4Y0AA

Shikimate kinase from acinetobacter baumannii in complex with shikimate
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
179
structure length
179
Chain Sequence
PSKAFETLPNIYLVGPMGAGKTTVGRHLAELLGREFLDSDHEIERKTGATIPWIFEKEGEVGFRTRETVVLNELTSRKALVLATGGGAITQAPNREFLKQRGIVVYLYTPVELQLQRTYRDKNRPLLQVENPEQKLRDLLKIRDPLYREVAHYTIETNQGAARDLAQKILQLILSNKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Shikimate kinase
publication title Structure of shikimate kinase, an in vivo essential metabolic enzyme in the nosocomial pathogen Acinetobacter baumannii, in complex with shikimate.
pubmed doi rcsb
source organism Acinetobacter baumannii
molecule tags Transferase/transferase inhibitor
total genus 65
structure length 179
sequence length 179
ec nomenclature ec 2.7.1.71: Shikimate kinase.
pdb deposition date 2015-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01202 SKI Shikimate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4y0aA00
2W0SA 3OE7A 4O2LA 5KDLA 1LS1A 3H86A 2BKUA 4YDSA 1JQJC 1GRQA 2Z6VA 3X1DA 3TVTA 1F2TA 4PHHA 2ZU0C 1P73A 1GP2A 1UAAA 4JZKA 1AM4D 3B1VA 4M2LA 5DHFA 3BH7A 4E03A 2ZS9A 1JR3A 2PEZA 4XWOA 3ETLA 1Z28A 1F2UB 1Z29A 2W2TA 5IDVA 5FPHA 4EFLA 2CNWA 2YOHA 2ZI4A 2C2HA 4OJKA 1KMHA 3W5IA 2BMFA 3ZQ6A 1E2DA 1DAEA 2C77A 3BK7A 4Q7MB 5TMPA 2G3YA 3QPVA 2DR3A 4MUBA 4LDJA 1D2MA 2JDIA 4PFSA 2PH1A 5EE9A 5FBVB 1DBSA 1F60A 4ERNA 3IUYA 4DT1B 2WPDD 3R9IA 3CUEF 2H17A 4HAUA 5C18A 3T35A 5JS8A 5DN6D 3GLIB 5FUYA 4AYTA 821PA 1OXTA 4BLRA 5FPYA 1U0JA 2IHBA 2W6JD 4Z1MD 4NCJA 2ZSBA 2REBA 1VG9B 2PMKA 4BFYA 2WJYA 2DBYA 3T5GA 1LTQA 1RRCA 3UWOA 4RD4A 1SXJD 2HT1A 3AVWA 2OCAA 4RSGA 3LVQE 3MMPA 4TQAA 2ODWA 3SJBA 2J0SA 3R9XA 1SGWA 2QTVB 3UMFA 2G0NA 1CRQA 4ABYA 4QM6A 4N0DA 2ZYWX 5FTNA 1XTIA 1EK0A 4MH0R 4NP6A 4B35A 3I73A 1FMJA 1DAKA 3NIBA 1EFRA 4RD3A 1X86B 2IBMA 2GJKA 1ANKA 2ZRKA 4TTRA 2V7QD 2KE5A 3RHFA 1D9ZA 2A9KA 3RC8A 1OIVA 1OH8A 1NMYA 3U2QA 1KK1A 3T5DA 2FJUA 1ZRHA 4ZIRA 1YJ5A 1Y63A 3C8UA 1OFHA 1G8YA 2G1KA 2REOA 4IVRA 3NDPA 2O8BB 4M1OA 3ONWA 4LV8B 4YONB 3NHBA 1T3LA 2XNSA 2V1UA 1DS6A 2GJAA 4IXNA 5HZHA 1RPZA 3B60A 3MAAC 5KSOA 2FZ4A 3BIFA 1TF7A 2ZSFA 3FHOA 2XXAA 1II0A 4LYJA 5E7IA 1NVVR 2GETA 4FD2A 2WIBA 5DIFA 3ADBA 4OI4A 5HE9A 1G7CA 2JJ1A 4OQXA 3HDTA 2VSFA 1KKMA 1WBDA 2P5TB 3TQCA 4OYHA 2NTYC 1N5IA 5CM8B 1QDEA 1G3RA 1E0KA 5JI2E 2BJWA 2X2EA 3OEED 4OHYA 2G0TA 3LXXA 3QNUA 1XJ0A 4E07A 1XD8A 2OG2A 2KBFA 4BFVA 1P2UA 4NZYA 4DUGD 1LS6A 2PCLA 5B30A 1W0JD 3FDIA 3C15C 3DVLA 3BBPA 2O0KA 1PLKA 1LFDB 1P72A 1Z6GA 4BQSA 3FTQA 2WIAA 2KWIA 4MGZR 2VLIA 5TY0A 3VR3A 621PA 2ZRFA 1Q1ZA 4OK5A 4DCSA 1M34E 1SXJC 1NY5A 4V0LA 1NRJB 2FFQA 1P61B 4MUAA 4F4CA 2QAGC 3WHLA 5GJVC 2Q9CA 4MRNA 1G5RA 4B3FX 2C9OA 1ELOA 2F1IA 2V6IA 2B8WA 3QKUA 3DKVA 1WMSA 2LKDA 2J0UA 4QJ5A 1VHTA 3MFYA 4B48A 4W7SA 4LV6A 1XTRA 3BFKA 1N5LA 4LY6A 1XX6A 2GJ8A 2XSZD 4M9XA 4WZAE 1H65A 1MO6A 1U0HC 3RS0A 2XB4A 5FI0B 3U3OA 3D3QA 4PC7A 2CXXA 1COWA 221PA 3OFND 2C04A 2R6AA 2JJ8A 1TL7C 1N0WA 2F6RA 2NIPA 2Y8EA 1FNNA 3A6PC 2LCFA 1P4SA 2BMDA 4ZV4A 5DGXA 3PJRA 3HYRA 2V1XA 2OO7A 3RLFA 1F2UA 2F9MA 3EIQA 2IYVA 3EZ9A 4XJXA 4CDGA 5JMTA 5FL3A 3LBHA 1Z6XA 2FPKA 3QXHA 1XCPA 4DSTA 1W4AA 3WNBA 3Q9LA 1KNQA 4M1WA 1Q3TA 4Q1CA 1DO2A 2BKEA 1P60A 4MA4A 2W83A 1SKQA 2GEUA 4NYJR 2VYFA 3TR0A 4DT1A 5JWHA 3MWKA 1PLLA 4ZDKA 1YVDA 3I4LA 1KYIA 3K9GA 4IJMA 2RGBA 2VP9A 2WKPA 3REGA 3PG5A 4M1MA 2ERXA 4UJ5A 1IJEA 3RWMB 2C8VA 1S1MA 5F98A 3EZ7A 4OHXA 1CR2A 3KXKA 3W3AA 1E4VA 4HB2A 3F3YA 4HDOB 1OXXK 4QM7A 2ORVA 4B47A 1ZC4A 1IN4A 4TMXA 3RSOA 3GLGE 4W5HA 3C5CA 4CRWB 2OV2A 3NH9A 4Q18A 3AGQA 1TF5A 1IJFA 1OXSC 5FPKA 5IRCD 4TYWA 4Q21A 2VEDA 1U0LA 2CE7A 1T0JB 1VYUA 4AKEA 1KO8A 5TARA 1OXVA 2JJ2D 3LRPA 1PLJA 1BH2A 2OEPA 3KJIA 5A0FA 1EX7A 2O8DB 1A1VA 3EZ6A 3LW8A 3RAPR 2AKYA 1OFUX 2O8BA 2YC2C 2VP0A 1IBRA 4TSFA 5KPJA 1VCIA 4XH9B 1YRAA 3BS4A 4G5QA 3WY9A 4DB4A 1P2SA 4NMMA 5KSYA 5BWMA 1O87A 2ZROA 4C30A 1OH7A 1OF1A 4D4JA 3VR1A 5HR5A 3QE0A 4X8OA 2GA8A 3IILA 2ORIA 4XD7D 3RS5A 3IO3A 4LJ4A 2O8FB 4DZZA 4BECA 4QXAA 4NYIR 1TMKA 2QPTA 3HP1A 1FQJA 4US1R 3A1SA 3G0HA 4OQFA 2OCPA 4RD6A 5SZIA 1GKUB 1Q3HA 1KTVA 3U7EB 5EUMA 2ZI6A 1Z2AA 1KY3A 2QORA 2YJTD 2OM2A 1XTJA 2GK6A 4HATA 4FWTA 3GEIA 4ZCLA 2EU8A 3U5ZB 1G8FA 4HDCA 3P4XA 4QFMA 4FN5A 3QF4B 1NBMA 4GT1A 2OUKA 4XIGS 2ZYUX 2ZJYA 2IA5A 3G5UA 2JLRA 4QGHA 2N46A 2G88A 2QSZA 1KK2A 3SDZA 4B2LA 2BWJA 1ZNYA 3WHKA 1SVIA 1KO7A 1T9HA 2D2FA 1IXSB 1S4QA 4HEJA 5AUOB 4JLBA 1IAQA 4GRAA 1W4RA 2A2ZA 2ZITA 3EA5A 5LD2C 5DO9A 2DWQA 3PCRB 2G77B 1II8B 2OBNA 4IVPA 2ZJAA 2WOJA 2AFHE 4IFBA 3A37A 1FPMA 1Z0IA 3TUIC 1IM2A 1C1YA 1TU3A 4BE7B 5A5GA 3AVXA 1Q22A 2VHUA 4HUQA 5FFMA 3C4JA 4BASA 3AGPA 1MOZA 2J3EA 1DARA 1G64A 2F3RA 4JIMA 4URVR 4QBIA 4JMPA 3U4QB 3QOFA 1AN0A 4CYMA 5KHOC 2CLSA 3TUZC 4LJYA 4PSVA 1KDTA 3PFIA 1DAHA 1GKIA 3B82A 3O8RA 1JR6A 1MRSA 4AIIA 1L2TA 1QZXA 3Q7PA 4B44A 4BZPA 2OT3B 1X8JA 5FH9A 2RB4A 1XU4A 5E7JA 1OB2A 2J46A 4JT4A 3ADCA 4D6PA 5AWFC 3WP1B 1GAJA 1G41A 1U8AA 1KSHA 3PQCA 3B85A 3HR7A 4IDOA 2IYWA 4AG6A 3IBGA 2F43A 3BB3A 4UXHA 2JLYA 5JJKA 1E6CA 1W7AA 3P26A 1S8FA 2PZFA 4QBHA 1KGDA 2PMDA 4B34A 4DDUA 2FSFA 