4HGOA

2-keto-3-deoxy-d-glycero-d-galactonononate-9-phosphate phosphohydrolase from bacteroides thetaiotaomicron in complex with transition state mimic
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
163
structure length
163
Chain Sequence
MKEIKLILTDIDGVWTDGGMFYDQTGNEWKKFNTSDSAGIFWAHNKGIPVGILTGEKTEIVRRRAEKLKVDYLFQGVVDKLSAAEELCNELGINLEQVAYIGDDLNDAKLLKRVGIAGVPASAPFYIRRLSTIFLEKRGGEGVFREFVEKVLGINLEDFIAVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase, hydrolase
molecule keywords acylneuraminate cytidylyltransferase
publication title Structural Basis for the Divergence of Substrate Specificity and Biological Function within HAD Phosphatases in Lipopolysaccharide and Sialic Acid Biosynthesis.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
total genus 51
structure length 163
sequence length 163
chains with identical sequence B, C, D
ec nomenclature ec 3.1.3.103: 3-deoxy-D-glycero-D-galacto-nonulopyranosonate 9-phosphatase.
pdb deposition date 2012-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08282 Hydrolase_3 haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4hgoA00
1O08A 1TA0A 1WVIA 1ZJJA 4C4TA 5AIAA 3NALA 5AM3A 4Y2XA 3ZUPA 4IG4A 4C4SA 3KOOA 2X4DA 4BEWA 1Z4JA 2BDEA 2HCFA 1VJRA 5AKXA 1Y8AA 3UMCA 5AKJA 2FPUA 1T9ZA 3L5KA 3NUQA 3QU9A 4F72A 3EWIA 3IRUA 1YNSA 2IYEA 2FPSA 3A1CA 1QQ5A 5AK4A 2OA0A 2JAOA 1RPZA 1FEZA 2IOFA 2FEAA 5AW3A 5ALNA 4NAVA 2FDRA 5AW9A 4EENA 1U2SA 4FYPA 2VKQA 5AI4A 1ZD5A 1U7PA 3WK6A 4AS3A 1XPJA 4ZEVA 4YIHA 5ALHA 1IWOA 2R8YA 1ZD2P 2BDUA 2HEGA 3OTQA 5ALDA 1S2OA 3B9RA 2W43A 1J8DA 2GMWA 4Y2UA 4Y2SA 3I1YA 3BWVA 2MU1A 2DQSA 3CZ4A 2C4NA 2C9MA 1Q92A 3A1EA 5AI8A 5AI9A 2HO4A 1X42A 4J03A 4KNVA 4DFDA 2C88A 5JJBA 3QUTA 4OHFA 2JAUA 3SD7A 2ZG6A 2PR7A 2ZOSA 5AVWA 3SKYA 1WZCA 5ALXA 1SWVA 3E8MA 1LTQA 3AR8A 1XP5A 3B8EA 1TJ3A 5AM4A 1RMTA 3MC1A 3N1UA 3ZX5A 5T41A 1MH9A 2EATA 5AICA 4NWIA 3W5DA 1ZD4A 5ALQA 2RARA 2JARA 5AK3A 2FPXA 5ALZA 4BYGA 1F5SA 5AI0A 5AI5A 4HYTA 2HOQA 3U13A 4DWOA 4YCMA 3A1DA 2MSNA 2YJ3A 3U26A 1TJ5A 3L8HA 4L57A 3SHQA 5AM2A 3L1VA 3N5KA 4B6JA 5AK6A 4JB3A 1N8NA 5ALRA 3ZVLA 4EELA 2HHLA 5FP0A 1ZRMA 2G1AA 2WFAA 1Z4OA 1JUDA 3OCXA 3P96A 5AW4A 3WKEA 3SF0A 3KBBA 2EAUA 3AR9A 2YJ5A 2Q4TA 1J97A 4RETA 1LVHA 2FUCA 4OFZA 2NO5A 2YBDA 3QUQA 3WKCA 3ONNA 2BY4A 1XVIA 2ZBGA 4UM7A 1L7NA 5AW0A 2HX1A 2PKEA 4NABA 2Q4RA 1QQ7A 1Z4MA 2I6XA 1RDFA 3VAYA 2JGAA 3DV9A 1N9KA 1ZRNA 4FE3A 1WR8A 5ALLA 3OCYA 4MWOA 2B30A 3FZQA 4O8CA 3QU7A 3WK9A 3KD3A 3OCVA 3QU5A 3ESQA 2IOFK 3D6JA 1RMQA 2D2VA 2W11A 2ZBDA 1WPGA 5ALUA 5ALVA 1RC8A 1KYTA 2WF8A 5AI6A 3UM9A 3AR2A 2G0AA 4UMFA 5AM5A 1RKUA 3QU2A 3E81A 3AR5A 4HGRA 2G07A 4JDPA 2G08A 1L6RA 2WM8A 3L7YA 3W5CA 3PCTA 4RESA 1SU4A 1U02A 2JAWA 4BKMA 4EX6A 4CF3A 4DCCA 3RF6A 4PNHA 5AVYA 2QYHA 1Q91A 2YMPA 2G09A 1L7MA 4AP9A 2CN1A 3J7TA 4KX3A 1RLOA 3WK7A 1RQLA 4UMDA 5E0OA 5ALJA 2RB5A 3MMZA 4XQ0A 5ALKA 2I55A 1U2TA 2HF7A 2I54A 4UAVA 4BX2A 3ZTWA 3QLEA 5AK5A 3PGVA 3OCZA 3ET4A 2HF2A 3UMBA 4CE6A 4YGYA 5ALEA 4KN8A 5IT4A 2OM6A 1YV9A 1YJ5A 4OD0A 2IOHA 2YFYA 4KYTA 3NIWA 2YN4A 3L0BA 1RLMA 4UATA 5AKIA 3ET5A 2P9JA 3WK5A 4E88A 4NV0A 3FPSA 1Z5UA 2FI1A 5AKKA 3W5AA 2B82A 3BA6A 1CQZA 2YMQA 3ZTYA 3L0CA 1Z5GA 2B0CA 2GFHA 1TE2A 2HDOA 3WKBA 4YH1A 4YCLA 3RFUA 3DAOA 3I76A 3AR3A 3FGOA 1RKVA 3ZX4A 2WF6A 3OCUA 4UU0A 2CFTA 2FPWA 4C4RA 3IJ5A 3HLTA 3ZW7A 3SKXA 5A3QA 5ALTA 2CFRA 4FFDA 2O2XA 2O9JA 3M1YA 1ZD3A 1S8OA 4H1WA 3U7HB 2NYVA 3L1UA 2GHQA 3U19A 1QYIA 3U7EB 2C8KA 5ALPA 3S6JA 2R8XA 4HGQA 2HSZA 5AHXA 5ALGA 2IA5A 2ZBEA 4G63A 3WKAA 5AKLA 3NANA 4BX0A 4CNQA 1NF2A 1QH9A 2AMYA 3GYGA 3QUBA 4ZEXA 3FM9A 2I34A 3WGUA 3L8EA 2AH5A 5AVZA 3WK8A 1O03A 2AUTA 1Z4PX 3KDPA 5AW6A 1PW5A 5ALMA 3SMVA 1L7OA 4UASA 1T5SA 1CR6A 2PQ0A 3U7GA 1Z4KA 5IT0A 3QGMA 3CNHA 5AKYA 2WHEA 3AR7A 4QJBA 3N07A 3A3YA 1NNLA 1SWWA 5ALSA 3F9RA 4UM5A 2B1RA 1YS9A 4GIBA 1ZOLA 4ZEWA 4I9GA 3R09A 2R8EA 5AVVA 1RKQA 1RQNA 3W5BA 3ED5A 1EK1A 1Z4QA 3QU4A 4HAIA 4L6CA 5ALFA 3N8GA 3B9BA 3OPXA 2G80A 4BX3A 3WK4A 4XPZA 3NASA 4AS2A 2P11A 2C8LA 2P27A 4XOUA 4UMVA 4QQFA 5ALIA 4BBJA 3SLRA 1TJ4A 1VFPA 4HGOA 4BNDB 1K1EA 2ZBFA 1RMYA 4EEKA 5AVSA 2RBKA 4HGNA 2OYCA 3U7FB 1RLTA 2YJ4A 2CFSA 3IB6A 3ZVNA 4IFTA 3I28A 3QUCA 3PDWA 3PGLA 4Y2JA 5AW8A 2FPRA 4KX5A 3QYPA 1YMQA 3WKDA 2NO4A 5AVTA 1NRWA 1VJ5A 3R9KA 2OBBA 5AVUA 4Y2RA 4GXTA 3DDHA 2RAVA 2GO7A 2WF5A 4YIKA 3EPRA 3K1ZA 5ALOA 1ZS9A 3KC2A 1RRCA 2WF7A 5ALYA 3MN1A 3L8GA 4YCNA 3NAMA 4BEVA 2ZXEA 1L8OA 4MUMA 4J2TA 4Y2PA 3R4CA 3MPOA 4UARA 3ZWDA 5A3SA 3EF0A 2WF9A 5AVRA 4G9BA 1Z4IA 4CF4A 1U7OA 2HI0A 4Y2VA 1Z4LA 4F71A 3ZU6A 4HGPA 4EX7A 3NRJA 3UMGA 5AVQA 1EK2A 5AKZA 4EZEA 5AESA 2B8JA 5AVXA 2ODAA 2B1QA 3EF1A 1L8LA 3KZXA 5AM1A 1Z4NA 5AW5A 5AKEA 5AW2A 3WGVA 3AR6A 4UU1A 4UW9A 4NFLA 2W4MA 3TLMA 3E84A 3ZVMA 4OCZA 5IS2A 2Q5EA 3FPBA 2B8EA 2I7DA 3ESRA 3L0YA 1Z88A 4BNDA 4I9FA 2YJ6A 1AQ6A 2G06A 2EARA 3AR4A 5AKHA 2GHTA 3E58A 3OCWA 5AM0A 2YMMA 4KNWA 3I6BA 4CF5A 2YY6A 2QLTA 5A3RA 1YDFA 4Y2YA 2R8ZA 5ALWA 4UMEA 5AW1A 3M9LA 2YMLA 3ZWKA 1L7PA 4UAUA 1T5TA 2P69A 4Y2QA 4XE5A 1QQ6A 5AW7A 4L6AA 5AIBA 3HYCA 2FUEA 2AGVA 3L8FA 5AKGA 3FVVA 4Y2TA 4Y3UA 3QNMA 3QX7A 3QXGA 3N28A 2I33A 4DW8A 3ZI4A 3DNPA
