4YC7A

Crystal structure of human fmnl2 gbd-fh3 domains bound to cdc42-gppnhp
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
179
structure length
179
Chain Sequence
AMQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQRGLKNVFDEAILAALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Formin-like protein 2
publication title The structure of FMNL2-Cdc42 yields insights into the mechanism of lamellipodia and filopodia formation.
pubmed doi rcsb
source organism Homo sapiens
total genus 60
structure length 179
sequence length 179
ec nomenclature
pdb deposition date 2015-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4yc7A00
2GILA 1H8HA 4DT1B 4IRUB 2FU5C 1TPZA 3NDBB 4A2PA 3TQCA 1M6NA 3AQ4A 2E87A 4JBXA 4PPFA 1GSIA 3K0FB 4MKGA 3C5CA 1NSTA 5EZ5A 3BRWD 1YZNA 3NIBA 1X8JA 4YMUA 2DY1A 1N6NA 2A5YB 2R44A 1OHHD 2AKYA 4TYQA 1KSFX 3ZZUA 1AGPA 2XXAA 3SI7A 1R5NA 3SC3A 1MO4A 4OI4A 1SULA 4W9MC 3R9IA 2CCKA 3EWSA 4DLXA 5JBQA 3RDPA 4J0QA 4Q4AB 5KDOA 1I4DD 2HDNB 1N6OA 4L15A 2JJ1D 4C9BA 2ZRAA 3BC1A 4Q4HA 2OBMA 1KJZA 3O8RA 2YWHA 3HJNA 4BLPA 2CLSA 2ZJ2A 3CH4B 1VKJA 1E99A 5FUWA 3ZQJA 5L3QB 4C0AC 2Q9AA 1OLOA 4O0MA 4JBYA 3OHMA 8OHMA 2ZJOA 2QP3A 1F3OA 2AK2A 1CTQA 2NZ8A 4C0KA 3VMFA 5FBLB 4ZKDA 2XEXA 2C9CA 3RANA 3I73A 3LXXA 3Q9LA 2REOA 4ZPXA 5IRCD 4IOLA 2XNDD 1M7GA 5FL7D 4KBFA 4NPHA 4AIIA 2PZGA 4B2PA 4CYMA 1E9SA 1XXHB 1GL9B 4X8MA 1E3MA 3V4RA 1RYHA 4AKEA 4DHEA 4CEJB 2QMHA 2DFTA 2Z4SA 4P31A 3THOA 3TQFA 2FZ4A 3E2IA 1FQJA 4HZUA 3FMFA 1Q1BA 1G5TA 3QEJA 1KK3A 4PAQA 4OHXA 3PITA 1X8LA 4C0JA 5FTMA 4FD2A 1GTVA 3CRMA 2ZS8A 4BEJA 3J81k 4L16A 3EIQA 1QF9A 2QN6A 2XTMA 2FZLA 3EZ6A 3CNLA 1WRBA 3Q85A 4TYYA 2V55B 4JL5A 2HUPA 3IHLA 3BFVA 1D6JA 5DLQC 1KJYA 2WTUA 5GJVC 2KBFA 1C4OA 2HXSA 1QDEA 2Q9BA 1XMVA 1OW3B 2QU8A 2ZI3A 2ZUBA 5DISB 3JZAA 2X19A 4CDGA 1KZGB 2IC5A 2DYKA 2ATVA 3OESA 1U94A 4HLUA 4Y0VA 4YMSA 1W0JA 2FMXA 4TL8A 2RGAA 1XPUA 1EG7A 4BLTA 2CE7A 2KI5A 3L82B 4OQLA 3KKNA 3TR5A 1NIPA 2ZU6A 1P9WA 3ND8A 1KDOA 1RPZA 1NG9A 2QBYA 3K70C 2CK3A 1SHKA 3AGQA 3K9GA 3UMSA 2G9NA 2HLDD 4NU0A 4JLKA 2XZOA 2JAQA 3MRSA 4TMVA 4OQFA 2F43B 4UXJA 4K46A 3UXMA 4E5UA 3H84A 4BZXA 3CWZA 1D2EA 1HQYE 3U3JA 3KL4A 3L0SA 3IIMA 1ZIOA 1JR3E 2OV2A 2YINC 2WM9B 3NH9A 5EE5B 4RD1A 1D5CA 1E9AA 3CIOA 3KXLA 3K70D 2GXSA 3HU1A 5M04A 2QRZA 2DBYA 3AVUA 3S1AB 4MKIA 2BCGY 3AB3A 4Q7MB 5JLJA 2OCYC 4C3ZA 4XWOA 3OIUA 1KNQA 1SXJC 2VP4A 2QAGA 3C7KA 1QHXA 1N0VC 1NP6A 3QXSA 1EWQA 4XIGS 2WSMA 2XTZA 4JT4A 4UJ3A 4XTCS 5EE3A 4QGAA 4TSFA 2X1VA 4U5XA 1ETUA 1G16A 3UG6A 2R6CA 4FN5A 3WNDA 2CCGA 5EE1A 2YNMA 1SXJD 3IEUA 3BE4A 1Q3HA 1Z0KA 3KKQA 4LYFA 1CF4A 1G291 1EFUA 2CHGA 1L8QA 4TTPA 4D26A 1YHNA 2MSDB 2RGBA 1CEEA 3VU9A 3FMPB 3HR7A 2J7PA 1XD8A 5AUNB 5JI3E 2ZRHA 3K8YA 4AG5A 3L0IB 1M8PA 3EC1A 4A15A 1B23P 4Q9KA 4BLQA 4TWZA 3SZRA 4C2TA 4L4UA 5CLLA 5K8LA 3X2SA 1Z08A 3ZLJA 1G7TA 3GMTA 2F55A 3FPAA 1LVGA 4K8OA 3P26A 3GLHB 3UWOA 1E0AA 5HE9A 4KAXA 1OXUA 2WMOB 4ON9A 3BGWA 2PMDA 4B3CA 1PZNA 2IHBA 4KLZA 3AEZA 4R71A 3K9HA 3GJ8A 3KDSE 4QNRA 3P32A 4EKDA 2J1LA 2ZJZA 4NYIR 4EJSA 1RFLA 3B60A 3AVXA 5KYKA 2ZRGA 1U9IC 3EG5A 1VCMA 3I1FA 4D4KA 4DUGA 3ADCA 5EE9A 4P4UA 5EUMA 2XOKA 1Z3IX 1RJ9B 2HYDA 3BB1A 2IS6A 1G8HA 3IIKA 2J9RA 2JATA 2PCLA 1PV4A 1Q21A 2QQEA 4CEHB 3CW2A 2O8DA 3K70B 5G3ZA 3KXIA 3AV0B 4KYUA 5B57C 3QVVA 4YLGA 4FCTA 2FA9A 3KJIA 4Q9JA 2ZPTX 3LW8A 1CRQA 4MDFA 2Z43A 3THWA 4MKFA 1RYFA 4Z54A 2JLYA 1XU4A 1OYYA 3NBYC 4JSYA 2EW1A 4D0LB 1F2UA 1QHYA 3MMPA 2BDTA 3NHBA 3M1IA 3H1TA 4A1FA 5JWOA 2CJWB 4NCNA 5A0FA 4HAXA 5GJBA 3CONA 1SVLA 2EWWA 4YMTA 3Q8XB 1TTTA 1FTNA 1V5WA 2HCJB 4HB4A 3SN6A 3WP0A 2BHRA 4OHVA 3U7GA 4ESHA 1OT3A 1VPLA 1SXJB 2GF9A 2CNWA 3TR0A 3WMGA 4LK2A 3B78A 3A58B 3AVWA 4OQNA 4DDUA 2FE4A 2Y8EA 4ASUA 1XTKA 1E69A 2FSGA 1BOFA 5B58C 4I1VA 1XX6A 5KPJA 3QUSA 1WXQA 2NQ2C 4HAVA 2O8EB 4BFUA 1G5RA 5KOYA 1GRRA 3QF7A 2F9LA 4JKYA 5JHHB 2H57A 4DSOA 1F48A 3CZPA 4LJ4A 5GVSA 3VNUA 1IY1A 3O8DA 1R0ZA 3AM1A 1ZM4A 1N5LA 4LYHA 4IFEA 1XPOA 4Z8YA 1IN6A 3CM0A 3KX2A 2QENA 3W6OA 1Z6XA 2D06A 1W49A 3CF0A 1ZRHA 4UJ5A 3VR5A 1P2SA 3TVTA 2E9SA 2CL6X 3WY9A 3QEOA 3THXB 3JVUA 1Q22A 4KFUA 1E0JA 4PZZA 3RWOA 1RE0A 4PQFA 1E1RD 3B1VA 1IXRC 3NDPA 5FFMA 4F93B 3FE2A 3LX5A 3OF5A 4LJ5A 3EIHA 1GG2A 1KDTA 1Q57A 2WBLC 2ZSFA 4FIDA 4I4LA 1P61B 1G3IA 3CZQA 3DHWC 1KI7A 1XFAA 2B8TA 2H1LA 2P65A 4OK5A 3SOPA 4D4JA 2GEDA 1DAGA 2JJ8A 2MMGA 3QG5A 1Q0UA 3RHFA 2BWJA 4TYNA 4LGMA 2D7DA 2PEZA 2BM0A 1Z6TA 1OYWA 3K0EA 4ABYA 3M6AA 1ZC4A 3ASYA 3A37A 4PHHA 4QM6A 4EUNA 5TVKA 2IF2A 4FXPA 4NMMA 3B7GA 1NN1A 5FOXA 3OEEA 1KI8A 5JZVA 3AH8A 1P9RA 2JIZA 3CUEF 3LBNA 3TLXA 2CLDX 5UKDA 5IT5A 4HLUC 2AWOA 1Z47A 2V4ZA 3LRPA 1J90A 1R8SA 4O2RA 1L4UA 1BO6A 1P5ZB 1YZTA 1NG1A 5FR1A 3DOEA 3EZFA 3N2EA 4WOPA 3UMFA 2XGJA 5KNCA 5LPNA 4MA4A 4B71A 4A0FA 2K5UA 4BFVA 4TZ6A 4BLRA 3U7FB 4ZI2A 1PLKA 3QPVA 4JJZA 3BFKA 1COWD 1OIWA 1KZ7B 1SGWA 3TSOA 3SJBA 3VHXA 1W0JD 5EXPA 2O8CB 3TMKA 4KVAA 4HSEA 421PA 1OFTA 3IIJA 3FYHA 3QOFA 2OLKA 4Q4LA 1KI3A 3U3RA 4F4JA 5IK2D 1ZIPA 2QMEA 2VLIA 5D3MA 1PVOA 1Z0FA 2CK3D 3C41J 1BMFD 5DN6D 3VQTA 5JI2E 2NO1A 4WZAE 1WE2A 4MQBA 3KQNA 