2SCUA

A detailed description of the structure of succinyl-coa synthetase from escherichia coli
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
286
structure length
285
Chain Sequence
b'SILIDKNTKVICQGFTGSQGTFHSEQAIAYGTKMVGGVTPGKGGTTHLGLPVFNTVREAVAATGATASVIYVPAPFCKDSILEAIDAGIKLIITITEGIPTLDMLTVKVKLDEAGVRMIGPNCPGVITPGECKIGIQPGHIHKPGKVGIVSRSGTLTYEAVKQTTDYGFGQSTCVGIGGDPIPGSNFIDILEMFEKDPQTEAIVMIGEIGGSAEEEAAAYIKEHVTKPVVGYIAGVTAPKGKRMGAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGEALKTV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (SUCCINYL-COA LIGASE)
publication title A detailed structural description of Escherichia coli succinyl-CoA synthetase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase
total genus 105
structure length 285
sequence length 286
chains with identical sequence D
ec nomenclature ec 6.2.1.5: Succinate--CoA ligase (ADP-forming).
pdb deposition date 1998-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00549 Ligase_CoA CoA-ligase
A PF02629 CoA_binding CoA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 2scuA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2scuA01
4NZ9A 4AFNA 5TT1A 1L7EA 3IJRA 3VZRA 3OIFA 4NQZA 3Q3CA 2Y0EA 1JTVA 1DRVA 2CDAA 3AI2A 3DC2A 3PFWO 4PLGA 3BZUA 4FJ0A 4BVAA 1VL8A 3PGXA 4J7UA 4NIMA 1J6UA 3NV9A 3FHLA 3WS7A 3GDGA 3M1AA 2PD4A 1K6JA 4HY3A 3JYNA 5AQ1A 4F3YA 3U9LA 4FJ1A 3WG9A 2VWGA 5GZ6A 3QVOA 1IZ0A 2I67A 4CR6A 4GX5A 3FSRA 4CMIA 1NR1A 4TRJA 2AQKA 4BO6A 4IPTA 4TRRA 4K6CA 3HJAA 3WGYA 4HBGA 3BTOA 3WLEA 1H0KA 4Y6RA 1E5LA 3ZNQA 3ZV3A 4XZ3A 3OECA 2B5WA 3PJEA 3R3SA 1PJQA 4NK5A 4FFOA 2VRCA 1VI2A 4BNIA 4PCVA 2LDXA 5B1YA 1PR9A 1DEHA 1YBVA 4IJKA 2IDZA 4IQGA 2WEKA 1SB9A 4L4SA 4N5LA 1EK6A 3AFMA 3WYEA 5CG2A 3TN7A 3V2UA 3JV7A 2I76A 1GCUA 3PWSA 3U5TA 3AY6A 3MJTA 5JO0A 4D7AA 1NFQA 2C7VA 3B20A 3GN2A 4EUFA 2PK3A 4L76A 2FY8A 3KM0A 1LQTA 1M6HA 3QV1A 1LDEA 4MP3A 3N74A 5BR7A 1XEAA 3H3FA 1Z7EA 3PZRA 1X7HA 3ZN2A 3AUTA 3HDHA 3LF2A 1ORRA 1EFLA 1PU2A 4NJOA 1LRLA 3RC7A 1I2BA 1KVSA 4WLOA 3GN1A 2RCYA 3C7CB 3LZ6A 3GGPA 4HUJA 1A9ZA 4J91A 1DFIA 1CJCA 3KHUA 1Q0LA 2BGMA 3G1TA 2IZ1A 1T2AA 3RC2A 3DR3A 3GG9A 5TT0A 1VSVA 1UDBA 1ZK1A 1I2ZA 5JMWA 3LT2A 4ALNA 4YR9A 4BQPA 1SCUB 2B0JA 4CM1A 1WZIA 1IUKA 2JHGA 4NBRA 4E2XA 4JNKA 4DUPA 3HZZA 3NGXA 3AM3A 1WP4A 3H4VA 2AA3A 3L9XA 3JQFC 5I7FA 1NQ5A 1NAIA 4Y6PA 5JLAA 5H83A 2G0TA 3DBLB 4DMLA 4PLVA 2OBYA 1QR6A 2H63A 1R4MA 3GDOA 2XPCA 4GGPA 5JAMA 1ADGA 2BLLA 4JJGA 1BXZA 4WNCA 4CL8A 4KTVE 3Q2KA 3NEPX 4UEOA 4GX0A 2JCVA 3GLQA 3VC7A 4EEXA 1YQXA 2E82A 4W99A 4M54A 1LQUA 4CQMB 2O50A 1RYEA 3EHEA 2V6MA 3W8EA 2VWQA 4BMVA 3I52A 3H7AA 4DC1A 1F17A 1HL3A 4ND1A 2HCTA 1HEUA 1DBVO 2HK9A 2NQ8A 4J90A 1HDRA 4ND5A 2BFOA 4JN6B 2X22A 2WD7A 4XQEA 3NDJA 2O3RA 2B36A 2H5LA 5DP1A 4E21A 3FTNA 5JCJA 3KEOA 2NU6A 3GR6A 2QZ9A 5ITVA 2BH9A 4ILKA 1ENYA 3LLSA 1P45A 2WDZA 1MG0A 2YV3A 3PJFA 2EJVA 1ZNQO 5JMPA 1YB4A 1W73A 4MKZA 1U1IA 2FSSA 3BTSA 5FYDA 5FF9A 1RKXA 2NUAB 3NT2A 4OOEA 1R37A 4R3WA 1K5HA 4DXHA 1T1RA 2I9PA 4OQYA 4L74A 3D5TA 1U9JA 2CF5A 2Y05A 4NFSA 1NVTA 5BNIA 1E7MA 1N1EA 1UXKA 1I5RA 1E6WA 1BWSA 3N58A 4LRTB 4QX6A 7MDHA 3EGOA 1AE1A 1DO8A 2V7PA 4ESOA 5TRTA 5KJ1A 4AL4A 3DMYA 1SC6A 4RVDA 1U7HA 4KDFA 5CEFA 4YRAA 3DZHA 4CLRB 4A7PA 4XYGA 2DU8A 3GRKA 3I1JA 1K89A 4D0RA 1X15A 3VKUA 1I24A 4HFNA 2VYVD 2X1HA 2Y1OA 1R4NB 1S7CA 1HDZA 2PD6A 3MOIA 3VZQA 3CZRA 4I1IA 5U4QA 2ZIZA 4RO0A 4E2WA 1XSEA 4TZTA 3ZI0A 3RJ5A 4B79A 1ZH8A 3MEQA 5JY6A 4RF5A 2ZQYA 4OO3A 3D4PA 3MOGA 4FR5A 3F3SA 4XQCA 1I8TA 1I10A 5L3ZA 4E4YA 4KMSA 4J0EA 2PV7A 2RIRA 3BA1A 2J3KA 1RJWA 5JE8A 4AJ1A 5F1PA 5A9SA 2VYND 3M2PA 1CYDA 3C3XA 4AJHA 1OC4A 3A1NA 5TQVA 5L4NA 1Z6ZA 1ZCJA 5BT9A 3L07A 9LDBA 3ZHXA 2GASA 1HTBA 2IRWA 1C1XA 3GG2A 4TMFA 3FD8A 1PJ4A 3KSDO 2C0CA 1U3VA 4JXKA 3HB4X 2GO1A 3GC6A 5FI3A 3JYOA 4BKRA 4EJ0A 5G0TA 3PPIA 4DQVA 4GGOA 4Z3KA 3ZGYA 4LGVA 3RSHA 1PJCA 5DOVA 2BI7A 4DPLA 2I5PO 3KB6A 4FSHA 1KETA 2E48A 3TSCA 1UXGA 4UUPA 4YJFA 1UZNA 4II2A 1QV7A 3KVOA 4CLOA 1EVYA 2BHLA 3AUAA 4D45A 1UXJA 4YT2A 4ZN6A 5TS3A 4RPGA 5C5IA 4J0FA 3GPIA 5A9TA 4R4JA 4IJWA 4OM8A 1GCOA 3WSVA 2ZK7A 1PSDA 1V35A 5T57A 4LMRA 4WLNA 2NV6A 4PG7A 2W2LD 1A5ZA 3DO5A 4UUNA 1SEVA 5DCYA 3JQEA 4DBZA 4CMGA 3RFTA 4O5OA 3NYWA 4HNGA 1ZK3A 3K31A 1DB3A 4Z6KA 1ULSA 3DONA 3PHHA 4E32A 3R6DA 3F5SA 2J3IA 3Q9UA 4BB6A 1P77A 1V6AA 3ZDFA 3EY4A 2FPIA 5TX7A 1TT5A 4FOOA 2FN7A 1HWYA 4N54A 1GZ6A 3JQ9A 4CMIB 3WGHA 3FI9A 3H5RA 1Z74A 3OM9A 4MVJG 3TPCA 4J9VA 4MVJM 4NFYA 4G2NA 2QYSA 5K6AC 1J5PA 4J1TA 3NX4A 3IP1A 3UUWA 4J4TA 1QYWA 1LNQA 3DZFA 3E9MA 3BMCA 4R5MA 4CM3A 2ZB8A 4MP6A 5G4KA 1IE3A 4BNUA 1XA0A 4Q3DA 4CV3A 1I36A 4U0KA 1I3NA 2CVOA 3CINA 1KC3A 2GSDA 1GQQA 1UAGA 2JFHA 1X7GA 4KDEA 1R12A 2PWZA 3U62A 3WDSA 1ZK0A 3DHNA 3WX0A 4A2CA 2BF7A 2HO5A 1NTOA 4RLHA 1R16A 3WTCA 1ONOA 3AI1A 4IDBA 1PWZA 1UDAA 4QQRA 3TZ6A 3ROKA 2CD9A 2J5RA 3I6QA 4BNZA 1FXSA 2DFDA 2X0RA 4OQZA 3JTMA 3C1TA 3JQAA 2FPPA 3RI3A 1KEVA 1CRWG 2EXXA 1D4FA 3QP9A 3DWFA 4AJIA 3W4KA 3OH8A 5F1OA 3VPSA 4AJNA 4U5QA 1AHHA 1Y9AA 2BFMA 1KY4A 1YQDA 4IBOA 4IQ8A 1CF2O 1YONA 2IZ0A 1HYHA 5DNAA 3OQ1A 3WXBA 2J3JA 4L73A 5DDIP 2J6IA 4MVJP 1ZIDA 