chains in the Genus database with same CATH superfamily
1EHCA 4GZLA 5CURA 3N6VA 4C5CA 5T4FA 4MYCA 1ZHHA 3M33A 5JYCA 1BHO1 3ZDRA 4LZWA 3WQSB 2FZ4A 4Z9XA 1JFSA 4W6ZA 3M9XA 1Z6QA 3P4XA 4OHRA 5AXAA 4HI0E 2P4UA 3F1KA 1IJBA 3BK7A 4PS0A 3UMCA 4HBGA 4MCHA 1OXXK 3EEOA 4GOKA 1DIHA 1YQWA 3TVYA 3V8RA 1P77A 5COBA 3V42A 1CLUA 1K7YA 1VOTA 2DFVA 2OILA 2WTNA 4LE2A 4N0PA 4ZODA 3IRUA 4P8RA 1J2EA 5HIMA 5GZ6A 3S1AB 1QF6A 4L9WA 1Y34E 1BAPA 3GLHA 1OYVA 1JHVA 5DYWA 3WP1B 5IHXA 1E9VA 3H2YA 3EIHA 1E5TA 1PFQA 4QVIA 2P4HX 1G5TA 3BK1A 3F4KA 2ST1A 3DEIA 3R0IA 3KAPA 3MXTA 1YR8A 1EFVB 4ZQBA 2BMEA 5T5QA 2HGSA 2X9QA 3DMYA 4FXOA 5G1PA 3F74A 1XU9A 2Z9CA 5HE9A 2OQVA 3W2TA 2P6OA 2NAFA 4AYXA 4MA5A 2J6CA 1E4EA 5DK4A 4F1KA 4NBLA 1PRYA 1KETA 2B8TA 2IY9A 4O2AF 1MFZA 4RACA 3OWOA 4CI9A 4GDMA 2PXXA 4IVNA 4N7RA 2JGEA 4HB3A 5LYJF 4IQGA 2NQTA 4WCDA 5ALDA 1GPAA 3N2EA 3NH6A 3PFCA 1TM5E 3I1YA 1EFCA 2DHCA 5BOVA 8LDHA 2D74A 4M60A 2AD1A 4LY3A 3ND7A 1TF7A 2BHTA 5B3JA 1ISRA 3A1EA 5E1BA 4PYNA 4EABA 2EJUA 2O7QA 1VI2A 5EPOA 5H59A 5DHRA 3V4PB 5FWNA 1E1KA 1QCZA 1EFRD 2PO7A 1GFZA 2PQMA 4UBLA 2M6SA 2O5VA 3ZZNA 2PE5A 4UPVA 2HL6A 1YZ3A 3KR0A 4ZI7A 1PUJA 2VPYA 1GTJ1 3WLPA 3LLSA 3UHOA 4CN8A 3M89A 2BFAA 3OEHD 4W7SA 4DY6A 5CB4A 1SBCA 2GR9A 4KOAA 5LBUA 4TWRA 2VA9A 4NMWA 5KTRA 1LNZA 4RSHA 3FUCA 1P2DA 3VGPA 3ZV3A 1UDRA 2P77A 5ELMA 4DBZA 1FNSA 1Z6TA 2P40A 4H3SA 5FWYA 4DADA 4S1WA 4MI3A 4KSBA 1B8UA 3B1YA 1A7UA 3OPVA 5FHRA 4B7CA 3SEAA 4IXNA 3T3MB 3CONA 4HG2A 3Q12A 1HY3A 1A4RA 1MOPA 4NYMQ 5C1IA 1MH9A 1E18A 1B00A 2ID7A 3MRXA 3E5RA 3C1UA 3P2IA 3SXUA 3B3GA 5HBRA 4HDQB 4E32A 5BNIA 1VYUA 1JL3A 2Q6LA 4GPD1 3IEPA 4MIYA 4GX1A 1WSDA 3ACBA 4FYYA 4TMTA 2GVZC 5FBWB 1ICEA 3G82C 5FBHA 1V2HE 4S2UA 2G7ZA 3C3KA 4CMCA 2B36A 4FSXA 5JSYA 1TK9A 4YRQA 1GPKA 4EYOA 3MHTA 1ARZA 4GSYA 1RJ9B 4CIAA 5IAGA 3PITA 5BUSA 3EIEA 2W4QA 5G4KB 2EFJA 4IIBA 4BN4A 2YJGA 5EWMB 2BFDA 3EYWA 3S8MA 1WETA 4BMXA 4H08A 3T7JA 3V8PA 4K3UA 1UOEA 1WW8A 2HLNA 4LGVA 5J1TB 1ZC3A 2WWIA 3ODPA 2WILA 2A9OA 4EELA 1GUYA 3N53A 4AYWA 1Q95A 4KR9A 3SHOA 4DN6A 1PT7A 1IM8A 3V2GA 3HACA 3OCXA 2XB8A 3KZOA 1SQ0A 2K6GA 1B23P 2FWNA 1DAPA 2YFKA 3D43A 5JO9A 3H1TA 4D9BA 2FSVC 4Y6QA 3QKRB 1WZEA 5H68A 3HKDA 1MXFA 4ZVKA 3UWDA 4EW3A 2BP7A 1S2GA 2A94A 2VDWB 5FBVB 1XMIA 1P39A 2FUCA 1G55A 2XQFA 3N0TA 4D8UA 2YJNA 4OA8A 3QVVA 2R751 4QPDA 1Y9EA 3K0CC 3W79A 3QUQA 3WKCA 3VNVA 1ZNYA 1JMYA 3U1VA 1NAIA 3KXIA 3NHKA 4WLOA 1L7NA 2HHJA 4FN5A 4GI5A 1UINA 5T6MA 2GYVA 3EOAI 4NABA 3G6WA 1ZRHA 2PLNA 4RD4A 5TF0A 3CGGA 2DHRA 1UC9A 1J5XA 1X1TA 1NJGA 1OLXB 4G4IA 1KHHA 3V1MA 2VDUE 1XEXB 3T4EA 3L6UA 5LZ5A 3TR6A 5I7HA 5KU7A 1TYDE 5KJ6A 2B30A 2B34A 1WRBA 3BVPA 4NAUA 4YJKA 2R0QC 3OU6A 2IHBA 1JAXA 2XUPA 1C7IA 4E1BA 4BXOB 4EY4A 1BRMA 3BPSA 1JDNA 2IOFK 3L0DA 2BM1A 3PEVA 2I3DA 1KJIA 3CVOA 4WY5A 2FP4B 1G9XA 1E6CA 2FJPA 2H7VA 3KHTA 3I52A 4KXVA 4JUBA 5DBOA 5ED4A 1KJJA 2CMGA 4LZZA 3WAJA 2X0IA 3NHMA 3VPAA 1MX1A 1KY3A 1YQTA 2WIAA 3DVRX 5FRDA 1UMKA 2Y9PB 1T0BA 4YX9A 1L0BA 4WBNA 2PMEA 3QPDA 1WXGA 2FPKA 2FJUA 3IT1A 1NXSA 2IW3A 2VAWA 1FP2A 2H9YA 1R0SA 3AH8A 3AQ4A 4N49A 4QTTB 5CPFA 1X7XA 5K3DA 5L7YA 3NV9A 1WB6A 3PRKE 3TOXA 3PQ3A 4NPHA 4IHAA 4RSRA 3EEYA 4MQMA 1LSUA 4DV6B 5EXDA 2QD3A 4ZQHA 5JS6A 1JWAB 1OOEA 5DM2A 1RPAA 1P0MA 1SN7A 4HX9A 2A92A 3A1FA 3H2SA 1HFWA 3A4VA 3V6MA 4DL9A 2CUKA 1X77A 4IUDS 4Q6WA 2HIMA 5DNCA 4C7VA 3EVNA 3KOYA 4Y0AA 2ACVA 1R4MA 3DCJA 2OFFA 4ALJA 4E6EA 3AU8A 4LC0A 2PYDA 1AUOA 2C7VA 2GPTA 3PIDA 1L5ZA 2NXWA 1Z6ZA 5CK4A 1FW8A 5E0OA 2FMTA 3PHHA 1F0KA 2WIJA 2A6PA 4NJMA 4RD2A 1IB6A 3M5DA 1XNJA 1P6XA 2C20A 2M1ZA 3AIMA 1B4DA 1X2EA 2N46A 1S8AA 3DONA 4ZEOA 3AHIA 4MV4A 5LDGA 1ZISA 2EIXA 3URKA 4HS9A 1NKTA 4O4HF 2D5BA 3AERB 3JZMA 4V2IA 5D01A 2ZIGA 2GDJA 3I0NA 3NEAA 4IMRA 5FPSA 4RTLA 3VDRA 5IT4A 4EO9A 1Z7WA 3OH8A 4TLAA 1HA3A 3TTVA 3U7IA 5EY5B 1OMOA 1JU9A 1UBOS 2HPVA 2YFYA 1LPNA 2QPTA 2JKVA 1JG1A 5CFOA 1AA9A 4LXYA 3M3DA 1EXVA 2B94A 1F14A 1L4EA 1V5EA 1LA2A 4GZMA 4HWGA 2P9JA 4QYWA 5LQNA 2COUA 1PX2A 5IM4A 2YIDA 3CRMA 1CUFA 3VSBA 4NV0A 3L40A 4YV2A 2EG9A 3MTQA 1LK0A 2D4HA 2XAAA 2ROQA 3BKXA 3HCCA 2BELA 1V0JA 4MB0A 4C0AC 3QLJA 1P3DA 3HY3A 4FJ0A 3H1FA 3DPIA 3O2JA 4I5EA 1X0VA 2ZRPA 1UK9A 2P6MA 3HXPA 4KPUA 4RIGA 4CBVA 4JGIA 1KKMA 3OQBA 2C3YA 2QPLA 4Q1FA 3TEFA 1SK8A 2KS6A 1QIMA 4FYMA 2ODWA 5BSVA 9MHTA 5TPWB 2V6MA 4LBWA 3GIWA 1N5JA 4JJGA 3SJAA 5BSGA 2R6R1 3VYWA 1I4WA 3IAHA 1NJFA 4H16A 5ERYA 4FGLA 1LDGA 2QQ5A 4RNDB 4B87A 4AKSA 1EVKA 2OWEA 3MWEA 1MAUA 3A10A 1E77A 4II2A 1H1LA 4YJ2A 4FOLA 3LUFA 1WCYA 3FTCA 4LVOA 3TUIC 2UYHA 4QUHA 3IKMB 2XA2A 1I3LA 4TLEA 3KT3A 3OZSA 4MKHA 4E21A 3SG0A 2VBGA 2IH2A 1EP1B 5HQTA 1DBPA 5JD6A 3HB4X 5BNFA 4JN6B 2XYVA 1SBTA 3E9CA 4GEKA 4B81A 4CNQA 2PO5A 4CL2A 4YAFA 4CLRA 2VYQA 1EFTA 3S5JA 5M7EA 2YY7A 4QU8A 4DV0B 1GN9A 5EKSA 3ORRA 3WHLA 3RAPR 3W04A 3WGUA 3CWCA 4FZJA 4J1NA 4ZI3A 1DO2A 1SK9A 2OUIA 5BWOA 4EZBA 1JG3A 5IKXA 5AW6A 3O2QB 5EE0A 1TAUA 2DBQA 4RHUA 4F4IA 4XUEA 1VBMA 2R1TA 3IT0A 3PT9A 6CHYA 5JR3A 2PY6A 2HCRA 1OBVA 4QWMA 1YQXA 2RGXA 3A04A 3G0CA 4QBKA 4PICA 2DUMA 4G0QA 2I7TA 2DFNA 4UAGA 4ESEA 2BSQA 4X6LA 4H35A 4JJ6A 3IEUA 1QPBA 4YLEA 1GM5A 4FFPA 3RJTA 2DPXA 