3VPSA

Structure of a novel nad dependent-ndp-hexosamine 5,6-dehydratase, tuna, involved in tunicamycin biosynthesis
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
303
structure length
303
Chain Sequence
KHRILITGGAGFIGGHLARALVASGEEVTVLDDLRVPPMIPPEGTGKFLEKPVLELEERDLSDVRLVYHLASHKSVPRSFKQPLDYLDNVDSGRHLLALCTSVGVPKVVVGSTCEVYGQADTLPTPEDSPLSPRSPYAASKVGLEMVAGAHQRASVAPEVGIVRFFNVYGPGERPDALVPRLCANLLTRNELPVEGDGEQRRDFTYITDVVDKLVALANRPLPSVVNFGSGQSLSVNDVIRILQATSPAAEVARKQPRPNEITEFRADTALQTRQIGERSGGIGIEEGIRLTLEWWQSRDLDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords NAD-dependent epimerase/dehydratase
publication title Biosynthesis of nucleoside antibiotic tunicamycin proceeds via unique exo-glycal intermediates
rcsb
total genus 103
structure length 303
sequence length 303
chains with identical sequence B
ec nomenclature ec 4.2.1.-:
pdb deposition date 2012-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3vpsA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 3vpsA02
4WLVA 4BO3A 4BNKA 5THQA 3ZWOA 4BB5A 1XQ1A 1KVTA 4XGIA 4RGBA 4RF4A 2BH9A 2V65A 3JV7A 3PJEA 3X2FA 5EN4A 4MIEA 4NK4A 1HLPA 1B8PA 1R37A 3EVNA 2PZLA 3CH6A 1N9GA 4WCFC 5H81A 5JC8A 3SEFA 3ZWXA 1D1TA 3S2EA 2GN4A 2ZTUA 5U4QA 2FWMX 3H5AA 1HZZA 4PLVA 3IMFA 5FWNA 1LTHR 3QQPA 3RD5A 5FFFA 1H2BA 4BNYA 3CPSA 2VTDA 1JU9A 1PJBA 2FPPA 3E8XA 1TLTA 3NDIA 3Q6IA 4G2NA 4J49A 4PCVA 1T2CA 3OIDA 3ETGA 3RVDA 3O8QA 4HKTA 2ILTA 3DL2A 1AUPA 1ZH8A 3FTNA 3DBLB 4PLGA 1U5AA 1Z7EA 1I2BA 1DAOA 3UICA 2D1YA 2HRZA 1LDYA 4KDEA 3JQFA 4CMBA 3PLRA 4D3FA 4B7UA 4AJLA 3IKTA 1BDBA 4UVDA 1IUKA 2JHFA 4NPCA 4CR8A 1ENOA 3EMKA 5HBRA 5JMPA 1A4IA 1OZAA 4IQGA 4BHTA 3QP9A 4CM6A 1N1EA 2Y05A 3GRPA 1VJ1A 2AA3A 2YDXA 1DJQA 1PR3A 1LRKA 3ZWBA 5CDUA 2IDZA 3L9XA 1SZJG 2O7SA 3ORFA 1PR9A 2GN9A 3ON5A 1QLJA 1PGPA 5CEEA 4JX8A 3A1NA 5A3VA 2NTNA 1SMKA 3DHEA 4H7PA 3EC7A 3JQBC 4MO2A 3I9KA 3G49A 2IEDA 1IHXA 2VRCD 4R1UA 2ZKLA 5L4NA 5BR7A 5TC4A 3B20A 1E92A 3H2ZA 1JQBA 1MXHA 1PEDA 1B3BA 5I7EA 4CM9D 1DIBA 3DOJA 1R4NA 1YBVA 4KQWA 3KSZO 3MTGA 4Q3EA 1T4BA 3UF0A 5KJFA 1TT5A 1UDCA 3EVTA 1Z82A 2YYYA 3GEMA 1LEHA 3MTJA 4R68A 4BO6A 4CQLB 3OSUA 4FGSA 4BNZA 1PU2A 3BMOB 4M89A 5DBGA 3VDQA 3MJCA 4BNTA 1XSEA 2VOJA 2EXXA 3BMNB 3SJUA 2F00A 1M6HA 4PLZA 1R66A 1NVMB 1SO8A 2Y68A 4GL4A 2FSVA 3ZWAA 2YV3A 3ETEA 4D3SA 3E9QA 2HMUA 1ZO8A 2W2LD 1NHGA 1NR7A 1UDAA 3HADA 4E4YA 4RF5A 4N7RA 2GPTA 3I9LA 1EUDA 4OOFA 4XB1A 1CIVA 1FJHA 2AW5A 2CF6A 2ZJ0A 4NG5A 4GVLA 4GGPA 5CG1A 3EW7A 2JCYA 1I33A 4IUYA 4NI5A 4G65A 4P22A 2POQX 4MKZA 5F5LA 3U3XA 2JFGA 1E7YA 4UEOA 3D3WA 3LLVA 4IMPA 5IAAA 1ISJA 1SB9A 2YQ4A 4CLRA 5I9NA 2VUUA 8LDHA 1T25A 3BA1A 3FWZA 3QVWA 4JQCA 1GZ3A 3IL2A 1XELA 4GKVA 3FCOA 3DO5A 5BSEA 2NV6A 2P9CA 1UXGA 2JD0A 3LC2O 4YYZA 1QMGA 4YJHB 4ZRMA 5JPIA 5L9AA 1PGJA 1M66A 1XU7A 4M87A 3I5MA 2PA3A 3GGGA 4BNNA 2D59A 1DJNA 5L7TA 4GX1A 3INRA 5T57A 1KERA 3LDHA 4TRMA 3QY9A 2BI7A 3DFUA 4NJOA 1PJLA 2PWZA 3H7AA 4BNJA 4ID9A 1ZKMA 4IXWA 2FRDA 3G79A 3E6AA 4CQMA 2VYND 4D3DA 3ZU5A 3EDMA 1Y8QA 3D64A 3ZNNA 3JD2A 2C54A 2WD7A 4B79A 5T64A 3VZSA 2HO5A 1EFLA 3DC2A 3M1LA 5KNLA 5EESA 2HK9A 2Y67A 4OKNA 4XEHA 1GEGA 1Y5RA 4PLPA 3HN2A 4LSMA 5JW6A 1NP3A 3RJ9A 1C3VA 3QW2A 1GV0A 4DBZA 3RUAA 3FN4A 3PXXA 5HS6A 3FNEA 2GYYA 3JD0A 1YB1A 1KEPA 3GMSA 2JD1A 3S8MA 1WWKA 4FFMA 3L6OO 5KJCA 4E6PA 3Q1LA 3NDRA 1JTVA 4Y6PA 4YT5A 5KVVA 3NV9A 1DAPA 2Y93A 3GAFA 4RCVA 3VH4A 4PLTA 1VM6A 2B0JA 5A9SA 4G81A 5AYVA 3O38A 4YACA 4OIMA 1Q7GA 3ROKA 1WDKA 4JJIA 4XDYA 4D41A 4CODB 1GZ6A 3MJTA 1ONOA 3HDYA 5ILOA 1U3UA 1NNUA 3DFZA 3ZV4A 1GUFA 3DMYA 1D3AA 4A26A 4PN3A 2GSDA 3IC5A 4J4HA 4KTVE 3WGIA 5TQVA 4FGWA 3D4OA 1HSOA 4H3VA 1R0KA 4J2HA 3WTBA 4Z0PA 4CMIB 1UXKA 4ND5A 2R2GA 1NQ5A 5H83A 3FI9A 4MP6A 2HK8A 2OBYA 2WJPA 2CD9A 2DT5A 3E1KA 4LMPA 1UZNA 1AGNA 1YDEA 3GVIA 4XQ9A 3WGTA 4TKMA 1ZUD1 3T4EA 1CJCA 1GYQA 3RFVA 2NM0A 5ADHA 4FFPA 1YB4A 3P7MA 2J3KA 3PYMA 5JCXA 2V6GA 1W8DA 4IQ0A 4QQRA 4RPJA 4JGBA 2Y1EA 2PR2A 4PLFA 1EUZA 4WEQA 4GAEA 4LSWA 2P2SA 2XXBA 2Z1NA 5ITVA 1F17A 3DAFA 2WD8A 4WLEA 4TRRA 5TIIA 1DHTA 2PLAA 3NDJA 3W8EA 2DTEA 1X1EA 2VWHA 4AJNA 5KJEA 1ML3A 4BNMA 4EUFA 3D3EA 3FHLA 3DR3A 3FNGA 2C7VA 3R6DA 4L9RA 3UN1A 1RYEA 2Q3EA 2B4RO 1ZEJA 1R16A 2AG5A 2I3GA 2ZJ1A 3H8VA 4CMKA 1GTMA 1WPQA 3M1AA 2JL1A 5CDTA 3MJEA 1F12A 3WMWA 4XA8A 3JQGA 3VH3A 3O9ZA 4DIOA 5L40A 1MG0A 2J3IA 4TZKA 3U4IA 4YEDA 4CLEA 5EJ2A 1TEHA 1YH3A 4DBVO 1U8FO 1ZJZA 2Y1GA 3GK3A 4L4XA 1K89A 1XKQA 5DBIA 4J9UE 4F6LA 3NGXA 3OJOA 1Y1PA 3NT4A 1YL6A 3JQ7B 5IN5A 4IDEA 2RIRA 1BW9B 3OJEA 4JBIA 1ONNA 4FIZA 4U6QA 1YBAA 5TJHA 1UR5A 3TRIA 3RWBA 4K9DA 3FBTA 3A28A 1PL7A 4JBGA 1NX6A 1A71A 1HRDA 2CF5A 3OECA 4HX5A 4MIOA 2ZYGA 2P5YA 5DP1A 2JFFA 4RO0A 3F4BA 3RUFA 4ZQFA 3E82A 4JNKA 3U09A 1IHYA 3WS7A 3BHIA 1PWXA 3DBRA 1GQ2A 3WGZA 1R4MA 1NQOA 4FSHA 2FN7A 1HETA 3GQVA 1OMOA 3TZHA 3KBOA 4QXMA 1HDRA 1QYVA 4F45A 4IDDA 1X0XA 1J49A 5IDYA 3KSDO 1PWZA 1X15A 4D0RA 1R6DA 3H9JA 4GVXA 4FW8A 1ZMOA 4BGIA 1UP7A 1QR6A 2NVWA 3AUSA 4EYEA 3ICPA 4BO0A 3NUGA 2EP7A 3X2EA 3G0OA 2RHCA 4B4WA 4KUEA 1WVGA 3HDHA 3W4KA 3R1IA 2ZYAA 3CEAA 3RBVA 4QUKA 2ZTMA 3WIEA 2HMVA 4P4NA 3ZWPA 1G0NA 2TMGA 