4YC7A

Crystal structure of human fmnl2 gbd-fh3 domains bound to cdc42-gppnhp
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
179
structure length
179
Chain Sequence
AMQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQRGLKNVFDEAILAALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of FMNL2-Cdc42 yields insights into the mechanism of lamellipodia and filopodia formation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Formin-like protein 2
total genus 60
structure length 179
sequence length 179
ec nomenclature
pdb deposition date 2015-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4yc7A00
2PJZA 4PO1A 3VTKA 4BEBA 5KU1A 1Q12A 1OFHA 1EK0A 2CCJA 1F6BA 1NKTA 2PMDA 4DHEA 4JLAA 2BJVA 2VF8A 2Z0MA 4YMUA 4JSTA 1XF9A 3OEEA 4UNQA 3NC0C 3MWLA 4ZDWA 1A7JA 2GVDC 4D4LA 1Q1EA 1AKYA 4CW7A 1FNNA 3A37A 3GFPA 1H65A 1KAGA 5IDVA 3HR7A 4MRPA 1SXJC 3PG5A 4GI7A 2O8EB 1XNJA 3GLHA 3VQTA 3F5FA 4KO8A 2QSYA 1NY5A 3GMTA 1KK1A 4U00A 2VYFA 1VDZA 2C9CA 3RRZA 1G3RA 2CCKA 2DWQA 2ZR0A 5FTKA 2QMHA 5FBRB 1SXJB 4A1FA 4B75A 4Q9KA 2CVHA 4Q7MB 2HYIC 4O3MA 1VTKA 1YZGA 2Q6TA 1KYIA 4HZIA 3FKSA 1NRJB 1N0WA 1VMAA 3GLGA 1VYUA 3WYGA 1S3GA 2J7PD 3AUYA 2IYYA 3B9QA 4P4SA 2JDID 2AD5A 2RGCA 3TIFA 4M4SA 1QG2A 3TR5A 4OQNA 3S1AB 1OJLA 3CF6R 3P4XA 1CXZA 2FJUA 1E0SA 3U3OA 2F1RA 2O8CA 1W2GA 1XXHB 4OI2A 2AN9A 3U7GA 3NVAA 2JIZD 4A9AA 1N6LA 1PV4A 5JLJA 2WWWA 4A0HA 3DOEA 1JB1A 2J41A 2NO1A 1ZVQA 4LV8B 4TMTA 1N2CE 3M0EA 4FMCB 2V6IA 4QBFA 4DUGD 3U6KA 5GJBA 3THWA 2O5VA 3W9YA 2OCYC 2V7QA 4X8LA 2D06A 8OHMA 3CW2A 3P32A 3WBJA 2ZVPX 4EPWA 1PLLA 3I32A 3NBZC 4TLAA 3TW8B 4US2R 2YWFA 2IS6A 2VRWA 4B47A 3OFNA 4GDFA 4JL8A 4F4CA 1NIJA 2MSCB 2CK3D 3EXAA 2C2HA 2QTHA 1X1RA 2QRZA 4X8MA 2JLVA 3RRNA 2OHFA 5FL7A 4F92B 2V1XA 5EE9A 3T1TA 1WB9A 3AVXA 4JLBA 5J40A 1IN6A 2QTFA 1XEXA 2H57A 1E1QD 2XEXA 5LD2B 4KITB 2GAOA 2I1QA 1JI0A 1VCNA 1DAHA 4E03A 1D9ZA 1II8A 1QHXA 3EIQA 3GJ0A 1IJFA 4Q7KA 4BFVA 1IY0A 1F2UB 1SVWA 1VYTA 3C14C 1T3LA 2BMDA 2GEVA 2NPIA 2OM2A 2AWNA 1W36C 3ND8A 3N2EA 1KDOA 1ZU5A 3FTQA 3DHWC 1ETUA 1G7CA 4OQLA 4IXNA 5TDHA 2JCSA 1B23P 5C4MA 1NIPA 3FMIA 2FFBA 3Q3JB 3JVVA 3SHFA 3G0HA 3VKHA 1DPFA 3AKDA 2GXAA 4P33A 1AJEA 2UKDA 1TU3A 5JI3E 5SZKB 4JYCA 5EQTA 2EFEB 1HQYE 1VHLA 1U9IC 3DVLA 3T35A 3TQFA 4NCIA 1EX7A 5G40A 4Q7JB 1T4GA 1YZUA 2VP0A 3SOPA 2Y8EA 3NBXX 4URZR 1P72A 3LBHA 3SJAA 1IXSB 2FA9A 4M53A 4V0KA 3BS4A 1UBGA 4IOJA 4BLTA 4E07A 5CK4A 4LRWA 3CNNA 2CE2X 3CR7A 3ZLJA 2A5YB 1U99A 1S1MA 5DHAA 4I1VA 2PEYA 2D2EA 3GJ4A 2W58A 2JLRA 3LLMA 2FEOA 1ESNA 3Q72A 4R9UC 1P3JA 1LS1A 2GA8A 3EX7C 2W2VA 2IHYA 2VP4A 2VSOA 2OFWA 3UWKA 4AKHA 1QDEA 2FE4A 3KKMA 1R5BA 4LJ4A 4WXPA 4FMCF 3IIJA 2R65A 3SN6A 1Q1ZA 4HEJA 1M7BA 1TADA 2XOKA 5FI1B 5H70A 4QBIA 4XVUA 3O8DA 1DBSA 3WP1B 1ZC4A 5HTKA 1G8FA 4KFUA 5EXSA 4QM6A 2IS2A 1XPOA 1Z83A 4V0OA 1E9CA 4FINA 4UJ5A 5AJZA 4KYIB 1ZD8A 3LBIA 5KUTA 1MRNA 3BD9A 3DM9B 4PQRA 3JZMA 3THWB 4QBHA 5BYKA 2GZAA 3QF7A 4LJ8A 1W47A 2CNWD 5JECA 4UNNA 5FOUA 4B6FA 5KSOA 1N6PA 2WVJA 4BFWA 5JSZA 5KHOC 4LV5B 2AFHE 4UNRA 3BBPA 4HAXA 3WY9A 4PZZA 2GCOB 1R0XA 2FH5B 2EFHB 3B1ZA 4PFSA 5JS7A 4LBVA 1N5JA 4YMSA 4AWXA 4DLYA 2XXAA 3KUDA 3B82A 3W34A 2I3BA 4P3YA 1E2FA 2IHBA 3B6EA 2F1JA 4XOIA 2JLXA 1KK0A 1YU9A 4V0ME 2ORWA 2ZJ2A 4M1YA 2FSFA 3E5HA 4HDQB 3I92A 1CJKC 4G1UC 3CRMA 1Z3IX 3KKNA 1G3UA 3R7WB 5AUNB 5B57C 4N0EA 2QMOA 1OFIA 2GHIA 4HAUA 2GKSA 2FPKA 3EZ9A 421PA 1ZYUA 1YE8A 1JEEA 3U4QB 5FPYA 4QFMA 4XWKA 1YKSA 5J5CA 3WMGA 1CRQA 1D2MA 4GP6A 4MDFA 1AIPA 3TW4A 2ZS9A 1NI3A 3AKEA 2HT6A 2GWHA 1U90A 2ZRFA 2W2XA 3CO5A 3H1TA 5FOVA 4RY2A 4PAQA 3W8RA 1G7RA 3ZVLA 4KU4A 3ZH9B 4NYIQ 3DO6A 1KO7A 3FFAA 4Q4HA 1Z29A 3W90A 4DSTA 5F3WB 5CM9C 3LXXA 5K8UA 5KDDA 1XMVA 3K0AB 3WYAA 3EIHA 1XMIA 2OZEA 2YWEA 5J47A 3B60A 4HAZA 4Q02A 5ANRB 3U3RA 4D0GA 3JVUA 4OI1A 2JJ8A 3QE0A 1RJ9B 1RVDA 1XD9A 3S1AA 1XD8A 2GJ9A 4DSNA 1M7HA 4DLRA 4QG7A 4N0DA 1W4AA 1XCMA 3SDZA 1YQTA 2J7KA 2NO6A 1NVUQ 4FWTA 4TYWA 4F7WA 2QAGA 1UM8A 4PAMA 3FMPB 1OXVA 3HR8A 3ZVNA 2ZSBA 1TUEA 2CEAA 3SR0A 2EWWA 1UF9A 3A4NA 1E9SA 3AP3A 3H84A 3LH5A 4L4UA 4TLCA 1E94E 2V7QD 5BN3A 4HYYA 3LDAA 3TSZA 3A36A 1CTQA 4C7OA 4DWJA 2ZJ8A 4AY2A 2G77B 3MMPA 1DADA 1G5RA 1NLFA 1CR4A 1OIVA 2ZJBA 2J1LA 3CZQA 3IUYA 4C9BA 4QNMA 3SYNA 1HT2E 4YDSA 2CBZA 1SVOA 3QNUA 1PUIA 2X2FA 1Z07A 3BRWD 1ZP6A 1NMYA 4JL5A 2V55B 1NMXA 1Z0IA 4QOSA 4B2PA 1YRAA 3L0OA 4IFEA 2PL3A 2RB4A 3RAPR 1F2UA 4JLOA 2QPTA 1MT0A 2OFXA 4HLCA 3I62A 4P31A 1S2MA 3IO3A 4US1R 3UG6A 1NBMA 1EFHA 5GJVC 3NHBA 2HJGA 2ODWA 1XDBA 2ZE6A 2ZI6A 4Q7LA 4G01B 4HZUB 2D74A 4OQMA 1V43A 2AKYA 2HF9A 2IYLD 2D62A 3KJIA 3VAAA 1XEWY 3TBKA 2YOGA 2OAQ1 1II8B 2VHTA 2O0JA 3GLIA 5FUYA 2CL7X 2D4HA 2VHCA 1TEXA 1N6OA 2C8VA 2X77A 2VH5R 2WMOB 4DCNA 1KSFX 4MRNA 5CB8A 1Z2AA 3U3JA 4ZI2A 2PCJA 1TTTA 1B0UA 4LZZA 4AK9A 5JRJA 2ZRAA 4DLWA 2X8AA 1CS4C 1EX6A 1P9WA 2WWFA 3GEHA 3KFXA 3Q7QA 1GWNA 2XZOA 1LV7A 2RGNA 3K9GA 2H8KA 4KYUA 4LY6A 3PJRA 1JAHA 1N5LA 1XMJA 3U44A 1E32A 4JT2A 3ZZUA 2OE2A 4O2LA 1R5OA 3LNCA 4L9SA 1SKQA 2G88A 2GBLC 1MO5A 4A92A 1UBEA 2ZRCA 3T5GA 2RGXA 4IDQA 2ZRNA 1OXTA 1E9FA 3T12A 3MUFA 3KQNA 2QRNA 