2RG7A 1ZGHA 3A3YA 2PX3A 1NUQA 3HCNA 3IXQA 3N07A 3ND8A 3Q85A 5AXCA 4FDAA 3O8BA 1U4SA 3LBIA 3PI6A 1B2RA 1D0VA 2VG8A 2RB4A 2AEMA 3DC2A 4WZ6A 3VUFA 1CQIB 5KAPA 2OXTA 4WBSA 2H0RA 4OL9A 2JVKA 1I4OA 1IL0A 3I09A 2WOOA 3S2EA 2EX4A 3N2KA 3ABOB 3O2NA 4UU8A 3OIGA 3HBJA 2GD6A 4ZCPA 5I3ZA 2A5DA 1RXSA 2VF2A 3ZWYA 5LIPA 3PS9A 3HRKA 1ZWLA 4MKXA 1IBKB 1Z45A 2C94A 1POXA 1M1YB 1ZWKA 3CH7A 1WXEA 4OB8A 4I1UA 3OEWA 4BASA 4JBWA 1RHMA 4X3OA 3NHWA 2DTXA 4QHSA 2HWYA 3QWAA 2JFPA 1M6YA 1JEEA 2QN1A 1JHXA 2VZLA 4NE7A 5PGMA 2PGXA 2VJMB 3L7MA 5DWVA 3R3WA 1W5SA 3P97A 1MABA 2CVHA 3W05A 4NESA 3D7SA 2AOTA 2B9EA 2VHTA 4XRRA 3FHLA 4OQLA 1N5LA 1RI5A 1GQFA 4GSKA 1HTWA 3Q7IA 3RTCA 1NR1A 2QUZA 3PE4A 3NIGB 2YJ4A 3IB6A 1P17A 1D3AA 4KYVA 4N8SA 1OASA 2I1WA 4B17A 1C7QA 1P5ZB 1DC8A 1G16A 3CUTA 1R8SA 3EWAA 4AZ3A 5HIKA 4Z7OB 5KOHB 3THWA 3AKEA 1YC5A 1V39A 4HRVA 4J7UA 1M6WA 1SQ6A 4KFSA 5E6UA 4TKUA 4AMYA 4ZZIA 4MV3A 5AVTA 2Z83A 1C9NA 1VJ5A 4KWIA 5K05A 4ZAGA 4DMCA 3DTVA 5I5GA 3DDHA 5KCZA 5EAIA 1JEOA 1DQYA 2AFVA 3UOWA 3NMUF 5SICE 4BKUA 2OG1A 2XBLA 2E1PA 4EVQA 2NU6B 3G02A 2V1UA 4QUJA 1PNVA 2D54A 3H5IA 3ZIAA 4D41A 3K0AA 1V7ZA 4J75A 1WPRA 4IDGA 3UAXA 4TMKA 3S8YA 4TSRA 1UQUA 5B1DA 3L7IA 4FWBA 3W5VA 1UJMA 1NN5A 1ODCA 2RAFA 3EMDA 3KQYA 4PNEA 4US2R 3MPOA 1W36D 1IOVA 4UARA 5JS7A 3DCYA 1RI4A 3RC9A 4KGXA 3CEHA 5CW1A 3TBKA 2J0SA 4NICA 4JC5A 5DYGA 5C32A 3AF5A 5GZ1A 2Q21A 4I2NA 1XU7A 4G0NA 2P3QA 4FCTA 2OPBA 4LRTB 1C14A 5E8RA 3ZG6A 1H4SA 4DBLC 5K6AC 1BXZA 4HVCA 4CTKA 4LJ6A 5DT9A 4HGPA 2GARA 3CPJB 1D07A 3K9GA 2PZFA 1MF7A 3D7MA 1EUYA 1KEWA 1YONA 3CLKA 5AESA 1WEHA 2OM2A 2OZVA 3WQHA 2PJUA 2VYFA 4RY0A 3A0RB 3PFNA 2FFHA 4LXUA 2EDCA 1MC5A 2IDKA 2W2KA 2ZWPA 3FOAA 1UT6A 3MRSA 3MRTA 4UDOA 2HA5A 2OESA 3GCZA 3ILXA 2NV0A 3WSWA 5HM6A 5C46F 1Q83A 3BM5A 5CDGA 2BTEA 4A91A 2Z9BA 3EQ9A 3GFGA 3WGVA 3ECSA 4FD2A 4ESOA 5JRZA 4DQUA 4DUPA 5HW0A 1P1RA 5A6SA 1FYWA 3RS2A 3FRHA 2FXIA 1PLLA 3B5EA 2BCEA 4LDAA 4NCKA 4OCZA 3TB4A 3FPBA 1KE2A 3K8OE 4CT5A 4HR7A 4EFLA 3AUUA 3IUMA 5DNEA 1F8XA 3FCAA 1WOYA 1Z13A 4LSGA 4FHDA 3WBFA 2JCYA 3K92A 1N7JA 4FBGA 4YQFA 3VNBA 4JOBA 2Q41A 3RS7A 3UFXA 2C5SA 4M46A 3DO6A 4FOSA 4TM7A 3T61A 1LC3A 2MSCB 2Y1WA 2OO5A 1HF3A 1PJSA 2Q6TA 1ZFNA 4LV5B 4Z4IA 2O06A 4JXJA 4QU0A 2CXSA 5G4LA 1Y0BA 4X6XA 1QVRA 3MTJA 3RSQA 4JKOA 1YRHA 1RLUA 3C6ZA 3DFFA 4MV0A 5F12A 1PQYA 1QK5A 1T5TA 1ADYA 4UAUA 4UHKA 4A6XA 4DLSA 1X7HA 2XKKA 4KQ6A 4L6AA 2XNJA 4P4NA 1M75A 2ZVJA 3A3NA 2JJ2A 3C16C 4IHQA 5AKGA 3T9BA 3IOEA 3UH0A 1QHSA 1JSCA 1TDJA 3NR2A 3CEAA 1T3SA 4B8ZA 4BNWA 2D2FA 1ZJYA 2VDRB 3B48A 4AO6A 2GF9A 5F7ZA 1WVIA 1JHOA 1YZGA 2G6TA 3GEHA 4FGJA 2X9GA 4RS4A 5EJIA 2QD4A 2M6KA 2D0OB 1S2LA 1WO8A 1PZXA 3CJTA 4RF4A 4Y2XA 1H4QA 1Q0LA 1FJ2A 1EU1A 2AG0A 4Q16A 2WUFA 4EI7A 1AN9A 2HEIA 4HF7A 2HJHA 4WJZA 2GKSA 1Z4JA 1SU6A 1PVOA 4OHYA 4IIHA 3TLBA 1AD2A 4OYYA 4N82A 1GN8A 1JXAA 2D0IA 3WWDA 4BNYA 3R6LA 2PVCA 2OHFA 1SC9A 3PVZA 3NATA 3GJQA 4LGCA 5LC1A 3HCFA 2I8CA 1BSVA 2RKOA 4FOOA 4L72A 3OCJA 4ZRDA 4M0EA 4OQFA 1V9SA 1Y89A 3A05A 8ATCA 3G5AA 4TWZA 3ZW8A 4C5AA 1V11B 2ZQZA 2CCGA 4P0TA 1GVNB 1I0LA 1WP4A 2P9EA 3UW1A 4LHVA 3MELA 5LYYA 3RS3A 1FUIA 1LPMA 2AOUB 3MJVA 3QBEA 2LUOA 5HG0A 4JH0A 4UHFA 1Z2AA 5CT5A 3E22B 1PUIA 1H4TA 1JQAA 4YQZA 5JSKA 3SICE 2AN9A 3GDFA 5JJ5A 5IZ4A 2W6ID 4CLOA 3OLYA 2W4IA 2GXSA 4S0XA 2O7VA 2ES4A 2V3VA 1DLJA 4IIJB 5FKJA 2ZM5A 3HXQA 4K81B 3ETHA 2DQSA 2ZSEA 2W2XA 2XDWA 4CDMA 1KI9A 4QNRA 2C5EA 2FTKE 2J5BA 2VF5X 3AIOA 3C74A 2WKQA 3LUBA 4ZMRA 5JCOC 2IBMA 2F6RA 3DTTA 2FHPA 3FWYA 4AMBA 4MDEA 4QUDA 1A72A 3LCRA 4BJ6A 5EC8A 4DT1B 1CQXA 2X7HA 5AH0A 2J3IA 2QTZA 1RFLA 2JGIA 3H8SA 4PSVA 1NBHA 1UZAA 4E5NA 5BSHA 4MQUA 1J0XO 1XB2A 4JLJA 4FN4A 4EPRA 4FWTA 4Q21A 3MS7A 1EVEA 1EH5A 4AN4A 4XVUA 1N2ZA 1PLKA 3SKYA 4DXAA 2R4TA 1L4BA 3CR8A 4C87A 3GI1A 1X1EA 1QZZA 1EUZA 1N7IA 4RTRA 4P84A 5HX7A 1ZBDA 4BWFB 3L7OA 3O2SB 3B89A 5F7JA 5I7FA 5BMVA 3AR8A 4YMHA 3W9YA 1SNYA 2G9UA 1F2TB 5TGDA 5A02A 1XTRA 4JNCA 4GMFA 1WHTA 4BFSA 5HR5A 1GKKA 4RELA 1N0VC 2Y9MB 3S40A 1E96A 4UUAA 4FYVA 5KSOA 1U8ZA 1ZM2A 2ZTLA 3ZD6A 3TWOA 4KVAA 1YL7A 1N1DA 3KJXA 4IILA 4HB2A 5CFRA 1W4RA 2A4KA 4IH4A 4K9NA 4TTVA 5EXSA 3RLIA 5JFOA 2DF8A 3TQFA 1D2MA 3RC7A 3DNFA 4OHCA 2GNPA 5AI0A 2XCOA 3WAGA 3C4JA 4LZOA 3IUPA 3O4RA 2OVFA 3K9CA 5CAEB 4ARUA 2KX7A 1B8NA 1KDTA 5ETJA 4E5YA 1X7GA 5A3JA 1V47A 1V7PC 1MZPA 1IQUA 3NO4A 2FEXA 2HDWA 1PWZA 2O4UX 1H2WA 2HPZA 2OCLA 5GZ3A 5A4IS 3DEZA 3BXOA 4G4JA 4Y9UA 4MV6A 4W99A 3ZBQA 1QCCA 2VL7A 2EJCA 4YV7A 4NXMB 2GN2A 3IPYA 4ZAWA 1FW6A 3RJ9A 4RDIA 5BN4B 4FS8A 5FP0A 3NHPA 4F3RA 5C8YA 1FVXA 1ESNA 1NQWA 1MJNA 1LLDA 4R1NA 1Z4OA 2ASVA 2WMYA 3WSVA 4DUGA 1AA6A 1U94A 4C4PA 5AW4A 2EL7A 2JIOA 3TW8A 2MINB 3AONB 3ITKA 2REQA 3GEGA 1GZ7A 3IPLA 3UCXA 5IUNC 2WTEA 2RCNA 3W3AD 3R24A 3BC1A 3FBWA 5IKEA 1Z2OX 3OFNA 4KQIA 5BOSB 2W6JD 2BKVA 3QKTA 1HO3A 2J3MA 2GTPA 2WU3A 4MMYB 1C9EA 5DGTA 4UCQA 4X92A 2YC4C 3VC3A 4E70A 1ZM7A 3G9ZA 3K8QA 1SRQA 3GUUA 3QE3A 4YRNA 4EFNA 5DOZA 3GV0A 6GPBA 2GO1A 1IYZA 1IZ8A 1VA4A 4DOMA 5C18A 1E3JA 4F5EA 2IX9A 3P4UA 2CD9A 2W9XA 2BFCA 3OPMA 2BEUB 3QK7A 3T5DA 5KVAA 1MG0A 1NVVQ 2NO9A 2JIZA 3IB3A 1JIVA 3IMKA 4P92A 5ITZA 4L5CA 2Y1OA 4FFBB 1RAEA 2JH3A 