4YC7A

Crystal structure of human fmnl2 gbd-fh3 domains bound to cdc42-gppnhp
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
179
structure length
179
Chain Sequence
AMQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQRGLKNVFDEAILAALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Formin-like protein 2
publication title The structure of FMNL2-Cdc42 yields insights into the mechanism of lamellipodia and filopodia formation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 60
structure length 179
sequence length 179
ec nomenclature
pdb deposition date 2015-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4yc7A00
2A2ZA 4AG5A 2W6JD 3H84A 4A8JA 3DM5A 1GIAA 2ZU6A 4CT4B 3C16C 4URXR 3EZ6A 1HUQA 3BFXA 4YDSA 2GCOB 3SU8A 1M6NA 3AKDA 1T3LA 1XCPA 3RRZA 4OQNA 4URUR 2DWQA 1SXJB 1NVVQ 3KJHA 1G7RA 3CRRA 5EJEA 4CGZA 3QKUA 2CHVA 1AK2A 4GI7A 2IYZA 3LBHA 5CB8A 4B3FX 1JXOA 1P2UA 5TXGA 1E2PA 1RC8A 2ZE7A 4D2IA 2H57A 4B3BA 4PPNA 2D7DA 3T1QA 3NC0C 4RD1A 3KUDA 2J87A 5EXSA 1VECA 4QHYA 1G3MA 4DCUA 3AB3A 4EFMA 3I72A 4BFTA 1NY5A 4CDGA 4CIDA 1CBUA 1NLFA 4HYYA 4JMPA 2FFBA 2IUSA 3CF6R 1XPUA 2Q0HA 1FMJA 3ZIAA 2OBNA 5EP3A 5JBQA 1KI8A 1KK1A 1LF5A 2VF8A 3BC1A 3WMFA 2GF9A 1JQJC 3E2IA 1MOZA 2KBFA 2AN9A 2ZUCA 4RD2A 3Q72A 4UNNA 4EPTA 1J2JA 2AFHE 3I8SA 1WE2A 1QHHB 2OHFA 3OFNA 5B30A 1B23P 5FOVA 3ZVRA 4HAZA 5L3SB 3CRVA 1ZW6A 1H8ED 4URVR 1PZNA 3X1YA 2VSOA 1AQYA 2AXPA 4S2EA 3SI7A 2QN6A 1BKDR 1NJGA 3H0KA 1RJ9B 4DB4A 4JT4A 2Z43A 1G21E 3RS2A 1GAJA 4DLVA 4XSHA 2AK3A 2CL6X 2V6IA 2WWHA 1TX4B 3QPVA 4PQRA 4MKFA 4RZXA 4DT1B 1GRQA 4DLRA 1RE0A 1GUAA 3PEVA 1RYHA 4M8NE 4RFVA 3S1AB 2ZR7A 5JS8A 4ZCIA 1VDZA 1E2HA 4PX9A 2REBA 2IYSA 2ZSDA 2GA8A 5DN6D 2NIPA 4GT1A 3TMKA 4YMUA 2BKEA 5FTNA 1QHYA 3A36A 3BGWA 1G41A 4TLEA 5E95A 3I5XA 1IONA 2FFAA 3K9LA 4P33A 2O8FB 1WDTA 4M53A 3VR1A 4F4CA 1I4DD 2QTHA 2CLCX 4FMDF 4ZI3A 5FBWB 4YXWD 2B7CA 5P21A 2PX0A 1GL7A 3BFKA 1S1CA 5EXTA 4HDCA 2ZYUX 2OCBA 1U0JA 1E2EA 1XMVA 1OIXA 1W2GA 3H1TA 2BKUA 4GPTA 1ZVQA 4HUQA 4V0OA 4B75A 2PX3A 1IQPA 5ELXA 4OI2A 1WBDA 3IEUA 1E9CA 4FINA 1KAGA 1YR8A 1NMYA 1NY6A 4N0EA 1IXSB 3IILA 4CEIA 1ZYUA 5EXPA 4TL7A 1NMZA 4UNSA 4ZIRA 4Y0VA 3QXCA 2Z83A 2QAJA 1HYQA 1TNDA 3RABA 2V1UA 4PR0A 2IYQA 6Q21A 2HYDA 2KJQA 3Q85A 5FR2A 1W0JA 2ORIA 4M21A 3A4NA 1II9A 1OT3A 5JWHA 2R65A 1NMXA 1NN3A 1YQTA 2ZJ5A 4LOAA 4Q4HA 3ZIAD 1ZM7A 3FHTA 2F1JA 4WIAA 4EJSA 4ACAA 1KGDA 2CLDX 3P32A 3K0CA 2IL1A 1VIAA 2FF7A 2IYRA 1E99A 3I1FA 1G18A 2CBZA 3AGQA 3OFND 5EP4A 1SXJD 4M9SA 4A8JC 3HJNA 3KFVA 4FD2A 4LJ5A 4YMVA 1NG1A 1SVMA 3CPEA 2XOKA 5LBIA 2GXAA 5JEEA 1E0AA 1QHNA 3OESA 2CDNA 1OXVA 5G40A 2JJ1A 1DG1G 4A0FA 4NDZA 1E1QA 1CS4C 3LH5A 4MKGA 3AVXA 4F91B 1U8YA 3R8FA 2I4IA 2YC2C 1FUUA 4XWKA 3KXLA 1P62B 2LCFA 3PUXA 4M1YA 2A5JA 5DHAA 1NSFA 1CLUA 3DPUA 3SOPA 2ANBA 5BN3A 3QG5A 5HKKD 3RC8A 1VTKA 5JRZA 4Q1EA 4JKYA 1XFAA 3MLEA 2CJWA 1TQDA 4TLBA 2OM2A 2P2LA 1LW7A 3BS4A 4B74A 2ATVA 2YNMA 1W46A 2VYFA 3DKVA 2XJ4A 1V43A 1YJ5A 2CE7A 4GZMA 2LKDA 1OH6A 4URYR 2ZJYA 3R9IA 1T9HA 3ZZUA 3D8BA 4LRWA 1N5IA 1QDEA 1PLLA 5FH9A 2JLYA 2OBLA 2UZIR 5C46F 4LJ8A 1D8TA 4LHWA 2YHSA 4URWR 3U3JA 2GRJA 2V3CC 1BMFA 4TL9A 2ZRPA 1VCMA 2Q9CA 2WV9A 5CM8B 2ZR9A 2J0VA 1DTSA 2J7PD 4C0AC 2YZ2A 3QENA 4KO8A 2CCKA 3CKLA 2EYQA 4M1KA 2QM7A 1XTRA 3W90A 1GL9B 4L15A 1U99A 2GAAA 4FWTA 3QG1A 3IEVA 1OB2A 4CEHB 3BBPA 5FUYA 4NTZA 3NH6A 3VU9B 1W0JD 2F43B 3THXB 1K8RA 2GZDA 3OE7A 4HSEA 3RSLA 4LHXA 2QTFA 2ZSEA 4A82A 4PHGA 2IT1A 2ZRHA 5SZHB 3AVUA 1KSJA 4Q03A 4B47A 5KNCA 1P7CA 3X1XA 4CRWB 3NBYC 1P3JA 3EA0A 4K8OA 1SVIA 4FXPA 4LYHA 2GCPA 2GXUA 1QVAA 1XX6A 5CIQA 3ZDQA 2VHQA 1NKTA 2BEJA 2OESA 4P4TA 5TB5A 2XOKD 4EUNA 3GEEA 2RHMA 4Q47A 4D4MA 1JQLB 2JJ1D 3EC2A 3ZQJA 1A1VA 4ZO4A 3K8YA 1E1QD 1US8A 3FDIA 4D0GA 4ARZB 3LO5A 3CRMA 1G1MA 2W58A 3PV0A 3CR7A 2QP9X 3MFYA 1VG0B 5TV2A 3PCRB 2O8DA 4K46A 2R6CA 3KDSE 521PA 3V4FA 4JLKA 4JT2A 4C7OB 4F38A 3Q7PA 4A4DA 2LKCA 1WA5A 3BB1A 3VTKA 1KMHA 1P9RA 3P4XA 1EFTA 1NJFA 1DADA 4EJSC 3P27A 1R5NA 4LYAA 1E69A 3NDBB 2BCGY 4E09A 3L0PA 1KNQA 2X2FA 5GADl 1AN0A 3B9QA 2QROA 1JAIA 3T1OA 2GEVA 3LAWA 1FPMA 2WPDA 3EARA 4BGDA 3QKSA 3QXHA 4ILEA 3QI2A 2IS6A 3A1UA 3P1JA 4N0DA 2F1HA 3B6EA 1TTTA 1BMFD 3FYHA 3PUYA 3BB4A 2WWYA 1XPRA 4NYMR 4RVCA 4M0LA 2RGAA 3OEHA 5EZ5A 1UJ2A 2QAGB 3THWB 2FG5A 5ANRB 5DNYB 4OL0A 3OEED 1E4YA 1RYFA 1Q3HA 2ZRAA 4PHFA 1SKYB 5HR5A 1K5DA 4LC1A 3TUJC 4LJAA 1IJEA 4MDFA 1E4VA 1JJVA 2CVFA 1MO3A 2BMFA 3OE7D 2ZJ2A 3IHLA 3U5ZB 2GVDC 3IPXA 4URZR 4CYMA 2JIZD 5E7MA 1RRGA 4AC9A 1EGAA 1R0ZA 2ZRDA 2ANCA 2ZR0A 1NP6A 4MGIR 5TMPA 3W5JA 3VNUA 2JLSA 2RGCA 1Q12A 4WZ6A 1XXHE 5FTKA 4B34A 2UKDA 2HXYA 1P5ZB 3QVVA 1EFCA 1R0YA 2H8KA 2RGGA 3F5FA 1XCMA 3QKRB 1IN5A 1N6IA 4M9ZA 4KXFB 3GLIE 1G4UR 1L4YA 2OLJA 1XEXA 3ND9A 4DKXA 1JECA 1JR3A 4G5GA 2DFLA 1OHHA 1XXHA 4QBFA 3BIFA 3SEAA 4PPFA 3U60B 1IOZA 4A9AA 1YRAA 1NVVR 1OF1A 1JAHA 2GEDA 3DMNA 2ZI9A 1NKSA 3TSOA 2C99A 2CHQA 4GP6A 2C8VA 3SJCA 4A0GA 3C7KA 3VHLB 3GFPA 3L8ZA 4MUAA 4C9BA 2GILA 1G3QA 2FFQA 4B3XA 4UJ5A 3VKWA 3UWKA 1VYVA 5DE3A 2C78A 1YRBA 4M4SA 5KU1A 5JJLA 2HF8A 3I5YA 1G4AE 1AGRA 1YZNA 4KFUA 