2BRUA 1FMCA 3C1AA 4R41A 3TZCA 1G1AA 4RZIA 1BHSA 4WNCA 2IE0A 1M2WA 3TZQA 1WAMA 5FYDA 1XWFA 5G4KB 1PS9A 3CMCO 4K6CA 4DPMA 3GDOA 4F6CA 1BWSA 1PQUA 2LDXA 3UCXA 4IGFA 4S3MA 1RM3A 1GYPA 2DTDA 4AICA 4BNIA 3WSVA 2DKNA 3E48A 4J7CA 2ZB4A 2EGGA 4BO7A 3GNQA 4HADA 3ZW9A 1V0JA 1VE9A 4PG5A 1Z6ZA 3UAGA 3QVTA 4ZVVA 3VOSA 1Y8RA 4IMRA 4D79A 4URFA 3OJLA 2QIOA 3ZW8A 1HDCA 1AXGA 1HEUA 4FC7A 2OOSA 1NYTA 1C0IA 3U9LA 1UDBA 1D7OA 1YONA 1RM4A 1ONPA 2EJWA 3ENKA 2Y1OA 3PJDA 3VPXA 1UXIA 1V8BA 1YKFA 1E5LA 2ZCVA 3K2EA 3RBXA 3QVSA 3ZHXA 3ZWYA 3NGLA 3JYLA 1EQUA 4J7XA 2CSUA 1VL6A 4FJ2A 1IYZA 5T5QA 1PL8A 3B1FA 5C7LO 4K26A 1H0KA 3I6IA 2AQ8A 3OA0A 1JWBB 4WOKA 3KO8A 3PIDA 1M67A 1U3TA 4Z3DA 2ZIZA 1HYGA 3GGPA 4P4LA 1PJ4A 1GZ4A 2VN8A 2RH4A 1C14A 1NXQA 2RBEA 4I8XA 4E31A 2BFOA 4E12A 4D7AA 4H16A 1B15A 4DMLA 1P0FA 5EERA 3NT5A 2BGKA 4Y6SA 2NVUB 1K6XA 4GSKA 3F9IA 2FP4A 4WCDA 2GERA 2WWRA 3I52A 2YHIA 3D7LA 1E0DA 4XQCA 3JD3A 4PLHA 1TT7A 2GZ1A 5KVQA 3Q3CA 4CUJA 3E5RA 3PEFA 3KLMX 1SPXA 1WP4A 1VSUA 1FDVA 4WGGA 1Y9AA 4YT2A 5CDSA 2VTEA 2A92A 4ALIA 4CLDA 2JJYA 3SJ7A 3EY4A 1ZNQO 2D3TA 5IZCA 5A04A 4A2CA 1L7DA 2HJRA 2Y1DA 5H82A 1MGOA 3F5SA 4TRJA 4TVBA 1DXYA 3KZVA 3PYXA 3JYQA 1FDTA 3G1TA 4XR4A 3QWBA 2O2YA 2FR8A 1A4UA 5COBA 3PWSA 1JKFA 2HQ1A 4CM8A 5JDCA 5B1YA 4XQGA 1NVTA 1E1MA 2VNSA 1P1IA 1E3EA 3RC7A 4PG8A 1BXGB 1DIGA 4J1NA 5DDIP 4GPD1 1BVUA 1DEHA 1HWYA 1YQXA 2DAPA 1C1DA 4XRRA 5AVOA 2GN8A 3HHPA 4PGFA 4EJ6A 4B4OA 1GQQA 3PQFA 3PJGA 3AU9A 1F14A 2G76A 3CIFA 1Z74A 3FSRA 3LT1A 4MP8A 1KOLA 3VPGA 4IJWA 3K8ZA 3ROQA 5B4VA 1IE3A 2LDBA 3INGA 4ND2A 1KVSA 3WBFA 3DB2A 2B37A 4IDCA 4M86A 5KJ1A 3H9EO 4WCFA 5T6BA 3PWZA 3AUAA 5JAMA 2I99A 2QYTA 3JD1A 4E0BA 3I4FA 3GC6A 1HE5A 4NDNE 3LSYA 4ZQHA 4CMJA 1NPDA 2WMDA 2X5KO 3CE6A 1DOHA 3QSGA 4RVHA 3IQDB 3RCBA 3VTZA 2ZQZA 1JVBA 3QE3A 1N7HA 4RPKA 1Q2XA 4OQYA 4HNHA 3U49A 3DTYA 1ZIDA 3NYWA 4ALLA 3FTPA 3QHAA 4MJLA 4B3HA 3O03A 3K6JA 4LGVA 2PY6A 4FOOA 1DSSG 3IOYA 2PGJA 4Y9DA 4TWRA 5EIOA 3MZ0A 3WDSA 1FXSA 1EFKA 1LLCA 1YOVA 3JSAA 1LDBA 1EMDA 2E49A 4AJ4A 1KEUA 2PNFA 1RWBA 3LF2A 1LSJA 1PJTA 2BFAA 4EW6A 1Q7CA 1E7WA 2NU6A 4A10A 5C3MA 1ORRA 4WLOA 4L73A 4J1QA 1T2EA 3GUCA 3ZCXA 4HBGA 2C5AA 1A72A 1H6AA 5JY6A 4RF3A 1Y5MA 1R0LA 5HRUA 3H6KA 5JAIA 5DF1A 3KYCB 2IYPA 2QX7A 1WDLA 1P77A 1FDSA 2DC1A 3GVPA 4WOJA 1NASA 1ADBA 1GFSA 2WE7A 4O5OA 3FF4A 4NJMA 1PZFA 4PZCA 2J6IA 1T4DA 3OEWA 4YT8A 1YL5A 4CLHA 1HE4A 3KTDA 5HA5A 1ENYA 3JQBA 4K28A 1AXEA 5JO0A 1JAXA 3KRTA 4RVGA 1E1NA 2DBVO 5JFOA 4FCCA 3S1LA 1P1FA 2C2YA 4DPKA 1OC4A 3GT0A 3WICA 1V3TA 5T67A 3FR7A 5IXSA 2OFPA 1NFFA 4E2ZA 5ENDA 5IZCC 3DXFA 3AM3A 4I08A 5KCZA 4ZN6A 4F46A 3TPCA 3GH3A 4B4VA 3U62A 4Y6RA 2PKRA 1EZ4A 2VRCA 2UUPA 4LVUA 3CSDA 4PG6A 1PIWA 1E1KA 5JDCC 2BHLA 4ZICA 1ZEMA 3ZV6A 2YHUA 1C1XA 3CMMA 4E32A 4MVJD 1G6KA 4N5MA 5KTKA 4I5EA 4EBFA 4CM9A 4B8ZA 4BNLA 3WYBA 3OQ6A 1SEVA 1GCUA 4NMHA 4HXYA 3OIFA 4A27A 1N8KA 1EVIA 1BXKA 4Q3DA 2YFHA 3AOEA 4YAJA 3WXBA 3A06A 1KYQA 1IB6A 2C5EA 3I3OA 5CEJA 4IDFA 3BMQB 3QWFA 1PZEA 3L9WA 5BSHA 4B8WA 2GDZA 2X5OA 4EI2A 4JBHA 2XXJA 1Q0HA 3HSKA 2EW8A 2VWGA 2HAEA 5GZ3A 1PSDA 4YBZA 3W8DA 2W2LA 2J8ZA 1ZXBA 4RORA 3HB4X 1JKIA 4D45A 2H9IA 4UUPA 2EG9A 2WE8A 4AJ2A 1A5ZA 2VNAA 4CLOA 4EJMA 3PTZA 3KM0A 3PWKA 4E5PA 4B3IA 4YJGB 3V1UA 5U1PA 1SCUA 3RC2A 3KSUA 2BI8A 1DFGA 1U2DA 3AY3A 3JYNA 1NWCA 1RYDA 1UAGA 3PIIA 4B7XA 4BMVA 3DMTA 3RASA 1BG6A 3DAPA 4E5KA 4P8RA 4CMHA 5GZ6A 4Y67A 1I30A 4A03A 4GKBA 1SBYA 2UYYA 4AJHA 2DBQA 3TDKA 4DRYA 1AHIA 4QX6A 3WFIA 3GPIA 1T2AA 2FR1A 3EYWA 3FNHA 4FPXA 4CM4A 3NTOA 4YT4A 3GZNB 3Q2IA 5BNTA 2AEJA 2EJVA 4XDZA 5IDQA 1VJ0A 1Z75A 2G17A 2HLPA 3GVCA 4QT0A 3FD8A 1NAHA 5C7IO 4RJTA 3VAZA 4BMNA 1MP0A 1YVEI 4K6FA 5C5IA 1X7GA 3B1JA 1U7HA 4OGWA 4BGEA 3KHUA 1GDHA 1MXFA 3D1LA 2VYNA 4L74A 5C7OO 1E6WA 1VL8A 2OUIA 4CMIA 4DYDA 5F3RA 4L4SA 2CDBA 4QO8A 1U4OA 4HFNA 3IDSA 1UP4A 4PG7A 3OH8A 4MVJM 2VHXA 4WE3A 2X5JO 1PS0A 1Z73A 3LLSA 4OKIA 2CUKA 1KY4A 1PTJA 4IIVA 2RH8A 4YQYA 1QYWA 2Q4BA 4DIBA 1M76A 4FFLA 3E9NA 1U5CA 3F4LA 4E33A 2JKVA 4BMSA 1CWUA 2PD6A 5DN9A 2O4UX 4FQ8A 4ZRNA 4YXFA 3HE3A 2OO5A 2ZYDA 4U7WA 9LDTA 1H9BA 5AXCA 1X1TA 2PD4A 4ROSA 3DBHA 1HYHA 2X9NA 2O3RA 2EIHA 1VC2A 2FZEA 3GVXA 5EQFA 1YDWA 5K9ZA 3IUPA 4N5LA 1DB3A 1R15A 2D4AA 3B1KA 3COSA 4M55A 1Q1NA 1K0UA 1Y7TA 2DM6A 3OP4A 2UV8A 2NQTA 1CDOA 2HU2A 4L75A 3AOEC 1DO8A 2EKLA 4Q3AA 1IL0A 1F8GA 3WIDA 2YJZA 2QRJA 1RPNA 1VSVA 1O89A 3N7UA 1W0CA 3OQ1A 2VOEA 5A9TA 1UXJA 1BDMA 1Y6JA 5KIAA 1P0CA 1LRJA 4A0SA 2IZZA 1T26A 1YWGO 1PGOA 3KLPX 1U1IA 3HDQA 3RC1A 4YR9A 1GCOA 1UUFA 4CL8A 5F21A 4YJFA 4EEZA 4I5DA 2AQHA 4PVDA 5A06A 4XJTA 4C4OA 5AQ1A 3DMTC 3LYLA 3JQEA 5CFZA 3LT2A 2VCYA 4HY3A 3NJ4A 3RUIA 4PFJA 3VZPA 3WLEA 2BELA 4GWKA 2AEMA 4U8GA 5CDGA 1HDYA 3LK7A 2E4AA 1LSSA 3B6ZA 4IZHA 1DC5A 4KUGA 3DZKA 3WQQA 4EDFA 2VWQA 1D4FA 4R01A 2X22A 2DTXA 4BNVA 4CMEA 1LDGA 2V6MA 1PJ2A 3RUEA 2O2SA 3CINA 1ZK0A 2ET6A 3GNTA 4J2OA 2NU8A 3SVTA 5FI5A 2OXIA 1YO6A 3SLKA 4CMGA 1P1KA 4GX5A 1G0OA 2Q49A 3ZH2A 3M6IA 1MX3A 3F1KA 1X13A 3BZUA 3OJFA 1N5DA 2AMFA 2PZMA 2AEFA 3GGOA 2P4QA 4BO2A 1B16A 1B14A 4Z9FA 1P3DA 1YQDA 1XA0A 4RVUA 3V2GA 5ICMA 1NTOA 3DDNA 4IZIA 2YW9A 3AW9A 4EUHA 5BSFA 1D8AA 