4HGOA

2-keto-3-deoxy-d-glycero-d-galactonononate-9-phosphate phosphohydrolase from bacteroides thetaiotaomicron in complex with transition state mimic
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
163
structure length
163
Chain Sequence
MKEIKLILTDIDGVWTDGGMFYDQTGNEWKKFNTSDSAGIFWAHNKGIPVGILTGEKTEIVRRRAEKLKVDYLFQGVVDKLSAAEELCNELGINLEQVAYIGDDLNDAKLLKRVGIAGVPASAPFYIRRLSTIFLEKRGGEGVFREFVEKVLGINLEDFIAVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for the Divergence of Substrate Specificity and Biological Function within HAD Phosphatases in Lipopolysaccharide and Sialic Acid Biosynthesis.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Transferase, hydrolase
molecule keywords acylneuraminate cytidylyltransferase
total genus 51
structure length 163
sequence length 163
chains with identical sequence B, C, D
ec nomenclature ec 3.1.3.103: 3-deoxy-D-glycero-D-galacto-nonulopyranosonate 9-phosphatase.
pdb deposition date 2012-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08282 Hydrolase_3 haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4hgoA00
4BEVA 1RC8A 3PCTA 3FVVA 2I6XA 3ZTWA 4UU1A 2HEGA 2YJ5A 3SKYA 3WKEA 1IWOA 4KYTA 2ODAA 2JGAA 2FPWA 4L6AA 1PW5A 1ZRNA 2G07A 2IOFK 2NYVA 3KC2A 4CE6A 3SD7A 1YV9A 2I55A 1Z4NA 4XOUA 4J2TA 2JARA 5AI6A 3QU2A 3OCUA 1F5SA 3I6BA 1Z4MA 4GIBA 1RMYA 4BNDA 5AI4A 3ZI4A 2FEAA 4CF3A 4ZEVA 2WF5A 1L8LA 3OCYA 1MH9A 4Y2XA 1RMQA 4G63A 1J8DA 3AR8A 3MN1A 2WF8A 5IT0A 4J03A 3QU5A 4IFTA 1RPZA 2QYHA 3N8GA 2HOQA 3AR3A 4GXTA 3L0CA 4OFZA 1L8OA 4XQ0A 3B9RA 3SLRA 5AIBA 3DV9A 3WKAA 3UMBA 2WF6A 4EELA 3S6JA 3E58A 3UMCA 4BX2A 5AKYA 3ZU6A 3ZW7A 4F72A 4Y2VA 2B8JA 1CQZA 4Y2YA 4DCCA 4O8CA 3L8GA 4YCMA 4YCLA 1WR8A 1NF2A 2OM6A 3ESRA 1ZD2P 4DFDA 5ALVA 3QUCA 5AESA 4UASA 3FPBA 1VJ5A 1QQ7A 3HLTA 5AW5A 4EENA 4AP9A 3B8EA 5FP0A 4EX6A 4Y2RA 1CR6A 2I34A 1YDFA 2YJ6A 5ALUA 5AKLA 3D6JA 3N28A 3R4CA 3TLMA 5AKHA 5ALJA 3IJ5A 1QQ5A 2OBBA 5AKEA 3OPXA 2FUCA 3WK4A 4BNDB 4UATA 3WGUA 3R09A 2Q4TA 4EEKA 2ZBFA 3QUBA 1ZJJA 2AUTA 5IS2A 1Z5UA 2ZBGA 1ZS9A 3E81A 4C4SA 1L7OA 2I33A 4IG4A 2CFRA 5T41A 2B30A 3MPOA 4JB3A 4L57A 5ALDA 1EK1A 3I28A 3CZ4A 2WF7A 3CNHA 3ZX5A 2I54A 1O03A 1TE2A 2YJ3A 1SU4A 2NO5A 4UU0A 3FM9A 5ALSA 4UMEA 4C4RA 2PQ0A 4HAIA 5AK5A 2EARA 1VFPA 2HO4A 3M9LA 4FFDA 4XE5A 5AW9A 3U19A 2YFYA 3QXGA 5AK6A 4ZEXA 2WM8A 4DWOA 2G06A 1RDFA 4CF5A 2C9MA 4Y2TA 5AVRA 3UM9A 5AW0A 3NANA 3I76A 2I7DA 5ALNA 5AVSA 1RKQA 1RQNA 1U7PA 2MSNA 3WK5A 3ZVNA 4Y2PA 4YH1A 3W5DA 3KDPA 5AVVA 4Y2SA 1JUDA 2FPSA 3PDWA 2O2XA 4HGOA 3K1ZA 3VAYA 3KZXA 2HDOA 2QLTA 3L8EA 1X42A 1ZRMA 5AVZA 2W11A 3F9RA 2YY6A 3QX7A 3DAOA 3OCXA 2GHTA 3NRJA 5AM1A 2FDRA 1Z4LA 2FPRA 3DNPA 1Z4IA 3ZUPA 2G0AA 1SWWA 5A3SA 4YIHA 3ED5A 3KD3A 3E8MA 2GMWA 5AKJA 2Q5EA 3W5CA 5AICA 1WVIA 2ZG6A 1YNSA 2AGVA 2HHLA 3BA6A 2GO7A 2P27A 1LVHA 1TJ5A 3QUTA 5AM3A 5ALEA 2GHQA 4QQFA 1EK2A 5AM0A 5AVQA 4BX3A 1FEZA 3QLEA 3WK8A 4UMFA 2G80A 3OCVA 2P11A 5AIAA 3RFUA 3OCZA 3AR5A 2CFTA 3AR7A 5ALOA 3E84A 3EPRA 3DDHA 3FZQA 5ALHA 4KX3A 4I9GA 1AQ6A 5ALPA 2ZXEA 3QU9A 4Y3UA 4B6JA 2OYCA 1U2TA 2G1AA 4KN8A 4RETA 3ET4A 2JAOA 5A3QA 2ZBEA 3QNMA 3SHQA 1ZOLA 2RBKA 1ZD5A 1QH9A 3N07A 1Z4KA 1TJ3A 3ZTYA 1XVIA 2HSZA 2CFSA 5IT4A 2R8XA 4UMVA 1Z4QA 2VKQA 2P69A 2JAUA 5ALLA 2YN4A 3MC1A 2C88A 1J97A 2HI0A 1Z4JA 3ONNA 3IRUA 2C8KA 1YJ5A 2C8LA 2R8EA 1ZD4A 3KBBA 1Z5GA 2HX1A 3L0YA 5AVTA 3HYCA 3OTQA 3U26A 2ZOSA 2W43A 1K1EA 2B1QA 1T5TA 2YMPA 5JJBA 4UM5A 2G09A 5AW4A 1YS9A 5AW3A 3W5AA 2WFAA 3NASA 2BY4A 3I1YA 5ALZA 5AW6A 1O08A 4DW8A 1YMQA 1Z4PX 3B9BA 2IOHA 3N1UA 4MUMA 1RLOA 4KNVA 1Z4OA 2IOFA 2YMQA 3ZWKA 4C4TA 5ALXA 4UW9A 2WHEA 5ALQA 5AI0A 5AK3A 3AR9A 1U7OA 3GYGA 3L8HA 5AVXA 5AM2A 4BEWA 2B8EA 5AW1A 2IYEA 4I9FA 1XP5A 5AI8A 1U02A 2FUEA 4NABA 2C4NA 2RARA 5AKGA 2FPUA 4NFLA 1Q91A 3SF0A 4NWIA 4EX7A 2PR7A 2EATA 2G08A 1U2SA 3U7GA 3WKDA 5AVYA 2AMYA 3L1VA 2BDUA 2R8YA 4Y2QA 3NUQA 2MU1A 5E0OA 3QU4A 2W4MA 4BBJA 4H1WA 2YMLA 3ZWDA 5AI5A 1RRCA 5ALRA 1NNLA 4FYPA 2ZBDA 1L7NA 1Q92A 2HF2A 1LTQA 4F71A 2Q4RA 2B1RA 2D2VA 1KYTA 2RAVA 2P9JA 5AM4A 3EF1A 4HGPA 4BX0A 2CN1A 4HGQA 3N5KA 3EF0A 2B82A 3QUQA 1TA0A 1S8OA 1T5SA 1RQLA 3AR4A 4UAVA 4YIKA 5ALYA 2RB5A 4UMDA 2OA0A 5AKXA 4BYGA 4MWOA 4YGYA 4XPZA 3WGVA 3WK9A 1WPGA 4BKMA 4JDPA 2BDEA 5AW2A 2X4DA 1WZCA 2AH5A 5AKKA 5AK4A 3A1DA 2WF9A 3NIWA 3RF6A 3A3YA 4RESA 1RMTA 2HCFA 4QJBA 4FE3A 3ZX4A 1Y8AA 4EZEA 3NALA 1QQ6A 3KOOA 3UMGA 4OCZA 4NV0A 1S2OA 1XPJA 5AI9A 3WK6A 4OHFA 4KNWA 3L0BA 4UAUA 2JAWA 3FGOA 4Y2UA 4ZEWA 2YMMA 2FI1A 3SMVA 2B0CA 3OCWA 3PGLA 3SKXA 3U7FB 3L1UA 2IA5A 2HF7A 5ALIA 3L5KA 3BWVA 3J7TA 4UARA 4E88A 1QYIA 2R8ZA 3AR6A 4YCNA 5A3RA 3A1CA 3WKBA 1RKVA 2FPXA 4G9BA 5ALFA 3ZVLA 4AS3A 5ALMA 3EWIA 4OD0A 2YBDA 3FPSA 5AW8A 2O9JA 4CNQA 1NRWA 1RKUA 1RLTA 3ESQA 4HGRA 3QGMA 5AKIA 3L7YA 3L8FA 1SWVA 3U13A 1RLMA 5AW7A 3ET5A 1L7PA 3NAMA 1N9KA 3QYPA 2GFHA 2YJ4A 1VJRA 5AVUA 3WK7A 4CF4A 3ZVMA 5AVWA 5ALGA 3PGVA 3A1EA 3M1YA 1L6RA 3IB6A 3U7EB 4Y2JA 2EAUA 4PNHA 2PKEA 4KX5A 1ZD3A 3AR2A 5AKZA 3MMZA 1TJ4A 5AM5A 4HGNA 4AS2A 1Z88A 1L7MA 3P96A 3U7HB 3R9KA 2DQSA 4HYTA 3WKCA 5ALWA 4UM7A 1N8NA 5ALKA 2NO4A 1T9ZA 4NAVA 5ALTA 3QU7A 3W5BA 5AHXA 4L6CA