4OJKA 3HU1A 2F3RA 1NVUQ 2QPOA 2MSCB 1T3HA 2ZS8A 1HV8A 4DSNA 1E2KA 2WVJA 3P26A 5FPTA 3CB4A 2WPDD 3KQNA 4OI0A 1N0UA 4EQ6A 4QKQA 2R2AA 1CKEA 4PTLA 2FGJA 3NBZC 2CL0X 2QMUA 3CBQA 1GFIA 3WBJA 3X1WA 3O8RA 3HU2A 3U4QB 2FN4A 2VP6A 4JVMA 2NZ8A 3H2YA 2JATA 1XF9A 4B6EA 3OEHD 2H17A 3EIEA 3FHOA 4KJZA 4M1WA 2QSYA 4L5BA 2BHRA 4M1SA 4RCZA 4ZV4A 2QENA 1ONBA 1T0JB 2GAOA 2IYWA 4JJKA 2RAPA 3KL4A 3E1SA 1KSHA 4X8MA 4V0NA 5GJVC 2F1RA 1H8HA 2P3SA 4LX0A 3QF4B 2CL7X 4QXAA 3GEIA 2NGRA 1G7SA 3IKJA 4JVSB 4FIDA 2AFIE 4IFEA 1Z63A 4LBVA 4TYNA 3FPAA 3AVWA 4QBIA 1OJLA 5F9HA 3Q3JB 3KKPA 4TQAA 1QZXA 2W6ID 2BBWA 1XTJA 3M6AA 4OQFA 4CZ2A 2DFTA 3LVRE 2Q9AA 3EW9A 4MYHA 2A5GA 3VNVA 2XJ9A 2Z4SA 4BUJA 3U61B 4M22A 1KI4A 3GFOA 2FWRA 3K70B 1KO7A 4FCTA 3SYNA 1F2UA 3PJRA 1IY0A 4YMTA 1FFHA 1FP7A 2O8BB 3I92A 1TF7A 2WMOB 1XEWY 2KE5A 5DYGA 3C15C 3ND8A 2AKYA 1JR3D 4BFSA 1XD2A 4DRZA 1OHHD 2TMKA 3ZYCA 3OIYA 1E96A 1GVNB 3EZFA 4MKHA 3LDAA 1ELOA 1VG1A 1GDDA 4DCVA 2QPAA 2JLVA 2VLIA 1GZSA 2ZRLA 4DB2A 4H9GA 2ZITA 3CNNA 2KB0A 4AI6A 2V54A 3TUZC 3I61A 2HYIC 1XP8A 2XZOA 3L0SA 5CJPA 3EZ7A 3IPYA 2FGKA 4JJZA 3TJZA 4ZDJA 2C9CA 4I99A 1TMKA 3EWSA 4D4JA 1W36D 1X3SA 2RGEA 3L43A 3Q5DA 2OBMA 3UMSA 5LD2B 3JVUA 4JZKA 1MRSA 1YR9A 2A9KA 2VP9A 3LNCA 2ORWA 5EE5B 1W7AA 2I1QA 3TGPA 3L0IB 4V02A 5DLQC 2V6JA 5JRJA 2VP4A 3GLFA 5J40A 4NMMA 1J70A 1OSNA 4C30A 4QBHA 2FEOA 4FI3C 4B43A 1CRQA 1U98A 3O8BA 3EWAA 3SJBA 4C0LA 1ESNA 2IS2A 1BH2A 1AJEA 1B0UA 2PCLA 1TUEA 3DOEA 5EP1A 1KDTA 3RS5A 3I73A 3GJ8A 3B1ZA 3EPHA 3QOFA 3KFXA 1P9WA 1H8HD 3HR8A 4N1AA 3ADKA 3R9XA 1S4QA 4LHZA 1A2KC 3AUXA 1LVGA 4NCJA 4MDEA 2HT1A 3GLGE 4BEBA 5BW8A 2CK3A 5FUXA 4D4KA 4HAWA 2AD5A 4NYIQ 4BFUA 4AKEA 3AP3A 1W36C 1IBRA 3A37A 2FOLA 4V0MA 4KITB 3QSYA 4JYCA 3CWQA 4Q1FA 5EE1A 4DSOA 1P72A 4U00A 5EQTA 1RVDA 1CXZA 5KO2A 5JZVA 2NTYC 2PBRA 3GLGA 1AS3A 2XEXA 5JSZB 4L9SA 4TSFA 3UMRA 2FDCA 1RRCA 1GNQA 3GFTA 3G5UA 5KSPA 2W00A 4P3YA 3WBKA 1LY1A 1NLYA 1XZPA 2DFNA 3MWKA 2W6JA 3ZD7A 2FH5B 1XTQA 2BM0A 3AF2A 5JCZA 3THYA 3EPLA 4ZKDA 1CULC 5AUPB 2E1RA 4HZIA 5FTJA 5CJ2A 1N6PA 4LJ6A 4Q7JB 4R9UC 5EZ6B 1AS0A 4OI1A 5JJIA 2OE2A 1NL3A 1SVOA 3SHWA 3UG6A 3KXIA 4U02A 5SZJA 3C5CA 3TQFA 3K0EA 2C04A 3SDZA 3K70D 1OFTA 4ZI2A 3J81k 2C03A 1TL7C 1UDWA 4WBSA 2OT3B 4L9WA 4P4UA 1Z06A 1AKYA 1E3MA 2QMEA 2R6FA 1WQ1R 4LV5B 121PA 3KKOA 3FE2A 2AL7A 1KOFA 4BZQA 3A6PC 2GWHA 2ZVQX 1G9XA 1TAGA 2RGNA 4ZPXA 2F55A 2E87A 4DDUA 1MV5A 3AKCA 3G0HA 2MMCA 1KDPA 1AS2A 4A2QA 4PSAA 5TY0A 4BRUA 3KQUA 3TIFA 5DYIA 3NEYA 1E9AA 4BFYA 1FQKA 2AXNA 4MRPA 3LRPA 4LPKA 2PCJA 2N1BA 1OB5A 1H8EA 2WICA 3A58B 1DS6A 5L3RA 4HB4A 3I4LA 4NCIA 4Q19A 4E07A 5LPNA 1MABB 1UKZA 2A5DA 3AUYA 4PO9A 1E98A 1FX0A 4R7ZA 5FPHA 2CK3D 3LD9A 4AYWA 3NKVA 1Y63A 2ZIAA 3NIBA 1YZUA 4OYHA 1OV4A 4D0NA 2YWHA 4KYUA 3LY5A 4PQFA 1GOTA 2EVWX 4C0QC 4LHVA 1KJYA 1CIPA 5CK5A 1CRPA 5GJBA 3ZGXA 3QEJA 4HUTA 5DN6A 4AG6A 3QXXA 2CLSA 1ZM3A 3TBKA 3RS3A 4PAOA 4IOLA 3BE4A 4QGGA 3FHCB 1E2IA 3AKYA 2XGJA 1D9ZA 5AJVB 4TSFD 4TTQA 2OCYC 5D3MB 2DPXA 4TYPA 4I4LA 1QHXA 2FSIA 1KI6A 2IK8A 4S35A 3SJZA 1RPZA 1J8YF 1HQCA 2XTNA 1VG9B 3ASZA 4W7SA 5IK2A 4YXWA 2QBYA 3TNFA 4TMWA 4D82A 5KUTA 4EFNA 4JBWA 3EASA 2QNRA 1AZSC 4G5RA 2WTUA 4LBZA 2J7KA 4JSTA 4Q18A 1MO5A 3K0SA 5LB4A 1VHTA 4BFZA 4C2UA 1S2MA 2HCBA 1TPZA 1TQ4A 4DVGA 2IYYA 1TF5A 2P67A 5AUOB 3TSWA 1CR0A 5FBLB 1HE8B 2GBLA 3D3QA 5GJCA 1X8LA 1L4UA 1VCOA 2VPPA 3HP1A 1IN8A 1SXJE 3PUZA 2PJRA 1T6NA 2PEYA 1XWIA 3W3AA 4M9XA 1LB1B 2J41A 4X8HA 2IWRA 1DO2A 3FMPB 3AVTA 4DIDA 4PHTA 3IIMA 1G7CA 3FTQA 2NPFA 3FMFA 2IX3A 2UZ3A 2G77B 4BWYA 1XD8A 4Y0AA 3EPKA 2ZE6A 2GCOA 3PUWA 2VA8A 3BAFA 3NXSA 2EFCB 1RKBA 1YZQA 1SXJA 1HURA 1XB2A 2D06A 5C18A 1VCNA 3QF7A 2PL3A 1VHLA 1ZNWA 3N5CA 2IYTA 4IOMA 2R8RA 2ZVPX 3CZQA 3F3YA 3GEHA 4OK3A 2HUPA 4TLCA 3KB2A 3W9YA 2FMXA 2WIBA 4L8GA 4PO1A 5L8VA 4B33A 5GVRA 3PUVA 4JLDA 4DDWA 1NVXQ 1P75A 2DWOA 1YZKA 4M1MA 5TDHA 1ZJ6A 1M8PA 2W2TA 4IOKA 5SZKB 5J4KA 3BB3A 1P4SA 3VR4A 1DARA 4H1VA 3UATA 1CR2A 4LJ9A 3QPUA 2JLXA 1JI0A 1GWNA 3LW7A 4PQYA 5HKKA 2ZJBA 2D2FA 2FV8A 1D2NA 1KDRA 1L7VC 1ZM9A 3EIHA 2WKPA 4PFSA 4HI0E 2WOOA 3BH6A 2RGNC 3PENA 1NG9A 1QHHA 4JKIA 5E7JA 3KQHA 3IQWA 1CU1A 4NYJQ 5L3SA 4LUCA 5CLQA 1JPNA 2J1LA 2GETA 4HZUB 3SQWA 2OILA 3CX7A 5IK2D 2XAUA 2QORA 2YWEA 3O8DA 4OJQA 1G5RA 4TN1A 1R4AA 1RJ9A 4B76A 3LBNA 4WAUA 2WIAA 2W2XA 1RZ3A 4DHEA 1YHNA 1KZGB 4DT1A 4US2R 4LGMA 2YWFA 4QNMA 4LK2A 2GXSA 4TQ9A 1U2RA 3S1AA 2J7PA 1VPLA 5CLLA 4Q9LA 1OIVA 1ZNZA 2D4HA 4F4IA 2H92A 1R10A 3V00A 2VQSA 2ODEA 2GCNA 3HPRA 3BERA 4JBXA 5GVSA 2BMEA 4KBFA 2C2HA 1WRBA 4A1FA 2NPIA 3CR8A 3RRNA 4KLZA 2ZYTX 1XU4A 4YDHB 3SFZA 1ZNYA 2O8FA 2JCSA 1E79A 4JLNA 2LWIA 5BN5A 3TK1A 1YZGA 2IF0A 3NHBA 2YV5A 3QVUA 3U6KA 3LV8A 1X1SA 4A6PA 5JHGB 3CNLA 3B7GA 4QJ5A 1DELA 3AQ4A 5EP2A 3UKDA 5A4JA 3SQXA 2V4ZA 3QJYA 3RRYA 1M7BA 2ZE8A 3EX7C 2NMVA 2NG1A 4O25A 5IDVA 1N6OA 1F2TB 2VO1A 1N5LA 4MRRA 4QGHA 1G3UA 4LWZA 1UEIA 1SHKA 1W0KA 4KYIB 4RJLA 4G5SA 2DWPA 1XJQA 2AK2A 3D7MA 1QRAA 3CF2A 1LNZA 4HLDA 3DDCA 2DY1A 2YC4C 2ODBA 1HQYE 2C98A 3FWYA 1W1WA 5AJYA 2OFXA 2RH5A 2BBTA 2XXAB 4OHXA 4XH9B 2ZI6A 4C0BA 4KODA 2GBLC 1QG2A 