4HGOA

2-keto-3-deoxy-d-glycero-d-galactonononate-9-phosphate phosphohydrolase from bacteroides thetaiotaomicron in complex with transition state mimic
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
163
structure length
163
Chain Sequence
b'MKEIKLILTDIDGVWTDGGMFYDQTGNEWKKFNTSDSAGIFWAHNKGIPVGILTGEKTEIVRRRAEKLKVDYLFQGVVDKLSAAEELCNELGINLEQVAYIGDDLNDAKLLKRVGIAGVPASAPFYIRRLSTIFLEKRGGEGVFREFVEKVLGINLEDFIAVI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords acylneuraminate cytidylyltransferase
publication title Structural Basis for the Divergence of Substrate Specificity and Biological Function within HAD Phosphatases in Lipopolysaccharide and Sialic Acid Biosynthesis.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Transferase, hydrolase
total genus 51
structure length 163
sequence length 163
chains with identical sequence B, C, D
ec nomenclature ec 3.1.3.103: 3-deoxy-D-glycero-D-galacto-nonulopyranosonate 9-phosphatase.
pdb deposition date 2012-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08282 Hydrolase_3 haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4hgoA00
3WK6A 3PGVA 1QQ5A 2G1AA 3PDWA 2AUTA 4Y2PA 2G07A 5ALSA 3U19A 5ALJA 3P96A 2WF9A 1ZOLA 2EAUA 5AVWA 4Y2SA 2IA5A 2I34A 4YGYA 4KNWA 1WPGA 2B1QA 1Z4PX 3K1ZA 2P27A 5E0OA 1LTQA 3M1YA 5AM5A 1QH9A 3NIWA 2QLTA 5AW4A 2ZBGA 3ZUPA 1RMQA 1T5SA 2R8EA 3WK9A 2O2XA 3L0BA 5AKKA 2PQ0A 4G9BA 2BY4A 3OCVA 5ALNA 3AR7A 4YCNA 3ZVMA 5AM0A 1Z4LA 4KN8A 1Z4IA 3RFUA 3E8MA 4IG4A 4F72A 2YJ5A 3IJ5A 5T41A 5AI6A 2YBDA 3AR9A 1RDFA 4UMDA 4CF3A 2HEGA 3WKEA 3SF0A 2JGAA 3WKDA 3A1EA 4UATA 3IRUA 4Y3UA 1JUDA 3ZX5A 1Z88A 4I9FA 4KYTA 2HCFA 5IT4A 4Y2RA 3I1YA 4KNVA 3AR2A 2B82A 1ZJJA 2JAWA 4XQ0A 3U7GA 3QU7A 1RMTA 4XE5A 5AKIA 4BEWA 2W4MA 3KD3A 2EATA 3FM9A 3U7EB 5AW5A 4FFDA 4DW8A 2HF7A 3WK8A 1L7PA 2Q4TA 3OCUA 3QUQA 2NO4A 1XVIA 3U7FB 2I33A 4OD0A 3L0CA 3S6JA 5AVVA 1SU4A 4UM7A 4FYPA 3OCYA 3DDHA 4NV0A 1Q92A 1Y8AA 3QU4A 4Y2VA 1SWVA 3D6JA 2R8YA 2P69A 3ESRA 4NWIA 5AVRA 2WF6A 3I6BA 4J03A 2HHLA 3RF6A 5AW8A 5A3SA 3DV9A 3EPRA 3AR5A 2I6XA 4H1WA 3ET4A 2FPXA 1QQ6A 4J2TA 2WM8A 3AR4A 3ZU6A 3QX7A 1RLOA 5ALFA 4HGPA 3U7HB 4DFDA 2GMWA 2RAVA 3WK5A 4UMEA 5AIBA 4I9GA 2C8KA 2G06A 3AR3A 2HSZA 1YDFA 1J8DA 2B8EA 2B1RA 2ZOSA 4YIKA 1U7PA 2AMYA 2IOHA 3R4CA 1L7OA 1ZD5A 5AM2A 1L7MA 5AI0A 4CF4A 3HLTA 4KX5A 4FE3A 4UU1A 5AK4A 1YMQA 3E84A 2DQSA 5AKJA 2OBBA 3SLRA 2FUEA 3NASA 4JB3A 5AK6A 5AW7A 3N07A 1Q91A 5AK3A 2C9MA 4CNQA 2B0CA 2HDOA 3OCWA 5ALGA 3AR8A 4C4RA 5ALLA 1K1EA 5ALWA 4KX3A 4EZEA 1U2SA 3KZXA 3HYCA 1L8OA 4E88A 3AR6A 1KYTA 1U02A 2O9JA 2Q4RA 1ZD2P 3NAMA 1Z4NA 2NYVA 3A3YA 2HI0A 5ALXA 4EX7A 2Q5EA 3NRJA 3EF0A 3ZW7A 4HGNA 5ALDA 3A1CA 3DNPA 2G08A 3L8EA 3SKYA 4YCMA 2FEAA 1N9KA 4AS3A 3VAYA 3M9LA 4EELA 2GO7A 2WF8A 5ALYA 4XOUA 2D2VA 4HGQA 2JARA 2AH5A 2G09A 4AS2A 5IS2A 2C8LA 5ALIA 2HOQA 2ODAA 1QYIA 1S8OA 4MWOA 4NFLA 5A3RA 2YMMA 3ONNA 2MU1A 5AI8A 3QUTA 4G63A 4BNDA 5AESA 4HGRA 3N28A 5JJBA 5AKLA 1QQ7A 3OTQA 2FPRA 3IB6A 2HX1A 4BEVA 1TA0A 1Z4KA 2ZXEA 5AI4A 4XPZA 5ALHA 5AW3A 3J7TA 4ZEVA 1L7NA 1PW5A 3WK4A 3I28A 3QGMA 1O08A 5AW9A 2GFHA 4NABA 4GXTA 3W5BA 3OCXA 3U26A 1ZRNA 2AGVA 1RPZA 2OYCA 3W5AA 1YNSA 3N1UA 5AVQA 3B9BA 3DAOA 2FPUA 5ALTA 1XP5A 1RRCA 1RLTA 1T5TA 2CFSA 2WF5A 5ALEA 2WF7A 1RC8A 5AKGA 1RKVA 3ZWDA 3L8GA 4UM5A 4BX3A 3WGVA 5ALUA 5AW0A 5AVXA 1MH9A 1FEZA 2YN4A 3ET5A 2OA0A 2CFTA 5FP0A 2YMLA 1RLMA 1ZD4A 3L1VA 5AVSA 3KOOA 5ALRA 3ZI4A 2IOFA 4UW9A 4HYTA 3SMVA 1J97A 4UMVA 2OM6A 1AQ6A 3R9KA 1EK2A 1RQLA 3ESQA 4BYGA 4C4TA 1RKUA 4Y2TA 5ALMA 5IT0A 3E81A 3QU2A 1Z5GA 2EARA 2R8XA 1L8LA 5ALVA 4Y2UA 4B6JA 3KBBA 5AHXA 2GHTA 3QU9A 2ZG6A 4Y2YA 4AP9A 2CFRA 3NANA 5AVZA 4PNHA 5ALOA 4DWOA 4OHFA 2I7DA 4C4SA 3L8FA 4BBJA 5AKEA 2HF2A 2R8ZA 1Z4MA 4BNDB 1TJ3A 3QYPA 3PCTA 3W5DA 4Y2QA 2I54A 2MSNA 4Y2JA 1L6RA 2CN1A 3UM9A 1N8NA 1CQZA 1Z5UA 3KC2A 1CR6A 2YFYA 3SD7A 3R09A 4MUMA 5AK5A 3FPBA 5ALKA 4L6AA 3ZX4A 1U7OA 1NF2A 1O03A 1YJ5A 5A3QA 3ZWKA 5AVTA 4IFTA 5AIAA 3CZ4A 3QLEA 3WGUA 3GYGA 4L6CA 2WFAA 3ZTWA 1S2OA 3FZQA 2B30A 3SHQA 4CE6A 1Z4QA 1VFPA 4UMFA 3ZVNA 3QXGA 3WKAA 3UMGA 4O8CA 3CNHA 4EEKA 1ZRMA 3OPXA 4ZEWA 5AKXA 2WHEA 2YY6A 2IOFK 3N8GA 3U13A 2ZBEA 3UMCA 1F5SA 1Z4OA 1WVIA 3EWIA 1ZD3A 3PGLA 2W11A 3NUQA 1X42A 4EX6A 2X4DA 3N5KA 2FI1A 2I55A 5AW2A 1WR8A 4UASA 4BX2A 5AI9A 1LVHA 4BX0A 1SWWA 3BWVA 5AICA 3L0YA 5AM1A 2JAUA 4YH1A 3L7YA 4F71A 2FUCA 4DCCA 4HAIA 2IYEA 4QQFA 3MPOA 4BKMA 4EENA 3WKCA 1TJ5A 1EK1A 4ZEXA 2P9JA 3B9RA 3L1UA 3FVVA 2FPWA 5AW1A 2RARA 3L5KA 4HGOA 2QYHA 2VKQA 3QUBA 4UARA 1U2TA 2ZBFA 4GIBA 2ZBDA 2YMQA 1YS9A 2PR7A 3WK7A 2G0AA 4NAVA 2FDRA 5AM4A 3A1DA 3E58A 3I76A 5AVUA 1TJ4A 1RMYA 4YIHA 1TE2A 1WZCA 2RB5A 4UAUA 5ALZA 4CF5A 3MC1A 3MN1A 3KDPA 3WKBA 2RBKA 3ZTYA 4YCLA 3L8HA 4OFZA 3SKXA 3ED5A 2W43A 3QUCA 3TLMA 3OCZA 1VJRA 1NNLA 5AKHA 2FPSA 5ALQA 5AVYA 1IWOA 1RKQA 3ZVLA 2C4NA 5AM3A 3MMZA 2NO5A 3F9RA 4UU0A 2YJ3A 3FPSA 2HO4A 3EF1A 2JAOA 3FGOA 4RETA 3BA6A 5AI5A 3NALA 5AW6A 1RQNA 2YJ4A 4Y2XA 5AKYA 5ALPA 1NRWA 2C88A 2BDUA 2BDEA 4UAVA 3B8EA 1T9ZA 4OCZA 3UMBA 2G80A 2YMPA 3QU5A 4RESA 1YV9A 1VJ5A 2P11A 2PKEA 1ZS9A 1XPJA 4QJBA 1Z4JA 2B8JA 4JDPA 3W5CA 5AKZA 4L57A 2YJ6A 2GHQA 3QNMA