3NBFA 4DCGA 5FNVF 3VPGA 3EBOA 4D0LB 4PIMA 2XCRB 4I8XA 4OU5A 1MDBA 4JBXA 4ZPJA 1GQRA 2YNMC 2Z04A 5D86A 1ECFA 1WMSA 1I9GA 2QSZA 1CDZA 5DLPA 2YRXA 4K26A 3CNNA 2Q5CA 3HY6A 4V02A 4DM4A 3C39A 3UTCA 4UDXX 4EP1A 1Y42X 3BEOA 3MJTA 3PC6A 4RW0A 3G8BA 3NRCA 1GUFA 4IZIA 4JJ8A 3U0VA 1KVRA 4IXMA 1T2VA 3PQFA 3KB8A 3KELA 5KB3A 1TGYA 3KD2A 5KDDA 4L27A 3UENA 4FZVA 5BRAA 5JOQA 3ROPA 2VDQB 3WLIA 4RSGA 3P5SA 4LNAA 2ZSKA 5C0OE 1TZJA 3VKFA 3WJ7A 3WIUA 5EXXA 2CZQA 4C7MA 1L7RA 3WL8A 4G3XA 2YZ2A 1FQJA 2D1RA 2ZCVA 2QGZA 1D1PA 4TKZA 1Y63A 1BS9A 2FPMA 4E22A 3LKVA 7REQB 2GA8A 1I80A 1Q17A 4C6TA 3QEMA 1WDWB 1Y33E 2PAFA 3DW1X 4NR0A 5FR1A 4XIYA 5CX1A 5U4XA 1R6TA 2QRZA 3V8VA 2OGZA 2X7XA 3MFYA 5DSZA 2JANA 1FOEB 2CL7X 2VQ3A 4NS1A 3UT0A 1YFZA 4KMMA 3ZBUA 5LQUA 5ALKA 2H00A 3GJYA 2ZI6A 3F9IA 1WIWA 2B5OA 2CUTA 3GAZA 3GRCA 1UZLA 4KC0A 4OKIA 3UTDA 5HGXA 2H5IA 5JDIA 4DPKA 2VUIB 1U0LA 5L3ZA 4XTRA 3RV4A 1UXGA 4LOHA 2EFDB 1QSGA 2GS9A 3DHVA 3IA7A 3MQ2A 2LW7A 4UXHA 3NTOA 2J0VA 2X5JO 5C8ZA 4GX0A 4B3RB 1UR5A 4LISA 5A9RA 2R00C 1T8UA 1FCJA 1YV9A 1DAFA 1LF0A 1R12A 1ETUA 1Y6JA 2GX6A 5IH3A 2VSNA 4AN0A 1X2BA 3KQTA 2MSLA 2CNWA 4IEIA 1DKRA 2QRGA 3WE7A 1UEXC 2IH5A 4BGUA 2WQ6A 3P7MA 4C0BA 5CH3A 3KUUA 1JDZA 2XE8A 4E88A 5B7PA 4UHEA 3G1WA 1MC1A 5IWAB 2VRCD 4X91A 2V4UA 3R7NA 3SSOA 1P29A 2KSQA 4IFEA 5IAOA 5JJLA 1YKGA 2XMZA 4LC9A 4XVRA 3L6DA 1JDSA 16PKA 1KRXA 1JEYB 3FJYA 1PJQA 4CKEB 4FGSA 4N5LA 2FPGA 5JQGA 2X5XA 1RKVA 5TQ2B 3QENA 5LA6B 3C8UA 4RA9B 4JYZA 3K53A 2AT1A 2PRSA 1YVUA 3UWSA 3TGPA 3ZW7A 1SA0A 1W88B 2BKXA 3I01M 3MQ4A 4DMMA 4N01A 3OESA 3LZ6A 2WB2A 1JFTA 2O2XA 1SUIA 1A50B 2HUNA 2SBTA 4Y8VA 4IRUB 4IO1A 4B6SA 4M8IA 3BXPA 1DAIA 3DLHA 2HHAA 4DR5B 1HKHA 2IEZA 1T4CA 2K2WA 2QP4A 2DB3A 3FCUB 3DLCA 5ISMA 3DAYA 3K0SA 2Z6QA 2OQIA 4BWVA 4XH9B 1E69A 5ALPA 5IXSA 4JK3A 3HEBA 4Q05A 3MMNA 2V6IA 1MV5A 3Q7TA 2J0EA 2P6PA 5L45A 2A8YA 1SQFA 1XRJA 3R0JA 3GBSA 3ZDXB 2VWHA 3EC7A 3NANA 2RSLA 3RLFA 2G17A 4B3IA 4C3ZA 1BCRA 3GAMA 3H19A 1OB5A 1G3UA 2VXCA 3GB9A 3LV8A 5FUYA 4N5NA 4ZEXA 1SVIA 5EESA 3DF9A 2QLLA 4REMA 4M1MA 5K8TA 1NYRA 3EDYA 4RHTA 3GLGA 4ND8A 3SM9A 1W0JA 3VNAA 4MRMB 4JYAB 2QL9A 1OLOA 1WABA 4ZHQF 2DT5A 3I32A 1T5SA 5B1IA 3HWX1 5JSZA 2I4LA 4YRGA 2EBUA 3OX4A 1J2JA 2AZTA 2H2DA 3GQVA 2PEYA 4I4TB 4LRWA 4PAGA 4X5OA 2GNOA 2QN3A 1TF5A 3INGA 3TRKA 1YR1A 2CE2X 1TMGE 3D3WB 3NYWA 1TCUA 2BZ1A 3U44A 4P9NA 1ZN7A 1X7WA 1M6HA 2NSYA 2RHTA 3A4LA 4JENA 4IIEA 4HO1X 2O19A 3YASA 2Q6KA 4FKZA 3M2TA 4OX9B 3FCCA 4GBJA 4IDFA 4ZC1A 4CI0B 4D9NA 2AI2A 3O8NA 1NC3A 4I9GA 2QQ0A 4BFXA 2GPBA 3T5PA 3I73A 4D44A 3AYXB 1RQNA 4MUHA 2P7HA 3DKVA 4NH4A 2BWJA 1W93A 3W5BA 4ASUA 4RULA 5CJPA 1IN4A 1EK1A 3GUVA 2XD4A 3M1AA 2YQZA 3BSWA 4U7PB 3FN4A 1RS0A 4HVLA 3QU4A 4M8LA 4CXMA 4BTLA 4JLKA 3HMKA 2ZSDA 3B9BA 2QQFA 3HA5A 4UUQA 2PWYA 3O3MB 2X40A 4R01A 4O5AA 4PAQA 2GWHA 2PLWA 4JI2B 2NUAA 2OXRA 2C8LA 4OIFA 1JFFB 5B4TA 1V6AA 3KE9A 5FULA 1O4WA 1R4AA 1QYWA 1Z36A 2OE2A 1P1FA 1E0JA 1HH4A 1UDBA 2J9FB 3BHIA 3KFXA 4PGFA 4TRMA 4BNDB 1WS6A 1R88A 3W8FA 5CG2A 4N39A 4RJTA 1HT2E 3RYHA 5AVSA 5KKAA 3A9RA 4UUMA 4ZVVA 2M1XA 5EERA 4Q02A 3BDIA 3IBCA 3KZMA 3HUEA 4RU1A 3R7WA 3DTNA 1PR3A 3EFOB 4DMHA 4E94A 1S2NA 4DLRA 3FTQA 1SFRA 3AP1A 2DBVO 4X1YA 4M2LA 4J4BA 1JHAA 3WKDA 5B7GA 5JAZA 3OFVA 2ODPA 1NTOA 6REQA 1XA0A 3Q3HA 1HT1E 4ZVLA 3ZWMA 4NBTA 4F86A 3PFHA 3QLVA 1PYGA 4MWBA 1K0FA 3BXXA 3THXB 2B7LA 4Q37A 1K7XB 1W34A 3L8CA 2HPHA 3AGPA 1GUBA 1ZYUA 1QGED 4B85A 4F4JA 3FCEA 3C8MA 5L3SA 1SXPA 5FA8A 1L3BA 2BD0A 5CYOA 4DJ5X 2P9QA 1RE1A 1YVRA 3EIQA 3DDZX 3T41A 2R85A 4AG3A 1SXJA 2B3DA 3CZ9A 1XLUA 1X1AA 1G5HA 3TQOA 1L8OA 3I5UA 2C7QA 5E3HA 3GFVA 2VT6A 4GMXA 4UAJA 5ESRA 4KHZA 3TZEA 4D02A 1ZJWA 1WKCA 3WYEA 4WY8A 1L1EA 2ZRIA 1KOFA 2XA9A 5HF8A 1MMFB 3B20A 4OXNA 3P19A 4PVCA 1DINA 4XJSA 2XWSA 4K9OA 4U7JA 2AG5A 2G8LA 1TC1A 1BEZA 2DBRA 3ADDA 3FOWA 5JECA 1DHRA 1RWQA 2G72A 3RUIA 1TQ8A 3ZU6A 2ZJ5A 1H2EA 1C3EA 1QF7A 3ENWA 3PGKA 2QE6A 4ZICA 3ISVA 2AFRA 4XW2A 3S28A 5EJGA 3V4VB 4RZIA 2YHUA 3ZCRA 3ELYA 1ZXLA 3KUKA 3ROMA 3BD8A 3HZHA 2VF4X 3EMBA 1YQEA 2NUPA 1LWNA 3OT1A 1SOWA 2RIRA 4TPKA 5AKEA 1UFVA 3C48A 4G0MA 5FTWA 4DR4B 1ZD9A 1U80A 2VZ9A 4J0FA 3AR6A 2GM3A 2NVBA 1J9EA 3DD1A 1R6DA 2EZ9A 3LX6A 3KEFA 4OHOA 3T0IA 1MAWA 5DRYA 2HIAA 4A0FA 1WEKA 4QTUB 3JQQA 4D9IA 4LFBB 3E84A 3GUCA 1A2QA 3ICPA 4H27A 1F2UA 2VRBA 5CGZA 3A1UA 5EZYA 3DWFA 4L74A 3BFJA 3UK0A 5BUQA 5FH9A 5FA6A 1YQDA 4J3NA 1JIJA 4NCAA 2HM7A 5A9SA 4HGYA 2JCXA 2IYRA 2O2SA 2GSWA 1T8YA 4BMVA 2B37A 2H6EA 5CLHA 1R6AA 1Q19A 1TJYA 3ABQB 3MIZA 1DVRA 4G5XA 3FOZA 3TF5A 4FNGA 2GOYA 4MHSA 5JPIA 1G8KA 4HYQA 4YEDA 3UHPA 3NU1A 5IK2A 4Q00A 2C92A 1QKJA 1J8VA 3OJEA 5EJFA 5EJ5A 2PZAA 3QWHA 1Y5NA 2PZKA 2D5AA 4TLDA 4XPIB 5HA5A 1D04A 4L0MA 1Z22A 3DH0A 1QHYA 4FPXA 4IFIA 5ED0A 4ABYA 4EY8A 5JRDS 2UZ4A 2Z09A 4Z49A 1JJIA 5FF9A 4DRXB 2DKNA 4CODB 2COEA 3OU7A 3HGQA 2WTMA 4R2IA 4OYHA 1LI4A 2JLUA 4C4TA 2W6PA 2DPMA 1XP8A 1Y4UA 4MB6A 3WWPA 4ZYTA 3WLSA 4XKJA 2IODA 5C5EA 4DR3B 2WAYA 1MX3A 3GJZA 5J5AA 3AM1A 3KJGA 4PNPA 2G9RA 2Z30A 2V7QD 3IBFA 3V5NA 3PRJA 3ENKA 3IKTA 3H6HA 3Q9UA 2GF2A 2PFKA 4M0CA 4MQ6A 2I22A 3LPNA 1S7GA 3I6ZA 3UCFA 1M0TA 1OWMA 1WUHS 3OE7D 1EBUA 2IYTA 5D1HA 