4DLUA 3R8FA 2HCJB 3NWJA 3PEVA 5BWMA 1G4AE 1F3OA 3MFYA 1NBMD 1S4QA 4TN1A 3QEJA 3T61A 3A4MA 3RNLA 4EFLA 2IYSA 4G5GA 1CRPA 1F48A 1Z6TA 4E22A 3C5CA 4HB0A 4QHTA 4Q4AA 1Z2CA 5EP2A 2HDNB 4B3BA 1WMSA 4NONA 2EFDB 2F43A 2O8BB 3GJ3A 3MGCA 4V0LA 1E9RA 1KO4A 4YXWD 1CR0A 4Q00A 3B9PA 3FHTA 4DLSA 4HAYA 2VSFA 3AQ4A 3W8NA 3ZS8A 2BIFA 2NTYC 2ZE5A 3P26A 3IHWA 4WZBE 1F5NA 4IDPA 3QVUA 5EJEA 2VSXA 1R7RA 4DRZA 1Z06A 5BQ5A 4GL2A 2FU5C 2FZLA 3THXB 1PZNA 4BLQA 1W46A 3B1VA 1R5NA 3CNOA 3FKQA 1CR2A 4MGIR 4ZDIA 4ZIRB 1A2BA 5H8WA 1E9DA 3R9XA 2NG1A 2B6HA 1GAJA 2ZS8A 1FFHA 2OO7A 4KVAA 4LBYA 3BAFA 5CJ2A 3K0CC 2WTUA 1RKBA 1XD2B 2OCBA 4RZ2A 3X1WA 4TL6A 1YZKA 1BS1A 4CT5A 1CP2A 1CJVC 4YC7A 3V9PA 1NLZA 4KXFB 1JXMA 1UDWA 3I1FA 4RD3A 2WSSA 4EUNA 5TMPA 1ZBDA 4TTPA 1OSNA 1A4RA 1SKYE 2NIPA 2ZRHA 3OZXA 1AS0A 3TQCA 4CRWB 1L4UA 1XJ0A 2FFHA 3WRYC 4R71A 621PA 1GFIA 3D3QA 3NDBB 3SU8A 1G17A 2K5UA 1XWIA 2QY9A 2WBLC 3I8SA 1AA9A 1GZSA 1KI8A 1T3HA 1W48A 2RCNA 3GJXC 4G5OA 5JFGA 5ELXA 1U9IA 4C0JA 3FFBA 3D6TB 3QBVA 2ZEJA 1GILA 1HEIA 1OT3A 2KBEA 3PVSA 3UMRA 2J0SA 3TVDA 1TF5A 2B8TA 2IYQA 2FN4A 1GITA 3MJRA 221PA 3I72A 4CEIA 1G3MA 5DISB 4S35A 4LUCA 4QXAA 4EPXA 1Q1BA 2AFIE 3EZ6A 1RRCA 3K70D 1XTKA 3DEFA 3OHMA 4TYQA 1ZINA 5C1BA 2YVUA 2DHRA 2JA1A 1Z6XA 4OQFA 1HV8A 1N5KA 4BFYA 1H8HA 1RPZA 2ECKA 4PXAA 1P9NA 3TUZC 2FGKA 3DZDA 4PPFA 3ZQ6A 2CL0X 3TGPA 2ZE7A 5KDOA 4TQ9A 1U8ZA 4JLJA 2GDJA 1XP8A 2EW1A 3GEEA 1KJZA 1COWA 4D0NA 5B58C 2YWHA 3P4YA 4JVNA 1KJWA 3WHKA 3VR6A 1XZPA 4BUJA 4KAXA 1S0UA 3GFTA 3CPJB 3Q9LA 4ZV4A 1M34E 2P5TB 1F60A 4ZPXA 1XFAA 3WHLA 1N25A 2QM8A 4BLOA 4YMWA 2WSSD 4V0NA 2OFOA 4PHGA 4U7DA 4BECA 3PEWA 2FG5A 3K1JA 2R8RA 1G41A 3VR5A 4HUTA 2D2FA 2ZROA 5CM8B 2JDIA 2B8WA 5EXTA 5HKKA 2CLDX 3R8CA 2GXSA 4OHYA 5L3VA 1Q21A 1U81A 2ODNA 3NEYA 2DWOA 4RFVA 5G3ZA 2Z83A 2RGNC 3QEOA 3QSYA 3MWJA 1JAIA 5LDDC 4D82A 3DZ8A 4TZ0A 3QXHA 2QBYA 4URVR 4HLQB 2ZTSA 4WBSA 1OHHD 3BK7A 3PENA 4TT3D 2WKQA 2QI9C 1HH4A 2ZETA 1T91A 3U7HB 5IK2D 1ONBA 4FMDB 4AKEA 4QGHA 2QZ4A 3TJZA 5FUXA 1Y63A 2DR3A 4Q1FA 2AX4A 2D7CA 4TTRA 5D3QA 2JJ1D 4KFTA 4PR0A 1E9AA 1WA5A 4NCKA 2XZPA 3WMEA 1DO2A 5HZKA 2B7BA 4MA4A 2WMNB 1RRFA 1X3SA 4B48A 2VQSA 2Q3HA 4M0LA 4D81A 3ICQB 3B78A 4Q18A 3MG9A 4PPGA 4Q19A 2ZRIA 3LVRE 4DUGA 1FPMA 4AG5A 2GCNA 1G16A 4BRUA 3AF0A 2J7PA 4LYFA 4EAQA 2NQ2C 2VA8A 3KJGA 4LX0A 1OH6A 2N1BA 4ZDJA 2W83A 2ZRLA 5DLQC 3IPXA 3C41J 1JEDA 4AI6A 2KWIA 1EFTA 4KJZA 5E95A 3VU9B 4DCUA 5E7IA 5CDFA 2JEOA 2QE7A 5LB4A 1LB1B 2J0VA 1Z6AA 4TMZA 1EESA 2YYZA 3C16C 5AUQA 3MWKA 4HLUA 5KPDA 3DKPA 3ADKA 1KK3A 4BQSA 2QP9X 4A0FA 2PZEA 2RH5A 1UJ2A 2ANBA 4EQ6B 3UPUA 1AS3A 1LNZA 4O2RA 4JMPA 2P6UA 3UMSA 2BEKA 3CKLA 4A82A 2WSMA 4D4MA 1IOZA 3QUSA 5BN4A 1Q20A 5C4GB 4K46A 1QHNA 1QHHB 3SFZA 2IX3A 1Q3HA 3OAAA 4CEHB 4D4JA 5KSPA 4PO9A 4Q47A 1M2OB 4BWYA 1TQ2A 5FUWA 5FPTA 2IF0A 1XPRA 2JATA 1TUIA 1LVGA 4TWZA 4B2LA 4PANA 4Z1MA 4NPHA 2ZJYA 3B5JA 3BB3A 4WXRA 1E1RA 3KKPA 5J4HA 4EJSB 2Q0HA 3SJBA 1X6VA 2PLFA 1GUAA 4NYJQ 1SKYB 5HPYB 1WQ1R 1WRBA 3PEUA 4JVMA 4C3ZA 4FD2A 2QQ0A 1US8A 2VEDA 4M9SA 5HR5A 4FWIB 2Q3FA 1QBKC 1Z6YA 2ZRKA 2QE7D 3WRXC 2J0UA 3P27A 4X8OA 3LX5A 4XJXA 1P9RA 3GEIA 2O52A 5JSZB 3PITA 4NCJA 1N0VC 4LJAA 5J4LA 5KSYA 5KPJA 1G21E 3E70C 4RKFA 4PC6A 5HE8A 4ESHA 1SHKA 1TL7C 2GBLA 1NSFA 3EA5A 1FTNA 4FMBB 4JJZA 3TAHA 2EWVA 3FE2A 3PUYA 1L2TA 4IW3B 3THXA 1KDTA 2XXAB 1N6NA 4Q4JB 4II7A 3T1VA 1GRQA 2QGZA 4FXPA 4JIMA 2FF7A 3NBFA 3CRVA 1NMZA 5FH9A 1YR9A 3NTUA 3SYKA 5BW8A 2XTNA 1XTRA 3HYTA 4MKGA 4I1SA 3QY0A 1JR3A 2DPXA 1MKYA 4QJ3A 2A2ZA 2FDCA 1FQJA 1IBRA 3E2IA 4RFSA 1VECA 3RS0A 2O8FA 5L3SA 4A8JC 5DYIA 1KIMA 3R9WA 1NN3A 4RSGA 4DEYA 2PCLA 3EZ2A 1XCGB 4Q48A 4IVPA 5CLLA 2ZI3A 4BFZA 4B6EA 3M6AA 3BB4A 4JBWA 3W6OA 3FVQA 3CH4B 2WM9B 2UVQA 2GZDA 2KSQA 2JIZA 1OIXA 1HQCA 4H9GA 1EXMA 4UKDA 4V02A 1G5PA 2EYQA 4LYJA 4Q1AA 4PHHA 3QF4B 4BZPA 4OK5A 5CLQA 2ZUCA 3CX6A 1U98A 1GIAA 3IKJA 1E6CA 2WWXA 2F7SA 1W49A 2WIBA 1MR3F 4C0KA 3AF1A 1UKZA 2OXCA 1E9BA 4PC1A 2V4ZA 4LBWA 3UK6A 1MRSA 4NYIR 2F1HA 4LJ5A 4W5WA 3U61B 4GT1A 1C1YA 4M22A 1OPXA 2HLDD 2ZITA 2MMCA 4H1UA 5AK0A 2OBLA 4LYHA 1R0ZA 3WP0A 2ORVA 1QVRA 4JLNA 3DOFA 1H8ED 3BWDD 4L15A 4D2IA 2CK3A 4PC7A 4URXR 1QHYA 2QQEA 4G5SA 4FCWA 2GJSA 1GSIA 3IIMA 4PHFA 2QMUA 2X1VA 2QAGB 5H68A 5GADl 4D6PA 4ZKEA 4LJYA 4B2IA 3SYLA 4RD6A 3KTAB 1TAGA 2ZAMA 3DM5A 5EUMA 2ZREA 2YC2C 4TYNA 3MD0A 4MRVA 2IEZA 3GLHB 1A82A 2IYUA 1RW4A 2KJQA 3GJ7A 4KFRA 5DO9A 4IFBA 5HCNA 3AVVA 3CX8A 1C4OA 4Q21A 2QT1A 3VKWA 1TF2A 2IYWA 4P32A 3IHLA 3BFXA 1AGPA 4FN5A 2XX3A 4AYTA 5IK2A 4LHXA 4IVRA 1JR3D 2HLDA 1ZM3A 5J4VA 1X8LA 2PLRA 2OLKA 2RGDA 2AL7A 1NG9A 4XD7A 3UWOA 4ZCIA 3PEYA 4DLZA 5JI2E 1G6OA 3C5HA 3RS7A 3BC1A 3AM1A 3X1DA 2O8CB 2QA5A 3CPEA 4KSCA 3AF4A 5DI3A 1JECA 2QTVB 4UNSA 1H8EA 1ZC3A 3V4RA 2QAGC 2E9SA 1QVAA 3WNBA 3GP8A 1S96A 3K0EA 5EE3A 3QI2A 2A5GA 3LVQE 2ZRPA 2WOJA 3KTAA 4K81B 4KHZA 4JKIA 4URWR 4B3FX 4ZI3A 1Q44A 2RMKA 4JLKA 1W44A 4DLVA 4KBGA 3AEZA 4PC2A 4JT4A 4EFMA 2DYKA 3FB4A 3T34A 4MYTA 3SEAA 2HEIA 4OI0A 3P20A 1N6IA 2ZXUA 4YLGA 1SHZA 3RS4A 2AWOA 2QP3A 2D3WA 1DEKA 3H4MA 5DHFA 1GVNB 2QENA 2GF9A 2XAUA 3KQKA 5J4KA 