chains in the Genus database with same CATH superfamily
3PCXA 2PEYA 3WK6A 1YZQA 4MS3A 2HLDD 1QO9A 3PK0A 3ZXXA 1Q95A 5GM2A 4DMHA 2AA3A 3O83A 2IYZA 2R47A 4Y2PA 4OM8A 3CNOA 3HXOA 4N1AA 3CUSA 2PGIA 1AX9A 5FL7A 2HY7A 3LUCA 3BB1A 3R41A 3ID6C 1GSIA 2ZRFA 2DCMA 1MZPA 1QE3A 4WHMA 1RWXA 1YZGA 4F9EA 1D03A 1Q15A 3JXEA 4GMHA 1LPAB 4QUEA 3U16A 3WSVA 2GZRA 1N6IA 3L7DA 3KJXA 3OIUA 1UOQA 2RK3A 3TLJA 3S5JA 5CEFA 1GOTA 3VC1A 4OXQA 3NIWA 4NCIA 2QLTA 3ROEA 4A5OA 4MW0A 2FWPA 5B12A 5FA6A 4JXKA 4FGUA 1MO6A 4MCIA 1ND6A 2AEFA 4IFIA 4H7FA 5DN6A 2PH3A 4BJ6A 3D7SA 3NT4A 4XQEA 3HCCA 1EWVA 1NM5A 2OUKA 3CLRC 3L1JA 1IZZA 4W5TA 5A5DA 9ABPA 1UJBA 3ZCQA 4KREA 2CCGA 1RXIA 3ORYA 4YJGB 4Z0NA 1KYYA 1XI2A 3RFUA 3DCNA 3SI7A 1UMKA 1LF5A 2KWIA 2I67A 2PPLA 3CRZA 4FJ2A 1ZCFA 1KVQA 1NW5A 1CJKC 1DXHA 1QRSA 5EXPA 3EXAA 1RDFA 2I8CA 5JYEA 4H1HA 1FP7A 2B21A 4JN6B 4JBIA 2IYVA 1KEEB 1TIKA 4FJ0A 2J5XA 3IRUA 1NQOA 4DC0A 3A06A 4YJHA 4DJJA 3LUJA 4R2WA 4FD3A 2DECA 2VP6A 4QAQA 2GCOB 3ZWYA 4OHOA 2VHZA 3ZZNA 2YH2A 2W00A 1P1JA 1Y6RA 3LNTA 4KXFB 2JLZA 2KM1A 2JPDA 1R15A 1A82A 2GPWA 5J2TF 2QL5A 2C4MA 3WWYA 2X2EA 1CVLA 1ADYA 4LS3A 4YDSA 3C3KA 5H0IA 1PHRA 1ZJJA 1G20A 3BN3A 1PNVA 3BCSA 3PUHA 4QREA 2WU3A 4M0UA 4TM7A 1UEJA 1ONOA 5L6LB 2B36A 3KKQA 2QM8A 2NPOA 4J4TA 1XAIA 2BTEA 3BMXA 3KYCB 4P80A 4V24A 2HLNA 1K97A 3O31A 5TT1A 3AVTA 4MVWA 3SX4A 1BO6A 1L7PA 1N0VC 3DEAA 2Q4TA 5EHZA 1PR9A 2Y67A 4KDCA 2P5TB 4LOIA 2EHJA 1ISIA 4HSEA 2DX7A 2AYYA 3Q9SA 1T6BY 4ARZA 3SFTA 2HLPA 2H7YA 3VQTA 3PNOA 3DT6A 1NURA 2C5SA 4WMLA 2DY1A 4UM7A 4FYPA 1PT6A 1N9GB 4FNOA 3DZFA 1Q92A 3ANTA 3QLTA 4FGLA 5FI1B 3CBQA 1UWLA 2DT5A 5KQRA 4K03A 4UEOA 1LSOA 2GXQA 3H19A 3KBOA 4XUEA 1MOZA 1VE1A 2ONYA 4G1EB 2M6SA 4IIFA 4LI3X 5BQXA 4I1PA 1UP4A 4S3MA 2ZJ2A 4B4WA 5BWMA 1ZN2A 4HZGA 4YV1A 2CWWA 5JVDF 5IVHA 2XVMA 3TWOA 2QP9X 2QTCA 2FH5B 3EZYA 2YINC 4CT5A 4CL3A 4KZKA 4K3VA 1CEYA 2O8NA 4CKXA 4D3FA 1GUDA 2ZVPX 3F71A 4NMMA 3L4KA 4ZYZA 2P3QA 2ZTUA 3M5PA 4H1WA 3GFOA 1NRJB 1RI3A 1WBJB 2R8BA 2ZVDA 3KZVA 1R3UA 1F2DA 1KJQA 4I5GA 1QIHA 3LRTA 1ESZA 4MWDA 5DB4A 1QHXA 3LDAA 5ENDA 3E1GA 1HTBA 2PQ2A 1Q3HA 1X8LA 1GCIA 4HWPA 3S8MA 3MJFA 3EQZA 3W2FA 4Z5XA 4F5ZA 4JXZA 3O2SB 5A4AA 5TSDA 4J1TC 1A7UA 3W1WA 4POOA 5KI6A 5I8WA 1ZM7A 4YRPA 3VR0A 2AF3C 2IPOA 2MHCA 1M6WA 1E6WA 3UA4A 1JWLA 1ENZA 1R8XA 1VG0B 3CSSA 4YJFB 1F4VA 1E1CB 4BMXA 1OB2A 4U2BA 2JFYA 1MAAA 1KORA 1F4PA 3B9QA 3DQPA 3PPVA 5AH0A 4Z9BA 2H4HA 3BOSA 1XPOA 4LF9B 1EX7A 3C43A 1L7VC 2ZOSA 2JFBA 3CVXA 3NPAA 3R4CA 1ZD5A 5TQVA 1W8DA 1XLTA 3HDJA 1N5MA 1PFVA 4JP2A 3OFSA 4C6HA 3ZD8A 4HWGA 3K0HA 4HS9A 1Z22A 4PFJA 4WGFA 5J1TB 3HY6A 3Q7PA 1FJHA 2ZI7A 3SIRA 4F93B 2XMZA 3O1JC 4RTMA 3DBVO 3S55A 4F0JA 1I6KA 3H6KA 4Q3AA 2HV9A 1ZVVA 5G2OA 2P62A 4MUHA 4G4SO 1IONA 4OOFA 5A9SA 3WICA 1NPYA 4INZA 2P2ZA 4J3FA 1RTKA 1RE0A 5B3JA 5DMHA 5LLSA 1HH4A 3JTEA 4G4GA 4BVFA 2FRVA 2F3UA 1QB7A 1BN7A 1NA5A 2FOLA 2OO5C 3D8NA 3OLZA 5CVJA 3T6KA 4CNBA 1ECGA 1JG2A 3NG1A 3FDZB 4O3MA 4LEIA 5ALXA 3UICA 4DM3A 1ZGBA 4TMTA 1XEFA 3P0IA 2YWRA 5M7EA 2H52A 1VIVA 3B51X 2JH9A 3T34A 4MRMA 1JALA 1DX4A 1JS1X 3MTBA 5BW4A 2ES4A 4MIKA 2C0CA 2HWWA 2JB9A 3CZRA 1U0RA 4EHAA 3G2JA 4JIGA 1L1FA 2AOTA 2OB1A 1QHHA 4RSHA 3GZJA 1CE8A 3MWEA 3PJFA 4OHVA 5CT4A 3IP1A 3TL2A 3U3ZA 3W7AA 3R0QA 1VJDA 3NVDA 2WT4A 1W5EA 2GO7A 1HYQA 3NHUA 4ARAA 5B7GA 1CRZA 2PX3A 3E3OA 3RSZA 5BT8A 1I13A 3TZKA 4CM4A 5EPUA 1GGJA 3CPSA 4UU8A 3LOPA 5ALIA 4AKGA 2JFOA 1JQLB 4DBVO 1N2SA 3UK2A 1YVRA 4OK5A 1U8YA 2JIQA 5KS2A 1X7XA 1CUBA 2QMUA 1FDOA 4FHDA 1PL7A 1OWOA 3I72A 1W9HA 3SBOA 4BNDA 4FDUA 4ZMSA 4JC4A 3GELA 4YV2A 2QBYA 1OV6A 1VLVA 4TKMA 4WLFA 5HA5A 1XQ9A 4EEXA 1FSPA 1CJVC 5KIAA 3S8YA 1TQ8A 4FZRA 4YP9A 3H2HA 1YR9A 4URYR 5ALHA 3QRWA 4KDEA 4GF5A 4LSZA 2ZUFA 3K1JA 2VHWA 2HEIA 4LC0A 2WTNA 5HTKA 1PGOA 3KKZA 3PUJA 2R7KA 1TRHA 2YUTA 3CRQA 3E2IA 3I28A 4HYYA 5KCMA 1S02A 1Z7BA 4N49A 4F86A 4NABA 1JHYA 5J58A 4JYZA 2I4TA 4B3MB 4XVHA 4IIEA 4DQXA 1Q5PA 2AGVA 3DR5A 4EQ6B 4U7WA 2ZJAA 4LGVA 1DUSA 2WPDA 4AULA 1RJDA 1XP5A 1A1SA 1QNLA 3QKTA 4KQJA 1NBME 1SPXA 2XMRA 5EPOA 3TQFA 1AF7A 1RWVA 4G5QA 4IUYA 4JP1A 3W0LB 4EA8A 4F1KA 1BGWA 2I80A 3IVRA 3KR9A 4BTLA 3T5AA 1QC5B 5J3JA 3FDIA 4WZAA 1C0EA 3E8SA 2GA9A 3V7WA 4QUKA 2AI1A 1DDOA 1EFKA 1FCJA 2ZQYA 2GEFA 4OJQA 2AZ4A 1ZL0A 5LA6B 4RIEA 2OA0A 3BIXA 1L4UA 3CUKA 2AWNA 1GQOA 2OCIA 1JYFA 3PWTA 2VLBA 4XX1A 4RVSA 5BNWA 3CLUD 5EJEA 3HO1A 2L82A 3WGIA 1M6VB 2PGOA 1Y80A 4AZ3B 1P1CA 2YOHA 4UTVA 2E5LB 3U44B 4TKVA 2MSEB 1I1NA 1EPUA 5BUQA 2J0UB 3FVRA 3HSSA 3PF8A 1ZYUA 3HZZA 1AQ6A 2C3OA 4MZXA 4B46A 2ON6A 4J1NA 4EA6A 3TEFA 3VNVA 3ESQA 1IQPA 4MNTA 2HSDA 3EVBA 3QG5A 4Q7JB 1THGA 1PTKA 1JKFA 2HPVA 5LQMA 3R7FA 4FYXA 1NLMA 3QVXA 4ENSA 1IE3A 1T2VA 2YR0A 4L5BA 1RPAA 5IT0A 3C97A 1P5HA 1BE6A 4MJ3A 1E58A 3ZJYA 3HUEA 4WKGA 3U3OA 5BPFA 2EFGA 2VNKA 2WMOB 1EESA 4TMKA 4Y2UA 3LUHA 3HXQA 1DAMA 2E3JA 2X5JO 3UJ9A 2XMGA 4JX8A 4UEJA 4JLBA 1MC4A 3P4UA 1SXJA 2BI8A 1KAMA 2KMLA 3M1AA 4R1TA 4FTWA 4C08A 3RT9A 1K6MA 1K7SN 1DKUA 1J23A 4W1RA 3RASA 2VJQA 2ADFA 5IJAA 1YNOA 4RVGA 1GTMA 1FLDA 2IQ5A 5I6DA 1U5AA 2J9ZB 2RH9B 2F3QA 4UXIA 1PJSA 4JBHA 2WIJA 2A4MA 4FR0A 2I54A 4JJZA 5DHRA 4B74A 3WOVA 