4Y0AA

Shikimate kinase from acinetobacter baumannii in complex with shikimate
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
179
structure length
179
Chain Sequence
PSKAFETLPNIYLVGPMGAGKTTVGRHLAELLGREFLDSDHEIERKTGATIPWIFEKEGEVGFRTRETVVLNELTSRKALVLATGGGAITQAPNREFLKQRGIVVYLYTPVELQLQRTYRDKNRPLLQVENPEQKLRDLLKIRDPLYREVAHYTIETNQGAARDLAQKILQLILSNKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Shikimate kinase
publication title Structure of shikimate kinase, an in vivo essential metabolic enzyme in the nosocomial pathogen Acinetobacter baumannii, in complex with shikimate.
pubmed doi rcsb
source organism Acinetobacter baumannii
molecule tags Transferase/transferase inhibitor
total genus 65
structure length 179
sequence length 179
ec nomenclature ec 2.7.1.71: Shikimate kinase.
pdb deposition date 2015-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01202 SKI Shikimate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4y0aA00
4N0EA 1AZTA 3X2SA 3U7EB 3IIJA 2WMOB 5JCPA 1KJZA 4DZZA 4B34A 2RGAA 1AQYA 3FFBA 5K8LA 4KJZA 4L4UA 4LV5B 1CR0A 2F9MA 2GZAA 1D6JA 1YZNA 2BKEA 4NYMQ 1NRJB 2BBTA 3V4FA 3I92A 2Q6TA 4OBEA 3JZMA 5IRCD 1UBFA 4CYMA 2RHDA 3WP1B 4N3NA 4IOKA 1II8B 2HF8A 3GJ7A 5IK2A 1G5PA 2EFCB 2XSZA 2DWQA 2QAGA 1TUEA 4KFTA 1DAIA 4BLPA 1G3QA 2BKUA 3CO5A 5UKDA 1YR9A 3VR5A 1KMHB 2JJ1A 1DPFA 4CT5A 1BO6A 4RVCA 5FPSA 2WWWA 2BMDA 4OQMA 1KI3A 1WCV1 5CIWA 3B82A 4JLNA 4MRSA 3Q3JB 1COWD 1TL7C 2FH5B 3LY5A 1OF1A 1IY1A 2GXAA 3P32A 2J0SA 3UPUA 3OEHA 5JWHA 4NZYA 4H1VA 4KCGA 2EFHB 4Q4HA 1C9KA 3OAAD 4MGIR 5A5GA 5C18A 1YRBA 4QGHA 1Z22A 2BV3A 1XBTA 3EW9A 4LPKA 4C0BA 4KYUA 4DXAA 1N2CE 2WSSD 3AQ4A 1OKKA 1Z6XA 3TGPA 2HYIC 1FTNA 2WKPA 4MKGA 4TSFD 2HUPA 2C9CA 1OHHA 4P4SA 3DO6A 1ZU5A 5CDFA 4GZMA 1U0HC 2DB3A 3HU2A 4DT1A 5CJPA 3AP3A 3BERA 1E9SA 1RFLA 3ZS9A 4EJSC 2CDNA 1E2EA 4NONA 3W90A 1MO4A 2PEZA 5AJXA 3VX4A 3QVVA 4PZLA 2OE2A 1GSIA 1WF3A 2F1HA 4C9BA 2QAGB 4TTPA 3N5CA 1ZM2A 5KO2A 4BFZA 3NHBA 1BKDR 4LV6A 1OYYA 2A30A 1E2GA 1OFIA 3GFTA 3MJHA 3WHLA 1N25A 1GL9B 4TLBA 2VP6A 2FA9A 3IEUA 2HYDA 1FX0A 3KX2A 4M1YA 2EFGA 4A6PA 3PEYA 3ZVNA 1SXJE 3KKOA 1W7AA 1Z0AA 2OM2A 1E79A 2F9LA 2HLDD 5SZIA 3FKSA 1W0KD 1U8AA 3IHLA 1NVWQ 1BYUA 3ZGXA 4PQFA 1SKQA 3U7HB 1NKTA 3DZ8A 4Q4HB 1P9NA 3KXKA 4XVUA 2H57A 2ERXA 4IOJA 3G0HA 3IPXA 3EIEA 2VP9A 4TL8A 3CR7A 2DWOA 2ZRJA 2FNAA 2R2AA 5FUYA 3KXIA 2WKQA 4P4SB 3T35A 2R44A 1O87A 2JIZD 2BMFA 4DT1B 5EUMA 1ZBDA 1Z0FA 3B9PA 2IS6A 1T0HB 4LBWA 1XNJA 3PCRB 1SHKA 2UZIR 2ZRMA 1R5NA 2G3YA 4EUNA 2J7PA 4WZ6A 4LYJA 1G16A 2AN9A 2HCJB 2OFXA 2GEVA 3I5YA 1KDRA 3T1OA 4TQUS 1ZW6A 3C5CA 3QF4A 3VX3A 3CR8A 4YMUA 4YDHB 3N2EA 3G5UA 1U90A 3LVQE 1G7TA 4LBVA 2MMCA 1H65A 1TPZA 4PC3A 4PQYA 2Z0MA 4RZUA 3F0TA 4XOIA 3A37A 2REOA 3SQWA 3SDZA 3KZ1E 4TMZA 1UBEA 3FMFA 3U61B 2RMKA 4YMSA 3W8NA 2ZRHA 1H8HA 4M4SA 2ZRFA 4LOAA 3SBEA 1XWIA 2J41A 2GNOA 4JS0A 1M1YE 2ZJ8A 2JLZA 2RGNA 2ORIA 3KQKA 1D8TA 1EWQA 2H5EA 1QG4A 1G3RA 1XDBA 2F55A 4G1UC 3W34A 2B7BA 1I4LD 3U4QA 4QBGB 4AKIA 4Q00A 3VFDA 1G5TA 4BEBA 4XD7A 2Z5FA 5TMPA 4DDUA 3F8TA 5HE9A 2FDCA 2W6JA 3IBGA 4TTRA 1RIFA 1I4TD 2FFBA 1M6NA 2WWHA 4TL7A 3MAAC 5FBVB 1ZUHA 5EP4A 3ADDA 3M6AA 3WNDA 1G21E 1KI1A 3H1TA 5KDOA 2YC2C 4C0SA 2PJRA 3E5HA 3HWSA 4Y0VA 4N0DA 1G7CA 4C3ZA 2IYTA 3QF4B 1EESA 1KZGB 2CL7X 4FI3C 3AVOA 3LNCA 1B23P 1N6PA 5DNYB 4Q1BA 1YE8A 2FPMA 4TMWA 1YU9A 2WJIA 3ZIAA 3CF2A 2J0VA 3HDTA 1P5ZB 3K0AA 3TAUA 1UAAA 4PHTA 1QZXA 4RZ3A 5C46F 2QEQA 4DLYA 3Q7PA 1G1MA 1N6IA 5DI9A 5FH9A 4CGZA 5CJ2A 4DB2A 3K0EA 4JLAA 3ZD7A 4M2LA 2ZTSA 2O8FA 5EP2A 2IS4A 3GJ6A 3L82B 5DIFA 3KXLA 4ABYA 2IWHA 3BH7A 4ZDKA 2CNWD 4OK6A 4JYCA 3WMGA 1MV5A 3HR7A 1D2MA 1U9IA 3K0CC 3FVQA 3FHCB 3F3YA 2VSXA 2ZJ5A 2IA5A 3U4QB 4TLDA 3RS7A 4X8MA 4Q48A 4U7DA 1AZSC 3KFVA 5BN3A 1NNEA 2DYKA 1L4UA 2QQEA 3B2EA 1OSNA 2IYZA 1NBME 1ESNA 5KYKA 1Z83A 2CCJA 2NO6A 3HYRA 1TU3A 4DEXA 2P2LA 2PBRA 2QM8A 4ASUA 4F4JA 3EC2A 2ZQ5A 3ECCA 5LD2B 1TMKA 1YHNA 2GESA 5FTKA 5TDHA 3KJHA 1IY2A 5EE1A 1KSGA 3C8UA 2H17A 4V0ME 3U3MA 4HATA 3NH9A 1JR3A 1SVIA 4FW9A 2QMEA 1CR2A 5EQTA 3NXSA 1NVVR 2VP5A 2WOJA 4WXPA 5B64A 2GHIA 1G17A 1DAGA 3FOZA 4CEIA 1ZU4A 1AS0A 2O52A 1DARA 2WM9B 1S8FA 3GJXC 1Z3IX 2EFEB 5L8VA 5CM8B 1SKYB 1YZUA 3MSXA 1GM5A 1P75A 3FE2A 3TK1A 1N5JA 3K0AB 4OHWA 1QVRA 4GRAA 5J4LA 2B8TA 3QKRA 3IQWA 2HT1A 1Q21A 3VKGA 3NH6A 4UNRA 4YXWA 3QUSA 2IHYA 2R65A 1FNNA 1F5NA 4OQXA 3H2YA 2GVDC 4K46A 5SZHB 2WJGA 2IUSA 1XCPA 3B7GA 2WOOA 1OFTA 1AK2A 2I4IA 2C78A 2CLCX 2RKOA 4H9GA 2BEJA 4RZ2A 2EQBA 5JJLA 3QSYA 4AYXA 2CVHA 1OH5A 1S1CA 1TEXA 4Q1DA 3UG7A 2FSGA 4EIWA 2MSEB 1UM8A 3IDQA 3LBHA 1KK1A 1G291 2ZYUX 4Q9JA 5CIQA 3RS0A 4WVFA 1E0JA 1GRRA 4A8JA 2V4ZA 2G1JA 2PLFA 4K81B 2CK3D 2CMKA 2H8KA 2QSZA 4CRWB 4O2RA 5JLJA 5JECA 4Z54A 1Z6GA 1P73A 4JKIA 3P4YA 1M34E 4Q01A 4BUJA 4F4IA 2FGJA 3C15C 2CL6X 1FPMA 2JDID 3PFIA 3SHFA 2CEAA 5IF9A 3U3OA 3TUZC 2AKAB 2VQSA 3A6PC 3M4YA 2IF2A 2ZE8A 4CEIB 3EZ2A 4O3MA 3LBIA 1X86B 1TF2A 1KI8A 4IVPA 1FFHA 1OXSC 2W6IA 4OHVA 3CZQA 3WHKA 5E4FA 5C2JB 3O8CA 4OJKA 3GFOA 3MLEA 3QKRB 5E7MA 4PAOA 3S1AA 4C7OA 5JHGB 3NVAA 4G5GA 4Z1MD 4BEJA 4RD3A 1E2LA 4E5UA 1D9XA 5G41A 4MQBA 