1T4MA

Structure of a thermostable double mutant of bacillus subtilis lipase obtained through directed evolution
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
179
structure length
179
Chain Sequence
HNPVVMVHGIGGASFNFAGIKSYLVSQGWSRDKLYAVDFWDKTGTNYNNGPVLSRFVQKVLDETGAKKVDIVAHSMGGANTLYYIKNLDGGNKVANVVTLGGANRLTTGKALPGTDPNQKILYTSIYSSDDMIVMNYLSRLDGARNVQIHGVGHIGLLYSSQVYSLIKEGLNGGGQNTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of selection and thermostability of laboratory evolved Bacillus subtilis lipase
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
molecule keywords LIPASE A
total genus 67
structure length 179
sequence length 179
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 2004-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01674 Lipase_2 Lipase (class 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1t4mA00
3WYDA 1JU4A 2OQVA 3VVMA 1G4HA 1VA5A 4DNPA 3HRHA 4P9NA 4G4JA 2CZQA 4XJVA 1Y37A 3M83A 5ALIA 1DWQA 5HCUA 3H2JA 1BEZA 3OOSA 4AX4A 1EXWA 3OC0A 1E5TA 2ACKA 4M0MA 3H04A 4Q05A 2WFLB 3BDIA 1W75A 3IUMA 5T4EA 1QIJA 3AZPA 1CUJA 5FDFA 1CUCA 3GZJA 4BVJA 4H35A 4A5SA 4HRXA 2AJLI 2PVSA 4AO8A 1IMJA 1M33A 2WILA 1CUSA 2OCKA 1TIBA 5AK5A 4U2CA 3X3HA 1VA4A 2VSQA 1BCSA 1LBSA 3TJMA 1VJ5A 4AB1A 2D5LA 2OG1A 1JMYA 5LZ8A 2WKWA 3SK0A 4EA6A 2O7RA 2OAEA 5JD6A 2J3DA 4X6XA 4WY5A 1AMNA 4FTWA 5FRDA 4WDQA 2ZSIA 3D0KA 3QMWA 4X95A 2GBCA 4A16A 1DWOA 3H0CA 1YS1X 1QLWA 2V9ZA 1N1MA 4EZIA 5CXXA 3FOBA 1CQZA 3AZOA 1QIIA 2PM8A 3E0XA 1YA8A 3I6MA 3R3WA 3W06A 2XB6A 4LXGA 3AUKA 3WL5A 3ANSA 1D07A 3KSRA 3WK5A 2O2IA 4Y2QA 4C88A 5AKLA 3C8HA 1H2YA 2WHQA 1XRRA 2QMQA 1ZICA 4N5IX 2V98A 4E15A 2ZSHA 5D7BA 1VLQA 4M0EA 1JU3A 1XZHA 2VEOA 4CFSA 1R9MA 1CUWA 2WLSA 4EUSA 5CBKA 4JNCA 1NU6A 4BCDA 4LKOA 5ALOA 4PSDA 4Y2YA 5DJ5A 5FPPA 5AI5A 5A62A 5T4BA 3E1GA 1ODTC 2QJRA 3QH4A 2HA4A 1C7IA 4ZI5A 3QYJA 4BB0A 3ESCA 3WA6A 4C4XA 1WCYA 4Y2TA 4HXEB 2WHPA 4X91A 4K5QA 4B80A 4U2FA 3D4LA 1VXOA 3W05A 4G4IA 2ECFA 4KE6A 3KWJA 4QDXA 2WU3A 6YASA 1K4YA 2WTMA 4INZA 1R1DA 5HFNA 2VTVA 2O2GA 4BC0A 3N2ZB 4QWMA 3DQZA 3A2MA 4RNCA 4Y2XA 1TQHA 4UHFA 5LZ9A 3S8YA 2I03A 5C7YA 4JYPA 4MYDA 2XMRA 4D9JA 5HK8A 2I78A 1HL7A 3HXKA 3H2HA 3S2ZA 3V1MA 1AC5A 2YYSA 1JKMA 4G8DA 1IUPA 2ZYSA 3F97A 1W76A 5EHXA 3WQHA 3R3ZA 5ALDA 1W52X 1TAHA 3EIOA 1YS2X 1L7RA 5K3CA 3O4JA 3BF7A 2WSLA 1E8NA 5CT8A 4PSCA 4NMWA 1BN7A 5KWIA 5HKAA 4XIIA 2XUDA 5HQ3B 4E14A 4F60A 1A8QA 4LXIA 2C0PA 3DD5A 4ZXFA 2JBWA 1CUUA 1NX9A 1RYYA 3PFCA 1BCRA 1GXSA 4EY6A 2J3QA 1GGVA 1CUEA 4FFWA 3OM8A 1AZWA 1EHYA 4UBMA 2BUBA 3EF3A 5HQ3A 3EQ8A 4KE7A 3FSGD 5FP0A 4PQEA 4UBOA 2DFPA 4DNQA 3QPAA 1LPMA 1LPSA 3L1HA 3STYA 2Z8ZA 5AM1A 2DR0A 2WHRA 4BP8A 1EK2A 3OURA 5ALEA 1XKTA 2DQYA 1IZ8A 2G4LA 3BIWA 1ODCA 3FLEA 2WUDA 3V9AA 1XZBA 2GBIA 2XUIA 5JD4A 4QZVA 4FDMA 2RIPA 4BTVA 1YB7A 2QRUA 4CG2A 3GA7A 4H7IA 4FWBA 3D5EA 2JGKA 3DYIA 4FOLA 1ETHA 1S8OA 4QLOA 4RPCA 1CUHA 4OPMA 1XRLA 2PPLA 4HVTA 1XZIA 1XZLA 4H7EA 1SCKA 3A6ZA 2HA7A 3KXPA 4N5HX 4QNNA 5ALYA 1UT6A 2HA3A 1FFCA 1XLWA 4N8SA 3LIPA 2DHCA 5HFAA 2FX5A 1AX9A 2VJCA 4Q1VA 5JALA 3AZQA 1SCQA 1A88A 4C89A 4L3WA 3T52A 4MWSA 3UUFA 4UHEA 1JJFA 4UPDA 3WK7A 2C58A 5JAPA 4C87A 4B6GA 4MQLA 1QIHA 3Q8WA 5A71A 4KYVA 2R8BA 3WK6A 3BL8A 1TCBA 3L1JA 4K6HA 4C4ZA 1ZIYA 1QO7A 4FBMA 3GROA 3R3UA 3WLAA 4FHZA 3I1YA 3LCRA 4M0FA 5YASA 2ORYA 3U1TA 2Z3WA 1UOQA 5DLPA 1CLEA 2HA2A 2IX9A 2RAUA 4H7HA 4CG1A 4J3JA 4AO6A 4KRXA 2RHWA 5JZSA 2I3ZA 3GUUA 1QIMA 1XRQA 3MUOA 1H2ZA 4HAIA 4N8EA 4RE6A 2XMCA 3FWHA 2BGRA 4OB8A 1G5FA 3D2BA 1IVYA 2XQGA 1TK3A 4H7FA 3NGMA 3WWOA 2H1IA 4AO7A 4HRYA 4UHCA 2GYVA 3DNMA 2BFNA 1BN6A 2WQZA 1SFRA 3FCXA 2WUGA 1QIEA 3VJLA 4KJXA 5E2IA 3R3VA 2JGIA 4BRZA 3D7RA 5CT9A 1EVEA 1CUVA 3CXUA 5HF9A 1UFOA 1WHSA 4UHHA 3A2NA 3PF9A 2JGMA 1AUOA 1EINA 4JYMA 2XUAA 5EIHA 5DYYA 1N8SA 4Y2RA 5D6OA 2R11A 2Y1KA 2HA6A 1GPLA 1RWQA 5LZ4A 3KOOA 4BP9A 4AZ3A 5ALPA 4DMCA 2XQJA 3T4UA 4CG3A 5LKRA 1QOZA 3PICA 3WK9A 1CIJA 3PUHA 4DM7A 1QFMA 1FFDA 3V1KA 3WJ2A 5FOQA 4Y2VA 3D2AA 1UK9A 4FKBA 1THTA 1PJAA 4G1FA 3DJYA 4GWLA 3C6YA 4G4GA 1U65A 1UZAA 3H2IA 2B61A 5ALWA 4H7KA 2AXEA 1KU6A 2Y6VA 4DYHA 5HF8A 2BUAA 2WUFA 4XVCA 1CV2A 3AILA 2XUQA 2Z5GA 2XUPA 2HA0A 2G63A 1ZGBA 4TGLA 3WIOA 5CH8A 2HL6A 3R3YA 3IBTA 3D59A 3OTQA 5EHZA 5ALTA 4GLBA 3H18A 1C4XA 4MWTA 4B9EA 3BXPA 1WOMA 4YASA 3MVEA 1L7QA 2VAXA 2PU5A 4GEGA 4A23A 3P2MA 2D0DA 3C5VA 1GPNA 4G9GA 3STXA 4P93A 2JEZA 1XZMA 1LLFA 4KAAA 3BWXA 3JWEA 5A7GA 3ICVA 3ILSA 3C87A 4UFNA 1LPNA 4E46A 1YASA 3AIMA 3I2IA 4BTLA 1ZD5A 3QPDA 5AKKA 1C7JA 3M3DA 4CCYA 1WB6A 1GPKA 5AHXA 2XT0A 3QMMA 3G9ZA 3K9BA 3R41A 4OU5A 2ZYIA 3HYSA 3GBSA 3ZI7A 3C70A 2VAVA 5SYMA 2B9VA 4OUKX 4Q34A 3WKAA 2CBGA 4X00A 2QTBA 1JJBA 3IUJA 3WL6A 1E8DA 2JEYA 3FLAA 1Q84A 5JIBA 1BS9A 1LPOA 3O4HA 4UHDA 4IH1A 3CCCA 3LIIA 2QOEA 1X70A 4I19A 5EHNA 2W22A 1OXMA 1XRPA 4BC1A 1QONA 3FYUB 3PE6A 1K6EA 2V96A 1XZEA 3EQ7A 3FLBA 4H18A 3D2CA 2ONCA 1MAAA 2Y2VA 2XUHA 4B83A 2Y6UA 2XUGA 3H19A 1UKCA 2XQIA 4UBNA 4FLFA 5AKYA 2O7VA 4WFKA 4Q82A 3VDXA 1DWPA 1CPYA 4FLEA 4W1SA 2HRQA 2BJHA 5ALXA 5BOVA 3WKBA 1EDDA 2PBLA 4BYMA 4G8BA 1XRMA 1E66A 2JF0A 2X8BA 4L9AA 