3PNLA 1C1DB 4WK2B 4Q3LA 3M4YA 3WSWA 2JLYA 3IERA 4Z4FA 3UM9A 3OOJA 3EJ6A 1CQZA 1KARA 2ZGVA 2XUKA 2ASVA 4BN5A 4GC9A 2QN1A 1PNRA 3ZCRA 1MO2A 3ONWA 2NU6A 4A0GA 1CY0A 3VRHA 2R6GA 3WWEA 3IUSA 4PCAA 1ARZA 1UC8A 3OJFA 1NF2A 1ISGA 5EEHA 3RKSA 1CT9A 1Y42X 1Y5RA 2YXEA 4KVFA 3ENNA 3W77A 1KJYA 2QYTA 3OE7D 4OX9B 1P81A 1GJRA 5FOUA 3STXA 4GGMX 2Y0BA 4LHYA 5A0FA 4BLQA 4CFYA 4OGKA 2C1EA 1TZMA 1W8IA 3FHOA 1GPMA 4MW1A 1U0GA 1BD4A 1V3UA 1B8OA 3FZQA 3LX8A 3QA3E 4PQEA 5FL7D 3HRKA 2J4CA 3E22B 3NTLA 1UMBB 1CTQA 1EFVA 2LE0A 1K8RA 3PD7A 4GHWA 4HF7A 3KKLA 2HIAA 1KTIA 3CVYA 1NNEA 4E15A 4ZYYA 2G0NA 5K6AC 2HDHA 1KHHA 3RC9A 3HLYA 4REQB 1M1XB 2Y9MB 3CUUA 1KQGA 1WCIA 1BMFA 2QTZA 3D1JA 1TF5A 2V65A 3DO8A 2A3NA 5A05A 4FUTA 1P6QA 4WJKB 3BHIA 4L07A 3SEZA 3CISA 4PSVA 1T2NA 4H6VA 3WVNA 2ZRBA 3WLRA 1G20E 2XNHA 1YSCA 3EA0A 3EJWA 3PKIA 4YJ3B 3PR3A 2AW5A 2EWWA 5DN6D 1ZNZA 3KXPA 5E2BA 4DHWA 3JQAA 2GAIA 1MB0A 3U81A 4JJ6A 2I55A 1Z6XA 4DRXA 2CLHB 3Q7TA 2VNIA 5JC1A 1DXQA 4PLTA 4CDMA 1Q22A 1TYZA 4BX2A 1N33B 1MQSA 3NHLA 1H2XA 3O47A 4H35A 3PQ2A 4LK3A 3RUCA 2QIPA 2PYZA 3PGKA 3B5EA 1THZA 4OLJA 3UMRA 1WXXA 2YYSA 3R23A 5CB4F 4EGCB 2HSEA 1GAEO 3IPCA 3SHWA 3OSZA 2HPZA 1FRNA 4ESHA 5F98A 3L9WA 2J9RA 2OUIA 2JFZA 1IPFA 2PBFA 2SKDA 4FWIB 4TM8A 1GVHA 2FZLA 5IC6A 3SZUA 4C2AA 5EYPB 4A73A 1RZVA 5GGYA 1QH8A 1KRWA 3L4JA 1VKZA 1UDWA 1Z83A 2A14A 4GH5A 4OGGA 4CQJA 1L4GA 1E94E 2NV2B 2QUJA 3GJ6A 4MQEB 1JQJC 2YIJA 3DEHA 4XYGA 4CM9D 2QYHA 4EVRA 5LWQA 2DLCX 4KWEA 1AY0A 3BIJA 5JHHB 3TXXA 1AV6A 1SQFA 1E3TA 5AHKA 3PGMA 5JZOA 3NOVA 3ME5A 1YDMA 3ESCA 4H18A 4RVHA 5IJWA 2GARA 3ZV7A 3FJYA 2E82A 5BR4A 4KLZA 1TJ4A 3CLUC 4GDFA 3C74A 5LCXA 4UJ3A 4N0MA 3CZAA 2A5DA 4R71A 4BAUA 2IDKA 2N3ZA 2QDXA 1BN6A 2O7VA 3RYFB 4BMCA 1WSAA 1JH8A 4LHWA 2BUCA 2XPCA 4OMCA 4HX9A 1J70A 2G77B 2BM0A 2ZJ1A 6REQB 3ED5A 5D1HA 2P4QA 1I0ZA 1K86A 1KH3A 1REQA 4I0WB 4A82A 1KFEB 3LYAA 3R5JA 3HRHA 4DSAA 3PUWA 2BGJA 2OEPA 5TXGA 1Y5IA 1VJRA 1CUGA 1XVVA 2MOKA 6GPBA 3BKWA 1J42A 2X22A 3EFBA 1ZN9A 1UODA 1LJLA 1H94A 4EGAA 1CZUA 2WFLB 3QI7A 1P7CA 3FI0A 3PNVA 4LYAA 4NCJA 4HTAA 3ZGVA 3R3XA 4OM7A 4PAQA 2HAEA 4R1LA 2RB4A 1DZ3A 4H08A 3K9LA 3S2UA 3AIMA 2BW0A 5IZ4A 5JATA 4NCAA 1R18A 1IN8A 3EGCA 5FNVB 1UZNA 1QTNA 3T5GA 2V3WA 4ARIA 3A6HA 3P9CA 4PYIA 3L0DA 3K20A 4KN6A 1T1SA 3AU8A 2IEDA 4H3HB 5KQLA 2GPNA 1EAMA 3HE3A 3QVSA 2EKDA 3DM9B 3QF4B 5LMZA 3D4OA 1TECE 4F92B 2CSXA 1C30B 5KVCA 3UHAA 4JWKA 5JNRA 1AF4A 3AVXA 3UYLA 1BROA 4RE6A 1ZC3A 4RD4A 2FN4A 5JLJA 1Z4JA 3VNSA 1QE5A 5FA8A 1KO8A 1YVEI 1JEJA 2QD5A 4L57A 3BXGA 4C2UA 3PD1A 3OF5A 4X95A 3FSRA 3TR0A 1RJEA 1H0SA 2BFCA 5FLYA 2PSSA 1QF7A 1NYTA 1JVNA 4Q34A 5HQJA 2XUGA 4IJWA 4AQDA 3CH6A 1PEDA 4K6GA 2FN3A 2VZ9A 2O4CA 2XZOA 5IVIA 1B1CA 3VDQA 1T6YA 1ONNA 4I66A 9GPBA 5F1PA 4EI8A 4P84A 1N3LA 1RLUA 2QUHA 2RCNA 4TWJA 5FPTA 1UOOA 4PZAA 3TS1A 3A6DA 5H81A 2PJDA 1JECA 2P27A 2AXEA 1XCJA 1KKMA 2QNIA 4A6EA 4DR2B 2LCFA 3NATA 1Z2CA 1XSEA 3A32A 3F3YA 2LDBA 4OV6B 4XARA 3COZA 4CG2A 3BF7A 2VZ8A 1AZSC 2AT1A 1E3QA 3IBGA 4TN5A 4QFMA 1A8HA 1U90A 1I5OA 3AQIA 3SJ7A 3ZIDA 4BO2A 5KAMA 5KC9A 5JCJA 3SIWA 2K7FA 3I5UA 2JFQA 3QXJA 5L53A 5FBLB 5KTKA 5HCIA 4MI6A 3T4XA 2WD7B 3AR7A 3ZVMA 3QK7A 1JQAA 3RHSA 4OGWA 4FYYA 3K9FC 2BHTA 2V5UA 1DIHA 3HFSA 4F3CA 4MUJA 4H16A 3TBKA 1ZWKA 2ZBPA 3FXAA 2M32A 4D3DA 2VQFB 5KO2A 2JLCA 4IRXA 2G4LA 5ERGB 1EVYA 4QWMA 1U11A 2OC4A 5FR1A 3EA5A 2GUWA 4RXTA 3CE6A 3NM4A 3V1YA 1SB9A 2QRGA 4UD6A 5CJJA 1VPWA 2QT9A 4EUHA 4KOAA 1QV6A 3DAFA 5ENZA 1CUJA 1X9GA 2V7UA 4GBJA 3TMKA 4CQMB 2ZB3A 4HMPA 3GLGE 1QVZA 4YPFA 3CEPB 3TLGA 3KZMA 1YKSA 3VHXB 4D56A 3M6LA 4BLUA 4F4DA 4NSNA 3A28A 4N7BA 1B00A 5IFKA 3IKTA 4RIIA 1RVDA 1VL6A 1TIBA 5CURA 3HN7A 4WZAE 4R8VA 2XQGA 1E3LA 1IC6A 3ZE2B 3RHFA 1I4TD 3BB3A 3CCCA 4MV6A 2VT3A 4ARSA 5LU8A 4F2HA 3V6MA 1VCHA 1PNQA 1BJRE 1B14A 1U2RA 3HKDA 3MTJA 5FORA 3U7EB 4AJJA 3ZKAA 3DDOA 1NVFA 4WJLA 2VH5R 2EBFX 4HDKB 3X1WA 2Q5CA 1QGZA 2GILA 3Q1KA 4LZAA 3A4YA 3T9CA 2BV3A 2VTVA 2ZRNA 1NQTA 1NJSA 3JASA 4DLSA 5BV0A 3HI4A 5COBA 5CPBA 4KAFA 4EKYA 3UFBA 1V16B 1QAQA 2I33A 1VKOA 4JMPA 1UM8A 2VDPB 3SIXA 1IBLB 4JKOA 1IHDA 5DYYA 2EOAA 2YV3A 3N0WA 2OHFA 1T0BA 1M34B 1Z7WA 2PQMA 3I2FA 1J5PA 4G8CA 4US0R 3TNDA 3RK0A 4EGFA 5J2UF 2ONJA 4D96A 3VR5A 3FHCB 4M1ZA 1A8UA 3P4YA 1SQGA 2QM3A 4U2EA 5CAEB 5H68A 1QQAA 5CFQA 3EGXB 3AP1A 2PX2A 1TPYA 1MRZA 2G88A 1KC1A 3ANMA 4NWIA 4EHHA 3F2IA 5AVRA 1CIPA 1DIOB 2CDBA 1Q0SA 4FFWA 4AKEA 1P4HA 4JB0A 3OQBA 4HGZA 3HEBA 1WP9A 4O4HF 3DE0X 4ML3A 4EDHA 5JH7B 1X1BA 3KWJA 2WJZB 4RVFA 1A98A 5K51A 5KMGA 1HY3A 1JJVA 3C8UA 2C31A 2Y1XA 4N7JA 2BGRA 4JYBA 2GBFA 4P4UA 4O4LB 4ZCTA 5DM4A 4QUDA 1WNTA 3Q6MA 4FZ3A 4G24A 1A7KA 4ZKEA 2JCXA 4QOJA 4B1FA 1LBEA 5IANA 3PQ6A 5AJYA 4DUPA 4HGPA 1DBVO 2B7CA 2OBYA 3PTZA 5AVJA 2J4DA 3VKUA 3MCUA 1T5BA 3W8FA 1PYDA 4YRFA 3CX3A 1YQ9A 3T4UA 3WYDA 1UBLS 1OWNA 4LOAA 1G5RA 4BGDA 2VDWB 4NG4A 3H2IA 1J8DA 3KM0A 2B1RA 1L5NA 5TE9A 1TYEB 4FNGA 3WQHA 4LXIA 1BE8A 1PR5A 1FJ2A 1XZLA 4B84A 1JEYA 1U7PA 1AB5A 2AMYA 4L8YA 4WD3A 4EFMA 1H5UA 3NGMA 1WKCA 4F5WA 3OQHA 4JQSA 4BV2A 1XMVA 1YS2X 3LQFA 2A1TR 2AR9A 1I9GA 1ESMA 4GR9A 4Y1RB 3SDZA 1U9YA 3EZ6A 1M66A 3LPMA 5IULC 3T7AA 3WLMA 2EFHB 5DHFA 2G9NA 