2HF8A 3IKJA 1GWNA 4C7OA 2H18A 4PO1A 1OKKA 2XXAB 1H8ED 3BD9A 3GLFE 5L3SA 1XEXB 5LDDC 2Z83A 1K8RA 1T0JB 4CIDA 2QAGC 4B48A 4MRRA 1S1MA 4BZQA 2P3SA 4TLEA 4TT3D 5FBQB 4KYIB 1Z83A 4RZ2A 1G9XA 1T91A 4XWKA 3BH7A 4Q4HB 4B47A 5DHFA 5JEDA 1RIFA 5J4LA 3GFTA 4CZ2A 2YWGA 1GL7A 4JBWA 4QRHA 2ZANA 3EPHA 4EPXA 2XITA 3EWAA 4E03A 4RKFA 2WHXA 3K53A 3ZJYA 1XMIA 2WWXA 1YZGA 3B9PA 4POAA 3RLFA 3NBXX 5B64A 1WMSA 1GILA 3PUVA 3VAAA 4AK9A 4RJLA 1VCOA 2H92A 2ZJAA 1EGAA 2GVDC 2RGDA 3EC2A 4TSFD 3NXSA 1CXZA 4C0BA 2ASEA 2G0TA 3VX4A 2O0HA 4RD4A 4LPSA 1DPFA 2DFNA 1FNMA 5JWRA 4EFLA 4RY2A 1MR3F 4KXFB 3QKRA 3VTKA 1T0HB 1R7RA 2HCBA 2VQSA 2W58A 2AFIE 2PJZA 5F3WB 2GNOA 3BH6A 5H8WA 2ZRJA 3PXGA 3I32A 4ZDJA 4IHQA 2J0QA 5C18A 3B82A 1D2MA 2JLUA 1MT0A 3U7HB 5BN3A 4WXRA 3CPJB 4EQ6A 4OI1A 2IXGA 2WJIA 5FOSA 1SQ5A 5E3HA 4EFMA 1I2DA 3IHWA 3MAAC 2VSXA 4PQRA 1NVXQ 4Q1AA 1OH6A 1GAJA 3LDAA 4AI6A 1E0KA 221PA 4W5JA 5DYIA 1VG8A 1NN0A 1X8KA 4QBHA 2BJVA 2HEIA 4EJSC 5DIFA 1XZPA 1XJQA 1ZUNB 3A1UA 5E7JA 5AUQA 5FTLA 4TYWA 3PEVA 4YDHB 1UJ2A 1YZUA 5LB2A 4LBYA 4OHYA 2IYVA 3PUWA 5CIWA 2QI9C 4N0DA 4BRUA 2ZAOA 4TLAA 4I99A 1VCIA 1SVWA 2QNRA 4KODA 2OBNA 4QNMA 4XVUA 2QBYB 4R98A 2V6JA 3WXMA 4XSGA 2YWFA 1W4AA 4JZKA 4ZCLA 2OXRA 2Q6TA 4M9SA 4V02A 1ZJ6A 2EQBA 3AKCA 4WZ6A 1OFIA 2XOKD 1GITA 2JASA 1HT1E 1JR3D 4A8JA 1KY2A 2ZYWX 1E2PA 3W5IA 3SBDA 2PX3A 1E6CA 2AD1A 2P6RA 2GEUA 3SNHA 1NBME 3F3YA 3OE7D 1NMXA 2DR3A 3TSWA 2ZR9A 4D2IA 5KNDA 1YQTA 3LH5A 4MRSA 3RS7A 1S8FA 3M0EA 4B73A 1Y3AA 1MABA 5FOUA 3AP1A 3WRYC 1JBKA 1XTQA 2ERXA 2QAGB 4V0ME 3SS8A 1WCV1 4UNRA 3AVYA 1KSGA 4Z1MD 4Q02A 4EPYA 2FJUA 4OQXA 4WVFA 4C0QC 4XVQA 3FOZA 1W5SA 3AP3A 4F92B 4JIMA 2V7QA 5BYJA 3UWKA 4Q66C 2IYUA 1IXSB 2EWVA 2XSZA 2BBOA 4MUAA 1CS4C 1E2JA 2WSSD 3K0AA 2G6BA 3GJ5A 1K5GA 3B1YA 3C16C 3RSOA 3V4FA 3B85A 3NH6A 3WNBA 3VR6A 2GZAA 3CB4A 3CX7A 4KITB 1MRNA 1L4YA 2C5LA 4HDCA 1I4LD 4Q7JB 1G7CA 5FBWB 1HTWA 4DLZA 5CDFA 3A36A 2J45A 4OI2A 3B1ZA 5E4FA 3QKTA 4LHXA 3X1WA 3VU9B 1IJFA 1XEWX 2E1RA 4JL8A 4QL3A 2KSQA 3U44B 1HYQA 1E32A 1KAGA 1P62B 2CHVA 2WZQA 2GXUA 1US8A 1NY6A 4BQSA 3R8CA 3IPXA 3KUDA 1II9A 1N3BA 2YHSA 1OH8A 4EDHA 1WBBA 2V3CC 4QBIA 3BB3A 5EUQB 3REGA 2XB2A 1IBRA 3GCGA 2VH5R 1R4AA 4BPBA 1UBFA 2IT1A 2OAQ1 1OIXA 1GM5A 4N0EA 5TDHA 2QEQA 3VHLB 5K8TA 1CLUA 4JVNA 2IYYA 5FH9A 3NBFA 3PEWA 3HP1A 2WWIA 1T9HA 4JKIA 5JJKA 1LTQA 4TQUS 3ONWA 2BKEA 2IS1A 1XD2A 3TSZA 1YKSA 4IDOA 4EJSB 3RC3A 3QENA 5BN5A 3TUZC 2OO7A 4DVGA 4BFZA 2D2FA 4M1MA 4ZCMA 4TMTA 4F4CA 1JAIA 2VL7A 3AVTA 4AYXA 2HXYA 1J8YF 2O8FA 2RB4A 3WHKA 3L2OB 2FF7A 1NBMA 5H70A 4NBSA 5DI3A 2O8DB 2RHDA 2LKCA 4TL7A 2ZTSA 5B30A 2C8VA 1E2LA 2QRNA 3CX6A 2IW3A 4RZXA 3THWB 2FPMA 1E4VA 2P67A 1E96A 1KSJA 3HR8A 1F2UB 3UPUA 2OUKA 1TEVA 5L3RA 4LV8B 1OB2A 3SQWA 1ZM2A 5G40A 1Q1EA 1LV7A 3AGPA 4YC7A 2H5EA 2C95A 4UNSA 3T12A 1NKTA 2Z0MA 5TARA 1HURA 2FX3A 3TGPA 3HWSA 3EZ2A 2RH5A 2QROA 5KTYA 4HUQB 2A5DA 2H8KA 1KKLA 4PTLA 1T3LA 3NWJA 2WVJA 2F1IA 3B13B 2ZI7A 2YC4C 5AUPB 1FUKA 5EXTA 4OQMA 1W36C 3T06B 4GP7A 1KSHA 1NLZA 3QXXA 3LQQA 3DZ8A 2X2EA 4JMPA 4Q21A 2OG2A 3OAAA 2WICA 2A9KA 4WZBE 3RRYA 3FTQA 3QE0A 5HCNA 5FL3A 3T1TA 4PO9A 1WA5A 4D81A 2H17A 3NBZC 3RC8A 4DEXA 2QG6A 1R0WA 2EFCB 1FUUA 2FEOA 3NVAA 3PENA 3ZVMA 4RZUA 1KJWA 2ZROA 3I8XA 2FFQA 4A2QA 1NLYA 721PA 1IHUA 2WAXA 2NGRA 3FKSA 4GDFA 1G21E 4B3DA 5TMPA 4B6EA 2HJGA 4HZIA 5IDVA 1DS6A 1W0KD 5EZ6B 4A0RA 2D4HA 5KHOC 2OCPA 3BXZA 2DFKB 4V0LA 5C4GB 2PT5A 4FI3C 3LVQE 1ELOA 2FGKA 4IFBA 4URVR 5KNBA 2WIBA 1VDZA 2QQ0A 4PAOA 1KI9A 3NC0C 3KJHA 1E9CA 5HCIA 4YXWA 1E98A 3TBKA 1YVDA 3DM5A 2RKOA 4NCKA 1SVOA 1BIFA 2PMKA 1J8MF 2QUZA 2PZEA 1XMSA 2FPKA 3MWKA 2WOJA 4DDWA 1NJFA 4M9XA 2ZI6A 2MSEB 3WP1B 4DCVA 2XB4A 1G19A 4MKHA 5IHPA 1FFHA 1UKYA 2ZETA 2ZI4A 4Q1DA 3I92A 3FVQA 1Z0DA 1VHTA 4RCZA 4HDOB 3KFXA 3FMOB 4ZDKA 1XF9A 5JS7A 2WJYA 3DPUA 4B76A 5KSZA 2BC9A 3C5HA 1OXTA 2XTNA 4V0KA 4XD7D 2O8BB 1E4YA 3P1JA 5KDLA 4CVNA 4U02A 3WRXC 3QBTA 4LI0A 4BFTA 1Z0JA 2XJ4A 3TH5A 4XTRA 4KSBA 3KKPA 4B3GA 5KPDA 1Q3TA 2ZE5A 2GCOA 4M22A 2A5FA 2IYTA 4URWR 4LBVA 2AKAB 1T4GA 4DSUA 4JVSB 4PC7A 1GKIA 3RS5A 1JPNA 1Q20A 4TMWA 1J70A 1AS0A 4A8JC 5IF9A 2QPAA 1FW6A 2QL6A 5D3MB 2C78A 2FN4A 3A4MA 2OZEA 3NEJA 5AJXA 1ZMXA 2QTVB 2ZVQX 1F6BA 3ETLA 3I3SR 4DBLC 1P73A 1JQJC 5HKKD 3F8TA 3SE0A 1EFHA 4LHZA 3LLMA 1IAQA 1JPJA 4C7OB 1CJMA 4EPVA 4OKSA 4GMXA 2ORWA 4LJ6A 1CJKC 5L3SB 1R0XA 1T3SA 2WMNB 3GJ6A 2QAJA 4PPQA 4DLSA 1FX0A 3MGCA 3CO5A 4S35A 5JECA 4Q48A 5CIQA 2GESA 2QE7A 4KHZA 2OILA 3U3OA 1Z0AA 1GNPA 2NPIA 2WWFA 1O3YA 3L8ZA 1E9BA 1XRJA 4IJMA 4M53A 2FDCA 4NZYA 1DG1G 4URUR 121PA 4KV9A 1G17A 2EYQA 5DHAA 1IN8A 4MGKR 3AVPA 4NYJR 2W6JD 2QT0A 1R0YA 3RWMB 3AUXA 1FPMA 2YWEA 5KSOA 4UXHA 1MRSA 1NN3A 5J47A 5CYOA 1JEDA 1CR4A 1W2GA 1OSNA 2P5SA 3WMFA 2Z6VA 3A1WA 3GJ4A 1II8B 2F3TA 2J7KA 5LD2C 3EARA 1W46A 2ZJBA 3W5JA 3VR1A 2V7QD 3B1XA 1M7BA 4JLDA 3LD9A 1SVKA 3AVVA 2NO0A 3RS3A 1Z28A 4NYMR 3VKWA 3SFZA 1NJGA 3CRVA 3QKRB 4NHOA 1GUAA 3LW7A 3AF0A 4FMDB 4B44A 3PUYA 1AA9A 3LQRA 2AK3A 1OB5A 4A2WA 2WKPA 4PC2A 4G3XA 5DO9A 3KTAA 2X2FA 3RS2A 2KB0A 3QJYA 4EQ6B 4DLTA 1IXZA 4HUTA 2AFHE 1YJ5A 4F4IA 2JLXA 