2SCUA

A detailed description of the structure of succinyl-coa synthetase from escherichia coli
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
286
structure length
285
Chain Sequence
SILIDKNTKVICQGFTGSQGTFHSEQAIAYGTKMVGGVTPGKGGTTHLGLPVFNTVREAVAATGATASVIYVPAPFCKDSILEAIDAGIKLIITITEGIPTLDMLTVKVKLDEAGVRMIGPNCPGVITPGECKIGIQPGHIHKPGKVGIVSRSGTLTYEAVKQTTDYGFGQSTCVGIGGDPIPGSNFIDILEMFEKDPQTEAIVMIGEIGGSAEEEAAAYIKEHVTKPVVGYIAGVTAPKGKRMGAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGEALKTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (SUCCINYL-COA LIGASE)
publication title A detailed structural description of Escherichia coli succinyl-CoA synthetase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase
total genus 105
structure length 285
sequence length 286
chains with identical sequence D
ec nomenclature ec 6.2.1.5: Succinate--CoA ligase (ADP-forming).
pdb deposition date 1998-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00549 Ligase_CoA CoA-ligase
A PF02629 CoA_binding CoA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 2scuA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2scuA01
2Q3EA 5U1PA 2W2KB 3VVBA 5C7OO 3L9XA 1U8XX 2CVQA 4R69A 5EERA 4J3FA 3VH1A 1B8VA 3PIDA 4HNGA 2B5WA 1YQXA 2FSSA 4QSMA 1JU9A 1YO6A 5COAA 3JCZA 4AJKA 4AICA 4MVJG 3I23A 4D0SA 2HMTA 1Q0QA 4WE3A 4IXWA 1F17A 5T6BA 4O6VA 3W6ZA 3BHIA 4TRRA 4HNHA 5DDIP 2HMVA 5IZCC 3U4CA 1ZMOA 2IODA 5A05A 4XQCA 4PG5A 1BHSA 3E5MA 4KWIA 4R4JA 2AEFA 4E5PA 3UCFA 1GR0A 8ADHA 2VHXA 1R16A 4RL6A 1X7DA 2V6GA 5F5LA 3RUEA 1PZGA 1J0XO 3I9NA 3PIIA 4J0EA 4BL5A 5A3JA 1KEPA 3JQAA 4OXNA 4KQXA 4XYMA 1ZFNA 3FF4A 1U2DA 4BMSA 3SLGA 2ZYDA 2SCUA 3IUSA 1DSSG 1ID1A 4XB1A 1PJSA 4Q3CA 3ENKA 2GDZA 3GMSA 1F8FA 2X23A 4YWJA 3G3EA 3HZZA 2VYVD 2J5RA 4FR5A 1JTVA 5JCXA 2BFMA 4BNNA 2BGMA 1Z74A 4P4GA 3JQGB 5COBA 1HSOA 4MVJF 5CG2A 5BNIA 3F46A 1LRKA 4EGFA 1IULA 1E7SA 2D5AA 4XKJA 4YRDA 3DMTA 4NFYA 4BNGA 2O7QA 2E6UX 4Z9FA 3I9JA 2IYOA 2YDYA 3H7AA 1P1KA 2EGGA 2OP0A 1ZZEA 3MOGA 3JD0A 2X0JA 3WX0A 1LSOA 3AK4A 4FBGA 3WG9A 2R00A 4OAQA 4XIJA 1ZXLA 1MUUA 4R5HA 4J7UA 4CM5A 5KJCA 1W4ZA 2R2GA 2WYWA 3ITKA 1XQ6A 2EIHA 1DC3A 3JQFC 4M49A 5IZ4A 4WLVA 4P8RA 4R41A 4FOOA 3KVOA 4CR8A 2NTNA 4PLWA 4YB8A 4J7CA 4P4NA 1VKOA 3VZQA 1PEDA 3JD1A 2PWZA 4HX5A 5JC8A 2PD4A 4Y6PA 4YJGB 5DN9A 1BW9B 5A9RA 3Q2IA 2DTEA 2CY0A 1EQUA 1NR1A 3H9JA 4U8GA 1CF2O 3NEPX 1BGVA 2NUAA 1GEGA 4E32A 2O2SA 3MJTA 4C7KA 3OEYA 5K9ZA 3HADA 1EDOA 3ZWMA 1QRRA 4FJ2A 4MP6A 2BD0A 1ZO8A 3GFBA 2NVUA 3ITDA 4CMJA 3AM5A 4GLOA 4AJNA 5DP2A 4UREA 3MWEB 2Q4EA 4CV1A 4E5KA 2BH9A 2CF6A 1WZIA 2OO5A 1ONOA 5JMWA 4D0RA 4GVXA 1LLDA 3W4IA 4J4BA 3KO8A 2YDXA 3VDRA 4GKBA 1BTOA 1ADBA 2D5CA 1X13A 1DEHA 2FRDA 2DBVO 4MVJI 4L4RA 3ZWWA 5TNXA 3RU9A 5L7WA 1K2WA 5T57A 4ND4A 3FN4A 4L0QA 4D3SA 1HEUA 1ZK2A 4PLYA 4DLLA 4NBUA 5JFOA 4AVYA 3DAFA 1I2ZA 2CVOA 3I52A 2CVZA 1KVQA 4OM8A 3WMXA 3EW7A 4BNUA 2YHIA 3L77A 5B37A 5KVSA 1R6DA 3VTZA 4BGEA 4PLCA 4BKQA 1IB6A 1ZEJA 4BNXA 1YBAA 2QRJA 1CERA 1J5PA 3JQAB 1I30A 2UVDA 3O4RA 1P0CA 1A5ZA 4ZA2A 4N5NA 4NIMA 1PU2A 4BB6A 4YPOA 3H5NA 3JYNA 2JD2A 3BHJA 1QLJA 2VT2A 3I9KA 2SCUB 3RIHA 3UOGA 5THQA 3UCEA 1E7MA 3D4PA 1NBOA 4U6QA 3PZRA 4CMBA 2FHSA 3ENNA 4NJOA 2DVMA 4L9RA 3D3WA 5CDTA 3LF1A 1D3AA 4NQZA 3HB5X 4Q39A 1YBVA 1G0NA 4AJPA 4RZHA 4KDFA 1NAHA 4CM8A 3O03A 2CMDA 5KJFA 3AY7A 3WBFA 4JX8A 1SCUA 3DWFA 4I5EA 3C7CB 2ZB4A 1HDZA 2VOJA 4EJMA 2UDPA 1LRLA 3IIEA 1LDMA 4OQYA 5EN4A 1SOWA 1M66A 4BMNA 2P5YA 1SAYA 1ZSVA 1YQDA 3H3FA 4YT2A 5K0ZA 3ZI0A 1PR9A 1LDNA 2AW5A 1NP3A 5L53A 3GFGA 5I8WA 4DREA 3GGPA 3GN1A 4II2A 3V2HA 3M2PA 4YQYA 3U62A 2Z1NA 4UVEA 1TXGA 1GL3A 2OL4A 2W90A 3V5NA 3PLNA 5TIIA 4QEDA 1E0DA 2P68A 2WJPA 3D5QA 3GGGA 2DPHA 3R0IA 4YJFA 2BFPA 1I3KA 1NFQA 4JJFA 4JP3A 3W8EA 4E3ZA 2NUAB 3TOZA 1DC6A 3TOXA 3T4EA 4YT4A 3PRJA 5CFZA 1PJQA 2D3TA 2NU7A 1B15A 3E9QA 3L4SO 1HWYA 3MJCA 3TZCA 3GDOA 4AJOA 1PJCA 2NVUB 4TRJA 4KUHA 5EESA 4YJHA 1LA2A 3PVZA 3QWHA 4WEQA 1UDCA 2DUUA 2D59A 5C5IA 4E2WA 4RPKA 4CLHA 3LSYA 1XQ1A 4NG5A 4JROA 4ND5A 3UN1A 1DRVA 3PJEA 4ALJA 3OICA 3TPCA 1UXKA 4I9NA 3W8FA 3HSKA 2Q4BA 2YUTA 1GZ3A 1EVIA 1Z7EA 3D64A 2NTVA 3FNGA 4XEHA 3B20A 3JD4A 3I1JA 3K31A 4XGNA 5JDCC 3IS3A 5IDXA 1NHGA 3IAHA 4YT8A 3VZRA 4ZQGA 3PEFA 1Q0HA 1DLIA 1FK8A 1PR3A 4XX0A 4FGWA 1XEAA 3F5SA 4MIOA 1HZJA 5JMPA 1OOEA 4J1NA 4JJGA 1H9BA 4M89A 2NU6A 2J8ZA 5ICSA 4Y67A 2YHIB 1MLDA 1ZMTA 2EGHA 4Q3EA 5AXDA 1YL7A 3V8BA 4CMKA 1VI2A 1TT7A 4CQMD 5L7YA 4DQVA 4DPMA 2AQ8A 4YT5A 2X6TA 1LBEA 1PL8A 1YONA 1LX6A 5L51A 3GUYA 4FCCA 3SVTA 1E1NA 1YB1A 2FR0A 3DOJA 2NSDA 4CR7A 3LC2O 1NVTA 4YDRA 1XIVA 4RQTA 2NU8A 1UAYA 3GPIA 3D3WB 3ANNA 2VRBA 3I9OA 2R6JA 4LCEA 2Y66A 4A03A 4UEOA 5L4SA 1HYGA 2J5KA 3H5RA 4BO9A 1ADFA 3WQSB 2FPPA 4CM8B 1JKIA 1DRUA 5ES3A 3D4NA 1SZJG 4JCOA 4E21A 4EJ6A 1SCUB 1DJQA 1YRLA 3TF5A 3WGYA 5JC1A 1GQQA 2FN7A 4Y9DA 1WMBA 3BMQA 4KZPA 3U9LA 4PFJA 2VQ3A 4NU6A 1ZK1A 3X2EA 1Y9AA 4QT0A 3ZHXA 4JP2A 3E9MA 4H7PA 3MJEA 5G0VA 3FI9A 1ISFA 2GN4A 4QXMA 5LDGA 4OMUA 4BIIA 1RM3A 4LGVA 3WGHA 2DBQA 1DIHA 2IZ0A 3WYBA 4UVGA 4U6SA 1NNUA 2VUTA 3WDSA 1NQ5A 4URFA 1YJ8A 1V3TA 3G49A 3GLQA 4KOAA 1XKQA 3I9LA 