4OHZA 1XTQA 2VH5R 1Q21A 3GLIE 2OBLA 1U98A 1OIXA 1MO5A 1MABA 4IDNA 4JYBA 4Y0VA 5GADl 4PPQA 4K46A 1KZGB 4KITB 3BH6A 1DAIA 5BN4A 1Z3IX 2XOKA 1DOAA 2QAJA 2ZUBA 3CF2A 2XB2A 4HAVA 5J4LA 2EVWX 1E79A 5L3QB 5B58C 1Q1EA 4HLDA 4LJ7A 2GCNA 3CR7A 1TU4A 4D25A 5LB4A 2ZRPA 1SXJB 4IOMA 4LZZA 1W0KA 1Y3AA 1R5OA 2QE7A 3OAAD 3CF6R 3CRMA 4L15A 1OHHD 4LBZA 4D82A 4DLVA 3QG5A 1Z0KA 3H84A 2PT5A 3TW4A 4D81A 3U7FB 3HPQA 2A5GA 1NJGA 1QHIA 1TF2A 3B5JA 3LH5A 3OEHA 1EFCA 3ZIAD 2FDCA 2FOLA 1WXQA 2O8DA 1R5NA 1ZD1A 1G3UA 1RW4A 2BOVA 1AS3A 5FTMA 5JLJA 3KB1A 3QUSA 2J7PA 3QG1A 3T06B 2WZQA 2ZR9A 1ZNZA 1DEKA 3K0CC 4U02A 4D0GA 2IXGA 4CT4B 1DTSA 4BFZA 1T8TA 3N2EA 1OKKA 2EFEB 4NONA 2IS1A 1G1MA 1OYWA 1KMQA 1Q12A 1G3MA 3NEJA 2IUSA 1D5CA 4M0LA 4ARZB 1XEXB 1KKLA 2NPFA 1XTSA 3NKVA 4US0R 3K70D 1TUIA 5F2EA 3QSYA 2Q9AA 2A7QA 4GZMA 4R71A 3VX4A 4C0JA 1NIJA 3I8XA 4N1AA 4A1FA 3I61A 2O8FA 1CIPA 1TQDA 2I1QA 3L8YA 4PC1A 2B92A 3LD9A 1T0HB 2WHXA 4S2EA 2GBLC 3GJ4A 4PO9A 2Q0HA 3GMTA 1WE2A 2DHRA 2WTUA 3CIOA 3P32A 4B43A 1CXZA 4OQNA 3VHXA 4P4SA 3Q72A 2RGGA 2H57A 3ZH9B 4HZUB 5EJEA 1VCOA 2BEJA 2WSMA 2IYYA 1DVRA 1X1SA 2YWHA 5FPTA 2PT7A 3QF4A 5HCNA 3G82C 2VPPA 5G3YA 3LY5A 4EJSC 4TLDA 1KI8A 2O0JA 2R62A 4I4LA 3GLFB 4Q1FA 2P6UA 1GNPA 4IDPA 4RFSB 2KJQA 4GOXA 1E32A 2GXAA 2GCOB 1TNDA 2C95A 4LK2A 3KJGA 2QUZA 1W49A 3QXJA 1EFTA 3WYGA 2IT1A 1E9SA 1KJWA 2VHJA 4WZ6A 5G41A 4LBYA 1OFTA 4ZCMA 3EPLA 1QVAA 5FOTA 1II8A 3A36A 1KO1A 4A6PA 2NQ2C 1YZTA 3JZAA 2WKRA 4NHOA 3U60B 2HEIA 4AKGA 2NOAA 4URWR 3HJNA 3V4FA 2PLRA 2IUUA 1E9AA 3T1QA 2ZETA 3MWLA 4QRHA 1UFQA 2NO7A 4KAXA 3R7WB 1J8MF 4EFMA 1P3JA 3IHWA 2VHCA 5EP1A 2ZM5A 3FKSD 2D74A 3U4QA 1G8GA 2A30A 4WAUA 2D4HA 2UVQA 3HWSA 2GRJA 4DSOA 3SR0A 2PJRA 2ZU6A 1W36D 2YV5A 4LOAA 3A4LA 3VTKA 2WV9A 4C0AC 1R5BA 1B0UA 1CBUA 1Z2CA 3DDCA 3K70C 1ZM3A 1V43A 3EG5A 1ZW6A 1NVWQ 4M9SA 2BM0A 2ZUDA 2DY1A 5P21A 4URZR 2EFHB 4DEYA 4RFVA 2CMKA 4WOPA 4PPNA 3D6TB 3V9PA 2VIIA 1LB1B 1XFAA 4HYYA 4Q00A 4MYCA 4Q02A 5F9HA 4W9MC 3VKWA 3SOPA 5J40A 3DPUA 3ECCA 2IWHA 4GP7A 2E87A 4QOSA 4X8MA 1CJMA 1NLFA 3IDQA 2WPDA 4OHVA 5KOYA 2A78A 1G7TA 1MV5A 4JJZA 2CCKA 3AF0A 5DN6A 1WB9A 3CRRA 4CEIA 4BFSA 2ZE8A 4D80A 1G20E 4DLWA 2GCPA 2W6JA 5FOXA 1ZMXA 3ZZ0A 1U8YA 4Z1MA 5L3QA 2IUTA 2ZJ8A 3P20A 3PENA 1ZU5A 2BBWA 2CJWB 4JL5A 4RVCA 1RRFA 4Q47A 1SXJA 1M2OB 2GZDA 5FR1A 1NVVQ 2YVUA 1ZC3A 3MLEA 1NIPA 5E95A 3SJAA 3QEOA 1ZJ6A 2Z4SA 2ZRAA 5JHHB 2MSCB 3AF3A 5EP4A 4FMDB 1VECA 4A2WA 4JBWA 1PVOA 2YKGA 3GJ5A 5LD2B 1T4GA 2IYTA 4LC1A 5CM9C 4C0BA 2QQEA 2PCJA 3K9NA 4BEBA 3GJXC 2F1JA 3CX8A 1OIWA 3LAWA 1QHXA 1W2HA 2V7QA 4JLKA 3WBJA 1ZBDA 3SN6A 2RMKA 1KAGA 2QMUA 4RJLA 1N6KA 2R44A 2CK3D 3NBFA 2WWGA 2IS2A 1XP8A 2WWIA 4Q66C 4I99A 1FP6A 2J59A 3FHCB 3NEYA 3RYTC 4HUTA 1SKYB 2ZE7A 3LNCA 4LX0A 5B2ZA 2BM1A 3AV0B 2XZLA 4TMWA 4ARZA 1XEXA 4MYUA 2JASA 1W36C 2ZANA 3LV8A 4OI0A 3UXMA 4B3CA 3THXB 3R8FA 2V6JA 2FV8A 3ZVNA 2JLWA 4IOKA 4Q9LA 5FI1B 1XPUA 1DO0A 2QZ4A 1G6OA 1YQTA 3RNLA 4CZ2A 3QPUA 1M6NA 4DDVA 4TLCA 2CDNA 1JI0A 4TMTA 2AX4A 3WMEA 2ODEA 2QI9C 4M21A 4PHTA 3AP3A 2EW1A 2ANBA 1M7HA 4JT2A 2NG1A 3LVRE 5KU1A 3RC3A 1UDXA 4AKIA 5KSPA 1HTWA 1G7SA 1ZNXA 4HZUA 1JBKA 1D2EA 3IHLA 3OEEA 3LLUA 3K53A 4M1TA 4A9AA 4C0LA 2GILA 3DEFA 4DDWA 5K8UA 2QA5A 3LX5A 5JWRA 2BHRA 2VA8A 2CBZA 4DUGA 3JZMA 1W0JA 1NN1A 3GLFA 5JJLA 2X77A 4JLNA 3EXAA 5G40A 1XPOA 3UMRA 1E1QD 5EXTA 4RFSA 2J5XA 4KCGA 3UK6A 1CR4A 1WA5A 1LV7A 4L4UA 5JWOA 2P65A 4XWAA 1UM8A 3EA0A 4HDQB 3GJ3A 3GLHE 1NNEA 4TZ6A 5AK0A 3NWJA 2IXFA 1ZM2A 3MWJA 1N6OA 2TMKA 3C16C 3WMGA 4DHEA 1ZM4A 4ZKEA 3QKRB 4Q7LA 3F8TA 3WP0A 4E09A 4JS0A 3AQ4A 1CR0A 3O8BA 4NYJQ 1E0JA 1XMIA 2MSEB 2XSZA 2CL6X 2D62A 4TT3D 1FOEB 1N0VC 4C3ZA 4DXAA 1X6VA 1UEIA 2ZE5A 4QBFA 1KI9A 4UNSA 4BPBA 1F3OA 3SI7A 2Z4RA 4RD0A 3EC1A 4HLUC 1E96A 2H8KA 4XSHA 2JLQA 3OFNA 5DLQC 1JNYA 2GJ9A 4LYFA 2XTZA 4TQ9A 2UZIR 3IIKA 3GLGA 3OIVA 5C4GB 5DSZA 1IN8A 1KI6A 2RGNA 1KI7A 1Z6YA 4JL8A 4YDHB 2V9PA 3F5FA 1T3SA 4DCNA 4Q4JB 1NN5A 1BOFA 4BFXA 3WRYC 4XSGA 3V4RA 4HAWA 5H68A 5M04A 3M0EA 3LBIA 4GFDA 1P5ZB 1N0UA 2B8TA 5AJWA 3A1TA 4A15A 2PJZA 1CLUA 3B9QA 1Z83A 1E2JA 1WP9A 4BLSA 1R10A 2O8EB 2WMNB 3BORA 2P67A 3CBQA 4LYAA 2JCSA 3E1SA 5HKKD 3CPHA 1A5TA 1WRBA 2IYXA 2W0MA 2AXPA 3UANA 2OBMA 1UF9A 2YWFA 4JJKA 3FE2A 2FNAA 4RD2A 1G291 1NJFA 1I4LD 1PUIA 5BN5A 4EJSB 2CJWA 3I1FA 1KY2A 3MUFA 4GMDA 1VCNA 1ETUA 1SXJE 3NTUA 2AHOA 1FP7A 4L5BA 1G3QA 4EQ6A 5FL7D 1VG1A 8OHMA 3KKQA 4LPKA 1TAGA 1UJ2A 2ZR7A 2GNOA 5CYPA 1LF5A 3HU2A 1A2BA 3NHAA 4NYIQ 1JPJA 2V54A 1JXOA 4LHWA 1E9FA 3K0EA 4GL2A 3AF2A 3TQFA 1E4YA 4ZI3A 4B75A 2OXRA 3VMFA 5CIWA 4LHVA 3H2YA 3MSXA 1EFUA 3K0AB 3QXCA 5L8VA 3B1XA 5CLQA 1U2RA 2OFWA 1IY1A 4CF7A 3FPAA 4IEEA 3L43A 2VSXA 3TUJC 1SVLA 3GP8A 1XJCA 4OQMA 4XTCS 3ZS8A 2X19A 1GRNA 4QNRA 4C0KA 1ODFA 2XZPA 3PXGA 4DCTA 3THXA 4QGAA 3WYAA 1RJ9B 1KK0A 1RZ3A 4A0FA 1F5NA 2GDJA 4U7DA 4AY2A 2BCJQ 2VTKA 2IYQA 3K70B 3AVQA 2Z0MA 2ZVPX 4XD7A 2QRNA 2GHIA 4PO8A 3FGNA 3PUZA 4LCBA 3I5YA 3U44B 5AUQA 1C4OA 1HE1C 1ZINA 1GWNA 1G17A 4IVQA 4KVAA 3SFVA 1IY0A 2GESA 2FSIA 4A4DA 3OIYA 3KKPA 4UKDA 2VBCA 3BOSA 3SYNA 5AUNB 4XWKA 2ZI5A 2PL3A 4P33A 2V55B 1R0WA 3DZDA 1EWQA 3NDBB 4TYPA 1LW7A 4JBXA 