1UPTA 1Z0IA 3B6EA 4PZYA 3SEAA 1U8AA 4MGZR 2C96A 5E7MA 1HT2E 2ZSEA 4KU4A 2VP0A 1FNNA 1ONBA 2PH1A 3U60B 2IYRA 4DLRA 2REXB 3B9QA 1HQCA 1T3HA 3GEHA 4B2IA 2R6FA 2Q3FA 1F5NA 4NONA 4YMWA 1E2FA 2HYIC 2F9MA 2WWGA 1WB9A 5DNYB 2YOGA 2IHYA 2XZPA 2WV9A 3UG7A 4A6XA 4V03A 3KXKA 2YOHA 4MRVA 1VG1A 2IYLD 2P0EA 4FINA 5J4KA 4IDNA 1GKYA 2IUSA 3GJ0A 1ZP6A 4L9SA 4QG7A 4PANA 4G5QA 1RC8A 4LDJA 5AWFC 3ASZA 2KBEA 1G3UA 3GLFB 5LBIA 3T15A 5BXQC 3CPEA 1TQ4A 2VP2A 3V9PA 3R8FA 1YR9A 4I1OA 2OM2A 3D31A 1LS6A 4A8JB 4Q00A 1JEEA 4HAYA 4DDVA 3F0TA 3AF2A 1NBMD 3A4NA 2ONKA 1BYUA 3QKSA 2FNAA 1QHNA 1OF1A 1U0HC 2EFGA 2GZDA 5HR5A 1OH5A 4TTRA 1NIJA 1W1WA 3IQWA 1W48A 1MABB 3AF4A 2VYFA 1G4UR 3BJIC 3R9WA 1ZCAA 4LHWA 2P6UA 3QKUA 2GA8A 2VF8A 3ADBA 2BIFA 4UKDA 2AN9A 1F2TA 4BFYA 1UF9A 1UKZA 4QJ5A 1H8HD 1K6MA 1AIPA 2GZHA 3DOFA 1BYIA 4BEBA 2JLRA 1TADA 1ESNA 1KO8A 3A1VA 3L8YA 2VO1A 4RD3A 5G41A 4B34A 1KYIA 1UFQA 5CJPA 3NTUA 1WBDA 4TLBA 2RGEA 4NCIA 4C0SA 3I72A 2YV5A 1YZKA 2VHQA 1EFTA 3BOSA 3QNUA 3UANA 3W6NA 1YZLA 1YRAA 2JDIA 4DXAA 3R9XA 1P2VA 2FSFA 2BV3A 1G18A 5EP2A 3ZGXA 1GOTA 1DAEA 3ZIAA 2I1QA 3IBYA 5JEEA 1TUEA 1OJLA 3K09A 4HLCA 3K0SA 5LD2B 3TW4A 1E1QA 1U98A 2YZ2A 1VCNA 3CBQA 3QPUA 4GRAA 4Q03A 2G83A 1W5TA 1Z07A 1US8B 2IX3A 2ZXUA 4OHZA 1KI6A 4LJ9A 1J99A 4LBZA 3SHWA 4D0GA 3WNCA 3AKEA 3Q3JB 2QSYA 4DEYA 2B8WA 1Z22A 3FFBA 1TF5A 2CL0X 1VMAA 3LAWA 3UMRA 4ESVA 2AXPA 4P4SB 3T34A 4H1UA 5SZIA 3A4LA 4LYAA 5ELXA 2ZVPX 2ORIA 2F1HA 4A82A 4A36A 4AY2A 1ZUHA 1XD2B 5CB6A 1T5IA 2FFBA 2IEYA 2D74A 3GD7A 3SYKA 4IOJA 4O2LA 2BMFA 2VHTA 2R9VA 3QF4A 4PFSA 4CEJA 3PV0A 1XEWY 4R2HA 3CRW1 5AJVB 1NVVR 1XTRA 4D4MA 5JSZB 1KMHA 3OZXA 3QXJA 4LBWA 3H0KA 5J5CA 2C9OA 2RHMA 3THYA 2ZS9A 4N1AA 1JB1A 4QHYA 2EYUA 5KSPA 2PCJA 4ZCIA 3G82C 5DI3B 3RRNA 2V9PA 2ZSBA 4LJAA 1N6IA 3TW8B 1U0JA 4WW0A 4C4PA 4EPWA 4C2UA 2GDJA 4ZIRA 4IXMA 3VNVA 1JQLB 2B7BA 4LHVA 2JLWA 4MGIR 1G8GA 2OFOA 3BK7A 4JL6A 3VR2A 2W6IA 2A30A 1NL3A 4MYUA 1CBUA 1M74A 4Q1FA 5FOVA 3KQKA 3I5YA 2FV8A 4YDSA 4URYR 1HEIA 2LCFA 3B8HA 4LJYA 3SQXA 5EJEA 4FMCB 3GJ7A 1AQYA 4XVRA 1GL6A 2BOVA 2AD5A 4FW9A 1TNDA 5H68A 4LOAA 4G1UC 2LWIA 4PZLA 4D80A 5TY0A 2ZRBA 1FTSA 4X8OA 4US0R 4KO8A 4Q5IA 2BCJQ 4DZZA 1G5PA 2W2XA 3LXRA 3FKQA 2JA1A 3WBJA 3AKYA 4A4DA 4PXAA 1NVWQ 3U6KA 4FMDF 2RGCA 2IYSA 1OHHA 4XSHA 4Q4JA 3AVQA 1N5IA 2HV8A 1QVAA 3QIAA 1DE0A 1JECA 1TX4B 4PHGA 2RAPA 2NMVA 2QGNA 3GEIA 3KKMA 2HT1A 1GRNA 2BJWA 1G3RA 1G3MA 2DCUA 2EFHB 4I1UA 5J4HA 1E2NA 2JJ1A 3TNFA 3D7MA 4IOKA 2D62A 1DEKA 2A5JA 1X1SA 1ZM7A 4ERNA 5HZKA 2ZI9A 4TL9A 1XNJA 2PBRA 3REFA 1W2HA 3G0HA 1A2BA 1N25A 3WYGA 1JXMA 1ZCBA 1IONA 2IL1A 2I3BA 4GSYA 3SHFA 4CEIA 4CT5A 1IQPA 2BBWA 1P9NA 1GIAA 4QGGA 4QOSA 3TVDA 3EPLA 2QZ4A 3ZD6A 1WDTA 1JR6A 3T5DA 3O47A 1R5BA 1DG3A 1JXOA 5CJ2A 4DSTA 4Z8XA 3LNCA 5JHGB 2JEOA 3VR4A 1MV5A 2AHOA 1N6PA 2XNDA 5FL7A 2G88A 2TMKA 1KO7A 4DCUA 1N2CE 3CF6R 1N5KA 1KO4A 1D8TA 2QPTA 4EPTA 4HZUB 5FI1B 4M2LA 4NYIQ 1E2QA 1NKSA 1Z6GA 1PLLA 2R65A 2AR7A 3NEYA 4IDQA 4R7ZA 2EFDB 2O0KA 5AJZA 4ZDIA 4JLNA 5CDFE 1QVRA 4PAMA 2HT6A 2WOOA 2GJSA 3ICEA 5JMTA 4LSGA 2J7PD 2ZRFA 1XBTA 1VYTA 2NOAA 1G7RA 1XTJA 5FPTA 4FWIB 1UAAA 2MMCA 2GJ9A 2C03A 4NTZA 4MH0R 5TXGA 1P60A 1YE8A 1QG2A 4KBGA 1Z2AA 2G0NA 4QFMA 5E95A 5P21A 1A82A 1CKEA 1W4RA 5HZHA 3ZVRA 3D8BA 5J4VA 4IVPA 4RD2A 2ZJYA 4PC3A 2ZIAA 1OFHA 4KFTA 1UEJA 1VHLA 2VRWA 4DIEA 2XJ9A 3BERA 2CDNA 2ZQ5A 4Q9IA 3GLHA 2R8RA 4OHWA 1S1CA 2IXFA 2V1XA 2LKDA 4XH9B 1SHZA 1P2UA 4ZV4A 2GHIA 4HB3A 2QSZA 2YKGA 4US2R 2HLDA 2F1RA 2VF7A 4DUGD 2IK8A 2JLSA 5BN4A 1S9DA 2QY9A 2C77A 4MUBA 2XZLA 1XDBA 2I1VB 3E5HA 3CR7A 4EIWA 1CJTC 1QHHA 1U81A 4BLSA 1J2JA 1HE1C 1MH1A 1D9ZA 1S3SA 2OHFA 4WIAA 2ODBA 3FDIA 4TQ9A 1CR0A 1FP6A 3ZQ6A 2F1JA 3EPJA 2Q9CA 2QT1A 4QGFA 3DMNA 1IOZA 2FEMA 1ZD1A 1ZD9A 1FX0B 5FBRB 1WQ1R 1AKYA 3RRZA 1JJ7A 3GQBA 2IWHA 5F9FA 1T6NA 2ZS7A 4L5BA 2VTKA 4D0NA 5FOWA 3H86A 2OFXA 1HH4A 2RCNA 5AK0A 4RD6A 1TQ6A 2V54A 3HDTA 3KJGA 1V43A 3B5JA 3BS4A 4B2LA 4RVCA 3CPHA 3GLGE 2BEJA 3TUIC 2CNWD 1UKEA 3EIEA 5JRZA 2BEKA 3DMDA 5KDDA 3I4LA 3C14C 4ASUD 1SZPA 3K09C 2GJ8A 3CF2A 3EAQA 3X1XA 1A1VA 3PIRA 2CHQA 2CL7X 3K1JA 3M4YA 1YZQA 1CJUC 1QZXA 2N46A 2IWRA 4B3FX 3EPKA 4FWTA 2W83A 1XCPA 2FG5A 3EZ9A 3ZZTA 1SVMA 3MJRA 3OIWA 4NDZA 1FP7A 2AL7A 5FPSA 3NG1A 3ZIAD 3B2EA 3FWYA 4YONB 2ZRCA 3Q7PA 4LJ8A 5DGXA 2ZYVX 2VSOA 3KTAB 3P4YA 4TMXA 4FMCF 1KO1A 3Q7QA 3ICQB 4ZI3A 2J0VA 1SKQA 3LLUA 1KIMA 2P2LA 5A5GA 2KE5A 5DSZA 4A0HA 4OL0A 2QP9X 3U7EB 5E7IA 1NRJB 3FHOA 4B32A 2XNSA 4NP6A 1MO6A 4GP6A 5H1YA 3QQ5A 2O52A 3TK1A 4JLMA 4PPGA 4Q1EA 1FQKA 521PA 2B21A 4IVRA 2GEVA 1KI1A 3PJRA 1HV8A 1ZNYA 4QHSA 2IUTA 2OESA 1AK2A 1F60A 1U90A 4UQOA 1KO5A 3DL0A 5K8IA 1TMKA 3OEHA 1Q44A 3GPLA 1A2KC 1UEIA 4M9ZA 4A0GA 4YMVA 1EFRA 4TLCA 1AKEA 2BVNA 4LJ7A 1IN7A 1RKBA 3HPQA 2QPOA 2DHRA 2DWPA 2RGXA 3OEED 4LV6A 5L8VA 2JIZD 3U61B 1OPXA 1YRBA 3PEUA 2VBCA 1YR6A 3CNOA 2QA5A 4QJ3A 2ZSAA 3MWJA 4XJXA 3EZ7A 1TL7C 4QBFA 3A1SA 3QKSB 4PR0A 4AD8A 4F38A 4TZ0A 1RZ3A 1DAKA 4JLBA 2QORA 4M1YA 4E09A 1ZC3A 1E94E 2W2VA 1DAHA 2RGNC 2Z5FA 4UNQA 4UNPA 2GAAA 5AJWA 5GVRA 1WP9A 1W4BA 3GLGA 2VP9A 4HLQB 2BMDA 3UK6A 4CRWB 1F2TB 