3PJGA 3WTCA 2GN6A 1SEVA 1DIGA 3MWDA 3TNLA 1MG5A 1AN9A 3B70A 4DMLA 5JAIA 4D7AA 1E3EA 1N7GA 4YJFB 1HXHA 2YJZA 5AVOA 2X0IA 3L6EA 2PV7A 9LDTA 1WNTA 3GDFA 1GZ6A 4GX1A 1CJCA 4U5QA 4WK6A 2YV1A 3FWZA 1NWHA 5KNLA 1PZFA 5DZSA 3OJLA 4HFNA 2NU7B 1HSZA 1ONNA 1A4IA 1U3WA 1WP4A 5CPFA 2FY8A 2VZ8A 2A35A 2X0NA 4PVCA 1GYPA 3CMCO 3ONFA 3X2FA 4PGFA 3EVTA 4O1MA 4YJHB 2FPGA 3CE6A 2VNSA 2PZMA 3WXBA 3MOIA 4F46A 4KQWA 1WW8A 3AFNA 4AL4A 2CNBA 2AQKA 1EUCA 1ENPA 1GYQA 3Q0EA 4MO2A 1PX0A 2WD7A 5TQVA 1EUDA 2E48A 3D7LA 4DC0A 5AOVA 4CMHA 5BQFA 5L7TA 3QHAA 4BNIA 2VYVA 1LNQA 3FTPA 2I6TA 4GX0A 3BXXA 5TF4A 4WLNA 1VE9A 1UXHA 2ZYAA 3EAGA 1U2GA 4NK4A 4O5OA 3MEQA 1UXJA 4XX0B 2ZCUA 1B8PA 3QQPA 1YOVA 3RFTA 1KY4A 4D3DA 3SJUA 5KOIA 1DAOA 1N5DA 4A10A 1WZEA 2NU6B 1ZK3A 4RVHA 4UVDA 1NFRA 2CSUA 2AA3A 2PNFA 2EF1A 4Y6SA 3TZKA 5DOVA 2GLXA 1PJBA 4HXYA 3QE3A 4IS3A 5FYDA 4DWVA 1TVEA 4E5MA 1IE3A 1VKNA 4GQAA 3BAZA 3V1YA 1OBFO 4GGPA 2PD3A 5T5QA 3BMOA 3E82A 5J23A 3CTMA 1OAAA 2W8ZA 3WMWA 3KUXA 4BO6A 1CYDA 4ITUA 3QA9A 4CL3A 4DL9A 3IJRA 5EPOA 2HRBA 3JQ8A 4N54A 3NYWA 1WVGA 3HQ4O 1EDZA 1PL7A 2I66A 3I83A 2Z95A 2NU8B 1P74A 3FRJA 4Q3NA 2UUOA 3VHRA 3LU1A 3A9WA 3UW3A 3ZWAA 4R5MA 2ZYGA 1JKJA 1I3NA 3OBBA 3D4OA 4J1TA 2PKRA 1QP8A 1YVEI 1X15A 4K1LA 4TVBA 4FC7A 2FPPB 5TT1A 3WTBA 3Q11A 3PHLA 4GSLA 1YE3A 1B0AA 3U4DA 2PZJA 4R1NA 4R9RA 2B5VA 3BMQB 3AJRA 3ROKA 3LT2A 4R54A 4OHUA 4R16A 3GN2A 3JQDA 3DFZA 2Y67A 1ADGA 3WOHA 3P19A 3AY3A 5B12A 1PIWA 2C07A 4J90A 2Y1FA 3AW9A 2VRCD 3VPFA 4IY1A 3I9MA 4TROA 4OKNA 3ZV5A 2QZZA 1AUPA 2D4AA 3AU8A 3DB2A 5B4UA 1K6JA 1NQOA 4W6ZA 2EERA 4PLGA 5JAMA 1FMCA 1NQAO 1WMAA 3MWDB 1SC6A 2B69A 3QVXA 1NR7A 3SC6A 1DFHA 1MFPA 3GY0A 4YTEA 4BO0A 1Z45A 3CSDA 1JAXA 1H0KA 4OO3A 4D79A 1D1TA 2IEDA 2QZ9A 4OJNA 2Z1MA 3BMCA 1A4UA 3HDYA 3T7EA 4DYVA 4E30A 3ASUA 4OOFA 1B26A 4BQPA 1ZK4A 3RKUA 1HZZA 2CUKA 4ND1A 4XDYA 4PZEA 1VL6A 4EDFA 3CEAA 3LZ6A 3T4XA 2FMUA 2O3RA 1E7QA 1A7AA 3ZWVA 3N7UA 1MG0A 2PKQP 1UP6A 2E49A 3RU7A 3U4HA 2FPGB 1QSGA 3PWKA 2D2IA 2X5OA 3DHEA 3Q2KA 1Y7TA 2NWQA 2OOSA 2GZ1A 3U0BA 2B4TO 2AXQA 4XWYA 1DC4A 2FZWA 3HB4X 1EUCB 3WGOA 2WD7B 4MVJP 1L7EA 1EUDB 2JAHA 2P9CA 1LTHR 5BR7A 5A3VA 2NTJA 2AHRA 4ZRNA 4ZICA 3CMMA 5TS3A 3RC9A 3WJ7A 1U1IA 1O8CA 5ER9A 5TJHA 4CR6A 2H9IA 3LLSA 4NBWA 2PR2A 5C3MA 5I9MA 3OSUA 4PLZA 4OIMA 1YOVB 2Q2VA 4BO1A 1V8BA 4R1UA 2JJYA 3NDJA 4PIVA 5KJEA 4J0FA 3DL2A 5K6AC 1JQBA 4WCFA 4N5LA 2Q2WA 4K26A 4WUVA 1LDYA 1DLJA 2X4GA 3D5TA 1F0YA 1HE2A 1E77A 3GZ4A 4MPDA 2GERA 4A7PA 8LDHA 4RPJA 1SOVA 4WNIA 3BMOB 1X0VA 3EDMA 1CIVA 1ENYA 3G17A 4N7RA 3PZBA 4W7HA 5FI3A 3WS7A 5L45A 3TZHA 1CQIA 3DBHA 3TQHA 3JQ8B 3V2UA 3NTOA 3ZNPA 1ZCJA 3VDQA 2C0CA 3QWFA 2I3AA 2QW8A 2FR1A 4PLFA 5HBRA 5A4DA 1EE2A 2AG5A 4IDEA 2QYSA 5CAEA 3BMNA 2YFHA 4IJWA 2DBRA 3MCVA 1K0UA 3INRA 4PLHA 1V9LA 1EVZA 5H83A 4Z0PA 2JD1A 2BRUA 2ZKLA 1TB4A 3F1LA 3FHLA 4CODB 5G0UA 4UVHA 4ALNA 5A03A 1JVBA 4W99A 4FFOA 3OA2A 4TZKA 4GPD1 1DHTA 5COQA 2HJSA 4GX2A 2DFDA 2IZZA 3WSWA 1PQWA 4IM7A 3K5PA 3KB6A 3D0OA 3AI3A 4B3JA 2WYUA 4WEOA 3L6OO 3QIVA 4MKXA 3RC7A 2JD0A 1GUYA 2X86A 4I8XA 4CUKA 4C7JA 3WIDA 4CLOA 3C8MA 3ZHZA 2ZB7A 1Q7CA 3ZNQA 3OM9A 2O2YA 2GNAA 5GMOA 1LLQA 4DIFA 1PJ4A 3SXPA 4B4UA 2VHZA 4LISA 2I65A 4FC6A 4H3VA 4W4TA 4BVAA 2CDCA 4E0BA 3GEDA 1LC3A 1Y8RA 4BNYA 2A4KA 2P4QA 2I76A 2IEBA 4FFRA 3I4FA 1X1EA 3BMCB 3DBRA 3GVHA 4GH5A 2EG9A 2NV6A 1UR5A 4AG3A 4D41A 4RCVA 1D1SA 4K28A 2QG4A 5G2OA 1QMGA 3OETA 5KCZA 1KVTA 3ICCA 3UAGA 4CMEA 3VPSA 1PSDA 1H93A 3QW2A 1H6CA 4CQMA 4O0LA 5JSFA 3PHIA 2C5AA 1QORA 3JV7A 5CP8A 3TN7A 4A26A 2GGSA 4CLDA 4LSMA 4EEZA 3MTJA 4NMHA 2NU9A 1MC5A 4IJUA 4YAEA 3BTSA 4W82A 1GQYA 2EKPA 2RAFA 4M8SA 4XYLA 3QVOA 4PZDA 1GTMA 2HSDA 3OQBA 5CEJA 1RYEA 4F45A 4UUPA 2Y1EA 1QYWA 3GEMA 3M6IA 1HETA 3OEWA 1KOLA 3SEFA 3EZLA 4TMFA 3RKRA 2YQ5A 2TMDA 3DZBA 3FR7A 3QV1A 5DCUA 4NFHA 1GD1O 4WGGA 1BDBA 3ST7A 4N18A 2OZPA 4PG6A 2Q50A 1C14A 4DQUA 2Y05A 1AGNA 1O6ZA 2XPCA 4L75A 4Z9YA 4BGVA 4MVJD 3ZZNA 4ZJUA 1I3LA 4BNZA 1Z75A 4J16A 1FF9A 1TEHA 3MJVA 4WCFB 3NT4A 1PJTA 2XXBA 3H8VA 1DC5A 4G81A 4RZIA 3E18A 4P22A 4RF2A 2DKNA 2WE7A 4RORA 1TI7A 2O3UA 4MKZA 2A92A 1SB9A 2CDAA 3JD2A 4NZ9A 1NX6A 4F6LA 2VWPA 1Z82A 3H9GA 1J49A 1T1RA 3W4KA 1EBFA 1T2EA 5ILGA 3DOOA 1HDCA 3ICPA 1C3VA 1U3TA 1RKXA 1CQIB 1ZSYA 2X7HA 3DBHB 3ONEA 4NBRA 3TFQA 3C1AA 4YA6A 1MV8A 1LSJA 1MB4A 3T7CA 5CG1A 3WSVA 5JDIA 4BO5A 3GG9A 2DC1A 5KKCA 2NQ8A 2HUNA 4FJ0A 3WLEA 4OSPA 4P38A 1Y8QA 4OXYA 2JL1A 1NM5A 3ZWXA 2EJWA 1GADO 1V35A 4MDHA 3U4IA 4ND2A 5T67A 4IDFA 2UAGA 5U4QA 3IOYA 3VOSA 4FIZA 4Y8VA 1E92A 3H2SA 1E1LA 3KLPX 3SX2A 1EUZA 1O94A 2ZTVA 3F3SA 3KSUA 4H15A 3U5TA 2C2YA 2HU2A 3D3EA 3DHYA 2JKVA 4ZHSA 4CM9D 4K6CA 4CM3A 3S2GA 1E6EA 3F47A 4CPDA 1YKFA 3E1KA 1BMDA 3GOHA 4BV8A 3CUKA 5EL0A 3KSDO 3GRKA 1PQPA 4HADA 3IP1A 1PGNA 3NAQA 4CLOB 5ADHA 4IS2A 4I5DA 3LC1O 2Q1UA 4CMEC 5A5EA 1F14A 3FNFA 2AEMA 2NADA 4JGBA 3ZV3A 4TRNA 3AWDA 1UDAA 1Y8RB 3SBOA 3FD8A 2YW9A 1P3DA 5JS6A 1QV7A 2ILTA 3DBRB 2GUGA 3WGQA 1LRJA 4WLUA 1DIBA 2D8AA 1WDMA 2X5JO 4AJHA 1ZH8A 4HFMA 3KETA 2QIOA 4BKPA 3ASVA 4BO2A 4LK3A 2XAAA 4BOYA 3JQ7A 3F5QA 3V2GA 4XQGA 5DF1A 5A5FA 3QWBA 4CQMB 1N1EA 1UDBA 3PQDA 1DDOA 4ZGWA 2VWGA 2ZJ1A 2RH4A 