3R40A 3C8DA 3BF8A 1U4NA 4QA9A 2XMSA 3A2LA 2H9YA 1UK7A 4DNFA 4I3FA 4U2DA 4FMPA 4MEBA 5EIAA 5K3FB 3G0IA 5H3HA 1EDBA 2VJDA 1BU8A 1LPPA 2C5GA 4QDZA 2GZRA 3WJ1A 1SOMA 2X5XA 5KREA 2WJ4A 4X71A 5AM2A 3C43A 4WFIA 5ISMA 2H7CA 3DEAA 1J06A 5KWJA 5D3ZA 5AO9A 1QO9A 4QLAA 4F0JA 2RGUA 2C5FA 1CQWA 1K5PA 2O2HA 1ACLA 4N8DA 4DMKA 2V97A 5DTIA 5DYWA 1WM1A 1JMKC 3IB3A 3V1LA 5LIPA 3DKKA 3ANTA 2BKLA 1Z68A 4ZRDA 3TEJA 2GBGA 4DMFA 2YASA 4HXGA 4J0HA 1ZJ5A 3O4IA 3VVLA 3RM3A 2B20A 4K6KA 3W9UA 3C6BA 1EI9A 4X93A 1F8UA 1HBJA 4AN1A 4NS4A 4B0OA 2QXTA 4ETWA 2WG2A 4B7ZA 1YSCA 5ALNA 5AI0A 1UXOA 4OD0A 2HIHA 1G66A 3G0BA 3VXKA 2WIKA 5KBYA 2EEPA 1VOTA 4V2IA 1E8MA 4HS9A 4UUQA 4Y2UA 1UK6A 3WL8A 3H17A 4BE4A 2OAGA 2RONA 4X7BA 1BRTA 4Y7DA 1CUXA 1AGYA 2QT9A 4C4YA 2OGTA 5BV7A 5A2GA 1XZKA 2AJDA 3LLCA 3ZPXA 2BGNA 1EDEA 3GELA 4C01A 1QIDA 1KU0A 5AKIA 1A7UA 4DGQA 4Y9SA 5FKJA 1FFAA 1UOOA 4JUIA 3G9XA 3F98A 2QUBA 3QBJA 1SCIA 3HJUA 2P8SA 5C8VA 4MJ3A 4X90A 4HZGA 3WIBA 4KRYA 2QS9A 4J7AA 3NOXA 1DT3A 5IVDA 3C5WP 2XDWA 3QVMA 4W63A 4FBLA 1AKNA 2WFMA 3VJKA 2OCLA 3WKEA 1FSSA 3FBWA 1QTRA 4KAJA 2IIVA 1YAHA 3I2FA 2WIDA 1EK1A 5C8XA 1Q83A 3OPMA 2WG1A 2DSNA 5A7FA 4PSUA 3K6KA 1QZ3A 3N0TA 1FJ2A 3QITA 1XQWA 4ZREA 4W9RA 5JZBA 1UKAA 2DHDA 1MX9A 5AKEA 4GBGA 1TKRA 3B5EA 4WDRA 4MXDA 4LYDA 2WG0A 4BVLA 4ZV7A 1X2BA 1Y7HA 1A8UA 1QJ4A 4L0CA 1GZ7A 2J4CA 2NW6A 3PUIA 2PSFA 2WTNA 2HFKA 1DU4A 5EI5A 3AIOA 5CT5A 5AI6A 1ZI8A 1MU0A 3QPCA 3PFBA 4BCBA 2BCEA 5CT4A 4GXNA 4XWGA 1AURA 1I6WA 2ROQA 2QXUA 4Y2JA 5CMLA 2IITA 2XMDA 1O6FA 1CUGA 5AK6A 5ALJA 5DNWA 1NU8A 5ALQA 4QDOA 2PSEA 5D3KA 5AK4A 1MT3A 2FJPA 4IO0A 1XLVA 1U8EA 1OCEA 5K5EA 5AICA 4IH4A 4H7DA 2XMQA 4LIPD 1H23A 1N5MA 5CH5A 1YA4A 2XI4A 1GQRA 4HXFB 4QWWA 3K2IA 3VISA 2EDAA 3EBLA 3FNBA 2VJBA 4BCCA 5C81A 5K3FA 3F9CA 5ALLA 4ITVA 2B4KA 4EB0A 4J0CA 3WWDA 4J0DA 4HTAA 1LPAB 1HQDA 4EBBA 4J0GA 1JJIA 4DSAA 3CN7A 1QTIA 4O08A 2Q0XA 1YAJA 5ALSA 2CUTA 3W2TA 1UWCA 2H7YA 1XKLA 1O6GA 5DYTA 1THGA 4W1PA 4GW3A 3FSGA 5LYYA 2PUJA 4G8CA 5AI9A 4BDTA 4KE9A 3RARA 2K2QB 4UFOA 4J03A 4DIUA 4E11A 2VF2A 3DL7A 2HADA 1ZD4A 4J0KA 1XQXA 1XZDA 4UBLA 4TPKA 3F67A 3PDCA 1DINA 4CIBA 4U2EA 4X94A 3NWOA 4FLMA 3LS2A 3H2GA 4AQDA 3W04A 1LBTA 4JEIA 3GFFA 4PW0A 5JARA 3I2KA 2VT7A 3DCNA 5CT6A 5C8ZA 1T2NA 1XZFA 2LIPA 4AXBA 3HLKA 4W1QA 1QIGA 1WPXA 4IH9A 3C45A 4B9AA 1X2EA 2QJWA 2ACEA 4LXHA 3KWFA 4H7JA 5BWBA 2QR5A 1R50A 2WFZA 2ZYHA 3BDVA 5AM5A 1CVLA 3CN9A 2PUHA 1PV1A 3SX4A 4BDSA 1ZOIA 5JAOA 5FPQA 3G8YA 2WIFA 4CCYB 1FFBA 5DTJA 5LLSA 2C0QA 4CCWA 2DCMA 1QGED 4X3CA 3AJAA 4NVRA 2H7XA 1TRHA 3Q0TA 4IQ4A 4I4CA 4KAFA 4UBIA 5JD5A 1H2XA 1W1IA 2DQZA 4EY8A 2E3JA 2UZ0A 5ALUA 4UFPA 3DKRA 2HA5A 1KEZA 3MUNA 4BRSA 3IVMA 1F0NA 2XLBA 2W6CX 1EX9A 4KE8A 4Q3KA 3M81A 5HK9A 1BE0A 3ZLUA 3STUA 5AOCA 2PU7A 1MX1A 1HKHA 2JIDA 2XE4A 5ALGA 1EB9A 3AIKA 4DLNA 1ZD2P 4K6GA 3ZWQA 3ESDA 1QIKA 3G9UA 4B0PA 2ZYRA 1XFDA 5JADA 4X92A 5ALKA 3OG9A 1BROA 4BE9A 5JANA 2WIJA 4RE5A 4OSEA 2GZSA 3KDAA 3VKFA 1B41A 5AI8A 3HZOA 2XMGA 2HU8A 4DSZA 3R0VA 4OB6A 1K8QA 4BBZA 4WCVA 3WKCA 5AKXA 3HSSA 1XZGA 1CEXA 1A8SA 3ZLVA 4F21A 3I2JA 3VJMA 5LP1A 3ICWA 4PF1A 5IKXA 4X97A 1F0PA 5AIBA 5FXMA 5EFZA 1Q0ZA 1QFSA 3EQ9A 5JASA 5CURA 1IUOA 2WFLA 5JAHA 2XQKA 3WZMA 1GKLA 4OCZA 4U2GA 1USWA 2XLCA 3G0DA 2HU7A 5K3BA 5K3DA 1AQLA 4B81A 3ESAA 5LZ2A 2VJAA 2GBFA 4QDUA 5J3JA 1TCCA 2HM7A 3FAKA 4Y2PA 4FNMA 2Z3ZA 3R3XA 3D3NA 4BZWA 1FFEA 5E4YA 1YR2A 1MNAA 3B12A 3E3AA 4GHWA 5AOBA 4BAZA 4EY7A 3E4DA 4OB7A 3IULA 4KEAA 3DS8A 1J07A 4B85A 3RKSA 2QKYA 1E89A 5JATA 2XUJA 5AKJA 2CJPA 1XQVA 3V1NA 2J4FA 2DHEA 2CKMA 1CUBA 3B3QA 5CRIA 5HF6A 1CUIA 3DOIA 5AKHA 3I6ZA 4NZZA 1U2EA 2QVBA 4AZ0A 2WUEA 1VXRA 1ZGCA 2ZJ6A 4Q3OA 3H2KA 4QDTA 3HABA 1LZKA 1VE7A 4ZV9A 5DNUA 4KACA 2OGZA 3DOHA 4WFJA 2RI6A 3RK4A 5AIAA 2PSJA 1PFQA 4G9EA 4YX9A 3H1BA 5LZ7A 4BAGA 1WB4A 4DMHA 3FVRA 1UOPA 5ALVA 3W9BA 4PO3X 1HPLA 1XZAA 4OYYA 4W1RA 5I8PA 4MYSA 1B6GA 3BE8A 1TCAA 3PF8A 1G42A 3QZUA 3WL7A 1EH5A 4DTCA 1XLUA 1W4LA 3TRDA 5FV4A 2ES4A 2JGLA 4LYEA 4ROTA 2I3DA 4BAUA 5IVIA 3G0GA 5AI4A 1VZ2A 4FFVA 3G02A 3G7NA 3STVA 3AFIA 2RHTA 5FLKA 2FUKA 1WB5A 1XZJA 1XRNA 2YH2A 1CR6A 3V48A 1R4ZA 1EVQA 3O9VA 1UK8A 1DT5A 5EGNA 4AMYA 3UMJA 4ARAA 3WWCA 3WWPA 1DX4A 4B84A 5E4JA 1UKBA 4Z49A 1DX6A 1MN6A 4B82A 5ALFA 2JGEA 2AJCA 1P0IA 4YPVA 2HHAA 3DL4A 2FJ0A 3STTA 4ARBA 2CB9A 3C6ZA 4CI9A 3WZLA 3WWEA 1ORVA 2X76A 3SWWA 1GKKA 2VATA 3WYNA 1XROA 1HDEA 1K63A 4JH0A 5K3AA 1HLGA 3UUEA 1JI3A 1DQZA 3HI4A 4BZZA 1ORWA 2Y2UA 4X6YA 4GECA 1QE3A 3ESBA 5F4ZA 2AJBA 1P0MA 2G5PA 1MX5A 3SC2A 3DLTA 2PSDA 1Y7IA 2QUAA 4OYLA 2XUOA 5ALRA 4U2BA 3WI7A 3ZV7A 1P0PA 5HKBA 3I6YA 5K3EA 2XUFA 2XMBA 1CRLA 4FNGA 4MEAA 4LHEA 1J1IA 2WIGA 2AJ8A 2OCGA 1XQYA 4P08A 2GYUA 4WY8A 2XQFA 4UBJA 1VE6A 2WJ3A 3FYUA 4RGYA 1P0QA 4GDMA 2ZJFA 5AJHA 2VT6A 2WHPB 3BJRA 2BAGA 1WPRA 3O0DA 2PL5A 4MQMA 3STWA 5AK3A 1RP1A 1ZIXA 3TGLA 1Q0RA 3DDUA 4F5ZA 1MO2A 3WKDA 1IZ7A 1WHTA 1DQYA 3KD2A 4OU4A 1MPXA 3DYVA 2OPHA 3IURA 1ZI6A 4TVKA 1H22A 3ED1A 3FYTA 4Q3LA 4XX1A 5ALHA 2JGFA 2OXEA 2WM2A 1LNSA 1ZJ4A 2XMZA 1ZD3A 1MTZA 4C6HA 5IH7A 1ZI9A 4KR0A 2C4HA 1MAHA 1L7AA 2QM0A 3IUQA 1CUZA 1CUDA 3HEAA 3I28A 4P92A 