4YC7A

Crystal structure of human fmnl2 gbd-fh3 domains bound to cdc42-gppnhp
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
179
structure length
179
Chain Sequence
AMQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQRGLKNVFDEAILAALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of FMNL2-Cdc42 yields insights into the mechanism of lamellipodia and filopodia formation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Formin-like protein 2
total genus 60
structure length 179
sequence length 179
ec nomenclature
pdb deposition date 2015-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4yc7A00
4QJ5A 4TN1A 5CM8B 1EX7A 5E3HA 1YR8A 2Q9AA 1T5IA 2VL7A 4PO1A 5ELXA 2EVWX 4FMCB 2BBOA 3TIFA 3PEUA 1R5OA 1W49A 1DG1G 3IBYA 1SKQA 1GVNB 3Q5EA 4KFRA 4DSUA 5JMTA 1V43A 5KO2A 1NG9A 1G5RA 1W0JA 3B1ZA 1L7VC 3DOEA 4LCBA 2WVJA 4E03A 1KO4A 5BN4A 1ANKA 1KK3A 5FBQB 3SJZA 4BZQA 3UG7A 2A7QA 1XNJA 4IEEA 4Q1EA 2ZI4A 4IXNA 3QKTA 3WMEA 5EP2A 3IIKA 3NBFA 1XZPA 3QEOA 3BH7A 1M7HA 1M74A 2FPMA 2BIFA 2ZSEA 4ZIRA 1OXSC 1OYYA 1GIAA 1ZM9A 2O8FA 4ZDIA 1MO3A 2NTYC 1OIWA 2GHIA 2OCPA 1OLOA 3B82A 3C41J 3WYAA 4IKEA 3GLIA 2PCJA 2G6BA 4GT1A 1KHTA 5L8VA 1E1RA 4Z8YA 1W36C 2XITA 1UF9A 2AK2A 4E5UA 4PPNA 1IXZA 3W6PA 3R7WB 2V4ZA 3ZLJA 4DJTA 2P5TB 4L9SA 1VG0B 2OESA 1R8QA 2HXSA 1XXHE 3KQHA 1ZD9A 3W5IA 4W5HA 2ZSBA 1ZM7A 4TT3D 1G3MA 1KJYA 1DE0A 2ZS8A 4DLYA 1KI8A 1T8TA 2OCYC 2DBYA 2ORIA 4TT3A 1IN6A 4CF7A 1NN0A 3Q3JB 1E2PA 3KZ1E 1TMKA 3QENA 4POAA 2N46A 4NDZA 1NN1A 4UNSA 2GK7A 3H84A 4TQUS 2AHOA 1D6JA 1FUKA 1J8MF 1JEEA 5P21A 3QY0A 1DEKA 3M1IA 2AD1A 2HXYA 1IQPA 4HZUA 1VCIA 1XMIA 3R9XA 4GNKA 3PR1A 1VKJA 3T5DA 2JAQA 4IDQA 3UG6A 1KDOA 3ZS9A 2HF8A 3L43A 1T3HA 3K0EA 4B3GA 4MRPA 1OIVA 4O2RA 1PJRA 2ZEJA 4P3YA 4Z51A 2HT1A 4TLCA 2YWFA 3PCRB 4JJZA 4D4JA 4RFVA 3Q9LA 1F2UB 4Q1AA 2RGNA 1TUIA 1YZQA 2PZEA 5L3SB 4WA7A 2GF0A 4PAQA 1OHHA 3EWAA 4HLUA 1HE8B 1TQ2A 2ZANA 2J7PD 4I1SA 1Z6YA 4M9QA 5EXSA 5AK0A 4B35A 3PJRA 4US2R 3SYKA 1AIPA 2V6IA 4N1AA 4QBHA 1V5WA 2HEIA 2RGGA 4Q01A 5FTNA 1E2KA 5BQ5A 4RSGA 2DB3A 3TBKA 1Z3IX 3PEVA 4K81B 3VNVA 5JJLA 5JSZB 4TYNA 3QPWA 1KSHA 5CK4A 2R9VA 1UBFA 1X8JA 621PA 4ZDJA 1SXJE 4PQFA 4MGZR 1MO6A 2GDJA 2G3YA 1TF2A 5KOYA 3B78A 2YYZA 2WOJA 4NU0A 5J4YA 4PZZA 3GJ6A 2ZRDA 5BW8A 3SYLA 4DSTA 4KI0A 1P72A 1UBEA 5HE8A 2J45A 3NH9A 1ZP6A 1L4YA 2D2FA 2GBLC 2OZEA 1UPTA 3FMOB 3GJ5A 2C96A 2BEKA 4OKSA 1OFUX 5DGXA 1XD2B 1E0JA 1PLKA 2Z4RA 2RGCA 3ASZA 3QKRA 1XMVA 3A1UA 4AYWA 3MJRA 2WAXA 1OKKA 4BFUA 5F9HA 1JR3D 3BRWD 3F5FA 5L3RA 3IKJA 4JIMA 4M9SA 3KQNA 1OKKD 2OHFA 4GZLA 5J47A 3D8BA 2FJUA 3GLIE 4KLZA 3TW4A 1IXRC 1E4YA 1W5SA 2F3TA 4JBYA 4DWJA 3I61A 5C18A 4Q02A 4WXRA 1NLYA 4OYHA 1T5LA 3EPLA 3WYGA 4NYIQ 2IXGA 3OIWA 2CE7A 4DSOA 1Z28A 1E9DA 3LX8A 2W6IA 3I72A 1G6HA 2JJ1D 4UNRA 1UDWA 2O8EB 4Q7MB 2QGNA 1GDDA 1G41A 221PA 5TY0A 2AXNA 4LHXA 2MMCA 4JSTA 5JWOA 2ZRIA 3B60A 1FNNA 3EPHA 1IOZA 4B34A 2OUKA 3GPLA 3TJZA 1S96A 4G5GA 4M8NE 3SDZA 3GEIA 3R7WA 3BGWA 2F7SA 4Q9KA 1MT0A 4G3XA 521PA 2D7DA 2NMVA 3CRRA 2GZDA 1WQ1R 3HU2A 4GMXA 4LYJA 1S1CA 1SVMA 3RABA 2WHXA 2WZQA 3X1XA 4DZZA 5EZ5A 2P0EA 1P9WA 1ZU4A 4OI1A 2NO1A 1W47A 4OI0A 5IDVA 4US0R 1KK1A 2ANCA 2CK3D 3MWJA 1G1MA 4L5BA 1T3SA 4EPXA 1C1YA 3OIUA 1OXVA 4MKGA 2ORVA 4Q18A 4MYUA 2J9RA 5E7MA 3WRYC 4OHXA 1FUUA 3EZ7A 1TQDA 3DO6A 1X8LA 2GAOA 2C78A 5J4VA 1G7TA 1GUAA 2W0MA 4B6FA 5TXGA 3AEZA 4E07A 4C7OB 1W2HA 2B6HA 4OHZA 3CF2A 2F1HA 4MUBA 1RW4A 2JIZA 3ONWA 5FOVA 2IF2A 2IL1A 2GJSA 3HU3A 1TQ6A 1G5PA 3IHWA 1Z0IA 4MKFA 3RS7A 2HYDA 5DISB 1G4AE 3BIFA 3LW7A 1H65A 5FH9A 5FOTA 2W6JD 1P3JA 2WSMA 3CR7A 4CVNA 1ZMXA 1PUJA 3S1AB 4NCJA 4YDHB 1CKEA 3RVBA 4CYMA 3ND9A 3SBEA 1XRJA 4A2WA 2VO1A 1U98A 1E2MA 4MQBA 4XIGS 2CHQA 2EFGA 1G3QA 3A1TA 4URUR 2D62A 3P20A 1Z8FA 3L0PA 1G7SA 3A36A 1SXJC 5FTMA 2VP4A 1JAIA 4AURA 1SKYE 3WBKA 1E0SA 2Z43A 2Q0HA 4N0DA 3UMFA 1E2QA 4BFYA 2IYUA 2A30A 2P6NA 4DRZA 1NIJA 5TMPA 3Q72A 4OHVA 3A37A 5GJBA 1S3SA 1TAGA 4JZKA 4O25A 1GP2A 4B3DA 2VP5A 1EFHA 3I4LA 2ZE8A 2WWWA 2Y8EA 3M6AA 4MRVA 5JS7A 4G5QA 4C9BA 1EGAA 1ZCBA 4DLSA 4HZUB 2P67A 2ZREA 4NTZA 2ZRLA 5AJVB 2ZJ2A 5H1YA 4A4DA 3R20A 4TLEA 3AVWA 1G3IA 4B75A 3KKPA 4IDPA 1E2DA 1E98A 4WZ6A 5FR1A 4P4SB 2VRWA 1CXZA 4PC3A 1MH1A 2VF8A 4LK2A 5EJEA 1X8KA 4MGIR 2QE7D 1ZM3A 3EZ9A 3A8TA 4M21A 2OO7A 3CRMA 1TEVA 2QEQA 1QBKC 3ZIAA 2FWRA 1YRBA 3C15C 4V0LA 2GXSA 2XZOA 4IDOA 2A5YB 1XPUA 3SHWA 2JLWA 1XU4A 4TTQA 3E5HA 1KY3A 4WW0A 3LX5A 5EQTA 1P4SA 2X2EA 3ZVLA 3I62A 1CR0A 3H1TA 2G1JA 4O3MA 3MLEA 3V4FA 4ASUD 2OAP1 4LI0A 4TTRA 3UKDA 4YLGA 4DCUA 2N1BA 4H9GA 4ASUA 1KDTA 3HDTA 2NQ2C 3CRVA 2FA9A 5LPNA 2QU8A 5C46F 2FG5A 2CVHA 1LS1A 1M7GA 1P6XA 2H5EA 2CCKA 3AH8A 3NKVA 4IRUB 4BASA 4AKHA 2YWEA 1KI9A 3PQCA 3EIHA 2OM2A 4Y0AA 5JBQA 2QRZA 4RJLA 1G8FA 1UADA 4XWKA 2ERYA 2GCOA 2CL6X 1Z6XA 2CL0X 1KO8A 4LRWA 4QGGA 4C0KA 1GKYA 3REGA 4R98A 4Q4JA 2B8TA 2YINC 3AF3A 3O8DA 5EXPA 2NZJA 4K46A 1OH6A 2NG1A 4GDFA 1G16A 3V4RA 1FNMA 3BERA 1ZUIA 1W4BA 2OAQ1 2WKQA 3ZVNA 4EUNA 4KYIB 1JXOA 4IVPA 3CNNA 4K8OA 1E9AA 1XXHA 2R2AA 3IQXA 4JVLA 3X1YA 4URZR 4RD4A 2PLRA 4OHWA 3SR0A 4B3BA 3B7GA 1G18A 