1CQJA 1WXDA 4D3FA 1SBYA 2D0IA 4TWRA 4ZQEA 2GZ2A 4RVUA 4GI2A 5AYVA 1B7GO 5IDYA 4DBVO 4R51A 2NU9B 3QLJA 3TL3A 5KTKA 3DMTC 3CPSA 3U3XA 5JLAA 5CDGA 2G82A 2RHRA 1YWGO 3RVDA 1DIRA 4OKIA 3ZH2A 2IRWA 1VSVA 2PZKA 3TRIA 2NNLD 1EMDA 3EUWA 2R00C 1OFGA 1HF3A 4PLTA 5IFLA 2Y0CA 4ALLA 4E2YA 3PYLA 2W98A 4WOKA 2I3GA 1ZW1A 1DPGA 4GGOA 2I67A 2WWRA 2VTDA 2CD9A 1U3VA 2C29D 2PK3A 2V6FA 3VH3A 1C0KA 3RD5A 1RYDA 3QRWA 4FJ1A 3VH4A 3MTGA 5BSEA 3GR6A 3R1IA 3EZYA 2O3TA 1CDOA 5A1TA 1IZ0A 3DZFA 1HKUA 2PH5A 1M75A 1I5RA 1E5QA 3FBGA 2BFOA 1GV1A 2VRCA 5F1PA 1PJ2A 3RBVA 5JY6A 3O38A 3KZVA 3JQEA 3V1UA 1P31A 3H4VA 1Y6JA 5JAQA 3MJ4A 2DFVA 3BYZA 1NHWA 2O3JA 4KWHA 5G4LA 2V7PA 1H94A 3L4BA 4DBZA 2Q49A 2HRZA 1ISHA 3FBTA 1H9AA 3TZ6A 2YHUA 4OXKA 4NR0A 5F5NA 3AM3A 1ZVMA 5JNLA 4ALIA 3GHYA 1Y8QB 5H82A 3VPHA 2G17A 3UCXA 4PLVA 3HFSA 4R9SA 1YH3A 5JO9A 3SC4A 1OMOA 3HDQA 1Y81A 2H1SA 5CDYA 1HDOA 2VYND 5L95A 1F8GA 1V0JA 2RCYA 5IDWA 4MIYA 4GMFA 4HUJA 2Y1CA 2AE2A 2XF8A 1R0SA 2VOEA 2GRAA 1ULUA 3EC7A 3GMDA 3JYQA 4XJTA 1ZSNA 3PQEA 1IPEA 4GVLA 5GY7A 4GWKA 4YCAA 1JN0A 1DJNA 1YL5A 1B16A 4JN6B 4KUEA 3R3JA 3RUAA 5IXYA 1UXIA 3NDRA 1I36A 4C4OA 3VPGA 1U4OA 3N74A 1P1RA 1QLHA 4E33A 2IYPA 4ZQFA 1O95A 1MXHA 4AJ2A 4KMSA 4CMCA 3ZW9A 4PG4A 4CLRA 2ZIZA 2F1KA 2FWMX 3H9UA 3EYWA 5AXBA 4DXHA 3RC2A 4DIOA 1ADCA 3DBLA 3PDUA 2PA3A 1BSVA 4QO8A 2QQ5A 4ZN6A 5FFFA 3WQQA 4BNHA 3WR5A 2TMGA 5CDUA 1JKFA 4J91A 4G2NA 3JQ7B 1LI4A 1GUZA 3RUFA 4CL8A 1VC2A 3ZU3A 3JQ6A 3H9EO 3KYCA 4RLSA 4ESOA 1V6AA 3GA0A 3HHPA 1CQJB 5TT0A 5A02A 3L9WA 5DOZA 3OF2A 4MIEA 4MINA 3PHHA 3S1LA 5JBIA 3JQ9A 4CM6A 3KHUA 2JHFA 1C0LA 4QECA 2ZTUA 4AJ1A 4EITA 4LMPA 1HYHA 4MVJH 1KS9A 3C85A 4TZTA 4Z3KA 3GAFA 4CM1A 1A27A 2X0RA 4J7XA 4RVSA 2J5QA 1NPTO 4IQ8A 3OIFA 2OBNA 3BTVA 1X0XA 3K96A 1LQUA 3OP4A 4L4SA 2W4QA 2B35A 4NFSA 3PFWO 4ZQHA 4BO3A 1PGJA 1N9GA 1UZNA 4RVDA 3PDJA 3RJ9A 1ML3A 3N58A 4XDZA 4BQRA 4Z3DA 3GEGA 1YS4A 1LLCA 2H63A 1Z6ZA 2HDHA 1ISMA 3GVCA 3CXRA 1G6KA 3UFXA 4NH4A 3KBOA 4Z9XA 3WLFA 2NQTA 2OMEA 4G65A 1X7HA 4PRKA 1DHRA 3ETGA 1F12A 3UICA 2VUSA 1Y5RA 5KJ6A 3UF0A 2DQ4A 3LT0A 1KEWA 1R37A 1JDJA 4A0SA 2OXIA 1NYTA 3DXFA 5LCXA 3LK7A 3M2TA 1I2BA 1T26A 3P2YA 4E4YA 3LF2A 3GC6A 1OZAA 2HQ1A 2O4CA 4HV4A 5B1YA 2GZ3A 3PWZA 2AE1A 4D42A 2E37A 5I8ZA 2P4HX 1D7OA 3WGGA 1ORRA 1FDTA 3AUTA 1R12A 4XIYA 4CUJA 3KSZO 3AOEA 1EK5A 3R3SA 5IN5A 2I5PO 4YR9A 2YQ4A 1XYGA 1IUKA 3FCOA 1VJ1A 3WWYA 3K6JA 3OECA 2BI8A 5C37A 1SB8A 2XXJA 5CDSA 5HM8A 1DO8A 3AUSA 2DLDA 3WIEA 3KEOA 4DA9A 5JPIA 1GU7A 2GF2A 3BIOA 4IXTA 4EYEA 1IZ9A 4BO4A 4IMPA 4XJSA 1GPDG 3H3JA 3GVXA 3OFSA 2HCTA 2FZEA 2EWMA 3FWNA 3GUCA 1UUFA 4MP3A 5T8KA 5TX7A 4BNWA 5BSHA 4XYEA 3PPIA 4NI5A 3Q6IA 1U3UA 3IDSA 3AI2A 4XCVA 3A06A 1O89A 1YGYA 4W9NA 5CHEA 3S2FA 3HN2A 1O5IA 1BVUA 4IDAA 2JHGA 4CLRB 2WMDA 4II3A 1XA0A 1ZK0A 1B8UA 5EMHA 4H16A 1O9BA 3F1KA 1NTOA 3DBLB 4MVJA 1DB3A 2QRLA 4CV3A 3OQ6A 5ITVA 4CV0A 3M1AA 2ZB8A 4FFMA 1H2HA 1R4NA 2P9GA 3RASA 2Y1OA 4AJEA 4B3HA 5BSGA 1A72A 3KYCB 1QYXA 5F3RA 4XB2A 2HMUA 3WJAA 2ZK7A 1BG6A 2Q1TA 4MJLA 4CJXA 2PD6A 1SNYA 3DC2A 1EEHA 1L7DA 2DUWA 2F00A 3K8ZA 3ZV4A 1GCOA 1U9JA 2DU8A 4L8VA 1XDWA 2J3KA 1U8FO 2BLLA 3UGKA 1HE4A 4YAIA 1VL8A 4WPGA 1P77A 3QY9A 1A71A 3GF4A 5IAAA 5DBIA 4MOWA 1N9GB 1J6UA 3EGOA 3W8DA 3JQBA 1ENOA 1WDLA 1XU9A 4FW8A 5F1KA 3UFXB 2JFFA 5L40A 4I08A 1QV6A 4J2OA 1LDEA 2GPTA 3LYLA 4IZHA 1DAPA 3Q3CA 4N5MA 2O48X 3E03A 4Y98A 2Y93A 4CM9A 2DPGA 4FQ8A 3TWOA 1UP7A 2DT5A 2VWHA 2HK8A 1LQTA 2JAPA 3RBZA 3COSA 5DP1A 4JLWA 3NJ4A 5TJ9A 2YV3A 4XZ3A 4RVGA 4B4WA 4DIBA 3KYBA 2FPIA 4BNMA 4FFLA 3TFOA 2O3QA 1P1HA 1LLUA 3GPDG 3NKLA 1SMKA 3NDIA 3ZWPA 5IJZA 5DBFA 3ZV6A 2ZTMA 1M76A 3GDGA 1EVYA 3DZGA 4Z0TA 3CZMA 4DTIA 3H5AA 1I8TA 4YYZA 1OI7A 4FFNA 3W1VA 4PG8A 5A9SA 4YACA 2B37A 2J3JA 4B8ZA 3RFVA 4IQ0A 5L4LA 3CKYA 3INTA 4FD3A 5JCJD 5ICMA 1KYQA 3DAPA 5AXAA 4W9NC 3DDNA 2JCXA 1AE1A 3E48A 5AQ1A 1Q7BA 2ZQZA 1B2LA 2UV8A 1CRWG 3NT2A 4QUKA 4YAGA 1VM6A 2GN8A 4RQUA 5ENDA 3WGZA 3P2OA 1P0FA 9LDBA 4TSKA 2G0TA 4EEXA 1DRWA 1KIFA 3F4BA 5KWEA 5FI5A 1LJ8A 5F1OA 1EVJA 4CUZA 3S2IA 2X58A 3L07A 1B3RA 3WWZA 1SO8A 2VT3A 5IZCA 5CPBA 4XRGA 1PTJA 4Y6RA 1L1FA 2GN9A 1T2DA 4YVFA 4EI2A 3FNHA 3E8XA 3C7DB 3QSGA 3VC7A 4KP7A 5U9CA 3VH2A 1QYDA 4LVCA 4B7CA 3W4JA 4GKVA 2QRKA 4RO0A 1LSUA 1P33A 1YXMA 4IJKA 5BT9A 5KVVA 4A27A 1NASA 2YFQA 1U4SA 3AUAA 2PKQO 2UUPA 1XLTA 3IKVA 3PGXA 1R4NB 1HYEA 2RH8A 4FPXA 3LLVA 4RF5A 4QQRA 1T2FA 4D44A 3I6QA 1XU7A 3NX4A 5ENVA 3VPXA 1TA4A 1SPXA 1YDWA 1PZHA 3V1TC 1NVGA 1ISIA 1T4DA 3ZU2A 1HRDA 4CM7A 2P2SA 1Y1PA 1K6IA 1LSSA 1ZEMA 4RPHA 4J9VA 5AXCA 2G5CA 3EMKA 1ZJZA 3K9QO 4XD2A 1KEVA 4J9UE 4DLBA 2Y1DA 1YB4A 4AJJA 1JKJB 4LRTB 4R3NA 5EQDA 1LEHA 4AJ4A 1EZ4A 1T25A 4CLXA 2JFGA 3ROPA 2GASA 2C20A 4GX5A 4AJIA 4D45A 4L4XA 3H2ZA 3NT5A 4UUNA 1E3WA 2J3IA 4WLFA 1B14A 3LVFO 3CIFA 4UUOA 3ZW8A 5DCYA 1NAIA 4XGIA 2VYNA 4FGSA 2P5UA 4ZRMA 5A06A 1E7WA 1WPQA 2D1YA 1G0OA 4E13A 3GH3A 3LT1A 3S55A 3ZWNA 3JQFA 2WTBA 1R4MA 3FNEA 3OJEA 3WYCA 3PI7A 2RBEA 1AHHA 1YJQA 5L3ZA 1T1SA 5I7FA 5IXSA 4IBOA 4DQXA 3ANLA 4FDAA 2W2LD 3KM0A 4E12A 2FPIB 1GEEA 3JYOA 1P44A 3C3XA 1N92A 3B6ZA 1U28A 2VNAA 2P91A 4UUMA 5ER6A 1E6WA 4HP8A 5A9SB 1E3SA 3VTFA 4J43A 4DGSA 