chains in the Genus database with same CATH superfamily
2QVZX 1JPVA 1WCYA 4UAGA 3B6KA 2WK1A 3FCSB 3GA7A 1J00A 1PR6A 1NVFA 1NNSA 2HC9A 3PC3A 1OXXK 2XVZA 3DP9A 4UU1A 3N7TA 2YJ5A 3RFTA 9ATCA 1EUYA 1XCPA 4FD2A 4ZU6X 1WTAA 3A28A 1IUKA 3IE2A 2FSSA 2OVFA 2Z5GA 4NG5A 5CB4B 1Y1QA 1X1SA 2J7PA 3UK2A 3NHWA 1JHYA 1KYXA 4YDHB 4N5MA 5E38A 4M1YA 5KO2A 2A33A 2Q1YA 2EP8A 3SEZA 3CVWA 3G1TA 3U31A 3ROKA 4XOUA 3TD9A 3UWSA 1Z2OX 3PQ3A 1S3FA 2WILA 1Q3HA 4QGGA 3LI2A 5BV8A 5CFRA 1N3LA 4ESVA 4UM9B 2Q9UA 1YL6A 2DWCA 1P2FA 3LIIA 3OCUA 3NAQA 3PNVA 5CB4F 3EQ6A 3BKXA 1VBMA 4HNAA 4TMFA 5FYQA 1RVV1 5DOZA 4PVDA 4QSHA 2F6RA 2Q5OA 5C8YF 4OGFA 3U3KA 1EJ2A 1Z25A 1YB7A 4IYJA 5IJ0B 1P3DA 1CF2O 2I4RA 1HFJA 3A9UA 3B13B 3DE4X 3V4ZA 5KNCH 3ZI4A 1JWLA 3IERA 4FI3C 3T34A 3VDQA 1HE5A 5E3HA 2Y0CA 3CFYA 3D81A 4QOHA 1XLTC 2V54A 2JRLA 4O4IF 3ZKAA 4OMDA 4XQCA 2E1RA 1PR4A 3I9FA 1FYDA 4OYHA 4ZYTA 4OYRA 1VIYA 1OFIA 4MROA 4B6OA 4Q3KA 2FZEA 3S8MA 1JIJA 3SBDA 2MR5A 3K0SA 3MELA 1XFDA 3TXYA 2OHGA 3KOXA 3WLLA 1UBOS 3BDVA 1TMKA 1CB0A 1G5RA 4E11A 3DMDA 1SNYA 3P20A 4OFZA 4AZTA 3DPIA 5EKSA 5BSWA 5JADA 5AIBA 2X9QA 2YVQA 4JR2A 2EEZA 2QMZA 4NENA 4R31A 5KKAA 1I2MA 4M89A 5CCEA 5K03A 3PXUA 4C0QC 1UC4B 3E58A 1OYVA 4ASUD 2PTHA 4GMDA 2H57A 3HYRA 2KMLA 1J2EA 5JPIA 3IMFA 1ZD1A 1EWVA 2H5JA 2NPIA 1KYZA 4G9GA 3H2KA 5DGTA 2FUG1 5LDGA 1BROA 2NGRA 3ICCA 1QC5B 5DCUA 4YCMA 1NKVA 1CZUA 2Q1XA 1GRQA 1DIGA 4ER7A 2ECOA 1QAMA 2HJ9A 1AS0A 1FXSA 3QP9A 2ICAA 3VKWA 2QIOA 1CX9B 5D87A 4HLUA 3RW9A 1JAZA 3V1MA 3LL4A 2IHKA 2YCBA 1T5HX 4LQ4A 1UMKA 5IZ4A 5KQRA 3E27A 5KVVA 1KE2A 2NUTA 5FUMA 1EI9A 4Q3CA 4Y2RA 2FWJA 4L15A 1N5OX 4DJAA 4QXOA 4G67A 5ICEA 1YCHA 3SWWA 5JQWA 4KI7A 2EBWA 1O7JA 4ZTBA 2F4NA 5GONA 2PD4A 3ECCA 2QMEA 3E82A 5H3HA 3MZ0A 5EQFA 2ZM6B 3Q7IA 2R00A 5KTPA 1I7NA 2UUPA 1FUUA 1UH5A 1MCZA 2HNKA 2OBBA 2VJKA 1IM5A 1BHQ1 1N0VC 1XEXB 2CLOB 2I78A 2RH9B 3KLNA 1EWTA 4YJGA 4BNDB 1DNPA 2C3PA 4GLFA 3RR2A 1U2DA 2B5WA 3QUBA 4ZU3A 1P18A 3VPHA 4X66B 3NYRA 3MTDA 3CZQA 1ICIA 2OWEA 1EE1A 4DPKA 1PS8A 3FNGA 4PLPA 2BFMA 3R3VA 2I7VA 5B57C 3R44A 1E6WA 4QGAA 3VA7A 2P7HA 3MPOA 5LQUA 1VHLA 3ZDBA 1T6YA 3NNDA 3C4QA 5SY6A 3K9LA 1VJDA 3DVLA 3VAAA 1C2YA 1ZM3A 3CNHA 3OLQA 4PPFA 4WJZA 4MYRA 3BERA 4KW7A 2YJ3A 4N0DA 4CR6A 4RJLA 2GVNA 3GFPA 3T5DA 2RGAA 5KJ6A 1FRZA 2V3WA 4HLDA 5M04A 1BCRA 4JXXA 4C4RA 3UIEA 2NSYA 3O3CA 3W05A 1U1IA 4L72A 1FW6A 2J4FA 3PNMA 1VECA 2FVYA 4O3MA 2HDNB 3DUFB 5EJ5A 3GU3A 3MYYA 3OIWA 4Y98A 5KU7A 2Y27A 2ZRCA 4D0RA 1D0VA 2OAQ1 2X0RA 3C16C 1NP3A 2VJOA 2PJDA 4FMPA 2IKQA 4PS1A 3BGOS 1H1TA 1M6VB 1RDFA 1EFHA 3MBKA 3WHLA 3WZLA 5I7OA 3N6XA 4XASA 3KAKA 3U9SA 3IXMA 1NMSA 3V8RA 2D0DA 1DC4A 1V5EA 3PQ6A 4TV9B 3H3JA 4DG5A 1I4OA 4PIVA 2MSNA 4DXDA 4EYQA 4ZT2A 4U8GA 1FRQA 4TTTS 1ILWA 1E79A 2V9ZA 4Q82A 2G5CA 1PK7A 4N40A 2FZWA 5IF3A 1QTRA 4ARIA 4NZMA 4WK0B 3ZE7A 4UUNA 5JNLA 2KE5A 3PUHA 3EDQA 1F2VA 1SM4A 3FJ1A 3JAKA 4K6OA 1IBKB 3DDNA 2HPZA 2QLTA 2EJCA 2FWBA 4Y9DA 3FG9A 1AKUA 2H2IA 4U2KA 5EIHA 5KWEA 3GFTA 1O5IA 2OENG 2VAXA 1DARA 3CE6A 4N12A 1USGA 3NRJA 4WDRA 1RQ2A 3LKZA 2BTEA 4TLEA 3GLGE 1YNOA 4TSFA 3ZDAA 2BPOA 4N76A 1TLFA 3ODGA 5AT1A 2P3SA 1ZZGA 5ENZA 2WJ3A 4C7KA 4YIHA 3BXGA 1HLDA 1YQEA 1OBOA 4MR9A 4US1R 3DOIA 1FFBA 3UHOA 4EYGA 3FTFA 4QX6A 1XKXA 2ECQA 2JGEA 3TL3A 3EMVA 2ZG6A 4GXQA 4HDRB 4IIJA 5AICA 2YV5A 3ZDZB 4ZI7B 4FJ0A 4KYVA 4EKEA 1QTQA 3E48A 3HB0A 1QV9A 1RM5A 2CBZA 1NVXQ 1YWGO 3IV9A 2Q8NA 3Q6NA 1UDWA 5F3DA 4GOLD 5B7QA 2GRAA 1KPHA 1HRDA 2JIOA 1J7JA 4RZSA 1H5UA 3EVCA 3GD7A 1L4EA 2OFXA 4H1HA 4E13A 4JQSA 1W5FA 3EFEA 1J2YA 3JYNA 1ZN7A 1H6DA 5LQJA 2BTQB 3FZQA 5A6VA 4Y6RA 4BEJA 5HX7A 3VKHA 3RJMA 1E8DA 1U5BB 4N1AA 3ZBUA 2P2YA 2A4KA 5CW1A 4LXYA 4W5TA 3R2JA 4PG8A 3MVEA 2JA2A 3A8TA 4C6TB 1SGWA 3BFXA 4NOLA 1XTUA 2RKWA 1FMTA 1ZU4A 1JHQA 3D6HA 3GCWA 3P2EA 1TD9A 5CB4A 1IWPB 2QTLA 4CKCB 1JFTA 4GKJB 1QH9A 1I4LD 2QLLA 2WZDA 2OC4A 4MQFA 4M86A 1TJ3A 1M7HA 2XB8A 1XZNA 1LC0A 4HXFB 4C20A 5CGZA 1OH8A 1K6JA 1YZLA 2IVFA 2XNSA 1X7ZB 4ZEWA 3SZ3A 3K2IA 1CUEA 5B3KA 1O4WA 2GA8A 2J48A 4O4IA 4A4DA 3LUGA 2FXIA 4MEJA 5ALLA 4D92A 4DN6A 5TPWA 1UPBA 1P39A 4P0TA 4RGQA 3PTAA 3H5WA 3U17A 4PF1A 4WEQA 3RWMB 1DTWB 2VZ9A 5DT9A 3EVDA 3IRUA 4NBLA 3VSDA 2XUKA 3STYA 5HS6A 2OFPA 4W9NC 1YUNA 4E30A 5KKNB 5F9HA 1FCJA 4GNKA 4AXBA 3SBEA 4PR3A 4CKEB 2XZLA 4I2NA 3AL0C 2W2KB 1D2RA 2IT1A 4GR4A 2M6KA 3UA3A 3OJEA 3H9BA 5AW3A 1IIBA 1Q1EA 3KUCA 1V5FA 3I2FA 4Q1FA 2PM8A 4KC0A 2BEWA 4MPJA 4OXYA 4I08A 1GZDA 2G4VA 2WDZA 3IPYA 4FDTA 4UD6A 2VPPA 3QZUA 3ESYA 1Z7WA 3C6YA 4G97A 4ZO6A 4A9AA 5KYTA 4IZIA 2RONA 2QUJA 1WEKA 1LV7A 2IE8A 2J9XB 1FW8A 2WHYA 2W2LD 3JZFA 1JNXX 4LC1A 4OREX 5EXPA 2O7RA 2Q2QA 3IIIA 3LHKA 1AC5A 2XW6A 4MMZB 1D6MA 2CK3D 3F6PA 3DTYA 2R68A 3DF7A 2JIQA 2DULA 3UJ7A 2QSJA 1B43A 1R0YA 1VP9A 4PHTA 2AE2A 4TKUB 2GM5A 4ITVA 4C3UA 4C4AA 4D5GA 3AWDA 2JHPA 3HA7A 4PLCA 1G19A 4QATA 4B6QA 5IJ0A 4DLKA 4AUMA 3LYUA 3P9YA 1U2GC 5ESWA 4BP3A 4KPFC 1QIGA 3UGTA 5JO0A 2P6RA 2EW2A 3NUGA 2D3WA 4A8PA 4NSNA 4DCNA 2QM7A 4TOIA 1MTZA 4BO8A 2V1XA 1ULZA 3VO2A 1WXWA 5MN4A 5IFLA 2V4ZA 2CC2A 1UDRA 4DSUA 3P4YA 2JHGA 2WFLB 3BKWA 3NBKA 4JJEA 2PBLA 5K4HA 2I9KA 2F59A 1QCDA 5DEIA 2F1HA 3CYFA 1TK3A 3DAPA 4BYMA 