4BO9A 3NJ8A 3U3XA 1MV8A 3CTMA 3B1KA 2VNAA 4WCDA 4LK3A 3EMKA 1CDOA 2HMTA 1IZ9A 2A4KA 3IQDB 3KOUA 1AXEA 4KP7A 1JAYA 3A06A 3OMLA 1GYPA 3PLRA 4YRDA 1J4AA 1R4MB 3IOYA 1IL0A 2Y99A 4DIBA 5THQA 5L4LA 4PZDA 3T4XA 3PFFA 4HFMA 3KRTA 2XOXA 4TZKA 1KIFA 2XXBA 3MJEA 3RIHA 1YL6A 5L51A 3RQSA 3A14A 5A1TA 1CIVA 1U3TA 3JQ7A 3ZWCA 1AN9A 5KVCA 5F5LA 1GADO 4Z9YA 4UEKA 4NR0A 1F0YA 4GVXA 1E3EA 2IXBA 3FN4A 3Q0EA 3AM5A 4W9NA 4NDNE 4XYBA 3I6IA 4F6LA 1T24A 3GUCA 2WD7B 5JS6A 4YT8A 4I9HA 5DZSA 2JD2A 1N1GA 4H15A 5L7TA 1XU7A 4FQ8A 2NU6B 4R9SA 2AQ8A 4ITUA 1ZKMA 2BGKA 2I99A 1G1AA 4HFJA 4OXYA 4PG5A 2ZTMA 4ZD6A 4WLVA 1XR3A 2J5QA 1F8FA 5EL0A 3ENNA 3H3JA 3H5NA 5BNTA 1Z82A 2OXIA 2NQTA 3PVZA 2DBRA 5AXDA 4OSPA 1SZJG 1RM5A 5CHEA 2AEJA 1NHGA 2PZKA 2HUNA 3N7UA 1UH5A 1SAYA 3I23A 5DN9A 2Q2VA 6LDHA 1QORA 3CZMA 4PVCA 5CDSA 3COSA 3ZWOA 4IXWA 1CWUA 4FW8A 3UF0A 2D5AA 3V1YA 3RUCA 2DUUA 2P5YA 2V6BA 1IOLA 4DTIA 4B4WA 4F46A 3NT4A 3RFVA 2DBQA 1EVIA 4GKVA 4IZIA 1T1SA 3INRA 1LRJA 3D4OA 4W7IA 2JKVA 5L95A 1N92A 1B8PA 5JC8A 1PZFA 3SXPA 2D8AA 4JROA 1KYQA 4UAGA 3GAFA 1EEHA 3I83A 1SOVA 4WE3A 1GZ4A 2P9EA 3PTZA 5G0UA 1Y6JA 1GUFA 5CDYA 2X4GA 1PEDA 5ILGA 3BTUA 1E1LA 3WTBA 1BSVA 2XAAA 3WOHA 1PQPA 1E77A 4QTZA 1WPQA 5AXAA 4A27A 4TVBA 3L6DA 3SEFA 4WECA 4XYEA 5KJEA 5JNLA 1T2FA 2Q3EA 4DLLA 1XIVA 3ANMA 1E3IA 2VHYA 2X9NA 3EVNA 5HBRA 2FWMX 4ALIA 4CLEA 2AXQA 2B4QA 1Q7CA 1VL0A 1XLTA 3E82A 5A9SB 5FI5A 4BO0A 1SMKA 2ZTUA 3I3OA 5ES3A 1NFRA 5A5EA 4U0JA 1NXQA 2VUTA 4WEOA 4FFNA 1J0XO 1P1IA 5G0WA 1N2SA 4Y6SA 5KKCA 1C1XB 4J43A 5TGDA 4L75A 1JLLA 2OMEA 1VC2A 3EC7A 3BXXA 2W90A 3OJLA 1EDZA 4HFRA 4YCAA 2EJWA 2O4UX 4R1SA 1QYXA 2GN4A 4BO7A 2AMFA 4OH1A 5KNLA 1SPXA 2X5OA 4DPMA 1JKJA 2J5KA 4F6CA 4ZJUA 2GNAA 2VUUA 1YDWA 3KLMX 3ZWAA 3RC9A 3GF4A 1AHIA 1ZMTA 2Q1SA 4YJFB 2W98A 3UW3A 2WWRA 3PI7A 1ZK4A 3GMDA 4IIVA 2V6GA 1UUFA 4U7WA 4CLOB 1PL8A 3VVBA 5I7EA 4NK4A 1HRDA 3K6JA 3E18A 3TDKA 1K3TA 3IP3A 3R0IA 4I08A 2D3TA 2X23A 1Y9EA 1WLYA 1FDVA 2O3JA 4MIOA 4QFCA 1MP0A 4GWKA 3RUAA 5JSFA 4BNTA 3QY9A 1PS8A 4CJXA 4L0QA 4BO5A 5IXSA 1LC0A 3AU9A 3GZNA 2DVMA 5DBFA 1JA9A 4CMEA 4NH4A 1M6WA 3K30A 4P4NA 4BB5A 1ISGA 1B26A 4R01A 1NQAO 2IEBA 1XQ6A 3GVPA 3QRWA 4XDYA 1WMAA 1PZHA 3WQQA 4CLXA 4KQWA 3JD4A 4IUYA 4HXYA 4CMCA 1TT5B 3VPXA 3ONEA 1U2GA 2HSDA 4NBTA 1SO8A 4BO1A 5L9AA 4E3ZA 3MWDA 4PZEA 1KY5A 4M89A 1N7HA 3EUWA 4IDDA 3GEDA 5G4LA 1A9YA 5H81A 5KKAA 1TB4A 4BNJA 2ZATA 5AOVA 3MTJA 3GGOA 1ADFA 5FFFA 1VLLA 3WGTA 2DPGA 3RUHA 3MJCA 1MXHA 1MX3A 2IYPA 4IQ0A 4BGEA 1DC4A 1F14A 3ZV6A 1H6BA 1KS9A 4CQMD 2GUGA 5LDGA 3WMWA 1E3SA 4DA9A 5IF3A 3BMCB 2B37A 4JP2A 1C0KA 2PKRA 4FPXA 2O7QA 5G4KB 5I7VA 1E1MA 1ENZA 2FR1A 3Q6IA 2WSBA 3DBHA 4E2YA 2HK7A 1CERA 1HXHA 4YAEA 4BNKA 1W8DA 4ROSA 1FDTA 4QXMA 3G49A 3PK0A 2FP4A 4U6SA 4IGEA 4H3VA 1S6YA 4GAEA 1ARZA 2P5UA 3W8FA 4NFHA 2Q1TA 5H82A 1OBFO 2PGJA 4NPCA 4QFDA 3JQBA 3HUDA 3PYMA 3JQAB 8ADHA 2FPPB 1T4DA 1WDLA 2HMUA 3QHAA 1R0SA 1ZUD1 2CVZA 4O1MA 4R9RA 2VN8A 4P22A 3ZH2A 5K0ZA 4BL5A 2E6UX 4B7CA 1PJLA 3OJ0A 4JQCA 1LDNA 4KZPA 2O3QA 2WE8A 3VDQA 1A71A 4D43A 8LDHA 2P9GA 1XQ1A 2PTGA 3F47A 3RAJA 4HWKA 5ENDA 4MVJD 2C5EA 1JWBB 3H65A 5JW6A 2GD1O 4LVUA 1ZEMA 4PLHA 4E13A 1PIWA 1BXGA 1R15A 1VRWA 1NYTA 3B1JA 4CR8A 2G5CA 5DOZA 5KVVA 4OKIA 3AM4A 4EDFA 2PR2A 3E5RA 5EJ2A 1QYCA 3E6AA 1ZVMA 4IDCA 4WKGA 3QWAA 1GQ2A 3ZV5A 3WMXA 1DRWA 3GVXA 3A4VA 3DXFA 4Z9FA 5T5QA 2QZZA 4RLSA 3AK4A 2B4TO 4R3NA 2R00C 4AJOA 4S3MA 1P1HA 1C0PA 1FK8A 4CM9D 3JQ7B 1H5QA 4WEQA 2CZCA 1HLDA 3RJ9A 3UFXA 3M2TA 1X14A 4UVDA 4W4TA 1BDMA 4WJZA 4IY1A 1V9LA 2ZB7A 1GY8A 2Y0CA 5ADHA 2DM6A 2O3UA 1CQJA 2Z1NA 2EP5A 1EUZA 2VZ9A 3KUXA 4BNVA 4IIUA 4GKBA 3TFQA 2FPGA 2FHSA 4CPDA 4PLWA 2PKQO 3GUYA 3HB5X 1ADCA 1O0SA 1T2EA 5KTKA 4RPKA 2NACA 5JXWA 3GQVA 4WOKA 1WZEA 3U4DA 1XYGA 4D79A 4MVJH 3FR8A 4DVJA 2F1KA 1LDYA 1ID1A 4M87A 3U4IA 2AHRA 2LDBA 4MVJE 5HWSA 1KEPA 4JCOA 4PLTA 4WCFA 2YV2A 1PS0A 1MG5A 4JLWA 4R51A 1T26A 4BO3A 4BMNA 1NWHA 5U9CA 2Q49A 3ONFA 3ZU2A 3OA0A 4FCCA 5KOIA 4I5FA 4GL4A 3IKVA 2DQ4A 5JYEA 4Q3EA 4FD3A 4DYVA 4ALLA 3INTA 1EMDA 2H6EA 4J49A 5C7LO 1NQTA 5BSHA 2GZ1A 2PNFA 4XR9A 1BDBA 3ROMA 3HE3A 3D1LA 1SEPA 4ZQHA 5DP2A 4EUEA 1C0IA 3DQPA 3TOXA 3TF5A 3ZHYA 3C24A 3G79A 3E9NA 2PLAA 5EQDA 2PZMA 5JPIA 3RKUA 5TJHA 3O4RA 4DC0A 3GK3A 3ST7A 2HRZA 1DRUA 3TZKA 2VNSA 2YDYA 3PHGA 2QG4A 3WYBA 1WVGA 3TL2A 4PG6A 2PFGA 2P68A 3PDUA 4YJDA 1Y7TA 3KYBA 1KEUA 2VZ0A 3PHLA 4CM5A 5FEUA 4R1NA 3WFIA 3WQSB 4BNYA 3S1LA 1E0DA 3VTZA 2JHFA 3Q11A 3PWKA 3VHRA 1V3UA 3MCVA 3D3EA 2VRCD 1MC5A 1DSSG 1NPYA 4YAIA 4IS3A 1XCBA 1JLLB 4J2OA 4LRSB 4OXKA 2Z5LA 1ZW1A 4GSKA 3RD5A 4MPDA 2YFQA 3NTQA 1JKJB 2VHZA 3ZWWA 1QLJA 2QX7A 2BELA 3M6IA 3LT4A 3E03A 2PZLA 3E9QA 2I3GA 4DWVA 5IAAA 3LVFO 1O9BA 3ICPA 4GPD1 5I8ZA 1ZZEA 3IC5A 1FJHA 4II3A 4QSMA 2DBZA 3FWNA 3GPDG 4IGFA 1IPEA 5AVOA 2HU2A 2GCGA 1E1NA 2RBEA 3ZU4A 5L7YA 3S8MA 1NFFA 1YKFA 2A94A 1LX6A 2A9FA 2C2XA 3P5SA 4R1TA 2QYTA 3GZNB 1O95A 2NWQA 1I33A 1E7RA 3EZYA 3K96A 3AUSA 3D3WA 3HFSA 4BNWA 4CMBA 5ILOA 3CPSA 1HZJA 3F4BA 2JJYA 4XEHA 3WWYA 5EPOA 1R0LA 4RF4A 3H6KA 4HX5A 3ON5A 3DZGA 4Q9NA 4EBFA 3SLGA 5KIAA 1LDGA 2D5CA 4OXNA 5DULA 1BHSA 3HADA 3PWZA 5IG2A 4WK6A 4XD2A 3MWDB 5JDIC 2O3TA 