4HGOA

2-keto-3-deoxy-d-glycero-d-galactonononate-9-phosphate phosphohydrolase from bacteroides thetaiotaomicron in complex with transition state mimic
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
163
structure length
163
Chain Sequence
MKEIKLILTDIDGVWTDGGMFYDQTGNEWKKFNTSDSAGIFWAHNKGIPVGILTGEKTEIVRRRAEKLKVDYLFQGVVDKLSAAEELCNELGINLEQVAYIGDDLNDAKLLKRVGIAGVPASAPFYIRRLSTIFLEKRGGEGVFREFVEKVLGINLEDFIAVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for the Divergence of Substrate Specificity and Biological Function within HAD Phosphatases in Lipopolysaccharide and Sialic Acid Biosynthesis.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Transferase, hydrolase
molecule keywords acylneuraminate cytidylyltransferase
total genus 51
structure length 163
sequence length 163
chains with identical sequence B, C, D
ec nomenclature ec 3.1.3.103: 3-deoxy-D-glycero-D-galacto-nonulopyranosonate 9-phosphatase.
pdb deposition date 2012-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08282 Hydrolase_3 haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4hgoA00
1RKUA 4GXTA 4YIKA 2OA0A 4ZEVA 4CF3A 1RQNA 1NNLA 1YDFA 2G0AA 4XOUA 3AR5A 1Z4JA 3KC2A 2WM8A 3ET4A 2G06A 2MU1A 1ZS9A 2W4MA 1TJ5A 1CR6A 3WKBA 3N07A 3WKDA 3M9LA 2JARA 4Y2RA 5A3SA 3WGUA 3OCYA 2D2VA 4UAUA 5AI5A 3QU5A 2MSNA 1WR8A 3DNPA 3DV9A 1YMQA 5AKYA 1J8DA 2R8ZA 4F71A 3NANA 3WKAA 2BDEA 3L0YA 3FPSA 3F9RA 1XVIA 3SMVA 3WK4A 3L1VA 3W5BA 2I54A 2W43A 1WPGA 3GYGA 1ZD4A 2B1QA 4Y2YA 2HSZA 3R4CA 5AW3A 3SHQA 3RFUA 1U02A 3AR2A 4Y2QA 2P27A 5AM4A 3L1UA 4NAVA 1RRCA 4GIBA 4UARA 3E84A 4UU0A 1VJRA 3ONNA 2FI1A 3MPOA 4I9FA 5AM1A 4XQ0A 5FP0A 3ZUPA 1TJ4A 4RESA 2O2XA 1Z4OA 2NO5A 3N8GA 2YBDA 3EF0A 5ALHA 3ZW7A 2R8XA 2PQ0A 1U2TA 5AVQA 1X42A 4MWOA 4J2TA 4KX3A 4UM7A 5ALVA 5AHXA 4BX0A 4YCLA 3PCTA 1ZRMA 2HO4A 5AI6A 3U26A 3EPRA 3KOOA 2Q4TA 2WF8A 3KDPA 4BEVA 1O08A 5ALMA 3NRJA 3QNMA 2I34A 4HGQA 5AI8A 3AR8A 3IRUA 3SF0A 4CNQA 3ZX4A 4KNWA 4HGPA 2G07A 3QU9A 5AVWA 3L0BA 1TA0A 4EEKA 1FEZA 2VKQA 3KZXA 3SKXA 1Z5GA 5AICA 5A3QA 5ALPA 3U13A 4OCZA 5ALFA 3IB6A 5ALRA 4MUMA 5ALWA 2HOQA 3EF1A 3RF6A 5AW2A 1ZD5A 2AUTA 2FUCA 4Y2UA 3R9KA 3WGVA 3B9BA 4Y2TA 5T41A 2C8KA 2YJ6A 3OTQA 2FUEA 1RLOA 5AW5A 4BX2A 4BBJA 1T5TA 5AVVA 4UMVA 3QU4A 3ZI4A 2YJ5A 4CF5A 5AIBA 3OPXA 2EATA 3DAOA 1O03A 3PGLA 4YCNA 2EAUA 4G63A 1RMYA 1Z4IA 2DQSA 3CZ4A 4L57A 4IG4A 3W5CA 4BKMA 3ESRA 5AKIA 3ZVMA 3WKCA 4OD0A 1Z4NA 2RB5A 4YH1A 5AK5A 2FPXA 1YNSA 1PW5A 1RQLA 3SD7A 5AK6A 2P11A 4UW9A 3QU2A 5ALOA 5AW7A 3OCUA 1QH9A 4Y2XA 5ALJA 4HGNA 5ALYA 5AI9A 2C88A 4BEWA 4KYTA 4PNHA 3PGVA 2G80A 1J97A 4EZEA 3HYCA 1N8NA 1WVIA 1Y8AA 3NIWA 2NO4A 5ALDA 3I76A 2HF2A 1U7OA 1F5SA 2I33A 3NUQA 4HAIA 3ZX5A 3W5DA 2B30A 1QQ5A 2G09A 1YJ5A 1QYIA 2B8JA 3UMBA 5AM3A 5AKKA 3WK9A 3SLRA 1S8OA 3J7TA 4UAVA 5AW4A 4EENA 2ZBEA 5ALIA 4Y2JA 1EK2A 2HEGA 5ALEA 3L5KA 2FPSA 4AS3A 1EK1A 5ALTA 4BNDB 5AI0A 5ALQA 1WZCA 4XPZA 4YGYA 2ZBGA 4G9BA 1YV9A 4C4TA 3AR6A 2JAOA 2NYVA 2R8YA 5AW0A 1QQ6A 4F72A 2OYCA 2I6XA 2JAWA 2YFYA 1NF2A 4C4SA 1Z88A 2JAUA 3ZTWA 2CFSA 3ESQA 2C9MA 3E8MA 4HGOA 4XE5A 3N1UA 1Z4LA 2Q4RA 1L7OA 3AR3A 3WK7A 2RBKA 3ZWKA 2RAVA 2YMPA 4HYTA 3N28A 2Q5EA 2X4DA 5JJBA 2WF5A 4UMFA 4UM5A 3L7YA 5AKGA 5AM5A 5ALZA 5IT4A 1YS9A 4NWIA 1RKQA 3U7EB 1U7PA 5AI4A 5AVUA 4YIHA 2FPRA 4B6JA 1ZD2P 2HHLA 5ALGA 3UM9A 3OCVA 4EX6A 2GMWA 4DCCA 4IFTA 3NASA 5A3RA 3K1ZA 4C4RA 3SKYA 3BA6A 2BDUA 5AVRA 1RLTA 4OFZA 3QLEA 3ZVNA 2HX1A 3QYPA 1AQ6A 2ZBFA 2GO7A 2HI0A 3UMCA 3U7HB 1NRWA 4BNDA 4BX3A 1VFPA 4CF4A 1ZJJA 3MN1A 3I1YA 4AS2A 2FDRA 3UMGA 5AVXA 3OCXA 2IYEA 4I9GA 4FFDA 1KYTA 1T5SA 1RKVA 2QYHA 2P69A 3KBBA 1Z5UA 4UMEA 5ALKA 1LTQA 2CFRA 4O8CA 5AVTA 2B0CA 3U7FB 5AKZA 4QQFA 1K1EA 4Y2PA 1RC8A 3MMZA 2IOFA 2PKEA 2B1RA 1IWOA 1Q92A 4AP9A 5AK4A 4KNVA 3QXGA 2QLTA 1SWVA 2OM6A 3QUBA 2YY6A 1L8OA 2WFAA 2G1AA 2R8EA 3OCWA 5AW8A 1Z4QA 2ZXEA 5ALLA 3I28A 1ZRNA 2PR7A 4ZEXA 5AESA 1RLMA 4L6AA 3WK5A 2WF7A 1RDFA 2B82A 4UMDA 3FGOA 2YMMA 2CFTA 3L8EA 4HGRA 4KX5A 4DWOA 2ZG6A 3FVVA 2AH5A 2ODAA 3AR7A 4JB3A 4JDPA 5AM0A 4EELA 5IT0A 3ED5A 2I7DA 2IA5A 3QU7A 3PDWA 3OCZA 3ZVLA 4EX7A 3N5KA 1Z4PX 1SU4A 3I6BA 3A1EA 2WHEA 1L8LA 3MC1A 2FPUA 3W5AA 1L7MA 2G08A 3KD3A 3S6JA 2YJ4A 5ALUA 3NAMA 3QGMA 3P96A 4KN8A 1RMTA 4NV0A 4NABA 3WK8A 2OBBA 4FYPA 2GFHA 2JGAA 3DDHA 2RARA 4ZEWA 5AM2A 4Y2SA 2HF7A 2ZOSA 3B9RA 3QX7A 4BYGA 2WF6A 1JUDA 1RMQA 2BY4A 2AGVA 5ALXA 3EWIA 1Q91A 2FPWA 3IJ5A 3L0CA 5AW6A 4E88A 5AVSA 3AR9A 3A1DA 3QUCA 2YJ3A 2GHTA 2IOFK 4CE6A 5AKLA 5AKJA 4NFLA 5AKHA 1QQ7A 4Y3UA 3E58A 3FZQA 1L7PA 2HDOA 3FM9A 3L8FA 4DW8A 4J03A 5AVYA 3TLMA 2AMYA 3L8GA 3WKEA 1L6RA 1Z4MA 5AKXA 1T9ZA 5IS2A 3WK6A 1XPJA 2YMQA 3ET5A 3ZWDA 4H1WA 5AK3A 4Y2VA 1U2SA 3AR4A 1SWWA 4OHFA 5AVZA 3HLTA 1XP5A 5ALNA 5AIAA 4QJBA 1Z4KA 5AW9A 3QUQA 1TJ3A 1TE2A 4DFDA 3U7GA 2P9JA 3QUTA 3FPBA 2EARA 4UATA 1LVHA 2W11A 2B8EA 2YMLA 3A3YA 2HCFA 4UU1A 4UASA 1ZD3A 3A1CA 3NALA 1L7NA 3ZTYA 3ZU6A 2I55A 3E81A 2YN4A 1S2OA 2O9JA 3CNHA 4RETA 4YCMA 4FE3A 5AKEA 3L8HA 4L6CA 1CQZA 3D6JA 2C8LA 2FEAA 2IOHA 3VAYA 2CN1A 3U19A 2GHQA 1ZOLA 3B8EA 1VJ5A 2C4NA 2ZBDA 3BWVA 2WF9A 5ALSA 3M1YA 5E0OA 5AW1A 3R09A 1RPZA 1MH9A 1N9KA
