1F7UA 3MIIA 1XJCA 4KB5A 4HH3C 3MRVA 4Q3KA 1PUJA 4Q7LA 1JR3E 1B4DA 1JLHA 3LP5A 4R3NA 5LB4A 4YT4A 3QEBZ 4ZYYA 3QVSA 5LL6P 3K9HA 4TV8F 5IUNC 1RFLA 1XLUA 3TI7A 3QKSA 4FXPA 4NR0A 2XD4A 5EP4A 1JU3A 2PRZA 1Z4OA 3I53A 5B7PA 3DZJA 1CU1A 3U7QB 5IJXA 3BORA 1E3TA 2UZ0A 1XEFA 4D8UA 3N0TA 5GIOE 2PCLA 3P9SA 3A14A 4XSGA 2AOUA 1WULS 2AFHB 3N8IA 1BIFA 4QDUA 1KJ9A 3GUZA 2I7CA 3S2ZA 5BURA 3HCPA 1KOGA 3F6CA 1DQSA 4A0SA 1U2TA 2HBRA 1IIBA 2DZDA 1AUPA 5DZSA 3WISA 4H1VA 3RV3A 1AKYA 1B1AA 1N6OA 3L40A 4P22A 1TUEA 3ANTA 4DJEC 3HBJA 1J22A 2PMWB 2P3LA 4HWTA 1G6OA 1L7RA 2WWWA 3RNOA 4F9GA 4FFPA 2PYDA 4J1QA 2QW8A 5F51A 5ER6A 2SNIE 2J85A 2V7QD 1RI5A 4G26A 4WGFA 4TWAA 1LPMA 2WWFA 1GADO 2ZETA 2AXPA 1MNAA 4F1KA 2AYXA 1IM2A 5EIWA 2IUUA 2YASA 3GVHA 5HCUA 4LYGA 4QOGA 3PUYA 3KWMA 4FCWA 3R0QA 3ETJA 2J3KA 4J16A 4RK7A 3WP0A 3LSTA 2DLNA 3PDHA 3OESA 4XUEA 3QUQA 2QTTA 5E2IA 1DEAA 2DQSA 1RAFA 2C8KA 5GZ1A 3PB3A 4LJAA 2WM3A 4Y0VA 3ZWNA 1CIJA 1RJDA 2F1KA 3GEGA 3KYJB 1WUJS 2TRSB 4WXYB 1TUBA 4QBGB 3EC1A 1AT1A 4HADA 3ZN2A 2UDPA 1KQPA 3SGLA 4ZREA 1N2SA 1U28C 3GA7A 4AG6A 1TQ8A 1S2IA 5EZYF 3AM4A 3QELA 3EXEA 4IDBA 1YL6A 1X38A 3ENNA 4MO2A 1NXWA 3SX0A 4NCBA 1NBWB 1KJZA 2VNKA 1DCFA 2JEZA 2VJKA 2WVHA 1YR1A 2C57A 4YQZA 4DMFA 3B1KA 2H7VA 4LJ4A 1CRWG 4N47A 3RAFC 4PSCA 1FJHA 1VJDA 1YUNA 4C08A 4QEDA 4HAOA 1F0KA 3O8RA 1D9XA 3BH0A 3H2GA 1ACLA 4HVAA 5FL7A 1GTSA 4TN5A 5F7XA 2WJ6A 4FCCA 1CFJA 1US8B 3VI4B 4OQXA 2PZAA 5I7AA 1KZ6A 4CLRB 3GDHA 2OQRA 2R8ZA 4BLWA 2PKXA 3U7QA 3VV3A 3O47A 1Z39A 3PEUA 4CM8A 3M5CA 1D2NA 4OQEA 1UAGA 1VCOA 4BMVA 3ELUA 4LXTA 4CODB 3T7AA 2CSXA 4FFVA 2R8RA 3R09A 1NLFA 4LBZA 1XTVA 3TECE 2PL3A 2C4MA 1ESNA 4GR5A 3EVTA 4CQLB 1ANKA 3T7IA 2FSGA 4MJ3A 4KC0A 