4K8OA 3AGPA 4F4JA 3A6PC 1VCIA 2GNOA 5G3YA 1XZQA 1SVSA 2GCPA 1E2DA 4C4PA 1E2KA 4NYMQ 1J70A 4HDOB 4URYR 5F9FA 2F55A 3UATA 1J8YF 1D9XA 4I1UA 1KHTA 1E3MA 4HB3A 1LW7A 2YOFA 4Q03A 5FBVB 5FOSA 4IKEA 5L3QB 1LF5A 2RGEA 1KMQA 3UG7A 3V00A 3QJYA 4JL6A 3RDPA 2H7VA 4Q9IA 3K9LA 2QG6A 4CT4B 1UADA 4UXHA 2EQBA 4LI0A 1KSGA 4A2PA 3SJCA 4CEHA 2J5XA 3DMDA 3ETLA 4EIWA 3JZAA 1QRAA 2NO7A 2ZYWX 1OKKD 2VPPA 3OEHD 5DSZA 2XSZD 1EFRD 4C0BA 2P0EA 2C98A 2ZI7A 4R2HA 4C0QC 4HAWA 2YZ2A 3KJHA 4WIAA 2PJRA 3VX3A 3RS2A 4OJQA 1GDDA 3H86A 2CE7A 4LDJA 3M1IA 2BVNA 1W0JA 2X2EA 4F4IA 4NE2A 3A4LA 3MCAA 3OE7D 3W3ZB 3BB1A 4NDZA 3U4QA 3W5JA 1XB2A 3K09A 1NLYA 4ACAA 4BLRA 3QBTA 4LC1A 4LBZA 121PA 1M8PA 4JVSB 4LSGA 1AGRA 4BLSA 4QJ5A 3SJZA 4A0RA 4Q1BA 1IAQA 3AB3A 3MLEA 4L5BA 1X8JA 3AF2A 1GNPA 2AD1A 4QBGB 1FUUA 2PZFA 3CZPA 4DDWA 1GG2A 1G8PA 1WBDA 2J0UB 2P6RA 4KBFA 1YVDA 3EARA 1YR6A 2VP5A 4RZUA 4GPTA 2R44A 1ZW6A 3PCRB 3CWZA 5A0FA 1WDTA 5CDFE 2C03A 5L3RA 2PZGA 2ERYA 4US0R 1Q1QA 1W4RA 1VHTA 3IPYA 3K0SA 3BERA 1U8AA 2BBWA 3BH0A 1DG3A 3N70A 2X19A 1KAOA 1NVVQ 2R6FA 1VIYA 1ZM2A 3UIEA 2BCGY 1NG1A 1IN4A 4WA7A 1A5TA 1EWRA 2BC9A 4PAOA 1OLOA 1T9HA 4Y0VA 2F9LA 4GOXA 4QJ4A 1JBKA 1Z6GA 3ZIAD 1KSJA 3LXRA 2XNDD 2XB2A 3G82C 4QNRA 3FHCB 4OBEA 4TLEA 1CR1A 1X1SA 2DFKB 1J2JA 2OILA 3J81k 2WZQA 2XSZA 3FDIA 3QG5A 2NZJA 4EPVA 3RS3A 4GSYA 3O8BA 2F6RA 4ERNA 3GCGA 2OBNA 3VHXA 2Z4SA 4AYXA 2W0SA 1IM2A 1SXJD 1KI4A 1V5WA 5AWFC 4GZMA 3NIBA 2RGBA 5AJVB 1K5DA 4QGAA 2QM7A 1OXUA 2J3EA 3HPRA 3OESA 1S8FA 1AK2A 1U8YA 1Z8FA 1G6HA 4G5QA 4B3DA 4D80A 3SE0A 1ZM9A 1W5TA 2ATVA 1UKEA 4LGMA 4CDGA 4FCTA 3SQXA 3U60B 3I61A 4TMKA 5EE0A 2NZ8A 1XTIA 4A4DA 3LFUA 4GMXA 2F1IA 2REOA 3KX2A 3VR3A 1R8QA 2YHSA 2GTPA 1OXXK 3I3SR 2CHGA 2XITA 1Z0JA 2IYZA 2ZYTX 5FR1A 2FEMA 5A4JA 4D0LB 5KDLA 1KDPA 2WIAA 1E99A 1G4UR 1Q0UA 4ARZA 1W36D 3UKDA 4AC9A 1DOAA 3ZJYA 1XEFA 1UEJA 1MO6A 1ZD1A 3KL4A 4ZDKA 1OF1A 2ZI5A 1YHNA 1Q3TA 1XTSA 2GEDA 3M4YA 2IUSA 4PX9A 1E2LA 4RZ3A 2BKUA 1ZU4A 2I1VB 4Z8XA 3SBDA 2H1LA 3X1ZA 3GLIE 2W2TA 5GJCA 1P61B 2F3TA 3QPUA 1K8RA 4HUQA 4OYHA 3T1OA 4KV9A 3FPAA 1JR3E 3QXXA 1HE1C 1YR8A 2Z5FA 1Z22A 4OHVA 3WXMA 1JR6A 2LCFA 1KSHA 3SHWA 4RD2A 2FOLA 1ZNXA 2DBYA 2QROA 4MYHA 3QXCA 1X86B 2IYVA 3AUXA 3BOSA 4BFTA 2REBA 3H0KA 1N6HA 5EE5B 3PUXA 5TB5A 3LRPA 1S9DA 2IBMA 2YJTD 4LCBA 4H1VA 4WZAE 3T5DA 1BIFA 3RC3A 4IOMA 4XD7D 1KMHA 4I81A 1YZTA 2Z43A 4ITRC 4JKYA 3EZFA 1XEXB 3KKQA 5CIWA 2JJ2D 3GLGE 2AK3A 1XMSA 3TE6A 4ZCLA 2VF7A 4LPSA 1COWD 5DN6A 3AKCA 1VYVA 1E2HA 1JQLB 5K8LA 2C04A 1WCV1 3R9IA 2YKGA 1CEEA 3B7GA 3ASZA 2ZRJA 3W5IA 3GLFE 4JJKA 1UKYA 2W6IA 4Q4AB 2P65A 3QKRA 1SXJA 4PPNA 5DH9A 3OIYA 1NY6A 4NL4H 2R62A 1UDXA 3I5XA 1L7VC 2H17A 3NH9A 5FOTA 1E2JA 2GESA 5P21A 2IS1A 1RIFA 1KI9A 3BFKA 4I1OA 1J7KA 3EPKA 3SQWA 2JLZA 4CF7A 1N6KA 2ZJ5A 6Q21A 4PPQA 3GLGB 1DAGA 2CHVA 2J9RA 2QEQA 3ADCA 3QXJA 2WPDD 2MMGA 1HTWA 2J59A 1DE0A 4M21A 1T8UA 2NMVA 3GLHE 2IXFA 1W0KD 1ZMXA 3QKTA 4A6PA 1SVIA 3ZS9A 2MSEB 3QQ5A 2BHRA 4C0HA 3DDCA 2A30A 4AIIA 1HURA 3HU3A 5FL7D 2QPAA 4ZCMA 1LTQA 3QPVA 3L0SA 4URUR 2A9KA 2P5SA 4EPTA 1KNQA 1KGDA 4Q1DA 4TYYA 2VO1A 2IXGA 1VG9B 2CVFA 2QP4A 3WYFA 1W1WA 3BE4A 3GD7A 4M1OA 4R98A 3L0IB 3FGNA 1XBTA 1NP6A 3OEHA 3I4LA 5C18A 1ZJ6A 4NMMA 1GKYA 3K53A 3HDTA 3K70C 4Q4LA 2C95A 3WNDA 3F0TA 4GOJA 2O0KA 2WICA 4YQFA 2QU8A 3DL0A 4BPBA 1QG4A 3A1SA 2IUUA 3KXIA 2QL6A 1OH8A 4HATA 4QM7A 3SZRA 5K8IA 1TQ4A 3OE7A 4ILEA 3VNUA 1AS2A 1D5CA 5FR2A 2AHOA 3KQLA 2QGNA 3EW9A 1RFLA 2QAJA 2QNRA 1O87A 2ZUBA 4HI0E 1HY3A 4M1TA 4IEIA 1GRRA 2QN6A 4OK3A 4X8HA 4AURA 3RC8A 4JLVA 3HPQA 4EPRA 3TUIC 4QC2A 2UZ3A 4G0NA 4KLZA 1ELOA 4V0MA 2IF2A 4Z54A 5L3SB 4MDEA 3IBGA 3MJHA 3AGQA 2D7DA 5JHHB 3AVUA 1XU4A 1R2QA 1WP9A 4W9MC 2V54A 4UXIA 3TNFA 3NXSA 3HYRA 3B13B 4NHOA 4XIGS 2V9PA 1IXZA 4MUAA 3PR1A 3AP1A 2W0MA 2A5FA 2ZYUX 1ODFA 3CONA 4KCGA 2GCOA 3T06B 4Z8YA 1A2KC 1ZCAA 1X8KA 1YR7A 2XZLA 4HB2A 2V8OA 1KTVA 4HB4A 4XTCS 3W6NA 1XTQA 2MSDB 4IDHA 3EPLA 3KQUA 3Q85A 2BM0A 2IUTA 2R6DA 3WMFA 1ZNZA 2O8DB 3K9NA 2QMEA 2J46A 1K6MA 1VCMA 4DKXA 2Q21A 2NO9A 3OIVA 4LJ9A 2F9MA 2B7CA 3K8YA 1DO0A 1ZRHA 1US8B 1RE0A 2R9VA 4MKFA 3RSLA 3R7WA 1FUKA 3ASYA 4G5RA 4QGFA 1G64A 4CIDA 2PMKA 3OIUA 2HXYA 2FV8A 5IRCD 2BKEA 5L3QA 3OAAD 3CR8A 1GNRA 3AH8A 2WKRA 3CLVA 2PT5A 3LA6A 1UBCA 4TLBA 4RD0A 4P4TA 4F38A 4BGDA 3KXKA 3MAAC 1CJTC 4TL9A 3AVQA 2ZR9A 1OHHA 5JWRA 3NBYC 4DIEA 2LKCA 1Z0AA 4Q9HA 3VMFA 1D2EA 2DFLA 4IJMA 3UMFA 5CB6A 4Z51A 1ANKA 3B1XA 3D7MA 4A15A 4RJLA 1UKVY 1UBFA 1NN0A 1FP6A 5FBLB 1F2TB 2ATXA 2DB3A 1T0HB 1M1YE 2VBCA 4XVQA 4DEXA 3U6BA 2ZIAA 2ZU0C 1W7AA 3TR0A 3THYA 4F93B 4N3NA 3K0AA 3ONWA 3RWOA 4RCYA 3BGWA 5IT5A 5DE3A 1NNEA 3L82B 1VIAA 1OYWA 2OESA 5TARA 3TK1A 3QOFA 1IXRC 4BLPA 3IO5A 1OB2A 4ZKDA 1JALA 1KO8A 4GBMA 2HF8A 3LW8A 4MITA 4XSHA 1G9XA 2VIIA 2RGGA 3QKUA 4TMXA 1KZ7B 4GZLA 2L0XA 1ZNYA 3Q5DA 2AR7A 1E79A 1ZM4A 1E4YA 1T5IA 5JWHA 1LS6A 3LV8A 4BE7B 1E2PA 3EPHA 1EFRA 2P67A 1ZUNB 2J0QA 1Z5ZA 1P4SA 1OKKA 2A78A 2WOOA 2YINC 5FBWB 2WHXA 1QHHA 3AVOA 4Q9LA 5SZIA 1D2NA 3X1XA 4ESVA 1TU4A 3QXSA 4LWZA 1F2TA 3O47A 2NOAA 2H5EA 2WWHA 4B33A 1JXOA 4DLTA 4KSBA 1IN8A 4M9ZA 3PV0A 