1EQ2A 1GQYA 2OUIA 3NDRA 3H2SA 2OP1A 5ENVA 5CFZA 2YQ4A 3GVIA 1SOWA 1EUCA 1GZ3A 5GY7A 3WFJA 2E4AA 1Y5MA 3F4LA 3AY3A 2CDCA 3K2EA 2G1UA 1YB5A 3K5PA 2P9CA 2FZWA 4JX8A 3ITDA 1DIHA 1NQOA 1W0CA 4K1LA 1IHXA 4CODB 4EUHA 1N8KA 4BKUA 3ZWPA 1QLHA 1NASA 2NTNA 3HDQA 1ISFA 5COQA 1XKQA 2JD0A 3ORFA 4JBGA 4OIMA 4TRMA 3DBHB 1I32A 1YGYA 2P2SA 3VZPA 3DTTA 1YWGO 1XG5A 3OSUA 3OQBA 3RBZA 5JCJD 4CM4A 1E3LA 2AG8A 3HHPA 2ZB4A 2FP4B 4IS2A 4TSKA 5JYDA 3AOEC 3L77A 1TT7A 4MIEA 5EIOA 3GEMA 1P1JA 3LC1O 4YEDA 3TL3A 4DLAA 4DYDA 1X1TA 4ZRNA 1P0CA 2DTXA 5B4TA 2Q99A 4ONEA 3ZHZA 1C14A 1GPJA 2RAFA 1L7DA 1VE9A 2PA3A 4CMJA 4DLBA 4O0LA 2PH5A 5FWNA 3VPGA 4DPKA 4YAKA 2X8LA 1YL7A 3AFNA 3NT5A 4Y8VA 3RU9A 1ZSVA 2X5JO 1Q2XA 3CMCO 3FNFA 3PQFA 2CSUA 1B8UA 4FBGA 4WASA 2UAGA 3K9QO 5HA5A 5IDQA 4CUZA 3RBXA 1BXGB 1J49A 1YBMA 2D4AA 2QIOA 4NMHA 3GEGA 2W2KA 4S1VA 4C7KA 1GD1O 2WYVA 1X7DA 2AW5A 3NGLA 4TKLA 5GZ1A 4HV4A 1NP3A 4HKTA 4I9NA 1HE5A 3KBOA 2UYYA 2SCUA 1G0NA 4YAGA 2AG5A 3JD2A 3KLPX 4RVUA 2HMWA 4TQGA 4XRRA 4BGUA 3L9WA 4XKJA 3SVTA 2Q2WA 2ZCVA 3FCOA 3UFXB 2V65A 1CQIA 2F00A 4OL9A 5T8KC 4GH5A 5IN5A 2AE1A 1YOVA 1LDBA 2BMAA 4RORA 1CQJB 1A4UA 3LDHA 4HP8A 1HE2A 3JQGA 4R5HA 1KOLA 2FPGB 3P2YA 3JQFA 3R3JA 1HSZA 1UR5A 4BV9A 4O6VA 2ZJ1A 1HETA 3CKYA 3ROQA 5LC1A 2EGHA 3EDMA 4PRKA 4DBVO 3UICA 3DZBA 5EQFA 5BQFA 4XGNA 2JCXA 4B4UA 1NPTO 2EV9A 1HYGA 3OJOA 2VTDA 4AJEA 1Z75A 3QWBA 4FIZA 1Y8RA 4P38A 3W8DA 4UEJA 1U8XX 4AJLA 1P31A 2YW9A 3ENKA 4J1SA 2FR8A 1EBFA 5BSFA 3OA2A 5B4UA 3S2FA 2Q4EA 2NNLD 4WCFB 2QQ5A 3OICA 4EITA 4PLYA 4WLUA 1ENPA 3MZ0A 1T4BA 1ZEJA 4KUEA 4J1NA 1TA4A 4ND3A 1A7KA 1PJ3A 1RWBA 2OFPA 4WLEA 3P2OA 4I5GA 3GA0A 5IZCC 4R54A 4CM7A 3ZWVA 2FZEA 5A9RA 1Z45A 3AUUA 4D3DA 1PQUA 2I6TA 3BYZA 4M86A 2JAHA 1QYVA 2UV8A 3G1UA 4H16A 4QT0A 4AJJA 2YYYA 1FMCA 3KYCA 3AI3A 1GYRA 4CMAA 4E5KA 1H94A 3EK2A 1YJQA 3OEWA 3JD0A 1P3DA 5JBIA 1WMBA 1RYDA 4WGGA 3DAFA 2NLOA 4RZIA 4TROA 4W82A 4JGBA 3I9LA 3C1AA 2VWPA 5A3JA 2O7SA 3AJRA 3K92A 5I9MA 1DIBA 1E7YA 2WD8A 1B2LA 2JCYA 3RASA 4XYLA 4LSMA 1WW8A 3W6ZA 3PHIA 4BOYA 4JIGA 4XRGA 3I5MA 4XIYA 4B7XA 1NHWA 1BTOA 1LSOA 1QSGA 3ADOA 4R41A 3DTYA 4HADA 2ZCUA 1L1FA 4MO2A 3T7CA 4E33A 5IDXA 1HF3A 4UVIA 1RPNA 3OETA 4RF2A 1UP4A 5DCUA 5ER6A 3LT0A 4KUHA 2VTEA 1OOEA 3L6OO 2Z1MA 4RVHA 1H2BA 1C0LA 2GN6A 4EI2A 4W7HA 4PVDA 1V3TA 2HKIA 2V6FA 3KYDA 1GV0A 4JBIA 4NI5A 3E1KA 3LLVA 1XWFA 1FF9A 1PS9A 5J23A 5HM8A 4I9UA 1Y5RA 3WICA 1Y8QA 1UAYA 1Z7BA 3GVCA 1GAEO 2Y1CA 3DEYX 3OEYA 4YACA 1ZMOA 5HRUA 3H9EO 1TI7A 2GPTA 1B16A 1YE3A 2BKAA 4K9DA 4XB1A 5I9NA 5G0VA 4GMFA 2I66A 3TRIA 1MFZA 4RPJA 5G0SA 5HS6A 4LMPA 3SJUA 1F06A 1JVSA 2D0IA 2A92A 2DKNA 1SB8A 4CV0A 3D3WB 3L6EA 3I4CA 4XDZA 3DAGA 4UVHA 4CM8A 5A06A 2VT3A 1B7GO 5KJCA 3WNQA 4N5NA 2YQ5A 3WGQA 3CIFA 1I2CA 4KOAA 2OP0A 2YHIA 4FFRA 2HK8A 3ANNA 1TLTA 3FPCA 4ZQGA 1LUAA 1NPDA 2QRLA 3LU1A 4QEDA 2EG9A 3RKRA 1D1SA 1JDJA 1JN0A 2JD1A 1N9GA 3RUDA 3C7DB 2AEFA 1DIRA 4DRYA 4NG5A 3ZNOA 3AOGA 3M1LA 1XELA 2IODA 3IUPA 3TJRA 3W4IA 2QRJA 1EUCB 1LLDA 3FNGA 2PGLA 4LVCA 3DB2A 4ZA2A 4AJKA 2G17A 2OZPA 3X2FA 3KZVA 1NVGA 3NJ4A 4ZGWA 4EEZA 1BG6A 3D4NA 2GDZA 3ULKA 4BO2A 2CMDA 4Y67A 3H9GA 3ETGA 1H2HA 1DOHA 3NAQA 3BHMA 1IPFA 4XJTA 3CMMA 4R16A 2DT5A 3KTDA 1IB6A 3DZIA 4NNJA 3DZKA 1D3AA 1GUZA 3BIOA 3FPLA 2R6JA 4MKXA 1EE9A 4K6FA 4PLPA 3ROPA 4A03A 4BHTA 5L40A 2UUOA 5ICSA 3LT1A 1KVTA 2NTVA 4CM4B 4EGFA 3ETDA 4AJPA 4PLCA 2XF8A 3UAGA 3LYLA 3TWOA 1U3UA 4I5EA 3NTRA 5JCXA 1UDCA 5IJZA 4M8SA 4YRBA 3UHAA 1BW9A 2B35A 1ZXBA 3PEFA 4RZHA 3ZWNA 1BXKA 2VWHA 3WNVA 1GEGA 4EJMA 3WWZA 4YJGA 1Y1PA 5K6AA 3T4EA 3EYWA 1YXMA 1N7GA 1PGQA 2FOIA 1EFKA 1T2DA 1H93A 1A7AA 4WLFA 2X0NA 4YDRA 3DBVO 5C7IO 4BV8A 3P19A 1K6XA 4W6ZA 2VHWA 1X13A 4FFPA 3VTFA 4LCEA 1LEHA 1LLCA 3HQ4O 4M49A 2O23A 3OQ6A 2AQIA 2BD0A 3SLKA 2O3SA 1E7QA 4UREA 4DREA 2O2SA 5F5NA 1D8AA 4CQLA 4FS3A 1KC1A 3WGOA 4QUKA 5KJ6A 2W2KB 5L45A 2P91A 1QG6A 1P33A 3I4FA 2NVBA 3OHSX 1K6IA 4BNMA 3ICCA 2I3AA 1A27A 2DAPA 1JWAB 1QV6A 2GZ2A 3LF1A 4IINA 3DZJA 4RL6A 3WGZA 1PJTA 2X0IA 4E2ZA 2PD3A 2SCUB 4YJHA 1NR7A 2Q50A 5A5FA 1JVBA 4FB5A 2HMSA 2EKLA 2OBNA 4J16A 3CE6A 2EWMA 5K9ZA 3GGGA 2VZ8A 1PL7A 3L4BA 2DPHA 1CETA 1I01A 2X58A 1Z73A 3Q9NA 2PZJA 1CQIB 4IZHA 4YT5A 3OJFA 3GAZA 4FGSA 5EESA 3DMTA 4CLDA 1YOVB 4YPOA 5JAZA 3NKLA 4K28A 3VAZA 3C1OA 1NNUA 3JQGB 3ONDA 3VZSA 1UP6A 1EUDA 4YQZA 3U0BA 9LDTA 2EW8A 4JJFA 1MA0A 4GX2A 4Q3BA 4GWGA 5AXCA 1GYQA 4MKRA 4ZU3A 3RBVA 4B3HA 1I3LA 3HSKA 1Y8RB 4WNIA 1RM0A 2NU7B 2NU8A 2ZKLA 1PZEA 2PY6A 4KUGA 3ZWXA 2ZQZA 1AGNA 2YUTA 3S2EA 2JFGA 5IFLA 2NTJA 3L0DA 2D1YA 3VH2A 3NRCA 3JYPA 4LN1A 1HDCA 3PQEA 4FOSA 3GDFA 3FNHA 4BO8A 3INGA 1PGNA 3WGIA 4NU5A 1YO6A 3BHJA 5DBGA 1ISIA 1WWKA 1IYZA 3SX2A 4R68A 4MVJF 3TZHA 1LSSA 5T67A 1LRKA 1TVEA 4E0BA 1LDMA 1X0XA 1DC6A 1HLPA 4D3SA 4G5HA 2C29D 5BNFA 3KYCB 1ONNA 1E5QA 4N5MA 4Y98A 4IDGA 3BMOA 5DCWA 3D0OA 3DBRA 1NWCA 3FF4A 2EW2A 4NBWA 1RM3A 2BFAA 4A26A 2IYOA 4YVFA 5A04A 4OMUA 4D46A 3W4JA 1P1RA 3AWDA 4OJNA 3JQ9C 3Q2IA 1I3MA 3CSDA 2GZ3A 1E3JA 2YFHA 3S2GA 2DFVA 4XGKA 3ZW8A 1JQBA 2BRUA 4J3FA 4ZRMA 5MDHA 2HJSA 3JCZA 3WJAA 4JK3A 3OF2A 3F5QA 1UZMA 3WSWA 2E49A 4RDHA 5IDWA 2EF1A 3MJVA 1T25A 1WAMA 4C7JA 3VOSA 1OI7A 