2SCUA

A detailed description of the structure of succinyl-coa synthetase from escherichia coli
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
286
structure length
285
Chain Sequence
SILIDKNTKVICQGFTGSQGTFHSEQAIAYGTKMVGGVTPGKGGTTHLGLPVFNTVREAVAATGATASVIYVPAPFCKDSILEAIDAGIKLIITITEGIPTLDMLTVKVKLDEAGVRMIGPNCPGVITPGECKIGIQPGHIHKPGKVGIVSRSGTLTYEAVKQTTDYGFGQSTCVGIGGDPIPGSNFIDILEMFEKDPQTEAIVMIGEIGGSAEEEAAAYIKEHVTKPVVGYIAGVTAPKGKRMGAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGEALKTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords PROTEIN (SUCCINYL-COA LIGASE)
publication title A detailed structural description of Escherichia coli succinyl-CoA synthetase.
pubmed doi rcsb
source organism Escherichia coli
total genus 105
structure length 285
sequence length 286
chains with identical sequence D
ec nomenclature ec 6.2.1.5: Succinate--CoA ligase (ADP-forming).
pdb deposition date 1998-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00549 Ligase_CoA CoA-ligase
A PF02629 CoA_binding CoA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 2scuA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2scuA01
1XELA 4KMSA 1EZ4A 4JGBA 5I7EA 4IUYA 4NBVA 4NU6A 1RJWA 4RF2A 3D64A 5CAEA 3LT2A 2R2GA 1PZGA 2DBRA 4E2ZA 4O1MA 4XD2A 1WAMA 1VL6A 4NBUA 4BNUA 4J4HA 1HDXA 3ABIA 4XJTA 5IZCC 3RU9A 3VDRA 1QRRA 1C1XB 2QW8A 2B36A 1JLLB 1NVMB 1VM6A 1ZSYA 2DU8A 3GN1A 4YAIA 3GK3A 3JQEA 3DBLA 4YEDA 4GGOA 5JNLA 4FFLA 1LA2A 1BXGA 1PJSA 2HMWA 3VC7A 2CZCA 2DBZA 4J9VA 3W8DA 1T2CA 4W99A 2PV7A 1ENYA 4CM9A 1T26A 2YHIA 1TEHA 4AJJA 3S2FA 1RYDA 4XKJA 5DP2A 3AM4A 1Z6ZA 3LDHA 3Q0EA 4R16A 3ZV6A 3ZZNA 1PGNA 1SO8A 4E30A 4EJ0A 3OETA 4RPGA 2UUPA 1MC4A 4DQVA 1RM0A 5BSEA 3GZ4A 5A04A 5DBGA 4YRAA 1UXIA 1P9LA 1N8KA 1VKNA 2LDXA 4R9RA 4E33A 2CY0A 1MFZA 1R4NB 3WYBA 4BNIA 3AW9A 5IXYA 5IF3A 5KKCA 3G17A 2ZB8A 4IMPA 1ISHA 4H3VA 1MX3A 5TJHA 2NVUB 4ZQEA 3Q11A 1WDKA 3S55A 1WW8A 4D45A 2IZ0A 5T8KC 1CWUA 4YJFA 2C0CA 5A3JA 1EE9A 5IDYA 9LDTA 3BMCA 4J3FA 4PG7A 4CR8A 4YCAA 2Q1WA 3WWYA 1N7HA 4R41A 4MINA 2WD8A 5EQFA 4J90A 1FJHA 4GH5A 4LVUA 4S1VA 1JVSA 1PGOA 4BO9A 3WOHA 2QRJA 1KC3A 5FYDA 4GVXA 3SC4A 3LT0A 3MTJA 3P19A 4HFJA 1UXGA 3BMQB 3GRPA 1RKXA 2W2KB 4RLHA 1HZZA 4RVHA 4D44A 2IYOA 2PWZA 2ZYGA 4IDDA 3DO5A 2I6TA 3IJRA 4NJMA 5DF1A 2PZJA 1LC0A 1DOHA 3WGOA 1NWHA 2IE0A 4MIEA 1LQTA 4Q3NA 1GYRA 2SCUB 1K2WA 5I8ZA 3T7CA 4XRGA 4Z3KA 2CF5A 3PZBA 1PQUA 2EGGA 3L6EA 2POQX 3GEMA 1FDVA 1V0JA 1HDOA 2RHRA 3ETDA 3GNSA 4R1SA 1U8XX 4ZQFA 4CMKA 2JCYA 4EJ6A 5I8WA 4Z6KA 4J4TA 3U4IA 3AWDA 2AEMA 3TSCA 3KLPX 3WNVA 3ZHBA 3WTCA 1R37A 1UXKA 5L40A 5JBIA 2YDXA 4KQWA 4PCVA 1L1FA 1F0YA 1WLYA 1Y8RB 1SBYA 3QLJA 5A3VA 4N18A 3E82A 3UCEA 5JY6A 4BNHA 2EF1A 4XR9A 1I3NA 1SEPA 2HK7A 3QVSA 2YY7A 3IKTA 4LISA 4OQZA 2FY8A 4FDAA 1RPNA 1B16A 1ZNQO 1E1MA 1QYVA 3GN2A 4RDIA 4K26A 1DC5A 5KIAA 3K96A 3VPHA 4RVDA 4WEQA 4L73A 1TLTA 1U7TA 1HDYA 3CXRA 1VJ1A 4KUGA 4XB2A 3JD4A 5TJ9A 3RJ5A 3AM5A 1HE4A 1VI2A 1PS9A 1P74A 1SEVA 3KZVA 4CQMA 1N9GB 4KTTE 1U5CA 2D59A 3UXYA 2GN9A 1E3WA 3N58A 4I1IA 4B79A 1D7OA 1U5AA 3I52A 5K6AA 3KHUA 2BFPA 5TRTA 2BLLA 3OSUA 5TT0A 3PI7A 5LDGA 3BTVA 3HDYA 2G17A 4JXKA 3DBHB 4TKMA 5F1PA 4DL9A 1UAGA 4BO4A 2YQ5A 1T25A 2V65A 1ORRA 3GNQA 1DIHA 4CMCA 3C1OA 2AE1A 3NDIA 1X7HA 2DTXA 5AXBA 1MFPA 1T2FA 4MKZA 1X1EA 5DN9A 4DYVA 4IDEA 2CD9A 4TRNA 3G1UA 5BT9A 1JQBA 3KYDB 2VYNA 1GDHA 4YWJA 1B8PA 3S2EA 4IDBA 3V5NA 2YV2A 1ONPA 2VZ8A 4BO5A 8LDHA 1C1DB 5FFFA 2JCXA 4YJHA 1B15A 1T2EA 3VZPA 4OSPA 4PFJA 4ZICA 4B8ZA 5A1TA 4NDNE 3ZNOA 4BKOA 1I8TA 2JHGA 5A5FA 1Z82A 4GLLA 1NHWA 2VCYA 1YGYA 4GMGA 3R3SA 1YS4A 3GZNA 2VWPA 4WE3A 3IOYA 1T2AA 4IQ8A 4N5LA 5CEFA 4L4XA 1IB6A 1Y8QB 3R1IA 4E0BA 3ZNQA 2GRAA 3ONDA 3O4RA 5JPIA 4UVHA 4GKVA 2O4UX 3HADA 1K0UA 1Z7BA 4IQGA 2PZMA 2PD4A 3DTYA 5JDIC 5JXWA 3HJAA 2JAPA 4XX0B 1DIBA 4J43A 5HS6A 4E5MA 3H9GA 3GPDG 1EQUA 5LDHA 3FCOA 1M75A 2G1UA 3GQVA 1GEGA 5H82A 4YT8A 1YOVB 5KJ1A 4CUZA 4PGFA 3VOSA 2BMAA 2QZ9A 3TOXA 1YVEI 3H8VA 5BNFA 4PZEA 3ADOA 1E1NA 2NU8B 1YH3A 3GF4A 4BNJA 3WBFA 5IZCA 1IPEA 2AA3A 2Q2VA 2ZTVA 4E12A 3R3JA 3FR7A 3WJ7A 4CMEC 1YJ8A 3GRKA 4ALMA 4WCDA 5ENVA 4OYRA 3JQAA 1M76A 1DRVA 2X5JO 1PS0A 3BTOA 5CAEB 1N1GA 2GASA 2PNFA 1JTVA 4DREA 2DBVO 3ZU3A 4IPTA 4U6SA 1SAYA 1PU2A 5B12A 1Z75A 4FBGA 3UKOA 4KDFA 1KVSA 4J1QA 4ESOA 1BDMA 3DBLB 3GDFA 1NXQA 3RQSA 4CMBA 3IP3A 4DPLA 1PJ4A 1PJCA 1BXGB 5ITVA 3UH1A 4I08A 5JFOA 2E48A 2NM0A 1DJQA 3QIVA 1U3TA 4M86A 4PLWA 3OJFA 4OGWA 1MV8A 2QG4A 3GR6A 4IBOA 1U2DA 2VQ3A 3PYLA 2EEZA 2YHIB 1ZK4A 2O3UA 2AE2A 5JAMA 1BWSA 4OAQA 2GN6A 2HO5A 5ER6A 4Z9XA 4JROA 1OC4A 3TQHA 4Z0HO 3TWOA 2VT2A 3H2ZA 1YBAA 2JHFA 2J3IA 2AHRA 4I8XA 4RVGA 4A27A 1BXKA 2OOSA 1D4FA 4RLSA 3JYOA 3Q2IA 4TVBA 5ICSA 5KCZA 2E37A 2TMGA 4N5NA 4KUHA 3WNQA 1EQ2A 3G3EA 2GPTA 4FOSA 3ZV3A 3V2HA 1WVGA 1X0VA 5F3RA 4IXTA 2HSDA 3HFSA 5G4KA 1HE2A 4NHEA 2BFAA 2JD0A 3HQ4O 4YJFB 1MP0A 2DT5A 4JJIA 4MVJI 5FWNA 4E5KA 3PDUA 4CM6A 1ADGA 4RPKA 3BMCB 4BGVA 5G0WA 1EE2A 2Y66A 4BMVA 3IKVA 5THQA 2FZEA 1UDAA 4JNKA 1I3KA 4XGIA 5BSHA 1G0OA 5L45A 3UF0A 5TS3A 1AGNA 1NQTA 5T64A 4G5HA 1HEUA 2WD7A 4IGFA 2CDBA 4BNVA 1JU9A 2BELA 1B8UA 2GZ1A 