chains in the Genus database with same CATH superfamily
4BKQA 4DMUB 1FS4A 2IU6A 2QZ9A 4MROA 2CL6X 3G79A 1QUEA 2W2OA 3D3EA 4HYYA 3RUPA 4YJHA 4B7XA 1R5OA 4H7DA 4YPFA 1JAHA 3T7SA 3X1XA 4Z4FA 5G3YA 2H4YA 3CX3A 4X65B 2IYLD 2F64A 2G6BA 2ROQA 3AY7A 3EB9A 4I5EA 2HNAA 2OMEA 1E3JA 4UE6A 2I65A 1PUIA 4URVR 1ZWKA 3B1XA 5ICSA 5E2BA 1EG2A 4MUKA 2LBPA 4UZFA 4JS0A 3USES 1PGJA 2BFEA 3RNLA 2C7PA 1CS0B 5D51S 1NP7A 4RY0A 5KYXA 2YXNA 3T7TA 3S8YA 1WB6A 1XD2A 1FXWA 5AP9A 2AZDA 1E6UA 4LYGA 1NKSA 3TL6A 1N57A 1TXGA 3JV7A 4LDQA 2R8ZA 3MNFA 3RS9A 4W5NA 2J32A 5E9QA 3PDIB 1X94A 3DDZX 1O58A 3BWCA 3L0YA 1E1QA 4ZQCB 3WNCA 3WYCA 4DMLA 2VOJA 4FZVA 3RIGA 1WETA 3WK4A 3FBWA 3LHDA 3F2IA 2D00A 1UZUA 2ZR8A 3H2YA 1SOUA 4TLCA 5IEBA 5TSDA 4CUZA 2B7CA 2XODA 4ZK2A 1AGRA 2WJVA 4UHFA 1R0CA 1IY1A 5BSFA 4NNPA 4BGDA 5CVEA 3RQIA 1VCIA 3C6KA 1R15A 1W9HA 1SURA 2B5OA 2GZHA 4L74A 2G5TA 4TZ0A 3BF8A 3UJ7A 4BVFA 4YV1A 1SC1A 4OGGA 1C3VA 1JHQA 2VKTA 5EAIA 5G1PA 3FPCA 1FNNA 1U0EA 2ZRKA 3JQPA 1QRDA 2FEPA 3W9YA 1NUPA 4G37A 4H3SA 2BEWA 2W6ID 3H9GA 4P7KA 4UU0A 1HWYA 4MOWA 5KQLA 4RMIA 1YR8A 1K7FB 2N1MA 3IKJA 4R2LA 2UYCA 1CP3A 5IF9A 3MEQA 1J9GA 1IBMB 3ITKA 2ZCJA 2ETVA 1TQ8A 2BM9A 2IXBA 5E4JA 1SD2A 2YHAA 5FP0A 3RC3A 5KSYA 2D1QA 2FFBA 4RESA 1C9NA 2VG8A 3RJMA 3WIDA 4F6CA 5MGNA 3OQNA 2VOEA 4HVTA 3GFOA 3ZW7A 2RGBA 4XQEA 1W94A 1VKZA 2XLBA 2QUIA 4MW0A 4IV5A 3ZCXA 1KWGA 1CUIA 3LJKA 5DM4A 2ZIGA 1RRPA 4KIUA 3CNNA 3ETGA 3GFGA 3KVOA 2QX6A 4NVRA 4RZQA 2NTYC 4QM6A 1X0XA 3E9EA 3N5CA 4F3CA 4EB0A 4ONEA 5CMLA 1E3EA 1F12A 4AKTA 3K2EA 1T9GS 3E22A 3TBFA 1K06A 3ZS9A 3OVMA 1ZGJA 2ORED 5B1EA 1MO2A 4HYEA 4H1VA 4F4HA 2CNWA 3DKKA 2ZPTX 3GN1A 3ND9A 3NR2A 4JY7A 4ZEOA 4G5OA 4Y6SA 3SGLA 4JI5B 4QDXA 1E6WA 5KX5A 1KR2A 2D5CA 4KI7A 1QXSA 4ZRDA 4EJMA 5M34A 1L5KA 1T1RA 2ILTA 4G1MB 2AJTA 4DZRA 2JVKA 5EIFA 4R8RA 3R9WA 3E0XA 3PTLA 1TD1A 3GUHA 4RFLA 4V38A 5GGYA 3AIIA 5A5EA 3LC1O 4EHIA 3UXHA 3T61A 1FNMA 1XCJA 1T2UA 2OO7A 4ZZ2A 4ZVQA 3GP5A 3ANNA 3WWZA 1AE1A 1YCHA 2CYBA 5BR7A 2DKNA 3DXYA 4JLNA 4RSGA 3RV4A 2QVBA 4KN9S 3H04A 1BA2A 2A9PA 1E9RA 1DC5A 4TS9A 4WIAA 4EI8A 3GGPA 5JRDS 4CI0B 2QV7A 3TK1A 1Y3FE 2Z8ZA 5BXQC 2ERCA 3EVFA 4IR7A 1N5JA 2PKWA 4MPDA 2JHPA 8ADHA 2QSYA 2PBFA 4FD3A 3V7FA 1Q1GA 4A9AA 4OREX 2A58A 2PPVA 4QJ4A 5D8DA 3NM5A 4P58A 4DMCA 2H1HA 2OGSA 4AM8A 5DNVA 3IYLW 3EZ9A 5JNUA 5KHOC 4YCNA 1ZH4A 1PFUA 2RHRA 1DOAA 2QTVA 3O73A 3QX8A 5JYBA 5BQ3A 3R24A 5IW8A 4TZKA 1Z0KA 2J4CA 1MB9A 2NUPB 2WJWA 3EGVA 3PICA 5ITZA 2Q5OA 1VMKA 4GZ6A 2A4KA 5BW6B 1P60A 3ZD8A 3LBNA 3ADPA 4M1YA 4BP3A 3HO8A 4DLVA 2VNKA 4US2R 2GASA 3KKLA 2FPXA 4CM3A 5BV2P 3G9QA 2Q7OE 1UQUA 2KWIA 3H5TA 1DARA 1ZVQA 5KAPA 1B6GA 3ZCRA 1UWVA 2KB0A 1ZYUA 3OIGA 2X2PA 1ACLA 1HV8A 1KZ6A 4MVJI 1YASA 2PUTA 4L73A 4YT5A 1IHOA 2XA9A 4AYWA 5A4JA 3KZMA 4HEHA 5HCIA 4AG6A 1HE2A 3UJBA 2PD3A 3VX4A 1TKAA 4TXJA 1V6AA 3U3MA 4GZ5A 4OQFA 4IZIA 4PLWA 3CURA 5BOVA 1P4HA 1NIJA 1RRMA 2QWXA 3L7OA 1H42A 1LU9A 4OGKA 3GNLA 3H17A 3R3JA 1K92A 3WWYA 4D9FA 1E4EB 4J1TC 3QPWA 3RIYA 4I2VA 3TIVA 4GDMA 1ZJ6A 2VK2A 1DRUA 1E2LA 1Q1NA 2QMEA 2XEDA 3FR8A 1KVQA 1II9A 2IJGX 3IOBA 3JD0A 1ZO8A 3L6UA 5BSHA 5KTTA 2GNPA 2H54A 2DR0A 1IBLB 1QZ3A 3OPQA 1V37A 4PLVA 3DCNA 5F1YA 3WSWA 2WVAA 4DC9A 5IBCA 4H6PA 1C3XA 5AXAA 3C3PA 5DTJA 2B6NA 2RH4A 2QAIA 5FPPA 1BEZA 1KI6A 3L8ZA 1DFIA 3DWGA 4X7MA 3LI2A 2EVWX 3GLRA 3GZJA 5FPYA 4H59A 4JVMA 4W8HA 6ADHA 1I8TA 4ALJA 4I9UA 4D4GA 4J3JA 1O87A 4ITVA 4MMYB 4YLEA 4JQZA 2X8BA 3NBFA 3GJTA 4LY3A 2RONA 1SHTX 1S4MA 1WMDA 4XI9A 2FPSA 3G59A 4OLHA 4DV5B 1EK1A 3CRMA 4XDGA 3F8SA 2I1LA 3BCUA 3C6XA 4KV9A 2WE7A 3U17A 3ERCA 1FFBA 4GM0A 4XM1A 1QGAA 3P9CA 4XPZA 5EMJA 4DJTA 1ZOPA 1NMEA 1BU8A 1S0UA 3F46A 1HFEL 2J3KA 6NULA 4OH7A 3D2AA 5AHRA 3QE0A 3UXMA 1UBUS 2XUHA 2BR3A 2LCFA 2ZKLA 2ZDQA 1MN6A 1QQ6A 3Q2IA 4JQCA 3RV3A 2XPCA 4G2TA 4HSEA 3D3WB 4HVAA 2ZCVA 4Q05A 4HVLA 3HXMA 2QS9A 4RD2A 2NTNA 2I6XA 2V98A 4LS3A 4QUKA 2FPIA 1NF2A 1DZIA 3IR5A 3Q12A 4Z0TA 2X9NA 5HBRA 3VBEA 3HJNA 3X1YA 4OSPA 3P52A 3TUJC 3CZMA 4C7KA 3FSJX 4I36A 1Z22A 4JU9A 4TWJA 4E09A 3RU3A 5I4BA 2HU7A 2FOXA 1SAYA 2PXHA 2GZAA 3BL6A 1Z4LA 4NFYA 4RV5A 4UBKA 3Q4GA 4W1SA 3EUWA 3VPBA 5E9WA 1UBNA 4HEA1 1JB1A 1XRLA 2WJ3A 3RVBA 1R1DA 4P38A 1IXZA 2N47A 2AN3A 5GJCA 1Z2DA 4ENVA 2Q5EA 3MMSA 3NHSA 4CFZA 2RI6A 1C7FA 3KLOA 5CDTA 1P2FA 2OB1A 2WZDA 1LCIA 2BWJA 4PHHA 1FYWA 2OOSA 3OPYI 1N7HA 3TBHA 1RKQA 3IJEB 2H2WA 3RDPA 5HFNA 2PWZA 4G3XA 5K4AA 3WV4A 5MF6A 3R0ZA 2NUAB 1I9CA 2ZYWX 4BWGA 4CQNA 1Z63A 2JIOA 3MAGA 3VYSB 1QOPB 1KEUA 1DT3A 1YS4A 1KJ9A 4B6JA 1BQEA 1J9ZA 5FCDA 4DBVO 1I4OA 3GGJA 3ADDA 3BDVA 3VH3A 4ZHQF 3F98A 1F51E 4CQMA 4NZNA 4DCCA 3GLHE 4TSRA 2C04A 4NH4A 3O90A 2I3BA 4KPUB 3QBVA 3DHEA 1AUQA 2WD7A 2Z2XA 3R7LA 1AKTA 3UUFA 1BJTA 5JAMA 1Z83A 3ZDCA 3BC1A 4Q0MA 3NGXA 3MIZA 4BO1A 5K1ZA 1CJVC 3ZWPA 3AB7A 3H11B 4J3FA 3ZGNA 4OBEA 4YO7A 1IU9A 1XYVA 1J0BA 1G8PA 3HKCB 3GWZA 4WZBA 4JB2A 3ZKWA 4HWKA 4CM8B 5ECYA 2FWIA 3E1GA 2E21A 1J99A 4MR8A 3KYIB 3OOJA 3RBZA 4X64B 1IAVA 2VYNA 4KMOA 4ZPJA 1SRQA 1NVUQ 1PTJC 3I8SA 4ZVSA 2FF7A 3N0RA 3OFNA 5MN4A 2H16A 1W4LA 2ZTUA 4K3VA 3W6ZA 3DBLA 4BLVA 3I6MA 4OLAA 2EHDA 1QX4A 3PWTA 4TRRA 1K4KA 5IJZA 3SVZA 4RF3A 5EQTA 5JNSA 4IDQA 