2Y67A 3V1UA 3QVXA 1WDKA 2NVUA 1SBYA 4EYEA 1ZBQA 3QWHA 3B70A 4D44A 3H9QA 4OAQA 2GN8A 2C82A 2VYVA 3IMFA 2AE2A 3RCBA 5BSEA 3TFOA 2GRAA 5DBIA 5F21A 1VL6A 5TF4A 4BGVA 4GBJA 1ZXLA 4NJMA 2GLXA 5F1KA 5JY1A 4BNLA 3B6ZA 1BGVA 4I5DA 4U6QA 3ZWBA 1JKFA 2WE7A 2HAEA 3O38A 3QIVA 3KYDB 4PN3A 1P9LA 3I9MA 2CDBA 3IAHA 5TIIA 1AXGA 4M1QA 4BNGA 4YBZA 3DFUA 3JQ6A 3PHJA 3L4SO 4GI2A 4ALMA 2P4HX 1Y8QB 1DAPA 2ET6A 3CXRA 3PZBA 3MJ4A 2VYNA 3MTGA 1E92A 1B3RA 2G76A 4I8XA 3HFGA 3WIDA 5IZ4A 2G82A 1A4IA 1OC2A 4QECA 2NU9A 4U8GA 4A73A 2YV1A 2EKQA 3PRJA 3RFXA 1Q0HA 1KVUA 4ND2A 4ALKA 3O8QA 3OP4A 4RGBA 1HYEA 4TVOA 3GH3A 4RVSA 4N7RA 1OMOA 2IEDA 2WMDA 3X2EA 2HRBA 4RPHA 1D1TA 1U3WA 1ZFNA 4CM8B 4PG4A 4PLFA 4LW8A 4GVLA 4FN4A 4E5PA 1VJ1A 4O59O 4J1QA 3ZU3A 2YHIB 1HDOA 3A9WA 5CAEA 3PYLA 3IL2A 3IKTA 4B8ZA 2RH8A 1QP8A 3PQDA 1M67A 2PH3A 3DOCA 4DIOA 5A02A 1H6AA 4J4HA 4Z0TA 4IJVA 4OKNA 1E1KA 1N9GB 3HDYA 1GR0A 3PGJA 4YTEA 3UCXA 4EZBA 3GHYA 2C7GA 2YJZA 2FRDA 4GLOA 2Y66A 1Q7GA 1DHTA 4PZCA 4NBUA 1OAAA 3KSZO 2W2LA 2POQX 3RUFA 4MP8A 1CEQA 3WQRA 4B8WA 5CPBA 5L7WA 4XCVA 3RROA 4EJ6A 1ML3A 4IDFA 4IMPA 3BMNA 4RPLA 2PKQP 4W9NC 3OBBA 3MWEA 3PJGA 4IM7A 1YJ8A 2YHUA 1ADBA 4TKMA 1HDXA 4CL3A 3BMQA 5I9LA 1ZJYA 4BMSA 4WPGA 5JFOA 1O5IA 1YBAA 3K73O 4GQAA 1M76A 3WGGA 1VJTA 5KWEA 7ADHA 2VHVA 3RUIA 3S2IA 1OFGA 4E5YA 1VJ0A 1EZ4A 4YAJA 2R2GA 2Q4BA 2VQ3A 4DQXA 4YXFA 4UVGA 1EDOA 3BTVA 2CNBA 5JDCA 2IZZA 2Q46A 1BW9B 5CDTA 2O4CA 1MXFA 1E3WA 3VPFA 5CEEA 3FR7A 2WYWA 3FTPA 4YJGB 3U49A 1O94A 1JAXA 2OORA 4F45A 1DC5A 2VRBA 3HG7A 3TOZA 1DFHA 1JW9B 5U1PA 3H9UA 4DIFA 4TRNA 3U4HA 1TEHA 4YYZA 2GN9A 2CY0A 4TWRA 5AYVA 1G0OA 3KSUA 3B1FA 5KCZA 2E37A 4OGWA 1LSJA 3VDRA 3GNQA 4CV2A 1GU7A 4CQLB 1M66A 3R1IA 1EQUA 4BNNA 1VKNA 1UJMA 5B4VA 5GZ3A 4BKQA 1DIAA 4JBHA 3HWRA 3UCEA 4AVYA 1YRLA 4PG8A 1PGOA 3ASUA 4Q39A 1GEEA 3LSYA 4FFMA 1HE4A 2UDPA 5C7OO 1BVRA 5JC1A 2AEMA 4BO4A 2B69A 1V0JA 2VUSA 6ADHA 2HDHA 3IJPA 3QE3A 4DQUA 4YJHB 3ZCXA 4XX0A 3QVSA 4RCVA 1MFPA 1PZGA 1GV1A 5JAIA 5CDUA 2VCYA 1T2CA 3JD1A 1UXIA 4IJUA 3HN7A 3C85A 5MGBA 1PWXA 3ETEA 5EERA 3OIGA 4Q3CA 4ZQFA 2EIHA 4Y9DA 3PDJA 3QVWA 4XR4A 2UVDA 4Z0PA 4BS9A 1ISMA 1GL3A 4DGSA 2OHXA 1IHYA 4OOFA 3KETA 3UGKA 3U09A 1PR3A 2X9VA 1VM6A 1Q0QA 3DOOA 1EUDB 4CM6A 2DBVO 5F3RA 5LCXA 3WJ7A 3K2BA 4P4LA 1HDGO 2Z95A 4P8RA 5HTOA 1JKIA 1M75A 2RH4A 1F12A 1WNTA 3GZ4A 4RF3A 4UULA 1ZK2A 5ICMA 4XQGA 1C1DA 4UVEA 1LBEA 3EZLA 4L4XA 5BSGA 4K26A 2HMVA 2Y1GA 1LU9A 4LSWA 2NU8B 3GVHA 4IXTA 1TXGA 2WJPA 2GGSA 3JYLA 1P44A 1R0KA 1ZSYA 2H9IA 2R00A 3IUSA 1U28A 3JYQA 3LK7A 3QVTA 1QYDA 3A28A 4CMHA 2ZYAA 2HQ1A 2J3HA 4RJTA 3ZW9A 4J7XA 1XU9A 3F46A 3BHIA 1YB1A 3IS3A 2DTDA 4L9RA 1DFGA 1GDHA 3V2HA 2X86A 1B15A 1B8VA 1KEWA 4XB2A 1QKIA 2YDXA 4RDIA 5TSDA 3ZNNA 3DL2A 5AXBA 2I65A 5GMOA 4XIJA 1X1EA 3ZWYA 3ZNPA 4CMEC 1U4SA 3S55A 4D42A 2JFFA 1F8GA 2OL4A 4P4GA 1GFSA 5C3MA 4R1UA 1YVEI 1NBOA 1NX6A 2O2YA 4RVGA 3ITKA 5T6BA 1OZAA 1EK5A 3BMOB 1B0AA 3DBRB 2WYUA 3JQ8A 1LJ8A 2H1SA 3ANLA 1LLUA 4MINA 3U4CA 4GLLA 3CUKA 4E5MA 1U2DA 3GFGA 1I3KA 3FNEA 3P7MA 2OOSA 2J8ZA 2Y93A 4YQYA 4E30A 1XDWA 3WBBA 2EKPA 3O03A 1GPDG 2ZYGA 4NBVA 3G17A 1ISJA 4A5OA 5B37A 1YQGA 4FGWA 2EP7A 4N18A 3O26A 3TZCA 4XQ9A 4RVFA 3KEQA 2ILTA 3ADPA 4XYMA 1KERA 4MJLA 4B4OA 2CFCA 2FSVA 2NU7A 2QHXA 3CH6A 4KQXA 5EINA 1DJNA 2NVUB 1JU9A 1H9AA 4AJ4A 2DLDA 2P4QA 5DT9A 4B3IA 5A4DA 1U5CA 4ZQEA 4E6PA 3E8XA 3BAZA 3FWZA 1YH3A 4RV9A 1I30A 2DTEA 4AJ2A 3PP8A 1BRMA 3F1KA 5A05A 5G2OA 3L4BC 1GUYA 4NJMB 1YS4A 1VSUA 4URFA 5LDHA 2D2IA 2A35A 1QMGA 2B5VA 1K2WA 2JAPA 3GFBA 4ND4A 4E5NA 3SJ7A 3NUGA 2VOEA 1O8CA 4J6FA 5THKA 2UUPA 3DMTC 3HN2A 1C3VA 2RHCA 4G81A 4PIVA 1I0ZA 2X9GA 3JQBC 4M55A 4OSOA 2C5AA 3PIIA 3WLFA 4XA8A 5I7SA 4NHEA 1PJSA 2RHRA 3QWIA 2DC1A 3GOHA 3W6UA 5DF1A 3DHYA 5IN4A 3C8MA 3EW7A 2GR9A 3PIDA 3PYXA 2X6TA 3D7LA 2Y68A 1DJQA 4L8VA 1HT0A 2YY7A 3VH3A 4DMMA 2NU9B 4YT4A 1GTMA 3AW9A 4XGIA 1FDSA 2BI8A 2CF6A 4D41A 4ID9A 4X54A 1ULUA 4XWYA 5ITWA 4GSLA 1MLDA 3O8QB 3NTOA 4MDHA 3VH1A 4FC7A 3LC7O 2W4QA 2X5KO 1K0UA 4YWJA 1RM4A 1ZJZA 5B12A 4B7UA 1HE3A 3F9IA 2ZTLA 1DAOA 3QSGA 4J7CA 3TNLA 3UN1A 4WUVA 3G3EA 1E6EA 3SBOA 1HDYA 5CAEB 1R66A 4INAA 4PLZA 1H6DA 3GMSA 4D0SA 2EERA 1ZSNA 1VPDA 2B4RO 1U8FO 2EHDA 4RQUA 1LTHR 3OIDA 2VHXA 1B3BA 2IE0A 4MVJI 4LISA 4DL9A 2TMGA 4XJSA 3DFZA 4ALJA 3UOGA 2ZB3A 3KV3O 3GNTA 1IULA 3DOJA 4UUMA 1LLQA 1H6CA 4CLHA 5L53A 3ZZNA 1ZO8A 4ZQBA 1PL6A 2NM0A 2Q1UA 5JO9A 2Q1WA 3H9JA 2Q2QA 1EE2A 1AUPA 1UP7A 3JQCA 3W1VA 3NDIA 2Y0DA 1SCUA 2ZJ0A 1PQWA 2QW8A 1O6ZA 2CVQA 4YA6A 3BMNB 1PJBA 5IXYA 1DIGA 1QRRA 3MWEB 3QW2A 2NVWA 1H9BA 3GT0A 2Y1DA 3QA9A 1EVJA 4BUCA 1E6UA 1P0FA 3JQAD 1FDWA 3BMQB 3QJ5A 4KTTE 2C20A 5JAQA 4CR7A 1PGJA 4AG3A 3PJDA 4Z0HO 1DXYA 1XHLA 2TMDA 1VKOA 3DBLA 5HS4A 1BMDA 1G6KA 3DAPA 3AY7A 3TZQA 3D5QA 4QO7A 1U7TA 1X0VA 2OGUA 2OO5A 4ZVVA 4OYRA 1WXDA 3G0OA 5JDIA 4L4RA 5CP8A 1YL5A 4JJIA 2BGLA 2NADA 4UUOA 4A0SA 5CDGA 3VVCA 3VH4A 3PLNA 1N5DA 1E3WB 4WCFC 4CQMA 5TNXA 4NU6A 3V8BA 2GYYA 4FDAA 1DHRA 4BGIA 1P1FA 3K8ZA 3F1LA 3JQDA 1B14A 2ZTVA 3LQFA 3DHEA 4YB8A 3T7EA 3KO8A 1PX0A 3RU7A 3UKOA 1EVZA 5A3VA 2AQHA 2PGDA 5EN4A 5KVSA 1MB4A 3DDNA 1O89A 4MOWA 2IXAA 3AU8A 1LXCA 4PGFA 4BKPA 3I9KA 