2SCUA

A detailed description of the structure of succinyl-coa synthetase from escherichia coli
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
286
structure length
285
Chain Sequence
SILIDKNTKVICQGFTGSQGTFHSEQAIAYGTKMVGGVTPGKGGTTHLGLPVFNTVREAVAATGATASVIYVPAPFCKDSILEAIDAGIKLIITITEGIPTLDMLTVKVKLDEAGVRMIGPNCPGVITPGECKIGIQPGHIHKPGKVGIVSRSGTLTYEAVKQTTDYGFGQSTCVGIGGDPIPGSNFIDILEMFEKDPQTEAIVMIGEIGGSAEEEAAAYIKEHVTKPVVGYIAGVTAPKGKRMGAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGEALKTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A detailed structural description of Escherichia coli succinyl-CoA synthetase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase
molecule keywords PROTEIN (SUCCINYL-COA LIGASE)
total genus 105
structure length 285
sequence length 286
chains with identical sequence D
ec nomenclature ec 6.2.1.5: Succinate--CoA ligase (ADP-forming).
pdb deposition date 1998-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00549 Ligase_CoA CoA-ligase
A PF02629 CoA_binding CoA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 2scuA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2scuA01
1P1JA 4J9VA 3GZNB 1ZW1A 1Q7GA 1ARZA 1ADBA 3DQPA 1LLUA 1T1SA 2J3HA 2UV8A 1V35A 5EERA 5HM8A 1OBFO 1A4IA 3I83A 2FPGA 4XDYA 3QWFA 2Y05A 4OSPA 5T57A 1PSDA 2PD6A 2PNFA 1EUCB 3ST7A 5BQFA 1B14A 4NBUA 3DZKA 9LDBA 1GFSA 1SO8A 1OI7A 4J91A 1GQ2A 4M55A 2O2SA 3LF2A 4PLPA 1A9YA 5FFFA 1KEVA 4DIBA 1V3VA 3H5NA 2UUOA 5ENVA 4AJNA 5ENDA 1HLPA 3W6UA 1NWHA 2BHLA 5JYDA 2Q1SA 2WJPA 1D7OA 3PWKA 1MXHA 2Y68A 2C5EA 1EFLA 2PZLA 4JX8A 3ZV4A 4TROA 2PH3A 3QVWA 3HNPA 1I3KA 1AXEA 4R5MA 2OP0A 3RAJA 3FSRA 5JBIA 4J4TA 2C29D 3ZWWA 4DIFA 3FPCA 1QYWA 3AJRA 5GZ6A 4ILKA 3GT0A 4W82A 1B15A 3CKYA 4Z3DA 1MXFA 4ZQEA 2AEJA 5F1OA 3UUWA 2ZJ0A 2JCVA 3WGHA 3EZLA 3JQGB 1PJ2A 2QRKA 3IL2A 1XQ1A 3KETA 1XYGA 2G0TA 2VZ0A 5T67A 4GWKA 3WYBA 2PV7A 2ZB3A 3NJ4A 2GGSA 2P5UA 1E7QA 4CLRB 3EYWA 2B35A 1NHGA 4J1QA 2FP4B 1HYGA 1SOWA 2ZYAA 4LK3A 3HQ4O 1NX6A 2B5WA 2QRLA 3E1KA 3VAZA 3KSDO 3AUSA 3D4OA 3OQBA 3WGTA 2O7SA 1U4SA 3ENKA 1JAXA 3HZZA 1I10A 4OYRA 3D4NA 1WMBA 1FDTA 3EW7A 3I9OA 3ZWNA 1ZFNA 1X14A 3L4SO 4ZGWA 4R3NA 1MGOA 1U8FO 2I99A 3A06A 4KDFA 5J23A 1FJHA 1Y9AA 3A28A 1N7GA 4R1TA 1MX3A 5AXDA 1C1XB 1I2CA 3HWRA 2C5AA 2O4CA 2O3RA 2VYVD 4ZQFA 1F8GA 5TJ9A 5CP8A 1CERA 1Z82A 1G1AA 2EJWA 1HRDA 2HLPA 4OGWA 3E9QA 3AY3A 2PGLA 2OZPA 1Q0LA 2GRAA 2JFHA 1PU2A 2WWRA 4MIEA 4DYVA 3CINA 4W7IA 3ZCXA 3PP8A 3WFIA 1HXHA 2IRWA 3VPXA 2HSDA 3BMQA 4E32A 2VOEA 4BNVA 1UDBA 4C7KA 2HMWA 3TFOA 4J7CA 3ANLA 1KY4A 4B8ZA 1MA0A 2WSBA 3G1UA 5HTOA 1VL0A 4WOKA 1H2HA 4LISA 3HFGA 3X2EA 4Q3EA 2ILTA 3TQHA 3BMCB 4AICA 2HCTA 3CZRA 4RDHA 4P22A 4BNTA 3RU7A 1TEHA 1HKUA 3NAQA 3FWZA 2HMVA 3U5TA 1VKOA 4XB1A 4EITA 5ICSA 2ZB4A 1CYDA 4BV8A 3NDRA 5DULA 1HDYA 4R54A 3WWYA 1JVBA 1RM5A 4IJVA 4PZDA 3WB9A 4O63O 2X0NA 1YB4A 3MJVA 4YCAA 5I9MA 1Y1PA 4QO7A 2VHWA 4GVXA 1LTHR 2QHXA 4ZQBA 3ZWAA 4EDFA 4J2HA 1JU9A 1JDJA 2FN7A 2CDAA 3OIFA 1KVRA 4B4WA 2B83A 3ANNA 1Q7CA 4CLOA 3U09A 1C0PA 1MFZA 4MP3A 1YWGO 2P68A 1P3DA 4GI2A 2Q3EA 2VRCD 2X23A 4YJGB 3DZFA 4FN4A 3ZNPA 3NDIA 3NKLA 3HADA 5KJ6A 3OHSX 4LCEA 5DBGA 1GZ6A 3C1TA 4ITUA 4EBFA 1NP3A 2GN8A 1GR0A 1XLTA 2LDXA 3NTOA 4R5HA 5G0SA 4XQEA 4WLEA 1LLQA 2CVQA 4LVUA 2EF1A 1PL8A 3B1KA 1U5CA 4BMNA 5BSHA 3FNHA 5LCXA 4B7XA 2Q2VA 5HS6A 4D0SA 3MOIA 5T64A 5L7TA 2ZIZA 1GPJA 1IOLA 3ETGA 3WYEA 4CMAA 1U28A 2V6BA 4BNYA 4RVSA 3PI7A 3V5NA 3H9EO 4TVBA 3FWNA 3LC7O 1V6AA 1YKFA 2DTXA 4CLOB 1YOVA 1KEPA 5L4SA 5TC4A 5A3JA 1EQ2A 3B20A 3I5MA 3VPFA 1K2WA 5DBIA 2GR9A 5I7FA 4PGFA 1LQTA 3F47A 2IYOA 4ALJA 1E7WA 5U1PA 1PL6A 1NFRA 1BXGB 4CQMB 3S2FA 4NJMB 1W6UA 4D3FA 1M2WA 2WYUA 2P9CA 3C3XA 1E7RA 1DHRA 2FSVA 2Q1WA 2ZJ1A 1ORRA 1JKIA 2YQ5A 5CPBA 4IINA 1W8DA 4RPHA 4ZVVA 4L75A 3PHJA 1U8XX 4WNCA 3STHA 4XGIA 5IN5A 1GUYA 2D8AA 4BO6A 2VOJA 3H8VA 4RLHA 4IDBA 4KWHA 4RPKA 3GRPA 4RCVA 5B4UA 5JMWA 4BIIA 3QW2A 1A5ZA 3PJEA 3GA0A 4PG6A 3V8BA 4BO5A 1WWKA 1BTOA 1EVJA 1OAAA 1NFQA 5EINA 4INAA 1U1IA 3CE6A 1E3EA 1LRLA 2X22A 4GBJA 4A0SA 3H4VA 3T7CA 4F45A 1XKQA 4CMBA 4DLBA 2DU8A 3AUAA 5L7YA 1U7HA 4IJWA 4RF2A 2Y1OA 4BMSA 3ROKA 2UVDA 1N9GB 3D5QA 3U9LA 1B26A 3PHGA 2JFFA 1DO8A 1BSVA 1Y81A 4PG4A 3ZWXA 1RYDA 2HK9A 3IJPA 3W4KA 1YXMA 3K73O 1QMGA 4CM8B 1Y5MA 3NTQA 2I9PA 1HWYA 2QYSA 1KVUA 3PVZA 2RH4A 1R66A 4E2WA 3GK3A 5CEFA 3INGA 3VVBA 5L45A 3CUKA 2EP7A 1BDMA 1T2DA 2ZTMA 4Y9DA 5ES3A 1EBUA 2AQIA 3PLRA 4RF4A 1E0DA 1K89A 3CMCO 3WDSA 4I08A 3WJ7A 1IPEA 3MWEB 2IXAA 5MDHA 2BFAA 1BWSA 1G0NA 2A35A 4PLTA 3PQFA 4L9RA 3TDKA 2ZK7A 4OSOA 1VL8A 2B37A 4N5LA 5CG1A 1GV1A 2ZATA 5AXBA 5KVQA 3L0DA 4FGWA 2H1SA 4EZBA 3P2OA 1CWUA 4BO0A 3UFXA 4OH1A 4N5NA 1PJLA 5JDIA 4UEOA 2PY6A 1PR9A 2C59A 4HKTA 3EUWA 1X7HA 3DMTA 3GVIA 3ZWCA 1YBVA 4LMPA 4M87A 2Q45A 5U4QA 4BB6A 4CM4B 1UXIA 3F5QA 3L6EA 4KUHA 3KSUA 3INRA 3UXYA 2ZQZA 1T2EA 4DL9A 5IZ4A 5JCXA 2IZ0A 3BMNA 4HWKA 3KZVA 3VVCA 1WDMA 2NVWA 3NTRA 4JCOA 2EKPA 4YAGA 3ADPA 1XG5A 2EERA 2OUIA 4QTZA 4UVIA 4D42A 1V0JA 2X6TA 3E03A 1LQUA 3FNEA 4QQRA 3WGOA 4E12A 5AVOA 4HUJA 3OEWA 4QXMA 4A2CA 5TJHA 1SMKA 5JC8A 3LT2A 3PYXA 4BNGA 3ICPA 3CZMA 3RASA 