2W4QA 5TNXA 1PZFA 4FGWA 1HE5A 2NQ8A 1QXSA 2WTBA 3FPLA 2HKIA 4DIFA 4NJMB 4OO3A 5JCJA 3E03A 3C3XA 1VLLA 4PLHA 1Y7TA 4IM7A 4GLOA 1YL6A 3LLSA 1LDBA 3VPFA 1T4BA 3JQFA 1X0XA 4Y6RA 3OA2A 4DLBA 4E4YA 2CVQA 2P9CA 2ZIZA 3WGQA 3AI3A 1K5HA 5COAA 2O7QA 1W0CA 4AFNA 2HU2A 1LUAA 1P1JA 1PWZA 4CLOA 5DBIA 4II3A 1P0CA 4KWIA 4BV9A 5JW6A 1E3SA 1E3JA 3WLEA 1XR3A 3ROKA 1MC5A 4KTVE 4QO7A 5KKAA 5I7SA 5L95A 4ALNA 4EJMA 2C54A 1A72A 1R12A 4OKNA 1GCOA 1YJQA 3ZWOA 2YV1A 4IDFA 1BGVA 3NTOA 4UAGA 3WSWA 1SCUA 3TN7A 3UFXA 3EVTA 5F1KA 2PGJA 5COQA 1Q2XA 3BTSA 5K0ZA 1B14A 1KYQA 1TI7A 2VWGA 4BNNA 1MA0A 3ENKA 3ZNNA 3SC6A 3RI3A 3ZWYA 4OJNA 2Z1MA 2QRLA 3DAFA 1Y81A 2IXAA 3Q3CA 4J2HA 1PJBA 2Z95A 3ROQA 3V1YA 1I2BA 1SOVA 1E3WB 3QRWA 1A9YA 2NU9A 3HDJA 1GQ2A 3MOGA 3OJEA 4UUPA 2W2LD 3RC2A 1XYGA 3CPSA 1NP3A 5TQVA 1GZ4A 3F1KA 2H9IA 1LQUA 4IS2A 3WB9A 3GFBA 4F45A 1ONOA 4FW8A 4E2WA 4JBHA 3OFSA 1PL7A 2Y1OA 3WYCA 1EVZA 1P77A 4B7UA 2FP4A 3KBOA 5ICMA 1SB9A 1UP7A 2V6GA 3WICA 3B1FA 2C2XA 2I66A 1LLQA 4NG5A 1E7QA 3L0DA 5ES3A 3L6DA 2O3SA 1TT5A 2X5OA 4BNGA 4YXFA 3ETGA 1OZAA 3PFFA 2GR9A 1JWBB 4F6CA 3KV3O 4HXYA 1NAIA 2WSBA 4LSWA 4FS3A 2Q1UA 3BMOA 3EAGA 1ID1A 4CUKA 3H9UA 4YJHB 4DQUA 5IXSA 4QX6A 1MLDA 4Q3CA 1W4ZA 1PR9A 5TF4A 5IG2A 1LDNA 2HQ1A 4DWVA 3H9EO 2OZPA 1R0SA 3K8ZA 1KS9A 1UP4A 5CP8A 1A71A 3JQCA 3RAJA 4BO1A 3GZNB 1RM4A 3WGYA 4NH4A 3ITKA 4GSLA 4DPMA 2QYSA 5T5QA 1H9AA 3JYPA 3L4SO 2VHVA 2O3QA 1X14A 3ONFA 2GUGA 1MG0A 4DA9A 1EDZA 2PD6A 3RFXA 2CUKA 4R68A 1FMCA 4MVJD 3ZHYA 4BKUA 3AI2A 3CKYA 3PVZA 4WLFA 1KVQA 1E5QA 3ZNPA 4DLAA 4BMSA 2V6BA 4MVJP 2UAGA 3PDJA 3DHYA 2J5RA 4W82A 4J7UA 4R3NA 3NT2A 3E6AA 1SB8A 4R4JA 1KY4A 3CE6A 3PJDA 3RC1A 4WJZA 1NWCA 4J1SA 1TVEA 4EEXA 2FPGA 2I99A 4TKLA 1IE3A 2OGUA 2ZATA 1UP6A 4JBGA 4CMHA 4E21A 3NYWA 1GZ6A 1E5LA 1NFRA 3JQAB 1GZ3A 1OOEA 3B1KA 2VZ0A 2ZTMA 3U4CA 4TSKA 3QWIA 4CV0A 4RORA 4U6QA 5FI5A 4RJTA 1NFFA 3INGA 4YT5A 4XYLA 1IZ9A 5ENDA 3BZUA 2AQ8A 4DIOA 4D0SA 4FSHA 5JO0A 1ZJYA 4AJPA 4J2OA 1NPTO 4IJWA 4OXKA 1UDCA 4WK6A 6LDHA 4M1QA 1ZJZA 1YKFA 2GN8A 2Q99A 1DO8A 3D4NA 2WYVA 1R16A 4BO0A 1KETA 4A10A 1NX6A 3H9JA 3K73O 4NK5A 4ALLA 2Q2WA 2Q46A 1LNQA 1XKQA 2BH9A 3M1LA 3FNHA 4FOOA 5JYDA 5TT1A 4XCVA 1K6JA 3I9KA 5TGDA 4KWHA 4NFYA 5CDUA 3BHIA 3U62A 1QLJA 2BFMA 4EUFA 4L76A 3RJ9A 5A05A 4PLYA 4ALKA 4NPCA 2IDZA 4I5EA 5U4QA 6ADHA 3E9QA 4BMNA 1P44A 2Y1GA 3GG9A 4JIGA 3GLQA 1EFKA 2BD0A 2YZ7A 5GZ3A 3QWAA 1WPQA 4NBWA 3LSYA 2VWQA 4BNZA 5L7WA 1ISGA 1UZLA 4CM8A 5L7YA 1AE1A 3FBTA 2RBEA 2TMDA 1EBUA 2OORA 3NT5A 5EERA 3GHYA 3NKLA 3IUSA 5G4KB 1U2GA 1I2CA 2YFQA 5IDXA 3RBVA 3ZHZA 1P1FA 5KVQA 5K6AC 1Y5MA 4AJOA 1XLTA 5B1YA 1N2SA 4IQ0A 4UUNA 3PPIA 1F06A 3Q1LA 5L3ZA 2FR8A 5DULA 2PH3A 2EV9A 1AUPA 1O89A 4PG5A 1DIGA 1PQWA 1UZNA 1B26A 2GSDA 3IL2A 3H5AA 4P8RA 3UCXA 3FI9A 1HETA 4G65A 1I2ZA 3H6KA 3GH3A 1QORA 3EZYA 1Q7BA 1M6HA 2PK3A 2G0TA 4FC7A 1X1TA 1PS8A 4A26A 3DFUA 2EJWA 4BNYA 3DBRA 3ZN2A 4A73A 2DLDA 1V9LA 4QEDA 4BV8A 3O8QA 2X9NA 1L7EA 4R54A 1W8DA 2EWMA 3OJLA 4J16A 1DIAA 1N1EA 4CM5A 2NTVA 3TRIA 3OECA 1M2WA 2J8ZA 3PHLA 4K6CA 4C4OA 3EY4A 1YQGA 2H1SA 3KO8A 4CLOB 3QVOA 4CV1A 4R01A 3OIGA 4MVJG 5JAQA 5B37A 5G2OA 4RQTA 4CR7A 2AQKA 2X0NA 2DBQA 4QUKA 1E7RA 1H94A 2NSDA 1PSDA 3HDQA 1DRWA 5IN4A 5MDHA 2E4AA 4XWYA 1DFHA 1ONNA 4MVJF 3AOEA 4OHUA 1SCUB 3HN7A 2QRKA 3QWHA 3A14A 3F46A 3FN4A 4CMGA 3D7LA 1NBOA 2PKQP 5G4LA 1DLIA 1PX0A 2HMVA 3P7MA 4P4LA 4R69A 4AVYA 3MEQA 3PK0A 3JD2A 3TZKA 2X4GA 4LVCA 2Y0CA 4QSMA 4YAJA 2VUTA 2PR2A 4I9HA 3OA0A 1F17A 3QVXA 3DHNA 3C8MA 3PYMA 3DZFA 2C29D 3QA9A 2Q2QA 3H65A 4ZJUA 1F12A 4EEZA 1KVUA 1NPDA 4BQPA 3FHLA 2NU9B 5DOVA 2VWHA 3M6IA 2RIRA 3WFJA 1AHHA 2FZWA 2X5KO 2I5PO 1CQIA 1VRWA 2HRBA 4RVUA 3GVXA 4TRRA 3ZWNA 4FB5A 1QSGA 1LI4A 4MP6A 3O26A 5MGBA 1BSVA 3F3SA 4B4VA 2B69A 3JSAA 3QQPA 5DBFA 3E48A 2JD1A 3E5MA 3AY3A 3RFTA 2FP4B 1KERA 1I3MA 3JQBC 4JJFA 1H6CA 4XYEA 2CF6A 1B3BA 4ND3A 1S6YA 3W8FA 2Y1DA 1EK6A 3QWBA 4R51A 1TT5B 3F5SA 2YV3A 1PJTA 3FWNA 4MP3A 4CLRA 2DC1A 1AXGA 5AXDA 2CSUA 3B1JA 4BO7A 3CSDA 2WYUA 1O95A 3BMOB 5T67A 2OBNA 1ZO8A 1X7DA 3FTPA 4F46A 2Q50A 3JQ8A 4XDYA 1D8AA 1LX6A 4OKIA 2GERA 2O50A 3VTFA 4CMIA 2PKQO 3WTBA 1GYPA 1HLDA 3MJCA 4ND5A 3N7UA 4U5QA 4CM3A 1ZH8A 3PGJA 3U0BA 4YAGA 3DOOA 1BHSA 3CH6A 3HUDA 5KVCA 2FPPB 2I76A 1EDOA 4HKTA 1KVTA 1IY8A 3GMSA 5DNAA 4CPDA 3C1AA 1N92A 1OAAA 3KVOA 3Q6IA 3QVWA 4FFOA 4RF5A 3FR8A 3JV7A 4ZA2A 1HXHA 3T4EA 3I9LA 5HBRA 4P4NA 2Q1TA 1EUZA 2V6MA 2H63A 3A4VA 4RCVA 5I7VA 1J0XO 1P1KA 3RVDA 4Q3BA 4EBFA 2X86A 4Y98A 3K31A 4BNXA 2FPGB 1JKIA 4E6PA 2DVMA 2O23A 2EGHA 3NAQA 2HUNA 4WOJA 1H0KA 1JWAB 4XQ9A 4ZRNA 5G0VA 4HFMA 3RBZA 1P1HA 5G0TA 1Z7EA 3TNLA 3ADPA 4FD3A 3JQFC 3X2EA 3WFIA 4QFDA 4K28A 1I3LA 2B4QA 4TRJA 3OBBA 2ZCVA 1NFQA 4RGBA 1LRJA 3EZLA 1H2BA 1E7MA 2ZJ1A 5EPOA 3MTGA 3VKUA 3CINA 3W6UA 1V3TA 2VNAA 2Y1CA 3UW3A 3PJGA 1W73A 1A4IA 1PGPA 4JP3A 4TWRA 5H83A 4BGEA 2ZTUA 3WXBA 4XGNA 3FWZA 3IAHA 4DMMA 5DOZA 4KOAA 3ORFA 4IDCA 1VJ0A 4GAEA 1LRKA 4JQCA 3WGIA 1P0FA 1T4DA 1I0ZA 1LDGA 5C7OO 3AI1A 2B0JA 4CM9D 3VH2A 1EBFA 1QR6A 1O9BA 1ZK0A 3EVNA 1KEPA 1PL8A 2P91A 1EK5A 1DLJA 3DBVO 1Q0QA 3C7AA 1BRMA 1D3AA 4LCJA 2XF8A 2CFCA 3EMKA 2IODA 1J6UA 3L4BA 4CM8B 1GTMA 4PG8A 