4KWHA 1EU1A 1TTHA 3DAGA 4KE7A 2AX3A 4ISBA 2BF7A 3HXLA 3R5SA 1LBEA 5GVRA 4ALNA 3W8DA 1LBHA 4QTZA 3WIUA 3CB2A 3E3NA 4IXTA 1UQTA 2RI1A 1MU0A 1EPUA 1YMVA 4HQRA 1TMOA 1XRJA 3D0RA 4OMCA 5BQ3A 1EE2A 4U3JB 1TZKA 1QIGA 3KKKA 5I9BA 5L7YA 5TR9A 1VBKA 2GK6A 1OWMA 1DFGA 1ZH6A 1CFZA 3ZZUA 1Q1BA 4X94A 3T7RA 4UUPA 5IHXA 221PA 2BUCA 3DFFA 3OD5A 4YXWD 5K8IA 3Q9UA 2BISA 3UJBA 3KXLA 1N1MA 1OGJA 2ZM6B 2O19A 3QTLA 2AOWA 2EL7A 4R2KA 1ZGHA 2W0MA 4TSFD 3M8KA 1Y6JA 2G83A 2XKBA 1RTTA 1XZGA 1V39A 3M6MD 2YXEA 2Z8XA 4ER5A 6REQB 1NMYA 2D74A 1NM5C 1K1EA 1MORA 1LLQA 3OCWA 1Y4UA 4RHEA 4AQYB 4WERA 5IP5A 4ARZB 3DZKA 1MT0A 4JJGA 4OVKA 3U1VA 2ZZKA 1F8YA 4YHHB 2K2QB 1GM5A 1MOZA 1NA5A 2X3FA 4RX1A 4DDTA 2RAVA 4RZQA 2P2GA 1OIVA 5DHQA 4GI1A 4G56A 2ZR9A 4D9FA 5ESXA 2H1SA 1R64A 1YZQA 4GP6A 4MVJG 1NLZA 4RCYA 3X2EA 4IVRA 4AK9A 2GLXA 3L0BA 3GGPA 2EZTA 4RY8A 3CLUC 5H81A 1DU4A 1US8A 4JXKA 4MGYR 2JGDA 3FROA 2WZCA 4WD3A 4A6DA 4F1JA 4PLHA 1NI3A 4UHBA 2XJ4A 3KSAC 4S1WA 1JHPA 1TGVA 1I8TA 1SVMA 3WL8A 1GAXA 4PLVA 5BN3B 4F9TA 1E9VA 3TPZA 5FFMA 3WGLA 1QYWA 2KQUA 2O1XA 1RBZA 1Q14A 2EZ4A 2PYIA 3B1ZA 1PW7A 1OV4A 3QNMA 5F5LA 1OB2A 2QX4A 1WSBA 3G2JA 2P5UA 3K9CA 1H65A 4CQLA 1RPAA 3OQMA 2G06A 2YZGA 5TEVA 1FZTA 2DKNA 3WLPA 3Q0EA 4A5OA 1N2CB 2O2CA 1JIJA 2OV2A 2GWHA 2XCQA 2ZWPA 3HBLA 3VPAA 3WNDA 2BLNA 1HO3A 4NP6A 4RSMA 1KAOA 3MTJA 2NXJA 4XX1A 1GJRA 3T3DA 2QQGA 2J33A 4RO0A 3U7JA 1AA6A 1YC2A 1LLCA 2P8SA 3A1NA 3KNZA 2IOHA 4G25A 4HQKA 4JASB 3D9QX 3EAQA 1UP6A 4NULA 2ZIZA 4TXMA 3BWDD 5JALA 2IZ5A 1G2QA 1W49A 2BZ1A 1H3NA 2CCKA 3CN7A 3KBBA 1DEOA 4I5IA 5LZ7A 5KYTA 2AHOA 3AHDA 1KQOA 4J4BA 4ND7A 2HZBA 4UBOA 4NJMB 3DZGA 3E5RA 1Z2PX 2QGFA 2PT5A 2XF2A 3RYFB 1FFXA 2FSVC 2R8BA 