3VPSA

Structure of a novel nad dependent-ndp-hexosamine 5,6-dehydratase, tuna, involved in tunicamycin biosynthesis
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
303
structure length
303
Chain Sequence
KHRILITGGAGFIGGHLARALVASGEEVTVLDDLRVPPMIPPEGTGKFLEKPVLELEERDLSDVRLVYHLASHKSVPRSFKQPLDYLDNVDSGRHLLALCTSVGVPKVVVGSTCEVYGQADTLPTPEDSPLSPRSPYAASKVGLEMVAGAHQRASVAPEVGIVRFFNVYGPGERPDALVPRLCANLLTRNELPVEGDGEQRRDFTYITDVVDKLVALANRPLPSVVNFGSGQSLSVNDVIRILQATSPAAEVARKQPRPNEITEFRADTALQTRQIGERSGGIGIEEGIRLTLEWWQSRDLDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biosynthesis of nucleoside antibiotic tunicamycin proceeds via unique exo-glycal intermediates
rcsb
molecule tags Transferase
molecule keywords NAD-dependent epimerase/dehydratase
total genus 103
structure length 303
sequence length 303
chains with identical sequence B
ec nomenclature ec 4.2.1.-:
pdb deposition date 2012-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3vpsA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 3vpsA02
4WLNA 2WE8A 3PEFA 3ZWXA 3PK0A 2O7QA 5JE8A 3W1VA 1ZCJA 4RZIA 1LQTA 3ZNQA 4NJOA 2AEFA 3EZLA 1CYDA 4L4XA 3WMWA 4BIIA 3COSA 4S1VA 1LSUA 3JQDA 2EERA 4JP2A 5L4SA 4BNHA 3GDOA 4MJLA 2X9VA 4AJHA 1DC6A 2NTVA 2X0JA 2HJRA 2Y1EA 1B0AA 4HX5A 3D4NA 1B26A 2Y0CA 2JJYA 1NYTA 3DHEA 2BGMA 3OIDA 4Q9NA 3DBHA 1WDKA 2HO5A 3WG9A 1Y5MA 5JC8A 5THQA 2E49A 5A05A 4R3WA 1PJ2A 3ZHBA 2DPHA 1I30A 4L73A 3VZRA 4GQAA 5KVQA 3RUEA 3TL3A 4YJDA 3RUAA 4E0BA 1ZMTA 4EEZA 2NLOA 4W4TA 4DGSA 3RFVA 1EZ4A 1T2DA 3E6AA 1UP7A 3WGQA 3V1YA 4ID9A 1BVUA 1ZK3A 1NVGA 3HFSA 1GPDG 2CDAA 2XXBA 4JX8A 3JQ8A 4RL6A 4BB6A 1MX3A 5DDIP 3T7CA 2O50A 2Y68A 3KUXA 4KTTE 3BTUA 1HSOA 5T67A 1F8FA 3L6OO 4R01A 1PJ3A 2DAPA 2XPCA 4WE3A 2BGKA 3IJPA 5B12A 2VYVD 5JCXA 1T1RA 1PGJA 1UXGA 3FBGA 4D79A 5JW6A 3QWHA 3UCEA 3U09A 4L9RA 1W8DA 1DIAA 2VYNA 3NYWA 1U9JA 4OIMA 2Q46A 3DTTA 2C2XA 1NASA 4RVFA 4AJ4A 4DC0A 1P45A 5TF4A 2EKLA 3MTGA 1PU2A 3DONA 5C7LO 4LK3A 1SO8A 5CDTA 4BNLA 5ER9A 5G2OA 3UHAA 1PEDA 3HDYA 4BHTA 4KUHA 5EINA 4NI5A 1MFZA 3TWOA 1SCUA 2BD0A 5G4LA 3RROA 1VPDA 3EDMA 2O4CA 2GNAA 4GSKA 4N7RA 1VI2A 3AI3A 4P4LA 4BB5A 4ALNA 4BOYA 1ENPA 4TWRA 1H6CA 1GPJA 2DM6A 1YB1A 3PIIA 4RDIA 1S7CA 3TQHA 1E3IA 1KOLA 1C0PA 3ZV6A 1IZ0A 3VKVA 2Z95A 4KQXA 4YAEA 2AEMA 2VN8A 2TMDA 4U0KA 3RSHA 3ZWVA 4NH4A 2NVUB 2X0RA 3MJVA 1U4SA 2P5UA 4I5FA 2PFGA 3DZBA 4GGOA 4NJMA 4OYRA 1TT5B 3PDJA 1ZJYA 4E32A 3WLEA 3E5RA 3ENNA 3LK7A 2G0TA 4L4SA 3GGPA 4RORA 3VPGA 1M2WA 4M55A 4ZJUA 1LDNA 1Z7EA 3H9JA 3I1JA 3PHLA 4WUVA 3ZWYA 3ROQA 3ENKA 4BKUA 3U4CA 3C1OA 1SNYA 4LRTB 1D1TA 3RASA 1KERA 2BELA 3EZYA 4ILKA 1JDJA 4NNJA 1HLDA 4J9VA 3QLJA 5KJ1A 5IAAA 4CUJA 1JTVA 4FW8A 5AXDA 1PSDA 3E82A 5TSDA 1E3LA 1R0SA 2H9IA 1SC6A 3PWSA 2PZJA 2GD1O 4WOKA 3TDKA 3Q6IA 1YQXA 3C8MA 4MOWA 4ALKA 3OH8A 3ORFA 9LDTA 2G1UA 2JFHA 4XDYA 1PJBA 4MP3A 2NTJA 5CDYA 1EBUA 5TS3A 4ZHSA 3ZV3A 4EBFA 5KNLA 4AJ1A 4B3HA 1YOVB 2D4AA 4A03A 1C1DA 3AI1A 3PI7A 2UYYA 3ZI0A 3DR3A 1RYDA 2EG9A 2C5EA 4FGSA 5JDCC 5JO9A 3AFMA 2UUPA 1A71A 2AQIA 3R3SA 5IN5A 4CMKA 5JS6A 1GADO 2FPGA 4L4RA 2B37A 4DPMA 1I24A 4YWJA 3W4KA 1B7GO 1O94A 3JYPA 1DIRA 2X86A 2FPIA 2FY8A 4NJMB 2XOXA 1GFSA 4BNYA 2E48A 2GYYA 3HB5X 3K6JA 3AK4A 3VKUA 1QP8A 1ZXLA 1B8VA 3KOUA 2RHRA 4U8GA 1PGNA 1KEPA 4DXHA 1BSVA 1YJQA 5ER6A 4D41A 1R16A 1I2ZA 1X13A 2NU9A 1DO8A 2YV1A 2DBVO 1DB3A 3GMSA 4NBRA 2O23A 3WYCA 4A27A 2WSBA 1HZJA 3JTMA 2GZ3A 3PYXA 4KUEA 3AUSA 4PCVA 4IDDA 4TRMA 1M6HA 4XDZA 3V1TC 1TA4A 3IUPA 3OA0A 1ZK4A 3GR6A 4F6CA 2VUUA 4QX6A 3LU1A 1XQ6A 1RM5A 4E3ZA 1MP0A 3CXRA 4Z0HO 4CMAA 4CLRB 5BNIA 3Q2KA 4KP7A 1RM4A 4D3FA 3UH1A 5I7EA 1Z73A 4WCFC 2HKIA 6LDHA 4M49A 4XR4A 5CEJA 1JQBA 4K6FA 4Z0PA 3P19A 3PJFA 4BO6A 3UKOA 3C1TA 2IDZA 5IDWA 3AJRA 2ZJ0A 2IXBA 1M6WA 2VHWA 2X0NA 4KTVE 4XYGA 5KVVA 1R0LA 3P7MA 1DSSG 1W6UA 4IDAA 4D3SA 3CINA 4BO7A 1L7EA 1CDOA 2E6UX 1E6WA 5CHEA 3RC9A 1S6YA 3H5NA 1EVJA 4FCCA 3ROMA 4EJMA 4CLXA 2I9PA 4CPDA 3AU9A 4RPHA 3C85A 1ZNQO 3DBRB 2BHLA 4BKPA 2HMUA 2R00A 1E7QA 2FN7A 2PTGA 1NPYA 1E3EA 4EUEA 3GEMA 3DZHA 3DBHB 4H7PA 1UZNA 1NBOA 4J2HA 4LGVA 3F47A 3DMTC 5ICMA 4I5DA 4N18A 1JWBB 2WD7A 3GFBA 4CMIA 4J43A 4FFNA 2NSDA 4B7UA 4ONEA 2FRDA 1OBFO 3T7EA 3AWDA 2AA3A 4DLLA 3V8BA 3B1JA 3NJ8A 3TPCA 1O6ZA 1X7DA 5KWEA 4RPKA 5LDHA 4PG8A 1QV6A 1IYZA 3QE3A 3OEWA 4H16A 4J6FA 1YKFA 4ESOA 1LDEA 2VNAA 3QV1A 2I99A 4OKNA 3JQ8B 1ZK0A 2FR1A 1UJMA 1FDTA 3EUWA 4JBGA 2GN8A 1BWSA 4MVJP 4W7HA 3OJOA 4B4VA 2D59A 2EXXA 3OICA 3CZMA 2X7HA 3V2GA 2Q2QA 4BNIA 5CFZA 3A4VA 5BR7A 1UP4A 2UVDA 4IPTA 4XB1A 3PFFA 4JCOA 3CZRA 4ZGWA 3BAZA 3WWZA 1YJ8A 4YAJA 1IHXA 1SPXA 4NBWA 1WWKA 4DPKA 1XCBA 3PHJA 3QWBA 4BV8A 4OOFA 1LI4A 3JD2A 1GCUA 2A9FA 3OF2A 3QSGA 3GUYA 4I9HA 2WMDA 2IEBA 2WYVA 3RQSA 3WGGA 1PQUA 4FC6A 5AOVA 1PL8A 1F06A 3KSUA 4BGVA 1PJQA 5TX7A 4BUCA 3AFNA 1YL6A 2VWGA 2GN6A 3JSAA 3BTOA 3KSZO 3NTRA 2ZB7A 3WFJA 3CMMA 3ZV5A 3H8VA 3I4CA 4R9SA 4YDRA 9LDBA 3M1AA 5A9SB 2PR2A 4OQYA 5TT0A 3GRPA 5F5NA 1ZH8A 3SC4A 4IS3A 3I3OA 3Q9NA 1U1IA 4J1TA 4M89A 1LLDA 2CF6A 1DJQA 3NTOA 4DREA 4O0LA 3WIEA 4TZKA 3GUCA 3UICA 2Y0EA 4PG5A 1H5QA 1QORA 1ZUD1 4BGEA 4PLWA 4DBVO 3F4BA 5A9TA 3PFWO 