4ALIA 5K20A 1I4EB 1NFRA 1YRHA 1NV8A 1ZL2A 1SXJD 3RRBA 3V80A 2Q0XA 2ODWA 2B25A 2QEQA 4I6EA 2J85A 1ZIYA 1LU9A 3IP9A 3OM0A 4O2BA 5I01A 1Q91A 3I0MA 2A5FA 2IW1A 3P9XA 5AUQA 4JFAA 1QOZA 2XRFA 1HDYA 5ALLA 2IHJA 4KX3A 3SYLA 1L5GB 4ZI2A 3CMMA 1K7YA 3JYQA 3LW8A 4OQPA 1O6CA 5LYYA 1B7GO 1A8PA 2XB4A 1JR3D 1KO5A 4UM9D 2ID8A 2ZRLA 3CBGA 3AONB 3G0OA 5JLAA 4W8HA 1R9GA 2KLHA 4Q19A 3REFA 3AVUA 3MIIA 5JDCA 5C7OO 5B3JC 2XWPA 1ILWA 1UP6A 3I2IA 3D59A 4JJKA 5EIAA 3WZMA 2ZR0A 1JR6A 4O59O 4N6OA 1QVVA 2OP1A 1UR5A 3FOBA 3K9HA 1US8A 4DPMA 2I9KA 5EGSA 5EJ8A 1MO5A 5BN4A 2RHOA 1VECA 2ORYA 4FFPA 4AQYB 2GJ9A 4YUVA 1U5BB 2WZQA 1MAWA 3GAZA 3QBEA 3I34X 3RBVA 2JK1A 3TTTA 5A0TA 3P27A 1E1QA 3LC2O 4E12A 2DERA 3D4LA 2XNCA 4JLWA 4FLMA 1WDWB 4TYMA 5CLJA 4RCYA 2W6MA 2HT1A 2H2WA 4U9UA 4K6KA 4CMIB 1SQ0A 4YAKA 1IRXA 4BMOB 1AXEA 1DC5A 1NP3A 3DUFA 3GL9A 3W2IA 4NFLA 4HFNA 1JB1A 4HSGA 5JS1A 4NATA 5EJFA 5DNYB 1G7SA 2ORWA 1AOXA 3HVHA 4OFBA 3SS9X 3G8AA 3KEMA 3D5EA 5UKDA 1UH5A 3L01A 4HVCA 1D2EA 2WKQA 3LLCA 3NHYA 4AMGA 1NV9A 2FPRA 2GFQA 2PHZA 3U17A 4BQOA 1KZ1A 1TA0A 1WB6A 3TGWA 4G4JA 2FW6A 4IV0A 4NAHA 1XVLA 2ZB4A 4L9AA 3AUAA 1USKA 2A67A 4RTNA 4DT1B 2XRZA 1YBVA 2BMWA 4EB6A 1PUXA 2DLNA 1RYBA 4POAA 2RHLA 2PJRA 4KSBA 2XH8A 1WZUA 1A5SB 3D6NB 3W5AA 1JDJA 1FXSA 2P6UA 4LG1A 2FPUA 4P98A 4GVPA 1HTWA 1YBMA 4ARUA 4FHZA 1GU7A 3QJGA 2QLMA 3R5SA 5AVKA 4RS4A 1UPXA 3LE8A 3EEOA 2VTBB 3I42A 4ZU1X 4F6RB 3AI7A 4MLPA 3ZYCA 1ATZA 1C1HA 4UM5A 1LDEA 3VU1A 5A04A 5KWVA 1ZSYA 4EATA 3H97A 3RAPR 3WYCA 1Q7GA 3H1TA 4ZDIA 2LIPA 4E5VA 3H17A 3F6YA 2FNAA 3RTAA 4DLWA 2R3SA 3UPTA 2CFTA 2V7XA 5FP0A 1ND5A 3ZVKA 5FUMA 3RANA 1D2NA 4ZVVA 4X7PA 3GD7A 1M0WA 2QN7A 4PHFA 1FLVA 3H11A 3Q85A 2O14A 3P2YA 2OCBA 3Q8MA 3SHTA 3HU1A 4TLMB 1USWA 4O4JF 1R9MA 1UC4B 3OFND 1E7YA 2VK4A 4V1CB 3WWPA 3U3MA 2QZJA 3OE4A 5BWNA 1ZLYA 4DZZA 2JAQA 3NT5A 1KP3A 1IXSB 3NI2A 3KJHA 1PJRA 5LUAA 1FFXA 3BWDD 1H0HA 1KJWA 5LP6F 5EOVA 1N2HA 1P5RA 4Y2TA 2ZRAA 3OX3A 1NULA 4JR0A 2CV2A 4C0BA 3A2NA 2G9QA 2ZZKA 2LP4Y 1NPTO 3UGKA 1G1MA 4H6WA 5K0JA 4QSMA 4JBXA 5I8ZA 2D5AA 3C7KA 2PR2A 2GHTA 2Y1FA 3RR2A 5CA1F 1OY1A 4BHTA 5BVHA 1PUIA 4NPAA 4YRRA 4UUOA 3DLCA 2HQ1A 4MPTA 2O2EA 3PLNA 4KGDA 3TTSA 1O9GA 1V7PC 4HBGA 4L4ZA 1SCNE 1U04A 4Y30A 2LKCA 5DNWA 1GAJA 1N2ZA 1SUEA 1TC1A 3LZCA 4BO6A 4JHXA 2B92A 1KI7A 3ENQA 4G01B 3CX4A 3HDVA 3QEMA 1EBUA 3EXEB 1SXJC 3FGPA 4YLGA 2H1IA 2Q3JA 3A9TA 3IVGA 5CCDA 4LYJA 4D4JA 3IAHA 5IXYA 1Z34A 2ZZMA 3VTZA 2BEWA 2BZGA 4JZYA 2V0GA 3OZXA 2OK8A 1DTWA 2O57A 5E4JA 1WY7A 2FKNA 2Q5LA 2ZQZA 2XVYA 3CNQS 3JYPA 4X97A 5FUVA 3KAJA 4RBNA 3RF7A 2F1IA 3KKMA 3GC6A 4HH4A 4OIFA 4P38A 1D4OA 1KK1A 4IIYA 2BCGY 4K9NA 2GPAA 4TWRA 4BGUA 1MW8X 3ADDA 4MXDA 3WL4A 4BNYA 1WB9A 3BT7A 4M6WA 1DINA 1QB8A 1VCIA 2P30A 2CJPA 2I71A 2PZEA 1KC3A 4L78A 5JQWA 5K2OA 1M2WA 3HCWA 2ZI3A 1ITZA 3DT9A 3KAQA 3LGSA 3NNSA 1Y1LA 2ZBQA 3UV3A 3LT0A 4RY9A 2GJAA 2JL1A 4DG8A 2B6NA 1QDEA 5BMOA 4B0PA 1XNRB 1CDDA 4HX5A 5BW5A 2Y05A 4FX5A 2FKAA 3NGXA 4G07A 4IOLA 1HDOA 2XTMA 4KUGA 3FLEA 4TKLA 2R68A 3CUVA 3EODA 2NO9A 3BRCA 2BYTA 3ML1A 3PP8A 4OYLA 3UNXA 1MQAA 4FYKA 2IOFK 1GUBA 2PWBA 1SIOA 2QXTA 4LZPA 4YRGA 3CPEA 3C39A 3ZHTA 3QKUA 2J7KA 4QDZA 3FLBA 4DUYB 2R8RA 5G0VA 3S2YA 1HO3A 2HADA 2WDPA 5KJ1A 3MRTA 3O1LA 1YA8A 1KDYA 3MT0A 2Q6TA 4XM1A 5KTOA 4JUBA 5EFZA 5JCJD 3FOCA 3ZOKA 4N76A 1XXHB 2PA3A 4H1UA 1E77A 1E1CA 1G66A 3BMQB 1VHJA 2COUA 1BXKA 1SHZA 3ECAA 5HZGA 5AWFC 2WYHA 5T4BA 3ASZA 4NBKA 4OA8A 2Q6IA 2YVUA 3CRMA 1HF3A 4RORA 3ZZMA 5KQSA 1F8FA 1Z74A 1Y1QA 3EH2A 4NF2A 3TLXA 1L3CA 3I39X 3N7AA 5DDIP 3TPFA 1GG5A 1GGKA 3X44A 3M4XA 3PITA 3SEFA 5I7OA 1PBNA 1GCUA 2EXXA 2ZSJA 3IAXA 4AWXA 3K92A 1P4AA 1FS6A 2EV9A 1CY6A 2XDQB 2XJ4A 3WZLA 2YHSA 4EENA 5LOVB 1MO3A 3R4VA 5DHSA 4B82A 1QGAA 3CUTA 3O03A 2OOKA 2WJWA 4JS0A 3RBZA 3FR8A 4XW2A 2C77A 1I9CA 3D3EA 1NW7A 3C45A 5EWLA 5HIIA 1WX1A 4B81A 4C88A 5CITA 1UBUS 3I9V6 4R40A 3ZWNA 3AB8A 2FE1A 5LUBA 3F90A 3R44A 1OQAA 1J0BA 2OGWA 3RSFA 4B7UA 3WTBA 1E1RD 2P9ZA 2DTDA 3HMQA 1CUFA 3I6MA 2XUJA 3PZBA 3JTMA 5BW8A 4YIHA 3PB3A 4CF5A 2BOVA 1N6LA 3RS4A 5FO1A 1B42A 1T29A 3CWCA 3GZ4A 3U3DA 4GX2A 3FCXA 3VJLA 3BKXA 4LF6B 2J3EA 5I8PA 3DZHA 3DV0A 4JLOA 2WFMA 4RHTA 3IPAA 3BM5A 4BVJA 4E7OA 3B6KA 5JJ5A 2C8JA 3JATA 1THMA 4NEGA 1FMCA 1MX1A 4OAQA 4WOBA 1NIJA 1Q1AA 1C81A 2JFUA 1SXQA 2Y27A 1S2LA 3JX9A 3OJEA 1DP4A 1QCDA 3PSAA 5FT9A 4CUKA 4EYOA 2BP7B 5AVYA 1IWOA 2CDRA 1RKQA 3U4CA 3X1MA 5B7QA 5ICCA 1ZQ9A 2GK3A 3IDZA 4ZYVA 4R54A 2R44A 2VPZA 1VLLA 4KODA 3BRWA 2P91A 3FGOA 1GA6A 4FYJA 2PD6A 4M8KA 3GYBA 2N46A 1OLSB 1R8QA 5AI5A 5EEGA 1E79A 4TKUB 2C0QA 3WRXA 4WADA 4Y2XA 3UCFA 4IHJA 5J59A 4D92A 4NXNB 1XGKA 2IITA 2Y0CA 2EYUA 3AO0B 1U81A 4PANA 4Q66C 5CU7A 3FYUB 1NNI1 2Q8NA 1U7TA 4QOIA 1J5XA 1U1IA 2XA9A 2IODA 3IE0A 3G2LA 3OP1A 1V8BA 5EMHA 3ZWCA 4LPKA 4MA5A 4RESA 1C41A 1U3DA 1Z73A 3COYA 4JNCA 1FP2A 5AQEA 3UK0A 4YMHA 3PLAE 2O4UX 3VYSB 5C4IA 5KZMB 3F1KA 3LY9A 4RFSA 2PRIA 2WVHA 4DIUA 3OLXA 1MVLA 2A1UB 4I19A 2CMFA 3H2YA 4LY6A 3R7NA 4E4TA 3G2QA 2YWGA 1VSUA 2HJVA 4FSHA 4GI7A 1SULA 4IDBA 1VGVA 1PU2A 4AF7A 4CV2A 2CHFA 5C8YF 2C1ZA 2WBLC 2BHSA 1WUKS 1HFEL 3GGGA 3VH1A 3JAKB 3ZN2A 4EDFA 1DOZA 3U19A 3VR4H 5GM1A 1H6BA 3I8SA 