5DCWA 1SNYA 3OA2A 1U4SA 1BRMA 4MVJP 5KVSA 3KYDA 4HP8A 2PK3A 3GY0A 4JN6B 1DFIA 2BGMA 3JQAB 3ST7A 5KKAA 2VQ3A 2HSDA 2W8ZA 1BGVA 3IUSA 3S55A 5LC1A 5JE8A 4BOYA 4RL6A 1O9BA 5G4LA 2HJSA 3HFSA 1ZVMA 4YVFA 2ZQYA 4PIVA 4BL5A 4YA6A 2BKAA 1M75A 4M1QA 1QYXA 1ULSA 3D5QA 3E9MA 3HDJA 5G0UA 4GLOA 5G0WA 4IDGA 3PHHA 4F3YA 1MG5A 3BTVA 2VZ8A 4GWGA 3DWFA 4BKRA 1P9LA 3M2TA 2QQ5A 3PI7A 4L8VA 4N5NA 2HCTA 3JYOA 1K2WA 3K5PA 3LT0A 1CQJA 2B4TO 2Q2WA 3PGXA 3UFXA 4ZHSA 3GMDA 5TF4A 1D1SA 2C0CA 5G0VA 1ZK1A 3EAGA 4XD2A 5I7SA 4Q9NA 3BYZA 4IS2A 1MLDA 4R54A 1GAEO 4RVSA 4AJJA 4BO8A 4JROA 1GPDG 2YY7A 5DP2A 1HSZA 5DULA 1UAYA 1I5RA 4I5FA 5FI3A 1SOVA 3I4CA 2WEKA 1EBFA 4E2WA 5MGBA 3WFJA 1T24A 1EDOA 3RUCA 3JQ8B 3H9QA 3WLFA 2A35A 3PGJA 1SB8A 3GRKA 3BHMA 1S6YA 2A9FA 4IPTA 3GA0A 4O63O 2O50A 4LCEA 4Z9XA 4TKLA 4R9SA 1AN9A 3V2UA 1HDXA 2UAGA 3DZGA 3IKVA 1PS8A 1PL6A 3R0IA 3Q0EA 3UOGA 2PZJA 1ZMTA 3LVFO 3RFXA 1NFQA 4DL9A 4HWKA 4TRNA 4IBOA 3V8BA 1O94A 5U9CA 2X0RA 2Y1CA 3ONDA 3RROA 1I01A 1BXZA 1V6AA 1YBMA 2YUTA 4CMEC 4CQMD 4CPDA 1E3WA 2PKQO 1Z45A 2GD1O 4E5YA 5CP8A 4XQEA 1HLDA 4UVGA 3PJFA 4GLLA 1J4AA 4OJNA 1N9GB 1QYDA 3S2IA 2C7GA 2QRKA 1WLYA 2X23A 3GN2A 3NTRA 1ARZA 2PD3A 3VDRA 4JCOA 1Y9EA 3UXYA 1MA0A 2Q1UA 1DC4A 3C1OA 1X7DA 3DOCA 3LF1A 4DREA 1U3VA 3B70A 4FN4A 4J7UA 2HRBA 5LCXA 5TT0A 3L4SO 4JK3A 2C2XA 1P45A 1ZK4A 3RKRA 4BGUA 4J90A 4D0SA 4KQXA 1NQTA 3PZRA 4UEJA 2H6EA 4D43A 5I7VA 5I9LA 2EV9A 2FPGA 3ZHZA 3LU1A 3O8QB 1T2FA 1GY8A 1QORA 4R1SA 4DA9A 1ISHA 2IXAA 3DONA 4XYMA 5TT1A 2XPCA 2AHRA 3SBOA 2JCXA 1JKJA 5JXWA 3H5RA 2F1KA 5IG2A 3DZJA 2OGUA 5COQA 1EDZA 4BV9A 1WDMA 4CL3A 3BMCA 4RLSA 4Z0TA 2NADA 4I9HA 3ZU3A 2X0NA 3UCFA 4XCVA 1ADGA 4CMAA 5CEFA 4R16A 4EITA 4WLFA 2VUTA 2YQ5A 3VPSA 4YCAA 3CKYA 3F1LA 3F5QA 1N92A 3C7AA 3N74A 4XYLA 1JWAB 1IPEA 2D8AA 4PRKA 1LBEA 2OZPA 2FR0A 2P68A 3TWOA 4XR9A 3BAZA 3MJ4A 1QG6A 5G0TA 3EHEA 1MB4A 1DIHA 2CNBA 3NJ8A 4X54A 3DQPA 3FPCA 1I2ZA 1VRWA 1ZFNA 3EK2A 4KMSA 5JS6A 4L76A 3R3SA 1LA2A 1NR1A 2X0JA 5I8WA 3ZZNA 4BQPA 2CVOA 4NFHA 1R4NB 1E3IA 4RZHA 1P1RA 1LX6A 1H6BA 1TT5B 2CFCA 3RFTA 3G17A 2BGLA 4QEDA 1WZEA 1FK8A 1ISFA 1MC4A 3WMXA 1LXCA 2NWQA 3OHSX 4YB8A 3DBLA 3UW3A 3MJSA 3MOIA 2HKIA 4MVJG 3T7EA 4BO4A 4ZA2A 5AOVA 1PGNA 2YFQA 2ZK7A 1L1FA 4JXKA 3OM9A 2Z95A 3QVOA 3RI3A 4UAGA 1I32A 2Y99A 3MJVA 4JJGA 3PVZA 1V3VA 2A94A 3D4NA 3Q11A 4HFJA 1YQGA 5ER6A 3HFGA 5IDXA 4J0FA 4YAGA 3JCZA 1GUYA 3ANNA 2IODA 4U0JA 1QLHA 2P5UA 3QWIA 2VWPA 1I36A 2HDHA 3D3WB 1XHLA 2C20A 2PV7A 3PK0A 3C7DB 3KXDA 3PQEA 7MDHA 4CLRB 4NZ9A 1B3RA 5AXDA 1PJQA 1YE3A 3DEYX 3HB5X 5JC1A 4ND4A 2EP5A 1TVEA 1SOWA 2X1HA 1NM5A 4ITUA 4XIYA 2EERA 5F1KA 2QZZA 1WMAA 4DLBA 2FOIA 5L4SA 2P91A 4UULA 5F5NA 1YJQA 3DZBA 1LI4A 2PH5A 2ZB8A 4NFYA 4CQLA 3L0DA 3D5TA 1O8CA 1XGKA 1YRLA 3AOGA 3BMOA 5TNXA 2Y0DA 3ONEA 3BMNA 4PLWA 1OFGA 4W7IA 3P2YA 4U5QA 4EJ0A 5F1OA 2O3SA 4YRBA 2GNAA 3ZNQA 4OSOA 2VT2A 5MDHA 1B2LA 1ENZA 3MWEB 4CQMB 4QFCA 4WK6A 2EWMA 1LJ8A 4PRLA 4WPGA 1Y8QB 2W90A 4WLUA 2WD7B 1EE2A 1XEAA 1PX0A 5JAZA 1LSOA 3I9MA 4GQAA 2QW8A 5KVCA 1TI7A 1ZXLA 4KZPA 4FJ0A 2BFPA 4C7KA 2VHWA 2RCYA 3EZLA 4FFOA 1CQIA 4I9UA 1KY5A 2QYSA 4KDFA 1KETA 2ZCUA 5DBFA 4CV0A 4E13A 2CVZA 3WYEA 2YDYA 1WMBA 1ZK2A 1HT0A 5L51A 3LT4A 4M54A 4U0KA 4W9NA 1XCBA 4EGFA 4BKUA 1MFZA 3IP1A 3PHIA 3AJRA 1E7QA 1RM0A 2P9GA 5THKA 3W4JA 1DPGA 3MWDB 4YJHA 3U4HA 1YGYA 5A9SB 3UGKA 2ZB3A 2IXBA 1JW9B 4FFNA 3WBBA 4O6VA 3OF2A 1YB5A 2NVBA 1IZ9A 1UJMA 2V6BA 3QWAA 1OI7A 2Y1FA 2Y0EA 4MVJA 4O1MA 4CM7A 4BGVA 3DZIA 1BMDA 5ENVA 4DLAA 4NK5A 4NIMA 1HTBA 1S7CA 2PH3A 4RVFA 3VHRA 4J1SA 4WNIA 1U3WA 2UUOA 4I5GA 3WQRA 1IPFA 3GEGA 4ZU3A 5I7FA 3LZ6A 3TL3A 1HXHA 4BQRA 3MOGA 2EKPA 3C3XA 5TRTA 3GNSA 2JHGA 4M49A 3WGYA 7ADHA 4J4TA 2I67A 2VHZA 4Y8VA 4AVYA 3C8MA 3L77A 3HZZA 4UUOA 5IN4A 4GH5A 5B4UA 1H5QA 1HYEA 3WNQA 1VPDA 3H2SA 5A02A 2BD0A 1EE9A 4J3FA 3K30A 2XAAA 1CRWG 4W82A 3ZWWA 1ISMA 2CZCA 3PP8A 1OBFO 2WYWA 1TXGA 3K73O 3UUWA 3WSWA 1ENPA 3LQFA 1QP8A 4D46A 4J0EA 5IZ4A 4WECA 1WW8A 2NSDA 2Q4EA 4AJKA 1ISIA 3G1UA 3I83A 4IXTA 1HDZA 2PGLA 4Q3NA 5L4LA 3H3FA 4FC6A 2FSSA 4Z0HO 3H5NA 4YJDA 1A9ZA 3NKLA 4OAQA 3ROPA 2D2IA 1TA4A 1JN0A 3AY6A 1U8XX 3M2PA 3W8FA 3HG7A 3S2GA 2ZB7A 4BO9A 1J6UA 2I9PA 1UZMA 4UVHA 3U5TA 1EBUA 3PYLA 1T2DA 4EUEA 2YZ7A 4NU5A 4Y98A 1R0SA 5EPOA 3JQGB 1LLQA 4B7CA 3JQDA 1E5QA 2GCGA 1DHRA 4MVJH 3EGOA 4W99A 1E7SA 3QWHA 1O6ZA 2IRWA 1XIVA 2D5AA 1H6DA 1R12A 4QTZA 2HMWA 1QSGA 2B35A 4W4TA 4XB2A 1ZJYA 4BB6A 2X4GA 4LN1A 3AUUA 2NLOA 4FJ1A 3TFOA 1KC1A 4NFSA 4BUCA 5JCJD 3O26A 4XGKA 1WXDA 5F1PA 1KC3A 1K6IA 1RM5A 4MP3A 1B26A 4W9NC 2Q1TA 1NBOA 1VL0A 4ALMA 4E2XA 3EZYA 3GHYA 1I0ZA 2X7HA 3ITDA 1H94A 3WG9A 2CDCA 1LNQA 4XJSA 2J3JA 4CR6A 2VHVA 3DBRB 2ZTLA 3KB6A 4XKJA 2DPGA 4GGOA 1R4MB 3I6QA 1DLIA 2OHXA 5CPBA 3RSHA 3ASVA 4E5NA 3NEPX 1CF2O 3ASUA 3F47A 2O7QA 3P19A 1XR3A 4G5HA 4KP7A 5DNAA 3UH1A 4EZBA 1FDUA 2QG4A 4R1TA 2O3UA 2AQKA 3P5SA 1ZSYA 1ULUA 1MC5A 2O3JA 2CVQA 2UDPA 1N1GA 3TOXA 2NACA 2VYVD 3LC7O 3ITKA 3KUXA 2NU7A 2QZ9A 2E37A 5ER9A 3INTA 4EEXA 4PG4A 1VKNA 3DHNA 4GMFA 4GI2A 3IJRA 1VJTA 2NTJA 4IS3A 3JQAD 1ISGA 1ADFA 4A73A 1N7GA 2I3AA 4IGEA 2GUGA 3H3JA 3K9QO 1H6CA 1N2SA 3PRJA 3L6EA 4M8SA 5HM8A 