1ZSVA 1E1LA 3SXPA 3LK7A 2AQHA 2ZJ0A 1ULSA 2PY6A 3E8XA 1UH5A 1BMDA 2DUWA 2C7GA 1XEAA 3DWFA 3OMLA 3GY0A 4ND2A 1C14A 3I4CA 1E92A 1CQJA 1A5ZA 3CZRA 4L74A 5T57A 3RWBA 2D4AA 5A5EA 3H9QA 3L77A 3PHIA 3DXFA 4TRMA 1B0AA 3WQSB 1MXHA 1C0KA 1IL0A 3QJ5A 2FWMX 3K92A 1UJMA 3PYXA 3ZU2A 1BG6A 3VPXA 1YDEA 4HWKA 3NEPX 4L8VA 3RC7A 1E77A 3DBRB 4D7AA 3E1KA 1DXYA 1P1IA 5CDTA 5KTKA 4LGVA 3O8QB 1V8BA 1QYXA 2BFOA 5T6BA 1U3UA 5A9SA 2J3KA 3FNEA 3CMCO 3INRA 4FGSA 4QECA 3O03A 3EC7A 4XIJA 3VDQA 2YYYA 1ZCJA 5JMPA 4BGUA 4G2NA 3LF2A 4L9RA 2NNLD 3BAZA 1ZEJA 5CDYA 4JX8A 3FSRA 2PD3A 3HN2A 1MGOA 1IYZA 4BHTA 2ET6A 5BR7A 2A9FA 2F1KA 4BO6A 4DYDA 4C7KA 2HCTA 1YONA 1ISMA 5JCXA 3NUGA 3ZU4A 1E3EA 1TT7A 3RUEA 4PLZA 4UUMA 5CHEA 1NTOA 4FCCA 3KEOA 3WIEA 2VT3A 2YQ4A 3AM3A 5CPFA 2IZZA 5CDSA 2EP7A 3F4LA 5C37A 4PG4A 1AN9A 2OL4A 2XPCA 1XQ6A 2VYVA 2PA3A 2D3TA 3FD8A 1GQYA 2JCVA 2Q4BA 3GGOA 3OEYA 1SOWA 4FC6A 1NM5A 3WGHA 4I5DA 4CR6A 5TC4A 2BGKA 3I1JA 2XXJA 3WMWA 1LLDA 3OHSX 3ZW9A 1PL6A 3V1TC 4CM4A 2AG8A 3JQBA 4Q3DA 5BQFA 2HJRA 3LC2O 3IC5A 2P2SA 4U7WA 3T7EA 4BO3A 2GCGA 4CQMD 4RF4A 1CQIB 1EUCA 4UUOA 3NRCA 4R3WA 5KOIA 1HE3A 1R6DA 2AMFA 3OICA 1DAOA 1DFGA 2ZCUA 5JE8A 1GL3A 1PJ3A 3FNGA 2D5CA 3S1LA 4D42A 2BGLA 2EXXA 4WNIA 1DC3A 4R1TA 3JCZA 1U4OA 1ZK2A 2O3RA 3P2OA 3AK4A 2CVOA 2JD2A 3PLRA 4R9SA 1JAXA 2UYYA 1NQAO 2DTDA 3MJTA 1VL8A 2HK8A 4RO0A 1P1RA 3M2TA 3KSUA 4PLFA 3ZGYA 1LC3A 3DONA 2PFGA 4CLRB 4EW6A 3I3OA 3V2GA 3QV1A 1AXEA 1NNUA 3C7CB 2D1YA 5B4TA 3AFNA 4EUHA 4NK4A 4GQAA 3C85A 4WLNA 1CIVA 1HDGO 2VYND 5F21A 1EVIA 4E5NA 4QXMA 4BO8A 2RHCA 3WBBA 4CMIB 4UULA 3ONEA 2O7SA 4E5YA 1HYEA 1PTJA 4DVJA 3JTMA 1PGQA 4HBGA 1TA4A 3AJRA 2AEFA 2I3AA 3G49A 1ZXBA 4QQRA 3SX2A 4UEOA 3H7AA 3MCVA 3HG7A 1IOLA 2ZYDA 3TZCA 4ZD6A 4OOFA 3OP4A 4IGEA 4IJVA 1ML3A 3TF5A 5IDWA 4YT4A 2BKAA 3EGOA 4OOEA 4AICA 3D5QA 4L4SA 4P4GA 7MDHA 5KWEA 3FF4A 2VRCA 4IMRA 1GQQA 3I9OA 4BQRA 5ADHA 1DIRA 1GUYA 2NTJA 4HY3A 3UN1A 3DQPA 2C5AA 1B2LA 3FPCA 3CTMA 2P68A 3JQ7A 3RKUA 4BB6A 1HSOA 4FR5A 1HWYA 2BRUA 5TSDA 3OH8A 4KZPA 3D1LA 2PLAA 2J6IA 5A9TA 5B4UA 3KLMX 1DDOA 4DUPA 4EITA 4J7CA 3HB5X 3NX4A 2F00A 3HHPA 1C0IA 3DOJA 3JQAD 2Y93A 3TOZA 3ZWCA 2QQ5A 5F5LA 2O48X 2Q3EA 3KB6A 3VAZA 4ALJA 1PZHA 3CZMA 1A9ZA 1MB4A 5JC8A 1HL3A 1VSVA 4FPXA 1Y6JA 4U8GA 3PWZA 2NU7A 3TPCA 4DTIA 1XDWA 3GAFA 2P9GA 3RU7A 1R15A 4PLGA 4N5MA 3ANLA 3DL2A 3ZWBA 1DHRA 1PEDA 1YQDA 1LJ8A 3DZGA 4PG6A 5F5NA 4UVGA 3OJOA 4E5PA 2AXQA 2DAPA 4CQMB 1VJTA 3GOHA 1GADO 1XU9A 2HDHA 1E3IA 4JCOA 4PVDA 3AOEC 3A1NA 1SPXA 4N7RA 2O3JA 1LSJA 4RDHA 1F8FA 3VZRA 1R0KA 1D1TA 4J6FA 1H9BA 1UDBA 3WGZA 1QG6A 1L7DA 4E13A 3GVPA 4YB8A 3QE3A 4LN1A 1YB4A 4MKRA 4RZHA 3ZWAA 4NFHA 5A4DA 3GG2A 4LCEA 2WWRA 4LRSB 4F3YA 1LLUA 3GEGA 3RUIA 1OBFO 2VOEA 3ANNA 3ON5A 1I5RA 3QW2A 2G82A 4FFPA 2EP5A 1VPDA 4XEHA 4EI2A 4KP7A 3ZCXA 1YRLA 3I9NA 1ZKMA 4FN4A 3LYLA 1CQJB 1ZK1A 4MJLA 3W4KA 4TZTA 1WZIA 3MWDA 5GZ6A 4Y6SA 1K6XA 2OP0A 4CV3A 1I33A 4DGSA 4IZHA 3MJVA 3ZI0A 4YBZA 1HRDA 1ZSNA 2UUOA 1Z74A 3AUSA 4MP8A 4B4WA 5HRUA 2B35A 2FHSA 3FRJA 3Q2KA 3GEDA 4U0JA 2CDAA 4MIYA 4WPGA 3W4JA 1O6ZA 1Z45A 4DBZA 3T4XA 2R00A 2H6EA 5JO9A 1I10A 4M8SA 5A9SB 3PGXA 1PZEA 1V3VA 4F6LA 2X6TA 2OBYA 1YDWA 2IXBA 2VHYA 3UGKA 3DB2A 5EJ2A 3WQRA 4CLHA 4J0FA 5JCJD 4XYMA 3TJRA 4NQZA 4XQEA 1UZMA 4Y6PA 1RM5A 2DTEA 3DR3A 4GWGA 4YJGA 2ZYAA 5BNTA 4E3ZA 4LMRA 4LRTB 4FFMA 3IUPA 4MPDA 1CERA 5LC1A 2IEBA 5BSFA 4PZDA 3LLVA 3GUYA 3SEFA 4B8WA 5IFLA 5I9LA 2WEKA 2E49A 1I32A 2W2KA 3DHEA 3KUXA 5DCWA 4WCFA 4ZN6A 5FF9A 3QWFA 2E6UX 4ROSA 4XQCA 1BTOA 2ILTA 1NYTA 4S3MA 4BNMA 3KSDO 4M55A 2GDZA 4ZGWA 3ROMA 1I36A 2HAEA 3SLGA 1YBMA 2WJPA 4WUVA 2X23A 4XR4A 2NU6A 4CM4B 1CETA 5LCXA 3ZV5A 4BL5A 5IZ4A 3W1VA 1GR0A 3DOCA 1X13A 2FR1A 5IN5A 1YWGO 2NTNA 4UEKA 3PJEA 3TZ6A 4LW8A 5DT9A 5L53A 3BTUA 3F6YA 1ZVMA 3D4OA 1BW9A 1EUCB 3JD3A 4ZRMA 3VVCA 5EESA 3PIDA 1KEVA 4BVAA 1X7GA 4D0RA 2Q4EA 3E18A 4L75A 1Y8RA 3GUCA 5CFZA 4OXNA 4MVJM 1I30A 1FF9A 1V3UA 1QMGA 3F47A 3LZ6A 4AJKA 3U5TA 4RPHA 3K2EA 4YRDA 1VL0A 2OFPA 5JC1A 4YT2A 1OC2A 3IJPA 3KEQA 2GLXA 4W9NA 3NJ4A 2XAAA 1AHIA 1DB3A 3A28A 3ROPA 2NVBA 2HJSA 4YR9A 1QV7A 1XIVA 4DRYA 4XDZA 4GSKA 4E31A 1ISIA 2P5YA 3DZHA 1HYHA 2JFFA 4R1NA 4Z9FA 3STHA 5I7FA 1XU7A 5KJEA 1ARZA 1YBVA 3B6ZA 4E2YA 4W6ZA 3D3WA 1JKJA 3P2YA 3PHGA 4D41A 4AJNA 3M2PA 3HNPA 5CDGA 4PN3A 3GT0A 3U49A 4BNKA 3L4BC 3WG9A 4FJ1A 4PLTA 3I23A 4TMFA 1LRLA 2QZZA 3PEFA 3GPIA 2WD7B 3ZH2A 2VRBA 2QX7A 3SLKA 4OXYA 5C5IA 3MJ4A 4HV4A 1I01A 1K6IA 1R66A 2PH5A 1UR5A 2Z1NA 4JK3A 4RVFA 3VH4A 5C3MA 1DC6A 2GZ2A 4ZVVA 4GI2A 2P4HX 2I67A 1EFLA 4WNCA 3ASVA 3NJ8A 3PJFA 3JQ7B 3OQ1A 4KQXA 1SMKA 2Q49A 2FSVA 2XOXA 3IDSA 3DTTA 3L07A 1C0PA 3L9WA 5JAIA 1CDOA 3RUCA 4ID9A 1E7SA 3RASA 4B7CA 1B3RA 1ZXLA 4B3IA 1HDRA 4HUJA 1BVRA 2BHLA 3QSGA 5AOVA 2EHDA 2OXIA 4A5OA 4GBJA 2QYTA 3KTDA 3PZRA 1Z73A 4O63O 1HYGA 1ENZA 2RAFA 2X22A 4WECA 4CJXA 3UFXB 1CJCA 1F14A 3FBGA 3RD5A 4OH1A 4ZQHA 1IPFA 2FN7A 3KOUA 3W8EA 3MWEA 3I6IA 3VTZA 3RKRA 4CM1A 4QTZA 4DBVO 2NU8A 2GN4A 3DAGA 2ZB7A 3GA0A 4I9NA 5KJFA 2QHXA 1Q7CA 1XQ1A 4CMJA 4BB5A 2YJZA 5JS6A 2PKRA 5JAZA 3LC7O 2D8AA 4IXWA 1E3LA 1RM3A 3A06A 4B4OA 3ANMA 4TZKA 5CEEA 3GVIA 3EYWA 4CODB 1ISFA 1CRWG 1ZUD1 1SNYA 