1CIPA 1E2NA 4NYMR 5B30A 4NTZA 1KOFA 3HP1A 4OI4A 1TX4B 3NG1A 5FL3A 3VFDA 4BFUA 5FPKA 3F8TA 5DN6D 1GRNA 1QHGA 1E2EA 4HSEA 1JJ7A 2GEUA 1KZGB 2C99A 5E7JA 2W6JD 1A1VA 2YNMA 1IY1A 1G7SA 2WWGA 1WBBA 1W4CA 4M1WA 5JHGB 4CGZA 2BWJA 1HUQA 4NZYA 1MH1A 4BZXA 4RZXA 4QL3A 2IT1A 1Z0KA 5BN5A 3FYHA 1DAEA 2QBYB 2G83A 5AR1A 1GL7A 2XTZA 1RRGA 4TL8A 2XNDA 4DCTA 4JBYA 3KFVA 1QF9A 3MSXA 4IHQA 4U02A 1CJUC 1AKEA 3ZVMA 2IEYA 4PHTA 1FW6A 3CX7A 2XJ4A 4RKEA 4TQAA 4O25A 1P62B 2OBMA 3EG5A 4OQXA 5FBQB 4TYPA 4MGYR 1VKJA 2YOHA 4L16A 5C2JB 4IXMA 1Z0DA 2CNWA 3ADBA 2C9OA 2IC5A 2ZPTX 5DGXA 5A5GA 4UQOA 4YMTA 4QGGA 2H16A 2RHMA 5CJPA 521PA 1BH2A 3QG1A 1KY3A 1Z28A 1DVRA 1E9EA 3U5ZB 4CEJB 4QRHA 2IW3A 3OF5A 1PLJA 4OJKA 5FOXA 4BEJA 1AN0A 4IDOA 2A5DA 2IXEA 3U44B 3AVYA 1DELA 4GMDA 3TSOA 3LW7A 1KI3A 2WJYA 2W00A 1ZAKA 3A1VA 1CBUA 5J4YA 2CCGA 1P2SA 4HAVA 3AVTA 1G3IA 2ZRBA 4MRRA 1S3SA 2FMXA 4P4UA 4PZLA 5DIFA 4EQ6A 2WJHA 3KZ1E 4LHZA 5G41A 4F91B 1G291 3THOA 2E87A 2YC4C 2BBSA 3KDSE 3IBYA 3E1SA 1UFQA 2QSZA 5DYGA 1U0JA 4B3XA 4GOKA 3Q8XB 1G1MA 3LO5A 1BKDR 5JS8A 4POAA 1JQJC 2JLSA 4C30A 1PVOA 1G19A 2KI5A 5UKDA 3FWYA 1AZTA 1ESMA 4B73A 3GJ5A 3LWNA 3IQXA 4DLXA 5HKKD 4Q1CA 3ZGXA 4EJSC 2G1KA 2YWGA 4DT1B 4UXJA 3TMKA 5KNDA 4CEJA 3TKLA 3VR4A 2LWIA 3CWQA 3L43A 1II9A 5JEEA 3PIRA 3PUWA 1ZIPA 5JBQA 3A58B 1R10A 4AG6A 1QHSA 3A1TA 2ERXA 1TEVA 1U0LA 1NJFA 1D6JA 1I4LD 3TH5A 3CF2A 3HWSA 2UZIR 3HU1A 3R20A 5LB2A 4KODA 3REGA 5F9HA 4BASA 3CIOA 4NCHA 1G20E 4DDUA 1LFDB 1ZCBA 2Z4RA 1IQPA 1AQUA 1TQDA 3OFND 1CULC 2ANCA 3NHAA 1S1CA 1HA3A 4W5HA 4Q66C 4ASUD 2PT7A 4PSVA 4OHWA 4HLDA 4LJ7A 1II0A 1R6BX 2IL1A 3SS8A 4XWAA 1PJRA 3B85A 1U2RA 3QKSA 2G0NA 3PUVA 4LK2A 2WWYA 4DIDA 4DCSA 5F98A 2KE5A 1KJYA 2OT3B 2R6GA 2B92A 2GETA 1ZUHA 1OE0A 4RFSB 1E2QA 2ZJOA 3EZ7A 3U3MA 4TMVA 1N0UA 5LPNA 4IOKA 5EXPA 5CITA 4NU0A 1OYYA 1BYUA 3QVVA 3SBEA 3LX8A 4B71A 1G8HA 5TV2A 2ZJZA 4A0GA 1FZQA 5TY0A 2FFQA 4B3CA 1LF0A 4YMVA 1EFUA 4CZ2A 1FOEB 4MYUA 1SVMA 3TVTA 1GM5A 2GF0A 3HJNA 2QPOA 3PQCA 4IDNA 1TPZA 1W36B 3WNCA 3C8UA 3T15A 5JRZA 2FSHA 4WZ6A 4KLNA 3ECCA 4C2TA 1SXJE 2BBTA 4BZQA 1IN5A 4B44A 4A2WA 1GKIA 1YZQA 1ZIOA 1UEIA 3NKVA 3Q7PA 1O3YA 4HUQB 1C9KA 1UAAA 2ZRDA 4LC0A 5LD2C 1KI1A 4DJTA 1L8QA 2ZR7A 5EZ6B 3SC3A 1G8GA 3MRSA 1BO6A 4RD1A 2OSBA 2V6JA 2VLIA 4TQUS 4ZIRA 2ZRMA 2OEPA 3D31A 3K0FB 1MV5A 5G53C 2G9NA 2CMKA 4FIDA 1U0HC 2C77A 3DPUA 3PXGA 4DB4A 2Q9CA 4Z1MD 4QHYA 1KMHB 1E0JA 1IONA 3B8HA 1E96A 1VPLA 1JNYA 1R8SA 1BYIA 2EFGA 5IF9A 3GPLA 2FFAA 4B76A 3KB2A 5JCPA 1KI2A 1G5TA 1NF3A 5FI0B 2WWIA 4PZYA 3FMOB 1EGAA 1HE8B 2FNAA 3W3AA 2GVZC 2Q3MA 4HLUC 4Q4HB 4TT3A 4DDTA 2FX3A 2G1JA 4P0TA 3GLFB 4R2IA 3DMNA 1DTSA 2DY1A 3CF0A 2GXQA 2IS4A 2A5JA 1L4YA 3L8YA 2XOKD 3ADDA 4MGKR 3W6PA 3Q5EA 1NBME 2EYUA 4DDVA 2JLYA 3K0CA 2ZSAA 2VTKA 3A1WA 1FNMA 2E1RA 4J0QA 5SZJA 5EE1A 1XTJA 3V4FA 3U2QA 3BH6A 5K8TA 3ZQJA 2W6JA 1GTVA 1P7CA 1FMJA 2R6AA 1J8MF 3IQWA 5KTYA 4LOAA 2OXRA 2KBFA 4IEEA 4TSFA 2O8EA 3KKOA 5EP3A 4KFSA 5EUQB 5CIQA 5FUVA 2ZANA 2G3YA 5KNBA 3QPWA 3QIAA 3A1UA 4TLDA 3CM0A 4M1MA 2JJ2A 4WW0A 4PQYA 2GXUA 5CYOA 3VR1A 3PFIA 2R2AA 4M8NE 2JASA 5AJYA 3ZYCA 1OW3B 1WXQA 2P2LA 3RSOA 4B3GA 2EVWX 3NEJA 4ABYA 1R0YA 2CLSA 2W6ID 4B34A 4S2EA 2VP9A 2FSIA 1J99A 1YZLA 5EP1A 821PA 2GZHA 2AXNA 3QF4A 3X1YA 4MH0R 1HYQA 1BMFA 2Q9BA 4RVCA 2V1UA 1RYHA 2WAXA 2ZQ5A 3C7KA 3NC1C 3RABA 4NCNA 1E98A 2FGJA 3EAQA 1Y3AA 3N2IA 5CK5A 1CLUA 1KDRA 2KB0A 2G6BA 2WJIA 3L0PA 4PSAA 3B1WA 4E5UA 2H18A 1AM4D 1TQ6A 1W0JD 3NH6A 4HZUA 5TVKA 3WBKA 3VHLB 3CNLA 2JLWA 3AVWA 2VHJA 2OAP1 3PUZA 4LPKA 1XPUA 4XSGA 3U3KA 1LY1A 4FI3C 4XVRA 1XXHE 2IYXA 4CVNA 4OK6A 3GQBA 2N42A 4A8JA 1DARA 1OB5A 2BBOA 3C15C 3NDPA 4M1SA 1H8HD 3L8ZA 2HYDA 2R6CA 1FX0A 5HE9A 5L8VA 1W4BA 4D25A 2BM1A 4DT1A 4ASUA 4Q9JA 2FZ4A 2ORIA 3RLFA 5JEDA 3I5YA 2AK2A 1M7GA 5H1YA 5FTLA 1Q57A 2HUPA 1VG8A 1IJEA 1GNQA 1SGWA 3LQQA 2WAYA 5CYPA 1XJQA 3UANA 2WPDA 4DSUA 4EPYA 4GP7A 2P6NA 2OCPA 3EC2A 5FTNA 2GJAA 2OV2A 1R4AA 2BMJA 3CPHA 1E69A 2ZS7A 3A8TA 4B43A 2WJVA 1RZ3A 3CBQA 4LJ6A 5KSZA 3ZD7A 2ONKA 1W2HA 3BORA 4NH0A 1ZUIA 1T0JB 1N5IA 3FHOA 2FSGA 3FMFA 4PTLA 5BYJA 1I4TD 2XTMA 4D4KA 3IILA 4AKGA 3B2EA 4LHVA 4W5JA 3K9HA 3KB1A 3I8XA 2A7QA 1PUJA 3FKSD 3GLFA 1G3QA 4PO8A 1XJCA 2F3RA 3TSWA 3IEVA 1NKSA 1NN5A 3RRMA 1FX0B 3MWYW 2AKAB 2IK8A 4JSYA 1W0KA 3BIFA 2ZAOA 4MKHA 5B2ZA 3TRFA 4B32A 4MRSA 2XNSA 4G3XA 1FTSA 4AKIA 1YJ5A 5JCZA 2ZM5A 1DAMA 2ZSEA 4LV6A 3VR2A 1DAFA 4BRWA 3GFOA 4OL0A 4QKQA 5KYKA 1HT1E 4M9XA 1SVLA 5LBIA 1J90A 3RHFA 2CLCX 3GJ6A 5JZVA 3THYB 4DB2A 4GRAA 4WAUA 4EJSA 3AKYA 4EKDA 1ZD9A 1JPJA 2HT1A 1YZNA 4IVQA 3F3YA 4DXAA 2ZI9A 4JS0A 4IRUB 1S9HA 4OHZA 3ZZ0A 1KKLA 1XCPA 2NO0A 1OV4A 4HDCA 4A36A 3LBNA 4MQBA 4R7ZA 1FP7A 2C96A 4ON9A 4Y0AA 3LY5A 1P2UA 3EC1A 4TTQA 1UPTA 5D3MB 1Q22A 3KXLA 1T8TA 5TXGA 1OFUX 1FMLA 1GOTA 2LKDA 1FL9A 4C0LA 1XD2A 2HJVA 5GVSA 3BJIC 3AP2A 3CB4A 4C0SA 4YDHB 1I2DA 1E2MA 1RYFA 4Q5IA 2DCUA 4RD4A 3GLIB 4MUBA 1XRJA 4Q4JA 4MKIA 1NVVR 2TMKA 1P2VA 5AJWA 3KUCA 4ZO4A 1Z63A 1T6NA 4DZZA 1GL9B 1RRPA 4TMWA 1DG1G 1P6XA 3TAUA 3U7EB 2XGJA 2O8DA 1NVXQ 1NN1A 5GVRA 3ZD6A 1QZXA 4I99A 5EP4A 1E0AA 1G18A 