2OQIA 4H0CA 5AOAA 5HZGA 4QEKA 3RLIA 5ALZA 3FYUC 3G0CA 2WJ6A 1BEEA 5HF5A 5AM3A 1XZCA 5AP9A 4BATA 4X6UA 1MJ5A 2G5TA 1ISPA 1IUNA 5DNVA 5T4HA 1CUFA 3WK4A 5LZ5A 1GT6A 2OCIA 5IVHA 4WJLA 4S0XA 5ESRA 2PSHA 3O4GA 1H2WA 3PI6A 3IA2A 4H77A 2C7BA 1OILA 5EIEA 3MGAA 3JW8A 5FUMA 1YCDA 1T4MA 3M82A 4EY5A 1J2EA 4ZWNA 5ALMA 3C6XA 3U0VA 2PKYX 5I7UA 3IDAA 2JGJA 1F6WA 5BWCA 1EA5A 1ODSA 4CIAA 4AMZA 3YASA 2PX6A 5AH0A 3NUZA 4UHBA 4L72A 4Y2SA 3LP5A 4DNOA 3BJMA 1VZ3A 2EDCA 5EHQA 5CTAA 4K2AA 4EHBA 3BIXA 2GYWA 2HDWA 2VQ6A 1CUAA 4UBKA 3I2HA 3G9TA 2ZJ7A 5I9IA 3JYHA 1R9NA 3O9MA 4EY4A 1JFRA 1E3QA 5SYNA 1LGYA 2OGSA 4J0IA 2YXPX 2ZVDA 3O95A 5JYCA 3H1AA 2VA9A 4J0JA 4ZGBA 5A7HA 5AKZA 5JZ9A 1LPBB 2QZPA 4YK7A 3FCYA 3WMRA 1MNQA 3I1IA 4PV7A 4PNZA 7YASA 5JAUA 4AN0A 2CEKA 3WA7A 1YB6A 1QIFA 1CFJA 5CH3A 1LZLA 4GI1A 3F96A 5LKAA 2HU5A 3FVTA 1VKHA 5T4FA 2XUKA 4IHAA 1W6RA 3WK8A 1JT2A 5AKGA 5CXUA 5CW2A 5AM4A 5IVKA 4G5XA 3IUNA 1CUYA 1DTEA 1R3DA 3ZLTA 1GQSA 1SC9A 3I2GA 3CCBA 3L1IA 5E4TA 3QM1A 2OLEA 1EB8A 1ACJA 4BVKA 2Z8XA 2CMFA 3AINA 3F8SA 5A6VA 1N5RA 3A70A 2BUCA 2HFJA 5DWDA 3QMVA 2HRRA 3IIIA 4QE3A 4X85A 5AM0A 2WU4A 3HC7A 1R88A 3HACA
chains in the Genus database with same CATH superfamily
2C3YA 2P2NA 1JU4A 2OQVA 2V6JA 4KDEA 2QAGC 2MSEB 2RMKA 4MVJG 1RBZA 1LWOA 1QVAA 4MS1A 2CDAA 1OREA 4FKZA 2FE4A 1XEAA 1CZRA 1KAEA 3AI7A 1RLMA 3M83A 5KSOA 1TIKA 1GZDA 4OQLA 1HYGA 3AESB 3DO5A 1C80A 1O6BA 4A0GA 5AW6A 5I7HA 1WUHS 5ALIA 1P4RA 2NXNA 1TW3A 3RRXA 2OUKA 2QGNA 1LW7A 3K5HA 2WBLC 1V9LA 2Z30A 3UJCA 4C6TB 3KWMA 3Q12A 2VLBA 1FUEA 1Z7WA 2DAPA 1Q19A 1I36A 4O4JA 2WF5A 5LA6F 4PICA 4XCQA 3ZTTA 5HR5A 1JHYA 3JZDA 3H04A 4Q05A 1OC4A 2GZ1A 3H5LA 2JVKA 3PGXA 4FX2A 3OD1A 2GZDA 4F4UA 3AZPA 5FBWB 1CF2O 3B1ZA 1T5OA 2HWKA 2XAUA 4OMCA 5FDFA 2VF4X 1RYZA 4E12A 3LLVA 3GZJA 3K16A 4H35A 2Q0HA 2IEBA 5BQOA 3IAXA 3JQAA 1PFYA 1CE8A 1GL7A 1SQ0A 4RL4A 8MHTA 3JQBC 3A25A 3OEWA 3TW0A 5B64A 3TSYA 3QX3A 1U0BB 1ODLA 1NMSA 3G88A 4RMIA 4YHHB 4F93B 5B58C 2PVSA 2M6KA 2NU9B 3DCJA 3VI3B 2WILA 4XRGA 2XCTB 1CUSA 1RQNA 3QKSA 1ZHHA 2CVQA 4WGGA 1GZ3A 4BWYA 5AK5A 1GTSA 4FONA 2D1SA 3Q7RA 2O8VA 5HJEA 1OPXA 1BCSA 3EEQA 1O3YA 4P7KA 4YUAA 3T5AA 1K4KA 1VJ5A 1K08A 3HP1A 5HTKA 1I7SB 1YQTA 2PUVA 4NV0A 2JFWA 4UUNA 5JVDB 3OIFA 3DYBA 5EESA 3E35A 4LF5B 4EA6A 2WKWA 3L6UA 3OLXA 1DBWA 2ZULA 4JJAA 5CYOA 2C84A 2RH9B 3ZHOA 5EXDA 5HJ7A 4J2OA 4UTNA 4HATA 3AM5A 3O0TA 1ODFA 4KQJA 1L8AA 2R4TA 1NSFA 3EB9A 3KV1A 1BXGA 2C4TA 2QTRA 3KVOA 1YJ5A 3D6UA 1TIPA 3KT3A 3AF1A 3L7YA 1EVJA 1XG5A 4JBYA 4UVEA 5C1DA 2O0KA 3LG2A 1NW6A 4V0LA 3U6KA 4X7RA 1SVIA 3VM6A 4PRKA 3W5SA 4LEIA 5KYXB 2Y1LA 5CJPA 3QMWA 1EP9A 1L7XA 1EFKA 3BUSA 4HF7A 4X95A 4DA7A 4F9TA 2LR0A 4H6XA 4WK2B 1A76A 4Z9FA 2PSSA 1DWOA 1W2WB 1Z07A 1VYUA 2H5IA 1QLWA 1X7ZB 3KOUA 3PCXA 2PLNA 4MUXA 3FOBA 2Q46A 2IU6A 3HCRA 3MCUA 4TKUB 3I12A 2EGHA 3MJVA 5IF3A 3HJRA 2LDBA 3DTNA 3NBMA 3S0JA 4WINA 3L43A 3E0XA 4I3GA 5EIBC 1T8PA 3MBOA 4R9SA 3SX0A 3R8CA 1XZNA 1P80A 1YA8A 2ZWMA 4TRRA 3JAKB 3L8CA 1TVCA 3ZH9B 3D6VA 1MB9A 3NRCA 4P3NA 2IHZA 3HY6A 5PGMA 2F3SA 2HPVA 3ZGNA 4XD7A 2R47A 2IHBA 3SKXA 1GPDG 5LDGA 3WL5A 1G41A 2GH1A 3ANSA 4WLOA 5TXGA 1EDOA 2JKYA 3FRJA 1AKQA 2J0UB 3A6HA 3HKCB 3JY6A 4B6OA 1JI0A 3KKQA 3V80A 4YQFA 1VE5A 5KOHB 1H5QA 4IDNA 2YIVX 3VH2A 1H2YA 3JATB 4RADA 3R9XB 1N6LA 1MO3A 2QRLA 4M7PA 3HVIA 2OZKA 2OFXA 2NQTA 2FG7C 5I9NA 1XRRA 1W5EA 4JL5A 1QPGA 3PB3A 4F7DA 4MVYA 1WP4A 1T5IA 2XWQA 2A5LA 3N2GA 2IV7A 1ZICA 1DJOA 2TMDA 2VPIA 2C88A 5K0TA 1FVFA 3EOBI 4M21A 2E2WA 1GLNA 1CP3A 3EQZA 1WY5A 5JCXA 1UF9A 1A4IA 3CVJA 3CONA 1RYMA 3P4UA 4OQMA 4EL0A 2J67A 3KDSE 4JV5B 1J0DA 3NR2A 1RQPA 1NPTO 3M6AA 1NQVA 2VEOA 4HH1A 2O8FB 1DLIA 3AR9A 5B1SA 1FY2A 5AQ1A 4NCJA 4AYXA 2WWFA 4ANFA 3GBVA 1HV8A 2P6RA 3RVDA 5JWRA 3GRVA 4DCPA 2OECA 4KQXA 1T2UA 4L0QA 2H4FA 4NRDA 2D59A 3EAQA 4WXRA 2C5AA 2FX2A 3I9LA 1HDXA 3QA3E 4EO4A 2VPZA 4LHVA 4LKOA 5CM2Z 1SHUX 3NYQA 3UC5A 2QXYA 3LRTA 4M1YA 2O52A 3GRPA 3T1VA 1FFGA 3D7KA 4J16C 1W8IA 4UNPA 5A62A 1QS0A 2XE6A 3C6KA 3ZE9A 4G1UC 1ODTC 2B2NA 3MT9A 3C3JA 1TK2A 1YVRA 2GCEA 5KVSA 4N3NA 3MTJA 3ZHBA 1C7IA 2IYRA 5IG2A 3PQFA 2LZ0A 2I66A 4PAOA 2ZCVA 4QOGA 4N7RA 1JJVA 2PVPA 3V2GA 3R74A 2ZU0C 3F7OA 2A94A 2ZRQA 4YCDA 4BB0A 2J31A 5LSAA 3KFVA 2QYHA 1YZYA 4G97A 1G5HA 1WMBA 3PHIA 4KX3A 4FHGA 4EHLA 3DQQA 3TIXB 3MBIA 3OPNA 3E7XA 3CLRD 4JLWA 3NX4A 4B71A 2NXJA 2NYAA 2RDMA 3KJGA 1QF6A 1F1JA 1UKZA 3EXG1 4TMXA 3RC2A 1QDEA 2CNWD 5FBHA 3IIMA 4A15A 3CLTC 4K5QA 2A6PA 4MQEA 1AK1A 1RTTA 3D31A 4HNRA 1D9XA 3D4LA 1QKJA 5DP1A 2H17A 3ZWNA 5IANA 4G4IA 4CQNA 3LCCA 1UDCA 1B2LA 4C3VA 4ZIRB 2AG8A 4Q03A 2P1DA 1ZN8A 3WSWA 4ZVQA 3MUEA 2WA2A 1NM5A 2WU3A 3AFHA 4E3WA 1KZHA 4JENA 1M2FA 1ZH4A 3OPYA 4ESHA 3IBYA 5CFZA 5JDIA 1MRNA 2I3GA 4BFZA 1J9EA 1SVSA 1NUPA 3GO4A 4RVCA 1K9VF 1RKQA 2O2GA 2VTVA 3E8XA 3N2ZB 4IKOA 4X9XA 2IOFK 2X2OA 4L76A 2YKGA 1L4GA 1X74A 4D4JA 2W37A 3R7DA 4HXYA 2NMVA 2AZMA 1KSJA 1TQHA 4V24A 2Q5JA 4PLFA 3HA2A 4OAQA 1WIWA 2PA3A 3BL5A 5JMWA 1F4LA 4MNTA 3CUWA 2X14A 1E79D 4LPSA 5LZ9A 1KYQA 2GFHA 3BRSA 4ES6A 1Q3TA 2GB4A 2I03A 3F9RA 3WMEA 4CIYA 2ICAA 1YKGA 5C7YA 5G1NA 4LQLA 2UZ1B 3EFEA 3OE7A 2XMRA 7REQA 1JEYA 1N6IA 