5AXCA 4PZCA 1IULA 2A94A 4NR0A 5L4NA 2IRWA 1QV6A 2Y0DA 3AOGA 4KDEA 3ZWMA 2GNAA 3I9MA 4D3SA 3U3XA 1IZ0A 5ILOA 9LDBA 2FR0A 1ISJA 3IMFA 3I9JA 4B3JA 1VE9A 2D2IA 2EERA 2RH8A 5C7IO 1GY8A 1MG5A 5IDQA 1G1AA 1OFGA 2ZB4A 1V6AA 4OM8A 4Q3EA 4AJ1A 4RPJA 2X8LA 1E7YA 2CVZA 1P33A 2AW5A 2O2SA 3MWDB 2Q1SA 4LMPA 4J7XA 3MZ0A 3AU8A 1H6DA 4AJ2A 1FDSA 3NDJA 1RYEA 4NBRA 3OEWA 5EN4A 3X2FA 1CYDA 2PGDA 1EUDA 2FSSA 4UVDA 5K9ZA 3I4FA 5IJZA 1DEHA 2V6FA 3CIFA 3JQDA 1XWFA 4NIMA 4HNHA 4CLXA 1PGJA 1PIWA 2GO1A 4BKRA 3GNTA 4NFSA 4BOYA 1HDCA 1HT0A 4M89A 4K9DA 4NI5A 3ENNA 2NUAA 2C07A 3OIFA 4IDGA 4INAA 4IS3A 4J49A 1HLPA 5FI3A 3RSHA 3DMTC 1MXFA 1Y1PA 4YJGB 4CMAA 1GV0A 4IJKA 4I5GA 4R5HA 4AL4A 3FTNA 2YFHA 4GX0A 4JN6B 3GGGA 3OQ6A 4CV2A 1LSOA 5HTOA 1JAYA 1LLCA 4OMUA 2Y99A 3NGXA 5L7TA 2NWQA 5HS4A 1IHYA 2C7VA 3JD0A 3EHEA 3E5RA 2UV8A 3PHJA 4ND1A 3VHRA 3TZHA 5G0SA 1CEQA 1GCUA 3SJ7A 3MJEA 4XIYA 4WCFB 4M87A 4CUJA 3EK2A 4OQYA 4FFNA 4GKBA 4LK3A 3RC9A 4XJSA 1A7AA 3GVCA 4Z9YA 1M67A 1P31A 2B5WA 2VUSA 2YHUA 4ONEA 1G0NA 3ICCA 5GY7A 3AUAA 2BI7A 3JYLA 1EVYA 2NLOA 1DFIA 2QIOA 3D4PA 3JQ6A 4BKQA 3UAGA 1XGKA 2GYYA 2NU6B 5TIIA 3C24A 1T2DA 1PJQA 4J0EA 3G79A 2DKNA 1O8CA 4DQXA 3ST7A 2WDZA 4MIOA 4Q39A 3DMYA 5CG2A 1SC6A 5U9CA 2ZB3A 3Q9NA 4AJHA 4GWKA 2EG9A 1BW9B 2EJVA 3WJAA 2D5AA 5DZSA 5A9RA 1QP8A 2Y1FA 2P4QA 4CQLA 4TROA 3VKVA 4BUCA 5JY1A 2I65A 3HFGA 3GVHA 3JQ9A 2O3TA 3WWZA 2Y68A 5IAAA 5HM8A 1WDMA 2G5CA 3LF1A 4I9UA 1PR3A 4WLEA 4XZ3A 4ALIA 2IZ1A 4UREA 1NAHA 4IDAA 4BIIA 3VH3A 3PRJA 2FOIA 3RBXA 2OMEA 2ZQYA 3PQFA 5EINA 3TFQA 5JDCA 3WMXA 5DDIP 4WASA 3WSVA 2NADA 3RUFA 5J23A 2VUUA 4AJLA 1JN0A 3D3WB 1JKJB 4GL4A 3KSZO 4PLPA 2JL1A 1P45A 3SBOA 1LSUA 4D3DA 4A03A 3ULKA 3RCBA 1U7HA 1I24A 4J1NA 3AY6A 4J1TA 1EEHA 1NR1A 3HB4X 1DAPA 3OIDA 3U09A 3ASUA 1DPGA 3AFMA 4OSOA 3H4VA 3HZZA 4BGIA 4ZU3A 2HRZA 1ZFNA 2EW2A 4Q9NA 5AXAA 2FPIA 1QYWA 2C2YA 5A03A 2O2YA 2A35A 3KETA 3V2UA 4I5FA 3BMNA 1ENPA 2HMTA 4JP2A 2ZKLA 1JA9A 4RPLA 4E32A 1QYDA 3I6QA 1YQXA 3PWSA 5B4VA 3KYCA 1BVUA 3WLFA 3R0IA 2VHXA 4GX2A 5KVVA 1JDJA 3R6DA 3AY7A 1Y9EA 4C7JA 4RF3A 5U1PA 1N5DA 3VVBA 2P5UA 5EQDA 4JLWA 2X0JA 2DUUA 3LVFO 4IZIA 3W6ZA 5A02A 1LBEA 1LDMA 4B3HA 2X9VA 3NGLA 2R00C 1D1SA 3M1AA 3S2IA 4D46A 1NVGA 2JJYA 1J49A 5ER9A 2EKQA 5JLAA 3RFVA 1DJNA 4GX1A 1NHGA 5HWSA 5ILGA 4NZ9A 1JW9B 1ADCA 4HADA 4YVFA 1UXHA 2VOJA 3HWRA 3GDGA 3OQBA 4PIVA 2Y0EA 3E9MA 4A7PA 2W90A 4BO2A 8ADHA 5JMWA 1Y5RA 4PVCA 1GAEO 3WGTA 1ADBA 2PGLA 1H2HA 4Y67A 3QP9A 3MWEB 1U9JA 1PJ2A 1ZIDA 2I3GA 3MJSA 1XSEA 3NDRA 5HA5A 3HDHA 3PWKA 3WIDA 4CM7A 1U1IA 3ZW8A 1U8FO 2O4CA 4W7HA 1V35A 2B83A 3H2SA 4FIZA 4CLEA 1DSSG 3I83A 4ND4A 4WCFC 3SVTA 3LQFA 4ZQGA 1C0LA 4QT0A 4FQ8A 4H7PA 1A4UA 1WNTA 3DC2A 1R4MA 5KNLA 3L9XA 2J3HA 3U4HA 4HNGA 3PQEA 1HKUA 3B70A 4YA6A 1Q1NA 5DCUA 5G0UA 1IUKA 3OF2A 2OHXA 3F5QA 1JKFA 2B37A 3DDNA 4JJGA 3IP1A 3ZV4A 3JYQA 4WLUA 3S2GA 1GPDG 4O5OA 1Q0LA 3DAPA 1S7CA 3CEAA 4QFCA 2VHWA 4MVJH 1GFSA 3BHMA 3RUAA 2IYPA 3BA1A 4R5MA 2WYWA 4R1UA 4DC1A 3TL2A 3AUTA 3ICPA 1GD1O 1PQPA 1YL7A 1M66A 2NQTA 2ZK7A 3QHAA 2W2LA 1JVBA 5CPBA 2GZ3A 3JD1A 3AUUA 3JQ8B 5JSFA 1NQOA 3DMTA 5T8KA 3DZJA 1LDEA 2Q45A 4AG3A 1EUDB 2UVDA 3UVEA 1Q0HA 1O5IA 2OO5A 4W9NC 3ZWPA 3DZBA 4EZBA 3LT4A 1IHXA 1WDLA 1H93A 4XYBA 1WMBA 4WOKA 2PZLA 4Z3DA 4J4BA 4G81A 2C59A 2RCYA 4ZHSA 2NUAB 3JQGA 4IY1A 3UHAA 4UVEA 4YPOA 3ZHXA 3GDOA 3H5NA 4BNLA 3TL3A 2NACA 2JKVA 2VN8A 3NT4A 1E6WA 4N54A 3RIHA 4IJUA 5KJCA 3PLNA 3W4IA 3KM0A 4H15A 4D3FA 1HSZA 5EL0A 3D0OA 1U3VA 4X54A 2X1HA 4H16A 1O0SA 3VPGA 4D79A 4CL8A 1ZBQA 3AU9A 3QY9A 4DLLA 4M49A 3GC6A 2VNSA 3EUWA 4Y8VA 4UVIA 1DRUA 4MVJA 4URFA 2J5KA 2C82A 1ZW1A 1WZEA 2WMDA 1DC4A 2EW8A 1QKIA 2WM3A 1OI7A 2ZQZA 3INTA 1U4SA 3RUHA 5JYEA 5I9MA 3Q9UA 4Z0TA 4KUEA 1KEWA 1UAYA 4MDHA 3D5TA 2CMDA 2VYVD 4WGGA 3FNFA 3GGPA 4HFNA 4AJEA 3PXXA 2J5QA 3VZQA 5H81A 4JBIA 3HE3A 1QYCA 3D3EA 3K30A 1E0DA 1GPJA 1R0LA 4ITUA 5KVSA 3CUKA 3K6JA 3PFWO 1YL5A 4YQYA 4EUEA 4A2CA 3UCFA 2AG5A 3K9QO 3NTQA 4YAEA 3VZSA 4UEJA 1KC1A 1N7GA 2Z5LA 3WQQA 5FEUA 5L51A 4PRLA 4CQLB 3DFZA 3ZWXA 2LDBA 1TXGA 1KIFA 2ZTLA 4P38A 1YE3A 3GFGA 4Q3AA 4MKXA 1ZEMA 3O38A 1YO6A 3C1TA 1NVTA 2B4TO 4YYZA 2AEJA 1VSUA 2PZKA 3U9LA 1FXSA 3V8BA 5GMOA 3S8MA 2VTDA 1C1XA 3O9ZA 1WMAA 2JFHA 1JLLA 4IIVA 1E7WA 1EVJA 1KEUA 1MUUA 3A9WA 4DMLA 1NQ5A 3L6OO 1K3TA 2BF7A 2CNBA 4NNJA 1YB1A 2Y05A 3RROA 4DC0A 2YUTA 2P9EA 4PLVA 1XG5A 2AQIA 4MO2A 1ZMOA 3H3FA 3OM9A 1GU7A 4TQGA 3WDSA 3DEYX 3I5MA 3OJ0A 1OMOA 4U0KA 4YACA 4QO8A 4GMFA 2H5LA 4O59O 5F1OA 3WYEA 2HMSA 4BNWA 2B5VA 3H5RA 2FPIB 1ZMTA 5TLSA 1ADFA 4IIUA 3BMNB 3WR5A 1G6KA 1R4NA 1Q7GA 1E6EA 3UICA 5CG1A 4RL6A 2NVUA 4FJ0A 1A27A 4P22A 3KYCB 3U4DA 1E1KA 4W4TA 5JDIA 1GYQA 1UXJA 3DZKA 2VRCD 2X7HA 1YXMA 1FDTA 3PQDA 4OL9A 4W7IA 4Y9DA 4B7XA 4DPKA 3PHHA 1B7GO 2DPHA 3EDMA 4YTEA 1FK8A 1UUFA 3LU1A 1WXDA 3IIEA 4YRBA 4O6VA 1XHLA 3G0OA 2DPGA 2A4KA 2EIHA 3P5SA 4L0QA 2FPPA 4CMEA 4ZQBA 4BKPA 4BS9A 1GEEA 3BMQA 1CF2O 1VC2A 3TZQA 1PWXA 4XRRA 7ADHA 4MVJE 1KBZA 2NVWA 5DCYA 1T1SA 4IINA 1ENOA 1ULUA 3C7DB 5EMHA 1HF3A 4NJOA 3H3JA 3KXDA 2EKLA 4XA8A 4CLDA 4J91A 2SCUA 2BI8A 3N74A 4L4RA 1FDWA 2HMUA 2X0RA 1DHTA 2Y1EA 4XYGA 3MOIA 5KJ6A 1LXCA 2JAHA 2YW9A 1J4AA 