1YE3A 4MVJI 5KOIA 4QFDA 4AJPA 2DC1A 4PG6A 1U28A 3B20A 1IE3A 3MJEA 1XU7A 3DEYX 2NM0A 4B7XA 4FDAA 5AYVA 2H63A 4IJWA 2OP1A 3HDQA 4OKIA 5A3JA 2DUWA 3IP3A 1ONOA 2X4GA 2CUKA 4WLEA 4YJHA 1XELA 4R4JA 4XYMA 1V0JA 3WNQA 4BKOA 3DHNA 2I5PO 3GOHA 1KY4A 4A26A 5A04A 1LRLA 3GVIA 2QRKA 4NZ9A 4CM8B 1M67A 2VZ9A 4YT2A 1P77A 2E82A 1HYHA 4RVUA 1ZMOA 1DAPA 3Q11A 1GCOA 1NAHA 1V6AA 2C7VA 3BMNA 3ETDA 4GI2A 3BHJA 1N5DA 4W99A 4CM4B 2P68A 3PHIA 3BHIA 3HUDA 1UH5A 1JVBA 4LRSB 1C3VA 1KEVA 1O95A 3V1UA 2YV2A 2VNSA 2P91A 3GLQA 5CAEA 1YO6A 4B4WA 3ROPA 4KWHA 3R0IA 1YDEA 3GZNA 3HADA 4J1QA 4GX2A 3VOSA 3FBTA 4RCVA 4GVLA 4XYEA 4CQLB 1LDYA 4YVFA 2VHVA 4PZEA 3TRIA 1DC3A 3K73O 3OM9A 2OGUA 1NM5A 5JO0A 5JLAA 2YY7A 3E03A 5JBIA 2CF5A 3KV3O 2B5WA 2PGDA 5KIAA 4K1LA 4CQMB 4CV1A 4JQCA 4U6QA 4RV9A 5I9NA 3BMOB 5DBGA 1FDVA 5EL0A 3A9WA 2V6GA 4OSPA 2DTEA 1D8AA 5JY1A 1GAEO 5F3RA 4ZU3A 1QR6A 3KLMX 2YDXA 4Q3NA 1WAMA 4NBTA 2NVWA 1O8CA 4YTEA 1N1GA 4BQPA 5IZ4A 4U5QA 3IS3A 4WLVA 1VJ0A 4CMCA 5TGDA 4BO5A 3TL2A 2IZ1A 3GH3A 4RJTA 5I7FA 2G17A 3UAGA 1WXDA 2W2KA 3ANLA 1R0KA 2C29D 4NPCA 3SVTA 3OSUA 1RYEA 1NHGA 3KVOA 1AHHA 4EZBA 4XYBA 3CE6A 1AXGA 2DPGA 3HN2A 3L9XA 2DUUA 5U4QA 3ZU3A 4WLOA 1Y9AA 2OBYA 5KJCA 1M76A 3RUDA 3WYBA 2Q2VA 5TIIA 4WNIA 2A94A 2DBQA 2BFPA 3E8XA 5THKA 2JKVA 3KYBA 3SJ7A 1JW9B 4YBZA 3DMYA 1Z6ZA 3RJ5A 3PLNA 2GASA 2GGSA 1SBYA 1T4BA 1PZHA 1CERA 4XQCA 1HL3A 4CQLA 1O9BA 1H0KA 4IXWA 2J3IA 4HP8A 1KVTA 5CEFA 1VE9A 4R5MA 1E1NA 4L0QA 4CQMA 1LBEA 2CSUA 3OBBA 5KKCA 1HEUA 3I5MA 1HDOA 3PJGA 2YQ5A 4CR6A 4E5PA 5FEUA 2AEJA 1BMDA 4C7KA 5T64A 4I1IA 1C1DB 1I2CA 3PWZA 4W9NA 5KJFA 5CEEA 2VT3A 1JA9A 4K26A 1YBAA 2ZB4A 1IB6A 1U3WA 2J5RA 1P33A 4U6SA 4GMGA 3B1FA 3RFXA 2JAHA 4UREA 4CUZA 5BSFA 1EDOA 3O9ZA 3U9LA 1HWYA 4HNGA 1LDGA 1LRJA 4ZN6A 1GEEA 3D4OA 4MIEA 2QHXA 1LC3A 2OZPA 2VHZA 4JBHA 4CR8A 5K6AA 5JPIA 3I52A 4DWVA 1ISMA 4FQ8A 1LXCA 1I01A 4L8VA 2FSVA 3DOJA 1LSJA 1B8PA 1FJHA 1KYQA 5JAQA 3MEQA 4O63O 2H1SA 3K31A 2YYYA 8LDHA 1H93A 1Y8QA 5DCYA 4D42A 3FTNA 2HUNA 2ZJ1A 4MVJA 5BT9A 4EJ6A 2GLXA 4NHEA 4R9RA 5H81A 5C37A 2YZ7A 3BMQB 3ZU5A 3QA9A 1UZLA 4MKXA 2P4HX 1NHWA 5DP1A 2DQ4A 2X9GA 2R2GA 1P1JA 1LNQA 3D64A 2D5CA 2QRJA 2ZCVA 3GG9A 5K6AC 4E33A 1VSVA 4BO4A 1EUCA 1NQ5A 3JQ7B 3K5PA 4GWKA 3QIVA 4RPJA 1KVUA 2YHIA 5HBRA 4BQRA 3HG7A 1M66A 3WX0A 3VVCA 4BMVA 3GVHA 3KSDO 4TZTA 4XGKA 1GZ4A 4CODB 5CDUA 7MDHA 5TC4A 1E5QA 1Y5RA 2DKNA 3GNSA 5AXAA 4U0JA 3DMTA 3PVZA 5GZ3A 4C7JA 3TZCA 3IIEA 1A4UA 1UXJA 2NU7A 1KETA 4A7PA 4JP3A 1F12A 4PG7A 1LJ8A 4X54A 3NAQA 2O3RA 5I8ZA 5JDCA 3GAFA 1E6UA 1P74A 3M6IA 3NT2A 2PV7A 1B15A 1NNUA 1PL7A 4I9UA 1E0DA 1P44A 3PHHA 5A9SA 1R4NA 5COQA 1DBVO 2GN4A 5EN4A 3B70A 2CVOA 3FNHA 2LDBA 2W2LA 1XG5A 2JL1A 1HYEA 4J9UE 1M75A 3WOHA 3F1KA 4EUHA 2Y0DA 4I08A 1MG0A 1HDGO 2Y1FA 1Z7BA 3IDSA 1BXGB 1WMAA 5JYDA 4YJHB 4BO3A 1VSUA 2PD3A 3BMCA 4BO9A 3U4HA 5A02A 2EW2A 1CJCA 4H15A 4RPGA 4ZQFA 2X5KO 1B3RA 3RFTA 1PJCA 2GZ2A 4BL5A 3DZGA 3LF1A 4B3JA 4FN4A 1ENYA 4RVHA 4LCEA 3DFUA 4M54A 3DBLB 3PDUA 2WWRA 3ITKA 1AXEA 5HRUA 3LLSA 4YB8A 4D44A 3JQGA 2BF7A 3TJRA 2WJPA 4D7AA 3PIDA 4BGIA 1IOLA 4XCVA 5JSFA 4A2CA 1A7KA 4YEDA 1QG6A 2IODA 5A4DA 4YT5A 1Y9EA 1PZGA 1LRKA 4RF2A 1JAXA 1V9LA 1VM6A 3VAZA 4YAKA 2YQ4A 3W8FA 2JCYA 3AM5A 2WTBA 1G0OA 1NVMB 2JHGA 3I4FA 1U8XX 2P9CA 2BLLA 2ZQZA 5TQVA 4TRRA 5A1TA 3IKVA 4I5EA 4AG3A 2JHFA 4PLVA 5JMWA 1U3TA 1TEHA 5COAA 1C0KA 1HE3A 2B5VA 4N54A 2B69A 3QWAA 2DFVA 1GZ3A 3ZNNA 2YW9A 4QQRA 1G0NA 3KTDA 2V6BA 4D45A 3GDFA 1VL0A 2F00A 1R4MB 1UDAA 4NDNE 2FHSA 3FSRA 3OJ0A 4HXYA 4UVHA 4WASA 2PZMA 3GGOA 3EC7A 3W8DA 3WQQA 5C7OO 4CLRA 1NR7A 1GYRA 4IDFA 3SC6A 3D7LA 1PGOA 3OMLA 2VZ0A 1AGNA 1FDUA 5AXCA 2P9GA 4ZRNA 3PJEA 2RIRA 3S55A 4Y8VA 4BNTA 4WLFA 1Z75A 5IZCA 4DC1A 3MTJA 1E3JA 1W0CA 4HUJA 4RZHA 1ADGA 1VLLA 2LDXA 4O1MA 3HJAA 1ZIDA 3K96A 2P9EA 4ZA2A 2OXIA 2Q99A 5TNXA 3V2UA 1LC0A 4GPD1 2AG8A 5DOVA 4HFNA 3JYOA 3WJ7A 3VTFA 3P2YA 5TJ9A 4R68A 3L4SO 1NR1A 4Z3DA 1BRMA 2PKRA 3KYDA 2X9NA 3W6UA 5EMHA 2FP4A 3O38A 5DNAA 1RJWA 2AG5A 4DIOA 5L95A 3PQDA 4GX0A 4XD2A 2WEKA 3NT4A 3OJFA 3G79A 3WNVA 4YRBA 2GPTA 3JQBC 3NKLA 3WBBA 1RKXA 5K0ZA 4OJNA 3AY3A 3IQDB 2CFCA 3R6DA 4FD3A 1ARZA 2D8AA 3FI9A 2C59A 4CMJA 3JQEA 4YAIA 4JK3A 2NQTA 3G1TA 4ND5A 1HRDA 2PD4A 3H6KA 4FJ1A 3QVOA 4QTZA 1K2WA 2JCXA 5ICSA 2J6IA 1DIGA 4UVGA 1VKOA 4B79A 5IXYA 2IZZA 1KS9A 1G1AA 5HTOA 4O59O 3BYZA 1QYWA 2EJWA 2VRCD 3QVSA 4J4BA 1GQQA 3M2TA 4IZIA 2FPPA 2EV9A 5F1OA 3RUFA 4UUOA 3EYWA 3QJ5A 4GBJA 4O5OA 4Y6PA 3PQFA 1EFKA 4GLLA 4MVJF 2Q49A 1B16A 1U3UA 3MJCA 4AJEA 4HFJA 2QZ9A 4R1UA 4DQUA 1NWHA 3GHHA 5I9MA 4AFNA 5IDQA 2CDBA 1XKQA 5DZSA 3JD0A 3SLKA 1C1XB 2HMVA 3OJEA 3AY7A 3I9OA 1E5LA 2IZ0A 1DDOA 1T2EA 1KBZA 1NFQA 4ZQBA 2BMAA 4CV3A 4WEOA 1X1EA 4LVUA 1I3NA 3DBLA 4Q39A 5AQ1A 1YB4A 4CM6A 1MC5A 4B7CA 3ZCXA 2HQ1A 3K9QO 4BMSA 2GCGA 2EKQA 3C1AA 5IJZA 1ISIA 4FFOA 2WYWA 4NG5A 4PLPA 2WM3A 3QP9A 3D4PA 4RVDA 4MVJG 2QYSA 2QZZA 3TN7A 4F3YA 3QWIA 3VVBA 3N74A 3G1UA 1T24A 1KVQA 2V7PA 1MLDA 1XWFA 3ZDFA 3EW7A 1K6IA 3GFGA 5JFOA 4QECA 1KEWA 5JAMA 2GN9A 3JYLA 1Z82A 3GNTA 3H9UA 3OQ6A 4J49A 3HQ4O 3UW3A 1X14A 4OAQA 4E2WA 1IUKA 2Y93A 2HCTA 1ADCA 1GQ2A 4GX5A 4ND1A 5TLSA 4UUMA 4FFMA 2EEZA 