1T24A 4DWVA 4GH5A 3F6YA 4XCVA 1NQ5A 5MGBA 4DC0A 4CMIB 4ZU3A 4EUFA 1PS9A 3DWFA 2SCUA 4BGIA 2HJSA 3AM3A 3RI3A 3TL3A 4NBRA 1GD1O 3R3SA 1V3UA 2J3JA 5H83A 2DPGA 1QG6A 3AFNA 3L4BA 4M8SA 4RDIA 2FR1A 2HO5A 3D7LA 5B4VA 1Q1NA 4YJFA 1BRMA 1B0AA 1NNUA 5EIOA 4E21A 1DIRA 4NBVA 4CMKA 4BKOA 3PRJA 4WE3A 1KVQA 1D1TA 2HMUA 2EGGA 1H9AA 1P77A 4AL4A 5KVCA 2BFOA 1HYEA 2D2IA 2IODA 1GYRA 5GZ1A 3ROMA 4UREA 1NVMB 4BO3A 2X9VA 4FJ2A 4E2ZA 4YRDA 3EZYA 4PLYA 2PR2A 3D3WA 4O6VA 4BO1A 6ADHA 3DOCA 1KC3A 3CTMA 4IDFA 3TPCA 1XIVA 4HY3A 3GQVA 1C1DA 4UUPA 7ADHA 3DL2A 3C7DB 5GMOA 3F1LA 4XR9A 2OMEA 3GUYA 2CUKA 3D3EA 3FRJA 4LCJA 4NIMA 1UP6A 4D3SA 3M1LA 2C2YA 4R41A 3QVSA 5FF9A 4R3WA 4BMVA 2DBRA 1E3JA 3VZQA 4J1TA 2CVOA 1IZ0A 1MB4A 2RH8A 3ULKA 4A5OA 4RQUA 3NGLA 2GN9A 1QV7A 3FNFA 3A1NA 4TKMA 3JQEA 3CSDA 4BNJA 2PD3A 3AY7A 3FCOA 1PJ3A 4L73A 4LMRA 1ADGA 4BO4A 5I8WA 3ZDFA 4M49A 2AXQA 4CUZA 3HDHA 1DPGA 3TOZA 4JP3A 2WEKA 2X7HA 1GU7A 3JD1A 4R9RA 2G1UA 4GLLA 4IZHA 3KBOA 4TQGA 2B4QA 2NNLD 1NBOA 4UVGA 2DBQA 2VYVA 1Y8RB 2P9GA 1X0VA 4UUOA 3SC6A 1LLDA 3I9JA 4NQZA 1O94A 4MKZA 5IZCC 3GFBA 4CR7A 2Y0CA 4DBVO 2P91A 5KJCA 2UDPA 1EE2A 1YS4A 3ASUA 4O5OA 3FR7A 4YBZA 2W98A 4GQAA 5A1TA 1C0KA 1QLHA 3WTBA 4RLSA 1MUUA 3PIIA 3QWBA 4NR0A 1CQJB 4XQ9A 1GDHA 4Q39A 4W99A 2BRUA 1PZEA 4ZHSA 1WW8A 5DP2A 4MP8A 2XF8A 4UEJA 2BF7A 2NV6A 4XB2A 1KETA 1DB3A 5DZSA 5H82A 4EYEA 1B3BA 4RPLA 3C85A 1E3WA 1WXDA 2EJVA 4JBGA 5COQA 2O3TA 3TFQA 3TL2A 4UUMA 3ZU4A 4I5FA 1F17A 4CM5A 4YJFB 1IYZA 3GOHA 1PJSA 3L07A 3BMQB 4D46A 4EGFA 4XQGA 1D1SA 1I01A 2AE1A 3AOEC 1HL3A 5F21A 3RIHA 3WIEA 3F5SA 1YJ8A 3PQEA 8LDHA 1ONPA 1OC4A 4RVDA 3ZHBA 4W7HA 3S55A 4MIYA 3OH8A 1A72A 1RWBA 1ZSVA 4XR4A 3RC2A 3JTMA 1IUKA 2PFGA 3F9IA 1MV8A 2OOSA 1E3SA 1ZSYA 2BELA 1GYQA 2YV3A 1PGOA 2GPTA 1YVEI 1ENYA 3BTUA 3SJ7A 2IZZA 5AOVA 1SC6A 1JKJB 3DMTC 4W9NA 4GGOA 1UDCA 5ER6A 3VKVA 4WEOA 4TMFA 4XDZA 4FOOA 5HRUA 3WSVA 3PGXA 1GCUA 2G82A 4D45A 1DIHA 4GWGA 5A02A 5DT9A 1E3WB 4HFRA 5DDIP 3W1VA 1HF3A 2AA3A 3PDUA 3KSZO 5I8ZA 3R3JA 5TSDA 1NAIA 4LSMA 4WASA 1ONNA 1T1RA 2QW8A 1O0SA 1BMDA 3JQCA 3KO8A 2FPGB 2D3TA 3DFZA 5C7OO 5THQA 1ISHA 1ISMA 1RM0A 4ID9A 1J49A 1QYCA 2Q1UA 1AE1A 4Y67A 4EJ0A 1KEWA 1GL3A 2VTDA 3VDRA 1I36A 1SEPA 1C0IA 3L9XA 1XGKA 4Q3BA 1ZUD1 2FR0A 1HDGO 3MJ4A 1T26A 2GF2A 2D5AA 3RU9A 4JBHA 4YAEA 3AOGA 1UP7A 1E6WA 2ZTUA 2FPPA 4MVJH 2O3JA 1C3VA 4E5PA 2NWQA 1G6KA 1A9ZA 1EE9A 1JA9A 2NQTA 3I6IA 1Z73A 3OFSA 1EK5A 1NPDA 2GZ2A 4WECA 5FWNA 4U6SA 1P1HA 4K6FA 4FOSA 3DBRB 1NR7A 3RBVA 3QVTA 1EZ4A 2ZYDA 3JQGA 2E48A 5TQVA 3OF2A 3EY4A 4J4BA 5AXAA 4BO8A 3OJEA 1LEHA 4K28A 1PEDA 4D0RA 3T4XA 1DIGA 2ZCUA 4RF5A 3VPGA 2GYYA 1R37A 3WG9A 2JD1A 3N74A 4E31A 4DPKA 2X5KO 4OXKA 1ZVMA 1JAYA 2NUAB 2DPHA 2HMSA 5JPIA 1LJ8A 4NG5A 2RAFA 2I76A 4U8GA 1DIBA 1L7DA 3A14A 1U7TA 3KOUA 4MVJP 3V2HA 4E33A 2G76A 1EVZA 1V9LA 4GL4A 3DMYA 4KUEA 4NPCA 3QSGA 2PA3A 2FMUA 4RL6A 1N8KA 3JD4A 2C82A 1MG5A 1VJ0A 1T25A 1SZJG 3HB4X 2V6GA 3EDMA 4ND4A 3GY0A 5BNFA 1GAEO 1NASA 2V65A 4FFLA 4BV9A 1GQQA 5JO0A 3SEFA 1YOVB 1P1IA 2JAPA 3W8DA 4W4TA 3OJFA 1UR5A 4CMEA 3GZNA 4H7PA 3WOHA 3F3SA 3DZBA 4GX0A 4H16A 2NU9A 3VH1A 4F3YA 4BUCA 1J5PA 3HN2A 2HK8A 2X8LA 2GCGA 3Q1LA 1ULSA 3GN1A 1E3LA 4IJKA 5CHEA 4IQ0A 5L53A 3SLKA 5EN4A 4CLEA 2IEDA 4BHTA 4ALNA 4FIZA 1AN9A 2G5CA 2PD4A 3DBHB 1SB8A 5CDGA 1E5QA 1GCOA 4R01A 5JW6A 1NPTO 4BNKA 5L4LA 2CDCA 3ABIA 3LU1A 4A03A 3GMSA 3C7AA 1OFGA 4WCFA 2IZ1A 1Q7BA 1VE9A 4OOFA 4RORA 2X0RA 4DYDA 1H6CA 1IHXA 1GV0A 5BSGA 1WPQA 3QHAA 5T8KA 1CRWG 3OEYA 1SCUB 3ONEA 3Q0EA 5IFLA 4PRLA 5DF1A 2R2GA 1RKXA 1LSJA 2R6JA 1DFGA 2Z1MA 1K5HA 2Y1DA 4CQMD 1U3VA 2ZTLA 2FPPB 3AI1A 1GTMA 2W2LA 5L3ZA 3S2GA 3I6QA 3ZH2A 4AJ4A 5JNLA 3L77A 1EVYA 4JNKA 3JCZA 1CF2O 3LZ6A 4XKJA 4FBGA 2GERA 3ZWVA 2G17A 2Y99A 4JQCA 2I5PO 4PVCA 4S1VA 3ZW8A 1YRLA 3RUHA 4CV3A 1N9GA 4WCFC 4HV4A 1DC5A 2ET6A 3EHEA 4NDNE 2P4HX 1X1EA 1Z75A 2AG8A 5A06A 3GNQA 1ZEJA 1A7AA 3LLVA 3QVXA 2O23A 1DC4A 1UJMA 2YDYA 1JKFA 1I8TA 2HAEA 3BZUA 4B3JA 4GGPA 5IDWA 2Q99A 1Z7BA 1QXSA 1O95A 2OHXA 2VRCA 4FGSA 4Q3NA 1IY8A 3MJTA 4RPGA 4GMGA 2RHRA 4Y6SA 3TZKA 3PYMA 3DAFA 2W2KA 4J2OA 4HFJA 5K9ZA 1WDKA 4II2A 1NWCA 3EAGA 1IB6A 3UKOA 5IG2A 5KJ1A 4TKLA 1Y8QA 2CSUA 1PJQA 4E30A 4E3ZA 2NTJA 3IMFA 2QZZA 4NFYA 2IDZA 4CM4A 3ONFA 1E92A 3FN4A 2HKIA 3QLJA 5CG2A 1VM6A 3A9WA 1JW9B 1PWXA 3U4IA 1R4NA 1C1DB 1S7CA 3W8FA 3WWZA 1F0YA 5JO9A 3MJEA 3GG9A 4OOEA 2OO5A 3E6AA 1BVUA 1GQYA 2FZEA 3WBFA 2B36A 1H2BA 1ZK2A 1J4AA 1X0XA 1ML3A 1R4MB 1WAMA 2V6MA 4NFSA 2H63A 2I67A 5JDIC 4G5HA 4PLWA 2VZ9A 4H15A 3IKVA 3H7AA 4PG8A 3RD5A 3FBTA 2WE7A 5TS3A 4ALIA 4AJKA 1QV6A 2NU6A 3GF4A 4WLUA 3TNLA 3RFXA 5BT9A 4DLAA 2YQ4A 3DEYX 1TI7A 2EKQA 4OKNA 3RUAA 3INTA 1VSUA 2VT2A 4HADA 3KVOA 3K9QO 4N18A 4GKVA 4AJLA 3WR5A 2OFPA 1U3WA 1KVSA 2NVUA 3B6ZA 3DBVO 3EGOA 3O9ZA 3UCFA 3BYZA 3WQRA 5IXYA 1Y7TA 3VDQA 5KVSA 3QQPA 3RFTA 4HXYA 4XGKA 3TZCA 4XRGA 2BD0A 3FTPA 1AHHA 4BNXA 1JWBB 3AOEA 4CLDA 2EHDA 3GR6A 3GUCA 4B3IA 3Q2KA 4EEZA 4XYMA 1BHSA 3R1IA 3TZ6A 4RQTA 1NTOA 4IIUA 5T5QA 1W4ZA 3AUUA 4NK5A 3CMMA 2I3GA 1E6EA 1NQAO 3MJCA 2PZKA 4O1MA 1ISGA 2WE8A 3HE3A 3QIVA 1VKNA 3OA2A 4EJ6A 5B37A 1ID1A 1PJCA 3IP1A 1G0OA 3WIDA 1DAOA 4A26A 3PLNA 3FTNA 