3PT5A 4RAQA 3WHKA 3CIOA 2FPUA 2EGGA 4PQEA 3SGLA 5KQPA 1N7GA 1QAOA 3EVZA 3BGSA 2HJSA 2XCQA 4FYMA 4LBZA 3LBNA 3SCZA 2W2OA 4OLJA 1MEOA 4QU0A 1TZCA 3FE2A 3ND5A 5EJGA 5F7XA 1T2NA 2OMKA 3DKKA 2EKPA 3PQCA 1MX1A 3O84A 3UMRA 2Y99A 3SZRA 3V8VA 1THMA 3L1VA 3R7FA 2BFPA 4NJOA 4BMZA 4DLBA 3HEAA 3HKDA 5CMLA 1DRJA 2C96A 4H1WA 3LUBA 3IDSA 2BBOA 2KQUA 2LZ0A 1XXHE 1SVWA 4QQRA 2GS9A 1OJ7A 4X62B 2HF2A 4YMGA 1NLMA 2XRYA 2OCPA 4H7EA 1B8OA 1KYTA 3QWFA 3S0JA 3TAHA 2X6TA 1WLSA 2O2JA 2P65A 2P9JA 4BO7A 2CT8A 2ZBQA 2EBHX 2ZUFA 3ILSA 3QY0A 3GLSA 2X9VA 2Q5FA 3EXEA 3Q98A 4YXFA 2HM7A 2J6CA 3EUAA 1FNMA 4BBAA 3KHUA 1TK2A 4GZMA 2AVDA 3IT1A 4HXYA 1RKXA 2EFDB 5T8KC 1U2RA 2YWHA 3NBUA 1PZEA 4HATA 5FBQB 1D4ZA 3FYUB 1E2JA 2G17A 1E6LA 2QX6A 1QVWA 2V4MA 4H7FA 4RHUA 3L6BA 4DR4B 2IHZA 1QHNA 4JX8A 1WPGA 2ORVA 3UXHA 4R9NA 3AUAA 1U7DA 3W8NA 2CNNA 4G2TA 3ABIA 4R3UC 3ZCPA 3GLHA 4ZCMA 3HY6A 3IT2A 3WGZA 4B6PA 2H7YA 2C8JA 4YMSA 4XLZA 1PKEA 2Q7DA 1XXHA 3GWZA 2UV8A 1QO0D 1VGQA 2Q2OA 5DN6A 4AYWA 4E5KA 3D0QA 3QE2A 3QX9A 5CDSA 4F11A 4EG3A 2HCFA 2NACA 1RBYA 4TUYB 3O5AA 4IJQA 1I14A 3A4NA 4Q7QA 2QHXA 3HNRA 3R6TA 5BSTA 1XFAA 5FWNA 2XT9A 3SN6A 4EFLA 3QPCA 1X80A 1MU0A 1FU4A 1RLUA 1USUA 1UWVA 2EJWA 3IELA 4Q6WA 4U7TB 1N2GA 5EZYF 3CLUC 1TAUA 4MHOA 1ZLXA 5A4AA 4S1VA 3FGOA 3QRWA 1BHJA 4M87A 5LM3A 4D79A 1L1FA 1KJ9A 2J85A 1FB5A 1R27A 2ID4A 4KWHA 2A30A 2ABWA 2GH1A 3V1NA 5K2OA 1I10A 4CVNA 2TS1A 1VJGA 2OGTA 3E3OA 2G70A 4MVJE 5AMXA 3T7AA 3VR4A 3ZTTA 1UFKA 2QP3A 3DPSA 4LX8A 1VMIA 2B21A 2I1LA 4HYQA 4Q48A 4CT0A 1BE0A 1PR2A 3GY0A 3GLHE 5DHTA 4IRMA 2HQRA 4B4UA 4JSYA 4Z7QB 1PDOA 2NT3A 3IKVA 1S4MA 1CP2A 1LWNA 2C2HA 2O6LA 4G1CA 4GDFA 4KR6A 2Q0SA 4YUZA 3KKKA 4QBTA 3BXHA 4ZXFA 3EWIA 4OD0A 5JCOC 1T2UA 3T3MB 3KAJA 2O9JA 3EXIA 5GOZA 3U09A 1SB8A 3AVUA 4BDSA 3SOPA 3VZPA 1P9WA 2VDWA 3F6BX 3GPCA 3HCWA 3KWJA 4M54A 4M9QA 3VHXB 5FBVB 1IK6A 3OOWA 4W5JA 5KWSA 1BN6A 1ODIA 1KE1A 2NX2A 1M3SA 3S28A 4CUZA 3DLTA 1V3VA 3FLBA 4RW0A 3ZOKA 3Q2KA 3M8KA 4XTCS 1TVMA 4MR7B 5EXXA 1HDZA 5FI5A 3WTCA 1JDUA 3KSBC 1VJRA 2RH8A 4PZPA 4IMIB 1K66A 2H7XA 3PGA1 1DO0A 3T95A 5K3EA 2JAXA 3T8YA 2B8WA 1OBHA 4HNSA 4PFJA 4RE6A 4ZAFA 3NHBA 3WLMA 4B09A 5EIBC 4ZKEA 5I01A 1ZJYA 3WBJA 3U7EB 5I6DA 2EL7A 1UJBA 1PWEA 1B14A 2ZVPX 3AY6A 1CUFA 4RQUA 2FEKA 4AUEA 5HW0A 5JWRA 3L4JA 5C0OE 2Y2VA 1OF1A 5DCWA 3RV3A 3CUEF 1SULA 4EPYA 1Q1GA 3HUEA 3KWMA 2NXEA 4ACAA 4BFVA 2A9OA 3IP8A 3D9QX 3JWJA 1Q22A 5E1DA 2YR0A 3DTNA 3AUTA 3A4LA 3LBHA 3WL5A 1DOHA 3GRZA 4QG3A 1AVTA 2VEOA 1EXDA 2V7XA 5DTJA 3RIXA 2WJIA 3P32A 3RVNA 5K0BA 1HT2E 4QQKA 3MNFA 5EJ6A 2JGFA 1N6PA 2V7WA 3VC7A 2QN1A 3T5PA 1DAIA 1KMIY 2L17A 2P1DA 4R9VA 5HF6A 3VPGA 1Q3TA 3UHJA 2HCTA 4MVJD 5BOSB 8ATCA 1M8JA 3SE7A 4LXUA 4XJSA 5CVDA 1ICEA 4TL6A 3U37A 1N2ZA 2H17A 3OU2A 5CNIA 3CUKA 1NBOA 3DL4A 1U1EA 1NP7A 4EH1A 1EJ6A 2QLBA 3HUFA 3NG1A 2XB9A 2QRZA 3A4MA 1CDZA 2JFVA 2VYNA 3NIDB 1CE8B 1G41A 2XTNA 4MRSA 4D4HA 4CEIA 3GDFA 4IFIA 1SIBE 4JI0B 4HDRA 3QBDA 1BQEA 4KQCA 5H68A 2VJBA 4FHGA 3T9EA 4CM4B 1RXVA 3TNYA 5DFAA 1IIRA 3PENA 5JU6A 3HZZA 2HLPA 3HSSA 4NULA 4MGYR 4G0XA 1NNUA 1ZNYA 2CHUA 1E32A 1XJWA 2GCOB 1Z4MA 2QV0A 1I6KA 1WDTA 3HA3A 4L3WA 4QBFA 5DSZA 4DT1A 1HDEA 5I7WA 2PUTA 4HB3A 1X13A 1PNOA 1O9HA 3VOBA 3VM6A 4BP1A 4CFYA 1W0KA 3IUJA 1I7QB 4L5YA 4ZVNA 1KRWA 2FEAA 1MORA 3JQDA 3NHJA 1G0OA 1ADGA 4G3XA 4JA2A 5CVJA 3DYVA 3OCYA 3JQ8A 5IKPA 2G82A 1FDSA 2ZBRA 4GVXA 1DQRA 1G3IA 3OZUA 3A37A 5K0EA 4ID3A 4EHBA 1JWBB 1IJFA 2NZ2A 2Q2VA 3MUOA 1TLLA 2B0JA 3R6LA 4NOKA 1YUBA 5JI3E 1RWOA 2EFCB 2OZLB 3AR8A 2WF8A 4ZU1X 4JQZA 4MJLA 1U2DC 1UXJA 4IOMA 4FWTA 2Z6VA 1XZLA 3ZXUB 3PZBA 3EY4A 3K4QA 3ZHRA 4NMMA 4UEJA 3KB1A 3M6VA 5IF9A 5GZ3A 3RYCB 5C51B 1F0YA 1ID1A 2JFBA 4XQ0A 1C80A 2DR3A 2ZAIA 1JGTA 1GPAA 1VG1A 1C29B 2F9MA 5JYDA 1YVPA 3WGKA 2OK8A 3DEYX 5A4DA 1XN1A 1QVRA 4RKWA 4UTRA 5DCLA 4JQYA 3TSAA 3I3SR 3MTAA 3LV8A 1ZVJA 3WJAA 3G79A 3VU8A 4TVSA 4XDGA 5P21A 3I8XA 3RGWS 3OQPA 4EVRA 1JIUA 4J4TA 5DRYA 4FX5A 3WL7A 4NS1A 1NF2A 1WMBA 1X1RA 2WJVA 3OCJA 3HHEA 4MO9A 2WM2A 3LWDA 4QUEA 4N3BA 1Y33E 3D6NB 3FPJA 4WN3A 2XCTB 3ICQB 3BSWA 3VR6D 4RVHA 1QJCA 4AP9A 4IFBA 1OFGA 3AGPA 3ZYZA 3BXZA 1P0FA 2YXDA 1PGPA 4BLQA 4JI5B 2Q0QA 2FPPB 2WUDA 1DQZA 3PXEA 4UHHA 5IN5A 2WIAA 1QHYA 1YBFA 2RI6A 3EXFB 3TLMA 2I7CA 4M4SA 5FI0B 1M75A 4IHAA 3FIJA 3QVGB 5IT9A 2ZAGA 4MX8A 2Y1EA 2O2GA 2YC2C 3CISA 2OB1A 3M83A 4IZHA 5HKLA 4EY7A 3K0AB 1JEJA 3WYDA 3FPAA 1ZM4A 2AWOA 1MOQA 1SD5A 4ZVPA 1K6IA 3SHWA 2AUTA 2IIQA 2B4RO 5IS2A 4CU2A 3AL3A 3SR0A 4YYEA 2H48A 3VNQA 4KU4A 4XYBA 1TT5B 4URZR 1DV2A 1PNQA 4FOTA 2I2DA 2ZSHA 4GMGA 5JAZA 1OVMA 5LQDA 2C3MA 4Q05A 2BDTA 3SYNA 4RSGA 2NV0A 4G36A 3QKIA 4DV2B 1LQUA 2ZR8A 1YQWA 2H2HA 2ID7A 3OTHA 1KI3A 1PJAA 2CW5A 1E1DA 4YC7A 3DKIA 2GUWA 3ISTA 5EA2A 4AG3A 2WABA 4OIMA 3FM9A 3NR2A 4EJSB 1N2JA 1GU1A 1UC8A 3GH1A 3C3CA 1DC8A 4KLNA 3BMNB 3HY3A 4MKRA 4HDKB 1Z0FA 3DT6A 2F8TA 1W2WB 3AVXA 2NSHA 4TTIA 3MWEA 2OO3A 2I87A 4EUEA 3AESA 1TM1E 3R3XA 4R1SA 4IMJB 3BEOA 4I4IA 2Q6OA 2CFCA 3PDIA 4N0QA 3CPHA 4R0NA 3ADKA 1P5JA 4W7IA 3L7DA 4XUEA 5EPOA 5F5XA 3WMRA 1COWD 3DLBA 3BUSA 2J0QA 1XU9A 2CLLB 2Q46A 5DM2A 3AI2A 2CXSA 4TV8A 2AX3A 4G1EB 3NWEA 4L4RA 2RKBA 4RPIA 4XYMA 5DXFA 