4FFLA 2NSDA 4GX1A 3STHA 3EAGA 5T64A 2YZ7A 4CV1A 4FJ2A 3UH1A 3MJSA 3E48A 3WYCA 3FBTA 1QXSA 3IIEA 3UVEA 4MIYA 4E31A 2CUKA 3CEAA 4O63O 1PTJA 1LA2A 3ASVA 1FDUA 1MGOA 4IDAA 2W8ZA 5A03A 3AOEA 4ZHSA 3O9ZA 4Q3AA 3GNSA 2NUAA 1EBUA 3VKVA 4PRLA 1W4ZA 4HNHA 5IDYA 1ISHA 4LCJA 3V1TC 2C07A 1V3VA 4CUKA 5L4SA 1UZLA 1U5AA 3QQPA 5KJFA 3OFSA 3WIEA 1HZZA 4B3JA 2C2YA 1D7OA 4XX0B 2EEZA 3F6YA 4R69A 4B4VA 2FR0A 2D59A 3ABIA 3TQHA 5COAA 5TC4A 2GERA 5TLSA 2JL1A 2GF2A 4MVJA 4QO8A 3PXXA 1W6UA 2C54A 2Q45A 1A72A 1HSOA 2Y1FA 3HNPA 4ZICA 3ZWMA 2B83A 1DPGA 4KWHA 3I9NA 4CLRA 1XGKA 1HKUA 4J4BA 1V8BA 2FMUA 2EGGA 3JSAA 1DLIA 3RWBA 3UCFA 3SC4A 1Q7BA 2QRKA 5ER9A 5CG1A 3ZU5A 1R4NA 1KBZA 1NM5A 4KWIA 4C4OA 4EW6A 2XXJA 5EMHA 3FBGA 1E7SA 1MC4A 4G65A 5CPFA 1C1DB 1LSUA 2HJRA 4BQRA 4H7PA 2BFPA 2WTBA 3WBFA 4FC6A 3IDSA 3HDJA 3RVDA 2X7HA 4D3FA 5C37A 1WDMA 4CMKA 4IDEA 3ZHBA 4CM9A 2VOJA 4PFJA 5TJ9A 1E7WA 1KVRA 1U4OA 1DDOA 1UXHA 5CEJA 1PJ2A 2HLPA 1ONPA 3LC2O 4RQTA 4BNFA 4JP3A 4A10A 5T8KA 2FPIB 1DC3A 1YDEA 2ZYDA 2Y1EA 3H5AA 4AICA 1BVUA 5I8WA 4OHUA 2DUWA 3RUEA 5JDCC 3GY0A 3FRJA 4Z9XA 4BNHA 3V5NA 1P1KA 4E12A 1NVMB 2VT2A 1ENOA 3D64A 3VPHA 3GHHA 2X0JA 5COBA 3KXDA 3E5MA 1DLJA 1LI4A 3EVTA 4IMRA 4Q3NA 3Q1LA 3JQ8B 3OJEA 3QWFA 1R6DA 3H2ZA 4GMGA 2C59A 3SC6A 4BNXA 4J2HA 1IY8A 3I9JA 3WB9A 2O48X 3QLJA 1Y81A 2WM3A 4BIIA 3I9OA 1SNYA 4J9UE 5KVQA 4WOJA 3V2GA 4CUJA 1NAHA 1P74A 1PGPA 1M2WA 3UXYA 1Q1NA 3JD3A 4BKOA 3C7AA 5IZCA 3H8VA 1LC3A 3RC1A 3GRPA 4Z3DA 1MUUA 3WR5A 3ZV4A 1KVQA
chains in the Genus database with same CATH superfamily
1GG8A 3TMAA 5D86A 5TT1A 3V33A 1TZKA 2WMOB 3ZUGA 3ZIUA 4NQZA 2PSHA 2Y0EA 3ETCA 1DRVA 3DFFA 1FUEA 4PLGA 5CK4A 3RKSA 4RMGA 3ZS8A 3MMZA 3DT6A 1GP2A 4LJ8A 1VL8A 4FI3C 4Z4QA 1YJCA 3NB0A 3K9BA 3GDGA 1MORA 3M1AA 4DCTA 5BVHA 4HY3A 1B00A 2QY6A 3Q7SA 4GYJA 4QXQA 3U9LA 2VWGA 4KJXA 3K0FB 5GZ6A 2C2KA 4YMLA 3NUZA 1DJLA 2WNSA 4MB0A 4RLFA 5IUKC 4V1CI 1PFGA 3R6GA 4IDQA 2FLVA 4BO6A 2PCJA 2R1ZA 1KYVA 4IPTA 3B89A 1ECJA 4OHRA 3R0QA 1RT9A 4JP8A 4TRRA 4YP9A 3CNOA 2CXNA 2G80A 2VJMB 2I0FA 3QU7A 4K2HA 3R6LA 4MV5A 4WBNB 3CVVA 3DOIA 3ZNQA 2PFSA 3OJXA 1U2SA 3R3SA 3ZV3A 1USVA 1SGWA 3LUKA 3PJEA 1QH9A 1CUHA 1LBSA 3DMRA 2QE6A 2GZDA 5L3QB 4J3JA 1MABB 3QJGA 5DNDA 3RVSA 2KW5A 1Q50A 3CX6A 1B41A 4LNUB 5EE3A 4NJEA 2LDXA 3RSGA 4ZANA 3KJGA 1YBVA 4IJKA 5EGSA 3ZCQA 4UNRA 4IQGA 2WEKA 3T5PA 3KQUA 2Z2IA 4P7KA 1BOOA 2VTBA 1ICEA 3WYEA 5CG2A 4YP7A 1ABBA 4IXNA 1Y34E 2R87A 3EGXB 3LRPA 3ZXYA 3U5TA 4REQB 5HKOA 3UYLA 1RIFA 4NCXA 3K5IA 3B20A 3GN2A 1IHOA 2IF0A 4RHFA 3P9SA 5CT6A 1M6HA 5D3KA 5E3IA 4N3BA 3TRDA 1OLXA 1XEAA 2P77A 3I8SA 5IJ9B 3SU8A 1KQNA 3VYRB 1LRLA 3OZCA 4DRXB 1QYIA 3QW4B 3EXFA 1S2MA 5EPEA 1PE0A 2VVTA 2WZCA 3GN1A 2D06A 3GGPA 4G0QA 2HM7A 3ZPXA 1Q0LA 3G5MA 2REOA 5MFPA 3UAVA 3GJ3A 4A5SA 4EP1A 5TT0A 2YVUA 1QFMA 1VSVA 2C0PA 4JQOA 1UDBA 2IIPA 3RAGA 3LT2A 1MQ9A 1PJZA 2VEDA 2FMKA 1I1NA 2B0JA 3MF4A 5P8WA 1IUKA 3CZAA 3M3HA 2JHGA 4DUPA 1H1LB 3WRWA 3NGXA 2EFHB 1YR8A 1OGJA 1XD8A 1R18A 3GRFA 1MBZA 4S0ZA 4BP3A 5I7FA 2AMJA 3C15C 2ZLBA 2GBFA 1HOTA 4A2WA 3B6EA 1S3IA 2UZ1A 3EOAI 3BCHA 5B3LA 3B12A 3L92A 3DBLB 4DMLA 2AVNA 5BYAA 5IS2A 3VUEA 2XPCA 2CLSA 4GGPA 4R2HA 3CWZA 1FNBA 1X38A 2BLLA 1DCMA 4JJGA 1OFVA 3UK7A 4ZFNA 1M1YA 3PEWA 2IV7A 2N3ZA 2WF8A 4KTVE 4Y9UA 5EWMA 3Q2KA 4GX0A 3SC2A 1XEXB 4F56A 3UJ3X 2D2VA 1DBPA 2QVZX 3AEQA 2V0CA 4DM4A 1KI6A 1YQXA 4CT5A 2GARA 3BWDD 1CB0A 5B3KA 1H9CA 1F2UB 5DEIA 1NMSA 2O50A 4D8YA 4XSGA 3W8EA 4V1CA 5JAOA 3VR6H 3PQ4A 2VA9A 2CYAA 5KZMB 4BWFB 2JIRA 4BMOB 2R751 3ORSA 2C94A 2AOVA 2FX5A 3K9WA 4FT2A 2I62A 4UOZA 2HK9A 3CG4A 2RIPA 2VH1A 1HDRA 3OLXA 3R3UA 4OD0A 4RHUA 1OX6A 3FKQA 2FWIA 4BEVA 2A30A 2IOFA 3NDJA 4WBSA 2ATXA 4E08A 2B94A 3B85A 3KEFA 3AVQA 4KRYA 4O4JB 5JCOA 5JCJA 3EXHC 4JVLA 4LE2A 5CXSA 5E6UB 4F9EA 1EX9A 3KEOA 3V1MA 3OIUA 4IR7A 1YB2A 5KNBH 3LLSA 3D43A 2PTHA 3W3AD 2WDZA 2HCRA 2WJJA 2PGAA 5CD1A 2EJVA 2NP7A 2MYNA 3G5LA 4F9TA 1EB9A 4Q7LA 1Z4JA 3EAFA 4BN5A 1U9IC 5FYDA 3T5GA 4QJ3A 3NT2A 4KN5A 5FPTA 2ZBUA 4WVFA 4JJZA 5JQGF 3K0HA 3D8UA 4B80A 2IV3A 2Q2NA 1VE7A 2ES4A 1N6IA 5IAJA 4L74A 2CF5A 3B3QA 4MEBA 4I1RA 4BFTA 4ZI2A 5BNIA 1M2OA 5FPQA 4RHEA 5FJIA 3IQXA 3TRJA 1YDHA 3C3KA 1DIOB 4YI3A 2R86A 4EMBA 4LRTB 1PD0A 1LD3A 2Z9DA 1W1WA 7MDHA 3C87A 3EGOA 1DO8A 2H5IA 4ESOA 4DSTA 2D1FA 2H2IA 1VG8A 1WABA 4RTOA 1GZ7A 1SC6A 3FNBA 4QGHA 3R7SA 1P4GA 3ZTTA 5EUQB 5CIYA 4HYQA 1TVKB 3WA7A 2RI1A 3WK7A 3NVDA 4BFCA 4DMFA 1FTYA 2GHRA 3GRKA 1M0TA 1K89A 1MX1A 1D07A 2HRCA 3WK9A 2XB6A 3ZY3A 4L0DA 4GQIA 4G26A 4KXNA 2D6FA 3EPJA 1I24A 4K9RA 1CW2B 1NBMD 1SKUA 3FMOB 3K9NA 4D3ZA 2OD2A 3MPUA 4ZDJA 4HYYA 1HDZA 5GV8A 4JI2B 1KDYA 1T6YA 3HUEA 3O21A 3GMIA 1DWPA 2LNDA 3P9XA 3TCKA 5FYQA 1SK8A 3FZEA 2P4SA 3RJ5A 1WIWA 1ZH8A 3OQIA 5I7WA 2OESA 3DXZA 4TLCA 2EJBA 1CR1A 4DM7A 4RF5A 2ZQYA 2C1ZA 3D7NA 4XDGA 5BUZA 5HUQA 5KOHA 4FR5A 2BH2A 4FE3A 1PK9A 3QOYA 5L3ZA 4DCJA 3JU3A 1Y3BE 2YUIA 4PV7A 1GARA 2PV7A 2RIRA 3BA1A 2GBLC 1RJWA 1X7XB 2IT1A 4WNYA 5JE8A 4AJ1A 5K0FA 5CB8A 1ZJ4A 2V9ZA 4RNCA 1CYDA 4NOKA 4D9JA 1GNLA 5K45A 2GN0A 2K4MA 4AJHA 4ZGGA 5BXQC 3CTPA 5L4NA 1ZCJA 3A3YA 4P7BA 4NOMA 1TEZA 1BX0A 1US8B 4DV5B 1I2DA 5EFOA 4CDNA 3KSDO 1TU4A 2C0CA 