3ZZUA 1R7RA 2OE2A 3AF2A 4C0SA 2GXAA 2IYZA 2JDIA 1XBTA 3F0TA 3CX7A 3RHFA 2KE5A 5A0FA 1GM5A 3JZAA 4OQFA 5D3QA 4QFMA 1E9CA 5IK2D 4KITB 3K0CA 4B43A 4B2IA 3OIYA 1GITA 2EWWA 4FCTA 2IF0A 3VR6A 3HP1A 1E1QA 1CULC 1Q3HA 1P61B 3G82C 1P5ZB 4DLTA 2GEUA 1NG1A 1TUEA 2GWHA 2QMOA 1KI7A 4C2TA 1CR4A 4QJ4A 4PC7A 1LV7A 2BMEA 4JL8A 2LKCA 4FXPA 2REBA 2QNRA 4NCIA 2VHQA 2RGDA 3LLUA 3NEJA 4MYTA 4DCVA 1TNDA 1VHLA 4EJSA 1DO0A 1RFLA 1W1WA 2CMKA 4U5XA 5BYJA 3VKWA 2OBNA 2ZVQX 1N5JA 1NLZA 1ZUHA 4H1UA 2Q3FA 4JLVA 1JR6A 1W0KD 4MA4A 2FFBA 2IYQA 2IYVA 4Q4LA 5JWRA 2WWIA 5EXTA 3BE4A 3C16C 4JJKA 4EPYA 2Q9CA 3TSZA 1RZ3A 4L8GA 2GF9A 4V02A 4GP6A 5JSZA 3SHFA 4GOXA 5C1BA 2BC9A 4DUGD 3RC8A 2Q3HA 1KDPA 1OIXA 1VCOA 2BM1A 4CEHA 2UZIR 2ZRHA 1R0XA 1SXJA 4QGHA 3MWYW 3M4YA 5J40A 2XTZA 4CT4B 1D5CA 2V7QD 1JJVA 1YZGA 3ZZ0A 4C4PA 2OFXA 1XTSA 1Q0UA 1A2KC 3OIVA 1E2LA 1S9DA 2CHVA 3LQRA 1FTSA 3ADDA 4DIEA 3B1YA 2PX3A 3SEAA 1VTKA 5LDDC 3THOA 1MABB 2K5UA 2V8OA 4F4JA 4FMDB 5K8LA 5FPYA 1DAEA 1P2VA 4Q03A 4GP7A 1NVVQ 3AF0A 1ZINA 1Y63A 3HYTA 1KYIA 3BC1A 5CIWA 1Q1EA 3AUXA 3CPEA 2AR7A 1KAOA 3BBPA 1R0WA 1EFTA 3EZ6A 3RWMB 2DYKA 1GNPA 4D6PA 4B2LA 4W7SA 3GCGA 4NCKA 2ZYVX 5KDOA 4BFTA 3FWYA 2R65A 1HT2E 3U44B 1X1RA 3ZVMA 1AA9A 1CIPA 4LGMA 4PO9A 4Q4JB 3K0FB 4RCYA 2IHYA 3WNCA 2PH1A 4DDWA 2QPTA 1M1YE 1G64A 2HLDD 3K1JA 1EXMA 3QPUA 3U7FB 1S3GA 5HKKA 3FMPB 1AS0A 3KJIA 1QHIA 3QKUA 3QF4A 4XWAA 1G8GA 1ZBDA 1BO6A 3SJAA 3VKHA 3P27A 1HA3A 3O8RA 2BOVA 3CW2A 3HJNA 4QNMA 3CPHA 1COWD 3CZPA 3KKNA 2IS4A 2WAYA 2ZJ5A 2ANBA 1UKYA 4R9UC 5GJVC 1KZGB 1Z6GA 1EFCA 3B1XA 3QBTA 2G9NA 4C0QC 5EXXA 5C4MA 5FPHA 4E09A 2V6JA 2NOAA 3A1SA 3UANA 2QTFA 1VG8A 1P73A 5DHFA 3OHMA 4XJXA 4TYQA 1AQUA 4A2PA 1E79D 1FPMA 1DARA 5DI3A 2EWVA 1NVWQ 1P7CA 3EA5A 3MWKA 4L9WA 1Q44A 4TLDA 1NBME 2CJWA 5F2EA 2ZE7A 3VU9A 4FMBB 4ACBA 1AK2A 4CDGA 2ZJYA 1JR3A 1II8B 2C2HA 1ZW6A 1K8RA 1I4DD 3IBGA 3Q8XB 4GMDA 4A82A 1HEIA 4PHGA 4US1R 4BFVA 1YVDA 2F1RA 2RMKA 4N0EA 1SQ5A 1JAHA 1F60A 1MR3F 2ODWA 5HZHA 2V1UA 1M34E 3JVUA 2XSZA 1N6NA 4P4SA 3U3RA 1CRQA 2XNSA 1NLFA 3LDAA 1ZD1A 4O0MA 3T61A 4G5OA 3WXMA 3LO5A 3O47A 2FFAA 2YKGA 4Q47A 2JASA 3HPQA 1GILA 1CTQA 3QXCA 2Z0MA 4I1UA 2CDNA 1PLLA 4GI7A 5AUOB 2E87A 4JSYA 3NXSA 1E2EA 4PSKA 4R71A 2ZPTX 3VR4A 2IWHA 3T1TA 5CYOA 5L3QA 5HTKA 4Z54A 3U5ZB 1BYIA 3HR8A 1ZM4A 1N2CE 2J41A 3VQTA 1GZSA 1R6BX 2JJ8A 3AGQA 2HT6A 5FUXA 2H8KA 1E2GA 5CLLA 1RVDA 2V9PA 1T91A 3LD9A 1DADA 1UDXA 3EPKA 4D0LB 1ESMA 1SXJD 1JEDA 1N5KA 2RGBA 4ZO4A 2F43B 2NGRA 4QHTA 4Q4HB 2QA5A 3KTAB 1CRPA 4C30A 2NO0A 5TV2A 5G53C 1I2MA 3B5JA 2JGNA 3QE0A 2CE2X 3SE0A 1E9RA 4QGAA 2QAGA 1Z0AA 5M04A 4ARZA 4FWTA 2AL7A 3ND8A 4TYPA 5AUNB 1T3LA 2AXPA 1IY1A 1RJ9A 3C8UA 2KBEA 1KTVA 1RRGA 5HE9A 5KPJA 1RRFA 3EARA 3E1SA 5DYGA 1I4LD 4MUAA 4WAUA 1Z2CA 1G5TA 4V0OA 4IW3B 4S35A 1TL7C 2ZJAA 1N6IA 2Z5FA 5AR1A 3I73A 2CEAA 4OQLA 1A1VA 4LBYA 3B1WA 1F3OA 4PC2A 1RYFA 1VYVA 1G21E 3P32A 5LB4A 4F7WA 2QAJA 3WNBA 4C0BA 4YMUA 2P6UA 4ZKEA 2WIAA 2CHGA 4EPTA 1AS3A 4NKRA 5K8IA 1J99A 5FOUA 4Q66C 3OZXA 3KB2A 1Z0KA 3LXRA 4Q1DA 4I4LA 5FOXA 1N6RA 1WE2A 4DLWA 2GKSA 3QBVA 4YXWA 4AC9A 1N3BA 5ANRB 4ZPXA 4B3CA 3QKSB 4BFZA 4EKDA 5JHHB 2F1IA 3TLXA 1CU1A 2VP9A 5SZKB 3U6BA 4URYR 4UXJA 3C5HA 1ODFA 1FX0A 3NWJA 1KZ7B 4BLTA 3FTQA 1RE0A 2WM9B 4X8MA 4LYFA 2PLFA 3BD9A 4O2LA 3OAAA 4B32A 5JCPA 4HAWA 2ZSAA 1KI4A 5DI3B 3CZQA 4Q7KA 2QUZA 1Q21A 1ZNWA 3DM5A 1DO2A 1X1SA 4PQYA 5KSPA 1DVRA 5GJCA 3GLFA 2V7QA 3CF0A 2B8WA 4JL5A 2X2FA 5E4FA 3THWA 1ELOA 2OG2A 2KSQA 3GJXC 1W0JD 4F38A 2O0KA 1OH8A 5JI3E 3DHWC 3BH0A 3ADBA 3IGFA 4HB3A 3C4JA 5JLJA 4HAYA 4OL0A 3AVOA 2JCSA 1F6BA 4G1UC 2BMDA 3WBJA 2O8BB 3PENA 1CJVC 3HYRA 1FQJA 4NCNA 3GFTA 2G0NA 2YZ2A 3ZIAD 2GNOA 1OF1A 2XJ4A 1ZIPA 3SNHA 5CDFE 1EG7A 3O8BA 2VSFA 5B2ZA 4C0LA 3GP8A 3ZGXA 4RY2A 3PUVA 4MYCA 5LBIA 5EP4A 4CEJA 3SJBA 3SC3A 2AWNA 3DMDA 4XSHA 3EW9A 2QG6A 3R9WA 1BH2A 3KKMA 2P5SA 1ZM2A 4Q5IA 2QP3A 3H2YA 4W5JA 4LJ5A 3TE6A 4AG5A 5HZKA 4NYMQ 2PJZA 3EC2A 3U4QA 2JATA 3THXB 2QMEA 4JYBA 3L0SA 1OE0A 2ZJZA 5CITA 2Z6VA 4IJMA 3GEHA 1VIYA 4NL4H 1TQ4A 3MD0A 5SZIA 2P6RA 4L16A 2GCOB 2B7BA 2FU5C 4HDOB 4LSGA 4E22A 4HAXA 1M2OB 1E9EA 5TB5A 4MH0R 5L3SA 1P60A 2EFCB 2WIBA 2YWGA 4HI0E 4DUGA 4YQFA 2WJVA 2J0UB 2VHUA 4F91B 3FKQA 3QXHA 4PSAA 4P32A 3DM9B 4UQOA 3U44A 2B7CA 1NVUQ 4F4IA 1ZUNB 3P26A 4D4KA 2REOA 3GLGE 4XVRA 4DBLC 3QJYA 1IN8A 2IWRA 2EW1A 2Z4SA 3DVLA 4DT1A 4B48A 1U8ZA 4WOPA 2BJWA 1LS6A 4MKHA 4OQNA 2O0JA 4P4UA 4EFNA 1G8HA 1KO7A 2VLIA 2JIZD 4IFBA 3K09C 4TL8A 2ZI3A 2F1JA 3T1QA 5LD2B 2ZRBA 4CEJB 3PITA 1RYHA 2H7VA 3WHKA 4B6EA 2FGKA 1HUQA 1W44A 4Q4AA 2BKUA 2QBYA 1EWQA 1LW7A 1YR6A 2PBRA 4QBGB 3T12A 4M53A 2CNWD 4PHFA 2PZGA 4HLUC 3ETLA 4DDTA 1UBCA 2QI9C 4XD7D 4OI2A 2SHKA 1UFQA 3PUYA 4B76A 4YC7A 4LV5B 3BWDD 1N0UA 4HAZA 4KVGA 1R5NA 2J59A 5CYPA 3UIEA 3IEUA 3ZDQA 1BYUA 1LY1A 1XTQA 4JT4A 1JNYA 2WOOA 2X77A 3B85A 2AX4A 4GL2A 1E1RD 4DDUA 4DLUA 3HPRA 2ZVPX 4LPSA 4V03A 1Z83A 2QSZA 1EK0A 3MFYA 2DCUA 3FHCB 2PX0A 3EA0A 2XZLA 3BB3A 2A5FA 3EASA 1GAJA 1II8A 2IYLD 2VYFA 3BOSA 2O8CB 1EFUA 3SQWA 3OFND 2IW3A 3IILA 5AJZA 1AZSC 2GK6A 2QQEA 2C5LA 3AKYA 3TAHA 3GLIB 2G88A 4A6XA 