1ZCAA 2QG6A 3GLFE 2W6ID 4B74A 2VRWA 2O52A 4C0SA 5KO2A 2GEVA 1TEVA 1OH5A 1R8QA 1KAOA 2V3CC 2WJJA 3K0SA 2H18A 2IYUA 3L2OB 5FUVA 2YNMA 2X8AA 3VR2A 4M9ZA 1GNRA 3JVVA 2QPAA 1E2LA 1GVNB 3LA6A 4B2IA 4RD1A 4G3XA 1S9DA 1XMJA 4GOKA 4M8NE 2EQBA 3Q5DA 3KQHA 4A82A 3QKRA 5J47A 4TMVA 1R4AA 5FBRB 2WOOA 2ZJOA 1G4AE 4MKHA 2CL7X 3GLIA 3EC2A 3EWAA 4ZPXA 5A4JA 3RRMA 4YMVA 4KSBA 1SVSA 3BB4A 3DZ8A 1VCMA 4CVNA 3B78A 1M7GA 1KJYA 1HH4A 4YMUA 1BMFD 3K0CA 1G3IA 4TL9A 4A0RA 2ZS8A 4V0ME 3DMDA 721PA 4QL3A 1IN5A 1GZSA 2NMVA 2ZUCA 2Z5FA 2F1HA 5KNCA 2ZSDA 2ODBA 5JHGB 1W36B 1SULA 3X1WA 3GFTA 1L7VC 3C5HA 5FBLB 5KTYA 3TIFA 1YKSA 2ZR0A 4Q4JA 4Q1AA 4EPYA 4ZCIA 1M7BA 5CITA 5FOSA 3THYB 2CL0X 1G19A 1QBKC 1Z0DA 4FW9A 1CJKC 4LJ5A 4ESVA 1BKDR 1W47A 4KFUA 2GBLA 3SYLA 1S2MA 1N6LA 1AGPA 4HI0E 2P6RA 2ZAMA 4EPVA 3K09A 3N2IA 4TL8A 4A92A 2VHQA 4QNMA 1J70A 4KFRA 3SEAA 3OESA 3VKGA 3HU3A 4RCYA 2HCJB 2JLVA 4QGGA 2ZS7A 3P1JA 1GM5A 4MRVA 4NYMR 2P6NA 1BS1A 1AS2A 1GRRA 4HB3A 2R6DA 4TL6A 3RDPA 2VP5A 1OB5A 2EFCB 4D4KA 1E0AA 4NL4H 2HYIC 3REFA 3NBZC 1SHKA 4KU4A 1Q20A 1T91A 2GEDA 3I8SA 4NE2A 1NG9A 2RAPA 1KIMA 2OFOA 2YYZA 3IQWA 4URUR 4PANA 5TB5A 3O8DA 1E9RA 2CCJA 4D0NA 4EFNA 2CVHA 4URXR 3U61B 1CKEA 4IFEA 5JI3E 1W5TA 1VTKA 3AKDA 3PUVA 3UG6A 2R9VA 1QG2A 1Z07A 2B6HA 3BC1A 4JLPA 2WWFA 3OAAA 4KLZA 1OHHA 2RCNA 4R9UC 1QHGA 3OIWA 5AJXA 2OE2A 2REXB 4GI7A 4LJ9A 2QT1A 4LRWA 3K0AA 2A5JA 3M1IA 1AIPA 1XMVA 3SHWA 3ZIAA 3E2IA 1XRJA 1E2NA 1H8EA 4AG5A 1ZUNB 4XVRA 1TQ6A 1SKYE 2BBTA 4LBVA 1ZNWA 2YINC 3SBDA 3K9HA 3AF1A 5EXPA 3GPLA 1Z63A 5EZ6B 3VHLB 3CX6A 4QG7A 3A8TA 2CHVA 1II9A 2QT0A 1RYFA 1CJUC 2WWHA 1BIFA 1N6NA 3QXSA 521PA 1RJ9A 4JLAA 2OCYC 1G5PA 4CW7A 2OXCA 4BFUA 3MGCA 4TLBA 1U90A 3GLHB 1A7JA 2FMXA 2QP9X 1YU9A 4P3YA 5JCPA 3U44A 1E2IA 3CZPA 3EIHA 1IXRC 1YZNA 5B64A 3H4MA 1D8TA 5GJWC 2R6FA 4Q1BA 1RIFA 3SQXA 3BRWD 4MRPA 2FE4A 1N5JA 3IO5A 3UIEA 5C2JB 1SHZA 2MMGA 1JB1A 4I1OA 1CF4A 1XMSA 1TQ4A 2WJHA 1LY1A 4R2HA 5TXGA 4OKSA 1CU1A 1E2PA 2HUPA 3KFXA 4NKRA 1SQ5A 3EZ2A 2VF7A 3DM9B 2A5YB 2E1RA 2OAP1 4J0QA 1C9KA 2AR7A 3M4YA 5C46F 3A1UA 3QEJA 1W1WA 4MQBA 3CRVA 3S1AB 1CS4C 4TL7A 4LC0A 1UKZA 4QKQA 1NLZA 3KB2A 4G5GA 3EW9A 3KKOA 1HUQA 4NDZA 5AJYA 1DPFA 4GOJA 4IHQA 4JLJA 1S9HA 2OAQ1 1E2QA 2PLFA 1R0ZA 5E7MA 2HDNB 2OFXA 2GJSA 3F0TA 2FEMA 2IW3A 1XDBA 2WWWA 2B7BA 1IONA 2J87A 1G7RA 3IGFA 5D3QA 4JSYA 2V8OA 2WSSD 3H1TA 5JBQA 3B6EA 4JLOA 3TW8B 4M4SA 4KBFA 2BBSA 1KOFA 1R7RA 1JAHA 3CKLA 1TTTA 5EE0A 1SVKA 1DADA 2WICA 3FKSA 2OCBA 1YHNA 3IPXA 1I2MA 1ZAKA 3HR8A 4EPWA 3CZQA 1Z0FA 4F4IA 1U9IC 4WA7A 5SZJA 1AK2A 4ITRC 2ASEA 3TJZA 3DOFA 2QAGB 1G8PA 2AL7A 2HCBA 1ZIPA 1XZQA 2C5LA 1UBCA 3QKSB 4PC3A 4JLVA 4MYHA 1XXHB 4NU0A 4QHSA 1YR8A 3DKPA 4A0HA 3BE4A 3BWDD 4ZDWA 4FWIB 2IS6A 2QP3A 4AURA 2ZI3A 3I72A 1H8HD 2Z43A 4DLXA 1IY2A 4DLYA 2B21A 3AP1A 2IC5A 4B2PA 2ZSAA 3PIRA 3TRFA 4NCNA 1E0SA 4G0NA 1KI2A 4DIEA 1JJ7A 2C9YA 4Z51A 1UKEA 4BGDA 1NI3A 2VP6A 2BVNA 4PAQA 3TSWA 4Q5IA 3AKEA 1NP6A 3DHWC 2LWIA 1U8ZA 1GIAA 1K8RA 2ZRIA 4EAQA 5FUWA 3AUYA 4MRRA 4ASUD 3UATA 1DE0A 1XCMA 2C03A 5TVKA 1OLOA 2HLDD 3RRYA 4B3DA 4B6FA 4B76A 1J90A 3O8CA 2PX0A 1KJZA 1T8UA 3EIEA 2X1VA 1VYTA 5JJIA 4Z54A 1N6PA 3CNLA 4AD8A 4M9QA 3U3MA 1XNJA 1KI4A 2W58A 3AVOA 2ZRJA 3WMFA 3ZGXA 3OHMA 5FBWB 1ZCBA 1OW3B 1G8HA 1HQCA 5J4VA 4MDFA 2Q6TA 2FPLA 2XNDD 5EE3A 1JXMA 1XCGB 4IDHA 1WBBA 1CJVC 1P62B 3TNFA 3BJIC 1HV8A 1KSFX 4AK9A 2H5EA 2SHKA 1S96A 1P9NA 1N6IA 2IYZA 4TYQA 2OSBA 5DNYB 2FU5C 1LVGA 2DB3A 4C9BA 2ZRLA 3IQXA 3L82B 2J45A 2ZE6A 4B3XA 4XOIA 1XTKA 5DHAA 1G6HA 3IBYA 1P9WA 1BO6A 1O3YA 2F7SA 3RRZA 1X8KA 4CEHB 2J0QA 1F48A 2CK3A 5KNDA 5L3VA 3N70A 1HT1E 1RE0A 2GAAA 2NO6A 2QROA 3BXZA 1Z0JA 5BW8A 4RZ2A 4C2UA 1RRPA 2IF2A 2WWXA 1KDOA 1HYQA 4Q03A 1QHHB 1NVUQ 4PZLA 2ZQ5A 3GLHA 3NBXX 3Q85A 4QJ4A 2NO1A 1A2KC 2C78A 3W8NA 3EPKA 3RS7A 1G4UR 3MG9A 3LQRA 4DIDA 1PV4A 2FFBA 1F6BA 3N5CA 1TADA 1JAIA 1FL9A 3AKYA 2AN9A 2EYUA 3DMNA 3FMFA 1HY3A 4LYHA 3RSLA 2AK3A 2QTFA 4IW3B 5CK5A 4M53A 5HCIA 2RKOA 3QVVA 2FSGA 3PITA 1PZNA 1CTQA 2VSOA 3W6NA 1E98A 3QY0A 4LV5B 3I92A 4F92B 5J4KA 2EFDB 4KODA 2O0HA 4ZDJA 1TX4B 1Z47A 4FMCF 5KDOA 3LO5A 3GJ8A 5K8TA 2DCUA 1ZD8A 2J0VA 2RGXA 4W5JA 1KDRA 3OIUA 5KSZA 2O5VA 4Q4AB 2NZ8A 2FGKA 4PZYA 3R8CA 3S1AA 3VR4A 4PSAA 2Q9BA 4RKEA 1E1QA 5DYGA 1W44A 3W9YA 1E1RD 1WDTA 4WZBE 3FHTA 4NTZA 3SJCA 4LUCA 2F9LA 3CO5A 4ILEA 4KI0A 3ZDQA 3KQNA 3TSOA 1WF3A 4YMWA 2HJVA 2I4IA 4EPRA 1X1RA 3CB4A 3WYFA 5EQTA 4N0EA 4FMDF 4GDFA 1V5WA 4P31A 1VDZA 2WVJA 3D7MA 2QY9A 4BLOA 2ATXA 2I3BA 2JIZD 1XJQA 2XJ9A 4C2TA 1GTVA 4Q48A 2QEQA 4D4LA 3VQTA 5B57C 2J41A 3BH0A 4TT3A 4MGKR 3T15A 1UKYA 5IT5A 1HA3A 3TK1A 5G53C 2H92A 4GPTA 1RKBA 5H8WA 2WAYA 4P4TA 5GJBA 2HV8A 1E2KA 1XD2B 1QF9A 5LBIA 1N2CE 2KBEA 2OESA 4PXAA 1KNXA 1N6HA 2QAGA 4BZXA 3WNCA 4EPTA 1ESMA 2B7CA 3IPYA 4OBEA 2G1JA 1GG2A 3QKSA 1GOTA 1XXHA 1NMZA 2CE2X 3AEZA 4DLUA 4V0KA 1OT3A 1AQYA 2NZJA 3X1YA 3IIMA 3SQWA 4TYYA 4E22A 2FX3A 2ODNA 5FUXA 1RVDA 5CYOA 2R65A 5F3WB 4KFSA 4V0NA 5DYIA 1KO5A 1SVWA 2Q21A 5EXXA 5TV2A 4BZQA 3ZD6A 5KNBA 4L9SA 4Q9JA 2QGNA 3R9WA 2QMEA 5IK2D 3ZS9A 3SBEA 4YXWD 5CJPA 1JJVA 1GL6A 3VNUA 4JLDA 1FQKA 3W6PA 1VMAA 2H16A 1MT0A 3KJHA 