2ZRGA 3VX4A 1P5ZB 4L9WA 2G0TA 1E1QA 2SHKA 4U5XA 5SZHB 2EFCB 4UJ3A 1EWQA 4M2LA 1TNDA 2Q9AA 4LHYA 3CRW1 1VCOA 3U7FB 4AYWA 3CUEF 2HV8A 4MGZR 4EDHA 3K0FA 4KVGA 3H2YA 3P1JA 1IY2A 2GJ8A 2NPFA 3RRYA 2GK6A 3EIEA 3FOZA 3AV0B 2C78A 2BMEA 2PBRA 1OXSC 3ZIAA 1I2MA 1E4VA 1FQKA 1NL3A 3BXZA 4B35A 2FPMA 1ZNWA 4JZKA 2NGRA 1BOFA 4DVGA 3RVBA 1GKUB 4C7OB 2VP2A 5AUPB 1KK2A 5B64A 1K5GA 2BJWA 2J45A 4JVLA 2A3RA 2ONJA 4WOPA 1RC8A 1XXHA 2JGNA 3D8BA 3UXMA 5BXQC 4UNPA 5FTJA 3QKSB 2ZYVX 2CL6X 2GRJA 5DI9A 2IA5A 4TSFD 2EU8A 2FWRA 2CXXA 5JJKA 4PC3A 1E2GA 4TL7A 1KY2A 2I4IA 4GFDA 1U94A 3ZVRA 2BEJA 5FFMA 5JJIA 1KNXA 2RAPA 2YV5A 2XJ9A 3IIKA 2CDNA 1D8TA 1E79D 1CF4A 4C0AC 2IYTA 4XTRA 5JWOA 3C4JA 4OKSA 5M04A 2ODBA 2IWRA 2JLUA 2GAAA 1CKEA 3EPJA 5JJLA 1G8YA 1MO3A 2BDTA 2RGAA 2JLQA 1IHUA 2OG2A 4Q1EA 1KO5A 2QUZA 3BH7A 4DC9A 2OLJA 3KJEA 1P75A 2XB4A 4JYBA 3O8RA 1AQYA 1XX6A 2PX3A 2Z6VA 4GNKA 1MOZA 3G5UA 5E7MA 4JLMA 4O0MA 1VG0B 2REXB 4AD8A 4M1KA 1CJMA 2AXPA 3TUJC 4PSKA 5HCIA 1G7TA 1RJ9A 1GL6A 5KNCA 2O0HA 3O8CA 4TZ6A 2PEZA 2CJWB 2ASEA 2O8FB 3KQHA 4ACBA 2ZI4A 2ZUDA 5AUOB 721PA 2ODEA 4DCVA 3DKVA 4JLDA 3BFVA 3AF3A 4YONB 2HXSA 2J87A 4XH9B 5HZHA 4DSOA 5DI3B 4LYAA 3K09C 4LHWA 2VHUA 4ARZB 2B21A 3AVPA 1M6NA 4NYJR 1MO4A 3OIWA 4DBLC 2CHQA 3ICEA 2JAQA 2WJGA 3LD9A 1T5LA 4FW9A 1SQ5A 1N3BA 3LAWA 4BFSA 1P73A 2WJJA 2ZE8A 4B74A 4A8JB 4CEIB 1E0KA 1E2IA 2F43B 2O8BA 4D26A 5F2EA 1DS6A 1XEWX 2QT0A 1P60A 4NKRA 1Z08A 3EWAA 5AJXA 3I73A 1QHIA 4FMDF 3SI7A 4EFNA 1AZSC 2PH1A 1NJGA 4P4SB 4A2QA 2CJWA 1TF7A 2OCAA 4W7SA 5E4FA 3OEED 3LQRA 4L8GA 1SZPA 2IYRA 3QENA 3SFVA 4KI0A 1VG1A 3K70B 4JLPA 3CRRA 1T3SA 3EASA 5FOWA 3N5CA 1Z0FA 1MABA 1CU1A 2GILA 1NVWQ 3L2OB 3SNHA 3IEUA 1TMKA 2FPLA 4OHXA 4QHSA 4YXWA 5E3HA 5C46F 4E09A 4MYCA 2P3SA 4I4LA 2QORA 3CH5A 2IWHA 1M74A 4JBXA 1KI6B 2VL7A 3ND9A 5DNYB 2DFTA 5JMTA 3QKRB 4C2UA 2ZSFA 3IGFA 2ZJAA 1KI7A 4IOLA 2BCJQ 2WV9A 2ZSDA 3EWSA 2ZVQX 4N1AA 1YRBA 2VHQA 3REFA 1OIWA 1JPNA 2OUKA 1WE2A 2DWPA 5EXXA 3HU2A 4XWOA 1OH5A 3VKGA 1I4DD 2H92A 2C5LA 3ZZTA 1WF3A 2GJKA 1KO1A 2RKOA 1P2TA 3RS5A 3VNVA 2GK7A 4M9QA 5FPSA 1SVKA 3EA0A 2HCBA 1DAIA 4A6XA 1JJVA 2BOVA 3X2SA 1EFCA 2BV3A 3RWMB 3GJ8A 1EG7A 3CRQA 1MABB 3VU9A 5FPHA 2DFNA 1KKMA 3T1QA 2PX0A 4RCZA 3TLXA 2C9YA 5KOYA 1W5SA 3RYTC 4CYMA 1GP2A 5FTMA 1KI6A 4NBSA 2V3CC 5GJWC 1R0WA 1NSTA 3LLUA 2WKPA 3IDQA 1OFTA 2ZU6A 1OH7A 2N46A 4BFXA 2RHDA 1SULA 4Q01A 3ZDQA 4PQFA 1E1RD 3B1YA 5D3MA 1Z47A 1N6RA 5IHPA 5KO2A 4V03A 1IN7A 4FCVA 3RANA 1ZM7A 4WVFA 1BMFD 2JJ1A 1DAKA 4NP6A 2VP6A 5EZ5A 2BMFA 1PLKA
chains in the Genus database with same CATH superfamily
2NNWB 1HKUA 2GPWA 1TA4A 3FLMA 1L3IA 2C4VA 5ALLA 3U3DA 5EJMA 3WC4A 1I9CA 5HW0A 2CCJA 5HK8A 2QDXA 1SG9A 4JLAA 4NMHA 2VF8A 4C29A 4MVJE 3TNDA 3I6IA 2GYVA 3DWGA 3K8ZA 1Z36A 4X63A 1N5MA 3ODGA 1A7JA 4UUQA 4F2WA 3N86A 3BZWA 2YIVX 1Q1EA 1EVQA 5A9TA 4D4LA 1JB9A 4I14A 1UWLA 3PQ7A 4MS4A 3TDNA 5EHXA 4KOAA 4QO7A 4RGQA 4BEWA 3HJRA 2FQXA 1CUXA 5IDVA 3OCCA 3HR7A 2WB2A 2G67A 4GI7A 4QXOA 3VQTA 4L0DA 1QE3A 5CDGA 1VIMA 2H2IA 1KK1A 4BMPB 3IUBA 1Q84A 2VYFA 3RRZA 1XZIA 2CCKA 2DWQA 5CH8A 3K1ZA 4O6VA 3T7DA 2QMHA 5K0CA 1LQUA 4BTEA 4Q9KA 2CVHA 3O26A 3OCUA 3UJ6A 4Y2SA 2HYIC 4O3MA 3COSA 1YZGA 2PS3A 2Z2IA 2RH9B 3TLBA 3N7UA 4B3SB 2EV9A 4M76B 3VJMA 4OEHA 4CM9D 1KKUA 2FYTA 3PGKA 1JDSA 1SXIA 2D0DA 4QTUB 4XGNA 5B58T 1BHQ1 2GZ2A 2J7PD 3AUYA 1BGXT 3JX9A 1GTG1 3TIFA 3WYGA 4D8WA 4UNRA 4FDTA 1QG2A 5D8DA 3KXPA 4OQNA 3ITKA 3CF6R 1UPBA 4TXNA 4DCJA 1AG9A 3LZ6A 5DU2A 1O4WA 2XQKA 3T7CA 1DIAA 1SIBE 2F1RA 2WTAA 3DYIA 5KCZA 1W2GA 4XWYA 4A03A 4OI2A 2PU7A 4HH4A 4TZKA 5HBRA 4WCVA 1A8QA 3U7GA 3NVAA 2C94A 2JIZD 1QV6A 3MCUA 4OXYA 4YAOA 4A9AA 2O23A 1K7XB 2ZJ1A 3SF8B 1P8JA 1P1KA 3V7FA 5K0GA 4D4HA 4I2NA 3MXOA 2J41A 5T5QA 1Q50A 4MO2A 4HAOA 3HRHA 4FHDA 4HDMB 1WLYA 4QYXA 4JHXA 1TZKA 2C1XA 2KW5A 5ALXA 5I7HA 4FMCB 4FHFA 2C84A 1GARA 3RFVA 2OCYC 1RP1A 4BO8A 1K9VF 3WNZA 2V97A 3JQQA 4X8LA 1P17A 1FDRA 4ZTUB 4DMLA 4RNDB 1WSWA 2ZVPX 3IQEA 4DMMA 2PIAA 3BXOA 5JR3A 3C8ZA 2RHGB 5AOAA 2Y27A 3ED5A 1T3ZA 1IOWA 4US2R 4KR7A 1UWKA 4B82A 4GYYA 4Z0TA 3TFOA 1I3OA 2WT9A 5TGDA 1TCVA 4ER3A 4FM9A 3GEMA 3X2EA 4FSDA 1MVLA 2MSCB 3DWFA 3O84A 2AOXA 4GUDA 1LDBA 3S2SA 5BP7A 3PFGA 1XZCA 1Z82A 2Q4OA 4MB6A 4CM9A 1ENPA 2PSHA 3HCFA 4BZWA 2GPBA 4F92B 3JYPA 3T1TA 1U2TA 1L5GB 1OOEA 1HFWA 3VH2A 4DMUB 4EJ6A 4EJ2A 1E3TA 1E1QD 4MLDA 2YN2A 3O1HB 3SVLA 4NECA 4KITB 5I8ZA 4KQMA 2GAOA 1E6UA 1JI0A 2I1QA 2HJ9A 3CNEA 3DAGA 4ZAVA 1UMCA 2I1WA 3K92A 3ORQA 2G71A 1IJFA 1T15A 3Q2KA 4X7RA 4BFVA 5AHKA 4WNAB 1SVWA 3LY8A 1LXCA 2J4DA 2Q5IA 2Y1KA 4LWQA 1N2BA 2PAFA 2P0AA 1ZN9A 4UE6A 2OM2A 5TPZA 1UQTA 1KTIA 3V80A 1T0BA 4R83A 4RK0A 2UXBB 2P4EA 1JDJA 1DKPA 1HDCA 3DHWC 1ZL2A 3SBXA 1LC0A 1P7VA 1Z7EA 4R81A 2IW1A 2JCSA 4H0CA 4JDUA 5C4MA 1S02A 1XU9A 5HOEA 5JXWA 4CQMB 4IHAA 5CH5A 1PK7A 3BCUA 3JVVA 1C7ZA 3B20A 1SKBA 3VKHA 1JGTA 2Q2QA 2WJ6A 5HMMA 2UKDA 1NWHA 1GV1A 3BMCB 3LLSA 2EHJA 1TGYA 2RFLA 3ZLBA 4BDSA 4UU7A 4HNRA 4IZ6A 4QUIA 3AG5A 5A9RA 9LDBA 5JI3E 1EVYA 1MGPA 4KLAA 2K7FA 5C5CA 1J0CA 3NVKI 5EQTA 1BQEA 3OZUA 4MVWA 1VHLA 2HDWA 4R6WA 1I5OA 1S8OA 1VE7A 1JLHA 5DW0A 