3JZAA 4KQ2A 2BGKA 1WMSA 3R6DA 1NW3A 4ZU1X 4DRZA 1VMEA 2O19A 2AOUB 2ZRGA 5LIRA 3ZI0A 4UM8B 1FTYA 4E5SA 3FF1A 3RADC 3CF6R 5KKNB 4Q66C 4ZXFA 4FCCA 1TZJA 3MMZA 1E92A 1YQQA 2V65A 1IHXA 1PX0A 4YDHB 3UUGA 1XMIA 5EHZA 4E5DA 2XNDA 2IYVA 5LQKA 1Z8NA 3E6AA 3KKKA 5FBRB 1JH9A 3NLLA 4UU7A 2QDKA 2IIVA 3PNQA 3D5TA 4X20B 4MKIA 5CCEA 3IVRA 2VYVD 4OU4A 1YIAA 2DOKA 1H5UA 3PA8A 3TYXA 3DVSX 1Q16A 3CPEA 2CVPA 3JVDA 2VWQA 3H2IA 4L9SA 1DMRA 3LRXA 1O8CA 3IDZA 3QXSA 4P86A 2I6FA 2ZRBA 5AW8A 4ZYLA 3PNMA 3WP1B 3F96A 1YVRA 1S1MA 1JLLB 3IP1A 4H1HA 2G72A 5FB3A 1Z2AA 1Y37A 1PR9A 4JOBA 3A31A 4JP8A 3GFQA 4R2JA 1EQ2A 3MWKA 1A4XA 3QYJA 4MR7B 3DLBA 1B3RA 2CFTA 1A4RA 3I04A 1SA0B 1E3WB 4MVJG 4ND7A 2O2EA 2ORIA 4WJZA 3VDRA 2ZIFA 3EE6A 1E3TA 2QM8A 1EFCA 1A2QA 1QO9A 3IEXA 5GV8A 1B0AA 2JI6A 3GDWA 4OSOA 5ITWA 1W96A 4N54A 3T7DA 1J7JA 3W8NA 4AUEA 2VF2A 1A5AB 4AF8A 4P4SB 1OBOA 4Y1FA 3O7WA 3OSZA 1AS0A 3AETB 4QQKA 4GNKA 1ZR4A 3NBZC 1JU4A 3PF9A 2QE6A 3X1DA 2ODWA 2AD5A 2DUNA 1XU9A 1MAAA 3HJBA 1KH2A 3WNBA 4AZVA 4Y7CA 3G2OA 1L9XA 3EYWA 4K9SA 3MT7A 4KQFA 4FLMA 1SKUA 2JLSA 4JC5A 1CLEA 3ICOA 2P41A 4CODB 4OFBA 3ZEAA 3RARA 4JJGA 5I7UA 4JHLA 4OL0A 4NCXA 2Y67A 2ZSAA 4NJOA 2F1KA 3NH6A 1ZUNB 3BJZA 5C3UA 4Q82A 1IOZA 2A0WA 3JVEA 1V0JA 3IMCA 4RJKA 3IPAA 1QV7A 4KIWA 4M54A 5B3AA 3N8HA 1W4BA 5IM4F 1N5IA 5AM2A 5EA2A 3BA1A 2H5LA 4ZT3A 2QAGA 3W1EA 2EEZA 2BY4A 3NBMA 5K0NA 3MWDB 1SCAA 3G0HA 3EZXA 1QDEA 4EW6A 4PG7A 3L0CA 1XZEA 3AB3A 5I9IA 4XVHA 5FF9A 4E88A 3GMIA 4M9XA 3SX2A 5F23A 3DLPX 2PWAA 1UPBA 2DWQA 4QGBA 1AGXA 1XMJA 2C0CA 5EP1A 1ECCA 2R97A 5LD2C 3HB0A 3FR7A 2G7MC 4AWXA 5EJ7A 4E5PA 3C6QA 4RSRA 4IHQA 2FV8A 2HXSA 2MTBA 3I3OA 5EG5A 4MRVA 5KU1A 1QE0A 2F3TA 2PZLA 1R66A 2QEQA 4YXWD 2OV3A 4WK2B 2CMDA 2H7XA 1XEWX 2GPNA 5JAOA 1AT1A 5BQPA 4WNAA 3RTEA 2YWXA 4CYMA 3WK6A 5CFPA 3CXUA 1XPJA 1F4PA 3VR3D 4UDYX 1ABBA 4DB4A 1XZIA 4N40A 1NNUA 4PE5B 3R3HA 1RXIA 2NSDA 4LGCA 2PSSA 1U2SA 2QQ0A 2R6JA 3AR4A 3IB3A 2RGXA 3P4UA 3GH3A 3QKSA 521PA 4CZ2A 1CRQA 2V7VA 3RVNA 4I8DA 4U2BA 4FHDA 2ZUEA 2FR1A 1SUEA 4NQZA 3TOSA 4AJIA 4C43A 2C84A 5C1OA 2GZ3A 1D2AA 1TO1E 3N7UA 2DPHA 4UDOA 1NW9B 1TE2A 1J70A 3RWOA 3T8YA 4KU4A 5JSUA 3UG7A 4Z8XA 2AI2A 4CUJA 1L5HB 1RQXA 1H2ZA 1XXHE 2PMEA 4B6GA 1BMTA 1NQVA 1W48A 3DT9A 2YJTD 3OFND 4HR7A 4MKHA 2QIPA 3SJAA 1P4SA 3IEVA 2OHJA 3ZDYB 3ICWA 1LPNA 4LQCA 1B0UA 1S2OA 2O2IA 4BZZA 2PMCA 2ZYGA 2M9MA 2JLCA 3S7ZA 1AKEA 4YUWA 1J22A 2OESA 2XRFA 3NDJA 3D8NA 4I4TB 1YS6A 2NXWA 1G8MA 3CX7A 3WVNA 1IH8A 4J0IA 4RZXA 3FGPA 4V3CA 2BSQA 3RSLA 4HLCA 2WWWA 3NHUA 3GRFA 3UWMA 3A9SA 1HETA 4ZHQA 2XB6A 3M1YA 3ABIA 2AFIE 2ZT8A 2X8JB 3WISA 1UZNA 2FMFA 1Z7GA 1Z39A 4B6EA 3G8CA 2J45A 4FCVA 1XELA 3Q2OA 2GXSA 3TAUA 5CDSA 3EOBI 3EULA 4N65A 4F38A 2MSCB 4ZEVA 3CJRA 1PIWA 1RQNA 1FX0B 3OZCA 1WP4A 1JHPA 1UKCA 4WNCA 4CTOA 5JC1A 5LR6A 1WVGA 3O1JC 5D86A 1NPDA 3LO8A 2XHZA 4I46A 2V8BA 3IMGA 4EABA 1XOIA 2H4ZA 3DB1A 1CR6A 2N3ZA 3DM5A 4WESA 3IT0A 3N07A 5J2UB 3U7JA 2CKMA 2I78A 1Z35A 2IHKA 3M9LA 3PC4A 4UUMA 4B6RA 1W93A 3CVVA 4BQSA 5TB5A 4F6RB 1ZIPA 4ND6A 1RSZA 4HTAA 4X8MA 2D2VA 2VHWA 3OQVA 2Q62A 3E0QA 3HCPA 1X70A 2J59A 1ORRA 1TVMA 3FWYA 2RGGA 4TV8F 3GPDG 2IU0A 3U3ZA 5J43A 1OB2A 5CYPA 1QX3A 2AMJA 4EH1A 5IK2A 1A9PA 2FX3A 1QR2A 4E70A 2ACVA 3HWSA 2AG1A 3RHFA 1BXRA 4X41A 2A5LA 3IIMA 5FADA 3I12A 1NMSA 5G4KA 3V1KA 5F9FA 1R8XA 1ISJA 1UPXA 5EIHA 1ECGA 1GGJA 1ZQ9A 2BFFB 3SSOA 3CZCA 4MRPA 4JMLA 4YRRA 1HUQA 1W75A 5HR5A 3BB3A 2JS7A 5JISA 1ESCA 1Z5PA 4HO1X 2E55A 5HW0A 4IPTA 1HLGA 1R6BX 1MJFA 5AW3A 4AC9A 3T35A 4DLNA 3RH0A 4ETMA 2WWRA 2NT4A 3F5SA 1CNEA 1TUGA 3A6FA 1PR4A 3KQTA 3QA9A 2XUAA 2B2CA 4L02A 3I0MA 3RAGA 3TZEA 1B76A 1PQUA 3BAZA 3GCWA 1MEEA 3IVMA 3R0VA 1FRVA 3GLFE 2FUKA 3IILA 4BIMA 3VISA 4PBSA 2AUMA 3G5MA 3VJMA 3T3OA 1C8KA 2ODNA 1GFSA 2OBLA 1YRAA 2WJJA 3N0VA 1IHDA 1J09A 2HU5A 3ZK7A 2G1PA 2PIAA 4EF6A 3GJQA 3TQQA 1U2PA 4ALNA 2HUNA 3WC4A 1TJNA 3IUBA 4W8GA 4QNRA 2Q3EA 4C87A 3UQZA 1ZC4A 1TECE 3Q40A 3UJ6A 3MCVA 1E2EA 4MWOA 2R1VA 1LPSA 4JOSA 4MJLA 3GBPA 2GEBA 5EMHA 5B3JC 5CB6A 3KTAB 5AHXA 5KJ1A 4FBLA 3OF3A 2PXCA 2O0MA 2EZTA 4OJYA 1LPOA 3FJ1A 3PCTA 4LY9A 4DCNA 4BHTA 3D6MA 2XUKA 3GJ5A 3THXA 1BE6A 3FNQA 3TXYA 4R9NA 2D2IA 1UODA 3NC0C 2EWVA 1FFHA 4L9AA 2HTFA 4QODA 1L3IA 3RBXA 1GPMA 3IELA 1J8VA 3I6ZA 4LDJA 4TGLA 3KOWA 4CNQA 2FLWA 3SCZA 3IAFA 4H1UA 3VOTA 3ZX4A 1V5WA 1H94A 4XSGA 4S05A 1UBMS 2I4OA 4K28A 4LC9A 4NENA 2BGWA 3BRWA 4MQEA 2J3IA 4AZ3B 5CYFA 3H1AA 1GEGA 1ZGAA 2ZJ7A 1BOFA 3KLNA 1DQYA 1U28A 3SX4A 3WLPA 3RVPA 3RW9A 4DG5A 3DUFB 3EVCA 4XH9B 5F5XA 2FZ4A 5HTKA 2O5EA 1T3SA 5C32A 2EJBA 3C3XA 1X7GA 4LJ6A 3A4LA 3I04M 4FMCB 3K0SA 1JSCA 4NDNE 3Q3IA 4CLOB 2XVXA 5I3ZA 3TQFA 3P26A 2OLJA 1JHYA 1WDMA 2FZLA 1CF4A 1XA0A 3RM3A 2P2ZA 1NVKA 2P62A 1DQZA 1OX6A 4QOIA 4F11A 3W77A 4OQ4A 3DBRA 3SOPA 3ETDA 4DNXA 2YVLA 1UEIA 1V5IA 3GFVA 3SYLA 1P9NA 3LBYA 3VU9B 3WL4A 4TN5A 4ZZ1A 4L4SA 4WMLA 3THRA 4DQVA 2OBMA 5AVJA 1B8OA 2QRNA 2EAUA 1M1ZA 3ELUA 3QE2A 3RLIA 1H4QA 3V4SA 2PUGA 1KZHA 1JDJA 2GN6A 3KOUA 3DQPA 5JY1A 3H7IA 1Z4IA 4HUQB 4CNBA 1NDHA 4LJ4A 2Q3LA 4UVHA 3PT5A 1YZQA 2Z5VA 4AQ7A 1E2BA 1OD6A 1IJKA 5IANA 4JI0B 1ZSNA 3FOEC 2JCSA 5KVVA 1QP7A 3BRWD 1NDQA 1E7QA 1RJDA 2IY7A 