4KSCA 2OFWA 1X1RA 2QM7A 3SYNA 3W6PA 1EESA 2GBLA 3TKLA 2DFLA 3KFVA 1RRCA 4DB4A 1XMJA 5FTKA 3ZD7A 5B2ZA 1NF3A 1Z29A 1OE0A 3U2QA 3PUZA 1OXSC 2IF0A 1N5JA 3KJEA 3PG5A 4ZKEA 1UBCA 1NLFA 1ZINA 4IEIA 1YR7A 1OXXK 1OKKD 5KU1A 1ZBDA 2F6RA 3GEEA 1E0SA 1SKYB 3PQCA 3DKVA 1W36D 3RYTC 3DO6A 1XEXA 2DWQA 3DVLA 4HDQB 2EFEB 3A6PC 3LV8A 3GFOA 3TE6A 2NIPA 4B6FA 3MUFA 2QP4A 3ZVNA 3W3AA 4RKEA 1TQ2A 4EAQA 5CITA 2R6GA 4U7DA 2BBSA 4HATA 5C1BA 2W0SA 1KI6B 5J40A 3U3MA 1BS1A 1CR2A 2ZRDA 1R6BX 5BYKA 1E1RA 2ZJ5A 3FHCB 4Q18A 2ZYTX 3TUJC 3SJCA 1JALA 3BIFA 1G3QA 3SJZA 2IYZA 1U2RA 4CGZA 4Q7LA 2CEAA 1RRFA 1XZQA 1G7SA 5BW8A 4C30A 2ZR0A 4HB0A 4IW3B 2ZI5A 4BFSA 4IVQA 1MKYA 1XB2A 2CVHA 2JJ2A 3VFDA 2IYQA 1LF0A 4B3XA 3GLIA 4I81A 3ADKA 2O5VA 2WPDA 3BWDD 3H2YA 3QF4B 4MYHA 2GCNA 4QGHA 4C0LA 3BH0A 1WF3A 1C9KA 1EX6A 1SVSA 1E2EA 1KMHB 1VYVA 2GRJA 1LW7A 1Z06A 4KLNA 4QHTA 5G3YA 2VSFA 3THYB 1UDXA 3PR1A 5DYGA 2ZRKA 3X1ZA 3G5UA 1N0UA 1Z5ZA 4MRPA 2B6HA 5EE0A 4DKXA 1Z2CA 2YC2C 4ARZA 2GAOA 4BUJA 4G5SA 4QBGB 3ADDA 3OIYA 2A3RA 2A5GA 5K8UA 4JLOA 1CJVC 4ZIRB 2ZM5A 4OI0A 4IDPA 4OYHA 3NC1C 4WXPA 3QXCA 5FPHA 4G5RA 4E07A 2PLRA 1HY3A 2NO7A 3RNLA 5HPYB 3VKHA 3QBVA 5C2JB 1VECA 4AYTA 1COWA 4URZR 3SYLA 1KI4A 3IO3A 3C8UA 1TU4A 1ZM9A 1AZTA 1YU9A 2ERYA 1ZVQA 3CH5A 2QTFA 1DAFA 3MWYW 4WA7A 4X8LA 2YJTD 3ZH9B 2MSCB 1M2OB 2JCSA 1GFIA 3TAHA 2C99A 5CB8A 4HB2A 2ZSDA 2VPPA 1KTVA 5IK2A 5D3QA 3TIFA 4CT4B 2GCPA 5JCZA 1CRPA 3T1OA 1N0WA 1S2MA 2BM1A 4LY6A 2FPLA 1BMFA 2G1JA 5DN6A 1G1MA 4KFSA 1ZM3A 1OFUX 1TQDA 4Q4JB 4AWXA 1BH2A 1EX7A 2WAYA 2ZRPA 3PUXA 1GKUB 1VTKA 2OSBA 1H8EA 1W36B 1S9HA 4PHFA 1DELA 4A6PA 4P4TA 5EP3A 5LB4A 3LX8A 3R7WA 1E9EA 3MLEA 4NCJA 4Y0AA 4LUCA 1E79A 3ECCA 4TT3A 4DSNA 3GJXC 1OIVA 4MDEA 1XP8A 3K9LA 5FBVB 2JLVA 1JNYA 1TF2A 3UATA 3QSYA 1SVIA 2JGNA 3EXAA 3IGFA 2AX4A 4ZDWA 2QMOA 4CEIB 1ZNZA 4G01B 5ANRB 4M8NE 2UZ3A 2J0UA 1H65A 1GZSA 3W3ZB 1XTIA 1IN4A 2PL3A 2ZRNA 3OIVA 1D2NA 4O25A 2J0SA 1E9FA 1RW4A 2XSZD 5JJLA 3AP2A 2OAP1 4B43A 1NMZA 4HAZA 4A9AA 1W47A 2JLQA 5FTNA 1ZNWA 2V6IA 1IY0A 2FGJA 3T35A 4GNKA 1SKYE 4Z51A 1G20E 3TAUA 1IY2A 4JVMA 2ZE7A 4C0HA 4RCYA 1RRGA 1FZQA 5L3VA 4TLDA 2ANCA 4JSTA 2JLZA 3L43A 4JJKA 5FUVA 5CYPA 3VX3A 1HUQA 4M21A 4RFSA 2FH5B 1LS1A 3D6TB 3KB1A 4GBMA 1NY5A 2NTYC 2ZU0C 4DC9A 4WBSA 2R2AA 4QXAA 3U44A 2J46A 4Q1CA 1CP2A 1N6KA 2QGZA 2GJAA 4AKIA 2IS4A 3RRMA 2OLJA 1S3GA 1S96A 2N42A 2OEPA 5CK4A 1VIYA 2C98A 1Q1ZA 2FOLA 4KCGA 5C46F 2F7SA 2V8OA 2BMJA 2ZREA 3MG9A 4DRZA 2X8AA 4CW7A 4F91B 3GFPA 2CE2X 3E70C 1KGDA 3IQXA 1NMYA 4GZMA 2GKSA 5SZHB 1W4CA 4L9WA 4UXIA 3ZS8A 4GPTA 3L0OA 4Q9HA 1TEXA 4UNNA 3SBEA 3DEFA 4EPRA 1IJEA 1R8QA 2Q0HA 3LVRE 4ACAA 1PLJA 3VR3A 1LY1A 2Q3MA 4PQYA 4Q1BA 1XXHE 1E2HA 4E22A 2ZJ8A 1KDRA 1NI3A 1D9XA 5FR2A 3ZDQA 3ZS9A 3HU3A 1G41A 4GL2A 1QHHB 2IUUA 5EXXA 3DDCA 5CLQA 1JR3A 3FB4A 3OEHD 4IKEA 1PUIA 1EFRD 2QMUA 2RGGA 2WJVA 1XTSA 4M1SA 2D2EA 3OE7A 4W5HA 2GVZC 1ODFA 3HU2A 4D82A 1Q1QA 1MO5A 4OJQA 1XWIA 4Q47A 4P3YA 3U4QA 1ZU4A 2UVQA 1C1YA 3QPWA 3EW9A 1G4AE 5TV2A 1R5OA 2UZIR 4M9QA 2CBZA 2J3EA 4XOIA 2GBLC 4RSGA 2CLCX 5GADl 3RABA 4DT1A 1ZYUA 3LWNA 3LO5A 2HJVA 4Z1MA 3SDZA 1O87A 3MCAA 4LRWA 4M1WA 1KK2A 1QRAA 3RSLA 3PCRB 3K0FA 1TAGA 3AVOA 1IN5A 3K0AB 4JS0A 1AM4D 1GNQA 4OK6A 4LZZA 3CRQA 4R2IA 4HUQA 2WSSA 1ZU5A 1FOEB 1GNRA 3I5XA 1P3JA 5F2EA 2WWHA 2D7CA 4B35A 4F7WA 4HYYA 1GP2A 1JAHA 3TJZA 1AS2A 5JRJA 1EFCA 1TUIA 2G77B 1G8FA 2OBLA 2YYZA 2ZAMA 4ZO4A 2ZE8A 2GETA 3AUYA 1A4RA 2CCJA 3OAAD 4Q4AA 3U3KA 2REBA 4M1OA 5C4MA 1QHGA 2SHKA 4B75A 2G3YA 3Q5DA 1X86B 2ODEA 2VEDA 3U5ZB 4JLPA 4D25A 4DLUA 3N2IA 1W44A 5JJIA 2BKUA 1UBEA 1LF5A 5EQTA 3T5GA 5L3QA 2WWYA 2PLFA 5J4YA 1E2IA 2ZR7A 3FKSD 2IBMA 3JVVA 3OFNA 1AJEA 2P6NA 2PT7A 1XEFA 5F98A 1RVDA 2WWWA 2B7CA 5GJCA 3ND9A 4ITRC 4Q19A 1XPRA 4QM7A 1UM8A 1MOZA 3CLVA 4G0NA 2VHJA 3WYFA 4FMBB 1XXHA 1Z6YA 2ZRIA 4JLJA 4NL4H 1ZD8A 5AUOB 1W7AA 1CULC 1DO2A 3DKPA 2VA8A 4Q9LA 3GJ3A 5SZJA 4YXWD 3KB2A 2Q3HA 3KQUA 4AURA 2O8FB 2IA5A 2YOFA 5JCPA 3SU8A 6Q21A 4B74A 4JLAA 4X8HA 4O3MA 2OCAA 1NVUQ 4PPNA 1UKVY 2CVFA 5HTKA 3D3QA 2JJ2D 2W0MA 2EVWX 4PSKA 1LNZA 4LHYA 4BE7B 4BLOA 2WPDD 2H7VA 1LFDB 4DWJA 3IO5A 2D3WA 1GVNB 1HE8B 4JT2A 5KUTA 1A5TA 2L0XA 4AG6A 1U8ZA 2J41A 4U00A 3IBGA 4LWZA 2GXQA 3AF1A 1HA3A 3T61A 1KNXA 2WJGA 3RVBA 2BMEA 1EK0A 1R2QA 4BASA 1B0UA 3K0CA 3X1YA 3O8CA 5KO2A 2O8BA 3EX7C 3SJAA 5EXSA 2FSIA 3FHTA 2NG1A 1ANKA 1U8YA 5EP4A 3X1DA 1R10A 3GLHE 2RGNA 3L0PA 1N6LA 1VG9B 2CMKA 3NKVA 4FCWA 5AJYA 2BBTA 5BWMA 3GLGB 5CM9C 4AKGA 1MO3A 1U0LA 3ZVLA 1S0UA 2QM8A 1NN5A 4N3NA 4KFRA 3CR8A 4NYJQ 4Q7KA 2F43A 1I4TD 3UKDA 2RMKA 3MWLA 2GTPA 2HF9A 4IEEA 2A78A 3DM9B 3WMEA 3T1VA 3W8RA 4NKRA 1P75A 4M1TA 1M34E 1UADA 1TF7A 2V1UA 3CNNA 1E2GA 4NH0A 3MSXA 3WBKA 1N6HA 1GRQA 2FFHA 4MYCA 1VG0B 2IYWA 1Z6AA 4JVLA 2F3RA 1VIAA 4B33A 4NYMQ 3S1AA 1G8YA 4YQFA 3TRFA 2GWHA 5CK5A 4IXNA 2ZITA 3ZZ0A 3I61A 1DO0A 2WJHA 4PC6A 3I62A 2QE7D 2QTHA 2NPFA 4LV5B 1E79D 3CX8A 4I1SA 3QG1A 1E9RA 1N6RA 3BFXA 2AWNA 4LPKA 1CR1A 2NO9A 2A2ZA 2ODNA 1W0KA 3R20A 2ZEJA 4S2EA 5FUXA 2PEYA 4W5WA 1DBSA 5FPYA 4AC9A 2ORVA 4IOMA 3JZMA 1M1YE 3C15C 1E2KA 4RFVA 1QG4A 3MJHA 5TB5A 