4PTLA 1NLYA 4TMKA 5UKDA 5HKKA 4CEJB 5C4MA 5FOWA 1QG4A 2QTHA 5CDFA 3AVVA 3PR1A 2IWRA 5EUQB 1FTNA 3SNHA 4WIAA 4B6EA 3FKQA 5JSZB 4Q01A 1QHNA 1ZUHA 3HYTA 3PUYA 4Q1DA 5EP2A 4U00A 2JEOA 1B23P 3IIJA 3T1TA 4LJAA 2MMCA 1LNZA 5FR2A 4FCTA 4JVLA 2ZI9A 5FL7A 4CGZA 3BGWA 1DELA 3U6BA 4M1SA 2DPXA 2ZYTX 3PUXA 1W5SA 2FN4A 1ONBA 4Q4HB 1W48A 1E2MA 4QBGB 3U3JA 1XEFA 1FTSA 3ICEA 1Z06A 4G1UC 5HPYB 2WAXA 4OQLA 3GJ0A 3VNVA 2XX3A 1XBTA 4S35A 2IF0A 2QNRA 4OJQA 4CEHA 2QRZA 3SC3A 4PX9A 1RC8A 3QPWA 3TAUA 3T61A 1UBEA 4JKYA 5J5CA 3WRXC 2ANCA 2ERYA 3C7KA 3B9PA 4LPSA 5D3MB 1P9RA 3FMPB 3RVBA 3AVPA 2HF9A 3RABA 4D26A 4P0TA 4AI6A 2GCOA 3A1WA 4KSCA 1QHHA 4XTRA 3TSZA 5ANRB 4F93B 3TGPA 2BCGY 4I1SA 3E5HA 3RS3A 4D0LB 1EGAA 5FOUA 1Q0UA 2P3SA 2YHSA 1K5DA 4DEXA 4HB0A 4TLEA 3EASA 2KSQA 3CLVA 1NMXA 2RHMA 1AGRA 1WQ1R 4GMXA 3R7WA 3SHFA 1T5IA 3B7GA 1AKEA 2CEAA 4Q4LA 4CT5A 5LB2A 1W2GA 1OXUA 3UWKA 3T12A 1M1YE 2ZJBA 4KFTA 4MKFA 1M74A 2KB0A 2D06A 3FVQA 3TAHA 5JZVA 4V0MA 2ZVQX 1NKSA 5BYKA 1OV4A 4YQFA 2RGEA 3W34A 3NC1C 2D2EA 3O47A 4AYXA 2GZAA 4PZZA 1Z22A 3ASYA 4PR0A 3D8BA 1YR7A 2ZTSA 2CLDX 1YZUA 5AJVB 4Q4AA 2J9RA 1DAFA 2W6IA 1FFHA 3PUWA 3FWYA 4JSTA 5GVRA 1J99A 4G01B 1IN6A 1UBFA 3VU9B 5SZKB 2C96A 1G9XA 3MD0A 4ON9A 3QI2A 1T3HA 3ZJYA 4C4PA 4EIWA 1TPZA 4JVSB 1P6XA 4AWXA 4L16A 2ZRNA 3BERA 2YZ2A 1KK3A 4A8JC 4EDHA 2BMJA 3LQQA 1X8LA 2FSHA 5DI9A 4MGIR 1W4CA 3ZVRA 4PQRA 1R0XA 5E4FA 1N3BA 3ZZTA 2QM7A 1XF9A 1IHUA 4TQUS 4F7WA 5JCZA 2OZEA 4TMZA 4NYMQ 4OL0A 2ZRMA 1KO4A 5IHPA 5JEEA 1FZQA 1XD2A 1BMFA 5K8IA 2AXNA 5BN3A 2HF8A 1E9EA 1L4YA 2W2VA 3CWQA 1NSFA 1K6MA 4QC2A 3CPEA 4G5SA 1XXHE 1Z8FA 4NCIA 1HQYE 4PQFA 1CULC 1KSJA 1US8B 3CH5A 3VR6A 2WJIA 1NN0A 2WMOB 3KFVA 5JECA 3KX2A 4NH0A 1YZLA 3B1YA 5DI3B 5JRJA 3LW7A 2OLJA 3GCGA 2H1LA 4TZ0A 1TQ2A 4MGYR 4HB4A 3SS8A 2RGDA 2ZJZA 4Q19A 4PQYA 2ZRGA 3TMKA 5DISB 4DC9A 2XITA 1Z5ZA 3MWYW 4LI0A 1XD9A 2FFAA 4A6XA 1FMLA 1JALA 2JJ2A 4JL6A 1VHLA 2QQ0A 2GWHA 2CVFA 3A4MA 1J2JA 4R98A 1T5LA 1YZKA 3NBYC 4WW0A 3GJ6A 3H0KA 2HYDA 1S3GA 1G16A 1T6NA 2DYKA 4DWJA 4OI2A 4CEJA 2R2AA 5CDFE 2AD5A 3OE7D 1DAGA 5H70A 4TTPA 2WBLC 1D2NA 3CW2A 3D31A 4EUNA 2GXQA 5FBQB 5JEDA 1UKVY 4H9GA 2A3RA 5JSZA 3AVYA 1R0YA 2GZHA 3Q3JB 3KZ1E 3ZZUA 2NO0A 1FUKA 4UNPA 4FMBB 3U7GA 5H1YA 2XTMA 4MYTA 1S0UA 5JRZA 2ZJ2A 1L4UA 1JR3D 1P2VA 2CLCX 2DWPA 1X3SA 2CNWD 4OHWA 1EG7A 4M1YA 5FTKA 1R6BX 1AKYA 3BB1A 3KKMA 2GK7A 1ZP6A 4GZLA 4Q4HA 3IEUA 2HXYA 1Z08A 4A0GA 2G9NA 2FFHA 4LJ8A 2JDID 2V4ZA 4L9WA 3ZVMA 3W8RA 1I4DD 3HU1A 3THOA 4KHZA 4JVNA 4O2RA 4ACAA 4PHFA 5E3HA 1CJTC 3OF5A 1ZD9A 5D3MA 2PBRA 3MJRA 4C0HA 4IOJA 5KPDA 2N1BA 3EWSA 4KYIB 5CIQA 3ADDA 4PSKA 2P2LA 1J8YF 4HUQB 1FX0B 1U9IA 2HT6A 2W2XA 1AJEA 1KDPA 2A5FA 4Q9HA 4P32A 3UPUA 1XEWY 4F91B 4KBGA 2ZXUA 1XEWX 121PA 3K8YA 3QXXA 4MKGA 1I2DA 4X8HA 2O8CB 3BD9A 1FNMA 3FMIA 3GEHA 1FW6A 1JR3E 1EFRD 1A4RA 3TR5A 2J7KA 2L0XA 3KQLA 1XZPA 5CB6A 2VP4A 5L3SB 4KLNA 3PEVA 3Q8XB 4I81A 5KUTA 5F9FA 4GNKA 1ZYUA 2A5DA 2FA9A 4WXRA 3UMSA 1DG1G 2F43B 3ADKA 3QENA 3AVUA 3I62A 2IL1A 1MR3F 3P27A 3GJ7A 4PC6A 3LFUA 2YWGA 2ATVA 3CONA 4W5WA 1RFLA 4JVMA 2AFIE 1WCV1 1MH1A 1MABB 1CRPA 1G21E 1VYVA 2D7CA 4GBMA 4RCZA 1NKTA 4MKIA 3VU9A 2JATA 1YR6A 4GSYA 4IEIA 2CCGA 2FZLA 4U5XA 3TH5A 4Q9KA 4QGFA 2JJ1D 1YZQA 3A58B 2VP2A 2C9CA 1NN3A 4DLSA 3SU8A 3LXRA 5LDDC 4LJ6A 4B71A 2O8EA 4YMTA 1IQPA 4H1UA 4ZI2A 5C1BA 4O25A 1JQLB 1JPNA 1LF0A 5CJ2A 2PZGA 1UPTA 2JLUA 2FGJA 5KYKA 2GXSA 4DLRA 1HE8B 3VR5A 2ZRCA 2WSSA 1XB2A 4EJSA 3QQ5A 3FFBA 1KZ7B 3EARA 1EWRA 1Q1QA 2AKAB 3K9LA 3AUXA 3SFZA 3X1XA 3KUDA 2ZPTX 1GUAA 1UDWA 1RYHA 2BBOA 3ND8A 1AS0A 1US8A 3TBKA 4O0MA 1JEDA 4V02A 1ESNA 2GKSA 2QMOA 5DI3A 4AC9A 3ZVLA 3W3ZB 1RRGA 3KXLA 3LLMA 2MSDB 4MDEA 3VFDA 2RGNC 1N25A 3AB3A 1SZPA 4Z8XA 3NC0C 1G18A 3DO6A 1H8HA 2GF9A 1Z0AA 1TEXA 3Q7QA 2D3WA 2ZEJA 4US2R 5K8LA 1KSGA 3T1VA 1E2EA 2OILA 1P2TA 4Q7JB 3AF4A 3CNNA 6Q21A 3SZRA 1COWD 3SJZA 1EESA 4BLTA 2F55A 4Y0AA 2IHYA 4PC2A 4UNNA 1EXMA 4P4SB 3K0FB 1E2FA 2RGAA 3GFOA 4BFWA 4G5OA 2H7VA 1NF3A 2WKQA 3C14C 3JVUA 3NG1A 4ASUA 2HLDA 4HAYA 3LWNA 2VHTA 1E9DA 1K5GA 1OSNA 3EX7C 4Z8YA 3PEWA 1IN7A 4PHGA 2Q3HA 1QHYA 1VG8A 3C41J 3TE6A 3CR8A 2XNDA 4JYCA 4MITA 3BFXA 2ZREA 4A8JB 1GL7A 5HZKA 3VAAA 4DVGA 2QN6A 4F38A 4YC7A 3SE0A 1QHSA 1Q1BA 3TKLA 2AD1A 4GP6A 2EWVA 2FEOA 1OFIA 4HAXA 2ONKA 2CHGA 3E70C 4K81B 4C0QC 2IYSA 2QM8A 1M8PA 1FX0A 3QBVA 4P4UA 2D7DA 4LHYA 3RS2A 1W46A 5JFGA 1OH6A 1GL9B 3VKHA 2IEZA 4IRUB 1E2HA 3ZLJA 4NBSA 3B8HA 1SVOA 2JGNA 2O8CA 1HURA 3AH8A 2QSYA 2ZIAA 4LHXA 2OLKA 4DJTA 1ZM9A 4QJ3A 2ZI7A 3UKDA 3CRQA 4R2IA 2BDTA 2WJVA 4BRUA 4XVUA 1AQUA 1PJRA 2GVZC 3FMOB 2XGJA 2AWNA 2P0EA 5L3SA 2P5SA 2VF8A 3PEYA 2ZRDA 2XZOA 4A36A 2IYRA 2Z83A 4I1VA 1S1CA 4C7OB 1GFIA 4UXJA 4IXMA 4IDQA 4KV9A 3T34A 5BQ5A 2YOGA 4TSFD 3RWOA 1P7CA 2DFTA 2DWOA 3B13B 4F4JA 4M1KA 3OZXA 2BEKA 4TWZA 4TYNA 2HXSA 2ZRBA 5DE3A 3THYA 2GF0A 2GTPA 1Q57A 3CRW1 3L8ZA 4JKIA 4R7ZA 1SVMA 4LGMA 2GXUA 2RHDA 4CEIB 2QBYB 2QL6A 3GFPA 5HTKA 4UQOA 4DBLC 3CNOA 2ZAOA 1E1RA 1XWIA 2ZSEA 4NCHA 3VX3A 3U6KA 3ND9A 4PPGA 4BRWA 4OK3A 1GILA 2QPOA 3AKCA 3A1VA 4ACBA 3ICQB 2RH5A 1R2QA 1NL3A 1N5KA 1I4TD 1P75A 4FINA 5IF9A 1NSTA 4Q9IA 1U94A 1S3SA 3LX8A 