2NIPA 2OCBA 4NCHA 1RVDA 4D81A 3LW7A 4A8JC 1HA3A 2QT1A 4WOPA 5HCNA 2Z4RA 5HE8A 2C04A 4QL3A 3MG9A 4HI0E 3K9LA 1SXJC 2XITA 4A0GA 1E6CA 2ZREA 3I4LA 4QJ5A 4D4MA 4I1SA 2IYQA 2FPKA 4OK3A 2IYWA 1RRCA 3RYTC 1YVDA 2ODBA 3B13B 4LY6A 4ZCMA 4HB0A 2N46A 1A4RA 1E9FA 5JWOA 1XX6A 4M9XA 4PAQA 4ACAA 1IN6A 4HAZA 3ND9A 2X1VA 3REFA 3ZLJA 2JATA 2JLQA 3DDCA 2BOVA 5FOUA 1NN1A 4EAQA 3LH5A 3P20A 5F9FA 1W2GA 1XTSA 121PA 2VHCA 4MH0R 3P4XA 3IIKA 1NIJA 2D7CA 4LK2A 3LX8A 3VKWA 3ZVRA 1GUAA 1CBUA 1N5LA 5HTKA 4POAA 3QEOA 5IK2D 4QHTA 2FSHA 3IKJA 1XZPA 1E2QA 1YR8A 1UADA 2FFHA 3S1AB 4TL6A 4AYTA 3K0SA 2GF9A 4MUBA 2P5TB 4GL2A 1VCOA 3A1TA 4PXAA 4DCUA 4LYAA 1XJQA 3FHOA 1R8SA 2ZYVX 3PG5A 4PHHA 3ZJYA 1Z6TA 3O47A 4Y0AA 2OT3B 3REGA 4RD0A 1JI0A 5DN6A 2ZEJA 2CCGA 4TMXA 1W46A 1JXOA 2QPTA 3HPRA 1T3SA 3C14C 3L0PA 3IEVA 2ZU6A 1XD2A 4CF7A 3U6BA 3K8YA 1T4GA 5CLLA 2IL1A 3ZQJA 2IYUA 3ZZTA 3CM0A 4HYYA 4HZIA 4HAUA 1JJVA 3K09A 5J4YA 4GMDA 2BIFA 3EX7C 2WKRA 4URWR 4DDTA 1FQKA 1UEIA 2A2ZA 2XZPA 2ZSDA 4Q9HA 1E2KA 4TQAA 1HEIA 3TMKA 5EE9A 1X1RA 2AD1A 1G3IA 4TLAA 5D3MA 2IEYA 3CONA 4RZXA 2H16A 2C95A 2ONKA 3AV0B 3LRPA 4W5HA 4DLTA 3AF4A 2NO7A 4EPYA 2VP0A 3VAAA 1VHLA 5KPJA 4IEIA 3B78A 3W6OA 4KODA 4GFDA 3U6KA 1E2NA 4JBXA 1XMIA 4H1UA 3LX5A 2QRZA 1HV8A 4DSNA 1E1RA 1DBSA 2RGEA 2ZSBA 3PEUA 3AVWA 1E2PA 1NL3A 2J0UA 3O8BA 1NVUQ 1NBMA 1F60A 1E1QA 1E99A 1E2DA 4RKFA 5H68A 4EFMA 4YMVA 3MJRA 1KI9A 1W4BA 1W0JD 3UKDA 1KHTA 4HAVA 3M0EA 1E0KA 4G5OA 4A1FA 4MA4A 1P62B 4DLUA 3GFPA 5EZ6B 1J8MF 2IBMA 4TN1A 3SYNA 3K0FB 2O8EA 1OB2A 2N42A 4KYIB 2Q9BA 4I1VA 1EG7A 1XD2B 2NMVA 2LKCA 4BFUA 2GAOA 1N6NA 2W0MA 4B76A 4ZPXA 5AUQA 1Z0JA 1Q12A 2OSBA 3ZQ6A 1ZM4A 2XNSA 3LFUA 3R9XA 1IN4A 1CU1A 1Z28A 3ZVMA 2WJJA 3I8SA 4LZZA 1NKSA 5CK4A 4MKIA 2YOHA 5FTNA 3NC1C 1U94A 4M9SA 1SVMA 3WNCA 1IY0A 1X1SA 1Z47A 2SHKA 1GRQA 4B35A 2OFOA 1VG9B 1CS4C 4IOLA 4E03A 1YJ5A 3QKUA 3AB3A 3V00A 2A5FA 1W1WA 3CW2A 5TB5A 2JGNA 1KI7A 2WTUA 3TKLA 5SZJA 4Q4LA 4OQLA 5B2ZA 1BS1A 3UATA 4YMTA 1R5BA 3ETLA 4B3DA 3GLGA 2J0QA 4AKGA 2AXNA 1WMSA 3KJIA 2C2HA 4I1UA 4PHGA 1MT0A 4DSUA 2BWJA 2WPDD 1PUIA 2J0UB 2BBWA 1HE8B 3TSWA 1D5CA 4B32A 2FEOA 2ZAOA 4DIEA 4ZDIA 4AY2A 1RC8A 4IHQA 1BIFA 1HH4A 3PQCA 5M04A 3GD7A 4Q1CA 4CEJA 3RC8A 4KSCA 3RAPR 3JZAA 1XEFA 2QROA 2O8EB 1ZNZA 2GXSA 4ERNA 2DFTA 2IXEA 3HU1A 5DHFA 5BN5A 3DM5A 3CNNA 3T5GA 4HB4A 1YQTA 4RD1A 1FNMA 2BC9A 4I81A 3IGFA 2FZ4A 4PX9A 1DO2A 1YRAA 3NC0C 4O25A 4XIGS 1KGDA 2GBLC 4DCVA 2ZRNA 2W6JD 2VSFA 2ZIAA 2IC5A 3DZDA 3RC3A 4B3BA 1OPXA 3DKVA 4FINA 1XXHE 4CZ2A 4ZDJA 2XXAB 3VNUA 2EU8A 3EPKA 2J7KA 2YNMA 2MSDB 2YOGA 4L5BA 4TMKA 3CIOA 5DI3A 2D62A 4FXPA 1XP8A 4IKEA 1NLFA 2QAJA 3AH8A 4MDEA 1IN5A 1RKBA 3GLGB 1WE2A 3DVLA 3KFXA 1N5KA 1R0XA 4BWYA 3T1QA 2ZR7A 1PLLA 1U8YA 2NZJA 2QSYA 3KL4A 2ZJAA 1P2SA 4C4PA 5H70A 4G0NA 4NE2A 3RNLA 2GJ8A 4NYIR 4LUCA 1P3JA 3D31A 2QE7A 4CEJB 1Q44A 4C0AC 2VF8A 1E2IA 3TQCA 2WJYA 3RS5A 2D74A 2XZOA 2J3EA 3BWDD 4LC1A 2V6IA 3EZ6A 3CUEF 1OFUX 4Q9LA 3JVVA 3SJZA 3EPLA 1VG1A 1SULA 2WHXA 1IHUA 4UXHA 2G9NA 1G8GA 2OAQ1 1M7BA 3KQNA 1G64A 5L3RA 5FPKA 1QHSA 2D4HA 1Q20A 1TUIA 3AVXA 3GEIA 4PSVA 4KFUA 4NCNA 2XGJA 1N0UA 3BIFA 1FMJA 1QBKC 2C77A 3O8DA 4MKFA 2LKDA 3QE0A 1JQLB 2V54A 4LHZA 5JFGA 4ITRC 2A9KA 2YWGA 3BOSA 4BRWA 1G20E 1X6VA 4YC7A 1DAEA 5KSZA 4G5SA 4MYCA 5DI3B 3RSOA 1EFRA 2P5SA 2OLKA 4C7OB 1BOFA 4NMMA 2OBNA 3B1WA 3BXZA 1HY3A 4FMCF 1JR3D 2H7VA 1EXMA 3R7WB 1EX7A 3LA6A 1YZLA 3AM1A 1OH6A 3K70B 2VHJA 4HLUC 2ZRCA 1Z6AA 2XJ9A 4RY2A 3NEJA 4TYYA 4AG6A 3QXXA 4RFVA 1DAHA 4UNQA 4PO1A 3T1TA 2A5YB 4DVGA 1KZ7B 2LWIA 3ZVLA 1IN8A 1X8LA 1Q57A 1H8EA 2XOKD 3VNVA 4BZXA 3ZZ0A 2ZJOA 4BRUA 4EJSA 1QHHA 4YXWD 4PQRA 1GRNA 1KDTA 4BE7B 3AVVA 5EXPA 5LB2A 2OFWA 2AFIE 4B6FA 3D7MA 3QXHA 4HB3A 1IJFA 3QBVA 3L2OB 2QTVB 4OI4A 2BM0A 3B9QA 4QJ4A 2X8AA 3QQ5A 3BD9A 5FR2A 4B71A 1PVOA 1OH8A 4Q7LA 1E0AA 4RSGA 1F2UA 4TTQA 4CDGA 5DYGA 4YMWA 4QKQA 4DB4A 1S2MA 2Y8EA 2NPIA 4Z8YA 5AUPB 2YZ2A 4Q21A 4PC6A 4JL6A 4L8GA 2R6GA 3U44A 3T1VA 4UNNA 5HZKA 3SQXA 1GILA 5EZ5A 5E7JA 1XMVA 2ZYWX 3EZFA 1HYQA 2EYUA 2ZSAA 3CKLA 2N1BA 3HP1A 5FI1B 2O8DA 5KDLA 4EPTA 2ZS7A 4DUGA 4HEJA 1R7RA 4E22A 2WV9A 2QL6A 4D0NA 1UJ2A 1Q3TA 4RJLA 4KSBA 5IHPA 3AF3A 4JYBA 1JXMA 5KHOC 3K9GA 4EJSB 5DYIA 3QNUA 4IXNA 3AVPA 3BB1A 2JJ2D 4GBMA 1SVSA 3A1UA 4IDNA 4TLCA 5P21A 3L0IB 4BFSA 4M1TA 1FQJA 4GI7A 3MUFA 2X2FA 2IYVA 5E7IA 2ZR0A 1GFIA 4OK5A 3GQBA 3IUYA 1TEVA 4LJ9A 3EWAA 4LHVA 5KSOA 3TVTA 1CULC 2QT0A 3TW4A 3VR3A 3DKPA 3CLVA 3CZPA 1DAFA 2ZE6A 3LVRE 3AKYA 2MMGA 5E95A 2JA1A 1F2UB 5FPTA 2VL7A 1E4VA 2BBOA 4QG7A 2BMJA 2FJUA 2ZR9A 5KU1A 1AN0A 3GLFE 4MYTA 1DOAA 2C99A 5AJVB 4M1OA 4GT1A 4HLQB 4KVAA 2D7DA 1Z8FA 2FWRA 3TR5A 3QF7A 1AGPA 2GCOA 3LLMA 4A0FA 3BB4A 4V03A 1ZM7A 5TV2A 2ANBA 4PC7A 5FTMA 4DLXA 2X19A 2PT7A 3FDIA 4A0HA 4HB2A 1KDOA 4BFVA 1UKVY 1KO1A 1NMZA 1RJ9A 5L3VA 2O8DB 3RVBA 4DSOA 1RW4A 1W36D 2J5XA 5E3HA 5C4MA 2IX3A 3ZZUA 4BFXA 1YR7A 2GCNA 1EK0A 3U7FB 4TYQA 4LBYA 5FPYA 3EAQA 3KQUA 1I2MA 1FX0B 5DO9A 1Z07A 2WIAA 4PC1A 4QNMA 5CITA 4NH0A 1JAIA 1G8PA 1II0A 2A3RA 3FB4A 1AA9A 4JSYA 2ZS9A 4RD4A 4PPQA 4YQFA 3THWA 3UMRA 1LFDB 1US8A 2QBYA 2FU5C 3R9WA 3KDSE 3CPHA 4MYUA 4C0LA 3C7KA 1S3GA 3GLHE 