2C5EA 1GV1A 1KOLA 1T1RA 3F9IA 1LSSA 3TDKA 1HTBA 4AJIA 3HSKA 4WKGA 1R4MB 2BGMA 4RQUA 1BDBA 1LDYA 4A0SA 4WLOA 4D43A 2VHZA 2D0IA 1DBVO 1WWKA 2Y67A 2R6JA 5ITWA 1EMDA 2W98A 2CDCA 5EIOA 2UDPA 1W6UA 1O94A 1P3DA 1U3WA 2NV6A 1ZK3A 1XCBA 2W8ZA 2OP1A 3BIOA 3IQDB 1LU9A 4MOWA 3E9NA 4BNFA 4II2A 2VTEA 1TB4A 4YAKA 4DXHA 2E82A 1E6UA 3WGGA 3UUWA 1H5QA 1NASA 1X15A 2JFGA 2B4RO 4GGPA 4FFRA 1T24A 4XB1A 2IEDA 3EW7A 3ZWVA 2WE8A 3COSA 1H6AA 2DM6A 2EKPA 2DFDA 3ZU5A 1N9GA 3SJUA 2X0IA 4B4UA 4PRKA 1K89A 2HLPA 2XXBA 5TX7A 1KY5A 2C20A 4YJDA 1U28A 3JQ9C 5GZ1A 3PIIA 1GUZA 3GHHA 1Y9AA 5L4SA 2G76A 4K6FA 4HX5A 5CEJA 2RH4A 1NPYA 4GVLA 2PTGA 4RZIA 4ILKA 3DBHA 4WEOA 1LTHR 4XGKA 3F1LA 4EYEA 1F8GA 2X58A 5AYVA 4YDRA 3UOGA 5JDCC 2J3JA 4FJ2A 3JQGB 3CMMA 3JYNA 4EDFA 3NV9A 3VPSA 2DFVA 1KVRA 3KYDA 3ZDFA 3KRTA 4NBTA 4RV9A 4NMHA 4J9UE 2FMUA 4HP8A 4WLVA 5AQ1A 5DP1A 3PP8A 3BHJA 3LC1O 2GF2A 3PTZA 1C1DA 1QLHA 2GD1O 5I9NA 3K5PA 4YQZA 4TVOA 2A92A 5AVOA 3B20A 1VKOA 4NU5A 3VH1A 1C3VA 2YDYA 3RUDA 2V7PA 1HDZA 3BXXA 1A7KA 1GUFA 3DZIA 3F4BA 2I9PA 4OIMA 4XQGA 4DIBA 1HZJA 3KYBA 2X9GA 1B8VA 4HFRA 4E2XA 1J5PA 4GPD1 1Y8QA 4O0LA 4RVSA 3BYZA 1RWBA 3ETEA 1NR7A 3GMDA 5COBA 1WP4A 3G1TA 1BXZA 3ITDA 3GAZA 5THKA 3WS7A 5L9AA 1YB5A 4XX0A 4AJ4A 4LSMA 2FRDA 3QVTA 1SZJG 1XA0A 3LT1A 4M54A 4BNTA 2NU7B 4K1LA 5BSGA 1YOVA 2DQ4A 5C7LO 3WX0A 3TFOA 5BNIA 1PJLA 3V1UA 1M6WA 4Z0PA 5A06A 2OUIA 3NTRA 2HK9A 3ZWWA 2WE7A 4PLCA 2VZ9A 3IS3A 1ZZEA 5L4LA 1H6BA 4GX5A 4CL3A 3K2BA 1FDUA 2GGSA 4EGFA 1LEHA
chains in the Genus database with same CATH superfamily
1XELA 5CNKA 3NATA 1RRKA 3QPWA 3L1IA 2IL1A 2P8JA 3H5VA 5JI3E 1OF1A 3I6YA 3O95A 4RF2A 3VJRA 2P1DA 1YFKA 1EAYA 1VI6A 2DY0A 3LT2A 3PUKA 4K9SA 5CIQA 1W35A 2B7CA 2DB3A 1L5HB 5DTIA 3QVGB 4BQQA 1T8PA 3W2TA 1WAMA 3MTQA 3QELA 3SHVA 4EB3A 4XJTA 3DA8A 1LKZA 1NU6A 3QE0A 3V3TA 3J80A 1LX7A 1WCWA 7AT1A 3QU4A 4IVQA 2YN2A 2GXAA 2I2BA 3HR8A 1YS2X 3TK1A 4IVRA 5BOSA 4IXDA 2B36A 1ZSYA 4YAIA 2IA5A 3A6DA 3BGIA 3F97A 2OFWA 3LECA 3RRYA 1JYFA 4AKSA 4M38A 2DMRA 3DDZX 1X19A 5IK2A 1LA2A 2HMWA 2CZCA 2OT3B 3QF4B 4GWLA 2R65A 1RZVA 3BWCA 4J9VA 1ML4A 2BFEB 1ENYA 4PYNA 1RRPA 1FDRA 4ZVTA 3SE0A 2H5IA 4CM9A 2ZEJA 3DPIA 3I6MA 5IT4A 1TEHA 3MLBA 1Z68A 3E4DA 3KCNA 1C3OA 3S2FA 4UNPA 3QMPA 4LPSA 4FSXA 1TZJA 3BB1A 1RYDA 4MUMA 4D4HA 3DHVA 3U6KA 2D2VA 3WVNA 5KYUA 3AL2A 3AM4A 1Z6ZA 3LDHA 4L1KA 4A8JC 3D6FA 4E30A 3JPYA 3B6KA 5IKXA 621PA 2VJPA 1BA2A 1XNGA 4IWNA 2WWHA 3C7TA 1XXHB 2QMQA 3GZ4A 1MH9A 3O90A 5ALZA 3TB6A 3TGWA 1Z39A 4FR2A 1N8KA 2Y0BA 1QCZA 2V97A 4YRAA 4CN9A 4KMRA 2NYVA 2XCTB 3WYBA 4BNIA 5K2MA 1XNQB 1M6VA 4B6RA 4QPCA 5IF3A 4TYQA 3EGVA 5ECGC 1ZYUA 4IMPA 5B3KA 2R85A 4MV1A 4ZQEA 2ARKA 2IE8A 3Q11A 3S55A 4DRXB 2OKCA 2P27A 4I0WB 2ZT6A 2QLNA 3SU8A 3ESZA 2BH2A 3THSA 1CWUA 5J2UF 3Q6MA 2UVPB 1UEIA 1OCEA 4M4SA 1FZTA 2OB1A 1GJRA 2JFPA 3W5SA 2ZSEA 3KKKA 4RFSB 3Q3EA 3N1UA 1L5OA 1N7HA 4R41A 1KE1A 2EZTA 2WD8A 1WUIS 5DN6A 4GH5A 3CVJA 1YFJA 1JVSA 2X77A 3GX1A 2QMUA 3KQNA 3URKA 1SCQA 1GVHA 3A4IA 4UQOA 3JRNA 1WB4A 3SC4A 3T9AA 3ZE9A 3MTJA 3RWOA 3BMQB 3WZMA 3GRPA 1RKXA 1TKRA 4JEIA 3MM4A 4RLHA 1HY3A 4G3XA 2XUFA 4AYTA 1N2HA 1PVDA 2GPWA 2QUJA 5TX7A 3ZK8A 2E6KA 1S96A 1KZGB 2ZYGA 4XFDA 1G8AA 3VC1A 3DDSA 1JPNA 3U3ZA 4NJMA 3TQTA 3VTKA 2PZJA 3L7OA 4PNZA 1QH8A 3UT6A 2DR3A 1NWHA 1IEVA 2GEKA 5E2IA 1X6VA 2V7GA 4QL3A 2F2TA 5I8ZA 4BWFB 3T7CA 3LG2A 5LDDC 4JL5A 1X7ZA 4R6WA 3IV7A 4HDNB 5AH0A 4ZQFA 1V0JA 4R1SA 2JCYA 3B6MA 3HJFA 1QZZA 1AKEA 1LJLA 2AYYA 2Z09A 4PQEA 3BERA 5DM4A 4D8VA 3IH5A 4CKBB 3FW1A 2AEMA 5IABA 3SBEA 3EBPA 3WNVA 4F60A 4LJ7A 3ZHBA 4RM3A 5TR9A 5IAJA 1N6RA 1XTJA 1E6LA 1QIGA 1Z18A 3E05A 4G01B 1UKVY 5L40A 3K6RA 1PFVA 2Z3VA 3BWVA 2O5VA 3LK6A 1UOPA 1F0YA 1KEEB 4HD8A 4MTLA 5FPPA 5F1YA 3TTVA 1SBYA 1JP7A 3QLJA 4YH1A 3AEKA 5A3VA 3UCEA 5JY6A 3NS7A 4XR9A 4WH0A 5IKOA 1W5BA 1SEPA 3LQQA 4L4YA 2AJBA 1GAWA 2D5BA 3KHKA 3Q98A 4LISA 3N53A 5EKUA 1VMDA 4L57A 1D1PA 1H3FA 4FDAA 4PGGA 4Q1CA 4ECAA 1B16A 3GW8A 5JVDF 5IT5A 1E1MA 2OENG 3CPHA 4KXLA 4KR0A 2ABWA 4DNXA 1HH4A 5KIAA 2PUAA 3K96A 2ODEA 3HBLA 3H1EA 3W5BA 4JI4B 3W3AA 4WEQA 4EVIA 3R3YA 5K3EA 1VJ1A 1ZM7A 1XQ9A 4FKMA 2O19A 3K4HA 1EFVA 1VGVA 3BJMA 5LJLA 1SEVA 3G7NA 3KZVA 4DKXA 1O08A 2WT8A 3BB3A 4GBGA 1N9GB 4X1OA 1N5IA 4N82A 2ZRGA 2O0MA 2D59A 2ETVA 4ZV4A 3TKYA 2GN9A 1E3WA 1K68A 2J4CA 4IOKA 1S2DA 4IOJA 2CV0A 2AB0A 1ORVA 4NV0A 1U5AA 3B82A 1X1RA 1JB1A 4NOMA 1T4MA 5AVKA 5K6AA 1PDWA 1AQ6A 2BFPA 2QZSA 1RCTE 1WU7A 1RMQA 2NPFA 1PNRA 1EFTA 1NUPA 3N2IA 3HDYA 1KE2A 3PEVA 4B33A 2C94A 1ZJ4A 3DBHB 4JXKA 3M5WA 4DL9A 4FNMA 2FDXA 3IVMA 5BWCA 4BO4A 2IIQA 4IIYA 3VV3A 3ZZTA 4B7ZA 4EYKA 4XWOA 3RWMB 3TR0A 4CMCA 4Y7DA 1XCPA 1T2FA 3ASYA 4BN5A 1E2BA 3ZTYA 4IDEA 4DYVA 2R0QC 2Z5FA 3BT7A 3G1UA 1ABFA 4R98A 5LU8A 2I3ZA 3PEUA 5GV7A 4DABA 3STWA 2OXFA 1VJGA 2H07A 1RAEA 1GDHA 3BWMA 3H7IA 3K0AB 1JTFA 4D9NA 5FJJA 1B8PA 3SYNA 4U2KA 5FR2A 1ONPA 2FDRA 4B3TB 2CFTA 1OWPA 3FKSA 5TQ2A 8LDHA 1C1DB 4ZKEA 3OP1A 3N2KB 2VYCA 3L6UA 4ZC8A 2ZSAA 3D8SA 3R6GA 2FSFA 4OSPA 2MSEB 4PFJA 2ZIWB 5HDBB 1SU8A 2FFRA 5DV9A 3RT1A 4BKOA 4ZICA 1Y3CE 1I8TA 2AN4A 5JR3A 1RKUA 1ZN8A 4FEGA 3WB1A 5J58A 1YGYA 2L2QA 3R3SA 1YS4A 2CZGA 3CCFA 2QPLA 2Y1LA 3U61B 