2PMWB 3AJRA 2HY7A 1G3MA 2XNJA 1AHPA 5KX5F 2HDHA 4RJ2A 2CNDA 1OLXB 4HRVA 4BCCA 2DHDA 1FFXA 5G53C 2UUCB 1PEKE 3GZNA 2VP0A 2J7PD 2C31A 3BE5A 4J29A 1VLVA 3PXXA 1VECA 2WWFA 3WOVA 2VUHB 4AYTA 4OHBA 2AJBA 4JBGA 8LDHA 5FHRA 2I2XB 4BV8A 1PLLA 3ROQA 1XQ6A 2R6HA 2OD2A 2GRUA 3B9QA 3IFSA 5SV2A 3ZHSA 4CMAA 4D4JA 3BFJA 4RDXA 1XDZA 3HADA 4FFLA 5B1SA 5HQJA 4RF2A 3NAZA 1QHXA 2ZYAA 4A15A 1R37A 1T5OA 3FNIA 4HNUA 4X00A 1GITA 2QD4A 1NJFA 1ZM2A 4RYLA 3VVBA 3E15A 1QYCA 2WMNB 3NC4A 3UA3A 1IULA 5ESRA 5L4LA 1Q22A 2ZWAA 4OJQA 1I3MA 3DMPA 4BMPB 3CWQA 5JS2A 4N3GA 2PSHA 2M1XA 1JDNA 4WWHA 5DFAA 5K3OA 1II8B 4G81A 3LF2A 4UTXA 2WYIA 3TGWA 1PV4A 3C8DA 2BONA 4CT4B 2FF5A 5DM2A 5I4KA 4L4ZA 4NP6A 1C1XB 3HM9A 4KKVA 3ZN2A 3NHYA 1MU0A 1NXXA 2Z6VA 3DVAA 4IBOA 2ZBEA 5KEIA 4DUGA 3AVTA 1YGPA 2VHCA 2GNOA 3L5KA 2C2MA 5SYMA 4TTTS 3CF0A 4J07A 4IGFA 1EDDA 4NK4A 4QPCA 3HVKA 4OH1A 2H5JA 4BVJA 1T9CA 2ABWA 2OV4A 4LAFA 3M6XA 4Z51A 3RO7A 2NVUB 5GJWC 5IFKA 5JRJA 3C41J 4M1EA 4MGEA 2VT3A 3MTIA 5A6SA 4EKGA 5LQJA 2XKJE 3OJCA 2IHTA 3LUFA 1RXUA 1Z38A 3WLMA 2P35A 4F8EA 1JDSA 2IBSA 4K26A 2ODPA 1PK7A 4FOOA 4KQJA 5IC6A 5CXUA 2BFDB 2ZI6A 4LCJA 5CB4F 4KGDA 4JLBA 4W9MC 1E1RD 1U8XX 4Q24A 2QIOA 4RPCA 4I50B 3OZSA 3VYTB 4U7DA 1IQ0A 5AMXA 1U7DA 4NFHA 2V58A 3ZZNA 5K05A 4MINA 3UHPA 1TUBA 2GCEA 1J21A 1ESEA 2VVTA 1LXCA 2G88A 2GZ2A 3PS9A 1TTPB 1W0KD 4HFRA 2NUBA 2DMRA 4AJLA 1G2OA 3INGA 3BH0A 4QASA 3IHTA 3QFRA 4B4WA 2F8TA 4ZDKA 2RH9B 3PWZA 4MV6A 4OMCA 3VYWA 4IIYA 4B6QA 2ZYIA 2NSJA 1E0KA 4BNJA 2P6PA 1LBTA 3L7YA 3TW4A 1GPDG 3EEQA 3E7XA 4J0HA 1PUXA 4RNDB 5DBFA 2WLTA 4OXQA 3D7KA 4KOAA 5G02A 3SVTA 1ZR2A 3EFOA 2F43B 3IA2A 1GNVA 1X15A 4I0WB 3ZHVA 5I6DA 5BYKA 2OV2A 5K8VA 4V1CA 1F0KA 1UINA 4C07A 1QP4A 1TLTA 5C3MA 3MW8A 3AILA 2CLCX 3FNEA 2NU8A 4GS5A 4YEDA 3FLBA 4J91A 5FO1A 2HA6A 2ZITA 3MINA 4IFIA 4LUCA 2RE8A 1K9VF 5A5GA 1ZCFA 4KXUA 3BTUA 4RK1A 4O1HA 3WDKA 1BXGA 2GN8A 2JH9A 3LWDA 3VI3B 1TQ6A 2QN3A 4CDGA 2IYRA 5SZHB 4GLJA 4IYJA 2GOYA 3CNBA 1MF7A 4B71A 3V2IA 1EWTA 4ND2A 5JEDA 3KAPA 1VA5A 4L0QA 3UMCA 1ZK2A 2ECQA 3V97A 3CBQA 3LQKA 4EHDA 2ZRJA 4PRZA 2VLIA 4OP3A 4BNDA 3KVNA 4DTCA 3KWLA 3BH7A 4JYBA 1MQAA 2A6PA 2XLCA 3CF4A 2FZKA 1VHLA 1XRSB 2Q46A 1UPCA 2YR0A 4IO0A 5FI0B 3NJRA 3CTPA 4WINA 1NBAA 3MILA 4HRYA 2H07A 2JCVA 3KZKA 1Y80A 3OCXA 1U8ZA 4D9JA 3OOYA 5H4HA 5BMOA 3LUCA 5H3HA 4KPYA 1AKUA 2D8AA 5F76A 3ENNA 4DC0A 4E11A 1Q19A 4G0YA 1UKZA 4FWTA 1O9GA 1KDOA 3UTDA 1T5IA 2OYRA 1SVKA 4P7FA 5HXAA 3UFXB 3OURA 2O50A 2VEOA 4WN9B 5AVTA 2B0CA 5LMUB 3HTXA 4UOZA 3GP8A 1DIOB 4YCCA 4PXYA 3FFBA 1Y8RA 3GJXC 1HDXA 1NT2A 4WFIA 4RZUA 3PUKA 1U0GA 1WZNA 4RF4A 4I9HA 4EZBA 3IP9A 2BISA 3HXLA 3HR7A 2Y4NA 3FE2A 2G1UA 2WJAA 3JAKA 4NEQA 4BNIA 1MJGA 3QXGA 3F74A 4P54A 3E3LA 4LYEA 3VSCA 3PXBA 2VJCA 3KX2A 2GVZC 4PZEA 5LKAA 4TN1A 3K96A 3LXRA 3OZIA 4BMNA 4W5OA 4TRJA 3MA0A 4CMIB 5JI2E 2OCAA 4A8JA 1VL8A 3FHCB 1KDZA 4LMPA 5F33A 3DF9A 1T2AA 3A1UA 3JD2A 3AKDA 2ZRQA 1YVPA 2SKEA 1M67A 3VMMA 4M8NE 2FR8A 3PEWA 4M0FA 3Q7RA 1VKJA 2Q1TA 3BM5A 1IPHA 1K5GA 1GG9A 5JQWA 2VSOA 3HPRA 1ZX1A 3A2KA 5K4GA 1Q6YA 2XQKA 3QVOA 2NPFA 4BZQA 1NI4B 3NP7A 1P72A 2WEKA 1ATZA 1FP4B 4W6QA 2HXGA 1QP8A 4MARA 2CCKA 2HD4A 3P8ZA 2MMGA 2IA5A 3C3MA 3QPDA 5ES3A 2C4UA 3MZ0A 3M6AA 3TLCA 4RH3A 1H8EA 2FPGA 3GJRA 1WHTA 2LW7A 3TECE 1P9WA 5A7GA 5KJFA 3MXTA 3CM0A 3E2PA 3I6BA 2XTJA 3HYNA 3WRXA 3BFPA 4XX1A 4DDWA 3WDSA 3PRJA 4Q34A 1KJ8A 4U39A 1S3SA 5KMGB 2W2LD 1HEUA 1H69A 1T15A 2EX0A 2HREA 1FLDA 1DV1A 2BHLA 3MGAA 2XX3A 4G0UA 2CXQA 2O8VA 4RA6A 4Y2SA 2PEYA 4BJHB 3HFRA 1W2HA 1S2DA 4R8KA 3PPXA 2OT3B 2ZM5A 2A84A 2PWBA 2IYQA 3N2EA 4PG6A 4AMVA 1MFPA 1UZMA 4ZCTA 3H2KA 5I48A 1R6UA 4QPPA 1SM4A 1NXVA 4W82A 1DO2A 1VRCA 5E6UB 1YJAA 2BMJA 2HRZA 4FYKA 1SCUA 1OYVA 2WU3A 4ZMSA 2ODQA 2NYAA 4EPVA 3ZXIA 2OMKA 3GVHA 3G5UA 1QYDA 3N2ZB 3RSCA 3DLTA 3T99A 2ATEA 4RDCA 4C7OA 3HCRA 1A8HA 1DQPA 3L9XA 1WWKA 1YRHA 5I9TA 3FM9A 5FTMA 5AOAA 5AUQA 2C78A 2EFCB 1BMQA 1FSGA 1B7GO 1GFWA 4HDNB 2QROA 4KO2S 4KUHA 5DLPA 3OCJA 1UMCA 1I1HA 2ARKA 4IXDA 4QDZA 4IDPA 4PW0A 2Y71A 3HFJA 3PQ7A 3U80A 1P77A 2AC2A 1CULC 3M4XA 3TKYA 1IUOA 1WXEA 1T9GR 2ANCA 3NDPA 1ZGZA 2QVGA 3JQFC 4FOSA 4YAFA 5EIBC 1NXWA 3R40A 2HSJA 4YAGA 5AVZA 4AW9A 2HF9A 5FAXA 1U6IA 2CUTA 3CLHA 5FXMA 4CHGA 1EVZA 2Q5FA 1ADCA 3AJ9A 1FF9A 1QTIA 4Y0AA 2B92A 2EHJA 5KOIA 1QHHA 3NXSA 3WRYC 4AROA 4ESOA 2UXCB 4OLJA 4KO3S 3W8EA 4LZZA 3U7GA 3W2GA 1Q7GA 3CPHA 4DF3A 2EARA 3DZ8A 4WW0A 3IERA 1ESNA 2QNBA 5AUNB 1IN8A 1K6IA 1GR0A 2HCFA 3OO0A 4UU1A 2ZK7A 3MAJA 4LX8A 1UJ2A 3NALA 4HI0E 1EVQA 1E9FA 3UMRA 4Z53A 3CE6A 1YACA 4D44A 2BJHA 3FDZB 5REQB 1IIBA 2BGRA 2W2KA 4RK4A 1UBSB 4HV4A 4R1QA 5ERYA 4GMKA 1J2TA 3QVGB 2DWUA 3DEAA 4FX5A 3HCCA 3PHIA 3U81A 1OGJA 2DKFA 4LQLA 3ZV6A 2OAQ1 3H4VA 5JJCA 1KOGA 1JKJA 2CD7A 1O96B 2R7AA 1EDOA 2D5AA 3D8TA 3U9SA 1TIBA 2J09A 3JCZA 4MA0A 4WN3A 2MSKA 1NUTA 2AHOA 3MTQA 3BTSA 5EZ6B 4GI2A 1A7JA 1XLTA 2OGTA 1X3SA 4DR1B 3BWEA 5DEIA 1RC1A 5K6RA 5CA1A 4BO0A 4GXTA 1N78A 2BE7A 1D07A 3C98A 4WERA 4Q3NA 4RL6A 4H0CA 4X91A 3D3JA 3O0TA 4ZC1A 1U1GA 3P4XA 3RYIB 1GCOA 5KTRA 5DHUA 2MU1A 1QC5B 2X5JO 1TJ5A 2XQJA 1N4DA 2QG9A 3L7AA 4RCZA 2XOKA 4PNZA 1LLUA 2D1TA 2WMYA 3OPYB 3QY0A 3RUEA 1CUCA 