1JG6A 2JJ1D 1AS2A 3ZZTA 1KZ6A 3DPUA 5K99A 4RTSA 3O1IC 5TGDA 3C6KA 2BKLA 2WJ4A 3KZOA 1L1RA 3QFFA 1T9BA 1I7LA 3FAKA 2FW0A 1AKVA 5BO5A 3QPWA 1KI9A 3EZ7A 1KKLA 3NRBA 4RH0A 1I10A 1QH9A 2B83A 2WWVD 3RRNA 3DVLA 3BWEA 3D7RA 1GZSA 3I9LA 4NQRA 3PXEA 2ANCA 2J9GA 3LWNA 4TZKA 1L6IA 3LY5A 5T4EA 3OZFA 1AGPA 4DAOA 5H9WA 1XNQB 1EM8B 2GHIA 3T9BA 3FPHA 1MJNA 4DADA 4KYUA 5D5PA 1YUNA 1ORTA 1FX0A 1JZQA 2GN4A 2IPLA 4GRAA 3IUJA 2ODQA 5ESWA 1WMDA 5JJKA 3FIJA 1P4RA 4UQPA 1L1EA 2CNLA 1EMDA 3U7QB 1N5RA 5ALNA 5A4KA 3Q72A 1UOEA 4D9FA 3EW7A 2CL0X 2FPGB 4MCHA 4MRVA 5IDXA 3FZNA 2RH4A 4TROA 1XMJA 4L5CA 1A97A 3TSZA 5BORA 4DV2B 2FZ5A 3D6AA 4MVJG 3UT0A 1QU3A 4HQKA 1QS0B 2G76A 1W36C 2D6FA 3G1TA 3UHOA 4UFPA 4QDJA 1X1RA 3IELA 2FF5A 5DTEA 3AM1A 3IB3A 4XEHA 4E1VA 1C2YA 1DJPA 1T1EA 3RU3A 4RIHA 4IO0A 2CV0A 2X58A 1HE5A 2X8JB 1LCIA 2P9TA 3D0RA 1NTOA 4K7JA 4QASA 2YJNA 5FDFA 1L4MA 1SBTA 2W2KB 3OE5A 1E1QD 3QVGA 2VTEA 3WRVA 2IYTA 5BT9A 2WYWA 4BB5A 4M36A 2J7PA 2VNHA 4K8OA 2JIZA 3KPWA 5F1YA 3HMKA 1DUVG 4Z9AA 3E7PA 4RV9A 1R5JA 4JQZA 4RCVA 4RPHA 1KMIY 1C1DA 2H3EA 2FU5C 3GFPA 3H8SA 1MAUA 4JAVC 1TM1E 4CU5A 5LN1A 5J2TB 1QNFA 4JBNA 3W90A 2MYNA 4NYJQ 4TMWA 5EJAA 4GKKB 1RYNA 4YROA 4WKPA 3C6QA 2XITA 1FXWF 4JDUA 4QX6A 5AW5A 4FFDA 3V7FA 4Q3DA 2K7ZA 4AP5A 3BYZA 3EGDA 3PQ5A 4MIEA 4QQRA 4M4SA 2OD9A 3JVDA 3U6BA 3K6KA 1OBVA 3U7FB 1UMCB 3GJ4A 2VRWA 5FD8A 1WJGA 5TRTA 3RUEA 3L43A 3S6JA 2NPIA 3D6UA 3IA7A 4UOEA 1M2NA 1JDVA 1PE0A 4PYOA 1CJTC 4DLAA 3UBMA 1Y8AA 3EAFA 1A2OA 1I0IA 1OYYA 2DJIA 1WY5A 4LKRA 3GHHA 4U02A 4P3PA 4HG2A 1UZLA 3AHHA 3ZBTA 4ZRDA 4DPLA 2OLEA 3E3AA 5ITSA 4J4BA 4TWZA 2F59A 4I4TF 1G59A 4KR2A 4QLOA 3I6BA 2CFOA 1CQJA 2HHLA 3EVZA 5JWRA 3K9WA 5AW8A 5HZHA 4QU5A 4ZD6A 5DGIA 4DSUA 1Q77A 1HBJA 1TEZA 2Z1MA 1W88A 4MW5A 5JVDB 3O94A 4QA9A 5JASA 1QQ6A 1F1JA 1BXGB 2O5CA 1FSFA 3AR4A 4KE6A 3ZU6A 4J43A 2EEPA 2J5QA 4FGZA 2GYWA 4I1VA 4LRYA 3AUUA 3UAYA 3OETA 3FBGA 1P60A 3AHEA 2Q9BA 3PFHA 4P36A 4DARA 1JQ3A 5CEEA 1JL3A 2PD4A 3B48A 1B8UA 3IHLA 2QI9C 4PVDA 5GONF 421PA 4C03A 2HPHA 3I8XA 4JP5A 3WDKA 3AV0B 1NMSA 5CX1B 4I3HA 5KNLA 2H9IA 2QSYA 5T57A 3KPYA 2PMCA 4YMSA 4MVJA 2ATVA 1O58A 3FYSA 4IDDA 4BO8A 5DK6A 2XIJA 1LSJA 1J2RA 1QF6A 1NJ6A 2VHXA 3NPMA 9MHTA 4MLCA 3T54A 2XVAA 4LQLA 2QAGC 3WY9A 2V7TA 1IULA 2G72A 4IV5A 1C7QA 4CKBA 3ZV5A 1EP9A 1YS6A 4GVLA 4DLVA 1ID1A 2I1LA 5EKSA 4JVNA 3U6KA 2GM4A 4J1QA 1Q74A 1M7HA 2WNIA 2BKXA 4UBJA 4A9AA 4J16A 4BIIA 3D54D 4MVJP 3F8TA 4BO7A 2P8SA 1IOZA 3DZJA 1BVUA 1SHLA 2Q2WA 4H3VA 2YBEA 1E9EA 2XUHA 2A30A 1QLWA 1U3FA 2ERXA 3EBOA 1RAGA 4OXRA 1PK7A 3G2KA 1O5OA 1SBCA 4PNEA 1U9IA 4S1NA 5IAAA 1KETA 4ZGBA 3PTAA 2P5SA 1ODKA 2OYSA 2OD7A 1Z36A 1BCRA 2QW0X 5CTJA 4IDFA 4EJ6A 3AR6A 1CR2A 4CGYA 4HLQB 4ZQIA 3K35A 1XR3A 1MUUA 4ZDWA 1NUTA 2CUTA 3ED1A 1T0HB 4UHHA 3A4TA 1EWQA 1JFFA 4UJ5A 1XEWX 3F46A 4M21A 2P68A 3GO4A 1FPQA 2DTEA 5GY7A 3LX4A 4ETWA 2F3TA 4KR3A 2QTMA 4G5HA 3HDGA 1NF8A 4M9QA 2JEOA 3TE7A 5G4KB 4N4AA 5MDHA 1CR4A 3OQIB 5H3CA 5JDCC 2IWRA 3ZHZA 3D4NA 4ZZIA 1STOA 4UZSA 3JQ7B 3KVOA 1NT2A 4L95C 3ZDCA 3EVAA 3PEVA 2C2MA 1II0A 1LH0A 1M0TA 5C2JB 2JARA 3AKZA 4UUBA 4UXHA 2WG2A 4FFLA 2LV8A 1C1YA 4KBFA 1P2BA 3IVAA 4GWLA 5INTA 3PL5A 3TCXB 3ZQJA 1NVMB 4DC9A 3BSYA 1S8OA 4ZAWA 1NKTA 3ZIAA 3A27A 4WDRA 1AO0A 2QG6A 4I3GA 2GKSA 4L50A 3QF4A 2ATIA 4MUBA 4ZT7A 3RSOA 1VA4A 1UT8A 1N5DA 1Y7TA 2JCVA 4BXOA 1E69A 4AZ0B 1KZ9A 1VZ3A 3TUIC 5CYGA 2OBMA 1AZWA 3TLYA 3RADC 4DNQA 1Z4KA 4C04A 2H2FA 1WA5A 1MX3A 2HZBA 1NUQA 1YZFA 4LY0A 4L22A 4R31A 5HJ2A 5KCZA 1TAGA 1H5NA 4PY2A 4DZRA 4C0JA 4X6YA 2BFDA 1JR2A 1U8XX 2O54A 2B5VA 3W5BA 2QRZA 2XW6A 4CLXA 2FZKA 1RPZA 1TZ2A 2WAAA 5KWJA 4NOKA 5DBOA 3FDFA 1TT5B 2CXHA 3N1UA 4PTLA 4A8JA 3G5TA 2AHRA 1K63A 1UKAA 5AUOB 3DYIA 4BMVA 4B3SB 5ALEA 4WWHA 4I1UA 2PSDA 1DXYA 1YR6A 2AFHA 3MWJA 4HS4A 5DO9A 3RRZA 1N6NA 4DQKA 2AKAB 1E9SA 1ENPA 2NZJA 3GU3A 2B37A 1KI6A 2WA2A 4IXWA 4WSOA 1SURA 5KVQA 2HR1A 1PLLA 5HJ7A 4F8EA 1MH9A 5BW6B 1JDBB 2VWHA 3BGDA 4AJ9A 2AFRA 4C1BA 3ET5A 2N1MA 3IE2A 4CTKA 5B1EA 5T41A 1TD9A 4I81A 1AHNA 1BS1A 1J7JA 4FOOA 4OHBA 4PO1A 3RYIB 1EA7A 3CW8X 3FDXA 5IZCA 3AUXA 4I9HA 5ALRA 1A8IA 2J3IA 3QPVA 1XRPA 1DKPA 2EL7A 2IOFA 2YW9A 1P0CA 3K9BA 1NVVR 3KU4A 4Q9DA 1KRHA 2CGEA 2QZPA 3WLHA 2ZSKA 3IR5A 1OF1A 4IDEA 4OQFA 4RTKA 2XRMA 1L4FA 4HJRA 4Q01A 5ADWA 1IMOA 1SVKA 1JE0A 3DDNA 3KS9A 4GQBA 4ZC8A 5BSWA 1I0LA 4D9GA 4KZPA 4C4TA 1M5RA 3RAGA 1PIWA 4BGIA 1RBMA 4WXEA 4KQ6A 5E9AA 2IX3A 2BUBA 3KUUA 1P7WA 4QDUA 1M8PA 1P2FA 1VYVA 4XWKA 2N1BA 5TIIA 1E59A 4WRRA 3ZD9A 4C01A 3Q11A 4ENTA 2OWEA 2XMBA 2BEUA 1D6SA 1T9AA 5L6MB 2CNDA 3O21A 3I61A 3KTDA 2ZG6A 3H4MA 4NY1A 2VYCA 4YP6A 3WXBA 1QYWA 2PSEA 5MGNA 4XSVA 1V9LA 3I0ZA 5AVZA 5J4KA 1RT9A 2I7DA 4TTTS 5F33A 1WVGA 3HJHA 3AKEA 2IFTA 2XZLA 4EPYA 4D3SA 3BRWD 1MDFA 2EF0A 1M7GA 2Z9DA 3ADKA 3D8HA 4RY2A 3K4PA 5HF5A 1SUPA 1E9DA 5LMNB 4D0NA 4YUZA 4RHFA 2OGSA 4KQ1A 1Z18A 1LLQA 5K45A 4TS9A 3AFNA 1R9NA 1T36A 1WABA 4MWGA 3LQ4A 5CFOA 3KJEA 4N9WA 4IV8A 1TKBA 2RGNC 3C5WP 3B6ZA 2Q2NA 3HC7A 4TLBA 3FHJA 1W6RA 2FWBA 2WJYA 1NXTA 3FPBA 5ALKA 3PC8A 1I3LA 1OTXA 4CKYA 1SVMA 2ODNA 2P4UA 2CVHA 4QQNA 5BNIA 1G8YA 1UDBA 5TT0A 2QTGA 4R8MA 1GL7A 2JHFA 4WACA 5D00A 3ANSA 1GADO 