4KAXA 3RVSA 3QRWA 3CX6A 4EW2A 4PHTA 4M7WA 2OBFA 1L4NA 1HL7A 1ZA2A 1BDJA 3LX5A 4LRXA 1L4EA 3DE3X 3H2HA 4V02A 2F8MA 3RPEA 1MCZA 3V1MA 4E2ZA 4X62B 2XZLA 2FMUA 1AB5A 2CJYA 2YYSA 4G8DA 1C7ZA 2I6SA 2QX4A 4IILA 3LUPA 4KXNA 3EEYA 2NPFA 5EZSA 3RS7A 5C8DA 1IUPA 3SI7A 4EVRA 2PFSA 3OM9A 3GQBA 2UYCA 4ZJPA 4CLDA 1U2GC 4YQZA 4J16A 3KEOA 2J08A 3IV9A 3TTTA 5DFAA 2P1ZA 3UMMA 3GNLA 5FL3A 4FYMA 4XEUA 3VAYA 3E82A 3WRYA 2AR9A 5CIYA 3OP1A 2PGIA 2YS6A 4I50B 3O4JA 1V3UA 4PBRA 3TLZA 2GD6A 4L5IA 1E8NA 1EQ2A 1MXHA 3PJDA 4DCCA 4PSCA 4QGAA 2HIGA 4WPGA 4V0OA 1Z2PX 3BC1A 3EXEB 1KI4A 2EKZA 4JC0A 4L9RA 1REQB 2FP4A 4TT3D 2FZWA 1U3DA 2C99A 1II8B 4LFAB 3BRWD 1K2WA 2XUDA 2GT1A 3OY7A 1UM9B 4IHJF 4PN3A 5HQ3B 4C29A 2IUFA 5HXAA 4Q4HB 4I6GA 1KMNA 4LXIA 3VNSA 1DMSA 2J9FA 2MR6A 3OHMA 5I9TA 3CRNA 5C7OO 2ZIVB 4ZXFA 3WLLA 2W2MA 4LY6A 1XDZA 3F6PA 2CFIA 3MERA 1NX9A 1RYYA 1U2SA 1V3VA 2UUOA 3U3OA 1TM2A 5JFTA 1UBUS 4O5OA 1BCRA 5K0LA 3WOVA 1VKNA 1RQXA 3PVSA 4EY6A 1P2SA 3CNOA 4FFWA 2YWEA 4DUYB 3MGGA 3RFFA 1YD7A 4UTVA 2CCJA 4FDVA 4NMXB 3TZEA 4ZI7F 3N28A 3RSHA 2OV2A 1K6MA 5BVGB 3CVXA 4S1NA 1OAAA 2HHHB 5JROA 4BWGA 3USES 4BU1A 4Z0HO 5KYKA 1CC1S 1LTHR 4UBMA 4UKDA 3UWKA 4E5YA 2BUBA 3LDGA 2Q2VA 5EQJB 4A2QA 2UAGA 5SICE 2BEWB 4MWDA 1IN1A 3EFOA 4OFZA 2BT4A 4MR9A 1DCMA 3H1FA 5TQ2A 3W1EA 5G3YA 1TO2E 1XX6A 1VL5A 2C4KA 1ZM9A 2ID7A 2P79A 3FSGD 1GQOA 2PT9A 3K5WA 4KPUA 5CM8B 1TF5A 1PUJA 2VDPB 4HADA 4EPVA 3BD8A 3DD1A 1FC0A 1HX7A 4H27A 3D64A 3IAM1 1F7VA 2OENG 2JFVA 2Q6OA 4S3MA 3UPTA 3D4PA 4XYMA 4ML3A 2IEDA 1GFSA 1GDDA 1LPMA 3NBKA 3QPAA 4GX2A 3CJTA 5DULA 3TX6A 5FNVA 5DM60 5BP7A 1ABBA 2ZITA 3BXZA 5SZKB 4AJOA 1E9RA 1RM4A 2WHRA 3UAGA 3CB2A 4XB2A 3RF7A 1II8A 3R5FA 2F1IA 2FK8A 3H2ZA 4TMZA 4L4XA 4PHCA 2V59A 3WY9A 1RYHA 3W3AD 1NE2A 4FDMA 2ZDGA 4LZWA 1CVIA 1DTWB 1KO4A 3FNFA 4KV9A 4QO8A 2PGXA 3SC4A 1LQ2A 2WSYB 2B3TA 3ZCSA 4ER5A 5JZVA 3SQLA 2QRVB 4AJ1A 5FJIA 5IZCA 4POAA 2EFCB 1QYVA 3GJ7A 3HNOA 4IEEA 3ACCA 1M9NA 2K4MA 1WW3A 2PZKA 1GTL1 2H1VA 2QLFA 3DW3X 3ANXA 4B17A 1KGSA 1SKYE 3D5EA 4FWBA 3L9XA 4EVIA 3O91A 4FOLA 3TUIC 2YZ7A 3CZAA 4IVPA 4NBUA 3PX7A 4IIDA 1S8OA 1FMJA 3MT0A 2GARA 1CU1A 3NBXX 4J1TC 4P3PA 1PSZA 4QLOA 2YMQA 4RPCA 2I4MA 3ROMA 1GM5A 4P7GA 1FDRA 2BMJA 3IPXA 4FUQA 1H3EA 4C6RA 4OPMA 3ST7A 5ECDA 4OUDA 1XZIA 1J0XO 5KNBD 5ED0A 1XZLA 1KQPA 2PGNA 4G0ZA 1SCKA 5H7XA 2BGJA 1PX0A 3A6ZA 3EXIB 4Y1EA 2HA7A 2AUNA 1XA0A 4WVFA 3UYLA 2GKGA 3KXPA 4ER0A 5LNK6 2ORVA 2B1JA 5JC8A 2G9RA 5ALYA 1Q0TA 2GMWA 1WCV1 1ZWLA 3GRYA 3AHDA 3PQ6A 4N6OA 4XVUA 5KX5F 1KSGA 3F6YA 2M32A 1OI7A 3OA2A 3VSEA 1E9CA 1FSPA 1CD5A 2C3UA 2GK4A 2IUYA 3SHTA 5F2NA 2C42A 1DKOA 1TI7A 5B2ZA 1PFGA 4GM1A 4P3YA 1YNOA 4MQFB 4RZUA 4MWOA 3WAGA 1NRIA 3OX3A 3GRAA 1P9OA 3FLMA 3R9WA 3M89A 4NBTA 1K4MA 2EGGA 2FX5A 4NI5A 1AX9A 4U7DA 5KC8A 1OC2A 5AHWA 4ONEA 4QBHA 3AZQA 4EBFA 4MKFA 1E1LA 3EGXB 4P98A 1RJ9A 4L3WA 1M7GA 2HBZA 1O94C 4DAEA 3SF8B 4JQCA 1RMTA 3DZ8A 5KOIA 1UKYA 2EJTA 1JG2A 1PVVA 3RIYA 4EYKA 3R8FA 4BXOA 4B35A 1NJGA 3N3AC 4DDHA 4RK1A 3FPAA 4Y7CA 5CUQA 3F5FA 3VQTA 4MJ7A 1TZJA 3IC5A 1AKVA 4B6GA 2H5EA 5JBQA 3DCYA 1NY6A 2C2GA 3DOCA 2Q62A 3UA4A 5DDIP 3KHSA 4R8LA 5KTPA 5IJ0B 3FA2A 3KYBA 5SV2A 2IYOA 5A71A 5FPSA 1JYEA 5LA6B 1FMCA 4IDPA 3IERA 2R8BA 3WK6A 3GVIA 4CM4A 4N3BA 3EUEA 4UPEA 1ZJYA 2FZLA 4HMOA 5FTLA 4M83A 5DTMA 3L1JA 5U4QA 3KQHA 2W0SA 3ZD9A 4HQOA 3EYWA 2G07A 4FBMA 1Q7EA 1DAIA 4FHZA 4KI7A 4L4YA 1OX6A 3HDGA 2R6JA 4HAOA 3NANA 4JP3A 3GX1A 3PUXA 5FPHA 4EP1A 3LCRA 1B8OA 1T3ZA 2W4QA 3KZCA 1R4NA 4RWEA 4JGBA 1EA7A 1EXNA 1G2IA 4M1ZA 4WXHA 1UOQA 4NF2A 3P45A 5DLPA 2HA2A 1NIJA 3CR7A 4LTNA 5CA1A 4KIJA 2J48A 4UQOA 1UEXC 1FNSA 1VKRA 3EAGA 3QXHA 5BSMA 3FDJA 2GSWA 2PV0A 4D92A 2KI5A 4RGVA 1GTRA 2RHWA 2ZIXA 4W8HA 4UNIA 4MP6A 2Q27A 1EG7A 3RTDA 1V0JA 3MUOA 2PKEA 4AC9A 3NYRA 1P2BA 4GRIA 5A4AA 1T35A 3MC1A 5I7VA 4ZOEA 4FX5A 5KCZA 1XU4A 3FGZA 4TMFA 4RE6A 1AUQA 1R9JA 1KOJA 1I7PA 4LOAA 4DANA 2P62A 4EO9A 1G5FA 2P2LA 3IDQA 3P96A 3MMSA 4NPHA 1JFFA 4GSKA 2XTZA 3AL0C 1CDEA 2FPIA 2IEYA 1D4ZA 3D2BA 2Q1WA 3OQHA 4E7OA 4ZAVA 1RIFA 4DG9A 4MI9A 2AQHA 3QHPA 4HUJA 5JY1A 4WKGA 4BIMA 2H16A 3GEDA 3DGEC 1F14A 4H7FA 5GV7A 4FFRA 4TLMB 4ZVRA 1GT91 4H1UA 1K27A 4OP1A 4UHCA 5DK4A 3KG2A 2IKQA 1PTJC 3LGSA 1YXMA 4XZ3A 1OH6A 1IATA 4EGJA 3NWJA 5DEIA 3W6ZA 2WUGA 1QIEA 3F49S 4KBFA 1G7RA 1QFZA 3GDWA 2OFWA 5EWMB 5E2IA 3HCAA 3NHLA 1CQJB 3AOEA 3R3VA 3VVCA 3D7RA 5CT9A 4R1TA 2JARA 1YCFA 3UGQA 2DT8A 3AFMA 1L3BA 4IKEA 1FVXA 3SP1A 4DEXA 2PCLA 4I4TB 3CXUA 4ZVTA 5EMHA 4H2DA 1WHSA 2H1WA 3A2NA 3PF9A 2FEMA 3BREA 2H06A 1Z0ZA 3BBLA 4NSNA 2P9YA 5FLEX 2QTTA 4HN9A 3ACDA 1E20A 2QTFA 1DKNA 2WJGA 2XHZA 2ZR0A 5CIQA 5ENZA 3KXKA 5TMEA 3SZOA 1UH5A 3PXGA 4L28A 4P1ZA 4BS9A 2OB2A 1NSTA 2EBWA 4IDOA 5FF9A 5FUYA 5DYYA 4LTMA 2C31A 4JT8A 4HQLA 4Y2RA 1YFKA 3CXRA 4WXYB 1D03A 1MVNA 4RDCA 5D6OA 3DPSA 2ZANA 3TAHA 2DQSA 3BGOS 4KN6A 3RV4A 3VUEA 3ZBUA 1M5RA 3C7AA 3WGLA 2HU2A 1LSOA 2R11A 4MRPA 1P1FA 4B8ZA 1IZ9A 3D4IA 3RG2A 4C0XA 1XDDA 2REXB 5G4LA 1H5NA 3DMDA 4M1TA 1BHQ1 1LW6E 5EJFA 4DB2A 5JAZA 5FPYA 3UMVA 1WMAA 2XHEA 3PNLA 2BYTA 4M76B 4QRHA 1ISRA 1QC5A 1T6YA 4YO7A 5EOVA 1N6HA 3AP1A 1YZTA 2PGOA 3QBEA 5ALPA 