2SCUA

A detailed description of the structure of succinyl-coa synthetase from escherichia coli
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
286
structure length
285
Chain Sequence
b'SILIDKNTKVICQGFTGSQGTFHSEQAIAYGTKMVGGVTPGKGGTTHLGLPVFNTVREAVAATGATASVIYVPAPFCKDSILEAIDAGIKLIITITEGIPTLDMLTVKVKLDEAGVRMIGPNCPGVITPGECKIGIQPGHIHKPGKVGIVSRSGTLTYEAVKQTTDYGFGQSTCVGIGGDPIPGSNFIDILEMFEKDPQTEAIVMIGEIGGSAEEEAAAYIKEHVTKPVVGYIAGVTAPKGKRMGAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGEALKTV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (SUCCINYL-COA LIGASE)
molecule tags Ligase
source organism Escherichia coli
publication title A detailed structural description of Escherichia coli succinyl-CoA synthetase.
pubmed doi rcsb
total genus 105
structure length 285
sequence length 286
chains with identical sequence D
ec nomenclature ec 6.2.1.5: Succinate--CoA ligase (ADP-forming).
pdb deposition date 1998-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00549 Ligase_CoA CoA-ligase
A PF02629 CoA_binding CoA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 2scuA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2scuA01
3RFVA 3IKVA 1K5HA 1ENYA 5DP2A 5GZ3A 3RU9A 5CEFA 2WEKA 5L95A 1NM5A 1GTMA 2C20A 3W8EA 4IDAA 3OMLA 4MPDA 3L4BC 2JJYA 2Q1TA 1HETA 3FBTA 1H0KA 3GVIA 1P9LA 2Y93A 1UZLA 5L7WA 3VDRA 5CEJA 1YB5A 5DP1A 2GDZA 3V2GA 2C29D 1ISJA 1P33A 1E5QA 3PEFA 2ZATA 3D3WA 4P22A 4WGGA 1HRDA 3DWFA 3FD8A 5AXDA 3ZNOA 4ND5A 4MIEA 3DAFA 4CM3A 1UP4A 2WD8A 4B4OA 1NHGA 4WCFC 4BO0A 4FJ0A 4DLBA 2NVUA 5KKCA 4CMAA 2B5VA 3P2OA 4J1NA 3VPXA 1SCUB 3ZWXA 3DZHA 5C5IA 3G1UA 2NU9A 4EITA 3GVHA 1FDTA 3MCVA 4O1MA 3E03A 5C3MA 5DCUA 3O9ZA 2BF7A 1WDMA 2ZK7A 3K2BA 3OJLA 3VDQA 4CM7A 2OGUA 1JU9A 1X13A 3GC6A 3TFQA 4FC7A 3PDUA 2XF8A 3OQBA 3DBRA 1K6JA 1NASA 1N1GA 2NUAB 4O5OA 4QXMA 3WNVA 1KEPA 5K9ZA 3QLJA 2RHRA 1GU7A 3KVOA 4PLHA 1DOHA 2FZEA 3OEWA 1UR5A 3TFOA 1F17A 3QWAA 4D41A 2WM3A 1ZJZA 3GY0A 3EVNA 1YQDA 2FPGB 1GCUA 3G0OA 1ZK3A 3DBLB 3HFGA 5KJEA 1DFIA 1YJQA 3OH8A 2PV7A 4C7JA 1P1FA 2FWMX 1W4ZA 3HDHA 1H9BA 2NM0A 3MOIA 3WG9A 3G1TA 4B8WA 1OC4A 3B20A 4KUHA 4EUEA 9LDTA 1GUZA 4U8GA 1UUFA 2DLDA 4E2WA 2NQ8A 4UEOA 5FF9A 5T57A 4BNTA 3IOYA 1P1IA 1P0CA 3DZFA 4KUGA 2HK9A 2HMWA 3TF5A 2AEJA 2XXJA 2NUAA 4Y6SA 4JBGA 2Q49A 1CRWG 4GL4A 1YL5A 3JQ9C 4CMIA 4QFDA 5F5LA 5TJ9A 3RASA 1A72A 2VWQA 4I9NA 5G0WA 4DQUA 3QA9A 5JCJD 4UUOA 4IQGA 4S3MA 4OQYA 5TT1A 1FJHA 4IDEA 1TI7A 3DFZA 1DO8A 3F9IA 4KQWA 2VUUA 1VC2A 2Q2QA 1QG6A 1E3SA 3JQ9A 2QRKA 4YJHB 2E37A 3RUFA 3BMQB 3H5AA 1TXGA 1HYGA 4R68A 3ETEA 2DBQA 4E5KA 3L6EA 3BMOB 3JQGB 2PFGA 1B3BA 3UH1A 2GR9A 3PFFA 5JYEA 4AJ4A 3U9LA 1LX6A 4U5QA 1R12A 2A35A 4ZQBA 2HCTA 1IULA 3NJ8A 2AQIA 5IF3A 3IJPA 2ZYAA 2PD3A 2XXBA 2I9PA 3TZKA 5A06A 2DTEA 2OO5A 1PSDA 2ZIZA 2HMTA 2FPGA 2DUWA 1T1RA 3OFSA 5HS4A 3AY6A 3JQ8A 3DZGA 3O4RA 1SNYA 3OEYA 4XZ3A 4PLVA 4DBVO 1ID1A 2R2GA 2ZTLA 4BO8A 1I01A 3WYBA 3E1KA 1N8KA 1X1TA 4EYEA 1YL7A 1E5LA 3SLKA 3KETA 4HNHA 2RAFA 2C7VA 4GMGA 1Y8QA 1EUCA 1NX6A 4AICA 2HRBA 3O8QA 4BKOA 1XU9A 2ZB3A 3VHRA 3I9MA 2DPHA 3MJSA 3R3JA 1Q7GA 3GDGA 1KY5A 4PRKA 4H16A 5KWEA 3TZQA 1ZMTA 4FJ2A 2HMSA 3VH2A 3GOHA 2BD0A 2FZWA 1SPXA 2Q3EA 2NADA 1UZMA 3AK4A 3I23A 2EP5A 3TZCA 2YDYA 3JQFC 4NMHA 3VPHA 4EI2A 2YV2A 3WGIA 1MFZA 2HMUA 4FFNA 1GV1A 1C3VA 3VTZA 2O7SA 1HDGO 4WNCA 4FOOA 4WECA 4XGIA 1ZJYA 3PYXA 4O6VA 3WB9A 5I7FA 4WCDA 4A03A 3CTMA 2OUIA 2O7QA 5LCXA 4CUJA 3E5MA 3EZYA 4D7AA 4KQXA 1PU2A 2OP0A 5GMOA 1FDVA 2BI8A 2X22A 1NR1A 3FTNA 4DXHA 1TEHA 5AVOA 4IXWA 1NVMB 3ZHZA 4RPHA 1PQWA 1R4NA 2RH8A 4A26A 3C7CB 4HP8A 4CODB 2UYYA 3BTSA 3K6JA 4CLDA 1JKFA 4JIGA 1WWKA 3WXBA 3PFWO 5HTOA 1WZIA 1NNUA 4OMUA 3UN1A 1GFSA 2O3TA 3QV1A 4NBUA 4HBGA 4J43A 3CZRA 2PK3A 3LU1A 5ENDA 1X15A 1Y8RB 3OJOA 3RJ9A 2D3TA 1LDBA 3PWSA 4GGOA 5CDGA 3CIFA 2NU6B 1E7QA 5CG1A 2ZTVA 4CMBA 3F4LA 4NR0A 2I3GA 1E6UA 4P8RA 3LZ6A 1VJTA 2Y1FA 5KVSA 3UGKA 3PJGA 1SZJG 3LDHA 1K6IA 2WWRA 1DIRA 1XIVA 2NVWA 4BNIA 3PHLA 1KVTA 2EW8A 3HDJA 3NDIA 5MGBA 1RYDA 4MVJG 4ZQGA 3MJEA 4CJXA 3U49A 3U4HA 1PJSA 1D4FA 1I30A 3ETGA 4J2OA 1MB4A 3S2EA 2LDBA 2I6TA 1U28A 4RVDA 3QVWA 1R37A 5JDCA 2GRAA 1Y5MA 3BXXA 1ISFA 3JD1A 1QYDA 3RJ5A 1DC4A 3TN7A 4WCFB 1AE1A 4IIVA 4Y67A 3F46A 1CIVA 1N5DA 2D4AA 2C5EA 3OICA 4IXTA 5IN4A 1BWSA 1KEWA 2IZ1A 4CM8B 3JD0A 1LRKA 5A5EA 1GQQA 3FF4A 4FBGA 1JW9B 1KVSA 1NQOA 1PS8A 3RFXA 4CMEA 1WNTA 3RBZA 1GYPA 1AHHA 4IM7A 3GEMA 4YCAA 5JY6A 3NDJA 5G0UA 3MEQA 3RCBA 1UXIA 3E18A 3RC2A 4TMFA 3DFUA 3ZW9A 2I65A 3ZU2A 3PQEA 3KSZO 1XQ1A 1I24A 3A1NA 1UXGA 1X7GA 1R0SA 4NG5A 4JN6B 4GVLA 3ZV5A 3WIDA 4P38A 2W2LD 3DZKA 2VRCD 3AI2A 3HJAA 3PLRA 1W6UA 1ZK2A 5DBIA 3FI9A 5A1TA 3COSA 1KIFA 4BKPA 1U9JA 4BO2A 2PLAA 1W73A 3WICA 3QVTA 1MFPA 1SAYA 5EN4A 2EF1A 2JFGA 4DMLA 4DREA 1T2CA 1BXGB 4MVJH 4IIUA 5LC1A 3GQVA 2X4GA 3C7AA 2POQX 3HFSA 2Z1MA 4DBZA 1ONNA 4YJDA 2GO1A 3MWEB 4W82A 3GVCA 3TL3A 1Z6ZA 2AA3A 1Y8RA 1BDMA 5DOZA 1NPDA 1QYXA 1MG0A 4GLOA 4MVJD 2P4QA 2Y0DA 1PGPA 4E2ZA 2Q2VA 4IJUA 1EFKA 4YBZA 1ZUD1 2JAHA 4J4TA 5JSFA 3MTGA 1PIWA 3KLPX 4GX2A 2BMAA 2DKNA 3JD4A 4CM9D 5KJ1A 4OXYA 1ZSNA 3CE6A 3SLGA 3L4SO 3GFBA 1LC3A 1I32A 4LSMA 3WFIA 