4LYJA 4ACBA 5GJWC 1SXJE 4GMDA 3FGNA 3BB4A 4LCBA 1T5LA 1X3SA 3H4MA 2VHUA 4JLVA 4PSAA 3CWQA 1FMLA 1E2DA 3HYTA 2G1KA 3FFAA 1EWRA 1II8A 4CF7A 3T1QA 5HE8A 3PEYA 1GDDA 1XD9A 4W7SA 1EXMA 2NZJA 2GXAA 3AF3A 1ZW6A 3PFIA 2O0JA 1DTSA 1OV4A 1TU3A 3GLIB 4LX0A 3SFVA 2IYXA 1T8UA 1E2MA 5FTJA 2DPXA 1CIPA 2ZRLA 4PSVA 1P7CA 4M1KA 4GOKA 1CU1A 4D4LA 2OXCA 5BQ5A 3U6BA 4V0NA 1M7HA 3MFYA 4PO8A 4HI0E 3HPRA 2VP5A 3P27A 4ARZB 1OXVA 2OCBA 4XD7A 1KMQA 2FWRA 3CKLA 1A7JA 1P2TA 3W8NA 1ZUIA 3LA6A 4MYTA 3K9NA 3I8SA 1UDWA 4V0OA 3WHLA 1NNEA 3Q5EA 4WAUA 3W9YA 4AYWA 821PA 2ONJA 1KAOA 2GCOB 4DLVA 2VHCA 3BAFA 4D6PA 5JWHA 4HAUA 3O8BA 1ZAKA 2PX0A 2ZRMA 3C4JA 3LBHA 2P5TB 4GZLA 3W90A 3ZYCA 3KQLA 4PX9A 2NO6A 1JJVA 4Q01A 1RJ9A 5G53C 1S4QA 3EA5A 3NHAA 4CEHA 2ANBA 1XJ0A 1AN0A 1Y63A 3KKOA 4DCSA 2IXEA 5HKKA 1XJCA 3QI2A 4JYCA 3P4XA 2WKRA 4URXR 1X6VA 1KI2A 3DZDA 2A7QA 2IS2A 1KOFA 2VIIA 3EA0A 4GOXA 4HLDA 3GLFA 1P4SA 4NE2A 1BKDR 4BFWA 1KKMA 5F9HA 4BZPA 1LB1B 1IM2A 3R7WB 2B92A 2ODWA 4GI7A 1K5DA 3AKDA 3BBPA 3E1SA 4RZ3A 1DADA 1DVRA 4QJ4A 4II7A 4US1R 2CJWA 3WYAA 5DE3A 3QXHA 1XCMA 2I4IA 4RD0A 3LBIA 2ZYUX 1Z8FA 1DAMA 3RAPR 5A4JA 4ILEA 2KWIA 2GK6A 1YR8A 5AR1A 1VYUA 4OBEA 1DARA 4OJKA 4DCNA 2ATXA 1QHSA 3B1WA 2W6JA 2PJRA 2YVUA 1NSFA 1SXJA 2J0UB 4DLWA 2C04A 5EP1A 1QHIA 4L8GA 2IEZA 2XAUA 3HYRA 2XX3A 4FCVA 5FI0B 3LFUA 3KUCA 3V00A 3KQHA 5DI9A 2GK7A 2FSHA 1U99A 4NCHA 1DAIA 3P20A 4TN1A 4BGDA 4P0TA 3N5CA 1AQUA 3CRRA 1J7KA 2EU8A 3PVSA 4XWAA 3IUYA 4DB2A 4LC0A 2H16A 3EASA 3RS4A 3A1TA 2JDID 2O8EA 4TL6A 4DCTA 2FFAA 1II0A 3A8TA 3RS0A 4GOJA 4M0LA 1UBGA 1KHTA 4BRWA 1Z63A 2Q21A 4PC1A 1E1QD 1NVVQ 1AZSC 2GJKA 3FMIA 4RFSB 4DIDA 4KI0A 2X77A 1E9DA 4BECA 2OT3B 5FOTA 3KZ1E 2J59A 1T8TA 4KVGA 3F5FA 1KDPA 4OK3A 2GF0A 1G8PA 1FMJA 2VP6A 2UKDA 3W34A 3THXA 5DH9A 2N1BA 1PUJA 4PHTA 2W2TA 1L7VC 4G5OA 1KK1A 1P72A 2C9YA 2DWOA 1PJRA 4M4SA 1G64A 2ZE6A 3OFND 4JYBA 2AXNA 3IDQA 3GP8A 4TQAA 1FL9A 1OH7A 5FPKA 2WKQA 4P4SA 5CM8B 3UIEA 3SR0A 2ZUDA 3Q72A 4GT1A 4B3BA 4DLYA 2DB3A 3N70A 1QBKC 4DDTA 1ESMA 4IDHA 4LC1A 4DJTA 3GLIE 4KJZA 2C2HA 2J5XA 2ZUCA 4HAWA 4P32A 1XCGB 1U9IA 3BORA 3QVUA 4BFXA 1AS3A 4MITA 4EFNA 2OE2A 5SZKB 1DOAA 5JSZA 2WIAA 4H9GA 4A92A 3IEVA 4AKHA 2Z4RA 1Q12A 1AGRA 2WJJA 3QY0A 4BWYA 2R62A 5FUYA 2ECKA 4P33A 4TTQA 3K0CC 4QKQA 1ZNXA 5JS8A 3LY5A 5JFGA 1G6HA 4QC2A 2KJQA 2PZFA 1KK0A 4R9UC 4GFDA 4MGYR 2R6AA 3VKGA 3IPYA 2J87A 621PA 4TYPA 1L2TA 4HEJA 3U4QB 1JI0A 2W6ID 5KSYA 1P6XA 4MRNA 4H1VA 2CXXA 1I2MA 2W00A 3IILA 2R6DA 3MD0A 4TMZA 1RRPA 4G5GA 4TMKA 1KY3A 2O8CA 4V0MA 4K81B 1G6OA
chains in the Genus database with same CATH superfamily
1NX9A 2P9QA 3PHCA 1Y1PA 3ZDFA 4CMCA 9LDBA 1YI0A 1SC3A 1CY6A 2CHUA 4BNKA 4NAHA 4A2PA 2OCDA 3KT3A 3TQCA 1WHSA 4FONA 1GQSA 2E87A 3UGQA 4PPFA 5F4BA 1H9BA 3C5CA 2HIGA 3ETHA 3QMWA 3I34X 3A2LA 3MEQA 2EJUA 3NIBA 4O4LB 4PFQA 4YMUA 5I7UA 1JSRA 1D4AA 4TYQA 1JPUA 1KSFX 1SA0B 1ND5A 2C7VA 1WXWA 5A1JA 4GI3A 3PC3A 1Y4SA 4TV9F 4LDQA 1LZKA 1PQUA 2CCKA 3EWSA 1RP7A 2ZUUA 3VAZA 3BA1A 3TLBA 4M0UA 3S2UA 3IXQA 1CY2A 3DS8A 1HTBA 4WADA 2ACKA 4L3VA 3WSTA 3DO8A 1R8XA 1X3LA 2SKCA 1SCAA 2PO7A 4GC5A 1KJZA 3D81A 1HDYA 2VPYA 3ACCA 2YVQA 4M49A 3L7DA 4MRMB 3FLAA 3ILXA 4DTCA 2YIMA 3E18A 2CLSA 2QN3A 4YGYA 2Q0QA 5C5DA 2QJOA 3CH4B 3VPAA 4YCLA 4CF3A 2CDRA 1G9SA 5E4JA 2ZIFA 1E99A 3W7VA 3TQHA 4OXNA 3SXJA 4JBYA 1BX3A 2ZJOA 4HNAB 2H4XA 2TSYB 2SKDA 2NZ8A 3VMFA 4NLLA 3K4PA 1Y1QA 2XE4A 4KI7A 2REOA 4ZPXA 2QRHA 3AEKB 1ISRA 2V65A 5FL7D 4CQLA 4LE1A 2JFHA 3PIIA 4Y6RA 4NPHA 2IHKA 1L5HA 3VPBA 1E8NA 4CYMA 3UMMA 1Z0UA 3KJNA 5EJ2A 2P9BA 1E3MA 4EWLA 1RYHA 4AKEA 3THOA 2DFTA 3QZUA 3DNFA 3FRJA 4HZUA 2X4IA 1SU7A 5B1EA 3QEJA 3R3VA 4PAQA 3BGDA 4CM7A 3RVKA 2O5CA 1BDBA 1NLUA 1X8LA 2GF2A 2QMZA 3CQ9A 3WYNA 4D41A 5J2UA 1CVLA 5FTMA 4RL4A 2NZXA 4N3AA 4TS9A 5EQFA 5BW6B 5JDIC 4L16A 4M36A 1QF9A 2I4OA 2VJNA 4JX9A 2JAUA 1KEZA 1LX7A 2FZLA 1J2TA 4BMVA 3RSZA 3AHDA 2HSZA 4K9PA 1T2VA 1RWXA 3IHLA 1BRMA 3BUSA 4NOJA 1IYZA 4TKUB 4B5KA 2J33A 5GJVC 2EQ5A 2OXIA 3RLIA 2C4NA 4A26A 4UUAA 1O6FA 2ZI3A 3IODA 5HFAA 4DWVA 3RTDA 4S1OA 5L4LA 1KZGB 5ECYA 5IH7A 2WAAA 4BQFA 1I7QB 4ML3A 3LTNC 2CMFA 3KUXA 5BW5A 1XGKA 2BONA 2DJIA 2FMXA 1WDMA 4IL5A 4B81A 4YDQA 1DXHA 4EEXA 4ZI7B 2ACWA 2HA2A 1ZR4A 5FO1A 3BKXA 1XPUA 3TKYA 5LLDA 3ZWCA 3KKNA 5JZ9A 3RV3A 3FTPA 5HRUA 4MI1A 3WLHA 3AUFA 4JT9A 4IVNA 3K70C 4OMFG 2P78A 3K9GA 2GGSA 4B6SA 2LIVA 2QTLA 4MV0A 5I8WA 2QTAA 3RARA 2O2HA 1SXPA 1HOXA 1E89A 2F43B 4PZCA 4IJVA 4UXJA 2IXDA 1T8SA 4JD5A 1QH8B 2OYRA 3H84A 3UXMA 3BXOA 3CWZA 3VDXA 3FCEA 1ICIA 4NY1A 3M5PA 2C5HA 3KQSA 1JR3E 2OV2A 5EG5A 1ZH0A 3JTEA 4MV1A 5AW8A 4HYEA 4H7PA 4AUKA 3Q3VA 1T1IA 5AKIA 2I2DA 2PRJA 4XI9A 3VZDA 4F6LA 5AK5A 3J80A 4EG8A 3ZY6A 4WLVA 1M67A 3M34A 3WWCA 2XVAA 2QRZA 4F4HA 5M04A 1S5PA 2DBYA 3NQ41 1E3IA 3PQ2A 3SD7A 3ABIA 1H0KA 4K0KB 1Z15A 3PLAE 4QICA 1C0KA 2P27A 2JGFA 3IDFA 4C3ZA 3OIUA 4Y98A 4YWHA 3CH6A 1KNQA 2CUKA 2A9FA 3JQBA 3MUNA 2VP4A 1YI1A 2I2FA 3C7KA 4AIRA 1VP9A 1URPA 1JB9A 3P0EA 2Q4EA 4DUPA 4O4HF 2A57A 4MS1B 1NP6A 1K5HA 4XIGS 4KR2A 3IDZA 4OHRA 4RESA 2VOEA 1GPLA 2P9YA 3I2HA 4A8PA 1W88A 1Q7TA 2X1VA 1RJGA 1ETUA 5ALKA 