2FPUA 4RVNA 1CIVA 2XQJA 1L5HA 4DMCA 1JUDA 2PRYA 3PYMA 3DE0X 3T4UA 4CG3A 1PHPA 2ZI3A 2CLDX 1ZK2A 4LRSB 1TECE 3VZQA 3WK9A 3ZI4A 5IM4F 2PE5A 3I4FA 1BA3A 2Y0BA 2IY9A 1DDIA 3PUHA 4C2BA 3VNRA 5DT2A 3GLFE 1U7ZA 3PUZA 2FWBA 5E7IA 1VCOA 1FFDA 1W49A 1RM3A 2ZDHA 5C5EA 2QU7A 4C05A 4R81A 3GGCA 2IPAB 3KYCB 5FOQA 4Z99A 3CO0S 4FJ1A 4R41A 1F1BA 1QRUA 3D2AA 1U8CB 1TQ4A 1UK9A 3LGXA 1E0AA 4OQPA 3SJ7A 1C9YA 1N5DA 2YV4A 2WJJA 1THTA 2JIZD 1PJAA 3GAAA 1PJLA 4FKBA 4L57A 4QQRA 4TZKA 5DGTA 4DY6A 1WETA 2EXXA 4OEHA 5C3UA 1T9DA 2GAOA 3C6YA 5D01A 1AHNA 2IY8A 3AY6A 3C2QA 1GZ4A 3IHWA 2PR2A 4IRUB 2ENWA 3TD6A 2GD0A 4YUWA 2D0OB 3H2IA 2B61A 1P4JA 3GR6A 3B1FA 1BVUA 5CK5A 1K3UB 4GE3A 5ALWA 4NP6A 5IHPA 2V65A 5KJCA 3CQ9A 1V8PA 2YWFA 3TLAA 3PGVA 3FGNA 1GRRA 4UQPA 2AC7A 4BBPA 4ENPA 5HTOA 2JCSA 2Y6VA 1Q1GA 3Q3HA 1IN5A 1GO2A 4ITUA 4CLOB 3LVBA 3PXEA 3IJ5A 4TL9A 4KITB 1G55A 1LLUA 3O4VA 4PCVA 1DC4A 3WNZA 1R18A 1DXQA 4L3VA 1JHRA 4Y6OA 1P7YA 1G9XA 3K0EA 1PDWA 3AILA 2QBYA 4V3BA 2H1CA 2XUPA 1C7EA 3CZQA 4JYZA 2DBQA 3IDOA 2NUTA 2FN4A 2D0PB 2G63A 3R9XA 5GMOA 3CB4A 2Z83A 3GZ4A 5DSXA 3AVVA 2DWOA 4D8VA 2FEOA 3HKCA 3T7JA 1SEVA 3PWSA 3A1CA 4KQFA 5TEWA 2CD7A 3D1VA 3FPHA 3QE4A 4Y6QA 5T6MA 4KOEC 2A9KA 1UJBA 4EI9A 2XUZA 3QWBA 1ZGZA 3C5CA 2R7LA 3D59A 4TL6A 1CT9A 5EUBA 3INNA 5B4TA 5DNCA 5EHZA 2XCQA 4GLBA 3H18A 1DARA 4FYKA 1QWSA 3JALA 4MWTA 4LOIA 2IH5A 1PWZA 4G1EB 1X1QA 2HMSA 3QE3A 3GCWA 3I92A 3SFTA 1COZA 3GARA 3KV3O 4TSKA 3WXBA 1CVRA 1C3OB 4LRTB 5JMTA 5JPIA 4IGFA 5KTNA 4CKBB 2XOEA 3Q10A 2PU5A 2R65A 3NCTA 3W2FA 2A30A 1FNMA 2V7UA 4GEGA 1ORDA 4A23A 1GPWB 1LQUA 2XADA 3P2MA 5DLYA 3VPHA 5EY5B 4WCDA 5GADl 1M8GA 1HWYA 3C5VA 3H3XA 4IHJA 4ZVMA 3KB1A 1YI0A 3DE5X 3F1KA 5BN3A 4DKXA 3JVEA 1K7FB 1US8A 2AI2A 1PIWA 1V5WA 2FZKA 2WT8A 4GWKA 4IUYA 4JLJA 1LS1A 2FG6C 1RLTA 3C41J 4HZIA 3UAOA 2GO1A 3I42A 3FWZA 3WTCA 1NF8A 3SIWA 1U3WA 4KAAA 3TKYA 3SS9X 4EY3A 1TQ6A 3ZXUB 3Q4GA 3UGJA 2Q3MA 1E3JA 5BN1A 5SZHB 1PBTA 4DDUA 5A7GA 1BIFA 1UBKS 3ICVA 3QUTA 3NZEA 3C87A 2DBYA 3PFFA 1IQPA 4GKBA 3I76A 3ZK7A 3CPHA 1CF9A 4XGRA 4YNBA 2GPAA 1YGYA 1FYVA 4FE4A 2WJZB 3S8MA 4E46A 2COEA 1KH1A 1M2JA 4TS9A 3D7MA 3LLMA 2OK7A 3VU9A 1HQYE 3AIMA 1UC4B 3IA7A 3PNYA 3PEYA 2KM1A 3L7KA 5IJ9A 1L7PA 5LYJF 3TH5A 5JJ5A 1JAXA 1ZD5A 2VCEA 3QPDA 4TLDA 3K9WA 5AKKA 2VLIA 2ZB3A 1NG1A 1C7JA 3OMXA 2EVWX 3H83A 3EH2A 4RV5A 1R5JA 2CLOB 1HT3A 1C2YA 1D2CA 4W8OA 1D2RA 5CVVA 4RTJA 4ZALA 1MEOA 1Z0SA 4YRKA 3LBYA 1K7YA 2DKNA 4D79A 1EGVB 1WRBA 2XT0A 4CTJA 1L7VC 3IBFA 1YHYA 3R41A 3EXFB 4TTVA 5AYVA 3ADPA 4JLOA 3GBSA 2QTAA 3OBBA 2WSSA 1QB7A 3LQ4A 4ZEWA 5T41A 4MVJD 4ZAWA 3VZCA 1V2GA 2I1WA 5ECGC 4PTLA 1NVVQ 5EE9A 5FAXA 5HKLA 1YTUA 2FSUA 4OIMA 4RTPA 2W11A 4W5HA 1I32A 1T24A 1SVKA 3NDPA 4MICA 4PAQA 4BX3A 5A9SB 2VHUA 1EIWA 1BYIA 2RG1A 2RHMA 2CF6A 5JAQA 1KY5A 2CBGA 4LHSA 2CMGA 2PLWA 1WDTA 2JK1A 5ITWA 2J9ZB 3LBNA 2GZAA 3ZS9A 4BO9A 1ECBA 3P2JA 4XFDA 3U3KA 1GRNA 2AC4A 2XV1A 1O5IA 4Q24A 1KYWA 3AEQB 1FB5A 1Y4ZA 4TS4A 4WSOA 3DAOA 5E6SB 2PEYA 2X19A 4H0FA 1SIOA 3O4HA 2JHPA 5DK6A 2FVXA 5LMUB 3OZUA 5I3CA 4AMGA 1JDPA 4NZNA 1VIYA 1X70A 2XKBA 2YMPA 4I19A 2F64A 4I8XA 4PPYA 5HFJA 3W8NA 5F9MA 3OP4A 1XN1A 3SQXA 1Y3CE 1LKZA 4MLCA 2PWYA 2XCLA 4LZPA 3JYLA 4GR5A 1XJ0A 3FYUB 3QKWA 4JD5A 3ZWPA 4D3XA 4KTTE 1UWLA 4AUEA 1SXPA 1XZEA 2C07A 4KKVA 2F1RA 1FNBA 3GGJA 4LOHA 1FP1D 4HBZA 3EQ7A 3LE8A 1EUCB 2O8EB 2BRUA 3EVAA 4QOEA 3U13A 5KX5A 1IQRA 3PC4A 1U7HA 2H08A 2QNBA 2C9CA 1WUKS 1Q3KA 2B8NA 2ONCA 1ZCAA 4O4JF 4J4TA 4KLRA 5LA6A 1DELA 4WNCA 3PQDA 1ZUD1 2Y2VA 4N82A 2FPRA 2WWHA 3TVYA 5T3UA 3EDMA 2J0QA 1G8KA 2IELA 2OWDA 3NT2A 1SCUB 2X6RA 5MN5A 3LTNC 4JMPA 1VMAA 3PC7A 1HDGO 3LDUA 3LQ2A 2JD2A 1EMDA 2OUIA 2PS3A 3GRZA 3MFQA 1BEUB 4KBYA 2YVUA 2ZUVA 4LQ4A 1KERA 1SCBA 1TKAA 4DLSA 2ZREA 4FLFA 3SYKA 3WHKA 3A1VA 1M34E 1JA1A 2O7VA 3H9CA 3NTVA 4WFKA 5FHRA 1A27A 4GLJA 3VDXA 2WKRA 3EGXA 2O57A 3OPVA 2BJHA 1GNLA 4NZ9A 3DT9A 5J59A 3WKBA 4BMOB 5KNCD 3TTXA 3L7BA 3TPCA 3NB0A 2FOXA 3MWDB 2HK6A 1CZLA 3ELYA 1XYYA 3KLNA 5FWYB 1PQYA 3N70A 1CZOA 1B43A 2BSAA 1ZY2A 3AGQA 4G8BA 4AZ3B 4R3WA 1BS2A 4CKCB 4IDHA 3FDZA 4XX0A 5HOEA 3ZLJA 1JQEA 2LP4Y 1VLVA 3O83A 3P9IA 4ZQEA 1GIAA 1H2BA 1F5SA 3NHJA 3C8DA 4ZPJA 5JHGB 5L45A 1U4NA 4P4TA 5AVYA 2ZVQX 4DREA 3TQIA 4Y0AA 4QJ3A 2R8YA 2Q9AA 3M6WA 2YJ4A 4XJTA 1UZNA 2HSGA 4BLUA 4BYGA 3Q0IA 4I3FA 4IRXA 4OXYA 1E3EA 3ZX4A 5EXTA 3G0IA 4ZO4A 2GCGA 2WSBA 1SUIA 1BU8A 1LPPA 2C5GA 3R5XA 1MZVA 1EE9A 4FFNA 3EAFA 4E13A 3ZD6A 4JLBA 4QDZA 1GWNA 4B75A 3CYFA 4NENB 3K70B 4JLPA 2NV6A 1XE3A 3AVPA 4GOKA 3NJRA 4ZD6A 2HEGA 4EW6A 1SOMA 2X5XA 3FROA 4CI0B 4RPGA 3M5WA 2F43A 1XVTA 3GN2A 4HNUA 1XPOA 4G0UA 2HT1A 3FDIA 1BVRA 1JIJA 5EINA 3WR5A 2OXFA 2VSXA 2QNRA 4L4UA 5DNVA 5A05A 5LDDC 4LS3A 4R8VA 1HM5A 1OLSB 4ZVVA 3TNLA 4G09A 1R4MB 1EUDB 3C43A 4KYTA 3NAMA 3UYKA 2Z1NA 1ZW6A 3B3AA 3DEAA 1FQJA 1DZIA 3DEFA 3HBFA 5KWJA 3KKZA 5GV8A 4LJRA 5EMLA 1E0SA 1V43A 1WL8A 3E53A 3IPRA 4J1QA 2QVZX 1OROA 1U4SA 3BMOB 3H65A 3OO1A 3ENQA 1HQKA 4FEYA 4HQNA 5L7YA 4W7HA 3WGTA 4I9HA 4IDEA 1EK5A 4N8DA 4CCAA 1RVDA 4HBGA 5DTIA 5DYWA 3IB3A 2X5OA 3OEEA 3K0CA 1EBUA 3H5RA 5EKXA 5LQKA 3C5HA 4WN9A 5LIPA 4PY2A 5ABPA 4ALIA 2J3JA 