1L5ZA 1A2OA 3HB4X 4JXKA 1R00A 3GLIB 1KK2A 3EMDA 2G25A 2IHNA 1YZYA 1F2TA 1UKCA 3PPIA 5SZJA 3LPMA 3RS8A 3ZGYA 3GFTA 3L1KA 5EHIA 3EWAA 2BI7A 2E4YA 1AQNA 2I5PO 4KJZA 1T3HA 4Z1MD 3Q8KA 3AB7A 3LY8A 4FEAA 3TSCA 2QBYA 2RK6A 5B6IA 1AK2A 1W0JA 4MO9A 1UZNA 1I3OA 4RIFA 1VMEA 4U7TB 3WJ2A 4Q6WA 5BR8B 1C1YA 1YI8A 2TMKA 3A7EA 4Y2UA 1K8YB 5KNCA 5TARA 4CLOA 1O03A 2ZYVX 4YV7A 4YT2A 2GHIA 3D4IA 2YC4C 4F96A 1NVUQ 4ZN6A 1W0KA 1ZG3A 2HDOA 1ZUIA 3PE3A 4B40A 4NABA 1F5NA 3D6HA 3VZDA 3GPIA 4BRWA 3GCZA 5CW1A 4ER3A 1GCOA 3QBEA 2ZK7A 4QUDA 1F6BA 1QB8A 2DQKA 3B9RA 3UPDA 4AMUA 1CZOA 1NBME 1QWSA 3RYHB 4LOKA 1O97C 5HCIA 3UH0A 3N8HA 5KSOA 3GP8A 2C31A 1G6OA 1A5ZA 3UMSA 1FZQA 1SEVA 1KZGB 1JDBC 2QTRA 3JQEA 3RARA 3F73A 4LJRA 3IGFA 1KTIA 4UPEA 4O5OA 3VV2A 3K31A 4TVKA 5LOVF 2CUNA 1ZD4A 1ULSA 1KJIA 3DONA 3ENVA 4DXDA 3VA7A 4E32A 3LXMA 3UM9A 2LWIA 4BB6A 3NWPA 2W43A 4G9BA 2MOKA 3C4QA 4FOOA 5DNEA 3WBKA 4HBZA 5H5JA 1T8YA 2B2CA 1HWYA 2G6BA 3VNUA 2JK0A 2VJKA 3AUFA 1CJVC 4UBJA 4XOIA 2FMHA 3JQ9A 4MGKR 4LJ7A 4MQ4A 1J90A 2NUBA 4UCXA 4H18A 2XNJA 4OTZA 3U37A 5F4BA 3N2KA 4X1IB 4K8OA 3I53A 4KSBA 2BSQA 1TCBA 3CNHA 2OSVA 4NMWA 5DYYA 1MV5A 1GTSA 4MVJM 1HQKA 2KQUA 3CKKA 4UD6A 5K6AC 1G20A 1Z0UA 1ZGZA 1Q2UA 2IPXA 3IP1A 2G63A 4RMHA 3UUWA 4J4TA 3SEZA 2QLFA 1QYWA 1GR1A 1LNQA 1O94D 1E89A 2PG3A 4A91A 2GSWA 3KCNA 1IE3A 3PENA 3IA7A 2X0KA 4J0GA 4K6OA 4CV3A 3UQZA 1TW3A 5AKHA 3BZWA 4U0KA 1I3NA 2CVOA 3CINA 3ID6C 3V8RA 1WBBA 3KP1A 2CEAA 2O8FA 3HVIA 3QEKA 3TOCA 1X7GA 2CBXA 4KDEA 3H1AA 1DEXA 1CD5A 1PV1A 2OAEA 1JSLA 2BF7A 2COKA 1NTOA 2HO5A 3AEUA 4Y6LA 3WX0A 2XKJE 3H2HA 3AI1A 3G7SA 3GQBA 1VXOA 1UDAA 4JI3B 3TZ6A 1JEDA 4Y2QA 3RIXA 4KGDA 4NZNA 2CXUA 2G0NA 2NX2A 1SIOA 4OQZA 3MSXA 4RTMA 2C4TA 4AW9A 4WFJA 1VPTA 2CXXA 4EI8A 2DZDA 3PGA1 4P54A 1QP4A 4NZPA 2EXXA 2X2PA 3I28A 5HDBB 2CHEA 4BEWA 5K03A 3OQMA 3MRVA 2J9ZB 1ZGGA 5F1OA 4BWVA 4GZLA 2QX4A 1OWLA 1ZM3A 121PA 2WV9A 2ZWAA 2C04A 2B1GA 3N07A 4MHOA 1CF2O 3MS2A 1BQ4A 5BWOA 1ZPDA 1X7WB 2IZ0A 3UW1A 2P0AA 1HYHA 3D3KA 4KSCA 3OQ1A 3G2KA 5FOVA 3OPXA 4UUAA 1FE8A 3IEPA 3IUBA 4LYFA 3W5UA 2FX3A 1F1BA 2W6JD 5DDIP 4B8YA 2J6IA 4BO9A 2RGYA 3RE1A 2HR1A 3U3XA 3CTMA 2FMFA 3F6RA 2VNAA 3UGTA 4DQDA 5AI5A 3EGVA 4PYOA 3EMKA 1MNQA 2QQGA 1TL7C 1U9ZA 2ZVPX 3DV0A 3W2IA 1IZ9A 2A4KA 2HSZA 3IQDB 3K2IA 4WINA 2WTMA 2X0DA 2ZUUA 5A2GA 1GGEA 3EVZA 5ALVA 3U48A 4TSFA 1KL7A 3E0XA 1NI5A 3P9CA 2OCPA 3ZGXA 1M1UA 1J4AA 3IOYA 1YFJA 3WL5A 2UXCB 2ZWPA 5AI8A 4C0BA 1JQDA 1YVRA 2H7XA 3GFRA 4KXVA 3OSZA 9ABPA 1B0PA 3MG9A 4GXRA 4EA9A 4YCBA 5L51A 4X1OA 1FVOA 2X40A 3A14A 1UBSB 2XQJA 1OXBB 1CIVA 3JQ7A 1VCIA 4Q15A 3BULA 1T5TA 4OI0A 2JBHA 3E9YA 2ORYA 3M33A 1IPHA 4UEKA 2W0MA 1V4NA 4MLPA 2QLJA 4GVXA 4R2WA 1RYHA 3FN4A 3Q0EA 3AM5A 4DQ0A 2A1UA 5E1MA 2KBEA 1N25A 5LKAA 2YFKA 3L8CA 4UNNA 3VNBA 1M2HA 1TIBA 1Y80A 2WD7B 1E66A 5EIBC 4PAWA 3ZR4B 4OSEA 2JD2A 3KHTA 4F4DA 3BB1A 5JSYA 5L7TA 4RTSA 2QTAA 4A8JB 3O92A 1H4SA 4ITUA 1ZKMA 2I99A 4HFJA 4I9GA 4PG5A 4D4LA 4LGYA 1SUFA 2YJ6A 2PKWA 3HLKA 4JLNA 3CVJA 4LX8A 3UJ6A 1F8FA 3ZLBA 1R8SA 1MJGM 1Z6TA 1NW5A 2OXIA 4BP1A 4AMBA 3N0XA 2A88A 2XGOA 4CU5A 1XL1A 2ZUEA 2XWSA 4MRAA 2G9NA 2X76A 1NHGA 3A25A 4G1UC 1D0IA 3CUSA 5JU6A 1AMNA 3G9ZA 3H05A 3I23A 5DGTA 5DN9A 5BQXA 3AIKA 2OO7A 1TVMA 2E1RA 4OB7A 1Z3CA 3ER9A 1A50B 3V2IA 1T6NA 3JATB 1OREA 2BRUC 3VYUB 3S8EA 2BFCA 3UF0A 1XQYA 2D5AA 1ZOOA 1ZGBA 1BEZA 2V6BA 4P53A 3SIRA 1KJZA 3QU4A 3WLJA 5BMVF 2FZKA 4GKVA 5K0BA 1PZNA 4OHYA 2JAWA 3INRA 1P91A 1W2WB 1LRJA 1MO2A 4MLZA 4NCJA 2MJLA 4W7IA 5EWJB 5FWYA 2N75A 3T3EA 4L50A 3ZVMA 2F3QA 1OV4A 4K9PA 5L95A 3UKDA 2D8AA 1Y3HA 3BWCA 2YRFA 4QUEA 4WUTA 5EKUA 3FUTA 4GM4A 3BFKA 1EFVB 4HX9A 1F7VA 1UMDA 5FBVB 3L2OB 2FZ4A 4D97A 2O1SA 1SOVA 3KAPA 4US0R 2ERYA 2OXFA 4Y2TA 5FOUA 2DT8A 4HUTA 3OZIA 4BXOB 1GZ4A 1TNDA 4DEVA 1SVIA 1ZL0A 2A1TR 3FMPB 3OM1A 1GUFA 1WCIA 2OD9A 2QD1A 4MZXA 1J2JA 3TMKA 3VJKA 1FZTA 2ID7A 4AZTA 1CVRA 1BSVA 2W6PA 4MWTA 2BTOA 5GQSA 1PQPA 1YRAA 2RHTA 3FXAA 4QTZA 5AXAA 3WOHA 4EHBA 3L6DA 4QDOA 4WECA 4XYEA 5CYPA 4UHHA 1T2FA 1DAKA 2QA5A 2Q3EA 3OCYA 5AJWA 4DLLA 2XXAB 2L42A 3PCXA 4P0PB 1EFRA 4B82A 1E3IA 4UKDA 2IU6A 1CKEA 3ILXA 3K2QA 4MQ6A 3H1PA 2B4QA 2F3UA 1EG2A 4MJXA 2DWUA 1O87A 1EDBA 1VL0A 3B5IA 4CRWB 3WDKA 5FI5A 4BO0A 1HRKA 1CY8A 2OTCA 5ES3A 3RUPA 1NFRA 3C6XA 3IA2A 3QEJA 1J70A 1YZFA 3IELA 4U0JA 4HB2A 4X84A 4WEOA 2B92A 2RARA 4RFVA 2PZAA 4G1MB 4KO4S 4Y1RA 2P0YA 1C1XB 4EY7A 4J43A 1LBHA 1M7GA 4C29A 2YBDA 1VC2A 3EC7A 4HFRA 1PR5A 4RGQA 1ZJ5A 2HQBA 2GFIA 3PA6A 1P2BA 2GN4A 2AMFA 2GEDA 3NOVA 5EZYF 4AZ0A 1ORHA 5KNLA 1K75A 1IG0A 2PSDA 4HDNA 5IMBA 4M1YA 5DYGA 3H04A 1VGRA 4R9VA 2C03A 1FS6A 4KBGA 3KLMX 3P2KA 4PX5A 1DV2A 3G5TA 5C4IA 4B09A 2JK1A 3GF4A 2A9RA 4KQIA 1KSJA 3G6WA 4DV2B 2RK4A 4YJFB 3R0VA 5JD3A 2W98A 2YZ2A 3PI7A 1QRSA 4FW9A 3GMDA 1T9GR 4EECA 5A5GA 3SJZA 1K8XB 4K5QA 4U7WA 5F73A 5I7EA 3LV8A 3S2EA 5T7BA 1JR2A 3FDXA 3FI0A 4L6AA 2HA7A 1EXWA 3FYUA 5DB4A 4B46A 3P52A 4J2TA 1K3TA 5KTOA 4TWZA 1XNHA 2AK2A 4I08A 3R0IA 4U9UA 4OQDA 5HS6A 1WLYA 3I8OA 3CZQA 2A9JA 3CZCA 4YLEA 4BB0A 1R0YA 4ZAFA 5JSFA 1T9CA 2A0KA 3IAM1 4H1HA 3SD7A 3BJEA 1L4BA 1JFFA 1LC0A 2RG1A 2X1VA 3GZNA 2DVMA 3L79A 4OI1A 3K70C 1QX3A 4C7OA 3K0AA 