1G291 2JJ2D 4AK9A 1E96A 1KNQA 2FOLA 2QAGB 4IOJA 4KJZA 5C2JB 3E2IA 4QOSA 4J0QA 4B71A 1OT3A 3A4LA 4UNPA 3IHLA 2EQBA 4BFSA 1N6PA 4QBFA 1N25A 4EPVA 1QHHB 1G20E 2JLUA 3I92A 3U6KA 2PZFA 4LBZA 4TYYA 5G40A 1WBBA 1S1MA 3SI7A 1P75A 5IK2A 2J3EA 3T15A 1T0JB 1GG2A 4JS0A 2V55B 3EAQA 1CR2A 4CRWB 2FSGA 4GZMA 4YONB 1E99A 3TVTA 3ASYA 4R7ZA 5JI2E 4W9MC 1Z5ZA 4JLPA 4D4LA 4EQ6B 4DEYA 3IIMA 1VIAA 1X86B 2VTKA 3QXJA 3IUYA 3OEEA 2PJRA 2NPFA 2X8AA 2PEZA 4YMVA 4QM7A 2XX3A 3OEED 2WKPA 2EYQA 2PT7A 5DH9A 2DY1A 2Q6TA 1NMYA 5FUWA 4TL7A 2J0QA 1F2UA 4C0HA 2QPAA 4QKQA 4AKIA 3QVVA 3VAAA 3DKPA 3BJIC 1G9XA 2NO7A 3NBXX 2WMOB 2BKEA 3DEFA 1NI3A 2DFLA 3QSYA 1HH4A 2WWHA 4MGKR 1EESA 2DWOA 4A0GA 4FD2A 3NHBA 1J2JA 1CR1A 3QI2A 3GLGA 1JQJC 1ZC4A 3CWZA 4MITA 4OK3A 2BM0A 2P65A 4D81A 4TMZA 4YXWD 5EE0A 2ORWA 2A5DA 4EFLA 3UXMA 3CB4A 5E7JA 3MSXA 4LWZA 2QT0A 3NIBA 3CKLA 1L4UA 3IDQA 1FL9A 1G8PA 1NF3A 2IHBA 2D74A 4PHTA 1KO5A 5FL7D 1E9FA 4KXFB 2C9OA 2GZHA 1U0JA 3FMIA 4ERNA 1DOAA 1PVOA 3GD7A 5JRZA 1XD2A 2WJYA 3QKRB 5J5CA 3U7HB 2MMGA 3FGNA 3OE7D 2GEVA 2QM7A 4CEIA 1W46A 4A6PA 4N3NA 2WSSD 3QVUA 2V3CC 2WKRA 3RS5A 1UJ2A 1LNZA 3IIJA 1TF7A 4KODA 5SZJA 4LJ4A 4G5SA 2EFDB 4FCVA 2B21A 2QGZA 4DXAA 4MGYR 3SU8A 4QC2A 4OQMA 3LNCA 3THXA 2QT1A 4FN5A 3L0OA 4PX9A 2GBLA 5F9FA 1UKEA 2FSIA 2W0SA 3I1FA 3AKCA 4RD2A 3RS0A 4BRUA 2IEZA 1FP7A 1HY3A 2EYUA 5IRCD 1RRPA 1X6VA 1T8UA 4FINA 4Q1BA 3LWNA 2NZ8A 4KBFA 2AKAB 4TQAA 4BUJA 3BFVA 1KMHB 4ILEA 4MRRA 1QHYA 3DZDA 1QHSA 2RCNA 3T1OA 1KSGA 3ZS8A 4EJSC 2C95A 2FPKA 5FOWA 2HJVA 3B8HA 1XB2A 4JVSB 2F6RA 2HYIC 2QQ0A 1W0KA 2QROA 4B2PA 2IYSA 1WBDA 4AD8A 1QHNA 3W8RA 4DT1B 1IJFA 3GJ3A 4BQSA 2R6DA 5J4KA 3A58B 1OXTA 3AKDA 1XF9A 1FMLA 5B58C 3TW8B 1XEXB 1RC8A 2CLCX 2IXEA 3U3OA 3AP3A 3OEHD 1IHUA 2FFHA 2VH5R 3GLHB 1DPFA 1EFRD 1XX6A 4B3FX 5B30A 2J1LA 3UPUA 3EIEA 5KHOC 2AFHE 1ZRHA 1EWRA 2UZ3A 4Q4HA 3TAUA 2N42A 4Q48A 1M7BA 1E94E 5C4GB 4KSBA 1YZKA 3PUZA 4TMKA 2PT5A 3RRYA 2QY9A 2O8CA 1NBMA 3Q7PA 2NPIA 1VHTA 3SZRA 1MO4A 4NYJQ 1AJEA 3TUJC 4PZLA 2TMKA 4ZDKA 2QENA 2RKOA 1O87A 2IUSA 4QHSA 3SJCA 2F9LA 4IXMA 1M8PA 4D80A 1R0ZA 1XCPA 4TMVA 2ZS9A 1U8YA 1QHGA 5A4JA 4DVGA 2YWHA 1DTSA 1D2NA 1KK2A 2AWOA 1U81A 3AF1A 4IFEA 2OSBA 2YV5A 2JJ1A 3ADKA 3K70D 4GBMA 4I1VA 1AKYA 3TNFA 1KSFX 1OFHA 1BIFA 3N70A 4PHHA 5DN6A 2D2EA 3B1VA 1G4UR 3RANA 3DDCA 1E0AA 4M9ZA 1Q3TA 2YOGA 2IYYA 3KKOA 3JZMA 4NMMA 5FFMA 3U3MA 2AK3A 1WF3A 1R4AA 1ZC3A 2QORA 1IXSB 1QZXA 3CWQA 4LJ8A 1XD8A 5DNYB 3LVQE 4G0NA 4RD6A 3PEWA 1YHNA 3GLHE 3I8SA 2GJ8A 1NSFA 2CK3A 3DPUA 4QL3A 3KQUA 4URWR 4OQXA 4URVR 1QF9A 2VBCA 2YVUA 4DIDA 2J0UA 3O8CA 5JHGB 1GNQA 2GTPA 4D82A 1WMSA 1ETUA 1T4GA 4C7OA 3AVQA 3T06B 1E0KA 1DAMA 2CXXA 1XTIA 3CUEF 3MRSA 4TMWA 3H86A 3TQCA 2VA8A 1N5IA 4HZIA 3N2EA 3Q5DA 1S9HA 1Y3AA 1NP6A 1YE8A 1QDEA 1SZPA 4RFSB 3U3KA 3PIRA 4I99A 4URXR 4DHEA 3FHOA 2IEYA 4HB0A 2XNDA 3VR3A 2WJJA 3WY9A 2XEXA 3GJ7A 4EAQA 2FZ4A 3NEYA 1DAGA 1YR9A 2ASEA 3RSLA 1JECA 1NVVR 1ONBA 3N5CA 1U0HC 2J46A 4LHYA 2JEOA 2OCBA 2IUUA 4LJ7A 3W3AA 1NRJB 2OLJA 5EZ6B 3W6NA 3F8TA 1YKSA 2GRJA 4JT2A 5FUYA 1OH7A 3NTUA 1I4TD 2QPOA 3ZD6A 4TSFD 5FPTA 2FH5B 1GKUB 4QGFA 3R9IA 2ZRPA 5CM9C 4CEIB 3NDBB 1XTRA 2OFWA 1SVSA 3AVPA 3SS8A 2XXAA 2O5VA 2ZETA 2J7KA 4RZUA 4WVFA 5D3MA 2D3WA 4BEBA 1ZIOA 3RS2A 5DE3A 1G7RA 2DPXA 4QXAA 3W34A 3CR8A 4IOLA 5BN3A 4FIDA 2WWGA 2ONJA 4DSNA 3QOFA 1MOZA 1YU9A 3LLMA 4UXHA 1D9ZA 2XB2A 1AQYA 3U7EB 1K5DA 1E2IA 2ODEA 3A6PC 1KNXA 2QTVB 4DLZA 4V0MA 3I8XA 4H1VA 4HUTA 4B73A 4BRWA 1Z63A 4DKXA 3KDSE 1H8HD 3C14C 3LRPA 4TMXA 2O8FB 3QG1A 2QZ4A 1QG4A 4A0RA 721PA 1XPRA 4Q1FA 4QJ3A 4LJ6A 4NH0A 4NCHA 1KI6A 4DLVA 1K6MA 2ZXUA 1W4CA 3SQXA 1MO5A 4UJ5A 4Q7LA 1D8TA 2A5JA 1ZYUA 3OE7A 1NKTA 5AUQA 1X3SA 1E1QD 1U94A 2XOKD 4DB4A 4JLBA 1KK0A 1KSJA 4LYAA 1OB2A 3V9PA 3UWOA 5BXQC 2Z83A 4MDEA 3ICQB 3THYB 4BLSA 1N0VC 2ZRKA 5AJYA 1LFDB 2A5GA 4QRHA 2R6AA 4HUQA 821PA 4M1TA 1XEFA 5DSZA 1UKZA 2OILA 4F4CA 4FWIB 3BXZA 1GRQA 5JJIA 4Z1MD 5SZHB 2VP2A 1MKYA 5FL3A 1T6NA 5KDLA 1FMJA 8OHMA 4PR0A 2QAGC 3GJ8A 4PC6A 4DCNA 2RH5A 5HCNA 4JKYA 3LBNA 1AN0A 1W36B 4TL6A 4YDSA 1CEEA 4TWZA 1Q12A 4ON9A 4NYJR 2QN6A 1NY6A 4HDQB 3LA6A 1YZLA 3UMRA 1J90A 1Q20A 2QRNA 4LJAA 3PXGA 4U7DA 5JJKA 1II0A 1VPLA 3AQ4A 4JYCA 2HCJB 1OPXA 4BLRA 2ERXA 2ZAOA 3KUCA 5LB2A 2PMKA 2JLSA 4M9XA 4M1KA 2GCPA 4KFUA 3KKQA 1E6CA 2IA5A 3GJ4A 5HR5A 3OAAD 1E2FA 1OV4A 3LBHA 5KUTA 2YOFA 1Q1ZA 2A3RA 2ZRMA 3CNLA 3QXSA 2WJGA 3WHLA 2JDID 1QVAA 1C4OA 4D25A 3FKSD 4P33A 4FI3C 1F5NA 3K9LA 3K0SA 3VMFA 1M6NA 3GQBA 4LC1A 3L0IB 5F98A 4IEIA 2ZRGA 3ADCA 4ZI2A 1S8FA 2DHRA 3QNUA 4TMTA 3FFBA 3ZQ6A 2LKDA 1FFHA 1N6LA 3ZYCA 1XJ0A 5JEDA 2BBWA 3C5CA 3CO5A 1N0WA 3A1VA 2F43A 1E2NA 4XD7A 1G19A 1MV5A 1US8A 4A8JC 2FDCA 1PZNA 2QMUA 2ZJOA 3AM1A 4TSFA 1KDRA 4Q21A 2W2VA 1OHHD 4Q9JA 1G7CA 1CLUA 1W2GA 2ZAMA 1P9NA 1AS2A 5JEEA 2KB0A 2RGNC 3EG5A 4JLDA 2C99A 2H1LA 2ONKA 3P4YA 4Q7JB 3E70C 1GWNA 3FB4A 4BFXA 1C9KA 3EC1A 1SVIA 4A8JA 4LYHA 1GNRA 1NN5A 5DN6D 1SVWA 2OV2A 1NJFA 3CF6R 1OW3B 3LXXA 3MAAC 5FTKA 4FW9A 2ZR9A 4IDHA 1XMSA 3TH5A 2F3RA 3VTKA 3LVRE 1GL7A 2VIIA 3MUFA 3QEJA 4U02A 1KY2A 2BEJA 4V0NA 3TUIC 4ZV4A 4ESVA 1AM4D 