3C3BA 3HM2A 3TB6A 3NMUF 4YROA 4CE6A 4FXOA 1RKXA 1L7EA 4CIDA 1KZ9A 2BEWA 3G2PA 1DPGA 1E1QD 4DQ0A 1DBSA 3HU5A 3GCXA 1LBEA 1F7UA 4YRMA 5KDOA 4IFBA 1II0A 4QELA 5GZ3A 5B37A 1YBHA 2XQVA 5KQLA 1XMJA 2O0MA 1W87A 1M2KA 1Q1ZA 2EWWA 1ZJ5A 4WKCA 5L3ZA 1MIHA 1E96A 4RM2A 4ENRA 5LMCA 1CXZA 3DZDA 4LJAA 2FPWA 3FKJA 3EMKA 1G3QA 1OFVA 2JAHA 3OLVA 4IJUA 4FDUA 3LL4A 5I7AA 2OLJA 2Z2XA 1EI9A 3BZWA 1RAGA 2G25A 2ZVJA 2AHRA 4Z1MD 3FPBA 4FKMA 4W99A 4BGUA 1F8UA 4FGWA 2J5KA 1HBJA 3MTEA 3VC1A 4Q7LA 4PG6A 1FUIA 4B0OA 4EB3A 4MWGA 4L6AA 4EJFA 2E1RA 3ESXA 5EVCA 421PA 2V9CA 4DLWA 1B0UA 5ALNA 1UXOA 3WGMA 4DYVA 3LK6A 4F2HA 1PJ4A 1VBKA 1G66A 2WA1A 3LHKA 3G0BA 4HDSB 4V38A 2VTBA 3OFND 4L5AA 4OLJA 3A4LA 4KR6A 4PC3A 3FZQA 2JAWA 4CTMA 1IFXA 1PVOA 1UMDA 3O21A 2JJQA 4V2IA 1WZIA 1RI2A 2A5JA 2W8ZA 3DBHB 3RS5A 3GAZA 3HWWA 2EBUA 5I9BA 3TZHA 1FTNA 2DUWA 1DBRA 2OCDA 4PZDA 1ZU5A 1MC4A 4FT4A 5AVJA 3VO1A 3WL8A 1WABA 2OAGA 3ABZA 1FJHA 5IM4A 3NOVA 5KTOA 4Y7DA 3SFZA 3U4CA 3AVXA 5B4UA 1M2VA 3F6CA 1TGYA 3VPDA 2QT9A 3VOSA 3ZW7A 3RBZA 4MA0A 2B8WA 2OGTA 5B53A 4OLFA 2X8AA 3IP9A 2AJDA 1UP6A 1OZAA 2GZHA 1QDUA 3ELDA 3K0HA 4XSVA 4Y67A 3SDBA 1PZFA 4N01A 3SIXA 3V6MA 2PH5A 1EDEA 1NBEA 1E2UA 2Z6AA 3IR5A 4RXMA 4GL2A 7REQB 2PCJA 3O6VA 2A5GA 2CFSA 2REBA 2BJVA 3I8SA 1OLUA 1XWIA 4MS3B 3DHWC 5F35A 1PV4A 2QM3A 2WZCA 1JAZA 2VDKB 1W94A 2FSIA 2VP5A 3CT6A 4QOFA 1QAOA 4DEVA 2EJWA 2QNIA 2BSXA 2C2ZA 1UPBA 1IULA 3AFOA 4IR7A 2ORIA 4JUIA 2OFFA 3L77A 3F98A 1BDMA 3EVFA 1KKUA 4CKXA 1E18A 3QQPA 1UBRS 1VG9B 3VRHA 4Q9AA 4HMPA 5AUQA 5EERA 4OQEA 1SVNA 2HNBA 2ZZNA 3G7UA 3B36A 3S5JA 3HJUA 3B70A 2YVAA 5F5NA 4Q4AB 4Q6BA 2GBLC 4X90A 2J5BA 4HZGA 1L4KA 1PFKA 3MB8A 3NHRA 1CHNA 3PD1A 1KQ3A 1YL5A 1JHXA 2I4OA 2QS9A 5KNDA 2HRCA 3NOXA 3HL0A 3ONFA 3C5WP 2OHIA 2B34A 2ZRJA 4W63A 1Z4QA 3C6QA 4FYVA 4MSUA 2HZ7A 5BQFA 2IXAA 3HTXA 4EVSA 2CL0X 2J7KA 3OKCA 5KVQA 2H3EA 2OCLA 5EP3A 3TSAA 4EPTA 3FBWA 1HE2A 4F85A 1YONA 1OJLA 2IL1A 3ZZNA 5BORA 1X1EA 4CGZA 3HV0A 4O2BA 3K1JA 1NBHA 2D2IA 1I1NA 3NEAA 4EJSA 3ITNA 2EFEB 5CA0F 3Q3EA 4PSUA 2XSZA 4JK3A 5KS2A 5BQ5A 3FUTA 3N0TA 2QTGA 3LT2A 1YHNA 4C3OB 2VKTA 3SHVA 3M4XA 4M9RA 4X8HA 1MX9A 4TRNA 4Y30A 1GTVA 5AKEA 2G8LA 5CDFE 4Y2GA 1SZCA 2DECA 5JSUA 4ZEVA 3THRA 1O0BA 5BSEA 5MDHA 2WG0A 1YK1A 2WMYA 3A4TA 1U2RA 3FNEA 3WQSB 4XIYA 3CUUA 2G77B 3AWIA 1YRBA 1NXPA 1Y7HA 2VF7A 1QJ4A 3LZDA 4UEOA 1RBYA 3GLTA 1USGA 4N03A 2J30A 2G5GX 3IPYA 3U56A 1ML3A 3O3OB 4I9NA 5DM1A 2ZK7A 3A1TA 2NW6A 3LU1A 1XTQA 2A1IA 2IDKA 2PQ2A 1NJ8A 2JW5A 4IRMA 5CVJA 5G0UA 3L49A 1FYEA 5B57C 3PT5A 1PLKA 5JQGF 2Q3CA 4K8OA 3GP3A 4K81B 4CT0A 5CT5A 1VMDA 4KN9S 4YMIA 4ZAGA 4AJIA 1AK9A 1ZI8A 1NLMA 1I2BA 1MDFA 1DRJA 4ZOAA 1SUEA 2VJPA 2YNMD 3GA5A 3NJ4A 3AY0A 3IT0A 4Q9NA 5CM9C 5FI3A 3S2GA 3GEGA 4LN1A 1GCOA 3MXOA 3C3EA 1M75A 4PXYA 2GD1O 1OLXB 2YS7A 2PY6A 4QFDA 3EIQA 5COAA 2ROQA 4EGAA 4Q9KA 1XCLA 2XMDA 4D82A 1O6FA 3N2GB 1ONPA 3BL6A 1KGDA 3GD5A 1GL9B 4M8LA 5AK6A 3A14A 4DA6A 1M1YA 3IXLA 4FDLA 2ODTX 3LFHA 5BWOA 8OHMA 4N41A 5F9HA 3AEZA 3E7PA 1NU8A 2IKSA 5I4BA 1HE1C 3REQA 6REQB 1G2OA 1UDXA 5AK4A 2BR5A 4HGOA 5E6SA 3SEZA 1MT3A 1K0UA 4B87A 2EC5A 4R2HA 4WA8A 2R60A 3F4KA 2AE1A 5G0TA 1KS9A 2Y3IA 2Q7DA 4DRYA 1YRYE 5G4KA 3I0ZA 1PF7E 2H1HA 1PJTA 4MW9A 4PHFA 4ROSA 2QQ5A 2FSGA 3G68A 1ISIA 3A58B 2A0YA 3C7KA 1WWKA 1M3SA 4HN2A 1VJ0A 4LDZA 4GSYA 3R76A 3AY7A 3TNJA 5CH5A 1T4BA 1YA4A 1EFVB 2XI4A 1GQRA 1TEHA 2H00A 1MO6A 1GUDA 4HXFB 4IIHA 2DH5A 1SC1A 3K2IA 1JEDA 3VISA 3EBLA 3EARA 1U1FA 3RB8A 3RIEA 5KHLB 2JL1A 1GDTA 1XTKA 2BGMA 1UDBA 4KXVA 4MYRA 4B7CA 3C7CB 4XA8A 4II3A 5EIOA 4C3ZA 5ETJA 4IJKA 4CV3A 2ZTHA 3WB9A 4EB0A 5FEUA 1VC2A 2B4YA 3FMVA 3MWLA 3IE1A 5AW5A 1ID1A 2A33A 1W0JD 3RTAA 4I1PA 2A1UB 1M6WA 4IV8A 4J0CA 4J0DA 4EYQA 1KJIA 2LRHA 1K8XB 4EECA 1V8BA 1AS2A 4EBBA 4J0GA 1ZOLA 3CN7A 1ENOA 1T2FA 2WMDA 3CSSA 1AD2A 4LY0A 4MITA 4Z3KA 4KQKA 5ALSA 4YV2A 3T5PA 3W2TA 4HNGA 3B6ZA 3ROPA 3U3XA 3FPGA 1XKLA 4JGGA 1O6GA 3DXXA 4QXAA 2XWJI 1THGA 4W1PA 1R0XA 4XIJA 1B6SA 3RYIB 2FMKA 5DZSA 1XTSA 2W2LA 1E9BA 2WD8A 5HE8A 5BQXA 1CYEA 5L7WA 2VWQA 5JEEA 5CP8A 2P8JA 4RHCA 5E6RB 2H07A 3HUTA 3RARA 1OBCA 4AY6A 1TZKA 3ASVA 5JV5A 2QTVB 4CVNA 1L9KA 1AKRA 2AYZA 2WT4A 3TECE 2VNIA 4DDWA 3JX9A 1EFRA 1B8NA 1CS0A 4IHKA 4QU8A 3FNIA 1NZFA 3II6X 3TGPA 1U7XA 3DL7A 4U3JB 3RRZA 1O8BA 4JT9A 1X1RA 3GFTA 4J0KA 5LBTA 4FE7A 2OA0A 1L6RA 2X86A 1XQXA 4NULA 1WPQA 3V4ZA 1U8XX 2ECKA 4XD7D 1M6NA 4D0RA 2POCA 4MWBA 3L05A 2UUAB 3EGOA 3KKMA 2ET6A 1DINA 1DUVG 1MA0A 4U00A 2PNJA 1K5HA 2NUAB 3VTAA 3MK31 4RVUA 2J3IA 4PX2A 3U7QB 4EA7A 4BLRA 1UKVY 1P17A 4X94A 1Z2DA 2WDZA 3QEMA 3NXKA 4KVAA 4DR7B 3SC3A 4B3IA 1KFCB 3FSEA 5JO0A 3O8QA 3T95A 4AQDA 4DLVA 3ZVMA 4GZ3A 4D3FA 4DY4A 1QGAA 4EDFA 4JBWA 1E5VA 1Z5UA 2NTVA 5DM4A 2B1QA 3U4DA 2EF1A 3EPHA 1H1DA 2PL1A 2Z56A 4AKEA 2IBMA 5FA5A 3KE9A 3TUZC 4CEHB 1W30A 1BGVA 3D8TA 3DCNA 3DFIA 4I99A 2HWUA 1NJ6A 3GUZA 3TW4A 3CLSC 3VZRA 1IN7A 1T6ZA 3OZCA 4NOMA 3TDKA 2LIPA 3PNMA 5FOWA 3HLKA 5B3AA 1F8GA 2W6OA 2B7LA 1QIGA 3HYLA 3D8UA 4W1QA 1JVSA 4DKJA 1OFUX 3N9IA 2WJYA 1QUFA 1I24A 4U6NA 3UMSA 3K73O 3D4NA 2YXBA 4QOJA 2R751 4B9AA 4G24A 1BMFA 4YRPA 4QXQA 2R6AA 3W5UA 5CTJA 2J4DA 3CUSA 