5IFLA 2G1UA 2UVDA 2NQ8A 1CETA 3BTSA 4JIGA 1HKUA 1T1SA 3JQ7A 2SCUA 1NVGA 2W4QA 1BW9A 3WWYA 4CV3A 1W4ZA 3AFNA 3D4PA 4UREA 2VUSA 4II2A 4JP3A 3DZFA 4E30A 3F46A 3F3SA 2J5KA 4LVCA 4UVIA 4BKPA 1HDGO 5TSDA 5LDGA 1SC6A 4FD3A 3WGHA 1HL3A 4DIFA 1GQYA 2VRBA 4BS9A 1CERA 1Y8RB 4NBWA 3UVEA 2E82A 3A4VA 3CZRA 1EQ2A 4ALKA 4OXNA 1GEEA 3FRJA 1Q0LA 2PZKA 1KBZA 4LK3A 4IINA 1NHWA 2FZWA 3H9UA 3KV3O 2VHYA 2O4CA 2WYUA 3RUHA 3W6UA 2WM3A 4CV1A 2GZ3A 4NBVA 2O48X 3ANMA 3RKUA 2B36A 5JDIA 1ZW1A 1P33A 2AG8A 3OEYA 1SAYA 4GSLA 2C07A 4W7HA 3GHHA 3ETDA 4E5MA 1UXHA 4DPLA 1JVSA 4GX0A 3HNPA 1LUAA 4HNGA 4IJUA 4IY1A 4LISA 4ZD6A 4R3NA 1ID1A 3CZMA 5G4KA 2X9GA 4J43A 4BNXA 4BNGA 5K6AA 4II3A 1A7KA 4LCJA 4L0QA 2ZATA 1LRLA 3Q9UA 1E3JA 2Y0CA 1O0SA 3HUDA 4B4UA 1EK6A 4P4GA 5JO9A 2I5PO 3E18A 2DU8A 2W98A 4BV8A 5DCYA 3L07A 1IZ0A 2YHIB 3WYCA 5KWEA 4OO3A 3H65A 4XZ3A 4C7JA 3WGQA 4OM8A 2OBNA 3C85A 3ZDFA 4YRDA 3NRCA 4YAIA 2J3HA 4WEOA 3ROMA 4MVJI 4OXKA 3AU8A 2IZ1A 3VZQA 2AE1A 2BFMA 3DBVO 3RIHA 1DFHA 1DIAA 2H63A 4IM7A 4S1VA 1GU7A 4YTEA 1I10A 2PKQP 3GPDG 4WKGA 2E48A 2FY8A 3AI2A 3AK4A 1LSUA 3H4VA 3JQ9A 5DOVA 1P74A 1I24A 3STHA 5FF9A 4IJVA 4BNUA 4KUHA 6ADHA 3PDUA 2I66A 3H9GA 4GMGA 5DT9A 1HZJA 3PDJA 4TMFA 4CM8B 1WNTA 3RQSA 5L3ZA 3QJ5A 1GUZA 2O3TA 1SEPA 3TN7A 4YAKA 1TB4A 4DYVA 1ZK3A 5EINA 1A27A 1E6UA 1VI2A 1NWHA 1XG5A 2G5CA 2VZ9A 5ILGA 1C1DB 4ZGWA 1Y81A 3W6ZA 3R3JA 5K0ZA 4BNHA 1UZLA 5TS3A 2PTGA 4ZJUA 2RAFA 4NQZA 2X86A 1ZBQA 3AY7A 5DZSA 4PLYA 2NVUA 3ZWNA 3AI1A 4IJKA 4WCFB 2V6FA 3OICA 1MFPA 5A3JA 3FNFA 2TMDA 3DZHA 1K6JA 2JFHA 3ZNPA 1P44A 3P2OA 1XQ6A 1H2HA 3JQFC 4CLXA 3W4IA 1KS9A 1YS4A 4XYGA 4PVCA 2Q2QA 2J5QA 4PZEA 4MKRA 1LDMA 3TL2A 2EKQA 5GMOA 3I1JA 1DRWA 2Q1WA 4KWHA 5JDIC 2JD2A 2HK7A 3E5MA 1KVRA 1Q7BA 2B5VA 2JAHA 3QA9A 3ADPA 3JQCA 1EVJA 4E21A 4J1TA 1YOVB 4I1IA 4QECA 4RPGA 4RPLA 4E3ZA 3KETA 3ZU4A 3GLQA 5A5FA 2RHRA 1GD1O 3WQSB 2W2KA 5IDWA 3WJ7A 3DTTA 1C0KA 2GZ2A 3ZI0A 3GN1A 3WJAA 3WTCA 1BXGA 1L7EA 4MPDA 1QKIA 1T1RA 3SC4A 3MEQA 5K6AC 3PFWO 4XYEA 1KVQA 3ONFA 2FHSA 4MDHA 4R5MA 3W1VA 4OHUA 5T8KA 3RAJA 4BO1A 3GUYA 2P9EA 2X58A 5LDHA 1NPTO 3DOOA 2Q99A 4NJMB 2Z1MA 4BIIA 4XIJA 5A4DA 4OSPA 4CUZA 1BTOA 2DBRA 2V7PA 1QRRA 3WOHA 1GADO 2I76A 4RV9A 5IF3A 4N18A 1LQTA 1B7GO 1DIRA 3L6DA 4CV2A 5L53A 4UUNA 1PQWA 2OORA 3PQDA 2DQ4A 2D0IA 3ZWCA 1F06A 1BVRA 3V2HA 4BKOA 1DC6A 4AJ1A 4OQZA 4OYRA 4RPHA 3BHJA 4QSMA 5G0SA 5L7YA 1V9LA 4NHEA 3NX4A 1U7TA 3BTOA 3JQ9C 1OC2A 3IP3A 2O3QA 4UVEA 1XU9A 3GEDA 1K5HA 4R9RA 1EK5A 3L4BA 5JAQA 2D5CA 4IDBA 2HUNA 1C1XB 4BO5A 5TJ9A 3BTUA 4Q3CA 3AWDA 1IULA 4Q39A 2CDAA 1QYCA 3OJ0A 4A5OA 5JYEA 3C7CB 3IIEA 5JMWA 3ABIA 3ZHYA 3K31A 2X9VA 3ENNA 2XOXA 3KYCA 1B8UA 3FR8A 2PGDA 1PJSA 3VZRA 2NTVA 4YRAA 4J9VA 2I6TA 3MCVA 4R4JA 3RU7A 1U9JA 2OL4A 3IAHA 4Q3BA 1I3NA 1U2GA 2DBZA 1B8VA 4DQVA 3VTFA 5BNIA 1PZGA 3T4XA 3VC7A 2GGSA 3U4DA 4BNFA 4XRGA 3QV1A 4NBUA 1DC3A 4CLOB 2XF8A 4W6ZA 1YL7A 3LC1O 4RDIA 1ZSVA 5L95A 3T7CA 3ZV3A 5GZ1A 1ADCA 1LC3A 1P31A 4DMMA 4KTTE 3GFGA 4DGSA 4I9NA 3AI3A 5TX7A 1KEVA 4HFRA 1JLLA 1C0LA 1V3UA 4IIUA 4AJPA 2VT3A 3WWZA 1FF9A 4BNWA 3QVXA 4KWIA 2DVMA 3CTMA 1I3KA 2Q45A 4WLNA 2DFVA 3GR6A 4R51A 1XLTA 2C29D 1ZCJA 3I23A 3K2BA 4DC1A 4J16A 3KEQA 2C59A 5JBIA 3WX0A 3FBGA 3K96A 4CM4B 1ZZEA 4ZQEA 2CMDA 5B4TA 4K1LA 3OMLA 1I2CA 4YPOA 3KEOA 4J6FA 3C1TA 3A14A 5A03A 4MKXA 1AHHA 1PQPA 4UEKA 2DUWA 4Z9YA 1HDOA 1KVUA 2YV1A 4HFMA 2BLLA 3GF4A 3OBBA 5T8KC 4A7PA 3BMQA 4YWJA 2Y66A 1VKOA 4ZQBA 1OOEA 4CM3A 4DXHA 4JLWA 5L7WA 4UUMA 1X14A 2ZTVA 3OQBA 1HE2A 4BKQA 3HJAA 3HN7A 4U6SA 1A7AA 3F6YA 4RQTA 1MV8A 2QRLA 4FDAA 1CYDA 1IOLA 2Q46A 2NUAA 4JJFA 4ESOA 4XGNA 4RVDA 3JQ6A 1UP6A 2GN6A 2J5RA 5B37A 2O23A 4NH4A 3PZBA 1LDEA 4LMRA 2NNLD 4R3WA 4YJGA 4DTIA 5JNLA 5ES3A 3VVBA 5TGDA 4TROA 1O95A 3OFSA 3TOZA 3FWNA 4LRSB 4RF2A 2C82A 1I3LA 1K3TA 2EEZA 3RJ5A 4CR7A 4OOEA 3PHLA 3WGGA 1E3LA 3ZU2A 4QO7A 4CM1A 4FOSA 3NAQA 5J23A 5I9MA 2AE2A 3L4BC 4QFDA 2B5WA 3JTMA 4AG3A 5KJ6A 1I8TA 3DBHB 4LW8A 2R00A 3ADOA 4MVJE 2GO1A 2B83A 1ZSNA 2IYOA 4TZTA 1WZIA 3AFMA 2JAPA 1J5PA 3GFBA 3I9OA 3ZNOA 3GOHA 4OMUA 1CEQA 3SLGA 5A9RA 2H1SA 4OXYA 4P38A 4E2YA 5A1TA 1QV7A 1X0VA 3GZNA 4J91A 3U0BA 1GYRA 1F0YA 5CG2A 3Q2KA 1U28A 2B4QA 4DUPA 4N54A 4R5HA 3ULKA 2IZ0A 3V1YA 1JDJA 2HMSA 4ALNA 2X6TA 2IEBA 4XYBA 1AE1A 1NPYA 4R69A 2EHDA 4HUJA 5TLSA 4BVAA 4O0LA 4ONEA 3TNLA 4YDRA 3ZGYA 5L45A 3GG9A 4NR0A 4MOWA 3RBZA 3TJRA 1NFRA 5IXYA 1H9AA 4ND3A 3O4RA 4NNJA 1O5IA 3GAZA 4YJFB 3SX2A 3ZV5A 1NAIA 1LC0A 5JY1A 1E3SA 1IY8A 8ADHA 5EL0A 1F8FA 3ICCA 2HMTA 4D42A 4FB5A 1E6EA 1HE3A 1W6UA 2GLXA 1QXSA 1RJWA 5AXAA 4LRTB 2GRAA 4CJXA 4RDHA 1GL3A 4CM5A 1E1LA 3U4CA 1J0XO 5GY7A 4KOAA 1UH5A 4AJOA 1LDNA 1DDOA 1E77A 1RKXA 1W73A 3TSCA 4H15A 1LLUA 1HF3A 4DWVA 2X8LA 4Z6KA 2EGHA 3I9JA 3GDFA 3VKUA 1DRVA 2GF2A 4J4BA 4FR5A 1XDWA 3PHJA 1PJCA 2WSBA 3WNVA 3JYPA 5BQFA 1E7RA 2EW2A 3BIOA 4JP2A 3NTQA 4ALJA 3C24A 3SXPA 3AM5A 4Z3KA 3ZWVA 2H5LA 3UHAA 1QV6A 2VZ0A 1A9YA 4FBGA 1PGQA 4XWYA 1XYGA 2G0TA 3FPLA 3IS3A 1KEWA 3UKOA 4MVJF 6LDHA 2GR9A 2PFGA 1M6WA 3AUTA 2Z5LA 2YV2A 2NU9A 3GDGA 3KYDB 1EEHA 3QRWA 3ANLA 3I9NA 5C37A 4XX0A 1EVYA 4ND1A 3S2FA 4INAA 3CXRA 3TZKA 5ICSA 3QIVA 2P4HX 4DQUA 2W2KB 