3GJ0A 3MD0A 4QNRA 2DBYA 2OBLA 1E9CA 1KYIA 1MR3F 2XNDD 1CR4A 2XAUA 3CRVA 3MWJA 1HQCA 1EFHA 5KDDA 2GK7A 3BE4A 721PA 1OIXA 1Z63A 2HXSA 1TF5A 4IDHA 2JLUA 4MGYR 4OHYA 3OIUA 1KAGA 2FG5A 3RANA 2QMOA 4DHEA 3KKNA 5JCZA 1Z0KA 2ZM5A 1J8YF 1S9DA 4ESHA 1JR6A 2CE2X 3KUCA 4V0OA 3CPJB 2GCOB 3Q9LA 1CEEA 1I2DA 1P6XA 1NI3A 1XEWX 4WAUA 4BASA 3K0CA 621PA 5JJIA 4KLNA 2WZQA 1J7KA 1A2KC 4IVQA 1UDXA 4IDQA 3H0KA 4XVRA 1NIPA 4ZI3A 2PZGA 1RJ9B 3I8XA 1JB1A 2ZSFA 1GIAA 2DFNA 3RS2A 1ANKA 5H1YA 3QG5A 2IUUA 2AXPA 3R9IA 3WRYC 1B0UA 4LHWA 4LJAA 4ZCLA 5KNCA 4U02A 2BHRA 3VU9A 1HE1C 1Z29A 1DS6A 2WWGA 2QG6A 1U98A 3MRSA 4KBGA 4O2LA 3IIMA 2C5LA 3GEHA 3SYLA 2NG1A 3T34A 3LQQA 5FBRB 2KWIA 1QHGA 3THWB 2C9OA 2VF7A 1US8B 3I73A 2Q9CA 2JAQA 3NG1A 2QBYB 4AC9A 1LV7A 5ANRB 4KI0A 3DM9B 4NBSA 2V7QD 3TSOA 2Q21A 4P33A 4P3YA 2ZJ2A 4TT3D 1UKZA 4ESVA 1G9XA 2GK6A 1ZM9A 2ZRAA 4EQ6A 2CBZA 3SHWA 3NWJA 1HTWA 4NU0A 4HSEA 1IOZA 2P6RA 1P9RA 4ARZA 2CLDX 1FP7A 2NZ8A 4U00A 1NJGA 4QRHA 5B30A 2KE5A 2D06A 4K8OA 2ZAMA 2ZS8A 1SVOA 3AEZA 4G3XA 2PMKA 4EFNA 2ORVA 1EFCA 4PZYA 4TMVA 4OQFA 1N6OA 3OE7A 5TXGA 1GL7A 1KNQA 3DHWC 2ZXUA 4ZO4A 1XEXA 2V8OA 1UF9A 1VPLA 3EPHA 5EE5B 3IPYA 3QENA 1XD8A 3MFYA 3VU9B 1F6BA 3KJEA 2GTPA 4JMPA 1J99A 1Z2AA 3LXXA 4DSTA 1U81A 3SJAA 4DCTA 1OXVA 4B3CA 2OZEA 1GAJA 4DJTA 3VTKA 4IRUB 3UG6A 2PJZA 2O8FB 4C0HA 4X8LA 1FOEB 1W48A 4QHYA 1M8PA 2BM1A 3TAHA 3RABA 1KO8A 4MRPA 4G01B 1G3MA 3GLIE 5J4KA 3I62A 1Q1QA 1YKSA 3NBXX 3ICEA 5FL7D 4JLOA 3CBQA 2HT6A 4OQNA 3EG5A 4EQ6B 3I32A 4HUTA 1E9EA 1M7HA 3FWYA 4XH9B 1MABA 5EE3A 1P2VA 3KKMA 3L0OA 4QFMA 3FMPB 5LBIA 4ARZB 4TZ0A 2ZE5A 5FR1A 1ZP6A 2VH5R 4QBHA 2FV8A 2ZYTX 1ELOA 2OEPA 1C4OA 1SXJA 1JJ7A 1COWA 1UKYA 3AKEA 3CF0A 3HYTA 2F3TA 4KLZA 4M21A 4URVR 3WYFA 4NCJA 2F3RA 4M1MA 3GMTA 2W83A 2H1LA 4JSTA 4OI1A 3H86A 3ZH9B 1VTKA 2W2TA 2JASA 1XCMA 3EPJA 2D3WA 1JPNA 4A82A 2H92A 1CR1A 1AKYA 2Q3MA 3B85A 3BFVA 3NIBA 2IUTA 3OAAA 3PUZA 4DLVA 4F7WA 1Z06A 3FKQA 2IYSA 1W4AA 1HQYE 4P4UA 5CYPA 1LW7A 2WSSA 3A1VA 1QVAA 1R6BX 4W5JA 3PR1A 2VEDA 3AUXA 4EPVA 3GLFA 3X1YA 1GP2A 4RFSA 2FFAA 4QM6A 4NCIA 4C0JA 1G4AE 3ZD6A 2QE7D 4M9ZA 3VR1A 4MRVA 4FCWA 3RWMB 4S35A 2IS1A 1R5OA 5FOXA 3QVUA 1U2RA 2IYXA 2WBLC 2OBMA 4QGFA 1VKJA 4BLQA 3BRWD 1ETUA 1OE0A 3EC1A 3QJYA 3AF2A 2DR3A 1CJTC 3Q7QA 1M74A 4C30A 3J81k 1U0LA 5D3QA 1RRFA 1T3LA 3WP0A 4UXJA 3EIQA 1T9HA 4XTRA 3SI7A 4A36A 1MABB 4YLGA 4ZCIA 1CJUC 1G7SA 2PX0A 3CRQA 4M1SA 8OHMA 4A8JB 2ZRIA 4M1KA 1AGRA 4X8HA 1TAGA 5J4HA 1W44A 2GEUA 4OKSA 1AJEA 1G18A 4LRWA 1SXJB 3IHWA 5BQ5A 2E9SA 1NJFA 2GJ9A 2ZJZA 1VCNA 1W0KA 2E87A 1WQ1R 2HF9A 2OV2A 2ZI6A 3OFNA 4Q7KA 3W5IA 1Y3AA 4GOXA 4IFEA 5CLQA 4DLSA 4JLKA 1CJMA 2XZLA 3Q5EA 4XWAA 1U0JA 1MO3A 1U99A 1VG0B 1XEWY 4FMBB 4HDOB 3K1JA 3CPEA 2A7QA 3ZDQA 3GEEA 4YONB 3WY9A 1EWRA 3LQRA 1CP2A 4JT4A 1KK0A 3AF0A 4GP6A 2JCSA 2XSZD 3DEFA 4RFSB 4FMDB 3AGQA 4Q1AA 1S96A 1O3YA 2JIZA 4NYJR 5C4GB 5BYJA 2BMEA 3W6NA 4AD8A 3R20A 3AVYA 1LS1A 2JJ1D 1L7VC 2HJGA 3B5JA 4PO9A 4GP7A 3PVSA 4OYHA 1KTVA 2VRWA 4J0QA 5G3YA 3H84A 2CCKA 2DHRA 5GJBA 1PJRA 5CB8A 2GZDA 1UFQA 2RGBA 3OF5A 4KITB 3OEHD 2OCPA 4GOJA 2JLWA 4JLJA 3ADBA 1UDWA 2DWPA 4A2PA 2JLSA 1JAHA 2FN4A 1W49A 2QN6A 4JT2A 3BK7A 4AK9A 1R2QA 4Q7JB 1OKKD 3EZ9A 1KMQA 1QG2A 2PL3A 4R71A 4URZR 2V1XA 1OHHD 3DOFA 5TARA 1CKEA 4Q9IA 2AL7A 1OJLA 2JLRA 2IEZA 4LJ4A 2TMKA 2QGZA 2QA5A 3W3AA 4MDFA 2QTFA 1QHYA 5J5CA 2BVNA 4LC0A 4DDWA 1HURA 2FPLA 1HUQA 1NMYA 1S0UA 4ZDWA 1W36C 1JEEA 1U8ZA 2NGRA 3VKHA 1S3SA 2W2XA 3AKCA 1NVVQ 2ZANA 1W4RA 3R8CA 2V1UA 1P2UA 4LYHA 1N6HA 4NYMR 3B60A 4EKDA 3OIYA 4W5WA 1DADA 1QHXA 2ZI9A 3SBDA 2ZRLA 1XMSA 5KUTA 4Q7MB 4IJMA 1IN7A 1KKLA 1M7GA 1ONBA 4CVNA 1R10A 5JJKA 1E79D 4V0MA 4A4DA 4LJ7A 1KI6A 1CIPA 3K9HA 3FKSD 1Q3HA 5JZVA 2GDJA 1RPZA 4B3XA 2J9RA 1K5GA 1RE0A 2QU8A 3CX7A 3D8BA 1JBKA 1UPTA 2GJSA 2WAXA 3PUVA 5KOYA 2AK2A 2ODNA 4LPSA 1XB2A 2F1JA 2AKYA 3D6TB 4MRNA 2IWRA 3LBNA 5FFMA 5CDFE 1R8QA 3UANA 5D3MB 1KNXA 4HUQA 2CNWA 5A0FA 2PMDA 3EZ7A 4RD6A 5GJCA 3GJ4A 2OILA 2YWFA 1K8RA 5A4JA 3KJGA 3TUJC 1GDDA 1KK2A 3GLIA 5ELXA 2EWVA 4QM7A 4II7A 2J7PD 2RHMA 2XEXA 2GBLA 2UKDA 1QDEA 3NKVA 1KSFX 4JIMA 4V0NA 1MOZA 2GEDA 3NBFA 5JI2E 4Q4AA 3VQTA 3TLXA 2PZFA 1UBGA 1WP9A 4DLRA 4B74A 4Q5IA 4B6EA 4WW0A 1E94E 3A4MA 4BFTA 4D80A 1NG9A 1EFTA 1WA5A 1Z6YA 4Q1FA 4D6PA 1VYTA 1YZTA 1VECA 1G19A 1H8HD 2NOAA 3Q8XB 1KI6B 2W00A 3BS4A 4L9WA 1XJ0A 2W2VA 1KOFA 2AK3A 3A4LA 4JZKA 5CK5A 1NP6A 3PITA 3ADKA 4F4CA 4A92A 1KO7A 5FBWB 3SN6A 2C96A 2C9YA 4IOMA 3SEAA 1Q0UA 1XF9A 1Z0DA 1HT1E 4EPXA 5L3QA 4AWXA 1JEDA 3MGCA 4XD7D 2VTKA 1G4UR 4F91B 2QENA 3TBKA 1GNRA 3TE6A 5FOSA 1W5SA 4L9SA 4HUQB 1DG1G 2XTZA 1TADA 1K5DA 1GTVA 2F1RA 4UXIA 5J40A 1SZPA 1WBDA 1PZNA 4JLVA 3TR0A 2CHVA 3LW8A 3GLIB 3PUXA 3E70C 4Q02A 1XZQA 2I1QA 3UK6A 2O5VA 3C5HA 3M1IA 1A82A 2R9VA 3X1ZA 2ZUDA 1G3UA 4JL5A 2FGKA 5K8IA 1RYFA 4IFBA 1XPRA 3QPWA 4US2R 3AVQA 5LPNA 1AIPA 1E69A 4OI2A 2F43A 1E9AA 3ZIAD 4JL8A 4MGZR 4Q18A 2B7CA 3SFVA 1FMLA 2P0EA 5JEEA 3SZRA 1EGAA 3W6PA 3TNFA 4BLSA 2OAP1 2JEOA 1N0WA 4CIDA 3U3RA 1FW6A 4LBZA 1CJKC 1XTQA 5HZHA 1P2TA 2VIIA 4PTLA 1PLJA 1NN3A 2Q9AA 4HLUA 3X1WA 3K53A 3CH5A 1BMFA 1UEJA 3JVUA 3TVDA 3ONWA 2UVQA 2ZI3A 