4P4LA 2B36A 1E3JA 3RUHA 1CWUA 1U5CA 2CDBA 2HLPA 3ZNNA 6ADHA 3SLKA 5KKAA 1IOLA 2PY6A 3HWRA 1YB5A 3R6DA 2NVWA 3AUUA 4XRRA 3OHSX 4WLOA 1DIAA 1VJTA 1GY8A 1PZEA 3RAJA 3AFMA 3HNPA 1RM0A 1R15A 4KUGA 4MVJE 3WQRA 4E5NA 3OA0A 1T24A 1HE5A 4I9UA 4NNJA 3U49A 1U7HA 1I3MA 5A04A 2J3HA 3PHJA 1HDXA 2C2XA 5JYEA 1QG6A 4WCFC 3KV3O 1TLTA 4RDIA 4YXFA 4E2XA 1NPYA 4BNTA 1VPDA 2DM6A 2GD1O 3ZN2A 2JCVA 2WEKA 2BFAA 5JY1A 1D4FA 1BXZA 2HAEA 3EY4A 2O7SA 3G1UA 1OC2A 5H81A 4ZD6A 1HE3A 3ZHYA 1Q2XA 3L6DA 5TC4A 1LDBA 2YZ7A 3RQSA 5KVQA 2AQHA 4UAGA 1QR6A 4Q3DA 1GPJA 2CF5A 1KY5A 3IUPA 4OL9A 1A7KA 1Q0LA 2POQX 3RC1A 4E5YA 4DVJA 4J4TA 3RWBA 4FSHA 2AMFA 4GWGA 4I9HA 1KERA 5I7VA 2J6IA 4GL4A 2IXAA 3O9ZA 5G4KA 2FSVA 3H6KA 2B83A 2PH3A 2HMWA 4BNLA 1XHLA 7MDHA 3AM4A 5I7SA 3GRPA 4UVIA 2C54A 4ZQBA 3EK2A 2QYTA 1HLPA 3B1KA 3KXDA 3PHGA 3ON5A 4E31A 1C1XA 3DMYA 2Z5LA 1RWBA 1PGOA 4G5HA 3UUWA 2PFGA 4IDDA 1E7RA 4K6FA 2E4AA 2O50A 3GT0A 2HK9A 1OC4A 1M2WA 4HY3A 4Q3AA 3PYXA 4BGUA 1EQ2A 3IJPA 3KYDA 5CAEB 4B3IA 3BMNB 1ZJYA 5MDHA 1MFZA 4YQZA 1ULSA 1DBVO 4LVUA 4HWKA 4WOJA 3PGJA 1E3WB 4YEDA 3RUIA 1K3TA 1ZUD1 4LMRA 5I9LA 2PGDA 2G76A 4EUEA 1PS9A 5HS4A 2IXBA 3VKUA 1UP4A 3UHAA 2YV2A 1PS8A 1U5AA 4J4HA 3NUGA 1UH5A 2H6EA 4NBTA 1E3IA 1VL0A 3ZNOA 4NDNE 3GZNA 4EJ0A 1I33A 1R4MB 2VHYA 2UYYA 1PQUA 3NTRA 4PRLA 3DEYX 2JCYA 3HN7A 3OIDA 4M54A 1PWZA 3F4LA 4NU5A 1Q1NA 3ZU5A 4GLLA 2EEZA 4B4VA 3S2EA 3IKTA 3ANMA 1NQTA 3KOUA 1P45A 4RPGA 2V6MA 5JO0A 1R66A 2YYYA 2HJRA 3P5SA 4PCVA 1NPDA 1QXSA 5KJ1A 3KLMX 4IDGA 1C0IA 4WCDA 3BA1A 4WLEA 1LUAA 1MC4A 4M55A 4ALKA 1FJHA 4TKLA 3PTZA 1H6BA 2CFCA 3I4CA 1E5LA 4Z0HO 4ILKA 4EBFA 2FOIA 4JK3A 5G0TA 4E6PA 1RPNA 4BO7A 4R1TA 4L73A 5HA5A 1HLDA 4RPLA 1ONPA 4O63O 3GNSA 2GYYA 1SEPA 2BI7A 3NV9A 4E2ZA 4HBGA 1F06A 1LC0A 1YL6A 5LDHA 1EE9A 1ZIDA 1JAYA 3O8QA 3OQ1A 5JDCA 4ROSA 2B4RO 1D8AA 3L0DA 4R3WA 1GZ4A 4ONEA 4TKMA 3ROMA 1FDUA 3KEQA 1ISJA 4OH1A 2RHCA 2WE8A 4B8WA 1QYVA 2DAPA 2VWQA 4JBIA 1WAMA 4PG7A 5TSDA 4NJMA 1MXFA 2HKIA 4YRAA 3K92A 5HTOA 5FEUA 5JDIC 2XOXA 1GQ2A 4MKRA 4YAJA 1I01A 4X54A 3TSCA 5JXWA 1FXSA 5DULA 2I99A 3LT4A 3FPLA 2EKQA 3OMLA 3I3OA 4OOEA 4YJDA 5G4KB 2X9GA 3B1FA 4FOSA 3VKVA 4QO7A 3WNVA 5BNFA 1R0KA 5JYDA 2BGLA 3QVTA 5ILOA 1X7GA 5THKA 1PJ3A 2A94A 2ZTLA 1VJ0A 3WGIA 4LN1A 3ULKA 1C1XB 4B79A 4OGWA 2Y0EA 4BKOA 2X22A 3RBXA 3GNTA 3DHNA 3HUDA 1O0SA 5BNTA 1Z73A 2EV9A 2Q99A 4NK5A 4XYGA 3RUDA 2P9EA 3JQCA 2X9VA 1XWFA 3KYDB 4A73A 1AHIA 1RM5A 5EJ2A 4GBJA 2ZCVA 4GAEA 1FDWA 4J49A 3WGTA 1JLLA 2H5LA 5CEFA 3IP3A 5JCJA 1KBZA 3DZIA 4IPTA 2EXXA 2RIRA 4UEJA 5DBGA 3WBBA 2V6BA 2OFPA 3I6IA 4KDEA 1KC1A 4KTVE 4L74A 3GZNB 1GCUA 4OSOA 1IHXA 4CM4A 3ABIA 4XQEA 1N8KA 1T2CA 1S6YA 1NXQA 4XR9A 1PGQA 1MX3A 4LSWA 4BB5A 3P7MA 3GK3A 3BTOA 3ZDFA 5CEEA 4S1VA 3INGA 4BV9A 1N1GA 2I9PA 2VTEA 4YAKA 3DBVO 4DLAA 4D46A 1VRWA 4WJZA 2A9FA 4BGIA 1BRMA 4R01A 1I0ZA 2EKLA 4NPCA 4CMIA 4EZBA 2V65A 1EBUA 4NBVA 2O3SA 5DNAA 1DXYA 3ONDA 5HS6A 2G1UA 3WFIA 1EFKA 4M87A 5F21A 1PJLA 5IN4A 3UH1A 4FS3A 1XELA 1ZKMA 4DUPA 4WNCA 4J1SA 3GG2A 1ARZA 3ETDA 2C7GA 1BXGA 2X5KO 4M1QA 2WDZA 3U09A 3G0OA 2YY7A 1U7TA 2B4QA 1M6HA 3AU9A 3G79A 4QX6A 4XR4A 2EW2A 5HWSA 1V3UA 2WM3A 1FDSA 3HJAA 1BXKA 1M67A 3ROQA 3K2EA 1KVUA 2NLOA 4IQGA 4A5OA 3HDHA 3O8QB 1UJMA 3PJDA 3AY6A 3SJ7A 1LDGA 3JQAD 4BS9A 3PYMA 1HL3A 2Q46A 3K2BA 3ZGYA 3ZU4A 1H2BA 3E9NA 2DTXA 3AI1A 4Q3BA 1VSUA 3E6AA 2PGJA 1EK6A 3G1TA 5JAZA 3D1LA 4IINA 4ZU3A 1A9ZA 1KVRA 4NJMB 1JVSA 1I32A 1BDMA 3LDHA 3KTDA 5DT9A 3UXYA 3GHHA 2OHXA 3L4BC 2PLAA 2QX7A 2AG8A 4LCJA 4UULA 4U0KA 1VLLA 2HO5A 3KRTA 4WECA 3K73O 4CMAA 1PGPA 1P1JA 2BMAA 4PZCA 7ADHA 1G1AA 5FF9A 1P1IA 1QKIA 2LDXA 2W2LA 4NHEA 2OGUA 5KIAA 1ZNQO 3ORFA 3A28A 1KETA 4LW8A 2IE0A 3UVEA 3PXXA 1K5HA 3RFXA 1XG5A 3DOCA 5GZ3A 1WDKA 1W0CA 3HFGA 2NVBA 5ITWA 2Q45A 4HFRA 4XGKA 3RCBA 5IG2A 3PJFA 2HMSA 2O4UX 2QHXA 1LXCA 1JLLB 1P1FA 4DRYA 3QWIA 1I24A 1XGKA 5BSFA 4EUHA 5EIOA 4AFNA 3Q1LA 1H5QA 3JSAA 3M1LA 3OJOA 1AXGA 4JIGA 2WSBA 3DFUA 1PS0A 1CETA 4MVJM 2VZ9A 2PZLA 1A9YA 4I5GA 5G0SA 4M86A 1Y5MA 1NFFA 4BKUA 4QTZA 4CM4B 3H9QA 4F6CA 1HDYA 5TGDA 4YBZA 1AXEA 1YDEA 2Y0DA 4Q9NA 2ZATA 1E6UA 3CINA 1M6WA 1Y9EA 2OBYA 2VUUA 2ZQYA 2WYVA 1NVMB 4BHTA 3DO5A 4RVFA 2VN8A 2X8LA 2NACA 1ISGA 4ID9A 5GZ1A 1JWBB 1X14A 4IIUA 1LU9A 3RROA 4CMIB 2NM0A 2AEJA 2EHDA 4FN4A 1HTBA 4RLHA 1DOHA 3DZHA 2OP1A 3JQ9C 3K30A 4IDBA 4PLPA 5B4VA 1TT5A 4IIVA 3UKOA 4L76A 1UXGA 3BZUA 1FDVA 4DPKA 3GGOA 2Q1SA 3QVSA 4JBHA 3OJFA 3WYEA 1KC3A 1XCBA 3DONA 1I10A 1IL0A 3CZRA 3OIGA 1BXGB 3W6UA 3DQPA 1MP0A 1YBMA 3HE3A 5T64A 1EFLA 4LRSB 1DFIA 4U0JA 4CQLA 1Q7GA 1CEQA 3JD3A 3ZWOA 3HG7A 1I2CA 4JQCA 5GZ6A 1IHYA 3DZKA 3CH6A 5TRTA 3ZHBA 4J6FA 1GV0A 1C1DA 4IMRA 1UZMA 4JBGA 3TL2A 3RSHA 1N2SA 4F3YA 4UEKA 1E3LA 2IZ1A 3EVNA 3I5MA 4TQGA 2EP7A 3C1TA 4W7IA 4RJTA 4A2CA 3IC5A 4BKRA 4ZVVA 1XSEA 5K6AA 3A4VA 4CLEA 3Q9NA 1S7CA 1HDGO 5C7IO 1IY8A 1H6AA 1X1TA 2ET6A 3GAZA 2OUIA 1KEUA 5I9NA 3QWAA 2BHLA 1E1MA 3FPCA 2GSDA 3S8MA 4FB5A 3C7AA 2BELA 3PQFA 4DYDA 5TLSA 1GFSA 4J2HA 3Q9UA 3VAZA 4BO8A 3VVCA 3FSRA 3QP9A 5EQFA 3MJSA 3AOEC 2B0JA 3FR8A 2FP4A 3OJ0A 4I1IA 2GO1A 4JNKA 1N7HA 2BKAA 3QJ5A 5MGBA 4WKGA 2C82A 2WD8A 1KVSA 5IF3A 4TRMA 4BNFA 1W73A 3BTUA 3TZQA 