1N0IA 4N47A 4POOA 3DG9A 2R6CA 1B26A 2CCGA 1JFTA 3QHAA 4ETMA 2EEZA 3HWRA 2B94A 3I53A 3KOOA 4ETWA 1P5FA 5DTMA 5CCBA 1JHYA 2I03A 2JNWA 4IR7A 4BO3A 2CLKB 1N2OA 4YRDA 5AI8A 3TSAA 1D7AA 3ZCUA 3JZFA 5A02A 2GAJA 1EFUA 2WHEA 2UV8A 3V48A 4LF7B 4XAQA 2TECE 2FSUA 2FPRA 2QD4A 2IIQA 2X4LA 2MSDB 4I55A 4GP9A 3D1VA 2VN8A 4RQTA 4Q4CA 1PUXA 1BA2A 1IG0A 2VEOA 3VZPA 3C87A 1T10A 3ZJTA 4REQA 4BNJA 1V47A 5BSHA 1V25A 3EC1A 4MDYA 5JXIA 1B23P 4QU5A 4KXQA 2WV7A 1GYQA 3GJSA 1I13A 4BLQA 3SZRA 2GEBA 2EHJA 3ZD8A 5A0TA 4FP9A 1AB5A 3ZLUA 5CLLA 3ZLJA 1LQTA 3WQBA 3FPAA 1RZRA 2OC9A 5LP6C 3MWEA 3A2MA 5J59A 4D45A 4H1HA 4BNWA 1VZ3A 4COKA 3WAJA 5I48A 2ESRA 3SFTA 1NSYA 5K4GA 1FXUA 3I5AA 3PFBA 3Q7TA 5DYTA 1FC0A 5IAKA 3AEZA 3K9HA 3GJ8A 4QNRA 5TQ0A 4A8TA 2XAAA 3KKLA 4NYIR 1CSEE 2MINB 1JR2A 2I7VA 5KYKA 5LZ8A 4EKEA 3OQBA 2QQ5A 4D4KA 3FZNA 4KXLA 3L1KA 4BJ3A 3HM9A 3C7DB 4LTNA 3PB3A 2OGUA 1ECGA 4NFSA 3F47A 1MUUA 1G8HA 5AVQA 1Y7TA 1HNNA 3IIKA 4IMPA 5BSVA 2ZWOA 1AKUA 1D4FA 3USZA 3D2LA 5F33A 3VSDA 4KYUA 4E30A 5B57C 3QVVA 1EK5A 2QLMA 2VQ3A 3G9ZA 2I6TA 4HEHA 2XE7A 4WKOA 4EY3A 2CB9A 4Q9JA 2REQA 1W6UA 1N7HA 1T15A 1Y7PA 3KVVA 1LNQA 1ZMOA 1QO0D 4ETIA 1ZIXA 3N07A 3NHBA 1FXWF 4ESOA 3UMYA 3IKLA 5B6IA 3IUEA 4KQ9A 5JNLA 4UVDA 2CEKA 4DAOA 4TOIA 3DP9A 3CONA 4IINA 5A06A 5I3CA 1KOJA 2OQIA 3BAZA 1N2XA 1RQRA 3ER8A 3ZE7A 2Z5LA 1ADBA 1EYZA 4H7JA 2PS3A 1CDZA 3I5MA 3U7GA 5HIMA 3V8PA 4MAFA 1CQZA 2AN3A 2CNWA 5FDFA 1E63A 4BQNA 2PL1A 2YN2A 4BVGA 2RDMA 3Q6MA 4FZ3A 2YDYA 4XEHA 3TR0A 5JIBA 4Z4EA 5EQDA 3CLSD 4KIGA 2FE4A 3FYUB 2Y8EA 3OX2A 3TNJA 1AKQA 5AQ1A 4G8DA 3HY3A 5FO0A 1A8SA 5KEIA 4A6EA 4BVEA 1KWGA 1TJ3A 2XUZA 5KPJA 1H4QA 2GEJA 2NQ2C 3NTVA 3F5DA 2GA9A 4E3WA 4UBOA 1EVIA 5T41A 2ZJFA 4BFUA 3VPSA 1JEYB 1KARA 2AFIB 4I0WB 3D6VA 3CU5A 4OFWA 4ZTBA 2VDMB 3W78A 3NPAA 1GQYA 3KTOA 3TS1A 3L01A 4XRGA 1F48A 1T6BY 4I50F 1OLSB 3WHPA 3ZDXB 3MWGA 5KX5F 2F90A 1R0ZA 3HP7A 5AK3A 1A50B 4DNXA 5JNRA 1SUFA 2HQ1A 4IFEA 4ETNA 2ZIGA 3DBRA 3EQ2A 2V7BA 2QENA 4GWGA 1TUBA 1S2NA 1NQWA 1E5TA 3IE0A 3J81A 1R3UA 2Y0CA 3HJCA 1SIWA 3O8OB 2DHQA 3VR5A 3TVTA 1SUBA 2E9SA 3HA3A 1D0VA 1Z4LA 5FAKA 3H8VA 4KFUA 3O31A 1RE0A 4PQFA 4JJEA 5IJ0A 5BMOA 3NDPA 4F93B 1LW6E 4LJ5A 3NTLA 4YAGA 3MXOA 2OWEA 5JU6A 3IR6A 4Z5XA 3S55A 2ZSFA 5BORA 1DFGA 1XZGA 2WT4A 3UUGA 3V3TA 1G3IA 4JZYA 3CZQA 4F21A 1N8SA 1SCNE 1Z5PA 1TT5B 1S8AA 1GARA 4FR2A 3GOQA 4LNUA 4URHA 4YJ2F 1FY2A 2MMGA 3QG5A 4E1AA 2RHTA 1FMCA 1HDGO 4X3OA 4CDNA 4DV3B 3C3PA 4LGMA 1ZOSA 1VA4A 2A9PA 3RFVA 1CUUA 1AC5A 4IWYA 4ZARA 3MELA 4EA9A 1M2KA 3R41A 3TZEA 1QQTA 2IF2A 3L0ZA 4FXPA 5TVKA 2VF4X 4NMMA 1CQIB 1A76A 1JJIA 3LQKA 3H5TA 4BMYA 2JIZA 3CUEF 2O8NA 3OLQA 4XWWA 1H3EA 1S3IA 3DE7X 3M3HA 2LV8A 3AF6A 3DVAB 3OOJA 4OB6A 1HNWB 3ANLA 3EBOA 4HDRB 2WFLA 3ABSB 4X44A 2PY6A 4ZRDA 3RI3A 2BSXA 1XTTA 1NG1A 3DOIA 1BMDA 3FD8A 4D9GA 5EWJA 4ZCIA 4WOPA 3KHUA 2JJMA 2XGJA 2O1XA 3RIXA 1EINA 1MO2A 2PZAA 1G59A 3D0RA 4BN0A 4MA4A 2H1CA 1WUKS 3DZHA 5CT8A 1VMKA 4JJZA 2PTHA 3AQIA 5IM4A 2CUZA 3NFYA 4ESEA 4RCVA 5T7BA 1H2FA 1SY7A 1KZ7B 1AHPA 2QK4A 3O03A 3SJBA 4YCBA 4AZSA 4MPRA 5EXPA 3JATB 1IHOA 4UTRA 3QVLA 1C7QA 5CEJA 4HSEA 3P9SA 421PA 2WSYB 3IIJA 4OM8A 1JEQA 3FYHA 3RS9A 2OLKA 4FHZA 4NMLA 3T7CA 1U4OA 3TJRA 2X3FA 2BGNA 3IAEA 2C2MA 3FFTA 2KLHA 4WN9B 3U3RA 1AUQA 3JAKA 3WL5A 2VLIA 3REQB 1D2HA 3PCTA 4BNIA 2FPOA 4J6FA 1GQ2A 1I9CA 3I42A 2JVKA 3T9FA 3TVYA 1BNCA 4OHKA 2NO1A 4WZAE 1WE2A 4MQBA 3VTFA 5DWVA 1NW6A 1S7CA 1TAUA 3WGNA 2VDWA 1MC4A 1WKVA 2XXAB 3AL0C 1P1FA 2BFWA 3IJ5A 2VA9A 1UMCB 3N8NA 1YZHA 4MROA 3WGZA 4C1BA 2OR3A 5HNKA 5DCUA 3IOCA 2BDUA 1GFZA 1DG9A 4B48A 3UXHA 2XRYA 3T3GA 3I9MA 1L5RA 4BZQA 4EK9A 5FBQB 5CXSA 3MK31 4OQEA 4RZ2A 4X1YA 1T91A 2DT8A 5D3ZA 3U3DA 4DBLE 5DHFA 1SCBA 2DUWA 4QBKA 3CMMA 1VKZA 3F9RA 1XAGA 4CZ2A 3VSAA 5JH7F 4QRHA 3KXDA 3EPPA 3WK5A 3UZUA 2OGTA 3KSRA 5HJ5A 4RKFA 3K53A 1YB1A 1M0TA 1ZD2P 4KNWA 2PKXA 2QYTA 5HOEA 1BD4A 1HYEA 2MSKA 2WWXA 1YZGA 3A9CA 3HWX1 4POAA 3NBXX 5IBRA 2A5LA 1WMSA 3CUYA 5B64A 1FF9A 1GILA 3PUVA 1IK4A 4KRGA 4PTYA 4AJHA 4PR3A 3K6SB 3PC8A 1U8CB 3WLEA 3EC2A 4AK9A 5CEFA 3AM5A 4J7CA 4BNMA 4TSFD 3QWAA 1TGVA 1WNFA 4D8YA 3HSYA 2H9YA 2ASEA 2HRBA 1Y9ZA 2B4AA 1QM5A 4RH0A 2C9MA 4FYYA 4NR0A 5JWRA 1SRQA 4LPSA 3F5SA 4E6EA 5AW1A 3A9TA 4U0JA 4F3NA 5AI0A 1EDEA 1LBHA 2EGUA 1GXSB 1Y4UA 2HCBA 1PL7A 2MJLA 3ESXA 2W7TA 3OZDA 4X6UA 2NUAB 4B6RA 2GNOA 4Z9FA 1O8BA 4ZHQB 1IWBB 3C2QA 5H8WA 1TA4A 3IT2A 3PQDA 3VH4A 10MHA 1F1BA 4HH4A 4M9RA 5FA5A 4CDMA 1VRVA 4JUBA 4S0ZA 5BN3A 2ENUA 3JWEA 4WXRA 1YJQA 1Z82A 3HV2A 4NBKA 2YR0A 3HCRA 4OI1A 3OT1A 5E3HA 2PXCA 2H2WA 1I2DA 3IHWA 4G0MA 3NP7A 1LVHA 3FUWA 4GQIA 4Q1AA 1I4EB 2NV6A 2Q1SA 2ZBDA 3HM2A 5CDTA 1Z4QA 3CX3A 2QLNA 1VG8A 5HSGA 3UV6A 4QBHA 5IVKA 1C9NA 2HEIA 4OEHA 2FHSA 1E1DA 1U0FA 2HSGA 2X0RA 2AHRA 5DIFA 3UICA 5FTLA 2W4QA 2YJ6A 2OPBA 3PEVA 3C85A 4W6QA 2R6ZA 5EIBC 3ETJA 3EDQA 4N0DA 1SN7A 3MBOA 5DXAA 3NS7A 4LE2A 3T7EA 3SXUA 2EWMA 4EY5A 2C59A 4I99A 4WTOA 1QORA 1VCIA 3KYIB 3OM1A 3GXBA 3EGDA 3U0VA 1G4HA 5HTOA 4YJ3A 3T4PA 3UAZA 3URKA 3GLVA 2AFVA 3VVLA 2AMFA 4WZAA 3DLCA 3O2JA 2DFPA 5ED0A 1TAHA 4WKCA 5AKZA 2VZEA 1E7MA 4V02A 5EIWA 2VH2A 