5BO5A 4LXHA 4BNKA 1D4AA 2C83A 4DXDA 3QE2A 1AZTA 1N8TA 2WFZA 3SYTA 2OHVA 2D3WA 3LL7A 3BDVA 4ISBA 1M6VB 4FFPA 2JJ2D 3H1TA 1CVLA 4UHJA 5ANRB 5BRNA 4BQSA 1UINA 2PUHA 3OC6A 4MVXA 2VDVE 1EPUA 4LRYA 1PJCA 3LDAA 4Z9AA 4ITRC 2A1TR 1FMTA 1UM8A 3H0KA 4R1PA 4UMDA 2DERA 2O07A 1M2EA 2FGJA 1N3LA 4WE3A 1HI9A 1N9GA 2WT9A 1C1XA 2X7JA 3CZPA 4GAEA 2QD3A 2VQEB 3UWPA 3QIAA 2UU9B 3ICEA 4OXIA 1QGED 3R6LA 3LX8A 3JR3A 3AJAA 1XAJA 3KBBA 4I14A 1JWAB 3K2QA 1YRLA 3O1JC 3ICCA 3RADC 3Q9LA 2JJ1A 5IX8A 5JU6A 5JRJA 4D02A 4OKNA 1C3EA 3QMPA 1XEWX 3BHNA 4WBXC 3OF3A 2PRIA 3UOWA 2AOVA 1JE1A 1KEWA 1W581 1AHHA 1HDOA 2PRKA 1ISMA 1XTZA 4MTLA 4RK7A 2E3JA 4TTRA 3E48A 1IZ0A 1SAYA 3JQAD 5JD3A 2ADMA 1TOAA 5BNWA 4IJQA 2O5EA 3G1TA 4UFPA 2ONKA 5J63A 4RABA 4AUKA 4RJTA 3BFXA 1R5OA 4BRSA 1EGQA 3N7TA 1UBJS 4BJ3A 2YHSA 4BB9A 3ZY3A 1DHRA 4WJZA 4EPWA 5JCPA 5KB3A 5IEJA 1FFYA 2XLBA 4RA9B 5DN6A 2CHVA 1NIPA 3EWAA 4DIFA 1LDEA 4PG8A 1US8B 3COWA 4O2LA 1NURA 2F59A 4HCJA 4OHPA 4OA5A 3ZWKA 1BE0A 1GUBA 4MYTA 5GONA 1QC5B 4QVIA 5BN3B 5JXWA 2BWJA 4P2GA 5CDTA 2RCNA 4MVWA 1RAEA 2ORED 1UP7A 2AW5A 4IS3A 1G3IA 1G21B 1MX1A 3MLBA 4WZAE 5MN4A 1Z15A 1PJ2A 2XGOA 2XE4A 5BOSB 1V6CA 5H8WA 5ALGA 2OAQ1 3IB6A 4QAQA 4Y2HA 2HCJB 4YRSA 1ZD2P 2R97A 4OQNA 2X9QA 3MNFA 4NG4A 2AQKA 1NKTA 2DY0A 3HYNA 4UXJA 4I55F 5JS6A 3ZDBA 3G9UA 2V7XA 4B0PA 4G37A 5B7NA 3AT1A 3A7EA 1TQ2A 1XFDA 3QWAA 3OZXA 4ZAYA 1NHGA 1N33B 2ZUSA 4JR1A 3M9WA 5DO9A 5ALKA 4XVHA 4TSFD 5EP2A 1J21A 3L5KA 1BROA 5FFFA 3EEIA 5HDQA 3ZCTA 4BE9A 2Q3LA 1Q1AA 2BM1A 4LJSA 2WLTA 1T3GA 1NY5A 4C07A 4EYSA 5BUSA 3K70D 3UY4A 2X22A 4TTIA 3TBHA 3AI3A 2JZOA 4WFQA 1T34A 5AVSA 1P39A 1VDMA 2P77A 16PKA 2IVZA 2BGIA 4G0XA 1FS6A 4UDNA 2C0CA 2XYPA 3LW7A 2NUTB 4A2PA 2PFGA 1Y3FE 1ZSYA 3R0VA 1J6UA 1C8KA 1K8QA 3WNDA 1M34A 1V2HE 2C3PA 3LV8A 2ZQZA 3M1YA 4QARA 3FFAA 3U1BA 4YRGA 3HSSA 3TR6A 1O4VA 1XEXA 2C4NA 2Q4TA 3P71T 3FMGA 3N2LA 1HY3A 3EG9A 3THYA 4H60A 1V5EA 1N2GA 4F21A 1IVSA 3LZCA 1DB3A 4MRMA 5LP1A 4HZUA 3CWQA 3ICWA 5ED4A 1FU8A 1PTJA 4OXNA 3F3SA 1M6VA 4F8YA 5KWSA 1NXTA 1OZ0A 1AUVA 3IOMA 4URHA 5ERGB 2OKCA 5J5AA 2HK7A 3EA4A 2PBZA 2P2GA 5EFZA 3DE7X 4GI7A 2A78A 4CM5A 1ZQ9A 3TXYA 1X7YB 4DEYA 1IHYA 3WYEA 2JIMA 4HDRA 4RL6A 1Z63A 2IPOA 1R0CA 1DMRA 1LDBA 1V6SA 4HYYA 3T0IA 5CURA 1J1UA 2DU8A 1NR1A 2QRKA 2UVDA 4EKEA 4HO1X 4EITA 2W2XA 3IEKA 2IP2A 1Y7TA 2CXHA 1CR1A 4FYIA 1W0CA 3DOUA 4OCZA 2DR3A 2X4GA 1FNNA 1P7WA 1RM5A 4C7KA 5AHKA 2GM4A 4QBKA 2NO1A 4XKJA 2JDID 1U2QA 2IF0A 1SBIA 1LVUA 3I53A 2DKOA 1LLCA 1ZC3A 3KEMA 5EZYB 5BVHB 4RF3A 5IYZB 2VDOB 2D1FA 1MXFA 2HU7A 3Q72A 4QGBA 1W5BA 1PKEA 1RLIA 1OKKD 3CX8A 3K1AB 2BZ1A 4KVZA 4S12A 5M5BA 5BYKA 3FOAA 3OZBA 5CLFA 1U3UA 2ZYWX 4OBEA 3KEGA 1TCCA 3EDOA 1N8KA 1FUKA 3FKSA 5KNDH 5CNKA 4C9BA 1GSHA 2E9SA 3D3NA 1NN0A 1SG0A 4YRDA 4DAOA 5DEOA 1ZRHA 3BGIA 4F1WA 1TUIA 4CNQA 4MOWA 4S04A 1LDMA 3KQNA 1H6CA 1LK5A 2Y1DA 1VIAA 1YR2A 3BCSA 3M4NA 5AOBA 4ZU1X 3P9XA 4DL9A 3G5LA 5ELXA 2SKDA 2R6R1 2VNJA 2YFYA 4P2BA 3E4DA 1G38A 4WCFC 3LUJA 3U44A 1W36D 2YWHA 2WVHA 3GPBA 1RPJA 2P7HA 5MGBA 5JRDS 5FO1A 3U16A 1VPTA 1JSCA 3VYVA 1X1DA 1JF8A 2G72A 3Q9UA 3VVBA 1F2DA 4LTDA 4YRAA 3QEAZ 4K9QA 4TS1A 5LOVA 1RVV1 1CLUA 5A9SA 1ZK0A 3EUWA 4TXNA 3I37X 3QNWA 2IYTA 5I8WA 4WQMA 2J32A 3LF1A 4G1VA 5L3QA 3M6VA 4AYTA 4YCBA 2IY7A 1GR1A 2X8JA 4YCSA 3OU6A 3UJ8A 1H8EA 5FUWA 3DOIA 1XT6A 1OW3B 5AKHA 2BPOA 4NZZA 4CIVA 3O3NB 1S3IA 4LNUB 1A5ZA 1IN8A 2IW1A 3HA7A 4GC9A 2SHKA 3SAJA 2IYWA 2JFZA 2ZJ6A 1L7OA 3DAPA 5EPEA 5H1YA 1LZKA 1U0RA 2PX4A 4WA7A 5A3VA 1K8RA 4B3HA 4E5KA 1QU3A 5AJZA 1E9VA 1UQRA 1PO7A 1V7QA 2Z04A 2PSJA 3NDIA 1N0HA 2C8LA 3GJ6A 3NI2A 2BE9A 4G9EA 1KE1A 3TL2A 3R0IA 4HVAA 3F4LA 1I5RA 3H1BA 1NXVA 3IVCA 4CIXA 4DPMA 3N1UA 1TRKA 1WB4A 4R9VA 5IJWA 2IZ1A 2OBXA 2H6EA 4KC0A 5ALVA 2IS2A 3KFXA 4YJHB 1TZBA 4GPAA 2PUFA 5IFKA 1G6Q1 1XDGA 1XHLA 3AHJA 4PO3X 4JAVC 1HPLA 2GXAA 4OYYA 1B0PA 1QG0A 1XN4A 4ZXPA 5FORA 3GZNA 2H7VA 4MYSA 3OETA 5CBPA 4YMTA 4IVQA 3HV2A 3KT6A 3RSCA 3PF8A 2R85A 1Y6RA 3IQIX 4N4AA 1RHUA 3REQB 4OXQA 3SFVA 4W4TA 1YOBA 3GJXC 4DTCA 1W4LA 3TRDA 5MF6A 2J9XB 4ZODA 2F1JA 5DE3A 2FKAA 1ADBA 3IIKA 1QWOA 3RSFA 3R4CA 4OJYA 2JFFA 3JQ7B 2NVUA 3RUIA 2Q6LA 4MDHA 2VTBB 1K7EB 2AUMA 4INPA 2GPNA 3B6IA 2HIMA 4KSBA 4EKIA 3HO6A 2H2IA 4G4SP 4R16A 2L42A 3SSOA 3S4YA 1GKUB 1KO7A 1SULA 2I3DA 5IVIA 1P9NA 3OKFA 5C5CA 3NEJA 2IOQA 1GGJA 3BK2A 1R8XA 3GUHA 3W5JA 3KCQA 3TN7A 2PUCA 2W90A 3UEOA 3G02A 4IDDA 2HSZA 3IVAA 1HFKA 5B1DA 5CFOA 5C1IA 3AFIA 2WMNB 5F7OA 3H9JA 3PFWO 2QAJA 2FUKA 1WB5A 2BTQB 1RBQA 2Q6KA 4FMDF 4RK4A 1XZJA 3ELWA 4K1XA 1CR6A 1TAGA 2H85A 3FR8A 3VO2A 1B4DA 3T9BA 5L3SB 3L4SO 1K89A 3O9VA 1SUCA 4KO8A 2G04A 3ZWDA 1UK8A 4CZ2A 1JG3A 3SMQA 3TO5A 3LKVA 3PJFA 3UMJA 4BVEA 1LV8A 5GP1A 1PUIA 3WWPA 2EFGA 4MQ5A 2ID9A 3PDJA 1CYDA 3AVOA 3EPPA 5CLHA 2YWRA 5DYNA 3BMCB 4EGCB 4DJJA 2JAQA 4BFUA 1OB5A 8ATCA 1X7YA 4EELA 2BI8A 2CSXA 1SRRA 4GOXA 1N9KA 5FTJA 4LY9A 3LXUX 4HGQA 4NHOA 4UUAA 5HS6A 3VYUB 4YA6A 2ZRHA 4I81A 5E6UA 3ZZTA 4Z49A 2XYRA 2Y4OA 2LWIA 1BH2A 1C0PA 2R8ZA 1CK4A 2ZKIA 4COKA 4MR7B 2C92A 1SKQA 2J5XA 4FD3A 1JZSA 2Z1DA 3KZMA 1UR5A 3OY2A 3C4QA 4NQZA 5JAMA 1DOZA 2GPBA 3SZUA 1AE1A 4GYWA 3N5CA 