2YV5A 2YOFA 1S1MA 1OLOA 4WBSA 3NTUA 2QMHA 5EP1A 3W9YA 4LJ8A 2ZRKA 4Z1MA 2OCYC 2ZI7A 2WVJA 1T8TA 4JLMA 3IO5A 4UNPA 2WAYA 2B8WA 5JEDA 1G6OA 3VMFA 1VDZA 5FUWA 3CNLA 3T15A 3TJZA 2VYFA 3GJ5A 3DMNA 1WDTA 4ASUD 5F3WB 4C2UA 4NKRA 3DPUA 1WBBA 1QHIA 5FOTA 1NY6A 2K5UA 2ATXA 2CLSA 2O0HA 2V6JA 1II9A 4EFLA 1D9ZA 3RS4A 3AP1A 1S4QA 5DHAA 3E1SA 5BW8A 1DE0A 1T8UA 1SKYE 4AURA 2F43B 4M53A 3I1FA 4BLOA 1CLUA 1V5WA 3TUIC 5JRZA 4WA7A 4WZAE 2QUZA 2ZI4A 2B21A 4WXRA 3A8TA 2B6HA 3BFXA 4IXMA 4JBWA 2GJKA 1ZIOA 2RCNA 3RRYA 4JLPA 3MMPA 2RB4A 2EW1A 2A5DA 2NTYC 5FTJA 5GJVC 3I5XA 3HR8A 4TQ9A 1JPJA 3GJ3A 2QMUA 5FOWA 3BC1A 4DBLC 3C4JA 3OEEA 1W4CA 3BGWA 3IO3A 1KY3A 1JALA 2YYZA 2FOLA 4URUR 1BH2A 4QJ3A 1ZCAA 5JS7A 5JHHB 3LV8A 3KUDA 4M1WA 2ZUCA 3OZXA 4AYWA 5K8UA 2P3SA 4LHXA 4R2HA 3UIEA 1DEKA 3SNHA 3ICQB 3DMDA 3RLFA 3BFKA 4L15A 1X8JA 4JVMA 5HCIA 4E07A 4DEYA 2GILA 2X2EA 4NCKA 4PO8A 3C41J 2KSQA 1BYIA 3AUYA 1SXJD 1FL9A 1JR3E 4MGKR 1GVNB 4B3FX 3VR2A 4CT4B 5JMTA 1RZ3A 2ECKA 1Z08A 4KFSA 5JRJA 2QP9X 1KDPA 3THOA 3SYKA 4B47A 3X1XA 4R7ZA 1E96A 3LO5A 3IQXA 1J2JA 3SE0A 2BJVA 1EX6A 2CE7A 2W6ID 2G77B 4W7SA 1P4SA 1ZRHA 2E1RA 1P9WA 5AUNB 4Q9KA 4URYR 2V55B 4JVLA 3HJNA 1XJCA 4PAMA 2QAGC 1E32A 3A1WA 3WXMA 2MSCB 5EXSA 1QHHB 5KNBA 5C1BA 1XTIA 2QM7A 2BDTA 5AJWA 2XJ4A 3P26A 3QI2A 1CF4A 1SQ5A 2FSFA 2GZHA 1KK3A 4ILEA 1W47A 3SOPA 1TQ2A 1E3MA 2A5JA 3A4NA 5L3SA 1KAOA 1AKEA 1PLKA 4KBFA 2BCGY 3SU8A 2ZJBA 4B3GA 4KHZA 2Z4SA 1ZD1A 5FPHA 2WWXA 2JLVA 4DCNA 4N1AA 3RRNA 2IT1A 1L2TA 2RGDA 5DISB 2ZRBA 2WMNB 2HJVA 3ASZA 4IDPA 1W0JA 4R2IA 4WZBE 4XWOA 2O8CA 1C1YA 2ODWA 1DO0A 2GETA 3SC3A 1NN5A 3U44B 3WNBA 4QBIA 4DC9A 1MKYA 1DG3A 3MWLA 1XU4A 4QGGA 3VHLB 5TY0A 3OFND 4DKXA 5FUVA 4JJKA 1G7RA 4M9QA 4BECA 4V02A 4AKEA 3BAFA 3QPVA 4X8OA 2GKSA 3FYHA 5AK0A 2PT5A 2EWWA 2QORA 2VLIA 2I3BA 4GNKA 2ZPTX 1LF5A 4M8NE 2Q0HA 5F2EA 4YDSA 4DRZA 2FX3A 1A5TA 4AIIA 2YWHA 4GOKA 1XXHA 2IHBA 2G1KA 1E2JA 1KI4A 5KNDA 2ZITA 4PSKA 3WRXC 1E9BA 1W5TA 2AX4A 3IBYA 5GADl 3H4MA 4NYIQ 5DN6D 3QXSA 1Q1BA 2AR7A 1HT2E 1ESMA 5L3SB 4PSAA 2PEYA 2VHQA 4NL4H 4NPHA 2ASEA 2FFQA 2I1VB 4HLCA 4D82A 1QF9A 2VA8A 1JECA 2WPDA 4P4TA 5HPYB 4G5RA 2DCUA 1ZM3A 4KO8A 1YZKA 5KTYA 2O8CB 4B44A 1NN0A 1DELA 2P6NA 1LNZA 2F1IA 3FPAA 5J4VA 1LS6A 3ADCA 2RGXA 3CRMA 1R4AA 3IILA 1ZUIA 3K9NA 4F93B 4QC2A 1WB9A 821PA 1ZNWA 1XCGB 2AWOA 3RRZA 1M2OB 3P1JA 1X8KA 1J70A 5CYOA 3RDPA 3PXGA 1NLZA 4XTCS 4JBYA 4Q03A 3LLUA 1TU4A 4LHYA 1TX4B 1GZSA 4B73A 1R0WA 4D4JA 4C0KA 1Q1EA 3U7GA 3CH4B 1E4YA 1K6MA 2KBFA 3BB3A 1E1RD 3L0SA 3SR0A 4CW7A 1VMAA 3DOEA 2IK8A 4P32A 5EXTA 1XXHB 1ZNXA 1NBMD 1E1QD 1Q1ZA 3CRW1 2Z43A 1D2EA 2D2EA 1GL6A 3KKPA 3W5JA 4A2QA 1Q22A 1W2HA 1ZNYA 3Q5DA 1KJWA 4HLDA 4QBFA 2R6AA 1TTTA 1ZC4A 2RGCA 3EWSA 2FEMA 3HU3A 4MUAA 5DE3A 4LJ5A 3FMIA 2JLYA 4URXR 1Z5ZA 3CF6R 4A9AA 3SJCA 1CRQA 2RGNC 3QOFA 1IXSB 1TF7A 2HV8A 3D3QA 4TMTA 4V0LA 1UKEA 1VYUA 2P6UA 2ZVPX 3TW8B 2ZSEA 4AG5A 3UWOA 4GZLA 3WMFA 2ATVA 4GMXA 4QXAA 2VSOA 3L8YA 4LJYA 5IT5A 2GCPA 2R8RA 2WSMA 4Q19A 3AP2A 2YJTD 5JSZA 3N2IA 2J45A 4D0LB 4Q1EA 1YR6A 3OHMA 4JVSB 3QEJA 5HKKA 3DL0A 3RWOA 1OW3B 3MCAA 4IW3B 1ZCBA 4ZKEA 2PH1A 4EDHA 2QZ4A 2F7SA 1LTQA 3T12A 5GVSA 5J47A 1IONA 2QP3A 4R9UC 1T0JB 2IYLD 4PPFA 2DY1A 1VIYA 4XSGA 4B2LA 5LD2C 1AS2A 3QIAA 1JQJC 5B58C 1D2NA 4OHXA 3THXA 2ZRDA 3Q85A 2P65A 1E2FA 1XFAA 1XTRA 2G6BA 2GXQA 3C16C 4KFRA 2OLJA 2LCFA 4B43A 1ZD8A 4D2IA 2O0KA 4US1R 2V3CC 3KKQA 1E9DA 4L16A 4UQOA 1YZGA 5JWRA 3W8RA 1E9RA 1ZIPA 1TQDA 3BBPA 5CB6A 1P61B 2Z6VA 4DDVA 3EA0A 3AKDA 2ONJA 5EJEA 2KJQA 1G41A 1OV4A 1Y63A 4LGMA 2QPOA 1ZMXA 3TIFA 1SVKA 2L0XA 2GA8A 2VPPA 4DIDA 2FZLA 4BQSA 4MITA 3KQLA 4V0KA 4TYPA 2EFDB 4XJXA 1T3HA 1U9IC 3ND8A 2G88A 1JNYA 1AS3A 3SFZA 3GPLA 3QXCA 3KB1A 3V4RA 3R8FA 2WICA 2OCAA 2XOKA 5JSZB 1P7CA 2XB2A 2IS2A 1NSFA 1XMJA 4Q4JA 5FBQB 1KKMA 4B33A 1T5LA 5KPDA 2VP4A 2OESA 3TRFA 2X77A 1IBRA 2R6DA 2C03A 5AJZA 1ZC3A 4PZZA 3THYA 4PANA 2A5GA 4UNSA 1A7JA 1KO5A 1P72A 3HPQA 1LF0A 4LCBA 3THXB 3NBYC 3PJRA 3GLGE 1XEXB 4NDZA 3FHTA 1N6LA 2WJHA 3AVUA 2J87A 2OXRA 2GF0A 3AF1A 3CX8A 3FGNA 2ZI5A 2CHGA 4NHOA 5DH9A 3A1SA 5EE0A 1NSTA 4B2PA 3K70D 1XRJA 3QBTA 2W0SA 2ERYA 2RGGA 4ZIRA 3LWNA 3L8ZA 3RSLA 2ZVQX 4FIDA 4TSFA 3ASYA 3UMSA 421PA 2IF0A 4D4LA 2OG2A 1ZJ6A 2QNRA 4Z8XA 3U5ZB 4US0R 5DSZA 2YWEA 1DVRA 4QHSA 4DLZA 2CJWA 1VIAA 1GNPA 1SVLA 2ORWA 2HCBA 1T91A 1BMFD 1IQPA 1ZVQA 2KB0A 4B75A 3I61A 3PEVA 4LI0A 2CHQA 1NMXA 3RS3A 1VYVA 2IYRA 1CJVC 3V9PA 2EYQA 2VO1A 3PUWA 3VHXA 4D0GA 2O0JA 3SJBA 5LB4A 1MO6A 2RAPA 1N3BA 2QRNA 4Q47A 3B1ZA 4RCYA 5FL3A 1ZD9A 4Q4JB 3FTQA 4TYWA 4RD2A 2JJ2A 2XB4A 2QI9C 3NHAA 2P67A 4PC2A 2AFHE 3TSZA 5EXXA 1QHNA 3A36A 3THYB 2HLDA 1RRPA 2BBSA 2ANCA 1TQ6A 2GXUA 1EFRD 2G0TA 1GKYA 2H18A 3T61A 1VG8A 1GG2A 2PX3A 4A2WA 2ZRPA 4UJ3A 1V43A 3GLHA 3UWKA 1DAMA 1Z0IA 3VR6A 4D4KA 3TH5A 5F9HA 4B48A 1F2TA 4HDQB 3T06B 4AI6A 4P31A 2KI5A 1NLYA 1XD9A 2BJWA 2ZROA 3NBZC 4ZIRB 3QG1A 1OXTA 3PIRA 3GLFB 1KSHA 2AHOA 3U60B 5KSYA 1CTQA 1LY1A 1G8YA 1SHZA 1S9HA 3X1DA 1E98A 5FBLB 3G82C 1H8ED 3MWKA 2F6RA 2XTNA 1IXZA 2GJAA 2O8BA 2R6FA 3QPUA 2CJWB 4KVGA 1A2BA 2HXYA 4QGAA 1ZINA 3OEED 4U5XA 1NG1A 1TNDA 5BXQC 1I4DD 4BLTA 5F98A 2UZ3A 1ODFA 