2C59A 3QVWA 4KTTE 4YRBA 1K6XA 2DTDA 4R68A 5EINA 3ADOA 3NGLA 3RI3A 3GQVA 3IMFA 4RV9A 2IDZA 2W2KA 4DPLA 3HDJA 4EW6A 1DFGA 4INAA 4AJLA 4OYRA 4CMGA 3TJRA 1E1KA 3DAGA 2LDBA 4D43A 4RF3A 4OQZA 5T8KC 1T4BA 2VHWA 2ZB3A 4PN3A 2E82A 3FTNA 3ADPA 4B4OA 4DC1A 4BNKA 4JJIA 3BHMA 5A9TA 3WB9A 3NGXA 3A1NA 1B3BA 1UZLA 1BWSA 3B1JA 5L4NA 2VCYA 3ZWYA 1Z7BA 1P9LA 2PGLA 4RGBA 4Z6KA 5I7EA 1W8DA 1UAGA 2HK7A 3NJ8A 3DR3A 4R1SA 1GUFA 1PWXA 3IL2A 4PVDA 4IDCA 5L9AA 1ZBQA 2VHVA 3A14A 4CV2A 3F6YA 1E7YA 4ND3A 3PFFA 3JYPA 1JW9B 1R0LA 3DTTA 3ZCXA 4RDHA 3VZSA 1C0PA 5IDQA 6LDHA 5KVCA 2VZ0A 2Y1GA 4BNVA 3F9IA 3C24A 4J1QA 1TT5B 3PLRA 3H65A 3ZWBA 2CZCA 4QFCA 5B4TA 3GNQA 3JQGA 2Q2QA 1J4AA 4MP8A 4HFJA 2EP5A 1RM4A 3WNQA 3C1OA 2Y99A 4O59O 4U7WA 3TDKA 2AQIA 3LC7O 4BUCA 1IYZA 4CQLB 1HDRA 3GVPA 3NRCA 4K9DA 4RF4A 4ALMA 4IGEA 2Y68A 3E5RA 5G0WA 1W6UA 1GDHA 1C1DB 3WICA 2O23A 2DBZA 4IZIA 3JQBC 4EUFA 1MGOA 4IUYA 1YQGA 4BNJA 2Q1WA 3ZWCA 4B7XA 1RJWA 1MA0A 2FR8A 5HRUA 1K89A 3OH8A 3DTYA 3AOGA 4GMGA 5LC1A 2EJVA 2ZJ0A 4DMMA 1GAEO 5JE8A 3GVIA 2C5EA 4IJVA 4XYBA 5C7LO 4TVOA 5JW6A 1T2AA 3EHEA 4B7UA 3NTQA 3PWSA 1V3VA 4FFPA 4S3MA 3RUCA 4BMVA 2C7VA 1IPFA 1WWKA 1WLYA 3PK0A 4YJGA 1JWAB 1BW9A 2X9NA 1ZXBA 1QYCA 1PL6A 2EW8A 2X1HA 1H6DA 4HKTA 1NWCA 4QFDA 5FWNA 3JTMA 3PP8A 2PTGA 3ETEA 2JFHA 4I5FA 5DCWA 3LQFA 3RJ5A 3VZPA 4JXKA 2FP4B 3DZJA 4GSKA 1BVRA 1JA9A 2BF7A 3MZ0A 4XA8A 3O26A 1GYRA 3WFJA 1HT0A 1XR3A 3STHA 4WASA 3MWEA 3IQDB 2GCGA 2OORA 1ENZA 3JYLA 4IGFA 4XQ9A 2BGKA 2GR9A
chains in the Genus database with same CATH superfamily
1X2EA 3HXKA 1QHIA 1BHJA 3FOBA 2W2KB 4CMAA 1EWVA 2ANBA 2MSLA 3C45A 4JELA 2ZUBA 1QHEA 2ZPTX 5HQJA 2PSFA 3MBOA 3VH1A 3PXAA 2IHZA 4HNGA 1Z0AA 2C83A 4Y2SA 2YJGA 3H5TA 2GILA 4A9AA 1EAYA 2CN1A 4MVJG 3Q7TA 5TMPA 3H84A 2J33A 4Y6GB 4IXWA 4OXQA 2DHRA 1HQYE 4XUCA 1S02A 5DU2A 3W6ZA 2GFQA 1J9GA 3IDZA 3RT9A 1RRKA 3AHGA 4DR3B 1FPMA 1ZMOA 1EK0A 3AUJB 4RZSA 3RRBA 4B6PA 1MRZA 1BHSA 3F5FA 4FMPA 5D3MA 3VHLB 4KWIA 2AEFA 3CT6A 3I12A 1P0MA 3QQ5A 3GH1A 1MB2A 3QU4A 8ADHA 2WIBA 2PPVA 1R16A 1X7DA 3ROZA 1KBOA 4KXUA 4OLFA 3RUEA 1VPWA 1AM4D 1DUSA 1G19A 3SS7X 3U3DA 1D6SA 3I9NA 2WU1A 3LQRA 2RJ3A 3BWBA 4J0EA 4LXGA 4MUHA 1WMSA 4K6HA 4AY5A 2XB4A 4OXNA 1OT5A 4DTCA 5K8JB 2AZMA 4KMOA 3FF4A 3PFCA 1TNDA 5GTDA 4M1MA 3DH0A 4BMSA 1GNLA 4U3JA 4BE7B 1ECGA 3DKVA 3RK0A 3IUSA 5LL6P 4R1OA 2YIJA 1TCAA 1TLFA 1CQWA 1ID1A 4UBOA 4D8XA 2HV9A 1OJ7A 1O6GA 3ENKA 5JQGA 2O0KA 3BF8A 5BN4B 1F4LA 1F2DA 4NOLA 2PXCA 3G3EA 3HZZA 2IHUA 2J5RA 3JS5A 1B6GA 1SZDA 3NKFA 3PGA1 3TOCA 4B74A 1P8AA 3N8NA 3DE6X 3TNJA 5KYGA 4Q9DA 3ZIDA 1X8XA 2GCPA 4FOLA 5AHXA 2A5GA 2DPMA 3JQGB 1HSOA 3OPMA 2UUBB 5J2TA 3F46A 5EHNA 1J8QA 5JNVA 1EVKA 2QL7A 4IHQA 3W5HA 2FR8C 2WQ6A 2EW1A 3KT0A 2ZI3A 3Q7QA 2D5AA 4KPGA 4NV0A 4X6XA 2VPYA 1U1GA 4U2GA 4XKJA 4UE6A 3ZC3A 4ER0A 3DMTA 1US8A 3P2KA 3I9JA 2BONA 1C7EA 4Q48A 5SY6A 2NN3C 1J7KA 4MO9A 3WX0A 4GBMA 1LSOA 3G2KA 4LQ4A 1HL7A 1MOSA 1GAWA 2VHJA 3RVKA 2WHQA 5SV2A 2MMCA 3G59A 1DE0A 1MENA 1VECA 4NCNA 4CM5A 2YVUA 1W4ZA 1Z5ZA 1FDOA 5LZ4A 1ZVJA 1XQ6A 3LA6A 3SHVA 2O8VA 3MELA 2M6LA 2GM5A 3EQ7A 4ZQCB 3CURA 3JQFC 3OPVA 4Y0NA 1C9NA 1VGVA 4GI7A 4L9WA 4PRYA 3SJAA 4M49A 5DASA 4A8TA 5JAUA 5FLXA 2C5GA 4R41A 4FOOA 1M1YA 1QRSA 4Q05A 3FM9A 2ZRIA 3G8BA 4J7CA 1TD9A 5CX1B 1VKOA 5IWCA 5EOVA 2PWZA 2V7GA 4PBTA 5JC8A 3SQXA 4YJGB 1GRQA 4AZ3B 4QPNA 4HLUC 1IMJA 1BW9B 4H7IA 3DTVB 2LWIA 2X7JA 1Q3KA 2WHPB 1Z2EA 4B3XA 1E9EA 4UXHA 4XUGB 1YULA 3UV7A 4AK9A 3NEPX 3LK6A 2NUAA 2IPLA 1PV4A 4GPBA 2QRQA 2ZS9A 4MGEA 3DAYA 1H2FA 4INOA 3UJPA 3OEYA 1Z7WA 3CU5A 3TNYA 1UWCA 2Z08A 2O8CB 1EDOA 2FUNB 1G16A 3GGJA 3PQ6A 2A8YA 4P7BA 5HF8A 1AKQA 3VSDA 4EARA 1ZO8A 1T5HX 1RYYA 3KHSA 4D8TA 4ZYWA 3IALA 3BD6A 3RTAA 2NVUA 4G1BA 5AI6A 3D6JA 2B99A 4YRMA 1T6YA 2P6RA 4X5OA 5IKOA 2CHEA 4NS1A 2K6GA 2DB3A 1WZIA 1YVRA 1NXXA 1W2HA 3BH0A 3KTAA 5EXSA 5F12A 1XMXA 3SZOA 5JMWA 2N1MA 3OU6A 3E4DA 4GVXA 4X3OA 4HWRA 4DM7A 3W4IA 3H1FA 5FQOA 4DCUA 3H0EA 4P3PA 4HVLA 5AKKA 4YJ2A 1ADBA 2I4TA 1NVXQ 1TUGA 3UC5A 1PT6A 4MV9A 5GQSA 2Z57A 2VDRB 2FRDA 3LBHA 4WZAA 2YXNA 1CR0A 5B7QA 2BGUA 3TOSA 1RC1A 4WKBA 5DNYB 2HFJA 4BB0A 2Y0BA 4EGQA 1ND5A 5C8DA 1K2WA 3SYNA 4ND4A 4DVGA 4U4AA 4D3SA 1R0BA 2O0HA 3OOSA 4GU5A 4PLYA 4Y3UA 1NJGA 4ARSA 3OF5A 4LOLA 5CR9A 1I2ZA 1LVHA 2CVOA 1VJCA 4UQOA 3SR4A 3J7AC 2WTMA 1X92A 3S4YA 5CCDA 1V25A 3KQPA 2GBGA 3CWZA 3ROXA 1ZH4A 3AGPA 3MCUA 2AUNA 2EZ8A 4IIJB 1EZZA 4BQQA 3SX0A 1W29A 4TSFA 4OHYA 4RHFA 2Z2XA 4ZVQA 3WNZA 2HW8A 2HHCA 3QU9A 1RC0A 1CERA 1U02A 4MS1A 3NEAA 3SC3A 1FQOA 1QO0A 1P0CA 2NQ2C 1A5ZA 1WR8A 5LXTA 4IW3B 3OAAD 1JFVA 2ZSJA 1WSAA 4N5NA 4NIMA 2DPYA 4OBBA 4R83A 4F1WA 3JYNA 1QC5B 3RIHA 4C76A 3NH9A 2SCUB 2FSVC 2EEPA 3FWPA 1E7MA 1NW8A 2OXEA 2VDOB 1QJ4A 3FHJA 3D4PA 1P73A 4U6QA 1Y6GA 4KYIB 4CMBA 1GO2A 1H0HA 3QF4A 3STWA 2GZAA 3ENNA 3KJXA 2DVMA 1JEYB 5C1PA 5FOSA 1EGQA 4L8YA 4HNRA 1WG8A 4RLQA 1GWNA 5CVVA 1D3AA 1M2VB 3ZLBA 3KOOA 1QPBA 3B1XA 1MJNA 1SCJA 3AKCA 3GLKA 5A5DA 4FYKA 4BNDA 1Z22A 1ZL2A 4MUFA 5U4XA 2OQ2A 3FVWA 3HA2A 2FG6C 1SCUA 3F98A 5TPZA 3DWFA 4M1ZA 5JJIA 1G9XA 3LQ4A 2O8NA 3PC8C 2YWCA 1E9BA 2PN1A 3QVUA 2C03A 2VOJA 4JVSB 5JH7A 1LRLA 1Y89A 2WJWA 2VF8A 3KT8A 4G5RA 