4FXPA 4BLPA 1CP2A 1GDDA 3RS4A 1UADA 5BXQC 4QHYA 2JIZA 2F1RA 4E5UA 5G3ZA 1DAMA 1H8ED 1HT2E 4NCKA 1VG0B 1NBMD 2G6BA 5BYJA 4BFTA 1BYUA 5GJCA 2HJGA 2PX3A 1AA9A 3W6OA 3Q5EA 1KI1A 1UBGA 2ORWA 2QU8A 2DFNA 4DCVA 3THWB 3B1ZA 4DSNA 2XAUA 4JLMA 2JLZA 5FTJA 2I1VB 3KL4A 3V00A 2OHFA 1VKJA 4KXFB 3ZYCA 2JA1A 4CIDA 1R8SA 2QMHA 4UNQA 4OI1A 4X8LA 1EFHA 1UEJA 1VIYA 1QRAA 1JECA 4HZIA 4TN1A 4H1VA 1HEIA 5CLLA 1EX6A 4K8OA 4M22A 3RANA 2IK8A 2EFGA 3KTAB 1N6RA 2AWOA 2R6GA 3A4NA 1E3MA 1CEEA 3L0PA 4KVGA 3B1WA 1GNQA 4NPHA 1E69A 4EPXA 4ZKDA 2JLXA 1MO3A 4RKFA 3SYKA 5IK2A 2BIFA 3K09C 4HLUA 4YXWA 5J4YA 1NG1A 3K0FA 421PA 1W4BA 3X2SA 1XPRA 3CM0A 4HSEA 3T1OA 2QP4A 1CR1A 5FTLA 4DLZA 3KQUA 1L8QA 3NXSA 3RRNA 2GAOA 3AVTA 1FUUA 2IYLD 4HLCA 1NBME 2NPIA 2NO9A 1JEEA 1KI3A 2AK2A 4A2QA 4BUJA 2JLSA 2DFLA 1F2TB 1A82A 4PO1A 3UG7A 2YWEA 4KO8A 4TLAA 3GD7A 3LBNA 4V03A 2DFKB 2YOFA 1Z6TA 3NH6A 5FOVA 1NY6A 4YLGA 1YZGA 1MKYA 1KMHB 3EPJA 3KUCA 4A8JA 3KDSE 3DOEA 4JBYA 2ZRHA 1D9XA 2JAQA 3I32A 4QHTA 4AYWA 2BC9A 4DCUA 5GVSA 4FI3C 4ZDIA 4A2PA 4LWZA 4PAOA 4O3MA 3MCAA 3FB4A 1QVRA 3ZD7A 2BMEA 4TTQA 4UJ3A 1ZU4A 4KYUA 3CH4B 2G83A 3GQBA 3ASZA 5SZHB 1Z6AA 2XOKD 5AUPB 2IX3A 3EPHA 3BAFA 2KI5A 3B2EA 3BFVA 1ZVQA 1GITA 4DSUA 1E79D 2R6CA 2IXEA 4MRSA 2N42A 4LHZA 2VO1A 2ZJ5A 3QVUA 3TVDA 2IEYA 5ELXA 3FOZA 2R8RA 3PV0A 2YC4C 2VQSA 1W0KD 2QE7D 3IKJA 5DH9A 5JS7A 3IEVA 2CHQA 4B33A 3W90A 4YMSA 4AKHA 4PPFA 5KDDA 2UKDA 2NGRA 4B32A 1BYIA 3TLXA 2FH5B 2BJVA 3GLGB 3QKTA 2WJGA 2FG5A 3W5JA 3OEHD 1KI6B 4B3BA 4D4MA 1U99A 4WBSA 2FWRA 4C7OA 5TDHA 4RZUA 2J1LA 3I3SR 3NVAA 3KQKA 3R20A 1YE8A 2J7PD 4DKXA 2Q3FA 5FPSA 4BLQA 4FIDA 2PZEA 4DLTA 2XJ4A 1ZUIA 1U81A 4PAMA 3WNDA 1YRBA 4ZIRB 2RGCA 5EP3A 4BEJA 3U7HB 1TUEA 1OKKD 3QIAA 4FMCB 4KJZA 3CX7A 3DM5A 3ZQJA 1GKYA 1J7KA 4UXIA 4WVFA 4RY2A 4V0OA 3X1ZA 2QBYA 4RZXA 5CK4A 2XXAB 1OJLA 3CF0A 3U3RA 2BV3A 4LSGA 2LKCA 4L8GA 3MRSA 4EQ6B 4DRZA 1NVXQ 3PEUA 4EKDA 5AR1A 5CB8A 2VL7A 4G5RA 1Q44A 3CPJB 4I1UA 4LBWA 4XVQA 2PEYA 3K1JA 1OYYA 3PVSA 1ZIOA 3LDAA 4ZO4A 4OK6A 5J4HA 1VIAA 1DG3A 3QBTA 4BWYA 4Q7KA 2ECKA 1YR9A 5LPNA 3WXMA 2C98A 2K5UA 3L0SA 3FFAA 1E99A 2WM9B 3MJHA 1GSIA 3L0IB 4B73A 2EYQA 3P4YA 4ESHA 5L3RA 2QENA 5EE5B 2XTNA 3THWA 4URYR 3KXIA 2IS4A 4DB2A 4IOLA 4HAZA 5EZ5A 4II7A 4B3GA 1E9BA 3EZFA 2WWYA 1ZM7A 1AZTA 3M6AA 3QF7A 3U3KA 1AZSC 1E9CA 1KHTA 5HE8A 1OPXA 4HLQB 2UZ3A 2QGZA 2E9SA 2FPMA 4D2IA 2X2FA 3WBKA 3KTAA 2ONJA 4POAA 5AJZA 1IXZA 2XEXA 2GVDC 3KJEA 2J0UB 3L0OA 1E2GA 1PUJA 2ZYVX 3EAQA 3GEEA 1MRNA 1OE0A 3CWZA 1MO4A 3HPRA 2C99A 1VPLA 4Q1EA 4WXPA 5EXSA 4RZ3A 1D6JA 4DDTA 2F3TA 3QJYA 4IKEA 3I5XA 2Q3MA 3J81k 2FF7A 3FYHA 1G5TA 3AM1A 3AP2A 3KKNA 4N3NA 4UNRA 1E94E 5EE1A 2W00A 1IOZA 3DL0A 4FCVA 2EWWA 4FCWA
chains in the Genus database with same CATH superfamily
5JNWA 3M5CA 3OE7A 4ISBA 5C31A 3RUHA 5B1HA 4QEKA 5JPIA 4GECA 4JI2B 2AEJA 3KEMA 3OZ7A 1P80A 3X1DA 4CF4A 2DR0A 4NMXB 2ZU0C 4CDRA 2NYUA 4YT4A 4JZKA 2J33A 5A9SA 2QL5A 1AM4D 3OIFA 3EGXA 4W9NC 1WS6A 3F6PA 2QV0A 2MU1A 4QASA 4YPFA 2ZS9A 2JBWA 5CX1B 5FPHA 1PBTA 2YOHA 2VJMB 4S1VA 3FLBA 3TQTA 4EFLA 1GUBA 1DAEA 2C77A 1T2CA 2EJWA 3TQOA 2YRXA 5AHWA 2FMTA 2GI4A 4Q7MB 4NY1A 3NTRA 3QPVA 4UM8B 3K71B 3MYRA 1R4NA 3K5WA 4R2MA 2DR3A 2GHTA 4OH7A 2IPNA 1T6XA 4LDJA 4PFSA 1LD3A 5EE9A 4LZPA 3UMMA 2C2OA 3DOJA 1DBSA 4RTSA 2PU7A 3BXOA 1C9MA 2V03A 5DTEA 1ZIXA 2B94A 2JZNA 1L7DA 1ODLA 2AFIA 3IP5A 3NKLA 3I12A 3IOBA 1CFJA 4HAUA 4COOA 3WKCA 4AYTA 3GLIB 2HAEA 821PA 2D4AA 3DCNA 3LUFA 3AZOA 4Q9AA 4LISA 1Q0TA 1J1IA 3VO8A 2M1XA 4DLPA 1LTQA 3B6MA 3SZGA 4BYMA 4RD4A 3RI3A 1LVUA 1UFRA 2MWMA 2NTEA 2ACVA 2G1AA 4W5TA 4RSGA 3LVQE 3R9XA 1V35A 2BEVB 3SEQA 3EW7A 2J0SA 4RM3A 4ETIA 3JQ8A 1KXJA 5AVWA 1KARA 2G0NA 4WMLA 4F3KA 1G0OA 5AW5A 5A9TA 2I2WA 4CMEC 1PP4A 2JRLA 4ZOBA 1N0HA 3GX1A 1SURA 4RFLA 1TCVA 1XTIA 1EK0A 2I67A 1XZMA 1UXOA 4B35A 3AL0C 1FY2A 1TD9A 1OI2A 2BFFB 3I73A 3MAJA 1ECBA 4DJDC 1DC7A 1Q1AA 1FDUA 1EFRA 4DSZA 3P9XA 4RD3A 1X86B 1YZFA 3H8VA 4XQCA 1XTPA 3DLHA 5LZ2A 2KE5A 2D1TA 3N1UA 1XZ8A 4EEXA 3NVDA 1WVIA 1XMXA 1U2EA 2C9MA 4JT9A 1OH8A 1NDQA 5AW6A 3D7KA 4CKBA 4HMOA 2FJUA 4B6OA 4G37A 2XMCA 1ZRHA 4KRXA 2BL4A 3C6MA 3NANA 2G82A 4JJ4A 4QQKA 4DCGA 4YJ2A 1YVPA 1MEEA 2H1HA 1G8YA 4U8HA 5AI9A 3SG0A 3UFXB 4K6OA 4M1OA 3A27A 2WA1A 4YRLA 4NFSA 3HLYA 4L02A 5G1PA 1T3LA 4CM6A 2VQFB 3L0ZA 4FDTA 3ASVA 5HZHA 3D9QX 3PGLA 3CB2A 1SH7A 2FZ4A 3CRNA 3GRUA 4DHWA 3S2SA 3T38A 2ZSFA 4J1TA 3T7CA 3BE8A 4LYJA 1XROA 4GLJA 3QEMB 1BWSA 4R2WA 1U7TA 4BE4A 3F71A 3ADBA 3KEOA 4QJIA 5LIPA 3HYSA 2XVMA 3N6XA 1U65A 4OQXA 1VI2A 1BKYA 3HDTA 2DQYA 4UE2A 1WBDA 3DE6X 2P5TB 2CNLA 2ZRQA 3C5WP 4OYHA 3HCDA 3L6OO 2YBEA 1VRCA 1UP6A 1XZIA 2FK8A 2GA9A 4MW9A 4PCUA 2F48A 5E4JA 3OETA 4AF8A 5ARBA 5JI2E 3O9ZA 1XK6A 3BWBA 3QNUA 2VHXA 3AM4A 4E07A 1PGNA 5IUNC 3HA7A 1YBFA 4JHXA 4DUGD 4HVCA 5AM2A 1FC0A 1OLUB 3FDIA 3C15C 4LQ4A 2O0KA 3GVIA 1BE6A 4P3PA 3U37A 4BQSA 4CN8A 2I6QA 1YFKA 1KP2A 1UM9B 1RC1A 2RHLA 4GPD1 2Y1EA 1V1RA 3UBTA 4BVLA 3ABQB 5IVDA 1NRJB 2DHCA 2FFQA 1IQUA 5SYNA 4F4CA 3NCTA 3WHLA 1XSEA 2ZPUA 4WH0A 3EXIB 4C4ZA 2JGRA 1Y80A 3CJRA 1G5RA 1NOKA 1ELOA 4KXXA 4LF7B 4C04A 3JQAA 3UPTA 5DNUA 1KJJA 3QKUA 1LW6E 1XA4A 