4BQNA 5BR1A 2VJMA 3M6IA 5BNTA 5CW2A 2BFFA 4M8NE 4AYTA 4PCLA 2W6JA 1ZAYA 4RUKA 2Z8ZA 1VHLA 3ZVNA 2OC9A 2OLJA 3RC8A 5F76A 3MELA 1EVKA 5L7YA 4C14A 1YVPA 3RK1A 1H2WA 4MUAA 2AJCA 1RR6A 4D81A 4PHTA 2BGTA 3GCGA 5CT8A 2JEYA 3OJ0A 5C1IA 4UHDA 3UATA 3OPXA 1SCUB 2H1HA 3IA2A 2YY6A 4GXRA 5J5CA 3DAHA 3U13A 3CKLA 5JSFA 1NU8A 3V1MA 3P19A 2CVPA 1JHAA 2WW8A 1Z4OA 2JS7A 5EP3A 1ZD3A 3TRHA 4QOSA 3BGIA 1NQVA 2HK7A 2VDUE 5AOCA 3U7IA 3JQ6A 2WIGA 4WN9B 2R7MA 1XRLA 2HRQA 1Y8CA 2QF7A 2WV9A 2MDTA 3ONVA 4ZQGA 2ZB7A 3NJRA 2VQSA 4J0KA 5CFLA 2B2CA 4KLCA 1FRZA 4RYLA 1YL7A 4K2AA 1XZIA 4L9WA 1ETHA 3NBYC 2PUCA 4PYQA 2OQ2A 3AHFA 1LC3A 4EHDA 3HCPA 1X7ZB 1E9FA 3TFOA 4ALMA 1RKXA 2E4WA 3CJTA 5FUWA 4E2WA 4RTPA 4JBYA 4R9UC 3ZDAA 2FTKE 1E99A 4HH3C 1P29A 3G23A 4X1YA 2EKZA 4TT3A 3AEXA 2C4KA 4UU7A 4QO7A 2FETA 2F3RA 2NVUB 1PNTA 2QOEA 1GG9A 1GFIA 2Y1CA 1TW3A 5CB4B 2CJXA 2QTNA 2O3JA 1DCKA 1GU1A 1BYIA 1RC0A 3SQOA 3WLIA 1WB4A 4FMDF 1CY8A 4M1MA 2P9BA 3P94A 2QX7A 4N12A 3U61B 1W47A 2HIMA 1NSFA 4AKIA 3BG5A 3IBSA 3KQPA 2GS9A 3H0KA 3REQB 3KFLA 3U4QB 1E6UA 3WNDA 1TCVA 3EHEA 1G8GA 3L18A 1N0UA 3HUDA 4HEJA 4W8GA 5DHPA 4DEYA 2G0AA 5H70A 4HUJA 4LQ4A 1P8AA 1TL7C 3PNBA 2DBRA 4K81B 4LHXA 4R9RA 5DGHA 5EP4A 5HVNA 1AV7A 1SNYA 4Q1AA 2D1TA 3DE5X 1QTRA 2C7VA 4L0DA 1X2BA 3S2FA 1XWIA 2GQ0A 3Q3HA 3BTUA 3LTNC 4Q4AB 3UT6A 4AJ2A 3HBJA 1G8JA 4L0CA 3GT0A 1VL0A 4TTQA 5ICEA 2QTFA 3KV3O 4UVEA 2OM2A 1U65A 1KMHB 3P2OA 4YN3A 1YB2A 3AGPA 2R00A 2X1MA 5KOHA 4AO8A 1MAVA 1MX9A 2CC2A 2QN6A 4NBTA 1YK1A 2FFRA 1DT5A 3RODA 3TK1A 4ZFNA 4PLGA 3U3RA 4DYHA 5K0EA 1CG6A 3R9IA 3ITKA 3MMZA 2ZTVA 3U49A 3QE3A 5KREA 2I6SA 5BOSA 2I65A 3NUZA 5B4VA 5LQCA 4R0NA 1X70A 5JSKA 3S44A 3IFSA 3IDFA 1L7RA 4J07A 2YRFA 3JQDA 3OUTA 2UVQA 1X94A 2PXAA 4WINA 3HI6A 3LFHA 5CGZA 3OC0A 5L3ZA 1R2QA 2R7LA 3DUWA 3LYUA 3ST7A 2ETVA 4DDHA 3KQSA 4C87A 5KNBH 1U0HC 2QV7A 5L8VA 3BFPA 4C9BA 4FGJA 1IAVA 4MUKA 3G13A 3UMBA 2C42A 1GGMA 4L2IA 3KYJB 3JQ8B 3QU5A 4QUHA 4RJKA 3JD1A 4UNSA 2REXB 4FFBA 2ESRA 4HEA1 1OXUA 4ZCQA 1CIVA 2G9UA 4HMOA 4DF3A 2JAHA 4MV3A 1VPEA 2ZXFA 4WERA 4Y6QA 3QNMA 4C7MA 2X5OA 4TRNA 1AK9A 3FZYA 1O4WA 4ILKA 2XQJA 4NH4A 1NBHA 3I9JA 1E3EA 2WHYA 2C7PA 3NWOA 4EKGA 2QTAA 2F48A 2I76A 4JU8A 2VHCA 4MVJD 3RRYA 3L2OB 4F6RA 2EAUA 3A1FA 2H63A 3HA3A 4ZI5A 2YYYA 2C5BA 5JARA 1G6Q1 4RADA 5DF1A 2GDZA 1A71A 1D1TA 2VAVA 2FPIB 3L6EA 5FUXA 7REQB 4MHSA 1IJFA 1JKIA 1SIWA 3CZ5A 2ACWA 2RAUA 3LO8A 3NBFA 4X71A 2W8BA 3AKDA 2RONA 3GLFA 2RGBA 1D6NA 1LTQA 4UUQA 5IK2A 4U2FA 5JAUA 1IY2A 3SU8A 3SR3A 4QU8A 5BSEA 1HZZA 2QORA 2IV2X 5HNKA 1HG1A 5DEOA 4BQQA 3EEBA 1U2DA 3C8ZA 1MTZA 4Q1DA 1NJFA 4DA6A 2A84A 2MIIA 4E11A 4ZHQA 1K3FA 2YDXA 4CRWB 5A03A 2XUQA 3MGGA 1E5VA 2VIIA 1W4AA 4XLZA 2Z98A 1U8CB 4CM8B 1GTZA 1FQJA 1XELA 2AN5A 2FX2A 1M5UA 2PV7A 3DE2X 4HUQB 2HCRA 3OY7A 4NJOA 4PPNA 4UBIA 2E87A 2WAYA 3SNKA 4F72A 2YJ5A 1P4GA 1PX2A 5D7BA 1MHTA 5DOVA 1N2XA 2WPNA 4H0NA 4JMLA 3MGKA 4P22A 1UXKA 4PR0A 3DVSX 3V4VB 1HDEA 3HDTA 3QVUA 4EI2A 3EIWA 3IV6A 5G0UA 1WF3A 4NE9A 3R8FA 1T9CA 4NOJA 4HXFB 4LBZA 1T4CB 3LQ2A 4MIYA 4EH1A 5EVJA 1Y1RA 3WOHA 5DSXA 1EJ0A 2QD1A 1RQPA 2NSYA 4GG1A 1BTOA 3IRVA 5JEDA 4OO3A 2BVNA 2PIAA 4RACA 1R5BA 2HMUA 1MN6A 2HCFA 1I1QB 3MS4A 3CCFA 3M83A 3THSA 5I5GA 3BB4A 1ONBA 5JEEA 4Q03A 1OIVA 1CXZA 4JSYA 4DPKA 1E2PA 4YX9A 4O8ZA 1J5EB 2OHXA 4BNVA 5ICGA 1NQAO 2AR0A 3FBTA 3QFRA 3V8NA 3ZIAD 2VF5X 3EXFB 4AMZA 2IZOA 3KD3A 4I4CA 4XWGA 1DAKA 1X38A 3F73A 3HFGA 3O8OB 3UJAA 5EXTA 1ICIA 2HF7A 2HJGA 4R8KA 4B3GA 2B94A 4UUNA 5ETJA 1XMXA 3EFOB 1X13A 4QTUB 4FOLA 1KR5A 2PGXA 5EUQB 1XVIA 3NBUA 2O2GA 16PKA 4TS1A 1I51A 5JSYA 5TX7A 4A2CA 3KU1A 1XQYA 3BH0A 5AVVA 1X1EA 5KSWB 4DN6A 2M1ZA 3IT1A 1L4NA 2OXEA 4NV0A 4ADSG 4C6RA 5HHTA 3HYNA 1CUYA 1KWGA 3A9WA 3G89A 3DTNA 2GKGA 3N7TA 3LLMA 2NMVA 2YKGA 2HWKA 2OQVA 1B3RA 3FRHA 1QRRA 3NMUF 1BRMA 1MC5A 2AV6A 3KZKA 2QN3A 1EWYA 2V1XA 4LVUA 1JPVA 4L8FA 3CURA 5BUSA 4N03A 5J2UB 3K9QO 5JV5A 2WF6A 1ORDA 4NXMB 4NECA 5KDLA 1ZNWA 1H6CA 2JFVA 2OB2A 1GQSA 1VSVA 1X39A 3GJ7A 3MD9A 4HXYA 4QHSA 3VZQA 4ZOLA 4E4YA 1G8AA 2UUPA 1MLDA 1RYEA 2V55B 3A6ZA 3QE0A 3DTVA 4M1TA 4V03A 1P9LA 3GEDA 5IBQA 3OQ6A 4WNAA 2R5NA 4RS3A 3ROMA 1R0YA 2NNWB 1H69A 3U3KA 5HMMA 2P6NA 4ND4A 1O97C 1YB4A 4O4HB 1GGHA 3TJMA 2QRUA 1CRLA 2X1HA 3GX1A 3SZOA 4OU5A 1CUAA 1DU4A 4R83A 3SS8A 2O8FA 4I50A 3PUVA 1UC5B 1AN0A 3IV9A 1AHHA 1CJSA 3GCZA 1DBRA 3CZPA 4MS4B 4D4LA 4NE7A 1I7PA 3HWRA 3WA7A 1BHJA 3EXHC 3SDBA 3OQMA 5BMVA 3MCVA 1J2UA 2Z2ZA 3P2JA 2FGKA 5DRTA 3WB0A 2ZT7A 1K88A 2A88A 1OD6A 4M55A 2VQ3A 2XDQA 3S40A 5LOVA 4ARCA 3T9EA 3R74A 1OBFO 2R84A 2WJVA 4D4HA 3T12A 5FUYA 3UUEA 3DW3X 4KK4A 1TTQB 4JUDX 4NULA 2IYNA 3I2HA 3A4MA 3ASYA 4YAOA 5JJCA 1P73A 3P2MA 1OWLA 2XMDA 4M8SA 4AKHA 2VO1A 2ZBRA 4Q1VA 5IUKC 1TQ2A 4JB3A 4DY4A 1UJ6A 1AUOA 3C5EA 3N07A 4TPKA 1VKRA 4AVYA 4RD3A 2X6QA 5GOTA 1DAHA 1M2GA 4RKFA 1ICEA 4EZEA 2CV1A 4ZXFA 4D42A 4EL5A 3SMQA 3EZXA 1L8OA 5K5EA 4RVNA 4NJMA 5ERYA 5DV9A 3A1NA 1F51E 3D3NA 1WU8A 1VDZA 1M2KA 2ZRMA 2I1VB 1U9IC 3PQ7A 1F9EA 3A3YA 4GZ3A 1MU0A 2WG1A 3DMRA 2YS6A 2G9VA 3EZGA 3NRJA 3K5IA 1EUDA 1IOWA 4QECA 1Q12A 5LL6P 4GPBA 1H42A 4BAGA 1GSAA 2JLAA 3ESDA 3K05A 3DLAA 1SUDA 2VPIA 2BJVA 2CE7A 3B2NA 4C3OB 