1XD9A 1KI6B 3NH6A 4RZXA 2CLSA 3KXLA 4DLXA 3IQWA 3W3ZB 2VHCA 3SBDA 2F55A 3ZQJA 2IC5A 4G01B 4NPHA 5JRJA 3CX8A 5HCIA 3MG9A 5TVKA 1DG3A 1SKYB 2IS2A 1NJGA 2GXQA 4KSCA 3CX6A 4QNRA 421PA 2I3BA 2QL6A 2CJWB 2XZPA 5FBLB 2VPPA 2VQSA 4M1SA 4PPQA 5FR2A 1NL3A 1NBMD 3IPYA 5DIFA 2CL7X 3RRNA 1NKSA 4OJQA 1P2UA 1GRRA 4MRSA 3FYHA 2W58A 1G17A 2JLZA 1YR7A 3IO5A 4CGZA 3K8YA 1B0UA 2OXRA 2ZR0A 1F2TA 4DDVA 3IO3A 1JR3E 2I1VB 3SOPA 4A1FA 4A36A 1A7JA 1RKBA 4B74A 2W6ID 2CNWA 5FI0B 2ODBA 4CEHB 4X8LA 3KJEA 3HR7A 1XEWX 1DS6A 3QF7A 2OBMA 3AVYA 3KL4A 1T9HA 3H4MA 1SHZA 1OYWA 1R2QA 1W7AA 4JLOA 1U2RA 3UMSA 3FMFA 4LBWA 4ZCIA 3GFOA 4BPBA 3RS3A 1KKMA 4U00A 3AV0B 1ZJ6A 2WICA 2HLDA 3H0KA 2BV3A 2H18A 2ZRCA 4RZ3A 1CJUC 4BZPA 3MGCA 2IS6A 3NBZC 4AI6A 3QF4B 1T0HB 3K9HA 3RLFA 1XFAA 2BCGY 2H57A 2OFOA 2ZRFA 4M2LA 5CB8A 3OFNA 3R8CA 2C04A 2VHTA 2G0TA 2GEDA 3VKGA 2RB4A 5EE3A 3D31A 3UATA 2FFQA 3L82B 4JLKA 2GCNA 1VDZA 1KJWA 3X1WA 1OSNA 3REFA 4LY6A 2WWYA 5BWMA 3BAFA 2JLQA 4EIWA 1G3RA 1S2MA 3BORA 2ZIAA 3TK1A 3W6OA 3KTAA 1EFRA 1A2BA 3DOFA 2H17A 3ZVRA 4FCWA 3DMNA 1IBRA 4PANA 4BWYA 2WJIA 1E79A 2R8RA 3I5XA 4BGDA 3FOZA 4TL9A 3U7GA 3WP1B 4ARZB 4I81A 2A2ZA 3CONA 5CK5A 1J8YF 1OFTA 1GSIA 1DELA 4R2IA 4PPGA 2Q9BA 2IYWA 4HAUA 1KI3A 3GEEA 4UNNA 1Q1QA 4RVCA 2VP6A 3VNUA 2FF7A 2ZITA 1Z6AA 2L0XA 3RS4A 3PUXA 1IONA 4TLAA 4M4SA 3TR0A 1LF5A 4DEXA 4DB2A 4XTRA 5UKDA 3AUYA 5JS8A 2IX3A 5JECA 2V54A 1RIFA 3TR5A 2BMJA 4TTPA 3RYTC 3CRQA 3P1JA 3S1AA 4AG6A 1CJKC 3K0CC 1RRCA 4NBSA 1A82A 3LW8A 2O8EA 2ZJBA 2ZI6A 1S0UA 4HAVA 4UNQA 3J81k 3G5UA 2OCAA 5EP1A 2C03A 4Y0VA 3JVVA 1IN7A 1Q22A 2IUTA 4ACAA 3BH6A 2WWFA 2MSCB 2J0SA 3NDPA 5GVRA 1AGPA 1IY0A 3NHAA 5J4LA 3BK7A 3TSWA 1IY2A 4IOMA 4LZZA 4RD3A 3RNLA 4CW7A 4JVMA 3UWKA 3FVQA 4KO8A 1DAHA 5AJWA 5FL7A 1VECA 3VHLB 2QP4A 4KCGA 2IXFA 2IK8A 5KNBA 5H68A 5KSZA 1XDBA 4HSEA 1AKEA 1BOFA 4XH9B 4GFDA 4M1OA 4KAXA 4P31A 4A8JB 1N6OA 4I1OA 4X8OA 5F3WB 1VYUA 3LY5A 1TX4B 4IVQA 4B44A 4M22A 1R10A 5L3QB 2BVNA 4LJYA 4PAOA 4W5WA 2JLXA 2REXB 2H92A 3I3SR 2FZLA 5HPYB 1KMQA 5KSYA 1WB9A 2XGJA 1NN3A 1ZCAA 3BFXA 1E2HA 1SGWA 3KFVA 4Q19A 3ZZTA 4ZI3A 4AKEA 3U60B 4RZ2A 4FMCF 3IEVA 3ZH9B 1H8ED 2C8VA 1HQYE 2ZRJA 1QG2A 4PTLA 5KPDA 2E9SA 2YJTD 1O3YA 4LDJA 3LBIA 4G5RA 5AWFC 1VCNA 3DL0A 4A2QA 1ZD8A 1ZVQA 4JMPA 5JFGA 2XXAB 4NP6A 3U2QA 3AGPA 4QHYA 1EX6A 2R6FA 5KU1A 1N6KA 1ZAKA 1Z0DA 5GADl 2I1QA 2KWIA 1YZTA 2R6CA 4XVUA 5DHAA 4EQ6A 3PFIA 2BBSA 3WP0A 2UKDA 2D4HA 3T1VA 1TPZA 1N6HA 2V1XA 1P9RA 1WDTA 3Q7QA 1OH5A 2BDTA 3GLFB 1UKVY 2HUPA 1NVXQ 3THWB 1ZU5A 3EWSA 3PUWA 1IN4A 2CCJA 2FSFA 2ZS7A 1W36D 1KI2A 4R2HA 1E32A 3SN6A 3EPJA 2R44A 1FZQA 4PO8A 1QHHA 4C0JA 1R5BA 2GJ9A 2ZU0C 5KSOA 3R8FA 3MCAA 3KQKA 1Q57A 2FGJA 3W8NA 4P0TA 4A15A 3OESA 1SVKA 2ZYUX 3CLVA 4TQ9A 3ZJYA 4NE2A 4TZ6A 4XOIA 1W5TA 2W6JA 3VR5A 3KUDA 1PV4A 1P2TA 4UXIA 1BMFA 2YC2C 1XJCA 3K9NA 2ATVA 1SXJB 4JVNA 4D2IA 2PEYA 1Z06A 2QTHA 1KAGA 121PA 5E7IA 1TTTA 1CF4A 2RHMA 2DFNA 4UKDA 2GILA 2XAUA 5H70A 5K8TA 2J87A 1A4RA 4BEJA 3VX4A 2QBYB 3AKEA 4F93B 1E2JA 1J70A 1LF0A 1JXMA 1WRBA 3LAWA 1D2EA 1GL9B 2ZQ5A 4PSVA 1N5LA 4EFMA 3TQFA 5BYKA 5G3ZA 1XJQA 3NVAA 4TZ0A 4L15A 3UK6A 3X1ZA 4TLBA 5L3VA 4V0ME 3FDIA 4QG7A 5A5GA 2ZROA 1TADA 2O8DB 2IYRA 4DCSA 4LV8B 4AIIA 1F2TB 3TSOA 2CBZA 4D0NA 4LHVA 5IT5A 2ZUCA 4LBVA 1S4QA 4WZBE 1TU4A 3W9YA 2CCGA 1KMHA 1MRNA 1YZUA 2H16A 2ZE6A 4WZAE 1JALA 2YOHA 3L8YA 4JLJA 4OBEA 4BFWA 2GVDC 2ZI5A 1GRNA 2MSDB 2YHSA 3KFXA 4OI4A 4LOAA 4UJ3A 2YC4C 2RAPA 3GJ0A 4RKFA 1OFIA 4KFSA 2VP0A 3IPXA 3GLGB 1JQLB 3D7MA 3BFKA 2XB4A 4B3XA 3I32A 4OK5A 5G3YA 3GMTA 1KKLA 4AYTA 5FBRB 4A92A 1GFIA 3BB4A 4Q9LA 3TKLA 4CT5A 2ZTSA 4NHOA 4HB4A 1XEXA 4GRAA 2DWPA 2ZSFA 2EFHB 1YJ5A 1FOEB 2W00A 3EZFA 1MABA 4JBWA 4Z8XA 2XTNA 2GJAA 3LQQA 3VX3A 4TYWA 2BMFA 2FPLA 4PAMA 4JL6A 5CLQA 3X2SA 3AVTA 4HEJA 2O0HA 3L2OB 1UAAA 4KU4A 2ZI7A 4IHQA 4Z1MA 1IJEA 1SHKA 1W48A 3FFAA 1U9IC 4GSYA 4RD0A 4XVQA 1UM8A 4ZKDA 2W83A 4HLDA 1KIMA 2E1RA 1SVOA 1XCGB 1Q1BA 2R6GA 2WWXA 2Q21A 1RPZA 2KI5A 1NY5A 2I4IA 3B2EA 3CRW1 4ZDWA 1HURA 2WJHA 2JLYA 3P4XA 4II7A 3U3JA 5TDHA 5EUQB 5FPKA 2IYXA 1CP2A 3VR1A 1XMJA 3EXAA 3TVDA 3FPAA 1P62B 4ITRC 4HDCA 1QRAA 1ZNYA 3HU1A 2WBLC 3GFPA 2QM8A 1VMAA 3CNOA 2WMNB 4IOKA 2EU8A 5HKKD 1OB5A 2IT1A 3EX7C 2CVFA 4X8HA 1HV8A 5GVSA 3TUZC 1MRSA 3NG1A 2HDNB 1Z29A 4KV9A 5IHPA 4JKIA 1G6OA 2RGAA 3TMKA 1E4VA 2HF9A 4D0GA 1D2MA 2LCFA 2HCBA 3MMPA 2KJQA 4ZCMA 1GL6A 1R8SA 4IDNA 3QPVA 3ECCA 4YMSA 3CIOA 1CS4C 4PZYA 4QBIA 3WRXC 2OXCA 2FEOA 1SULA 1WA5A 3KX2A 3M0EA 2R62A 3QQ5A 4LX0A 1ZNZA 2QMHA 3K53A 4BLOA 3B6EA 4B33A 5TARA 4Q00A 1HT1E 2A9KA 4AYXA 3BB1A 1WXQA 3GLHA 2GAAA 5EUMA 1UBGA 5FBVB 2C98A 4JLNA 3BS4A 2IS1A 4EJSB 5H8WA 2ZYWX 2RGEA 4ABYA 1BMFD 3AP2A 2ZRAA 1U8AA 4A0HA 1U0LA 3SFZA 4ZCLA 1U90A 1JJ7A 2NIPA 1E69A 3C7KA 3RC3A 4HLQB 4WBSA 5FPSA 2ZUBA 1HE1C 2P2LA 3F3YA 4M1YA 2OLKA 3ICEA 3RDPA 3DKVA 5CJ2A 3RWOA 2X1VA 3WNDA 1FTNA 1SVLA 1ESNA 3RRZA 4CIDA 3KQLA 4D26A 3LV8A 1AGRA 2FEMA 4MDFA 4CZ2A 4IVRA 2VHJA 1LVGA 4L4UA 4LC0A 2G1KA 1VCMA 2KBFA 2VSOA 3K9GA 5EE5B 2GJKA 5FI1B 4KVAA 3K09A 5K8UA 2BJVA 1UEIA 2BHRA 2JLRA 2J5XA 2NO9A 1NSTA 1H8HA 1ZNXA 