3QWHA 1Z73A 2W2KB 4TRMA 3F5QA 4UUNA 3TPCA 1ZIDA 2QYSA 3VPFA 3T7CA 1PJLA 1RM5A 3KLMX 2WDZA 3V8BA 1ZSYA 4TZKA 2YQ4A 3GNSA 4P4GA 4W7IA 1PGQA 4BNFA 1ZSVA 1QYWA 2HSDA 3M2TA 1PZGA 1U2DA 1ARZA 3NGLA 4HFMA 3RU7A 4NJMA 1P31A 4WEOA 2PZMA 4HX5A 4Q3DA 3VH1A 3WFJA 3ON5A 3LT4A 5IN5A 3AY7A 2EERA 1EQUA 1RM3A 2JHGA 1D3AA 1B26A 1CF2O 4MKXA 3GPIA 4OHUA 1VPDA 1U5AA 3QJ5A 4QO8A 4W7HA 3AM3A 5I7EA 3LT2A 5HS6A 5B4TA 3WMWA 3GGGA 3OIFA 4BNYA 4GAEA 5CEEA 3NGXA 2UAGA 1W0CA 1GEEA 2X9GA 1ZK1A 4CUZA 4Y6PA 3PQFA 2QHXA 2DUUA 2IXAA 2BGMA 1M75A 4D79A 4J7CA 2ZCVA 1IB6A 4FPXA 2ET6A 4BIIA 1E7MA 4ITUA 3MTJA 3FR8A 1IUKA 5KNLA 1EEHA 1YBVA 4JJFA 3KUXA 3F1LA 3EZLA 3HDYA 3G3EA 1Y9AA 1UJMA 2QG4A 4FOSA 1P3DA 3C1AA 3AUAA 1M66A 4ALMA 2B36A 1BGVA 3AUUA 4NFSA 2CZCA 1DJQA 1JVSA 1ZNQO 3KB6A 3C3XA 3FNEA 3F47A 4DQXA 3DQPA 3GDOA 2GYYA 1E1NA 1MC5A 2J5QA 1YO6A 3ULKA 5B12A 2VYVA 4JP2A 1EQ2A 2OL4A 2PGLA 4FFOA 5T67A 4KTTE 4PFJA 1UDAA 1P1KA 1GZ4A 1ZXLA 1C0KA 5EMHA 1HZJA 4XQ9A 2NTNA 3RVDA 2O3SA 1PJCA 3QE3A 4U0JA 5G0TA 2V7PA 3DOJA 4PLFA 2P4HX 4BNUA 4NNJA 2JD2A 2C5AA 3OA0A 4DUPA 4YQZA 1NWHA 3LLVA 3JQCA 2VUSA 3DZIA 5C7IO 3ENKA 4DLLA 2YHUA 1O95A 2XAAA 1DC5A 1IPEA 3ICCA 4Z9FA 4PLPA 1WPQA 4Z0TA 2FP4A 3H4VA 5TLSA 4ONEA 1X7DA 1HKUA 4TRJA 1XEAA 1A9ZA 1I5RA 2X58A 3BIOA 3DXFA 4H7PA 4UUPA 3ZWBA 2YY7A 3SC4A 4RF3A 1GZ3A 3KSDO 2EKQA 2AMFA 4NI5A 4FFRA 2PD4A 4IJVA 3FBGA 3PP8A 4B3HA 2X1HA 5ILOA 3T7EA 3LC7O 4CQMA 2A4KA 2W4QA 4WEQA 3RUCA 3E5RA 1XLTA 2PH5A 1CQIB 4R5MA 2FN7A 4EJ6A 4J6FA 4BL5A 3EY4A 3AUSA 3WQRA 4H3VA 4CL3A 1CWUA 1EK5A 1SOWA 4G5HA 1PJ4A 1H94A 3BHIA 3GF4A 4MKRA 1T25A 4J3FA 3LSYA 4J2HA 3K5PA 3WBFA 4D0RA 4FSHA 5H82A 4I9HA 4RGBA 1OZAA 2H1SA 4NQZA 4XYEA 3ONFA 4UVDA 3WJ7A 4OGWA 2NNLD 2X9NA 1DIGA 4XGKA 4CLHA 4D3SA 5I8WA 2EGHA 2ZB8A 3QHAA 4QEDA 3GRPA 2UUOA 2X7HA 4OSOA 5THKA 2ZQZA 4BNVA 4FCCA 5T64A 2NTVA 4YRDA 1YB4A 5DCWA 4M1QA 3NX4A 2DBRA 2HAEA 4RPLA 1I2BA 3OECA 4R01A 1F0YA 2W8ZA 1NFRA 2FSVA 3LVFO 4UVEA 1R6DA 1O6ZA 5IZCA 3JQ7A 3QVOA 4NZ9A 4BNJA 3A28A 3DBHB 3IAHA 2B5WA 1I8TA 2QZZA 2IDZA 4M55A 2Q99A 1QKIA 2A92A 2HKIA 4PG5A 1XWFA 1ADFA 3ANLA 3OQ6A 3Q1LA 2HQ1A 1I3NA 1WW8A 2Y1DA 4BMNA 5BSFA 3GAFA 1LSJA 1EE9A 1NWCA 4HFNA 3ZWNA 4Z0HO 4NJOA 1H6CA 1ZFNA 3BHJA 2W2LA 4CUKA 2C07A 1PWZA 1LA2A 2P2SA 3JD3A 4JNKA 3DMTC 1UXKA 5GY7A 1HDXA 1PGOA 5DOVA 1K2WA 1IHXA 4UEKA 1KY4A 3TOXA 4BO9A 2GN4A 3ICPA 4IS3A 2GZ1A 3PJEA 5KOIA 5COQA 3VKVA 1Z7EA 4EDFA 4RVGA 4ZRMA 3FHLA 5DDIP 4AJPA 3I52A 2GZ3A 4NBRA 2QIOA 1P44A 4B8ZA 5K0ZA 1TT5A 4RF2A 4KDEA 4CMIB 2P9EA 2X0JA 4OL9A 3F1KA 5KJFA 3ZWWA 3GR6A 3C85A 2GLXA 4L76A 2DTXA 2YDXA 3GAZA 4LN1A 3UCEA 2O23A 1LBEA 2CMDA 2OXIA 4BQRA 3RQSA 1GL3A 2Q45A 3ASUA 4JGBA 3VOSA 5F3RA 1PZHA 4O63O 1YBMA 5I9LA 3MWEA 3R0IA 2YUTA 3WX0A 4UVIA 3KSUA 4CMGA 5A03A 3GPDG 3H8VA 3D64A 4E5PA 3H5NA 4FD3A 4R51A 4CR7A 1E3WA 3WSWA 1VJ1A 1K0UA 3GGPA 2NU8B 3RUHA 2FPPB 2E82A 5K6AA 1M2WA 4Q3NA 4E32A 4KMSA 4JQCA 3W4IA 3LLSA 5L7YA 4QECA 2EHDA 1ULUA 1VKOA 3F6YA 4NBTA 1KETA 3IDSA 3RSHA 4J9VA 2YHIA 4INAA 3GMDA 5JW6A 4Q3BA 4A73A 4A2CA 3F5SA 1IE3A 2GSDA 1B7GO 3VVCA 1V8BA 2AE1A 4CR8A 3VC7A 1HDOA 3EDMA 3FWNA 4K28A 5JCJA 5BQFA 1C14A 4TQGA 2Y68A 3RBXA 3I9LA 5L7TA 4XIJA 3UHAA 4GH5A 2VT2A 4L9RA 3W6UA 1HSZA 2RCYA 3WJAA 2D5AA 2V6MA 4MVJM 1YS4A 4CV1A 3SVTA 4GGPA 4E3ZA 3OHSX 4IDCA 4UVHA 2GN9A 4A0SA 5IG2A 3OBBA 2YFHA 2C0CA 4FDAA 3S2IA 4DPMA 1YJ8A 5IXSA 4XQCA 2WTBA 5IAAA 2JCXA 4RZIA 4YJFA 5DT9A 1P0FA 4N5LA 1DAPA 4F46A 1T1SA 1U3UA 2VQ3A 2IZ0A 4DTIA 2Q50A 4AFNA 4I1IA 7ADHA 5JC1A 1DPGA 3JQAB 5TJHA 4IMRA 4GMFA 1Q7CA 2HJSA 3N74A 3WOHA 5L51A 3FR7A 3P7MA 2NQTA 1DIHA 2VWHA 4J0FA 3CINA 4Q3CA 5CFZA 1DLJA 3O8QB 1NFQA 3ONEA 4R1SA 4B4VA 3I6IA 3S2GA 3I4FA 4XX0B 2C54A 3FNGA 3HHPA 3B1JA 3VH3A 2VZ9A 2CVQA 3V2HA 1AN9A 4MIOA 1ADGA 1T2FA 1DHTA 2H5LA 3WTBA 5CDYA 3DBLA 1C0IA 4UEJA 4MO2A 4D0SA 5IZCC 3JQAA 2UDPA 1U1IA 1Q7BA 1EUZA 2IYOA 3ZWMA 4FGWA 1HWYA 3W1VA 4AJ1A 4IZIA 5IFLA 3KYDA 3PI7A 5I9MA 1NBOA 4GWKA 4PLYA 4YT2A 4XB1A 2WYUA 1RM0A 3DZBA 2GN8A 3AU9A 3PK0A 3GFGA 4JBHA 1HF3A 3H9EO 2O2YA 2YV3A 3HE3A 4S1VA 4AJIA 4FB5A 4ID9A 1YRLA 5BSHA 4IQ8A 2DM6A 4JXKA 1XKQA 4FFLA 1SMKA 5JLAA 3CXRA 4IDDA 3RFTA 1B8UA 1P77A 2O3JA 1C1XA 3R6DA 5DBGA 4OIMA 1FMCA 5I7SA 1N7HA 3LQFA 4XR9A 4DGSA 3FPCA 1KEUA 1H6AA 1B14A 3ENNA 4CM5A 1DXYA 4B4UA 1R4MB 2E4AA 1AGNA 1J0XO 1I3MA 4JCOA 2VT3A 2NVBA 5TC4A 1NQTA 3KZVA 2QRLA 2QW8A 1OBFO 1SEPA 2ZQYA 4D3DA 1B8PA 2Q1WA 2VHVA 4C4OA 1AUPA 2HU2A 4M86A 4XDZA 5AYVA 3WGQA 1DC6A 1LLUA 2CVOA 3HG7A 1LXCA 3AOEA 3DO5A 3OP4A 1E6WA 4ND4A 3GMSA 3EK2A 1JQBA 1LDMA 4OOEA 1U8FO 2P5YA 2E48A 3GZNA 4PZEA 4Q3EA 1F14A 4MVJF 2I66A 1MC4A 3Q9NA 5IXYA 3NUGA 2DC1A 3JQFA 3QWBA 3WYEA 3IQDB 3WLFA 2VHYA 3BMCB 1DRUA 1L7DA 4AJOA 4BV8A 3K30A 1FF9A 3G49A 4IQ0A 4XEHA 3GEGA 3AM4A 3ZNPA 1YOVB 4IDGA 3JV7A 5T8KA 5K6AC 2AEMA 4IJKA 5ENVA 4TKLA 4MVJA 1Z75A 2NV6A 2NU7A 5DF1A 2CVZA 4PLZA 4BO4A 1LRJA 3F3SA 2WSBA 2O3RA 4N18A 2GD1O 4W4TA 1Z45A 4OO3A 1YXMA 4YR9A 1MP0A 3T4XA 4UUMA 5G0VA 4GX1A 2DT5A 2Y1GA 4QSMA 4BVAA 1HE3A 2O2SA 4RVUA 2C82A 4J91A 3RKUA 7MDHA 3JYQA 1QMGA 4MP3A 3UFXB 2VUTA 4RZHA 3KEQA 4ZQFA 3CPSA 1AXGA 3P19A 1Q2XA 2G17A 3PJDA 4XDYA 3NTRA 1JTVA 4QUKA 2C2XA 4PN3A 