2VP2A 2O0LA 1YKFA 1GRVA 1EU1A 2D0PB 4N5IX 1KOGA 3OIWA 3JR7A 3FFBA 1ESDA 2I2BA 2I8LA 1C3JA 2OFXA 3B6IA 3RUHA 3ZE9A 1M0SA 3FNHA 1ZD1A 4U5XA 2D2VA 2I3BA 4H17A 3RSQA 4DLYA 5JCPA 2W6JD 1OTYA 4KITB 4EYSA 4KVAA 5CLIA 3QFHA 2YDYA 5I3ZA 3VA7A 4RZUA 1RYMA 4P7BA 4P54A 4Z86A 1NMZA 2GX6A 1VJGA 2H8KA 2BM1A 1P9WA 2WIKA 1WL8A 3B7WA 1EXWA 1GGVA 3OI7A 4A1OA 5C18A 1Z47A 1E96A 1Y34E 1XJWA 3KG2A 3MTIA 4HV4A 3ZJUA 3U4IA 4KGZA 5T6BA 1W5BA 4TTJA 4BEVA 1SUIA 5C32A 1I4LD 1O89A 4RU1A 1FFCA 1PT9A 1SUSA 2Z6QA 3ACCA 4RZSA 3AP3A 4TLLB 2WSBA 4IDQA 2BMAA 3S7ZA 3B9PA 3IH5A 4EPWA 5D87A 4CL2A 5A6VA 5T67A 3AVWA 4CEJB 4Z9XA 1EDDA 3LUPA 621PA 1Z7GA 3AY3A 4PSDA 1CK4A 2HIGA 2ID4A 2VJYA 5CVCA 5CX4A 3SYNA 3F7MA 1T6NA 3GJ5A 1KAGA 2E0IA 4MP3A 2LW7A 3L1KA 5FI5A 1W1UA 1TJPB 3P8ZA 5BNZA 4QYIA 3WWZA 1A1VA 3DFMA 4Y18A 5EN4A 1QRUA 2H0AA 3LYHA 5M5BA 1IG3A 1M6EX 4TT3D 3AF6A 2IUFA 1L0BA 3EE6A 4BX3A 2KPOA 4KJZA 1C3OB 1SHKA 4JBLA 4ZTBA 1FFYA 1ABFA 2Z8XA 1XQ1A 4P5PA 1QCYA 2X41A 4BO5A 2YMLA 4M0PA 1TVKA 4PZUA 1XKQA 3SOPA 5C8XA 2ZYGA 3BAFA 5JNUA 5DI3A 3RYTC 3I9FA 2AUNA 3MJDA 2Q5OA 4QTYA 2W2OA 3E3MA 3AETA 3L40A 1CUXA 1PJZA 4UE3S 1DKRA 3IMKA 3RH0A 4DIMA 4EFLA 5KWEA 4B09A 2ZUUA 3A6PC 4C0AC 1DXOA 1M1UA 4IXTA 1ACJA 4ANFA 1RS0A 4R9NA 4QNNA 5HYVA 5LBTA 4FMCF 2PLWA 5IZCC 1ZEJA 3BDVA 4Y7DA 2GEDA 1XEWY 2IHKA 2B4TO 2FSPA 4NCKA 1ORWA 3VVCA 1D2CA 4O4JB 4DTCA 1KKUA 3KXLA 2IYPA 4MV5A 4J4HA 1HK7A 4Z8YA 4BRZA 4C0HA 5F2KA 2JI9A 1LBSA 1NXVA 4WTOA 4NEHB 2OR3A 1P8JA 1WPQA 2JCYA 5HM6A 5LP6B 3M81A 3N2GB 4MGKR 4JLPA 4EKEA 2HPAA 2EIHA 3GK3A 4CQLB 2X9VA 4A2WA 4WBSA 1JT2A 4Q7KA 4AN1A 4EA7A 3O73A 2SCUA 4IIVA 3OESA 3JYNA 3RS3A 1SHTX 2ILVA 4G85A 1V11A 2PWYA 4KFRA 4YV0A 5CA1B 5AXAA 3HCFA 1K5HA 1Z4MA 1M74A 3HKBB 2GTHA 2FXVA 3S5UA 3R5XA 1DTSA 4TMYA 2JIBA 1C1XA 2DFPA 3D6MA 3NHBA 3RTEA 3EK2A 1H9BA 5TJ9A 3W2EA 2AFIA 1G4UR 4Q7EA 3WJ7A 2F4VB 1JA9A 3MS2A 3MCWA 1VQ1A 2FZGA 2OCKA 4KXXA 1UMCA 521PA 1VCOA 4A2QA 1EK6A 3OZWA 1QGUB 4D9HA 1W19A 3PRYA 3WB9A 5HRCA 5IM4F 3PHIA 5F21A 1IK4A 3WJAA 1YIAA 4MI1A 3RJ9A 4F85A 2XCLA 1P5FA 3FPAA 5FEMA 4PN3A 4EZIA 1W2WB 4ETIA 3H2SA 3IAS6 4REMA 2P9EA 4FUQA 1V8OA 1BW9A 2CUNA 4JYCA 1T4DA 1Q11A 1YTUA 2VUIB 3BTOA 2V3CC 1E7MA 1U7WA 4KQKA 1YF3A 3GRRA 3TJZA 3PC8C 2VP0A 5IP5A 1YE3A 3LNCA 3HABA 1KZGB 3QY0A 4UMFA 1CUSA 4RJTA 3GUVA 4OXIA 4XWYA 2XEXA 1K68A 3LH5A 3FVTA 2TMYA 1WDTA 2HK8A 2D8MA 4LFCB 4C6TB 2A9PA 2VT2A 4WVFA 2JJ2D 2OMEA 2V9PA 4JGGA 3CF4G 5FUBA 4ZEWA 2P4SA 4HNSA 1UQTA 5DULA 5J40A 3RSLA 3TXYA 1IZYA 2BFBA 1GRRA 3NTVA 3PC7A 3W2GA 1ZJWA 4B3TB 3MJTA 1UBMS 5KYUA 4ENQA 3Q8LA 3LL7A 1V43A 1FDVA 1WVIA 1OFUX 4R84A 4K0RA 2QR5A 3DG9A 1C80A 1BRTA 3DE6X 4LY9A 1T26A 2X2FA 4BQFA 2X4DA 1MNQA 5C4GB 4F4CA 1CY2A 2Y1OA 5COAA 1NONA 1ZGHA 3CEAA 1SH7A 3LHSA 4HR7A 4Q82A 4ZIRB 3V3TA 2QD3A 3C4VA 3INGA 5HW0A 5K8TA 1FP6A 4IHAA 4AWAA 2HF9A 5TB5A 1J0XO 3NHAA 4ERNA 1JG4A 1LQTA 5AICA 3W3AD 2VF4X 5TY0A 4BN4A 3K8OE 1E98A 1WW3A 4U9HS 4F3KA 1OLUB 3L7MA 2H00A 4E3ZA 3GUZA 1LPNA 4RL4A 5CB6A 2PBZA 3TFQA 2Y3IA 4CHGA 4L3OA 1ML4A 4N8SA 3T9FA 1H2BA 3PPWA 1XKXA 1OREA 2WTXA 3ZXSA 5L3QB 4RH3A 1D0SA 5KYYA 5MN5A 5LD2B 5BOVA 1GTRA 3E23A 4FGWA 1K3TA 2J0EA 3WGGA 1I7DA 2XE4A 1R64A 2AG8A 4XAQA 3GVPA 3I1IA 4D9MA 1RXWA 2ZRQA 2DULA 2YNMA 2ZBDA 2Q45A 3EYWA 2VTDA 3ICPA 3P7MA 2HU8A 1BQEA 1W59A 3V8RA 5IF3A 2WHPA 3GT7A 1JDTA 3AINA 1IBCA 2FDRA 1ZIPA 3OPYI 4UTOA 2IEIA 3KXKA 1SPBS 3E58A 3TO5A 2H2AA 5IAOA 2FK7A 4D97A 2ZRJA 4GMKA 4AJPA 3HUTA 1Z08A 4UAUA 5ALZA 4YONB 3WMRA 2EGGA 2UVPB 3H7AA 2Q9AA 3IBYA 5IABA 2P0EA 1ZLXA 1A5AB 4XEUA 2WUWE 2HCJB 4E4RA 1QIFA 4ZYUA 2X3FA 1Y3DE 2DHRA 3DZCA 4BXOB 3AI1A 3GA0A 1NPDA 2IS4A 4G56A 4U7PB 1TO6A 4WKNA 3SXPA 1XRJA 3J81k 5CGQB 4GI2A 1IB0A 3CV3A 1RXVA 1M5TA 3T7SA 4LJSA 3HCOA 4C0KA 2TMGA 3NHPA 3QMMA 1CHDA 1RJ9A 3TLKA 2V4MA 3EC1A 4I4NA 2ZYSA 3I8OA 2QENA 1G2IA 1V6CA 3T1YB 4YMWA 1OU4A 3KHSA 3OZTA 5NULA 2C7OA 1VG1A 1KJ9A 4R98A 2R00C 2C00A 3SX0A 3W4KA 4XB6B 1L5MA 3SLGA 2JGFA 5LBUA 5BR8B 3PBKA 1B93A 1IWPB 2M6RA 1WLYA 3PUXA 3NALA 2C61A 5EKUA 1GQRA 3VO2A 1AQNA 4AZ0A 3PEUA 3D3JA 1XJQA 2RCYA 1P0MA 2C82A 4OG2A 4ZVMA 2B4YA 1GPAA 3DTVD 5LZ5A 4EHIA 2HA2A 3LXUX 2FVYA 4ALNA 2FRDA 5A06A 4XTRA 3D4BA 1GQYA 3ZU3A 3K70C 4YGXB 3H2ZA 3ZZ1A 1WDKA 3PHJA 4BLSA 3ABOB 3C24A 4PS0A 5FPQA 4JDPA 2GF2A 4OB7A 3AT1A 4RK6A 4ZO9A 2PL1A 2OO3A 2DHEA 1TT5A 1OWPA 4O6VA 4PG6A 4F46A 1KP2A 4KIGA 5AXCA 3UK7A 4BVKA 1E0SA 3X1XA 2AR7A 3INYA 5LZ2A 4R1MA 4FLFA 2JGEA 5JZ9A 5JJLA 4KNYA 5T7BA 1SA0A 1S1MA 1OJLA 2O2IA 3KZNA 2Q7DA 4B7XA 2H2HA 4L4RA 3SYMA 5HS4A 5AVWA 4K3UA 4MWZA 4XJTA 2G25A 5C8YB 2P1DA 1C9YA 3ZY2A 2GCNA 2PZAA 4MA4A 1E5QA 3E1SA 5T5QA 1PYOA 1W48A 1F2UA 1HFJA 3Q0TA 2Q5QA 1RM0A 2YWDA 2Z8YM 4MQFA 2A4KA 4XPIA 1WMSA 2ZWAA 1Z6PA 1A9YA 3FR7A 2VCHA 3JZDA 3N2KB 1JX6A 2I6TA 2QU8A 4QEKA 4X1KB 4X92A 1A9XA 3AXSA 1ZKDA 4TT8A 3MLEA 1AQIA 3IVCA 4WESA 3GMSA 1X80A 3DB2A 2ICAA 4JYAB 3O6VA 1V8ZA 2Y4OA 4HAZA 2XLBA 4BFSA 4Z0TA 1PZFA 1DL5A 2ZANA 3D81A 1MQ9A 3LPDA 3PNKA 4NMWA 4NENA 1YDGA 3QXXA 2A0KA 2PLFA 4YO8A 4LYYA 3BMCB 3G88A 2PQ0A 3OZAA 3DD5A 1O96B 4HRYA 5C5EA 1HZZC 3BMNA 3OCVA 4M46A 4IVQA 1L7DA 1POWA 1A0OA 2PGDA 1U2DC 4XVCA 3ELYA 4CKWA 2B98A 3D3WA 4JA0A 4C3UA 4Z1MA 