4RQAA 1ZI9A 5BW6B 4GEGA 2IQ5A 3SE0A 5LQMA 4OTZA 2W42A 1SZPA 4ZVVA 3EPKA 2H1CA 4N3CA 1Z37A 4D26A 2BR3A 4HZGA 5FWYB 3AKCA 2DTXA 2O9JA 3DAYA 4ARZA 4M1TA 3RVKA 4KN9S 4LGVA 4YQYA 3U3ZA 4DJTA 5JVDF 4LXUA 2D5AA 3T1HB 4ZO7A 2BW0A 3GXOA 4I46A 4ANFA 1KDRA 3L0SA 2BL4A 1S3FA 2E9SA 5JTTA 5P21A 1QTIA 1BCRA 1HOXA 4MW2A 5DBOA 5TX7A 5HJ5A 4TRRA 1GNTA 1Y63A 3SDBA 4MV5A 4CV3A 2C5FA 2FQWA 3PQ6A 1E5LA 4EVSA 2OLJA 1R0KA 2JGNA 3QU5A 2OXFA 4LJRA 5EKSA 1RKXA 2WJAA 3KUDA 5BN3A 5LQUA 3DHNA 2CLLB 4DSUA 1Z5PA 2C9ZA 3DV2A 5K20A 1EDBA 2C2ZA 2FOXA 3K0BA 3LF2A 3UT5B 2I6SA 3F6EX 4Y2TA 3ABIA 4ER6A 1OXSC 2LBPA 5FOVA 3KQPA 4M9XA 4WKNA 4MQ4A 3K1JA 2GTPA 2NQ2C 3T0FA 4B0OA 2N75A 3IP6A 1MZVA 2XTZA 1JNXX 3DKRA 4XOIA 4PPQA 3GBSA 1MJNA 3N05A 1OPRA 4S24A 1H5QA 2QD4A 2EHDA 2MTBA 3KPJA 1ISHA 4KIUA 4C0JA 2VHZA 4M8IA 1GUBA 3IEUA 1M5UA 5HKBA 1O6GA 1X9GA 5BOVA 2GH1A 3O8QB 2N47A 5LWHA 3CRNA 1R6DA 4F5DA 5IJ9B 3AYZB 4G89A 2CLHB 1BGVA 1X1EA 2QZSA 4HNQA 3RYTC 3ZCPA 1E92A 1Y7HA 1YBAA 4NJMA 3TEFA 4EECA 2FN8A 2W2LA 2P6UA 4DZTA 1P0MA 1B1CA 1YC5A 3RHSA 1F2DA 1FP7A 1AA9A 3HJUA 3QMVA 5T4EA 5TT1A 3RYFA 1JPNA 2X3UA 1PR6A 3OZXA 1QCCA 2H31A 3G5MA 4EI7A 4LDRA 5DT2A 2C4NA 1S2OA 5JV5A 3H42B 2P67A 4HQ0A 1JEJA 1QFZA 4PLTA 4FHZA 3TIXB 2CXPA 2IEZA 2QT9A 4X64B 2C95A 1IY0A 3EWIA 3U9SA 2NTVA 3CPHA 4NQZA 4C22A 2OORC 3OQ1A 2AI3A 4G81A 1QKKA 2BFBB 2FQQA 2HBQA 3J7TA 1Z25A 1QH1A 3BDIA 2XUZA 4G67A 1USIA 1WCIB 4LN1A 4PAMA 4POOA 1MN6A 2DQ4A 4ED9A 3QX3A 3L05A 4RL6A 3ROTA 4UM5A 2D7CA 4RWZA 1OZ0A 4M86A 4P1ZA 3WIOA 1UUFA 1UK6A 1T1GA 3DWFA 5B7QA 3GLHE 3QLUA 5LVAA 1JU9A 3IBCA 3OFKA 4CN8A 4OKIA 5JFTA 1Z0DA 2RC5A 2TMYA 2MINB 2BTOA 4FGUA 2H2GA 2W2VA 2DR0A 3KQUA 3HACA 3FDXA 1SOMA 2CNNA 4FWBA 