4TRMA 3WFJA 4ALKA 4ESOA 1H9BA 5KKAA 1E7SA 1Y8RA 2E4AA 2W8ZA 3GGOA 2OORA 4TRJA 3OICA 3ZV6A 5IDXA 3GEGA 4JLWA 3KYDB 3PZBA 3DR3A 2GUGA 3O4RA 2V7PA 1PS8A 5ITVA 5TX7A 3TF5A 1O89A 3FI9A 4XYBA 2J5KA 2PWZA 4HP8A 4ZD6A 2VNSA 5JSFA 1NM5A 2HMTA 4AG3A 1E7YA 1LSSA 2ZKLA 3WQQA 4PLVA 3NUGA 3DBHA 4CLHA 2YV2A 4E4YA 4AJJA 4MPDA 1VRWA 1Y8QB 1T2CA 2BKAA 3H9QA 1HE3A 1XDWA 3E8XA 2Y66A 1JVSA 4QFDA 3GDOA 4U0JA 3DO5A 4XD2A 5C7LO 3HDJA 1ZEMA 1R4NB 3G0OA 4B79A 4BQPA 4IPTA 1UXGA 3O26A 3JQAA 3HHPA 1F06A 1PS0A 1SB9A 3JQ8A 1TXGA 2A92A 1M76A 3R0IA 4LGVA 4MIOA 4KTTE 3E5MA 5G2OA 4RPJA 3C8MA 3QJ5A 1I33A 4I9HA 4F6LA 2O7QA 4FDAA 1NR1A 2C7GA 4TRRA 4AFNA 4G81A 9LDTA 2Y0DA 5K6AA 1YL5A 2BGKA 4IUYA 1ZBQA 4CMCA 2YDXA 4JIGA 3NT2A 1M75A 1VC2A 2Y1FA 4J1SA 2DLDA 2XAAA 1P31A 3I3OA 3ETDA 4ND2A 3FHLA 4PIVA 2WM3A 2P2SA 3GC6A 2NQ8A 4I9UA 2BI7A 5A9SA 5GZ3A 3RVDA 1YDEA 3TWOA 1CEQA 4I5EA 1PGQA 3NX4A 1ZKMA 5C7IO 2NUAA 1ULUA 1LC3A 1T4DA 1DLIA 3M2PA 1SPXA 5AQ1A 2P9EA 4RV9A 5C37A 5GY7A 3UFXB 3UAGA 4N54A 1DXYA 1MC5A 5I9LA 3AM5A 2JJYA 2Q2WA 5G0UA 1HZJA 1MLDA 3PGJA 5L95A 4IQGA 4CM3A 5G4KB 1LU9A 4PLZA 1EEHA 2HQ1A 4IDCA 5JDCC 1GZ3A 3WS7A 5TRTA 3PXXA 4I5DA 3E18A 4EUHA 4HFNA 5JLAA 2X9NA 2WD7A 4IQ8A 4Q3DA 3W4JA 2GD1O 2DVMA 3JQ9A 5FEUA 2X5JO 3Q3CA 2FWMX 4F6CA 1CQIB 4UUNA 5JCJA 3RC7A 4YQZA 1B8UA 4BL5A 2IEBA 4U0KA 5THKA 4FB5A 5EQDA 1NVGA 2FSSA 3PWZA 1DIAA 4IMPA 3RQSA 3CH6A 3ZN2A 1XHLA 3HN7A 4FSHA 1HLDA 2QQ5A 4CV2A 2CF6A 2VWHA 2HRZA 4OJNA 3W6ZA 1X7DA 3U4DA 2YY7A 4YJHA 1ENPA 4LW8A 4YJDA 1HSOA 4E5KA 1LC0A 3V2GA 2OP1A 4OO3A 3KV3O 4G65A 2ZQYA 5H81A 5I7VA 2JL1A 1HYHA 2Q1TA 4BNZA 4DQXA 1NQTA 3TZHA 5B12A 1DJQA 4YEDA 3GZ4A 4FFPA 2DQ4A 3ZWMA 3V2UA 4TWRA 3B1FA 1K6IA 2QIOA 3K31A 4WLFA 4DBZA 3GVCA 5A04A 1JN0A 1K3TA 2O3UA 2Y1GA 3H6KA 3DZGA 2QRJA 4P38A 4Q3AA 4D44A 4J0FA 3W4IA 3ZU2A 5BSFA 4RVFA 2O2YA 3VPSA 1NYTA 3ZU5A 5EESA 2X1HA 2PZJA 1X13A 2YFQA 2VUTA 4ZQGA 3ENNA 1MG0A 3OSUA 1U9JA 2GNAA 4J3FA 4AJPA 3RKRA 4AVYA 3GN2A 2AE2A 2J5QA 2OXIA 2B4TO 1JWAB 5JFOA 5F5NA 1HETA 3I52A 3KYBA 4TZKA 3GGPA 1YE3A 3OP4A 3JQFC 1KIFA 2NU7A 4RVGA 5C3MA 1UZLA 1V8BA 3U49A 1R16A 3VTFA 4ZJUA 4EW6A 5CDYA 1HSZA 5DCYA 4B7UA 2EIHA 3RJ5A 2VWPA 4QT0A 4WNIA 3PPIA 1F12A 4FJ1A 1DOHA 3WNQA 4BKUA 5A9SB 1R6DA 5F3RA 3JQ7B 4Z9YA 4TRNA 2I66A 2DBZA 5A9RA 4J0EA 1H94A 2AQHA 1P33A 1NFFA 2AEMA 1BVRA 3AI2A 3Q6IA 3KYDA 4IY1A 3S2EA 2J6IA 5BNTA 1Z45A 5TIIA 3H9UA 5BNIA 3DB2A 2D1YA 2DC1A 4CM1A 3GNTA 4YA6A 3PJFA 4P4LA 2Q2QA 1LXCA 1LI4A 3U62A 5JAQA 2GASA 4L8VA 3AU8A 2YV1A 4FFRA 2BGLA 4QX6A 2A9FA 2HUNA 4XJSA 2O50A 3ZV5A 1CETA 1A71A 1DRUA 4PLFA 5CDUA 3LDHA 1LX6A 2VUSA 3WSWA 1KS9A 1ZK4A 3AUTA 4Y6PA 4YR9A 3GHYA 4Z0PA 4IDAA 1LDBA 2C07A 4GSLA 1LDNA 1DHTA 3OQ1A 4JJFA 1P74A 1PGJA 4PCVA 3KHUA 4JP2A 3RBXA 3WLEA 1KBZA 4JK3A 3WGIA 1BXZA 1LDGA 1YQDA 3CEAA 2CFCA 3BMOA 3ANMA 4B4UA 4ZICA 1XCBA 3EC7A 3BHJA 4YJHB 1KOLA 2R00A 5HBRA 3PYLA 3WXBA 3HFSA 5JS6A 5U9CA 1C14A 1BDBA 3JQ6A 1N1EA 2Z1NA 2DTDA 5DN9A 1CQJA 4QEDA 4PZCA 3U3XA 1IE3A 3JQDA 5DCWA 3WGYA 1LDEA 4M89A 3UF0A 2VHYA 3GRKA 4AJHA 5ITWA 1GUFA 1EUCA 4IBOA 4CJXA 4GVLA 2UYYA 4NNJA 1P45A 2EXXA 4GX2A 1HE5A 4JXKA 5ADHA 2VCYA 3DOOA 3SBOA 4E0BA 2FHSA 4WJZA 2AEFA 1J6UA 3MZ0A 1EQUA 1QR6A 5L7WA 1H93A 1ZZEA 3F4LA 4MVJF 5C5IA 3GEDA 4PRKA 3ZWPA 3Q2IA 4EI2A 1B7GO 4ND5A 1FMCA 4YWJA 4YT2A 3CXRA 5KCZA 1ZXLA 3RUCA 4MVJE 1QYDA 1UH5A 4PVDA 2NTNA 3WGZA 4IIVA 4E5NA 1KEUA 2RCYA 2B0JA 5IZCA 1PIWA 4PLHA 3VH3A 3CPSA 1WZEA 3DZIA 1E6UA 4BGUA 4F46A 1CJCA 1NXQA 1X15A 4TSKA 4XJTA 4CM9D 4EJMA 3LC2O 4TVOA 2DFDA 4KDEA 3RUDA 3I1JA 1M6WA 1R12A 3E9MA 4L74A 1ZK1A 5L51A 3UGKA 5DOZA 4CM7A 3OJLA 4Q3CA 4XYGA 1GPDG 1UXKA 2NLOA 1IL0A 2NU6B 1WP4A 3ITKA 1VI2A 2YHUA 1NHWA 4K1LA 4FQ8A 1ADCA 3H2SA 3WLFA 1PX0A 4RGBA 4UEKA 4J16A 4P4GA 1O8CA 2W90A 3BXXA 1NAHA 4RJTA 2CZCA 3GDGA 3JYLA 4Q9NA 3DC2A 1LRKA 1D4FA 4DXHA 1ZO8A 2Y67A 4U6QA 3E9NA 5LDGA 3QV1A 4J7UA 2O4UX 1HDOA 2YYYA 4D41A 3VH2A 1LBEA 4D43A 1GY8A 3GMDA 4P4NA 3ZGYA 4OKIA 4A7PA 5IXSA 5G0TA 3C1AA 1QKIA 2F00A 4BS9A 1WNTA 3RJ9A 5KJFA 1DFHA 4TZTA 4A73A 2WD8A 3BTOA 1RYEA 3JQBC 2FOIA 4CPDA 4MP6A 4KP7A 3WTCA 3PQDA 4FC7A 1ZMTA 3G1TA 4L4RA 3SLGA 1Y9EA 2LDBA 1I3LA 4Y8VA 3SX2A 1UZNA 2E82A 3LVFO 3QP9A 3U4HA 1H5QA 1PJTA 3FR8A 3DBLA 4J7XA 4O0LA 3C24A 1Z7EA 1ZXBA 2DUWA 1N5DA 1E1NA 4W9NC 5B4TA 1P1RA 5IN4A 4FW8A 1DSSG 1GADO 2JD0A 4XZ3A 3Q9UA 2RIRA 4MDHA 3P5SA 1ISJA 4XWYA 3ASVA 1SEVA 3GHHA 1T4BA 1IULA 1XWFA 3L4BC 3JYNA 3ORFA 1E77A 1PR3A 3JQBA 4MVJI 3S2IA 2JD2A 2EGHA 1U4OA 1B8PA 1A4UA 3GPDG 2GO1A 1YONA 1P0CA 4DRYA 1QYVA 1BXGA 4CQMA 3NEPX 4BNFA 2Q4BA 1C1XA 3ZHYA 1LSOA 2Q4EA 2O3QA 3DZJA 3M6IA 3OA0A 2OL4A 1HT0A 3KTDA 1WVGA 1XQ6A 3LC1O 1U2DA 4RZIA 5HS4A 1TA4A 3RKUA 3PJGA 2NM0A 2WMDA 1K0UA 4P8RA 4WEQA 1R0KA 2OGUA 2E6UX 1EFKA 1EMDA 2C54A 2NTVA 4JBIA 2OBNA 2X0JA 1B8VA 2POQX 3IJRA 3E5RA 4CMIA 4QO8A 1BG6A 1EVIA 2HK7A 3MTGA 1YQXA 3UICA 1DDOA 3AI3A 4CM6A 4GAEA 5A4DA 2CD9A 2EEZA 2FPIA 3PJDA 3TZQA 1M66A 3WMWA 2PK3A 2HJRA 3RUIA 4EUEA 3GLQA 4D3DA 1R0SA 2EW2A 5A5EA 3WGGA 3K6JA 2D0IA 2H9IA 4BNIA 4IDEA 1ENZA 1NPYA 1YQGA 3PDJA 1XR3A 4KZPA 1ONOA 4ZRNA 3MCVA 3NRCA 4A10A 3ZW9A 2DBVO 2VHXA 2GSDA 3QE3A 2CNBA 1TT5A 4CMGA 5G0WA 3SXPA 2DKNA 5KIAA 