1O0SA 1Y8QB 3G3EA 1BXGA 4BO1A 1DFGA 1A7AA 4DTIA 4GH5A 1HDXA 4QFCA 3ZHYA 2V6FA 2Q50A 2P4QA 4II2A 5KVCA 2WE7A 2Z1NA 3MCVA 3O8QA 4P4GA 4ALJA 5IF3A 2UV8A 4YJFA 4PN3A 4BO2A 1B8UA 1XU9A 3RUIA 3TF5A 3FRJA 4OSOA 3W6ZA 1XDWA 4CLHA 2AMFA 3D0OA 3GNQA 2O3UA 4GGPA 4BNFA 5JCJA 3O4RA 5I8WA 4GAEA 3BMCB 1Y8RA 2HK8A 3PPIA 4LSMA 3CKYA 3GVCA 4HADA 1ULSA 3EY4A 3L0DA 4WLUA 4AJNA 2G5CA 3CH6A 1LX6A 1MUUA 3HNPA 2ZKLA 1HT0A 2CY0A 4J1SA 4CL3A 3UFXA 1OC2A 1YVEI 1QYXA 2Y05A 2BFAA 3H9EO 4E6PA 4OM8A 5EESA 1K5HA 5L7WA 1LEHA 1BDBA 2O3QA 3RKUA 4GLOA 4IDEA 2GSDA 3R1IA 3MJ4A 4WECA 4EJ0A 4QUKA 1OOEA 4UVIA 3SEFA 2VYVA 4XQGA 4EYEA 2X0IA 1DLJA 1YBMA 4HWKA 4DRYA 3IL2A 1JKIA 1GV1A 3AI2A 1I3LA 3ST7A 3WGZA 4RLHA 1R4MA 1U4OA 2V6MA 2Y1GA 4LMRA 1HDRA 1U5AA 1W73A 3ASVA 1WZEA 1ZSVA 1QYDA 2OHXA 3B1KA 3ICPA 4WEQA 4YR9A 4QXMA 1LDBA 4INAA 4RVSA 5F21A 4NFYA 2FMUA 3L4BA 3QQPA 3IOYA 1ORRA 4Z9YA 3PGJA 3HFGA 4J7CA 1UZMA 2VHYA 2QRLA 1CRWG 4J91A 2NTNA 1AUPA 1MGOA 2HRBA 1BTOA 2ZB3A 1GU7A 2P5YA 5EQFA 4B3IA 1PS0A 1TVEA 3I23A 3VTZA 3CSDA 2Y66A 2ZYAA 4TROA 4DYVA 4EDFA 3G0OA 4N5LA 4AICA 4F45A 1PGQA 4Q3EA 1N7HA 1WDLA 2ZYDA 1LSSA 3ZV4A 4UULA 5C3MA 3TZHA 1E7RA 1H6BA 3PTZA 3H4VA 2I3AA 3WGTA 4M1QA 4E2XA 2CDCA 3KO8A 4F6LA 1P1FA 1KC3A 2NU6A 4NBUA 4OL9A 3RWBA 4CMEA 5ES3A 3ONEA 1EQUA 3ASUA 3NJ4A 5DCWA 3W4IA 1FDSA 3TOXA 2POQX 3CUKA 3OP4A 4NFHA 2HMTA 4EITA 1PQWA 3L6DA 5U9CA 3S2EA 2VYND 5A9RA 3EVTA 2O7SA 4FFRA 1EVZA 3H9GA 3VPSA 4P8RA 1EK6A 3RUHA 3DZKA 4BO0A 2X5OA 5K9ZA 3VPXA 1HDCA 4EEXA 4Y6SA 3AM3A 2QIOA 3INGA 4S3MA 5KKAA 1ADFA 4WCFB 1ZEJA 4K9DA 3GY0A 4ND3A 3FR8A 4MIOA 3K92A 2HJSA 4L76A 4PIVA 1AHIA 2GRAA 1A27A 3GF4A 1T26A 2BFMA 2R6JA 3M2PA 4FC7A 4OOEA 2YFHA 1B14A 1NFRA 4NU6A 3ANMA 5F1PA 1E77A 4IJUA 3U62A 1YOVA 2EF1A 1C1XA 2J5QA 1X7GA 5L3ZA 1NPTO 1SAYA 2OOSA 3ZWMA 3FCOA 2PGJA 2W4QA 4M87A 5HS6A 3H9QA 4BNMA 3AUUA 3UCFA 3GHYA 3TSCA 4ZQHA 5KJEA 2HMSA 4BKRA 1Z74A 3Q1LA 1J0XO 4MDHA 3WDSA 1X15A 3RC2A 1GD1O 2AXQA 4RVGA 4WK6A 4YXFA 1WDMA 5BSEA 3KZVA 4W82A 4DL9A 5DBIA 1FXSA 1HTBA 1UXIA 2VZ8A 3PZBA 3ZW8A 1H9BA 1F8GA 2YJZA 3C7DB 3FWNA 3VH2A 3LF2A 4BNXA 4FFPA 3OECA 4XIJA 1XLTA 4TRJA 3U4DA 3K30A 4WOJA 4RF3A 1XQ1A 5G0TA 4CUKA 1YS4A 4IIUA 1N1EA 3GK3A 5FF9A 4J3FA 1N9GB 3QW2A 1D7OA 5I7VA 4P22A 3WSVA 1FK8A 1Q7GA 1GUFA 2PWZA 2HU2A 4A0SA 2C20A 3HHPA 3D3WB 4YYZA 1X1TA 4LCJA 2Z5LA 4R16A 4FGWA 3N58A 4BO8A 4BVAA 3S8MA 1E7MA 4E5NA 3JQFC 1QYCA 1HE5A 1T2AA 3BTSA 5A06A 2FZEA 1O89A 1BXKA 5G0WA 4XYLA 2E37A 1DC5A 3JQAD 4FOSA 4AJKA 2O3SA 4MPDA 1K89A 1T4DA 2YFQA 3WQRA 1J49A 3A28A 3E48A 4ND2A 3Q3CA 4E31A 2HSDA 1MXFA 5G4KB 2C54A 1EMDA 1GY8A 2VHXA 8ADHA 4ZRMA 1U8FO 3WWYA 2C5AA 3HWRA 4J7UA 4Z9FA 3INRA 1Y8RB 5FI5A 3JQ9A 1UAYA 3F1LA 4ITUA 3SJUA 2NNLD 3LZ6A 4D46A 5EJ2A 1MFPA 2WYUA 2C0CA 2YUTA 4JNKA 4IMPA 2VTDA 2VOJA 3DC2A 4RF5A 2VT2A 3DQPA 4NIMA 3P5SA 1XA0A 2NACA 1F14A 2FOIA 2GERA 2GDZA 1HE2A 1XIVA 1MV8A 3ETGA 2B83A 2BI7A 2EWMA 3M1LA 4RPLA 1E3SA 3UGKA 3BTVA 1R66A 2AE2A 3VDQA 5L51A 5ENDA 3AOGA 3OIFA 4GVXA 4XWYA 4W9NC 4U7WA 1DPGA 2B36A 5CPBA 3NX4A 3EHEA 4UVDA 4F46A 1IZ9A 4WKGA 1ISGA 2OBNA 3ZW9A 3F3SA 3RI3A 5L7TA 4Z0TA 3ONDA 1VJTA 3T4EA 1ZEMA 2O3TA 1Z45A 5F1KA 4CM1A 4ZICA 5T5QA 4QT0A 5KJ6A 2P2SA 5BNFA 2GO1A 4Q3BA 3KEQA 1PQPA 2CD9A 1WVGA 4FIZA 1V35A 4KMSA 1Y6JA 3SX2A 4XQ9A 3GRKA 1P1RA 1PR9A 1I3MA 1JWAB 3I9JA 2JD1A 3LC7O 1EUDA 5FFFA 2EHDA 2WD7B 2B35A 4CMIB 1QLJA 3DZJA 3GGGA 1QSGA 4CM9D 3ONFA 4IS2A 4B4UA 3U4IA 2VWQA 2IXAA 1E7YA 2G82A 3BHMA 4Q3AA 2BH9A 1YWGO 5C7IO 2W2KB 5B4UA 2PGLA 2EGHA 3KYDB 5B1YA 1KY5A 5MGBA 3JYQA 1RWBA 3WBFA 2OMEA 3VZSA 2JAPA 3WIDA 1R15A 4CM5A 1XHLA 3JD4A 3JYNA 2I6TA 1JAYA 4ND4A 4IQ0A 1PIWA 3KYCB 1H6AA 2B0JA 3IKTA 1UUFA 2PKQO 1FDWA 2OFPA 4PGFA 3DL2A 2VWPA 3BMOA 2X8LA 3MWEB 4DLBA 4DIBA 2Y1CA 1HE4A 1SB8A 1JKJA 1LLCA 4GX1A 5F5LA 5JYEA 3QY9A 3GC6A 5T8KA 3RKRA 1X7HA 2FR0A 4DQXA 2H6EA 2DTDA 3WSWA 3GMDA 4UUPA 3DO5A 1E1MA 4IGFA 4YRAA 4CM4A 1N92A 4YACA 1ML3A 1PS9A 5LCXA 1Q0LA 1TI7A 2SCUA 3FNGA 2HAEA 2CMDA 3ANNA 3OA2A 5HWSA 2O4UX 1LLUA 4FJ2A 3PWKA 4ROSA 2BFOA 2NVUA 4UEJA 3X2FA 1R12A 3QVWA 4PLHA 5CP8A 4J1NA 4IQ8A 1HETA 3S2IA 2AQKA 4XEHA 5L40A 1WPQA 1ZO8A 2DBRA 3I9LA 3NUGA 5T8KC 3MJTA 2EW8A 4I8XA 4J90A 3TFOA 2IE0A 3HZZA 4HV4A 2QG4A 4O6VA 3G17A 4CMBA 2TMGA 4UVEA 4FSHA 4ALLA 2C82A 1KEUA 3D3EA 2W2LD 4HNHA 2X23A 1OZAA 4P4NA 4Y98A 4BS9A 1ADBA 3PYLA 1DIBA 2AE1A 4BNGA 1K3TA 1H9AA 2D2IA 5L53A 2DLDA 4DMLA 1UDBA 2IYPA 3AW9A 2ZK7A 4R5HA 5EPOA 1UXKA 2PZKA 1E3WA 2J8ZA 4GKBA 4WPGA 2JFGA 4JLWA 5DCUA 1CEQA 4PLGA 4LSWA 4EW6A 1GEGA 2PA3A 1ONPA 3DZFA 3NT5A 2VRCA 1H2HA 4JXKA 1P9LA 4B4OA 7ADHA 3JQAB 3FWZA 1Q0HA 3W4JA 4XJSA 4PVCA 4A73A 3O8QB 1Y7TA 2J3JA 2RBEA 3A1NA 1ULUA 3FTPA 2ZQYA 2BRUA 1QXSA 2EP7A 2BI8A 5CDGA 1DOHA 1A4IA 4IDBA 5IFLA 5BQFA 1GUZA 3AUTA 3HDJA 3E1KA 4Q3DA 4R1SA 1Q7CA 4LW8A 3S2GA 1BW9A 3O26A 2UUOA 3BZUA 4J0EA 3WLFA 1OAAA 4YAGA 5JDIC 3ZWOA 3F5SA 1EEHA 5L9AA 1I36A 1SMKA 5LC1A 1X0VA 3RU9A 5IN4A 1H6DA 4JN6B 4E4YA 4H3VA 3WS7A 4NFSA 4MVJD 3WGHA 1HZZA 4A10A 2HLPA 1JN0A 1RM3A 2Y99A 2EGGA 3ADOA 1PWXA 3PZRA 5TRTA 4BNZA 2C7GA 3I9MA 1DRUA 1DLIA 3LDHA 1R4NB 3DFZA 3BA1A 1TT7A 4AL4A 3BMQA 2DFDA 1WNTA 2WD8A 3K2EA 3NDJA 