1SVSA 3W6PA 3RLFA 1PLKA 2EYUA 3QBVA 1IHUA 3Q7QA 2XZLA 2O8CB 4TMXA 3U3MA 2P6NA 1MH1A 4LBWA 4A15A 3C8UA 3T12A 3TE6A 1F2TA 2ZRIA 4RKEA 2OCPA 1YKSA 3E5HA 4Q4JB 5CYOA 5BYKA 4GOKA 4O2RA 1EG7A 1NBMA 1XPOA 2WJVA 1JEEA 4NONA 4O2LA 1E2FA 3RNLA 2Q21A 3K09A 3Q5EA 1OE0A 2DB3A 2ECKA 2J45A 4JLMA 1SXJC 1ANKA 1F5NA 3IO3A 3NVAA 3WNDA 1ZD1A 1GKIA 4PC2A 4U5XA 3M0EA 1P73A 3NH9A 2GJKA 4G5OA 4ZKEA 3MG9A 3U6BA 1ZINA 3QY0A 1N0WA 3EZ2A 4QFMA 4AD8A 3GJXC 3FKSA 621PA 4JBYA 2O0JA 3MWYW 2O8EB 3OIUA 2G0NA 3LQQA 3OEEA 5AWFC 2FPMA 5H1YA 4PC3A 1GRNA 2ZAOA 4D6PA 3WYGA 1DBSA 1C9KA 1W2HA 1D2EA 1E79D 4P31A 2JDIA 2JLUA 2QQEA 2R6AA 2IA5A 2QUZA 2RCNA 4LHYA 2FFHA 5J4LA 3TW4A 2JIZA 3N70A 4IRUB 4JL8A 1KAOA 4QBGB 4AWXA 3U44B 4KU4A 1QHIA 4JLJA 2MSEB 2ZETA 4XWOA 1FMLA 2VHTA 2IS4A 3IDQA 1E2QA 2G9NA 4MQBA 2P65A 4FCWA 1Z29A 1W0KD 3BH7A 2RGBA 3VFDA 1TQ2A 3QEOA 1KI3A 2PT7A 5B58C 4QRHA 2W0SA 5G53C 3AP2A 5F3WB 2R62A 4CEHA 2IYLD 5FOWA 4PPGA 2D74A 4HDOB 3LLMA 4QHTA 1ZNXA 2F43A 1XEFA 3VU9A 4KVAA 3THXA 1YU9A 2C77A 3M4YA 2QGZA 4DEYA 2ZS9A 2F3TA 4NBSA 2J0UB 3X2SA 2GJ9A 2N46A 3W34A 2GJ8A 4US0R 3NTUA 2A7QA 2OFWA 1DAHA 4QL3A 3SN6A 3WNCA 4EPXA 1F3OA 1XMIA 2IF2A 2NO0A 4TYQA 4YC7A 1NBMD 1ESMA 1K5GA 1LV7A 2H5EA 2DBYA 2IEZA 4OHZA 5J4HA 1NN5A 4B3CA 2H1LA 4C0JA 4IHQA 4XWAA 3EA5A 5HPYB 3ADDA 3K0CC 3CX6A 1VCIA 5BYJA 4RFSB 2QSZA 2YVUA 1OFHA 1E2GA 2HEIA 1J90A 2ZEJA 1Z2AA 2V7QD 1JNYA 1Z83A 2AD1A 4P32A 4P4SB 4C0SA 2IXEA 2VIIA 2ZE5A 4ARZA 1S96A 1Z0AA 2PZEA 2XNDA 4XD7A 4PZLA 1ZD9A 3VKGA 1G64A 2FX3A 2DHRA 1E9RA 3IIJA 4V03A 2J0UA 1F48A 4C7OA 3FKSD 2GHIA 3RRMA 3DM9B 4ZDKA 4HAVA 3AVOA 4ABYA 3CUEF 3CLVA 3VAAA 4Q9HA 4GDFA 1KI1A 3FKQA 1Z8FA 1UKYA 1YZLA 1NN1A 3IBGA 2P6UA 4NHOA 3K9NA 2IC5A 1AA9A 1Q57A 1E2NA 4LSGA 2JDID 5AJWA 3ZH9B 4TTPA 1E2JA 2A30A 1HT1E 1N6RA 1O3YA 1CF4A 1AIPA 1RW4A 3IUYA 2CE2X 2IHYA 2ZRNA 1ZU4A 2E9SA 3UG7A 5C4MA 5KHOC 1NRJB 1EX7A 1XRJA 2WJHA 3K09C 4Q00A 1JR3E 4IKEA 3AM1A 4MGZR 4GOJA 4LJ4A 2QRNA 2ZRBA 4NH0A 1W44A 1E9BA 1FNMA 2QA5A 2W6IA 5AJXA 3AVYA 4DEXA 1Z0JA 1BS1A 2QZ4A 3SZRA 5K8LA 2QAGA 3THWA 2B21A 2BEKA 3C4JA 4C2TA 3QKTA 2QTVB 4OI4A 2CVHA 4NZYA 3OIVA 3DMDA 1KZ7B 1I4TD 3P4YA 4IXMA 3GLIB 1LF0A 4ZDWA 3WMGA 4Q1DA 1NSTA 3AVQA 2IS1A 2G1KA 4TMKA 3MD0A 3W3ZB 1N3BA 2B8TA 1D9XA 5FTMA 1UBEA 1X6VA 1CJUC 3AKEA 5C1BA 2VHUA 2IXGA 2W0MA 3TRFA 2DCUA 5CB6A 2ZRMA 2XZPA 3MCAA 4KFRA 2XSZA 4IJMA 4LBYA 4EPWA 3UK6A 5EUMA 1FTNA 1VMAA 3QKRA 1OXXK 2F9MA 4BLQA 3WYAA 4DCSA 2QEQA 2BCJQ 4JSYA 2XX3A 3K0AB 2FE4A 3RHFA 4Z1MD 3T06B 1E9DA 1G8FA 2QMOA 4BE7B 1W4AA 2XNDD 1XEWX 4BLRA 4XD7D 5KSOA 3B1YA 3CPHA 3G82C 1W4BA 2VTKA 3BORA 4LYFA 4E5UA 4MRSA 3GLHB 1QHGA 2J9RA 4C4PA 1N0VC 2Q3FA 1TF2A 4DLUA 3TQCA 2RKOA 2OAP1 1MT0A 2HCJB 3ZLJA 1Q3TA 4QHSA 1KNXA 1KKLA 2W83A 3TR5A 4DIEA 1OLOA 1L2TA 4HATA 1E2LA 2CEAA 2WAYA 3B5JA 4NCNA 5F2EA 3UPUA 1E2DA 4DLTA 1UFQA 1LTQA 2J0QA 5DH9A 4LZZA 2PH1A 1U0LA 5AUQA 5FPKA 3PEYA 3NG1A 3K0AA 5KDDA 4TMTA 4B44A 5J4YA 2ZANA 3ZZ0A 1JBKA 1QG4A 3SYLA 3CF0A 4MKIA 4YONB 3MMPA 1XMSA 2D62A 1FOEB 1JEDA 2WWIA 2BVNA 2IUTA 3H86A 4IDOA 3U4QA 1U8ZA 5FUVA 5A5GA 4F92B 1E0SA 2OAQ1 4Q7LA 2BOVA 4NYJR 2JJ2A 3ZVNA 2JASA 3LLUA 3UMFA 2QY9A 4MITA 3DZ8A 4MH0R 3CWZA 3MRSA 1P6XA 3CM0A 2FNAA 1J99A 1DPFA 1M74A 2AKAB 4A2PA 1VIYA 2ODNA 2HLDA 5D3QA 4B32A 721PA 3UANA 4LY6A 3QF4A 1LS1A 3IQXA 1BOFA 2Z5FA 3HU3A 3VR3A 4LPSA 1GNRA 4B35A 3WHLA 4GOXA 3WHKA 2QRZA 2BM1A 3L0OA 3RC3A 2PZGA 2REXB 4B2PA 2JLRA 5CK4A 2IHBA 4KV9A 3BJIC 2VH5R 1BIFA 3EAQA 1IN4A 1E94E 4HAYA 2XSZD 1Q22A 3GLFE 2FPKA 1E9SA 1GL6A 2FPLA 3GJ0A 2O8BA 3KXKA 2N42A 1J8MF 4HDQB 4PSKA 2ZUDA 1OYWA 1C4OA 3FVQA 5L3QB 5L3VA 2QAGC 2ZJAA 1SVLA 3RWOA 3T15A 1Y3AA 1PUIA 2GKSA 1W5SA 4DLXA 3M1IA 1HEIA 3AF0A 1D5CA 2OG2A 4Q02A 2GK6A 4RCYA 4K81B 1RIFA 4HLUA 1XZQA 2W2VA 3KQKA 2WKRA 4Q01A 2QP3A 3PEWA 5FBQB 2QM8A 3VR2A 4MGKR 5JWOA 4V0ME 3B1VA 4Q9KA 1TEXA 4UNPA 3HDTA 2RMKA 2RGXA 2HF9A 5HE9A 2A5FA 4Z8YA 1KSGA 3FGNA 3CRW1 1EESA 3RDPA 3R7WB 4D80A 5JCPA 2OSBA 1ZU5A 5KNDA 1UF9A 4I1SA 3FFAA 3F8TA 1PVOA 4YQFA 2OXRA 2JA1A 2QG6A 1S3SA 4DCTA 4Q7KA 1IY2A 1T3SA 2OEPA 2WKQA 2HXSA 2ZM5A 3JZMA 3SC3A 3FFBA 3IBYA 3QUSA 1MRNA 4KAXA 1N5KA 4RD0A 1NN0A 2WOJA 2GF0A 3FMOB 4HAXA 2J5XA 2B92A 4LJYA 4PC1A 4TL8A 1IY1A 1G5PA 2J3EA 4RSGA 1XNJA 4POAA 2JJ2D 4FWIB 4KSCA 4GMXA 1HA3A 4PZYA 4DLSA 4JIMA 3BH0A 1JB1A 1P60A 4TMZA 1G291 1X8JA 1A5TA 4OKSA 2OO7A 5DGXA 1QBKC 2HLDD 5E3HA 3EIQA 1KSFX 4I81A 4CEJB 3I32A 1R5BA 2ORVA 1DE0A 5BWMA 1ZCAA 4F4JA 1Z5ZA 4TT3A 1X86B 5J4VA 1VYTA 1WB9A 4WW0A 2VRWA 2Q3MA 3HYTA 1U8AA 2V55B 2KBEA 4NKRA 3CO5A 4BLPA 4W9MC 4DLZA 1MKYA 4HEJA 4O0MA 5JS7A 1OH7A 3EG5A 1GG2A 3SS8A 2GDJA 4GSYA 1DAKA 4X8OA 2YOHA 4FMBB 3SYKA 1UADA 5FUWA 5DO9A 5AK0A 1UAAA 5JLJA 4CW7A 4XTCS 1ZM4A 2QE7D 4NCHA 4B3DA 3W8RA 2RB4A 4BASA 5JSZA 2Q3HA 1D2MA 2CNWA 3EC1A 2AR7A 3D31A 3K53A 3KTAB 4C3ZA 4HB2A 5LB2A 1P9NA 2FEMA 1GITA 4HB0A 4JLVA 3KQLA 1S9DA 4TZ0A 2FZ4A 3TAUA 5SZIA 1IJFA 3CRQA 4TQUS 2ZYVX 4AYTA 3U7HB 4M9QA 3REFA 4A36A 2MMGA 1A2BA 2X1VA 2HT6A 3A1WA 3HWSA 1UM8A 2EW1A 4Q4AB 3AGPA 5C2JB 3QBTA 1KO5A 3KJEA 5FL7D 1FTSA 3N2IA 5CIWA 1U90A 4F93B 3DZDA 4MRVA 2OXCA 1R8SA 