1EQ2A 2HHCA 4DQ0A 1V1MA 5K99A 3A6JA 3W5UA 1E4VA 1FMJA 1B6SA 5DBGA 4Q4HB 2RGDA 5AW3A 1U0BB 1YOBA 5CCEA 1P2GA 2QVYX 3T54A 2VCEA 4YAGA 2XH8A 2ZQYA 3LQ4A 3PRHA 2XBUA 4XFDA 4WLEA 1QIHA 2OGUA 2GBPA 3E7DA 3V97A 2JLQA 2ZBRA 4M86A 5K3FA 2O23A 1VJTA 2Q7XA 4GVXA 2Q7DA 2YN0A 1LX6A 1N1MA 2MJLA 1XZLA 3AJEA 4I5DA 3BWVA 1IPEA 2MU1A 3I42A 4YAKA 1YACA 1E1RA 2EERA 2FLVA 2V5AA 2C9MA 1ADFA 1NNI1 3S2ZA 3DMDA 5DM1A 1YHNA 4MH0R 5H3LA 5HF5A 1ZXBA 2KI5A 3JD4A 1REQB 1SUBA 3HNPA 5EZQA 5DHAA 1FNMA 5EXPA 5ADHA 3WV5A 1NY6A 3EPLA 1L5LA 5IAAA 5J23A 1JILA 4I4NA 3V00A 5DT2A 1WTCA 2J5RA 4ZU1X 1BVUA 4IS2A 1C9KA 2XHEA 4U9IS 2QUHA 3HFGA 4LYAA 4TTTS 5AJXA 4NOLA 4J3JA 1OH5A 1M9NA 4OGWA 4RH0A 5JQWA 4LBZA 4MVJP 4KO1S 1DG1G 3KT0A 3H1AA 2NZJA 4QARA 3S2GA 5D85A 1A9SA 1JQJC 2AXEA 2UZAA 3IAS1 1LDEA 4B3HA 1EINA 5E1DA 1FTWA 4GXQA 2NPFA 5LP1A 1JVNA 2B92A 3HTXA 2QM7A 2ZRKA 1CU1A 1UJCA 4JDUA 1DWOA 1E7RA 2X0NA 1ZSYA 2DWCA 4Y9DA 3ZDYB 5ALQA 3VXKA 4F46A 5E8JA 4KZPA 4F5ZA 2FSSA 5E6SB 4HDNB 4PGMA 2WWGA 2OPHA 3IDZA 1IUKA 1XN1A 1XC7A 3K2IA 2R68A 1T8PA 2YV4A 2E2WA 2Z95A 3L9XA 4X61A 4PBTA 5CYGA 1JDPA 1C9DB 2N0SA 4GGOA 3L0SA 5HZHA 3A4MA 1C8KA 3T3GA 1YF3A 2R1VB 5EUMA 4JROA 1GG5A 1KC3A 2QIOA 4D57A 1E0DA 3D81A 4FDLA 1H5UA 4R6WA 1RYZA 2NG1A 3ILHA 4WKBA 3BMCB 3JAWA 3NGLA 2R2AA 3L8MA 1PFWA 2RAPA 2FFQA 3NNNA 3AM5A 4R9SA 5DGXA 1XZCA 3SZGA 3S1LA 5A5EA 3PNPA 2H1OA 4IV5A 1IUOA 2FWIA 1H4VB 3ICVA 4N65A 1OIVA 4S04A 2FR8A 1XGKA 4PNZA 3EGWA 4XUDA 5FTKA 4DBLE 5CFZA 2IUSA 2G77B 5D7NA 4WT7A 1LQTA 5KAMA 4BLPA 4DM7A 2ZCJA 1RJWA 2QBYB 2FX5A 3CIFA 5LOVF 1YA4A 1FUEA 1XA3A 3DYBA 4LQDA 3LLVA 4N0MA 3HJGA 5FUVA 1FA9A 3ZKWB 3DHEA 4EFMA 4NCHA 5JI3E 2G5PA 1H94A 2CXXA 3GXBA 2DPHA 1CE8B 1PFYA 1CRPA 4YQYA 2CKMA 2FRVA 4HAZA 3BF7A 1X8XA 3Q8WA 3C3DA 4A2WA 3VAYA 5TXGA 5IDQA 1VE1A 4IQ0A 4RYDA 2FJ0A 1VHJA 3Q72A 3OQVA 5FOUA 3HY4A 5BW4A 1M6VA 2Q50A 3T1TA 2NUTA 3I9V6 3HBLA 5AUQA 2JDIA 5AHOA 4KGVA 3AV3A 2A88A 3KSDO 3HLKA 3ZY2A 3S1SA 1JJFA 2H4HA 3LHDA 2J33A 1JLHA 2BKEA 4W5RA 1E2GA 4L9SA 2REXB 4HRYA 2P5SA 4Z2YA 1DMSA 1U1GA 3E15A 1KR2A 5EHNA 1ZC4A 4NDAA 3ZJUA 2X14A 1U8AA 4IUBS 3NV7A 4ZVTA 1N25A 2JBAA 3QMMA 4A82A 1FBTA 1U31A 2A5FA 4D3XA 1HTBA 1SUSA 3HB7A 3PD1A 4OJTA 1HYGA 1M6NA 4PHHA 1XCMA 4JWTA 3HE3A 3AR5A 2NLOA 3IDAA 4MVJM 3SAJA 1I2MA 1R5JA 3UXYA 1U0RA 1A77A 3K09C 4B2YA 4DKXA 1KZYC 3UN1A 4DIFA 1MT0A 4XFJA 2RCYA 1E5XA 5DXFA 1Q1ZA 1Y3HA 5HIIA 4JQOA 3LC1O 4FYXA 1WJGA 1SU4A 1R2QA 4KYIB 4O6VA 4ARZB 4F6RB 4AZTA 1DBIA 1JIQA 3A9CA 3E9MA 3UV6A 3KJHA 4PTZA 2IC5A 4Q7LA 5AOBA 1M66A 5HNKA 1UBKS 2IYAA 1V7CA 3CZRA 1SVSA 3Q11A 2VP5A 4M88A 2EKDA 3PDIB 3TDNA 3EPKA 3SZMA 1U5AA 2QYHA 3G2KA 1N1GA 1NKVA 4KJZA 5BUCA 4CDRA 5M04A 2CK3A 3W7AA 4P5EA 4RF3A 3WGNA 4P82A 2BM0A 1W47A 5EZ5A 4HSEA 3B3AA 4AG5A 1G7CA 4Q34A 4R1LA 2QL6A 1CR0A 4XQ0A 5B36A 3HDHA 4JEMA 3TIFA 2HF7A 4RHEA 4B2PA 3E2MA 1YA8A 2HV9A 2V59A 5JZSA 3GG2A 4UBMA 2AKAB 5CLQA 1RWVA 4JSRA 5DLDA 3ZTWA 3BRWA 3FW1A 3EGOA 5FPQA 4EGJA 3IOMA 2H2AA 3DE7X 2ENWA 4AY2A 5A06A 3FNFA 5A7HA 1XTJA 5H3CA 4TOIA 1D5WA 4U7HA 4YP0A 3C5EA 3VPDA 4HWOA 1EM8B 5CM2Z 3OQJA 4PN7A 1FX1A 1XAHA 3BTOA 2Z8YA 3G1TA 3I9NA 3TL6A 4F2GA 2AZDA 4LWOA 2TECE 1GGJA 1BE8A 4WERA 3AVOA 1Z17A 2OV2A 3DOUA 4JP2A 4M22A 3TMYA 4K88A 1RLMA 4NE2A 5IMSA 4YCCA 3M4YA 3VGJA 2EOAA 1QJ4A 4G09A 1E6EA 3IP5A 1J2UA 5H82A 3K2BA 1DELA 5LBIA 1W48A 2N9UA 3KYIB 3PJDA 1JHQA 3PKJA 3WK5A 4EG3A 2JK0A 1YRWA 2D3WA 3W5AA 3H13A 4WTOA 2I2DA 2B82A 1ISMA 3BA6A 2HB6A 2F1KA 4OREX 1TU4A 2FQXA 2ZJZA 3OIFA 4C2AA 3ZDBA 2Q49A 3EEQA 3BMNA 4Q9HA 3S3TA 1X39A 1ZK1A 1RCTE 1W5TA 2B7BA 3PF9A 4A2PA 3TTXA 3CB4A 2DFLA 3QV1A 4P32A 3DAOA 4QQKA 4XGIA 1BHQ1 4WESA 1ZRSA 1B8OA 3ZX4A 5KYUB 3ESBA 4FZ3A 3H9QA 2P1RA 4XVQA 2O8DB 1IN1A 2JEYA 1AZWA 3DUFB 4QYMA 5KC9A 1FUKA 5A3QA 1YRBA 4Q1AA 5ALTA 1QHHA 4LYHA 3RK1A 4EATA 2OUKA 3I61A 1YK1A 3WMEA 4E2WA 4DRYA 5AJTA 3IQXA 2QN8A 4M1YA 4QFCA 3BJIC 4BAGA 2FPIB 1WXWA 2Q1TA 3WFZA 2I78A 1AUXA 1O6BA 1YQQA 2F9MA 4GECA 5EIFA 1B1CA 4AUKA 2BTQB 2DETA 1WQ1R 1YKFA 3FDZB 5BN5A 3NC4A 2EYUA 3S6JA 1NUHA 5G40A 5IXJA 3TE6A 4EB3A 4CV2A 2JIQA 4EDHA 1SKBA 3A3OA 2V9PA 2Z6UA 1M2EA 1P7PA 2FK7A 4YP1A 1SUCA 2NVUA 1N6PA 4OGKA 5HXAA 2ZDQA 3AFNA 5TRTA 3FWKA 3O8CA 4BX0A 2I3AA 3D7KA 2NW6A 4XWYA 4A15A 3LIIA 1JU4A 4A6DA 2WA1A 3BTSA 3ROZA 3FM9A 3RRXA 1GGVA 4QL3A 1NFRA 1RWMA 3EH2A 4XR4A 2MIIA 3I6IA 1L7OA 3AESB 4GVPA 4MGYR 4WK2B 4DDHA 3E3MA 5JCXA 3JALB 3P9YA 1A5BB 2OMKA 2PQ0A 3AP2A 3QYJA 4I1IA 4E07A 4EL5A 2AN3A 1BHSA 1KO7A 2QU8A 3G6KA 3QGMA 3VR4A 5CA0F 2LRHA 1P4GA 3LKBA 5HJEA 5J2TB 4P93A 4QSMA 3PVCA 2GJ4A 2UVDA 5C1DA 3AF1A 4EG0A 2O2ZA 4MSUA 1ZCFA 1XAJA 4U7DA 1RXIA 2RI1A 1GOTA 2QHXA 3HJNA 4C07A 5C1OA 2PGLA 1SKYB 4R16A 5FUWA 4DIOA 1SOAA 1AB5A 5CT6A 2PH1A 1UODA 3QTLA 2YTZA 2RKBA 4K87A 2PRYA 3TH5A 3PE3A 4IOMA 2XMDA 4OL0A 2HBZA 3R3SA 4DLAA 4CIBA 4I8DA 1DT5A 1RAAA 1TAGA 4R31A 4ER6A 2J67A 3RADC 2PH3A 4G0WA 4A0GA 4ZAXA 3HCPA 3CCBA 4D6PA 4EMSA 4XX0B 3VOBA 1H69A 1GPMA 3CF2A 1PK8A 2A33A 5CVCA 1Q7RA 2ZKIA 2CNBA 2YDXA 4COOA 3VH3A 1M76A 4UVDA 1KL7A 1NQAO 3N9IA 2C2XA 5AUPB 2PA3A 1JE1A 2WWVD 4B3GA 1OZFA 1FU7A 2PT9A 2D5IA 3U7QB 2WHRA 1YK0A 4NXNB 1YRLA 3Q15C 4DY4A 3EISA 3NC0C 4IS3A 1BXGA 5COAA 