2GQ0A 4QDOA 4URZR 5DX8A 2HMSA 4P8RA 3M5WA 1KH1A 4JB2A 5K0FA 2L2QA 1E7QA 2GUWA 2IRWA 1USIA 3D8RA 3FZQA 3BSWA 3CNNA 3SYTA 3HJUA 5ADVA 1T13A 2OFPA 1H23A 7REQA 1WOYA 2DCMA 1GGHA 1U99A 4C7JA 5J2TF 4ZT7A 3OU7A 2WMDA 1TC2A 2D2IA 4LNAA 1XZNA 1C7JA 4UATA 3I05A 2D2EA 3DE2X 4JOSA 5CX4A 2JLRA 5DTIA 5LP6F 1ESNA 1VE5A 1ZOSA 3EY4A 3WGKA 2B1QA 2GN6A 2WJZB 1FVXA 2GA8A 4AVYA 5DV9A 4JUIA 1QFMA 1UZUA 2VSOA 1JQEA 4AKHA 1U9CA 1FYWA 4CYMA 1B1CA 1ZJWA 3KKMA 1EFVB 4BNHA 3HVHA 1KH2A 4EG5A 4FLEA 4XYLA 1M7BA 2XQVA 1DBRA 4NBKA 4BBPA 1RHJA 5FD8A 4AB1A 4Y6QA 4PN3A 4ESEA 4W6QA 3ISJA 3R2JA 4L5AA 3JQPA 2QI9F 3GZNB 4FWBA 2IV2X 1IBLB 2VDJA 3QE4A 1T36A 3OJ0A 4JOBA 4KFUA 1UBMS 3ABOB 2IS2A 4MW1A 2NU7B 3ZC3A 2QX7A 1DCMA 3OX2A 3PA8A 4FINA 4ZPJA 4OF4A 3LBIA 4NC9A 3OTGA 5KUTA 1MRNA 4FJ0A 5EMJA 2IKQA 4RF2A 2NXCA 3WSTA 1UQUA 4OP3A 2Q45A 4JYMA 3URKA 4W1SA 4JBLA 3RM3A 1WS6A 3AEXA 1Y6JA 3W05A 4J0IA 2IQIA 5FPQA 4ALKA 5KHOC 3BXPA 1B93A 1OI3A 3WYBA 3AQIA 2Q3EA 5AESA 1MAVA 1REQA 4Y6OA 1NJ5A 3UO8B 3LQYA 1RPNA 2XUKA 3AM5A 3PYXA 3R7DA 4KZPA 4JOQA 2I3BA 1U1CA 4S1OA 4J0DA 5AOCA 1QX3A 2DECA 2LXNA 4D44A 4GVXA 4FE3A 4XYMA 2FUEA 1YU9A 1P3Y1 2Q62A 4DA6A 3RT1A 4U2BA 3JQRA 2FSFA 3UW1A 4HDQB 3TNLA 3I92A 2F59A 1U65A 2JANA 3A9WA 2R7AA 3B6KA 3T4EA 4DCMA 1Z3IX 2IPXA 1G3UA 1VLQA 3M6XA 1BDMA 5AUNB 4N0EA 2QMOA 2R6HA 1V41E 4EA7A 5DTMA 2B3TA 2FN9A 1UODA 3HVIA 2AFIB 4G07A 4KLRA 3VU3A 5FYDA 2VOEA 2ZBDA 1ZYUA 421PA 1YE8A 4FHZA 1JEEA 2AG5A 4UEOA 3WLMA 1PT5A 3HJGA 1V4VA 4HJXA 2KLBA 3DBOB 1XN4A 5FKJA 4NENA 3TW4A 4YJ3A 1L1FA 4BMDA 3O8OA 2HV9A 5T4BA 1DT5A 4OFZA 5ULLA 3BGDA 4EW3A 3CO5A 3QP9A 5FOVA 1AX9A 1JIQA 5K4GA 3ZVLA 2XGOA 2C9BA 2B0JA 3Q9UA 2H85A 4YO7A 1ACLA 3FFAA 4LMAA 4F3YA 1N1DA 4Q4HA 2LRHA 1RD4A 3UJHA 3W90A 5F3WB 3A9RA 4W1PA 4YIHA 1P81A 2C00A 3VUFA 3RSZA 3ZKAA 2FEKA 5K8UA 2EX1A 3RGGA 3EIHA 5AVVA 1O7JA 2GS9A 2ZYGA 1MT3A 1ONNA 1J2YA 2BTQB 2Q0XA 4F6LA 2DLCX 4J16C 3B60A 4HAZA 1S5PA 2FB9A 2P79A 3CMMA 4LYDA 5ANRB 3O4GA 4GQIA 1P80A 2VCEA 3O9ZA 4IEFB 4OI1A 2JJ8A 2ZBRA 2RJNA 2XXJA 3CO0S 3G8BA 1RVDA 1XD9A 3ZE0B 2VR1A 3ZWDA 2H06A 1X70A 1GRVA 1YQQA 3F6EX 4MR9A 4N0DA 2I2CA 3GUUA 1W4AA 2OL4A 2WVGA 2E5WA 5HSGA 1V96A 2QAGA 1UM8A 3GJSA 3E58A 4FFPA 2BI7A 3BDVA 7AT1A 1OXVA 1V5EA 3HR8A 3AM4A 2QRHA 1AV6A 3ABRB 3L8HA 2YYAA 3M49A 1BXZA 5AVYA 4I9NA 4QGBA 3QBDA 1ID1A 3E3OA 5ISMA 1FSGA 1V37A 2G8NA 4L4UA 3F3SA 3TSZA 5I6DA 2QJRA 3A36A 2D59A 4XR4A 4YRJA 3EWNA 2PYDA 3L7CA 1WDMA 2DAPA 4TTAA 3FJYA 1A50B 3F1LA 2G77B 3SG0A 2HA7A 3ZDBA 3NP7A 1XLWA 1RHUA 3WK5A 1CR4A 2ZJBA 1MIOA 3F67A 3I39X 4QYSA 4QNMA 3WKDA 1RYNA 4FE4A 3KELA 3WIBA 1Z07A 4UFOA 3WLAA 4FOPA 1T1JA 4JL5A 1S01A 5A3QA 3W4IA 3MB8A 4YNBA 3R0IA 1WM1A 2V55B 3HB4X 1Z0IA 4P7BA 4RQUA 4E3WA 5IFKA 1DWOA 1RQ7A 1T8WA 1YRAA 4IIXA 4YLEA 1GQSA 2QPTA 1MT0A 3G02A 4M60A 4YRNA 2DUMA 2XZTA 3ETJA 4HLCA 1S2MA 3DT8A 2A0XA 3IO3A 3NRBA 1EFHA 3UG6A 5IASA 2M6SA 3SVTA 5I5EA 1Z4KA 4K28A 4G01B 4OQMA 3TN7A 1YQXA 4LW8A 3O8LA 5F78A 4BWFB 4BX2A 1XU7A 2HF9A 2C20A 1JIJA 2HD4A 3WTBA 5IYZA 2D62A 1C30B 2EJVA 1XEWY 5A5VA 4KQKA 4K6HA 5EJ9A 2OAQ1 1II8B 2RG1A 2RK4A 3AF5A 2AC7A 2I3ZA 2XF8A 4R51A 4UNIA 4ZVOA 3P94A 2D4HA 1SCUB 3A06A 1N6OA 2I2FA 2IPLA 2Y1FA 3ISVA 4QG3A 5CB8A 2F8MA 4L57A 3FDJA 1BKSB 1P1JA 2PCJA 4RL6A 4CDMA 1G42A 3GRYA 3IP3A 1D4OA 3O3NB 4FX2A 3OJCA 4ZI5A 2X8AA 1EX6A 1P9WA 3GEHA 3PFCA 4I5EA 1GWNA 3TTTA 1QUFA 5EZQA 4FNAA 2HNBA 3OZIA 3RUIA 1CG6A 4URHA 1N5LA 4ZU6X 1E32A 4C7VA 4R8SA 4Y9RA 3ZZUA 2OE2A 1UBSB 2EC5A 1ZJ4A 4O2LA 2BHTA 3LNCA 5DHQA 3WMXA 1SKQA 1TIKA 1RWNA 2ZRCA 1EQ2A 1Z15A 2JF0A 4QYIA 2RGXA 5FV7A 2M6KA 3FNBA 1IUKA 2AVDA 1OXTA 2ZRNA 4RWZA 2J85A 4A2CA 5JADA 3KQNA 2OVBA 2HW8A 4EUSA 2QRNA 3OH8A 2MR6A 4DLUA 2CW5A 4XOUA 3ZTTA 3NWJA 2X7HA 3IUPA 3GMDA 4ZYYA 1C9JA 1G4AE 3M4NA 1J7JA 3MFYA 5HIJA 1S4QA 4BQNA 1EMDA 3H1PA 3ZK7A 4EFLA 1DJQA 2JGFA 1Z6TA 2OBYA 4AUMA 4E22A 3C5CA 1DIRA 4QHTA 5DW3A 2IYEA 2XVAA 1B8UA 4Q4AA 4U7FA 4XD2A 4AU1A 2M2IA 1WMSA 4FFMA 4NONA 1Z34A 1Z4NA 2F43A 3R6WA 3MGCA 2VJYA 2HU5A 3PTLA 4ND5A 2Q1TA 4V3BA 4E11A 5L95A 2O2DA 2R1UA 2ZYSA 3B9PA 3OP4A 4G85A 4HAYA 3ZS8A 2BIFA 4QICA 5ETJA 5B3JC 4EHBA 1YVPA 3IJ5A 6ADHA 1QLHA 1F5NA 5EJEA 4KH1A 1XRRA 1R0LA 1R7RA 2NYVA 3IEXA 1TZCA 4LNHA 4OBBA 4GL2A 5ED4A 4KXUA 4H27A 1PZNA 3CEAA 4NFYA 1WZIA 3OFJA 1CR2A 2X9VA 4LGYA 2OZKA 4TKMA 2B6HA 1GAJA 1FFHA 3R3YA 4LBYA 2JHFA 4CIVA 4M9UA 2FWNA 5H83A 4RZ2A 1NULA 1WVIA 3G68A 3CCBA 3DXXA 4MS4B 1U0GA 4TPKA 1WBJB 1EUDA 1CP2A 4LRTB 4EY8A 1VL2A 2BGGA 1TUBA 4KXFB 4EELA 5IJZA 1JDZA 4ZI7A 3ROQA 5AXDA 1LBHA 1OSNA 4L1KA 4PHCA 3CXUA 2HQRA 3H4VA 4BB5A 2NIPA 2ZRHA 4A23A 1L4UA 1XJ0A 3BXGA 3QHQA 3STWA 3V4OA 4JC4A 4R71A 621PA 3SU8A 1G17A 2FWMX 1ZK1A 2J3QA 2K5UA 4Z0PA 3ZLUA 1R6VA 4DZRA 3FDZB 5KWEA 1W48A 3GJXC 1B0PA 4G5OA 3CISA 1V9CA 3SICE 5BVGB 5FNZA 1TTTA 3QBVA 1XRMA 2JFUA 1HDGO 1SPXA 3RVSA 4CMBA 5A5FA 2Q29A 3DS8A 3FY4A 2CD9A 2KBEA 4X61A 5COAA 3HXQA 2IGBA 2PVCA 2IYQA 1I7SB 4DMGA 1D0IA 5FLKA 4S35A 4LUCA 1SIOA 4QXAA 2AFIE 5DMXA 3RTDA 4EPXA 1A9SA 3E53A 3V6LA 1PE0A 5BQFA 2JD2A 3ZHVA 1BE8A 2DG2A 3WIDA 3K6SB 2IQ5A 1F0NA 4YRPA 4DQDA 5C32A 1DC3A 2IE8A 2IHZA 4YJGA 