3FBGA 4HBGA 1CIVA 1JQBA 3ZHZA 5BSEA 3HDYA 3DTTA 4BB5A 4YB8A 4YT8A 2NU8A 4MO2A 4PN3A 4HFMA 4W6ZA 3BMCA 1YB1A 3ZZNA 5CPFA 4MVJA 5CDTA 3DAGA 2UAGA 4XA8A 3IC5A 4LSWA 4J6FA 4DTIA 3MWDA 1YL6A 2ZTVA 3QA9A 2PLAA 5BR7A 5CFZA 5KWEA 2X0IA 3MWEA 1GYPA 5A3VA 2EG9A 2JAHA 3JQ9C 3ZV3A 5CDSA 4OQYA 5AYVA 2NU9B 4I5GA 1HTBA 4FPXA 3DOJA 2F1KA 3O8QA 1RJWA 1EBFA 4CQLB 2CMDA 3ZNOA 1O6ZA 2AQ8A 2IYPA 3GNSA 4FFNA 3ZU3A 3WX0A 1XA0A 3O38A 4EEXA 4OL9A 1NQOA 4G2NA 3RWBA 3P7MA 3JD3A 1I2BA 4FFOA 4YJGA 4RZHA 4R1SA 5CEEA 2I3AA 2P5YA 1ZH8A 2X86A 1QP8A 3LF1A 4CM9A 4RVUA 3N58A 3OMLA 3OBBA 5I9NA 1SBYA 2J3KA 4IGEA 2C20A 5I7SA 5TT0A 4D79A 3ZWYA 3H5RA 5JC1A 1N92A 1O9BA 2P4QA 1PQUA 3WMXA 1OOEA 1BW9B 3K2EA 4DREA 2I6TA 3WNVA 3PWSA 2BFMA 4Z3KA 1JLLB 4IMRA 4Z9FA 4HX5A 1IHYA 2FPIB 2VTEA 4DLLA 1EUDA 2H5LA 3K30A 3KXDA 4NH4A 2AHRA 3NV9A 4NI5A 5TT1A 1QSGA 3K2BA 4AJOA 4DA9A 3SC4A 1JKJA 4IS3A 4AJEA 3DBRA 2PKQP 4CL8A 1SAYA 1MP0A 4L4SA 3TSCA 3WYCA 1P9LA 4WUVA 1U3TA 4E2YA 5IDQA 1PJ4A 2BMAA 3WJAA 5F1PA 3T7EA 5A9TA 4NJMA 3F1KA 4HNGA 3KYCA 1PGNA 1I0ZA 4ALMA 2NVUB 4CR8A 1DFIA 3H3JA 3WGQA 3IKTA 4DVJA 1VPDA 1UAGA 2E37A 3ITDA 2X5OA 3KM0A 4I8XA 3NJ8A 5FYDA 3HG7A 1CDOA 4GLOA 3EMKA 4XIJA 3NT4A 4XYLA 4GX5A 5IAAA 2VUUA 1TLTA 3BHIA 5ILOA 5F1KA 1ZJYA 3AM4A 4WLOA 4B3HA 3PEFA 1ZCJA 2Q46A 3PHLA 2V6FA 5KVVA 3GG2A 3COSA 2BFPA 4UVDA 5TLSA 1PWZA 1Z6ZA 2RBEA 3VPHA 2NVBA 4L0QA 4NK4A 3W8EA 2WDZA 3QWHA 4OXNA 4DIOA 4FJ0A 2SCUB 1YB5A 3ONDA 4XEHA 4JN6B 1ZJZA 4K6CA 2XPCA 4Z0TA 2I65A 3O03A 1AUPA 1L1FA 1I2ZA 2Y0EA 3U4CA 1PQWA 3VZRA 3IDSA 4YAJA 4OAQA 3JQ7A 1HDZA 5T8KC 5KOIA 3JYPA 4XX0B 1LUAA 2PKQO 3BAZA 4IXWA 4NFHA 3DTYA 4NZ9A 5COBA 2DM6A 4OM8A 3ZWBA 2IXBA 4ROSA 1VL6A 4ONEA 4BO7A 3I4CA 1AGNA 4LVCA 3H65A 5L40A 2DFVA 5TGDA 4JROA 1VJ1A 3K5PA 4WCFB 3UCEA 1VLLA 3H9GA 4QUKA 2YZ7A 3DHYA 2RHCA 3K96A 4FD3A 2FY8A 3GDFA 4Z6KA 5JDCA 4KTVE 4DGSA 4PZEA 2CF5A 2GZ1A 4CMEC 5JAZA 4DQUA 3SJUA 1E3IA 4RO0A 1UAYA 4XIYA 1ZIDA 1BW9A 2A94A 1I3NA 3MJSA 1PJBA 4ZA2A 5G4KA 3KEQA 2HDHA 3UN1A 3G49A 4IGFA 3D5TA 3ROPA 3WBBA 1LNQA 1HDXA 5B1YA 2CY0A 5CEJA 3PIDA 3F46A 1HEUA 1EDOA 4DQVA 3LYLA 1TB4A 4BO9A 1SCUA 1FDVA 1DRVA 1QYXA 4E5YA 2JFGA 1X1TA 5KNLA 2J3IA 3D1LA 3H3FA 3N7UA 4XX0A 1ISFA 1PZGA 3I9NA 1A7KA 1OC2A 1GZ4A 1J0XO 1KERA 3OECA 3EK2A 3L6OO 4J9UE 3GVPA 4OXYA 3BIOA 2JHGA 4UULA 4UVHA 3VZSA 1VJTA 4DPMA 2PH5A 2Y1CA 4MVJD 4IS2A 3RCBA 1V3TA 2XXJA 3B70A 1ZK3A 1I5RA 5L9AA 4BNWA 1W0CA 2BLLA 2EKLA 3PFWO 1DC3A 2GZ3A 3GFGA 1ZMOA 2C2XA 2WYVA 1D3AA 1ZK0A 3DAPA 3GAFA 1DEHA 3ZHXA 2CDBA 3IS3A 4FFMA 3TRIA 3C1OA 3QVOA 4WLNA 3R6DA 4BNHA 2XOXA 3H2ZA 4K9DA 4YRBA 4BKRA 3NDJA 1DLJA 4DMMA 1F8FA 4R9SA 4BGEA 3M1AA 1TT7A 2PGJA 3GVHA 2VWQA 3NT5A 2BH9A 5CAEA 2DTEA 4XGNA 3AFMA 3IOYA 5HWSA 4MOWA 2X58A 4L4XA 1DAPA 4YQYA 1PZHA 4WGGA 5IJZA 2QG4A 1LRJA 4YTEA 4YVFA 3KYCB 1PGPA 4DC1A 1PQPA 2DUUA 2FRDA 5LDHA 4QECA 1BXKA 1WDLA 3HB5X 2VQ3A 4CMJA 5EPOA 5G4LA 2CVZA 3VZPA 3DHEA 4HNHA 1GEGA 1GEEA 3P2YA 4KQWA 4FC6A 1FXSA 5JY1A 3NGXA 1LDYA 1GUZA 1FDWA 3AU9A 1B3RA 2WYWA 5IDYA 4MJLA 4E2XA 1QRRA 4L76A 4KWIA 5K0ZA 4A27A 4DUPA 2EP5A 3IQDB 1Z74A 3JYOA 6LDHA 1AXGA 1XEAA 1WLYA 5DOVA 5JXWA 3GEMA 3UW3A 2YW9A 3AY6A 1EDZA 4BO2A 4RVHA 4ND1A 4CV0A 2UUPA 1U5AA 1Q2XA 5JYEA 4N5MA 3VC7A 3ZNQA 3IUPA 3MOGA 1WZIA 3JYQA 4NU5A 1ISIA 3IIEA 3O8QB 1YO6A 3OJ0A 1F14A 5IF3A 8ADHA 5HA5A 3BMNB 3P19A 1KY5A 2NU7B 3FNGA 4CV1A 1UDAA 3LSYA 4MKRA 4GKBA 2X4GA 4GX1A 3PHHA 4NBWA 4PFJA 4NMHA 4YXFA 1E1KA 4C4OA 2PTGA 4I9NA 5DBFA 1KVTA 5COAA 4R16A 2R00C 3OIDA 2VYND 3IP3A 1R4MA 2VT3A 3QRWA 1CQIA 3MTJA 1MFPA 5EMHA 4R68A 1UUFA 4GMFA 1A27A 1N2SA 1X7GA 3BA1A 4R1NA 4Z0HO 3MEQA 2Y1EA 2NACA 3D4PA 7MDHA 1DC6A 2J5RA 3LT0A 3KUXA 2DT5A 3BTSA 1TVEA 2A4KA 2FP4A 2TMGA 1LSUA 4IXTA 4RF3A 3GAZA 3OETA 3HJAA 1IZ9A 3JQAD 4R1UA 3ETEA 4IZIA 2PZMA 4XQCA 4IM7A 2FZWA 2W2LD 1QLJA 5ER9A 3RC9A 1JTVA 4Y98A 4QSMA 4BGVA 1P44A 3ON5A 2NU8B 4B4OA 3H5AA 5LC1A 4CR6A 2YUTA 4CQLA 4N7RA 3FF4A 4J43A 3U0BA 2AW5A 3D64A 1XU7A 2JCYA 4ALLA 3MWDB 3PK0A 1W73A 2YHIA 3ZNNA 5JAMA 1FDUA 2AG5A 2WTBA 2QZ9A 4XRRA 1UXHA 5JE8A 5I7EA 3FPLA 1NVTA 4BKPA 2NSDA 3H9JA 1PL7A 3QY9A 3KLPX 3VHRA 4E5MA 1OMOA 1ENOA 1RPNA 1BGVA 1H0KA 3K8ZA 2VWGA 4PG7A 4R51A 3BHMA 4ZQHA 2J8ZA 2ZCVA 1M6HA 2EV9A 3I9KA 4KOAA 2DAPA 1I24A 4OMUA 3DDNA 3D0OA 1I30A 4CL3A 4FS3A 3V1YA 3OQ6A 1TT5B 1HDCA 1JLLA 3PZRA 4WCDA 1T2AA 4CMHA 4M54A 4MVJM 1VSVA 4WK6A 3V1UA 4U7WA 2VZ8A 3PHIA 2GDZA 2WD7B 2VHVA 3M2TA 3UCXA 3VOSA 4CLXA 1QORA 1AHIA 1E1MA 2D4AA 4IDDA 1R0LA 3LLSA 3RBZA 3VH4A 3JQAB 3VKUA 2BGMA 4Z9XA 5T6BA 4BNMA 2AMFA 4IJUA 4R69A 2H6EA 3DONA 3ICCA 2C7VA 3Q9NA 3JV7A 5JCJD 5A5FA 3DFUA 4IDGA 3UHAA 4YDRA 1KYQA 3I4FA 3KLMX 1FDSA 3D3WB 5JY6A 5DCUA 4B4VA 4CUJA 1B2LA 3JD2A 3TN7A 3X2FA 4J90A 3QWIA 2JCXA 1U2GA 3LQFA 3I9LA 1LLCA 5FI3A 3JSAA 4ZRMA 3DHNA 1H6BA 3GGGA 4LN1A 3DXFA 2VN8A 3WICA 3I23A 3JQ8B 3RFVA 1C0LA 3G17A 1P0FA 1K6XA 2IE0A 3CIFA 3RSHA 2VRBA 1UP4A 2Y93A 4J49A 5EJ2A 5F5LA 2QX7A 3LT4A 4JGBA 1M67A 3JD0A 1EK6A 1DJNA 1N7HA 2W2KB 2Z5LA 1RM4A 1LDMA 2B4RO 3LK7A 4WKGA 3UOGA 1DRWA 1OZAA 4PLCA 2GN6A 3OIGA 2X9GA 1RM3A 4NHEA 2AQKA 1E5LA 4BNUA 4II3A 2PKRA 4CM8A 4X54A 2EW8A 1P1KA 2Q50A 1B16A 5TF4A 3WQSB 4URFA 4ZN6A 