1X1RA 1H65A 3K70C 4KVGA 3RS4A 1BO6A 1G6HA 3H4MA 5DI3B 4LC0A 3SBDA 3W6NA 3LX5A 3LVQE 3PR1A 4CT5A 4NYMQ 4P0TA 1DAIA 2Z0MA 3K0FB 4R71A 2D7CA 3DKPA 1GKYA 1ODFA 5KSZA 1VG8A 4IDQA 5KNBA 3DEFA 2WJYA 1T8UA 4A8JB 1ZUHA 821PA 4HLUC 3ZZTA 4DSTA 2G83A 3B1WA 4WOPA 2FSFA 4EKDA 1KK3A 4BZXA 1ZUIA 2A78A 2R44A 1GSIA 3AF4A 3W5IA 5TARA 1W47A 1MABA 5DISB 1ZIPA 4M2LA 2ZREA 3KJGA 3VQTA 1CP2A 3VX4A 1E6CA 4TT3D 2FU5C 1S8FA 5JECA 1IN6A 4B73A 2VP0A 3QNUA 2BV3A 4GNKA 1HY3A 2IYXA 3HYRA 5CITA 1E0KA 4EPRA 1NI3A 5LD2C 3C14C 1E2MA 2WWGA 1NVWQ 3D6TB 4Z8XA 5AUNB 4BPBA 1TU4A 3AVVA 2IBMA 1ZIOA 1SKQA 1YR6A 2J46A 1KO1A 3GJ5A 3R9WA 3BK7A 1FQJA 4AY2A 1EWQA 3RVBA 4UXIA 1M7HA 2FA9A 1WXQA 2WSMA 1CJVC 4QM6A 4DZZA 2BMDA 2CNWD 2EWVA 1CJTC 3B60A 5D3MA 2ZRCA 5EXXA 4BECA 4II7A 3LXXA 4PPQA 2BMJA 1COWA 1WF3A 4Q48A 3ZVLA 3U7FB 1KI9A 1DAMA 1W49A 3SFVA 4H1UA 2D2EA 2WWFA 1S9HA 4IXNA 1RRFA 4C0HA 5C4GB 5JJKA 4GZLA 2IXFA 5EE0A 2O0KA 4FMCB 5JHHB 1Q20A 3ZVMA 4Q4LA 3PFIA 4Q5IA 5UKDA 4GRAA 2VL7A 4W5JA 4XJXA 2BBSA 2K5UA 1WBBA 1KY3A 2BBOA 3VMFA 1R0XA 3QXJA 2NO6A 1A7JA 1WMSA 1OFIA 3PIRA 3WNBA 4G3XA 1JPJA 4NPHA 1N6NA 3E70C 3WY9A 1ZAKA 3SJAA 2ONKA 4HAUA 1O87A 2R6GA 1YVDA 5KPDA 1IAQA 3WRYC 2NZJA 4BFWA 2BDTA 3LXRA 3BFVA 3ADCA 4JVLA 2WBLC 4WXRA 1A82A 2ZI4A 1GM5A 2VP2A 4DUGA 3CNOA 2CCJA 2YOFA 5FBRB 4BRWA 1G3IA 3CPJB 4RZ3A 2IW3A 2RGDA 1GNPA 2ZUBA 1QHSA 4HB3A 4QGFA 5FOTA 1ZUNB 2EWWA 1M1YE 3LW8A 8OHMA 1TUIA 4B3GA 4HUQB 4NL4H 2PEZA 2ZQ5A 1ZD8A 4QJ3A 1UKVY 5AJZA 4D4LA 4Q9IA 4CEIB 3N2EA 1EFHA 2QQ0A 2ZRGA 4ZIRB 3LX8A 1P2TA 1Z6AA 2GZHA 4JLPA 2O0HA 3B9PA 2VF7A 2ZTSA 2QL6A 1K6MA 2C95A 4Q7MB 2ZPTX 4QG7A 1S3GA 2VHJA 3TR0A 4X8LA 1U81A 4Q4HB 1XTIA 3K1JA 4EJSB 3QIAA 3REGA 4RKFA 4BEJA 2ZI7A 4BQSA 5JI3E 2C96A 2GESA 4UJ3A 4WVFA 1COWD 3DL0A 3FMIA 4LI0A 4EPYA 4HZUA 1Z0DA 2ASEA 1AKEA 4JYBA 2NO1A 1R6BX 4AURA 4TMVA 4EDHA 4B2LA 1UBGA 4GP7A 5FI0B 2XNSA 1P2SA 3AH8A 1KIMA 2D3WA 2QMHA 4IFBA 5H70A 2ATXA 2PJZA 5IHPA 2WSSA 3UXMA 4UNRA 1N2CE 1Z0FA 4RD3A 4D0LB 1P61B 1Z0IA 1RFLA 4OHYA 4TTRA 2G3YA 1G5TA 3VHXA 2BIFA 3TSZA 3NC1C 2ZU0C 4ESHA 4I1UA 4KBGA 1NBME 4KSBA 2JEOA 2PMKA 4DBLC 5IF9A 1VYUA 1XBTA 2CXXA 3TVTA 4CF7A 2XB2A 1HH4A 5HCIA 3SNHA 3ZS8A 1V5WA 2CJWB 2OCAA 2OV2A 5BQ5A 3QXSA 2FSGA 2GEUA 3OF5A 1ZRHA 5DHFA 1KK0A 5FL3A 1NNEA 2PLRA 3MSXA 4DUGD 1VKJA 1PV4A 4LYJA 4PSVA 4QM7A 3UIEA 4E03A 2BJVA 1OH5A 1YR7A 4L4UA 1QF9A 1MR3F 4DCNA 5K8UA 3MUFA 2WM9B 1N6KA 2F7SA 2V7QA 4DSUA 2XXAA 1UEJA 4DLWA 4B6FA 3B85A 4B48A 4N3NA 5KTYA 2EFDB 3U3OA 5FR1A 4GL2A 4L16A 1N6HA 2HV8A 3MJHA 4AK9A 2YINC 1KK2A 3TKLA 2GVZC 3A8TA 4IW3B 2O8CA 5F9FA 3PQCA 5KPJA 4PHHA 3CW2A 4PAQA 4TLAA 1E32A 1XCGB 1U0HC 4PC6A 1OIWA 4QJ4A 5B64A 5KDLA 4OHVA 3MWLA 1W5TA 1KJWA 2KSQA 4Q4JA 2I1VB 2X77A 3TUIC 1R8QA 2CHGA 3DHWC 3Q8XB 4NYIR 1OPXA 3TLXA 5M04A 2XITA 1AGPA 1C1YA 1R2QA 2ERYA 1NF3A 4DDTA 2FJUA 2ZRFA 4BLTA 4Z54A 1EX6A 1JXMA 4W5WA 3CZPA 2JLZA 3OHMA 5FBVB 1HT2E 2IWHA 1XTKA 3T1TA 3NWJA 5B57C 3RSOA 2O5VA 2REOA 4LJ7A 1G8PA 4AKIA 4KFTA 2WSSD 4F7WA 4DC9A 5EUQB 1US8B 4NE2A 4OK5A 1FP6A 3A1SA 2O8EA 5EE9A 3LQRA 4Q1BA 2JJ8A 2O8DB 4RZUA 3BXZA 421PA 1I2MA 1DVRA 2GK7A 4UQOA 1Z6GA 4US1R 1HE1C 1A4RA 2GJAA 3RS0A 4FW9A 3EXAA 3SHFA 1SQ5A 3RAPR 3TW8B 1KMHB 2G0TA 4FCVA 3U44A 1GRRA 1OXUA 4UNQA 4I1VA 1E1RA 1Z0KA 1M7GA 3BD9A 1T4GA 5JWRA 3HPQA 4B2IA 2WJJA 1I2DA 3GPLA 2XB4A 3QKSB 3ZJYA 2ZRJA 2ZROA 2V8OA 1JALA 4WXPA 2B6HA 3VX3A 2G88A 4ESVA 4LDJA 5B2ZA 3T5DA 3IHWA 4EAQA 3SBEA 3U2QA 2J59A 4Z1MA 4W5HA 3VR6A 4KCGA 4CVNA 1E9EA 2AX4A 4QNRA 3FOZA 1I4LD 3DO6A 2B7BA 2PMDA 3R20A 4E22A 3F0TA 5G3ZA 2PT5A 2XTMA 3R8CA 3EPJA 1IM2A 2OUKA 4DLYA 2VSFA 3K9HA 1SZPA 1DAFA 1EFUA 4G0NA 1Q1ZA 5GJWC 1XTSA 1U94A 1GKUB 1CTQA 1MO6A 4JL6A 1KMQA 3BRWD 4PO8A 1IXZA 4JS0A 1G20E 4R2IA 4EPVA 5LDDC 1II0A 5DI9A 4RZ2A 4M1TA 3Q9LA 4Q1AA 1Q21A 3RS7A 4OBEA 4AYXA 4RFSA 4TWZA 1X8KA 2WWWA 3NEJA 4Q9JA 3BWDD 1SKYE 5FFMA 4P4SA 3CIOA 1D6JA 4HLCA 2HJVA 1Q0UA 2IYVA 2NQ2C 3PVSA 1E9FA 4D25A 1KI2A 3I3SR 5FOXA 3ETLA 3RYTC 3U3RA 4Q1CA 4UKDA 3T34A 1XEXB 5HE8A 3W6OA 3CX8A 4FMDB 4G01B 4C0KA 1XXHB 1Z28A 4B71A 3A4LA 1OXTA 2DFKB 5DSZA 3WXMA 2J0SA 4FN5A 5A0FA 2JLQA 1LS6A 1ZP6A 4PAMA 5J5CA 3ICEA 3ASYA 1OYYA 1Z07A 4JLBA 3I8XA 3K9GA 4GFDA 4PZZA 3LFUA 4AKHA 4ZCMA 1E1RD 1UDXA 1KJZA 3JVVA 1SHZA 1KO4A 3WMEA 5HZHA 3VKHA 5CM9C 1W36B 4D81A 1FW6A 4Q66C 4UXJA 1T5IA 5G41A 2A5YB 2ZXUA 1KDOA 4DXAA 2GXQA 4EQ6B 1DAGA 4I1OA 2SHKA 4WZBE 3SR0A 2R9VA 2ZYWX 4RY2A 3IIKA 3QPWA 1KY2A 4MA4A 1G8YA 2GZAA 2QGNA 2OFOA 2WJIA 3ECCA 4EFLA 3LBIA 1F60A 1SULA 4XVUA 1KYIA 1ZMXA 4DDVA 2YYZA 4A0RA 1DO0A 3A1TA 4OQMA 3UWOA 1G8GA 3WP0A 4BZPA 3GLIA 2V1XA 4G1UC 3MWJA 1E0JA 1EWRA 1OKKA 2ZJOA 4KI0A 1FZQA 2B8WA 1G17A 4XIGS 2PZFA 4ITRC 1FNNA 3ONWA 3ADBA 3CONA 5HCNA 4J0QA 5JFGA 2P5TB 3GLHE 2FZLA 3KJIA 2HJGA 1PJRA 1G6OA 1Z08A 2KI5A 1BYUA 1CR1A 2V9PA 3AF1A 3DOFA 3ZS9A 4BLSA 1S1MA 3GJ3A 3X1ZA 1P2VA 4A2WA 4ZCLA 3U7EB 1OFUX 1YZTA 1PLJA 2Z6VA 2ZJZA 1ZC4A 3B78A 1UPTA 2I3BA 1U9IA 4R2HA 3QE0A 4GMDA 3LA6A 1F2UB 3SE0A 4O3MA 4ASUA 1FUKA 1AQUA 3GLHA 5BXQC 2YJTD 4LV6A 5CDFE 1FL9A 2BJWA 4MUBA 2P6RA 1UBFA 3JZAA 4WZAE 5JMTA 1XD2B 4OQXA 3L8YA 1SVKA 1NIJA 