1CWUA 3PLRA 3T3OA 4KQXA 6PFKA 1J70A 2YNMD 2FSFA 1MENA 3DF7A 3IOCA 3PPXA 3S68A 1AN0A 3VU9B 1XZQA 4JB0A 1Q7TA 4C76A 1DZIA 1N32B 2P9YA 4MO9A 3JQBC 1UWLA 4A8HA 1LLFA 3N8HA 3ANXA 4WK4B 1I0ZA 2HSEA 3DBIA 2IBTA 4PO9A 3KSMA 3LPLA 2NO4A 3RYIA 1THTA 1X9HA 1J49A 3GP5A 4TVOA 3V3KA 5M3BA 3AIIA 4AK9A 1X7ZA 4AAYA 4YDQA 1MOQA 2GO7A 3KYCB 3JV7A 3PUXA 4NARA 5TQ0B 2G9ZA 1DOAA 2PSFA 3VPHA 3EZNA 3SDBA 3HCRA 3K1ZA 3ZU3A 3MEQA 2AYYA 2Q3FA 4FKMA 1I5EA 3HP7A 2IVZA 4TMZA 3GR6A 5C3UA 5IKMA 4JVNA 1SKYE 5K3EA 4GYKA 2IXEA 1WMAA 5DGCA 1NMEA 1KOLA 4W9RA 1ODKA 4A0RA 3R4CA 1T6BY 2VK8A 5FOSA 2F8TA 5ESWA 5HS6A 2IY8A 2LE0A 4Y18A 4LWPA 3GZ4A 3U0BA 1OLUB 2V7GA 4M98A 5AVRA 4B9AA 2DY0A 4W6QA 3HRIA 3NBAA 4MUXA 4OQNA 4WDRA 3DOOA 4LF8B 2ZAGA 4AJPA 4RM3A 3FYUA 3O94A 4P4LA 4V0OA 2DWUA 2XUJA 1GG8A 3LQRA 3M6VA 4WCFA 5J59A 3ZY4A 5C7YA 1XHEA 1RM5A 5AVQA 1RLIA 5MGNA 4HDSB 1XMPA 2R97A 1QTIA 1W4AA 1NBWB 3K31A 2Q28A 3EF1A 1FSFA 1Z0IA 1DAMA 2B0JA 1XYGA 2QLJA 5DP1A 3VR0A 2ACKA 1O54A 3EZLA 2Z1NA 1Y7IA 1O96B 2R1ZA 1XYVA 1PS8A 1Z6PA 3HXTA 4H1VA 2I2BA 4XQ9A 2ZWOA 3JZDA 2QMYA 5CVDA 1KE1A 3UK2A 1GUZA 3FMIA 4CT0A 4LZNA 1EX7A 3A36A 3MERA 3AI2A 2H57A 4H59A 1AO3A 5EE1A 5K20A 4AJHA 3LNCA 3LRTA 3MOSA 3OTHA 5FNZA 5P8WA 4QFMA 3TLKA 1H0SA 4DG9A 3NOXA 4I9FA 3TLXA 2G70A 1K7FB 1JHZA 4B40A 5HWSA 4CFYA 5E2AA 4AYTA 1U3VA 1C29B 1YS4A 3FPAA 5AKHA 3TAHA 1RVV1 4R9RA 5ESXA 1FLNA 2P91A 3O95A 4DDMA 4EB8A 3VR5H 4EGAA 3NKVA 3F5DA 1XSEA 2AMLA 3HGTA 4LYYA 2OBXA 2QRVB 3GT4A 4PZAA 4MVJH 4Y2YA 4DA4A 2BE7A 1HRKA 4Y1EA 1SUWA 4F3KA 1HETA 2K87A 1XTZA 5A4KA 1GAEO 2IPXA 1N36B 4P3NA 3L4BC 5FBKA 2XSZD 1K9SA 4IAOA 3R75A 3K0HA 1P80A 5DDIP 2I33A 2JIBA 3LRXA 4OXXA 2FWAA 3ETJA 3AEZA 2FSGA 1X1BA 4RA6B 1JPJA 1NVTA 1HI9A 3AB3A 3JW8A 5BT9A 4DQXA 2PGNA 1CDEA 3NHYA 1E2DA 3QZUA 1C3JA 2ZB7A 3GRUA 4FOTA 4MR8B 3T52A 1KPHA 2AI1A 3FZGA 4P7FA 4BQEA 3HXOA 4U3JA 1Z15A 2Q5LA 2ZE7A 4RJJA 4WN3A 4C6HA 1EIWA 2ORED 3I04A 3LI2A 3NUQA 3CUSA 4H7IA 1FMFA 1YBMA 4C2TA 1M6EX 2IV2X 3A26A 3GBVA 5GINE 4Z8YA 1J6UA 1TKAA 1X1QA 5F2OA 5FOVA 5H9VA 5K4HA 3EXIA 5E4FA 1QHIA 1VLVA 2XYQA 2IOFA 2ZKLA 3DSRA 1TYBE 3UA3A 1A4XA 4RTMA 4NAVA 4QQNA 1ZNQO 1JSRA 3EFEA 2PX2A 3Q0TA 2OCPA 3WGOA 4BN5A 3OTOB 3SBEA 1NMYA 4I55B 4PYRA 1ZH2A 4DIBA 2ETVA 3I30X 3EHDA 4LDQA 3FAZA 2SCUA 4N6OA 2FGKA 4R1MA 5ECGC 4WLUA 1XPJA 4EQ6B 1JMVA 3EPHA 3OA2A 1W85A 4IPTA 5HOEA 4BKPA 3UPDA 1ZD2P 1Q1GA 1OQAA 3Q9SA 2PL1A 4HFJA 4YI3A 5ER9A 2A30A 1S2OA 3D8BA 4CW7A 1XBTA 1XD2A 2CC2A 2C9ZA 2QTCA 4IV8A 1H85A 3VPSA 1QHFA 3LGXA 2JFFA 3BAFA 3OIYA 4C7BA 2PX4A 3CZ4A 4RVFA 4C7KA 4GUDA 2QQEA 4K46A 5KVSA 4G65A 1Q92A 1TO1E 3LVQE 2W6CX 4K9MA 1I2CA 4BVHA 5KNDD 2P2SA 4N3AA 2ZUFA 4WRRA 5CVEA 3NHLA 1FDIA 4B84A 1OWOA 4FE7A 1MAVA 4A1OA 2JAUA 3OKCA 2IF0A 3BUSA 3V48A 2V7BA 1PFVA 1EFRA 1CUIA 3BIJA 4LYJA 5D6OA 1GWNA 4G84A 5BNTA 4X7MA 2H1CA 1UK8A 1JTEA 1BYIA 2YHAA 3OEHA 2GPJA 1TM1E 2HSJA 4ZV7A 1KFEB 4MRAA 3EY4A 3SFTA 5KOYA 1Y8QB 4IH1A 2FQ1A 2IELA 1FNDA 3HBMA 3PQCA 4I08A 1TJ3A 3R7BA 3HVRA 1RMTA 1NDHA 2X3YA 2WYIA 5JVDF 1SKMA 5T41A 1GCUA 2BBOA 1FUUA 3UGTA 4RDXA 1CZHA 2ZQ5A 3TQSA 4UTOA 3KQMA 4C7OB 3SF8B 1T0HB 2BGKA 2P0EA 2BFBB 4NQZA 1NJ6A 4RLQA 4HYEA 3LX8A 4BB0A 2HRRA 3KZCA 1Y98A 1Z68A 3OQIA 1H1DA 1U3UA 3IR6A 3RHTA 3M4XA 2C54A 3HEAA 1XEWX 4GU5A 1ZH8A 1VLHA 1YZVA 3S1AA 1JPNA 1ATZA 4CKZA 4Z3OA 3KUDA 1JSZA 5HM8A 3TL3A 1NA5A 2VVTA 2QJTA 4BLRA 1Y48E 3EZ9A 4JXXA 1OXUA 3C6BA 3U26A 4ML3A 4JCCA 2PVSA 4HNAB 3AUFA 4F5WA 1VGVA 4JL6A 4GLOA 5LUBA 1U8FO 5F9HA 5ADVA 5F2EA 4NBRA 3JQGB 1SU7A 4EJ0A 3MWGA 4FI3F 2VLIA 1UBJS 3JTEA 4NJEB 5LQKA 1DCFA 2QTNA 2ZROA 1GZUA 4PFKA 3ND6A 3VR6D 1QBKC 4F45A 5F1OA 1LDYA 2B35A 2WIBA 1CR2A 2X8WA 3NETA 2BL4A 5CYFA 2PKXA 3ZEIA 3ACDA 3KBBA 1W35A 1MJGA 1W25A 1S1CA 1BEEA 2I4RA 5IW8A 2D2XA 4QICA 1Z2EA 1UFKA 5AUNB 1AGPA 1L7XA 2Y4OA 3E61A 1L5KA 5K8LA 4DJFC 4I0WB 4YT5A 4OBEA 3HFRA 3SR0A 1JI3A 1IDOA 3CX3A 4EEZA 4Y6OA 1E2HA 1KU0A 1XO1A 1JHRA 4S35A 4AZ0B 2RD2A 4B83A 4D0GA 2YZGA 1ZKDA 2VP6A 4HQNA 4ZO9A 5FBQB 5TJHA 3SS8A 2I6XA 13PKA 4MR7B 3D4OA 3A2KA 1JKJA 1NG1A 5JAQA 5KOJA 1QM5A 1R74A 4ZIRB 1HWYA 3PZRA 5CIQA 1F38A 2JI7A 1NRJB 3RTEA 5FTMA 4BHTA 4MWOA 5KYYA 3GJ0A 1A5AB 3TKLA 2XX3A 5FAKA 2IUTA 1WDMA 4N3GA 3SVTA 1W1WA 1H3FA 2GJAA 4QBIA 2FX2A 3COJA 1A97A 2EQ5A 4K2AA 3FPKA 1NQUA 2W11A 4GVLA 4EITA 2ZBDA 5FX2A 2AOXA 1GDHA 2OHVA 1GYRA 1QNLA 4ZQGA 5AI6A 3AXTA 1NUUA 1Q5PA 4QTYA 4YMVA 3PNSA 1E92A 3Q3GE 1WU7A 4DTCA 2DLDA 2GCPA 2QVZX 2C96A 3PR3A 1KORA 2QVLA 3PUJA 2QMZA 4NZOA 3QU2A 4W5WA 3IHKA 4X9XA 3KFLA 4JFRA 1QS0B 4GWGA 3WNBA 5ICSA 2XCTB 2JFOA 2FPPA 4DDWA 4UUBA 4Z2AA 1RJ9A 2GGSA 3CUVA 5LVAA 3WMWA 1Q0RA 2PMFA 1FLVA 3W6PA 3ZD7A 4M37A 4HWRA 2Z5VA 1XTSA 1T2EA 5EWMA 1U4NA 2WICA 3B82A 3WB1A 4BKMA 1SQ5A 4TSFD 4QGFA 4NZNA 1VRWA 1M34A 3I4LA 4X60A 2GLXA 3P0FA 4J0IA 4IYRA 3NHZA 1E62A 1XZAA 3E48A 3JQAA 4PLYA 3DULA 4JQCA 3AUYA 4PNHA 3B1WA 4P86A 3DBRA 1NI4B 4TQ9A 3EXG2 2OP0A 4YDRA 1QRAA 3AJRA 5DCWA 5BV7A 1T36A 2WZDA 2QMUA 3U17A 5ITSA 1Y6QA 1U5BB 1NAHA 2ZUDA 2BH2A 4UFNA 1NDQA 1FP1D 3SX4A 2OBMA 2FR0A 1YB2A 1P72A 4WXHA 2VDWA 1P9OA 3RF7A 4DDUA 1QAOA 1L8AA 3LQKA 3W06A 1DBWA 4HQLA 3FOEC 3CINA 4PG4A 2IDZA 1YB6A 1R4NB 3MINA 5FWAA 3SHFA 