2PCJA 3E2IA 3LD9A 3A58B 2WWIA 1KSJA 2KBEA 3LXRA 4LDJA 3F5FA 2B92A 1FUUA 4TYNA 1AM4D 4XVQA 1KJYA 4G5QA 4GPTA 5K8TA 4HZUA 1XTKA 1KI2A 1J90A 1P60A 2QQ0A 4F92B 4IEEA 2IYYA 1A1VA 1NF3A 4OJQA 3WYGA 2WWYA 5AR1A 4P0TA 3B1YA 2XNDA 3GLHB 3KQHA 3I3SR 1G8FA 2C98A 2FSIA 3K0FA 3P27A 1F2TB 2ZJYA 3T5DA 3U2QA 4I4LA 1GKUB 1ZAKA 5EP3A 1G6HA 1NY5A 1EFUA 4ZKDA 1MRSA 1MH1A 1DAKA 4FN5A 4LJ6A 3RRMA 2VHUA 3TQFA 4DUGD 4A15A 4A6XA 1WXQA 1GKIA 1GWNA 4DCSA 2XX3A 2NO1A 4B2IA 5FUXA 1IXRC 2O8BB 3UMFA 4BZPA 5GJWC 5BN4A 4PFSA 4LV8B 3BORA 2OUKA 5B57C 1OXXK 4JVNA 2NPFA 3O8RA 5FI0B 1W36B 4GDFA 2R62A 4DWJA 2R6CA 3WMEA 3BJIC 3NDBB 5AJYA 3N70A 1RYHA 1TQ4A 1E2MA 1N6KA 4BGDA 2JLXA 2HEIA 5BYKA 2YKGA 3B1VA 4QOSA 4I1OA 2IXFA 4BFWA 4PHFA 1X3SA 3CB4A 4HZUB 2OHFA 1FUKA 3WBKA 1R0ZA 1N0VC 1OYWA 4ON9A 4KV9A 3W3ZB 1GOTA 2Z83A 3K09C 4BFYA 2HDNB 4FMCB 2NQ2C 2V9PA 5KSPA 4EPWA 3GCGA 2JJ8A 4NTZA 1T5IA 3I72A 3ZS8A 4Z51A 3CX6A 3WBJA 2G0NA 5GVRA 1GNQA 3ZYCA 2PZEA 2FE4A 2V7QA 2WWFA 4M0LA 4TT3A 5AUOB 4C0QC 1RRGA 5H8WA 2WJVA 1IAQA 4Q66C 3KTAA 4UKDA 2AD5A 2BEKA 2DPXA 3CNOA 3CWQA 4GSYA 2EVWX 5IDVA 5JS8A 5SZKB 4CEHA 4RKEA 4JLBA 2CXXA 3U3JA 1VHTA 5AWFC 5DGXA 2GWHA 1LVGA 4OL0A 4FWTA 4R98A 2VBCA 1YZQA 221PA 4MKHA 2XXAA 3EA5A 4OI0A 1L4YA 2ZU0C 4BPBA 4PR0A 1NVXQ 1OIVA 2D2FA 2OXCA 5JI3E 4IDOA 2YINC 1G8HA 2PLRA 1VCIA 3RHFA 1FZQA 4UJ5A 1KIMA 3Q72A 2IW3A 3MWYW 3EASA 2CVFA 3QKSA 1UBCA 3WYAA 1AQUA 4KAXA 4ZV4A 3UXMA 4NP6A 3B6EA 5EUQB 5G3ZA 2AWNA 2ODEA 1WRBA 4FWIB 3CWZA 4JJZA 4TWZA 4C2TA 2ZUBA 2FMXA 4OHZA 2QGNA 2RH5A 4WIAA 4O0MA 1L8QA 2QPAA 4LWZA 2YHSA 1N6RA 2GAAA 3PEWA 4EPRA 2J46A 3BH0A 5TVKA 4FMDF 4KXFB 4LX0A 2GVZC 2VHTA 4FCVA 1ZUNB 1QRAA 3EIHA 4FD2A 3VR4A 3QXJA 1FTSA 1G5RA 3QKTA 3B8HA 3LDAA 5DLQC 1SVWA 3KTAB 2J1LA 5FL7A 2ZETA 2YVUA 3OIWA 4BLRA 1F48A 4MRRA 2FF7A 3PV0A 4HAXA 2QP4A 4FCTA 4CEHB 3PENA 4Q4AB 2ZE7A 3SS8A 1XPOA 1OH7A 2CK3A 1Z2CA 4S2EA 2GRJA 3L43A 4JLDA 1GITA 3QY0A 1VCMA 2J59A 2DFLA 1CXZA 3BH6A 3NEYA 3PUYA 2Q3HA 3EARA 1N5IA 1ZYUA 1XPUA 2IXGA 4F38A 2XTMA 3CRRA 5FOVA 5LDDC 3NDPA 4HAWA 2JDIA 4D25A 4PPGA 3AVTA 5FTLA 2DFKB 1MRNA 4I99A 2BCJQ 4BZQA 4E09A 2OO7A 4NYJQ 1R0YA 3R7WA 4TLEA 1DTSA 3QKSB 521PA 2C8VA 1OB5A 3OESA 3EXAA 4PPNA 4HAYA 3U3KA 1LB1B 4HDCA 3FMOB 1E2HA 1E0SA 3B1XA 4IVRA 1II8A 2VP2A 1OT3A 1OIWA 3LAWA 2REXB 4LSGA 5CM9C 4JKYA 5L3QB 4ZI2A 2NO0A 5G40A 2QTHA 4TZ6A 1T6NA 1OXUA 2W58A 2NO9A 1IJEA 2G83A 1F3OA 1KMHA 1OFHA 4AKHA 1XTJA 2CL0X 2PCLA 4TL9A 1PUJA 3AGPA 4ACBA 4LYFA 5HKKD 2REBA 1IM2A 4DLWA 1PV4A 4XWKA 5HR5A 5JBQA 4XSHA 4W9MC 3GP8A 2YC4C 1MO5A 4KU4A 3OE7D 4MYHA 5G53C 3OIVA 2WIBA 4D26A 4A0RA 1CRPA 3GJ8A 4RCZA 1KY2A 5BWMA 4M22A 3FFAA 2A78A 3K70C 1SGWA 2ZRGA 1FP6A 3KB2A 6Q21A 2Q3FA 1KO4A 2QY9A
chains in the Genus database with same CATH superfamily
4C4AA 4FGKA 2FUCA 2CJXA 4HQLA 2WMOB 2WRZA 1NLMA 3G2KA 4I9GA 1I0LA 4LMAA 2QM3A 1U7DA 2W6MA 1CUXA 4CETA 1GDHA 2C7OA 4LV5B 1KYYA 4YUWA 5AVVA 4EY3A 5AVOA 1JFSA 3MT7A 1D6JA 4C2AA 5C8VA 2BKEA 3FWNA 2FZEA 2BBTA 4AW9A 5CCEA 4X65B 2VK1A 5ALXA 2CUTA 1E1KA 1IG0A 4CYMA 2HRCA 3GJ7A 1C0PA 5IK2A 2GGSA 4BO5A 1Y0BA 3G0OA 1QCDA 1LWOA 1TUEA 4LECA 4POOA 4F46A 1QQ6A 5HJ7A 4W5OA 2WK1A 1A8SA 3KDPA 3DULA 2SICE 4KFTA 2IOFA 4MQFA 1PFUA 3CO5A 5UKDA 1ZRMA 3O31A 1YR9A 3VR5A 2PKQP 2V45A 4X1YB 4ZMSA 3H0EA 4J0JA 4OHRA 4RVCA 4EKNB 3UGQA 1UFRA 2MTBA 1A9QA 1T2UA 2Z9BA 5CIWA 1F0NA 3Q3JB 1COWD 1JQBA 4MRSA 3KQOA 1GPWB 2FP4A 1RI5A 4CI9A 2ES4A 3P96A 2D8AA 2PLAA 4PS0A 4I9UA 1KJQA 3GELA 1VKRA 3OEHA 3TQQA 2EKBA 4RBNA 4CUZA 4KCGA 2ZTUA 2ASVA 3H2JA 2B3TA 3QX8A 5I01A 4W5QA 4J3JA 5A5GA 4W1SA 1YRBA 5B1EA 2RHOA 3O91A 4JC0A 3V97A 1Z22A 4LPKA 3RK0A 5JJ5A 1PVVA 1JWAB 1OV6A 5KHAA 4YCAA 3AWDA 4ER0A 3BWXA 4IDCA 2W2QA 1QKJA 1OHHA 2C9CA 3HB7A 4IWNA 2DB3A 3CNQS 2XRYA 3M6IA 5IC6A 4IJVA 1RFLA 1C30A 2AI2A 5EKXA 3LXUX 1ISFA 3IAEA 1SBNE 1SUFA 2PEZA 2GAFA 3C7TA 3LTNC 4MS1B 1H3FA 2DG2A 2F62A 1WF3A 4C9BA 1R0SA 1GGFA 2H5JA 2QAGB 4TTPA 3N5CA 1O89A 1ZM2A 3I5UA 3AYZB 3NHBA 3UCFA 1BKDR 4ZAFA 4HNHA 5BN1A 2H1VA 3MJHA 4YLEA 1RYMA 3L1JA 3ZOKA 3CE9A 3BILA 3IEUA 4M1YA 2HYDA 3HCDA 4EGSA 1WKVA 1VFNA 2EFGA 3JWIA 1H5UA 3WRXA 1D09A 2CFSA 1SXJE 5REQA 3IV7A 3KKOA 4KR6A 3O93A 1W7AA 1O5IA 3ANSA 1RHJA 1B0PA 3A9CA 4L0QA 5SZIA 3WK6A 3FGPA 4EO4A 3ORQA 1U8AA 2OCDA 3GFVA 3IHLA 4YQYA 3MXOA 3IDZA 3O5AA 3SP1A 2IXBA 3T5BA 2HXGA 4ONEA 5HIIA 2LDBA 3QU4A 5K0BA 3U7HB 1FU8A 1NKTA 1Y8QB 3DF7A 1N0IA 4ALKA 2NXJA 3A1DA 2NYAA 4IJKA 4A0QA 2P77A 3MF4A 5IJ9B 2IIQA 1E0DA 2H57A 4R8VA 4R9SA 3WICA 3WJAA 4XVUA 3FYDA 4ENRA 1XG5A 1XLUA 1WABA 1V48A 1LJ8A 3AESA 1ODKA 3EIEA 3EH1A 2EERA 1FPQA 3CR7A 1R6AA 3FXAA 4TL8A 5IM4F 1K5HA 1NHGA 4GKBA 4D6XA 2VJQA 5IS2A 1Q74A 3DV0B 3TSAA 4BB0A 2R44A 3G8DA 4PWYA 3VC2A 4EUEA 1WZ2A 4P5PA 3R3XA 5EUMA 1ZBDA 1XNQB 4ZREA 3HJAA 1WETA 3E22A 1YA8A 3W5AA 2I91A 1ACJA 2RG1A 3HC7A 2IS6A 3BSFA 4P0PB 4U1RA 4G84A 3PCRB 2Q0XA 3KPWA 1RWBA 2ZRMA 1YH3A 2XQGA 4EG4A 1J2EA 2E7ZA 1WZNA 4ZVKA 2HCJB 2AN9A 2OFXA 1I33A 3LBFA 2NXNA 2V6GA 4I8IA 2W4QA 4DC0A 3TIVA 1QYIA 2I3AA 5JY6A 3R6WA 1TA0A 4PVDA 4Y6OA 2CUKA 4YMUA 1JYFA 4YDHB 1F7UA 2GTIA 3N2EA 4UATA 4U2BA 2ZCVA 1CUIA 1NVEA 1VL2A 3FBWA 5EY5B 2MMCA 1H65A 1TPZA 