2G7MC 1WMSA 4MUGA 1N9ZA 1VJRA 1VHTA 1XTVA 3LFTA 4LRYA 3LTEA 4KK3A 5P8WA 4ESEA 1KRXA 4LY6A 1BS9A 1Y3BE 2HSZA 2AZTA 1KZ9A 3QU9A 5DFAA 5SYAA 2VBGA 3FGZA 3G9QA 1NRXA 5ALWA 4CQNA 1CNFA 1MO6A 4HX9A 3VKUA 4Z4CA 1FFDA 5FI0B 3D3QA 3G88A 3MLAA 1ORHA 2F8LA 2HNKA 5A6SA 2CVZA 2W37A 4GLBA 2G6TA 5HFAA 4ZYLA 4K3VA 1YB7A 4MKRA 5JXWA 2WK1A 1QP0A 4CIYA 5DBHX 2EIXA 3MRXA 4ZEMA 3Q9UA 2JJ8A 3EIWA 2WI8A 1RLOA 1ZY2A 1FNNA 3GJYA 2QU7A 4LWQA 4F1WA 3WRWA 4CM7A 1P4SA 5FXMA 1I7NA 1YV9A 4G97A 1JAYA 5ITZB 5JNTA 4TKLA 1NXXA 1BAPA 3OTQA 3H1FA 3KQQA 5CX1A 4BL5A 4HNVA 4Q3NA 1EVKA 2IYVA 3C0KA 3FROA 3M3HA 5F76A 2DBRA 5HIKA 3QJ5A 4U8GA 3UXYA 2DECA 1PNOA 1NULA 3CCBA 1X7GA 3USCS 2KPOA 2NYAA 1NM5A 5JMOA 1P60A 4MA4A 1YDMA 2Y1GA 2R4QA 4BGVA 2WUGA 3MNFA 3FNGA 4EARA 2E7ZA 1R16A 3TR0A 2Z98A 1U3CA 1PGOA 1R6UA 5CPBA 3MWKA 2QRHA 5JWHA 4HGZA 5CG1A 2YUIA 3OFKA 1YFZA 4BVHA 3H2ZA 3S1LA 4I5GA 4M1MA 4CL3A 1K7FB 2D59A 1QVZA 1SIBE 3L0CA 4LE0A 5BQ3A 3RWMB 1LLFA 1N2JA 2C8VA 1S1MA 5IAAA 3EZ7A 1XNRB 3MXOA 3C2QA 2E37A 2TMYA 2O2IA 3W5AA 1E4VA 4LVCA 2FZKA 2BEVA 4RHCA 1QH8B 1Q7GA 1Y7HA 3D2BA 5NLLA 4X91A 3PQEA 3WIEA 1NPYA 1S8OA 1TKRA 2OHXA 3C43A 3IJPA 2XNKA 4I55F 3JASB 3N76A 3NV7A 2GOYA 4LK3A 4YLEA 4AMUA 1IUOA 2C5GA 2JARA 4W5HA 5IX8A 3ETEA 3GPDG 1MC8A 4F45A 3CN9A 2BFFA 1L5FA 4HDKB 3U7JA 3NH9A 2P4EA 2RD2A 4TVKA 2XD9A 2XF2A 5BP7A 1IJFA 2RSLA 3GVHA 4TPKA 4HNTA 4TYWA 4RLFA 2VEDA 2QUKA 3CTPA 5L6LB 2BFCB 3IH5A 5E2AA 3ZC3A 1KO8A 1UWVA 2NAFA 3GV0A 5TARA 1OXVA 1P1JA 1BH2A 1MT3A 4ZQCB 2G70A 1K4MA 3EZ6A 2ZJ1A 3BMXA 3RAPR 4EKNB 3ROTA 3FVRA 4WADA 5ALOA 4EA8A 2OFFA 1AY0A 1OFUX 3QBJA 3ZWCA 2B2NA 1GU7A 2YC2C 1JG2A 2VP0A 1TYDE 5HDQA 4TSFA 5KPJA 3DEIA 1VCIA 2O8VA 2XKJE 3BS4A 3P9KA 4C4RA 4PLFA 1P1FA 1V7ZA 1YH3A 1O87A 3V4SA 2DEUA 1Q83A 1QYXA 5AKGA 4C30A 2NV2B 3G1TA 3U4DA 3VR1A 2EF0A 2YRWA 5HR5A 1LDBA 2HBZA 4QE3A 3IILA 4XD7D 2CSUA 4DLAA 2Y9PB 4U2GA 3MT9A 4ZVLA 2O8FB 1W93A 4EUEA 4BECA 5A02A 1XFDA 4DWOA 2A9QA 1BA2A 3NYRA 3OO1A 1TMKA 4B17A 1NNI1 2QPTA 3HP1A 3P2YA 4X44A 9ATCA 3SQOA 1CZLA 1GGKA 1Q19A 1V7CA 3A1SA 3FM9A 4US1R 3PQ7A 3VC1A 1LX6A 1Q3HA 4F1KA 1CB7A 3AB8A 1UPFA 2OECA 1HF3A 1GYRA 4MQLA 2UVPB 4Z0HO 2XVYA 2IU3A 3FOCA 1KY3A 3GY0A 2VJOA 2VC2B 3FPKA 1OY1A 1XTJA 3O21A 9GPBA 1JLLA 3TZEA 1X9HA 1OLUA 1VB5A 4L0QA 1EP9A 3Q88A 3U5ZB 1GN8A 1TLFA 5ALJA 4DTIA 1VJ1A 1JHYA 4QFMA 3LM8A 4ML3A 4GT1A 4Y1RB 4IZHA 4B4VA 4MVJP 1XU9A 1UDRA 4NU8X 4YCAA 3W2HA 3W5HA 4QU5A 1LRLA 3T7EA 3KQPA 1FRFS 4JC0A 1VL6A 2ZYUX 3LE8A 2YNMD 3GFVA 4XIGS 3R7NA 3VR2D 4YACA 4QGHA 1G1AA 4JB2A 3G2OA 1E59A 2C3YA 5L3ZA 1VLQA 1KK2A 2OO5C 3V46A 1K3TA 2C4TA 2G9QA 3UK1A 1L7EA 1SVIA 4UU7A 3LG2A 4GRAA 4LI3X 2A2ZA 3KM0A 4QOHA 4TLLB 1I5EA 5LD2C 5DO9A 2QYSA 3H2HA 3HY6A 1R9GA 1II8B 3W4KA 4YS6A 3DDHA 1XMPA 3UJ3X 1IQ0A 1NJ1A 1X80B 1EIZA 4QVIA 2ZJAA 1BWPA 2AFHE 3DZGA 3A37A 2NO4A 3F8WA 1UZNA 3KL2A 4IFBA 2VNAA 1EAYA 2HIAA 2XWJI 2P2DA 3DOUA 2EZTA 3K9WA 4BE7B 1Q22A 3V8VA 4CKXA 2VHUA 2W6MA 2QNBA 1HE4A 2GN8A 2WJ4A 1JAZA 4YRFA 3NTOA 2YUTA 3NIFB 2X7JA 5F78A 3RSGA 1AN0A 1YDGA 4TTSA 1N8NA 2EG5A 1X70A 3OIDA 4XPZA 3VGPA 1YFJA 3TUZC 1PEDA 1T1JA 3PFIA 1XLWA 4RKYA 2YZGA 4X9XA 5ITZA 1LPOA 1NKVA 2Q5LA 4KRYA 4AIIA 4B44A 3LHKA 4DUPA 4D9HA 4XGKA 3ZE8A 1X8JA 2PR2A 4IJVA 2J46A 1EAMA 4D6PA 2VQDA 2G40A 1GY8A 3C45A 3DC2A 4EJ0A 1GAJA 3NPAA 3PHHA 4NU5A 3RS9A 1YUNA 5B36A 5C7LO 1XNQB 2WT4A 3BB3A 1E7QA 1E6CA 4MPDA 5ALGA 3VPDA 3RQIA 1S8FA 2PZFA 4WK4B 4IWNA 2KQUA 3FLMA 4QBHA 5CT4A 5ISMA 3KU4A 3JD0A 1FSZA 1EUDB 3K72B 3TOCA 2FG6C 4ZZ3A 1KJ8A 4KDFA 3TB6A 3KTDA 5JZBA 1UODA 4BKUA 1MO5A 1MABA 1FNBA 3BIJA 4IDNA 4JYBA 4LY0A 4KUGA 4RF4A 1USGA 4ZARA 4YRPA 1GPH1 3BAZA 3BH6A 3S44A 3SQDA 4KITB 5IN4A 1DAIA 3CG4A 3HUFA 2ZT6A 4HAVA 2CNDA 5G0WA 4G6ZA 2PGXA 4QATA 1E79A 3B1JA 2DFVA 4IM7A 5LJLA 3ZPXA 1QH8A 3IMGA 3CG0A 5L3QB 5J2TF 5B58C 3OZEA 3QRWA 1BXKA 4U6SA 4IIUA 2FEPA 3JASA 1PUXA 3CR7A 1UDAA 1J22A 1MJFA 5F5LA 3FAKA 2ZRPA 1SXJB 4PZPA 1XYGA 2H52A 4MICA 2DCMA 2B30A 3EEYA 1W0KA 2QE7A 4HDKA 4EELA 3CF6R 1IIBA 3TTXA 3PNVA 5JADA 3QG5A 3H84A 3ER9A 1CUEA 4L5JA 2C57A 4GEKA 2BFCA 1U02A 4RGYA 3PPYA 3JD2A 1QHIA 3NDJA 3B5JA 4BNXA 3RIHA 1EFCA 4D4HA 2FDCA 1VE5A 3VDMA 2FOLA 1ZD1A 1G3UA 3IIEA 1EH5A 3I01A 4PLVA 4FN4A 1PL7A 5BWBA 2JB9A 3KB1A 2NXNA 2IKSA 2V7WA 3FNQA 4PVDA 4E94A 1EUCA 2IXBA 2QGFA 3FCEA 3LWDA 2WZQA 4GMHA 3T06B 1JTEA 4DRYA 3RIGA 4QG3A 4C7XA 3IBSA 4D0GA 4YMLA 2IXGA 1IPHA 5IAGA 4P7BA 2G5PA 5BUSA 3HMQA 3PL5A 3JCZA 4YAWA 5I9IA 5K0LA 1OKKA 1AB6A 1MD9A 1VQ1A 4NONA 1N4AA 1ZR2A 3OIGA 5AKLA 3OQNA 2HJ9A 2IS1A 2AYXA 2J3QA 3ORSA 3NEJA 1FVFA 1D5CA 3D7LA 3LJKA 1XEXB 1OBHA 4M0LA 3UH1A 5LLSA 3UEOA 3NKVA 3WL4A 3ZD9A 1JJFA 2VHWA 1WR8A 1E3WB 2Q9AA 2SKCA 2L17A 2POCA 4E5NA 3MELA 4MJLA 3I8XA 4NMHA 5U4QA 1ZR4A 1J2UA 1MZPA 1CIPA 2O8FA 1A97A 1J20A 3L8YA 1HYBA 2J6IA 2XYRA 3DYBA 2HQOA 2H2AA 4X0EA 2WHXA 1Q1GA 2P90A 5JDCA 1O5IA 1T2EA 2FRVA 3L93A 3MQFA 2Q0HA 3C8DA 1VDMA 4ZYWA 5C1DA 1LWOA 2DHRA 3NYQA 3CIOA 2WTUA 1GV1A 5EEGA 2XRZA 1FMCA 3IA2A 2H1CA 4XXHA 2UVPA 1F20A 3BD8A 4H7IA 4JLWA 4R2LA 3VOTA 4YJKA 3TEJA 2H57A 1SU7A 3IE0A 3GI1A 4N54A 3A2KA 2BEJA 1P8AA 1OGIA 2B8JA 2OORC 2P27A 3OPYI 2IYOA 2ZPAA 2OG1A 2IVZA 3EULA 