2WAXA 2ZAMA 1ETUA 2H18A 2X19A 3GJ7A 3TH5A 4KFSA 4DJTA 1Q44A 3OAAA 1JJ7A 5KDOA 1EFRA 2NO9A 1UBCA 3DVLA 4TZ6A 1YE8A 3X1DA 5CDFA 3GJ6A 3AEZA 4YMWA 4ACBA 4V0KA 2UVQA 3I62A 3BOSA 1UKEA 1TEVA 3QQ5A 2DYKA 4MYCA 2YOGA 5FOSA 1R7RA 5F98A 1GP2A 2X8AA 2EQBA 1KI7A 1G3RA 3OIWA 4FMCF 2IUUA 1T91A 1S0UA 2JLWA 2PLFA 3FB4A 1IN7A 2EFEB 2AWNA 4HLQB 4KLNA 2XTZA 2QE7A 3OZXA 3GLFB 2Q9BA 2L0XA 3A1VA 3P20A 1KO8A 4XTRA 1PUJA 1Z6TA 5KOYA 4MYTA 1M2OB 5HZKA 1TQ6A 2NOAA 1AM4D 2C5LA 4IVRA 2GTPA 2Z4RA 2ZJ8A 2O52A 2F1IA 4XVRA 4DWJA 3T35A 1W4CA 4OHWA 4PXAA 1OKKD 3NBFA 4IVPA 4QOSA 4TYWA 2ODWA 3IGFA 5HTKA 1Q1QA 2EU8A 3TAHA 4AKGA 4XOIA 3L82B 2CMKA 1R0WA 1WCV1 2QP4A 1OW3B 2VEDA 2BC9A 4KHZA 4U7DA 3GQBA 1GTVA 4TLDA 4A92A 4JLOA 3PG5A 3CH4B 5FL7A 3T5GA 3CH5A 3KKMA 1J7KA 2QT1A 3B13B 5TVKA 5L3QA 3TVDA 2C9OA 2MSDB 3WYFA 1II8B 2AHOA 2BWJA 3GLGB 5AR1A 4PANA 3B82A 4ASUD 3PXGA 1WP9A 5E4FA 3B1XA 1ZBDA 4TYYA 3MAAC 1BYIA 3B8HA 3NDPA 2RHDA 3W8NA 5FPYA 4NU0A 5JEDA 4RD6A 2WMNB 1XMJA 1G8HA 3GD7A 1Z2CA 3AP1A 1AZTA 4G5QA 2IEYA 1KKMA 4MRNA 4R98A 3MGCA 1RRPA 4UXHA 3O8CA 2ZS7A 3THYB 3OAAD 1DG3A 1DAEA 4BLOA 4ZDIA 1ZC3A 1EFRD 4PC7A 4OQLA 4NCKA 3R7WA 1TADA 2GNOA 3L2OB 3AVPA 4M1OA 1T0HB 1HTWA 2QI9C 1F6BA 1SVWA 3WRXC 1EXMA 4IDPA 2GJSA 3ICQB 1EK0A 4LV8B 2JGNA 5E7IA 1N6LA 3C41J 1II8A 4XVQA 3VR5A 1Q1EA 1M34E 2AWOA 1ZM2A 1KHTA 3T1VA 2P0EA 3AV0B 3GJ4A 2QU8A 1TU3A 2JAQA 4Z51A 2QPTA 2EFHB 2ZRKA 2ONJA 1G16A 1U9IC 4Q21A 4A6XA 1Z22A 2X2EA 2WJGA 2WWXA 1SGWA 3GP8A 1W48A 3IO5A 1KTVA 1Z6YA 1CJMA 4BFVA 3RWMB 5KSYA 3V9PA 4BFXA 4MYUA 2R6DA 1Z47A 1OH8A 4CEJA 2VP5A 1DOAA 4OK6A 1G7TA 3C5HA 5IT5A 3AF3A 1XJ0A 3B2EA 4D26A 2FSHA 5H8WA 1NLZA 1IXRC 5K8TA 1NIPA 2VSXA 5G3YA 2ZI5A 5DIFA 4ERNA 2NO7A 4EIWA 2H16A 4IDNA 3KX2A 1FX0B 4TL6A 4XSGA 4YLGA 1QVRA 5EE3A 5FI1B 2WZQA 1XJCA 3ZQ6A 4LCBA 2YWGA 2EFGA 5FOUA 2H7VA 4AIIA 1LFDB 2VHCA 2C9YA 2Y8EA 4JL5A 3MJRA 3KKNA 2OLKA 4MGYR 5FPSA 2G6BA 1XDBA 4IEIA 4WA7A 4IDHA 1MO4A 1G19A 2DR3A 3EZ9A 3V4RA 3KTAA 5CYPA 4IEEA 4QGAA 3KUCA 4ON9A 1L8QA 1W4RA 3PITA 1Z6XA 2YKGA 1KI6B 2F9LA 5H68A 3KZ1E 3HR7A 3T61A 5K8IA 3GMTA 3KB1A 1GILA 4GBMA 2QBYB 1T8TA 4JLAA 3RANA 4RD4A 5J47A 1Z3IX 3A4MA 2G1JA 2Q6TA 2VBCA 3NHAA 4YMSA 1ZCBA 1Q1BA 1CR4A 3LWNA 2A3RA 3THOA 5JI2E 3ZD6A 1CEEA 4IOJA 2ZSFA 1N5JA 1N25A 4Q4AA 2P5SA 4V0LA 3NBXX 2F6RA 2QT0A 2ZSBA 4A0HA 1R5OA 3O47A 3PEUA 2HDNB 1JR6A 4QC2A 2OZEA 3GCGA 5FTLA 5IRCD 1OXSC 2ZSAA 4JVNA 5DI3A 2ZI3A 3U3KA 5BN4A 3KKQA 5KYKA 2CCGA 2IYUA 1T5LA 2ERXA 221PA 3U7GA 4NP6A 1XD9A 2KWIA 1DEKA 3K0FA 3WP1B 2WHXA 1CJKC 4IVQA
chains in the Genus database with same CATH superfamily
4AG5A 2W6JD 3H84A 3PX2A 2B3DA 4J4BA 4WINA 2H2IA 2ZU6A 3T5MA 1OYOA 1MUUA 4YAFA 3BFXA 4YDSA 3QOYA 2OFPA 4EMSA 5DEIA 1QWSA 1QORA 1HKUA 4OQNA 2DWQA 1KE1A 3OSZA 4TRRA 5EJEA 3QKUA 2CLOB 3GBPA 3VPCA 1AK2A 2A14A 4XYEA 7AT1A 5JALA 5LKRA 1GGHA 4UBNA 1BX0A 2V74B 1P1CA 4RACA 3BXHA 5REQA 2ZE7A 1JE1A 2H57A 1E6KA 3W5SA 1SD2A 4DQLA 2H9YA 2DKOA 1X7YB 1E7QA 1GG5A 1B6RA 3NC0C 5FRDA 2Z2YA 4QHYA 4EW6A 3WMXA 2I2WA 2ZUVA 4DCUA 1IVNA 1C9DB 3RIEA 2Z3WA 1UFKA 2AJCA 1NY5A 4V3CA 4YMLA 5HUHA 1CBUA 4IICA 4GI5A 5BPHA 1ZGHA 4X1YB 4A6EA 4H6WA 2IUSA 1MIOA 4ZU6X 3WK9A 1WUTA 4XLLA 1ORVA 3WIDA 3PPVA 3SFTA 3ZIAA 3L18A 1EDOA 1GCGA 1GGVA 4UVDA 2VF8A 3BC1A 4PYJA 1J6UA 2GF9A 4YBZA 5E4JA 4RM3A 1ZH6A 1MOZA 3E2IA 2G72A 4RD2A 5LDGA 2PBZA 4BBZA 3EBOA 2WRZA 4GRDA 1IHDA 1CG6A 1YXMA 1ZDMA 1B6SA 3I8SA 3ZW9A 2XKBA 4KQXA 5B30A 4D41A 2PS0A 2OCIA 4UCQA 4AJ9A 2A33A 1NW9B 2WY2D 3LVBA 4EHFA 3PWKA 2UVPA 2FZ5A 5A71A 3DAYA 2VSOA 2AXPA 4LY3A 3B7WA 1NJGA 5DHUA 1RJ9B 2G40A 3GMIA 3IPLA 3C85A 1GAJA 3BDAA 2X5KO 1NKVA 4CDMA 4CU2A 2PRJA 2CL6X 2WWHA 1TCBA 1Y80A 3ZQUA 3IV7A 3UHAA 3NNSA 1GRQA 5IBRA 1RE0A 4HJRA 3BM5A 5JXWA 1RYHA 3S1AB 2O1EA 2PRIA 1ZMRA 1VDZA 2YY7A 3RSCA 3UW1A 5BQXA 4KX3A 4BV2A 4ZEVA 5K99A 1PSZA 1EB9A 1VSQA 5A7HA 2ZSDA 1W85A 2QN8A 1U3WA 5G0WA 5DN6D 2HGZA 5JNVA 2DBQA 5IJXA 1RYDA 3E5NA 4P81A 3N7AA 5DXAA 2VF2A 4KIUA 4CTNA 1SR8A 2XY4A 5DNVA 3RIYA 3GVCA 1XSEA 3A36A 3BGWA 2FW6A 3UNXA 1G41A 1GNTA 1CX9B 3ABSB 1IONA 4E7OA 3EYAA 3I09A 3INRA 5I51A 5BR8B 4F4CA 4JMLA 3U0BA 2QNBA 4FMDF 4B80A 2CNNA 4UAUA 1CRZA 2B7CA 5T67A 4ZTUB 1GL7A 2X0KA 1IZ8A 4RFLA 2FRXA 2YJ5A 4HDCA 2A7XA 3AQIA 1ZUNA 2OCBA 1E2EA 1XMVA 2YRWA 1OIXA 4FBMA 4HUQA 4JNCA 4NZOA 1IQPA 1XZJA 3RYIB 4CN9A 5JIBA 2YRXA 1TCCA 4JJ6A 1KP2A 2RK6A 3SQLA 1NY6A 1OBOA 2LNDA 3ETNA 4YGXB 5K6AC 4HNUA 5IC4A 1EGQA 3CCBA 3FGPA 2D2XA 2FMHA 4QOJA 4WVLA 4PYOA 2ATCA 3H17A 1UPUA 2Z83A 3JD3A 5TR9A 1TNDA 3HDVA 4C5CA 2F8SA 5KOJB 1C0EA 4L4YA 1W0JA 2ORIA 2O8NA 3EVZA 1PQPA 3O1HB 4M21A 3C74A 5ESWA 4WZZA 1UKBA 1OT3A 1PWEA 1ZKMA 4OLJA 3ZKAA 1NMXA 3DHNA 1MX3A 4MDEA 4Q4HA 2ZJ5A 2JFYA 2YJ6A 4KI7A 2OC4A 2VXOA 3OHPA 5LP6C 1U7ZA 3D8HA 1PJTA 4EI8A 5BURA 3QFCA 1KGDA 4W6QA 3DOJA 5ALOA 1VIAA 2FF7A 3WB2A 1SQSA 3AGQA 3OFND 1IBCA 3W5BA 5EJ7A 1XRNA 3KFVA 4LJ5A 1ZCFA 4M8LA 3OKAA 2YR0A 1NG1A 1SVMA 3CCFA 3CPEA 4UTXA 4FGJA 5LBIA 2FETA 1E0AA 1OOEA 4U2BA 3KT6A 3T7EA 1TOAA 3AHJA 1CHDA 2CDNA 3OESA 1RTTA 4WKBA 4KWTA 4A0FA 2FDXA 1VZ2A 4NDZA 4EJFA 2I29A 4KUHA 3LH5A 4F91B 2YC2C 1XZFA 1FUUA 