3DCNA 3FFXA 4PC3A 4QTUB 3ZLTA 2HHHB 4J1NA 4Q9DA 4IBOA 2FYTA 1GQ2A 4XWTA 5F5XA 1ZEMA 2YMQA 2H48A 4HS4A 4K3VA 4M4SA 3ZBQA 1KVUA 5T57A 3U61B 1L3CA 4QPCA 5TPWA 3FM9A 1EM6A 1THTA 1TKBA 5LA6A 1W96A 3ZGOA 2ET6A 1Y3CE 4MV7A 1BCRB 1JLLA 1JLKA 4ZV7A 5BSTA 3LC2O 1MHTA 2ZJ8A 2JLZA 4LKOA 5LYJB 2ORIA 1D8TA 3DUWA 4ZT7A 5IYZB 1XDBA 3EH2A 3NPAA 4EYOA 4G1UC 4OYYA 4WH0A 3W34A 4W5NA 3SLKA 4M9CA 1I4LD 2CEKA 3KAPA 4PSDA 3VJLA 2ST1A 4P58A 4Q00A 5HBGA 4BEBA 4AKIA 4XD7A 1U04A 3N9IA 3P9ZA 2W6JA 4ZHQB 2CFRA 1THGA 2B34A 2Y6UA 1QPBA 4MVJG 2FFBA 1RQ7A 1M6NA 2WWHA 3KFLA 4TTRA 3DMPA 3ZG6A 4CNBA 4E13A 3OD5A 5KJ1A 1K2VN 2XB6A 1O96B 4D3XA 1JFFB 1R8XA 2IY9A 2VAPA 4OA8A 5JQGF 5KDOA 3HI6A 3IKLA 1HEUA 1DKRA 5EPEA 4CODB 4N0DA 4IO0A 4R51A 3PNLA 1N2JA 4DWJA 3C74A 3NMUF 4YTEA 2B7LA 2OYRA 4AMVA 1ID8A 3HKEB 3TXXA 4ZVPA 3SS9X 1H6AA 5EJMA 4IIJA 4B4KA 2HSEA 3BTOA 5DNYB 4Q1BA 4WFJA 2FPMA 1ATZA 3RRJA 1UOOA 1YI1A 1YU9A 3ETDA 4BNIA 2EDAA 2PU7A 4AZTA 2HO5A 3L05A 3V1NA 1QRSA 1S2LA 2I55A 1E1MA 3ENVA 2DQSA 3K0AA 3FAKA 1CZNA 3AQIA 4F04A 2YZGA 4AN1A 3O8QB 1PWXA 1Z4KA 1NR5A 5U4QA 4J7XA 4R4JA 4RZ3A 1UIMA 1JAYA 3JQQA 4DLYA 3KLOA 1G1MA 2IZ1A 3IMEA 3JQPA 5FH9A 3HFSA 4Y2PA 5D5PA 3ZWXA 5JPDA 2VCHA 2YUIA 5EP2A 1RQPA 3GJ6A 2Z1DA 3E5MA 3CG0A 3STTA 3WDSA 4ABYA 1B41A 4EHJA 1U3UA 5A5FA 3ER6A 3OUTA 4NBWA 4F3NA 4HG2A 5A1TA 2VZEA 1RWQA 5D8DA 2OHIA 3M3PA 1GA4A 3HR7A 3AB8A 4BV3A 5M2QA 4RTQA 2XZDA 2AG5A 2VUTA 3H87A 2VSXA 4RY8A 3R7AA 1HZZA 3P4UA 2HQOA 1JQAA 3UHJA 5A5DA 5KTPA 1B1AA 3HUUA 4UUBA 3U4QB 4TLDA 3RS7A 1DC5A 4J03A 1UC4B 3KFVA 2O1XA 3WLRA 4DYDA 2DYKA 2NU6B 2X7XA 3KQYA 1LC0A 2VDMB 3U0VA 5IN4A 2G80A 1EDDA 4OUDB 4YBZA 1BS2A 2H7YA 1A77A 3IR7A 1JDNA 2NO6A 3OOSA 3BM5A 2ZQ5A 4QTZA 5KZMB 3ECCA 3HN7A 3A4YA 3M70A 4PNEA 4YUYA 5LD2B 2I99A 3KJHA 3K9FC 1IY2A 5DGTA 3DZGA 5EE1A 3A9SA 3NJ8A 4DAOA 4FZ3A 1D8AA 2AOTA 2RDMA 1CR2A 3QSGA 4ANFA 2JNWA 4KK3A 4G23A 2GHIA 3OE1A 1DAGA 4OHBA 3Q3VA 3WDLA 2WM9B 1S8FA 3KYBA 1Z3IX 2EFEB 3A9RA 3E9EA 1YZUA 1XCOA 3TDMA 4EUFA 1QMGA 1L7DA 1CJCA 2CW5A 3L77A 4UHJA 2PGOA 1SC9A 2V7PA 4Y30A 4GRAA 3R7DA 4L51A 4TUYF 3QKRA 1TVKB 3AONB 1ORIA 2YWXA 1RTTA 5ALJA 1AZWA 5CXUA 3TFOA 4LXYA 3SM3A 1N2CA 4PXYA 3DZKA 4CKCA 1UKBA 3VKGA 3EQZA 3QUSA 3KAKA 2XE4A 2PO5A 2GAIA 2VUIB 3Q7RA 1ST2A 1UANA 4GE3A 1CY2A 4U6NA 4QVGA 5HFAA 3RHTA 3TX6A 4DDKA 1WO8A 2WJGA 3B7GA 2I4IA 4FVTA 5DRYA 4CFZA 2BEJA 5G4KA 2VWHA 3TLGB 1ISHA 4D57A 3D43A 1N3LA 3QSYA 3F67A 3K6SB 1IWPB 1S1CA 1TEXA 3PDHA 4HXYA 3PSHA 1JEYB 5DNVA 5I9TA 5KWSA 1UM8A 3CJQA 3LBHA 5AVJA 1KK1A 2VYCA 1G291 2C54A 2ZYUX 3I04A 1PFYA 2GN0A 4FWBA 3V1YA 2I2CA 2I3DA 1BD3A 4A8JA 3V34A 3IUEA 1IQ0A 5JOQA 5INTA 2CK3D 2CMKA 2H8KA 3BIWA 2OY0A 4AP6A 5JLJA 2B9VA 5K3OA 3LUDA 1QF7A 4U39A 4O4JB 4GIBA 1NRIA 4E0BA 1Z6GA 4Z54A 3NV7A 3HRIA 2EJUA 4DF3A 1SPXA 3P4YA 2WFAA 5C7IO 3ZQUA 3L9XA 3EVEA 1VE6A 4RKRA 2D5CA 3C15C 3EVDA 3KZKA 4NOLA 4ID9A 4O4IA 3MCTA 4G2NA 5CCXA 3R7SA 4CG1A 1NF9A 3GVCA 5KOJB 3IJ5A 4CEIB 4QGBA 1Q0ZA 2WJ6A 1FFHA 3PZRA 5FBZA 2M1ZA 4F4UA 3KEOA 4NENB 4DWVA 3E7WA 1B4DA 1T2VA 3JW8A 5IKPA 4OJKA 3UAGA 1E8NA 4RVUA 1G60A 1JHZA 3DOJA 3MTIA 5EMKA 4Z1MD 4BEJA 4F97A 5LKRA 3NU1A 1WW3A 2P5UA 3RTAA 4D81A 2X0RA 3JD1A 1OYOA 4IDAA 5LN1A 2C04A 5DKFA 1R4NB 2R8PA 3E23A 5KSWB 2PXXA 5EUCA 4KWHA 3AIKA 3LIIA 2HIAA 3MG9A 4FOSA 1Q95A 4FI3F 5HM8A 2FPKA 2W2LA 2DU8A 1XTVA 3HUTA 3RYTC 4F9FA 4LI3X 4B6SA 4DA8A 2FPSA 5JWOA 1KARA 1XX6A 2WHQA 4M9XA 4MI1A 2FMTA 2HR1A 3SYRA 1HGXA 1IN6A 4JBHA 1V1MB 3DPSA 1WTCA 3OCVA 3ZV5A 3DB1A 4MVJD 4MAAA 1XFDA 2JLQA 4WNAB 2JBHA 4JB3A 5ALEA 3ZV4A 5FOUA 2Y2UA 1EA7A 3LH5A 3FTNA 3DUFA 4E4RA 1WAMA 3HCEA 3QV1A 1KJNA 2J6CA 1W2GA 3D81A 2OENG 4L73A 3DE2X 5E0OA 4R6XA 2CN1A 3NKLA 5F76A 1M66A 5BWCA 1L7OA 2ZZKA 3T3EA 4MQUA 3RFUA 3LX8A 4YJDA 3PR2B 3IEIA 1CBUA 4PFJA 4UAGA 3UFXA 3ZCVA 1BWPA 3L41A 1R6UA 3LXMA 1JG3A 2BFEA 3PI7A 3IKJA 4MIYA 3N76A 3PXEA 1OLXA 1NR7A 1V3VA 1ZI9A 5AXAA 4AYTA 3K0SA 2GF9A 1FRVA 1U3CA 4GQBA 1ZI8A 1VCOA 1LKZA 4GBJA 3ETNA 1X77A 3PPYA 4PXAA 1OFVA 4XGQA 4PXSA 5LC1A 2ZPAA 5TIIA 3UAYA 1XT6A 3MOGA 2ID9A 2ZTLA 5HILA 1XO1A 3FHOA 1R8SA 3OT1A 4PHHA 2UVDA 3W6UA 3ZJYA 2FWNA 3M9LA 4BMYA 3U09A 3C6BA 2C4NA 1J25A 1FFBA 3PLRA 3WGQA 4Z9YA 1B6RA 5L4NA 2EBUA 1EVYA 1PTJC 2GSWA 2ECFA 3AR8A 3PXDA 5DDIP 3G5AA 3L4KA 1T3SA 3ZJ4A 1Z33A 3IEVA 4KO2S 5YASA 3U6BA 2A59A 3K8YA 4FK8A 4LZOA 5B36A 3PA8A 3ZQJA 4ICIA 4DRXB 3FRHA 3ZZTA 3CM0A 1HDRA 3TO5A 2DECA 1QWOA 4HZIA 1EQ2A 4HAUA 1JJVA 2GS9A 2YVQA 3K09A 4L28A 4F4HA 4FKZA 2BUAA 4LYGA 4QNNA 5CB4B 4RULA 1EFDN 1LSSA 1QPGA 1TVMA 2C7BA 2DFDA 2Z3VA 3GRPA 2IEIA 1FQKA 2A2ZA 2C84A 4TQAA 1HEIA 3TMKA 3ELYA 4IFTA 2CB9A 4KYVA 1J2UA 4L5YA 5DRTA 1UBUS 1VC2A 5D3MA 3HR4A 4BMSA 1NBEA 1P4JA 2ONKA 5DTRA 4DLTA 4W63A 1D04A 1U5AA 1RQXA 5KNBD 3AF4A 1FMCA 1R15A 2LCIA 3UJAA 4NBLA 1RAGA 4MHTA 5LIRA 4UUMA 1TO2E 1Y7LA 3IA7A 4I5EA 4GFDA 2Z8XA 4OGFA 5ARCA 4NMHA 3WAGA 3WJ7A 2ON6A 1RWXA 1Z73A 1CUWA 2QRZA 1VPWA 2XBMA 3AIOA 2D5BA 2OP1A 2QYSA 1LEHA 1MX5A 1FX1A 3PEUA 1PNQA 1K8YB 3QX9A 3AVWA 3AFNA 1NL3A 4GPD1 1P4HA 1NBMA 4HC4A 1MD9A 4HYTA 5H68A 4DGSA 3L04A 2Q5FA 3A3NA 2R1TA 2E4ZA 1C3VA 1H1LB 3HEAA 5AOBA 1VDMA 1EFPB 5EEHA 3QBJA 4G85A 1W0JD 3T3PB 