4G5HA 4NK4A 5GY7A 4W6ZA 3ZNOA 4N5NA 3PYMA 1UXHA 1A5ZA 1ZZEA 3DBVO 3U0BA 1ZW1A 2OL4A 2NV6A 3RAJA 1QKIA 1T1SA 3JQGB 3MOIA 2VCYA 4KDEA 4ZQGA 3KETA 3IJRA 1GV0A 2D1YA 4BNUA 4RGBA 2J3HA 3BXXA 1Q0QA 3G49A 3DWFA 1DFIA 2O2SA 3UVEA 4ZQEA 4LVCA 2FR8A 4MIYA 3ON5A 4TQGA 2Q1UA 4J7XA 2UDPA 4CJXA 3STHA 3FPCA 4ZD6A 1ZVMA 4OXKA 4J4HA 4IGEA 2ZTLA 3GG2A 1MA0A 1YONA 1V3TA 3CIFA 3KRTA 5DBFA 4Y67A 3PXXA 4QO7A 2JFFA 1NXQA 3ABIA 4BNNA 4DMMA 4EI2A 3DBRA 4I5GA 5ILOA 3U3XA 3EAGA 4Z9XA 1MB4A 1R6DA 4JJGA 5HM8A 4G81A 4WGGA 2IEDA 1ZK2A 2EP5A 3VZQA 2NADA 4MKRA 3D5QA 1I0ZA 3E9MA 2J5KA 2PK3A 3L9WA 4GWGA 4HKTA 1QV7A 1U7HA 4MINA 2EIHA 4PLYA 5BSHA 2J3KA 3GA0A 4W7IA 1DRVA 4EUFA 1C14A 4K28A 1N7GA 3GVXA 3FR7A 5G4KA 3HDHA 2IRWA 4YRDA 2Q2WA 3IUSA 3GPIA 3SLGA 4Z6KA 3T4XA 4E2YA 4PZCA 1Q2XA 2C07A 1LDMA 1ZJZA 4E12A 4MVJE 1U5CA 1L7DA 4PRKA 1OFGA 4CM8A 5JY6A 3JQFA 5DOZA 5B4VA 1ENZA 4IY1A 2Q4EA 5COBA 4NMHA 5B4TA 4CLOA 3CMCO 2HDHA 1HXHA 2AHRA 4XRGA 3R3JA 3H3FA 3WXBA 1R37A 4KZPA 4RLSA 3MOGA 4G2NA 4E5KA 3TNLA 5CPFA 3WTCA 4XQEA 1VRWA 2CVZA 3KYCA 5CG1A 5ADHA 1Q7BA 4RDHA 2QQ5A 3VHRA 1N2SA 5ILGA 4PRLA 2O3JA 2JD0A 2Q1SA 4DLAA 1BVRA 2PZLA 4TMFA 6ADHA 1SOWA 4D43A 1JKFA 1EBFA 2FSSA 4TVOA 5EERA 3ZWNA 1H2BA 1LA2A 1U2DA 3TZKA 4RQTA 4XGIA 1V8BA 3WGIA 3GEGA 3INTA 1Q1NA 3RIHA 1BHSA 1EVIA 1NPDA 4E30A 2I67A 1ZXBA 3GVPA 1VL6A 1YB5A 1I32A 3FHLA 1VL8A 1CF2O 2Q45A 1GYQA 2EJVA 3RBZA 5H83A 3PHGA 1EUZA 3D3WA 4CLEA 2VOEA 3I9KA 3I6IA 1GQYA 3NGLA 4DIFA 5JCJD 4N5MA 5LDGA 5CDSA 3ZNPA 3ETEA 3K8ZA 4IZHA 5JMPA 1X0XA 1LLQA 4JROA 1K6JA 4B8WA 2FZWA 5DULA 1NFFA 3H7AA 4OQZA 3KB6A 1VJ1A 4OXYA 3WFIA 4XRRA 2Y67A 3GN1A 3CPSA 2OORA 3GZ4A 5C5IA 1W4ZA 4BNVA 2OP0A 1NWCA 4YT8A 3QVXA 5IDXA 5G0SA 4R54A 4URFA 4CV2A 3AY6A 3JV7A 5HA5A 1HLPA 3L07A 5KTKA 3ADPA 2O2YA 3Q9UA 3JD3A 3DHYA 3LQFA 3WGOA 1YGYA 3K2BA 2RAFA 3WJAA 3C24A 4BGUA 3SBOA 3VH1A 4MP8A 1DRWA 1T25A 5BSGA 1ISFA 3WYEA 3HE3A 3IMFA 2NQ8A 3WGYA 5DN9A 3ULKA 4OMUA 2YV3A 4CL8A 5L4LA 1DHTA 3RC1A 1LTHR 4DQVA 2I66A 3JQAA 4OH1A 3EVNA 2X5JO 1I3KA 3TZ6A 3GQVA 4OGWA 4CMGA 3DAPA 3DAGA 1NAIA 3L77A 4BKQA 2VQ3A 2ET6A 1PJ4A 4HFMA 3C7CB 2W8ZA 3OQ1A 1ZBQA 3SXPA 2X6TA 3OHSX 1YL5A 3JQ9C 2YHIB 1CQIA 5I7SA 3AM4A 3F6YA 2ZCUA 3OIGA 3FNEA 1PJTA 4NR0A 4DUPA 2AQHA 2QX7A 3FPLA 3GAZA 1QMGA 4IJVA 4RQUA 1EE2A 1YRLA 1IL0A 3PJDA 4E21A 4PZDA 2HRZA 1E1KA 2BKAA 4XB2A 4NU5A 2X1HA 4G65A 4E5YA 3BMNB 3LT1A 1O5IA 4IDCA 3LT4A 3WR5A 5L45A 2H5LA 3OJLA 1BW9B 1LQUA 4ALMA 4YQZA 1PL6A 1E7WA 4PLCA 4QSMA 2CZCA 1A72A 2FWMX 2Q1TA 1MXHA 2CVQA 4YA6A 3JQ6A 3WB9A 1E1LA 1V3UA 4UUNA 3CEAA 3DXFA 1K0UA 3LT0A 1IPEA 3U49A 1SZJG 1TLTA 4AJIA 2RCYA 3LLVA 3IC5A 3C7AA 3HB4X 2DTXA 5G0VA 1Y1PA 1V3VA 2GUGA 3RBXA 3GN2A 4CM7A 1DEHA 3Q2IA 1FMCA 3F4LA 1YQGA 2F1KA 3UCXA 3VPFA 1P31A 2HK9A 4TRNA 3ROKA 1HDZA 3NDRA 3V2HA 5FYDA 1YDWA 4FOOA 4L75A 3PGXA 1Y81A 1ZK1A 2A35A 3F5QA 4BNWA 4CV0A 1P0FA 1MG5A 3WMXA 1XYGA 4AJJA 4AJOA 3ITDA 1RM0A 1JLLA 5J23A 3RVDA 4YJGB 1C0IA 4HFRA 2NWQA 4K6CA 3GEDA 1AE1A 2ZATA 1JVSA 3MZ0A 4FR5A 1GYPA 1MC4A 1PS8A 4OXNA 3RCBA 3P2OA 1U3VA 3L6EA 2PD6A 3S1LA 4XGNA 4GL4A 2ZIZA 1IY8A 3H65A 4PFJA 2VUTA 3FNFA 3PLRA 3WICA 1YH3A 2PY6A 4DVJA 3V5NA 1B3BA 1K6XA 1DIHA 3ZU2A 2D5AA 3DAFA 5L4NA 2XXJA 1ZSYA 3NEPX 4ZVVA 4DPLA 4J16A 4M8SA 4MVJH 1E3WB 1YL7A 1XSEA 4TSKA 1UDCA 3LVFO 3GPDG 4MP6A 4C4OA 5T6BA 1PX0A 3DB2A 3ZH2A 1EFLA 1LSOA 2VWHA 5GMOA 4KUGA 4AVYA 1UP6A 4I9NA 4IINA 1L1FA 1CQJA 3DZIA 4IJKA 4Z3KA 2WDZA 4FB5A 5A5EA 1BXZA 1WLYA 3EK2A 2NU8A 1P3DA 3QHAA 5I9LA 1LUAA 2ZYGA 3LC1O 3JD1A 3PQEA 4HBGA 3GDGA 2X58A 4CLOB 3UN1A 3QWFA 4B8ZA 1PZFA 2ZTVA 3MJSA 4IUYA 3ZWWA 1KVRA 4D0SA 1U2GA 1E7SA 3O03A 5JAZA 5FI3A 5AVOA 3E5MA 4LISA 1DJNA 5A3VA 4J0FA 5TJHA 3QRWA 1P1KA 3NRCA 4UEKA 1UAGA 1YBVA 2E4AA 1GL3A 4XIYA 5H82A 4FS3A 1OC4A 1VC2A 2W98A 4M86A 4PLTA 5TT1A 4QO8A 3ZWAA 2YHUA 1BGVA 3FF4A 4GKVA 4MO2A 1ID1A 3KHUA 1QYVA 2I65A 3D5TA 3NDIA 4RO0A 5BNTA 3MWDB 3N7UA 4XA8A 4CM3A 1DHRA 1ISHA 3KLPX 4WNCA 5A5FA 1P1HA 1E6EA 4L74A 1IHYA 4HY3A 4EGFA 2PH5A 3LSYA 3OFSA 3WQSB 2VRBA 4YCAA 3VH4A 2XAAA 3H2SA 4FPXA 3E9NA 3ICCA 4JBIA 1DC4A 1HF3A 4AJLA 5IG2A 3LT2A 3RJ9A 2I3GA 2B4QA 1ZFNA 5T57A 1IULA 5JDIA 3GZNB 4GSLA 3I6QA 4IM7A 2DBZA 4XX0A 3W8EA 3TFQA 3LYLA 2ZB8A 3ZWCA 3ZGYA 1J6UA 1TB4A 5EQDA 1E92A 3OEYA 2Q1WA 1ISJA 1SEPA 4TKMA 5MDHA 1XEAA 3EMKA 4R51A 2ZTUA 5DP2A 3ZZNA 2Z1MA 2AQ8A 3F46A 1XGKA 1SB9A 3ZHXA 4JGBA 1DAOA 1B2LA 5JNLA 1KC1A 1PZEA 2GR9A 2AW5A 3H3JA 5DT9A 2JD2A 3H2ZA 4J2OA 4XR9A 1AN9A 3FD8A 4R69A 3JCZA 5JC1A 1EDZA 1JU9A 1P0CA 2DVMA 3RBVA 1YXMA 3TOZA 1NQTA 1UR5A 3E18A 4P38A 1T2CA 1ONNA 2A4KA 3I9NA 4TVBA 3RC7A 4E2ZA 4CM9A 1N9GA 1GUYA 1NVTA 2PH3A 1J4AA 2W90A 4KDFA 4NBVA 1D1SA 4YJFB 2NUAA 1FF9A 4LMPA 1HYGA 2NVBA 4JJIA 3VDRA 5ENVA 2YDYA 3JQCA 1P1IA 4KWIA 4OHUA 5A03A 5ITVA 2Y1DA 3DOCA 4QEDA 1ZSNA 2XF8A 4BMNA 2RH8A 3RD5A 1DXYA 4YJGA 5G0UA 5B37A 2Q4BA 1PGPA 1IPFA 1ENOA 1NX6A 4MKZA 1HKUA 5KVSA 3KXDA 4FJ0A 3UUWA 4XJTA 2PKQP 3AUAA 2OO5A 3KM0A 3AOEA 3C3XA 2X22A 3KBOA 3DTYA 4PG4A 4BNJA 5FWNA 1I33A 3D1LA 3IAHA 4IDGA 1NTOA 2Q3EA 3RUCA 1OI7A 3DDNA 1GZ6A 1XR3A 4IBOA 1KIFA 3PP8A 3UF0A 4R41A 1TT5A 4CLDA 2A92A 4JIGA 4KOAA 4PLZA 1LU9A 3A14A 1PJSA 4XKJA 3NGXA 