3LX4A 3AKEA 4MAFA 4J9UE 3QF4A 1J0XO 5CT6A 5BW8A 5LDDC 3COJA 5KKAA 4JEUA 4AULA 4W5TA 4LXUA 1E2UA 4JI4B 1ZM9A 1XF1A 1BGWA 2ATXA 2HMWA 2YJGA 4I08A 1HDEA 2DSNA 4WLEA 2AR9A 2JBAB 3GLGB 2PZ8A 3BN3A 3DNPA 4X8OA 1EE2A 3DJFA 1E69A 3GAZA 1I7PA 1CD5A 1X9GA 3ZE9A 1N5RA 1BJKA 5FO0A 5C37A 1R8YA 3IUJA 5E6RB 2A1TS 4MTLA 2H2DA 3H9QA 4B3BA 4AXBA 4KMRA 1H3NA 2DY1A 4BKOA 4OXIA 2OHOA 4Y6RA 2BTQA 3VYUB 3EGXA 3AZPA 3B70A 2XQVA 4OQNA 1DDGA 1A3CA 3CPSA 4NMHA 2O5CA 3W3ZB 1U1IA 1V11A 2VA8A 4TMVA 3PZBA 4D42A 2Q9UA 1Q0QA 1EYZA 2Z3VA 4KRGA 4OB6A 4LK3A 1QFMA 1TYDE 4G0QA 1OZ0A 1Y8QB 3E03A 5KPDA 1AHNA 1VIAA 4Q48A 4UBOA 3IS3A 4X84A 1EDZA 5B6IA 5G0SA 3R5SA 1G17A 1FDTA 4LTMA 2QTNA 3AXTA 4N7BA 3UXYA 4LF9B 2IEAA 3NV9A 1EXNA 3JD1A 3OETA 4C29A 4KUGA 4C21A 4GOJA 2P6NA 1V7QA 4RVFA 1F2DA 3QHPA 1PR3A 2BELA 5J5CA 3RFCA 3CNOA 1C4XA 2YWJA 1NBOA 3UUEA 4DBLE 3L2OB 2WY2D 1MCZA 1W8DA 5DHRA 4QVGA 1ECLA 4D74A 4FYVA 1Z0SA 1MTZA 2F62A 4LMBA 1T9BA 4JR0A 2HHCA 3DHVA 4J6FA 3A6LA 3DBIA 4AJNA 5LP6B 4OLBA 2UZIR 5EL0A 4JQOA 3HN6A 4JB0A 3T6KA 4EB6B 4F4CA 2JJ1A 1NPTO 2X1MA 3I83A 4B76A 1SC9A 4P6VF 4BP8A 1DJLA 4ND5A 1NW7A 5CCXA 5BPFA 1G4UR 4HGQA 5LQSA 3RFFA 3QJ5A 4RXTA 2H2AA 3V7NA 4LRSB 1KGSA 4QEZA 1DSSG 4HPJB 4P36A 1CT9A 1S01A 4DIKA 3OPNA 1XXHA 4MUHA 4QO8A 2LRHA 4QXRA 4ZI7A 2I80A 3BD7A 3PJEA 4MRMA 1EFRD 3NH9A 5EMLA 3WB0A 3HA5A 1T4CA 2PBLA 1E66A 3CLUC 3L0BA 4M86A 2JI4A 2NO1A 1EP9A 4WKNA 1LF5A 3OE1A 4RLQA 1OTYA 1GPKA 2GWHA 2VTEA 3QHQA 3QI7A 5LC1A 3ZXXA 4YJFA 5ALPA 2AEMA 2OZLB 3LVBA 3MT8A 5L3QB 3M5DA 3M5WA 1F3OA 4BECA 1XNQB 2QYOA 4BLRA 5JMOA 2CFIA 3N2YA 5AT1A 1DB3A 3MHTA 2FPPB 1MOQA 1YZNA 3IBTA 4R01A 4GL2A 1JLKA 1MRNA 2HNBA 5IHXA 4MUAA 5FEMA 4S2UA 3T4UA 1A2BA 1QCCA 5L4SA 1KY3A 3SM9A 2HPAA 3P45A 4BLSA 4BNHA 2VAWA 5AVVA 2EL9A 4R9SA 4DEXA 2DTXA 2I91A 1ZINA 3OPXA 2EATA 3ZCQA 2O8BB 1QS0A 1XRJA 2V7BA 4N4AA 5EXEA 2RKWA 5J40A 1XLVA 1UFOA 2E48A 1M7GA 3PR3A 2Q29A 3DKPA 2IYNA 4HUJA 3HCFA 4Q9AA 1MORA 1Z29A 4YCBA 3QKRA 5A03A 2IH4A 2OK8A 3ORFA 4FSXA 5G4LA 3GLVA 1PEAA 1YO6A 1VMDA 3HWRA 6YASA 2WUDA 4GKKB 5E9JA 5DBOA 4M0KA 2ZQZA 3KAJA 1NQUA 4G0MA 4KFSA 4XTCS 3G88A 4DA6A 1EB8A 1AKQA 5AHWA 4Q3LA 2DG2A 4CIVA 1V8PA 5BOSB 4FS8A 1J8FA 1D4OA 2PGAA 3CN7A 5B58T 1CYDA 2QTFA 4KQMA 3ZD7A 4IXWA 1AF7A 4NK5A 4QBTA 1BKDR 4YAKA 1OTXA 1OUMA 4ICIA 2RMKA 3BK7A 2PGLA 3DLCA 4QTTB 2CWDA 4JQYA 3HGQA 4F45A 1HXHA 4OUDA 4FSDA 4F21A 2IF0A 3CCCA 1E6LA 1SNYA 2IH2A 2HA2A 3U3DA 4OM8A 1DBQA 4MAAA 2X5NA 4M0DA 2VH1A 1Q2UA 2WIAA 4II3A 1LBQA 4MKZA 4N7JA 1K89A 5HFJA 4EPRA 1MPTA 1U8UA 3G0IA 4NHOA 1E89A 1E63A 1JFFA 1AZWA 2OXTA 1V96A 2H18A 1JDBC 4PNHA 4O8ZA 4FFNA 1Q6ZA 2CF5A 3MAAC 1RWVA 1MJNA 1VIVA 4MB6A 2YWCA 3VHXA 5FTWA 4R8MA 5GOZA 4D9EA 2NO4A 1IUKA 3HKBB 3WO0A 1JIJA 3STVA 2LKDA 5J4YA 3MJTA 1AQYA 3LX5A 4LF7B 1FLNA 1HE5A 5LIPA 3B12A 4AQYB 3FY4A 3E9YA 1MT3A 1LDMA 3LCJA 4FGJA 1G2IA 1YJBA 1OGYA 2H0AA 2XH8A 4FZJA 4V0NA 4WFQA 4G36A 1G6Q1 1XDBA 3EIOA 3T95A 3FFWA 4QHTA 2EIXA 4EL5A 1EK2A 1BX0A 2HEGA 3CPJB 4LIPD 1U8CB 3UT5A 5J58A 4QU8A 5JDIC 4H7KA 2C92A 3H6HA 3EMVA 4GSLA 1N8SA 2I2BA 3ZV7A 4XGNA 3UBTA 3NHJA 2IGTA 3K9FC 4S3MA 4H3HB 3IPYA 3DZIA 3OKAA 4GLOA 4H3KB 5F21A 3ZJUA 4PX2A 1IEQA 2K7FA 2VNAA 1RE0A 4LJ5A 1TQHA 3SR3A 4ARVA 4KQKA 1XKTA 4RTSA 3ZVKA 2MMCA 1V9LA 4FHEA 3E7FA 3MBOA 4MYUA 4D4IA 1UMDB 2RK6A 1N2BA 2JAWA 4J0KA 3VPXA 1DWUA 2NTJA 2IZ5A 4JVNA 4FDLA 2B69A 1ZDMA 4LDPA 5AK0A 2C0QA 3FTPA 1A9QA 3EGOA 3Q7PA 3RAPR 4CCSA 2QXUA 1XDUA 1KI4A 2DR3A 1E2MA 1NX6A 2HWWA 1AQJA 2Q4RA 3E9ZA 3ENKA 1OPXA 2WIKA 1HDIA 2CZGA 1AM4D 2OKGA 3HVRA 1M2VB 5CB8A 1Z33A 3RS4A 5HDQA 3GAMA 1LRKA 3ZWKA 1TEZA 4OG2A 1P1CA 5FPTA 4LVNA 5JJBA 3C7TA 2WF5A 1HNNA 2UZ1B 3JWHA 1F0NA 2FW1A 4TM8A 5F98A 3C8UA 3AM4A 1DIBA 3BFXA 5CA1F 1W0KA 4K9MA 3EIUA 4KWTA 2F9LA 1IJFA 4IZOA 4QBGB 4KQ1A 2B8WA 5TQ0B 3V9AA 4KUEA 4EHLA 1W49A 3WBJA 1BS9A 3AERB 4FXPA 4KBYA 4X6LA 3EDYA 1O97C 4A91A 1Z2EA 1ZD2P 1PGNA 4KQXA 3REGA 1PTKA 4BJ1A 5LQDA 4CCAA 4URUR 4JJZA 2W6ZA 4WNIA 3OCVA 1ZMOA 3KZNA 1NOJA 4EPTA 1XHEA 1YFZA 3P0HA 1CJBA 3SKYA 4H16A 1CY2A 4QRHA 2OXFA 3K2BA 2OCBA 3ITNA 4NE2A 4DILA 3K1AA 4I8IA 3U39A 4L3VA 2CDNA 1TCUA 4AURA 4YI3A 5T67A 1W36C 4YJ3B 2PFSA 1U7WA 1BCSB 1NVVR 4IY1A 2D1YA 3TNYA 1FL9A 3FTNA 3RE1A 2I62A 1VI6A 2GAJA 2VF4X 3GL9A 3OEED 4N0EA 5CLJA 4LF8B 5EXXA 1N6LA 3TR5A 1WZ2A 1JILA 1RXYA 4K0RA 2VIIA 4RMGA 5D5HA 2FEMA 2INGX 3CC8A 1SG9A 1ACJA 3OX3A 4B7CA 2X9GA 5TARA 4E6PA 1U8TA 4F2WA 3AUXA 4GW3A 1FY2A 1E8MA 1MB2A 1B8NA 3K70B 2FGJA 4KMSA 3ZHRA 4Z3KA 2PUBA 5K0LA 1T91A 3ZUGA 5A0FA 4AO8A 5GQSA 1ZL0A 3O8NA 1SQ6A 4J0QA 2PUVA 2ZI5A 2IHVA 3MUEA 2ES4A 2H2IA 2WHPA 4MLPA 2IUTA 4GP7A 4ZVRA 1X80B 4K6CA 2ZTHA 1O9HA 1UZLA 3VJKA 3DLHA 1TQDA 2XUJA 3BEOA 5JAZA 4AP9A 1DJOA 4KHZA 2A1UA 3TVDA 4GC9A 2O5RA 3I5YA 1C7ZA 5BUCA 1TC2A 4UXIA 2HK9A 3R44A 3MLEA 4LDAA 2ZB2A 1J2JA 1R5BA 1Q7TA 5DYGA 5DTEA 5KVQA 3VZCA 2ZE8A 4R69A 4B9EA 5KC8A 1P1KA 4DJFC 2BFAA 2W0MA 1GU1A 2XRMA 4OB8A 2JKZA 5ENZA 3ZHXA 3DZHA 4QNNA 4EJFA 4GMFA 4UREA 1JEJA 3I28A 3TVYA 2XTNA 1PFKA 2WABA 2IKQA 1V5FA 4ZRMA 5JTUA 3K35A 1FVFA 7MHTA 4B87A 2ZIWB 3FPJA 2NP6A 2DAPA 1SVUA 1H2YA 2WB4A 1JV2B 2YHIB 4DSTA 1I30A 3L8EA 3ENQA 4Q1BA 4P92A 1I7DA 4OPMA 