1AY0A 1LDMA 1K27A 2H29A 2VEOA 3GBSA 5B30A 2M6RA 2Q2OA 1M66A 4CWAA 1P4GA 3R5KA 1QZ3A 3NBZC 3F2IA 1OYVA 5K0ZA 4Y6QA 4KO1S 3DE5X 4JR0A 5FBZA 1U4NA 1X77A 1LDNA 3M0EA 3UAWA 4FYIA 2OSVA 5L53A 5HIJA 1JL3A 1TYBE 5HBGA 3RRZA 5ESRA 5I8WA 3T4PA 3DMPA 3GN1A 3V2HA 1XVVA 1BYIA 4BFXA 4JJZA 4YQYA 2JJQA 3MJDA 3PSAA 1L2TA 3CEPB 1CXZA 1SHKA 1NVDA 1BVYF 4LQLA 3EODA 3KQWA 3RSQA 1ZOLA 2CC2A 4DDUA 3AVTA 3CN7A 3D5QA 3GGGA 3V9PA 2DPHA 1XP5A 2P9TA 2BFPA 1A95A 1V1RB 1XNGA 4BWGA 1L4YA 1D2AA 5K0TA 4WJKB 1VJDA 1N2GA 1WSWA 1MRNA 3BN3A 2LD4A 3TOZA 1DC6A 1DOZA 1G8MA 4G4SO 1JR2A 3TOXA 1J5EB 1ZWKA 1XJWA 3PRHA 4OMDA 4KPEC 2FWRA 1YJ5A 3IP6A 2NU7A 3U81A 1ECJA 1WPGA 4V0LA 1ABBA 3TZCA 3LS2A 5F51A 3F5DA 3FMPB 2PLRA 5BSMA 1HYBA 2OCDA 5TPWB 3UGQA 5K8IA 3GARA 2REQA 2OV1A 2GM9A 1L4FA 3M6AA 3U9TA 4CTNA 3DDHA 4B6GA 1DI0A 3A1WA 1L7PA 1V37A 1WU8A 2TMKA 3AUXA 3MINB 4NYIQ 1LA2A 4PBSA 4WY8A 2ZUSA 3QWHA 3I09A 3HJFA 7MHTA 1KH3A 4TYQA 1E2KA 4ZYYA 4OUDA 4ZMSA 1XQ1A 5A4KA 4R0MA 4JROA 4ND5A 4O0MA 3PJEA 2QU8A 4JOQA 4S35A 3A1UA 4UEQA 3MIIA 2WICA 4ZVMA 4EPRA 3PUZA 3M33A 1LPOA 4KN8A 3T7DA 1U65A 3IX7A 1JEDA 4WFQA 2QMQA 1GZ3A 2R44A 2ENWA 1EVIA 5E4YA 1Z7EA 4DAOA 1NI5A 3SNKA 1J00A 2V3VA 4G1UC 3K31A 4XGNA 5HJ2A 2V7TA 3ZEAA 4Q1AA 3IIJA 2H2HA 2OE2A 4XARA 4YT8A 1OI4A 1RTTA 3W90A 5L3SB 2J67A 4O2BB 2OWDA 4XX0A 2E5WA 4FGWA 5LXTF 2W8BA 4C0JA 3GLIB 2OB2A 1G20B 1NUQA 3RYFB 2QQFA 4J1NA 3O8RA 4PINA 1FP4B 1GVHA 5KQSA 1WY7A 2XVYA 4CEIA 4NULA 2YHIB 4LG1A 2EGHA 5AXDA 1PBNA 3ZGXA 1YL7A 3M5PA 4UTPA 2G3YA 4CMKA 1VI2A 3IQFA 2JLZA 2H5EA 2VP0A 1BXRA 2D00A 3N8DA 3KE8A 2ZAGA 1ODSA 4WA8A 5L7YA 4W5OA 4BJ3A 4EK9A 5JMTA 4CI0B 2O7RA 3PE3A 2XRMA 1P4RA 4M6WB 4P82A 2OHIA 4YH1A 1YONA 4KIGA 1LX6A 2JVKA 3IAEA 3PPVA 4R1QA 3SQOA 1YAHA 2YJNA 4FCCA 4TTQA 5LQRA 1XZMA 1E1NA 3IAM1 4AWXA 4ZEXA 4YUAA 1OZHA 2QXTA 2LGJA 3PTAA 4FR0A 5BVGB 3P45A 1ETUA 2BISA 2BR3A 5IYZF 4MULA 5LNK6 4B6SA 4P08A 5B3LA 1JZSA 1PSZA 2GTPA 3QEAZ 3GXBA 3EQ2A 3JRWA 3OX4A 5JVDA 4LCEA 2Y66A 4DR1B 3WDLA 4H3KB 4M2LA 5DWVA 2FFAA 2J5KA 1QR2A 3FPAA 4BO9A 2VJCA 3GNLA 4CM8B 3ESDA 3K2IA 2EYUA 1RBMA 1RQ7A 1Z0ZA 2P5SA 2R8XA 4NS4A 1YRLA 1DJQA 2X13A 3BIWA 3CZPA 3LRPA 1GQQA 3TZLA 2Y1LA 1WMBA 4NYMR 3TGPA 4U5XA 2G1AA 4LFBB 4PFJA 1W19A 1Z47A 1E2BA 4OQMA 5HGXA 3H16A 2IUSA 2P4UA 1QDLB 4QXMA 1XAJA 1PR4A 5K3EA 3PR2B 3HYTA 4OMUA 2XT6A 1WUYA 3ZUPA 1USWA 1AD2A 4D4JA 3L6CA 4FFBA 3WL4A 5J43A 3O7MA 5IT9A 1NZFA 3HDGA 1NNUA 1FYXA 2VUTA 1SQSA 2ZWMA 2H4JA 3RLIA 4QXPA 2ZUFA 3LDAA 4KQHA 3UFBA 4F93B 3AKDA 1AKNA 3C3CA 3GLQA 3R3HA 4HATA 4FKBA 3RVBA 1JNXX 1GVNB 1P5FA 4KOAA 3I9LA 5B1SA 3GRYA 1DKNA 1CJTC 5CLLA 4HYYA 5EZSA 1Z37A 4QVKA 4LWQA 5FLKA 3B70A 4L8FA 5KQRA 1NBIA 3AJ9A 1IHDA 2I22A 2I6FA 3R5XA 4FEAA 5ALYA 1G38A 2A1UA 4DABA 1IMOA 2DFNA 1EJBA 1M74A 1NQXA 1RWPA 2ISCA 3HB1A 3MMXA 3BWEA 5E1MA 5EHXA 1C80A 3HJTA 1Q3HA 2YJZA 2QN2A 4MROA 3TYXA 2YHSA 3LUHA 5FPYA 3FY4A 3N3BC 2YX1A 1FYVA 3GDFA 3ADKA 3E8SA 1DTSA 1YZFA 3OJWA 4YCNA 1CJCA 4U5QA 4WZAE 4DLNA 5DZSA 2OYCA 5HX7A 2VJAA 1W49A 1E2EA 2WNHA 3OE1A 2EX0A 2B30A 2FY8A 2VZ8A 3KWMA 1UK6A 5AHKA 3M8KA 2Z58A 3QTBA 4RMIA 4LYFA 1GTJ1 4HRVA 2H57A 3QX9A 2A5LA 4IX1A 3AP2A 5BUCA 3PQCA 2PMKA 2VNSA 1T34A 3O82A 4L07A 2PZMA 1RXEA 3MOIA 2C5LA 1N5RA 4ISCA 1GAXA 3MS4A 3AFNA 2RHWA 2W2PA 2GFIA 3E0XA 2IW3A 1QHNA 2JF0A 2P2ZA 4F4HA 4LPSA 5DO9A 1KJJA 5ARBA 2E48A 1GG9A 1JFFB 2DSNA 3OOWA 5BQFA 3QHAA 4JXJA 1NF8A 3I6ZA 2VYVA 2GK4A 1MIHA 2XTMA 2I6TA 3KELA 1OA1A 3DT8A 1A3CA 3BL5A 3BEOA 3EDYA 5TF4A 1VE9A 3GWGA 1TVKA 2P35A 2ZYAA 3D02A 3EAGA 1AQUA 5AP9A 4NK4A 2JGRA 2ZCUA 1B8PA 4AKGA 1YB7A 1YF3A 4DJJA 3ZE9A 4D3DA 2W83A 4F8JA 3KOWA 1DAOA 1N5DA 4L22A 5IAKA 2NU6B 1XZ8A 3TPZA 4AJ9A 1FXUA 2FDCA 1JEOA 4Y6SA 1DWUA 5DOVA 3NUZA 4IS3A 1VKZA 4HXYA 3MSXA 1IRIA 4C43A 4GQAA 4ZGGA 1IBRA 1OT3A 3BAZA 2ZXUA 5FR2A 2GH1A 1VG0B 2RKWA 2PD3A 5K99A 2I7CA 4KKXB 3JY6A 4FMDF 3NZEA 4TMYA 3I2FA 3GZTB 4NV3A 3O8OA 4EG4A 1OAAA 2C3YA 3ELBA 1CYDA 3A0RB 1AMNA 2CFSA 4RVNA 3IJRA 1BC5A 1WCV1 3LMKA 4J0IA 2IUYA 3JQ8A 3A7EA 1BOOA 4N54A 4ZT2A 3EH2A 4KR7A 1PL7A 3CZ4A 2W4MA 1KWKA 1RZRA 2I03A 4QOSA 1K97A 2DUNA 4C6RA 1CUCA 1P74A 4Q3NA 3ZWAA 3NDPA 5A6SB 3A9WA 2NUBA 4WXRA 3VVLA 1WKCA 4BQFA 1RMQA 3SJCA 4BLPA 5DNUA 1AA6A 5TT1A 5M3BA 1YVEI 1HLFA 3AF0A 2XCIA 4FC7A 4HNSA 3O47A 2BJVA 3Q11A 4BP1A 2REBA 1YE3A 3KJHA 2ZTSA 1OXBB 1L5QA 3BMQB 3WK9A 4JSRA 2ESRA 3D9QX 3PQ5A 3ROKA 5EWJB 1XV5A 4HEA6 1GLNA 1S2DA 2MSCB 2XJ4A 4OHUA 3DULA 2HADA 4YALA 2DUMA 3ONVA 2Y67A 4CKWB 4I6GA 1L5OA 3TLGB 3AY3A 3SIXA 2DWUA 2ZQ5A 2O9JA 1J2JA 1YASA 1OX4B 3AW9A 2OZVA 2VRCD 3EGWA 2P3SA 1C7RA 3BWMA 1WQ3A 2QSUA 1F60A 4OKNA 2XE8A 4P3NA 2D4AA 2YZ2A 3WC4A 2BKLA 1KO5A 2HCJB 2QE7A 1K6JA 3PFIA 1J2RA 3Q8LA 1Y7PA 4H2DA 3DL4A 1FMFA 1EZ1A 2PX2A 2EZ9A 5JAMA 3BEDA 5T4BA 2F4VB 3E05A 3MWDB 3QOFA 1SC6A 3OWOA 3QVXA 1ZJWA 4FD2A 2VO1A 1NR7A 5BQPA 3HPRA 1ZKDA 4ARCA 1MFPA 4DV0B 1E6KA 1Z45A 4D79A 1E0SA 4EG5A 1EWQA 1Y7HA 1U9IC 2GZDA 4NATA 4RZ3A 1KIAA 4HNUA 4AN0A 2NTYC 1UKCA 2HX1A 2WMYA 4N0EA 4O4LF 4Q12A 4PZEA 4EDFA 1GGEA 4QOGA 5HTKA 3FJ1A 4F84A 1XTJA 3CEAA 1EHIA 3Q9LA 3LZ6A 1Z38A 3FYUB 1N2ZA 1D2GA 3N7UA 2ODEA 2PKQP 4N7MA 121PA 4S0ZA 3FAZA 1D2RA 1UP6A 1D8TA 5D1HA 3R7SA 4YJ3B 