4FBGA 1A9ZA 1HDYA 2GZ1A 4DBZA 3S2FA 2IYOA 1EE9A 4AJ2A 1PJLA 2CNBA 5GZ6A 2GF2A 1I10A 4KQWA 5U1PA 5CG2A 2UAGA 1TXGA 2DT5A 4PLFA 1H94A 1NQOA 4WJZA 1GDHA 3JQ7A 3E9QA 3ZN2A 1KVSA 2VUSA 1OMOA 1HSZA 3EGOA 4WCDA 4A5OA 2Y1OA 1PR3A 1WP4A 5IXSA 4Y6RA 2HMWA 3OETA 3VH3A 4R3NA 1QRRA 5HS4A 4CMEC 4WCFA 1D3AA 2R00C 3RU7A 2PLAA 3NV9A 4R1TA 5JAIA 1YQDA 5DF1A 4ALIA 3A06A 4IMRA 3HSKA 1CIVA 2HK7A 2ZTMA 1EK5A 3VPHA 1WZIA 4RF4A 4YT4A 4Q3CA 4R1NA 5IDYA 3FN4A 1C0LA 4CQMD 5IZCC 1ZKMA 3AOEC 3AU8A 1U7TA 3I83A 1CWUA 1RPNA 3QVTA 2VTEA 3VZPA 1T2FA 3TZQA 5EIOA 3HN7A 3IP1A 1DFHA 3UXYA 2V65A 3L4BC 4IIVA 4NQZA 5L7YA 1WW8A 5AXBA 2D0IA 2RHCA 3KEOA 1QLHA 2B4RO 3WTBA 1N8KA 4FFLA 1BG6A 3LC2O 4OO3A 3H5RA 1EVYA 1NP3A 1VKNA 2OUIA 4TKLA 5GZ1A 1WMBA 3JQBA 3OQBA 4PVDA 4CMHA 1BDMA 4JJFA 3ZU4A 3ZWBA 1G6KA 2D3TA 4E13A 3BIOA 1I2BA 1D4FA 1PTJA 2QYTA 4DYDA 3PRJA 5ITWA 2ILTA 3U5TA 4XZ3A 4GMFA 2QW8A 4NK5A 4YQYA 3B6ZA 4II3A 4MVJM 4UEOA 2EKPA 1I5RA 4IQGA 1GR0A 4DA9A 4YPOA 5JXWA 4D3DA 4E5MA 1A9YA 4CR7A 4LN1A 4D0RA 3CTMA 1EQ2A 2DU8A 3VC7A 1GTMA 3Q0EA 4UAGA 3ZHZA 1PWZA 5KCZA 2BGLA 4J4TA 2JCVA 2I76A 3GT0A 2PNFA 1F0YA 1J5PA 1NQAO 2B4TO 4Y9DA 2C2YA 2G76A 3UOGA 3H5AA 1CETA 1SOVA 2O48X 1SEVA 3ZWPA 2RH4A 4IXTA 1F17A 4BNKA 4BV9A 3X2EA 3F9IA 3NTQA 1I8TA 3DOOA
chains in the Genus database with same CATH superfamily
2WE8A 4OJQA 1GTRA 4HAOA 1ZCJA 1NVEA 4R84A 3MELA 5MFPA 2JEZA 1WY5A 4L4XA 4Q66C 3U3KA 3EDRA 1TW2A 2HWWA 1SCJA 3COSA 1VMAA 3KPJA 3Q1KA 4S1VA 3JQDA 3MWGA 4ZCLA 3TDNA 2FW0A 1EFPA 3MFYA 4BNHA 1QZZA 3GDOA 2QL9A 5F51A 3VAAA 4RX1A 1HO3A 4A92A 3HRHA 4UATA 1YZTA 1ZOIA 1DJMA 2X0JA 4LRYA 3V6LA 1OJLA 3U80A 4LRQA 2V55B 3JZIA 1B0AA 1DU4A 4HX5A 4O08A 1YZGA 1VE7A 4JB0A 2QAGC 3HYNA 3G8DA 2JANA 3NTXA 5I8PA 4O4IA 2AN3A 2J3LA 4KV7A 2KBEA 1YULA 3UUFA 5JC8A 3BORA 4GLFA 1N2CE 3HLYA 3SIRA 4L9SA 4FUTA 3P4UA 3AIIA 3RYFB 1V4BA 1KBQA 2ORED 1MPXA 2GVDC 1ZLYA 3VZRA 2BM1A 4ERXA 4DE5A 1F7VA 2W6NA 3ZWQA 2ZRMA 5I9IA 2AFIB 1Q1AA 2XITA 4WFQA 4AWBA 2BE9A 3OLVA 3RUEA 2D5IA 1ZMTA 2FRDC 2Q3MA 3TEMA 1YHZA 2HWUA 2VA9A 2PT7A 1EZ4A 4PPGA 4A2PA 1UP7A 3AX6A 5C32A 5K09A 5M2QA 3UBTA 5JXJA 4WI1A 4FDTA 1SKUA 3HFSA 2CDAA 1GTG1 1C41A 2XE8A 1VJDA 5CH5A 2X76A 3EIWA 4R8RA 3CFYA 2QR2A 4PFQA 2SBTA 1MX3A 3EPRA 2A3NA 3BM5A 5T7BA 5AIAA 3BTUA 1HSOA 1Z5UA 2IYZA 3G9XA 4JA0A 4P5PA 1Z2PX 3BB3A 1P7VA 3BBLA 1HNWB 3IJPA 1FFXA 4HTFA 1UXGA 1IUPA 2W6JD 3DMRA 2F55A 4PSCA 4P08A 4A0FA 4EQ6B 3ZYZA 2JJ1A 5FX2A 5JW6A 3R0XA 1AGPA 1XOIA 4FLFA 4KQJA 1J00A 1O7JA 2C2KA 2OZVA 1QH9A 5HJ7A 3MMSA 4C3OB 1HQCA 4BUJA 2Q46A 4DC0A 1NASA 2Z2YA 3C41J 3L93A 1P45A 4HPWA 4L1KA 5TF4A 1ULAA 2EKLA 2JDIA 2RBKA 1PZXA 2Y1KA 4A91A 3N3AC 1DEXA 4ZAVA 3UQZA 3VR6H 4LK3A 4ASUA 1Z8FA 5K3SA 5G2OA 1PEDA 2KLHA 2R25B 2YVKA 1R9JA 3FFXA 4G1BA 3HDYA 3OQJA 3TLEA 4BHTA 4NI5A 1XROA 3TWOA 5IABA 1EX7A 2VTKA 2FXVA 2WF5A 2VH2A 3MGGA 3B5IA 4FGJA 2AWOA 2CLSA 2R8XA 1INLA 3QH4A 1HGXA 2O4CA 3DO8A 5IVDA 1CJKC 2IU3A 3AI3A 3WLQA 4BB5A 1GPUA 2DETA 2JGLA 3EEQA 1NW3A 1YB1A 3KCNA 3PIIA 1S7CA 4H7KA 3KPWA 1EUDB 2CXPA 1KOLA 3TQHA 3ZCTA 4YV2A 3VKVA 4M99A 5IKEA 2VN8A 2TMDA 1YCDA 5EEHA 5B53A 2QT9A 4DLTA 1H8EA 4KEAA 4JSRA 1E2LA 2NO5A 3H11B 2X0RA 3MJVA 3R20A 1X7YB 1WUYA 4K9NA 5ALQA 4I5FA 5BUQA 1MB9A 4GGOA 1I7SB 4FX5A 2AOUB 2EW1A 2JGMA 2WJ6A 3RHZA 4UU7A 1Q11A 4LRWA 3W78A 1M7HA 1TCCA 2N1BA 1XDBA 2OC4A 3ENNA 3LK7A 3M1IA 4I46A 5DFAA 1M2WA 4QATA 3BHNA 3BK7A 5EKTA 2QLFA 1S7GA 1MABB 1XTBA 2WWIA 3PHLA 2XIJA 4R9NA 3DCYA 3ENKA 3ZUGA 4OI1A 3U4CA 3C1OA 3RASA 5CLIA 1D1TA 2F3QA 1KPGA 1VA5A 1NMXA 3EZYA 4LQ4A 3V46A 4MKFA 1EHIA 2BV3A 4YCMA 1ZJ5A 4MKIA 2I7CA 3RYHA 5IAAA 1OPRA 5KJ1A 4H2DA 3AETA 1H4SA 1JTVA 1O8BA 1E59A 5AXDA 4KKXB 1E3LA 2ZPTX 3DE7X 3IGFA 5J4HA 2ZVJA 1UOEA 1BIFA 3PWSA 4LJKA 2OYCA 4Q9DA 3HL0A 4Z51A 2PZJA 2P7IA 5HKOA 5KAPA 2H1OA 3K1YA 2OV8A 1DO2A 3G9TA 4ZT5A 5AVYA 1NXTA 2XRMA 1FFHA 2FW1A 2G1UA 4XDYA 1MH9A 5KPDA 5KPJA 2BOVA 1MZVA 1QVAA 1VG8A 1KP9A 2ZGVA 4IXMA 4EBFA 1DBQA 4PR3A 3GCGA 4NNPA 2PH7A 4IEEA 1Y80A 5LB2A 3OE5A 3A36A 3WIOA 3A31A 3AI1A 4LDZA 2XTAA 1YASA 3PI7A 1MMFB 5EHNA 1H2WA 3ZQJA 4L9AA 3CGGA 4HMQA 4HPJB 5JDCC 2EG9A 4XWGA 1ZAKA 4NMMA 1G2IA 5DTQA 3F6SA 3ZX5A 2WF6A 2R1VB 3DZ8A 3EIFA 5IN5A 5JS6A 4RMJA 3FPBA 1B43A 1GADO 1P5RA 4Q7MB 1T36A 2VJKA 5GJVC 3MHTA 1I24A 4KQCA 4YWJA 3D8TA 4TMVA 5EKXA 4M7PA 3ME5A 2PQMA 2ZJ5A 4NDNE 4WASA 2HREA 2RHTA 1XWWA 4D56A 2GILA 3HUEA 1UPXA 1X1SA 1DIRA 2YXDA 4RZ2A 3T3EA 621PA 5HDBB 1GAWA 1YA8A 3EN0A 5AI6A 2FY8A 5LYYA 2G72A 4P54A 3FOZA 2DFPA 2OORC 1YACA 3VKUA 1QP8A 1MHPA 4IF6A 4MLPA 5IWAB 2A67A 5DTIA 2ECKA 1O4WA 1PGNA 3ESQA 4IDUB 3QG1A 1YJQA 1YI0A 5HE9A 3SMVA 3O0DA 2Z2XA 3O1HB 4EA9A 2EQ5A 2YL2A 5C46F 1TEVA 2GETA 2NU9A 1SK8A 3IEKA 1DO8A 4PYQA 2VQSA 1TTTA 4UM9D 3CZ9A 4NBRA 2VNJA 2FF5A 1WM1A 1ZUIA 1I2DA 4JLDA 2G36A 4FT4A 5F7JA 3EVFA 1EK2A 3KJGA 3UATA 5E2IA 4F8YA 1YFLA 2PUFA 1QU3A 4EDHA 3V1TC 5DYWA 3EGXB 5GAJA 3IUPA 1EG7A 3C8HA 2RSLA 3U3JA 5HM6A 4X65B 1MQ8B 1ZHHA 3DV0B 3U56A 4PZYA 4ECEA 1XQ6A 4RC9A 4E3ZA 4HUQB 1MP0A 2JLRA 3CXRA 1MJNA 1VPTA 3DWGA 3E8SA 1D7AA 4KP7A 3RTDA 3W3AD 3ZTTA 3ZZTA 4CLRB 2PL3A 5DMXA 2J9RA 4DMRA 2NUPA 3TL6A 4PC2A 4F1JA 3UK1A 3WGUA 4ENSA 2JHPA 