3FPBA 1T3HA 2O3JA 4G1EB 4I9FA 1CRPA 2F1JA 3TYXA 5HUHA 3BH6A 4TV9B 5BRJA 1F4PA 4RTSA 1FP4A 1GLVA 2R6ZA 4LF6B 4TYMA 4EW2A 3ZIAA 1XJQA 4RV5A 1L6RA 3R74A 2IC5A 2ZYGA 3FHCB 1SFRA 3O8DA 1GAQA 1XNGA 4LXGA 1XZIA 3O4FA 1L7MA 1AUQA 1V43A 4PY2A 3RVPA 3S2YA 1PG2A 3C87A 2DQKA 2HU8A 1XCOA 1R8XA 2PPLA 4AO6A 1SD5A 1YT5A 3CV3A 3RFTA 3S2UA 4C0SA 1RZVA 2PL5A 3KOMA 4IOMA 3PT9A 2XEXA 3D8HA 3HO8A 1VKJA 3MS2A 4GNKA 2AF4C 4ZT7A 3U0BA 5KTOA 2PV7A 3FVWA 3O8QA 3ORFA 3L4BA 1U3UA 5IJ9A 4O4LF 4RUKA 2Y1FA 4GMXA 4I50A 3WFZA 3C3YA 4XGKA 4AYTA 1Z75A 3RCBA 3U0VA 4L15A 5HKKD 5TMPA 3BTVA 4ZAFA 1E2LA 1TFRA 3PENA 3ZY6A 3I83A 1SCDA 3C3BA 2PRIA 1CUVA 1ICIA 3QRWA 1VB3A 3E7WA 4MR9A 1CEXA 5T3YA 5LA6F 3RVBA 1KOFA 3MTDA 4COKA 4LQCA 4RIFA 2FE4A 5AI6A 3IP1A 2ORYA 2PUJA 4ZEMA 5JJCA 4EG3A 4G4SO 4IIDA 3NBYC 3TUJC 3LC7O 4AJNA 1KMHA 2CDNA 4UD6A 4YRPA 3JAKB 5AK0A 4AJLA 1A95A 3FFAA 1WCIA 4C2BA 3U60B 1ZA1A 4EA9A 5DNUA 1TVMA 4ML3A 1AGPA 5KSZA 1TKBA 2P90A 4B3DA 2G9ZA 3ZW8A 1ZUHA 4BP3A 3AJAA 1Z5VA 2I87A 3X2SA 1OX6A 1CULC 2PKQP 4WADA 3AHEA 1KJYA 1JLMA 2BMDA 1YXMA 3MD9A 2HWYA 4R9VA 4X1YA 4C6SA 2V3CC 1P7VA 3H5OA 1UJBA 4FUTA 3H3JA 1JQKA 5K3CA 1U3WA 2ODTX 1L7XA 3H16A 1KSFX 1JVBA 1HK7A 1YBMA 3BYZA 1II8A 3O4RA 3DD5A 3D7SA 2D4HA 4TV9A 3WJ1A 3IDZA 3NEPX 3D59A 2HDOA 3Q7RA 4NVRA 4XM0A 5AVXA 1RT9A 3RJ5A 2JLZA 1E7MA 1OH8A 2CLFB 3IQGX 3OCVA 3NATA 5ERGB 1OJLA 2TECE 2C2MA 4ENUA 2Z56A 3I3SR 4P36A 1TCAA 4GFDA 4INZA 5DCWA 1TYAE 4QEKA 1QB7A 2P6MA 4EGQA 1DXOA 1Y3DE 2BGTA 4R5MA 2VBCA 3IAXA 4JVOA 4B7XA 4PYJA 1WQ1R 4DIBA 5IDWA 5IH7A 1AZSC 1C3XA 1QHSA 1PL6A 3GGDA 5CA1F 2BGRA 4FLMA 3BICA 3R40A 4FTWA 3JYQA 3SMVA 1I5EA 1MGOA 1XCBA 1REQB 4N5DA 3S5JA 7REQA 4RKQA 3M2TA 2JAOA 4Y3UA 1GYPA 