1KZGB 3I76A 2RFLA 5AVSA 2H59A 1F4LA 1W4BA 2JS7A 2QENA 3CLTD 2DY0A 4UZSA 4MGEA 5IYZF 2VHCA 2EERA 4BGEA 4W99A 1XZ8A 4TXHA 3KDPA 3NCHA 1Q0HA 2ACEA 3KG2A 2QRMA 4GX0A 2ANBA 1I9CA 2GR9A 2H54A 3D2BA 4Q47A 4JGIA 3RC9A 3UWDA 1XR3A 3AY3A 1V16B 3P7MA 3B2NA 1KP2A 3GQBA 4WZBE 3EISA 3BHNA 4JEIA 3ZHSA 1ZESA 3D0KA 5C52B 1E60A 1Y4DE 5GONB 2B4AA 2P4QA 2J6BA 3O2QB 4IOLA 1AB5A 1ABFA 5TPZD 3X2SA 4FYYA 1RW4A 4OK3A 4BQOA 1IPFA 2PD3A 1Z17A 2YNMC 4C0BA 5CYPA 4CL0A 1ETUA 1ZH0A 4TMWA 1A95A 5EVJA 4I55B 5KJFA 1FQJA 1NUPA 2AG0A 1LQ2A 3F5SA 1Z4LA 1JQJC 3H1AA 2XMRA 3N8KA 8GPBA 3QW4B 4XW2A 5EP2A 3WNQA 2AJDA 3AI3A 1QGDA 2LXNA 3GVXA 2A0XA 3KUDA 4PC2A 2GETA 5TT0A 4XYEA 3Q1KA 4FEEA 5JCXA 2WTNA 5CXQA 1DEHA 3IV7A 4C0JA 3MWDA 1SVMA 1I4TD 2J9FA 2GCNA 3G5LA 1V1JA 1FIUA 4RIEA 1FX0A 2G9RA 1MOPA 2JCXA 1LPPA 4J1NA 1JSCA 1WVIA 1OXBB 3BA6A 4NARA 2VSFA 3TQFA 5FX2A 1U3UA 1XTTA 3I9V1 3CLRC 1E2IA 1BFKA 4DMLA 1JSRA 3LIPA 2F1JA 4IYRA 1MQSA 4X1KB 1PQPA 1I4EB 1TXGA 1FVXA 3QKUA 4S1TA 1PUJA 2WJYA 2YZKA 3DBHB 3OTWA 3PUWA 5HJ2A 2JFYA 4XWOA 3EUWA 4YI3A 1BMQA 1H94A 1OFVA 4TLAA 4DRXA 3BRCA 2CFTA 2CHEA 3UTCA 5DTQA 4MQEB 4XLLA 3FVTA 3PXBA 5CDFE 3CZCA 4F46A 5JH7B 3GFBA 3A6FA 4ZWNA 2A14A 3B7GA 1NTRA 3B48A 3MOSA 2CMHA 4KX3A 4TVBA 3UMJA 4D9EA 4DQDA 2HWUA 4XOIA 1IAVA 3ZVRA 1RI5A 3GFRA 1NBWB 3EXG2 4XJVA 2ERCA 2H7CA 3SX4A 3PKZA 3ONWA 1UMDB 4YUAA 4JZYA 1FSFA 4HCJA 3L4SO 4XUCA 2R7AA 2VK4A 2AUNA 4CF7A 2X1LA 4NMWA 5NLLA 5BW5A 5F2NA 2YRWA 5DTIA 3BMCA 3BL8A 2VJDA 3FW1A 1QTNA 1R6AA 1R6VA 3AJAA 3BTSA 1VBKA 3H75A 4FNMA 4GR9A 4MGIR 4MPPA 4RTOA 1CUUA 1JTEA 1VA4A 1VPLA 4I50A 5I7SA 2FN4A 4QDXA 5L6MB 2O0JA 3DVRX 2WTEA 2JAUA 4ZYZA 2MHCA 2POCA 3Q88A 3HXPA 3T6KA 2R1UA 5DBFA 3TLZA 4H77A 2GNAA 1YI8A 4IBOA 2FMUA 2HSGA 4V2UA 3G2MA 5LXTF 2QV7A 3IQHX 5DBGA 2REXB 4GRDA 2HXYA 3T54A 2D62A 1K1EA 3HFSA 4RTPA 3CX3A 1REQB 3H4IA 3OHSX 3RKRA 7ADHA 5ILQA 2PRSA 4OQQA 3VVLA 1DPGA 3MCZA 3RROA 4AO7A 3GLIB 1O08A 5KC9A 1AZTA 1VSVA 3ETGA 3C3YA 3LGSA 4QPDA 5KTMA 2O5EA 2GLTA 3DP7A 3NH6A 5A71A 5KJCA 2VJQA 1ZK4A 4AD8A 2QUZA 2CUNA 3FA2A 2QTGA 3GARA 1RIIA 2I03A 1YZKA 4U5XA 2E4VA 4WZAA 2FP3A 3FHLA 4U02A 4WXRA 2BEKA 1Y9EA 2GRJA 3FLAA 1B8UA 4R2IA 3WLTA 5IUNC 2Z83A 1L5FA 5JVDB 4UTPA 2VBFA 5JAOA 3BDIA 4JVNA 3ELYA 5SYAA 3RRZA 4AQDA 5C5DA 2TYSB 1BXRA 2C1ZA 3RU3A 4HAYA 4CDNA 3ZUGA 3DVSX 1H9BA 3TEJA 3V55A 3V9PA 4PBRA 1QC5A 3KXKA 1PWHA 4IUDS 2HZ7A 3PEUA 2GWRA 1B0PA 2VZEA 3AHJA 1YE8A 2GVZC 3KZVA 4MLZA 3E5RA 2Y0EA 2POQX 3IAS1 1J4AA 5AI8A 1QQAA 3JD4A 1J99A 3GGCA 3QWIA 1YA4A 5E2AA 1DKNA 1TB4A 4ODIA 4CEIB 4R7ZA 3ONEA 4Z8YA 4DV3B 3JZDA 4W7HA 2OG1A 3K8QA 4ZVVA 1U8UA 2RGBA 2WU4A 1Z56C 3BIJA 5E7IA 2A5DA 4JS0A 5L9AA 5I7UA 4KR0A 3O8CA 2VF2A 3UB3A 1HOXA 3A6JA 5AWFC 4A10A 4BAGA 5L3QB 1EHYA 1P5FA 1U2SA 2VNAA 2J3HA 4HEHA 3ROQA 2FVXA 2VHYA 3O1HB 3R40A 1XOIA 2E4ZA 2X5OA 4MS3A 5D5PA 4DB4A 5JTUA 3QPAA 1ISIA 1WETA 4UCQA 2YMLA 4FEGA 5AI5A 4NPCA 1YFZA 1G9XA 2WJ4A 1XB2A 3AI1A 2C3YA 3RV4A 1R4ZA 1GFIA 1DPFA 1HE8B 3LS2A 3LWNA 4BB0A 3QXCA 3PFIA 1LTQA 3VR5D 4C4ZA 4CV2A 5I4BA 1F20A 3U7RA 4NV1A 2VP9A 2JIMA 3HHPA 2ZETA 2DYKA 4HGPA 5EEHA 4FJ2A 1T29A 2CN1A 1NGSA 1XA3A 2P79A 5H3CA 4JK3A 2E2WA 1UBLS 1L3IA 4CV1A 3ERCA 5ANRB 4C89A 1CFJA 3PUJA 4MYHA 3IAS6 2RG7A 2W83A 3PHHA 3QUQA 5DNWA 1XD2A 2VHEA 1V1MB 2PMFA 2XUHA 4L8GA 4M1WA 1SIWA 4QICA 2XH8A 2DHDA 2BFNA 1PJLA 3FHJA 4LVNA 1GT6A 4TZKA 1KU0A 3NEJA 4H59A 1QH1A 1WOYA 2VSQA 1EJ0A 4M22A 5JCOA 2G9ZA 3Q2IA 4K8RB 1HFKA 3DWGA 2QN2A 4J2OA 5THKA 3I01M 3RK1A 3MCAA 3D64A 2ONKA 1RHJA 1U8FO 4WNYA 3K9CA 4IGAA 1N3YA 1WD7A 4YBRA 4RBNA 4CT4B 1B42A 3JZIA 1GPJA 1AZSC 2WF9A 2ZSUA 1NVAA 2PSFA 4KLZA 5TPWB 1IZ0A 3HBMA 4ENUA 2JG3A 1G7CA 1IEWA 4RF3A 4V39A 4XD7D 2O8CA 1ORIA 4K3VA 1N2SA 4U7HA 5A0FA 3KJNA 4CW7A 5JWOA 3LPLA 4RFSB 3ZWCA 3WIDA 5DYWA 4EBFA 2CLEB 4AJ2A 1Q95A 4RVSA 4UEQA 1BE6A 2WHPB 2DZDA 3ITDA 5EHZA 4BXOB 3WLNA 4HAUA 2RAUA 1FRNA 2WWHA 2SKDA 3FFXA 3W7VA 1BTOA 5EC8A 3MHPA 3EZNA 3IDFA 3ZWXA 1LV8A 1RXIA 1MW9X 1JU4A 1TCAA 4LWPA 3EEBA 4GPZA 2OORA 3DB1A 4HDMA 4L16A 2BOVA 1CNEA 1SCJA 2M6RA 1I2AA 2QTBA 4IJMA 4RK1A 3TQCA 4RH0A 2C5FA 1Z82A 3GW8A 3RWOA 3EVNA 3REQB 2R8ZA 4DA8A 3NV9A 4DWWA 1XI2A 3BREA 4BFXA 3PDHA 5AUPB 5BV7A 5IU6A 2ZUUA 4WXMA 4FN5A 3GT7A 1MRNA 2GXSA 2QR3A 3C3EA 3K71B 5EIXA 1LA2A 4LY6A 3U1TA 2D2XA 2CNBA 3LY9A 1UBNA 4XSVA 5CLHA 3L4KA 1E1QA 3A9WA 4GZLA 4PZYA 4RVUA 2X3UA 5FOVA 1PQWA 1YBMA 3KZCA 4ZOCA 4DZTA 1NRWA 2FOXA 2ZYSA 4NZOA 3M4YA 4XFKA 1IQRA 4F5YA 3HP4A 3TSCA 3QTBA 4WLVA 3TH5A 5CA0F 3GQBB 1VSTA 4NCJA 1ZXLA 1UP4A 1XZHA 1L7PA 2PIAA 2VWHA 1V39A 2Z2KA 3EUFA 2IHYA 2WB2A 3CRVA 3F8WA 5KNBA 1OB5A 2AEFA 2ONJA 4E1AA 1DAHA 2Q5JA 3ZE6A 2PH5A 2UVPA 1U0OC 5JBQA 1QRSA 4BVKA 3I73A 4KQXA 1WNFA 1XQVA 2IGBA 2QD1A 3HV0A 3V7FA 4JV5B 4TV8B 2ZRNA 2QRKA 3QPBA 1LBTA 4IJ5A 3ANTA 2BZSA 2GPNA 2BMEA 2V5AA 1E1RA 5DGHA 4EKYA 3OF5A 5LUBA 1A7JA 3VH4A 4PO8A 3DTVB 3QXJA 1JILA 1Z0UA 3B36A 4AROA 1TJ4A 2WAYA 4RX1A 1QOQB 3HUTA 1NVTA 3GRCA 1H2FA 3FF4A 5GADl 5K3BA 2ZB3A 4TYNA 2PGIA 2HXSA 2WIFA 3INYA 4D4JA 1HNWB 4WBSA 4KO8A 1E1NA 3B9PA 3F4LA 5EP4A 3V1KA 5LXTB 3ESZA 3GLUA 4EUHA 1NYQA 4MP3A 4MS4A 1AN9A 5CX4A 2Q3EA 1GGEA 4EO4A 3FTDA 1ZFNA 1I5RA 1PS9A 1PSDA 3LWZA 