2JHFA 1DBVO 4FCCA 1HE2A 3AWDA 2VHZA 2Q49A 4NU6A 3SVTA 4DPLA 2GLXA 3S8MA 1MC4A 3K92A 4YT4A 2Z95A 3Q11A 1XU9A 4YAIA 4YACA 4JJGA 3F4BA 5L4NA 3S1LA 3OJOA 4GSKA 1SOVA 1N1GA 1H6AA 1ZSNA 4AJ2A 1EUDB 1S6YA 4CLRA 3PTZA 3B1JA 3DZHA 4BVAA 1E7MA 1HZZA 3ZWOA 3DBLB 3KEOA 4OIMA 1XELA 4QFCA 3UH1A 4E6PA 1SNYA 1YBMA 3TOXA 5A03A 4BNNA 3FD8A 4J1NA 1I32A 4C7JA 4MKXA 1YBAA 5K6AC 2TMDA 4B7CA 2VYNA 4WPGA 1R15A 1K6JA 1YGYA 2PGDA 1O5IA 3AK4A 2O48X 4WLVA 4MVJG 4R4JA 3RC1A 4MINA 4AJ1A 1U3UA 1FK8A 3E82A 4PLGA 1FF9A 3RUFA 5KKCA 3TJRA 1L7EA 4YRAA 4GPD1 5JAIA 3GPIA 1Y5RA 1I3MA 2YFHA 1YH3A 1H6DA 1PTJA 1Q0QA 1UXJA 2E49A 1XSEA 3JQFA 1ZNQO 4KUGA 4BKQA 4UVEA 3LT1A 3PFFA 2OBYA 3RROA 5ICMA 4OQZA 4DMLA 2JKVA 4UAGA 4AJIA 4WOJA 3KB6A 4XYEA 4YPOA 4H3VA 4YYZA 2HRBA 4BNLA 5KTKA 4KMSA 4CODB 3IUSA 1D8AA 3EVTA 5DNAA 5JMPA 4YAKA 3HDQA 3HSKA 1PZFA 1P1FA 3A4VA 3L9WA 3G3EA 2B69A 3AW9A 1Y6JA 3L6DA 2YHIB 4E13A 3KRTA 3HUDA 2YJZA 1Q0HA 2GN4A 2HU2A 2C0CA 4M86A 1YDWA 4BQRA 4NBTA 3ZI0A 4B8WA 2ZYGA 3BTVA 1YJQA 4LRSB 4NJOA 3RUEA 4BOYA 2ZB8A 4ND3A 2VNAA 3QWAA 5EQFA 3GVXA 4LRTB 3UVEA 3NYWA 2EWMA 2ZB7A 1KC1A 3OM9A 4OHUA 3E48A 3VTZA 3V1TC 1UZMA 4K26A 4PG5A 5DP1A 1T2FA 4CUKA 3EVNA 3ROQA 5FI5A 4JJIA 5EL0A 5AXCA 2D5CA 1EUZA 2W4QA 1ADFA 4I1IA 3C7CB 3ADOA 4Y6RA 4S3MA 5CAEB 2FR8A 4FR5A 4YT5A 1LA2A 1HE4A 2QYTA 4D7AA 3G79A 1YL7A 3BMOB 3IAHA 1WMAA 3GH3A 3I9MA 4KQXA 5TNXA 5ILGA 3T4EA 2O3SA 2B5VA 4J4HA 5KJEA 4M1QA 1HDRA 1E1LA 2BI8A 2D59A 2XXBA 4U5QA 5A05A 4O59O 2NADA 5G0VA 1IPFA
chains in the Genus database with same CATH superfamily
1P1JA 4D4MA 2J4CA 1XMSA 5IM5A 1UC5B 2PGAA 4O5AA 4Q9JA 2VLIA 3QJYA 5FADA 4MTLA 1I5EA 2QBYA 4D5EA 1PN3A 3C4QA 2MIIA 4KW7A 5IVIA 3CUUA 3DQPA 4RQAA 5EYPB 2J3HA 3QU2A 3B7WA 5ULLA 3SPXA 1DX4A 5JD5A 5F9FA 1A4IA 1B6TA 1YZQA 4E1BA 3W5SA 1DAHA 4FBMA 4NNPA 1ZGJA 5T57A 3W05A 5JZVA 2W2MA 2PD6A 1E2PA 1EUCB 1PT5A 3GIWA 2QL9A 3V7FA 4P33A 9LDBA 3HP4A 2AOUA 3U40A 1LD3A 4QATA 1QQAA 2FMFA 3LF2A 5FFFA 5LA6B 4DIBA 1RI4A 2JFNA 3MN1A 4IRMA 3N75A 1WXWA 4C30A 1OLXA 2UUOA 5C1BA 2ACKA 3GYBA 3OIVA 1HLPA 1UBUS 1NNSA 4IKEA 4N40A 1T5BA 2BHLA 3FYUC 5JU6A 1GKKA 3DTVA 3NB0A 3W5HA 4G4IA 4I4CA 2C5EA 2HL6A 3N87A 5CDFA 3UMRA 3HI6A 4MX8A 1GKIA 2XA1A 1NIJA 1AXEA 1L7OA 1S8FA 2CW5A 3D7NA 3AW8A 3RAJA 2ES4A 4DJEC 3DVLA 4IMJB 3NBZC 5LQKA 4DIFA 3FPCA 4KXLA 4RBNA 2RG1A 3GT0A 1G41A 3AFGA 3SR3A 1N7IA 4M1YA 1S3SA 2RHWA 4B3BA 1N2GA 4OHYA 1JJ7A 1FVOA 2ZBGA 2ZJ0A 3C6YA 1GTL1 1QHXA 3O3OB 4RD3A 3WGHA 1V1JA 3EZLA 3JQGB 4WY2A 1RACA 3SKVA 4NCAA 3KETA 1T8SA 1GGVA 3LPNA 1RS0A 3PQ8A 1DU4A 1M5RA 2VZ0A 3L6UA 3WYBA 4MQBA 1VPVA 3NJ4A 2GGSA 1R0RE 2ZSBA 5AK4A 4C6SA 1E7QA 1EHYA 1QV9A 4V0NA 1NHGA 4J1QA 1SOWA 1HYGA 1CUYA 1UZUA 2ZYAA 3WGNA 3OM1A 2B5WA 2Q6OA 2XCTB 1Z36A 4G0UA 4GYWA 3KSDO 5E4YA 1QU2A 4ZCIA 2HCBA 3AUSA 3LQ1A 4I50B 2CUZA 5HKAA 3GUHA 4IV8A 2IOFK 4BZQA 4KN9S 1EJ0A 3SSMA 1JAXA 3UWSA 3HZZA 1W30A 3C5VA 5DNUA 1TQ2A 2Q07A 1ELOA 2JBWA 4GP6A 4OYRA 1DINA 1WMBA 3UMFA 1R5BA 2PUWA 2AR9A 1FDTA 3PX2A 4HWRA 3L4SO 4WX2B 4PM4A 3QVLA 1SCBA 2I99A 5J23A 2Z5FA 3HHEA 1MZPA 5GIOE 1YZLA 3RRYA 3A28A 4GYJA 4K5QA 4ARZB 5FB3A 3HB0A 4UXHA 3VBCA 1I2CA 2IZ7A 4QDJA 4YRIA 3HFJA 2C5AA 2OFXA 4ZQFA 4W7SA 5LB2A 1CDZA 1KYIA 3S68A 5CP8A 3J7TA 4ND6A 3U3ZA 2R79A 4QBFA 4QDUA 1Z2CA 2X42A 1EXWA 1UKZA 3WO1A 3F71A 4EX6A 1PNVA 1PYDA 4LY6A 1PU2A 4QTXA 1U3DA 5DW0A 4W7IA 3LCMA 4EZIA 5A7FA 1T36B 2WF5A 5KDLA 1ZITA 2GD2A 2IITA 2O59A 3ZI4A 1CUIA 1XDUA 1XTVA 5CMLA 1YZKA 1U3GA 4FMPA 4E32A 5K8IA 1UDBA 4C7KA 4DJJA 4QDOA 3CJQA 1SXQA 5DSTA 1CNEA 1KH1A 2ZVPX 3DT9A 4X20B 4YBRA 3VU9B 2J0EA 2ZM6B 3SQWA 2WSBA 1HFEL 3E7XA 4WOKA 4KQ6A 4LISA 2OCAA 2R8ZA 4EO9A 3FSJX 2WVAA 3X2EA 5JS7A 1VJGA 3DW1X 3TQHA 3LW8A 3BMCB 4UM5A 4WTOA 1XRQA 4MCJA 3V1KA 4RH0A 3MTIA 4RDHA 2ADFA 4BNTA 2V3WA 1TEHA 2GPBA 3N2KA 3QFFA 4OQPA 5LYJA 3RU7A 3SDZA 4Y2GA 3QPDA 1YI1A 1U5BA 5CLGA 2SNIE 2O20A 1L1EA 5BQ5A 3W9SA 3WWYA 4G5FA 1SUPA 5ALPA 4BECA 4O63O 3S5JA 3Q8XB 1GKYA 2HIAA 3OEEA 4GZMA 5I9MA 4R7TA 2XGSA 3UJ7A 2VHWA 4G1UC 1WXHA 3BXHA 3R77A 4YASA 1DQZA 1YQWA 4M0KA 2IQ5A 2W8BB 2QUIA 4BPBA 2GD0A 1JU9A 1ESDA 1R6VA 1X1RA 1JDJA 2P9YA 3B8EA 2C42A 3VPBA 3WLTA 1RXVA 1KVRA 4CF3A 4JR1A 2B83A 2D8MA 1AQJA 2RHBA 3GYGA 3U09A 1KFKB 1P1CA 1YWGO 3BH6A 1GGNA 3FJ1A 4GI2A 2X2EA 1CEXA 4LK2A 1Z4QA 4DBLE 5LXTA 5KOJB 5FV7A 4G37A 3DZFA 2BW0A 3T41A 5KKNB 5DIZA 4JJEA 3IT3A 2O2XA 1PEAA 2AJ8A 1PV1A 4ZAFA 1FMFA 5LQNA 2ID4A 4MSUA 3R7WA 1GZ6A 5CHYA 3C1TA 4MS3B 3QY0A 3SF0A 1LPPA 2WHPA 4JU8A 4RTQA 1XLTA 3MWGA 4ZAYA 3PEYA 4QYIB 3L0OA 4MR9B 4R5HA 4XQEA 4AF6A 1SULA 3EULA 4WLEA 3HB7A 1DVRA 2CVQA 4JFAA 4QLOA 1ODCA 2EF1A 4LVUA 5D85A 3EXAA 3B1KA 3QLUC 1N5RA 2ZRAA 3Q8LA 5D8DA 1AA9A 3DMFA 1OLOA 3O4GA 4Z3OA 5A3SA 4I9FA 4D0SA 5IKXA 4ESVA 1JMVA 3S7TA 4F91B 1BX0A 1ZN7A 3PNVA 3MOIA 5T64A 2ZIZA 2XD4A 5TV2A 2WY2D 1LPNA 1GPJA 4F4HA 2H07A 2BT4A 4LYHA 1TVMA 3WYEA 4ZMRA 3VMMA 3LWBA 3DLBA 2XCIA 2V6BA 4QVGA 4NJEB 2BJWA 5EIHA 3FWNA 5TQ2A 4N6OA 4P31A 2WUWE 2VC2B 3G5MA 5FI1B 1V6AA 1RLOA 3L0PA 3LOPA 5C8XA 3I9V1 3SJAA 3B78A 3X43A 2CL5A 2Q0XA 5DH9A 5KCMA 4BEVA 1ZLYA 5L4SA 4MTCA 2FE1A 3IUYA 3FOZA 2BP7B 2BWJA 3QHPA 3B20A 4LDNA 3WLAA 5L3SA 4TUYA 5DBIA 4JSRA 4PGFA 