2QJOA 3V34A 1EFPB 1PT7A 3PSAA 3PJFA 4U3JA 3ND6A 4MH0R 3EGVA 4O4HA 5DYYA 1A9QA 4GICA 2HRRA 2CK3A 1UK8A 1O08A 1FUYB 3CE9A 1K9VF 3AJRA 1NKTA 1BDHA 1Z0UA 2VO1A 3BAFA 1M6WA 2ACKA 1QDEA 2PXCA 3NXSA 4FYPA 1DKNA 4KTVE 4Y30A 3PJRA 1R0LA 3P7MA 1S4MA 3AEKA 1D9XA 4R81A 5K3CA 4YN3A 4DCNA 1L7EA 1UBUS 3TTYA 1E6WA 5BNZA 3QXXA 4UFNA 2V7VA 1OI4A 5ALIA 3VISA 5CURA 5EP2A 4E11A 1UKEA 4KWTA 4BFTA 3F5FA 3K2IA 1EVJA 5J2UA 4E03A 2OCKA 2GN0A 3R3XA 2QR3A 5A3SA 3PDWA 1FYWA 4MWTA 3S40A 2Q4RA 1P61B 2PUHA 5AD1A 5JAHA 2NVOA 3VKFA 1SU7A 1ZNQO 2Q41A 4NENB 4BKPA 2HMUA 2R00A 4LKOA 1MEEA 1UPUA 4S24A 3HVKA 1NPYA 3U13A 2NUTB 3LAWA 1G3UA 3DZHA 3DBHB 5AVQA 3T5GA 2NYUA 1FFSA 3T3IA 1Q1QA 2BBTA 4EY8A 3DMTC 5ICMA 2JLZA 2VF2A 3R5SA 2VJCA 4D4HA 3Q8MA 1C9YA 4ZXFA 3UAVA 2Y27A 4PX2A 4ND8A 5TMPA 4BJ5A 3LTNC 4QQFA 3TXAA 1T8PA 2PRIA 4LJ4A 3SM9A 5KNCD 1JIXA 4ABTA 2X0FA 1SRRA 4AC9A 5LP6A 4PU0A 4YRJA 3T7EA 4WERA 3TOSA 4CCAA 3MBKA 3D6UA 2AJ8A 3TPCA 5KWEA 4G4SO 4RPKA 2H7CA 1T35A 4AIIA 4PG8A 1KZYC 4KWCA 1T2VA 3AEYA 1IYZA 2PQ2A 2NO9A 3MGBA 3KVNA 4H16A 4TL6A 1YKFA 4ESOA 2ZIXA 4OKNA 5KWSA 4KYTA 1NVXQ 2AD1A 3PNKA 3CLSC 4P5EA 3TRKA 2A5YB 4BFWA 1PUJA 1AGRA 1OB2A 1FDTA 3EUWA 2VYQA 1SVNA 3NNSA 3DPSA 1IY1A 2GN8A 3Q7QA 4JBGA 4MVJP 3RG8A 2I4IA 3ZE6A 1YUMA 5F1YA 1LWOA 3OICA 4IH9A 5EG5A 2ZUDA 2F3PA 3G2MA 2VA8A 2X7HA 1J2RA 2WU1A 2VQDA 3DLHA 2JK1A 4Q4AA 1S02A 1U4NA 2P1ZA 2W37A 3A4VA 2UVDA 3TCXB 5CB4A 4GOJA 1M2OA 1N6RA 2Y2VA 4OU4A 4Z4FA 3CZCA 4G0QA 3BRSA 1IOVA 3H5TA 4R98A 4RSMA 3BAZA 1KS2A 5DLPA 1YJ8A 5CXUA 5DN6D 4PNHA 3A2MA 1IM8A 4NBWA 1WWKA 3IKJA 4EW2A 4LG1A 1K08A 3DDHA 3ZBPA 3SR4A 4DPKA 1XCBA 4ZOLF 4EK9A 5JJBA 4BZXA 1RYBA 1UCFA 3KQSA 5KTOA 1ZUHA 3ZL9A 3QWBA 1OHHD 4OOFA 5J5CA 5ALUA 5AK5A 5JNRA 4TMTA 4LZNA 3TNDA 1J9EA 3EQ6A 3GUYA 4GD3Q 2IEBA 3IMGA 2J0QA 4G01B 4BLUA 5ARBA 5J47A 1GHTA 4L4YA 2E3JA 2F1HA 3L0PA 4FC6A 2WJHA 3PGLA 1JDUA 3WL5A 1GAQA 1XI2A 5LOVF 1JWLA 2JJ2D 1PL8A 3WBKA 2FHPA 3UMYA 1F9AA 1XMSA 4MMZB 2GN6A 2GTPA 1KQNA 1XQVA 5HPYB 3KSZO 1BH2A 1PHPA 3CMMA 1T8YA 3I4CA 1YQEA 2C94A 5AUQA 1E1RD 1A50B 1IHUA 3K15A 5A9SB 5TPWA 3W7VA 3GRPA 2JNWA 5F5NA 1AO0A 3SC4A 3I3OA 1VB3A 3WNDA 1U1IA 2ZS7A 4J1TA 4EUSA 4UTPA 4ZVTA 2PX2A 1CHDA 1DJQA 1C8VB 2PWAA 2GKGA 4F1WA 1NBWB 4O0LA 4ZOCA 3WIEA 3GUCA 3D43A 1WW3A 4BGEA 4PGMA 4PLWA 4DLXA 1C3OB 1XEWX 2HLDD 5A9TA 3TLKA 2P2ZA 2Q28A 4EVQA 1RXSA 4QFDA 2A1UB 3QI2A 2DC1A 1NV8A 1CE8A 1BX3A 3MJEA 1XU7A 4GBED 4XOIA 2NM0A 1OVMA 4FDAA 4QLBA 2BTQB 2ZRGA 4GECA 2H63A 5J2TF 3W5JA 2OP1A 2VQ6A 1JAIA 1AQUA 3HDQA 4OKIA 2DUWA 2M1XA 4ZOLA 3LQRA 5JXIA 1E2NA 1NXVA 1ONOA 3EXHC 3HA5A 4YJHA 3T34A 4MW1A 1EG2A 3ZVLA 2PUGA 4HNSA 3G23A 3IAAA 4BKOA 4K2AA 1Z6GA 3DHNA 1TMGE 2I5PO 1KY4A 4GW3A 2GPAA 4IOJA 4O0MA 5DEIA 4A26A 4DDMA 4FQ7A 4NE2A 3TGWA 5LXTF 1QB7A 4C0HA 2F3TA 1HYHA 2Z98A 1DAPA 2YV4A 1YE8A 4LHEA 4UE6A 3WOVA 5KU7A 3GUZA 2C7VA 3O47A 4GI2A 5IEBA 2NIPA 2DKFA 3R74A 1OH7A 3GGSA 5EJ6A 1VYHA 2WUEA 4N03A 4NDAA 3SIXA 4TXJA 1WDWB 2QXYA 3U1TA 4B6SA 4FYYA 3L1JA 2WR8A 1NSYA 1Y3FE 1D5WA 4ZMBA 1JVBA 1C3VA 2WIGA 4KLRA 1QRTA 3I62A 1Z83A 2NZ8A 3L82B 5TQ2A 4JT9A 5CAEA 3GLQA 4G41A 2HTEA 3IAEA 1FP7A 4EYOA 3RR2A 4C21A 3AH8A 2F43A 3HADA 3MVEA 5CNMA 5DX1A 2XNCA 4GX2A 3V1MA 5FWXB 3FBTA 3HABA 4GVLA 3GH1A 2QTTA 4E5SA 1XL0A 2A9VA 1ZJ6A 1ZWLA 5FO0A 3VR6A 1FP4B 2AG1A 4AZ0A 5HJEA 4B3TB 1EEXB 3UYKA 3CR8A 4JUAA 5JJ5A 3V4OA 2OGUA 5EHXA 2IITA 5JLAA 2LGJA 4U7PB 4WNAB 5JSZA 4I5IA 2AOVA 4K1LA 1LV7A 3AEUA 3LGXA 1QIKA 4CIWA 3R3YA 2QVZX 2Z08A 4JQCA 3PE6A 3OZCA 2PLWA 1V41E 2XQFA 2MSEB 4DANA 1V1JA 5I9NA 4X84A 3BMOB 4LF6B 3AM1A 3SGLA 4C20A 2DTEA 1N0VC 2EWVA 2JGIA 4ZVLA 4C7BA 1N8TA 1GAEO 3FSEA 5JY1A 4ZU3A 1Z29A 3OWHA 2YDXA 3SJAA 3E7PA 1RXIA 1YAJA 5K8IA 1O8CA 3VMFA 5DSXA 3DTVB 3P2EA 4L3VA 1AQYA 4YTEA 1G20B 1SCIA 3JQQA 4WUTA 1DZIA 3KZNA 4HBZA 2C78A 4HQOA 4LBVA 5ALDA 3LUPA 3UM9A 5KWJA 3KTOA 4PAOA 5AMXA 3HMQA 5KHLB 1E2JA 3BQ9A 1B93A 4RGVA 3UAGA 3ADCA 2W2KA 1F20A 2CL7X 2C29D 2C2OA 1P5ZB 1CXZA 2OZLB 3OSUA 3IUJA 2IDMA 4ZYYA 1AHHA 1F2TB 4EZBA 5HEKA 2QM8A 1KU6A 1XTZA 2M6KA 2R60A 3L9XA 4H7JA 5JHGB 3DB1A 2DUUA 2P27A 4WLOA 2V9ZA 1Y9AA 1QH0A 1X8KA 3CX3A 1A4RA 1W19A 4Q4CA 2H4ZA 1F1JA 1VYUA 4G9BA 2Q2VA 2HQSA 1SVSA 4CKEB 1G7TA 1NONA 4Q16A 5IWCA 1CG6A 4P6VF 1EM8B 4X7MA 3DMYA 3KFXA 4YBZA 5BWMA 1Z5GA 2GA8A 2AMJA 1JX6A 2AT1A 2PBFA 2OYRA 3W9UA 1IXYA 5BRAA 3MGAA 1I1OA 1FYVA 2YC2C 1CERA 4L2IB 4XQCA 4EKNB 4CQLA 1XTTA 1FUEA 1YS7A 2GI4A 4YJ2B 1HMPA 1JI3A 1O94C 3G7SA 4HP8A 1IIBA 2B21A 4YJ3A 4UFPA 3HUTA 5JI3E 5BRJA 1TEZA 4BN5A 5K05A 5CEFA 3C6BA 3LT5A 5GINE 3KQKA 1E1NA 4A0RA 1YZFA 4ZAFA 2BTOA 3H8SA 2CSUA 5E8JA 3QPAA 1HEUA 3I5MA 4QNMA 3GQBA 1S2OA 1N2JA 5FEUA 4D4LA 4LYGA 4QUGA 1BMDA 4JBWA 2FSGA 1MVLA 1NBHA 2BGUA 4BZQA 2R68A 1QTNA 1KO4A 3ML1A 1R9GA 2B8EA 1YBAA 4G8DA 3DEZA 3LH5A 2V9CA 3W8RA 2KS6A 4B6QA 2F8SA 1QQ5A 2ECFA 3MC1A 4KRGA 2RJ3A 2PX8A 3C70A 3KT0A 2O8FA 1NJ2A 1F2VA 4WDQA 4MI3A 2XVAA 5LWQA 1YT5A 3G9QA 3RFXA 3ZCSA 4CEJA 2KX7A 1XPRA 3L0SA 1SIOA 4GMHA 3O9ZA 1TW3A 1HWYA 3SYNA 1ZH4A 3EY9A 1LDGA 1A82A 1UBCA 2FGJA 4PRZA 3D4OA 4GI5A 4ARSA 3ZVMA 4F86A 5DNWA 4I4TA 3NFYA 1JGTA 2QHXA 2FFAA 1WTCA 3G88A 5H70A 3DEIA 5BYJA 3I52A 1ISMA 1Q77A 