4G1FA 3W2EA 3LDFA 1K3TA 5BORA 4UE6A 2RHGB 2C5EA 4GVLA 4BWGA 4Q4HB 1EDZA 2Y77A 3ZTWA 5K0LA 3L7BA 5B1IA 3RVOA 3WNDA 5C8VA 2CEKA 4UUBA 4CMEA 4ER3A 3HH8A 3C4JA 4R0MA 4A91A 4RJTA 2HLDA 3NKVA 2PLAA 1JI0A 1Z2AA 4IIBA 1CW2B 4KAAA 4NY1A 1VB5A 3L8MA 1L1RA 1Y8RB 1LLQA 3F96A 3DONA 1Y3AA 2VDWB 3EA0A 3TI9A 4DEYA 1K98A 4IS2A 1O4VA 2X7JA 2ZR7A 3AERA 3L04A 1HDYA 2JFFA 3UJBA 1R0BA 1X86B 1P0IA 1KDPA 1N9GB 1IQUA 1G2QA 1UZMA 3BQNB 2CBGA 4R1LA 4RACA 5JS2A 5FNVB 3F7NA 4GZ3A 1V4VA 1XRPA 3OAAA 4JLPA 4IIGA 2B6NA 1TF5A 1UWKA 3NHMA 1TKCA 1Q3KA 2JI4A 2H4HA 1U3DA 2ZB7A 3OZBA 4O2LA 1MTOA 2RIRA 4R40A 5CVUA 1WZNA 3M4NA 3VDXA 1TIBA 2OAP1 4JVLA 3TX2A 4REMA 4EG0A 3IPRA 1N3BA 1NXOA 4RH1A 1QIDA 4I5GA 1QHSA 4AWBA 1UK8A 1FLVA 3KSDO 4LPKA 1ZGGA 4UZEA 4FUQA 5LXTA 5H8WA 1WM1A 3O9MA 4JL5A 2HA0A 5FA6A 5H0IA 2C61A 1JN0A 2ILVA 3P9QA 3AY7A 4KQ9A 1OPXA 4X44A 5KOJA 3C5WP 3JWEA 3L9WA 3LKBA 4UEWA 5G4KB 3WKAA 5KX5A 4EY5A 2YZMA 3A7EA 1U81A 3UMBA 3WP1B 5GVSA 3LPNA 2BCJQ 3P2YA 1DRVA 1TJYA 3O74A 4JBLA 4JVMA 5F5LA 3RVMA 3UATA 5B7GA 2D59A 4XUGB 3ENVA 3IKMB 3D6UA 1JLMA 4KE7A 2DE0X 4DLXA 1A9RA 2F3QA 4ND6A 4JI7B 4KXWA 2Q21A 2J6HA 1DL5A 2R6CA 2A8YA 3CCCA 3DEKA 2JFNA 5DLQC 1T9GS 5KAMA 3WLKX 4CWAA 4CEJA 3O0TA 4WINA 3STUA 1WBBA 1Q0ZA 4FNAA 1L4GA 2NP6A 2WMOB 2Z2YA 3TN7A 2JFXA 3NHKA 2EKQA 3ND9A 2XADA 3CBGA 4A92A 4MWDA 1OH5A 2OG2A 3EODA 2F3RA 4BV9A 4J16A 3TCXB 1C9DB 5EINA 1GKUB 4CM4A 4DQ0A 1MXHA 2ZYRA 6LDHA 5LWQA 3VR4D 5DYTA 5AKHA 3G2QA 3FYUA 3Q4GA 4WY8A 4EY6A 3VOAA 1W73A 2AF4C 2NU7A 1D1PA 4UDOA 4W8GA 4WXEA 3I6QA 4A1FA 2Q4BA 4EB6B 5F2EA 3UFXA 1NMQA 4QXPA 2Q2WA 1ZWLA 2B9VA 4KQ6A 3P9KA 1IZ9A 2VXCA 4J2HA 4AJOA 3L7KA 3BTOA 5DNAA 3X1MA 1KNXA 3JQRA 4KCGA 3W8EA 4FUTA 4M1OA 5DU2A 4PLFA 4AP6A 4BJ6A 4C0KA 1ISFA 3I04A 3TECE 3KTOA 5LDHA 2W0SA 5BN1A 1PFYA 3DR5A 1TT7A 1V9CA 2B30A 4RM3A 4B3RB 2XWJI 1LFDB 2JLQA 1D0IA 3VDRA 3DJYA 3M6FA 2CLMB 1LLCA 4IDBA 3QELB 1OLXB 5HBRA 3RYFB 3F73A 1W85A 4KSYA 4U7GA 1U8AA 4I5DA 4C6RA 1TE2A 2XXBA 3UCXA 5A9RA 5F35A 1JG6A 1OT5A 1O87A 2OHOA 3FWYA 3DHYA 3GA5A 3QXXA 4TUYF 1F7VA 1S1MA 2FH5B 5AJHA 1ZLYA 2NUBA 5DLYA 5G4KA 4DG8A 5KX5B 1UOQA 1X1BA 2VNKA 1V43A 2ZULA 3DR3A 1XDZA 1JXMA 4HD8A 3ONDA 3U1BA 5AW9A 2BGTA 1PL6A 1SC9A 5KOHA 4DSZA 1ARZA 4KO3S 3EXHA 4CQMA 1DEKA 4BQFA 2G1PA 3OU6A 4ZMSA 2JJ2A 5JZOA 1KJIA 4OXRA 1CB7A 3TAXA 1DG1G 2ZRKA 1QZZA 3KJEA 3KYDA 4GBJA 3PC7A 1W29A 1VKNA 1IN1A 4Z4QA 3JPWA 4Y2PA 1CUDA 2NQ2C 1GADO 1NPDA 2DVMA 3HN6A 3MB8A 4WNAA 2HT1A 4TKVB 4MJXA 4XVRA 2O2CA 4LNHA 4Y2SA 1A50B 3CG0A 4I8DA 4TQGA 1A5ZA 3OUUA 1U0FA 3UJPA 1H0HA 1QIIA 4RVCA 1JHDA 4BFTA 3K1ZA 4L1KA 2XKBA 3CZAA 3BAZA 5ED4A 3NHUA 4C1BA 2FZVA 1UBSB 3DO5A 3USCS 3HJFA 1P9LA 4H4CA 4HDMB 1EH5A 2EGUA 2YY6A 5E6SB 4JITA 4DBLE 1T9CA 5FOWA 4Z4FA 5A0VA 4R81A 3O75A 4NPAA 2R66A 5KWJA 4NU5A 1EQAA 4Q7KA 4LF8B 1YB6A 3FTQA 3W2TA 5JFOA 1ZKMA 1FUIA 3VU1A 4QQNA 2LV8A 5B4VA 1C30B 2X9LA 4N7JA 4TTVA 4OXIA 4MNTA 5KJEA 4DDKA 1CJCA 3P9CA 5REQA 2DSNA 1JWAB 5IXJA 3EDYA 1AKNA 4ZGWA 4LYYA 3BL5A 2PNFA 5GMOA 2Y0PA 4F7WA 4BLSA 3U4DA 3EXEB 1WF3A 2R7KA 3H2JA 3KL2A 4NE7A 4PG7A 3TL6A 5B7NA 3L8ZA 5FPTA 2G71A 2CYBA 5DHSA 4LCBA 2WLTA 4ROTA 5AM0A 3FZYA 1EK2A 4BXOA 1B2RA 4DV5B 4C7XA 3VI3B 1K5DA 2DPLA 1MIHA 1AG9A 4FYKA 4Y0VA 1PLJA 2ES4A 4MUEA 2PMWB 5EE3A 5H4HA 1O0BA 3T3IA 1AUQA 4P36A 1Y3DE 2DHCA 2EOAA 5AQEA 1XYGA 5D3KA 3AO0B 5DCYA 1QVAA 2IF0A 2X8AA 2BFFA 3BWDD 3RG2A 2QRGA 3RJTA 4PRKA 3N2NA 1P19A 1YS2X 4JJ6A 4L2IA 1Y1PA 4K87A 3SR4A 4KR7A 4RCYA 4XRGA 4BZQA 4YT5A 3C3KA 1FP1D 4KPYA 4ZKDA 2ZXEA 2BI8A 2XHZA 4PQRA 4GMFA 5CHYA 4R3NA 3UMVA 4NCKA 5JVDF 2JBAB 1SA0A 3R8XA 3E5MA 1SUCA 2XRFA 3PQ2A 4XZ3A 1YAJA 3RGGA 1ZOLA 4J8PA 2DCMA 3LA8A 4JR0A 1X7WA 3IMCA 4MUKA 2LE0A 3LP8A 2GZRA 1Z4KA 1D03A 1FS4A 4L0QA 4BAZA 1CRPA 4D25A 2CXTA 2AZ4A 4G0YA 5AUQA 3O92A 1CR0A 4C7OA 3HGQA 2LIPA 4ND4A 5KQGA 2R8XA 2VJYA 1QH0A 1VMAA 5H82A 4MRAA 4KMMA 3UK6A 1Z07A 2ZIXA 2HBRA 1UJMA 2P69A 2EIXA 4WK6A 3F5QA 3PSAA 3STHA 3RUIA 2BEJA 4ENRA 3EGWA 4DSAA 2HCJB 1QS0A 3VU0A 2HLNA 3P1JA 4QRIA 4PZUA 5DSTA 3TRIA 3UFBA 3V8EA 4HAZA 5KC8A 4FGWA 3N6VA 1SG6A 4IJWA 1NC3A 3G5UA 1UBUS 3A2LA 3LY8A 3PUVA 1BXGB 4GR5A 1N6KA 5K0SA 2W43A 2PGOA 5EVCA 1E9VA 4MVJM 4O63O 4D0GA 1CEYA 2WZBA 1JA1A 2KS6A 3P5SA 4L7VA 3AIIA 3RS5A 3LE8A 2NVUA 4Q4DA 3QVMA 4I5EA 4WGFA 1YIAA 5BWNA 3PICA 3HCCA 3QVXA 5C81A 1YMQA 3K09C 4FTWA 1RC1A 2PXHA 4OTZA 2J3MA 5EOVA 4OM7A 4LHYA 5J2TB 2FDCA 5BMOA 2J0SA 4KR2A 1C9EA 3NETA 3QHQA 4IHQA 1R8JA 1NBEA 4RHEA 1FTNA 4RKQA 4FBMA 2IOFA 3HU5A 3B1VA 3PGKA 5ALXA 1J70A 5JMOA 1Y9JA 1L4MA 2PU5A 1NXVA 1UBMS 4NMXB 3ZGLA 3BH6A 3K96A 4LJ8A 4DCPA 4E31A 4DV1B 4OH1A 3K6KA 4OQZA 2IH5A 4Z4EA 4GUAA 2H63A 1CEEA 3ASYA 3WWCA 4LE1A 1CVLA 3IEPA 3K2QA 1U3VA 3H5VA 3K20A 3K8ZA 2AG1A 5JH7F 3OJWA 5BSHA 2V45A 3W8RA 4H3KB 1BWRA 1NLFA 2QNIA 2VUHB 3PFWO 2IEBA 5TV2A 4I8IA 1C41A 4TSRA 5F12A 1YCDA 4P3PA 2VPTA 1P33A 4B3DA 2AVNA 3VISA 2V55B 4PBTA 1LUAA 1ANKA 4BFZA 1OZAA 3BEDA 1OBFO 4I4LA 1SZPA 2E55A 5AVKA 2OB2A 5GM2A 2Q4EA 4RXUA 2XQVA 4I2VA 5SY4A 1UPAA 4GI2A 4DCGA 2AOTA 4F12A 5J4HA 4LF5B 2VT2A 1PAUA 1QIFA 3N59A 4LS3A 1GU7A 1V16A 5LN1A 1SH7A 2QUKA 2E89A 2PWBA 4ZI5A 4B3IA 4Q9LA 2C84A 3O3NB 1VE7A 4LZJA 1K2WA 