1LQTA 4BIMA 1CK4A 1U1CA 5U1PA 4NECA 2ACVA 1NFRA 4YYEA 4OBEA 3S2FA 1FPMA 1QB7A 4K6OA 2CHFA 2P0EA 2P9CA 2R7NA 3AUYA 1TAGA 1YR3A 4V2UA 3W2HA 2FSVA 2Q1WA 3K6KA 4IIJF 2F6RA 4IG9A 2QVGA 2FUEA 2XUJA 1XC7A 1JKIA 1OWLA 2J5XA 4JITA 4KQFA 5JZOA 1GOTA 1KKMA 3PHJA 2ANCA 1R7RA 2H8GA 3MWLA 2GJSA 4XGIA 4GZ5A 5CW1A 2WJ4A 2JGDA 2G07A 4U7FA 4ZK6A 3H8VA 4RLHA 4CWAA 1HX7A 3TIIA 1Q3KA 2JJ1D 3IT1A 1TYDE 3GRPA 4MV0A 5DYYA 4RCVA 5JSKA 1P0QA 3ZCUA 2XQIA 4AO6A 5B4UA 5JMWA 3TCKA 1NE7A 4TTRA 1A5ZA 3PNPA 3BE5A 3PJEA 1VIAA 3UHOA 2IDKA 3VR5D 4YIKA 2E21A 4YFYA 1NLUA 1OAAA 2XHEA 3IHKA 4INAA 3CE6A 3FDJA 3KDAA 2W6IA 4S2UA 3AJAA 5EINA 1XEWY 5KYUA 4N5DA 3H4VA 2CT8A 1KJWA 1QG2A 2GTPA 5HILA 4F7DA 4AUKA 1OXKB 1PR1A 3LL7A 1U7HA 2ECFA 5JZSA 4WOPA 1JIJA 3ROKA 2UVDA 1WBJB 3AR6A 4YXWA 1NSTA 3NTLA 1Z34A 1JSZA 1ZJJA 4GM0A 2QTBA 3PHGA 3T5DA 2DHDA 3EQ2A 4A6EA 2QZSA 4C6TB 1KH3A 3EGEA 1FVXA 3EXEA 3IESA 3B2QA 2B7BA 4PG4A 4KU4A 2D54A 4DEYA 5KS2A 1OGYA 4ICIA 5M04A 3F3KA 2IS4A 4OHOA 4IR7A 3M6FA 1XEFA 2QYSA 1RRCA 1KVUA 1OUMA 1E1CA 3IGFA 2CLIB 3O21A 1PLLA 1DZIA 2I4TA 4MW2A 3MT8A 2IH5A 3GP8A 1MJNA 3PT9A 4E2WA 2FDCA 5J63A 4B6PA 1J56A 3AUJB 2VTKA 4OQMA 1DEAA 2UYCA 1F8UA 4RXTA 5IBQA 5CA1A 1B00A 2ZR9A 2ZTMA 5K4GA 4A8TA 1EBUA 3PLRA 1SM4A 3PUHA 2YZKA 3ZIAD 3WNZA 4C7XA 1XLTC 4MV6A 5K3CA 2K2QB 3WISA 2LVBA 1Y4SA 2FKAA 3PFIA 5CFNA 4LCBA 5HZKA 1N5KA 1G0NA 2BFAA 3L6RA 1LLFA 1GL9B 1WZNA 4I3HA 3S6JA 1ZD2P 1H3EA 4UBIA 4CKEB 1AHNA 2JK1A 4H9GA 4BLSA 1HKHA 4KPEC 4I14A 2LIVA 5CNKA 3M82A 1Q84A 5AXBA 3SF8A 1OPRA 3IJ5A 3NBQA 5JQGF 4EZBA 3P2OA 1KDOA 3U2QA 3BK2A 3T4PA 3UFXA 4O4JA 1ZLXA 3OO0A 3SD7A 3SEQA 1YHYA 4L2IB 4W1RA 4WXYB 5FNVF 5FKJA 5L3SB 1PR9A 1U81A 3IELA 3VDMA 1NBAA 3HM9A 1MA3A 3DMTA 4KI7A 4LGCA 4ECAA 4M87A 1KQGA 1A9PA 1J8MF 1WF3A 2RBKA 4XQ0A 5EJIA 5U4QA 4V1CI 1W5FA 1UXIA 3OY2A 4KUHA 4LPKA 5H59A 3KPUA 1C7RA 3KSUA 4S1NA 4GXTA 4UOEA 3LPLA 1C2TA 3EG9B 4DL9A 1H8ED 1V47A 5IZ4A 3BMNA 4HWKA 4MEBA 2DG2A 3M81A 2NVWA 1SK9A 3KDSE 3QE2A 1USUA 5U4XA 1TUGA 1G4AE 3ADPA 4YAGA 2IGTA 2EERA 2NZVG 1JXOA 3FETA 4JY7A 2FSIA 4UVIA 3RS4A 4D42A 2PQ2A 2NZ8A 2X6TA 4QQRA 1FRZA 1ZIOA 2HFJA 4IO1A 4QXMA 3TZBA 2YWBA 2FZLA 1SMKA 2D4HA 2D1TA 4UEQA 3GEHA 2XGMA 1Q91A 3Q98A 1DKNA 3ZZ1A 2AI1A 2PZFA 1D2HA 2BGIA 3FPKA 1NJGA 2YX1A 2HA5A 1OFHA 2H0RA 4X41A 1X77A 1T24A 4A6DA 3MBOA 4GH5A 5KTOA 5MGBA 4LV5B 4INPA 3WLJA 4RHTA 4F4UA 2O8NA 4ZU3A 1AY0A 4PSDA 3KJFA 2ZXEA 3THRA 4BGIA 3AM3A 3BGWA 4ZFNA 3TL3A 4BN5A 3UJ6A 1V3UA 4BTEA 1J8YF 3ZHVA 3MVEA 4INOA 1QG6A 1YDHA 4XOUA 3CY6A 2A0WA 2PM8A 1D6SA 1CVLA 5B4VA 5CD9A 2HHLA 4XW2A 5EEGA 4YJFA 5BOVA 4EG3A 1BRMA 5E9AA 1T8RA 1U65A 1BS9A 2OVFA 3R76A 3R74A 4A0HA 4AYWA 2YWDA 3M6XA 2H1IA 3K72B 3LUKA 2TMKA 3DO6A 3WYNA 3VTKA 3DLAA 1M10A 1RJDA 4GE3A 3AO0B 2Z09A 3O2JA 4AL4A 3JS5A 3T1TA 2UYOA 2BFOA 3EDYA 4V3BA 1OQAA 2ZJOA 2LGJA 1Z8DA 4MR7B 2YXDA 3CG0A 1ZVJA 4YRPA 3T1NA 3QUSA 2AYXA 5IABA 1NVMB 3RK0A 4FJ2A 3CVJA 4BO3A 1QRDA 4CI9A 2R8XA 4E2ZA 3EIEA 4D4IA 2WF9A 3AUXA 4EPYA 2Z58A 2FWBA 1QQBA 4BO1A 2NAFA 3L41A 1WSBA 4L22A 2PBRA 3G9TA 5LIPA 6ADHA 4FONA 6PFKA 2A57A 4AYXA 4N41A 3GQVA 3REQB 2ZIXA 4KC0A 1STOA 2ZUBA 7ADHA 3DL2A 1FNMA 4TYNA 1K9VF 1VYUA 2D5LA 2OMEA 1DAFA 3GUYA 421PA 1LJUA 1T8WA 2Q3CA 1ZOIA 4TXLA 3EA4A 3FVWA 3KK0A 5DTQA 1HQKA 3M1LA 3QM1A 1KP9A 5FF9A 4BMVA 1X1QA 3CLRD 5DGCA 3VZQA 4QULA 4J1TA 5IVPA 2RH8A 1NQUA 1T0UA 4V0SA 5B55A 3NETA 2WFZA 2GN9A 1GPYA 2XE4A 3WZMA 4FLFA 2VQFB 3JQEA 1WCIB 1SIWA 4IDNA 1IZYA 2PD3A 3AY7A 3FCOA 4LZZA 3TLMA 1PJ3A 4L73A 1R8JA 1ADGA 2H17A 4ENTA 4YRSA 4C2TA 3ZJTA 4OX9B 3MA0A 4M49A 2AXQA 3OUUA 2A0UA 3KL4A 5F76A 4C1BA 3O7MA 3HDHA 4CUZA 4EHDA 2C96A 2X8JA 3C6MA 3D5EA 5KTNA 1UMBB 3KKNA 3LIPA 4R9RA 3JD1A 5EKSA 5KYWA 3SC3A 5SY4A 2YWXA 2DHEA 2I4NA 3G2NA 3I1YA 4UVGA 3VOBA 1XCLA 2P9GA 1WHSA 1BJKA 1Z9BA 2HSWA 1EWQA 5C1IA 2EZ4A 3AR4A 2ZYSA 3SC6A 4L15A 1IB0A 2HRCA 1NT2A 2O2ZA 2VSQA 3I9JA 3LGAA 1W52X 3NC4A 4G56A 4HEA1 4NQZA 4Q48A 4PX5A 5K51A 4DBVO 4HLDA 3V7WA 1MCZA 3QBTA 1VCOA 3NM4A 3D3KA 1A4XA 2B9EA 1NBIA 1O54A 4MW9A 4O5OA 3MLBA 2KYRA 4UMVA 2OC9A 4GQAA 1LBIA 1AUVA 5TMBA 2QM3A 5SYNA 3WTBA 3WMRA 2VDPB 4HL6A 1Y0BA 3OPYA 3AF2A 3AILA 4NF2A 3PIIA 1OY1A 1QNLA 4B75A 4DLXA 1OLUA 3A37A 3H7IA 1CQJB 3F5FA 3FB1A 4Y9TA 2MMGA 3CLKA 5CH8A 3QTLA 3I42A 2WA1A 3OWOA 5CFPA 1Z0UA 1X80B 3UT5A 3CZ5A 2B8WA 4M0EA 2XI4A 4MMZB 2OGTA 3ZY3A 3TLCA 3B1ZA 4OJQA 4WFKA 3HCBA 2EQAA 2VBFA 2IHJA 1F5NA 3RVOA 1S3FA 1DB3A 5H82A 1L7VC 4BQEA 4EYEA 1B3BA 4RPLA 5AJXA 1ZM3A 2BOVA 4ARBA 2Z9BA 3HNOA 2EJVA 4JBGA 1II0A 3I0NA 2IPLA 2GXQA 1P2GA 1JJAA 2PL3A 2UYGA 2DQKA 4A8JB 4E51A 2XT0A 3ZU4A 2AFRA 2X4IA 5ICGA 1SBTA 4EVIA 6GPBA 1PV2A 3L07A 4EGFA 1BH2A 2OQRA 1CV2A 2ZJ6A 1I01A 2H59A 4BVLA 5BT8A 1QE3A 2FEPA 4QUAA 5IH3A 3CJRA 5CLIA 2R8OA 1JQ3A 1M8GA 1H42A 3LH5A 4R2JA 1XZHA 4MIYA 1A72A 3LC0A 4GRAA 1X6VA 4GO1A 1KEKA 3R5FA 4CF4A 1Z2PX 4PZYA 2GO7A 3WLKX 4O8ZA 4WV3A 3FTQA 1IBRA 3E8SA 5K01A 1BHJA 2A5LA 3E0QA 3KQVA 1WB5A 4HUQB 1G21A 3C97A 3TIGA 3BTUA 1ENYA 2FUNB 3BXGA 2VAXA 4LC0A 1VLZA 1YA4A 1N6PA 4DIUA 4D8XA 6REQB 1XE3A 4GGOA 2P6OA 2XB2A 1UDCA 1QJ4A 3JZAA 3M7IA 3NHJA 3OT5A 4NG4A 2EOAA 4XDZA 3VKVA 5HRUA 4MB0A 4D45A 1CRPA 1L5MA 4GWGA 3WYAA 