4DG9A 4QA9A 5CVJA 1X3LA 1WU8A 2XGMA 1J0DA 5EZ6B 4D43A 5F1KA 3SYNA 4MV9A 1MX9A 3ROKA 4HWTA 1A76A 1OB2A 2P90A 2I2DA 2ROQA 1EG7A 4QFDA 1L5ZA 3HLYA 3SYMA 1PX0A 2W0MA 4H7HA 2WF6A 3I28A 3BJMA 3RIHA 3B6KA 2EJVA 3OU2A 3WJ2A 3L6RA 2VN8A 4XR9A 3I9JA 2ZJFA 1ZN2A 1K4MA 2YFQA 3CNEA 4H18A 1G2IA 3TRDA 4ALNA 2J9FB 1TCAA 1IN4A 4G5XA 4BZZA 3G0BA 4O2BF 3TFQA 2DRIA 1ISRA 2O2XA 5CK4A 5BVGB 3ROMA 4MKIA 3NC1C 4OOFA 2H3HA 5JSKA 4HQ0A 5MGBA 3GY0A 1IY0A 1X1SA 1Z47A 3C3EA 3A4TA 2Q4TA 1DAPA 3MJFA 3AM5A 4NFYA 1T8WA 4IOLA 2IUFA 3Q12A 1YJ5A 4JU8A 4XI9A 2ERCA 3VZPA 1XMXA 2IZ7A 1W1WA 1EFAA 4QQNA 5TB5A 4YJ2A 1KI7A 3ZH2A 4DM3A 5C8YF 2C61A 5B2ZA 3PUIA 4YMTA 4Y7CA 3ETLA 4ZJZA 4B3DA 4WVLA 5I9NA 4AKGA 3AEQB 2C2HA 1W30A 3VZCA 1IUPA 2BKVA 4V1CB 4EA7A 2BWJA 2RHBA 3SQDA 2XE6A 3IOMA 3SC2B 2WPDD 1SQSA 3C3WA 4JBGA 1HE8B 4B32A 4CE6A 4D8UA 2ZAOA 4EFDA 2AN1A 3TWOA 5IZCC 3V4PB 1XUOA 1IBCA 1BIFA 1ODCA 1KH3A 3VAZA 1XVIA 1HE4A 1G4HA 4P7FA 3GD7A 3WKAA 3X1MA 4I2VA 4IMRA 4CG2A 5EIHA 5KOHB 1BVRA 3JZAA 4RF3A 2PFGA 2D1YA 4C88A 2O8EB 1KU0A 4HHEA 1DC4A 2R48A 1QRUA 4J07A 3ZCXA 3H42B 2CSUA 3MGGA 3PB3A 3HU1A 1Z6QA 1N0HA 3H2ZA 1DBIA 1T9DA 2HDOA 3DBRB 4HB4A 1YQTA 1ZGAA 2IYPA 2EX1A 2KM1A 4B80A 3BAZA 1MJ5A 4IHJB 2WKSA 3SVLA 3LLVA 4GKAA 3NC0C 2X1HA 2B5WA 3WLFA 1KFKB 4O25A 5C0OE 1U6IA 2A7XA 2H1OA 5ALGA 5DX0A 3WLAA 1BOOA 3GCDA 2OO3A 2VSFA 4MW5A 3EOZA 4B3BA 1Z5PA 4QDJA 4ZDJA 3FCUB 4MRMB 1AO3A 2A0FA 2E48A 2YNMA 1CDDA 1L4HA 1KH2A 2AFHA 2HMWA 2YOGA 4HWKA 4S1NA 4TMKA 3DOOA 1R50A 3D3KA 4L3OA 2QN7A 5KKCA 1XP8A 5CLIA 3F1KA 5FNVB 4CWAA 1H3EA 1ESEA 1GT91 3AH8A 1L5KA 3QVGB 1RKBA 2B8JA 4JX9A 4N54A 1K4YA 1UT8A 4Z7JA 2OFFA 2HA3A 4EHHA 2J3IA 2PKQO 2R7AA 1DBWA 2RBEA 1IG3A 1NVGA 1U8YA 3KL4A 4OXIA 9LDBA 4MUEA 1ZH6A 5AKEA 5FYDA 3IJRA 2VT6A 3KAJA 1NQVA 3EXHB 2XUIA 3D31A 3Q88A 3AUSA 4JB0A 4CEJB 1MT3A 1Q44A 2CD7A 2I7TA 3PC7A 2VF8A 2MDTA 5CH8A 4GL2A 4N0PA 5DZSA 2WJYA 4RF4A 3RJZA 3S7ZA 3Q6MA 5ALOA 4CQJA 3TECE 1SBTA 2XMZA 1SD1A 2J3EA 2LDXA 3M3HA 3P2EA 4Q9LA 1QOZA 5JAQA 2D1RA 2ZJ6A 3DMHA 5AW1A 1SULA 3RO7A 3FVRA 3FIJA 1JJFA 1QO7A 4BOYA 1WEHA 2XRFA 3IYLW 4GI2A 4TV9A 1G64A 3N59A 4S0XA 2BP7A 2QTVA 2Y1CA 1TPYA 2EJWA 4KFUA 1SK9A 2EZUA 3UC5A 3AW9A 4DBVO 3PGA1 1FMJA 2ZTVA 4J75A 4MKFA 4F1KA 1I3NA 2LKDA 3EZGA 5THQA 3IESA 3GFSA 4BMZA 5TLSA 1O08A 1TTQB 3HUEA 3BOSA 3G2MA 2WD7A 3FZNA 2ZRQA 3K5PA 3TD9A 1G20E 2G5PA 4FZRA 4YC7A 1DAEA 2R4QA 3PHJA 3PNPA 1Y4DE 1A9XB 2QL7A 3A28A 4IIEA 3AR4A 1IXKA 4WOKA 2OLKA 4KMRA 1N9ZA 3B1WA 3URMA 2A88A 4G0OA 1HY3A 3DBHB 4BIIA 4IZ6A 4IX1A 3LA6A 1DCMA 2XGGA 1BN6A 3AIIA 4EKIA 4PYJA 1B8VA 2W70A 1AQ6A 4RANA 1T9GS 4V24A 1Z6AA 3B9BA 3NEJA 1T15A 3ELWA 5KX5A 1J9ZA 1NW3A 3QHAA 4RFVA 1DAHA 4UNQA 1VMIA 2A67A 3T1TA 2A5YB 4S12A 4Q4DA 2VQDA 4QYIB 5JH7B 4DR6B 4BPRA 2RI1A 1GAWA 2FEAA 3A32A 3TRJA 1Q16A 1KJ9A 1XLVA 1H8EA 1KZ1A 4KZPA 3G23A 4TS4A 4WKNA 5EHGA 2IS4A 2I65A 4BZXA 2O5EA 4Q12A 1VRVA 4BRUA 1WQ4A 1I9CA 2FQQA 2L19A 3DNPA 4ZZ2A 2Q1XA 4PQRA 3AVVA 4RADA 4YA6A 4E4TA 2AFIE 4ZI7F 1BXGA 3F6YA 5KJEA 4AL4A 3D7MA 5B1SA 3NJ4A 4M6WA 2HSJA 3QXHA 1YR3A 1IJFA 2W7TA 2QV0A 1RNLA 3QBVA 4HB3A 1YBAA 2HL6A 4OI4A 5JW6A 5JUWA 1BKSB 1UBLS 1FTYA 1I2BA 1MC8A 4B71A 4M0CA 3T54A 3VC3A 5DASA 3BQ9A 4C4RA 1NPTO 3HACA 4F11A 4Q7LA 3NT4A 1IUNA 2HFKA 3OI7A 4IDEA 1GLGA 4J0CA 3CIFA 4XDYA 3ZXIA 4QKQA 1H2HA 4R31A 4BLUA 3WGYA 4DB4A 4KH0A 1MVNA 4NV3A 2YRWA 5AUPB 5ILQA 4BV8A 3ZHVA 4Q21A 4QWWA 4JL6A 3BL6A 4Y6QA 2GHQA 3NBMA 5ALYA 4NK5A 3T3MB 4LX8A 3T1VA 3DHEA 3ESQA 3ABSB 5I7AA 4ETMA 1T8RA 3SQXA 3MILA 1CQZA 2B4RO 2EG5A 2Q3EA 5T67A 3SBOA 5CX4A 5LP1A 1D3AA 1THZA 1CV2A 2XQJA 3G8BA 3EZFA 3NO4A 3OY2A 5E7JA 1IQUA 5E4YA 1AB5A 1HYQA 4B9EA 1I94B 1HSOA 2P68A 3HP1A 5FI1B 1Y6QA 1X0VA 3L1HA 2QHXA 2VATA 2EBWA 1WXDA 5KDLA 5BR8B 2O4UX 1UDRA 1IZZA 4H1HA 4IR7A 4LXQA 2BDEA 1QFZA 1R7RA 4BX2A 2QL6A 1DLIA 4MQFB 1KDVA 5JTTA 1AGYA 4YXFA 4RTSA 3Q7TA 4RJLA 1RXWA 2H7XA 3AF3A 3GR6A 4JYBA 2W43A 4BKUA 4EJSB 5DYIA 3E6AA 1H2ZA 3GCXA 5A2GA 3AVPA 3BB1A 3BIOA 2BE7A 3AO0B 1N9KA 3PPXA 1SVSA 3A1UA 3H5LA 4RNCA 3R0IA 1T1IA 3L0IB 4HDKA 5P21A 3CSUA 3P9CA 2IYVA 4D8XA 5E7IA 3K9QO 2ZR0A 3EDMA 1GAEO 3HB5X 2CWDA 3A3YA 3IUYA 1RP7A 3GYBA 1U2EA 4HGYA 4NOKA 3DZJA 1RLIA 2WNHA 2QT0A 4OMUA 4Y2JA 3DKPA 2QRPA 1DAFA 3F7TA 4YAJA 5JANA 5LZ4A 4AY6A 1NVFA 4DFDA 4KR3A 1DJQA 1SXGA 1YVPA 3FSGA 1XDWA 2IHTA 2JA1A 3OJ0A 4DLLA 4ZCTA 1XRPA 4GEKA 5FPTA 2O1EA 5FUBA 4IUBS 1GG5A 1ZDMA 3BDVA 3JQGB 4ND3A 5HKLA 3RTCA 1JV2B 4HK4A 5DM1A 2CFOA 5I7UA 4MYTA 3LDUA 3GLFE 1DOAA 1IMJA 3PTLA 4FILA 2BELA 3CVUA 4C14A 5HW0A 5FEMA 2D7DA 3MHPA 2B1IA 2W37A 1RVV1 5EJ7A 1L4BA 3AEKB 1EB9A 2WVGA 1AMUA 2O06A 3H83A 3QF7A 4K9KA 3FR8A 3JWHA 4G4SP 1HLGA 1URPA 4A8PA 3COJA 1NMSA 4P7KA 5CB4A 4HPWA 2WMYA 2WFMA 2OBBA 2PZMA 1IU9A 3FPKA 4HDRB 2QG4A 2YTZA 2X19A 2PT7A 4PC7A 4S3MA 4HB2A 5C1OA 5A1JA 5LR6A 3ACDA 1HC7A 1KO1A 1NMZA 3EGEA 4K9SA 1T1SA 3OU6A 5F2KA 2CV1A 4MW1A 4BFXA 1NWCA 3CKYA 2CFCA 3NZEA 2J3DA 5MFPA 4EZIA 1EK0A 1Z7BA 1X9HA 1QH1A 2PZBA 3IOYA 4FYKA 5FPYA 4YR7A 5HKOA 1H2EA 1TYZA 2YYAA 2ZIXB 4DUZB 2DXIA 4I5GA 3K16A 2CZGA 3D0OA 3NHZA 2I4TA 3O73A 3VO2A 1BW9B 1VA4A 1H2YA 3RG2A 1V26A 4H3VA 1QX4A 5JU6A 3MTGA 4JSYA 1AA9A 