1IZ9A 4DQUA 1BXRA 1Y82A 2JA1A 4OQFA 1HV8A 4Y3UA 4A73A 4JK3A 4ECEA 2Y1XA 2ECKA 1FQWA 1EDOA 1ML4A 4PXAA 1LNSA 5B3KA 2FGKA 2K2QB 3ZQ6A 2CL0X 2FPGA 2ZE7A 3KB8A 4N4AA 1U8ZA 4TQ9A 1B15A 4HDRA 3QMPA 1SRRA 2Q1UA 2Q5HA 4MS1A 1KJZA 1L4NA 1UKAA 3A58B 3KAQA 1QANA 4B6QA 3EQ9A 1KJWA 1YULA 3KIPA 3VR6A 4F2HA 4DPLA 4KAXA 1MQAA 4NFHA 1IJKA 1YI1A 1S0UA 1HI9A 3EVCA 3LHIA 1P44A 1Z4QA 2KX7A 3CPJB 3P5SA 3L8FA 3VPCA 4AJJA 2VNIA 2UYHA 4ZPXA 1XFAA 2RHTA 2HO5A 2WIFA 3UAXA 1Z5NA 3EVNA 5DOZA 5CVEA 2OFOA 3STHA 5JPIA 3K1JA 4R1NA 2R8RA 3MUNA 4HUTA 2WSIA 4UD6A 5CM8B 4DWVA 2Y6UA 4WQMA 3BD8A 2CLDX 2GXSA 4OHYA 4IYJA 1GLNA 1TM2A 4WJZA 5L51A 1U81A 1J0DA 2X8WA 3QEOA 4J7UA 1WOMA 3BFJA 5LDDC 1JAIA 2O3TA 4TZ0A 1HOXA 1T0PA 2E0IA 2QBYA 5HX7A 3UA4A 3L7OA 1OHHD 3KPWA 4BHTA 3A6GA 3CVVA 1EVLA 1HH4A 3RV4A 4H6WA 4RVNA 1VQ1A 1QQBA 1C3OB 5IK2D 1ONBA 1R6XA 4NBRA 4AN0A 4KHPB 2E55A 3TJZA 4KIGA 4IR7A 4NI5A 1Y8QA 4KN8A 3AEUA 4FUQA 4IH1A 4MW0A 4RLHA 2D7CA 4JJAA 4RJKA 1N75A 2NT3A 3A25A 4KFTA 4HX9A 1JBQA 1X7YA 2YMLA 4MV0A 3TXAA 2DUJA 1WA5A 1O58A 1RU3A 3P9IA 5FRDA 3FFXA 2HSDA 2XZPA 3OJOA 4OHOA 2MCFA 3SF0A 4DJEC 2B7BA 4O8ZA 2NZ2A 4QWWA 5KYWA 2KS6A 2WMNB 2HN9A 1RRFA 1Y4ZA 2XDAA 1CWUA 2HRRA 2VQSA 3DE4X 2Q3HA 4IL5A 4M0LA 2WDZA 4OGGA 2Q7OE 4D81A 4HG2A 4D8YA 4Q39A 4EI9A 1DC7A 2UV8A 3WSVA 2I4NA 1DJMA 3ZCSA 3M2PA 4BRUA 5WRFA 3O4RA 3TLZA 2RK6A 5I4BA 5LWQA 1CEYA 4EAQA 3IQDB 1DDIA 5G1NA 2ZBVA 3NGXA 3AUTA 3T99A 3D4NA 2N1BA 3H2GA 1A5ZA 3GFBA 1TW2A 2CXNA 2X6QA 2W83A 5DLQC 3GVPA 3L6OO 1YQGA 3IPXA 4AI6A 2KWIA 4Q6BA 3BHMA 1PBNA 3PNQA 1EFTA 2CMGA 5E7IA 4WUTA 2CYCA 3JD4A 5EIFA 3B36A 3P9RA 4N47A 1O0BA 3TD9A 1Y8ZA 2HY7A 1M9NA 5LB4A 3TTXA 1AURA 1BHJA 1T2NA 1Z6AA 2O1XA 2QXTA 1XHEA 4Z4GA 1PGQA 1PD1A 2PZMA 4HLUA 1E4EA 3ZJVA 3ZJ4A 5EHGA 4IG4A 1NV9A 4BVKA 5KNDH 2RH5A 1UJ2A 1NNSA 1KJNA 3HGTA 1R0KA 4EQ6B 4YT2A 4I36A 1WU7A 3R3VA 4TRJA 5FA6A 4UTRA 7REQB 2TS1A 4BNTA 3UMVA 3QTBA 4A82A 2WSMA 3GG2A 1IOZA 3QUSA 1IQ0A 1SBTA 2I7CA 3MN1A 4K46A 2GHQA 1JT2A 3VSBA 1QHNA 1ULUA 5BQOA 4F3NA 5KWSA 3IVCA 1HFJA 1R88A 2IX3A 3UYKA 4CEHB 2Y6VA 3HKEA 3UHAA 4D4JA 2EP5A 4R1TA 2ZSJA 1SBZA 5AKJA 1PJTA 1Q0RA 2ESRA 1SC1A 1U4SA 2EWMA 1M2OB 2JFWA 3MBIA 3KSRA 4PO9A 5ERYA 5KJ1A 2ID7A 2VTEA 2Z95A 2NAFA 2Z57A 1LVGA 3G8AA 4FGJA 4F9FA 1RQLA 3HVRA 1FS6A 4GWGA 5TMEA 3B5JA 2QQFA 5DJ5A 4CIWA 4EJSB 1RLUA 3NTRA 3MINA 4L0CA 2EFJA 4NE7A 3DDWA 1FXWA 1IOVA 4JOCA 4NYJQ 5HPYB 2AJTA 3CC8A 3DOIA 1T4CA 3H5AA 1NW7A 1ZG3A 3PEUA 4FD2A 4JVMA 4QBKA 1YQ9A 2QQ0A 4GLJA 4XDZA 4CHGA 4DAOA 5MGBA 2QMQA 1SXGA 1M1YA 1VZ3A 2JGJA 2PRIA 3ASUA 4OUKX 2ZRKA 4YCDA 2QE7D 3ZUPA 1J2EA 4L9AA 2BRUA 3P27A 4G25A 2G72A 4UHDA 4XJXA 1APBA 2EW2A 3VYTB 3FSEA 2ZWOA 1O6FA 1N7HA 2H7YA 2O52A 3AHGA 1AHPA 4X7BA 3CINA 3LY7A 3T3NA 3BF8A 3AL0C 4PNEA 5EI5A 1B76A 5AOVA 3IA7A 1GXSA 2HA0A 4KAAA 1NSFA 2GF2A 3AX6A 1XA4A 3EA5A 3GGCA 3NV9A 1KU6A 2EWVA 4IW3B 1L2TA 1LRKA 4GNRA 4BVEA 2RI0A 5EMKA 2JK1A 3T1VA 1C29B 4FXPA 4XUDA 2XUHA 4HZGA 3FR8A 4JIMA 2AMJA 1SUPA 3IUEA 4NH4A 3U4CA 2AF4C 5LXTF 2W6QA 4PPYA 1XTRA 3OUZA 4MKGA 3ILXA 1KQNA 3QY0A 1MKYA 4ZREA 4QJ3A 1E7WA 1EE1A 4DR7B 1IBRA 1PSWA 1TUBB 4W9NA 3BCSA 4ZT5A 1Q77A 3HYSA 4V0RA 3HQ4O 3WB1A 2Q5CA 4QDJA 3KPVA 3G2MA 2AVNA 1NN3A 3AW9A 1XA0A 1RJFA 5FUBA 3C7CB 4HXEB 4OO3A 4BQFA 4E03A 2PCLA 2CJYA 1WMDA 4Q48A 3QVSA 1U8CB 1N2CA 4XLLA 5CLLA 1GTL1 3GT0A 3W6OA 4CL0A 3HCWA 2EKQA 3I42A 2VXCA 2IUYA 2J4CA 1X77A 1G8SA 1M2FA 1P45A 2JIZA 4B4WA 3NWOA 4G9EA 1WZEA 5JH7A 4Q1AA 1ISGA 4WN3A 3TZBA 4PHHA 1K68A 3KPYA 2E4WA 3PX3A 1XEAA 4DTIA 1U6KA 4KXMA 1XCBA 1QIKA 5CLQA 1OY1A 2CUKA 2GHTA 3KETA 4KMOA 3IKJA 1E6CA 1YS7A 2YXNA 2F7SA 1W49A 4C0KA 1DKLA 1E9BA 4JZYA 2MSLA 4N5IX 4AQ7A 3VDQA 2PTHA 2X3YA 2ZUVA 4LJ5A 2JFFA 4W5WA 1NAIA 3L1IA 2VJMA 5K0EA 4XYBA 4NE9A 3SWWA 1H2HA 2HLDD 4ZQBA 4W8OA 4LZNA 2J32A 2YMPA 3FN4A 3I12A 4YP7A 2ORVA 3EXHC 4F5EA 1LK0A 4NMLA 1MJGA 4JXKA 3AVVA 3GRKA 2O6LA 1AK1A 5EVCA 1RYEA 3WL6A 3WX0A 2CK3A 1Z4MA 2H2FA 3BYZA 3DEYX 2AN4A 3MGGA 4G37A 4G5SA 4M9RA 4PC7A 4YT4A 1JG1A 1V1RA 5IZ4A 2GDZA 1GSIA 3Q8MA 1EUYA 4MCJA 4UMEA 4PHFA 2QMUA 2X1VA 2QAGB 3COWA 3ROEA 3QEBZ 4YRFA 4BFCA 1NASA 5IC6A 3E3NA 5EUMA 3VAYA 2ZREA 1T1SA 4TYNA 1DKMA 4N65A 1GZ4A 1ZO8A 3UWPA 2GI4A 2XNHA 3IELA 4HUJA 2HSEA 1RW4A 3O73A 2II6A 5HCNA 5B1YA 4IFBA 3GDOA 2G28A 3PI6A 2FPRA 4Q21A 4QUHA 1L7XA 2QT1A 2ZRQA 3SZGA 5HGJA 4ZMRA 5GONA 5C1DA 5EZYB 3CG0A 3D64A 1EBBA 3BL8A 2Z08A 4O4LF 1KFEB 2VZEA 1CQPA 4AYTA 5F51A 3P9SA 2BGMA 1BGVA 3DZBA 4ZT6A 8LDHA 3J81A 3OU2A 4FYPA 1SBYA 2C7RA 1TM4E 3L7AA 4IVRA 1JHRA 1GPJA 2K87A 3USES 4BNKA 3IH5A 1IEVA 1M2HA 4K9LA 4WOJA 4KQJA 2ID8A 2ZUEA 4JODA 4N5HX 1ULTA 2RGDA 4LXXA 1NG9A 4HQ6A 1Z2OX 4P2GA 1WTCA 4RPKA 4DDKA 3O8QB 1QC5B 3RVQA 3T0IA 1JHQA 3JAKA 4Q3AA 3S29A 1YJAA 3CPEA 2AFVA 5DNEA 3EGDB 5FBHA 3WJ7A 4EGQA 3AB8A 4ARSA 1Y7HA 2QAGC 3HCCA 1AVTA 4JUBA 4JI3B 3ZZ1A 1Z39A 3O8OB 3AFGA 3QI2A 1PJAA 3E15A 4NG5A 2CNDA 2P4QA 2ZRPA 2ZUWA 3KTDA 5E8RA 3QXGA 2I62A 3S40A 4DN6A 2BZ1A 3X1JA 1BEUB 5BWBA 4TQGA 1Q44A 2RMKA 2MYNA 1W44A 3GLTA 1SVNA 3Q1LA 1Z8DA 3ANTA 2ZWPA 4HK4A 2VYNA 1Z6PA 1GU1A 4HV4A 5FQOA 5LOVF 1M0EA 1GU7A 3SEAA 4OI0A 2PNJA 