1EDEA 2YWHA 2JK0A 3NDRA 5FPTA 2DWCA 3RVJA 3RIEA 2K7ZA 4Y1RA 4BO4A 3HK2A 3GXOA 4YCDA 1DKNA 5E1MA 3C70A 3LY5A 3ZCSA 1KI8A 1UOOA 1UBLS 1YKGA 2R62A 3I23A 4FJ0A 1TIBA 4HDNB 2H85A 4M0DA 4NG4A 3PR3A 1NBIA 1HDGO 1RWMA 2XCLA 4I4LA 1M72A 1WB5A 3ESZA 3P97A 5KSWB 2HCFA 1MVNA 4GOXA 4MUIA 3DE1X 3TRJA 1RHUA 2C94A 3IS3A 1HR0B 2C95A 5EKXA 3A6KA 1W49A 2IT1A 1OWOA 4MMZB 4W5NA 5E1BA 1NZJA 4LBYA 1EZ4A 2UYCA 3ZX4A 4TGLA 1II8A 2GCIA 2Q1WA 3WGOA 3U5TA 2FZVA 4GG1A 4F21A 3TJRA 3U60B 2WKRA 4NHOA 4BMNA 1TW3A 4AKGA 4URWR 2P2SA 1T1GA 1T2FA 4BAZA 4OB8A 3ENNA 4FFDA 1E9AA 4R7TA 5ALIA 2ZETA 3DOCA 4II3A 4CMKA 1YI8A 2NO7A 4KAXA 2DVMA 2W2OA 3IHWA 5IZCC 3FPFA 4KNYA 3FYDA 1G8GA 2A30A 5BWNA 4CG2A 2V8BA 3WWDA 3PIIA 1U0RA 4EA7A 1HNZB 2GRJA 3WOVA 4DDHA 2BPOA 3SJ7A 1P5JA 5GQSA 3FUTA 1TMGE 3R5JA 3SR0A 1L8OA 4U1RA 2V59A 3GN1A 3DR5A 4IO0A 1LRJA 2YV5A 5K3AA 1GU0A 2HJWA 3CLRD 4P81A 1NFRA 2WV9A 4IRXA 2I3DA 5GP1A 1Z2CA 1EK5A 2MCFA 1V8BA 3KYDA 3P9PA 3MGKA 1RXCA 4KUEA 2E21A 1JSZA 3K8QA 7AT1A 1JG3A 1K2WA 2ETVA 3FPBA 1RYMA 3H4VA 4M9SA 2ZUDA 3K2IA 3U4HA 2JLZA 3TTSA 4URZR 1ORVA 2EFHB 2LV8A 2GLTA 2VAMA 5J5AA 3RR2A 4DEYA 2R8EA 3L79A 4WOPA 1EUDA 2VIIA 4AJKA 4QUAA 4IYJA 2CLFB 3WOHA 2QLJA 4W9MC 4NC9A 1YCHA 2JHGA 2C83A 2OHHA 4EVRA 2AA3A 3WFZA 4KMSA 4QOSA 1ZN2A 5JXIA 4ZGWA 3K05A 2J3LA 5LMCA 4KW7A 1NLFA 3IDQA 3VV3A 4L8VA 4JJZA 5BSVA 3AF0A 3GO4A 2JHFA 4EKEA 4EJFA 1UC4B 1ZMXA 3V4ZA 4E12A 5L3QA 3FUWA 2ATIA 1UPAA 2CYCA 4ITVA 4TV9B 3S99A 5IYZA 1UWCA 4UAVA 3KVYA 1Y5LA 4Q47A 2ST1A 3GJTA 1SXJA 2C00A 4FOOA 4RLQA 5JIBA 3F73A 3QLJA 1NIPA 2ZULA 3QEOA 1KFBB 3L06A 4V3BA 4DG5A 5EP4A 5JUWA 4KN6A 1D4AA 3ZYZA 4FPXA 1T36B 2PH5A 4CI0B 2J67A 2I2CA 1TZCA 1AURA 3I6IA 4LC1A 4AWAA 2GAIA 5BT8A 3PTZA 4TXLA 4S3MA 5JAOA 3V2IA 5K01A 1OIWA 2WYHA 3EVTA 1EJ2A 3IFSA 2Q1XA 4G5FA 1RLUA 1KE1A 5GZ3A 5KYUB 4O2AA 3PQ2A 1FUYB 2RMKA 1KAGA 5EEHA 3SN6A 1EK6A 5DGHA 1N6KA 4UHDA 3ICCA 2CK3D 3NBFA 1JI3A 1NUSA 4M99A 4K6FA 4RHEA 7ADHA 2IS2A 4E4YA 3F98A 4OKIA 1KERA 1AH2A 1SKYB 3LNCA 1CD5A 3TG8A 4KE6A 2EZ8A 4FOLA 1CZOA 5L4SA 4I9GA 1IB0A 2XZLA 1XEXA 3TDMA 1AA6A 3PC8C 4AJIA 4NCAA 3MERA 4MYUA 1VE9A 3TECE 4GM0A 1JLRA 1OVMA 4IL5A 3CKMA 3HI4A 3QE4A 3MTIA 3SICE 3THXB 3D8HA 2PAAA 2VUSA 2O3TA 3OCJA 4Q9LA 5C0OE 4R3WA 5ALUA 2QZ4A 1PZGA 1G6OA 2JA2A 1JHAA 1Q0LA 3I9LA 3D3NA 3JRNA 1M6NA 3TTTA 5DHQA 4DDVA 1EJ6A 3KQOA 3OT5A 5EIEA 1P17A 4J16C 2CDNA 1JI0A 4TMTA 4BQPA 3WMEA 4M21A 4PNHA 5ICFA 2EW1A 2ANBA 2JVIA 2Q6LA 4YMGA 4KQXA 3IKTA 2NG1A 3LVRE 1RZUA 4TWBA 5J5VA 4F5WA 3QUAA 3FN4A 1L5YA 1G7SA 4B1FA 3OLVA 3PFBA 2HL6A 1NXWA 1JBKA 1D2EA 1EP3B 1SC6A 3IHLA 1HRKA 4RY9A 4FFWA 1I51A 5K8UA 4MVJH 2OD2A 4OHUA 2HMYB 1EG2A 2BHRA 2X5JO 3A05A 3QU5A 2CBZA 4I4TB 4ZYUA 4CKZA 4HDNA 2NLOA 3UYKA 4YRKA 1C29B 1A7AA 2X77A 1XPOA 1ZDMA 2FW8A 3EXAA 4DR6B 3D02A 3UMRA 4MKXA 4PYOA 5EXTA 1KXZA 1PGPA 1IXKA 2J5XA 2CXRA 1T1SA 3JSAA 4KQHA 1H5NA 3UK6A 2BE9A 1WA5A 1LV7A 3QYAA 3KKKA 1VCHA 3QZUA 3R09A 2JLAA 2AV6A 4K9KA 4P34A 4XWAA 2DXIA 1BEUB 4TZ6A 2GSWA 2FN9A 3GHHA 1XTZA 4MPPA 2IIPA 4EY6A 2LDBA 1EBUA 3C16C 4KWCA 3WMGA 3DPIA 4KYVA 2ZAYA 1SBIA 3AT1A 3QKRB 4MVXA 4JS0A 3WP0A 2ASVA 1DSSG 5C1OA 3G02A 3WGTA 1CR0A 1I2AA 3ILSA 1JFVA 2HRRA 2YJ6A 3IUBA 3ORHA 1OBFO 3PT9A 4MQ6A 4UBOA 3SSMA 1X0XA 2QXUA 3G2KA 2CL6X 1AKUA 4JNCA 3BJMA 3R3XA 4ZQFA 1FOEB 3HB1A 3RFXA 5LQSA 2EZ4A 3F96A 1I14A 1VI6A 2W5UA 1Z18A 1CZKA 4QBFA 5H59A 4BNIA 4F8YA 2DUNA 3D4LA 3R0XA 1Y6QA 4YQYA 4XEHA 1DDIA 1XK7A 4XUGB 1Q0QA 4OLAA 5B6PA 2GZ1A 4HLUC 2PSSA 1R1DA 2H8KA 2Y6VA 1DKPA 2JLQA 2IUYA 4I66A 4P5DA 4ROTA 5DLQC 2ACEA 4JN6B 2GJ9A 3KJZA 4LYFA 2WTAA 2XTZA 2CVQA 3K31A 4TQ9A 1MB4A 4R2XA 2XB9A 2DM6A 3PYLA 2UZIR 3IIKA 2ZIWB 3RVLA 3ESXA 5C4GB 3SHQA 1X9IA 2JFVA 1DLJA 2BSAA 3OC0A 2HADA 3AFHA 4YCBA 3F5FA 1QYDA 4ECAA 2CFCA 4DCNA 2VYVA 4IJUA 1HEUA 4NE7A 4OGLA 5EIXA 1PS0A 1QE0A 2R96A 3GRPA 4BFXA 3WRYC 1YBHA 1ADYA 3WA6A 4HAWA 2MOKA 5BYBA 1AV6A 3BUSA 1NVEA 3SS7X 5KKAA 1SQFA 1X92A 4LY3A 1W0CA 3QPAA 4JJGA 5E2BA 4CM1A 1E2JA 3VNSA 1TYCA 2QL9A 2WMNB 3BORA 4LZAA 4WK2B 4KWHA 5J9FA 4EKGA 4KQ1A 3ZY4A 5K1ZA 2NXJA 4UPDA 1Y1KE 1R37A 4NR0A 5C5IA 2R7KA 3CPHA 3LXMA 3LY9A 2FFRA 2W0MA 5EUBA 3UANA 2O7QA 4D43A 4XEUA 3A1NA 3IAS1 1UF9A 2YWFA 3PNBA 1H2AS 4G1FA 4BNUA 4XUCA 3RIYA 4RD2A 3LF2A 1SQ0A 3U39A 1BQ4A 1NJFA 4OA5A 4TV9A 3FR7A 1ETUA 3OTWA 3NTUA 4B8YA 3D8NA 1X7ZB 3FTNA 4ARUA 5DU2A 2O7NA 5AW3A 1UJ2A 2ZR7A 2VKTA 4QXMA 2GNOA 2GGSA 4B6GA 5COQA 4RY8A 2P4HX 1PKEA 3GFGA 2MSKA 3RC9A 1JXOA 2KW5A 3DO8A 4CKEB 3LHFA 4LHWA 1E9FA 3K0EA 4C1NA 2GR9A 1CVRA 1E4YA 2VJAA 3ABIA 5KYUA 3NV9A 1ZD5A 4D4LA 1XZLA 1WPRA 3QXCA 1VZ3A 5AI0A 3D4PA 4CM9D 1HNNA 3QEBZ 5KTOA 3H11A 1SUFA 2OFWA 2AI1A 5K0EA 2BR5A 2X9LA 4IEEA 1YD7A 3QNMA 3CO0S 1SVLA 1XJCA 4AZ3A 4DY4A 1QKIA 1GPLA 4NJOA 4QNRA 2WT8A 1Y9EA 3ZOZA 4AJ2A 5BWCA 2JNWA 1ODFA 3EHDA 4DCTA 3DXYA 4I0WB 4JC5A 5L51A 3THXA 3BXXA 1YMVA 2EARA 2R8XA 3EY9A 4NLLA 3WYAA 4A0FA 3C3KA 2EDCA 2RJOA 3ROXA 2VTKA 2IYQA 4BRSA 3K70B 1SOMA 1EE9A 2AS0A 3G8CA 2C4UA 3CZ9A 4RVOA 3C97A 3ISTA 4EA6A 4L5AA 2QZ9A 1GR1A 4LCBA 1PT9A 3I2GA 3I5YA 1N2GA 1I3KA 1SBQA 3U44B 2FPRA 4ZU1X 1C4OA 1C3VA 1P2FA 1A5BB 4JUFA 3HEBA 5CLFA 1JFFB 3L8MA 1ISIA 1CQWA 