2G25A 1NF9A 4BGUA 1N2HA 1UJBA 2LCFA 1P29A 3LBAA 1R6TA 1RQ7A 1TZ2A 1NSFA 4NV0A 5EHNA 3L8EA 2OGSA 1CLUA 4ITVA 5F1YA 1DV1A 2DERA 3DPUA 3SOPA 3EFOA 4ZO8A 4UUMA 1CW2B 3KWFA 3SZGA 5BN3A 1DB3A 4J7XA 2P0YA 3JYOA 4EG7A 4G5FA 4YV2A 3HJBA 3EMKA 1JG7A 4BN5A 1K5HA 3HCAA 4XQGA 2K4MA 4DLLA 3IAS1 1TQDA 2GWRA 3BFJA 3DFIA 3GY0A 3LT2A 4JYPA 4I3GA 3UJ3X 2ATVA 2DWCA 3DKVA 3JWHA 4L50A 4RNDB 1YQUA 1ST2A 2LKDA 4IKPA 3PQFA 4QYIB 2ZYHA 4K9NA 5KB3A 1OH6A 1G55A 4YRKA 1LRLA 1C29B 2QF7A 3D8BA 1YU6A 3IAFA 4LRWA 4MR8A 2ZTMA 2R6HA 4RJ2A 4D4HA 5FH9A 2R4TA 3E48A 2YHSA 1QJCA 3U3JA 2RH4A 4K6HA 2C9ZA 5IXYA 3PZBA 4F5ZA 2G4CA 4XI9A 1BMFA 4QXMA 5A3JA 3OM0A 4L5CA 3HXMA 3T9FA 3P9RA 3RC1A 3S0JA 2J0VA 1DTSA 2XRZA 1PNTA 3QENA 3CKLA 2EYQA 4HRAA 4M1KA 1O77A 3W90A 4RIFA 3F7TA 1R4MB 4FWTA 3O4IA 4ZZ0A 1O0CA 2FPWA 5BSVA 1OB2A 3GLQA 4HDRB 4ZHQA 1B2RA 1O96B 4WY5A 1CLEA 1C9YA 3ZGLA 3VU9B 2MTBA 1K8RA 3A1FA 3F6EX 1TLLA 2Q6KA 4G41A 1AXGA 3LT1A 1T34A 4LXHA 1OBVA 2QTFA 5AW6A 3A10A 2EKZA 4HQRA 2XD9A 4OEHA 4E1BA 3OKFA 5SZHB 5E6RA 4F6CA 2XUPA 4Q03A 1Z8DA 2JEYA 3A1EA 3BSSA 4B47A 2C2MA 4EDFA 3NBYC 3AFIA 5T4EA 1P3JA 4MO2A 1SVIA 1M8FA 1UJ6A 3HN6A 2IEAA 2EBWA 2G1UA 3DTVA 3WLEA 4CTJA 4X6LA 5B2EA 5TB5A 4WSOA 2H54A 3GEEA 3WLFA 3OCVA 4CQLA 1PJCA 4MR9B 1UBMS 3ZQJA 1E8DA 1CE8A 3C4QA 3WWZA 1OLUA 3K8YA 1Q7CA 5IC6A 1GQYA 3AMVA 3N5KA 4D0GA 2FQXA 1XZLA 4WH0A 1TYBE 3CRMA 2W58A 1PZEA 3ZE1B 4RA9A 2QP9X 3MFYA 3TLJA 1SHUX 5TV2A 3H5RA 4PFKA 4DCCA 3ETHA 4KXQA 5EYPA 1V7QA 1TM4E 2R6CA 2RIRA 3CYFA 3LO8A 3PIIA 4J2OA 4JT2A 2OV6A 3V4FA 2JH3A 3VR0A 4F38A 4POOA 1U4SA 1UPFA 1GZDA 3QMWA 1K68A 1WA5A 2HY7A 5TQ0A 1ISJA 4A4DA 4DR1B 4HWPA 5TPWB 3G9QA 5JV5A 2DQ4A 4GBJA 2QMQA 4G0MA 1O1YA 3BB1A 1Y9AA 2XYQA 3FM9A 1RLTA 5AYVA 1KMHA 3TW8A 5IMSA 4KPGA 3COSA 4LF4B 4F3TA 1QK4A 1GQ2A 1WV0A 1R5NA 1XXLA 3HG7A 4M7PA 3AUJB 4P98A 4FHCA 3NDBB 1BH6A 4MVJH 2BCGY 1B6GA 2HA2A 3I5UA 2GN4A 3KZCA 2EEPA 2JGEA 3MJVA 4C01A 4E09A 4JQSA 2P3OA 2X0JA 2X5JO 1ZGAA 3B9QA 1DKOA 1JLRA 5COQA 5INTA 2IEBA 2OAEA 3DJFA 3PT5A 4PGMA 3LAWA 4BGDA 2CSXA 2EFYA 3EARA 4HAOA 1IDN1 3QKSA 4L9AA 1P1KA 1P6UA 4ZAGA 1T36B 1ZO8A 4MLCA 4RELA 4Z4EA 1TTTA 4QYWA 1M8GA 4CMGA 4L6AA 4L5AA 1QPGA 3PLNA 1EQAA 4X6XA 3U40A 2RGAA 4UNIA 3THWB 1UJ2A 2LW7A 4I5FA 2BFFA 3PF8A 1NVKA 1TZBA 1SKYB 3BMQA 3PGMA 3BG5A 4IJQA 4OXYA 4NXMB 2O0MA 5HR5A 3AERA 1K5DA 2VZ8A 4F56A 4EH1A 5HF6A 1JJVA 4LZNA 2HM7A 3VTFA 3BIXA 2Y2UA 4KPFC 1HYGA 3VVCA 4OAQA 1KOLA 5EHQA 3G0GA 2EX4A 2GVDC 2MINA 1U1CA 2FVXA 2I4LA 3IPXA 4URZR 1L4HA 4CYMA 3ANYB 1RRGA 4AC9A 1H0SA 1AO0A 4ZTBA 2ZR0A 2IKSA 1NP6A 5EJFA 3VNUA 2RGCA 4AB1A 4BX9A 4DA4A 1B14A 4WZ6A 1JFVA 3MBIA 4B34A 2JGJA 4JFRA 3QPCA 2GPYA 5L3ZA 1GVHA 3D59A 4GZ3A 2RGGA 2PO5A 4AJJA 4XRGA 1DL5A 3TPFA 2C82A 5JTTA 3GLIE 3RV3A 3LC7O 1Q7TA 3LZDA 5TEWA 1L4YA 2AYXA 2D54A 1UBUS 2RFLA 4XPIA 4R0NA 5L4NA 4H6PA 3TF5A 4DKXA 1JTVA 4BIIA 2DFLA 2CJYA 3K0BA 4LYGA 3FLAA 3HJFA 1DTWB 4PPFA 3EB9A 3STUA 5AVTA 1D4ZA 1ZY2A 3EQZA 2HJ9A 1JAHA 1XYVA 3PHJA 3LU1A 1BGWA 3HB7A 1I2BA 1CZUA 2C99A 1SHLA 3HA7A 3SJCA 1R6DA 3GFPA 3W7VA 3ZE2B 4CF4A 1BVHA 3CTPA 1L5SA 2FFQA 3MT9A 4KLCA 4B3XA 4UJ5A 4EVRA 1EBBA 1JZQA 1UJNA 3BEOA 3U1TA 5DE3A 4DTIA 1RXUA 1H3FA 2YN4A 1G4AE 4OJKA 4JC4A 2DMRA 3WMRA 4AZ0B 2F3RA 2YV3A 1NVUQ 4QTZA 1WUJS 3PUJA 3E8MA 3B89A 5AQEA 2ZS8A 2IOFA 3R1IA 5LWHA 5DBGA 2WVJA 4I6JA 3I04M 4CIVA 2YN2A 2DHDA 1N0UA 4J1QA 3TLAA 1W8DA 1GU1A 3CT4A 2UUPA 3DMTA 3MQ2A 1T3ZA 3MRTA 1S6YA 3ZY6A 1DXYA 3OU2A 1V37A 5GM1A 3CBQA 3WBJA 5DSTA 3U4QB 2JAUA 2FN4A 5ELMA 4ZQGA 5K6TA 2EP7A 1CYDA 4UUPA 2JATA 2DQSA 3R5XA 2O59A 4D79A 5TPZA 1JHPA 2P8SA 1SWVA 2CWDA 2HWWA 3I9OA 2YQ5A 1WPRA 4ZV4A 5IM4A 2X6RA 4LC9A 4MUEA 2GAOA 3RSZA 3WJAA 3MIIA 2AGVA 2RKBA 3B3FA 3HUDA 3K2BA 3NHUA 1XWWA 1T5DX 1YKFA 1WVGA 3ENQA 2I3AA 3KL4A 3PD7A 4LNUB 3IT1A 4X8MA 2I0FA 3FCOA 2XNCA 5FFNA 3VU0A 2JB9A 2WIJA 4V0NA 3PSAA 2YIVX 4LX0A 2P3SA 3GRKA 4XYGA 4QXAA 3P0HA 1R9JA 1ENPA 1QKJA 2PWAA 1FS4A 2PU5A 3B70A 5E0KB 2H3HA 3C3AA 3QY9A 3FPAA 3UUGA 3VGJA 4N3BA 3V4OA 1BU8A 5BR4A 3OCZA 3Q3JB 1SVUA 1ZGCA 1DRVA 2V9CA 4R3WA 4C1BA 1DJQA 1HEUA 2W6ID 2BBWA 3RRXA 4FFMA 1EAMA 3VOSA 2DFTA 3OWXA 5HQ3B 4MYHA 5JQGA 2NO5A 5ED0A 2Z4SA 1IQUA 4ZALA 2X8BA 2JIQA 1W9MA 2FSPA 3GFOA 2FWRA 2G09A 4BNVA 2A35A 3JRNA 3SIPA 1IY0A 4H7DA 4IIUA 1FCJA 1FP7A 4FNGA 1D5WA 1TF7A 2D3TA 4EJ0A 1Q1AA 2R8BA 2HUNA 4X54A 3L8MA 1JR3D 4BFSA 3MPUA 5J2TB 1OHHD 2HD4A 1IBSA 2H2DA 5CT8A 4KIFA 3LHFA 3ZYCA 1NJ8A 4L0MA 4MKHA 2XZTA 3IOCA 4CDNA 3UM9A 2V7XA 1GDDA 4K9DA 1H6AA 4OGLA 1RHUA 5EPEA 1DKUA 1IATA 2ZRLA 3HKBA 4CLDA 1SEVA 3A2KA 5CB8A 4WKNA 2X0RA 4XARA 3LKVA 4S3MA 3I61A 9GPBA 2XZOA 4LWOA 2V7UA 1I4EB 2FGKA 2JFUA 1T2AA 3CG0A 4JJZA 4QXOA 3KPWA 1P4GA 5SV2A 5T57A 4ZDJA 3OE1A 2IOQA 5CBPB 2H2GA 4JI0B 1BROA 5B6IA 2CLIB 1Y4UA 2Y05A 3Q5DA 2P7IA 2VG8A 3EIOA 4JZKA 5CW2A 3CUYA 4LRQA 4WLEA 2W71A 2DTXA 5ICFA 4F3KA 4LI3X 1D2RA 3GVHA 2J9GA 1W7AA 1PFQA 4UMDA 4D9IA 3TGPA 3CUKA 3HWWA 3IMCA 4OHUA 3TQOA 3L0IB 3IL2A 2QUKA 4OA5A 1ZD5A 2V6JA 4HUJA 5IVHA 4DCGA 1J70A 1OSNA 2AH5A 2BONA 1QFZA 4U3JA 4FI3C 5IDXA 4ONEA 3STTA 4ZO9A 4B43A 4L0QA 1YB5A 3VHRA 2F64A 1BH2A 2OOSA 5SYMA 