5I7SA 2J5RA 4N03A 5GGXA 1G6Q1 2CL7X 2FZ4A 3AHIA 4L8VA 5EFOA 1E5TA 2FW9A 3ZV7A 2FQXA 2W6JD 3RHFA 1NZJA 1COWD 1DC6A 1H93A 1HZZA 1NJFA 3HY6A 3E8MA 2A5FA 3QYFA 1BDHA 1A8QA 4LTMA 3DKVA 3PHLA 4H1UA 4S04A 1ZVKA 1KA9H 4W63A 3FCEA 3OCXA 1T3GA 3C8HA 2BHTA 4XWKA 2BJWA 1KJIA 5IABA 2VT6A 3D0OA 5JNTA 2I29A 2R6AA 2REXB 3M4NA 4G0PA 4JITA 1PYOA 1VECA 3DTYA 4MQLA 5E4JA 1G60A 4UTZA 3NPMA 2CNKA 4RADA 3ICEA 4LYYA 2TMKA 1E99A 2Z30A 4R6WA 3E3OA 1GGNA 1Q7EA 1UBEA 3JAKA 3R3WA 4BYMA 3TLCA 3D2AA 4WN9A 1AXGA 5ENZA 4BVHA 2ZT5A 1B8PA 1U0LA 5C0OE 4HAYA 4D79A 2I4OA 2NO4A 1KNXA 5AUOB 1N1DA 2N1MA 4YDSA 2X6TA 2Z6QA 3FOZA 4NNJA 5KNDD 1NR1A 1KDTA 3LDAA 4FE7A 1JZSA 2BC9A 4FCVA 2ZUWA 2Q5QA 2V7VA 3AU8A 4TTAA 5AW9A 2GCPA 3F5MA 3FLMA 4D6PA 4Q9DA 3KKEA 1FF9A 2MT9A 3GVPA 2Y0EA 3C3AA 3N1UA 8ATCA 1HDYA 4C2UA 4CMEC 2YV1A 4LXYA 1P19A 1E89A 1XCPA 3QPUA 4CQMB 1CE8A 2W6QA 5CJPA 4E09A 4A26A 2IFTA 1UEXC 3HYCA 4RFLA 1N7IA 4IZOA 5HK8A 1L1EA 4W5QA 3AU9A 4OI1A 4IH1A 4LY6A 2IYNA 3CF0A 1L2TA 4JT4A 5D5HA 3W5HA 4BVLA 4UUMA 1KVTA 1HYHA 3B7GA 1KZ7B 2V4UA 3BJZA 3WLEA 3V4PB 3ZBTA 1A1VA 2P1DA 2EGHA 4ZHQB 4EEZA 1VA5A 2GF2A 4M9UA 3TQFA 5AVKA 1WQ3A 1WA5A 2QJTA 4KKXB 1QP8A 4RJTA 3NEYA 5CFPA 1E98A 1S4MA 1CX9B 5FWXB 3R7LA 1S96A 4PC6A 4HOYA 4JKOA 3DMTA 1BEZA 3O1HB 4BP9A 2K4MA 2OP0A 1ZRSA 2PRYA 4L85A 3JQFA 4UXIA 4FSDA 2LPMA 3ETEA 1TEVA 1REQA 3EULA 4R9RA 1SUDA 1ZMRA 4PANA 4MYSA 3L4JA 5F7JA 3I9JA 2APJA 3WE7A 1L4MA 2PQ0A 4YQFA 1RXVA 2WDZA 1XDSA 3QXCA 4D8VA 4ZK6A 3WLSA 1GZ4A 1LFDB 2DULA 3G2LA 1RC8A 4EX7A 2PS0A 3DS8A 2JA2A 3H87A 4CL0A 1R0YA 1P5FA 1OLUA 3C3EA 3SQWA 2C8LA 4N76A 4S1VA 2R62A 4JJ8A 5BNWA 4IVQA 2Z6VA 1NQAO 5TJ9A 1Z0JA 2VWHA 2D1TA 1VLLA 1HR0B 1C0LA 4JCOA 3FTCA 