5DO9A 1MEJA 2QLMA 4JDUA 2G77B 4TPKA 4B2LA 2G0NA 1OV4A 2A5GA 1YL7A 1Q3HA 1JA1A 1LNQA 5JD3A 3RU2A 1XQXA 1E79D 1WB5A 4J0GA 3KV1A 1JR3D 1G20A 1Q3KA 3MMPA 3AV0B 2EZ4A 2IEDA 4M1SA 2CE7A 2VPQA 3GPIA 2FG6C 1UFRA 5JAQA 3GJ0A 5KREA 4G2NA 5KKCA 2E18A 1B6SA 2XB8A 4ENSA 1ZY2A 2Z5LA 4H3VA 4HX5A 4O4LB 4DJEC 3ECAA 2P67A 2NSHA 1K2WA 2JAXA 3P0JA 5K2OA 3AX6A 4JV5B 4G5QA 1FQKA 4QTUB 1BYIA 2P6MA 1EXMA 2O8NA 2ZAMA 1M6VA 3QA3E 1SHLA 5FORA 4KLRA 3THYB 2CV2A 1V7PC 4F4IA 4CIWA 2HK8A 1NWHA 3ASZA 5AJHA 4NV0A 3WK8A 3MYRA 1KRHA 5E1DA 3GQBA 5BNZA 1B0PA 4Y0VA 2XXAB 2Z83A 4F5EA 4PV7A 2BI8A 3B6IA 3VO8A 4BYGA 3OOEA 4YR9A 5TQ2B 3MGCA 2IXGA 2W2NA 1QTRA 2GRAA 2OCDA 3LFTA 5LU9A 2E5LB 1OBCA 4OSEA 3A3PA 1HQYE 4KYIB 2J0SA 3NHLA 5AW6A 1LY1A 1L6IA 1V1JA 3BMNB 4XLLA 3EXIA 3QIVA 5EMMA 3FVRA 4JFAA 1QYRA 2IHYA 1F2UA 4DLWA 1RYMA 2VDJA 4EY7A 3GH1A 1LRJA 4M3NA 4MV3A 3K6KA 3JZMA 2QN9A 3W4KA 1QQ7A 1YZKA 1RJWA 3AL0C 1FXUA 4F3KA 1JA0A 2UZ0A 2Z3WA 5FFNA 1OBHA 3H6KA 4CQLB 4CM4A 2LVBA 3G7UA 3M81A 1KC1A 1M6YA 3NYQA 2VHZA 4GU5A 2W2QA 2H1CA 4XYGA 3SFTA 3NC1C 3OAAA 1WQ3A 3VR1A 4IHKA 1G8KA 3R6TA 5H5JA 1NVWQ 4AZTA 5EE0A 2QRKA 3C4QA 3PFGA 1CY8A 4PHTA 5DNAA 2IDMA 5KHAA 1AUVA 1JAIA 1TF5A 2YMQA 4NICA 1SBQA 2UXDB 2YL2A 4DR5B 1ZN7A 2ZSIA 5JPDA 2M1ZA 2Q6LA 3EEYA 4J7AA 4MIKA 2RH5A 5DYYA 1RHUA 4L08A 3U44B 4IZ6A 2EG5A 3G6KA 2AI3A 3BGSA 4RORA 3JS5A 3I2GA 3SZLA 4QJBA 3PXAA 4UM9D 4ECAA 3NVDA 3AY0A 4HFMA 2IIBA 3TLGB 1O95A 4EKNB 3R41A 2O7NA 5FRDA 3SIRA 5EJEA 3P9YA 1XK7A 5J3JA 1GPAA 4HH3C 4P9NA 5G1NA 1YQGA 1Y8CA 5LYYA 3KOZA 1OZFA 3WSTA 2OORA 2X9VA 4LSWA 4DA8A 2C2GA 1NSTA 2AEFA 1G19A 1NU6A 4BAZA 4HDRB 1CVRA 3GOQA 4J1QA 5G3ZA 1UH5A 2RSLA 5I47A 3G0BA 2CSXA 4EM6A 1T9DA 1KVUA 1US8A 3KSRA 1RJ9B 4GYJA 5KQSA 3VAYA 4RTPA 4NNOA 1F4VA 2FSSA 4UCQA 5T5QA 4MW2A 3N7TA 1UT5A 3HVHA 3DFIA 1EA7A 2CXOA 2E5FA 4FJ1A 2DUWA 3MD9A 2O8FB 3KOMA 1X1CA 1UPTA 3HB1A 2PMDA 1D8TA 2E5WA 4QSHA 1AUPA 5DXFA 3PJRA 3O8QB 4DXAA 5JAUA 1JR4A 5LD2B 4KTVE 3QOFA 1JI0A 5DNCA 5IF3A 4LW8A 1XIVA 2OA0A 4CV2A 1R12A 3BF7A 3PNPA 4LJ9A 5JWOA 3D3KA 1OX4A 2VF7A 3WNDA 1QFSA 2ZUSA 4HH1A 1IVNA 2JJ1D 5DH9A 3TEJA 1Z4JA 1WCYA 2IELA 1J56A 3MCAA 2G06A 3SIWA 3WI7A 2MSWA 2PZGA 3PHGA 2XNDD 1RVDA 3QEOA 4G8BA 4JJAA 4KVGA 4UBJA 5CNIA 5SYAA 4C7BA 3S2EA 2CNNA 2WNIA 4HP8A 1O8BA 2HGZA 3K4HA 5EYPB 4TYPA 2NU6B 2ZSJA 4X7RA 3AM1A 5KYUA 4DLRA 4IDAA 4B2PA 1KMNA 1LH0A 1R6AA 2FN9A 2X8WA 2BFBB 1YDHA 4J0DA 4YYZA 4FI3F 2GZRA 3OUZA 1UADA 1OX4B 2YWFA 2YTZA 5GV7A 3L40A 4BEJA 1C50A 1NRJB 3ML1A 4ITUA 3C4JA 4EZIA 1MZPA 5LDHA 4L2IB 4TYYA 1GUAA 3LUJA 5BVGA 3M4NA 3KQNA 1EJBA 1FMJA 3EGEA 3KTFA 1RS0A 2AXNA 2GK4A 2NUTA 1CEXA 3RCBA 3VVLA 1FJGB 1ZHOA 5J4KA 4RZSA 4QYTA 2CL7X 5D7BA 1Z5ZA 4ZAVA 4D80A 4OGFA 1H1LA 5IKMA 1KK3A 4I1IA 1W19A 1QVRA 1WY5A 1WKBA 3ANTA 3WYBA 4LZPA 1E7WA 1LI7A 1U65A 1WULS 1XTPA 3H9BA 2I03A 2WWHA 3K6RA 4I1UA 1P7YA 5AM4A 2IOQA 2GCOA 4KR6A 1V16B 1G8SA 2DUUA 2EFJA 2JHCA 3DL2A 1YB4A 3X0DA 5BN1A 5DN6D 1GZDA 3PDUA 2PD4A 1K75A 2R4TA 1YJXA 4BV2A 3H0EA 5I7EA 1A8IA 1PBNA 4BTEA 4CQMD 4PF1A 5JS1A 1QCYA 3FNBA 4JIGA 2IL1A 1SXQA 4MX8A 4ATNA 4RVSA 1TVCA 1EEHA 5D5PA 2IYAA 4AX4A 5BSTA 4AG3A 1DX9A 1XCBA 2PO7A 3OF5A 2WA2A 4YRJA 1RPAA 5AW1A 1YD7A 2VEDA 4F12A 2A5JA 1GRVA 1NV8A 2DTDA 2OC9A 3FROA 3CLRC 2AMLA 2IPNA 1NQAO 3EA5A 2H59A 3OE7D 2PGJA 5EJFA 4YP0A 1RHRA 4RHXA 5ALVA 1I94B 3LC0A 1Z7YA 1KDTA 2JJQA 1OH5A 3RU7A 3CEJA 5EZYB 3A4NA 3PGXA 1EWKA 3FVQA 1LLDA 1DXOA 3EPJA 2JNWA 5KC9A 1M5UA 3KDPA 1KR5A 1WXFA 2X41A 2XVMA 3QY9A 1USVA 1CE8B 3NRJA 2GRJA 5HEKA 3FD8A 3UF0A 4LYJA 4QC2A 4YDRA 3G2JA 1E5LA 1ORHA 1Z75A 3AZQA 2LE0A 3HXPA 1HKHA 1Z9BA 4DR4B 2BFPA 1OVGA 5IBRA 3AHFA 4CV1A 5BVHB 4HGPA 2PSFA 3KXKA 3VSBA 1V2GA 1TQ2A 2NN3C 4DYHA 3NYRA 2XUFA 3FMIA 4H35A 1G8HA 4DZZA 5HJ2A 4DR7B 3R77A 5AICA 3LY8A 2WKWA 4CHTA 4F04A 1U3GA 1JQEA 4OCZA 3RWMB 2I1WA 2GD1O 2ADOA 1X8LA 5TQ2A 4UNNA 2W8ZA 4DJAA 1D2EA 1XTBA 1Q11A 3PR1A 1FB5A 1L0BA 1SRRA 1E94E 5F7ZA 1HR0B 1XNRB 2E3JA 5IJWA 5EIOA 3JASA 1U3UA 1K27A 2DFNA 3BBPA 1V8ZA 5DF1A 3DOFA 2P9FA 3IH5A 3ZWXA 421PA 1WXQA 3VC1A 3G8YA 3TIFA 4DLAA 2ECFA 3DKVA 1M6VB 2E89A 1NBIA 4MUEA 3BWXA 4YUVA 2YQ4A 1VI2A 4P5PA 3QVKA 4BCBA 1NR1A 2IX9A 3EAQA 1IY9A 1PG0A 1ESMA 3EVGA 2CB9A 3FYHA 4LK2A 4MVCA 4OP2A 3FDIA 3MFQA 2OGUA 3A3KA 4XOIA 2X76A 3HCBA 4UHHA 4CR7A 4IQ0A 5JY6A 2PVPA 3LLSA 4EKYA 5ITSA 2Y27A 2AJ8A 3B6MA 4PY2A 5HZGA 1PVOA 1CR0A 1D9ZA 4IYRA 4DIBA 5BYBA 4ENRA 3IMKA 4L57A 2OZVA 3H16A 2EKDA 3KSUA 1OHHD 1NY5A 1OBFO 3C24A 3QPCA 4LBWA 3ZE2B 3W5CA 1QSGA 2ZREA 5CA0F 4W8OA 5A9RA 1NXPA 1Y1KE 4ZCLA 2V96A 3UAYA 2ZZNA 2FCRA 4FHGA 4YMUA 1XQYA 3ESYA 5EWMB 4S35A 5F1KA 4W1PA 4EYQA 1BH2A 5JCOC 4C0LA 1G291 4D45A 2PQ6A 4MAMA 3HZOA 4N18A 4EA7A 2LDXA 4OLFA 4OUKX 3WA6A 4F2GA 4HEA6 4EEXA 5CBKA 7REQB 2VUTA 5L53A 1O5TA 1F2TB 2ZYUX 3GPCA 2WDZA 3H8SA 4GH5A 3TQTA 1IZZA 2OTCA 3ANXA 5L3RA 3TZHA 1JFVA 3BT7A 5AXBA 1SXJA 4QUGA 2VJKA 3OEYA 5HSGA 1LA2A 3HS3A 1CX9B 3Q98A 2QI9F 1HX7A 3NBKA 3MB8A 3Q6NA 5ALJA 1ECJA 2NT3A 2O7RA 2WA1A 4ZVOA 1VP3A 5IABA 1FCJA 1NMYA 1SBIA 2FHPA 2CXTA 4WBSA 5AI9A 2AFHE 2ZWMA 3JWIA 3HCEA 4MHSA 5AJXA 2E37A 1LKZA 5ESXA 2WJGA 5AD1A 3HYCA 1XK6A 2WW8A 4O33A 3ZD6A 1CY1A 1QWSA 3SSMA 3NIWA 