1E3WB 5DDIP 2FWRA 4G2TA 3PDUA 4ZOEA 5JASA 1NLMA 4YJ2F 5I8ZA 4DRZA 3R3JA 2BBSA 2JATA 4RIHA 1NAIA 4LSMA 4RIEA 2ZZMA 2JFUA 1RW4A 3MD0A 3PXBA 2PSJA 1O0SA 3IKJA 3JQCA 3KO8A 4N3NA 5C7OO 1T6XA 2KB0A 1ISHA 1NL3A 1NY6A 2R7LA 2QTCA 3MCZA 1YR9A 4JEUA 2XMPA 4ZVLA 1AB5A 3RPEA 1G17A 2C9OA 1J49A 2Q1UA 3REGA 2OO5C 1EIZA 1AE1A 4Y67A 2JNWA 2RG7A 4HSGA 3T15A 4YJ2B 1E59A 2QUJA 4Q3BA 1ZUD1 2GEVA 2Z3ZA 5EIWA 4MVWA 4B3DA 2GF2A 5E38A 4MWZA 4A8JA 1C7JA 3AVVA 3VU1A 2NP7A 4JBHA 4IEFB 2YWEA 4JD5A 4TKVA 1U2RA 3AOGA 2L19A 2GPSA 4TT8A 2PS3A 1T4CB 2DGDA 2QE7D 2RFLA 5JCOA 2IOYA 3OU7A 2BZ0A 1O2DA 2C94A 4X0EA 5BQ3A 4YRFA 4K8RB 4RMHA 1S7GA 4K9RA 1TQDA 4EQZA 3WGVA 2HCJB 1F60A 5I7WA 2O7VA 1EK5A 4LNAA 5IMSA 2GMWA 5FWNA 1M6YA 4K6FA 4DMFA 2QXYA 3RBVA 3GW8A 3L7OA 1W0JA 2ZYDA 3P45A 4LHVA 3JQGA 3DDZX 3BEDA 4YREA 3RVJA 2E48A 3MCWA 5HSGA 1ZD9A 1MT3A 1SWWA 2Q3JA 4WUTA 3RADC 2JIBA 1QHGA 2AR7A 5GONA 1X2BA 5IJ0A 3KE9A 4KXUA 2W6ID 4U7JA 3BCRA 3BULA 3T4XA 1F2TA 4ES6A 3T52A 1CLEA 4JR2A 4UTPA 5HFJA 4RF5A 3VPGA 1GPBA 1XTUA 2GEJA 2HM7A 2COUA 1YS6A 3PB3A 3N74A 3Q1KA 3UK1A 4E31A 4EPTA 4DPKA 4OXKA 1QP0A 4BFVA 3UWPA 1LJ8A 3R6TA 1TCCA 1L7DA 1QMPA 3D6HA 4KJZA 4TS9A 1GARA 2HLDA 4WDRA 3WOVA 4LYJA 1ULTA 3KZXA 4PZAA 5DB4A 5C3UA 1BDIA 4EF6A 2Q9UA 3GROA 1C1YA 2W71A 4KUEA 3QSGA 2IZOA 2ZRBA 1KJ9A 4REQA 1FUKA 3TRHA 4B82A 1VJ0A 3ERCA 1B74A 4Q02A 1SZJG 5JVDB 4PC7A 4TV8A 5BORA 2QD3A 4HX9A 4FFLA 4BV9A 1GQQA 5JO0A 3SEFA 1YOVB 1P1IA 3W8DA 4WJLA 2QY6A 2FWAA 3ELYA 1UMDB 4D9BA 1FLVA 2IDMA 2AHOA 1TZMA 3OI7A 2FZ5A 1EX1A 2GAFA 1PQ4A 1JB9A 1NP7A 5ENZA 3WOHA 5IJ9B 3DL0A 3IPYA 2NU9A 2LBPA 4FMDB 4G25A 4BUCA 1XQ9A 4ZEWA 1ODLA 1Z63A 1M72A 3FFXA 2IP2A 2FEWB 4IJKA 3DL4A 1QHHA 3ILYA 1DWUA 3PGKA 4FDUA 4WMLA 5IT5A 3SLKA 2HZ7A 3FOAA 3OLYA 2IEDA 4KBYA 3IILA 4BHTA 1Y9JA 1JA1A 2VLBA 5AWFC 3UJBA 1SB8A 2H85A 3W5VA 1E5QA 1GCOA 4OJMX 3QF4A 3RF6A 5L4LA 3ZY6A 1D4AA 3NFRA 5K0FA 1EVEA 1WB9A 2CDCA 2BZ1A 1TECE 3HVIA 4R8MA 2F9LA 1KP2A 3GMSA 3IEIA 1QHIA 4WCFA 2GYVA 5THXA 4MHSA 5IAGA 2CXXA 2KLHA 3CUYA 1CD5A 1CR1A 3IAM1 3QU5A 1VE9A 3PDCA 4KAXA 2OSVA 2IPOA 4CIDA 2X0RA 4DG8A 4DYDA 1OH5A 1YZYA 4R2IA 5B36A 1ND6A 1IHXA 4C4SA 2YH2A 2ZSJA 5KQGA 2QN9A 1M8KA 2E5WA 4UHFA 2RC6A 1Z2OX 5E6SB 3EVFA 2CMGA 5T8KA 3RNOA 3KUUA 3ONEA 3ZY4A 1E8MA 2A33A 4RY9A 4NBSA 2R2GA 5ILQA 3HY3A 4MYCA 4PWZA 5D84A 3R3VA 5ALVA 2O8BB 2W2LA 2R1ZA 5LZ2A 3ZH2A 2H1HA 3UMSA 1Z2DA 1G8AA 3L77A 2RIPA 3JCZA 3LZ6A 3MWYW 2OXRA 3PF9A 5KTRA 2MSEB 2P1ZA 1ZM4A 3SAJA 1E62A 2BEWA 2GERA 4FBGA 4EG5A 2AF4C 3EXHC 4EW3A 4QE3A 2Y99A 3H16A 4N01A 1WTCA 3ZEIA 4BNDA 3IAUA 2BISA 1VSTA 3ESXA 2E1PA 3FIJA 1RAIA 3G1WA 2LCIA 2WI8A 3GA7A 3L1JA 1MF7A 4LYYA 4QUJA 3ZW8A 3CUWA 4UTNA 3BIJA 3OFND 1EFAA 1N9GA 1DX6A 3EGDB 5H02A 4KRXA 1N2XA 2ODTX 2QJFA 3JQQA 3EISA 5HOQA 2X6RA 1X1EA 1KZ6A 2AG8A 4AUEA 3GNQA 3DG9A 2JJMA 3AKDA 3LLVA 4LWOA 1VLHA 4MW5A 3Q7PA 4HC4A 5INTA 3PPYA 2PPVA 3PFGA 1YB6A 1KQ3A 4F71A 4GGPA 3EWNA 1CZHA 4G5RA 2LCFA 2DSTA 3TQFA 2VRCA 3LQ4A 3HMKA 4Q3NA 2OHIA 3RIEA 1L7XA 4NENA 3DLIA 3ZOZA 2ZU6A 4Y6SA 5EJ7A 4R3UC 3TZKA 3DAFA 3C16C 1WP9A 3ENVA 1IFXA 4HJRA 4R2WA 2NXWA 1WDKA 2Q6KA 3LYAA 1FUYB 1PZNA 2YXPX 5EZSA 1U2SA 4M88A 3TMYA 3X1XA 4D4LA 3EMVA 4CDNA 1XRNA 1U0LA 4M9QA 2NTJA 2VJKA 3FA2A 2JLSA 2D06A 4DRXB 1DARA 4CM4A 4ENPA 3ONFA 5EFZA 1E92A 1YRHA 3Q40A 5KTPA 3HGMA 1U0NA 3A9WA 1OYYA 3D6FA 3QKRA 2NAPA 4B4KA 2Q6VA 1C1DB 1S7CA 1C80A 3W8FA 1T2UA 3TH5A 1F0YA 1E4VA 5JO9A 3WWZA 1XCJA 1T9KA 4UJ3A 4EW2A 1DP4A 3F9CA 4IICA 1FFAA 1APBA 3D4IA 3OP1A 3E6AA 3I2GA 1GQYA 3WBFA 2B36A 2BFDB 1OX5A 1JLMA 2D3WA 5AKYA 3PA6A 4EECA 2RHJA 4DJAA 1NOJA 2AYZA 2H63A 3OOEA 2QX9A 1UFVA 3QQ5A 1RXCA 4G5HA 4PLWA 4Y2UA 1SXJB 1ZZGA 3AR3A 2DUNA 5FCDA 4C0BA 1YS7A 3NRBA 1QS0A 2O07A 3LIIA 2AOXA 1UFKA 1L2TA 2ECKA 4LOAA 5CA1F 2VSNA 4FEEA 1NN3A 1R00A 3DM9B 4AJKA 2CLEB 1QV6A 2F3TA 2AC4A 4MQUA 3GUVA 1OA0A 1WVMA 3Q6NA 1FFXA 2E4VA 2OZVA 3OZGA 4JB3A 4JIMA 5H70A 3KELA 3RRBA 4IH1A 2EYQA 1XB2A 3T3HA 5HCIA 1SUEA 1G5QA 5DSXA 4OKNA 3R7DA 1Z0ZA 4MI9A 1O9GA 2IL1A 2IPAB 4V0OA 2HF9A 2VT2A 1J0EA 1KI9A 3EXIB 2R6DA 3K9QO 3KVOA 2QIPA 3OX1A 4HADA 4N18A 5AW4A 3S4YA 3OJWA 3D4BA 2OFPA 4H0NA 2QQEA 4JJKA 3MS4A 1Q0TA 1H4TA 2G88A 3INYA 1NNLA 1XRJA 3QQPA 3RFTA 5BPHA 3TZCA 4XRGA 3CUTA 2C5FA 1I9GA 5ESRA 4GKKB 2EX0A 2J87A 1NMSA 3BPSA 5LMUB 4B3IA 2SKCA 4XYMA 1BHSA 5F64A 1J21A 5DN6A 5DTMA 4IFIA 1L6RA 1OI4A 2OD7A 2YMPA 4IIUA 3HXMA 1D2MA 2QW1A 4NHOA 4NK5A 4EA9A 4LF5B 1JNYA 1P29A 1X86B 1Z4JA 3TOCA 2GARA 2I3GA 1G1MA 1KPHA 1Y82A 4DDKA 1BVHA 1IUPA 1FS6A 3MJCA 4O1MA 1MC1A 2XHZA 7REQA 3E70C 4RA9B 1VKNA 1CRLA 1KYZA 5HRAA 2BEUA 2J48A 1Y4DE 3RRNA 3CWCA 1IVSA 2FB9A 3Q72A 4WY5A 4A2PA 4MUKA 5B37A 4QOIA 3ACDA 4V02A 5KWVA 3I4LA 2WAXA 2I8AA 2WOJA 3EAFA 3DLPX 3ANSA 3HVHA 3FTNA 5DGHA 4A26A 4ZARA 4ALKA 4Q82A 4RTNA 1E7SA 2E4AA 3GGOA 4YCDA 4ME6A 2OORA 1SRRA 2QX6A 5REQA 5IDXA 3OOSA 1U63A 1O7JA 3FPFA 3SIRA 3WBJA 3C6QA 1GKUB 1OYVA 2J0UB 3O82A 5DLPA 2GUGA 3UO8B 5IT0A 1PS8A 4HH0A 5TX7A 1TUIA 4CT0A 4KR0A 4BFTA 2XSZA 2PUAA 2PWZA 5A6SB 4ZD6A 1HMPA 2NT4A 2QMUA 4AG3A 3P0IA 1XD9A 3EVGA 4MHTA 1E7YA 3CW2A 4D8UA 3Q9SA 2J9YB 1A8IA 3GPLA 2J6BA 2J08A 2VPYA 1UBSB 3SHQA 3WQQA 4CLHA 1JJBA 4MPDA 5MHTA 