3VRHA 1E4VA 4XM2A 4B44A 4PX2A 2A9PA 4ISCA 1MQAA 3G9QA 1XDBA 5AHKA 1SUDA 5KDDA 5TMEA 3CUTA 1RRCA 5ALRA 4E22A 1DXQA 4PLWA 3UW3A 1GTSA 3QKTA 4P9NA 1JSLA 1P3Y1 1YRWA 3COWA 3SLKA 2ECPA 3JWHA 3AP2A 4D6XA 3AF6A 4TV9A 2WIJA 1RYMA 1JKXA 4TRRA 5JDIC 5AQ1A 3EC2A 3A04A 1R66A 1NG1A 4YQYA 3PFFA 5T4BA 3AJRA 3THXA 1WMAA 1QB8A 4R0VA 4RD2A 1RAFA 2I2FA 2XMGA 3KKMA 4CUKA 5C4MA 2WSLA 5JXGA 2B82A 1TO2E 5HR5A 1MV5A 5JSQA 3EEIA 4Q4AA 2WJWA 1GPKA 4UM8B 1Z37A 1MQ8B 4UTVA 2WLSA 3IAM1 4NX2A 3C8ZA 5TNXA 4FSDA 3DBOB 4W8HA 2QG6A 1E9SA 4G37A 1NLZA 4IDDA 5D3MA 3QEMB 4YRSA 4B2YA 4UCFA 1V35A 4TV9F 4B76A 5EJMA 4BKMA 4DLPA 3ISJA 1T9HA 3BGWA 2AJ8A 1UFVA 3LW8A 4OPMA 1KKUA 1YE3A 2DHRA 3A0UA 4EG8A 2WQ7A 1IXYA 3GV0A 1N34B 3OZDA 4I7EA 4DA0A 4JP5A 4HV4A 3TJRA 4P31A 1Z5VA 4MCJA 5DHRA 5MF6A 4RMIA 4L4UA 4JEHA 1SELA 2GJAA 1DWQA 2MYUA 4UHEA 2XE6A 5REQB 2D5LA 3SC3A 4F6RA 2VRWA 3B1FA 4Q18A 2F64A 2O2EA 4Z0TA 3RC1A 2R5WA 3LLUA 4LXXA 1K89A 4TMXA 1OGYA 4WBXC 1Y8AA 2HO5A 1T25A 3BJZA 4NHOA 4COKA 3N9IA 3ZY6A 1GNSA 4DKXA 4QYMA 2JK0A 5C1BA 3KXDA 4RIHA 1Z0AA 3ASZA 5U4XA 2IWRA 3WK6A 2DTDA 1EESA 3GZNA 5MDHA 2WIKA 1HGXA 3IIEA 1F2UA 4RL4A 4Y1GA 1SCIA 1T3TA 4DF3A 3SMVA 3A4VA 4AIIA 3E7XA 4KRXA 5I45A 1YZQA 2YYZA 3OCWA 2IYWA 3T15A 1J2JA 1IM8A 3I2IA 2BUBA 2WSBA 3O47A 4HRVA 1E3SA 3IA2A 3MQ2A 1FTGA 3QITA 1K7XB 3DDUA 2HXGA 1W19A 3K8OE 4HNHA 4E88A 1RYNA 4FWIB 2GJKA 2BJWA 1C9YA 2DUMA 3KQOA 5B58C 5JS8A 4WCDA 1G20A 4FPXA 1REQA 4JP8A 1DAOA 1KFCB 1QRUA 4CKCA 4CZ2A 3AFOA 5C1PA 3N0WA 2PXCA 1KBOA 3PDUA 1KXJA 3D1JA 2MYTA 1H6CA 5GM1A 1DXHA 2HRBA 2KI5A 4BOYA 4HGRA 3WQSB 1FY2A 4DC0A 3DHVA 4OHVA 2ORIA 3QVJA 1P4SA 2OFFA 3TLJA 3TNDA 1AHHA 3TR0A 3U13A 5AW7A 1Q7BA 3NIBA 4HWTA 3ZIUA 5I8PA 2AZDA 4S1NA 2F4VB 1KS9A 2FMKA 2YJ4A 3T5MA 4HMQA 3TZQA 4CIXA 1Y8ZA 1CS0A 3F5DA 4IEIA 1QCYA 1QKKA 1KWGA 4MV3A 4G5GA 2IIBA 1SU8A 2PKEA 2BGUA 4INPA 1DFIA 4LTNA 4WA8A 2PKXA 3B1ZA 3MCWA 2XRMA 4OSEA 5CM9C 5AKZA 1VKZA 1M7BA 4QELA 3W5VA 3V8NA 1U3CA 2DT5A 3T1QA 5EJIA 5KHAA 4MB0A 2OP0A 3UQZA 4IUBS 1R6DA 1A7UA 3H5TA 3H2IA 2NU6B 2GN6A 3D1VA 1C0LA 1X7YA 5JPCA 4MYTA 2XHEA 1FP6A 4K9LA 4U7FA 4G81A 4R2WA 3SVZA 3I6MA 2IELA 3PL1A 4PZEA 3BM5A 4WIAA 2BEVB 1VLZA 2FLKA 2OQVA 1N8NA 1D2HA 2HF8A 1MJFA 4P7GA 4QU9A 5KNBH 4D8WA 3EXG1 1QS0B 1PZFA 1VZ2A 2HFKA 4AJKA 2WAAA 3N0TA 4IIXA 5AHXA 5B1SA 3C24A 3LTNC 2NUAB 1ULBA 5TVKA 2GK4A 3W2FA 5BNTA 5HDBB 2OV3A 4JLKA 1K5GA 1QPGA 3HCRA 4F6LA 2JBAA 1VOTA 1ECFA 1JYFA 3CNEA 3AOEC 4V3BA 5EUCA 4BFCA 4NH0A 5HK9A 2WMDA 3H9JA 4DL9A 5BV1A 1GWNA 4LHXA 5FTKA 1P1HA 2GN4A 2N0SA 2JGAA 2PSJA 4HADA 4XTRA 1BWQA 1XTSA 3BMXA 4NKRA 1CHDA 3EXIB 5DJ5A 4BWYA 2EWVA 5FO0A 2QZ9A 3AI7A 2IP1A 3U80A 4KWCA 4DBVO 2I8CA 3GN2A 5P8WA 3BRSA 3JCZA 1GZSA 4W4TA 4A23A 4HJRA 1Z4NA 1PS0A 4BNWA 4N0MA 3L7JA 4GL4A 1EINA 1WXHA 2C3OA 1Z39A 1ACLA 3Q2OA 5DN9A 1JT2A 3CSUA 2RJOA 2AXPA 1V1RB 3GOQA 3IEKA 5SYNA 4OHKA 5J9FA 4CMAA 1L4FA 2BFFB 2LKCA 2VYVD 2ACVA 2VSOA 4J16C 1RAAA 3GFFA 2XNHA 1T2AA 4PTZA 4RADA 1P1FA 1QFJA 1E8MA 2D1QA 5G3ZA 4KQMA 3NFRA 1RS0A 4ESEA 3BD7A 4EKGA 4X0EA 1DKRA 3A27A 4P1ZA 5BSGA 1L2TA 1Z5OA 3I4LA 4P22A 4LOAA 2C2ZA 1L8LA 3B1XA 1QVVA 5M34A 3I92A 4UBJA 1OLUB 1RADA 3PRKE 4YP5A 3TRHA 2XRZA 4FYHA 1M0SA 3CX4A 1DGQA 5CEFA 1WHTB 2Q0HA 4K6CA 2RH4A 2HWXA 2OFOA 4HDNA 1ZH6A 5JSKA 1XMQB 3Q9SA 1LK7A 1A7AA 4V0LA 3DBRA 3QU5A 4UBMA 4A1OA 2AV6A 2YV2A 2W8ZA 4MUXA 1SKQA 4WD3A 5K6TA 1J90A 1GLVA 1VL2A 2D00A 4HOYA 4RORA 3P0RA 2QLFA 2X9NA 1UIMA 1LBIA 2YXBA 4KN9S 3KWFA 5EHQA 2VHUA 4X91A 1ZGJA 2PRKA 2VCYA 2WF6A 3FSEA 3L0ZA 1LPMA 3BILA 5BW8A 2ERYA 3K5WA 3PRHA 3Q40A 5H5JA 2UYHA 1JKJB 2FW1A 1HNXB 1Y5MA 2YNMD 3DT9A 4QGHA 4HGZA 4Y2VA 4YRRA 3TTXA 2PRIA 3GJ8A 1PN3A 2HIAA 1EVZA 3EK2A 3HGMA 4IJUA 3A6HA 3OJ0A 2K2WA 5G02A 4GP6A 1WR8A 5J5CA 1OFUA 2CV0A 2QQ5A 5ALVA 2EDCA 5CX1B 1QLWA 4GT1A 4YRJA 1S3IA 3L4EA 1YZ3A 3F5FA 4GZ5A 4IXDA 3IOYA 3VYUB 1GEGA 2B4TO 1D4OA 1CDDA 1P75A 3ZDCA 2DBQA 2I34A 2J9GA 2Y68A 3NWOA 3OBBA 2YV1A 2ARKA 1SZJG 1CY8A 4O5AA 4E2WA 2BKUA 1BGWA 1H2RS 3LY7A 4ETWA 3FMVA 2QD2A 1Y5NA 3FD8A 2FW7A 1H4QA 2QTMA 2F9FA 2P68A 4LF6B 1LI4A 1D2GA 5JEEA 2B99A 2GAFA 3K1YA 1NW8A 3DZBA 3PWZA 4KWIA 4D7AA 1YTUA 1SOVA 4ILKA 1LDEA 1J24A 1JIIA 2IU4A 2R0QC 1UFRA 2IYLD 3UK1A 4PAQA 3ANSA 4G6ZA 5I9NA 2QL7A 1UBFA 2HK8A 2ZTUA 3L18A 3U3ZA 1EK1A 3PIIA 1W1IA 1WMDA 1XAHA 3NMUF 3GEPA 4V2IA 1KAHA 1MPXA 3DC2A 1QRTA 4UU0A 3UG6A 4DYDA 4CM8A 3OE1A 4OUKX 4RWEA 1YZFA 3W7BA 1MUUA 3AHIA 2AL7A 1J21A 3NYQA 3WNCA 4ZRMA 5H9WA 1KFEB 3E7WA 2BD0A 2FWPA 3L02A 3PA8A 3GNSA 1CT9A 2B92A 4JLSA 4IIEA 2OXRA 1VFPA 4J9UE 3QH4A 5TJHA 1FP4B 1UFOA 1XMXA 3KYBA 5FB3A 4DUPA 3DZFA 1ZGCA 1UP7A 5I5GA 4DWOA 2ZXUA 5BOSA 1VLVA 4ZVTA 3FPGA 5AVRA 5B6JA 2D2EA 4CCYB 3RUAA 3HU3A 2QD5A 2LGJA 3ER8A 3Q7SA 3TW8A 1Z0IA 2B34A 2HA2A 2OD2A 3FRJA 2PSHA 4CGYA 3SIPA 2BONA 3TIFA 3GFSA 2W90A 2ZAOA 4ALJA 1Q21A 2E37A 2Z9BA 3E18A 3ZU5A 3B2EA 2ZREA 3EH2A 1R12A 4Q1CA 3WLSA 1WSBA 1SEVA 2VTKA 2X19A 3PQFA 5K99A 2O2XA 4G5FA 5A5DA 4QREA 1C50A 4P58A 4PLHA 4CLDA 1ZUD1 2EV9A 4AVYA 1T0PA 1ZRMA 4D96A 1HUQA 5AVZA 2JLAA 3BB4A 2A84A 3PNBA 5TGTA 1CKEA 3O4JA 1W76A 4C29A 2ZYGA 4KE6A 2DOKA 4PLGA 5IG2A 2QL9A 4W1SA 1SBNE 3PUZA 1Z2NX 1YBAA 2C42A 3MUNA 2GNPA 