2Q27A 4ER7A 2LWIA 2PH7A 3TBHA 1IB6A 1NU8A 4E0BA 5J4HA 1R8JA 2HUPA 3VDMA 3ZQKA 4DDVA 5JPIA 2B34A 1ID8A 2ENWA 2HA2A 1WG8A 4FMDF 1Z7BA 4C4TA 5ALDA 1XEXB 1IEWA 2PZMA 3LXMA 3BH7A 5JDIC 3RFUA 1KY3A 1XHFA 2ZVJA 4JLNA 3SJBA 1RWKA 1Z4OA 3G8YA 2G1UA 3TLGB 5H82A 3VU8A 4CUZA 4BAGA 1ICEA 2QZ9A 3IOBA 1YVEI 5TXGA 4I9GA 2GLTA 1L8LA 1V95A 3HCEA 1L9XA 3SJCA 5LZ7A 1UBSB 4MK4A 3PQ4A 4GUAA 3W1EA 3WBFA 3G8DA 5D8DA 3S40A 4FYWA 4N8SA 3CVYA 3KXPA 4MW2A 1YR2A 3AF2A 3R3JA 5KWSA 3TRDA 2Q0SA 4C04A 3V9AA 3WJ7A 4CMEC 1YJ8A 2Q0HA 4TSFA 5IHPA 1A8UA 1OFHA 3NHBA 2XTJA 5T41A 3ZV7A 2A33A 2J4DA 1K6EA 1N8NA 3EWSA 5HQ3A 4KBFA 3BTOA 3PNPA 5FBRB 4ZVQA 3T9DA 2RJ3A 3UWOA 5DU2A 3PFNA 4AY4A 5C8ZA 5ELMA 4REOA 3PIRA 3BSYA 2DBVO 3ZU3A 5JXHA 1NQWA 1X1DA 4HQ6A 4BATA 1UBCA 3LUGA 4U6SA 1CHNA 4D9CA 3MIIA 3ZHTA 2PZGA 5E6RA 1Z75A 4FBGA 2C1XA 1N4AA 3CO0S 3MPOA 1SCBA 4KDFA 1KVSA 3DMHA 4M3NA 3AHHA 3JAWA 3W90A 4DN6A 4KO8A 4ESOA 2QLBA 2CXQA 2XKBA 3GDFA 4PSDA 1KYWA 2CVHA 1ATZA 2ZDGA 3G23A 3GRAA 1T15A 4L5BA 5DHSA 1IUNA 5JFOA 4GKAA 1ZITA 2AN9A 2ZYUX 3UFBA 3LPDA 1TAQA 1LF5A 2IYRA 4EOGA 4IBOA 3LFHA 4WFIA 4XWGA 4MPJA 3UJ7A 2K6GA 1YR8A 2YHIB 1S2GA 1RD4A 1TZCA 1Q91A 3TECE 5JAMA 1HFKA 4L22A 2QSJA 2YS6A 3ZCVA 3KHTA 1H1TA 3K9NA 1FSGA 4PAOA 3TQHA 4NFLA 5H68A 3VSBA 1CDDA 1JKMA 1SBIA 4BYMA 1UBEA 2VT2A 5SY6A 1P4AA 3IA7A 1N36B 2IHBA 3IIKA 1YBAA 3LCUA 4EHFA 2AHRA 3S0JA 4ZEWA 3B53X 4A27A 1GKKA 4YUWA 2RGWA 1BXKA 4XPIA 1WQ4A 3FLBA 4RELA 1N6OA 5DKFA 3JYOA 1BFDA 2VAVA 3EEQA 4G0YA 1WXFA 4G8DA 2AKYA 2EBUA 2RKWA 1RRFA 4PXSA 5FOUA 4BYGA 5KCZA 4YI5A 2KBEA 5SYAA 4FEEA 4HJXA 5TQJA 1DXHA 1JEAA 1E9RA 2GPTA 3G3EA 4LXGA 4H08A 3AF6A 2D1QA 4IXTA 4FFBB 4YDSA 3AF4A 2FUG6 2OV8A 4XWAA 2OESA 1HE2A 1A7JA 4L50A 5G4KA 1KZ7B 5H70A 2JD0A 3R0QA 3K6SB 4YHHB 2IKSA 5D87A 2JIDA 1U28C 4R1MA 5FWNA 1RBQA 4AY6A 1FRNA 3PDUA 1ADGA 1H0RA 1VJRA 2BZ0A 3MBOA 3OFKA 3NP9A 3BMCB 2Q6TA 2PFKA 1OI2A 5G0WA 3IKVA 5THQA 2AYZA 4X0EA 1OYOA 2JVJA 5BUCA 5CLGA 2JIPA 1FNDA 1V2GA 1VYVA 4NBSA 1AGNA 1NQTA 5HIMA 2RGAA 2V9ZA 3BUSA 4H4EA 4BLUA 4G5HA 4WZBB 2FX3A 3I32A 2YS7A 1QZTA 5SZHB 2GTIA 4RY9A 2MYTA 4PW0A 3FPHA 2R97A 1JU9A 1I13A 1BN7A 1B0PA 4IG9A 4OYYA 3HCBA 5B36A 1D1QA 5CCDA 3FPLA 1KSJA 1TZKA 3DL4A 4DIFA 2H52A 1AS3A 1NBMD 2ZRBA 4OO3A 4OHVA 5JCJA 4PGMA 4CF4A 2XLBA 4JJ8A 4XI9A 1J2JA 1PZMA 1TGVA 1WSDA 1Y1SA 2ZRPA 3O47A 3MCWA 2ECKA 2IGBA 5CB4A 2XUGA 3GP3A 4H3KB 3CW9A 2LV8A 3ZHSA 1L4FA 2ZIZA 3WGQA 3TQQA 1WE2A 3AI3A 5COAA 2O7QA 4N48A 1C7JA 2MU1A 1W0CA 5JCZA 4EYQA 3I4LA 1LUAA 1P1JA 4G9GA 4LPKA 1W5FA 5J5CA 3DM5A 4OB8A 2H1RA 1SBTA 2WZQA 1E3SA 4LK2A 1KHTA 1MB2A 1E3JA 2COUA 2FQYA 2GXQA 4QFBA 1SQSA 4COOA 1BCRB 4K5QA 3ROKA 3RPEA 1MC5A 1UINA 1V7QA 4ALNA 4ZFNA 1A5SB 4EJMA 2RGCA 1N1DA 2FPSA 1O96A 3GLIA 1DXQA 2CHEA 3NTOA 2I1WA 4IWXA 1SCUA 5BUQA 5JH7B 5JT1A 2PGJA 5COQA 1PR6A 3LY8A 3BTSA 2F67A 3LAWA 3PUHA 4LQDA 1C1YA 2JIZD 4DDMA 2VWGA 4B3DA 3AUFA 3AYZB 1EPUA 3BXZA 4M36A 4XVHA 3OOHA 3UOWA 3G85A 1TUBB 1FP4B 4K7JA 5REQA 1E1CB 3FCYA 3PB3A 4ZVOA 3RI3A 2Z1MA 3DAFA 2CL5A 2IXAA 1ZVQA 2VPXA 4ACBA 5ALTA 3TUZC 1V1JA 3LL4A 4PZUA 4ZV9A 1T8YA 2F3UA 2ZB2A 4PSUA 2JAOA 1COZA 3DTVD 1A9YA 2R6DA 3HDJA 1UJ4A 2IUTA 3O4FA 5AJUA 1EWRA 1UBMS 2ZJOA 3EGCA 3NPAA 1EGMB 1UJ6A 1ORHA 3K1YA 4TMXA 4RS3A 2FFQA 2PGXA 5EZQA 3CPSA 1NP3A 1MZVA 2GN2A 5A7FA 5LVAA 3J7AC 3WB9A 3GFBA 4F45A 4FW8A 2FWBA 4ZARA 4JBHA 1X1CA 1PL7A 2WFLB 3N0TA 1QFZA 4PZAA 1E89A 1P77A 1AO0A 4NPHA 4OX9Y 3BD6A 1G5HA 3L0PA 5ICMA 2I6QA 4P3NA 3B1FA 4L3OA 4ZYUA 4LOAA 4FWTA 4QUGA 2G1JA 3L6DA 1FYXA 1KAGA 2O3SA 4GYYA 4LNAA 5HJ2A 4ZEOA 1PJZA 4O4HF 3ETGA 4HYQA 4X6UA 1Z0ZA 1JWBB 5AHXA 3V1NA 4HXYA 2XQJA 3B9QA 4F6CA 4JVMA 2JIOA 1DKNA 2Q1UA 3B3JA 2CEKA 3BMOA 1Q83A 1DUSA 3A4MA 4Q7KA 2E1PA 4YJHB 4HWGA 4D4LA 4LQLA 5IXSA 1OKKD 1W4ZA 3RIGA 3EXHB 3HRHA 1L5FA 3RTCA 2AD1A 1HM5A 2ZOSA 5TF4A 2OZPA 1R0SA 1KS9A 1UP4A 5FA8A 3VU3A 3RAJA 5KINB 1Y7LA 3GZNB 1RM4A 1WEKA 1X92A 4EG1A 5EWJB 2XODA 4Z7QB 1P9WA 3OU2A 2L18A 1GUAA 5B7PA 1UMCA 3EXIB 3L4SO 2XUHA 2O3QA 1QRUA 1X14A 2Y2UA 4RA6B 4HWRA 2QL6A 2VDKB 1A77A 3OD5A 4DA9A 4GD3Q 1UDRA 2CUKA 3JASB 4GRIA 4QHTA 4R68A 4BKUA 5IANA 2B61A 1U5BA 4IUDS 2BWJA 3AI2A 1AQNA 3CKYA 4UOQA 4ZMRA 4WLFA 2P6UA 5T4FA 1V71A 1WUJS 2BONA 4UM7A 3TQIA 3UGTA 3OE7D 1W52X 1WMDA 2PUGA 1FPMA 4MVJP 2UAGA 3PDJA 1K5PA 4AD8A 1I80A 4BXOA 4O4LB 4W82A 4M1ZA 3NT2A 4ZANA 3C4JA 3E6AA 1JHXA 4R4JA 3TZLA 3W77A 2EZUA 3DD5A 1A9QA 3G7UA 3PJDA 4IEFB 3RC1A 2K7FA 5K8UA 1WKBA 1NWCA 4V2UA 5LYYA 4RNDB 3HVRA 1U7XA 4EEXA 3THWB 2GEDA 1AY0A 1IE3A 2XE8A 1MD9A 3R7LA 4BEVA 1PKEA 4JBGA 4NOLA 3UYKA 5LIRA 1XEFA 1E5LA 1Z4MA 1HZZC 5CXXA 2BDUA 2C83A 2JGJA 3TQSA 2VZ0A 1UJ2A 2ZTMA 5ICGA 1NNEA 4JT9A 3WGNA 3QWIA 4ZCPA 4RORA 4FKZA 1FBTA 1R74A 5HKLA 2IX9A 2OV2A 1IZ9A 3EVAA 2HRQA 2W6IA 1G19A 3BZUA 4L8LA 1F5NA 5JRDS 1YNOA 3NCTA 1NPTO 1TM4E 4J2OA 4MWTA 3BQNB 4IJWA 4NAVA 3BQ9A 4WK6A 2D2FA 4YLEA 1D4ZA 4M1QA 1FP2A 3CNHA 1ZJZA 5B2EA 4DV0B 3GLIE 4OX9B 1WW3A 1KA9H 2Q99A 3H0EA 4H0CA 4PGHA 2WYVA 1CLEA 1R16A 3WGKA 3WQBA 3ZXSA 1OD6A 2EFYA 1KETA 2G67A 1QNLA 4G0PA 5A0VA 3FPFA 4EFNA 2P4EA 3MWLA 4TTQA 2BH9A 3M1LA 4HRXA 2IVZA 4K86A 3FNHA 1F6WA 2DP4E 3OZRA 1G41A 5L3QB 1UK6A 2BFDB 4QNNA 4F1WA 