4GQAA 5EJFA 5JS2A 3COPA 3TB6A 2B35A 4H7IA 2Q41A 4DPLA 1Z6PA 1GN8A 1YACA 1HE3A 1EFDN 1WDLA 4WK0B 3REFA 1UKBA 3WWDA 2R65A 4KPFC 1QLWA 2YXDA 1AN9A 3FNQA 3PQFA 4Z7JA 1KEEA 4BNZA 4OBBA 4DSTA 5K8VA 4G8BA 5LBUA 3Q12A 3EFEA 2UYQA 3IAUA 5TF0A 3HHPA 1PJAA 2JAQA 5JW6A 3G5TA 1U0RA 1E2UA 1C2TA 4TS9A 2HRRA 1WL8A 3UGKA 1JEAA 3BWMA 1TA0A 4KBFA 3GFSA 1QWSA 5D6NA 2IHJA 3L1IA 4DR2B 3CH5A 1AM4D 1N7GA 5CHEA 1W88A 3VH2A 4DCPA 1GYQA 1U5AA 1Q1GA 1VSUA 4AO8A 4DCVA 1I3CA 4S12A 3DOOA 1HUQA 1YR2A 3WSWA 4CQMA 2ZE6A 5AVSA 4Y0AA 1IRIA 1WLYA 1B0PA 4HUQA 1NWHA 3VZCA 4DW8A 2G28A 4JAVC 2CFRA 3MOSA 1W59A 1WPRA 1Z47A 4Z3KA 3ZHCA 4LJ7A 4KHZA 4MVYA 3TZKA 5EJEA 1YHYA 3CSSA 1H8ED 1BROA 1H1TA 4KFTA 3MCWA 4WDRA 4XSHA 3QFSA 1NONA 1G291 4E2WA 4FZ3A 2IOYA 5LZ8A 4X9XA 4C3UA 1GSHA 1WEHA 1WB5A 2ALJA 2QT0A 3G02A 3PUIA 5FWXA 2JFUA 3WBFA 1YR9A 2I6QA 1WHSB 2DB3A 4FYHA 3I2GA 5I9MA 2JKZA 1JQ5A 1UPFA 1PLLA 2W93A 3MQFA 1XVAA 5BMOA 1UK7A 3FYHA 1SA0B 2C0QA 4Y2RA 3VAZA 3UG6A 3E22A 2DPYA 2M6SA 3KOXA 3L2OB 3QJYA 4L07A 4PCLA 5A5FA 3P0JA 2OQVA 5BSVA 2ZANA 1GO2A 1LDMA 3ZY4A 5IK2A 3KB2A 1TM1E 5JHGB 3AB8A 3ANLA 5E3HA 1XXLA 5HUQA 4DXAA 2HW8A 3K0HA 4IEEA 3KSZO 1GR0A 2YVQA 5F3RA 5KKCA 1TZJA 2WYUA 3D64A 1X8JA 1HEIA 3KB8A 4NMMA 3COYA 1CLUA 3TRHA 3DD1A 2BHRA 3DOIA 4RF2A 4YAFA 1CUFA 4NCKA 3A9CA 4C6HA 3OCZA 3NM5A 4MKHA 1KAMA 4Z3OA 1H5UA 4UMDA 3RVMA 1KEPA 1SCQA 1C3VA 2NVWA 1YIDA 2JD1A 2HHLA 2VPQA 1C4OA 3I37X 3IKMB 4HN4B 5ED0A 3N9IA 1MO4A 2A0YA 2E4YA 2ZRCA 1JMYA 1OCEA 1EFLA 3IA2A 1OB5A 2OESA 3GRZA 2JJYA 1ISMA 4HSGA 5AO9A 2G9UA 3JY6A 2NT4A 1RWWA 1YR8A 3M70A 1ZL2A 1PNQA 4KGDA 1ZH2A 5A2GA 1NW4A 4BMXA 3C6XA 4D80A 4U9HS 4E3ZA 1RYHA 1GGMA 3BCRA 4L75A 5THQA 3T8YA 5K03A 1TFUA 1G1AA<