1ICIA 4XGNA 4HC4A 1E64A 3OM1A 4GPIB 4BE7B 4ZI7F 2XRZA 1JPUA 4LG1A 3H2KA 3E7FA 3LP6A 3PGVA 4O2BB 4UUNA 4Y7CA 4Z0HO 3D1VA 4BU0A 2R6FA 2XQIA 3GEMA 1ZI8A 3DOIA 1QO0D 3H9JA 4OMCA 4G67A 3PNBA 2QTFA 3BCRA 4KUGA 3D7NA 3D1JA 4JOCA 4TMWA 5JMPA 4L9AA 4ZMSA 1DB3A 4E12A 3GEEA 3WBKA 1L4KA 5ES4B 1A1VA 1R4ZA 3LLUA 1QYDA 2AWNA 5DMXA 4AW9A 4ZZ1A 2A0WA 3OQNA 4M99A 1FYFA 3ZJVA 4H6WA 3U4CA 4WGGA 2UUPA 4I9HA 4QDXA 4EHFA 4BFCA 1MFPA 1SCDA 1F4PA 2QG6A 2QTTA 3PVSA 2YHBA 1L5HA 4RPHA 1N2CA 2HUPA 1KYXA 2FP4A 2YMQA 3GJRA 3ZTYA 3MT9A 1EDOA 1NVFA 1VP3A 2HDOA 4N7MA 5ARCA 3VV3A 4F97A 1DG9A 5C2JB 2D13A 2FY8A 3GDGA 1OGIA 2GTIA 4GAEA 4X85A 3BGWA 3ENQA 3HYSA 3OSZA 4G85A 4G1CA 4I1RA 3RFUA 2KWIA 4KXFB 3GCGA 1M2KA 4N5DA 1I4EB 2HFJA 2A67A 1C8BA 1AB6A 5E2BA 4IHJA 5TE9A 4IIJF 5EP1A 4LJ7A 1YJBA 2GPNA 4UBKA 3U56A 3HLTA 2FN7A 5JZOA 1NBME 2J0UA 3SKXA 3PTZA 2XRMA 2CL6X 3R40A 4KO8A 4IIXA 4BO9A 3NBMA 4AURA 2YWGA 4J90A 2H9AA 1ZMRA 3CEMA 3GFOA 2YRFA 4LJKA 4V0NA 1YO6A 1PSWA 3GU3A 5KNBH 1YMUA 1BA3A 3DBOB 3PEYA 3BBLA 4B6QA 3GGGA 2XECA 5JSQA 3KIPA 1EGVB 3NLLA 1DKOA 5UKDA 2A9KA 4YBZA 3NVDA 4EFKA 3B6EA 1H9BA 4J2HA 2O0LA 3WNZA 4UZSA 1SOMA 1SCUB 1HLPA 4FMCB 4B5LA 1HLDA 1MJ5A 4H15A 1B43A 5EMHA 2ZYDA 4UVGA 3SBOA 3W4JA 4ESVA 2V74B 1K4YA 2BSXA 1HK7A 1KERA 1XJWA 1XXHB 2WTBA 3G85A 4XIIA 4N9QA 3T06B 3V7NA 3NM6B 4PSAA 1AH2A 5HMMA 1EMDA 4EYEA 1V5WA 1KSHA 2IPMA 3H17A 4LX8A 4NJOA 4QTZA 3ZWNA 5IJ9A 4CGZA 4YA6A 3PGXA 1BQEA 1QP0A 2JGDA 1IG3A 1CKEA 5FUQA 2UXDB 2OMEA 3AERA 1W87A 4OI0A 1NVUQ 1KF0A 4B4DA 2C8VA 3KRTA 3L79A 3FRJA 4HVTA 1IM2A 3Q1LA 4LBVA 3RC1A 4L0CA 4BQNA 1U7WA 2WWTA 1DEXA 3AR7A 2G5GX 3P71T 3ESYA 4MTCA 4C29A 3EXEA 3R20A 5EHGA 3UBMA 1HYHA 1NNLA 2DQYA 4E15A 3V1LA 3D6FA 2BGRA 3U4MA 2AJ8A 3BWCA 4UM5A 2AYZA 4JZKA 3VRHA 1EDBA 3A25A 3CF4G 3MCUA 4Y67A 2B1RA 2AA3A 1J25A 5EINA 2R4QA 3JQ7A 2R5WA 4W9MC 3WVNA 4LYGA 1D6MA 1E2UA 2R8EA 1BN6A 4XAQA 3HDVA 3UYKA 2HMSA 1P2TA 1FYXA 2AKYA 2OHIA 1P1HA 1V5FA 4ETIA 1FDWA 1K98A 4NL4H 1P60A 1GYQA 5KHOC 5DNYB 1JHYA 1L3IA 2GN8A 3HWRA 1UOPA 3LH5A 2H59A 4XPZA 2QUBA 1UWKA 3AUSA 4G37A 4M76B 1KARA 2IDJA 4EGCB 2G0NA 1UJBA 5EI5A 1LF5A 3CY6A 4JBGA 4QPPA 1J0CA 1I3KA 4PX5A 1N1EA 2PGAA 2R87A 2WMNB 3HU3A 2UYOA 3D6AA 2R8PA 5EP3A 4H18A 1Z62A 4HQOA 2WJZB 3RVKA 3ZNOA 1SD5A 4BIIA 4TKLA 2ZBFA 4LAFA 3H1PA 2RBKA 3C41J 4P80A 1XXHE 3RSGA 1SG9A 3JR3A 4QPNA 4BO7A 3PWKA 3TX2A 2EFYA 3ZW9A 5CRIA 4F2DA 4OM7A 4U8GA 4ENWA 4XI9A 1IHUA 4IVQA 4K6MA 3T1OA 3L7JA 2AMJA 4UCFA 2VDLB 4B3BA 4KSYA 2OFOA 1PJCA 2EWWA 4D0RA 2YC2C 3KJFA 2V6GA 1LDBA 3PFIA 1NSFA 3K32A 2QEQA 1K9VF 3KTFA 3MWDB 1F0NA 3DT6A 4L9RA 2QLFA 2VT7A 4C0HA 4DGSA 2ERYA 2OGWA 4PIVA 2W7TA 5CDFE 4YB8A 2SKEA 4M38A 1MKYA 4RE5A 2PNFA 2IV3A 4K9PA 3SOPA 3B60A 3RC2A 1F17A 4HOYA 3UCEA 3HO1A 2ZIAA 2ZR7A 3F7MA 5EIWA 1O2DA 4GKJB 1YB4A 1KDVA 1UKZA 4I50F 4KQWA 1ZCZA 3GUYA 4QXPA 2IXDA 2VHCA 2ADFA 1Y3IA 2OR3A 4J2TA 4MDHA 4KAFA 1E59A 2PGJA 4OTZA 5A5DA 1JLKA 1UPFA 4FZRA 1OYYA 1WSAA 5E9WA 4D9HA 2WF9A 4RTPA 2K5UA 5HZMA 3ZJ4A 3MGBA 3Q2KA 1ZJ5A 3GGDA 3AI7A 3ROXA 4Z3DA 5K3SA 2PKYX 3LSTA 5BNWA 4KQGA 1CSEE 2NU9B 1GZ5A 1V5GA 3MW8A 4MUYA 5D3QA 4R2JA 1EBBA 1TECE 1LK5A 3O4HA 4RMJA 1Z06A 1GCAA 2AQHA 5C1BA 5J4VA 2FEKA 4XGKA 4I5GA 3GRAA 4EKDA 1SHUX 4QBFA 3HJHA 2VK1A 1M1YA 4CQJA 4PLPA 4V0MA 4O0MA 4YS6A 2VHYA 4CIXA 2FWPA 4F2WA 3FNEA 4WZAB 3LW8A 4L5BA 1GRCA 1Z7GA 1SCBA 3H5OA 3PBKA 1JHPA 5D3KA 5TB5A 1MB9A 3AHCA 4NCIA 3IAAA 3S2SA 2XW6A 3HGMA 2B8EA 2PK3A 4ZYWA 1IHOA 4P7JA 1K86A 3A9WA 5IP5A 1JYEA 1IY8A 5REQB 4ZGWA 4BQPA 1RM4A 4MUAA 3KP1A 3OMWA 2DQKA 2QAJA 3R2JA 1A76A 1DFIA 4U9UA 3E58A 4ZOCA 4CQMD 3R6DA 1IZ9A 4OXIA 1U8YA 4PWYA 3OX2A 2NO6A 3TI7A 2E48A 5JAMA 1E8NA 5KOHA 2CVQA 2ESRA 3TSOA 3WADA 4MWZA 1PG2A 3WRYA 5D6NA 3KOWA 1ELOA 2BMAA 2HIGA 3P9IA 1ZXXA 4JWKA 4NCNA 2ODBA 2VQ6A 1Z2PX 2QPAA 5H3HA 3KKOA 1QQ6A 2C04A 4IVPA 1NI3A 3EX7C 3OJLA 2ZSHA 3QPAA 1ZCBA 2Q8QA 3M6AA 3NIDB 3EDRA 5KOIA 3QXGA 4WXYB 1UEIA 3MWYW 5IVDA 2OZLB 3ZI4A 4A1FA 1Y7TA 2QAGC 4HMOA 3GARA 3KLMX 1G21A 1V6CA 5LZ9A 3GLFE 10MHA 2B1IA 1KEVA 3BRSA 1NPTO 2PRKA 3I5YA 1IJEA 5LA6F 3ELUA 2G83A 1OKKA 4DC9A 3GNTA 1J8MF 1J99A 2D5CA 2VDOB 2BW0A 2XMCA 1QOPB 4PYKA 1NZDA 2E6KA 5AKXA 4LJ8A 1O8BA 5LLTA 5G2OA 1NW5A 1OHHD 5IPFA 5JXWA 2XNSA 2TMKA 1NXOA 3F2VA 3U5TA 3QVJA 1YDGA 4LMRA 5CLGA 2O54A 3WLQA 3T5GA 3HA7A 4F72A 1I30A 1I3CA 1G18A 4WZAE 4AWXA 5KTPA 3ZQJA 1JT2A 5HOQA 3WYGA 1YNSA 2ZRBA 3VZDA 3O90A 3UNXA 3VTFA 3KK0A 5F3RA 3TLGA 4MJ3A 1E2BA 1MO2A 3AVPA 2V45A 1KS2A 1PR0A 1QVZA 2HCJB 1XRQA 2ISSD 4HWSA 4KR7A 3ADKA 5AUOB 1J8FA 4IKPA 1P2UA 3ZTTA 3TSCA 3PTAA 2IUYA 2Y0DA 3N2GB 4D81A 4PQYA 1KJNA 4TV8A 2EXXA 1PFGA 4DS3A 1WUJS 3G2NA 3A6FA 3QXCA 2YS7A 4QECA 4BNXA 2CKDA 1NJ1A 3RVRA 2XMRA 4ZEVA 1N3YA 1SCKA 3RHZA 3MWLA 2V3CC 2J45A 3G0OA 1EG2A 3WYCA 3PDUA 4S1NA 4YMTA 3DL0A 4NEHB 4TX1A 3A6DA 3CA8A 3EVZA 5D00A 2W6IA 3R9XB 3IIMA 4FHZA 2GETA 4NV1A 3WL5A 2A0FA 2GI4A 5F23A 1A5SB 4PFSA 4BP1A 4D3ZA 4I9NA 4Z4QA 3HP1A 1U8CB 4I4TF 4DAEA 1JAIA 1T2FA 3RU3A 1ZSNA 2A0XA 3DBLA 2JLZA 4J03A 4NPAA 2W6NA 3CBGA 1LX7A 5BSTA 4XWKA 4YMIA 4AIIA 4ZWNA 1DC5A 1IH8A 1CNMA 1O95C 4W1RA 2BGTA 1JT9A 1Q1QA 2E4AA 2PR7A 2YWXA 3T35A 3GVXA 1S3IA 3TZQA 5JNSA 2FQQA 