1Z07A 3PV0A 1Z2AA 3QXXA 4PFSA 1G3UA 5E95A 4NONA 4KHZA 5KYKA 2C9CA 1Z08A 1XP8A 3SFVA 3PEYA 1KJZA 1LB1B 4C0AC 4PC1A 1XPOA 1GOTA 3VU9B 4A9AA 1J7KA 2QE7A 4HYYA 2XJ9A 2UVQA 2WSSA 1TF5A 5KNCA 3MJHA 2FV8A 2FSHA 3RSOA 1W4AA 3KJHA 4JBXA 5DYIA 3FKSA 4Q9HA 1AZTA 1FP6A 4YMTA 2ZE5A 1YQTA 3PG5A 5EP3A 5FUVA 4FMDF 1DBSA 1XWIA 1WCV1 4RFSA 5EE1A 3K0FA 5JWHA 1HQCA 4BLQA 1JPJA 3CM0A 3V00A 4D4MA 2HV8A 4NYMR 1DAFA 1D9XA 5KNDA 5KDDA 1KGDA 4EDHA 4PQRA 2O8DA 2GETA 2D7CA 2PMDA 3CPJB 3K70B 2PCLA 1QHXA 3MWLA 1P2SA 4NYIR 2NO6A 1KI1A 4KFTA 2BWJA 1IAQA 3QIAA 3LFUA 2QP9X 4GPTA 1XCMA 1R0YA 1VG1A 4C2UA 2J0VA 2ZYTX 4RD1A 5FTLA 2ZRNA 4S2EA 2IBMA 3D3QA 4BECA 3A1WA 3VFDA 3QUSA 3WMGA 4MKIA 2FN4A 2G83A 3DZ8A 4HB2A 1Z0FA 1U99A 5D3MB 1E3MA 3WYFA 2RGXA 3LH5A 1YZNA 3OEHA 3AP1A 1B23P 1JPNA 2LWIA 1LTQA 2P3SA 5BN5A 2WPDA 4OHYA 2ODNA 3TRFA 4DCTA 2WPDD 3K0AA 2ZU6A 3VR2A 2CLDX 1A5TA 1BS1A 2ECKA 1K5GA 1Z22A 2ZSDA 2VEDA 3AVVA 1PLJA 4P4TA 4HLCA 3A4NA 1NMXA 5GJWC 4WXPA 4DLRA 1JB1A 1WP9A 2AD5A 2MSEB 3D6TB 2PL3A 4BLPA 2ZR7A 1NMZA 2VSXA 3KB1A 4LHWA 1IM2A 2C77A 2FNAA 4F92B 2XTMA 2XOKA 2OEPA 2O8BA 3Q85A 1TU3A 3CBQA 4KYUA 4Q9IA 1KO1A 1XZQA 5FOSA 2ZI9A 1HTWA 4RKEA 3T5GA 2AKYA 4GOKA 2DFTA 1G8YA 1KOFA 5CB6A 3FE2A 2DR3A 2J7PA 5FTJA 2A78A 3HWSA 2X19A 3CH5A 2OBLA 4GOJA 1VYTA 2FX3A 3T34A 1H8EA 4A0FA 3I5YA 3AF4A 3AVUA 4ESHA 2O52A 2C9YA 5CJPA 3ZD7A 2GVZC 4OJKA 1FX0B 4PPFA 1JI0A 1QVRA 3EIQA 4LJ9A 1F48A 4Q1CA 4C3ZA 4HUQB 4DC9A 3QG5A 4XSGA 4AKGA 5B57C 1I2DA 1HYQA 4Q4AB 3FHTA 3NBYC 3VHXA 1UEJA 1GTVA 3CH4B 3K0AB 4LV6A 2D06A 4AWXA 5AUPB 4OK6A 3W90A 2DWQA 5DLQC 5KTYA 2JA1A 3T35A 1DAKA 3RAPR 4RCZA 5JZVA 2EFEB 3GLFE 3NC0C 2DFKB 2W2TA 2FE4A 4HATA 5FBWB 1XTJA 1COWA 3KXKA 3G0HA 3OF5A 2B92A 4QM6A 1NNEA 2G77B 2GA8A 5DI9A 2AFIE 1W4RA 1CJTC 2WV9A 2YNMA 1U9IA 2ZUDA 3X1DA 4AY2A 5AJXA 1PUIA 4MRNA 4XWOA 2GESA 4NZYA 4BE7B 1E9BA 2W2XA 5JCZA 3L8ZA 1CBUA 3RRMA 3KJGA 4M1MA 5CDFA 4V0KA 1L2TA 2ZJ8A 3B9QA 4KLNA 2XNDD 5LD2C 1JBKA 5EE9A 1YRAA 3U61B 4JLMA 2VF7A 1VG9B 1II9A 1XXHB 4M1WA 1IN5A 4EPWA 2AN9A 3N2IA 4XTCS 4LUCA 5J4HA 5DO9A 2GZAA 2FMXA 3PVSA 1Z47A 3QKSA 3K70C 5CIQA 1FW6A 3W5JA 4YMWA 1E9SA 3KXIA 3B9PA 2QSYA 1L8QA 2IYTA 3U4QB 4KBGA 4BZXA 3THYA 1XTKA 1Z0JA 3AB3A 4MYHA 2XSZD 4B47A 2RHDA 4LPKA 4EPRA 5IF9A 2WTUA 4WIAA 3A4MA 1OJLA 4PXAA 2BCJQ 5B64A 3TGPA 2GXUA 2Q3MA 1OXUA 1NIPA 4ZIRB 1FQKA 1RJ9B 1TEXA 1XEWY 2ATXA 4LHZA 1BKDR 2F9MA 1US8B 1Z6TA 3SYNA 2BBTA 6Q21A 4JLAA 2HJGA 2JJ2A 3NC1C 3WMFA 4M0LA 1DAIA 2OT3B 3B13B 5G41A 2ZM5A 2JLVA 3AVXA 1GKIA 1CJMA 1OXXK 3EZ2A
chains in the Genus database with same CATH superfamily
3S70A 4R83A 5JNRA 1OU4A 5E3HA 2SICE 1PL7A 1YR8A 5IEBA 3T1YB 4XSVA 3VVMA 1XCBA 3PPVA 5HQ3A 3DKIA 3HJRA 2WUVA 3DD5A 2Y1DA 3Q41A 2IHKA 3R6LA 4C21A 5C53B 1YDGA 1UWVA 2HD4A 3Q7TA 2HRZA 1GNTA 1UZLA 4JKOA 1QO7A 5JVDA 2OOKA 2Z95A 2OXEA 4V1CB 1K08A 4MQ4A 4YHHB 1Z5VA 2SNIE 1W0JA 2NVUA 3AFGA 1RXIA 3DOEA 3DXXA 4LCBA 1EVKA 5EJ5A 5JH7B 3N7AA 2WVJA 3D0RA 5DPMA 5BN4A 5KNCD 1LD3A 1VSBA 5GV8A 3E7FA 2YYSA 2QVGA 3R0IA 2EZUA 1V8BA 4TV8F 3RFVA 3U1BA 1PVDA 4K6GA 3QLEA 1NYLA 3H7IA 1OCEA 2YJ4A 4IEEA 4JJEA 4Q1EA 1U8XX 3IERA 1XZPA 2IYAA 1FJHA 3I6MA 2EHDA 4XQEA 1FNDA 1TZBA 1KFEB 5EG5A 3K4QA 5HDBB 4ZQCB 4E2FA 3NPAA 1GPYA 4L07A 2BKVA 2PN1A 3W5BA 1DUIA 1DTWB 1OXSC 3LC1O 4MYSA 5AVZA 1NVKA 2F8SA 2QZJA 1DKOA 4O4IA 5G0TA 1OIWA 1QYDA 1KBQA 1YZHA 2GHIA 3C41J 6CHYA 4IKEA 4RPJA 3RQSA 3ZR4B 3OCZA 3SZOA 5ALQA 2QN3A 4QYIB 4DLAA 4Z2AA 4QQ8A 1E1RA 1VL2A 2GO1A 4Y2JA 1IQUA 3NTOA 4PLZA 1Y9DA 3QUCA 4MUXA 4FJ0A 3H1BA 4OXRA 3STTA 1ZJJA 3UCFA 3KSZO 1TM5E 4KWCA 3ZCVA 1Y9ZA 4LRQA 4YJFB 5ERXA 3EYWA 4DV7B 2OESA 2G8LA 3GQVA 4LSWA 4NBVA 5HX7A 3KQHA 1A9SA 4W5HA 3IKVA 1JHPA 2ZSBA 4CM6A 4P7JA 4DLYA 1FEZA 1T8TA 3DONA 2OCYC 3DSRA 5AVJA 2ESRA 4DIUA 5DRTA 4FGWA 2QMQA 4JOQA 3QENA 1L3IA 2BEWA 2W2NA 1C8BA 4POAA 4QE3A 4WACA 4B0OA 4N5IX 1NN1A 2DQYA 1E6UA 1QGDA 4UBLA 5LYJA 4CLOB 1SBCA 3DZHA 2RI6A 2WYIA 5FF9A 3VYRB 2PLWA 3UJ8A 2FHSA 2UYQA 2HU5A 4XM1A 2X86A 3QY0A 4KQIA 1FTWA 2QI9F 4YAFA 4X45A 2DZDA 1XZGA 2HXYA 1XZEA 3MGKA 1SC1A 5TNXA 2ZAYA 4FLFA 2E4UA 9LDTA 4DSZA 5ILOA 1VCIA 2AC4A 4PYJA 2PUAA 2JPDA 1KS9A 4FFOA 3D8NA 3UG6A 3DVRX 1XLWA 2RIPA 4KIGA 1L7OA 3WJ7A 3NQ41 4DLKA 4UU0A 2ZEJA 4Z51A 3JSAA 2VR1A 3RYFB 1I1QB 1J42A 1MORA 2J6IA 1L7EA 1LLDA 2VTVA 3G0IA 3OQPA 4C7MA 1J9EA 6YASA 2J6BA 3QLVA 3Q9LA 2VK4A 3V9AA 4Q1AA 1XRSB 3BDAA 4X92A 1YZQA 2YFHA 3CRNA 3FTPA 1XJWA 4X91A 2HBQA 4QSHA 1UJNA 3FMGA 5EXSA 2J7PD 1QE0A 1QKJA 4M9QA 4U2CA 4B35A 4L0MA 1NOJA 5T4FA 4HX5A 2J4DA 3SYKA 1WVIA 1U7DA 1V5WA 2HEIA 2RGGA 2VHEA 2W6NA 2VS1A 2YCLA 3GROA 3H4VA 1QGAA 3K9BA 1J97A 5KNBH 5DLDA 3TLCA 3WJAA 4ZICA 5D6NA 4QLOA 4YFVA 4K81B 1KJJA 1C4WA 1D3AA 5E38A 4TYNA 1F0KA 4TS9A 3QPWA 1E92A 1KSHA 2CVQA 2NXJA 1I5EA 3DVSX 3OA2A 3PQFA 3OJCA 3WGZA 1NDQA 4MS1B 5CK4A 3F4BA 3UXEA 621PA 4ZDJA 1Z7YA 3F98A 3SZ3A 3TRHA 4MGZR 4OF4A 1MO6A 1YBVA 3ZXXA 3B78A 4D6XA 1WM1A 1RRMA 2EV9A 4NFHA 1XTPA 3V8EA 1SELA 2AOXA 3AHHA 1LFAA 1THZA 4BB6A 1P72A 3V1UA 1NFRA 2AGVA 4Y1EA 2CYCA 1HXHA 2ZB7A 2GBLC 1SNYA 1JSCA 5DGXA 1CIJA 3QKRA 4ZOEA 1M2NA 2RGCA 2XH8A 2Z4RA 2G1PA 