5EMHA 3UCEA 1GR0A 5JCJA 1P1JA 3TZ6A 3DHYA 2FPIA 4DVJA 4L4RA 5DCUA 3PPIA 5IJZA 3VPHA 2B69A 2R00C 5BT9A 2AXQA 4ILKA 1MUUA 5JLAA 5A05A 4MINA 4YQZA 5JYDA 3WGOA 1DRUA 3BXXA 5BNFA 2A4KA 1BSVA 4FFRA 5HTOA 3VH1A 1EVZA 5CPFA 2DLDA 2CY0A 4TVOA 1H93A 2DFDA 3A9WA 3HQ4O 4RLHA 4TQGA 4WJZA 3HWRA 3QLJA 5EQDA 1LLDA 1FDWA 1YXMA 3ZHBA 4AJIA 4WUVA 1DLJA 3GVHA 4GBJA 5I8ZA 2GASA 2VYVA 4CMCA 1LQUA 4AL4A 1X7HA 4YAEA 5HS4A 5KKCA 1I3MA 1NQAO 2I65A 1GV1A 2WTBA 3CUKA 5BSGA 5KOIA 3JD4A 4AJEA 4NBTA 1Q0QA 2QHXA 3GZ4A 1EUCA 5B12A 2JCVA 3VVCA 2AQIA 9LDBA 2Q1SA 1V35A 3JQAA 4B3JA 4DQXA 3TF5A 4O59O 4MIYA 1P1HA 3RU9A 5DOZA 3TFQA 2BF7A 4AFNA 1PJ3A 4PLCA 3VPFA 5CDYA 3G3EA 4HV4A 2DUUA 1E7MA 2FMUA 2WDZA 2G82A 3D0OA 1C0PA 2EF1A 1DBVO 4R1NA 4TSKA 5CHEA 2BMAA 4GX2A 1E3WB 2WYVA 4ZQGA 3KVOA 4DC0A 4FS3A 1JA9A 4PZDA 5A5EA 1LU9A 3OIGA 1KIFA 2E6UX 4D44A 1PZHA 3KOUA 3GG2A 3N58A 1YJ8A 5FEUA 4OH1A 4IDAA 3IJPA 3OETA 5AXBA 2R6JA 3KYBA 3SC6A 3Q9NA 1OAAA 3VKVA 5HWSA 2OP1A 2DPHA 3AM4A 3PFFA 5COAA 5JSFA 3ZWMA 3WR5A 4OL9A 4RQUA 3E03A 3RUDA 3PHGA 4DLLA 2OP0A 5ITWA 3WB9A 3K92A 3ZN2A 1JAYA 2OMEA 3V5NA 1GPJA 3JQ8A 4WASA 3TQHA 4NBRA 4NU6A 2Q2VA 1VLLA 5CAEA 3PLNA 5G2OA 3VH2A 1B0AA 3RC9A 3BMCB 3V1TC 1Z7BA 4IQ8A 3DAGA 3EUWA 4CUKA 2X0IA 2Q50A 3NT2A
chains in the Genus database with same CATH superfamily
2BFDA 3QTLA 3Q98A 4NARA 3RS9A 2OO7A 2VJCA 5THQA 4YN3A 5LU8A 3GGDA 3N2EA 2P0YA 1KVTA 2B21A 1KZ4A 3NLLA 4FNMA 4EARA 2D2FA 4RGBA 2BH9A 3ZS9A 1U9IA 5EN4A 2VJLA 3AUXA 4N5HX 4YCSA 2GXSA 1HLPA 1NXTA 1TFRA 2JGDA 3I37X 2EVWX 2IX3A 4HDCA 2A1TS 5BWMA 2J33A 2Q5EA 1G59A 1U0NA 3KELA 4Y6OA 3RIYA 4IDNA 1JJAA 3KAJA 3ZWXA 2Q3CA 4TV9F 1D1TA 5I7WA 3S2EA 2F3TA 4IFBA 3T0IA 2ZTUA 3AKZA 1C8VB 1A7UA 1NUHA 2FWMX 3FHCB 3H5AA 5JLJA 3FB1A 3COWA 1S2NA 2ETVA 3QQPA 3RD5A 1YFZA 4AZWA 5AJHA 4ZC8A 3L0BA 2VTDA 3U6BA 1ZQ1A 5BT8A 5TY0A 2W0MA 3T34A 1QPGA 3RWMB 1WDTA 3DEIA 2OXTA 4FE7A 4G2NA 1TQ6A 2ECFA 2VLBA 2FCAA 3F78A 4RHXA 3UC5A 3E58A 4DLNA 3OIDA 2FDCA 1Y4SA 3DL2A 1FFAA 3TTTA 2TECE 4UXIA 1ZH4A 1U5AA 4Z8XA 1Z7EA 3NANA 1G20E 4Q9KA 1X38A 4ZOLA 1Z26A 1C9EA 3IBFA 4LE0A 2C5LA 3K2QA 3KKLA 3T3DA 3V7FA 4CMBA 1W85A 3PLRA 4RMJA 1QZTA 4K3VA 4WBSA 4D3FA 4ZI7A 1OUMA 2O8CB 1P4RA 2DLCX 3W77A 5JNLA 1XAGA 4UUBA 4UVDA 4TWIA 3SF8B 1Y6RA 2PVCA 5HMMA 4G63A 5EHQA 3RQIA 4OSEA 4BB9A 3TGLA 2PSHA 3BXPA 1FNDA 2V3VA 3MMPA 4CR8A 2GCOA 1IONA 1WB4A 1R0ZA 1Y1TA 2WKSA 3CNBA 3IVMA 3PVCA 1TJ4A 4BTLA 3MJFA 4IQGA 4CM6A 4BUJA 1W1WA 2Y05A 3GRPA 2XNHA 1KQNA 4GE3A 2X0EA 1LRKA 4K9RA 3L1UA 4IV8A 4W8HA 1VHQA 3D54D 3R41A 1BOOA 1C3EA 3BBPA 1V5FA 2PZAA 5EYPB 1GNLA 2ZT5A 2G1AA 3G9UA 2L82A 4UE3S 1PGPA 1QKJA 1IJBA 4Q47A 3AKDA 1SMKA 1BQEA 3MTEA 2CK3D 1ZIPA 4LHZA 4MO2A 2EZTA 4H59A 4NWIA 5IFKA 5L4NA 3NNNA 5TC4A 3BJMA 1E92A 3DSRA 3H2ZA 1J0CA 1JQBA 3IDOA 3URMA 4BLTA 5I4IA 1EFRA 1PEDA 1B3BA 2A59A 3P9QA 5I7EA 4KHPB 3I8SA 3QITA 1ABFA 4QYIB 3DF9A 4KQWA 4Q3EA 2XE8A 2I6GA 1CG6A 1MHTA 2YY5A 2Z3ZA 3G9ZA 2R84A 2YHSA 1RZRA 2ZWPA 1MVOA 3DF7A 2CL5A 2Y4NA 3OSUA 1ECBA 3EGXB 1PU2A 4FGSA 1IRXA 4I55A 1YB6A 5FBLB 5FKJA 5I4BA 4BNTA 4H0FA 1ILEA 2QVBA 2V7WA 4EB0A 1IHOA 3BMNB 3HABA 3UXMA 1IJEA 1A77A 2MTBA 2F00A 4GL4A 2Y68A 3ZHTA 1HK7A 4GC9A 3ZWAA 1XDZA 3I6BA 2XNDD 1U99A 1ZO8A 4DR3B 4G23A 1M2KA 1XDDA 4O4HB 3KQUA 3BIWA 4JODA 4Z9AA 5ED0A 2GPTA 4ZDWA 3TD2A 4N8DA 1EUDA 4OOFA 1U81A 1TA9A 1FJHA 1PK9A 1H3FA 3FJ1A 3I73A 4L51A 4FZJA 5CIWA 2JK1A 4JOBA 5CT9A 4NG5A 1NN0A 1U9IC 2FUKA 3OT5A 1PR0A 4L3VA 1PR5A 3IB3A 3M4ZA 4OFXA 1DAGA 1YHYA 2YWDA 5BQXA 4NXNB 1UJ6A 4JUAA 4MLZA 1E2IA 2JLZA 1H3NA 4P31A 4NYJQ 5G40A 4D4KA 2XLBA 5CG1A 4IMPA 2EFYA 3B6MA 2OD7A 4HGYA 3ZR4B 2F2TA 2C7BA 4JNGA 1ND5A 4CZ2A 1O87A 8LDHA 1JHMA 3FWZA 2N47A 2XYVA 2GKGA 3C8DA 5ALDA 5AI5A 4A2PA 5KYYB 3IL2A 2BMEA 1DQZA 2HWWA 2VRNA 4HZUA 4GZ3A 2X6QA 1P75A 4PR3A 4YYZA 5BSEA 2QTNA 2JD0A 4YJHB 1USIA 2VYQA 4OHXA 2IDJA 1IM2A 2P8JA 3G8AA 5JPIA 2WG0A 4Q4JB 3FFTA 3ZXXA 4IWXA 4KQ1A 3I5XA 1ZHOA 3NIWA 1N78A 1J0DA 3LKZA 1F7VA 4UATA 4M87A 1R5JA 4J0DA 4LYEA 1QWSA 4GYWA 1Y33E 3MXOA 2FFRA 1R8QA 1WCV1 4G85A 4DMKA 3INRA 2AJBA 3WXMA 5JJLA 1B41A 3HO1A 1SHKA 3DFUA 3E1GA 2OCDA 3MOSA 3O4VA 4ZIRA 2REXB 3QBVA 4Q7MB 1NP7A 2PWYA 3N59A 1CIJA 1MV5A 2FRDA 3DT9A 1U7XA 4HMOA 2Q3JA 3FGOA 2BR4A 5HBGA 2HIGA 2O8DB 2QT0A 3IQWA 3LMKA 1XXHA 4N7JA 3ZU5A 3I01A 1RLMA 2WZBA 3EDMA 2WYHA 3D6TB 1U6JA 3JD2A 2C54A 3WSTA 1A76A 4DR6B 1XRJA 3IAEA 2HO5A 1EFLA 4AKTA 4B6QA 2YKGA 4BAUA 3PQ5A 3FUCA 2ZSHA 3IVRA 2Z83A 1KAEA 1VCMA 4PLPA 4XEHA 2W00A 2YC4C 3HN2A 4LSMA 2FV8A 2FUEA 3FLEA 3RJ9A 1O96A 3QKTA 3VR1A 4BE9A 4WZBB 5DGCA 4IGIA 2WVHA 1U6KA 1OBCA 1PFWA 3WAGA 2C8JA 1RC1A 5DEOA 4MV5A 3CB2A 1ZC3A 4YRGA 4BE4A 1TD1A 3AP3A 4OLJA 4G86A 5CYPA 2DJIA 3L6OO 3Q7IA 1Z8DA 3C3BA 4E6PA 5HR5A 5IT5A 1CSEE 1A5SB 3AF3A 1MNAA 3PXEA 3E23A 3NDRA 5CA1A 3UGJA 3OIVA 1KDRA 1O5TA 4Y6PA 4BVKA 1Z68A 3LHKA 4AY4A 4QQNA 1EGHA 3VH4A 2QP3A 3WO0A 5A9SA 2JBHA 3A4TA 4G81A 1UEIA 4U2GA 3PD1A 4YACA 3RABA 4OUDA 1EWVA 1K4YA 2C4TA 4UTRA 2K7ZA 2QE6A 3WDLA 3QXGA 1L5HB 2QUZA 3IR5A 1JR6A 1W96A 1A7JA 3X1DA 4BVJA 1XCLA 1NNUA 3BL5A 4UEWA 4UDOA 3ZJ5A 1CZOA 3QBJA 4HDMA 3M6FA 1UAAA 3AJ8A 1D3AA 1KZ6A 3IC5A 1BEUB 2ADMA 2VP5A 2XMBA 