4K87A 1FXUA 1NAHA 3E8MA 1BRTA 4S1OA 3GQBB 1T5HX 5AJHA 5T4EA 3S70A 5DXJA 1XZEA 4TM7A 4Z1OA 2QBYA 4MYUA 1VPVA 1YE5A 4PO3X 1I2ZA 2QRMA 3GJ0A 4QNRA 3HDQA 2DBYA 1A9TA 2OBLA 2Q1TA 1MU0A 1CR4A 4BIMA 1HQCA 3FI0A 4TMFA 2A0KA 4RKYA 1DZIA 5JO9A 3KB8A 3IAUA 4FT4A 2IXTA 2GM5A 3CMCO 1X0XA 2JG3A 1SIWA 1FLDA 2UZ0A 2KQUA 4IDHA 1FYXA 2DR0A 4B4UA 5H3HA 3RVSA 1KAGA 1V11B 5TRTA 3RANA 2QMOA 2J67A 3LP8A 1JR6A 1Z0KA 2HIGA 1I30A 4FNGA 1INLA 2CE2X 5JYCA 2Y1KA 2VLBA 2I2AA 3LCVB 3CPJB 1I2DA 1P6XA 1NI3A 1V7PC 3N0RA 4NESA 4MKZA 4MINA 2YR0A 1PSZA 2X6QA 1R9JA 1ES9A 4YRCA 3ZXUB 4ARSA 3H0KA 5K3BA 1ZGBA 2WP0A 3I8XA 3MLAA 4WKBA 4N5NA 3KT6A 4GZ5A 2O3JA 4QOIA 3HWWA 2QRHA 3QG5A 4EHKA 2WT9A 1QH8A 1RZVA 4RGBA 5AOVA 4JLSA 3WRYC 1B0UA 4P38A 4LJAA 1Q0HA 1EIWA 2LVBA 4INZA 4OJTA 4B0OA 3HA3A 5LWQA 4B46A 5JFTA 2XD4A 1UODA 3PNVA 2QG6A 4BFCA 2R7NA 3LPDA 2C5LA 3PU6A 4H6XA 3FDZA 5H9WA 3MW8A 3V2GA 2HWXA 1DQPA 2VF7A 4BDSA 5BMVB 2OAEA 2O2YA 3A9VA 3PX3A 1IPHA 4OREX 3K32A 3WGIA 3CLKA 3U16A 3DM9B 2ZM6B 3SLGA 1DJPA 2YV2A 1C8VB 3DFMA 1QV6A 2ZJ2A 3UO8B 4RTOA 2VHZA 2QD5A 3GLSA 3MNFA 3UEOA 3IPAA 4P1ZA 2ZUSA 4BP9A 3V33A 4DARA 2QR3A 5T4HA 1TK2A 1FTWA 4AJ4A 3SHWA 4Q0MA 3NWJA 1JFVA 2E3JA 3AUJB 3IQZA 2GA9A 3KSMA 2CLLB 2X5NA 5K4GA 4I5FA 3SM9A 5E1MA 1D2GA 2XUOA 1LPAB 2Q7OE 1P9RA 1X13A 3PUKA 5H0IA 3S3TA 2EEZA 2NZ8A 3U40A 1NJGA 2X3FA 3IR5A 4QRHA 4COKA 4K8OA 1F8XA 3U7QB 4WKGA 5BMOA 1BDHA 2ZS8A 1SVOA 2B0JA 3AEZA 4JSRA 5M29A 3K5WA 1LPNA 2PMKA 2JFGA 1EFCA 4G1CA 3WV4A 4MDYA 1Y1PA 1G8JA 1FYFA 4OQFA 4BKMA 1I9GA 4UM9D 3SICE 3BFPA 3GFGA 4UCXA 4MUXA 4NFHA 2BAGA 4MUNA 5ABPA 2D0OB 1WV0A 1W87A 1ZN7A 2HIHA 2R87A 1WCIA 1EK2A 4UASA 3SEQA 2EZTA 5EE5B 1S2IA 3GK3A 3IPYA 3QENA 2O2CA 5ESRA 3MFYA 3VU9B 4K0KB 3KJEA 3GVHA 1RXUA 2ZBGA 1YCHA 1J99A 1Z2AA 1GTJ1 2AZDA 2IHUA 2Z58A 1XTUA 3EMBA 3C8DA 2X0DA 1C2TA 4FYWA 4DCTA 3TRIA 1P31A 3IPCA 1TZCA 4DJTA 3I9V1 4IRUB 1EDZA 3UG6A 2DJIA 2HPHA 3H8WA 4YGXB 1QIMA 3EPRA 4C0HA 5MN6A 2Z3ZA 4D9HA 1E59A 1BFKA 1KBOA 4J7CA 1M8PA 4QHYA 3NASA 3TAHA 1F3LA 1KO8A 1VPEA 3KPUA 4OXYA 1R6XA 5EVCA 2OL4A 4QOFA 5AVZA 2GN9A 3VR4D 5J4KA 1YKSA 4XUEA 3W2IA 3MAJA 3OCCA 2ZUFA 1SVUA 3WB0A 4JBNA 3FYUB 4EY6A 3D8UA 3DAPA 2HT6A 3GLQA 4OQNA 1FSGA 3UUGA 2O2GA 3IFSA 3MQ2A 4HUTA 5DBIA 1N4DA 4KXYA 3FWYA 4XH9B 1MABA 4MV5A 4WJKB 1LX6A 3FGZA 4D45A 3VSDA 5DGCA 1J20A 4L5IA 2Z4TA 5LXTA 1JIKA 3L0OA 4Q7EA 3EBPA 1TZ2A 2HA4A 1NUTA 3FMPB 2G7ZA 1RAFA 2KLHA 3ANNA 4QPZA 3OO0A 1H2WA 4V3CA 5FR1A 3RKSA 1SOVA 1T5SA 3R75A 5DHQA 2EDCA 1LNQA 2Z5LA 1CDOA 2OEPA 4JDPA 4M21A 1COWA 4RWZA 4KLZA 4XWYA 4URVR 2F3TA 1KZHA 4KRXA 3WA7A 4FOPA 1L1RA 4NCJA 2AA3A 1HQDA 3H86A 4NJOA 1SU6A 5C81A 2IODA 1AKMA 1T5DX 3WYEA 1CQPA 5U1PA 4A82A 2Q9UA 3IS3A 2Q3MA 3PD7A 4WLEA 1ZQ1A 3SZMA 1N32B 4F7WA 1N2IA 1Z06A 1W581 2IPMA 1ZVVA 1P33A 4TXLA 2XWQA 3CLHA 5IYZF 3UWPA 1QTQA 1W4AA 4RVDA 1PG2A 1JKIA 1LW7A 5SY4A 1QVAA 1R6BX 4W5JA 2VEDA 4PNZA 4TV8A 1UMCA 3KPYA 1N2CB 3X1YA 5D85A 1GP2A 5FQOA 1XZKA 2OHGA 2OPHA 2CBXA 4C0JA 4QXPA 1G4AE 4CIWA 4M9ZA 3ABZA 4R9RA 4ZHQF 3RI3A 3RWMB 2J4FA 4S35A 3RVKA 2IS1A 1GV1A 4TSKA 5DEOA 5FOXA 3DD5A 1X14A 3ZHZA 3E2PA 2V7GA 2OBMA 1SXPA 4BB5A 4EF4A 1VKJA 2H07A 3BRWD 4YMGA 2ZBRA 3SIPA 2AN5A 5D3QA 2NSHA 4EY4A 1V95A 4B7XA 3C8HA 5KHLB 4XTRA 1YNSA 1ZA1A 4M60A 3A05A 4WJZA 1KU6A 4A36A 3TF5A 1E2BA 4GF5A 4YLGA 2AKEA 2C8KA 3DO5A 2PX0A 4RXTA 1L5LA 1U7TA 8OHMA 4A8JB 1ND5A 2D1TA 2WM8A 3M9XA 5TS2A 4UMEA 1CT9A 1U7UA 2I2BA 1TAGA 3BIXA 2FE1A 3E1KA 2CV0A 3UJBA 1B6SA 2E21A 2GZSA 3OVMA 4LNUB 1QYCA 3FNIA 4BS9A 5CFMA 4LRWA 3QPAA 2H54A 4LAFA 5HHTA 1PTJA 3QHPA 4U7TB 2O3SA 3M4ZA 1VCNA 2E87A 3CVVA 2GZ2A 3L7JA 3M5DA 4DIMA 3OFNA 4U6SA 1Y3AA 5CLQA 2PWBA 5J1TB 1N4AA 4EX6A 3ITKA 3Q5EA 1VFPA 1E64A 1QE0A 1U0JA 1U99A 2CUNA 4XWAA 1XEWY 5BSEA 4LF9B 2VJYA 4RXMA 1L1EA 4LGVA 4FC6A 1UC8A 3CPEA 1ZJWA 1UZNA 2C5FA 2CZCA 5CDTA 1QB7A 5AVUA 2EW8A 2JL1A 2PS9A 3GEEA 3DFFA 3OHSX 4YONB 3UWDA 2NZYA 4IGEA 1EWRA 1U1CA 1U3WA 4K2AA 4EX7A 3GUZA 3AF0A 2JF0A 1QCZA 4GP6A 4GYYA 1YRLA 4TKLA 4ZHSA 4RMHA 2XSZD 4OQZA 1SVNA 3RKUA 3QW4B 3AGQA 1I01A 1UM9A 3VGPA 1S96A 2I71A 1JMYA 2PGDA 5HIAA 5DWVA 3WDKA 1WCXA 5BYJA 1U6JA 2BMEA 5SICE 4AD8A 3T94A 4B3IA 5GGXA 2YMLA 2HJGA 3NTXA 4QPNA 4ZVQA 1A9ZA 3Q9NA 1TQ8A 3T95A 1T8PA 4J4BA 4AWBA 1EQAA 2X9GA 3G17A 5ADVA 3H84A 4KE6A 2DHRA 3LY7A 4HGNA 2GZDA 3H9JA 2RGBA 2G17A 3QX7A 1K7XB 2E2WA 2XMPA 3D8SA 4RACA 3AHFA 1I3CA 2YHBA 3VXKA 4DY6A 2D5IA 3TMYA 5EIXA 4EHDA 1UDWA 1CNMA 1U8CB 2ACWA 4C7MA 3ADBA 2IOQA 2DH5A 3DT9A 1MHPA 4LF7B 3H1EA 1OC2A 4QOGA 4D0RA 3R0VA 3BK7A 3EFOA 4REQA 2DPHA 4AK9A 1O03A 3LP6A 4UPDA 1OKKD 3C8ZA 2R66A 1L5MA 5I51A 5CNKA 1KMQA 3IAXA 1RWMA 3BICA 3KEGA 4HPJB 1YQQA 4G0XA 2PO7A 2IYEA 1M1YB 1XTZA 2NWQA 5LU8A 1JFLA 2QGZA 2QA5A 4XE5A 3WAJA 4MDFA 3D2AA 1JDUA 2QTFA 2JK1A 1QHYA 4E6EA 1NX6A 2BVNA 4YRTA 2EG9A 4DCMA 4JOSA 2FPLA 4MS3A 1NMYA 1S0UA 4ZDWA 3UGKA 4GE0A 5BWOA 1T9GR 3F4BA 3PGXA 3QYPA 2W2XA 2AZ4A 4O1HA 2AMYA 4CL2A 3DEZA 4FHCA 2A92A 4LYHA 4B6OA 2E55A 1DADA 2ZI9A 2ZRLA 4HKTA 1XMSA 5G4LA 1NSYA 3T38A 5KUTA 5CB0A 5BQ3A 1F0PA 3LCJA 4IJMA 4OMFG 2FLKA 4TVKA 1I51A 4UE3S 4CUJA 3OZCA 4O4JF 1RZRD 4BJ6A 3G5MA 3X0DA 4YWJA 1F12A 1R10A 5ALHA 5E1OA