1XALA 3GY0A 4AY3A 1JG1A 3GI1A 3BRQA 1RRMA 3HJBA 3W6PA 1T9GR 4Y6PA 2Q1WA 1R4ZA 1XTPA 1M8JA 2C9BA 2XZTA 4TN1A 4CF3A 4EARA 5KYXA 3RBAA 5T3UA 3EEYA 3BJMA 1V4NA 2HK9A 4LYDA 3VR1A 3WBFA 4IUDS 3NTXA 1AMOA 4UBKA 1G8HA 4IRUB 2HA4A 1KP9A 2X13A 2YQ4A 2LDXA 3LS2A 5H16A 4N47A 2POCA 4GSLA 1UAAA 1UM9B 2TECE 1Z06A 4KYTA 2ZRKA 1KVTA 2NZUG 3MRSA 1MC8A 2MYTA 3ZQKA 4D99A 3FVQA 4HT3B 2RGRA 2FCAA 3GPCA 4C5AA 1YI1A 2VJNA 2QD4A 2O7NA 5LVAA 3IUBA 3Q8XB 1JTEA 2Q2VA 3JPYA 4TWAA 3VC2A 1SZJG 1W4LA 3ZE6A 4M8LA 1NMYA 2QDKA 3HHPA 2JKZA 1RMTA 5KYTA 2Q62A 3IEVA 4Y9RA 5TEVA 4RDHA 1E4OA 1UPCA 3LMKA 1PWZA 4UNQA 5E2AA 1OV4A 4NZ9A 5EWMB 3RHTA 4C05A 3X1DA 1XCGB 2EATA 3SQXA 2QP3A 1IUNA 4NFHA 4FMBB 5EXEA 2OORA 1O6BA 4WOCA 2R1VA 4ND3A 4W99A 4LDJA 1N3BA 4RPKA 1I1HA 1TTPB 4QUGA 4W5NA 4HPWA 4HWKA 2NO4A 4KO2S 3GJ8A 5KOIA 3VKGA 5KSPA 3FH0A 3DFKA 4QQ8A 3N0TA 3DKRA 4I55A 1IY0A 3SBEA 3R5HA 1K8ZB 1OT5A 4CFZA 3O3NB 5JIBA 3S2GA 3H0CA 2L19A 3CEMA 3NDIA 3O4FA 1B0UA 4MB0A 1UKYA 4Y6OA 3MMNA 5DWDA 3S8EA 1C3VA 4JT8A 2RJNA 4DCPA 1GARA 1JAYA 5THXA 1Y8QB 1WHSB 2PZMA 2HRBA 4KVZA 3RUDA 3N6VA 4QARA 1OZGA 1NI4A 1G42A 1WBBA 5EUCA 1W85A 4C7OB 2OLKA 4DIKA 1N57A 4R8LA 2GLTA 3T3IA 3ADOA 2WSSA 3EHDA 3FOZA 2VDLB 4I4TB 3EPRA 4X7BA 2WLSA 4RANA 2HZ7A 3GJQA 1FNNA 3U1VA 1E2JA 1C50A 5K1ZA 1K89A 4HQ0A 1BX3A 2ECPA 2QXUA 4P0QB 4YI5A 4KHZA 5ICSA 4ZU3A 1ZA2A 1ADJA 4PR3A 4CLRB 5B6PA 3KQMA 5B36A 3OU7A 3PRHA 3BBPA 4XVUA 1AGRA 4W5JA 3P4XA 5G53C 3NHZA 4HDNA 1GUZA 1LSSA 5IHXA 2P4HX 4O1IA 5JYBA 3Q6NA 2KE5A 2AFIE 4Q24A 1QFZA 3A6LA 3KZ1E 4IWXA 1P74A 4P5EA 3W8DA 3QXHA 2CVZA 9LDTA 3DZGA 5K3DA 1J22A 1JHUA 4F8JA 3JZAA 2YWJA 4D9BA 4M7RA 1ZHHA 3ZY4A 4WCFC 5J4HA 1E9VA 5GONB 3ORSA 1ELOA 3RRJA 3GAFA 1P2TA 5GTDA 5B57C 3IKLA 3H6GA 4KR0A 4UREA 5CBPA 2J5RA 3LG2A 3PTLA 4QOGA 3WADA 2BF7A 5AM2A 1XLVA 2K2QB 3UCEA 3GLRA 4UM8B 3C8HA 3AWDA 4JK3A 4WZBB 1GU0A 4TMXA 3WL7A 3S1LA 5KDOA 1OYOA 3U4QA 3QX3A 4FWBA 4MDYA 2Y6VA 3NASA 2DSTA 2Z56A 5AP9A 2PUDA 2W2NA 4IW3B 3K2BA 1Q2UA 1JJBA 2M9MA 2HDOA 3QBJA 1POXA 1UXIA 2F8MA 3UJBA 3WQRA 4DJEC 3VOBA 3QV2A 1A4RA 1NY6A 2PCLA 2H4WA 2VSQA 1ZNXA 4IL5A 4XUGB 1U2SA 4EF5A 4E13A 3HYCA 3AY7A 4B43A 2ZJFA 1JIKA 4NBSA 2GXAA 3R7AA 4YAIA 1TZKA 4NPCA 3M6XA 3GEGA 1ZD9A 2YOFA 3BAZA 2ADMA 3NAMA 4PZDA 3IQEA 5K03A 2AQKA 4KQWA 1SUCA 2IZ0A 1K5DA 3CUEF 2GAOA 1OX4B 1BMTA 3KT6A 4JC0A 4UKDA 5ALDA 3SOZA 5C8DA 4CLEA 1X7DA 3CN9A 2ZIZA 1H3FA 4BFUA 1GM5A 3GAAA 5AOVA 3E82A 3BD8A 3U7RA 2VR1A 4BNNA 4BKRA 1M1NA 1HA3A 1I2DA 3PE6A 3UJNA 5EHIA 1E5TA 4YT8A 1A96A 3MXOA 3UGQA 4Q39A 1WNFA 1UPUA 3IOCA 3WV4A 2ZIXA 2QI9F 1ADGA 4AYXA 1MO4A 2ODAA 2WSLA 1L7BA 5L51A 3FPCA 3GBVA 1M3SA 3R75A 5EZSA 2YUIA 2CUKA 2EWMA 2D06A 5AESA 1KSHA 4PFKA 5I5EA 3TLEA 3B8HA 1MHPA 2QMEA 1U8FO 3F3SA 4M37A 1TM2A 2OZKA 3JZMA 4QJ3A 1K5GA 1U2QA 1HUQA 2EHDA 4JVMA 3CWQA 2H4JA 4ZZ1A 1MR3F 2IUTA 4JBWA 3BDIA 4BZZA 1L7NA 2AXQA 2R8PA 4FE4A 4X1OA 1JKXA 3WK4A 2V8BA 3CM0A 4JI1B 4I46A 2H07A 4Q9NA 4AF8A 4HAOA 5KEIA 4ZTUB 5LWHA 3CR7A 3G7UA 1L9XA 2Z1DA 2Q50A 2EQBA 2ZPTX 4WXPA 4K9QA 1LVGA 4TTVA 1I2ZA 3VVLA 3KQLA 1C3LA 3SJCA 3B9BA 2COKA 3A36A 1P2DA 2OHIA 4WUVA 5L4LA 4DCTA 1B8NA 2K4MA 4O2BF 2C57A 1I3NA 4U9IS 1F1BA 5C81A 3ZY3A 1VGQA 3GZNB 2GEUA 4NNJA 1KQPA 4Q12A 3WISA 3WGVA 4MWEA 1YI0A 4E6PA 2NVBA 3PC3A 3RWOA 4DTIA 1XCBA 1BFKA 1N0HA 1GNLA 2AMFA 4GNRA 4H7HA 4YMIA 4D80A 3P2EA 4RM2A 1CC1S 4H4EA 2C20A 3ZXIA 1RCUA 4EEZA 4H6PA 4Z3KA 5JXIA 1NE7A 2WAOA 3TZ6A 4CTJA 5B6IA 5IJ0A 4IOMA 2YNMD 4QXAA 2Y66A 4FDAA 2O5VA 4DCOA 3BQMB 1G3IA 1MDBA 1S2GA 5EJIA 1HYEA 1NWCA 3RVMA 4UMVA 4QNMA 5JCOA 3TDKA 4J8PA 3X2EA 1NQXA 2V5AA 1NW6A 2OM6A 3JYHA 1FYVA 2YHUA 5BRAA 4BO1A 3DDCA 4BYGA 1HPLA 5FLXA 1JFVA 2IUEA 1F3LA 3PXGA 3S1AA 5HK9A 2O07A 1PFKA 3C1TA 3UHPA 3K0AA 1NJ1A 4RA6B 4F96A 3GGOA 4AN0A 5KU1A 4HCJA 1E4VA 5BSUA 2EARA 5ALVA 5KSZA 3U3XA 1ZVJA 1RWBA 3HXLA 3S4YA 3BMOA 5IYZB 1RYHA 2DHCA 2EFJA 3SJUA 3LIPA 3OZ7A 2O8CA 4Q48A 4DXHA 3ADBA 2VHJA 3GUYA 3EXIA 3W05A 1JSLA 1Y5LA 3IVMA 4KTTE 5CRIA 3KLPX 2DWOA 5LMUB 1C5KA 1K7FB 1UBCA 3E9CA 4RY0A 3UAWA 1QP4A 1TPZA 3CRRA 1CB7A 4G2NA 3RC7A 2UXCB 2GEKA 2RHRA 2WR8A 3FNRA 2DRIA 3FCYA 4R1PA 4CG1A 4Y2JA 3ROZA 1SFRA 4V38A 4YQYA 4LWOA 3CVWA 2XVXA 1S01A 5L3VA 3HGTA 4G6ZA 1MOPA 3AU9A 2PWAA 2CJWB 2NTEA 3H9EO 5F77A 5DYWA 1DEOA 3FCUB 13PKA 1P3Y1 2WT9A 3KOUA 4KVGA 2QMOA 5G3ZA 3VPCA 1NSTA 3P32A 3RJZA 2Q9UA 4RX1A 4U6QA 2H2GA 3EQ7A 5TQ2A 2Q3DA 2H54A 1EHIA 1UWCA 2LBPA 3B1XA 2PMBA 1BFUA 4BLRA 4GOMD 4JI7B 4G8BA 3ZWKA 3F5FA 3W6UA 4QPZA 1S8FA 1ZISA 1BFDA 4J29A 5CNKA 5DPMA 1Q50A 5F73A 2O1WA 1MG0A 1NW4A 2EC5A 1QFXA 1GLNA 4FHCA 4IILA 4RIFA 1K75A 3AEUB 2OGUA 4OL9A 5LYJF 3TD2A 1ULUA 3HUUA 3ETHA 4P4SA 1ATIA 3CNHA 5T3YA 2QR2A 4N40A 3V8MA 2OHVA 4EEKA 4BMYA 1II8A 3G0CA 3GPBA 5ER6A 1PYGA 3DLHA 2BFNA 3ZGZA 5CXQA 2J41A 2ZBEA 1IQUA 1YACA 4W6QA 4QOHA 3RRFA 5E6SB 2JATA 5E9QA 1XU9A 1RJWA 2CK3A 4OAOA 2L69A 4EF6A 5KWIA 3GN2A 3CLVA 1DE0A 2BMJA 2ONKA 4URHA 2PWPA 3K6SA 4MUNA 1ZI6A 4P53A 3IKVA 3UC5A 3Q3VA 2G5PA 4U7TB 3PC6A 2X0RA 1JW9B 1OAAA 1BC5A 3JYOA 3R0VA 4UDNA 4MV1A 2VUSA 4XTCS 4Z1MD 3LCUA 4H60A 2BJWA 2DYKA 3DMGA 1J06A 2Y68A 4KQIA 4RVCA 3WLOA 3VPFA 1F4LA 1Y1SA 5H1YA 4U63A 3W5VA 3G3EA 4EJFA 3STWA