3KPWA 2QF7A 1MTZA 1RJ9A 4FFVA 1R0KA 4J2HA 3WTBA 1F2DA 1VL2A 2R2GA 1IK4A 2FRXA 3C4VA 3LHSA 5CJ2A 1IG3A 2IKSA 5H83A 3UATA 3FI9A 2WUVA 3RS8A 2Z6VA 1T35A 4FDVA 2FZGA 4A8PA 5B53A 3E1KA 1QTNA 5EJEA 4XJVA 1UZNA 2YXLA 1GGHA 4LHVA 3EX7C 4DS3A 4RHTA 1U0RA 3BWXA 3M6UA 4K40A 3RC8A 3B5JA 3LLMA 1DMSA 3CM0A 4M83A 4DV5B 3DWGA 1EGMB 5CFLA 4CTMA 4MMYB 4MCJA 4ENTA 5KSYA 2J1LA 1YB4A 4FFPA 5FFMA 4QUEA 4DWOA 2QTMA 4QOEA 5EXEA 4ENPA 4RDXA 1WQ1R 1Z17A 4FYPA 1AKTA 5EMNA 4EKDA 3CHYA 4G1EB 4PICA 4JGBA 4B34A 5K4GA 4ENQA 3N5KA 4PLFA 3UK0A 3K9CA 2FEXA 2YZKA 4GAEA 5G3YA 4JYCA 2GRJA 2QKYA 2JFXA 3W9BA 1JHQA 3P9YA 5BN4A 2AI2A 3KU4A 3H05A 4WLEA 3CX4A 5K03A 4FMDB 1DHTA 1SUSA 4RKYA 5BMVB 4ZK2A 4TMVA 2C2OA 2GBGA 4HK4A 1DTSA 2WR8A 1P0QA 4A2QA 2DTEA 2PJRA 2AVNA 2VWHA 1AQNA 5KJEA 1OPXA 4BNMA 4D6PA 5K0EA 1NSTA 3TTWA 3DR3A 5EXXA 3B7GA 3UN1A 4QYSA 1WV0A 4FWBA 1Z4OA 2M1ZA 2XMZA 5J2TF 1RYEA 2YH2A 2Q3EA 2B4RO 1ZEJA 1MEJA 4MGZR 4NS4A 5AW9A 2QJOA 1R16A 2FRDC 3ZG6A 4ZAVA 2ZJ1A 4AU1A 3H8VA 3GJ6A 3R7AA 3ZU6A 3WK7A 4OB8A 4X90A 3M1AA 3U3MA 4QPPA 2JL1A 2G1KA 5CDTA 2YN2A 1F9AA 1WHSA 4FN5A 1N7IA 5D7NA 3JQGA 3TLMA 1QDEA 3V2IA 4DIOA 2QN1A 5DRYA 1Y5LA 3HJCA 2QQGA 4KV7A 1NVUQ 3DEAA 3A9RA 4LOKA 4TZKA 4YEDA 5HIJA 5DNEA 4KE8A 5LBTA 2Y1GA 5J2TA 1K89A 1Z8FA 2I4TA 3GJRA 5EWJA 3PWTA 4F6LA 3SYTA 1ETUA 1YL6A 4X0EA 4YV2A 4Y2YA 13PKA 4OI2A 4I14A 1SUIA 2FUCA 4QYXA 4XD7A 5PGMA 4U6QA 3X2SA 2H1FA 5JQWA 5TJHA 3NV7A 4H7IA 4EA7A 1VCOA 1ORWA 1ESDA 2Q5QA 4LNAA 3TRIA 3G13A 3FWPA 1QV9A 1SU4A 1YA6A 2VHTA 4NCKA 2W6IA 2D8MA 4JBGA 1FUYB 3TNYA 1FS5A 2P67A 1HRDA 5ELMA 1CVLA 1W88B 3AGPA 2P5YA 4P7BA 1WTCA 3LHFA 4Y2TA 4ZQFA 4QYWA 1I4DD 3ZJVA 2IZ5A 2PO7A 3BHIA 1LZLA 1PWXA 2ID9A 2DSNA 2XE4A 2YZNA 2WY2D 2OBBA 2RDMA 3MGAA 3MFYA 2H48A 1VMKA 1OMOA 2V8OA 3OE1A 1OHHD 1PX2A 1QYVA 1RRGA 1AU9A 3IBTA 2H7CA 3KSDO 3KHSA 1V1MB 4TUYA 1IXYA 2ZYUX 2PUFA 2B7CA 3C3WA 2X0DA 4P36A 1AKYA 5SV2A 3CVYA 2H2IA 1KP3A 4XUDA 1NXWA 2RHLA 2VDNB 1GTRA 1WVGA 2FN3A 1VRCA 2VXYA 4RXUA 3RBVA 3FVVA 4ESVA 1CBUA 4LNUA 3IXQA 3K6RA 2E1PA 3KXLA 5H4HA 3OO0A 2TMGA 4FXPA 2HIAA 3A6LA 2JEZA 3C1AA 4JQZA 1K4KA 3AUYA 3UJ9A 4RZIA 5LNK1 1F0NA 2G5GX 2RGNA 5HYVA 3G2JA 2VHQA 5CH5A 2JFZA 4O2AA 4HO1X 4C1BA 5E1OA 4LF6B 1U2RA 4K6CA 2DZDA 4CCYB 5AFSA 4UTNA 4JUIA 1ZWLA 2DPMA 3UCXA 3KSAC 4F3TA 5CHYA 1RM3A 3O9VA 1NBIA 3H8WA 4WXHA 2I7CA 4AS1A 4AICA 5BV0A 3NBKA 3UTCA 2YVLA 1TC1A 3OPYB 1YCFA 4KRXA 4IDUB 4S2UA 2EGGA 1Q11A 1V41E 3PQ8A 3T4PA 2FI1A 3C3PA 1P0MA 4KQ6A 1VE9A 3RU2A 4PG5A 2C2GA 1WO8A 3ZW9A 1D09A 1OZGA 1YGPA 2UZ0A 3GV0A 3UAGA 3W5UA 4PSAA 1Y8RA 1JE1A 1D4OA 2ZLBA 3MTAA 4CF6A 4D79A 3UMMA 3RIMA 1ISRA 3OJLA 4OI0A 3UEOA 3GLIA 3KCQA 1HDCA 1KPHA 1ZYUA 2HPAA 3Q15C 1GVHA 2UZ4A 5K3EA 4Z8YA 3PNKA 1L5FA 4JYBA 3ZEIA 4QSHA 5C18A 5CXUA 4FBLA 1DXHA 2RG1A 5CB6A 1V8BA 2EDAA 1YKFA 2X42A 2ZCVA 3B2QA 1TZ2A 3EEQA 4FEAA 3WA6A 2HXGA 3MGBA 3B12A 4KPYA 3MB8A 1EQUA 4RD4A 4QTXA 3D3JA 3Q7TA 4FJ2A 3T3MB 1IYZA 3IPRA 3ZD9A 5IKPA 3PXCX 1GKYA 1H0KA 3KS9A 2CYAA 3OTIA 4M9QA 1QJ4A 2IJGX 3PIDA 2ATXA 2Y0BA 2O14A 5CLHA 3ZKAA 1GKKA 3SZ3A 1VZ2A 2B4AA 5I7UA 1VLVA 3GBVA 3LWZA 3PFCA 4OBBA 2AX4A 2PGOA 4H6XA 4QOFA 3C4QA 4UZSA 1E2MA 1GNQA 1OE0A 1T9HA 2QJWA 2RBEA 1Z5GA 3ND7A 1I1OA 4E31A 3JR7A 3NDBB 1SXJD 1A0OA 2P3LA 4D7AA 4RTNA 1B15A 3RRBA 4DMLA 2KS6A 5EJFA 1W94A 4HATA 4Y6SA 5JJCA 4V38A 5TXGA 2JA1A 3O74A 1T8SA 2JGKA 3GJ7A 1X19A 2GVZC 2YHIA 4P3YA 4ARVA 3JD3A 4FSDA 1H23A 2VATA 4RD6A 4RAOA 4B7ZA 5AVTA 4CUJA 3PEFA 2O2IA 4JC8A 1GRVA 3TRFA 3WKAA 5DLPA 1VSUA 4PGGA 3H5VA 4WAUA 1Y9AA 1V3QE 3VZCA 3EYAA 4PZ0A 4WJKB 4I4LA 2ZJ3A 3MF4A 4I46A 1JU4A 4MWOA 2PSEA 3FMVA 3V4VB 3LJKA 3SJCA 1CZNA 3DTVB 1L7DA 3DMDA 1Y8ZA 1MGOA 4TRJA 2EQBA 2YMQA 4YDSA 5BV7A 1H5NA 4LEIA 3V97A 1O95D 2BIFA 2GNPA 3QWBA 4M0UA 4XR4A 3GJ8A 1A4UA 3PWSA 4PC7A 1PDOA 1SHZA 5IJ0B 1NBAA 5A0VA 1E1MA 3C5EA 3FOCA 2VNSA 3UJBA 2RGNC 1D9ZA 2OLJA 1F4VA 2NZVG 1VKJA 3BS4A 4J1NA 3SEQA 3MWKA 3TZBA 2XYHA 4KQFA 1BYIA 3ESYA 1BVUA 4GPD1 3TRDA 1Z6GA 2DAPA 2XWQA 4QBIA 5HZMA 4TQAA 2B99A 4J0HA 2GN8A 2B1RA 1TVKB 4B4OA 4XWKA 1WXIA 3PJGA 3RYCA 2ZT6A 1TD9A 2P77A 4MWZA 3VNQA 3CIFA 3FSRA 5HGXA 2QUJA 1QRTA 4NE9A 2JLWA 1V4BA 2YWXA 4MQ4A 4P83A 4QU5A 3RREA 4GQBA 2J6CA 3OG9A 4IDCA 5KJ1A 4EELA 4WXPA 2B3TA 3H9EO 4X6LA 1U7OA 4ZKEA 4BTVA 2I99A 2RGXA 4PSUA 3I4FA 5CLJA 5IKXA 1HE5A 4NDNE 1CT9A 4ZQHA 3HGMA 1NPDA 2X5KO 2YR0A 2BDEA 1B6TA 1CRQA 1YRAA 1Z8NA 2C03A 2Q62A 1JVBA 2WT4A 2WVGA 3QSGA 4RUKA 1I0IA 1N2BA 5KYWA 3U49A 3HL4A 3DVSX 3LY9A 1WUYA 4RQTA 4JVOA 4ALLA 3UAXA 5K7SA 3PIRA 1U1EA 2WSYB 2J07A 2BFEA 1S8NA 2JIQA 3QKIA 2BUAA 4GM4A 3ZHOA 3OD1A 3TNJA 2CHUA 1MZPA 3F8WA 5DTEA 3F6SA 1DSSG 3JATA 3K72B 4O25A 3IDAA 2D1RA 4TWRA 5DHFA 3ZIUA 3GJXC 3LUBA 3HKDA 3JWPA 2VNJA 3H0KA 5H02A 4TTSA 4O2LA 1RWBA 1P0IA 1TRKA 4KXXA 3LF2A 1LSJA 1KAMA 3ADKA 4MZDA 3LDAA 4MV7A 2NU6A 1AHNA 4WVLA 5F2EA 2IBMA 4ZAGA 2R85A 3U4QB 3S29A 5EXPA 3ZCXA 2Q8NA 3KQQA 4PC2A 2C5AA 1WG8A 1RQGA 1H6AA 3AI7A 3PA8A 5JY6A 3C41J 3GRUA 4TXMA 2QZPA 4WSOA 4H7DA 4AY3A 4M22A 4IKPA 3JZFA 4N3CA 3GVPA 4AP9A 1NASA 1CUGA 3JYHA 1BFDA 1GFSA 1KO1A 4O5OA 1NC3A 1T4DA 2XB6A 3OEWA 4M8IA 1YL5A 3UT0A 3B3AA 4TM8A 2QW0X 3KZMA 5JVDA 2AN9A 3HJNA 