2IDMA 2IE0A 1XDWA 4R01A 3A1UA 1H2WA 4AYWA 4X00A 4HT3B 3C70A 5DBEX 5IKXA 3BRWD 3TOZA 4YPOA 3J80A 3Q9NA 4YJKA 1V3UA 1OKKD 1YT5A 3QBDA 3ZNNA 5CCEA 3DNFA 3PQ7A 5J47A 2P77A 3MLAA 1XDUA 4QQFA 4KLZA 3TW4A 1IXRC 3EDRA 2B3DA 4N8DA 1T2EA 4KH1A 9LDBA 1U3WA 3U4CA 3AILA 4PN7A 3M3PA 1A5ZA 1F6DA 4JBYA 5LVAA 1KZ9A 3O03A 1YL5A 1FDIA 1W35A 1VRWA 4WXRA 3T7TA 1UAAA 1T5LA 4F3RA 2ZP1A 1ONNA 2GZSA 4NYIQ 3WYGA 4GF5A 1JU9A 1NF9A 2C3YA 3ZXUB 1JJBA 3OX4A 5K20A 2W6IA 4DM4A 1UFOA 4FZVA 4M0FA 4UVEA 5TMDA 3W5HA 5KWVA 1GDDA 2AOVA 4KXLA 4AZ3A 4GYWA 4UM5A 2O8EB 1N2GA 2ZRIA 3NCHA 1XLTA 3EPHA 3KJNA 3WAJA 3HA5A 2OUKA 3FTEA 3SDZA 3QVSA 4ZO9A 4D97A 2F7SA 1BEZA 3AEUB 1MT0A 3EZYA 4HS4A 1PSWA 1KAMA 4Q9KA 2GKGA 3LIIA 1TZCA 1WQ1R 1XPJA 4LYJA 5B7NA 5EGSA 1SVMA 1CD5A 2WZQA 1H42A 2DC1A 3N07A 2BFBB 5EKTA 4D8YA 2Y76A 2XUHA 4BU0A 4DZZA 2ZCJA 4Q7QA 4U6NA 1LQTA 4XX0A 4HN4B 4NK5A 3SZMA 5IDVA 3QV2A 2Y6UA 5KVCA 1WETA 3O8LA 2F8LA 5IAGA 1OXVA 1NUTA 5EZYA 4TKVB 3SHTA 3D7NA 4M0EA 5E7MA 4OKIA 5LQJA 2GAOA 2VDOB 2YASA 4BNHA 1G7TA 4KIWA 4N18A 1BX0A 1T36B 2CJYA 2IZ7A 3OHSX 4RVFA 3RJZA 1UT5A 5TXGA 4J3NA 4C7OB 4N3AA 1NXXA 4BNKA 1XZJA 3KVVA 4PBTA 3IQZA 4MV6A 4MUBA 1J9ZA 2C54A 2ON6A 3FN4A 1HWYA 3EBPA 4XPIA 5I4BA 3HU3A 4B3RB 1X8XA 1OWPA 4JJ4A 2IDZA 2OL4A 1CZHA 4MKFA 1QXSA 5I4KA 3EOZA 4R1TA 3BIFA 2C7BA 3GPIA 3LW7A 3SPXA 4B4WA 2YY5A 1H65A 2O2YA 3BF7A 3C3PA 4IMJB 4MW7A 2E6KA 3EXG2 5EPOA 5ESXA 5FOTA 5SY6A 4CQMD 4CU5A 1K89A 1HDEA 2BGGA 1GG8A 5IBPA 4CVNA 1G5FA 2F67A 3V4ZA 3VBEA 4B3SB 2CXOA 4NCJA 4YDHB 5D1NA 3ZJTA 1L9KA 3RVBA 4RACA 4ETWA 3A6DA 4NBWA 5K45A 2WLTA 1IUKA 5AVWA 2HWKA 3AEQA 4F5DA 2QR2A 2CHQA 2EFGA 2F4NA 4NZ9A 5FA8A 5BQFA 2JVKA 3OBBA 5FTMA 5B3AA 2DT8A 1XZHA 5FFNA 3KU1A 4J43A 1DHRA 5K09A 2C2XA 5IDWA 3LT1A 2IEGA 2Q3BA 4M89A 4QDJA 4D1YA 3EVNA 4Y9UA 1PNQA 1TCBA 2ZWAA 2DR0A 3EXEA 3WYEA 4I50A 1ZXBA 1VPDA 1X1BA 3A37A 5LYYA 3ROPA 2OQ2A 1S3SA 3QLJA 2OORC 4JZKA 3CVWA 1Z4KA 3F6EX 3ESBA 2I22A 2QT9A 1YS7A 2BR3A 2Y8EA 3M6AA 421PA 3MUNA 4G5QA 5JYDA 1EGAA 3V80A 2HW8A 4GX2A 1ZCBA 3TEFA 4MVJA 2CV2A 2VAPA 3GEMA 4HZUB 3C4VA 5EHXA 3GLRA 3ISJA 3CW9A 2P67A 2ZJ2A 3D2LA 1NASA 3KHTA 2E21A 1SFRA 4IDPA 4DIOA 1E2DA 5BRJA 4HQRA 3C8ZA 5BYAA 3ABRB 4OP3A 5HXAA 3D02A 3KEQA 3EZLA 4JXJA 4LK2A 2AC2A 3AW8A 4KQWA 5ES4B 4PIPA 5JPCA 5I5GA 3WR5A 1BHJA 1I4EB 1VLVA 4O4LA 2NUPA 1O54A 1W5EA 3CRMA 1FMTA 5A3RA 2QEQA 3DT6A 2JARA 3WWZA 3C15C 3OJFA 2GXSA 1CNEA 4JBHA 2ISSD 2PUWA 2UVPB 4R1UA 2R00A 3OQ6A 4XCXA 4E15A 4ZT6A 2W70A 4JB8A 4ZCSA 4MV1A 3DEZA 3ZN2A 4ADSG 2EWMA 4TV8A 1U3UA 3R3VA 2HDWA 5AKLA 1GUBA 1SG9A 3A6FA 3EZXA 2C20A 3H1TA 4FP9A 4OUDA 3V4FA 4FQ8A 3CX3A 4BX8A 3QOXA 4DADA 1DGQA 3MBIA 4C6HA 1MJFA 2C07A 2WYHA 5KNDD 1O03A 4U3JB 1RWXA 2YWCA 1AGYA 1DDIA 1E1LA 3M89A 3PNOA 3AF5A 1KDTA 5LPNA 4HHEA 3PC4A 4R69A 2QU8A 1Y8QB 4KSYA 1Y4SA 5FBKA 3KBOA 3CPSA 1LS1A 2W93A 2XDQB 3O3MB 4YS6A 3NKVA 4HNUA 2YV1A 3NJ8A 5FP0A 1OROA 2XDYA 4CLDA 1KYZA 2OM2A 3GT3A 2C58A 3MGBA 4XWKA 1A9TA 4QGGA 4C0KA 4I1IA 2C7GA 3CXUA 1GKYA 4RLFA 4ZZ2A 3T7RA 4EG8A 3K6RA 5ED4A 2B5VA 1N1DA 5CPBA 1OWNA 5K1ZA 3AF3A 3NEPX 3SZLA 1LC3A 4QFCA 1OH6A 2PPLA 1CFZA 2NG1A 3VYVA 3AXTA 3MAJA 1LC0A 4OLAA 5C80A 3ITKA 1WUYA 2AHRA 1MGOA 2B8NA 2WKQA 2YYAA 3OOSA 4NMLA 5D85A 3ZVNA 1ZVJA 2XCSB 4EUNA 1LNSA 3WLPA 1BRTA 2Q6KA 2PGNA 4K1XA 4IVPA 4RESA 4UHHA 1C81A 2VJKA 4FZRA 3HUTA 4YAJA 2XAAA 3MUEA 4LWPA 1VP9A 5DM0A 1E9AA 3ZE7A 4HPWA 4C4YA 3FWHA 4YT8A 1S4MA 1XALA 4OHWA 4G23A 9MHTA 1JNXX 1SZJG 4Y2XA 1NHWA 1YVRA 3JSXA 2CB0A 4CTMA 1DWPA 1IK6A 1M1YB 4LTMA 3T3NA 2QJFA 2WJ3A 1RAGA 4N5MA 3SJ7A 2J4FA 3PGMA 5IK2D 1E9CA 1I7DA 3K0CA 1AQ6A 4B2IA 2GAFA 5LOVB 3GQBB 3EBLA 1N1GA 2HJWA 1VKHA 4AO8A 2VDLB 3OZRA 1Z5PA 4K0RA 4R0NA 1P5ZB 5FWXA 1FXSA 3UMGA 4KQ2A 4DLTA 5C7OO 2B4TO 3DTVB 1CR4A 1CQJA 4WLUA 1V5FA 1LV7A 3HKDB 3MWDA 2LKCA 1F20A 1IYZA 2REBA 4PX2A 5F1OA 1XZMA 4YRIA 5J2TA 3EMVA 1RI2A 1QH8A 5CT4A 2X3YA 4MARA 3H9BA 3WIBA 3KTOA 5FLEX 2HQOA 5C1PA 4L6IA 3N1UA 2C3MA 1FVFA 1OAOA 3R4CA 1T5TA 1TNDA 1RKVA 3CLKA 1DO0A 1KYVA 1Y37A 3OT4A 4ICIA 3DHNA 2RB5A 1SHJA 3VKWA 4BE9A 2VN8A 4C03A 5KWSA 1NLZA 1QK4A 4QDUA 4JLVA 3N05A 3W05A 3BUSA 2W4IA 2ZBDA 3EAFA 3F6YA 4ARIA 2FFBA 3KQWA 4L0DA 3DMTA 1GPLA 2NTNA 1N8NA 2WWIA 2J3DA 1NBAA 3ZYZA 5CA1F 1DCFA 4NBLA 4WA7A 4UAUA 3WFZA 5KJFA 3IAHA 1Y4DE 3PR2B 1RZ3A 4V02A 5BPHA 5KIAA 3OT1A 4F8EA 3FRHA 2PAAA 1QG6A 1ULUA 3OIFA 3GI1A 5CVVA 2H1RA 2GFQA 4QDOA 3DLBA 1HNWB 1VBKA 1ZESA 2UZIR 3TTTA 1UZUA 3UTDA 5L6MB 4L4YA 1J33A 2Y9PB 3MWYW 4QGHA 3M4YA 5CAEB 1CVLA 3CCFA 4GI1A 1DV2A 2PYZA 1HQKA 1YZGA 1U2ZA 2O06A 2YWXA 3G13A 2V9CA 1CZUA 3GDHA 4P54A 1HG0A 5ARDA 3ZZ0A 2OD7A 1E1KA 4KXWA 4OD0A 3W7VA 3CURA 3OIVA 3AUUA 1QORA 4Z4EA 3WLJA 3QHAA 5DWDA 4UHJA 3ADDA 4DIEA 1SQSA 3GGOA 5ER9A 4UHEA 4QWMA 3WRWA 4NMXB 1YO6A 2VJAA 4IO1A 5LDDC 1MABB 3OX3A 3ZWOA 2VNKA 3EVDA 4M7OA 5FPYA 3PNPA 3MTQA 1DI0A 3HYTA 1T5OA 4QO7A 4QEDA 1KYIA 3UW3A 5KVSA 5CIWA 1U2TA 1Q1EA 2E49A 4X84A 1I3OA 2AR7A 3JWHA 1KAOA 3PSHA 1OX5A 3RADC 1HX7A 3H75A 4NBNA 4J1NA 3CEMA 3MT8A 4HFNA 3WKBA 3GRZA 1L9XA 3IT2A 2DYKA 3FAZA 2Y67A 3NT2A 4D6PA 5CB0A 3ZG6A 4B2LA 4U7HA 5AFSA 4HXYA 3DNPA 2ZYVX 