3CWQA 3I9KA 4CTKA 4YCMA 1H05A 1ZXXA 1S4MA 1KO1A 4FWIB 4HRYA 2LZ0A 1ECJA 5CDUA 4XWKA 1FDIA 1HC7A 1QLJA 3D8HA 2IITA 4EUFA 1ZRSA 3I53A 4DHEA 4PYOA 5JARA 3PXCX 2Y8EA 1GNLA 2MWMA 2X8AA 4DLZA 3D6AA 3ND7A 5AI0A 1P2VA 3FLEA 2GTHA 3E9QA 2QRVB 4BMNA 3K71B 2Z6AA 3U1BA 1IIBA 5C8VA 2FPKA 2G07A 3GLQA 2D1FA 3PA6A 3KHSA 1FQOA 2YZ7A 1X42A 2G4VA 2YRXA 3K5IA 4DA4A 4QC2A 4A91A 1FEZA 2VWQA 3A3KA 4HMPA 2AOXA 3HEMA 2IHYA 1UZLA 2PL3A 4IHJF 4C6SA 3JU3A 1T8SA 2C9CA 3OVMA 1VPWA 2RBEA 1OW3B 3KT6A 4DB2A 1EBUA 1MT3A 1TO1E 1AQJA 2H4ZA 5LD2C 1MO3A 1XXHE 2PS1A 4ZWNA 1UPAA 3G9UA 4QEKA 4V1CB 1CBUA 4N3NA 5I4IA 1BX0A 1P1FA 5KVQA 1SKYB 1XZEA 3FFBA 1M1XB 4MUBA 1Y5MA 1PNTA 1Y4SA 1ESNA 2FGKA 2GS9A 3O1JC 5L3ZA 1O4WA 1VFPA 2FR8A 2PTHA 3LX6A 1ZG3A 4D9FA 4ES6A 3T1VA 1O89A 3QKRA 2RGXA 3B7GA 3GB9A 1UEJA 1UZNA 4GLBA 3ZKAA 1B26A 1XCJA 1Z2AA 4DGQA 1V41E 2XT6A 3DE0X 4XJVA 4EO4A 1NW9B 5BNZA 5JWRA 3KELA 1Z0AA 3F5DA 4K87A 4TMKA 3FI9A 5D85A 2ECFA 5EQJB 5EHNA 3LY9A 3ABRB 3EZYA 3AILA 1M6HA 1U8UA 2PK3A 4N12A 2YVLA 3SYKA 1CF4A 4ZCIA 2LE0A 3DFUA 3TUIC 4GE3A 5F2EA 3R3WA 1PTKA 3RSCA 4BNYA 3DBRA 4L07A 5AIAA 3FMGA 2ACVA 4QEDA 1P18A 3L01A 3VZDA 4R54A 1W8DA 4J16A 1NXTA 1QQ6A 4HAYA 2LCQA 4MYHA 3T41A 1A8PA 5DM70 3M83A 2O2EA 4OP1A 2GVDC 3O5AA 1RTTA 3G02A 4IIBA 4KV9A 1P6UA 2Z2YA 4ND6A 2J8ZA 3OIWA 1JDTA 1ODJA 3KSMA 2DHDA 3G2LA 3WXMA 4C4OA 3EY4A 1YQGA 4J7AA 5IS2A 3PTAA 4M8NE 3BF7A 1YE5A 3QVOA 3OIGA 3PT5A 4ARZB 3C43A 4W5OA 3FPAA 1JDBB 3KU4A 5FOTA 5D1NA 1TC2A 4M9RA 2AQKA 1HFWA 4FINA 1ZAKA 3VPBA 3ZE8A 1DJPA 4B45A 1Z6XA 3QXXA 1Z17A 3PQ8A 4RVNA 4OI1A 1UKCA 1JWLA 2NSDA 1E4YA 2QRQA 3E3OA 5DBHX 4FDVA 1DRWA 2J30A 2W6QA 5A6SA 4PYKA 3VR6A 4NC9A 4N3AA 3HO1A 3AOEA 4UM9D 1FOEB 3DCNA 5KYNA 4CMGA 1NBOA 4IRUB 1PG2A 5G4LA 2XSZD 5TPZD 1PX0A 2HMVA 2V7QA 3Q85A 1BH2A 4P4LA 3MEQA 1XTTA 1UAAA 1SIBE 3L7MA 2HA7A 2PZFA 4AF6A 2C2GA 2YX1A 1LFDB 3L49A 5JZMA 3T7TA 1K1EA 3UC5A 3NHWA 1V37A 5EWMB 3DHNA 4A16A 2O20A 2VXOA 3PYMA 5FWAA 3S8EA 3C87A 3CTPA 4I6GA 1J9ZA 4YRJA 2PMFA 5HKBA 4KC0A 2HCJB 4AKIA 2XYGA 5KAMA 3AV3A 5JU6A 4G5RA 1GZ7A 5B5SA 2O57A 3SS9X 2H2AA 2NU9B 4QULA 1W75A 2PJDA 4Q9HA 5ETJA 4JITA 2X5KO 5KSPA 1L6IA 2H08A 3U1VA 5ALXA 2HRDA 1BFUA 3TNYA 4DCNA 1VRWA 4RVUA 4TRRA 3IAAA 1WPRA 2B69A 3QQPA 2OZKA 4WKNA 5DBFA 3E48A 2MHCA 3E5MA 3BEOA 3RFCA 5EVJA 4WVLA 3RE1A 1QHNA 2R11A 5GADl 2UUAB 4JFAA 4JJFA 3HBFA 1B3BA 1Y5NA 1S6YA 3TCNA 3E9RA 1CZUA 1Y8AA 1MX1A 2RMKA 1PFGA 3ZS8A 2WT9A 4U7FA 3TJZA 3SVLA 1MJNA 2VJOA 5EP2A 1PJTA 1U2DC 4HMQA 2ZRFA 4EHLA 2ZE6A 2DC1A 4L8WB 4ZZ3A 3HJTA 1O95A 1NVXQ 2F7SA 3AGPA 1NUHA 4AMBA 5ISMA 1T2UA 4B31A 2CUNA 2VDRB 4A36A 1RI2A 1BDHA 3QEBZ 2AOTA 3FTPA 3L4EA 1PFUA 4FHGA 4IG4A 3UB2A 3L93A 1G2QA 1CS0B 3CF4A 2ESRA 1EFRD 3M9LA 1UMBA 1YZNA 4LNUB 5M04A 5AO9A 2PKQO 3FVQA 5AKKA 2Q8QA 4BMDA 4JB0A 3W3AH 1U9IC 4RTQA 2QUBA 2YW2A 5D00A 2W6NA 3PGJA 5B2FA 2IV7A 4KODA 4YAGA 1RDFA 3DOOA 1V4VA 2FWJA 4BFYA 4NMXB 2GZMA 4EY7A 1QNFA 4YMIA 1E2EA 1EDOA 1KVTA 1IY8A 1JEQA 1QE5A 1VJDA 3GMSA 4O0MA 5AK5A 2O52A 3C1AA 1JFLA 2YBDA 1FUUA 1TCVA 4CFZA 4QQKA 1IC6A 1G5PA 2G83A 3KVOA 3Q6IA 1FUKA 5ALLA 3KFLA 1DKQA 1KJNA 2IDMA 4G56A 1OXVA 4JIMA 2I29A 4PNHA 1HXHA 4RD0A 5J9FA 3T5BA 4ER6A 5K3OA 1Z0IA 2CNKA 3TRHA 5GIOE 5AUOB 3F7TA 4L6CA 1QAMA 1ZGHA 2OFXA 3PE4A 4B47A 4EBFA 5AFSA 2X86A 2DT8A 4HH3C 2I03A 4BNXA 4MDFA 4WJLA 1JKIA 2EFCB 3LQYA 4JB2A 2C7BA 2EGHA 3L0ZA 2WVHA 3NAQA 1H0KA 1JWAB 1J21A 3TLAA 4R8KA 4B09A 3G0HA 4NYIQ 2WWTA 4TWZA 3AIMA 1GQOA 4HFMA 4PZYA 1L1RA 3UQYS 3WLAA 1DAMA 1U2RA 3KTOA 3KJHA 4JUAA 4EPXA 2I2AA 4CXMA 4WUTA 1DP4A 2XOEA 3ADPA 3C6ZA 4QRIA 3HWX1 2PJRA 4B6SA 1UBLS 2XKAA 8ATCA 5KDOA 2IYYA 2C78A 5K2OA 1G21A 1ZNZA 1P2UA 2GJAA 1I3LA 3BQMB 4IF6A 4JELA 1LRJA 3DZCA 3STUA 5FWXB 3EZLA 2NZXA 4DJFC 1Z6GA 2ZJ1A 3AJ9A 3IV9A 5J63A 1I7LA 5I3ZA 4AUNA 2BRUC 2WM8A 2IU4A 3NC1C 4IUBS 4NH0A 5FCDA 3WWDA 4D9IA 4Q7LA 3EFEA 3OJXA 2OK7A 5H83A 5KTTA 2ZTUA 3FUWA 3HS3A 3FWZA 3OU6A 4KRYA 4B73A 4CCWA 4IZ6A 1Y4ZA 4IDCA 1VJ0A 2BL4A 1AZTA 3VDNB 2LD4A 5BQXA 5IK2D 2H0AA 3Q8MA 2A3RA 4BY9E 3NIWA 3ZWOA 4JQCA 3X43A 1DAHA 2PUTA 1X74A 3KJEA 3KOZA 1NKSA 3UAYA 3EPHA 2JIQA 4CM9D 1G55A 5BVHB 3C3AA 3VH2A 4CIDA 1BX1A 3PFCA 3IVAA 2Y3IA 3HCRA 5D84A 2ZXEA 2JGAA 4BDSA 1V2HE 4LUCA 5I7RA 3U31A 1OTXA 1Q0QA 2J9FB 2ZSIA 3SSOA 2XF8A 1XMSA 4QDZA 4F56A 2IODA 3L4BA 2WSSA 1WTCA 4PG8A 4G0WA 4NEGA 4HDCA 4NULA 4A1FA 1E1LA 3KQKA 3SXPA 4IGIA 3LK7A 1OT5A 3N75A 5JQGA 2Z2ZA 1B00A 1KARA 1ULSA 2PY6A 4XASA 3T5GA 4LZWA 3URMA 3DKVA 4L9AA 4HDQB 2J08A 1L7QA 4FFWA 3N0WA 1V5FA 4TSRA 3DWFA 1RPTA 2XDWA 1X8KA 3I58A 1C14A 1G4AE 2PFSA 3V7NA 4DLYA 4DRZA 3I4CA 2C04A 1EXNA 1O1YA 4W1PA 4D9GA 5T57A 5DPMA 2H31A 2HWXA 1B42A 3H9QA 2A5JA 2QTAA 1P9NA 1J8QA 3NHPA 3DXFA 4E5VA 1H4SA 3CS3A 3H1AA 1U0EA 3C6YA 4IV0A 2DE0X 3Q12A 2QLLA 4KGZA 3K92A 2J5XA 5ERXA 5KQSA 4NENA 5DN6D 2P9JA 4L8VA 3RC7A 1RFLA 2A30A 4D7AA 4B35A 2BF4A 2PX8A 4KAAA 2IVFA 2A8YA 2ZSHA 3DYIA 4D98A 4FI3C 4BFTA 5KYWA 1V8BA 5AJHA 4LTMA 5CA1A 1J39A 1QYXA 2NO5A 1FLDA 5T6BA 1U3UA 3VSEA 4EB6A 1CZLA 4F5EA 1WY5A 2BE7A 2HV9A 3BXOA 3U3MA 1EFPA 3INRA 4QECA 4XIJA 2NUPA 2J0EA 1M6NA 3KT0A 4CI0B 2HJ9A 1T0BA 2EBWA 1MDBA 4HQRA 4HTFB 4UFOA 2G80A 3L7YA 4MZDA 1VIYA 1ZEJA 