1U9YA 3UMRA 4BE7B 4LQ4A 3RT7A 4P4NA 3QVMA 3T5AA 3HKCA 4R01A 2ZUSA 1HORA 1XQ6A 1LX7A 3GNLA 1OJ7A 2QXUA 1COZA 2Q0SA 3HV0A 2ONYA 5F78A 3JD4A 2PJZA 2AFIE 2H9YA 4HXYA 1TT5B 1E9DA 4KVAA 4Y1EA 2HSDA 3R5KA 4KPEC 1FC0A 1SO8A 5CIQA 1WXQA 2C5GA 5HDQA 2PVCA 4PZEA 1KY5A 1N2OA 5I9TA 5TMDA 1U4NA 2ZT7A 2C7RA 1L1EA 1O6CA 5KKAA 1RYFA 1RYYA 4DA6A 2ZATA 4LFBB 1R7RA 5CVEA 3PQCA 2PRYA 4ZYYA 3MTQA 3MTJA 3CLSC 4FFSA 1ADFA 4UM8B 1VLLA 5FFFA 4E1AA 2GM4A 2DPGA 3K8QA 1HYBA 3FHCB 1JJ7A 4G5OA 4IO1A 4H7FA 3I0NA 4Z8XA 2PX4A 2DCUA 2R62A 3LWDA 1JDVA 1ZA1A 3ZEIA 4BGEA 1L5LA 1DC4A 5LZ9A 1KS9A 1R64A 1QJ4A 5LYJF 1TK3A 4PSKA 4N47A 3WMWA 3BMCB 3GJ7A 2GPBA 2PYZA 1C0KA 2PKRA 4JP2A 2W6IA 1GA4A 1QC5A 5HW0A 5G4KB 4DN6A 2OZKA 1ENZA 4WI1A 2INGX 3NHZA 2PUDA 4PE5B 1G21B 1S9HA 3OOSA 2BKUA 3W77A 1ABEA 1K0FA 3GXOA 1RE1A 3VKGA 4YRQA 4EX6A 4M37A 1G8SA 1KORA 2VF8A 3BHNA 3U4GA 4HH4A 4QRHA 4E15A 1CERA 1HXHA 5IX8A 3FOEC 5K8UA 4FCTA 3GUZA 4LHZA 4W6QA 1ZNYA 1WZCA 3G49A 1KI8A 3NYRA 3PK0A 4ZOLB 4R05A 4IGEA 4RKFA 3FNRA 1GNSA 4I4TB 1ARZA 3R9WA 1G2QA 2FJ0A 1GL6A 3E1GA 2PGJA 3LKVA 1IBKB 1FFCA 2CDRA 3JQBA 2IU3A 4QPPA 4JMLA 2ABWA 6YASA 3JQAB 1QFYA 1TYCA 1QP7A 1WDLA 1KYYA 7AT1A 4LF6B 3QHAA 4FZ3A 3CZPA 2CLDX 1QVVA 2C9MA 2E89A 2QDXA 3KWJA 4AF8A 4Q9LA 2RGBA 4YO8A 4OXIA 4B7CA 4TX1A 5CYOA 1N6OA 4B85A 1JG3A 1KI4A 3CVXA 2MR5A 2WE8A 1DDIA 4HGNA 3CYFA 4EQ6B 3O1LA 3IURA 2JEOA 1FSSA 1A04A 2QV7A 1QB7A 2WHEA 4QDUA 5TDHA 3RAJA 2VDRB 4BFUA 4FHFA 6CHYA 3VSEA 1D1QA 2C5EA 4FB4A 5JW6A 2L17A 1ZEMA 3IFSA 3O9MA 4IJ6A 4PLHA 1E9EA 4X6XA 1BXGA 4WY8A 1R15A 5ALWA 5KWVA 2P90A 1Y4SA 1HQCA 2ZBQA 4DQLA 4ND8A 1Y7PA 1YGPA 4E03A 2JLRA 5D5HA 4P9NA 5ALZA 4R2KA 4M6WB 4EDHA 4CIYA 2ZSFA 3E5RA 1AH2A 4EABA 1U63A 1XTUA 3LVBA 1DNPA 2PZBA 2GJAA 5DCLA 3ZI4A 4QXAA 4QELA 4V03A 3MHPA 3HBMA 1GQ2A 4WKGA 4QJ5A 4R2JA 4YGXB 2XMQA 3IVMA 3M6VA 4BX9A 5KREA 3UK6A 2YH2A 3GVXA 1SHLA 1JJAA 3V4ZA 4Z9FA 3LW7A 4XWWA 2QZZA 4YR7A 4MJ7A 1QAOA 1LVGA 4TLBA 3SLRA 2B4TO 4R1PA 2EQAA 5HG0A 1S3SA 3LOPA 3GRRA 3OZTA 4A0FA 1A8HA 2R00C 3VJMA 1JDUA 1G59A 4YRSA 1C0PA 3QK7A 1U3CA 4URHA 4B84A 1WTCA 4GKAA 1H5QA 4WEQA 2V0NA 3HCOA 3LIPA 2C96A 1HLDA 4TQUS 2B6HA 1KZ9A 2JAQA 3UFXA 1X14A 3DDCA 4LJ4A 4IDOA 4UVDA 1KDVA 3Q98A 3TRFA 5KSZA 4G8JA 4JT4A 2CLIB 1V9LA 3ND7A 1L3CA 3QITA 3F5DA 4M0MA 2HSWA 4J0CA 4P0QB 1UWVA 1W88B 5DHSA 4JH0A 4BUZA 3PTLA 3HO6A 3O95A 2VZ9A 3OFND 1UJNA 4GKBA 2FHSA 2WVHA 3T3HA 3RIGA 3HU3A 3KR2A 4PLWA 2PU7A 4OHZA 2C7OA 4FK8A 2WABA 1U8CB 3SSMA 3SN6A 2QI9F 3HB5X 1XJWA 1O0SA 4C2AA 2OFWA 3CCFA 1ORDA 1SBNE 1QV9A 4HL6A 3KJIA 1Q7RA 4D79A 4MVJH 4IFTA 2Y71A 5DI3B 4ID3A 3SPXA 1KZYC 4FDTA 1LDYA 1ID1A 1DPFA 5FWXB 2RE8A 1NVFA 2AHRA 1W29A 1KGSA 2HCJB 2VDNB 1KEPA 1EFPB 1IHPA 4JCOA 2BHTA 1MG5A 2G7MC 2GOYA 1NP7A 3CRW1 4JLWA 4R51A 3SQNA 4BO3A 2P9BA 4BMNA 3NTUA 2DSNA 3R6TA 4L9AA 5MN6A 3ZLJA 3COZA 4KIUA 4MGEA 3RAEC 3B7PA 4MWBA 1PVOA 4GL4A 3CY6A 5SYAA 1TC1A 4HS4A 5IHXA 4FD3A 2RB4A 3DVSX 1ZGJA 2G1AA 2OQIA 1WF3A 1PYGA 2DEUA 2C3MA 1Q16A 4PC6A 3BGWA 2QTFA 3KLOA 1BYUA 2JDIA 4PQFA 3VO8A 2PYDA 1ZMXA 4NX2A 3L40A 5H0IA 1YASA 1SEPA 1JEAA 2O2CA 1QQ7A 4ZQHA 2V8OA 4H7DA 4HVAA 5DP2A 4KIFA 5DSTA 4EUEA 1QK3A 1C0IA 1C5KA 1Z8HA 2CBZA 2WOOA 4ZK2A 3CLUD 4YMWA 3F74A 3OZEA 4WL0A 3HJFA 3TF5A 1DJPA 4KR9A 3HXMA 3C24A 3C5HA 3E9NA 2H57A 2YMLA 2PZMA 1U2EA 4LPKA 3THXB 1RC0A 2NXCA 4PNPA 2DY1A 1YR7A 3ONWA 4JL8A 3RKUA 3GK3A 4U9HS 3ST7A 4DZRA 3PPWA 2QAGB 5I7RA 2P3OA 1U0EA 3SQLA 2IVFA 2Q5HA 3GLHA 1RC1A 1WVGA 1XCMA 4RAOA 4BZXA 1PNRA 3TL2A 5IJZA 1E3MA 3EN0A 1WRBA 2ODEA 2PFGA 2P68A 2PLFA 3ED5A 3MIIA 3N5KA 3PDUA 2F48A 4HNSA 3ZX5A 1Y7TA 3SXUB 1FNNA 2XD9A 1H22A 2VZ0A 4BYGA 1ECPA 1MB0A 3PNLA 4CM5A 5E7MA 1Q14A 2ZT5A 1JZSA 5E8JA 4MVCA 4M0DA 2D1TA 2H3HA 1A2QA 4UFOA 1A9TA 1Q0ZA 4K46A 2P1ZA 4LDNA 1VMAA 2JCBA 1X86B 2YS7A 3O5AA 3PD1A 2OFXA 3DUWA 1G5PA 2QLNA 3VHRA 2SNIE 3KLBA 4FMBB 4YRLA 4GOMD 4PZZA 1YSCA 1WKCA 2QRQA 2VRCD 4OFWA 1O0CA 2BIFA 1UDXA 3A6PC 4G8CA 4IS3A 4N76A 4X8HA 5HCUA 1JLLB 4LRSB 3SYKA 1FYXA 1T0HB 5C3UA 3UAXA 2ACEA 2BFEB 2Z5LA 4OJTA 3VYSB 5K3OA 3LY5A 5CB4A 4MYUA 1HOXA 2HTEA 2YFQA 3T3GA 4HJXA 4X66B 4JJ8A 3ZGVA 3Q0IA 2R5FA 3T7RA 1DEOA 3ZWWA 3VOTA 1YA4A 4RHYA 3N6XA 5BOVA 4AQDA 1R6VA 1EU1A 3F0TA 3MUFA 4WIAA 3DAYA 3E9QA 1KZ7B 2D7JA 2AR0A 2QN9A 4WKCA 2I3GA 3RV3A 1J21A 1A2KC 1PV2A 2B7BA 2ZR8A 1P2SA 2ZRGA 3CT6A 3NHYA 3Q7TA 4FGUA 4UBOA 5DISB 1RJ9B 2LD4A 2WUFA 3TIIA 1JHVA 2BL4A 2ZAIA 1QR2A 1LPNA 1R9MA 5D2CA 5K6RA 1X74A 1R5OA 2GAAA 1FJHA 4GP9A 1S01A 4H9GA 1EIWA 3CVYA 1BC5A 1XTSA 1B43A 3AHHA 4MROA 7YASA 2Z6AA 3GCXA 3L0CA 4AY5A 4IGFA 1XVAA 3ECCA 2XCOA 1SVSA 1XX6A 1A8UA 3EE6A 5F9FA 1E1NA 2E1PA 2RBEA 3QPWA 2QIPA 2WZDA 3PD0A 4R1OA 3REOA 5LP6F 3QKWA 3WAKA 4DR7B 1YKFA 2A94A 4A2PA 4NYIQ 3KAQA 3PDHA 4ZO6A 4OHKA 1I33A 3A2MA 3K96A 1U8EA 4ENQA 2HEGA 6GPBA 2GXAA 2X7JA 3CPSA 3R09A 1BDHA 4QHTA 4XEHA 1EZZA 3WWYA 1TF2A 5DNYB 4I1VA 3ZE6A 1T43A 3B48A 1M54A 3H8SA 2IYWA 2HA5A 4RF4A 5C34B 3P1JA 2P9ZA 5EE1A 1LI5A 4E51A 4JUAA 1JHXA 4GVPA 4MQEB 5FOWA 2YZNA 1J5XA 1BHSA 4ZAGA 4QTYA 3AG6A 5IH7A 1KDZA 2MSEB 1LF5A 2O3TA 4GUAA 1N9KA 1T3LA 4MS4B 4QA9A 3SR4A 4KMMA 1OZ0A 3I2GA 2PMBA 1UL1X 3KR1A 3WLRA 3DVAB 4W7SA 1Z0SA 3IAM6 4P81A 2OP1A 