2JCYA 1CVLA 4YH1A 1EE9A 3LQ2A 1AJEA 5BMVB 4B3SB 2JVJA 4IGEA 3RS5A 5JFOA 3B1ZA 5CEFA 1V47A 1CZNA 3B1FA 3PD0A 4B85A 3F3KA 2I2DA 4N49A 2P9HA 3EEFA 3HR8A 4N1AA 1U8EA 1S4QA 3GLRA 4NCJA 1EVYA 3AUXA 3KFLA 2XWSA 1VBNA 3KWJA 4ZT7A 4BEBA 3BWCA 4O29A 2A0UA 1PVDA 5ITWA 3Q8MA 5F52A 3QQPA 2H4JA 1XNRB 4RETA 3W77A 2P69A 4REQA 3AP3A 3SY8A 1IBRA 2HMWA 3R7BA 2FOLA 1Z5GA 3FSGA 2AC7A 3F7MA 1U3CA 3DC7A 2JIBA 2IDKA 1KQ3A 5EKDA 3DMTC 3LP5A 1CVRA 1BMTA 4DSOA 1P72A 4IYRA 1Y82A 2O2EA 2RDMA 3VTAA 3RK4A 1CUYA 4MVYA 1V5EA 5AT1A 5DOZA 3QNWA 3FFWA 2AJBA 3TL3A 3O5AA 1PDWA 2XEXA 3W5UA 1N1MA 4L9SA 1TE2A 1N7GA 3IXQA 4UAGA 4YCJA 4CM7A 3G2PA 3GFTA 3G5UA 3JQBA 5AICA 4R3UC 1LNSA 4K9KA 3UJCA 1NLYA 1W4LA 1D2GA 4LHSA 5IUJC 1R8XA 3VR3D 1ISGA 1H0RA 1I1QB 2FH5B 3AF2A 2EF1A 4GMGA 4R9SA 3THYA 1WDKA 4PRKA 2WM2A 3TAXA 2E1RA 3B3GA 4HZIA 4Y2TA 5H0IA 2PBFA 3QH4A 4B8WA 4LJ6A 4R9UC 5TQJA 4MUNA 4BXOA 1AS0A 2A0FA 2C5EA 1NV9A 2AJLI 1Z4PX 2ZYGA 1VPVA 4OI1A 3TOZA 4C7JA 4KFCA 3HVRA 1N8KA 1SVOA 2V3VA 5DM1A 3UG6A 3KXIA 4FT4A 3TX6A 1IPEA 4BLUA 3H13A 2C04A 3H9JA 3UMBA 2VYNA 4PWYA 3EGIA 3J81k 4U2EA 4L9WA 5D51S 1T1GA 1Z06A 4P4UA 3RVQA 4EGAA 2WQ7A 4OHCA 3WHIA 1AKYA 4MK4A 1E3MA 2QMEA 3KOXA 3I2YX 2ZTUA 2RHCA 4H4DA 1DFIA 1Z38A 2I55A 3N8IA 2QTBA 4GD3Q 4IJUA 4BZQA 2VOEA 1AU9A 3GZ4A 3DA8A 2ZVQX 3C5WP 1G9XA 1TQHA 1SXHA 2RGNA 2ZIUB 2LE0A 1V8DA 2GFQA 2XHZA 3DTTA 3PBKA 7YASA 2JH8A 5L6MB 1TIKA 4LOKA 3MW8A 5GOTA 1MV5A 2QN1A 2OP1A 2MMCA 1E3WA 4BRUA 3ZHCA 2X1MA 3GZTB 4RLSA 5EHXA 1ISFA 4IWYA 2Z1DA 1XUOA 4Q16A 4BFYA 4MR7B 1FQKA 1RXEA 3UVEA 3PL5A 4MRPA 1ZD2P 3LT4A 3P2KA 3VH3A 3LRPA 3UKOA 1JH9A 1J06A 3HCPA 3OZ7A 1K89A 5F2NA 2N1BA 1MZPA 2H6EA 4DR6B 1KH2A 3VOAA 3HYCA 1MOQA 2KS6A 4XEUA 3DUFA 2PQMA 1MABB 4E07A 4PZCA 1UKZA 3KQVA 2NP6A 2HHJA 5BVGB 1OAAA 2ZFUA 2V97A 5DMHA 2X0NA 2KLHA 3BF7A 4GPZA 4MW6A 2NYVA 2OB2A 4NFSA 2VF5X 3USZA 2ZIAA 2XKKA 1FF9A 1JMVA 1QH1B 2YYSA 1NYRA 2BI4A 2Y1FA 3DSRA 3OKPA 4D9NA 2AUTA 5EMLA 3UOAB 4C07A 1OV4A 1GLVA 4D0NA 3DS8A 1L7DA 2ZQYA 1FU4A 2YWHA 1A4IA 3SJUA 2R68A 1QF6A 1MZVA 4M0KA 4OIFA 4LHVA 3TRIA 2X13A 1CIPA 4FWBA 1V7PC 3O8QB 1QRRA 3LQ4A 3ZGXA 3OM1A 2RK4A 5FJIA 5GJBA 4PLTA 3NM6B 4R7TA 2O6LA 5LZ4A 1ZD3A 2Z6UA 3WA7A 3W8FA 3DDWA 2CUKA 1E2IA 3CURA 3AKYA 1D9ZA 4OQQA 3FSEA 2OCYC 4GVLA 2DPXA 3INNA 2FSIA 1KI6A 1EP9A 1PV2A 1TIBA 1ISIA 4HOYA 4S35A 5IYZB 5KMGB 1QE3A 3SJZA 3T0IA 2FUEA 3ZD7A 1VG9B 1ISMA 1SOAA 3IAM1 4RDCA 2EJCA 3R3YA 4HWOA 2VA9A 2H5IA 2FPIA 4K6CA 1OI4A 3JYHA 4JBWA 4FYVA 3EASA 2WF5A 5DU2A 3ICCA 4ZXFA 3DLBA 4IDFA 2B1IA 5C4IA 2IU4A 2YFQA 3OJ0A 4BO9A 4C2UA 1U6IA 3KOUA 4WNYA 3VNQA 1TPZA 1ODSA 2JHGA 4F4DA 4LTDA 4NZNA 5ESDA 1ZL0A 1G63A 3V1UA 1L5OA 2FW0A 1TA4A 3DE0X 5EWJA 3U81A 1KVQA 1D7AA 4P84A 5FBLB 4X93A 2GBLA 5FHQA 3FCAA 3HUFA 5AKHA 5GJCA 2VHXA 1VCOA 2X6QA 3HP1A 4TV8A 1E18A 1SXJE 4QATA 3I9LA 2LR0A 3PUZA 4YRPA 1UFRA 3W3AA 4M9XA 4M54A 1AKQA 3VYWA 4LJSA 1E4EA 2J9FA 4NBTA 4UU7A 2IWRA 4JH0A 1XZKA 2H1WA 3IUEA 4QRDA 3IIMA 4F04A 3AVXA 1G7CA 5IJ0B 1OYVA 5JROA 4MUGA 3KCNA 3VO1A 5GGYA 3RUAA 1IHPA 4Y0AA 3EPKA 2ZE6A 3JQBC 2FW7A 4QSMA 2VA8A 1KPGA 3NXSA 3DFMA 2EFCB 4XB6B 5CGQB 3TTSA 1GKLA 2OD7A 1Y6ZA 1SXJA 3H6KA 3PE3A 4PWZA 1SPBS 1VHJA 1YOVB 3QF7A 4RVGA 1VHLA 4P3XA 1YI1A 4MV5A 1K3TA 4WOCA 1EKXA 2R8RA 1KERA 1N9GA 2YN0A 2ZVPX 3H2ZA 2VOJA 1FFDA 4HWSA 4KIGA 3K1AB 4EGSA 4M8IA 1E8NA 1VE1A 4W1SA 1UBJS 4I9HA 1MC5A 4DDWA 4JLDA 2DWOA 2J5BA 4GF5A 3W2FA 2IH2A 5B6JA 4M1MA 1T26A 1TVCA 4XVCA 4M9CA 1NRWA 4ERXA 5KTKA 3UWPA 2ZIWB 2MT9A 3OX3A 2FUNB 2PGOA 2JLBA 5A5DA 3UATA 1CR2A 1WUHS 5T4HA 3V4PB 1E3QA 3QPUA 4UVEA 1JI0A 1UR5A 3GAMA 5CYFA 2JLXA 2ZJBA 4O4HB 4GKKB 2FV8A 2PKQP 3CNHA 1VPWA 1L7VC 1U0RA 3ERCA 4PFSA 2FOIA 4HI0E 3AWIA 2WOOA 2NAPA 1UBKS 2KX7A 2RGNC 4QU5A 1TTHA 2UYCA 2ZIXA 1GTJ1 4REMA 1CEYA 1OWMA 4AU1A 4E2XA 4GGPA 4Q34A 2DBVO 5C31A 5L7TA 3BJMA 4TZKA 4BUZA 1WTCA 3HBAA 2R751 4EPRA 1P9OA 4HZUB 1UC8A 4CLHA 1DX9A 4U0KA 1MQ8B 2AXEA 2QY6A 4MICA 2QORA 4ZAXA 4TN1A 3ZLUA 2X4DA 4B76A 3AIMA 4FHZA 1HE5A 4E08A 3OLYA 4KQEA 2WIAA 4MIYA 1RZ3A 3FA2A 1KZGB 5FBHA 1NUSA 4P5DA 4PM4A 3FYUA 3RRBA 3PQ5A 3QE2A 3HRHA 3MMZA 3SSOA 1L3IA 1OIVA 4GU5A 2D4HA 1FTQA 1V3TA 3V00A 2ODEA 3A9VA 4IF4A 1PT7A 2O6HA 5E1BA 4KBFA 2CFRA 3ROXA 3U49A 3QWIA 4PZEA 3RR2A 1NQ5A 4UDYX 1XU4A 4TXLA 4GEGA 1AMOA 1U0FA 3GQVA 3FR8A 2JCSA 3L84A 3AY3A 5BN5A 4H7EA 3QV2A 4CM1A 4DPLA 1YZGA 1RCUA 3HCEA 2AYYA 3NHBA 4F1WA 1YVUA 3U6KA 3PNOA 3ZPXA 5A4JA 1DELA 3KKLA 3QJYA 3RRYA 4TWBA 3EX7C 1QANA 4DE5A 1LLQA 4ANFA 3W04A 2F2TA 3EXHB 4CV0A 3KQPA 2VO1A 1N5LA 3L0ZA 4YT5A 1A0OA 1EP1B 4GLLA 4M0PA 1Z33A 1XOIA 1ZH4A 5LJIA 1X1EA 1NZJA 4YI5A 1W0KA 2XECA 2WYIA 4RJLA 3IR7A 3M6UA 2BP7A 4Q9DA 3H3FA 2WT9A 1XJQA 2AK2A 2OHJA 3TDKA 4AG3A 1LNZA 4HLDA 4BX0A 2QPLA 2NUAB 1JDPA 3FWYA 1RZRD 4PYRA 1HT0A 2XD4A 1AQ6A 4QUHA 5EMJA 2RH5A 2OC9A 3FZNA 4PLVA 4YQEA 4OHXA 3G6WA 4XGKA 4C0BA 3D3JA 3MINB 2GBLC 3YASA 4JKOA 1SUSA 1PLKA 1PS8A 3AUAA 3QBVA 3O3NB 4Y2RA 4LMPA 4M9RA 3ZCXA 4CNQA 4JC5A 4GX1A 1YI8A 1M6WA 2Z5GA 5C32A 1RSZA 1EWYA 4BQEA 3W78A 2PUCA 1K6XA 1MH1A 4A15A 2B36A 2MYTA 4L02A 1C7RA 3C8UA 3LLSA 5DTJA 1JVNA 2OD9A 1WCIA 3TE6A 3U80A 