4GICA 1SKYE 4WV3A 3ISVA 4XM0A 3T4UA 1JAXA 3KRTA 4CW7A 1E1NA 1FX0B 3NTLA 3S1LA 2FNAA 5FA6A 2IS6A 1A95A 3AV0B 2B4YA 2W48A 3BQ9A 2B30A 1HR0B 4D9IA 1X94A 4J1JA 3RE1A 1OX4A 4LNHA 1VGRA 3RRYA 3MUFA 1R50A 1PTKA 1RZ3A 3FR7A 2CV0A 2QP9X 2EZUA 2HLHA 3WHIA 2N9UA 1FTWA 1WRBA 4RZXA 4B2LA 1P5HA 4GR5A 1JLLB 2NGRA 4TLLB 2BONA 5KYKA 2AN3A 3FAKA 3GDWA 1OAOA 2W6OA 1G19A 1MDFA 4Y6RA 5JCOA 2XVMA 2KWIA 2PRKA 3F7MA 3ZL9A 1E1KA 2FPSA 1SG0A 1TUBB 1W1UA 5HIMA 1X9IA 1CV2A 1ZEMA 221PA 3RS0A 1C1XA 5BUSA 4M1KA 1PNQA 2IYWA 3GCDA 3NWBA 2HSJA 3WYBA 1VIYA 1USGA 1Y48E 4Q4AA 4C01A 5EE9A 3PLAE 2MSDB 4NMHA 4ZO9A 4UNIA 2GA8A 1N8KA 3ZGNA 1EVIA 1KK1A 4YUYA 4UPEA 2J0UA 4LBVA 4QIHA 4UUQA 1CF4A 1KYQA 3C8UA 3BB3A 1PHRA 2CNOA 3FXAA 3P2EA 2C5EA 2OHIA 5IABA 2RAVA 4IDFA 2DX7A 5BSHA 2AFIB 3CZPA 4JELA 2GDZA 4B8WA 3NB0A 1Q19A 1X3LA 4MRMA 5EP4A 4AQ7A 4RFVA 3THXB 1Q0HA 3HUFA 1T5LA 4RETA 5BVHA 1PNVA 2VWGA 1XX6A 5GOZA 3VO8A 1FXWF 2ZRBA 4I1PA 4C78A 2ZJFA 4F8YA 1JKIA 5KUTA 1N4AA 5KTNA 4EPRA 2WWFA 2NP6A 3FFWA 4Y18A 4EJMA 2EF0A 1C2YA 4XVQA 4E5PA 1Z2OX 4X92A 1KP9A 4F2GA 4JLUA 1W87A 5U1PA 4ZJZA 3S81A 1NG9A 4OVKA 3SHVA 1NRWA 4DN6A 1N6KA 3KSUA 3LO5A 1KWGA 5DI3B 2DMRA 3RNOA 4CL0A 1DFGA 5CGQB 4NOMA 4UXHA 1KORA 1YRWA 3AY3A 1NWCA 2BGJA 3O0DA 2XGSA 3JZDA 3PIIA 3T9FA 3ZUGA 3RASA 4XOIA 5CVJA 1JIKA 1Y9DA 1DELA 3K94A 1E1CA 1VL5A 3VNUA 3SPXA 3KXKA 3WGUA 4BP3A 4LC1A 4E5KA 1PBTA 1QVVA 5LU9A 3PQ7A 1Q5PA 2QDXA 3COZA 1EHCA 3MN1A 4LJ8A 4X1YA 2F1JA 1PYDA 5K0GA 3C16C 1E9EA 4HUQA 4BAZA 3NP7A 2IYEA 1Q1GA 3EYWA 5H70A 3U7HB 1RZUA 2X7JA 4X7RA 1D1QA 4CT5A 4QVGA 1O4VA 5HQJA 3FDFA 1ND6A 2EJVA 5IDQA 2QL6A 1VJ0A 4KDCA 1REQA 2G17A 3QVGA 4K81B 2HLPA 5F3DA 4QT0A 5C7IO 3VAZA 4MK4A 4CIWA 4JJ6A 5DK4A 5FBVB 4PU0A 1WUHS 3T54A 4BFYA 1BGWA 3MGGA 4MWDA 2J6HA 3KHUA 3JVIA 2AK2A 5EUQB 1GDHA 4BQIA 1MXFA 3AVXA 2GN0A 2WUFA 2GZSA 4L74A 2LVBA 1QIEA 3EEYA 5EXSA 1LNSA 1XKTA 3ES9A 5FPTA 5F3RA 3VFDA 2CDBA 4IIBA 1U4OA 4HFNA 3Q8XB 5FIUA 3S2SA 1JQLB 1OFUX 2YUIA 4O4LA 3G82C 3NWEA 1RP1A 1XZIA 1RHQA 4MVJM 4L4YA 1AUXA 1TZMA 1CF9A 1HFJA 1WEHA 1JIJA 4G97A 4HQLA 4WE3A 1B0PA 2BCJQ 3O95A 1F1JA 4OKIA 1PD1A 2CUKA 3Q3HA 3PTAA 1QYWA 2H29A 2Q4BA 2GBPA 2IYXA 2SICE 3V3TA 5K3SA 3E9NA 3F4LA 3YASA 3AVWA 1XHFA 4HEJA 4WBXC 1OAOC 3P96A 2O4UX 2JFUA 3OKCA 4FQ8A 3HE3A 4ZRNA 1PR6A 4AF7A 1RD4A 3PD7A 5JCOC 4U7WA 4Q9JA 4ROSA 1U0JA 2VJQA 3Q4GA 5KS2A 1HYHA 2XUKA 4EB8A 5E6RB 2QGZA 3OZDA 2R25B 3LDFA 1YDWA 3ZPXA 4RE6A 3B3GA 4N5LA 1DB3A 3LE8A 2PUGA 4OJYA 5AVZA 3BE4A 2NQTA 3CKLA 4L75A 4LY6A 4BC0A 3ELWA 1YDMA 2PL3A 1CS4C 5LZ7A 2PRZA 4CF3A 4KQJA 3I61A 3BE6A 1F8GA 3RVQA 3WIDA 4YP1A 2IEYA 4ZT5A 1NI4B 2QRJA 2V9ZA 4LJ9A 5KQMA 4JKIA 4MEJA 2HQRA 3OCYA 4RJIA 2Y1LA 3N7UA 1W0CA 1AIPA 1J20A 1JLMA 2FQYA 2G04A 3IGFA 1Y6JA 5KIAA 1NRIA 2GK7A 2L0XA 2XQKA 4A0SA 2VPWA 2ZJ4A 5FHRA 3IA7A 3O75A 4DKXA 4JI8B 5ERYA 3E7PA 4PNPA 1GXSA 2WUDA 3ROEA 4KK3A 3X1ZA 5JZOA 1HQYE 2IF2A 3CO0S 3HYTA 3CKMA 4LDZA 3RC1A 3WZLA 3DMRA 4UW9A 1T3LA 2HU5A 5F21A 3C6BA 1X3SA 4YJFA 3TMAA 4EEZA 5HJ5A 2INGX 1KOGA 4KQHA 3ESDA 2GOYA 2PS1A 3FMFA 3OOJA 1OXBB 1J5XA 2DHRA 3K4HA 3QVKA 2WFAA 3LTNC 4F5YA 2J87A 1HEYA 3QXCA 2I2FA 2TSYB 3OOYA 3UA3A 3WYGA 3ZGVA 1VXRA 1EI9A 3VJKA 3WRXA 4ADSG 3A6DA 3E0QA 3JQEA 1DKLA 3QOFA 1JJVA 4REQA 4WY2A 2QUIA 4FLMA 4PIMA 1L7BA 1PZXA 5L3VA 2QMZA 5KHOC 2YC2C 3VZPA 3OM1A 5HSGA 1PFVA 4QBTA 1SXPA 3MRTA 3GJ0A 2GRUA 2E4AA 1LSSA 2PGAA 1VIVA 3R5HA 4MW4A 1EESA 3FHOA 3DZKA 3DLPX 3QE2A 4EDFA 1D4FA 2JJ8A 4YCNA 3SSAA 1UZAA 3E3AA 4CMEA 2YNMD 2FA9A 1AKVA 4V0SA 1AQYA 1NT2A 3SVTA 4CMGA 521PA 3LX6A 3NBXX 2Q49A 2B6HA 1MX3A 4F2HA 1L4KA 4YLYA 1I4WA 1X13A 4D4MA 1QOQB 4J7AA 3TSWA 4HSEA 2XRZA 4UTOA 2AEFA 4MS3A 3IJ5A 2CHVA 4Y1GA 2OGSA 1IDN1 3ILYA 4MW1A 1Y80A 2H52A 2WIKA 1B14A 1RU3A 4HGZA 4PYQA 4Z9FA 1XMXA 1JEEA 3F3MA 1EWTA 1TRHA 4RAQA 3C15C 4B3FX 2YW9A 3AW9A 2C3PA 3CRNA 2XXAB 2ZVDA 3EJWA 5DCWA 4TYYA 4KI7A 2ECPA 1U4SA 4A16A 4C7XA 4I8DA 1RADA 4MVJP 2XVXA 3HUTA 4NLLA 2QMOA 2E2WA 4JN6B 4N1AA 1ZPDA 2BGMA 3WRYA 3R7DA 3GUZA 4ON9A 2HSDA 3ZE0B 5LZ4A 2BFBA 1IK6A 2QE7A 5I01A 1F48A 1YC2A 3FX2A 4CEHA 3FETA 3NR2A 1RZRD 1O9BA 2HJSA 1ZN2A 3LCUA 3R40A 3A6EA 4MUMA 5AVYA 1SBQA 4I6EA 4YVFA 5FA8A 2LGJA 1J56A 5KWVA 5WRFA 4M1QA 3RSQA 4ZI2A 1QYXA 2YS6A 3MG9A 5HVNA 4GLOA 3BEDA 5G0WA 2ZJBA 4MCAA 3WLLA 1HQKA 1U0SY 3VR3D 4NENB 2PRYA 5F1YA 5ULLA 1X7WA 1YACA 2VZ8A 1XRMA 3AR8A 4V02A 4WESB 3U4AA 1RAGA 4UNNA 5LQRA 1H2ZA 3L7CA 3M2TA 4PC6A 4B3BA 4QNMA 1A8PA 3C3KA 3MWGA 2R1UA 2HCTA 4MAFA 1K2WA 2UYOA 3F8TA 2Q2WA 4G6ZA 1IG0A 3R8XA 3D31A 1D1SA 1V26A 3OU7A 4MUHA 3VR5D 2FW7A 5A6SB 4LECA 4BU0A 3BYZA 2EHJA 3EMDA 4COOA 5IBCA 4R54A 4AJJA 2W6ZA 4KVAA 4ODIA 4RVSA 3GGSA 3UWSA 4BO8A 4N76A 1P2BA 4P4SB 1KXJA 2Q07A 4YP9A 5F9MA 4CTOA 2AOXA 3KKOA 2OK7A 1HSZA 1V8ZA 3I05A 4FHDA 3FNQA 5LMCA 2R66A 5DULA 1JBEA 5CYOA 5ALTA 4LWZA 1I5RA 4I5FA 4LF7B 4JJ4A 4X1KA 1Z6QA 4HNAB 1SOVA 3ZJUA 2WEKA 3LC0A 4MGHA 4V1CI 1M5TA 2GCNA 5K3OA 4QM7A 3GEPA 2VBGA 3G23A 3H9QA 2A35A 1PFGA 2JBWA 3L1VA 3PGJA 3VC1A 1XTZA 3M1IA 3EMVA 2A9FA 1II0A 2WIBA 5AVJA 1J9GA 1UC4B 2O8FB 2ZWAA 3R77A 3GLKA 3T7TA 4TKLA 1L5NA 1A8HA 1T5DX 2UAGA 2F6RA 3D2LA 2VH1A 3WRXC 5HFNA 1PL6A 4G0VA 4OBWA 