1XEAA 1DBQA 1XN4A 5D01A 5IAEA 4JI3B 4AZ0A 5LQMA 1NW6A 3W5DA 2QUHA 1B43A 3MZ0A 4M0KA 3F7NA 2XOEA 1X1RA 4RSHA 3ZVMA 1AA9A 4J49A 4LGMA 4PO9A 1UMDB 3FPJA 4Q4JB 5GQSA 4ZEWA 4AF6A 1JTVA 4HH4A 1ATZA 2OOSA 1AKNA 1T2UA 1Y82A 4NY1A 3K1JA 1H69A 4K26A 3G2KA 4BNVA 3HB5X 2PMBA 4LY3A 3C3XA 3FMPB 4YJ2F 1V9LA 1IY9A 1CS0A 3KJIA 1N75A 1A9QA 1TAHA 2Q1UA 3L0BA 1G8GA 3ONDA 3S2IA 2XUQA 1J5PA 2BGMA 2VHXA 2B82A 1ESCA 3AU9A 3HBAA 4GMFA 2V7UA 3DR5A 3SJAA 3RWBA 4MINA 1PG0A 1AUXA 4EYSA 3O8RA 1VLQA 2BOVA 3CW2A 5KYTA 3CZPA 1COWD 3FTDA 3DHYA 2ZUSA 4FZ5A 4HQNA 3NV7A 3E27A 4RGVA 3V34A 3E23A 4R9UC 1SH7A 3QBTA 3WS7A 4HEHA 5EXXA 5C4MA 5FPHA 4S04A 5JAQA 4FM9A 3OHMA 4IIHA 2W6PA 4TYQA 4F04A 1AQUA 4MZDA 4L4RA 1KF0A 3DEHA 1T26A 2I3ZA 2VEOA 2R8ZA 4MZXA 4UREA 1U0FA 2QKYA 5KTSA 3IPLA 3EA5A 3MWKA 4OA5A 1GPH1 3G49A 1UBNA 3WMRA 2ZE7A 1DC4A 1TJ4A 1TW2A 3A11A 2WU1A 2ZJYA 3A3YA 4G56A 4ACBA 4BO6A 1J06A 2PS0A 1ZW6A 2GD1O 2EW8A 2HGZA 1GKKA 2P27A 4GMDA 5CA0F 2G4LA 1C0IA 3SS9X 4BO7A 4EEKA 4JELA 1SQ5A 4G1EB 3MJ4A 3RU9A 3V42A 4DNOA 1JAHA 1F60A 3WLLA 4AJOA 4EAAA 3G6KA 1JHXA 1Z38A 2AMJA 2X5XA 1M34E 1DJQA 2GYUA 3QSGA 3JVUA 4RTLA 5HZHA 3OE1A 5F5NA 4CUKA 1S01A 1N6NA 1RM5A 3KT0A 4W6ZA 4P4SA 3U3RA 2V6FA 4RO0A 3NWEA 3FPEA 3T61A 1QFMA 4CFYA 3AX6A 4G5OA 4P3OA 1N5OX 3MN1A 4PAWA 1MT3A 4X1KB 4Q47A 2OPHA 1W76A 2P8JA 1EUZA 2Z8ZA 3M34A 2Z0MA 2PZJA 2DR2A 5EWJB 4EY8A 1E3JA 3VTFA 2R11A 1BW9B 4JSYA 4K2AA 1DAOA 4OMDA 4QPCA 5J5VA 4FR0A 2IWHA 4WKCA 4GMGA 1XK6A 5L3QA 5D1HA 5HTKA 3T4UA 1BYIA 1GLVA 1JJIA 3GOQA 3HHPA 2I99A 1VBMA 3HR8A 3PFGA 4TUYA 1N2CE 4XX1A 5B1YA 4CKCB 1YAJA 3IAFA 2YRXA 1N34B 4YCNA 1CQJB 1GZSA 1R6BX 3AGQA 3IVGA 3KCQA 3MTDA 3T3IA 4M9CA 1H2RS 4D96A 4P5DA 2H8KA 4JOBA 3JZDA 4BYMA 3F9CA 4YN3A 2PFSA 1KFJB 1A1SA 1ESMA 1SXJD 1J25A 1JEDA 1LLFA 2O23A 1EDOA 2O2DA 2WWTA 4JODA 1N5KA 2C3PA 3ECAA 3C1AA 4FSDA 3JQBC 4V38A 1R64A 1ZD3A 2Z8YM 1SU7A 1AKQA 3A6LA 3F9RA 3N0XA 1GG9A 3BIXA 1L5GB 3CG0A 3DV9A 5CLHA 1Q11A 1JRLA 3WKCA 1I2MA 1N2HA 2IYNA 5C37A 5D3ZA 1JSLA 1G59A 2QAGA 2B30A 4WQMA 4B7ZA 1Z0AA 1FSFA 1OAOC 4M99A 3TX6A 4A8TA 3KQPA 5AUNB 1COZA 1T3LA 3IP9A 4MKZA 4E33A 1CETA 3UMYA 3C8UA 1YVPA 3A3NA 1RRGA 2XD4A 1MRZA 1YWGO 2ZKIA 1GV1A 1SIUA 1KEVA 2J48A 3DWFA 5TQ2A 3E1SA 5DYGA 3UY4A 5ELLA 2WHPA 1Z2CA 1U4NA 4V0OA 2I4OA 4LY0A 5DHUA 4MUIA 4PYMA 1TL7C 2ZJAA 4PNHA 1QQAA 4NVRA 5JV5A 5AR1A 1WHSB 3V8QA 2XUPA 1ORVA 1YI1A 2YR0A 3WQHA 1XZ8A 1T2VA 1EUDA 2FXIA 5KQSA 1G21E 4YYZA 2HSEA 2QAJA 2OAEA 1LX6A 2OQVA 3WNBA 1H2BA 1YD7A 2E4VA 4RF4A 3ZJUA 3N2KB 5LKRA 2HSZA 2JEZA 4DMKA 4EPTA 1ZFNA 3P9NA 2F59A 1KRHA 4ZTBA 4YAGA 4Q66C 1WPQA 3KB2A 3DXFA 5FOXA 1XRLA 2YH2A 3NYWA 4I1YA 3QBVA 2UYCA 1GA4A 3ZWBA 4ZPXA 2H2FA 5TS2A 8ABPA 4WVLA 1O58A 3TLXA 4UASA 2WUEA 2R5WA 4ZT4A 1C7ZA 2BE7A 4URYR 3RPEA 3ZHZA 5C5CA 2RJOA 4OB8A 4OLBA 1ODFA 2YW9A 1FX0A 2XRFA 2YZ7A 3EIUA 3NWJA 3A1DA 4WZBB 4ZVQA 3B2NA 4Q16A 3P94A 3FTQA 1VLLA 2VQEB 1RE0A 1J9GA 3D6AA 3MB5A 4LYFA 4ZYYA 3BD9A 3PDCA 4B32A 1TVEA 1L7MA 4HAWA 1SHUX 1KI4A 1UPXA 1Z6ZA 3HN6A 1BU5A 1IWPB 1O5IA 2F8MA 2YJ5A 5FOQA 3ZWAA 3DM5A 4LE0A 1DO2A 1X1SA 2FN9A 2OBYA 3G17A 4IJKA 5GJCA 5KSPA 2JAWA 3CF0A 1YK0A 2B8WA 3THWA 1UP7A 5K05A 1EFVB 3TLGB 4DM7A 3VI4B 5JI3E 1L7AA 1KTIA 3DHWC 5F1PA 4EABA 2VTBA 2AJLI 4KKVA 4G84A 2A67A 5I9NA 3WB9A 4H15A 2UYGA 3LRTA 1DC7A 2JCSA 4G1UC 4J1QA 3PENA 1WSAA 3N8HA 2C1EA 3QNWA 4I6EA 3GFTA 5LU8A 3OURA 1NM5C 1NV8A 5IJXA 5AH0A 1WEHA 5JC1A 3EDYA 3PC3A 4QOHA 4RTSA 1E59A 4FLEA 3S5JA 2W42A 5BSRA 3U4GA 2VSFA 2PQ0A 3S68A 2PSSA 2IV2X 1FFGA 3UO8B 3V7YA 4C0LA 4MUHA 4RY2A 3R76A 4OUDB 2DJ5A 1IBLB 4IJ5A 3L04A 3S2UA 3SJBA 1UBKS 3UUFA 3DMDA 4QUAA 5BW5A 5IG2A 1M3SA 4XSHA 1IJKA 3PT5A 4L6AA 1BH2A 3OPMA 2AKEA 4LQLA 2E3JA 3DAFA 4NATA 4ALLA 3L6BA 1UXJA 3H2YA 5HS6A 1ECPA 4Q3LA 5HZKA 1MC5A 4H7PA 3R9XB 2PJZA 3HVIA 4HLNA 3THXB 2QMEA 4A10A 1OE0A 2ZJZA 3QU9A 4IJMA 5KWJA 1NBEA 4HNQA 4X1OA 3MT0A 4XASA 1VIYA 5IUNC 1K3UB 2I2CA 3D3NA 3TLEA 1TUBB 3FBGA 3HKBB 5AP9A 2I6UA 2HOQA 4EB8A 1BCRB 4V0SA 4D9FA 4D42A 4KLCA 4MICA 4IV0A 2F17A 2VT6A 3OI7A 1RHJA 3BBLA 1M2JA 2FJ0A 5FO0A 4DUGA 3DTNA 2J9FB 4WSOA 3U7QB 4JUBA 4TT8A 3WWCA 1FU7A 3V1KA 3LUDA 4BUCA 3SVLA 3E9QA 5JCOA 4UM9D 5B7GA 3E5NA 2NXWA 3TNLA 2HKIA 3ISVA 3DM9B 2AX3A 2O05A 4TZKA 1ZD5A 2B7CA 4N5NA 4F4IA 1ZUNB 2Z1NA 4IAOA 4XDHA 3DV2A 3MTBA 4D4KA 1P1HA 3QJYA 4Z4FA 3AOEA 3TD2A 4DT1A 2H31A 1QYVA 1U0SY 3CUTA 4KGDA 4UTVA 1XAJA 4MKHA 3S2SA 3SR3A 1H2FA 2IP4A 4MR7A 4B9EA 3C1OA 2AYZA 3DFUA 1YFKA 2A94A 2O57A 3HCDA 1UPBA 2HRDA 3JQDA 4JMLA 3BT7A 4NS1A 4P38A 1WDMA 2XF8A 2GD6A 1EAMA 4JJFA 4MK4A 4ZK2A 4IFBA 5JAUA 3NMUF 3NRCA 2AOWA 3KJXA 4CMEA 1QMPA 3FGPA 1RYHA 4R84A 2AW5A 2SKEA 4DPMA 5CDYA 3KTFA 4ZAZA 4XIJA 5ERYA 2VXOA 5AM2A 3U31A 1EWQA 1FTGA 1TC2A 1WSDA 2I2FA 2PBFA 4FVTA 2V7BA 4HLUC 4KWHA 3ETLA 1UBCA 4B40A 3C1UA 4OI2A 1AK9A 2O6LA 4LJLA 5TR9A 4KR3A 3KE9A 2JCXA 2ZYSA 4ZAGA 4WK2B 2DUNA 4LV5B 1N0UA 4HAZA 4JCCA 1R5NA 2J59A 4X93A 4FFSA 1XTQA 5D86A 5B1IA 3ZDQA 1D1PA 4E5KA 1JNYA 2BP7A 1YA8A 4O0LA 3N0VA 5I8WA 4PVDA 4LPSA 3WYCA 1EK0A 1S2GA 2DCUA 3QFSA 4IQFA 1FDTA 2VJBA 1JDUA 1V41E 2IYLD 3BOSA 3F5SA 3QFHA 4JOSA 3F46A 4ALIA 