3ABSB 4QUHA 1PDWA 1ZH8A 1YZVA 2D0PB 2EFDB 3TPZA 3AOEA 1U2GC 2XOEA 1FVOA 2YJZA 2YV1A 1Y0BA 2ZQYA 5CT9A 2HSWA 1DJMA 1SXJE 4G41A 5K3AA 4H60A 2X7JA 4K6MA 3BIWA 3D7NA 3LHFA 4G0XA 1N6IA 3IP3A 2HMVA 2YHBA 3M6MD 1THZA 4V0ME 1L9KA 5EQFA 3S5UA 3R8XA 1S8OA 5CX4A 3H99A 4E31A 3IR6A 1DQRA 1S96A 1Z5NA 2QL5A 4Y2JA 4OK6A 3UJNA 4ARZA 3KSMA 3OQMA 1KKMA 1QZZA 4MI3A 1VCHA 2C58A 4MWSA 5DOVA 4BNXA 1HSOA 1G6OA 5FLEX 5AJTA 4RK5A 4ZIRB 2AT1A 2F9FA 1Y9AA 4D0LB 3O3MB 4HNTA 2DECA 4R2KA 1JHXA 2X0RA 3I01A 1JZTA 3ZLVA 4CCYB 1V1MA 4N48A 1YI0A 2G9ZA 1USGA 2O2SA 4GZ3A 3PDCA 4N49A 4U2FA 4C7JA 1B3BA 1RI2A 4G97A 4N0DA 4XLTA 4D3XA 2OQ2A 3K8QA 4DUPA 3F9IA 4D8YA 1QF6A 3KYCB 4Z7QB 3FKQA 3TEFA 3AIOA 3LL7A 1K3UB 3BGIA 1GNPA 2BDTA 1TRHA 2XI4A 2A78A 4PQGA 5CFZA 3UMFA 4KR3A 3AF3A 3N1UA 2BTEA 1VYTA 1B8PA 3KR2A 2DQZA 3AR3A 4GOOD 2MYUA 3EN0A 1KQNA 2CJFA 4FZ5A 4NJEA 5CHYA 3I9LA 3MTJA 2W8BB 3OJWA 4KDCA 2XITA 4FW9A 5I01A 3V4RA 4I1PA 4MGYR 4P33A 4WUTA 3ER6A 1M54A 2GNAA 4UM5A 2WVGA 2HJ9A 2VJNA 4RGBA 5J5VA 3U7EB 5HMLA 1GZUA 3IPXA 4U2EA 4JROA 1J25A 1V9SA 3ELWA 4PCVA 1FP1D 2UZ3A 4LXIA 5JANA 3AYZB 4MKFA 4N41A 1E99A 1SELA 2VAPA 3VZRA 3AESB 3MJRA 3ND8A 4YIHA 1WXGA 1PS9A 4CKWB 3I4FA 4Q4DA 1EP3B 2HRDA 3ENWA 4IOMA 2O5VA 4PIVA 3RS2A 1P0FA 2VF8A 4JLDA 2UDPA 2ZVDA 5BNWA 5I9MA 4CR8A 1YDMA 4YROA 2G0TA 1V1RB 2QUAA 4C2BA 4FS3A 3O84A 1A5ZA 3PUHA 3T9CA 2W6IA 4ZEMA 2ATIA 3THSA 4EFMA 1TA9A 2AVDA 3CLSC 3ZEIA 2TSYB 4NL4H 1A50B 2A0XA 2AN5A 2YDYA 4NH0A 3C5VA 4WOCA 3A6DA 3IHLA 2B94A 1PNQA 1G16A 1IFXA 3IVGA 4BMDA 3JQBC 1X3LA 5AH0A 4YJ2F 3PHJA 2W37A 4X6XA 1NRWA 3ZWQA 5CM8B 4UAGA 4UTRA 4QULA 1RYZA 5EP4A 5DV9A 1N5DA 3DSRA 2DWCA 4JLWA 3S8MA 3SHWA 3MJFA 4WA7A 4CKEA 1E1QD 4OHMA 2CV1A 3EA4A 3OZUA 1JR6A 3UMGA 1AKYA 2FGKA 2CGEA 3VI4B 4OQQA 1OH6A 4JI6B 4TYQA 3OLVA 3VPDA 3P2YA 1G6KA 1W34A 3DOIA 5ELLA 4M0EA 3O0DA 2JH8A 2QSZA 1OREA 2W7TA 3KBBA 5MFZA 1Z5UA 4LWZA 1P6XA 1LTQA 2X5OA 4BO6A 5JADA 1CUBA 3BSWA 1OIWA 1P1BA 1AA6A 1ZU5A 3INRA 4CKEB 2H4XA 2C95A 3FZEA 3L8YA 1QIDA 1X1BA 1GZ3A 2H2GA 1KJZA 2X4GA 2QTBA 5BRNA 5KPJA 2FSPA 1PJZA 3B3AA 3H4MA 4B7ZA 5JASA 3VR6D 1KP2A 5ARBA 3A6ZA 4UHBA 3T1OA 3IL2A 3ZBTA 3P9IA 5HIKA 3VZPA 1G5IA 1E5VA 3U7RA 2C9BA 2LCIA 5IKEA 1F1BA 2R00A 5THQA 2GSDA 4KAJA 2YY6A 4C0WA 1JPJA 3O8LA 3W04A 4XWGA 5EP3A 3LW7A 1ML3A 4E4RA 4RKFA 3GLFB 1WX1A 1GTL1 2BFWA 4LKOA 4QUDA 5TIIA 4IJKA 3GAFA 3R7NA 1ZRNA 1JSXA 2IZ7A 2OORC 1O2DA 4S1WA 1OWLA 5EEGA 2ZJOA 1JQKA 1X14A 1P4JA 3PYXA 3TR0A 1GVHA 3RKSA 1GTMA 3SDBA 4D6PA 5D6OA 3SC2B 5IHPA 1EFDN 1KU0A 2RHOA 3L0OA 2ZJ4A 2PBZA 3FVVA 2Q4OA 4XXHA 3TL2A 4JDPA 1ZMTA 4P08A 3CVUA 4LISA 5LA6A 5JYEA 3A1NA 1XFDA 1TZCA 2R6CA 4L8LA 2P5UA 2RBEA 1WSAA 4S1PA 4XGQA 1ZMXA 5L7YA 3WMEA 4PN3A 2BP7A 2E4ZA 4RQTA 3D0QA 5DTMA 1TD9A 3JQFA 3N5KA 3BD9A 1NIPA 1E6MA 1U0LA 4NJEB 1R2QA 3DNMA 4W5WA 5FUVA 2P6OA 1T3TA 2NV6A 1SVMA 1TT5B 3MC1A 4BASA 1XJ0A 2VTBA 1FYVA 1CQXA 1ZN2A 5DCWA 3W5AA 5F9HA 2HQRA 3DTYA 4W9NC 5F1PA 4BN4A 1HG1A 1P2DA 3QJYA 4Q6WA 2JEOA 2PS0A 2QHXA 4XARA 4ZO8A 4FYHA 1ZMBA 3A4TA 4ZU6X 4KN8A 4COKA 3KYCA 3OC6A 4LSGA 1PAUA 2PU5A 3VJRA 2VDNB 2Y76A 2OBBA 3HUDA 2H1IA 2CK3A 3HDYA 4NESA 4NU6A 4UUPA 5U4XA 4ZEWA 3WWCA 4LE1A 3LBIA 2IYYA 2A9JA 2V1XA 1P80A 2ZOSA 3MJHA 1SKAA 3P1JA 4N47A 4ZI7F 3FVWA 2QAGC 4UDNA 4O4HF 2OZLA 3UUWA 3MELA 2FPWA 3BXGA 4DE5A 5LP1A 1OTHA 1YQUA 4WK6A 5KYNA 3O92A 3QPBA 3QUCA 4BATA 4MVJA 3QH4A 5KQPA 1I3OA 4IKEA 4CM1A 5KJ6A 5I51A 4NU0A 4YJDA 3WBFA 4CE6A 3WFZA 4NFLA 4ARZB 3NWPA 4N3AA 4QDKA 1OAOC 2PBRA 1GUFA 3CLKA 4OQPA 4H4EA 3GWGA 3KS9A 5FA6A 1B15A 1JNXX 5G1OA 3L8FA 2HWYA 4W63A 4DW8A 3BQNB 2K2WA 1K8ZB 3PI6A 1FDRA 2NZVG 2WQZA 1OFTA 1QLJA 1UJ5A 1PL0A 2JFGA 3G0CA 1NU8A 3LZ6A 3PXCX 5LWHA 2YRXA 2AWNA 2MWMA 2R5NA 2VNSA 3GUYA 2PUEA 3JVUA 1KQOA 2IVZA 3RSQA 4FGLA 3W2HA 4NYMQ 4ZANA 2WYVA 4KKXB 4KEAA 2C9ZA 4NARA 3V55A 3ZWVA 4G5GA 3GCXA 3T7JA 3LDHA 1VL6A 3KYJB 2XYGA 3L4SO 2JAHA 1Y4DE 3JZFA 4CIAA 3UJ9A 4I9NA 4E2XA 1GA1A 3L4BC 1LC0A 2R62A 3ZH2A 1ZEJA 2IHZA 3P2EA 1DEAA 1Z4KA 3OFJA 1Q5PA 3QUQA 5KWVA 3KP1A 5KB3A 2GFQA 3INNA 4DIEA 3AEZA 3QLVA 2ECPA 1PGOA 3HFGA 3FPBA 1XZJA 4AT1A 1L4EA 2B8EA 5HCUA 1AVTA 2YMLA 3E2IA 3EH1A 5C52B 3F6CA 5EVJA 5FPHA 5B4VA 2IHBA 1F2TA 2GYYA 1WSDA 3OPMA 1ZBDA 1Y8QA 4B43A 2Q3FA 4P2GA 3TZ6A 2MOKA 2H65A 2OCKA 1M1XB 4GBMA 4D41A 4P84A 2JFQA 2BM8A 4KQWA 1V11B 2O4UX 3OLYA 2AWOA 2IZ6A 5IDQA 2XT0A 1IDN1 2GZDA 4JC0A 2TYSB 3WQHA 2FEAA 2OFPA 5HJ7A 2C2OA 2BTQB 4O3FA 4Q9KA 1GRQA 3V1NA 4DCGA 2YXLA 1K9SA 4EVSA 3W6NA 1XXLA 4IHAA 2UYHA 1RYDA 1PVVA 3ZCPA 3Q11A 1EA5A 2RB4A 5E6RA 3REFA 1RPZA 3RASA 2DUJA 5F3WB 1ENOA 3OKPA 3F5DA 1YFLA 1HMPA 4M1TA 1MFZA 4JGGA 5BORA 1HLPA 1K6MA 1RW4A 4GMDA 4N5NA 4W5QA 2VPYA 1NNLA 1XCGB 3NATA 3F1KA 3C15C 2BD0A 4WCFC 1MNQA 1XTRA 2CHVA 1JG3A 1ZS9A 2W4MA 1WNTA 4E12A 3JRNA 1VDZA 4GX5A 1G8FA 2G4CA 1ODTC 1ES9A 2V7TA 1E5TA 3AJEA 3BSFA 3QF4B 4LYYA 5A3SA 1J20A 4REOA 2WP8J 3WO1A 1CR4A 1M2KA 2F17A 4ZO6A 5KQMA 2ZJ5A 3RR2A 3RYIA 1XL0A 4CRWB 4WCDA 2OGWA 4XQ9A 4MCIA 1YQ9A 5FBLB 4EY4A 2P9YA 1ODJA 1VA4A 3NKLA 3OU6A 1A7UA 3A6JA 2QRUA 2Y68A 5DGXA 2QORA 5TQJA 1A4UA 2N46A 2R7MA 4X1YA 1XVIA 2DBZA 2X4IA 2UYGA 5TV2A 2O8EA 4QATA 1Q0SA 1UOEA 4RGVA 3RUDA 1O96A 4RH1A 