2B6NA 3DKIA 3RVQA 4C4PA 2PZEA 2Q5LA 3QLVA 1O1YA 1TD9A 4RDCA 5DMXA 1JQ5A 1V1MB 1RCTE 1CZUA 2APJA 4WZBA 3ZV7A 4EELA 1C9NA 3RG8A 2GVNA 5C7LO 4XD2A 3BICA 3GDOA 3AT1A 4H08A 4U0JA 1YMVA 3HDJA 1GNSA 1ZEMA 2DFTA 1YR1A 2BUBA 2QN7A 4B79A 1Y3AA 1PVDA 1OJ7A 3P9ZA 4QRDA 1EX7A 1DTEA 5CYPA 3WL7A 3COPA 4LTDA 1SR8A 4QQ8A 5G3YA 3W78A 2WZBA 2R1UA 2J9XB 2CVHA 3NHWA 2DT8A 1R0CA 2DCUA 4P83A 4TV8F 4BS9A 5IKMA 3E3MA 3CR7A 4GGMX 4MRVA 4RH3A 1BA2A 3R0IA 1WB4A 1TUBA 1UIRA 1TCBA 2ADMA 1PK9A 1UK7A 2FJUA 3OE4A 4K9KA 4RPJA 4ZDKA 3QJ5A 3CR8A 1I33A 2GF9A 3EPPA 3TQSA 5KBYA 1DO0A 1JIVA 1NR1A 3VZBA 3HJRA 2LXNA 3ZLUA 1RI3A 3LUHA 3MG9A 2Y0DA 5K6AA 1VZ3A 2XDYA 3HN6A 4JIGA 4B17A 4X97A 3ZK7A 1G3MA 1N2IA 3H5IA 1I2MA 1DG3A 2BGJA 4JP8A 4KGVA 3W1EA 1GJRA 1SURA 3GRAA 1S02A 1UBJS 3L1VA 4FCVA 3S27A 1AS2A 1MABA 1Z5OA 4ZYYA 3FBWA 5KX5F 1GM5A 3GC6A 4FVTA 1QTIA 1YVDA 3F3YA 3C3EA 5A9SA 1DT5A 2OGZA 3OKFA 1U0SY 4QHTA 1YDEA 1QZUA 3U5ZB 3TWOA 3H83A 4K3UA 1Z5ZA 2JGEA 2G9RA 3NX4A 1IZ7A 5C7IO 2OV6A 1T4DA 3IEKA 1UBMS 5BUZA 5AW7A 1SPXA 4QU9A 3VYVA 4CCYA 5A62A 4RV9A 1W4RA 1AA6A 3WB9A 3UAGA 2ONKA 4DT1B 1UEXC 4YUVA 1WEKA 3JPWA 1F3OA 2WSSD 3ZXSA 5HHTA 2NZ2A 4FXPA 3PDHA 1L4EA 4BFWA 1WETA 2QPOA 5G4KB 1LU9A 4PLZA 3EUFA 4MDEA 2WG1A 2RH5A 3PXXA 1CG6A 2QKYA 4UUAA 4I5DA 3ADBA 3FOCA 4ZOAA 1DXHA 3E18A 4H60A 3GX1A 2X9NA 3C0KA 1KF0A 4IQ8A 3AL2A 2GD1O 1NYRA 4KWTA 5KOHA 5AUOB 3JQ9A 2VXCA 1UJ2A 1L8LA 4OXQA 4XUCA 1VB5A 3Q3CA 5FEUA 4F6CA 4HJXA 1T0BA 1QUEA 4WN3A 3ZX4A 4YDQA 5JD3A 5I48A 5JAHA 2JCBA 1Z6YA 4L3WA 4U0KA 1NRIA 1Y3CE 1NVGA 3PWZA 3RQSA 3U26A 1L4YA 1XVTA 2X13A 1J7JA 1XHLA 1EFCA 2WMYA 4FSHA 4CNQA 4RADA 3OZSA 5JECA 2ORIA 4PS1A 2RI1A 1KRWA 4MV3A 4EO7A 5JXIA 5HNKA 3W6ZA 1OB5A 2PNJA 1PFWA 1N25A 1T5DX 2FE4A 4UNQA 4YJHA 5ALZA 4CE6A 1ENPA 3HGTA 4PXYA 4UBNA 3BQNB 1U0EA 4UM9D 5HCUA 3D81A 2ZQYA 3RT9A 5I7VA 4QGAA 5HRCA 2HI0A 5J2TA 4EMUA 1NQTA 3TZHA 1JILA 3C87A 2GT1A 3NATA 3EY9A 1VG1A 3LRTA 1PR0A 4YEDA 3ELWA 5FWXA 1P72A 2IK8A 3ZY5A 3EZ7A 4TWRA 1MO5A 1K6IA 3VNQA 3U16A 1AV6A 1E79A 1D4ZA 1TJ5A 3CLSC 3RU2A 5FR2A 4O29A 3W5UA 1K3TA 1CPYA 3H6KA 4Q3AA 3TQOA 2ODWA 1YBHA 3JAWB 3ZU2A 5BSFA 3HGQA 1SXHA 1NYTA 3AYZB 5BN5A 1TA0A 2QVYX 2QVBA 2PZJA 4NNOA 3EWSA 1RNLA 2VUTA 2WJJA 4J3FA 5ALJA 4HNAA 2OC4A 1F6DA 2IEAA 5IBCA 3AETA 1QQ6A 4G5QA 2FRXA 2P41A 2B4TO 1NJ2A 1CRZA 4AN1A 1JWAB 3A9SA 1QIMA 4FZVA 4LKRA 5AH0A 3DVAA 5EJMA 5F5NA 1HETA 3KYBA 3OZWA 1AV7A 5CD1A 4GECA 2HWWA 1YE3A 5JRJA 1EWTA 4MWTA 3K0CC 1KIFA 2VS1A 4RVGA 4NAVA 1EP2B 2AMVA 3WL5A 3OQMA 3FUWA 3ZWCA 3BD8A 1DBWA 1CIPA 1KI8A 3VGPA 3DE1X 4BVBA 3B9RA 3LI2A 1ESMA 2EIHA 1J25A 3IAXA 3HLYA 3MGBA 5AIAA 2QTNA 3PPIA 4BKUA 1DOHA 1RWVA 1R6DA 2Q7DA 4QICA 1V9SA 4EUKA 4AKIA 4A0QA 3Q0IA 5LYYA 2R87A 1CFJA 2VJMA 4TRNA 4CCAA 2QROA 4XE5A 2VNHA 2AQHA 1P33A 4G63A 5FTMA 1FW8A 2AEMA 3LQKA 3ROXA 5KPDA 2F55A 3DUFA 4ND8B 1OHHD 4YCNA 2Z8YM 2UUCB 4N0EA 4X1IA 1GRQA 5EXSA 1Z6AA 3AEUA 3B2NA 5IC6A 3L49A 5HQ3A 3AGQA 5LBUA 2ODPA 3MWJA 2PN1A 3C8UA 4DR2B 3H87A 2MMCA 3C8ZA 3TR0A 2A59A 4FCWA 5BRNA 2DFNA 3UJCA 4D3XA 2WIBA 2NP6A 5I8PA 1LXCA 1EK2A 2G83A 1E2BA 5FOTA 1Q74A 2D1FA 5ALNA 4BP9A 2YV1A 5TB5A 4FFRA 1MN6A 4RNCA 1ECGA 5BN1A 2ZSDA 2HUNA 3SR4A 4BBPA 4QPNA 3GBVA 5DM2A 1VG9B 4XJSA 3ZV5A 2Q1XA 3JARB 5A71A 5FD8A 5BWBA 5CDUA 4O4LA 3LDHA 5K5EA 1LX6A 2VUSA 3EMDA 1F2DA 3M5CA 4CTOA 4DR6B 3OWHA 4M1KA 3MSCA 2P3LA 1N1MA 4DNPA 1KIAA 1S8OA 4IDAA 3ZTWA 1M2GA 2PUVA 3WKAA 2WVGA 1E8DA 2GBPA 3E0XA 4X66B 2QYHA 1QGDA 4GSLA 1LDNA 2IVFA 4JGGA 3J80A 4YI3A 2OV1A 3RVRA 1P74A 3TNFA 4MWOA 2A1UB 1G3IA 4R2KA 3REOA 3BREA 1VA4A 1K7FB 3DH0A 4CN9A 4FB4A 7ABPA 2MSLA 4HB0A 4A2WA 2FPOA 4XGQA 1XCBA 3VHXB 1S2GA 4YMSA 4G0VA 1V4BA 4N6NA 4Y0AA 5F35A 3EC7A 4KO3S 1M1ZA 2CLHB 4I4LA 5E8JA 4DA7A 3P9PA 2CLLB 2VK1A 2QUHA 3D3NA 3R6LA 5H16A 4P9NA 1KI2A 5HBRA 1J07A 3O1LA 3WXBA 1FP1D 2IHUA 4BFZA 2II6A 2DTDA 1JVNA 1CQJA 2NO7A 1UMBA 2X7JA 1XZFA 5LOVF 4MXDA 1M5UA 4PCUA 1J2TA 1GNPA 4JYZA 4ZCTA 5HOEA 3SSAA 3HJGA 4JL8A 4JEHA 4H77A 2CXPA 2HSZA 4N3AA 4IBOA 2GN1A 4GVLA 2UYYA 3PXCX 1OXVA 4E03A 4DJDC 3W5IA 3OZAA 1QIHA 1HE5A 4JXKA 4DXDA 2VJYA 3HA5A 4L3VA 3SBOA 4LRQA 4RTJA 2ONCA 1LNSA 2MWMA 1XVLA 5DX1A 1JG7A 1QR6A 1H93A 1ZZEA 2GCOB 3AV3A 4P7JA 4PZUA 5JLJA 4HLUA 4LXYA 1P9RA 3GEDA 5C5IA 2DY0A 3JARA 2IV7A 2DWUA 2QAGB 5ALWA 5H8WA 2QMYA 2LPMA 1P75A 1ZXLA 4LE1A 4RKYA 5IT4A 2ZUVA 3P20A 3GLFA 2B1JA 1RPZA 3KKPA 4PVDA 1L4LA 2G80A 1J2RA 2NMVA 3C6XA 2AGVA 5AJVB 4E5NA 2EBWA 5GJCA 3H8JA 4M7RA 3RR2A 2GB4A 3AVUA 1YSCA 1WZEA 3CPSA 1L8QA 1ZRHA 2QRVA 4XM2A 1E6UA 4AZWA 1DDGA 1E89A 2QF7A 4BGUA 4BRUA 1Y33E 1NXQA 2PKXA 3AIKA 4CM9D 3WQBA 4B48A 2VEOA 3LUFA 3SQLA 1R12A 1HTTA 4BQFA 4I1RA 2IUTA 3I72A 4Q3CA 1Z4PX 2NU6B 4RHYA 2VP9A 5DTRA 1RJ9A 1CS0B 4Q9LA 2X4LA 3AESB 5MN6A 5PGMA 4G1CA 3CGWA 4HWOA 4UEKA 4POOA 2JVIA 1B0ZA 2HQBA 2P9FA 2QX8A 2OK8A 5J4LA 2WIDA 2BZSA 2DQZA 3NOVA 5F2OA 5AVKA 3RIGA 2AC7A 1RHKA 5IF9A 1A9XB 1D4FA 2ANBA 3A25A 5IM4F 3K0FB 1V5WA 2WICA 4U6QA 4J7UA 4OP3A 2IUEA 2YYYA 3VH2A 1LBEA 1FX1A 2BHRA 4G1EB 4N8EA 1GY8A 3RUPA 1QFJA 4D43A 3AHGA 1M83A 3HC7A 3OCXA 3UAVA 4A7PA 5IXSA 1SA0B 4WWHA 1BU5A 1R9MA 3AR7A 5L6LB 1QKIA 3GUZA 1ZC4A 2IX9A 3T9FA 1FU7A 3LFUA 3H9BA 4RWEA