2CJYA 3TNDA 3ZQKA 2X5OA 3DHEA 2A88A 3AY0A 5HZGA 2WF8A 3Q2KA 2CV0A 2I9KA 1SQ6A 2OOSA 3PV0A 4TXMA 3B53X 5CFLA 1X7XA 3P0EA 5EVJA 2NXNA 3AUKA 3HKEA 2WD7B 1L7EA 3ZY2A 1EUDB 5H68A 2K5UA 2P9CA 1SA0B 1LTHR 2HLHA 4OHOA 4MZXA 1Z0KA 5EJMA 1GHTA 2X8JB 4ZICA 3RJZA 4MTCA 4XDHA 1O95D 4BVFA 4JD5A 1P17A 5DGCA 3OCZA 1U2SA 4J94A 4QJIA 4PN7A 3WJ7A 1U1IA 1O8CA 5ER9A 2PGOA 3M70A 1U0OC 3CLUC 4UTVA 5C3MA 1J09A 3ZI4A 2QUHA 3TG8A 2EKBA 3EXG1 3DLBA 1B0PA 5HE8A 3L6UA 3SK0A 1ORTA 2RG1A 3FTCA 2QG6A 2WWFA 2IOFK 1MOPA 1G21B 4GYYA 4IH1A 3DL2A 4LXHA 4RXUA 1LLFA 3TM5A 4E22A 4RTRA 3THYA 1AUQA 1KH1A 4N5LA 4X20A 4X63A 5BWNA 3ZVRA 1LDYA 2X4GA 4PX2A 1E77A 1ZJJA 4WXYB 5EIEA 5BY2A 4MPDA 4CVNA 1C7IA 1P0QA 2GERA 2Q4TA 4RPJA 4EDHA 3GB9A 8LDHA 2AUTA 3EMVA 1X0VA 3HSYA 3FCCA 1CIVA 1ENYA 4EVSA 3H05A 1Z8HA 2E87A 5AMXA 1Z0JA 2A2ZA 4JB8A 4CF4A 5BR1A 3TQHA 5A4IS 3ZNPA 3RUHA 4QKQA 2FN4A 1ZCJA 3PC6A 3RRXA 2BJWA 3VDQA 1ACJA 1PT5A 2W48A 2QW8A 3IT3A 4JUDX 4K87A 3FCSB 4HEJA 4OMCA 2FR1A 2HL6A 1EM8B 4NABA 1YRHA 5BN3B 5JSQA 5JZSA 1IJFA 2WD9A 1YVDA 4CCSA 3NXKA 5A4DA 5ELMA 3UT6A 3FDZB 3IUQA 3L7NA 4IDEA 1N2JA 4IDHA 1HX7A 1BFDA 1T4MA 4BV3A 4X1YB 2RB5A 4PLHA 3ZY3A 1GA4A 1PYDA 3F1LA 3FHLA 4BBJA 5IM4A 3O8LA 1V11B 1JVBA 3NHJA 5L3RA 2XQJA 2UZ4A 2ZSUA 4TZKA 4GPD1 4EI7A 5COQA 2HJSA 1F0PA 3E0QA 4ILEA 5TEVA 5IVIA 1DO0A 4IM7A 2HO4A 1AGYA 4RDCA 5KDLA 2VF4X 2EBUA 2FE1A 1ZD4A 2VEDA 5KSZA 3QIVA 2NUPB 2HNAA 1T4CA 1H3EA 5HIAA 4J75A 5IJWA 1OHHD 1N0HA 2JD0A 1J1ZA 4CUKA 3GFOA 1NX9A 4ID3A 1ZD3A 3KFXA 4CLOA 5J3JA 2ZB7A 3Q10A 4DIDA 4RJIA 4RHTA 1JIUA 1LI5A 2GNAA 3AHJA 1SJ9A 3GFRA 4DIFA 3ADCA 2VG8A 4W4TA 4FC6A 1WP9A 2DX7A 2CDCA 2YFYA 3FMIA 2HD4A 2QWXA 2ZWIA 3AF1A 2I76A 2IEBA 2VXBA 1N36B 2DR2A 1U1EA 3I4FA 1X1EA 3BMCB 4GH5A 3TJMA 1W1UA 2IIPA 4NJEB 2EG9A 5CGZA 5DXFA 6GPBA 1UR5A 2VDNB 3O4VA 4D41A 1E69A 1VA4A 4ZHQF 1D1SA 1GGMA 1G3RA 1XJCA 4GMKA 5G2OA 4AP5A 4GPTA 1EI9A 2FZCA 1I9GA 4MQFA 4N3BA 1KVTA 4EO4A 2ZJ6A 3EAFA 1PSDA 2X15A 5BYJA 1DS6A 1GNVA 4JP1A 3QW2A 1H6CA 4YN3A 4CQMA 4O0LA 4V3CA 5DW3A 4ZVUA 4ER6A 2WIDA 5JSFA 1K86A 1PV1A 2I87A 2VH1A 4TVKA 5CP8A 5IUJC 4AO7A 4EL5A 2JGNA 3VU8A 2O0LA 2H4HA 4A26A 1KMMA 3UJ3X 2PR7A 4EEZA 4RACA 3H4MA 1A9SA 4JQSA 2B92A 2ZBGA 3CISA 1UFVA 1EXMA 1Y63A 5HFJA 4I9FA 1OXVA 3PA8A 2V98A 3L0OA 2VNHA 1GL9B 3LRXA 1GTMA 3QVOA 4PZDA 1KAEA 2ONYA 5LMNB 4F45A 4MGZR 4N6NA 4XSHA 2WW8A 4QNMA 4UUPA 1LGYA 2HLNA 2XWPA 4TLAA 1HETA 4QGBA 3SEFA 1E9CA 3EZLA 5CYFA 3RKRA 1FP1D 2MDTA 2VTVA 2YQ5A 2ZIFA 3DZBA 5LZ9A 1GD1O 5REQB 4M8LA 3NH6A 4N18A 4DQUA 4UHJA 3UWMA 1KK0A 2Y05A 3JW8A 5JWOA 4RTMA 4BGVA 4OY3A 1NSFA 3U13A 2E18A 3M6LA 1DBPA 3GFSA 1I3LA 1UANA 1Z75A 1KP9A 1A2KC 1RRVA 5DHQA 1AX9A 3X1XA 2OC4A 4DA0A 1BQ4A 1ZD5A 4RF2A 2PL5A 1CP3A 1RAHA 4HSGA 2VSNA 4JEHA 1TI7A 4BBZA 3CRW1 4D8UA 2GEJA 5CCEA 1SB9A 5CM2Z 3JD2A 4F6LA 1PEAA 2F59A 3OQHA 4AMVA 2W6PA 3W4KA 1T2EA 4GEKA 5ILGA 3EFBA 1RWQA 3ZJTA 5TMBA 3ZQUA 3EWSA 4X66B 4EY3A 1CQIB 3ONEA 5EUBA 2IFTA 3K7EA 5E95A 2QB5A 1OVGA 2EFDB 1LSJA 2ZYVX 3HJRA 1E96A 2R86A 3EGVA 4JUBA 3T7CA 3WSVA 2BUCA 1G7SA 4BO5A 4NESA 4OCZA 1UMBB 3DNMA 3ZDCA 3GLUA 1DJPA 1J8DA 4I50F 5IHXA 5M34A 2J9YB 1QFYA 2HUNA 3T9DA 1EFPA 3I39X 5M04A 1FJ2A 5AUPB 2WT4A 2IPMA 2XB6A 3IR7A 2JI6A 3S5UA 3L1KA 2XUFA 1Y8QA 2H8KA 4M98A 1FMJA 1T9HA 1PK9A 4ESHA 4Y6OA 2J0UA 3KOMA 5T67A 4N65A 3FTEA 2A5DA 2R97A 5U4QA 2H9YA 4EYGA 3NPMA 3VOSA 4FIZA 2XHEA 4PFSA 3BJRA 1MDBA 3H2SA 4FXOA 4WZZA 1WB6A 1IVSA 2BDEA 3SX2A 4H15A 3IMKA 4CTMA 3CE9A 3D3EA 3LY7A 1XZKA 2XYVA 5GOZA 2JI4A 4INJA 4KVAA 2NO4A 4E51A 2CXOA 4ZHSA 4E7OA 3S2GA 4TS3A 5C8YB 5CB4A 1YKFA 3CN9A 3MB8A 3GRFA 2OHHA 1E8DA 4LZNA 4XOIA 1LF0A 2C2BA 4OQQA 5FTKA 4J8PA 1KZHA 5HDQA 2GA8A 1C8LA 1XX6A 2OAEA 4U7TB 4HADA 2G25A 1W75A 4AX8A 4URYR 1PGNA 4LJRA 3DCIA 2UU9B 3H2GA 4IS2A 3ZDRA 4WGFA 1M1XB 5E3HA 1KOJA 5JJBA 2V4UA 2FXVA 1ZONA 4Y2YA 5LMCA 2AEMA 1X7ZA 2NADA 2C0PA 2R1TA 4HDSB 4IDNA 3AWDA 4P3YA 3RV4A 4AAYA 5C81A 1DAMA 3HKDB 3D6TB 3P9ZA 3R5JA 4WZBB 2ILTA 1U2DC 4LXTA 2GUGA 4WSOA 1Z9BA 2ZBQA 2VHTA 2O19A 1U8UA 4OO3A 4QULA 4Z7QB 3LXRA 1WDMA 4G5QA 3UPUA 5FO0A 3EXEA 1T91A 5T3UA 4C1BA 1OH5A 2Q5OA 3OQIA 2EQ5A 4D74A 1NU6A 4DZRA 2M2IA 1O5TA 1Q7TA 4LK3A 1HC7A 2HBZA 4EW2A 3B6MA 1G41A 1MQ9A 2HPHA 3I30X 4YDHB 3V2GA 2B2CA 3TQIA 3PT5A 1DIOB 2Q6IA 5CJPA 1QQ6A 2W6JD 2Z5VA 2VBIA 4X00A 3VPBA 4EY8A 1ESCA 1REQA 3NIFB 2RB4A 1CQJA 4LHZA 3QPBA 5JUWA 1EFRA 2IYZA 5B3JA 1XCPA 4R2XA 1LCIA 5FDFA 1T3ZA 1FIUA 1CUGA 3RV3A 1DG9A 5F98A 4JXZA 4GI2A 2PAFA 4HRAA 2PX8A 3MCAA 2ROQA 3UUEA 2NU9B 3QLJA 3LT5A 2Q7DA 1SHUX 4XLLA 4QFMA 1ACMA 2FQYA 2J9FA 2RHRA 3RVDA 3COJA 4C7OA 4MYSA 1DIRA 1NXPA 2C2GA 3SSMA 4Q6BA 4OKIA 4BJ6A 4BRZA 4R7ZA 2PZKA 2NNLD 4FGKA 1EMDA 4DR7B 4RJLA 2A33A 2FU5C 2R00C 2HDNB 1Z12A 1HF3A 5IFLA 1S2MA 2IEAA 4MLZA 4E2YA 4IG4A 1TTTA 2W98A 1FUEA 5A7HA 3TQCA 3KSAC 1ZW1A 4Q18A 3WRYA 1DPGA 4BGDA 3VUEA 5A0TA 5CLJA 2CD9A 2C29D 5F3DA 4B9AA 1E99A 3ZCSA 1OBHA 3PLAE 2WIKA 3MTGA 4KIWA 3EBOA 3AG5A 4EBBA 1EFTA 1KYTA 1NG1A 4PE5B 4EFNA 5M7EA 4UZEA 3M3PA 1X70A 4YDQA 2PH5A 3CWQA 3P0FA 4JT2A 2AC4A 1I5RA 1E5QA 3FBGA 1JEQB 2JBHA 1GN8A 3O38A 2NXCA 3CNQS 2BFDA 5DX1A 1Y6JA 3CUWA 5HUHA 3GCWA 4A8HA 2KWIA 3BYZA 4GZ6A 2NTEA 