3PIDA 2XQJA 3SQWA 3UAOA 3HABA 2LVBA 3AKYA 4H1TA 3UQYS 3F5MA 3GLIB 1HNNA 4MJXA 2DCMA 3WGKA 4DAOA 1G291 4FS8A 2Z2JA 1MZPA 4V2IA 2WYWA 2XKJE 1U8CB 1W9MA 5BMVA 1PR3A 1OT3A 5E8RA 3WL8A 4DW8A 4TRNA 3A4LA 3EQZA 2CV1A 4MMZB 2Z4TA 3IHLA 4PBRA 4QAQA 3JQ8A 4IEFB 4QBFA 2Q8QA 3UQZA 4ALJA 5TEWA 2EIXA 4KN8A 2RC5A 1SEVA 2FY8A 1TT7A 1K0UA 2X5NA 2EF1A 5ADHA 1LW6E 4AFNA 1J0XO 1U6IA 3OWXA 1QX3A 1ZI9A 2PZFA 1ZKDA 4CLEA 4KRFA 4TYYA 2XZLA 5ALLA 3OQIA 2HPZA 3UPDA 1WBBA 2C59A 4FFWA 1K6EA 2J3EA 1KY4A 5G0WA 1E66A 4OCZA 3LF1A 3L1KA 3EAQA 2NQ8A 4R1MA 4YRDA 4CRWB 3Q9UA 3EB9A 2XA1A 4YONB 4IR7A 1Q7CA 5K8VA 1E99A 4OXXA 3ASYA 4AP9A 1QOQB 3TO5A 5FTWA 5JI2E 3I8OA 2H3EA 1BVRA 3QXJA 3HO8A 3AO0B 4WK6A 3WL4A 4H7IA 3D8HA 3ZCUA 2PEZA 2O0LA 2XX3A 3NDJA 4PLVA 2HA4A 2WKPA 1ZLYA 2VH2A 1SXIA 2EYQA 3ER6A 5B1SA 5CFZA 2YDXA 4KQMA 4N49A 3BK2A 5FUWA 2J0QA 4ZYXA 4C0HA 4RMJA 3GT7A 2IV7A 4DA4A 3QVVA 4DMUB 1Z13A 1ISRA 4RE6A 4C4RA 5EQFA 2VDQB 4ITVA 1E2UA 3E2PA 3AFOA 1G9XA 3PRYA 4EHHA 5A71A 5HUJA 2XGSA 2AOTB 3L7IA 2JAOA 4CL8A 4BO5A 2LDBA 1PTKA 1Y7HA 3DEFA 3UAWA 4I8XA 1K63A 1GPDG 2OP0A 4XDGA 1MIOA 3DMRA 1JMYA 1CR1A 1CX9B 3I9FA 3OOHA 4BEVA 1ZC4A 3A2LA 3CWZA 2P4HX 4KQHA 3JAMA 3TPCA 4L8LA 1X7GA 2BM0A 1L7NA 1PGOA 4D81A 3DBRB 4BP3A 1H2ZA 4IDCA 5TPWB 5ITZB 4LZOA 3A2NA 1PEDA 1SK8A 1U28A 4EFLA 2DSTA 1C41A 3KR2A 1PR9A 3NIBA 5BVHA 3CKLA 2QN2A 3GWZA 3DAHA 1G8PA 3N75A 4ZARA 1IK4A 1MPXA 4R9VA 1P4HA 4LJSA 1W96A 3ONFA 1Y5MA 3FMIA 3WL6A 2GD0A 4RX1A 2ACEA 2V98A 3QKRB 5JRZA 3U7HB 4AJHA 5JDCC 4FYIA 2NV2B 4GO1A 3KKZA 1YJBA 3IT3A 4A6PA 3ZJ5A 3E58A 4BWFB 4EHAA 3QVUA 4PZDA 3TZLA 3UMVA 3AEKB 1ZIYA 4Y6RA 1ZSYA 4KODA 1TUBA 3GNQA 3HKBA 3LUKA 1RP7A 4NH4A 1OA1A 3FPHA 4FCVA 3HZOA 2B21A 2G9QA 4IQ8A 4UEJA 4DXAA 1F8UA 1LRKA 1P29A 4QG3A 4QC2A 3AIOA 1MQAA 2GOYA 2X7XA 5I5EA 4O2BF 1QZTA 4FQ7A 3UHAA 4BO3A 2C5EA 3BSFA 3N3BC 3NVMB 4TGLA 3LUAA 3Q8LA 5HP4A 1WPGA 1M34B 1A4XA 3RS0A 2IRWA 2NXNA 3FFTA 4MIYA 1Y6JA 4Q9AA 4CKWA 3PEEA 2REQA 2C00A 2XTJA 1RRPA 3D1VA 3K92A 1T8UA 4CLXA 1SD5A 4RA6A 1IEQA 1W581 3DBLB 4KBFA 4I2VA 1EE2A 3OPYA 4V0RA 4BUJA 1YR2A 3BFVA 3QLUA 3FVTA 4O8ZA 1N5RA 5JXIA 4L7QA 2NYUA 4FGKA 2GZRA 3BGIA 4MRRA 5A7GA 3DZDA 3T8YA 1QHSA 2RCNA 2YMLA 2FW0A 1B3BA 2JGIA 3R6DA 4M86A 3KKEA 2C95A 3DF9A 3GFVA 3MILA 1C30A 3EDMA 5E3IA 5FOWA 4JVSB 2HYIC 2QQ0A 4LF6B 3G0DA 1AUVA 4XYEA 4Y9TA 2F8TA 2QROA 2WFLB 4C05A 2HMAA 3SQOA 2IYSA 4AUEA 3OC6A 1QHNA 2AOUA 4RM2A 5E0KB 3W8RA 5DBOA 4BB0A 4HNHA 2ID4A 4OAOA 4MVXA 4FU0A 1DX4A 5DTJA 1A7KA 3B53X 3STWA 1E3DA 3WL7A 3I1JA 4MIEA 4UBJA 1TYEB 3SHQA 1AMUA 3U3OA 3OQBA 3PVZA 2VH5R 2YVAA 1DPFA 2DP4E 2QRPA 2YWRA 1LLQA 2PL1A 3PXUA 1CFJA 2J1LA 2X4IA 3GGJA 3KR1A 3MQFA 3DLPX 1NE2A 5KHOC 3L0ZA 2BAGA 4KVZA 3ZV4A 4JITA 1EWRA 3QUAA 5EJMA 1JIVA 1Z5UA 2I34A 2N3ZA 4UUAA 5GGYA 5HF8A 1FFXB 4X20A 5BSMA 1YZKA 1YIAA 2PT5A 2KW5A 5E6RA 2IXTA 2WSLA 5I3ZA 1WZEA 3PNBA 4NYJQ 3WDLA 1D6NA 5K0CA 3MBOA 4OHBA 1AJEA 2J3JA 1V71A 4PZLA 4KXQA 1H6BA 5CXSA 4XQCA 5DYTA 2L82A 2RKOA 2RKWA 3R6WA 4MLDA 1H93A 3SJCA 3T0GA 1WXFA 2B1IA 1IRXA 2IYOA 2X7JA 4B6QA 5K6AA 1AF7A 1IATA 2F90A 4D80A 4TUYF 4IIYA 3SICE 1R0ZA 1XCPA 4BFZA 1V8ZA 3HP4A 1JXAA 2CUKA 3T5BA 3PCTA 1YACA 2ZS9A 4EHFA 1QHGA 1SCNE 3RVQA 1DTSA 3ZHOA 2M1ZA 3AF1A 3P2IA 2OSBA 4CV1A 2E82A 5ISMA 2J31A 3K70D 1T2NA 3S6JA 3LPDA 4ZCRA 1XHEA 1EWKA 1BIFA 4UPEA 3IPCA 2Q4TA 2LW7A 3EOBI 1X2BA 2HTFA 3U19A 1CYDA 2CSXA 3DDCA 5HWSA 1KVSA 2IZ1A 4YP5A 1E0AA 1JWLA 4W99A 2YOGA 4NMMA 1LJUA 3JZMA 2NACA 1IM8A 2AK3A 3D7KA 3O92A 1DEAA 1R4AA 4KE6A 3ZWDA 5I7SA 3OMWA 4OGLA 1T5BA 3CWQA 4EX7A 5DNYB 3LVQE 1K7YA 3GAZA 1ND5A 4DNPA 1U0TA 2PX8A 4BZWA 1XZKA 2C42A 2HIAA 4IV5A 5I51A 1M5UA 1NSFA 4HQKA 4K88A 1GPAA 2E4ZA 2GARA 1TUGA 4YRTA 3T7IA 1NC1A 3G5MA 2PVPA 1PV2A 3ID6C 3O8CA 5JHGB 1ZICA 3FNQA 2H11A 5AKHA 1WMSA 2ZVDA 5IASA 5FWYA 1I7QB 5LJLA 1QH1A 2J9ZB 1R6AA 3G2LA 3MPOA 5E6UB 1XTIA 4TMWA 5THQA 1G8AA 1X42A 4MWEA 1IIBA 2VA8A 4KB5A 1PU2A 1NGSA 4KXVA 3UMCA 3MTAA 1JLKA 3VU0A 1YRHA 1S9HA 1XNHA 4LOKA 1WB4A 1QDEA 3C3DA 4H7FA 1XZIA 4HQ0A 5DWQA 3GY0A 2VQFB 4I99A 3FTFA 1PN3A 3KWLA 4Y30A 2J4CA 4ZP1A 4N39A 1LDGA 1NNLA 2IEYA 2WR8A 3BL6A 2WJJA 3WY9A 4D9MA 1XWFA 2I7XA 3KR0A 5A4FS 5F5XA 2ASEA 5KOJA 1Z4PX 5LL6P 1NW3A 4FLMA 5FO1A 3RSLA 4D57A 5AW3A 1EJ0A 1NVVR 3P2YA 5LP6F 1U0HC 2G5CA 3ZNOA 4MW6A 4LJ7A 5K51A 3W3AA 3KYJB 1Q0RA 1T1EA 1NXQA 2OLJA 3FCSB 5LQNA 1YKSA 2GRJA 1QPGA 1B41A 4QUEA 2O8VA 3I45A 4E5DA 2QRKA 2QPOA 2ETVA 5A5VA 5L7WA 2E4WA 2CKDA 1GKUB 1KEWA 1P4AA 2FZKA 1ZN2A 1F4LA 2B4YA 3GBVA 2ZR8A 4G0ZA 5JDIA 3OECA 3AVPA 1U2SA 1FLNA 2R2GA 3FGOA 4RZUA 4WVFA 1I3NA 5BN4B 2XGGA 4GZ6A 1U1EA 3O8QA 4J16C 4GWLA 4QXAA 3CR8A 4IOLA 1RZRA 2WWGA 3RG8A 4TYMA 4ZVPA 1H0KA 5ILGA 1M2GA 4I14A 3TTYA 3QWBA 3C5VA 2W6ZA 4WOBA 1W9HA 4MVJI 2FZEA 5L53A 4S12A 5IM4F 5BNIA 5EKUA 3LCCA 3FPLA 4L3OA 4NK4A 3TRIA 2QTVB 4LF4B 2CZCA 5KX5B 4WKOA 4IZIA 4P8RA 4DQXA 1Z63A 4KXYA 4YAWA 2W71A 4G0MA 1T8PA 3EF1A 3FBTA 3LRPA 1Z5WA 3VNSA 5IF3A 4EYGA 4TXHA 2EFYA 1XPRA 2NXEA 2VJQA 3VMMA 2J9GA 4F86A 4QJ3A 4FHDA 1W1UA 3MIZA 4NH0A 5KMGB 2QRMA 2OGZA 2RHOA 4F9TA 3O4VA 2AG5A 1NT4A 1D8TA 2PUCA 2HR1A 3KL2A 4KDRA 1MJGM