1R0KA 3VJKA 1B3BA 4IVQA 4B8ZA 5BNTA 4N5NA 2GESA 1YJBA 3IAEA 4EYSA 3BOSA 3SYNA 4Z9AA 3WGVA 4XWKA 1JDNA 1EWKA 2GJ4A 2VPZA 2OCXA 5LOVB 4I4TA 2WRZA 2QD2A 4IG9A 2F4VB 3NDBB 1CF9A 2WLTA 1LW7A 3GLFE 3SX4A 2X7XA 4URFA 3L6UA 1OH5A 3OP4A 4QPDA 3U49A 2WFMA 5EIOA 4MS4B 5HF8A 4EYEA 3TL6A 1DEOA 3OVMA 4M9ZA 4F4FA 4OFBA 2QPAA 1PR0A 1GVNB 2I03A 3W5UA 2POQX 2G8LA 2ZSUA 2YV2A 3E0XA 4RZHA 3SKVA 1NW4A 3D6NB 3EC7A 3O82A 4GOKA 3CLUC 4H4CA 3WYEA 1NT2A 1PS8A 2DOKA 2GTIA 3MCTA 3QKRA 5J47A 1P4AA 3AXSA 4ND2A 3TI9A 2WOOA 1RZRA 2FQ1A 3OLCX 3DAGA 3BHNA 3M1LA 3SKYA 4BO9A 3FZQA 1JDUA 1AMOA 3OHSX 2OENG 5CT9A 4HQ0A 3EWNA 4YMVA 3ZDYB 3PUKA 1CY8A 1SVSA 2PBFA 3BB4A 4CVNA 3B78A 4E70A 3M2TA 4HT3B 2GS9A 4MW2A 2VQ3A 1L7RA 5DK6A 3I6YA 3K0CA 2X8LA 4TL9A 4F56A 4H7JA 4QNNA 4NZOA 4CWAA 1M8GA 4JXKA 1G20B 1YJ8A 3DMDA 5ES4B 3EEFA 3VH2A 3SKXA 3N2LA 1GZSA 5C37A 5CD9A 5DSXA 3SSAA 2F1HA 3V33A 4DGSA 2QL7A 2FLVA 1W36B 3X1WA 2OK8A 2P1RA 3C5HA 3P94A 4RORA 4Y3UA 1YKSA 4Q1AA 2QR3A 3E82A 3THYB 5FOSA 2CL0X 3HNPA 3KAPA 3UJDA 1Z0DA 1H2FA 2Y1OA 1HTTA 4LRSB 5T7BA 1BKDR 3G8BA 4RTJA 1ZVKA 5CJJA 4KFUA 5ALYA 1ZMRA 1LGYA 4D9FA 4C4OA 5IULC 1S2MA 1XVAA 3Q2KA 4ARSA 1K7CA 4LWOA 3DV0B 1K66A 3IIIA 2VHQA 4QNMA 1Z6PA 3D0OA 4KFRA 4ZA2A 4MIKA 1S8AA 2GPBA 1C7ZA 2EKDA 1JT2A 2HCJB 4QGGA 2Y0PA 1UKAA 3CEPB 3QLUA 4J91A 4WOKA 5AIAA 1PWZA 1TQHA 3I01M 3TLJA 3UCXA 1VP9A 2R6DA 4TL6A 4ZC8A 2VP5A 4CL0A 3H6GA 3URMA 1OB5A 4P8RA 3UGTA 4BO1A 1O97D 4MPRA 4H4EA 1SHKA 3REFA 1VJ5A 1Q20A 4EG1A 4ZJYA 5IYZB 1NG9A 4Z0TA 4IUBS 2RAPA 4AP6A 4X61A 4UTRA 1MXHA 2BELA 4EECA 4PANA 1X7ZA 4E08A 1LSJA 2XADA 4PAWA 1EVIA 4MUYA 1LX7A 3L92A 1CDDA 5T4BA 1NNLA 4I55B 3AKDA 3DTTA 4CKEA 1HZZC 2ZTLA 2AEMA 1GFWA 1WXGA 3FNEA 4W8GA 1T9DA 1WXEA 2J07A 2WWFA 3OAAA 1QM5A 2HMAA 2XNHA 3Q3IA 4QU9A 1ADJA 4D3ZA 3KOOA 3DBOB 5AJXA 5I8WA 2V9CA 3G2LA 4G67A 3H13A 3Q1KA 4CTOA 1BMDA 4HNGA 1W76A 2QT1A 2A5JA 2IXAA 3W1EA 4P4LA 2Z1DA 3ZIAA 3OE1A 3PA8A 1XRJA 1E2NA 3DB2A 1WQ3A 1H8EA 4AG5A 3GA7A 4V0QA 4XVRA 1ZONA 4PCVA 3NWEA 4R31A 2YINC 4TWAA 5D6OA 4Y8VA 1RXVA 2ZAIA 1MP0A 3AF1A 1CYDA 5BNWA 3WC4A 3QPCA 1Y1PA 1EPUA 3HXPA 4FWBA 4HLNA 2WWHA 2O8NA 1BIFA 1N6NA 1QOZA 4WT7A 1PJAA 5A7FA 2COUA 4C29A 4U9IS 3OLQA 4I36A 4BFUA 3MGCA 1V0JA 1NXPA 4TLBA 1IEQA 2FMXA 2CC2A 1RQNA 2QP9X 1REQB 1YU9A 2PUWA 5B6JA 3U44A 1E2IA 3DS8A 1WLSA 4LECA 1PJ3A 1IXRC 3DO5A 4MWDA 5C5CA 1GA6A 1L5SA 3ZW7A 1SCDA 2RGUA 1RIFA 3CLHA 3GEBA 4Q1BA 3SQXA 1JFFA 3IURA 2FE4A 3IO5A 1KIAA 4P3NA 1Q5PA 4U39A 5E9WA 3T4UA 4FLEA 4DNQA 4E11A 3HUEA 4HSGA 5C2JB 5EVJA 3SX0A 3AHDA 3HFGA 3AMVA 2PUJA 1N34B 3G2QA 3EXHC 2WC1A 1LDNA 1W581 2IFTA 5LOVA 1QIGA 1QG0A 2FMKA 7MHTA 4OXXA 3ZBQA 2Z1NA 2PKQP 4N7MA 3EZ2A 3W9BA 3A4TA 4N9QA 3YASA 3NUZA 5TGTA 3N0WA 4BV3A 3ORFA 1K7XB 1CUCA 1EE2A 5AVOA 1C9KA 1C7RA 2AR7A 3M4YA 4W4TA 5C46F 3ZV7A 3QEJA 1CUWA 3P9RA 1C0EA 4YJ3F 1QTIA 1W1WA 3E35A 2OMKA 1CS4C 1CRWG 4XGQA 5CVDA 5DT9A 2DSTA 5ED0A 3C7TA 4UTPA 4O4LB 1U3DA 4NDZA 3ENQA 3TAXA 4MVJD 3FYCA 4FYWA 4NNJA 3MT7A 4K0RA 5D3ZA 4RAQA 1XT6A 3EN0A 2PLFA 1EVLA 1R0ZA 2ZWAA 4RMGA 3RE1A 2OFXA 3PDHA 5EWJB 2FEMA 4BO0A 1SC1A 4YUAA 4TTJA 4YEDA 4MWGA 1EFLA 3HVIA 3N07A 1KJIA 2HA0A 2HK6A 4DR7B 2WSSD 4L9RA 4NBRA 5GIPE 2DKFA 1GXSB 1V25A 1WMDA 2QB5A 3T5TA 4EY3A 1R7RA 4RQBA 3CKLA 5DTRA 5HGJA 2HRQA 2G4CA 5EE0A 3UWMA 1SVKA 3WTBA 1THZA 3WSWA 4AFNA 1G20A 1DADA 3PCXA 4KXNA 3HCCA 3FKSA 2OCBA 3SMQA 4HP8A 1J23A 3IPXA 3VU0A 1DCTA 1F4PA 3HNRA 3G6WA 4MULA 3T4XA 3WZMA 1AK2A 3O0DA 4PSCA 2G9RA 3DH0A 2J0EA 1G8PA 1ONOA 2FYTA 4F3YA 2I71A 3G5AA 1RAIA 5JE8A 1XG5A 1E7WA 3ORRA 4PC3A 1Y9ZA 5HK8A 5CYFA 3DKPA 3AUSA 3ZJUA 1JE0A 1MEJA 2NUPB 1GZ4A 3BWDD 3OU7A 1T0IA 4J7CA 4PYKA 1G9TA 4JUIA 4ZDWA 3G0DA 3TQRA 1Y1SA 3MCUA 4CQMB 5BW5A 1E7SA 3I72A 2GBIA 1EE1A 3I2YX 5GV8A 3LZ6A 5D00A 2DQKA 1IY2A 2X6QA 5EJGA 2F3SA 4DLYA 5CFRA 3RHSA 2B21A 3AP1A 3GJSA 2LIPA 3LRTA 4A16A 3RJ9A 3LP5A 4R54A 3SC6A 3TRFA 3SYMA 2CN1A 2IDKA 1ORIA 2F1OA 3USZA 4BFCA 2GX6A 3LUAA 2P2CA 3CF4G 4BGDA 2BVNA 4BMVA 3O8LA 6ABPA 2GK3A 4Q5IA 3AKEA 1VGRA 2WIDA 2LWIA 3DHWC 1I6LA 1U8ZA 4CHTA 1K8RA 5IN5A 1CR6A 4BX8A 3AUYA 1XHLA 1DE0A 1XCMA 5B4UA 1XTUA 3M6WA 2GN2A 2Z5LA 3PT5A 2PX0A 1KJZA 3EIEA 4BB6A 4Z54A 4MWTA 1RTTA 2PH3A 3QA3E 4HVAA 4M9QA 4YALA 5J2TB 1XNJA 2H4FA 5H3HA 4P54A 1IBLB 4PPYA 3PHCA 1XVUA 2XTJA 3T7KA 1NYQA 4RH3A 4CJXA 5J4VA 3UJ9A 4CGYA 4ENTA 5G2OA 1XCGB 3PPXA 1P62B 3LVFO 2H1SA 3OPNA 3P9QA 3BJIC 1OLSB 2QRPA 3OJ0A 1KSFX 4ZU3A 1NVBA 1K75A 2C2YA 4CCWA 1P9NA 2Q46A 1N6IA 5T64A 4WINA 3DKIA 4C4XA 2ZJ4A 3GZJA 3FD8A 1SAYA 2EQ5A 3VAZA 2ZGVA 1U3WA 2OCIA 2OV6A 1NWHA 2EKZA 1M2FA 3PL1A 4ZGGA 3P2OA 4C9BA 2DB3A 2GM4A 1EXWA 2ZRLA 3IQXA 2V9ZA 5AI4A 2J45A 4B3XA 2P0AA 1UPXA 3BJRA 4RGVA 1JYSA 1N1MA 3CPSA 4D56A 1O3YA 1PK9A 1X8KA 4YWHA 1YS9A 3ZU5A 2P30A 4HQRA 3LT1A 5CXSA 1U7OA 2V3VA 2W2MA 4C2UA 4U6NA 1IVSA 1EMDA 1OASA 4DOMA 1U3UA 3E9DA 3OZBA 3AOGA 4A6EA 3G9ZA 4N7RA 1A2KC 2XRFA 3W8NA 1TYAE 3IP3A 1NVMB 4DIDA 4KXUA 1CY0A 1PV4A 1F6BA 4CTJA 4CHGA 3MHTA 1PJCA 1FL9A 3DMNA 4PZAA 4AKTA 5CK5A 5KOHB 4JY7A 1AMUA 3R3VA 4GXNA 3JARB 3PLAE 4HDSA 1D8AA 2FPWA 2FX2A 4KSYA 1WD5A 3W6NA 2WSBA 1E1YA 2WAOA 1E98A 2I2DA 4XARA 3PHGA 1SRQA 3I92A 3M5WA 4MQUA