2JCYA 1HYHA 5G4KB 1GDHA 5L45A 4FFPA 3A4VA 4ZU3A 4OOFA 4E12A 3N58A 4G81A 2NLOA 5CP8A 3I9NA 1HTBA 4BNWA 4BGIA 1NAIA 3ZHYA 1KS9A 5FFFA 1XELA 1NYTA 1PGJA 4TVBA 1UXHA 3U4DA 4U6QA 5L3ZA 3V1UA 1PS0A 3RUDA 3JTMA 1O8CA 4QX6A 2PKRA 4WUVA 4BO7A 1U2GA 1HDZA 1H6DA 3JYOA 2Q1SA 1MLDA 4FR5A 4ZHSA 1DIAA 2B4QA 1SC6A 1T26A 3C8MA 3DONA 3JD2A 4LSWA 4TKMA 3O03A 4H15A 5JDCC 4CLOB 3PYLA 2W2KA 1ZK4A 4KWIA 2UVDA 4EUHA 5H83A 1Q1NA 4FN4A 4L4RA 1U7TA 2VHWA 4AVYA 1Y81A 4ALIA 3EGOA 3I3OA 2W90A 4KZPA 2PD6A 5B37A 1UP7A 2Z1NA 3QWFA 3VPSA 1QR6A 3NJ4A 1VSUA 2Y1EA 2B69A 5MDHA 3PHGA 1TA4A 1A4IA 2Y99A 4WASA 5L9AA 4OM8A 1DLIA 1LI4A 3WGYA 4MVJP 2VNSA 4G65A 4II3A 4BGUA 1XYGA 5JY1A 1PL7A 1DBVO 2I99A 1EUDB 5JAZA 4W6ZA 5L53A 2OP1A 2EP7A 4HUJA 3DAPA 1E3LA 3FNFA 4WKGA 2CDAA 4ZN6A 2FSSA 5HM8A 5COAA 4J1QA 4R9SA 1DAOA 1E0DA 2VZ8A 3JQ6A 2Y1OA 4M87A 4XD2A 3CSDA 4ESOA 3AW9A 4CLRA 1GV0A 1DRVA 1H9AA 4WOJA 4CLRB 1E7YA 3UXYA 1NVTA 1I33A 1V6AA 4BO1A 3QVXA 3ZWPA 5T6BA 3WWYA 1CJCA 1LU9A 5A3VA 4BO5A 4JROA 2NU8A 4JLWA 5HBRA 2EKLA 2BI7A 1NR7A 2B83A 2C7GA 3BYZA 1R16A 1B0AA 4GKVA 4I9UA 2PKQP 4LCEA 1EBUA 3UICA 4XR4A 1M6WA 1ISIA 2GPTA 1M67A 3Q6IA 4KOAA 4YXFA 5KVCA 3ETDA 4YAKA 3H7AA 1V3TA 1K6XA 5F5NA 5TGDA 4XJTA 4BMVA 5A9RA 4N5MA 5HRUA 2BRUA 4GX0A 4HY3A 1VSVA 5A02A 5JS6A 2BFPA 2P9GA 3LYLA 5KVQA 3PGXA 3V1YA 2FMUA 3UCFA 4GX5A 5EIOA 2R00C 2GF2A 4J1SA 3ZV6A 2AG8A 1Y8QB 2V6FA 3JQBC 4FS3A 1L7EA 4TVOA 1T2EA 3EAGA 4RL6A 1UAGA 3I6QA 1WDLA 3TNLA 1E77A 4YVFA 1UZNA 3VVBA 1NVGA 2G1UA 2EGGA 2CSUA 2FPIB 1BXKA 4LK3A 1EBFA 2VCYA 4J4BA 3ZN2A 2HLPA 3RC1A 4W9NA 4CPDA 3GHYA 3I1JA 1DRWA 5F21A 2DBZA 4I5DA 4QT0A 3ZCXA 3U5TA 4TZTA 5JYDA 3KV3O 4N5NA 4UAGA 3S1LA 4J7UA 1VLLA 3L0DA 4YJHA 4FC6A 1XQ6A 3B70A 1EDOA 4KDFA 4P4LA 4E5YA 1P1HA 1M76A 3E9NA 4IGEA 3WQSB 1WLYA 1LLQA 2B0JA 4MJLA 1T4DA 4ZGWA 3Q11A 2X23A 2PZLA 1WAMA 5A9TA 4ND1A 2EXXA 5KVVA 1SO8A 3I4CA 5AXAA 3KO8A 3L77A 3Q0EA 4EGFA 3I9OA 3H6KA 3GG9A 1R4NB 3DBHA 1XDWA 1LLCA 2VWPA 4OQZA 3D0OA 4BB5A 1GYRA 1KVUA 4NDNE 1T4BA 3INGA 4K9DA 1VJ0A 5HWSA 5TRTA 1ZXBA 4GVXA 4L8VA 2VZ0A 1Z74A 4GWGA 1ISHA 2QZ9A 2CNBA 3NRCA 1GY8A 3DMYA 3KYDB 4AJ2A 5G0SA 5JAIA 2PNFA 3G79A 3D4NA 2GASA 2Q4BA 2I3AA 2OOSA 3KEOA 1LDYA 3AOGA 4IZHA 5EQFA 4CMHA 3I9KA 1KC1A 1JA9A 3FSRA 5ER6A 1HYEA 1RYEA 3PWKA 4WE3A 3O38A 4MP6A 4JBIA 5L40A 1VM6A 2Y0CA 3RAJA 5ICSA 1HE4A 3PPIA 4PVCA 5HA5A 2GNAA 2VHXA 3IJRA 4WLFA 5EPOA 3HSKA 1BVUA 1BMDA 5JCXA 4CM1A 1ZEMA 3CKYA 4CMKA 1YOVA 4R16A 4Q9NA 1YQGA 1N1EA 3BTOA 3Q3CA 2D2IA 2FRDA 2VTEA 2YFQA 2C2YA 4FIZA 4OH1A 1XA0A 3BMNB 4B3IA 4ZVVA 3KM0A 5JMWA 2NSDA 5CDTA 3MJCA 3ASVA 1HXHA 3DTTA 3I9JA 4R1TA 2YQ5A 4EEXA 3PZBA 4BMSA 1L1FA 3A9WA 4E5MA 3GDFA 4QO7A 3TZ6A 3AI1A 3D1LA 3PLNA 4I5EA 4NBVA 1Y9EA 3PQDA 4LRTB 4YAGA 4HV4A 4I8XA 5TX7A 5C7LO 3BHMA 4E33A 2X8LA 4E21A 1LSOA 3W8DA 3UFXA 1C1DB 4QTZA 3AUTA 4MIYA 5BSGA 3FTPA 2A9FA 1B3RA 4M54A 4CQLB 4E0BA 3TJRA 1BDBA 4CM9A 2VOEA 3RWBA 1H5QA 4WLOA 1JAYA 3W4KA 4PG4A 5FI5A 1DSSG 1PJQA 1LNQA 5DN9A 4A27A 3NKLA 2DFVA 1PL8A 3NV9A 2QYTA 1F8FA 2PKQO 3K92A 4BKUA 1P1JA 2JAPA 2Q2WA 2V65A 1PR9A 4RPGA 1F06A 4M8SA 3B1FA 4FQ8A 1PQUA 2DBVO 4OKNA 4YRAA 4ND3A 4PRLA 3U0BA 4U7WA 4Z9XA 4RLSA 3AY3A 3WGZA 1YDEA 1GAEO 2WE7A 4UULA 2ZB4A 2D5CA 4FGSA 1VI2A 1BXGA 2RBEA 2B4TO 2ZCUA 3GUCA 3HUDA 3WYCA 4DIBA 4PG8A 5ER9A 3V2UA 1NPTO 4RV9A 4ZQHA 1D7OA 1ZBQA 1IY8A 3UOGA 3X2FA 3PZRA 4YWJA 1U3WA 2EKPA 3MJ4A 4YEDA 2OBNA 1DB3A 4B4WA 3KTDA 4YDRA 2AW5A 1BW9A 1WDKA 4E31A 1BSVA 3OIDA 1MV8A 1U3VA 4J16A 1I2ZA 4DC1A 1CQIA 1YONA 1HT0A 1K89A 2RHCA 4R4JA 4D46A 1JLLA 3PTZA 5F1OA 4WNIA 1UXJA 3VZPA 2OMEA 1V0JA 2VRCA 2UUPA 4UREA 3M1LA 5JC8A 1O5IA 4BNGA 3JQBA 3JQAD 1JVBA 3UW3A 3ZV3A 2IEDA 1DEHA 1Q0LA 5DNAA 2IYPA 4BV9A 1GUFA 2AE2A 3HB5X 3VZQA 1ZVMA 4YAJA 2BHLA 4CLXA 2VYNA 4A7PA 3OSUA 1EVIA 4BB6A 2D0IA 1FXSA 1HDCA 1RKXA 4HNGA 1ZO8A 1QP8A 1E1MA 3AI3A 5TQVA 1O9BA 2DFDA 3P5SA 2DPGA 3BMQA 3HDQA 3INRA 4NIMA 3L6OO 4XB2A 3IIEA 3H9QA 1IHYA 4DYDA 1Z7BA 3HN7A 3PHIA 3PHJA 4CM8A 1H2BA 4XGNA 3ZI0A 1EFLA 3JQDA 1E7RA 3K73O 2RIRA 3K8ZA 3AU8A 3CEAA 1IOLA 1NPYA 4OKIA 3VPGA 2EV9A 3WLEA 3ORFA 4YYZA 1ZH8A 3WWZA 4TROA 4DYVA 1H2HA 1ORRA 3H3FA 4D43A 1DHRA 1G1AA 2IE0A 2AXQA 1ZMOA 1J49A 1MG5A 4L4SA 1LLDA 3TSCA 4WCFA 2CFCA 1I36A 4OAQA 4E30A 4WLNA 1XHLA 3TL2A 4EBFA 4ZJUA 4BGEA 3CUKA 3N7UA 1I2CA 3UAGA 2RH4A 3ZZNA 5A9SB 2TMDA 5U4QA 4XX0A 3VTFA 2V6BA 3ZWOA 1SB9A 4E5NA 3TDKA 5LDHA 1PJ2A 2F1KA 4TRRA 4EZBA 4II2A 3S55A 1X1EA 1YL6A 1OI7A 4U0KA 1ZZEA 1HEUA 1TLTA 3GK3A 1NXQA 1YVEI 1LDNA 3WGOA 1OMOA 4BNZA 4DIOA 2XOXA 5COBA 4PLGA 3UF0A 4MINA 1F12A 3GN2A 1HE2A 3CMCO 1CQJA 3OJ0A 4DVJA 4XCVA 4FW8A 2SCUB 2HJRA 5J23A 3E9MA 3QWIA 5CDUA 1N7GA 2J5RA 1LTHR 3FN4A 1DIBA 5DZSA 1GZ6A 3VZSA 1DFHA 5GZ6A 5CDSA 1CDOA 1TVEA 4OXKA 2WYVA 3DHEA 3U62A 3X2EA 1CETA 4CQLA 1U8XX 4DL9A 1KEVA 3BTUA 3ONDA 1E3EA 4BO6A 2O3QA 5TSDA 1MXHA 4O59O 3RC7A 4TRNA 3WIEA 1Y5RA 2JFFA 1UDBA 2Q4EA 2PGDA 4LVUA 4K26A 2YV1A 3ADPA 4BKQA 3SC6A 2VYVD 4DPLA 4CL8A 2PZKA 3L9WA 1JDJA 1EUCB 4BQPA 2FHSA 4IDFA 1PGNA 4J9UE 1HSOA 4K6CA 4XQGA 2JL1A 4RVSA 3PJFA 4BNMA 1EE2A 2D8AA 4Q39A 5CHEA 3H9UA 1J6UA 1HLDA 5I8ZA 2IRWA 3W6ZA 5FYDA 3ZV4A 5AOVA 3OETA 4URFA 1A9YA 4AJHA 4F3YA 2R6JA 