3AP1A 4QYIB 3GVIA 3Q7PA 1TZ2A 4LEIA 4CEHA 5KYYA 3FPEA 3HA3A 5GY7A 5LU9A 3WFJA 3BWBA 2E4AA 3F4LA 1P2DA 1FBTA 3AY3A 4MS1A 5DSZA 4X7MA 4F2DA 2G1UA 1W5BA 1YB5A 4Y2VA 2P9CA 2FZWA 2KLBA 2OR3A 4DARA 2W8BA 2NV2B 4P7FA 1VYVA 5C32A 1ZJJA 1W0CA 1NQOA 1SVNA 1F2DA 1YKSA 3PRHA 4CODB 1P19A 1RADA 2CSXA 4B4VA 1QGOA 1QLHA 2GM9A 1SCNE 2GAIA 1S5PA 5GJCA 3K6RA 1W30A 3ORFA 2M1ZA 3KB1A 3NVKI 2JHPA 3IQZA 4FUQA 3VZPA 2MYTA 3IOEA 3DR5A 1W36C 1D09A 4P33A 2L2QA 4CM4A 1CY6A 3NHUA 1VL2A 1ACMA 1VLJA 4UTPA 2CVHA 1QDLB 4RBNA 2WLSA 2V5AA 2NSHA 3LQYA 4X93A 3IKTA 4AQYB 4BY9E 3SNKA 2PYIA 4JBXA 2DG2A 1FMJA 5BO5A 3LC1O 4YEDA 4DYDA 3FVWA 1KPHA 5LQMA 3T3DA 4D8VA 3DOEA 2PUAA 2Q99A 3T38A 3G0BA 1E2BA 3F6PA 2PCLA 1C14A 4YRKA 5D3MB 1KRXA 2HIHA 2O0KA 1V9SA 1RYNA 2GJKA 1CF4A 2XBUA 3Q5EA 3QNUA 1L7MA 2VQDA 1TOAA 4OGKA 1EYZA 2Z9CA 1YI1A 4LA4A 4DCUA 1TLFA 1T0IA 2NYUA 4EFNA 2QT9A 1A5AB 2QG6A 5CLQA 3FNFA 3PCTA 3PF8A 4WASA 3ZXSA 1E79A 3DL7A 2C4HA 3K9QO 4J0HA 4CUZA 2OV4A 5B7NA 3FLAA 1KJWA 2D4AA 2QIOA 2ZDGA 4NMHA 4R81A 2DFLA 2O57A 4YJ2B 2CMKA 2ONKA 2W2KA 3GEGA 3PUXA 4HHEA 4IDNA 4S1VA 3C41J 1GD1O 4C7KA 4BECA 5AUPB 2R48A 5EWLB 4KITB 3TECE 4RULA 1JR3E 1NM5C 4RMJA 2D2FA 3RFCA 1ZVQA 4C4YA 1N2CB 2V7EA 4BMPB 5GZ1A 4YHBA 2JIMA 4NBSA 5CITA 3EISA 2ERXA 3LVQE 4I2VA 5JFTA 1AQJA 2VDWB 1SD1A 4O4HB 4RA6A 3TLBA 2AWOA 2SCUA 1G0NA 3TO5A 1QHHA 3PA8A 1RLJA 2JATA 3HVHA 3I30X 3JD2A 5HKAA 3QF4B 1SELA 5KKNB 5DM70 1A1VA 4BGUA 1QGZA 4ES6A 2ZZKA 3HA7A 2VDVE 3NHBA 1FNSA 1SHUX 3NXSA 2NUTA 4RY0A 4Y30A 3ISJA 3SKYA 3ZXUB 2ZCVA 1KKLA 3I37X 2ZYIA 3HBJA 1KZ6A 1XRJA 2F00A 1TC2A 2Z5VA 1KKMA 3M34A 2XI4A 5GADl 4UZEA 5IN5A 4BZQA 1CUGA 3ED1A 1YOVA 4RKRA 2EOAA 1M7BA 3KTOA 3JAMA 4JYMA 1CQJB 3GYBA 3LDHA 4HP8A 5I48A 1HE2A 3JQGA 4BE4A 4RTQA 3VR2A 1OLSA 3KOWA 1TU3A 3R3JA 1YR2A 2Q6TA 1KYIA 2XVMA 4HXGA 1HSZA 1UR5A 4NV1A 4PXYA 2P0EA 4MYSA 5HF6A 4O6VA 4OG2A 2AJLI 3R3ZA 1W34A 3V1KA 3LG2A 1FU8A 4DCCA 4NBNA 2AYZA 3ZY2A 5BQFA 4HMQA 4PC1A 1T3TA 2XOEA 2M2IA 3OJOA 3C6KA 5CA0B 2J07A 4FIZA 2RHWA 2YL2A 2CW5A 1U8XX 3GARA 1FVHA 4URXR 1P31A 2YW9A 3UWSA 3LUHA 3ENKA 4DLXA 4EHIA 1ZD8A 1CVIA 4PZAA 5AW2A 3SSAA 4HQ6A 3LY9A 4WCFB 2NNLD 1RQRA 3AONB 4HLUA 2PT7A 4PINA 4DHWA 5M29A 1QPZA 3GLFA 4TKUA 3KOOA 3P97A 4FM9A 3S2YA 2I8LA 3HB7A 2VHCA 1ZEJA 4G0ZA 5CIWA 5JVDB 1KQGA 5M3BA 1PK7A 2C8JA 2OSBA 2V9PA 2PXAA 4JZKA 1GT91 3D6MA 2HIMA 2Z08A 3K9HA 4JB3A 1PW7A 4DV7B 4RSHA 1C7EA 2OBBA 5IAGA 2ECFA 3RT1A 1XTBA 1VKJA 1RBYA 4XW2A 1VG9B 2VP3A 4AJJA 5E7JA 4BJ1A 2DETA 3P9QA 1G3IA 4X44A 5CDFA 1FMCA 2W48A 3VVMA 2GM5A 2D5LA 4X1KB 5KYNA 1VGQA 1YJQA 3OEWA 1J2EA 3JD0A 4NKRA 1P3DA 5A4AA 2VFAA 5DM60 2XIQA 2EZUA 4AKTA 3CHYA 1BHO1 3DAFA 2V1XA 3NHMA 4MYCA 4WGGA 4TROA 4W82A 4M1KA 4RE5A 1C81A 4F7WA 5KYVA 2QSZA 2Y6VA 1AGRA 2VWPA 3LWBA 4OIFA 2Z1DA 1OBHA 2QR3A 3DEFA 2A59A 3BBPA 4RZUA 3HY3A 1E7YA 1OPRA 4UMDA 3D6UA 3RASA 4CG0A 4PFSA 5ALPA 1W93A 1WW8A 3MTEA 2PS0A 1G4HA 2WTAA 3W6ZA 3CEMA 5J40A 3ZHTA 1IVNA 1XJ5A 3I5MA 1U0BB 2J0UA 4B7XA 3CSUA 4CIDA 1WD5A 5J2TB 5CB6A 5D5PA 1BTOA 3WNCA 3ADOA 4R41A 1ZWKA 4FLEA 4ZO7A 4WZ6A 4DNFA 2KJQA 1XKXA 2GT1A 2H4JA 3NBQA 5FOTA 4HS9A 5E2IA 1QDEA 3QHPA 1Y1RA 5DCUA 3WJ1A 1LBTA 5KNCH 3NM4A 4KUHA 3DE0X 3RAFC 5FLKA 3LQ1A 1OOEA 1OVGA 3AHJA 5JWHA 2X0FA 2G7ZA 2UXDB 1H2BA 2GN6A 1JE0A 4TV9F 4EI2A 5BPHA 3THRA 5D84A 2VQSA 1E4OA 5EZQA 4JBIA 2IHVA 5EJIA 5H9WA 2AI3A 2YY6A 3GCGA 3WWCA 4B6QA 3FMGA 4DG5A 3MGAA 2VPWA 2A0WA 4OB8A 3X2SA 4G84A 1P7YA 1JHPA 2Y1CA 3I5UA 4C20A 1SXJD 3PBKA 1UK6A 4M21A 1NZDA 4EG1A 4CTNA 3K4HA 4OMFG 1OXXK 1XMJA 3IPRA 3D8SA 4O0MA 3TD9A 4UCQA 2CNLA 3BX1A 2VR1A 3H4TA 2WJHA 2AIRA 2OLJA 3ZD9A 5C2JB 5HJ7A 2J3LA 4XB1A 1L5GB 3UUFA 2PXXA 4CIAA 4HVTA 2H4HA 5G0VA 1C3OB 4GPIB 5EAIA 4ZEWA 1F06A 4KGVA 3SJUA 5LZ5A 5IVHA 1ZGHA 5C4GB 5B2FA 1JEEA 1IJKA 1SB8A 1YZKA 2ZSHA 3D3WB 1RI3A 3R5HA 4FHDA 4XDZA 1TKAA 1NNEA 2AUTA 1E2JA 1G6HA 3V4PB 4CN8A 1UXOA 5J58A 4UU1A 3ZVLA 1OX4B 1FNMA 2HK8A 2OVBA 2WJIA 2JA1A 1LUAA 2OCIA 3IBTA 4WMLA 2RJ3A 3LU1A 3OZGA 3FM9A 4F71A 2P35A 1Z17A 4GE3A 3PNPA 1UKBA 1ZMBA 3K4QA 1JN0A 1C8VB 1H8EA 4LZJA 1KFCB 4MW1A 2AEFA 2TSYB 5EE9A 1CLUA 3E4DA 2F8MA 4G2TA 1ILWA 3NPAA 1CUSA 3WRYA 1QWOA 3JYHA 3OF3A 2IODA 1X3LA 3IUPA 5HMLA 4OATA 4O02B 1FRNA 3K1AB 4YX9A 1EUCB 1N33B 2B2XA 5LYYA 3TTUA 1QKKA 2G9VA 4QBFA 3X2FA 1MDFA 3N2ZB 3NJ4A 4IIYA 1Q92A 1BG6A 2MSCB 4JXJA 3D4NA 5G53C 1T5OA 3PX2A 4UMFA 4ZKEA 5J3JA 2GAJA 2QTCA 2QX6A 1RBZA 3MILA 4O2BA 1OAKA 2J31A 1RYMA 2BBSA 4BB9A 2OQRA 3RABA 2P6RA 5AO9A 1SPBS 2C2BA 3AR5A 2EX0A 4NNJA 3RS5A 4DKXA 5JCOC 2R6JA 2GXQA 1EE9A 1Z7GA 2R8OA 3EPPA 1BN7A 2PX6A 4FQ7A 4HQLA 3IE2A 4K6FA 1YJBA 3QI7A 4MQFA 4IKPA 4QUBA 5T4EA 1SXJE 3LT1A 3BG5A 2Q5FA 2OV6A 4IVQA 1OFHA 4AJPA 1EWTA 1UC9A 2XF8A 2JHCA 2EZTA 5GVRA 3TWOA 5ED0A 1UM9A 1U3UA 2A7XA 3ZS9A 3CF4G 4I5EA 4MH0R 3O2SB 4F12A 1THMA 3LKDA 3FDZA 3L5OA 5DGXA 2AN5A 5HBGA 1CUBA 2R2AA 2NT3A 1N7JA 2J4FA 4EAQA 3AEXA 1XA4A 3REQA 1M2FA 2I1LA 4CF3A 3ZBQA 5B3AA 2YWRA 1GEGA 2IOFK 1IM2A 3GIWA 3WWZA 4EJMA 1AF7A 2O8CB 1BX3A 3SFZA 1N7GA 4JLVA 1GIAA 1T2DA 2DPMA 2ZM6B 1CFZA 3O93A 1A7AA 5FIUA 2X0NA 3E15A 4DE5A 4G5YA 1RAIA 2Q5LA 1M6NA 3T99A 5JWRA 3S7TA 2Y9PB 2CXSA 1FP6A 4DB4A 4YRJA 2BEWA 4BASA