1R0BA 1I01A 4CIYA 1LPPA 2PRJA 5ARDA 4G8JA 1B8PA 1JR3A 1KH2A 2ATIA 2O0JA 2PSEA 3MEQA 4MMXB 4LQCA 2W6ID 3IR7A 3OZXA 3TMKA 2M1ZA 1CF9A 2HDNB 1FZTA 2WW8A 3OAAA 3FJYA 4QD3A 4F04A 5D3MB 4EJ6A 1EI9A 3WV5A 2ZYWX 1NF2A 2GLXA 3FPAA 5DGHA 3PQ6A 5H81A 5C37A 1WXHA 2HSJA 1XXHE 2Z1DA 1UWVA 3BMQB 2VAVA 1UZLA 5TARA 3ZU5A 4MKXA 3WLMA 4DCGA 1NHWA 1NXPA 5AOCA 1THGA 1KI4A 2R2GA 2X9GA 1P1JA 3WGJA 3D64A 1XE3A 4ZAWA 1F6WA 4K6GA 4CNQA 1S1MA 2ZJZA 4E33A 3U17A 3LBFA 4N0PA 1D04A 3K5PA 1CZHA 1AZLA 3N0TA 4GWKA 1KVUA 1SXJE 1QHHA 1MJFA 2YHIA 4H31A 3R7WA 2VP3A 1H2ZA 4BQRA 3HDTA 3FIUA 3SXUB 3HG7A 3TK1A 2VPTA 2VL7A 4CG3A 4ZGBA 1BGXT 1IJKA 4X63A 5EXXA 4OTZA 3WGKA 1HFEL 3TMAA 3UV3A 7MDHA 2O5EA 3BWVA 1DJLA 3KOXA 2A0KA 3FF1A 2YKGA 2YASA 1E5QA 4JXXA 3F97A 1Z2DA 1LZLA 2C8VA 2CN1A 1QO0A 2WWHA 2JJ2A 2F3SA 3PVZA 3O83A 1KHHA 3MRSA 3M3DA 3TZCA 1PNTA 1D6SA 4WT7A 5FQNA 1O9GA 4P33A 5C8YA 2W70A 2NU7A 4ZV4A 4IDNA 1XMJA 4JP3A 4BC1A 4PG7A 7REQB 2VH5R 3H1GA 4X54A 5GVSA 2VJQA 5GTDA 3P9KA 4ZVNA 5JDCA 1B0ZA 3HCFA 2R65A 1E6UA 1FSZA 1L7BA 1P74A 2HGZA 1NNUA 1SK9A 1PL7A 2IHVA 1E0DA 1KO8A 3PHHA 4NDZA 3AJAA 1W4LA 3N87A 3FPGA 4TVKA 4OD0A 5TQJA 3BXFA 3OEHA 1U7WA 3BGOS 4TL7A 3GMIA 3ND8A 1ML4A 1DBVO 3DYBA 1JG6A 1FW8A 1QX4A 2P3OA 3A6DA 3IKMB 5EN4A 5FWYA 3FNHA 1YNOA 4J9UE 1OFIA 4H0CA 1RE1A 3WOHA 3P2KA 4TSRA 3AXTA 1Q84A 1RSZA 2CLCX 2Y0DA 2QNBA 3ZW7A 4EUHA 1GP2A 1G4HA 2ZETA 3L0OA 4O2AB 3TKYA 1VMIA 2Y1FA 5JYDA 1DQRA 4YJHB 4PGGA 1X19A 4EKYA 4CVNA 1EZ1A 2CV1A 4G8CA 3TTUA 4ADSG 1Z12A 2BFFB 3QPUA 4LNHA 1G3IA 3H4MA 4H15A 2DWQA 4EABA 3CZ5A 4LUCA 2PKYX 4AZWA 1O97C 4Y0NA 1YFJA 1AZSC 4B3JA 1KDOA 1ENYA 4FN4A 1TMOA 4RVHA 3BULA 5DNYB 3DFUA 1YUNA 4I50F 1TX4B 1AM4D 1GGFA 2HXSA 4LXGA 4EAAA 5LLDA 1IN1A 2GBFA 3O94A 2WWRA 4MRSA 2Z58A 1AXEA 3R6GA 4D6PA 4M9SA 3LLSA 1KZ7B 1R8XA 1AQJA 1PUIA 1USGA 1P1BA 2IHTA 3UJCA 3JQGA 4G0XA 2PQ0A 2ZI3A 3F67A 2WJPA 3TJRA 3ZQUA 2JBHA 3HJGA 1SQ6A 3F7NA 2P78A 5EOVA 1SHZA 2PGAA 4B6JA 3V4PB 4EHJA 3NDBB 1TAUA 1GGVA 1UEJA 1UJ6A 3MIIA 4Y3UA 4A2CA 3THRA 4CF5A 1EXVA 3F2VA 1KI8A 5A4DA 1Y9EA 3N7TA 2HJ9A 4WACA 4BDSA 2HMAA 1LRKA 1H2RS 3PD7A 2IEZA 3WP1B 3AHJA 2F67A 2EBHX 2IFTA 3BL6A 2ZYVX 2ZIFA 3BRWA 1UDXA 1IN7A 3EMBA 2HNKA 4YWHA 4BWFB 3PX2A 3O5AA 2DE0X 1SUEA 3WDLA 2V74B 4BHHB 2W2XA 5AIBA 1AZWA 2JHGA 1Z4LA 1V39A 1AS3A 1NF3A 1WQ4A 2BLLA 1CUVA 2P9CA 1ZQ1A 3GRFA 5FFNA 4HNUA 1EYZA 3FYCA 5A1TA 3AIMA 4I5EA 3I2JA 1G5IA 2V4UA 3E7WA 3D6JA 1DRKA 4NL4H 4ZV7A 4C4AA 5JMWA 5COAA 4C4OA 2B5VA 1K6EA 2QT0A 2YFYA 3AERA 3NHAA 1GZ3A 4X8OA 4WOCA 1E60A 1G0NA 4OJMX 4D9HA 2WM8A 3QELB 4YRGA 1IBKB 1U1DA 1VL0A 1PF7E 1MW8X 5E38A 3LHIA 2F00A 1VGQA 1HPLA 1UDAA 4KJZA 3VDXA 3WISA 3DMNA 4GPIB 3K0EA 4JJ7A 3TW4A 2WY2D 3WQQA 4B82A 5C7OO 5IJ9A 2IYXA 2WQ6A 2JLAA 5BQXA 3T9CA 1G20A 1CR2A 1MJHA 2WOJA 3FKSD 1DBWA 2C2GA 4KW7A 3OMLA 4TTVA 1AGNA 3HP7A 4BX9A 1FDUA 4CEIA 1AUQA 3OPVA 2QPLA 3PJEA 3H1BA 1QHYA 1JI0A 4IIBA 5K0EA 3S55A 1JR3D 1T2NA 4M60A 3SBDA 4WLFA 4I4TB 4Q4AB 3ZXIA 2IW1A 3KT8A 1GRCA 1C80A 1ESCA 3MTJA 3T7SA 4HUJA 1TUGA 4E22A 2W11A 1ZIDA 3HA7A 3HZOA 3K96A 3RRBA 2YXPX 1T9GS 2IZ6A 3QU7A 3QU4A 5IDVA 2OXIA 4F4CA 2MR6A 1RWVA 3GJXC 3WL3A 3TIIA 4WBNA 2HK6A 2FWAA 5DOVA 1H3FA 2ZQ5A 3OURA 5IKOA 1K92A 3GXOA 1JJBA 3JYOA 1IOWA 5C3UA 1TKBA 2AJLI 3PA8A 5IVKA 3A26A 3F3KA 5TJ9A 2EX4A 2FPIB 3L4SO 3UJ7A 4ZO8A 4Z3DA 4MS4A 1G3QA 5I45A 5KINB 4OLJA 4FFVA 1URPA 2XDWA 3IPXA 4X8LA 4IZOA 1DBPA 3EDQA 2AG5A 5L95A 1ZR2A 3B2EA 4GX0A 4F0JA 2WEKA 2WNSA 3D8UA 4HWTA 4TTSA 2N47A 4MPTA 4AP6A 4YRBA 5BUSA 2VRWA 3EULA 3KNZA 2IYFA 4LFCB 4NMLA 4P3PA 1ICEA 3FVQA 4O33A 4B71A 5LR6A 1K3FA 2HA6A 5JDIC 4X60A 3RHTA 3HZHA 1ARZA 2JIRA 1GJRA 3KV1A 3OTIA 3RREA 4N6GA 2CZGA 2ZJ3A 4IX9A 1PNQA 2NQTA 3AR4A 2J32A 3G1TA 4ND5A 5G1OA 3H6KA 1ZJWA 3KOWA 3OZBA 4KE6A 1K2WA 5AM4A 2WKSA 2VUHB 1VKOA 4GQIA 4EHAA 2IZZA 1KS9A 1S8AA 1YKSA 4LS3A 1OT3A 2R8ZA 5CBPA 2NP6A 3OKCA 4D26A 1XVTA 3GJRA 3IJEB 3ZE2B 1G1AA 5HTOA 4O59O 1I6MA 2PJUA 1QYWA 2O52A 5BSRA 5EPEA 1QS0B 5IC6A 2VP5A 4BFZA 5CT5A 1YC2A 2AFRA 4J4BA 3ZHUA 1WE2A 1TYZA 1GQQA 3HYSA 4C0LA 1CNMA 1TUBB 5JD5A 4H35A 5F1OA 3PNLA 3LD9A 1WXEA 3EYWA 3QJ5A 1I1HA 5KNBD 3QYPA 3PQFA 2QBYB 4WA7A 3SSNA 2JFXA 2DSNA 4GLLA 1SH7A 3RC3A 4XSHA 3FCUB 4MQ4A 1B16A 2MYUA 1KJWA 4AJEA 2Z9DA 4HFJA 4EB6B 4DQUA 5IH3A 2UVQA 1J97A 1G9XA 1QG0A 1XKQA 1S3FA 3OF5A 3BEDA 2XV1A 1BEUB 3A6LA 1NI4B 1ZH2A 3OFJA 5AJXA 3RS2A 2RHBA 3QLTA 2XYPA 3AY7A 3I9OA 2UZ3A 1SKQA 1LNSA 1NUHA 9ABPA 1EGAA 1Q5PA 3HXTA 4S1WA 4ZQBA 3WLAA 5K5EA 2BMAA 3PVSA 2BTQA 2YCLA 4F85A 2NT4A 4YCJA 5AQ1A 1WF3A 1YB4A 1M2EA 3AFIA 5AW9A 1MC5A 3M6WA 3ZCXA 4TQAA 1NV9A 2GCGA 3AFHA 4FEGA 3RU2A 3TD9A 2R5NA 4BMSA 4KRYA 1H4VB 5I4KA 4NG5A 3K9CA 3PUHA 5B7GA 3RODA 4DTCA 4CEJB 3D0RA 2TYSB 4JBLA 1OY1A 2YS7A 3OZSA 3VVBA 1BROA 4Q4JA 1CB7A 1FTYA 1LX7A 1MLDA 1FS6A 1L4BA 4MQFA 4PANA 3S7ZA 3CHYA 1NC1A 4IFTA 3GFGA 2W42A 4E1AA 4C76A 5JFOA 4OHYA 4QECA 2AFHA 2G1JA 5G41A 4N12A 3B1XA 3HU2A 3FVVA 1J25A 1KY3A 1NDUA 3AZOA 1F2DA 1Z82A 3GNTA 3H9UA 1I2MA 3HQ4O 4J49A 1COWD 1U0HC 1X14A 3I09A 4RWZA 2IHBA 2JBAA 3JX9A 1N5LA 2RGGA 3WYDA 2LV8A 5I7AA 1UFOA 2DQSA 2EEZA 1O0SA 2J3MA 1YDHA 1E6KA 2MT9A 4LY9A 3L02A 4TS9A 1A7AA 1PR6A 