3OF2A 2PY6A 3NAQA 3Q9UA 3EC7A 4IUYA 1NQAO 3KYBA 4EUFA 1IZ0A 3MJVA 2NU7B 1BTOA 5KIAA 1JKIA 3ROPA 2AEFA 2OHXA 3IL2A 4DC0A 3ZNQA 4AJLA 2FR1A 4Z3KA 4L73A 3RC9A 4O0LA 4E6PA 3H3JA 2E49A 4KP7A 3EW7A 1ZK0A 1UAYA 4BUCA 1GCOA 4ZD6A 3WR5A 3O26A 1RWBA 2H63A 4B7UA 1SEVA 2GGSA 4RPKA 2X5OA 3RUEA 3D3EA 2P9CA 1JWAB 3WBBA 4ILKA 1J5PA 2J8ZA 4HXYA 5G4LA 5B4VA 1C0LA 4MVJE 1U4SA 1B16A 5L4SA 3LT0A 4RORA 1A27A 3QW2A 1N9GA 1JKJA 4NH4A 3IKTA 3RUAA 1ADBA 4QQRA 4OYRA 3GGOA 1KYQA 1EMDA 1XG5A 4W9NC 5G4KA 3B1KA 3U09A 3RD5A 3AWDA 1OAAA 3LF2A 3F4BA 2AG5A 5KTKA 4R41A 3ROQA 1YGYA 1LQTA 4N7RA 5KJ6A 2X0IA 1Y1PA 1FDWA 4BOYA 5C7OO 3K31A 5F1KA 5THQA 4EJMA 3JQ7B 3WNQA 4B3JA 1IPFA 3I5MA 1X0XA 2BFOA 2LDXA 4DQVA 2OFPA 1C1DA 5KKAA 2H6EA 4GKBA 1FDSA 1VKNA 4YT8A 4ZICA 1O89A 1ZKMA 1EDZA 1N9GB 3RUIA 3H5RA 3D7LA 3FNHA 3BMNA 5C37A 4A5OA 1OOEA 4RQUA 1LJ8A 2CD9A 1PJTA 1HDYA 3Q2IA 4IMPA 3HNPA 4BNLA 5CAEB 2CY0A 2X0RA 5BT9A 4RDIA 4WK6A 2WJPA 3D5QA 4TWRA 1PR3A 1Q0QA 1TT7A 4WPGA 2F00A 2HK8A 2CDCA 4MOWA 5EINA 4F6LA 2VTDA 2ILTA 3IP3A 5DULA 1R0LA 2I5PO 1G0OA 5FWNA 4Y9DA 1KC3A 1UDCA 4IGFA 4EEZA 3HQ4O 4RF5A 4XA8A 1H93A 2Y0EA 3KYCA 5AQ1A 5TS3A 2DAPA 5IDQA 3H65A 1HLPA 1ML3A 1CERA 3OQ1A 4Y8VA 4AJJA 1ADCA 4Y98A 4YA6A 3NT5A 1GPDG 4PIVA 1TB4A 4CLEA 5JAQA 3ZHXA 3GVPA 2AQHA 3DHNA 1B8VA 1CYDA 1Y7TA 1YH3A 5TF4A 3GNQA 4CMCA 1RJWA 5BNTA 4D3FA 4G2NA 1BHSA 2PH3A 4E4YA 4ALLA 4AJEA 1WVGA 4L74A 2X6TA 1Q0HA 3A14A 2BGKA 1VL6A 5JNLA 3PVZA 1EUDA 5ITWA 2W98A 3KYCB 4ALKA 5JO9A 3INTA 3R3SA 1ISMA 4OSPA 5IDYA 5A05A 3WGTA 5KCZA 3UCXA 5EJ2A 4F45A 3C7DB 3K9QO 4IY1A 5ADHA 4AJKA 4Q3AA 5G2OA 3C24A 4LRSB 1KOLA 4ND2A 4YPOA 5B1YA 1EVJA 3ROMA 2D1YA 3DBRB 4CM6A 2Y05A 1K3TA 2EEZA 1AHIA 4PG6A 3B6ZA 1PTJA 2ZTUA 4R1NA 3ZHBA 5EL0A 1WP4A 4R3NA 2Y67A 5CPFA 3QY9A 4NHEA 4PZCA 2IZZA 5I9NA 1ONOA 5U1PA 1QLJA 5BSEA 1W8DA 5ITVA 3EUWA 1QRRA 1FDUA 4YJFB 2O3UA 3NTOA 3JQ8B 5JAMA 3DTYA 4GLLA 4RLHA 2CF6A 4HFJA 1VE9A 4J49A 2HDHA 1GQ2A 1X14A 1ISGA 2FR8A 1P74A 1XGKA 3DL2A 3ZDFA 5JXWA 2OORA 1N2SA 2BH9A 3ITKA 4XRRA 5IDWA 4L75A 1E92A 4IJWA 4RPJA 3S2FA 2VNAA 2WYWA 1A5ZA 4K1LA 2J3KA 3JQGA 2GZ2A 8ADHA 2SCUA 4YJGA 4D45A 3PWZA 1MX3A 5CPBA 4EJ0A 3OM9A 1CEQA 4J7XA 4NU6A 1R66A 2NTJA 2G82A 2G76A 3HADA 3MWDA 1V35A 4PVDA 5ICMA 1IZ9A 4WLEA 2FP4B 1KERA 4LMPA 1JAXA 2NU9B 3K96A 3M2PA 1UP6A 2PA3A 2XPCA 4YAEA 3QRWA 5GZ1A 2R00A 3G17A 1Y6JA 3L07A 3E6AA 4NJMB 3DZJA 3UVEA 4ZQEA 1D1TA 2UV8A 2B35A 1E3WB 4M89A 5FI3A 2BELA 2BGLA 3ZGYA 4NFYA 3M1AA 5JFOA 3RROA 4R3WA 3ZWYA 4F6CA 5A9SA 2CUKA 1F8GA 1FK8A 2IEBA 4Z3DA 3ZNNA 2NWQA 4R5HA 3GUYA 3R1IA 4FJ1A 1NTOA 3GZNB 5TNXA 4J1TA 3ST7A 2ZB7A 4AL4A 2AQKA 3SX2A 4R69A 3VKUA 4GQAA 1ONPA 3ITDA 3WSVA 1HL3A 1UH5A 1EZ4A 1NAHA 4Z9YA 2EJVA 2P68A 4YT4A 4NK5A 2HMVA 3BZUA 4KUEA 4BGVA 1V9LA 3WGHA 3GRKA 1IYZA 4ALJA 4MVJI 1IL0A 3SJUA 1I10A 4XRGA 5TIIA 5H81A 4XJSA 3ZH2A 1B15A 1BG6A 5CAEA 1U5CA 2OBYA 1QV6A 1WMAA 2NU6A 3PYMA 4R1UA 3UKOA 1PZFA 1QV7A 3TZHA 1MA0A 2JFHA 3U3XA 1DFGA 3H9GA 1YWGO 4ROSA 5EQDA 3E82A 4CV3A 1LEHA 3NTQA 2BFAA 4NU5A 5F1PA 1LSSA 2JCVA 4R9RA 2DVMA 2BLLA 4RJTA 1NHWA 2O4UX 4XYLA 2DQ4A 3ZWVA 2I67A 4BNNA 1A7AA 4RF4A 4TSKA 3PXXA 4HWKA 3IUPA 4BS9A 1T24A 1QORA 1KVQA 1SCUA 4XKJA 2FR0A 2GN6A 1KVRA 3D4OA 4E2XA 2DU8A 4PGFA 3FPLA 4RCVA 2ZYGA 4JK3A 3VH4A 3WGGA 4XIYA 1GYQA 2ZJ1A 1E1KA 2BKAA 3BMOA 4NK4A 1O0SA 4PLTA 1MXFA 4XYGA 4GI2A 3U4CA 4I5FA 4BHTA 5JDIC 3MOGA 2O4CA 4UVGA 5KJCA 4DRYA 1E7SA 4BNXA 4FFMA 3E48A 3NT4A 4X54A 4XQEA 4DPKA 4HFRA 1XR3A 4PG7A 1LDGA 4R54A 4ALNA 5L4LA 1EVYA 3TQHA 1PZEA 4CMEC 2X86A 4AG3A 1GEGA 6LDHA 4CM4A 5JDIA 2HRZA 4ZRNA 1ENPA 2B37A 3RIHA 1DJNA 4LMRA 3RBVA 3ROKA 3GT0A 3OA2A 1PX0A 2EWMA 3BTVA 3LT1A 6ADHA 2O50A 3ZU4A 3K2EA 1ZW1A 4BO3A 3IC5A 1RM4A 2E6UX 5B4UA 3ZWCA 5T5QA 2WE8A 3EHEA 4E13A 2IODA 3PDJA 3ZW8A 3BMCA 3P2YA 1LQUA 3GG2A 4CLOA 2VWGA 1PJBA 1GADO 4YACA 2WD7A 2J3IA 4LVCA 1JN0A 1OFGA 5BR7A 1B2LA 4KTVE 4CMJA 5A4DA 3SEFA 1U3TA 1MGOA 1DDOA 1YQXA 3FWZA 1E3IA 4J4HA 3UUWA 4RDHA 2VYND 1A71A 1WMBA 3V1TC 4DMMA 3I83A 2YZ7A 5ES3A 1LUAA 4LW8A 4CV0A 2QQ5A 1T2DA 2ZKLA 4GPD1 4BKRA 4M49A 4IS2A 3H2SA 3Q2KA 1R15A 4RO0A 4EW6A 3DBVO 3KBOA 1E1LA 2X0NA 5DCYA 3T4EA 3KXDA 3M6IA 1QXSA 2EJWA 4YAIA 1J4AA 2FPPA 5A04A 2J3HA 3CH6A 4I08A 1X0VA 1PJ3A 4I5GA 2WD7B 4D44A 4PZDA 2YHIB 1JKJB 2V6GA 3MWDB 1WZEA 3DR3A 4JJGA 2J5KA 4IDBA 1WXDA 3KOUA 4YB8A 4CR6A 1KBZA 5IZ4A 2CDBA 3IP1A 1U7HA 2I76A 1XSEA 3AFMA 4J90A 2ZYDA 1QLHA 2EG9A 3GN1A 5DBFA 1PS9A 3FCOA 3DC2A 4XYMA 2JD1A 4WLUA 2JKVA 4RVFA 1SOVA 3E9QA 2ZTMA 4NFHA 4D42A 1CQJB 1U4OA 5A3JA 3JCZA 1HDRA 4B7XA 3NDRA 5IJZA 3CMMA 3OJFA 3IMFA 3OIGA 2H9IA 1TT5B 4C7KA 4Z6KA 1BVRA 2PWZA 1I0ZA 1XU7A 3ANMA 1LDEA 2FPIA 5AXBA 5ILGA 2WMDA 1Z82A 3PRJA 1G6KA 1R0KA 3TRIA 4CV2A 2G0TA 4PCVA 1LSUA 1H6BA 1GD1O 3HWRA 2GCGA 1NP3A 4CM4B 5BNIA 3A06A 2C59A 1R4MA 3SXPA 1NFFA 4WJZA 3DHYA 3HN2A 4PLCA 4N54A 4ZA2A 2DTDA 3NEPX 2O48X 4J0EA 4RVHA 4KWHA 8LDHA 4OXNA 5JE8A 3W8FA 3QP9A 4W99A 4BNHA 2P5UA 5T8KC 1PEDA 4HKTA 3D3WB 1D1SA 2AQ8A 2VN8A 3RI3A 2EIHA 1LRLA 3PGJA 3DEYX 3STHA 5TT0A 1HZZA 2TMGA 1I3LA 1N92A 3DAGA 5A5FA 1C1XB 2IXBA 5JMPA 1V3VA 2VHZA 3W4JA 1S6YA 2GUGA 2ZJ0A 3PIIA 1PWXA 3V5NA 1JWBB 1GPJA 4YQYA 4YTEA 3GA0A 