4HL6A 4WLFA 3LWNA 4IX1A 5IJAA 1ZGZA 3OJ0A 2FF5A 4KBGA 3SYMA 4DLVA 3FFTA 3KSBC 2MDTA 2Q5OA 4L3VA 4RV4A 4UHCA 1BX3A 3TQCA 3QQPA 5FHQA 1XRLA 3CXRA 1CQWA 1S1MA 3DOCA 3E53A 4OV6B 4RIIA 2O8NA 4UEQA 1XRSB 2E1RA 1GCGA 2YX1A 1KK1A 2JLWA 2ZZMA 1E3MA 1NBOA 1QVWA 3UJHA 4DWWA 2UYCA 2ET6A 1QONA 2GUWA 2WMDA 3CXUA 3DTYA 4RGBA 1ZLYA 1FDSA 3EULA 4DV2B 1LBSA 3QUAA 1ETHA 2IEIA 3A28A 2BZGA 5JLJA 1RBMA 1X87A 1MIHA 1WW2A 2W2QA 3C8ZA 4LGMA 3RO7A 5I8WA 1A7KA 4HYTA 3GLVA 3G0BA 1GTSA 5BV1A 1TA4A 5F2KA 4B7AA 1ENZA 2I8AA 2A5JA 3CPHA 3OWXA 8GPBA 2HHHB 3N70A 5KYTA 1CHDA 3K70C 1T25A 1VYTA 5HYVA 1OYOA 2Q5FA 3LO5A 1MIOB 2QP3A 3PPYA 5ARBA 1M5TA 4MDYA 2EZTA 1CHNA 3U5ZB 4DREA 2ZJBA 2B98A 2BF4A 3COZA 3QLUA 5CH8A 2RHCA 3GVIA 3GGSA 3H1BA 3TD6A 5GIOE 1TVKB 4CG0A 1JDVA 3ZWPA 1UPUA 5EIEA 4H7DA 4ACAA 1EWRA 3QKSB 4QOGA 4CJXA 1DUIA 3VBCA 2QAIA 3DZBA 4CR6A 3TRHA 1UMBA 2Z98A 3RYFA 1GL9B 1FUYB 2E4ZA 1H3EA 4YMGA 5BY2A 3HVUA 3T4UA 1NVKA 2RHLA 4EMUA 5GAJA 3IV9A 2H16A 2JGRA 3SU8A 4D98A 2QRJA 5FDFA 1DEKA 2V7VA 2W6JA 4PO1A 4BWGA 1NW6A 4OYRA 2WU4A 1KMQA 2H1HA 2XYHA 4LBYA 4TZ6A 2Z1DA 5DBIA 3M83A 2Q4RA 2QT9A 3RE1A 2LKDA 3EXFB 1NGSA 2YOFA 4WOPA 5LYJB 1DWPA 5GJBA 1RCFA 4UDYX 1GTZA 2QJRA 3FI9A 5JCZA 4N47A 4U2GA 4EEXA 3IL2A 1Q12A 1R9GA 4X44A 3E2IA 4G0UA 4IMJB 1PZFA 4PAWA 1WUYA 4MLDA 1O87A 4EUHA 1TVEA 1KMHB 3S2IA 1QHEA 1GZDA 4BLVA 4OP1A 2FUG6 1SIOA 4JSYA 2GF0A 1FP4A 2CB0A 4JT2A 3ZGLA 4UDNA 5F7XA 5KUTA 3QMVA 1T0PA 3F6PA 1T10A 4RKRA 1ZNXA 5B55A 3MT0A 2OB2A 2P67A 1EUQA 3RSOA 5FA5A 1C30B 1NF3A 1QC5B 4FONA 4Z7NB 5LDDC 4YHHB 4UXIA 4OLFA 4WOKA 2PWZA 5CAEA 2KHZA 1T4GA 2G07A 2XOKD 3BD7A 1IZZA 3CX6A 4JDPA 5PNTA 1TM2A 3IESA 4Y6RA 1YJ8A 2DZDA 4IXWA 3WLJA 3FBGA 5CLJA 1FVFA 1NTRA 4M49A 2BFEB 5KWIA 1WMFA 4FMBB 2PD3A 1L5WA 1T91A 2QX8A 4P58A 5JE8A 4ETNA 1CRQA 5MGBA 5C51B 3W5SA 4I4IA 4EX6A 5CYPA 1U6KA 4TKVA 5EXTA 5JAHA 4CLEA 1BJKA 2JD2A 3RF6A 1ZUD1 3X3HA 4X7PA 2WA2A 1P6QA 1XTVA 2VHUA 3RRYA 3I39X 1E3DA 2JRCA 5IMBA 1KAEA 2W83A 3SK0A 3WGTA 4R1PA 5K8VA 2AHOA 4ECEA 4IBOA 4JU8A 4Q3DA 1DS6A 3CVJA 4OI4A 5JRJA 4ZAFA 2MINA 1R0XA 1I7NA 4KX3A 4ROSA 1SBIA 3PD0A 3ROKA 4S0ZA 1RXVA 2V1XA 5LP6F 3HFJA 4HCJA 4BX9A 3HM9A 1WCXA 4CV0A 2OKGA 4H1UA 2OXEA 4KOEC 2HA3A 2Z0MA 5IX8A 4NG5A 1KK3A 2G67A 2YIJA 5FXMA 4RENA 2ZRFA 1HL7A 4XIFA 1GNVA 4MW1A 1VGQA 1T5OA 3U7JA 3MWFA 1ABEA 3ET4A 3G68A 4MPDA 4JUIA 4YGYA 1QZXA 2D06A 2BUBA 5SZJA 5LQMA 5CHEA 4HDKA 1S0UA 3ISJA 4RAQA 4BFVA 2OM6A 1VFNA 3GDHA 3TJRA 4OD0A 5LQRA 2G6BA 4OQYA 4RD6A 3STTA 5JW6A 2MSWA 4UATA 4CEJA 2O5CA 3IQIX 4GGPA 5JZBA 3WTBA 4HBZA 3L7KA 1A9OA 1NOJA 1JSXA 4J7XA 1Q14A 3NBQA 4MLPA 3VPCA 3P9CA 1D6SA 2I6UA 3WRWA 5LM3A 1NIJA 1Q7GA 3BD6A 4YRSA 1XVUA 4DM3A 3PWZA 2O8FA 2Y0PA 5I8ZA 2VFAA 4GD3Q 2IYWA 5HF9A 1T8RA 1E3LA 4GPAA 4AJLA 1SPBS 2X8AA 4QOSA 4C1NA 3AVQA 4RFSB 2GEFA 1L3CA 2C5AA 3DLPX 3NAZA 4UNQA 1RAIA 1E0KA 5CNIA 2WD7B 1R37A 2ADOA 4JLSA 3EVAA 2W0MA 2ZPUA 1ZIYA 3UICA 4H6PA 5EP4A 3AR3A 3HVIA 4B9EA 4C4ZA 2IYFA 3QRWA 1WDKA 1UAAA 3TZKA 2CFTA 2IIPA 1YE5A 2RGEA 2VUHB 3IJ5A 1E9DA 3JCZA 4G5YA 4QUAA 1SRRA 1YUNA 3NIBA 4FIDA 1T9HA 1R0YA 4AVYA 2IUUA 3HVHA 1KA9H 3SQWA 3K0KA 3MILA 1T0IA 2C2GA 4LSMA 4OKNA 1FMCA 4KYUA 4JODA 4P38A 3M1YA 3S44A 1P0IA 2CLEB 4L4UA 3ZWOA 3E7PA 1FFYA 2VH5R 4RM2A 3P0EA 1VXRA 4MCAA 2QY6A 3H04A 4G0XA 2ZW9A 3Q3VA 4R81A 4YUWA 2GXAA 1PJ8A 1HG0A 5F35A 4OMFG 4U7WA 1X13A 3U7EB 1JBKA 3HC7A 3RNOA 5K7SA 1B6RA 2YCLA 3GVPA 3H3JA 2FSHA 1HYBA 1KAQA 4E5VA 4DLLA 4KPEC 4G63A 2WJWA 4YAOA 4ZXFA 4Y2HA 1OV4A 2EIHA 2FZWA 1ZDMA 3NBYC 4YRLA 5JCJD 1N33B 4WACA 3ZY6A 4UUPA 3O8QA 3U3OA 5JTUA 3OTWA 3Q6MA 1PZGA 3GYGA 1P7YA 3MB5A 4NYMR 1A95A 2I34A 1I33A 4CKBB 3L8EA 5GQSA 3UXEA 4RK7A 1CK4A 1KMCA 1QG4A 2EBFX 1RKXA 1PW5A 1WVMA 1C3XA 3BTUA 4IRMA 1DC3A 5HF6A 3H5VA 2OSVA 4CHTA 1GZ3A 2FQWA 1K4KA 1DLIA 3LUKA 3OUZA 3ZI7A 4CKCB 1EFAA 3CWQA 1IVNA 1VP9A 1ANKA 1BH2A 2C77A 3OOEA 3OZGA 3EJWA 3B1VA 1U5CA 3DMGA 3ZCPA 4DJJA 5CA1A 4Z8XA 5I7VA 5TMPA 5JXJA 2MOKA 2EF0A 2QR3A 5F52A 3VHQA 3ZIDA 1UFOA 2CYBA 4I1PA 2IE8A 4N03A 1DQRA 3SJ7A 4JP5A 3M6WA 2ZB3A 2IFTA 3OLWA 1K8ZB 2IL1A 3U3RA 5B4VA 4KK4A 1HZZC 2WD8A 2FG7C 5HK9A 3PC3A 3HYNA 1LJUA 4IZHA 1BKDR 3LLCA 3WLKX 1X1DA 3PLNA 4JBLA 3E0QA 5FOXA 4E30A 3GRVA 4P2BA 5KQGA 2FSVA 2GAIA 4HUTA 1Z18A 4P0QB 1MLDA 3IUEA 3GQBB 4C22A 1IB0A 4O4HB 1JEYA 4W8HA 3SIPA 3FTFA 1NJSA 4O1HA 2Q0HA 1J0BA 4WXPA 3QVMA 4XUCA 1QR6A 1UC8A 3ONFA 2ONZA 5DX1A 2C7PA 2DLCX 3K0CA 4LXTA 3LAWA 4RA9A 4QJIA 3OMLA 3CW2A 4XSGA 4TV9F 3OT5A 4BJ3A 3K5IA 3I1JA 2O4CA 1S9HA 3R9WA 4XYEA 1U3GA 2BMFA 1G8FA 4MITA 3UAZA 4CGYA 4LRQA 4UMVA 5K9ZA 3ZH2A 4ZAYA 1OXSC 5JPCA 3BT7A 4WN9B 2AK3A 4JB2A 2JASA 1SKUA 2OXCA 1XT6A 3WHKA 3TD2A 3PUYA 4HXFB 4R7TA 2WR8A 1G64A 3FHJA 4OUKX 5C5DA 4RKWA 1W73A 3FHOA 5B1HA 1J1ZA 2P2CA 3C97A 3TXYA 4XB6B 4URUR 1P4AA 1DOHA 3LVBA 3K0FB 1TUIA 6LDHA 3CF4A 3R5JA 1W30A 5AW8A 2ISCA 2VSQA 2FPRA 1GV1A 2EJVA 1MO4A 1Q0TA 1JEAA 2C0PA 3BZWA 3WYFA 3DAGA 3EIWA 3KB2A 5DV9A 2Q3CA 1NRWA 1RHKA 3QMWA 3K1YA 4MJLA 3P9XA 4TTPA 5AVUA 4OSEA 4EMBA 2RAVA 1RBYA 4LYFA 1GNRA 2FETA 4FEGA 3R3JA 4FFVA 2XADA 4ZARA 2ZIFA 4LQCA 2O8BB 4IW3B 4MRMA 2RC5A 4B3CA 3A11A 3KZKA 2Q0XA 5IG2A 2KJQA 3LQQA 1M67A 4R2KA 4GLFA 3WR5A 2V6FA