4YC7A

Crystal structure of human fmnl2 gbd-fh3 domains bound to cdc42-gppnhp
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
179
structure length
179
Chain Sequence
AMQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQRGLKNVFDEAILAALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Formin-like protein 2
publication title The structure of FMNL2-Cdc42 yields insights into the mechanism of lamellipodia and filopodia formation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 60
structure length 179
sequence length 179
ec nomenclature
pdb deposition date 2015-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4yc7A00
4UNPA 2CHGA 1R7RA 3AGPA 1Q21A 2WKRA 1UF9A 5EXPA 2ZS8A 4L9SA 4TLDA 4D25A 1P2VA 1GM5A 5DN6A 1E2EA 1IN6A 4M9XA 2H16A 2ZRGA 4OI0A 2F6RA 2BEKA 3B5JA 3UXMA 3GLFE 3B1ZA 4QNRA 4FXPA 3VR2A 2V6IA 2OXCA 5JECA 2ZE6A 4LHXA 3I5YA 2GCPA 2C5LA 4DC9A 3D7MA 4URWR 5E4FA 2ZI7A 2GXAA 3T1TA 3DKVA 1GWNA 1M7BA 1NN0A 4Q1CA 3THWB 2GNOA 4L15A 3KTAB 4NHOA 4JL5A 2F43A 1Z29A 3Q7PA 2J45A 3GLGB 1N6RA 5GJVC 2ZI4A 3TVDA 3EA0A 3CUEF 4JMPA 4KBFA 5FI0B 1VDZA 4MGZR 1KJWA 3ADCA 2QBYA 1W4RA 4I81A 5EUMA 4QG7A 1JR3D 1XPUA 3FE2A 3LLMA 5IDVA 3ZZTA 2H1LA 1DARA 5K8IA 1ZCAA 4HAVA 1E9FA 4JSYA 4PZYA 3SYLA 3TVTA 2N1BA 1T91A 1WQ1R 4NYMQ 1UBEA 3WMGA 1Z08A 3P26A 4HAWA 2JIZA 1KI6A 3ZS8A 1X86B 2C77A 2X8AA 3HYTA 2G6BA 4DIDA 2QROA 3UIEA 4DWJA 1AKEA 3SN6A 3QVUA 3WYFA 1U98A 1W5SA 1T6NA 2RH5A 4PSKA 3VR3A 4ZI3A 3JVUA 2KBEA 2REXB 1KSFX 1X8JA 4D2IA 3RHFA 1CR0A 2NIPA 3DZ8A 1CRQA 1IY1A 4BE7B 1ZAKA 2KE5A 2WAYA 2QN6A 1HT2E 4UJ3A 2IEZA 5DYIA 2XB4A 2A5DA 3JZAA 4XWOA 1KIMA 1P7CA 3TLXA 4PSVA 2EWVA 5K8TA 2P2LA 1OB2A 4AY2A 3NG1A 1TF5A 3QE0A 3SJZA 4TTQA 1XP8A 3X1WA 2Z4SA 1Q3HA 2J87A 3BH0A 1II8A 3QQ5A 3NDPA 2GEDA 1WMSA 3X1XA 5M04A 2ZI9A 1AZSC 5CITA 5EUQB 2J59A 3SU8A 4C0LA 2E9SA 2KI5A 3W6OA 3ADDA 1R0XA 2QU8A 1UFQA 2WVJA 4ZDKA 3OEHD 3ZZUA 4QGAA 1G6HA 5HR5A 4IRUB 3EX7C 3IKJA 1G5RA 4ACAA 3O8RA 2J9RA 2WJIA 3CPHA 4IDOA 4CT5A 1T5IA 4HAXA 1ZM2A 3NC1C 4LUCA 1DTSA 3OFND 3AKYA 4L4UA 3PEYA 3OAAD 4R2IA 4XD7A 1G16A 2F7SA 1T3LA 1NMXA 3QG1A 1Z6TA 2QPAA 2RB4A 2IS6A 1G4UR 3VR1A 2O8CB 4CT4B 4MKGA 4D0GA 2DYKA 2QMOA 1Q44A 4TYWA 2CBZA 5JCZA 