1LNSA 2CDRA 5G4LA 5K0JA 3DWGA 3SYMA 4DBZA 2M6SA 4MB6A 3FPBA 1C50A 2B21A 4XVRA 1G4UR 5FOUA 3ZD9A 1EJ2A 2PLWA 2HA6A 2ZUTA 4ETMA 4ALIA 5JNLA 2RAVA 2AC2A 2VQ6A 4NYJQ 4AS1A 1UQUA 4H0NA 2R8ZA 1O2DA 2B78A 2C2WA 2GN0A 3V48A 3AFGA 4GFDA 5H82A 3L41A 3N0VA 4PLVA 1NT2A 1GL7A 4Q82A 3SC4A 1OREA 2GZMA 4F8YA 4MPJA 1A9XB 2H1SA 2AMYA 1UM9A 3X1ZA 1F8GA 2IU4A 1SD1A 4MIYA 4XXHA 4GMFA 4HUJA 5BQ5A 1JQ3A 4KACA 3RIEA 4EFMA 1Z63A 1N6PA 2GRAA 2XZDA 4FDLA 1AZWA 1Q6ZA 3IKMB 3PQEA 4EKNB 1AZLA 4KPUB 4GWKA 3X44A 2E4YA 3EB9A 1T9BA 4KUEA 1Q6YA 1A5BB 3R3JA 4PTZA 3KPJA 3RYIA 4B6FA 3AINA 2FJUA 1UXIA 1I36A 2WFZA 2WF5A 4JXXA 3UJ6A 3IXMA 3VPGA 1QTIA 1E0KA 2VF5X 2PZAA 2VHCA 4Y1RB 3VYSB 3LW7A 3QBVA 3EGDB 3LQYA 5ALXA 4A1OA 1YFLA 3GA5A 5K8VA 221PA 1ZD2P 2NAPA 2QVZX 3AYXB 1LY1A 3QX8A 3ENWA 4QHSA 4GHWA 4M0FA 4DB2A 2XEXA 1C81A 4PG4A 1H65A 1VP3A 4B7AA 3R3WA 4XWOA 3X43A 1E8MA 1OF1A 2FWMX 5AXBA 3PU6A 2J9XB 4HMQA 3OUZA 4XOUA 5C8XA 1FVHA 4HTAA 4B5LA 1ORIA 1U7XA 1OX6A 4OP3A 4RENA 2AD5A 1OZGA 2NYUA 3VNBA 1ADCA 2ORED 4E3WA 1BSVA 2D1FA 4ZN6A 3SE0A 3HP4A 3WK5A 2EQBA 2JJMA 3KE9A 4P4SA 4B0OA 1A88A 2TMGA 1JKFA 4BNHA 4EZIA 1VC2A 4YI5A 3WLLA 4WT7A 3JQ6A 3KQTA 2COUA 3N6RA 4H6XA 4ZT6A 1O87A 4M0DA 2G8LA 2Q62A 3GFVA 4QAQA 3HHPA 4LJAA 3AL2A 3L6BA 4IJMA 1AC5A 1Z5NA 5FA6A 3S1LA 2C4VA 3PHHA 3RABA 2XADA 4G67A 3KHUA 4AJ1A 3HABA 1WQ1R 4PTYA 3QUBA 3DO8A 4EITA 3IBCA 4HVCA 3ZE2B 1B74A 2CXRA 1J22A 2G83A 4C03A 2OCLA 1KDTA 2ZWAA 1GKLA 3C85A 3S28A 4Z3KA 1YQQA 2X0RA 1U0JA 2OHJA 1EINA 2J5QA 5JQGF 1J8YF 1X0XA 3L7JA 4ZQHA 2ZANA 1JH8A 2R7KA 1J42A 2P65A 2OBFA 3PDJA 1BWQA 1D5WA 5BSTA 1NVEA 1YS4A 3A58B 2H63A 4F9EA 3CKLA 3CPHA 1G6KA 4ZPJA 1GIAA 1ETHA 2OR3A 1E2GA 4XQ0A 1JZTA 2NQTA 4Z9XA 3WLFA 4E07A 3FUUA 4TTTS 2C4TA 4C0QC 4KRYA 4RWEA 4UNSA 2HIGA 3DF7A 2VUSA 1K6MA 2FXIA 3BRWA 3IHWA 2WG2A 3IT2A 5EWLB 1MGPA 1NR5A 2SKCA 3LT0A 2P9JA 2C4MA 1IN6A 1R37A 1KI6A 1RKVA 1XUOA 2GJ9A 2I1LA 1JT9A 1MBZA 3IVCA 3O21A 3Q6NA 4JBLA 3LK7A 4HZUA 4Y2UA 1Y4DE 2QRVA 2WIJA 3HXOA 1E9SA 2CUTA 4ZT7A 2BH2A 4CF6A 2HQ1A 3CBQA 2VDKB 3DV9A 4YUVA 3P0HA 1RCUA 1HGXA 3ZJUA 1R0WA 4NOMA 3TIIA 1PJ8A 1AKEA 3C0KA 4XTRA 3DPIA 2WM2A 5I8ZA 2QMYA 1ZUHA 4IVRA 2BFEB 1S5PA 5FFMA 4ZGBA 5ALQA 3KSZO 1QFSA 4WINA 5AHWA 3ZEIA 3G0HA 1VMEA 2M1ZA 3B13B 2CFTA 3G9ZA 1IEVA 1VHQA 4YPFA 4BAZA 1YV9A 4BQSA 4DM4A 3TBFA 1L9KA 2I5PO 1AZSC 1VI6A 3ZDQA 3EULA 3FCOA 4G6ZA 3PGLA 1A50B 4UUBA 1WUHS 1OW3B 3K6JA 1HOXA 3OECA 1QIIA 4EKIA 5D1NA 2XSZA 2C8JA 5T4HA 1M2OA 1DO8A 3AUSA 2DH6A 4JP5A 1KYVA 2DLDA 2P30A 3EIQA 3TRKA 3WIEA 2FEXA 2YVAA 1RQXA 1NY5A 2A9JA 3HBNA 3LKVA 1L4GA 2W7TA 3X1YA 1B00A 2B82A 3L7IA 4X85A 3DMGA 1IZ9A 4BO4A 1O6CA 1OLUA 1SXHA 4IMPA 1I4LD 3H3JA 3GRAA 2JATA 4C88A 5KTOA 2A1IA 3OFSA 5T8KA 3FWNA 4MP3A 4BNWA 5AFSA 1UUFA 1WCYA 5D86A 2P7IA 4XYEA 3PPIA 1VLVA 3IDSA 2IY9A 1QOQB 3AI2A 1H4QA 1EP1B 1O89A 1PFGA 1YGYA 2QAGC 1Q84A 2DY0A 3S70A 3LTNC 1V16A 4QJ5A 2BVNA 4G1CA 4KFCA 4U2CA 4X8MA 4YJ2F 4RH3A 1JDVA 3M49A 4JENA 1F38A 4II3A 1ZK0A 2B8JA 2X1MA 4DMKA 5H4HA 3L06A 4H16A 1C1HA 4D9KA 2VK2A 3DBLB 4MVJA 4MWEA 2QRLA 4UOQA 3E3LA 4CV3A 2LCFA 3IOBA 1KL7A 4ZQIA 4JYCA 2QVLA 2Z8ZA 1VE5A 4FFMA 4AZ0A 1RE0A 3PCTA 2Y1OA 3RASA 1B23P 3ZBUA 2NZXA 4DCNA 2DEUA 5BSGA 2BGJA 1UJ5A 2YXDA 2DSTA 3D0RA 2J41A 4XB2A 2QMZA 4M60A 3MFQA 2G7MC 5B3AA 1RLMA 3SX4A 3VOAA 1O58A 1KPGA 4AB1A 3E9ZA 2WWYA 3MAGA 3VPAA 3MGGA 1EEHA 2E1PA 5T4EA 1A8SA 2F00A 1SUFA 3ZV4A 1FTQA 1M6VA 2A0KA 1NRIA 3AF6A 1T1JA 1HK7A 1I6WA 1XDWA 2BLLA 2ZSEA 1HE4A 4EW1A 4TYMA 3HCEA 4R2WA 2WFMA 1DBWA 3GA7A 5DNEA 1C4WA 1VL8A 3KR9A 4UOZA 2PZFA 1CPYA 2QRUA 2QTMA 3JVEA 2R1VA 1QHHA 2I54A 5FUBA 3QNMA 7AT1A 5KNCD 2D7JA 2D2FA 3A04A 1N9GB 1J6UA 4MOWA 2ZAMA 4RZUA 3IP5A 5BPFA 1IVNA 2QMHA 3OM1A 3HBFA 1TVCA 1DKQA 5E7JA 5ECGC 3RS9A 4ENUA 4EO7A 4KXWA 4KQ9A 1EU1A 2C9DA 4HQKA 3VA7A 2BL4A 2XQFA 3C97A 3UFXB 5L40A 3H1PA 1IJEA 1LDEA 2MJLA 4FX5A 1XXLA 1FUUA 3DUWA 4B3MB 3I0NA 3NNSA 1JJBA 3UO8B 4ENPA 1DAPA 1YA6A 5JH7F 5LVAA 3J81k 3L8CA 2ZT8A 2CYCA 2DPGA 4ZO4A 1UP7A 4C9BA 3PHCA 4NSNA 2VWHA 3GLVA 2HK8A 3JVIA 3I04A 3KALA 3W7BA 2JAPA 3FI0A 4ZCTA 2F17A 2ZAYA 3A05A 1GRVA 4MUXA 5EIBC 3V97A 4L9AA 5HCUA 2N0SA 1XYVA 3NJ4A 3QVGA 2C2HA 4XZ3A 3N5CA 5JYBA 3QK7A 4N03A 1NTRA 3DVSX 3GPDG 2NOAA 3HBLA 4BLOA 4KREA 1OYWA 4ZJYA 4Z4HA 3O95A 1M76A 1NVUQ 3D81A 1E64A 3GDGA 5EE5B 1UBRS 4DTIA 1L7AA 3EQ9A 1KO7A 5I7WA 1I8TA 3WBKA 2ACWA 1EGAA 3DDSA 3Q1KA 1WDWB 2QW1A 3P9NA 3Q7SA 2I78A 4FFNA 1R4AA 3OTGA 4B8ZA 4XGQA 3DS8A 3QXJA 4AO6A 5EZYA 6CHYA 2QUIA 4NCBA 4C3OB 3INTA 4ZZ1A 3F7NA 3W9UA 3H19A 4N49A 4CCYA 5FAXA 5JJ5A 5K3CA 3DZDA 3QIAA 1HA3A 5FPPA 1SWWA 3FFXA 2GM3A 1JSRA 1P29A 1HQDA 4JHXA 2PQMA 2Z2IA 3GEBA 4MRRA 1G8PA 4PICA 5AQ1A 2ZQZA 4JB3A 3JALA 3NT2A 5G3YA 1AKRA 3GUHA 1U2GC 2G7ZA 1VM6A 3IEPA 3LWBA 5CLFA 1XKXA 5LU8A 1K5DA 3WGZA 5BV8A 4P0TA 4D4LA 2XXAA 4KGZA 4OHRA 2GAAA 2JGFA 2BHRA 2JFQA 3LE8A 2AI3A 1IBLB 4KX5A 3S2IA 2X58A 4NU0A 3TIVA 3TQRA 1MRSA 1SO8A 3O94A 3WWZA 1R9MA 1CUAA 4BP9A 3TSWA 3NHRA 1MPXA 1U2TA 3PNMA 2W6NA 4TV9A 5IZCA 1PTJA 4Y6RA 1L1FA 3AEUA 4RKYA 2GN2A 4CG0A 1W5FA 3HU5A 1AZTA 1LW7A 3FNHA 3C7DB 3I1YA 3F8WA 4RESA 1L5KA 1QYDA 3SZUA 2PE5A 3BXHA 5TB5A 4GKVA 4QEZA 2QRKA 4RO0A 1P33A