3GEDA 2PGJA 1LC0A 4JP3A 2OZPA 1ZEJA 4IINA 2QRJA 3AFNA 1VL0A 3H2ZA 2HO5A 2QX7A 2YYYA 1A4UA 4IPTA 1EK6A 3IS3A 4WLVA 2HUNA 1A7KA 3ZWAA 4E2YA 4P4NA 4DIFA 1HE5A 3JSAA 4YJGB 5EERA 5L4NA 4Y6RA 2Y66A 3L9XA 2Z95A 1BXZA 3JYLA 3GH3A 4GSLA 2A94A 3DOOA 1ULSA 3JYPA 2J3JA 1GQYA 2Z5LA 4JJIA 4WOKA 1PL6A 2G5CA 3E8XA 3GHHA 1C0PA 3SBOA 2YJZA 4BNKA 2CF5A 3NT2A 2AHRA 4LCJA 2P91A 2J6IA 3PHHA 3S8MA 3EYWA 2YW9A 4Z0PA 3JYNA 1SB8A 3MZ0A 1E7WA 1D8AA 1ENOA 4JX8A 1E6EA 2VOJA 3GLQA 2Q1UA 1ZCJA 4MP8A 3BAZA 1YDWA 1YB1A 1X7HA 3C1TA 1V3UA 4U6SA 3AM5A 5JO0A 3QIVA 5LDGA 1OC2A 1VL8A 3L6DA 3LC2O 3CZMA 3SJ7A 2X5JO 1GUYA 1EVZA 4QFCA 1XCBA 2PR2A 3AJRA 1T2AA 3VZRA 3TOZA 1RPNA 2BFMA 1M6HA 1P45A 1QYCA 3HB4X 1YBAA 2NVUB 3QSGA 3D5TA 3LK7A 3VAZA 3D4PA 3ZU5A 1ENZA 4NPCA 2NACA 1VRWA 2FOIA 2D59A 4L4XA 4AJNA 1PQPA 1DC3A 2EW2A 3DB2A 4B79A 3ABIA 4DLAA 2JD0A 3RKRA 3DOCA 3IUSA 5BNFA 3TWOA 4GBJA 1AXEA 3GVXA 2B4RO 1MUUA 3KRTA 3EMKA 5CG2A 4B7CA 1BRMA 4NBWA 4PLWA 4MDHA 5EESA 4K6FA 4A10A 2X5KO 2PTGA 3DDNA 1O94A 3MJTA 3PIDA 3ZU3A 1NQ5A 4YRBA 2X9VA 4IBOA 2VRBA 5JPIA 4XWYA 4DWVA 4HADA 5I7VA 4GSKA 1YE3A 3HZZA 3BA1A 3GZ4A 4CQMD 4MKZA 2Y1CA 3KHUA 4LGVA 2HK7A 3WTCA 5JBIA 3EVTA 2Q46A 1G0NA 3C1OA 3LF1A 9LDBA 4YT5A 4CQMB 4OJNA 3WDSA 3H9JA 3WMXA 1YKFA 3OJEA 1QSGA 4L0QA 4XYBA 1BW9B 1I3KA 3LC1O 3WQQA 3QQPA 1GR0A 3GNTA 1P1RA 3QVSA 5U9CA 3DMTA 2FY8A 3JQEA 1JLLB 3ANNA 5FEUA 3NYWA 4RQTA 3L4BA 5AXCA 4LISA 3FRJA 4DA9A 2JHFA 1SBYA 1E3JA 2GERA 3U4IA 3WS7A 5IDXA 2PZJA 3ADOA 3AOEC 1S7CA 1QYVA
chains in the Genus database with same CATH superfamily
1X7WB 5AVRA 1IATA 2BDTA 4K9PA 3W5SA 4DV1B 3RFVA 2IYAA 1ZI6A 1K5HA 1KKLA 1Q44A 2HJVA 2HEIA 3UJBA 1NM5A 1N2HA 3CGGA 1IK4A 2C20A 1N0IA 4DMUB 5LWQA 2GXAA 3ZHBA 3OVMA 4IDAA 1OROA 1YB7A 3DE7X 2JJYA 2G28A 1HETA 5SZKB 1IZ7A 1J9ZA 3GVIA 3WK6A 1P9LA 4AIIA 1SXHA 1BS1A 1PR6A 4MR9A 5J5CA 4R8SA 4DKXA 2B8JA 2GDZA 3CKKA 3S2YA 4B3MB 1ISJA 1T36B 2ISCA 2ERCA 3QX7A 3GRCA 2XV1A 4V39A 3KPYA 2Q6KA 4IDPA 4X1IB 1M2OB 2OEPA 4E1BA 4V24A 1J2JA 1I6MA 2ZRGA 5HX7A 1VTKA 3DWFA 3FD8A 3E22A 2HWWA 2IUFA 3QG5A 1W76A 4MV4A 4MIEA 4EI7A 4BIMA 3F97A 4WCFC 3ER8A 5B3JC 3NONA 3I64A 4FJ0A 4CMAA 3VPXA 1B6GA 1XVAA 3AIOA 2WYIA 3GRRA 1LFDB 4M0UA 4F71A 1QQ5A 1R64A 4Y6LA 1XRLA 4BQOA 1KAQA 3I1IA 1XNRB 3MCVA 3I6BA 1N0HA 2A5YB 4O1MA 5C3MA 5DCUA 3LPCA 1KYVA 1EXVA 1JL3A 2ZK7A 4KQKA 4LYAA 3OJLA 1UEXC 4FNMA 1Z4OA 1JU9A 4JT9A 3VGPA 3OE4A 5A4JA 4RDXA 3QUSA 2P2YA 2VJMA 4BMYA 3KBBA 4LZLA 4NU0A 2PT7A 1U28C 3HCPA 3KHSA 4HMOA 1N1GA 1XJQA 2QORA 3ABOB 2R87A 4ABYA 2PE5A 2QE7D 3U5ZB 5JD5A 2QJTA 1TL7C 2I4TA 4IWNA 1DOHA 2FZEA 2ZE8A 3K0AB 4LDPA 3EDYA 4PLHA 4R8VA 5B36A 4DV5B 3OUZA 1UR5A 5FULA 5CUQA 2R97A 4D41A 1JFVA 1FDOA 2ZJ6A 3EVNA 5I7OA 1HEIA 3BL5A 1GCUA 1PZNA 4DN6A 3HFGA 2X6QA 4C7JA 2PV7A 4TXNA 1G20A 3PQ8A 3A1FA 3G1TA 3PE6A 3SOZA 2XITA 4KUHA 2J33A 4JKOA 4UAVA 4BX8A 4IEFB 3GEEA 1IZYA 2DLDA 2XE4A 4G56A 3LW8A 4OQNA 4UEOA 3CCBA 3AR5A 2PBRA 2PUGA 4KWTA 4TS9A 2UVQA 4N48A 1J09A 5A4AA 2FPUA 2NUAA 2F9MA 2R8BA 4JGIA 5A71A 4CMIA 1GFIA 2FX3A 2QQEA 5ES4B 4QFDA 4HS4A 4LBWA 1E9EA 2Z8ZA 3ZXYA 1M1YB 5DHAA 1A72A 1Z39A 2N0SA 3JVIA 5KQMA 3P2IA 5CYPA 2ZAIA 3QA9A 4Z4CA 4UUOA 4ZU6X 4IQGA 1HLGA 1N6PA 5TT1A 5I4CA 4G5QA 4IDEA 4CDRA 2QV7A 2VUUA 1F5SA 1QG6A 4FKBA 3OHMA 3JQ9A 4WJLA 1K86A 3QELA 4IHJF 4K8OA 3J80A 3MGCA 1ZUIA 1BKSB 1OX4B 3UK0A 1CUBA 1D6NA 1Z7YA 2FCAA 2OFXA 2AR0A 1TXGA 2IOFK 3BMOB 1EAMA 5JTUA 4KKXB 4NFLA 2BVNA 1E5TA 4JR2A 4ZO7A 4KGDA 3T94A 5LU9A 1EKXA 2HCTA 1IULA 4ZQBA 5FAKA 2NNWB 3BSSA 1MW9X 3EVAA 2PD3A 2FE1A 2GJ4A 3OE7A 2IOYA 1PSDA 3GRFA 4X00A 2HMTA 4R9UC 5AW5A 3PXUA 4TV8F 1XZIA 1OBCA 3FLAA 4QGHA 5EMNA 5HS4A 1HEYA 1JZTA 1ILEA 5E7MA 4R6XA 3OF3A 5TPWA 5LM3A 2O59A 1YZTA 4JOCA 3CVYA 1JR6A 3RFFA 1VG0B 2ZTLA 5K3SA 2DSNA 4HUTA 1C4OA 1JKXA 2FUEA 3N7AA 1RVDA 2IHZA 3FBWA 4K6KA 5C52B 2A4MA 1Y8QA 2C8LA 3LQ4A 1T3GA 3V34A 1V96A 4AICA 4P33A 3O8QA 2ZB3A 3CB2A 3KT8A 1FFXB 4FILA 4BAUA 4G1CA 2OAGA 1Q7GA 3CX7A 4EKIA 3IMGA 4PRKA 1FFDA 2WAYA 4QRDA 3ETJA 5KWEA 1AA6A 1ZMTA 1TVKA 2J3DA 4G9BA 2HMSA 3VBCA 2BSAA 2BD0A 2O8DA 3ET5A 1L7MA 1SPXA 3A9TA 5BQOA 4TX1A 1Y6QA 2PHZA 4OGLA 3WK7A 2CJFA 1YK1A 2EP5A 1FMJA 4ZOLA 3ND5A 2K6GA 4EI2A 1MFZA 2VQFB 3O31A 4XGIA 4CVNA 4N6NA 3PUYA 4F2DA 2W2PA 4O6VA 5I7FA 1CYEA 3KVNA 1XVIA 1G55A 4X1KA 4HUQA 3JYHA 5EG5A 2CFTA 5HF8A 5IS2A 4O4JF 1RACA 3IH5A 4PGGA 5JMOA 1QO0A 2JEYA 2QN9A 3EZYA 2ZSHA 4R83A 5AO9A 4FZ5A 4AK9A 3ETCA 1BYUA 4X1YB 1T5BA 2PG3A 2X22A 5JFOA 3CZPA 4ID3A 4OU4A 4WBSA 1TEHA 2W6PA 3EC2A 1NVMB 4G85A 1ZOIA 4IXWA 4RPHA 4M9CA 1B6TA 1QK3A 3PNYA 4K9QA 3TTUA 3C7CB 4HP8A 1RABA 1UBUS 4ECEA 2XNJA 4KO3S 4AP6A 5BQ3A 1CVLA 3A6KA 3T9DA 2BFBA 2ATEA 4JIGA 1WWKA 4PFSA 1FLDA 2PYDA 5ED0A 4CLDA 3PFWO 1A5TA 1E9AA 1Z0FA 4FSXA 4IJMA 5K03A 2QQ0A 5CJ2A 2RB4A 4EAQA 2XNKA 5BN3B 4NBUA 1QQTA 2EZ9A 3KR2A 3CZRA 1P6XA 1Y8RB 4V1CA 3GLSA 3TIIA 1SUFA 4Q3KA 3UB4A 1MU0A 2A9PA 2JB9A 3HLKA 4JJAA 4ZI7A 2J9RA 5E2BA 4CMBA 2AFHE 3NWOA 1E6UA 2K87A 2R25B 5LQNA 3UGKA 1Y3FE 5J9FA 1S4QA 5IKEA 3AL0C 1DIRA 1XIVA 5ITSA 1CHNA 5F9MA 2VZEA 2NVWA 4BMXA 5KNCH 3TLMA 4AECA 1SQFA 2Q41A 2YXDA 3RRJA 1FLAA 1RYDA 1QHIA 4MVJG 2XWJI 3ASYA 4CJXA 4RDCA 4ZT7A 1PJSA 2HPZA 