3MGBA 2ISSD 3RBVA 3AKCA 1SU8A 4DLBA 5KVQA 3BMQB 4Y2TA 3RIMA 1TB4A 3FAZA 3AT1A 1CYDA 1KY2A 1E2PA 5IVHA 2KMLA 1C2TA 2YHIB 4BL5A 2P6RA 3AJDA 1KL7A 3CZ4A 1ODCA 1DKMA 1C3JA 4L3WA 3OA0A 1A5AB 4B4UA 2K4MA 3DQPA 4MPDA 1XDZA 4R01A 1ND6A 1VIDA 3C4QA 1QFJA 5KBYA 1FX1A 1Y3AA 2UXCB 3O82A 1RRMA 5FOUA 5IX8A 4JXXA 2B78A 5GWXA 1TT7A 1XTQA 1YDGA 1A77A 4G4SO 4HVAA 1JAXA 3AHHA 5DX1A 1SHTX 4FYHA 5BO5A 2JFZA 4OV6B 4LZWA 1YNSA 1ZJ4A 2ADMA 2PX8A 4KE7A 3LYUA 4Z1MD 1LPBB 4RX1A 4BNNA 5LP6F 5TPZA 2FJUA 2WJ6A 1GLVA 2B4YA 4NSNA 4K5QA 4XVQA 3ZDRA 4WQMA 3MRXA 1PVDA 4ZV7A 5BYJA 4LZNA 4RVSA 1IXSB 1C7FA 1EQAA 2EWVA 2XSZA 1SUPA 1E2JA 3U5TA 2AFRA 3TDKA 2G6BA 1FEZA 1AKMA 2DBVO 3C16C 1STOA 3B1YA 3ZU5A 3V4FA 2VR1A 3PHGA 3WDSA 3DCYA 3JPWA 5EMLA 2YS7A 4S1WA 3W1VA 3FTFA 5DHTA 1I4LD 2WPNA 3OICA 3RVQA 2J45A 3PD0A 1W1UA 3V5NA 5E4FA 2RI1A 4R3UC 2HNAA 4LHXA 2A1TR 5C35A 1V9SA 3A6KA 4GKVA 2E1RA 3VU9B 3R7NA 1E3TA 2Y27A 1IVNA 5LYYA 1PNOA 1E32A 5ULLA 4GSKA 3HXMA 3HJFA 2VYVD 4JC4A 4H7HA 2WZQA 3JWJA 1TK2A 2XXJA 5C32A 3R8CA 4GECA 2O1EA 1L3IA 1N3BA 2YHSA 1U3TA 3AESB 3I6QA 4NU5A 5CTAA 5JW6A 1OH8A 3BB3A 5EUQB 2V3CC 1E8DA 1ZI9A 1AX9A 5IC4A 4DG9A 1HC7A 3OU2A 1DEXA 1E4OA 1TVMA 1V8DA 3EMDA 3R24A 4ID3A 3UJ9A 5KQLA 1GM5A 4JI0B 1SXQA 2FPGB 3M2PA 4UM8B 4M0EA 5C53B 1N92A 5K8TA 1CLUA 1N9KA 1TJYA 3QRWA 2WVAA 3HP1A 1ZONA 1H2RS 1Q0PA 3INRA 3QVKA 4JKIA 1RQ2A 3ND7A 3LUFA 3TBHA 3OTOB 1QX3A 3KJXA 3ERCA 2I76A 1YKSA 2E4AA 1YU6A 4ZVPA 3RC3A 2ZJ3A 3UKJA 5DYYA 2XYRA 3TTTA 2WRZA 1DHTA 3QENA 2XCTB 3IUJA 4NFLA 1NFRA 2VK2A 2RIPA 4L6IA 4TMTA 1JAIA 4F4CA 4OP3A 5I45A 2D0DA 5DNVA 1MN6A 1J8YF 2YMQA 4I5IA 3C97A 1I0ZA 3E3MA 5BR4A 1R9NA 1H22A 3D64A 3NHRA 1B43A 1QRSA 2I2XB 2LKCA 2ACVA 4J9VA 4ENSA 3TW8A 3N5KA 3HV0A 1YXMA 3AIIA 4J2HA 1HETA 1K86A 1L7OA 1E2LA 3BD6A 1QH9A 1FRZA 3IQFA 1L3CA 3VDQA 2M1ZA 3O4GA 3AM4A 4LMBA 2FPMA 1A3CA 2F3QA 1HQDA 3QVTA 3HR8A 4ENPA 1EFDN 3KC2A 3UPUA 2WVGA 4R6WA 3SEFA 1WQ4A 2H11A 5DSTA 3ZDBA 1P44A 5CRIA 3ON5A 2XQIA 5DBEX 4W5NA 1X15A 3DH0A 3I5UA 1NF9A 4CKEA 4QQNA 1LV7A 3T12A 4R40A 1EFPA 1FK8A 2Z0MA 1VL0A 4AJ9A 2G72A 1HURA 2FX3A 3TGPA 3RAEC 1U2ZA 4LVOA 2NZYA 1MAWA 4F2HA 5KOHA 4EB0A 2QROA 4YAUA 2X8BA 3TLZA 2A5DA 2W4IA 1EZ4A 3N6VA 4WECA 1J2RA 1M2VB 3LA8A 2D0IA 1EHYA 4GR5A 4UREA 3TZCA 3WADA 4L27A 5AXDA 1R0CA 3GPDG 3RGGA 2VUHB 5AUPB 1E9VA 1WW8A 5EXTA 2QN8A 1JVSA 5HQ3B 2AUNA 3IFSA 1NLZA 2H9AA 2WTBA 3CINA 4HDAA 4MR8B 3DZ8A 5DBOA 4CLXA 4F84A 2B4QA 4BP9A 3IAS6 1M73E 4HFRA 3OU6A 4J16A 2A9KA 3RRYA 4RA6B 2PZKA 3NDIA 4QFDA 3QVSA 2JA2A 1PTJA 3NBKA 1YRLA 3T1TA 4EX6A 4ND8B 1MXFA 3RC8A 4CCSA 3DPIA 4HXGA 2PX5A 3HWWA 4IZIA 2F67A 2Z98A 4L57A 4DEXA 3MAGA 4FB4A 2FEOA 3WLTA 3K5WA 4Y1EA 1Q6YA 4HRYA 1WX1A 4MX8A 5G1PA 2NO4A 3RROA 3MT9A 4M87A 2FFQA 2Q6KA 1NLYA 2VI5A 4HTAA 1G21E 1DHRA 4B3DA 2BW0A 4HZIA 1WPGA 2G63A 1MQ9A 3EVAA 4X85A 2JFWA 2WTAA 2R1VB 4ISCA 2H2DA 4ISBA 3KOMA 3NZEA 4MICA 2HMYB 1KEUA 2C2YA 2D4HA 3HK2A 1J2UA 1NONA 4GF5A 4FOSA 3K05A 4E51A 2NYVA 3JQPA 5EIOA 5A7GA 3KAQA 1TZJA 1MIOB 2GBGA 3EYWA 4G4GA 3Q8MA 4LW8A 4PAOA 1KI9A 2PGOA 3CZCA 3QX7A 2VBGA 1O96B 1ZNQO 2BJHA 5FD8A 4FDMA 1E98A 5HCIA 3EOZA 3DM5A 4DCGA 3D8SA 4NCKA 4WE3A 1NX6A 4BMXA 3E0QA 1J8MF 2BTQB 3I04A 3EF0A 3UKOA 4NENA 4EHIA 4KO1S 5DGTA 3V2GA 4XLZA 1CNEA 3CZ5A 1KEEB 2YY5A 2IYEA 3DT8A 3JZIA 3EXG1 3N7AA 3SCZA 2UZAA 3H5NA 3WP1B 4DCVA 2XB4A 4ZT7A 3G13A 4MR7A 3GGDA 3NUQA 3VPDA 1IJKA 3TOXA 2ZI4A 4Q1DA 2DPYA 3E4DA 1DEHA 4RCZA 4E31A 1T2NA 5JS7A 2UU9B 4RE6A 4YUZA 4ZEVA 1GPAA 3Q0IA 1TTPB 3USES 1M0WA 1QCCA 3OQJA 2G09A 3H05A 1MX1A 2XTNA 4XD7D 5FXMA 1U11A 2O8BB 3KSUA 4CVNA 1CEYA 5LZ2A 3OX4A 4U02A 3P9PA 4OHBA 1FVHA 3G68A 4LI0A 4B6QA 3CCFA 4QASA 3OE4A 4RTOA 1IU9A 1TM2A 4KSBA 3PI7A 1Q3TA 2ZE5A 3C6ZA 3VHXB 4KAJA 2Q1UA 2WMYA 4EKIA 4AJKA 1RQPA 2TYSB 1O9HA 1SC4A 4MR9B 5EJAA 2HPZA 1GKIA 3RS5A 4U9UA 4IV8A 3WXBA 1J70A 1AS0A 2YJ3A 4A8JC 2QPAA 3I64A 4R1OA 5D3MB 4PGFA 2C78A 1GHTA 2BZGA 2FN4A 2V74B 2YICA 4HDSA 3LDHA 3VPHA 3BMOA 4BKPA 1QO9A 1R74A 3B2QA 1P73A 3ENWA 5CT6A 3F8TA 4DDMA 1XJWA 3ROFA 2V7PA 1EFLA 4LHZA 3EE6A 8ATCA 1FSPA 2LXNA 2QOEA 2QUJA 4U6SA 4EPVA 1IZZA 1HSZA 2ORWA 4ZGGA 2JKYA 4LJ6A 4V3CA 3DEJA 1P0CA 4XX1A 3MLAA 2QAJA 4DRXA 3TXYA 4GUDA 2OB2A 2O1SA 2X0JA 1FX0A 3WGMA 1MV8A 1G21A 4KR6A 4EI8A 1NVMB 4RHUA 1XK6A 4ZO8A 4N8EA 5J43A 2OILA 1GNPA 4LXYA 5DW0A 1T9AA 1E9BA 1XRJA 2B6NA 4OFXA 5ED4A 1QIGA 2FDCA 4F3TA 2D5AA 2XNJA 1HEUA 4MMZB 4NZYA 4BEVA 1DG1G 5KNDD 1KRXA 1OREA 1OXBB 4IJUA 2BR3A 5K9ZA 2YL2A 3AVPA 3OCWA 4YAJA 5D6NA 3FKJA 3RWMB 3I4CA 4BUCA 4CMEC 5AVZA 2YWEA 1E1KA 2CGEA 4FDUA 4YT5A 2BKVA 4EG6A 3ZGZA 4R7GA 3RK1A 1E18A 1JEDA 3IUMA 1XI2A 2FAXA 5F76A 3N8GA 4NJOA 1IM5A 1EQ2A 2CFSA 3RUIA 3A1WA 4UU7A 2XF2A 4LI3X 2J7KA 5BSFA 5LD2C 2AZMA 3A0UA 2ZJBA 4D9CA 3W5JA 1IZ8A 5C81A 3RSSA 2B2NA 4P80A 3VR1A 1UBKS 2Q1XA 3B1XA 3E9CA 1P1KA 2YQZA 4HVLA 2CLFB 2OM6A 3AONB 1NNLA 1Z7WA 1KQGA 1NJGA 2QX4A 3QKRB 3HA2A 1GUAA 2D0OB 3E3LA 4L8WB 3VSCA 3F78A 1C9EA 4Q0MA 1IBMB 2ZSHA 1WSBA 3W2GA 2RGRA 3FDJA 4FFDA 1ZD3A 1EGVB 1A27A 2ATIA 3NTXA 4PC2A 3TOZA 4PY2A 5JPCA 3F46A 2BP7A 1Y5IA 4HX9A 4MHSA 4UPVA 1RZUA 5JD5A 3QJYA 1EXVA 4HUTA 