1ZESA 2WA1A 3EFBA 3Q0EA 1ZMTA 1IOZA 4KWEA 5CAEB 1OXSC 3SYMA 2JAQA 4JP8A 2BFDB 4HWKA 4BLWA 4DL9A 3G6WA 3ER8A 2PWPA 5B58T 1YASA 2CB0A 4PRYA 2BMWA 4D9MA 4B35A 2NNWB 2XCIA 3P2MA 2Y1CA 2Z2XA 3TQTA 3QU7A 3M6AA 4J8PA 3QX9A 1SC9A 2YUTA 5NULA 2DXIA 4CMEC 3HU3A 4HAVA 1UWLA 5K4AA 2XCTB 3IQFA 5J5CA 3D8SA 5FNZA 5C2JB 5AI4A 3CTPA 1X2EA 2GD1O 1Z0AA 2JGDB 3C70A 4RD1A 5CP8A 1T13A 4E5YA 5K20A 1S3FA 3PJFA 2ZR7A 4DADA 3W79A 3SR3A 1OLOA 4FIDA 3GN2A 3BJEA 2DR2A 2ISCA 1ARZA 3H83A 3AT1A 5F73A 3HPRA 2C83A 3VDRA 2BMVA 2BM1A 4TYWA 4Q34A 3EDCA 1Y9EA 1OAKA 2Y1WA 5E2IA 1O6BA 1X7DA 2PT5A 3BCUA 3C1OA 4EDHA 2VQSA 4L50A 4EKEA 3BSSA 3H5LA 4BEBA 5CJJA 3B70A 3O3NB 4P35A 4FN4A 3ICOA 2ZSDA 3EULA 3UJAA 3U3KA 2H51A 5B1DA 1JNXX 3DKRA 3KQVA 4JK3A 4R1QA 1U9ZA 3T1TA 1QPZA 4DDMA 4B3TB 1P45A 1ZK4A 1QF7A 2BR3A 3RKRA 4QUIA 5FOUA 1PW7A 1XLWA 5LBUA 4D43A 4UEJA 2H6EA 5I7VA 2AHOA 5JSZA 2WILA 4OQ4A 3P4UA 3WRYC 1KAHA 1CUBA 5AUPB 2PKYX 3DV0A 3HA5A 1JR3E 5IAJA 3NKFA 4LPKA 4R1SA 4X45A 4AMYA 4AY6A 4ERXA 4ZOLB 3H42B 4O0MA 1IZYA 2AZTA 2C2KA 5TT1A 1ULTA 3JXEA 4MW0A 5JXWA 1W85B 3LK6A 2E4XA 5COQA 3SYNA 4ZI7B 3COJA 4P9NA 1P2VA 2HU8A 1WDMA 4DDWA 2X3YA 3CRQA 4Z0TA 3A6KA 1OTXA 5TF0A 3H16A 2AFHE 3UCFA 4F93B 4BVGA 4BC1A 1OZFA 1V5IA 1BJTA 2JFVA 5JWRA 2FE4A 2VQFB 2GCOB 4R16A 5ISMA 1YJBA 4MHOA 4EITA 4H7FA 1W9MA 1RJGA 1WABA 6NULA 3NZEA 1V1RA 3GJ3A 4P33A 2P75A 3CKYA 3HXKA 3C7AA 1NMEA 2ZRIA 3C48A 4G89A 4HCJA 2A8YA 1FNNA 5EZ6B 5AIBA 3ANSA 4YRQA 1E96A 2FR0A 3CF4G 1G4AE 2EW1A 3T95A 5HM6A 3BAZA 3V7NA 1WDWB 4IOKA 1EIWA 3QIAA 2PYDA 1X42A 1EFVA 2WHYA 5E1MA 3R5TA 1MB4A 2J48A 2ZANA 4TTJA 4YUXA 1AM4D 4BGPA 3GD5A 4I81A 3NJ8A 4U7TB 3DQPA 1O6GA 2V96A 2B1GA 4PQEA 1BX3A 1T8YA 1SIOA 2OXCA 3EK2A 4KMSA 5FO1A 1SUWA 3R3SA 4NRDA 4AN1A 3K5IA 4R8KA 2QMUA 5CCDA 2H07A 4WKOA 4LKOA 2QVZX 4B6RA 1RWPA 3CRZA 4OFBA 4PANA 1XWWA 5M5BA 1C0EA 3KJQA 1P1RA 3IUBA 1DL5A 2IYRA 1G21E 2PIDA 3RS4A 3P0HA 2NXCA 2O06A 3F3YA 1G63A 3KWJA 4LIPD 4F9EA 1E9CA 5ECGC 2YQZA 5HFJA 3RVPA 4TZ6A 4RTKA 4I55B 1FK8A 3ABZA 1MC4A 3WMXA 4W8GA 4TTRA 2BSAA 5LQCA 3DBLA 4JLDA 1YR6A 3LNTA 5CFQA 3MOIA 3SFZA 2FWIA 2JATA 3OEHA 1M7GA 2RGYA 3QF4A 1I6WA 4TLAA 3T7EA 2X9LA 2YFQA 4XM1A 2ZK7A 1L1FA 1MHPA 4JXKA 2YYAA 3OM9A 1RI4A 2FB9A 2PFKA 1ZGJA 2JGRA 4IH4A 3BDAA 3FPAA 4L9SA 4DMRA 3AFHA 1K5DA 2A84A 4IVPA 1FVFA 5F2KA 5DM2A 1TMGE 2V97A 1EUDB 1K8ZB 5E4YA 1XRSB 2VJMA 3NC1C 4GOKA 3D2BA 1NW8A 1C4XA 5D3QA 3E35A 3S40A 2Q9UA 3HFGA 2G6BA 1K27A 2BKVA 1RPTA 2VJAA 2Z4SA 4FGUA 4J0FA 3JCZA 3WIOA 4YYEA 4BP8A 4EGAA 1GRRA 4F92B 1HNZB 2VCEA 1KR2A 3GZJA 3UGTA 4EKGA 1OX6A 1HYBA 2P5UA 3QWIA 4JGIA 1II8A 4MLDA 1I36A 1Q1EA 1S4MA 4DWWA 5A4FS 2JLVA 2VIIA 3PK0A 4UAVA 4WJLA 1PFYA 2DG2A 1EK2A 3PQEA 1KE1A 3UMFA 2NP7A 4LMBA 5AXDA 3GLHE 2B2CA 3RARA 3LXMA 4V0QA 2W9XA 4XD7D 2EP5A 4HZUB 5ALKA 1SOWA 2X1HA 2HYIC 1ADJA 4PAMA 1EWKA 1CUIA 3C5CA 1DO2A 1FC0A 5JSYA 1T9KA 1G5RA 1VECA 1T0BA 2QZZA 1WMAA 5F1KA 1C9JA 2EL9A 3MTQA 4H7HA 4TN1A 4CE6A 5L4SA 1IMOA 2H5IA 4QELA 3W6PA 3N75A 2GN1A 4UMEA 1GT6A 3S1AA 1G66A 4B6SA 1LI4A 2PH5A 2ZB8A 1OREA 1OQAA 2OSBA 3D5TA 3L0DA 1PJAA 3MT7A 4J07A 4PHHA 1CY0A 4GI5A 3SJAA 4JLAA 4URWR 3I6ZA 3ZTYA 3AB7A 4PLWA 1EX9A 3P2YA 5ICCA 4EJ0A 4ZJYA 5F1OA 2O3SA 4YRBA 4RGQA 5JHGB 2R1TB 1V71A 1SKBA 4MRRA 2FCRA 3CW9A 4IIYA 1GFWA 4X63A 5FBKA 5TPZD 3WRVA 2QBYA 3I5UA 4MHTA 1QG0A 3DNMA 4WK6A 4UMDA 4E5SA 1XXHB 3HWX1 3KYIB 4Q9IA 3BCSA 4L15A 4PRLA 5D5PA 1M6NA 1KY3A 4WPGA 5FBHA 1ABBA 3QUSA 5JV5A 2W90A 5JAZA 1EE2A 1XEAA 2FKAA 3NFYA 4MQLA 3ME5A 3IT0A 2QW8A 4KYUA 3O0TA 1ZXLA 5BV2P 2JRCA 5KVCA 4NMLA 1W25A 2H57A 1G8MA 3BIXA 4MKFA 4LZWA 5A71A 5EEGA 4D57A 2QRUA 3EZLA 3SJZA 5A5VA 3DDCA 1JTEA 1O96B 2XYGA 3KQMA 4I9UA 5JS1A 1ZGCA 2ODPA 2ZCUA 3A0UA 1R64A 4CV0A 1OKKA 4E13A 3OKFA 2X8WA 5JU6A 5ITZA 1QKKA 3LT4A 1Q7EA 4M54A 3TLEA 5U4XA 3IMEA 3QV2A 3LP5A 1OD6A 3OF3A 5CA1B 3NHBA 3OURA 2JZOA 3FKSA 4PAWA 2GWRA 4ZZ0A 5FTLA 1JEQA 5THKA 3WY9A 2PJZA 2ZFUA 3G0CA 4Q0MA 5A9SB 1XVVA 2F4VB 3UGKA 1KNQA 1JW9B 4FFNA 1UOPA 3MK31 4OUDB 1YB5A 1XROA 1IZ9A 2IE8A 4FKBA 1L5OA 1Q91A 2V6BA 4LPSA 4MR9A 4D26A 4OU4A 3GQBA 4OP1A 1XOIA 4MEBA 1DKUA 4CM7A 2CJYA 1ZWKA 2BZGA 3DJFA 3DZIA 2PWBA 4NK5A 3UT6A 4OEHA 1HTBA 2PH3A 1RJ9B 2OTCA 4HWOA 2WWTA 2CMKA 1YQWA 4O2RA 1X74A 4N03A 3TPZA 2IYFA 4UBOA 4KW7A 1QAQA 1ZGGA 5CVDA 3STVA 2BYTA 3EZ7A 3JVUA 1N6PA 4ZAFA 1TKCA 1JSCA 5T3YA 1ZM3A 2VSYA 3DW1X 3GEGA 3ORYA 4ZU3A 3LZ6A 2WBLC 1HXHA 2XD9A 3F6RA 3VDMA 2E89A 5F2NA 1VLJA 2XTMA 5TRTA 3USZA 1NV8A 4L95C 3MCZA 4AMGA 7ADHA 3ESQA 1XTJA 2XHEA 2CUTA 1W29A 2QT9A 3H5TA 2VR1A 3M3HA 4J03A 4OHMA 5HKOA 3V8NA 4C0AC 2CSXA 2WFLA 3WWPA 1WXQA 1A9RA 3C3CA 4A2WA 5AW0A 4GL2A 3KXPA 3QF7A 4FFBA 3HZHA 5C0OE 3RU3A 5IJ9A 4IDQA 5KYVA 2R6AA 1G4UR 2MT9A 2VP4A 4DNXA 5F33A 4W82A 1IVNA 1A2OA 2CZCA 3I8XA 5JALA 5LP1A 5MFPA 4S35A 2LTAA 1CK4A 3QPBA 1TXGA 1XNJA 1P60A 3K73O 4BWYA 4QJIA 4N48A 2A5FA 5F64A 3QKSA 1JGTA 3W7BA 1RXSA 3SZGA 1EUYA 1RC8A 5D00A 1SIBE 2Z8ZA 1Z0IA 4M0PA 1WW8A 5GGXA 3O31A 2I7VA 3PNPA 5KSPA 5BN4B 1EJ6A 3I83A 2ARKA 3U7RA 4D56A 1HDZA 3DD1A 2RGRA 2PGLA 4Q3NA 2OVFA 3WV4A 4WZZA 1H69A 4WBNA 4XI9A 1LPSA 1GITA 3UK6A 1GA6A 2J3EA 3NKLA 1GPMA 2J85A 4FYIA 4KRFA 3IV6A