1CY7A 1BMTA 4J2OA 4Q24A 1MB4A 3W2TA 3JQPA 1Q3HA 5C46F 5K3BA 3W8NA 1YQTA 4WUTA 4INZA 1T0JB 3I37X 5BWCA 1A5SB 3OPQA 1NXPA 2YOFA 3QVVA 2JIBA 4RVDA 1OGJA 4LYDA 2WG2A 4QOHA 2GRAA 5DT2A 2IXEA 2D2VA 3R74A 3BXXA 4KAJA 3ZDYB 4B3XA 4BMZA 4DJFC 4JYAB 4BQQA 3RJ5A 2ZUWA 5ARCA 3TO5A 1QIIA 1DC4A 1LBQA 3TN7A 4RZSA 1SVUA 2JFPA 4WCFB 3GCGA 3A0UA 4IIVA 4XM0A 3BH6A 3L84A 1Q16A 4JBNA 3DE4X 3F46A 1MX5A 1N5DA 1U8TA 2X2PA 3ORYA 4OL0A 3MNFA 4QEKA 5FAXA 3ZC3A 3OICA 4IXTA 1KAOA 4E11A 5IF3A 2R1UA 5IN4A 5BW8A 1ZJ6A 4KMMA 1QCCA 3VKGA 3JD0A 1LRKA 3EDCA 2OV1A 3BB1A 4N49A 3FF4A 1KVSA 1M5TA 2B5OA 1TQDA 3A05A 3PHBE 1SUAA 1IH8A 2G4LA 4BE4A 3MA0A 1GYPA 1AHHA 2JDIA 1W0KA 3NDJA 3X3HA 2KLHA 4L5AA 4IIJB 1A9TA 1E9DA 1UXIA 2VJYA 4S1PA 4TMFA 4JI5B 3EGXB 1KYYA 1P4SA 5E8JA 5K8JB 5KOHB 1H9CA 5ISMA 1QUEA 3KKEA 2IE8A 1OZGA 1P72A 4CEJA 3GJXC 1I24A 2IF2A 1CQPA 1RQNA 3NANA 1R0SA 2OCIA 3OPNA 4G1FA 4JN6B 4KQCA 4NG5A 4UAUA 3ZV5A 1E79D 2W2LD 4LC0A 5ALSA 1R2QA 4KCGA 2D0DA 3NTXA 1IJBA 1JG4A 3P9RA 4LXYA 2VRCD 4CL0A 1ZK2A 5DBIA 5KPDA 1JQEA 5FOQA 3CVWA 1GAWA 2XXAB 5KKNB 2GUWA 5REQA 2ZS8A 3I04M 2ID4A 3QBTA 1MFPA 5F76A 4KRYA 3D7SA 4OH7A 2VZLA 1WHTA 4HDOB 3BVPA 4QGSA 1RAFA 1BXGB 1DMSA 3EMBA 3H2IA 2O8BA 1JYEA 4PW0A 5LC1A 3WWCA 1GVHA 3R6WA 1FFSA 1UBHS 1R6VA 4YMGA 4ZOQI 4RTQA 4YJDA 1FXWF 4BEBA 4ZK2A 2VO1A 3BXFA 4GZ6A 3BCHA 1T4CA 3QE4A 4WZ6A 1RCFA 2JKZA 4MR8A 4C4PA 4MMXB 2ODNA 3UAZA 5KDLA 4F12A 5IAOA 1BDMA 2C2HA 2N9UA 1DVRA 4LJKA 4QTUB 4XTRA 3KZOA 2W43A 4ML3A 1QYXA 5DOZA 2P4QA 1PR4A 4PO8A 2FX2A 1BFKA 4MQFB 1PGPA 3IR6A 2Q2VA 2MR6A 2P2NA 1U0GA 1ZBDA 3RVMA 5DXFA 1KZ9A 5I6DA 5JSFA 1JA0A 1ABFA 2Y71A 5JEDA 3AG5A 4HEA6 2DKNA 2C9OA 4OXYA 3BJMA 3WFIA 3MSXA 2GCOA 3HRKA 4D81A 4DW8A 5BSMA 4TM7A 2W2KB 3RANA 2NAFA 2QYSA 3Q6NA 4MUHA 4QUJA 5JCOA 2GJKA 4PQYA 3BXZA 1OSNA 3V8BA 4B31A 1C4KA 1ZSYA 5HUQA 1ZD2P 5BSRA 5D5PA 1JDBC 1D04A 4KLNA 3R3VA 3M2TA 3I9V1 3NHFA 3AL3A 3ESCA 4FFWA 2K7ZA 1ARZA 2GO7A 2WPDA 4LYGA 4WEOA 2GAJA 4OBWA 1JYFA 2BUCA 2GYWA 5IN5A 1H42A 1XOIA 2EERA 1XCOA 4EK9A 5J2TF 1VECA 2B20A 2NZUG 3PF8A 3EGWA 1U5AA 4L50A 4KLZA 4QO8A 3AM3A 4W7HA 2F43A 3A1SA 4EPYA 2XRZA 3WGLA 1LV8A 1YTUA 1KQNA 4CIBA 4BNYA 1CUJA 3PR1A 4ZYLA 3DHWC 3HNRA 3RS7A 3S70A 2BGGA 1MBZA 1GEEA 1D1QA 1Y1RA 1K97A 1YBHA 4CL2A 3E7WA 2O52A 3MAGA 2AK3A 4CUZA 1NBIA 4UNIA 2FMXA 2B1QA 4G8CA 5DNUA 4WKPA 2IXAA 1N2CB 1UEIA 4K1XA 4O2BA 4OK6A 3UQZA 4J7CA 2MSKA 4BFYA 3IT2A 1E7MA 1KRHA 1KH3A 3FR8A 4I19A 3DXZA 1R0XA 3KJQA 4EZEA 3OQHA 1O6BA 4L2IB 1A1SA 3V33A 1LPNA 1YBVA 3KUXA 3PRKE 4KNVA 5BYJA 3WXMA 2NZ2A 2R85A 3EZLA 4HK4A 2WF7A 3PPYA 1BS2A 4JB8A 3RV4A 1KAEA 5SV2A 2ZGVA 4KV9A 1P3DA 3DE6X 5IJ9B 1E3QA 4WK4B 4G37A 4YFVA 4YV2A 1ZHOA 2B36A 2BHTA 5IAKA 3LY9A 3IV6A 3AVWA 1BEEA 2CLFB 2G9VA 2OXRA 2E2WA 3KB6A 5BWBA 3C3XA 2XBUA 1P0MA 3CUTA 4C3OB 2GYYA 1WJGA 1MC5A 2J5QA 5IC5A 3TSZA 4F3TA 1O08A 2OCGA 2GBLA 2OV6A 5B12A 4TTTS 1JG6A 1IVNA 3I42A 2NZJA 1QO9A 2VYVA 4OHRA 4YJ2A 2OL4A 1QLWA 2PGLA 5H16A 2RJOA 3ISTA 4KTTE 3FETA 3PNOA 2GNOA 1M0SA 1R5OA 1GZ4A 2C2BA 2GPBA 1Q7TA 1C0KA 3IR5A 2EYUA 3ANYB 4MLCA 3RVDA 1XMQB 1T10A 4HDQB 4YCBA 4C9BA 5KB3A 2P3SA 4U0JA 2FZLA 2A0FA 4B5KA 1GP2A 3ICVA 5KC8A 2GZAA 1GOTA 1K75A 1GLGA 1S9HA 5EIWA 4BNUA 1QPBA 1T2VA 3I0NA 4NNJA 2C5AA 3AF6A 1FIUA 4YV7A 6PFKA 3HFJA 5IMSA 1THGA 2DP4E 3O95A 4RIIA 5J5VA 1Q74A 5DGTA 5ALNA 5C7IO 1RT9A 4DLLA 2YHUA 1O95A 2VATA 3LZDA 1TTQB 2XAAA 2IV7A 2YJTD 4HD8A 3H4MA 3CZQA 4ZK6A 2FP4A 3G8AA 4WA8A 1Z26A 4H4CA 4ZAXA 5JI2E 5TLSA 1SWWA 2I1WA 2N47A 4NXNB 3NOQA 2FLKA 3R9XB 2HA4A 3BIOA 4KO4S 1XMVA 1JFRA 4DJDC 2FQXA 3DFMA 3SC4A 4B3GA 3LL7A 2QTRA 4RF3A 2FVXA 3VR4D 2REBA 2AMFA 3I8SA 4NI5A 3KC2A 4Q19A 3RG2A 1E89A 3OTOB 4XD7D 1ISPA 2H18A 4MZDA 4EG0A 2X1HA 4N8DA 4GKJB 2B4KA 4JITA 2XLBA 2A4KA 1Z2EA 2W4QA 1NUSA 3CZ4A 3W77A 1YV9A 2BHRA 2OZVA 3EY4A 3MYYA 4EG6A 3LGXA 4UCXA 3A04A 3MINA 1C9EA 4KEAA 5JJKA 4ZI5A 1QH1B 4HT3B 4IRXA 4C22A 1L4YA 5DTIA 4UU7A 1PBTA 2CW5A 2WA1A 1RJ9A 4Q1CA 4J3FA 3LSYA 3ZD6A 3K5PA 3AB3A 3GDHA 1KFJB 5F35A 3WBFA 5LA6A 5H82A 4GYWA 1R27A 1WO8A 4JLNA 3TNDA 3EGXA 2BAGA 2LXNA 2NZXA 4NQZA 4Q9AA 4QBHA 4BTLA 5HSGA 4NY1A 1M8PA 4EHBA 3UJNA 1RWXA 2W2OA 3WE7A 1TQ2A 5IT9A 1TTTA 5CCBA 3EAQA 4X24A 5SYAA 2NNLD 4XGKA 1DIGA 4CLHA 1XZEA 4D3SA 5I8WA 3OCZA 2OYCA 2ZJ8A 4JU8A 2HRDA 3GGSA 4HNAB 2JLCA 3O1IC 5ELMA 4A8HA 3DLTA 4KLAA 4YRDA 2GKSA 4I14A 4LWQA 1XJ0A 1ZM3A 3QVMA 4M1QA 4FMPA 1WIWA 3K0KA 1W93A 2DQKA 2GRJA 1R6DA 1O6ZA 1FTSA 1U2PA 3V7NA 4RTSA 1Y9DA 4NZ9A 3V8EA 3FJ1A 2AF4C 3A28A 3AC0A 3FUCA 4BNJA 1IHDA 1I8TA 2QZZA 3GJYA 2IDZA 3UBMA 2Q99A 5AJTA 2A92A 2HKIA 4DFDA 1A50B 1VSTA 3STUA 3ANLA 2IFTA 3OQ6A 3Q1LA 2UUCB 1I3NA 2VP3A 4RSHA 4XX1A 3TCXB 3GAFA 1LSJA 5EE3A 1ZIYA 2K7FA 4NJOA 1H6CA 1ZFNA 2OGTA 5ICCA 3VC1A 1K4YA 3REFA 1XEWX 1V4BA 3JD3A 4NCKA 1ZZGA 5JCOC 1IM8A 4XPIB 1QTIA 2H29A 5GY7A 2ZYSA 1K2WA 2YXLA 2KB0A 5AI5A 5AI4A 1IDN1 2ZPTX 3AKYA 3O94A 2EZUA 3ICPA 1G4UR 2GZ1A 1RYMA 2WJZB 1OKKD 1RWMA 3WLHA 5COQA 3DCIA 5CA0B 2F3PA 1DAFA 1BE1A 2QUAA 4GZ5A 5DDIP 4NBRA 1DL5A 1B42A 4L51A 4BYMA 2ORVA 1FP6A 4JVMA 1N75A 3ZWWA 3R3ZA 2WVJA 3L79A 1ODSA 4CKYA 4LE1A 1BN7A 1SIWA 4B81A 4DIUA 5IAJA 1YZLA 1AGRA 3EH1A 1S2DA 2ZYUX 2E85A 1W9MA 2Q8PA 