5T6MA 5BQXA 1T35A 4F1JA 1SCUB 5SZKB 5JCJD 3PJEA 4BMNA 3D3WA 2IYZA 1F7UA 5J4LA 4EPRA 2WY2D 1VCNA 2CXOA 2GMWA 3IUEA 3OLCX 4MQ5A 5ESXA 1S4QA 1W0JD 3C5VA 3U4HA 2Q5EA 1M76A 3TB6A 2HHLA 2IXFA 1AO3A 1E1CA 4UNNA 5TY0A 3WGTA 4FFRA 5DNVA 4B71A 4UVDA 3CH7A 4MPTA 3OOSA 1NM5A 1O97C 1U3GA 3ETEA 5AIAA 2MINB 2W22A 3A0RB 1SU6A 3CZPA 3OCZA 2KHZA 1F51E 2JIBA 3DD1A 1MR3F 1C3OB 4Z9BA 3RFCA 2NTNA 4QEKA 4B43A 3U3XA 2M6SA 2VXOA 4GPTA 1F5NA 1JTVA 1C4XA 3AV3A 1UL1X 3BH7A 2AN3A 4PY2A 4LJSA 2BLNA 3NTOA 3OIDA 3QMVA 4N9WA 4RTNA 3D5EA 3CT6A 1RWQA 4ZPXA 4ESOA 1P7CA 1U2TA 2H1VA 3TBKA 3LDAA 3DBIA 2JAOA 4TTJA 1T1GA 4R3WA 3IQEA 1SRQA 1X2BA 4CJXA 4EHIA 2IS6A 2AKYA 1DBQA 4AICA 4E7PA 1NV9A 3GL9A 4Z4CA 1I7DA 4ABTA 2FLWA 2V7PA 4GBED 1XA4A 3WAJA 3ZQKA 2O2IA 2P0AA 1IZYA 3TI7A 3AHHA 3ILYA 4PX3A 5EZQA 3G0HA 1A69A 1MAUA 3KM0A 5EMHA 2FX5A 5BVGA 4MW9A 1UAAA 4NESA 3I0ZA 4MI6A 5L3QA 2P9YA 1NQAO 4PZ0A 3BA1A 3E9ZA 1AUXA 3C1AA 3HCFA 3RIGA 4QE3A 3NV7A 4B8YA 2Q99A 2GBGA 4ZZ1A 3EPLA 2XUAA 3N53A 1FMJA 1JP7A 1M2VA 5C34B 5JS1A 2HI0A 4BBZA 1JIVA 2O8BB 1ZD4A 3I5XA 5EKDA 1DRKA 2C4MA 4FJ1A 4PYMA 3HC7A 1Z5GA 5DPMA 4KQWA 1E2QA 3HYCA 1MRZA 2GLUA 1JA0A 2OHFA 4ZALA 1OHHA 1XTBA 3MD9A 3EMDA 1U0RA 2PZ8A 1ZOPA 2YJZA 1H5QA 3C7KA 4MQ4A 4OIFA 1ZCFA 3EZFA 4UU7A 5A2QA 4OEHA 5IJ9A 2YWXA 2ZS8A 3NTQA 2YWGA 2V7GA 5EJFA 2JLRA 2ZPTX 3I1YA 2YN0A 4FGLA 3RSSA 4EPWA 1ZGHA 4DW8A 3OM1A 4P7BA 1WG8A 1R9GA 1FP7A 1U7TA 3BN3A 3JQAA 3AV0B 1Y5IA 3PVCA 2O3JA 4TS3A 5AH0A 4ED9A 1WPQA 4IICA 4FZVA 1R50A 4NS4A 5IVDA 3PEYA 4AZVA 4OHZA 2PZLA 3FX2A 4KIJA 3VH2A 4EOGA 4GLOA 1KAMA 1B6SA 2GSWA 3PHGA 1IHXA 1DFHA 1PD0A 2XYHA 1BFDA 5A1TA 1VRWA 2HQOA 3AR9A 4WUVA 5IKMA 4PHFA 3QW2A 3WWEA 4B87A 2PS1A 3OJXA 1TTPB 2IW3A 3QUSA 1YJAA 3JATB 4R98A 3CPEA 4ZK2A 3TR5A 3HUUA 4C7MA 1KARA 2JJYA 4P4SA 1NVMB 2H5EA 2RC6A 3HVHA 5TQVA 1OXVA 3HBAA 4PANA 4RDCA 4AZ0A 1IEQA 4IIFA 5F51A 4YASA 4QVKA 3ZDEA 4KG7A 4BNTA 5CNKA 4NU8X 3CKMA 3U40A 1W75A 5EE0A 3DBRB 1JHUA 4HLQB 4L73A 1X3LA 3Q9NA 4KBYA 4C22A 1QV7A 3B6IA 2AZTA 3KXLA 4X3OA 1EZ1A 1K8ZB 1LTHR 2B1IA 2CHFA 4LKOA 4MITA 4A0SA 5J40A 1UBRS 2A94A 2PR7A 2WYOA 4J29A 4J6FA 4F4FA 3ZD6A 1BVRA 1IAQA 3W4IA 1L7DA 4MR8B 3I6ZA 4J0QA 1PEDA 2C7VA 2BDUA 2Q5IA 4PBSA 4C6HA 4NL4H 1WHSA 3M5WA 1DBPA 2NAFA 3FCEA 1VMDA 1RYHA 2W4MA 2FR8C 3KOMA 4YMWA 1CF9A 3ZC3A 1L5KA 5I4KA 2G1KA 4QO7A 2B3DA 2OC9A 1ODCA 4QEDA 4DQKA 5ENDA 4OGKA 1BXGA 4EJSA 2ZE7A 3P0HA 2DPMA 3H11B 1ILEA 1ULAA 4P54A 2MSCB 1T5OA 4P5DA 3BZUA 3RRYA 4G56A 4INJA 1FOEB 1GAWA 2XYQA 1CEQA 3S2YA 3TOCA 2E5LB 3GLIA 2GCIA 4OK5A 1P9OA 3TB4A 4JC8A 3RYHA 1R7RA 2XUGA 3DKPA 4YRTA 1WO8A 3DAYA 3K16A 5AJVB 4ZZ3A 1E9CA 3EGXB 4X1OA 3ZHOA 4UOQA 3W3ZB 3VTKA 1VHTA 1USWA 4UAVA 1AE1A 4Z0NA 3BXPA 3SICE 2BGMA 621PA 3MJSA 4MWOA 2NNLD 3KVOA 2QP9X 5FEUA 4FHDA 2C97A 5C8XA 1FU7A 1LY1A 1B0UA 1WQ1R 4FCWA 3M7IA 4UHCA 5EMLA 2YUIA 3S2GA 1C4WA 1RAGA 1U5AA 1UJNA 3RSLA 4BRUA 4F06A 4DDVA 3ZD8A 3G5AA 4HLNA 3EVGA 1KOJA 1NVVQ 2JIRA 3K9QO 1E3JA 1BMFA 3OPNA 1KF0A 1O9BA 1PYDA 3EOBI 2HN9A 4PYKA 5EWJB 1JT9A 5CJPA 4IV8A 1E59A 3RF6A 4H7IA 5I4IA 4HQRA 1F12A 4YGXB 3N2GA 1RMTA 1UXKA 1FYXA 1FTWA 3C98A 4LVUA 4MAFA 3U3JA 1ZRHA 4HDCA 3D6VA 1MP0A 5LCXA 4FE3A 3RUDA 4L27A 5LR6A 1N36B 1UKYA 4JODA 1NBHA 4N03A 1QQ6A 2LW7A 5JPDA 1EVQA 2PUGA 1ZX1A 3H13A 1Z29A 4NONA 2QAGC 1H1DA 1WTCA 2CL7X 3LBAA 2YJTD 2ZIGA 1QG0A 1SK9A 2G88A 5MFZA 5FTNA 1YHZA 4YDQA 3LUKA 2EWWA 5EHNA 1RYFA 3OLVA 1M5TA 2BKXA 2MYPA 3VZSA 1DV1A 3FYUC 4RGBA 3SKXA 3OWOA 3OY2A 3FB1A 4BGIA 4ZQEA 1KRXA 1T5LA 2P9QA 3BZWA 4LYDA 4AG5A 3BWVA 4RVFA 4M8KA 4RQTA 1EHCA 4X7RA 1NR1A 1PYOA 1GEEA 4PQGA 4WFIA 5SV2A 2WG0A 1R0LA 2ZATA 3M4ZA 4IH4A 4MCAA 2R44A 4DIOA 4F4HA 3CC8A 2ZU6A 4LK2A 4YCNA 1C30A 3PXGA 5JI2E 2Q2NA 5J63A 4CLXA 2WUGA 1OLSB 1OY1A 2W2KA 3BCRA 3HWRA 4H1UA 3GRAA 4KLRA 4H7PA 3SYLA 2P78A 2CSXA 4UTNA 5ULLA 3PBKA 1A9TA 1TRHA 4NJEA 4W8OA 2G9QA 1CIJA 4KLAA 2J5BA 3PD0A 4LEIA 1GV1A 1KO4A 4P92A 4PHGA 5E4JA 3HRKA 1RWWA 1ZNQO 2EX1A 4J3NA 2A7QA 1RLMA 3I45A 1DCMA 2PRJA 3TYXA 1IEVA 4F85A 4RPGA 1P1IA 1OZFA 3KB2A 1A2KC 1XF1A 1SXPA 1DJMA 4I4NA 2QJRA 5CT9A 1E1LA 3GAZA 3AINA 3RG8A 1YDMA 1A4XA 2WNIA 2R47A 5AXDA 4OI1A 4R8LA 3G17A 2C20A 3T61A 1QSGA 1VKHA 1XZEA 3IR5A 4Z1MA 3ETNA 1TJPB 2O2DA 5TVGA 3NNSA 4O4LF 3BT7A 1YR2A 5BWCA 1NDUA 2XGGA 5KBYA 4IDHA 3I83A 2HIGA 4R2HA 2ISSD 5GQSA 3UKDA 4JR1A 4LFAB 2NM0A 2YDYA 2OYSA 3IUSA 4YRDA 3X1WA 1B0ZA 5AM5A 2V5VA 5LP1A 4L4SA 5HRUA 1YO6A 3HKCB 4FHEA 2X8BA 3MGBA 1J0DA 1NJ1A 3ZQJA 4P5EA 1LI5A 4HQLA 1VJ1A 3DBHA 2VUSA 3FI9A 5BSFA 1GNTA 4GW3A 2BC9A 4IX9A 3D59A 5CK4A 2CNWD 3H16A 3T3OA 3L7LA 1WUJS 4C0XA 3KFXA 4LMRA 3P0FA 5EZYA 3ETLA 1EP2B 3QU7A 1U28C 4C7VA 4P80A 4I55A 1QHHB 4JLDA 2QXUA 2O5VA 2XWPA 3AF5A 4H1TA 4JXKA 4L6CA 4Y6OA 4A0HA 3W1VA 3F0TA 4EKIA 4TKLA 4A5OA 4B75A 2W48A 3L0SA 4UUMA 3FHTA 3OQ6A 1PHRA 1ZEJA 1U99A 4RVDA 1R1DA 1JIXA 2YXEA 4F8EA 3SLGA 1XYVA 1J33A 1AQYA 3TZKA 1V7PC 3ORYA 3MT9A 4ND2A 4B83A 1W0KD 5HIJA 1NWCA 2J32A 3AL2A 3T3EA 5MN5A 1CIVA 4MQFB 3ROZA 4OHOA 4B3JA 1YV9A 3OD5A 3HQ4O 4KH1A 2JGRA 4U63A 3VH1A 3ZNQA 4HG2A 1XRQA 1E1RD 2JBWA 5I9SA 4RU1A 2O5CA 1Z8HA 4OB6A 3C70A 2IQIA 3OCCA 1XSEA 2P9FA 3B6JA 1XC7A 3HCEA 3HKEB 4YY3B 2R60A 4DHEA 