4EYEA 3EAGA 2V8BA 4P0PB 2OCPA 2A3NA 1YJ8A 4R8KA 5CYOA 4PAWA 1JR2A 2BN4A 2GR9A 3VKVA 4FUQA 4UEWA 4DN6A 3PFGA 4E32A 2QRMA 4O2LA 2IPAB 2Q21A 3HL0A 1PI3A 3Q5EA 4S1PA 4EL5A 2DB3A 3ECSA 4JLMA 3MZ0A 1SXJC 4F6LA 1ANKA 3IO3A 1RBMA 1NVMB 2TYSB 4QOIA 5DXFA 1FTYA 1JKFA 4UAJA 2P1RA 3E9DA 1H2RS 1GKIA 4ZVOA 1FP1D 4CMAA 5MDHA 1HZZC 2JFGA 2QV7A 3EOZA 3MG9A 1T10A 3HL4A 3QY0A 4AD8A 1HQDA 3DQPA 4CLOB 4QELA 2HLNA 3FKSA 3VVBA 1P8AA 2O0JA 3NAMA 4IIBA 1X7XA 1EGHA 1RQNA 1N1DA 3E8SA 2BL4A 2G0NA 1C9JA 5CLIA 3OEEA 5AWFC 3L9WA 2WF8A 3C3PA 4PC3A 1P81A 1QIDA 1U4OA 3WYGA 3ZDBA 2JKYA 4I8IA 4L0CA 1IN1A 1DBSA 1Z16A 4CUJA 5K3OA 2DPHA 3IE1A 1JXQA 3AI2A 2HU7A 2JDIA 1JSRA 2IHVA 2RCNA 2QUZA 2Y3IA 4LHYA 4BAZA 1I13A 5CDUA 3TW4A 4OB7A 1YRQA 1XZDA 1AUVA 3U44B 4OBXA 4MI1A 4YV0A 5JY1A 5C5IA 3WMWA 1WWKA 1FMLA 4R68A 5HFNA 1OGYA 2NVUA 5IVIA 3B5IA 1JEAA 1JFSA 4CCYA 1V16A 4KTVE 3LSTA 5EXEA 1K7YA 3FWPA 4LECA 4ZEMA 1NW8A 2FVYA 3BH7A 4OQEA 2A9PA 3QEOA 3TKYA 1SM4A 4AJ2A 4E70A 4I46A 4QRHA 3AWDA 4RW0A 4D3XA 1GTL1 1OMOA 4Q37A 1PJBA 2XNKA 3AP2A 4HVTA 5FBKA 3DMFA 3OEYA 1TU0A 2JBAA 4HS4A 1KE2A 2IYLD 3MOSA 4IMIB 4JP3A 4CEHA 5FOWA 1FRNA 3JQAA 1ZNXA 2X3FA 1Q0SA 1QP8A 3JRWA 2OV1A 3PDIB 5AKIA 2C77A 5DKFA 3SICE 4EG5A 3DV2A 3VO9A 3SC2A 1CQJB 1IPHA 3H2SA 1A8HA 3IP5A 2J0UB 3R3SA 1HFJA 4PLWA 5HUJA 5LBTA 1M2HA 2GJ8A 5KINB 1HXHA 3NTUA 2OFWA 1ZWKA 4JOBA 3EVTA 5KQPA 2PH3A 3WIEA 2EZ8A 2CY0A 5CA0F 1Z74A 1ENYA 4TV9A 1SO8A 4EPXA 3EYWA 1RAGA 5DBEX 4RKQA 1OT5A 5GONF 4TYQA 3R5TA 2C2YA 4MB2A 2XT6A 4ER7A 2RE8A 2FWPA 1ESMA 4DM7A 4CT0A 5J4HA 1JJFA 5GOZA 1FXWF 3HDHA 4B3CA 3PUKA 1BXRB 4IHQA 3P9NA 1RRKA 3S2GA 4BNDB 1XTUA 2X23A 1YS1X 4UHJA 5IT4A 3HTXA 4RFSB 1U3FA 1OFHA 1E2GA 5H81A 3AFOA 2A1TS 4EG6A 1QKKA 4IAOA 5B7PA 1UM9A 1T1EA 2ZE5A 3GI1A 1ATIA 3P0EA 4KVFA 1IWBB 1WKVA 5F1OA 3M3DA 4JDUA 3I9FA 1SOMA 1Z0AA 3BE5A 1PNVA 1G64A 2FX3A 5GP1A 4F8EA 1E9RA 2Q6IA 5ADWA 2COEA 1P33A 1QVZA 1ZI6A 1G20B 3BEDA 3EMDA 2JGRA 5IP5A 1DJLA 4GC9A 1OXMA 2GHIA 4B40A 3JASB 2B4YA 4XAQA 9ABPA 1TEZA 3DM9B 2OK8A 2OZLA 2XA1A 3AVOA 3HJTA 4AP6A 3O21A 4CKEA 2AUMA 4INAA 4X85A 2O3SA 2H9IA 3MBKA 1TM5E 4N7RA 4GRIA 4BRZA 3K0HA 3WAJA 1KI1A 4ESEA 1Z8FA 3H11A 3IBGA 4PIPA 4TYMA 2HMUA 3FUWA 3T7RA 1M2WA 2PKEA 3K9NA 1REQB 3ZLBA 1E2NA 2I3GA 1E2JA 1I1HA 4RPCA 2OL4A 2UYOA 1ZR2A 1N6RA 1NJ1A 1AIPA 4LDZA 4KMRA 3IUYA 1ZL2A 2HQSA 2H1HA 4JQOA 4YQYA 2V9ZA 1ZXBA 1ZU4A 2ZRNA 4HGYA 1PD1A 5ALQA 4ZZ2A 5B3JA 3IODA 3MHTA 1BGVA 1RT9A 4XDZA 4EZIA 2OBXA 2WJHA 1OC4A 1JL3A 4JUDX 5E6UA 4FB4A 4Q00A 2Z6QA 4I9FA 1VLLA 4UBLA 4UFNA 2IXDA 2JBHA 2QRNA 3DBOB 3O8LA 1W44A 3H9UA 2O3UA 2O2XA 3A6HA 2VJOA 3D8TA 4LHEA 2QTZA 1XTZA 2EZUA 2QAGA 4KV7A 5AM3A 4DWVA 5GTDA 1XAJA 5T41A 3CEMA 3C4JA 3V7UA 3QKTA 2PZBA 3ICWA 1NJ2A 5FP0A 1DFHA 4ZPJA 2FMIA 4S1NA 1OZFA 3ACBA 2IHJA 4RVDA 1ST3A 2QR2A 5IUNC 1C2YA 1LJUA 3QVOA 4IXMA 5J2UF 4O08A 1IQRA 5ILOA 1STOA 2J30A 3BIWA 3FAKA 2GRUA 2OFFA 4DG5A 3LUFA 5MGBA 2CMDA 2V7VA 4MW9A 3TRJA 4YBRA 3W3AH 1RR6A 5F5NA 1D9XA 2ECOA 4YP9A 1ENZA 4G0YA 4TUYF 1W1IA 1U5BA 4R0MA 5ICCA 2W0MA 3AX6A 3WLKX 5COBA 1W5FA 3BAZA 3FVVA 4W1RA 2O23A 2XZPA 5KX5A 1JHQA 2Q8PA 1B42A 1N5RA 3S2EA 3EVEA 4RBNA 3U7RA 3X1JA 4M3NA 3VZPA 2YWXA 4EPWA 4RORA 3L6CA 1OXXK 3VU3A 2QEQA 2XX3A 3RLIA 3K0AB 3TWOA 2MWMA 3TMAA 3CLTC 4NE7A 4RA6A 4G85A 3KOWA 3KHKA 1E9DA 3ED1A 3CEAA 4G5YA 2XNDD 4XD7D 1EUDA 2FDRA 3CPHA 1VFNA 4XIFA 1SXQA 1B8PA 1CUXA 1W4BA 1HOXA 3P9IA 4RQTA 4C3OB 2Y0PA 4CFYA 4AL4A 3CZCA 1PFUA 5E9QA 1MBZA 1Y9EA 2NSJA 5I45A 4DIEA 1KNXA 1KKLA 2W83A 3OUTA 3P4UA 1OLOA 3P5BA 4HDKB 1SUIA 4HP8A 4X6UA 4EY5A 5DNUA 4RTNA 3E58A 3UPUA 1ULTA 4WX2B 1UFQA 4S05A 2P3QA 1Z88A 1LBEA 3K32A 1TYEB 3OICA 3PDCA 5C9ZA 3U9SA 5DM2A 5AUQA 4F4UA 3T5PA 3MCVA 5K0BA 4PY2A 3DFKA 3VISA 3RHZA 4ALIA 4FFSA 4B3HA 4R2MA 3LTNC 4QREA 3M9LA 3MB8A 3GV0A 4TMTA 5J4YA 1M0TA 1J49A 1JZTA 1QG4A 2WW8A 3GFGA 4G84A 1U6JA 3CF0A 4ENRA 4YONB 2PYIA 3MMPA 2AC2A 2HQBA 1XMSA 4RADA 2VH2A 5FIUA 1FU8A 2P2CA 3WL5A 5FEUA 1I3NA 1DQYA 1U7PA 1U8ZA 2YYYA 4Y1RA 5FUVA 1E0SA 3KQOA 3NOOA 1J8DA 2BOVA 2QN3A 4NYJR 2WE7A 4ESOA 3N6VA 1KBZA 3HA2A 4D7AA 1FJ2A 1KVRA 4R8LA 3SHQA 3LLUA 5HZMA 3JTEA 1T25A 3VC1A 3CWZA 1XDSA 1P6XA 3CM0A 3KK0A 4QQFA 4OMUA 3HCRA 2ODNA 2DSTA 1CY4A 1OTHA 2J3MA 4QODA 5D3QA 4W5NA 3B36A 3N6RA 2GNAA 3LPAA 3ND6A 1X7GA 1DQZA 5IWAB 4AZVA 2W42A 4XCVA 1KORA 5H9WA 2JFFA 4B35A 1BVUA 1K3UB 1SNYA 4QO7A 2BM1A 3DE6X 2QJRA 3K5PA 5K3BA 3OE4A 5EJ2A 4RO0A 4B2PA 3VC7A 5AK4A 2WSYB 3EY4A 5CK4A 1SUEA 2I4MA 1RRMA 4KV9A 3ZBQA 3TNYA 3GUZA 2AF3C 4CQMA 5B3JC 4YA6A 4MS3B 4D0RA 2O4CA 2XSZD 1Q22A 1Z62A 4DPMA 3GQBB 1MJGA 2COKA 4EW1A 3L7LA 3RC2A 2FPLA 2NU9B 3GJ0A 3WDMA 1J8MF 1JBEA 1OPRA 2A1UB 2V98A 2CGEA 2HO5A 2WTXA 3JQQA 3Q3GE 2GM9A 4GM4A 4PSKA 1VLHA 4EEXA 2QAGC 5L3QB 2QMZA 4DYHA 1ZCJA 3AZOA 1Z5VA 3RWOA 3VC2A 3S8EA 1PUIA 1IMJA 1V41E 5K3SA 4BU0A 1R88A 1Z12A 1A7KA 2PU7A 3AF0A 1NFQA 1O5OA 4RCYA 4Q0MA 4UCWA 3HDGA 4CKCA 4D9EA 1YO6A 3JWPA 4KZPA 4DR5B 3KQKA 2R7LA 4EYOA 3PEWA 4DR2B 3E9MA 3V8QA 1JPVA 1LPAB 2MOKA 1V71A 3JU3A 3QE4A 5HK8A 4LWPA 3HDTA 3DB2A 3F98A 1XJWA 4HXGA 5HE9A 4JT9A 4Z8YA 1V5GA 1C8BA 1I3OA 1MF7A 1I6KA 1A9RA 3CRW1