2EL9A 4A8PA 4RHFA 1MPTA 2FWRA 1ZAYA 2RC5A 1SFRA 4QFCA 5E9AA 1C4XA 5MHTA 2V6FA 2X6RA 4G5XA 4LQDA 2A84A 4P7GA 3OT1B 2XUHA 4WZAB 4RCZA 4R0NA 5DMHA 3MCVA 2Z1NA 4H1UA 3UMJA 1EVKA 4JR2A 1LY1A 2VDKB 4YJFA 5I4CA 4PN3A 1QQAA 2JCSA 3W6ZA 3BSWA 5FWAA 1FJXA 2OLJA 3KKEA 2FN4A 4I8DA 4MW6A 3UJ8A 4CRWB 6ABPA 2C42A 3ZHQA 1WZCA 1OVGA 4J3JA 2QTZA 2GN1A 3O4RA 3R5KA 3VOTA 3FHOA 2FQQA 4S1TA 4BLWA 5I8WA 1YNSA 4GAEA 3DNPA 4UAVA 3BMCB 1Y8RA 2HK8A 3PPIA 4Q01A 3IP8A 3V9PA 4UBLA 3CCCA 4IEFB 1ULSA 2P30A 3L0DA 4WLUA 4AJNA 2G5CA 5EFOA 4D8XA 4LIPD 3JZDA 1LX6A 4C87A 2ZKLA 1HT0A 1U04A 3S5UA 4JYAB 4DCTA 2XOEA 1KAGA 3H9EO 4D0NA 2C5FA 1DEKA 5L7WA 1SCDA 3FCSB 1N6LA 1TM3E 2O3QA 4L27A 2ZYRA 3B1YA 3EWSA 3O2QB 3QLUC 3UAYA 5CA0B 3WL6A 5T4EA 4B80A 3VMMA 4EJ0A 1OTHA 3WNCA 4D9JA 4MR8B 1M54A 5LQMA 1P75A 5BNIA 1H66A 4D57A 1T4CA 3OPYB 3P8ZA 4XQGA 1J8YF 4D98A 2D7CA 1NGSA 3PNPA 4DRYA 1H85A 5J40A 1I3LA 1OBHA 3ST7A 1ABBA 1ZRHA 4DA8A 2XYRA 4DA7A 1R4MA 2JGEA 3MAJA 3N2KB 2IXTA 1KAOA 4KJXA 1KJQA 1KEEB 2C77A 3LYHA 2Y1GA 4LMRA 1TPYA 4PE5B 1M1ZA 4QXMA 5CYGA 2D6FA 1PYDA 4RVSA 1RXVA 1U9IC 1HFJA 5K0GA 5JAUA 1RU3A 4Z9YA 1G16A 3HFGA 4J91A 3LP6A 3GOQA 1L1QA 2PZAA 3ROZA 3C45A 1KYXA 4IOKA 1W5EA 3E3LA 5EQFA 1R5OA 3I23A 4AQ7A 4OLHA 5JMTA 1DELA 4BQOA 5DNDA 4RIGA 4K03A 4TROA 1ORWA 1SUWA 1Y5LA 3ZE8A 5KNBA 2X6QA 4D8UA 4F45A 3LP8A 1PG2A 3RJTA 1NZFA 3FYUA 1PN3A 1VPLA 2ZYDA 2YJ4A 3OAAD 4R3UC 4YAFA 1E58A 3RSLA 5DHUA 3DVSX 3LY5A 3PTZA 1DAHA 2FEKA 3SJCA 1IQRA 4EATA 4AS3A 4F6LA 5F78A 1QGDA 1U1EA 2B7LA 3RTBA 5A4FS 5ES3A 1H2FA 3W77A 3KXIA 4M9CA 4ML3A 2WJ3A 5DCWA 4JITA 3C5WP 4EVRA 2A1IA 3TOXA 5AW4A 1Q20A 2JDID 1K63A 3CUKA 3OP4A 3L6DA 4JYZA 3S2EA 3NM4A 1S89A 1VG0B 4YROA 3VBEA 4MA4A 3G2OA 3EVTA 2O7SA 1QAOA 4FR2A 2PBLA 5TDHA 3WXMA 1EVZA 5AI9A 3DZKA 3RUHA 4WBNB 1PZNA 2WPDA 3KUKA 2X5OA 1DTEA 4DHEA 5K9ZA 2VP4A 5C34B 2K6GA 1E62A 2VCHA 4EEXA 3AM3A 4EG3A 3FDXA 1AA6A 3RIEA 4RHCA 2A1UA 4MMYB 1BRTA 1R9MA 4X1YA 4XIIA 1V8OA 4QJ5A 1U8TA 2O8CA 3A2LA 1S4QA 5BYKA 4JYPA 4DR4B 1AD2A 2O1XA 1A2OA 4PHCA 1Z25A 2IIVA 5AI8A 5AICA 1E69A 3QPBA 4PCAA 4R1PA 1L5GB 2JRLA 5TVGA 1NFRA 1KMCA 5AK4A 4DLPA 2ZVDA 4N82A 3IBGA 2ZUTA 3M83A 3MB8A 2IPAB 1R50A 2ZVQX 2CV2A 2EF1A 3WE7A 4JBNA 1H05A 3KE9A 3AZQA 4LGYA 3FCOA 2PGJA 2R8OA 3NC1C 3H9QA 4M87A 2RHLA 4AKSA 2OCPA 3UCFA 3TECE 3GHYA 3TSCA 5KJEA 3VUEA 2QNRA 2HMSA 4A2QA 1Z74A 3ZLVA 2NN3C 3RE1A 3IVXA 4FFBA 1XNGA 3RC2A 3TVTA 4O4HB 4U7GA 4E4RA 4CFYA 2EZUA 5LU8A 2PL9A 4YXFA 2AEEA 1JLRA 1LF5A 1XD8A 3TRJA 1TAHA 1UMKA 2PZ8A 1UXIA 1V45E 1ZX1A 2FFRA 2VZ8A 4IV8A 1H9BA 5DTJA 3IB6A 2IUUA 2VJOA 1SXHA 4CUKA 1Y82A 5D6NA 3FPJA 3C8UA 4IIUA 1N1EA 5BQOA 1N9GB 5JD6A 5I7VA 4DA4A 4P22A 3P2IA 3VHQA 3AB3A 3WSVA 2XMBA 3I28A 4WZAA 3ZBUA 1GUFA 3PFGA 1UBLS 5HIKA 3CRZA 3ERCA 5K8VA 2W48A 2UZ4A 2WU4A 3CPHA 4LCJA 4YYZA 4PAMA 1RAIA 2Z5LA 2OGTA 3N58A 3TNJA 1R5BA 4BVAA 4K0RA 2AMYA 5IBPA 1C4WA 2XXAA 4X9XA 3TQRA 1OSNA 1BXKA 4KGZA 4LKRA 4ND7A 5G0WA 2OV3A 3LX6A 4XYLA 2E37A 3JQAD 4BQSA 3GCXA 4YDSA 2EJUA 4YRKA 3WQRA 3MS4A 1NSFA 4ND2A 5LNK6 3UMCA 1J21A 1L7NA 2C54A 1EMDA 1GY8A 2OO7A 8ADHA 3K6SA 2I7VA 1KRWA 2C5AA 4GG1A 3G8BA 1OAOA 1G2QA 4J7UA 4QLOA 3VDNB 2OVBA 3QYAA 5K03A 4TYYA 1W2WB 3X1ZA 3L0ZA 1JTEA 4ITUA 3SJUA 1V1MA 3FXAA 2I3BA 3H42B 5KX5F 1MFPA 3T9EA 1U7OA 1C8BA 5CA1B 3ZDBA 3AEXA 4OHKA 1W48A 4L8LA 4F4FA 2ID7A 3DC2A 4RF5A 2VT2A 2OC9A 1MT3A 2G4CA 2NACA 2EG5A 1HY3A 3O8DA 4D9MA 1OX5A 2GCEA 3ITEA 2FRVA 3PNQA 3U37A 3MK31 1AMNA 1HE2A 4EMTA 2D00A 3ETGA 2B83A 4ZK6A 3B9QA 2K7FA 1E2KA 4RPLA 2WHPB 3B52X 4K9PA 4TKVB 4X8MA 4PSDA 5EIWA 3C74A 1M1XB 3P0RA 3KFVA 1RPTA 4I3GA 3PIRA 2GCOB 4C6TA 4FYKA 3BICA 4XWYA 4W9NC 1Q50A 4U7WA 1DPGA 4TLAA 4AU1A 1F8YA 1E94E 4FYWA 5CPBA 4KI0A 2XSZA 1E2EA 3E3MA 4IV0A 4LBYA 1IZ9A 2OBNA 2B7CA 1JFVA 2QBYA 5L7TA 3IT2A 3KJIA 1XN1A 3BIWA 3T4EA 4UQLA 4PO9A 3B1ZA 4LDNA 5IUKC 4HVCA 5AFSA 2ZR9A 4ZICA 3QOWA 4N7MA 5AM5A 4EFNA 5KYWA 1VCMA 2EL7A 2GO1A 2F8MA 3DLIA 1NA5A 1PQPA 3X1MA 2HR1A 1V35A 2ABWA 5LJLA 3MWYW 4KPYA 1Q0SA 2DULA 4O02B 4MVYA 3P97A 2DWUA 3OKAA 4GM4A 1I3MA 3WA6A 3LQ4A 4KBFA 4REQA 5A0FA 2Q07A 3A05A 2B35A 4EARA 4M0DA 1U0BB 1UDRA 3M49A 5KC8A 3H2YA 2EDAA 2FCRA 1II8A 1QSGA 3GGGA 2ZP1A 4IS2A 3B53X 3ROTA 5GADl 1U8CB 1SQFA 1YB7A 4TMKA 4ZCMA 3T0GA 2V98A 3KPUA 3H11A 5JIBA 2Q6VA 1KFEB 4QPNA 3BHMA 5TQ2B 5C7IO 3THYB 1YWGO 1RKQA 4ZCPA 2WFLB 1JSRA 1LJLA 1N2GA 2BHSA 1CF4A 1XEFA 4TKZA 5B1YA 2ZOSA 3JYQA 2OHGA 1OQAA 3AUYA 4MQUA 1EFUA 4G0OA 1NJ1A 3GI1A 2YNMC 3WIDA 1T6BY 3MJHA 1H65A 4YX9A 2W2MA 1W96A 3JD4A 3A1FA 3KHKA 4HGNA 3DLPX 1JAYA 2ZBUA 3WZMA 4IQ0A 2I87A 3P32A 2PT6A 4CIVA 3FPFA 1JB9A 2E7ZA 3PFIA 4JJ8A 3PPWA 1PYOA 1GSIA 2PKQO 1T0HB 2P4SA 1FDWA 3VNVA 4K88A 1ZHOA 3DL2A 3JU3A 5SYAA 1OYVA 1S5PA 3MWEB 3CURA 4DLBA 5BQ3A 4L85A 3OTWA 2BDTA 3ER6A 1M72A 1YS6A 1LPBB 2XLBA 3BWDD 2Z5VA 2WAMA 1S2DA 2CYAA 3QY9A 3GC6A 3TJMA 3Q8XB 3RV3A 1Z15A 5IJAA 2J6BA 1TADA 2GQ0A 2H6EA 4KXNA 3RKSA 4MQ6A 1YZYA 5HKBA 2VDQB 2HZ7A 4CM4A 3S2UA 3ZWKA 1FTWA 1F4PA 1ML3A 1XNJA 1FLAA 3N70A 1Q0LA 3ESBA 2I71A 3H5VA 1TI7A 3RARA 3RRJA 3ZZ0A 3RFUA 4L7VA 4CF7A 1E9EA 1VI5A 4FJ2A 1M0EA 1XMIA 3FCYA 4D8VA 4GEGA 1X2BA 1HTTA 1K5DA 1GTJ1 3IDZA 4OK6A 4RPCA 1R18A