3V46A 2HHCA 1ECFA 4G36A 1JLKA 4M9XA 2WKSA 3PEYA 2PD3A 4F8YA 1UQTA 1R9NA 3FFTA 3H17A 1G63A 2A9FA 4D4MA 4DYDA 4R0MA 3PR1A 3RVLA 3LOPA 1T8RA 5DYIA 4CKXA 5CHEA 3SZGA 1OH5A 1IK4A 5C4MA 4P3KA 2BGJA 2C5SA 2XGSA 3WIEA 5KU1A 4WXMA 2NTYC 2YQ4A 3OZAA 5I9BA 5K0TA 1M74A 2QQEA 4X9XA 3WDMA 3SYTA 1XWIA 4XOIA 2VPIA 3MLAA 3WB0A 5E3HA 1TK2A 3EWNA 2AKEA 2OL4A 1YS6A 1FMJA 1R2QA 2SNIE 3QELB 1RYNA 2ZROA 3FA2A 4MW1A 1Q3HA 2Q4BA 1C7FA 3UZUA 1SOWA 5CVVA 1NM5A 1AJEA 4YIHA 2Y1WA 4CR6A 2X3YA 5LXTB 1WVIA 3EOZA 3PGVA 2QM3A 1FLAA 4RWZA 4PYRA 2GEVA 4W1RA 4HV4A 1LLDA 3OHSX 1IWBB 5GOZA 3N8IA 3QBTA 3VZCA 1ZOIA 1PJ8A 1VG9B 2P2ZA 3ETCA 4BEBA 3HUFA 5DNEA 2I54A 2XQIA 3W3AD 3T5PA 3E1SA 5EVCA 4RYLA 4HUTA 1RSZA 4RKFA 2GA9A 1N5OX 4U7WA 3T7EA 2F64A 2HNAA 4ZOEA 4ZAGA 5CD9A 3R4CA 3Q8WA 1CQIB 1QDEA 4RF4A 4UUOA 3BF8A 1A9XA 4DF3A 3USES 2AT1A 2AMFA 2WYOA 4ZCMA 1G9TA 1U65A 4G0UA 4HDKA 2D5CA 3S1LA 4BU0A 3CRMA 2EXXA 1N6IA 3NEJA 4R1TA 4YS6A 3TMYA 3PTLA 1L4GA 1FVHA 3AK4A 4BFSA 1UM9B 3RVPA 3HTXA 1JAXA 1R9MA 2UYYA 3DOIA 4OQQA 2PIDA 3MJTA 4C21A 1L5SA 2X0DA 1I1HA 4EP1A 5ANRB 1YU6A 1C4WA 4EG4A 3E8SA 3FVWA 4HAIA 2VTVA 2Z5VA 3WA7A 3T0GA 3V4OA 2QMYA 2C8KA 3C6BA 2D1YA 3C7CB 3DT6A 1Z88A 4P7BA 1Q77A 1HQDA 2ES4A 3AFNA 4RV4A 5TEVA 5AUNB 5B4TA 3KQHA 4EUHA 1I2DA 1BDJA 5F2OA 4GQAA 4U1RA 1XVTA 4KXVA 2VNHA 2R68A 2DJ5A 4B32A 2XGOA 4LHYA 2A0YA 5GONB 4E5NA 4OHYA 3FKSD 2BKVA 3ONEA 4UULA 3A6GA 4NBKA 3KZNA 4TOIA 1T9ZA 5BN1A 4PTZA 3ZD9A 2G06A 4DVJA 2GRUA 5IHXA 4P7KA 3RJZA 4M83A 3W8NA 1TA4A 4H7FA 2HPZA 3AJRA 4QDTA 2PS0A 5JBQA 5IBCA 4RTJA 1KSGA 2I3AA 3NHJA 1GA1A 5DNDA 6NULA 4Q4HB 4ZOCA 3G49A 1TAGA 1ZXBA 1XE3A 3K0FB 4GYJA 4LCBA 4HR7A 4QQRA 4DM3A 3PS9A 3MCVA 4V38A 1JE1A 1KKLA 2G5PA 5AUQA 3CZPA 3WLKX 5BW4A 2V9CA 3DVLA 3L8MA 1DQNA 1LS1A 3TZCA 1QPZA 4ZD6A 3C70A 4E4RA 4XQ0A 4BFWA 4MRMB 5D7NA 2X42A 4MQBA 1FXWF 5IDWA 2QJWA 1PYOA 2FOXA 2P3SA 4L0CA 3EQ7A 1YQQA 3JALB 3M6XA 5CRIA 3DV0B 3UHOA 5HYVA 3CRQA 1TX4B 1AB6A 2GFIA 2VRCA 1GQQA 4IMRA 4BQRA 1W85B 1GUYA 2NTJA 3S7TA 2IF0A 3DQPA 4N5IX 3S28A 1OR8A 1V4BA 1XDDA 2C5AA 4N40A 3IKLA 3A3OA 5AP9A 5JWHA 1CUJA 1XRPA 2J3QA 3JQ7A 4BC1A 4DMRA 4FU0A 1AKTA 3WGLA 1ZL0A 5TSDA 3D1LA 2C2ZA 3BK1A 5E3JA 2J3LA 3A9TA 5JXIA 3U37A 1E3TA 5B4UA 2ZM5A 1NBWB 2PSDA 1DDOA 5C7YA 1RC0A 1BMFA 1D04A 4TSFD 1PBTA 3VBCA 5KWJA 4JVLA 1JXMA 2PX3A 5F7JA 1NV8A 1PKXA 3ZWCA 2F1HA 4MR8A 2YBEA 3LBNA 2O48X 3QPVA 3R4VA 2Q3EA 2YKGA 4M98A 2AFIE 3ADKA 3VAZA 3VA7A 1PZHA 3CUUA 3VDXA 4CIWA 4N65A 3V4FA 1HL3A 1VSVA 2FSVC 2LUOA 2ISCA 3LW7A 3PWZA 3JVVA 1XEWX 3HDTA 4MAAA 1PWEA 1VHQA 1X70A 2AI2A 2RJOA 3FZQA 3TGLA 2XA9A 5CH3A 1R15A 4N5MA 3ANLA 3DL2A 3OZSA 4OF4A 4RAOA 5AHRA 4DLRA 3BGSA 5F5NA 1C3LA 4H6WA 1AQUA 2ZRKA 1IZZA 1GTRA 3HEBA 3TTYA 1DTSA 5BWLA 4X45A 4HPWA 1XU9A 1JEEA 3CXUA 4PVDA 4S2EA 1XN1A 3LH5A 2ZUSA 1L5QA 3KZMA 4UBJA 4DHWA 3OIUA 2WTMA 4N7RA 2B92A 5K0FA 3I2YX 2HA6A 2O3JA 3CLRC 1G5QA 3U40A 3SR3A 1F8FA 4N49A 3RC8A 1D1TA 2XI4A 3L7AA 1ZD5A 3KQQA 3H16A 1UDBA 2XB4A 1OTHA 2ZWOA 3GVPA 2YH2A 1GCAA 2CE2X 5B3JC 5JH7F 5BURA 1U0SY 3QXGA 2ASEA 1KSFX 5LMNB 2UYGA 2WWRA 1JQJC 3KTAB 3QKUA 3BKXA 3SSAA 4RACA 1OXSC 1HLFA 1L4YA 1ZA1A 3NXKA 4QU8A 2IZ5A 2X9LA 4HLQB 2G82A 2IXFA 1P9RA 3ZI4A 3ICQB 2JGNA 3B5IA 1VLMA 4KP7A 3I9NA 4WBNA 3IELA 5J4VA 4MJLA 4V0RA 4U2DA 3W4KA 3IURA 4TZTA 3MWDA 1TCAA 4Y6SA 1NJSA 4MQ4A 5IJWA 4N4AA 4CV3A 4OAOA 1W49A 4DGSA 3FJOA 4OJKA 3Q41A 1HRDA 1AGRA 1YULA 1Z74A 3EXFB 4LDQA 5ALVA 4U3JA 3RYTC 5EI5A 1ITZA 4C20A 1SKYE 1VKHA 3SPXA 2B35A 3FRJA 2JI7A 4IDHA 2AUMA 1AMUA 4REMA 2GBGA 5IVDA 3W4JA 5BXYA 5CBPB 4DBZA 1L3IA 4X91A 2CLOB 4UXJA 2DHQA 1PZEA 2FMIA 1YDWA 3JATA 3DB2A 2G88A 4OL0A 1H2RS 2F55A 5JCJD 4MPRA 4MWEA 1S3FA 4UZSA 2QD2A 4NQZA 4RADA 5J4LA 2VF5X 2W4IA 4C4RA 3E7FA 3FY4A 5AVRA 1FFSA 3DR3A 3G8CA 4OUKX 4Q34A 1CE8B 2ZYAA 3T9CA 5A2GA 1KDVA 4IQ4A 2W2XA 2Y1XA 1RE1A 1ZI9A 3RYCA 5DNUA 1K75A 1CERA 2W2OA 4L7VA 4MQLA 1R4ZA 4Y9SA 5FLXA 2P6PA 4TUYB 3G2MA 1QGUA 4Y2TA 1GSOA 1K63A 4JOSA 4C7MA 1AZWA 1OB5A 4BCBA 3L1JA 2QTCA 5CB6A 3DDOA 4ZC1A 2JNWA 2PSSA 4UAJA 3ZJUA 1EDDA 2HWYA 1CP2A 3N2GB 4WA8A 1G5RA 5JTUA 1NJ1A 1VGRA 5DCWA 4WCFA 1CRPA 2BI4A 4IICA 1OGIA 3VU9A 1EHYA 5IX8A 1C8VB 4KHPB 3LUAA 2CJWB 1VB3A 2V4ZA 3HYLA 1BTOA 1MPTA 4GT1A 1NYTA 3ZC3A 4IWYA 1XCGB 4FX5A 2GDZA 1EP1B 1L7AA 1C30B 1CY8A 3N7AA 4LV8B 2HAEA 3KKLA 1NUUA 1R50A 3IJEB 3O75A 4LSGA 4RK7A 3JAWB 4UTNA 4TXJA 2REXB 4OLFA 2X23A 2NU6A 5EUMA 1CETA 1LBSA 1XPUA 2I4RA 2XYHA 4O4LF 1GR0A 3W1VA 5D6OA 4HSEA 3DOCA 1IXSB 2FR1A 1YWGO 1OXXK 2NTNA 4F4FA 2V0CA 1J2UA 2YFYA 3GAMA 1PT5A 2G1AA 3OQHA 5AI6A 3ZDYB 1EXMA 5J47A 3QMWA 1T3GA 1FDOA 3QK7A 3I2HA 4LWOA 4NX2A 5B57C 1SBNE 5TF0A 2HT1A 2OSVA 1X7GA 1K08A 1WU8A 1ZUHA 5CH5A 2VI5A 4HB2A 1FFEA 1SXJA 5T6MA 3U4MA 2XDQB 4QSHA 3UMBA 1G5TA 1HURA 4AJKA 3U5TA 4RPHA 2O07A 1INLA 4BGDA 2YVAA 1VL0A 2OFPA 3FDZA 1OC2A 4XPIB 2QW1A 3HM2A 5FOQA 3DULA 3U7FB 1NMQA 1A8HA 2VK2A 2M98A 2XAAA 3ROPA 3A28A 2XLCA 3Q9SA 1BEUB 3ZJYA 1AA6A 3VR6H 3TCKA 4DRYA 4HDSB 2QUZA 1VIMA 4FOTA 5JSUA 1D6JA 3HM9A 2XOKA 4NECA 1ISIA 3EMBA 3Q9LA 4QU5A 5J1TB 4FILA 4JP8A 4R1NA 4RQBA 1LY1A 2CCJA 2W6CX 1KBOA 5F4ZA 4PSKA 4GI3A 3W2HA 5HRCA 1IJBA 1H85A 2XZOA 3PHGA 4D41A 3KPYA 2A7QA