4O25A 4HEJA 3OZTA 3UWSA 4F3TA 1KC3A 2OXTA 2ZT5A 1NP3A 2DH6A 3EDQA 1ZMXA 3VH1A 2FJ0A 4BIIA 4IMRA 1Q15A 4CIWA 2OHFA 2CB9A 4YEDA 1R8YA 1WXDA 1RYDA 4WNAA 3C6ZA 5TDHA 3ONNA 1YO6A 4C2UA 1G20B 1FRNA 1QKIA 3WZLA 3BSYA 4EARA 5A1TA 3G2MA 3CU5A 4MWZA 3WWEA 3KWLA 4MQUA 2X76A 3H8JA 1YZHA 4B83A 4TT3A 3OQMA 2V6GA 3ZN2A 1ADYA 4NEGA 3SWWA 1O4WA 4BB5A 4BGDA 5AQEA 1U2ZA 3WYNA 1V45E 2VEDA 1Y8QB 1S8AA 4E4RA 1M1UA 1HZZA 1QR2A 1K63A 2YY5A 2E4UA 3SIPA 3KAKA 1K6JA 4KQIA 1PYDA 1HRDA 3FF4A 1Z7YA 1XA3A 4AECA 5AW7A 5JNUA 1Z4IA 4JL8A 2REQA 1I3OA 4YIKA 5A4KA 1JV2B 3GH1A 1J23A 5B1IA 5FPTA 2FPKA 4AY5A 1JR3E 1QE3A 2OZPA 1DJPA 4DR2B 2IH4A 1EFCA 5F4ZA 4BQRA 1KI6B 1ZM7A 2AZTA 4INAA 3NBFA 4JKIA 2H92A 1A69A 1DXYA 2A5DA 1WEKA 3F71A 3O8DA 1DBIA 1T1EA 2G5PA 2Y71A 2O4UX 5IC6A 1SBHA 3T1YB 3DLTA 2PSDA 1JFVA 3JASA 2Q21A 2VWHA 1IONA 3FDZB 4XX0B 3A1UA 3D1JA 3MG9A 5H0IA 4OYLA 1GOTA 3ZXYA 5ALRA 3NDRA 4PCAA 3TFOA 2BEVA 1A97A 3HB9A 4ZQFA 2KLHA 4BMNA 2PKQP 1NUHA 2VJLA 3GV0A 3NOOA 4RKYA 1ZUIA 1JPNA 3SLRA 2JASA 5CLLA 4TLBA 4W6ZA 4BRWA 5LJIA 1ESNA 5BMOA 2O4CA 2Y93A 9ATCA 3T7IA 3JQGA 1X1CA 1R15A 1J1IA 1M8FA 3V8MA 5K8CA 3H1EA 1FP2A 4MR9B 2AMVA 5CGZA 5F76A 4GVLA 1T0IA 1BC5A 1VQ1A 3IMCA 5GWXA 4PTZA 1E3SA 1QZZA 2GYUA 2AEEA 4M1QA 1TVMA 1W2HA 3TXAA 1NNEA 2XQFA 4MCAA 4UBJA 2CV2A 1VE6A 5U4XA 1IM5A 2R8EA 5FOXA 4M9ZA 1TZMA 1YBVA 3OFJA 3ISTA 1LSSA 1R66A 1SJ9A 2I6UA 3JD4A 4GOOD 5K45A 4G1CA 2ZT8A 4IIJB 2FSVA 5TRTA 3G2LA 2G5CA 2PD6A 4ARIA 3H0EA 4UE6A 1M76A 2H1LA 3ZDYB 3MHPA 4A8JA 4R7TA 1O58A 4HDKB 1HTBA 1Y8CA 3C7DB 1IEWA 2IXBA 2PHZA 5EIBD 3Q98A 2IP1A 2QX6A 2VDJA 4O4IB 1P2GA 2BCJQ 4NCKA 4PEVA 1UBFA 4PM4A 3RAGA 4MQMA 2NP7A 2XD9A 1GCGA 4NFSA 5AK3A 2GCOB 3UJPA 3HM9A 1S2DA 3CEAA 3FWKA 4OJKA 1DBQA 1KYVA 1RP1A 3KAJA 2A92A 5D86A 1RLOA 4UAJA 1Q0RA 3DAHA 3DDUA 4F5ZA 2ODEA 2Q41A 5FWDA 4UUMA 5BSKA 4AXXA 1OBFO 4I5FA 1OI4A 2V0NA 4NTZA 2PD4A 2VJMA 2O2XA 2ZAMA 5I51A 3CE6A 2PEZA 4FCVA 4O59O 1GLVA 1I14A 1PAUA 2QJFA 2QQ0A 1Z4MA 2VDRB 2XXBA 3KD2A 3QI2A 4HLUC 1NW9B 2D1RA 5AOVA 3UW1A 4TKVB 4PLWA 4Z7NB 4CDRA 2FF7A 1IY8A 3EYAA 1U3VA 2FA9A 4HQFA 4E5UA 4R31A 5A06A 1KAHA 2OPHA 1IY9A 2JHGA 3OTGA 4L02A 2W00A 3DC2A 4HWRA 4DN6A 4Z1OA 1HG0A 1ZMOA 3IQXA 3LY7A 4Q3LA 4PLTA 3LT4A 1M72A 5BN4B 3WLPA 1ZAYA 3ORRA 4GQBA 2ZATA 2WJPA 4B7XA 3T3EA 2JGFA 4NBKA 4BO6A 2JJ8A 1VB3A 5JZMA 1C3VA 1D4FA 2WM2A 1XMSA 3LK7A 2EZ4A 1QG6A 2ZBDA 1WY7A 3V7YA 5BMVF 1YIOA 4ZEMA 3OFVA 1ZJ6A 3NP9A 2YIMA 4NIMA 1MTZA 2NSLA 2VZEA 1ZESA 2BP7B 4GNRA 4HV4A 1W1UA 4LZJA 5EJ9A 1EWYA 3R7LA 1CJVC 2HSDA 3HJCA 4GMXA 4RW0A 4HYTA 2QYTA 4XUGB 1FFSA 4D8XA 3I64A 3KR1A 3JZMA 2ZUWA 3G89A 4LGVA 1Y5NA 1F2VA 1W47A 4MW7A 3G7SA 3M34A 5BT9A 5LD2B 2AOUB 2BL4A 3T7EA 1HRKA 1QJCA 3UTCA 2EBFX 4B09A 4YRLA 2NTYC 3DZJA 1HMPA 5JSZA 4DPLA 4I55B 2ASVA 3HEAA 4YB8A 5GIOE 5C8YA 1I4OA 1BFDA 3OSZA 1R6UA 3VDQA 3IO3A 2Z58A 4PFJA 2YN4A 1IK4A 3DDCA 3GPIA 4P92A 5JMOA 2VP9A 4JI6B 3T4EA 1YJQA 2I7XA 3WAJA 3OPYI 4ZTBA 1CNEA 4PX5A 1EFPA 2ZB8A 4HQKA 4E4YA 3QGMA 2HDNB 4GRAA 3D3KA 4BQOA 5KMGA 2F9LA 2WAXA 4DIMA 4QYTA 2Z2ZA 5ALZA 1F3LA 1U6IA 3RLIA 4YMHA 2ACWA 5HF5A 2Q50A 4HFNA 4L8VA 2WYIA 3HDTA 3VSAA 1JLMA 5AM3A 3T9AA 1Q1BA 3AKDA 1U8AA 2EWMA 3BEDA 3HUDA 2BI4A 4HEA6 1ZEMA 2G5TA 1WZNA 1A04A 4JITA 1GYQA 3PE3A 4DCGA 1G4UR 5JECA 3MMZA 3OE5A 4BPRA 1YHZA 5E95A 1EM6A 5D7NA 1F60A 2RHGB 2PGJA 2RGWA 3USCS 2XF2A 3OKPA 4I5DA 2WPDD 4F06A 4F0JA 1AHPA 3R09A 4YV0A 5EVJA 5FR2A 2SKEA 5A3QA 3IAFA 2H2GA 2PSHA 1YE8A 3DO6A 4PZ0A 2YVKA 1O87A 2EKQA 3IIJA 5BUQA 4E7PA 1Y1TA 2ZB2A 3SU8A 1NA5A 4F5DA 4D9CA 1HT0A 1NG9A 3VZSA 1OH7A 2O3SA 4QGHA 1GZ5A 3IUYA 1OILA 5KPDA 2HAEA 3MGAA 5I7OA 3DJFA 1M54A 3CR3C 1F4PA 2A9VA 2EEZA 4DIEA 3DTVD 3HXOA 1N2CE 2F9FA 2A9PA 1T4MA 1PS8A 3DLCA 4QTXA 3TVTA 5LQJA 1X0XA 1ULSA 3V4OA 5I7FA 5DM0A 2H1RA 3K5IA 2J6BA 4K9RA 4TV8F 5G4KB 4MHTA 1AA9A 2BONA 1KZ7B 4CQMA 4WOBA 3FJYA 1BWSA 1T5SA 4CNBA 4EHKA 2NO6A 4W5WA 1WV1A 4QRIA 2ZBFA 3GPLA 3BXFA 3MQFA 5I7UA 3IDAA 2PNFA 2JGJA 3T3NA 3PQ5A 1Z13A 2QZ9A 1M2NA 1OXBB 2B8EA 1XVLA 2RIRA 3H5IA 2VF5X 4Q48A 4YP7A 4CIAA 1Z37A 3CINA 4AMZA 4LK3A 3H5AA 3YASA 1OVGA 4BQIA 4DQLA 4FPXA 2PX6A 3H5TA 4MCIA 5AH0A 5HVNA 4CKWA 5DHPA 4UCFA 5L40A 1G9SA 2VBFA 4L72A 2HR1A 1YH3A 4KW7A 4HK4A 1JG1A 1GNVA 4M53A 2C9YA 3BJMA 1HOTA 5K8VA 2EDCA 4R2KA 2FFJA 2YXDA 1XELA 3X44A 2I2DA 5DHRA 4EHBA 4IIGA 1GPJA 2HDWA 1J8MF 4V0KA 4A2CA 4ENQA 4N12A 3HVRA 1IEVA 4UBKA 1V7PC 2G3YA 4U7HA 1HDCA 3GP5A 2ZJBA 3OEED 3I2HA 1L7NA 2XB8A 5CB4A 5JQGA 3RKRA 4E51A 4J75A 3OJOA 1TTQB 5AVXA 1AQYA 4RD2A 5K0GA 1UCFA 1TYCA 5ADWA 1A9PA 1IYZA 5F73A 3WIDA 4UMEA 3VR0A 4A2WA 1I2MA 2AEFA 1OUMA 2CDCA 4KU4A 1LGYA 4J0IA 4UOQA 3R7SA 5LB2A 3OMLA 4HD8A 2DX7A 3O95A 1NJ2A 4R68A 2XW6A 2Q29A 3N8DA 4M8KA 5KUTA 4A03A 5CFMA 4U9UA 1UUFA 2RFLA 4PLVA 1H1LA 3AERA 4HAUA 3PQ4A 1RXWA 3OQOA 1C7FA 4P7BA 4KCGA 4QX6A 3RYFA 3GLIB 2PZGA 1H2FA 4W5QA 2ZDQA 5BSGA 2GJ9A 1YZGA 2GN8A 4FHFA 2WF7A 4IWYA 4PQRA 2HK9A 5CCDA 3S27A 1LPBB 2YJZA 2C77A 4FWIB 2EG5A 2H2FA 1S1MA 3HHPA 4W82A 3L0CA 5KOJB 1OAKA 4W9NC 4YK7A 3WMRA 2Q3BA 1IHPA 4PV7A 1BE8A 1Y1KE 2VOEA 3T7SA 3ZU5A 4FFLA 2GN6A 1ZH2A 2H65A 3KAPA 2VHTA 4QT0A 2V45A 4Y3UA 2CEKA 3DV0A 4RV9A