2Q7XA 2VNKA 4CHGA 3MOIA 3GFQA 5K3DA 4DLKA 1C5KA 1Q74A 1YJ5A 1MGOA 3BTOA 4RO0A 3HRIA 3TI7A 5I7OA 2OY0A 2FW6A 3FCUB 5I9MA 4A03A 3R2JA 3AETB 2V98A 2Q2VA 2IP4A 2C96A 2FEAA 4JUFA 5E7MA 2JVIA 2ZSEA 1USIA 1Y6RA 2ZZMA 3ZX4A 4BQRA 1QFMA 4C7XA 3D0KA 2PX4A 3ED1A 1HQCA 4KPFC 3UJ7A 1LDBA 4G84A 5THQA 1F5NA 3EC7A 4UC0A 4DGSA 2YY6A 1V11B 1PDVA 1MGPA 4B0OA 1RAGA 4URFA 2ISCA 1UBRS 2YOGA 1JEOA 4CT0A 3EH1A 4RUKA 5AVVA 3LMKA 4V03A 1WAMA 5DHRA 1I7LA 1N75A 2PWYA 1VG1A 2IYLD 5A9TA 3G1UA 4IDNA 2IUSA 3Q3IA 1ZP6A 5DM1A 4QG7A 4PANA 3UA4A 1U8TA 2X6RA 3IJPA 2XMRA 4LDJA 2ECOA 2JGIA 3NUGA 5AWFC 4RTJA 1WZEA 5JY1A 3BSSA 2BHLA 4GYKA 3G85A 5CM2Z 3CPEA 1TQ4A 4GKAA 4I1OA 1E66A 2FPUA 1KRHA 1UDCA 2H7YA 5F3DA 4Q00A 4HAYA 3ORYA 2JBAA 5JFTA 2Y4NA 3ENKA 4JOCA 3T94A 5BVHA 3A4NA 3QKSA 3R3XA 4Q3DA 2FR8A 3A26A 5EHNA 4C87A 4MW2A 1HG1A 2EFGA 4TMFA 3HGMA 5HR5A 3M1LA 4JU9A 4EYGA 1QDLB 2BM8A 1Z88A 3IQWA 5JARA 3AF4A 2VYFA 1G4UR 3WJAA 3R9WA 3ZZNA 2VP3A 4GKJB 2QR3A 3EMVA 2BIFA 1AGNA 2BI7A 2EZTA 2ID7A 3OURA 1GTJ1 1V5EA 1UKZA 2C9DA 4H60A 1H8HD 4UHHA 3QV1A 1AIPA 2GZHA 3DOFA 1L5GB 2FFRA 4K7JA 1ZUWA 4KWHA 5KS2A 4YAEA 1CP3A 3EG9A 4ZAWA 4RD3A 2J6BA 5G41A 2INGX 4B34A 2ZULA 2I9PA 1T2FA 5TSDA 1N2CB 4CLHA 1N8TA 2H29A 2EJCA 2FTKE 4IUDS 4TKZA 5IBCA 5D5PA 5E1MA 2YV5A 3FDZB 3BOSA 1EFTA 4FU0A 4PG8A 5JVDF 2AN5A 5THKA 3R9XA 2JDIA 3AR5A 3W6UA 3CG0A 1USVA 5EP2A 4RS4A 1G20A 1X7XB 5LP1A 3BL6A 1E3SA 2Q0XA 3ZIAA 2JCXA 3ASUA 2JAHA 3IBYA 3RK0A 3K09A 1OJLA 4HLCA 2HO5A 2BMWA 4MJ3A 4BO4A 3OOHA 3OD1A 2J09A 3G0CA 3PQFA 1TMGE 3H04A 1VCNA 5TE9A 4B4OA 4Q03A 4MA5A 2HREA 4QXOA 2P11A 4B8ZA 4M9CA 1FFDA 1LPNA 4RM2A 2M1XA 4OHZA 2X0EA 2O3RA 4ZZ3A 1Y3IA 4LJ9A 3ACDA 3SHWA 3WNCA 2H6EA 2XT6A 5E9QA 3Q3JB 1ULSA 4DZRA 5DP2A 3IP6A 4DEYA 2B8WA 1Z22A 3FFBA 1TF5A 2VK8A 3WKCA 3AWIA 4JGBA 1VMAA 3UMRA 4EO9A 2C1ZA 2P68A 4HNAA 5FNVA 4ESVA 1UWKA 3Q3HA 1JG2A 3ZK8A 1GU0A 4OXIA 1CD5A 1BEZA 2EKDA 3QTTA 4Q3OA 5SZIA 4X5OA 4ARAA 2BEVB 5HJEA 4RQBA 4LYAA 5KWIA 1AE1A 3DDHA 2AF3C 5AHRA 5IT9A 3EULA 5B1SA 4IMIB 3LWBA 3FSGD 5CLGA 1EFKA 1VL5A 1XD2B 2I22A 2ATEA 2V7WA 3GD7A 1THMA 2YRWA 2VZ8A 4IOJA 1M6EX 1X1BA 3DAGA 4X20A 3LFTA 4YJHB 3X3HA 4PFSA 1HQKA 4FFVA 5BN5B 2HJRA 2HSWA 1RLTA 4D4MA 5JSZB 3OZXA 1F4PA 4LBWA 4F4FA 4BP1A 1T1JA 2VJBA 3QIVA 3H0KA 1YC5A 2RHMA 3SK0A 5BR7A 1UCFA 3THYA 2WG1A 1ZOLA 3M81A 1XYVA 4H6VA 2F64A 1D7OA 4NEGA 5KSPA 4GZ6A 3ZDAA 3G82C 3IQIX 4GKBA 1B2LA 3PKZA 4OQYA 2G5TA 2ZSBA 2H1OA 4UBIA 5AP9A 2IPOA 4WW0A 1GA1A 1NYTA 1QE0A 1AXGA 1N9GB 3CGGA 4C4PA 4EPWA 3DFMA 4C2UA 3DBHB 4WH0A 5AHWA 2LBPA 3TN7A 5DOVA 1JU9A 5J23A 3U3ZA 1X7ZB 3IVGA 4L8LA 1C3VA 3ESCA 4V24A 5K51A 3BK7A 2OORA 3VR2A 2W6IA 4J29A 3COJA 1J9ZA 5EZYA 1KE1A 1I1QB 4HQOA 5EY5B 1HEIA 2H4HA 4K05A 4G36A 4WX2B 4MVJA 3TQTA 5L51A 1AQYA 2WU8A 4ZI7A 2BOVA 2AD5A 2WW8A 2H06A 2X6TA 3DXXA 5A4KA 2O5EA 4G1UC 2PUDA 5IDQA 5TY0A 1MFZA 2ZRBA 3OPYI 3P5SA 5LXTA 2FDRA 1WG8A 5IYZF 1ADGA 4IICA 4PG6A 3FKQA 3R7AA 1FDSA 2YXLA 3WBJA 1UZNA 3AKYA 4A4DA 3NDJA 1NHWA 1SXHA 4PXAA 2QX7A 4ERXA 2V4UA 5L6LB 1E8MA 2DKOA 3HNRA 2F3SA 3IV9A 2IYSA 2AGVA 3E61A 4RA9A 2IYFA 3X1KA 5DLPA 1SU4A 2DZDA 4F3YA 2B82A 2HV8A 3LUPA 4HCJA 4QYXA 5COQA 1BWRA 1JU4A 1MG5A 4UBNA 4D3FA 4DLRA 1IULA 2Q6VA 1ZWKA 1T6XA 3TI9A 2HHHB 5AW6A 1W5AA 5IMSA 4ER5A 3KKMA 4RKRA 4HWSA 5DWQA 3ILYA 2HJHA 4AWBA 1O0CA 3VJMA 1YE3A 1G3RA 4DA9A 1CB7A 5DTRA 2EFHB 1UK7A 4QZVA 2O5RA 3RU3A 2BGJA 3TNFA 2R2GA 4IH9A 2D62A 1TD1A 2C07A 2GPYA 3O8QA 3S28A 3AX6A 4QU9A 2PBRA 4HXFB 3REFA 4JJAA 1W2HA 3DHEA 3F73A 4UEJA 3GZJA 1EVQA 1JXMA 3WYGA 3ROGA 2IL1A 1IONA 2GN4A 2V0CA 3BJEA 5SY9A 4BV3A 5ILOA 3IUSA 2DR2A 2FWIA 1P9NA 3MNFA 3A0RB 2YWCA 2OV4A 5T4BA 4KRFA 1LJ8A 4ZYWA 3GL9A 2QZ4A 3OY2A 1WDTA 3B48A 1JR6A 4HS4A 2ZWMA 3O47A 1R5BA 3R3WA 5CJ2A 1NQ5A 3FR8A 3MQ4A 3VGPA 3NAQA 1M1XB 3LNCA 3DDOA 3LC7O 4B4DA 4MKRA 2AHOA 5FL7A 1N6PA 2C4MA 3LLVA 4X92A 3RC7A 3ZHXA 1UPCA 2TMKA 4EF4A 4CR7A 5E2IA 3CF6R 1AK9A 4L02A 4I3HA 4CODB 4W8OA 3H19A 5B3JC 5DM4A 3GUVA 3GRYA 3I2YX 4IIJB 4HHEA 1E5LA 1A72A 1FBTA 1GCIA 1NKSA 1PFQA 2HX1A 4NH4A 4R7ZA 4MJ7A 4EVQA 1OI3A 4ZDIA 4JLNA 5H4HA 1QGUB 3D8UA 3P71T 5KAPA 1QU3A 1KFBB 1AV7A 2QTBA 2GJSA 4DQ0A 1XBTA 1NVAA 2HLHA 2LE0A 4PN7A 1XTJA 4IAOA 4FWIB 4A27A 2MMCA 4G2TA 1WHTA 2C03A 2WWTA 3G7SA 3VDRA 3ZTTA 1EZ1A 1USUA 4QFMA 4W1QA 1V6CA 1C4XA 2QG4A 2AXQA 2ZTLA 5JZOA 2XQKA 5JDCC 1LGYA 2ORYA 3VZSA 1Z4MA 4FYVA 2GCEA 5CFNA 3CUSA 1W94A 2P5UA 4N6OA 3ZVRA 3GJTA 2OENG 3EFEA 2DY0A 5CVVA 1OFHA 3TTSA 4CTMA 4N4AA 2XJ9A 2Y76A 4J1TC 3QFRA 1N32B 4AJNA 1S1CA 3Q7SA 3RVRA 1UEXC 1DBRA 3V8EA 1RQLA 3JR3A 4PVDA 5AOBA 1KS2A 1WXIA 1Z56C 2QSZA 1UKCA 2CMHA 3TIGA 2QZZA 2VF7A 1P4RA 1NFFA 1CNFA 4JA2A 5JYEA 2HU5A 3LSTA 3DR5A 3R0VA 4XPIA 3D5EA 4IILA 2FUKA 1QHHA 3ZK9A 2VTBA 4PG7A 3UAGA 3ZY2A 2I3ZA 1R27A 5GZ3A 1R4MA 1CR0A 1TUGA 1BMQA 5A4MS 2F1JA 2ZTVA 3CZMA 3KQTA 1YBVA 1YASA 4X7PA 3UH0A 4L22A 3D3JA 3S27A 4G6ZA 3EZYA 1NXVA 2QT1A 1CJBA 3KUKA 4OFZA 1BE0A 4II3A 4IGFA 4QGFA 3EAGA 4HVCA 5I4IA 3D6HA 1DJPA 1VLZA 2G76A 1EX1A 4R9SA 4FN4A 4GRIA 3CO0S 1RCFA 2GUWA 2UZ1B 3HKDA 5JAMA 4FFBA 4EQZA 2R1ZA 3IE1A 2Z6AA 4FILA 4L5BA 2VTKA 3LUAA 3ROEA 1UXHA 1OGJA