5IBCA 3OQHA 3P9IA 1I3MA 3BRWD 3FKQA 2GN8A 4NDZA 2CVHA 3T5CA 1RMYA 4AUKA 2ENUA 2IY8A 2WEKA 2RG1A 5KOIA 3P0IA 4F93B 3WJ2A 1E7MA 3GPLA 2E4WA 4B8ZA 5IXYA 3VOSA 2X1HA 2VXBA 2XT0A 2DFNA 2OCBA 1N6RA 3AJEA 4MV9A 4R1TA 5EWJA 2I6FA 3NB0A 4X6UA 4JQOA 5FLKA 3EWSA 4JI1B 4D3YA 1ONBA 2QN7A 1RYDA 1P8JA 3GGDA 4GX1A 2IXDA 2Y66A 2OAGA 1Z16A 4L9WA 2PGDA 2UZ1A 4BFYA 4B3HA 5CBPB 3L05A 1HXHA 4MCIA 4AJ4A 1IRIA 3PQEA 1RAIA 4D9MA 1S2LA 1D2EA 1E66A 3OO1A 4QU8A 3C5HA 4O8ZA 3F6EX 3FWPA 3HXKA 5B7PA 1Y6GA 1QLJA 2XLBA 5IDXA 5FBWB 3FVRA 4KV9A 1X7XA 5LUAA 2IW1A 4WWHA 1DEAA 2OO7A 1SHKA 2IWHA 5HUHA 2Z2ZA 1BEUB 3JQAD 3K6RA 3G02A 2E4AA 4Z1OA 3EX7C 5EXSA 1SC3A 1LBEA 2G72A 3UWKA 3ZBTA 4JAVC 3UJCA 1FVOA 2YQ5A 4GOXA 4L7QA 2XCOA 3MM4A 5KSYA 1JIKA 4TQAA 1DG9A 2Q1WA 1Z8NA 3KOZA 6REQA 1AA6A 3R5KA 5HVNA 1H1LA 2OEPA 4LYGA 3KE9A 1ONPA 3FYCA 2A0UA 3JQ7A 4FXOA 4EUFA 3Q12A 4R1PA 5HZGA 5AESA 3LX6A 1YVRA 1W8DA 2R48A 4LYFA 3TRKA 4M8NE 3B8EA 1DRUA 2PGAA 2WT8A 2JFOA 1Z06A 1NFFA 1VJCA 2V7QD 2H2FA 3EWAA 4MXDA 4O4HF 5IK2A 2ZE5A 2R4QA 2QP4A 2OPBA 2ZWAA 3HBJA 4UBNA 5FNVF 4DA6A 3NBMA 5BQOA 1GA6A 2VDOB 3LUPA 3MWYW 2QN9A 5ALJA 3C15C 4UXHA 4M3NA 1NVWQ 1JFFA 4Y0NA 2ZM5A 1RZ3A 4ICIA 3HM2A 4H7HA 5HUQA 1M2VB 2XUDA 2P4SA 1UT5A 3KT8A 2AOVA 3CCFA 4AMVA 3WGUA 2ACWA 1EX6A 2Q4TA 4HZUB 3RRFA 5GIPE 4UKDA 3CVVA 1JR3E 4LYAA 2MT9A 2ZBFA 3GMTA 3JATA 3OLZA 3NM6B 3PUKA 3K70B 5JCPA 1TTQB 3WXMA 1GLNA 1H8HA 1IM2A 4S2EA 3UC5A 1CDOA 4IHJA 4LPSA 3TFOA 3QSYA 3WB2A 1I1NA 2CYAA 4XIJA 5T41A 5KI6A 4BU0A 5I8ZA 1PJZA 1THTA 4JYBA 1O95A 2VS1A 4L57A 1EGAA 1D3AA 2BJHA 2HBZA 2PWPA 2XWSA 3FR8A 3UB2A 4BV3A 4G5SA 2TMGA 4R2JA 1B23P 1WZUA 2I54A 3IC5A 6YASA 2FPKA 3BOSA 1DQNA 5FUVA 2HV9A 5ECWA 4UMEA 5DO9A 5BNIA 2ZANA 4KXNA 2C54A 1J25A 2ZJOA 1IG3A 1OAOA 3L7MA 3Q8WA 5CB0A 1PTKA 2LWIA 4ZGGA 1E3WB 2W2XA 4CMGA 2O2YA 2AFVA 3AB3A 1J07A 4XD2A 3GIWA 4FE7A 5E9AA 2HMWA 2P6MA 5AK6A 2XCRB 4CMCA 5DNEA 1X8XA 3PE4A 3WLFA 1UK7A 4DJEC 1XEWY 2AFHB 3DCJA 3SBOA 4M7OA 1ORHA 1JQ3A 4OA5A 1JNYA 4KL8S 2IYSA 4A2CA 4I1YA 1R5NA 1EG2A 1EUDB 3K9BA 2P9ZA 3RPEA 2P0YA 3RQSA 1M8GA 3X2EA 5B30A 2GK6A 4WE3A 4TV8F 2LBPA 1PSZA 2WKRA 5JDIA 1JR3A 5BMVA 4DLNA 5AVVA 5JY1A 2G40A 3HFJA 4C5BA 4FR0A 2WPDD 5F7JA 3BJIC 1MT3A 5JSHA 3R5FA 1LDMA 2EWMA 1N3IA 1DT5A 1JLHA 2EZ9A 2JNWA 3PDWA 4Q4AB 4YLEA 3TZBA 3VAYA 2HU5A 4F1KA 2WJZB 4OBXA 5K8IA 4ZCLA 2PT9A 1C1XB 5KPJA 4G0NA 3P4UA 1WKBA 5E3IA 3R3JA 1NW7A 1LEHA 4D1YA 3KKZA 2GHTA 3OPVA 4MKGA 2B1GA 3RIMA 1P2TA 2OFWA 4GOJA 5LQRA 1PD1A 1KO5A 3D43A 5ES3A 1RRGA 1B26A 3FJOA 4JSTA 4BGDA 1A98A 1IVSA 1D6JA 1YIOA 4FLEA 5EYPA 4UU8A 3ZWBA 2VDMB 1MX3A 4NE2A 4XGIA 1O97D 3OQIA 1K5HA 4WKPA 1IMOA 3ZWNA 2VK1A 1HYBA 1EQ2A 3AF4A 1W25A 3M9XA 4JQCA 1I8TA 4F84A 4J0FA 2YQZA 1J8QA 1GP2A 4WESA 5E4YA 4ZCIA 2PDAA 5HZMA 2BJVA 4HHEA 3WOVA 4BLUA 1KWKA 4PZCA 2GHQA 3N0RA 1ONNA 1XCGB 1OU4A 2NV6A 2P9BA 3MTGA 2FSUA 2ZS9A 1GVNB 2V7TA 3IAEA 3W4KA 2VQFB 1SG0A 3EZXA 1HF3A 1XYYA 4U2GA 3P27A 3KDSE 1TCUA 3HU1A 2B4KA 3OZ7A 3RU2A 1JVSA 3LTEA 4YAOA 3MAGA 2J9RA 3TVDA 3V32A 4ZDJA 3EPRA 3ED1A 4ZI3A 5BRAA 5F23A 1N5JA 2QVLA 1X9IA 2RHOA 4MUJA 2DPYA 4MUGA 4O2AA 4NNJA 5JG7A 4DXAA 3MJRA 1WLYA 5LBUA 2O20A 1EUCB 3N2GB 3H8SA 5E2IA 2V8OA 4Q00A 1XIVA 1L5RA 4AZSA 1R4MB 1YOVA 4CMBA 4KIFA 1ZD5A 1V4NA 2I66A 1WDMA 9ABPA 1M7GA 1OKKA 2JIZA 3CEJA 4ER5A 3F3SA 2YWEA 3DDWA 4X1YA 3V1YA 4B32A 2PT7A 3L6OO 1ZVKA 1VL8A 4M37A 3UBMA 2XIJA 1K4YA 1KY2A 4KDFA 5EE1A 4B84A 5ER6A 2VH2A 4O29A 3UGQA 2RGXA 3FIUA 3LG2A 1OW3B 3HRHA 1ZHFA 3E22B 1RAHA 2AK3A 2VAPA 3AT1A 3FPFA 3MC1A 1SO8A 4A2PA 5KJ1A 2ATVA 5LWHA 1IE3A 3SQMA 3R0QA 3IA7A 3O90A 2XQKA 1Z4JA 2RE8A 2HMUA 3B5IA 1YJ5A 1WA5A 2R8EA 3KPWA 4FLFA 4EECA 2H08A 1MBZA 1T4BA 3OTQA 4N3NA 1BRTA 1YIDA 1W4CA 4M36A 1QYDA 4GP7A 1T10A 3KTDA 2XYRA 4Y30A 2VTVA 4RMJA 3T1TA 1RYEA 2QAIA 2W00A 3MUFA 4PX5A 1G21B 1RCUA 3MOIA 1YR8A 2J30A 4OOEA 3IE0A 3O7MA 3C6BA 2FSVA 1DMSA 3TE7A 3HYSA 5JRDS 2I76A 1NW4A 2ODQA 2ZCVA 1NW6A 3H2ZA 4K6MA 2E7ZA 4OJMX 4HVCA 5J47A 1J1ZA 1ADFA 2IOHA 3PLRA 4EUSA 4CM8B 2FQYA 1HNZB 2IV7A 1IEXA 1X7GA 4NK4A 1Z4OA 1W8IA 3KVYA 4WACA 1C1YA 1QHFA 1V48A 3WIUA 1ZM2A 3A58B 5ERYA 3AG5A 1E89A 2F1IA 2XKAA 1V8ZA 3ZJ5A 4BQIA 2VG8A 1YHNA 5FEMA 1FC0A 3BGIA 2B3TA 1JQEA 5JSYA 1ZN9A 4ZYYA 2PXXA 1GZUA 1F4VA 3D8UA 1JLSA 1Y9AA 2IEZA 1LC3A 3FKSA 4UNIA 2W70A 4QPJC 2HYDA 4BZPA 2X0IA 3NJRA 3E9DA 4ZARA 3Q7RA 5ER9A 3H19A 3TTYA 1UAYA 2IF2A 3GI1A 1VG8A 1UR5A 1NJ6A 2F67A 4WNAB 4CDMA 5AKGA 2P6PA 4G0UA 2Y6UA 2A1UB 3PQDA 4J7CA 5DM0A 3ZXSA 3P52A 1R8YA 1Z08A 3ZDFA 1J9GA 3LQYA 1PR5A 3U0VA 1HDIA 4AJ9A 2X22A 2GCEA 2HZBA 1G3QA 5E6UB 4B4WA 4DARA 2XAAA 1H2BA 1JEYB 1GY8A 3E6AA 5HA5A 5IDWA 1PT5A 1ZPDA 3EXHC 2QLJA 4Y2QA 4ZT3A 4KOAA 3TZLA 2XB2A 2FRDA 5G0VA 4ZZ0A 2FDXA 3JQ9A 1FJXA 4OJNA 1YB4A 2I4LA 3DHWC 3S44A 1HFEL 1M34E 2P67A 3EVFA 3L6EA 4EA6A 5SZIA 1UBEA 4XVHA 2MDTA 3NCTA 1RJEA 4YV0A 2ZCUA 3FUWA 5JAMA 1RRKA 3ZK7A 1TL7C 1Z0JA 2GZHA 2PAAA 3GLQA 2EXXA 3BCHA 2B1RA 1V8PA 2ZUWA 3H83A 3I0NA 4LZLA 4MUNA 4N5NA 4WQMA 2R6R1 3AKCA 4ZTUB 4TXMA 3WRYC 1XCOA 3ZGOA 3USES 4C21A 5JANA 4J90A 1H93A 3O8NA 1Q7EA 3L1HA 4YRKA 1MGOA 2FF7A 3IDZA 4QWMA 3V1LA 2SCUB 1RJDA 2PYZA 4XIFA 3DZIA 4XWGA 1N2CE 1QGZA 2WT9A 3HUDA