4LJAA 4U9IS 4AS1A 2ZI3A 3CR3C 2VCEA 4HLQB 5J2TA 1GRCA 1CB0A 1P9OA 1UOOA 4ESHA 5TMEA 4J0EA 3DXZA 3FKSA 3MRXA 2D2EA 2R68A 4UDXX 4ZT5A 2W2KB 4IIXA 1ZKMA 2WDPA 4HZIA 1XZMA 4FEEA 1DGQA 2PAAA 2QJWA 2CDRA 1XKXA 2JK1A 1RXEA 3QKTA 4ASUA 2YZ2A 1E7YA 3MPOA 3ESZA 1DDIA 1SVSA 3KB6A 4IRXA 4KG7A 4YWHA 1ISPA 1NDUA 2AG8A 2DRIA 4QGFA 3ZIAA 4DLSA 1Z28A 1ETHA 3DA8A 3NEJA 2UVDA 4TLBA 1GO2A 1IATA 1EPUA 3RC7A 3U4GA 2XCRB 1JLRA 3ZJTA 2P79A 3KWMA 3BG5A 3DV0B 1MC1A 4R54A 4C6HA 3H2SA 5FBQB 3E05A 3HQ4O 1M8KA 2IZ1A 2O2DA 1JQLB 3DULA 3K4PA 4MJ7A 1HZJA 3F5FA 4HNVA 2FFJA 1A0OA 2W6PA 4OOEA 5I8ZA 4MPJA 2GZSA 2FETA 4PX9A 1GY8A 4FLEA 3BPSA 1UKAA 5I7RA 3DH0A 2GCOB 1SG0A 3LPLA 3H3JA 4ESEA 3KLPX 1U99A 1JHDA 3RANA 2C2YA 1M1NA 1P7VA 3EPRA 3Q85A 2HSGA 5BW4A 1QUFA 4E51A 1PEYA 3CKYA 5BSMA 5M2QA 3DZBA 2AZXA 3NP9A 4JHXA 4O25A 5AI8A 1SUWA 1XPOA 2GXUA 5C34B 1ABEA 3C3KA 2DF8A 3DQQA 2P2DA 2VDUE 3S1LA 1SB8A 3FOFC 4OIFA 5AVWA 3K1JA 1PEDA 2YNMA 4L2IA 2P2CA 5E6UA 5FT9A 1C30A 2OWEA 3ZIDA 5I8PA 5FNZA 1TMYA 4MYCA 2PUWA 1H1TA 4RMHA 2XZOA 3I1IA 3K30A 3I09A 1NZJA 1PVDA 1KYYA 2PS3A 4H15A 1X1EA 4QPZA 2NU6A 3PA6A 3GLHB 3V4ZA 4B33A 1EX9A 2P68A 1SEPA 2QX4A 1E3MA 1VSVA 2EZUA 5GY7A 1LK5A 2CVOA 5A71A 1F1JA 1G66A 4O3MA 1ST2A 1VG8A 2W2XA 4HTFA 5BMVF 2HQBA 3AY6A 5ICFA 2XGSA 2ZTVA 1N1DA 5IJAA 2ICAA 3W3AD 3AUKA 4XIJA 1D2GA 3OY7A 4IDCA 1C7EA 5DMHA 4A0HA 1T4GA 4BX2A 4EWLA 5TGDA 3GT0A 1P0CA 5GONF 4C06A 3BMOB 1O54A 2FWPA 1BU5A 1GSOA 1VLZA 2QMOA 2YJ5A 3H7AA 3UENA 3VPGA 5HOEA 4ZRNA 1DI0A 4QFMA 3ABQB 1UXKA 1BQ4A 4Q19A 4J0FA 1WHTB 2VUUA 2CMGA 2VDVE 3EVEA 2I7CA 1ENPA 4YV7A 4MO2A 1SOWA 3KZ1E 2I4NA 4BFUA 2R0QC 1N6RA 5DM70 1UM9B 2IRWA 4BKMA 1EIZA 4EKIA 1NI4A 3HMQA 2JH3A 4Q3DA 4EMTA 1EX6A 4L85A 2PFGA 3ABOB 4QJ5A 2HM7A 2Z43A 2O05A 3A27A 2QQEA 3E48A 4PZDA 1S5PA 1MNAA 4AAYA 1ARZA 4OJMX 1ZZEA 3U9TA 3I9MA 3Q0TA 1QRTA 2O07A 4CMIA 2NLOA 1UC9A 1Y9EA 4P5DA 4WZAB 4CLDA 3BVPA 3NWEA 2HLDD 3BDAA 5AW7A 1RRFA 5DT9A 1KYVA 2WRZA 1WU7A 3LUHA 1PJSA 3TLGA 1FUUA 2YIJA 3A9RA 3QUAA 4GXQA 4EB3A 3WGIA 1PSWA 2YKGA 2B21A 1KJNA 2OPHA 2Y99A 2H00A 3S99A 2XGJA 5J9FA 2G80A 1W4AA 3ETNA 4RC9A 4RXMA 4E4TA 1PL6A 3GFRA 3LT4A 1YZTA 3AVQA 4JQSA 3T06B 3T5BA 4CL3A 2Z3ZA 2P5SA 2QVYX 5F12A 4I99A 4EAQA 4ZZ3A 5LNK6 4DT1A 1JMYA 4RX1A 1WY7A 3LQ4A 1PR0A 3U40A 4F4FA 5C2JB 3K5HA 3KFVA 4OGLA 4WN9A 4AL4A 2HIAA 2GB4A 1KI3A 3UFXA 3FAZA 5EE5B 4IMPA 1R3DA 3QFTA 4BVBA 1VKOA 1S02A 3W8DA 2ZE5A 4H7IA 1FS5A 5IVDA 4QYIA 3ROFA 3UC9A 4ZYZA 4P7BA 4CQLA 5FOVA 1UJCA 4F91B 1GZ5A 3KE9A 3KVYA 1VXOA 2XWSA 2GAAA 2GCGA 4LXXA 3G1TA 1VBFA 3VO9A 4DCSA 4BNDB 2NP7A 2XMSA 3B53X 1QGDA 1ZH6A 3I8OA 4YRFA 5KJEA 4UPVA 4IF6A 4MVYA 2R00C 3LPAA 1I0LA 2H1RA 3CWZA 5MN6A 5U9CA 2YOGA 4NLLA 3ZHZA 4F72A 5AW0A 1BXGB 4C2UA 1ORWA 5CT4A 5JCZA 1JI3A 3A1FA 3K0AB 3WHPA 2YS7A 3GQBB 2AE2A 2QW1A 2YFYA 5M3BA 3TCKA 1NZDA 3MINB 4DIDA 3OTGA 5KINB 5CCBA 3PX7A 2HJHA 3FWZA 3CKLA 1P75A 3ZQ4A 3N3BC 2NU8B 3THYA 1U04A 5BYAA 1M7BA 5GINE 3KPVA 2H1LA 4LECA 3HABA 5F7XA 4HGOA 3OU7A 1GWNA 1N6NA 1WS6A 5D2CA 1DG3A 2C77A 3H13A 4FGSA 4KL8S 5PNTA 1N9GB 3L1IA 3VC7A 4DCOA 2VI5A 3LWNA 4RUKA 2NAPA 4UTZA 3WHKA 2JD1A 4M8KA 4QVIA 3LGXA 5JDCA 3DE1X 3V48A 4H2DA 5EMNA 4HAVA 2RJ3A 2X4DA 3KEQA 4Q1DA 5IMBA 3UPUA 4Q4AA 3LBAA 5AFSA 1LEHA 5HRAA 1XRQA 6ABPA 3EX7C 1MQ8B 1AXEA 4N7MA 4TSFD 1Z8DA 1HFWA 3SDZA 3CSUA 3WK9A 4Q02A 3I3SR 5DI3B 3ZDBA 1PJAA 2O1WA 2JEZA 3I45A 4UE2A 1XE3A 2YXPX 1N2HA 4RENA 2FPRA 5EZSA 3URMA 2HA3A 1HI9A 3M1AA 1VHWA 3T7AA 3TKAA 3PC8A 3NWOA 4EBBA 3AGPA 4OQEA 3FUXA 1ZNXA 1WPXA 621PA 3NORA 4XX0B 5SY9A 4I50A 1W4ZA 2MR6A 1H4TA 2XCQA 2YWRA 1PJQA 1ADBA 2GARA 1MV8A 2H1FA 3KT6A 3FB4A 4A8HA 2J3JA 3D6TB 4UBIA 3BA6A 4FWBA 1GZVA 2WOJA 1RLTA 2LNDA 4PFSA 3T3HA 3NAGA 4DPKA 2FRXA 3IUSA 5IU6A 3EGDB 2I3DA 4IMJB 4ZVTA 3WGZA 2ZBFA 2MYNA 4A0SA 3K92A 4M0LA 2NVOA 1I1QB 1RYEA 3DEYX 4OIMA 3RVQA 1NSYA 3GJYA 3RRNA 4ZYYA 1EAMA 4AZ0A 1GXSB 1X80A 1U7UA 2FEKA 3LXMA 1ZN8A 3W2TA 1K6JA 2YWBA 1QU3A 3PR2B 3D5QA 1P61B 3P9PA 2C3MA 1L1EA 1YRBA 2WU0A 4QBFA 3KL2A 4GRIA 1NP6A 4KYVA 3UMSA 3DVAB 3VGJA 1RYFA 3RU9A 2V6IA 2HJSA 3GFSA 3SF8B 3ZV5A 1Z2CA 1YB6A 2WC1A 1JQDA 1K86A 2OUKA 1PS0A 1Z0JA 4JNCA 1EIWA 5JNRA 1MO6A 3G9XA 2ZUVA 5CNMA 2GN4A 3AV3A 5IFLA 1G42A 5CNKA 4RJLA 3RVMA 4BUZA 2IHNA 4TT8A 2AN4A 3DR3A 2GJ8A 1QBKC 2BGNA 4G1UC 3U4AA 3QX3A 2CLKB 4AIIA 2C03A 3EOZA 4TWRA 2GBFA 5KYVA 1W88B 4GF5A 1OLSA 3L77A 4MUJA 3VH4A 5LQNA 5LU8A 2Y9PB 4X0EA 1BCSA 3DC2A 1MGPA 5D3ZA 5K01A 1FC0A 1OY1A 3NDBB 1JWBB 4LZOA 1ADGA 1EK0A 3JQDA 4FDAA 4WGFA 1DKOA 1OE0A 1QHNA 1WG8A 3EOAI 3LG2A 4KH0A 2X1HA 4DTIA 4JBWA 3NM4A 3QMPA 4YHBA 1L1RA 2GPJA 2AFHA 1KEPA 2VQDA 3L93A 3QQPA 4K8OA 5CTAA 1OIXA 2P0AA 3GZNB 3NAQA 3NU1A 3QW4B 2JFOA 4UJ3A 1O95C 5ALLA 3CN9A 4A36A 4UUQA 4EJ2A 2Q6IA 1NW4A 1TF7A 4RD4A 1H93A 5JAHA 2BH2A 4PR0A 2UV8A 4YR7A 3WK5A 3PV0A 4ZP1A 5BT8A 3I23A 2YNMC 3ICPA 2GF0A 5C7LO 5TQ0A 5EJIA 1UWLA 1XTTA 3C1UA 5ESWA 1ESDA 3FCCA 4G89A 3HI4A 3KYDB 1ECFA 2CYAA 3WGJA 3KQOA 3MWEA 3N8KA 2OYSA 2H1SA 5I7WA 4HUQA 4WXRA 1HEIA 4FYXA 4IIGA 1Z7EA 2OECA 4EX7A 4RCYA 5FOQA 3IUPA 1KI1A 4HNHA 3HM2A 1KGDA 3FB1A 4GP6A 4WBNA 4KDRA 3AMVA 2A67A 1YC5A 3DBRB 1JT2A 4M0PA 3VNVA 1L7XA 3GVIA 3R9XA 1N2JA