3PCRB 3Q8XB 2XLCA 1XJ5A 2Q28A 3VOSA 3HZOA 3SKXA 1T9ZA 3SICE 1YBMA 2OG2A 3HJHA 1KTIA 2YUTA 2D13A 5FTLA 4CMGA 1AUVA 5A03A 2CLCX 2PX2A 4BO7A 5BUSA 1P5FA 1XAJA 4ZVQA 3IAS1 1LF5A 3D7MA 3D64A 4EX7A 1XPRA 2P8JA 4JXZA 3NYQA 3H5NA 3C8UA 5DX8A 4CR7A 4L16A 4LNUB 2X76A 2VJMB 3WSWA 4F0JA 3HY6A 2IEYA 1T1GA 4P31A 1J1IA 2NU8B 2FPPB 3DYBA 4CHTA 6REQB 2Q7DA 1JJAA 4JQCA 5DX0A 3SHOA 3VR2D 3LLSA 5I47A 3F6YA 1J06A 3SF8A 2R62A 4CT0A 1YD7A 4MWCA 1NUPA 4J0CA 1HG0A 3QVUA 3T34A 4GS5A 4TWJA 2VP9A 3T7AA 2FRVA 1B7GO 2YJGA 2ZJ4A 1P7ZA 2YZ2A 1I7PA 1K66A 2G9ZA 5E6RA 3U44A 4EB3A 1V8BA 1O95C 4B6GA 4NENB 5EJGA 1HDOA 1K0FA 4P08A 4K28A 3EGIA 2LD4A 2QUZA 4DCGA 3I9LA 2DLNA 1NNI1 2KE5A 4NCIA 4RD1A 3UHAA 5L7TA 4NBSA 4QHSA 3R0QA 4GL2A 2V6MA 4P32A 5EPEA 4CV1A 4MQMA 3F6RA 1E6CA 3VC2A 5EYPA 2O2XA 3ZZ1A 1GNLA 1U8EA 2V5VA 2W6JA 4JV5B 4UVHA 3R0XA 4JR1A 2IYYA 2C0CA 4MUGA 2J9GA 4DPMA 4QGBA 4F91B 4WOPA 4XQCA 5FWDA 4EB0A 2ZUEA 1G5PA 2XF2A 4I2NA 3NLLA 2GWRA 5DT9A 1P0FA 1KTVA 1SZDA 2X0EA 5IU6A 1DAPA 1DKLA 1U3UA 4L9WA 1BJTA 4G4IA 1M5RA 2VQ3A 4TMYA 3FTQA 4I1IA 4O4HA 1KORA 2XB8A 3WWEA 4RHTA 2IU0A 4DCNA 3B5JA 4BZXA 3ADBA 3K15A 1HBJA 2WYHA 1RSZA 2FPMA 1EP3B 2JHPA 3WOHA 5L51A 5J3JA 4RBNA 1IC6A 3DDSA 2XUGA 4YRCA 4GBMA 3LBHA 3P7MA 4ZXPA 3RTBA 2NQTA 2Q4OA 1MZVA 2CLHB 2H57A 4J0FA 4MQFA 1SBZA 1M2VB 4DA6A 3KEGA 3P9QA 4RD4A 3QEOA 1GG5A 3KOWA 4B4VA 4F2WA 3RGWS 1NZJA 1QHNA 1DWQA 3I4FA 2YKGA 3HHPA 1QRSA 3TVTA 3GMIA 3NKFA 3B1JA 3KS9A 2ON6A 2ACVA 2XWPA 1JDSA 1L7OA 5EJMA 1AA9A 1AN9A 1CX9B 4REQA 3V2HA 1PQ4A 2VDLB 2Q9UA 4LXGA 1ZUHA 1DHTA 3DVRX 2YICA 5LBTA 4BRZA 1SKYE 3EXEB 1J1UA 1L4NA 4UEJA 1ICEA 1IG3A 4MO2A 4RQAA 1T0HB 3ITEA 4NX2A 1D03A 2UDPA 4HDKA 3QXXA 1U1IA 1EFUA 1RAHA 2B78A 4H1VA 1RRFA 4D4MA 3M4XA 1Q7BA 3LQKA 3RJZA 4DCSA 4FLEA 2WAAA 1QBKC 3BSFA 2IYOA 4DZTA 1JEYA 1WL8A 2C7BA 1ZH0A 5IFLA 3PI7A 3BE5A 4BVLA 2OV2A 3O7MA 3OT5A 1JGTA 3K32A 3MC1A 2DPLA 1NVVQ 3DZBA 2GN8A 3AU9A 2PX8A 1VJRA 3IAS6 2D54A 3HUFA 3LXMA 2QVCA 3PK0A 1QFZA 4MW2A 3T12A 2X3FA 1Z25A 4H4DA 4PQRA 1AX9A 3C0KA 3QE9Y 2A1UB 1P9OA 4MWDA 3FWHA 5CT5A 4FB5A 1WM1A 4IDNA 1Q83A 4IQ8A 4J94A 3QUBA 2MSCB 4YRSA 4JXKA 1B00A 4U3JB 1PK8A 4IIEA 5DEIA 4E70A 1ITZA 1F6DA 2JJ1A 5FBVB 1B2RA 3ZDAA 4OFZA 4MICA 2BRUC 3TEFA 1L5HA 4BWFB 1GTL1 4DSZA 1U02A 3H4IA 3LVRE 1SVLA 2VJNA 3HYRA 1WRBA 4POAA 1IHPA 4UMFA 2H92A 3M4JA 5CVTA 1GCGA 1XLVA 3G13A 3AKEA 3SZGA 5KYGA 1AUOA 3PRYA 3T3OA 1DXYA 1F3LA 4QBKA 5CNKA 5FBRB 4N5IX 1A9OA 1YI1A 2PXXA 2CHUA 13PKA 4U02A 3O8RA 1WU7A 5DM4A 2VT3A 2NVBA 3YASA 4RSMA 1HORA 5TC4A 4EJSC 4LECA 1P0PA 4BPRA 2QW8A 3KD2A 2H4FA 2ZQYA 3SE7A 2H65A 3HJGA 3K9GA 1GM5A 5CCDA 2X2FA 2DWOA 3KB8A 1UZUA 1IZ8A 3IP8A 1OIXA 1LBTA 4M86A 3ODGA 4XDZA 3WYGA 2BTEA 3WGQA 4QICA 5DNVA 4Z2AA 1LXCA 3P94A 1W4CA 2AHOA 5KQLA 3S7TA 3GMSA 4QAJA 1OFVA 1EJ0A 1U8FO 2E48A 3WO0A 3R8FA 4LTDA 3QWBA 5LR6A 5JFTA 1KFBB 3TQQA 1WBBA 2A2ZA 2IXFA 1AU9A 2CDNA 4OK3A 4UM5A 2C98A 2JGDB 3LWBA 1YS2X 5CK5A 1GSOA 4PF1A 3BCSA 3THWA 3AM4A 2WIAA 1GHTA 1YOVB 1KGDA 1MRZA 2AEMA 3ASZA 4MWZA 3TOVA 3KCQA 4HYEA 3O84A 1YAHA 1ZGCA 1GTG1 2NU7A 4FYXA 1U9ZA 5DF1A 1YKGA 4JXXA 1AO0A 3FTFA 3OCVA 3DUFB 4WXMA 2JCSA 4O4JA 5I4KA 4MRNA 4B47A 3LUJA 5HK9A 1JWLA 3EXHA 1CKEA 3QPCA 4NYIQ 4CKWA 1QQ6A 1SC3A 1TLLA 4AKHA 1QGAA 1KI6B 1U2ZA 2X41A 3O4GA 4QQ8A 4YR9A 1MP0A 2YHBA 2JFWA 1KR5A 4GX1A 3CQ9A 4I4CA 1E0SA 3P9YA 3DAOA 4B2YA 5CA0A 2F3QA 5LLTA 2RH9B 1RI4A 3TOSA 2C82A 4BP8A 4CTMA 2CUZA 2Z9CA 3RKUA 1QH9A 3THXB 2PGAA 3LRXA 1RS0A 3JYQA 2ZZNA 4YCJA 3UFXB 1X7XB 2UKDA 3WHPA 3PUIA 5DGIA 4ZQFA 4H0NA 3CPSA 3UC5A 2XODA 3P19A 4DV3B 5K4GA 1N2XA 4XDYA 3NTRA 1I4EB 1JTVA 3HB0A 2E89A 2C2XA 1DWUA 2DY0A 2H3EA 5ALFA 3S1AA 1E2PA 5I9SA 5G4KB 4PN3A 3KZXA 4GNRA 4QFMA 5HKBA 5HUJA 3A4VA 1I3CA 4OB6A 2W2VA 3UMRA 1Q1QA 3M6XA 2IS1A 4M1KA 2PBFA 3NHZA 3DT9A 1KS9A 4JUCA 1XELA 3EVGA 4L85A 1PGJA 4XGQA 3T1YB 1XV5A 1A8UA 1CC1S 1LW6E 1WNFA 3G0DA 1U8YA 4U6QA 4B6OA 4BASA 4C87A 2PKYX 9GPBA 1MJFA 1Z22A 2P6PA 3EEBA 4QX6A 3RUDA 4KQEA 2PKRA 1GPAA 3EE6A 4HWTA 1UWKA 1SVKA 1U2GA 2FA9A 3BSYA 2ZWMA 2Q1SA 3DEFA 4L28A 5EJAA 3ZCQA 3L4KA 1DIAA 4UMVA 2FUG1 1T26A 1WW2A 4QODA 3UAYA 1H22A 3BPSA 2JGIA 3JD2A 5ULLA 4UBNA 3VJMA 2LIVA 1GPWB 1X7YA 2W71A 4CLOB 3PYLA 3UWMA 5JAOA 4KWIA 3QFHA 4M60A 5EWMA 3SQXA 1RI5A 5SICE 3LBFA 2GZMA 1KBOA 4KO2S 4PONA 2QD2A 3W7VA 1V5WA 1NI5A 1OTXA 1QIGA 1TIPA 3IIIA 5LJLA 1T9DA 4AVYA 3NOOA 1EXMA 5FUYA 2PMBA 2KLBA 5AM0A 5JUWA 2HN9A 3NOXA 2PD6A 1KMHA 3MD9A 3DLAA 3HXTA 2GRUA 3EEOA 3L01A 1QR6A 2WJ4A 1QH8A 3BWBA 1RQRA 1JIKA 2XQKA 4PO1A 1CNMA 2ABWA 2ZVQX 3PHGA 3SXUA 1EINA 1YTLA 1TA4A 3K2IA 3ESQA 4Q66C 1A4IA 2XKAA 4OSEA 4F2HA 5CDFE 1FXUA 2MOKA 4MR7A 2IHNA 3ORRA 4OM8A 3DMFA 1DLIA 1H1DA 2QPLA 2ZUTA 4HEA1 1DJPA 4O2AA 4LRXA 1F2UB 1UQRA 1Y4SA 2I29A 2V7QA 4BGUA 2VBGA 1SA0A 4Q16A 1EGQA 4LF7B 3H1EA 2VHCA 2I99A 5L8VA 1EUDB 1PFKA 2F1HA 3IAAA 2OP1A 3FNFA 2CDAA 2V97A 1X9GA 5COAA 4J1QA 4L0DA 4QGAA 4L0CA 4P3OA 1SCAA 1EGMB 4AF8A 3UT5A 2IIPA 2VZ8A 5E3IA 2C2ZA 2KM1A 3T3PB 2QTLA 1ZITA 3CSDA 4G63A 3AW9A 4RS4A 3WQBA 4KGZA 4ESOA 1NF9A 2HGSA 2J0UB 3NH6A 1V6CA 4MKFA 3SPXA 2O8EA 1Q95A 3RC8A 1S2MA 2WG0A 4ADSG 4XDHA 1ZG3A 1FFGA 3QVXA 3CVUA 3HWSA 1ESNA 1Z5GA 4L4UA 