1K4KA 3KAJA 2AOUB 3RS4A 2AWOA 2NQTA 5AICA 2JD0A 1N3LA 2D3WA 2QP3A 3MWGA 2L18A 3UUWA 4BOYA 2A1TS 4D02A 2XAUA 3ABIA 3TJRA 3KQKA 3NUQA 1PBTA 4K8OA 3SLGA 1YS1X 2A84A 2GZ1A 2HMWA 4R1SA 2BTQA 1LLQA 5G3YA 3SHVA 1D2HA 5LQMA 4C4PA 1SVSA 5K3SA 1E2DA 5JCOA 2B4QA 3VHQA 4URYR 4C89A 1O5IA 3FPCA 4G1MB 3UATA 1J8YF 4IFIA 1R3DA 3CUSA 4GBJA 5F76A 3UMGA 4DDHA 3OJEA 2YOFA 4Q03A 4OREX 1SUIA 3FZGA 3FB1A 1IHDA 1JLRA 4WV3A 1Q0PA 3SMVA 2V7BA 2Y68A 3UG7A 3ROFA 3KR0A 3V00A 4YRAA 4JP8A 3QJYA 3MJSA 4OVKA 3RDPA 1YA8A 2MINB 1EGQA 1RCUA 1NVFA 4IJ5A 4BNWA 4CT4B 3C39A 2QG6A 2A9VA 2PSSA 2A33A 1UFVA 1KSGA 4LI0A 5AM5A 2OGSA 2OORA 2ZKLA 5J59A 2B5OA 5BR1A 4CEHA 5TQ2A 4C87A 3DMDA 4EIWA 1QGOA 5B5SA 3UQZA 5ER6A 3JZAA 2VPPA 1RS0A 1YBVA 5DSZA 2XSZD 3L1KA 4S0XA 4C0BA 1WXIA 4I08A 1FRNA 4WEOA 5EMHA 1K4MA 2ZZKA 3HFGA 3GVIA 5K51A 2D2XA 1NDQA 1CT9A 3QIVA 3WFZA 4NFLA 3KJHA 5L6MB 2PJRA 2OGTA 3UJBA 1XXLA 4EO7A 2VT6A 3BXHA 4OJQA 5ILGA 4WK0B 3M1IA 3ZXUB 3KQVA 5AK6A 2BVNA 3HRKA 3EMKA 3QPCA 2X2EA 3PR3A 4HH3C 2VKQA 4OXQA 5JNSA 2DJ5A 4YQZA 3A4LA 3R9XB 1MC1A 1SC3A 5BNFA 4BXOA 3OE7D 3W3ZB 5IABA 1THMA 1NOIA 4H4EA 3LZCA 4NDZA 1GCAA 4DR2B 3H05A 3N8HA 4EKYA 1B4DA 4LAFA 1EPUA 3EE6A 4MLPA 1BQ3A 1E3JA 5I01A 1EXVA 3H11B 1N3YA 3K09A 4CKBA 3CB2A 4Z86A 1NLYA 2QD5A 4ACAA 3QBTA 3MBOA 2IOYA 4J94A 4LC1A 4LBZA 4BLRA 4ALJA 121PA 4DSZA 1M8PA 3DTVA 4GVPA 4KE6A 1ISFA 3CT6A 1ZOIA 2AZDA 2Y1CA 1T5HX 1T9CA 3L4KA 4L5BA 2VHWA 3AF2A 3SYMA 2AD1A 5AXAA 4Y2HA 2PZFA 4DDWA 1K75A 1UFKA 4Y2VA 3V4PB 3DHYA 2QE6A 3HFJA 1QJ4A 5AKKA 1W2WB 3C3DA 4CFZA 2WA1A 3CWZA 4FMPA 1Y1TA 4KNVA 2CT8A 2PZGA 1QGUB 5IPFA 2ERYA 1VB3A 3NHLA 1JEYA 1FLAA 2QSJA 2VDNB 1ODIA 2PX6A 2ZR8A 2QV7A 4GR4A 2QIOA 4X54A 4BBAA 4B3JA 1GPBA 1DG3A 1QQ7A 3L7LA 1DUVG 2X19A 3IVXA 3KVOA 3N75A 3ENZA 3P2IA 1ZM2A 3E9ZA 3O75A 1MPXA 2OQIA 3P2JA 3RIEA 2WWVD 4UFNA 1CPYA 1IN4A 3PIDA 2QY6A 2BC9A 3QX8A 4PAOA 3UGQA 3LYLA 1MNAA 1T9HA 1CC1S 2XE6A 1Z88A 1BCSA 1GPWB 9LDTA 2VSYA 1Z6GA 5A4AA 2R8PA 2XB2A 1EHYA 1NMQA 2OV3A 4QNRA 5HUQA 2D0OB 1EVZA 4MLCA 4OBEA 4DNQA 1SUFA 1CR1A 1J5PA 2DFKB 1N9GB 4ZOAA 2IXAA 3NP9A 3QVKA 2C59A 4N3GA 1P39A 4GSYA 3O8BA 4KQXA 4X5OA 2PRSA 3TOZA 3W2FA 4Y2TA 3G6WA 5HKLA 2HIHA 3LUPA 2NYRA 2QB5A 2WJAA 2F6RA 5DTRA 4LF6B 5F52A 2OBNA 4HBZA 4PG7A 4PS0A 3VHXA 4AYXA 3B2QA 3OCJA 1M1ZA 1WCXA 3UMJA 3W2EA 4ZAXA 3G1WA 5KIAA 4RAOA 3RYFA 1H2EA 3WYDA 2RGBA 3N6RA 2GM5A 4RZSA 4F5ZA 2J3EA 4KEAA 4MHOA 5T3UA 4B3DA 3O21A 1JFFB 2BZSA 4M0UA 1X7ZA 2JFPA 3GJZA 2WM3A 2DJIA 2FEAA 2C7OA 4IJKA 1X87A 3DYVA 3PYMA 4GMXA 1E5TA 3KX2A 3VR3A 4CWAA 1EGMB 4MI1A 3ZN2A 4FBGA 3RC2A 3CKMA 3V2UA 1OLSB 3NBKA 2H0RA 4UMDA 4M8KA 2C2KA 4D0LB 2GTHA 3V1LA 1G4UR 1SUBA 3TVYA 3PU6A 4KDCA 1BHO1 1W36D 2GBFA 4U5QA 1UKCA 4YT8A 2DPHA 3ASVA 1BE0A 4F72A 3ZJYA 3ABQB 1XYYA 4S04A 1MO6A 4G0PA 4ZDKA 4MVJA 1PI3A 1OF1A 1G66A 5ALGA 1EK5A 2Q5JA 2GNPA 1MJ5A 2IBTA 1ZX1A 2GEDA 2YNMC 4PX9A 4RZ3A 1E2LA 3GLIE 1BC5A 3SBDA 3PRYA 1XL0A 4RU1A 1P61B 3UENA 2Z1MA 4BJ1A 4HUQA 4E1BA 4OYHA 3FPAA 3U4HA 4DUPA 1QUEA 1YR8A 1Z22A 3FDZA 1PU2A 4GLOA 2IE0A 4AJ2A 2DPMA 4RD2A 3SHWA 1YMUA 2PUEA 1HWYA 1ZNXA 4TVBA 1U04A 4RTNA 4QGSA 3QU9A 4JD5A 1CUDA 5ITSA 5L7WA 1GZ5A 4DUYB 1PZFA 2Z9CA 3QQPA 4XX0A 3P0RA 1PN3A 2V9CA 2Y4NA 2HI0A 4KR3A 2FRDC 2YJTD 4LCBA 1C8LA 3I1IA 3W04A 4X6YA 4IOMA 2Y67A 2X0EA 3N2LA 2AK3A 4K6FA 3TE6A 2FFRA 4LPSA 5KKAA 4C6SA 5DN6A 2QRJA 5K8LA 2C04A 2P7IA 1WCV1 1YC5A 1YT5A 3FFWA 3WWCA 1HDYA 5FXMA 1XL1A 4BVHA 5G0WA 1SMKA 3W5IA 3A2NA 3ZXIA 6NULA 3GLFE 1ADJA 5ABPA 4PPNA 1R6UA 3OIYA 3UBMA 2AOUA 2R62A 5D5HA 4ZT4A 2PMEA 5BURA 3I5XA 2JIPA 2LUOA 4GSLA 4FZ5A 1TT7A 4CNBA 3NH9A 3Q7TA 1E2JA 3S7TA 2C54A 1V8FA 2F48A 3TQOA 1ZKDA 4KXVA 1M2EA 5CT8A 3BFKA 4I1OA 1NR1A 4WFJA 1FVHA 2JLZA 4FOSA 2E18A 1SBHA 1DC4A 3LWZA 2X0JA 2ZJ5A 3ZWWA 4GD3Q 1DAGA 1YS9A 3TMAA 1CE8B 2H65A 3C7TA 2QEQA 4ITVA 4ARAA 4EF5A 3CVYA 4AS2A 1QYWA 2MMGA 2ZDHA 2ZUFA 4DRYA 2X5XA 1DE0A 4WK2B 1WXHA 5LUAA 4K3UA 3GLHE 3ZWXA 4RXTA 1W0KD 1ZMXA 3CH7A 3E2PA 3QKTA 1SVIA 1C7IA 3IXQA 3EFBA 3KR1A 4KR9A 4ZCSA 2WUEA 3DFFA 3AI7A 1QGED 1IM8A 1HURA 2MINA 3HU3A 4ND6A 4B46A 1HNZB 1G2IA 2PJUA 5E4YA 1WD5A 4TTVA 2CJFA 3L0SA 1ZH4A 2XYGA 3AR8A 3PCTA 5IXYA 3D4BA 4FYMA 2HRDA 3S3TA 1C3OA 3PNSA 1OVGA 3DJYA 5DGDA 1YFKA 4JENA 2CLLB 1J1ZA 3SZLA 2AUNA 1OTYA 2CVFA 3WYFA 5T6BA 1C7FA 5KNLA 1XK7A 3BE4A 3QFSA 5EKSA 3WMWA 4Z7OB 3U09A 3LKZA 5CB4B 4R98A 3G5LA 3IKTA 3FGNA 1VDMA 1FYDA 4YAWA 5FDFA 2C9ZA 2UUPA 3KJQA 5H5JA 4AY5A 4GEKA 3MSCA 1RAHA 1PR6A 4NMMA 1GKYA 2C31A 3K53A 3B6JA 5ALFA 3U7RA 3PCXA 4Q4LA 3ITNA 1HEYA 3G5TA 1FLVA 3LHSA 1QKKA 1X80B 3DOHA 4YQFA 3HZHA 4L72A 2F2TA 5DHRA 2WYVA 5DYTA 1QG4A 1KFCB 2QU7A 1S2OA 1DP4A 3KXIA 4CE6A 1KVTA 4ZOEA 1HGXA 2Z58A 1Z17A 5BRAA 1IZ0A 2YWCA 4E2ZA 1RXYA 1I14A 4U3JA 3OE7A 3VPDA 3T5PA 3UAWA 1D5CA 4KWTA 2CNBA 1TYZA 1WLSA 3GZNA 4EX7A 2AHOA 5P8WA 3CSSA 1OWPA 5GQSA 4WADA 5BSKA 2WF7A 4DA8A 1IMOA 5TMBA 2Z3VA 4M1TA 4OXIA 1GRRA 1YJBA 2QN6A 2YWRA 3E18A 4QXRA 3TO5A 4AURA 3T8YA 4ZVTA 3HPQA 4AAYA 1LJ8A 3I9JA 5HA5A 3TUIC 4EPRA 5LU9A 4MDEA 2Z30A 2BHLA 2ZBEA 3C8MA 1U3FA 3Q7IA 4EGSA 2Z9DA 1IRXA 5K7SA 5TS3A 1Q7RA 4BNDB 5I5GA 4K9NA 3W7AA