5T6BA 1C7FA 1GRNA 1CJCA 1LU9A 4R8MA 1DCTA 4BO5A 4R1PA 3OTHA 1HQYE 5BURA 4EJSA 3PT5A 4IX1A 1Z0KA 4X64B 4E7OA 4KQ6A 1JHUA 2JA1A 3BYZA 2B83A 2FWBA 3IXMA 4QBTA 4WFKA 1L5VA 3NWJA 2E3JA 1SBTA 1YRYE 4RSGA 1ZD3A 4GBED 1KE2A 4TOIA 1EFTA 3UICA 1M6WA 1ISIA 1CY1A 2GPTA 3AILA 1JSCA 3LDGA 4B83A 2E4WA 2BEJA 3ETDA 4YAKA 2BFFA 1V3TA 2VJBA 3O4IA 4BMVA 4OX9Y 5K9ZA 1MX1A 2BRUA 3ZWDA 5FTKA 5KX5B 3U17A 5A02A 1UK7A 1AKRA 4LJ7A 3SCZA 4ENTA 4P4TA 2F17A 2WMOB 2MSNA 2X1LA 3C2QA 4Y2TA 2P2ZA 4D57A 1RFGE 4QPJC 5EIOA 5HQ3B 3CH5A 1E62A 4HLQB 2GF2A 3L5KA 2ONZA 1X1AA 2P9YA 3CNNA 3OX3A 4YJ2F 4BP3A 2J7PD 3CLSC 3ZVKA 4QG7A 1V39A 4MYUA 1IM5A 2DCMA 4C4YA 4RY2A 4G4SO 1V16B 1SUDA 3I6QA 1WDLA 1MAAA 3IP6A 1E77A 3T1OA 2QMUA 1PG2A 4YVFA 1YI0A 2FAXA 4X3PA 1VIDA 1NVGA 1UEJA 3AEUA 3LO8A 2P69A 3P9IA 4U6NA 3IO5A 2AKAB 1DKMA 1FQOA 2JRCA 4O8ZA 4P7GA 1TDJA 2ZR0A 3SYNA 3CB4A 3RC1A 2I2XB 5FPHA 1N34B 4FYJA 3DVSX 1H4QA 4NYMR 1XXLA 4DCMA 1VP9A 1W2WB 1KF0A 1K7XB 3B5EA 3DMPA 3RHSA 4LZAA 4G5OA 4TZTA 3U5TA 1XPOA 5JYDA 4N5NA 3SBXA 3VI4B 2EKBA 2AFRA 2GA9A 3S1LA 1GGEA 1GR1A 1H23A 1VLLA 1WSAA 4FC6A 4B75A 1CRPA 3L5OA 4DADA 1DQZA 1EDOA 1UJBA 1UBKS 2ACWA 2FTKE 2I2AA 2NSLA 2O5RA 4I99A 4BVJA 5AM2A 3K9HA 2Q3HA 1YNOA 4EGCB 1QAMA 3MS4A 4C76A 1Z35A 4HH0A 1U1CA 2YH2A 2BYTA 4FGUA 4EHNA 1I0LA 3WL7A 5DIFA 3OT1A 4J0KA 2PZLA 4ARZA 3HEBA 3TINA 5TQ2B 1TJ5A 5DNWA 1SO8A 5JMTA 3CC8A 5AXAA 5JS2A 3L77A 2I7CA 5JNTA 1ETUA 4IG9A 3OPVA 4KGVA 4OK5A 2I4NA 3WGMA 3AR2A 1FU7A 3I9OA 3ZUPA 1R4NB 4U7JA 1Y3CE 4V0MA 2ZB2A 5LLSA 2JZOA 4BB5A 4UNRA 4URXR 4KN9S 1KVUA 1WZCA 3KYIB 4RTLA 3E7DA 1LD3A 3H0EA 5IASA 1VJ0A 5HWSA 3CX6A 3HRIA 2QYOA 4GWGA 1IAVA 5BV2P 1ISHA 1J0AA 2QZ9A 3RVJA 1IVYA 1QFMA 5B2ZA 3UK1A 1RXEA 4AJ2A 4ZYXA 3A0RB 5JAIA 4DSAA 5JD6A 4NCAA 1EFPB 2WSLA 4GOJA 2LTAA 2WJ3A 4I2VA 5JS1A 4BFUA 1OCEA 2BT4A 2NO4A 2X4IA 2XVAA 4IVQA 1E2FA 1LDYA 2FJ0A 2XDAA 3AOGA 4PSKA 5EQFA 1L5GB 1Q21A 2WWVD 4PCLA 3ZDQA 1NI4A 3I9KA 3LPLA 5LQUA 2ZBQA 1CB7A 1E2HA 1WLSA 4HDMB 4KV7A 1NUUA 1SGWA 3FSRA 3RIYA 4JQSA 2FW9A 4L0MA 4QU9A 4MP6A 5G3ZA 2VT6A 2GI4A 1FP7A 2O2GA 1NUHA 3HKCB 2GNAA 2VHXA 2W42A 3IJRA 4KBYA 1B0PA 5EPOA 3ZE6A 4IMJB 4GFDA 2NPIA 2XUFA 4LY0A 5JCXA 1YASA 4ASUA 5IARA 1QKKA 1YR8A 4CMKA 4GYKA 3I6ZA 1V5EA 4OUDA 4M7OA 1ISSA 1C9JA 1YQGA 3Q3CA 5K8TA 3KQYA 1CD5A 2YFQA 4JS0A 4EB6A 3NDBB 3BMNB 3LUCA 3UMCA 3U7QB 5JMWA 2AOXA 4TTIA 5TXGA 2RG1A 3THSA 2AD1A 4W1PA 4GHWA 3KV1A 4R1TA 3WFZA 4MVCA 1GG2A 2YQ5A 4EEXA 1N9KA 1R9MA 1L1FA 1TIBA 5IK2A 3A9WA 4E5MA 3T5PA 4ENVA 1JALA 3AI1A 4Y6GB 4KYUA 1SQ5A 1FFWA 5HGXA 1ZONA 5AVWA 3PEEA 3RRYA 4KRGA 1GAQA 1DKUA 3OCWA 4HV4A 5C7LO 3BHMA 3IE0A 2B3TA 2X8LA 4TL7A 4E21A 3W8DA 3KOOA 2IUYA 4D8YA 3AUTA 3N2ZB 4HGNA 4PZAA 1FYDA 1D6MA 1RQPA 1TW2A 3AEQA 3GLGA 1SXPA 1VLHA 1H5QA 1L4KA 2IXGA 4QEZA 2CJXA 1DSSG 2AN3A 1RHJA 2Z2ZA 5KOYA 3NV9A 3F90A 3F9RA 3G5LA 2A9RA 3GFSA 4PFQA 2PANA 5AVTA 5K1ZA 4QQNA 4OHPA 4WVFA 1L6IA 1YQQA 2PKWA 3I6YA 3DBOB 3EFOA 1Y9JA 3ZI4A 4FMDB 5KDDA 1O3YA 1P1JA 1FUYB 4S2UA 3DQZA 1PTJC 4M8SA 3ZX5A 3TDMA 4JEMA 3ESBA 4F5DA 3B1FA 4MDEA 1DXQA 1NU8A 1L5NA 2DBVO 4OKNA 4I8DA 4L3OA 3IXLA 4ND3A 4M1EA 1NW3A 3IUEA 1L7XA 1YZKA 5DW3A 2W00A 4NV0A 1C7RA 4U7WA 4Z9XA 3AY3A 3NIFB 3C6YA 4YRQA 4DR4B 4MVWA 2WE7A 4F3CA 2YL2A 1RWPA 3EPRA 3QX8A 5HOQA 4ARCA 1XCMA 2ATXA 3OIWA 4FGSA 1VI2A 4FHZA 3EG9A 4TQUS 1BXGA 5EGNA 2VK1A 1PHRA 3OTGA 2IOQA 5B1HA 4ZAWA 2J3EA 3TXAA 2A3RA 3VM6A 2A30A 4D9GA 3MMPA 1NPTO 1Q20A 4P53A 1MMFB 4RV9A 5CIWA 1ZBQA 1IY8A 1DAHA 3X2FA 1C29B 1FX0B 4E0BA 3MQ4A 1GKUB 3FSJX 3OCUA 2X5XA 1U3WA 2EKPA 16PKA 3NPAA 3EIEA 2ANCA 3ZPXA 2IX9A 4WXYB 2AW5A 1BW9A 4E31A 1VBKA 1OF1A 2VSYA 4HVTA 1MV8A 2PYZA 3SZLA 4J16A 1VB3A 1Y5IA 1YONA 1MO3A 5ITZA 3H1AA 3LBNA 4D1YA 1LFAA 4M1OA 1DTSA 3IPXA 5EYPB 4R4JA 5G40A 5FWXB 4F8JA 1JLLA 5K3CA 4Y3UA 1Z6AA 3L46A 3FY4A 2IPOA 3IIKA 3RH0A 2ORYA 1UXJA 3DFFA 3KSMA 4KG7A 3TW8B 3CFYA 3LHDA 4QDJA 2UUPA 3VU8A 1U04A 4FWIB 5HDBB 3EMDA 5CVCA 1O5IA 4BLRA 2FHPA 1M34A 2COUA 2VG8A 1U1FA 3GFRA 3ANTA 3UW3A 2J4CA 3ZV3A 1RZVA 3S27A 1IBLB 2EFJA 1XF9A 2DXIA 3FPHA 3VZQA 1A82A 2VPXA 1KQPA 4YAJA 1SFRA 1KOJA 1Q17A 4CLXA 1QE5A 1KSGA 1QZZA 2XE6A 1OH5A 5T4EA 3AVUA 2B4YA 1MAUA 5FTJA 3Q8KA 4HNGA 1ZO8A 2WABA 4DUYB 1QP8A 4IJ6A 3QEJA 2PGNA 3NP7A 4OVKA 5IULC 1QQAA 2BM1A 3T9FA 4R7TA 3U39A 3MPUA 4TXMA 4EECA 2XGOA 1E6MA 3L6OO 3G2OA 2UUAB 4YXWD 3N8DA 1TM7E 4NZNA 2PX5A 3QVJA 1RQLA 1JBKA 3PHIA 1P91A 2XE7A 3EODA 4QXAA 3ZI0A 1JTEA 1JDUA 2JK1A 3CRVA 2IP4A 4OB8A 2ADMA 3K8ZA 1D8TA 3AU8A 2FW8A 4DV6B 1HOTA 1V8FA 4ZYWA 2D06A 3R3YA 1IXRC 1NPYA 2J5XA 4H3KB 3OD5A 4OKIA 3RVPA 3VPGA 2EV9A 1XKXA 2QF7A 5AJYA 1WSDA 2JLYA 1CK4A 1RJGA 2H1RA 3OCJA 3QE2A 5D3KA 4TROA 3BF8A 4ZAYA 4OLFA 4FB4A 1BKYA 3H3FA 1MEOA 4MR8B 5ALEA 4A1FA 5GAJA 3AR9A 2IPAB 5H3HA 1MG5A 3LFTA 4I0WB 5A0TA 2J3LA 1I36A 3WL5A 1FSPA 4HRAA 1P5RA 3A8TA 4XGRA 2YMPA 2O20A 4RA6B 3PTAA 2RH5A 1GGJA 4OF4A 3BWMA 3LHFA 4WY2A 1KIMA 1QIFA 1Z2OX 4PRYA 4Y2UA 5A6VA 5LP6F 1HC7A 4EG3A 1GTVA 2W58A 3E3LA 2WBLC 1BYIA 5A9SB 3IE1A 3GP5A 2M9MA 3QPUA 3CH4B 3DPUA 2F8MA 2PZGA 3KAJA 4XX0A 1JFLA 1Z8DA 5U4QA 1K27A 4BAGA 1SB9A 2HYDA 1T1JA 3EBOA 1OBVA 4PFKA 3TDKA 4DANA 2GXQA 2V7XA 1PJ2A 1JHQA 5EMKA 1FDIA 4OHZA