5C4MA 2YKGA 4BECA 2F43B 2ZJAA 3B1YA 4DLYA 5KSOA 1Z5ZA 4WVFA 2GEUA 1OHHA 1F48A 2R44A 4JKIA 5BYJA 2JEOA 2WSMA 2ZYVX 3GP8A 1LFDB 1F60A 2O52A 1JAHA 4HLDA 4RKEA 3ONWA 4EFMA 1FX0B 2J7PD 4XTRA 1KJYA 1MRNA 2ODBA 4FMCB 4Q47A 2WSSD 3K53A 2CL6X 2GZDA 1BOFA 3AB3A 3W5IA 2RGCA 1XX6A 3H2YA 4M22A 3QF7A 3U7EB 1ESNA 4BUJA 5BWMA 4QM7A 1FP6A 1KI6B 1C9KA 4Q5IA 2VL7A 3GJ7A 4B75A 3ADBA 3RABA 1FOEB 4AKGA 1JJ7A 1VG0B 3EXAA 3LDAA 5JWOA 4LRWA 4LC0A 2C99A 5FBLB 1FNNA 2ZSFA 3TR0A 3DM5A 3SHWA 4GNKA 1KDOA 5C2JB 2WWGA 4PC6A 4A92A 4C2TA 1SZPA 1Z83A 1XTKA 3QIAA 2H17A 3A37A 1XU4A 4OQMA 3UK6A 2VP9A 4X8LA 4BFVA 3LBIA 2HT1A 2O8EB 1II9A 4UKDA 5FTNA 5IT5A 4BFWA 1P5ZB 2D06A 1DS6A 2VIIA 2ZE5A 1Q1EA 4PC2A 2DWPA 1XTQA 4RD3A 4D0NA 1IY0A 1DAHA 3HYRA 1LF5A 2F1RA 4KHZA 2J0VA 4M1WA 3VNUA 3U7HB 3VNVA 1DOAA 3U44A 1VYUA 2JLQA 4M8NE 2EFGA 3A58B 4TTPA 2HF8A 2CCGA 2WWWA 3CRMA 5F2EA 1Y63A 3ASZA 1U9IA 3IIKA 4NE2A 1G8YA 2YC2C 4B3FX 1F2TA 2PBRA 5B2ZA 3BB4A 1ZUIA 1ODFA 1E4YA 3W5JA 1N5IA 1XZPA 1OW3B 1ZCBA 1NN1A 1DE0A 2AK3A 2YJTD 3IQXA 4DB4A 5JJLA 3AKEA 4C0KA 3RC3A 3T12A 1J90A 2XSZA 3PJRA 1KI1A 2FU5C 4NL4H 3VAAA 3I62A 1TF2A 4NU0A 1ESMA 2RKOA 3CH4B 2GF9A 1M7HA 2FZLA 2VP2A 3VFDA 1M74A 1P75A 4I4LA 3AV0B 4B2IA 2O8FB 2KSQA 1IBRA 4F38A 1OYWA 3GLIA 1KO4A 1G7RA 1TQDA 4OK6A 2W6ID 3MRSA 3VKWA 3QJYA 4E09A 3TK1A 3CW2A 1NVXQ 4KXFB 1G6OA 1A5TA 1TU4A 3R7WA 3DZDA 3ZGXA 4YMSA 4RD2A 2IS1A 2FGKA 2NO7A 2YWEA 5EXXA 2REBA 3U7GA 1HE1C 2C95A 1OE0A 1ZNYA 4DSTA 3THOA 4G5OA 1Q12A 1R8QA 5JI2E 5L8VA 4MGIR 1KMHA 1VG9B 2CVHA 2ZJBA 4I1SA 5J4VA 2IHBA 2IUSA 1EFRD 1FQKA 2QP3A 2QQEA 4Q1FA 4ZDWA 1S0UA 5LD2B 3E70C 4DVGA 3BFKA 1FUKA 1Z0DA 3SFVA 3TJZA 2V6JA 2EYQA 1RKBA 3IPYA 4HDQB 2QRZA 5EP3A 4QBHA 4U00A 1Z0IA 4I1UA 4PX9A 1JI0A 3H4MA 3RYTC 1E2GA 3L8ZA 3EPHA 2XXAA 1G7CA 4A82A 5GADl 4TSFD 3CWQA 2XB2A 2FSGA 1NY6A 1H8HA 2OFOA 3BRWD 1UPTA 5EE0A 3TUZC 2R65A 4I1OA 1TUEA 3EARA 1EWQA 2OESA 3HR8A 4V02A 8OHMA 1T8TA 3RRMA 4RZXA 1JJVA 3V4FA 4XVRA 2QRNA 2J5XA 4U7DA 3QSYA 2GF0A 3K8YA 1W46A 2Q9CA 5J4HA 3NHBA 2OV2A 3LLUA 4NKRA 2WOOA 3SZRA 4DXAA 1S96A 3U44B 1UM8A 2JGNA 3PUYA 4JVMA 2IYZA 2CK3A 1IN5A 1KGDA 1G3QA 3M6AA 1W0JD 2WKQA 1K5DA 2H18A 1ZC3A 2IWRA 3UWKA 2XAUA 3KKQA 1F2TB 2XTMA 4PAQA 5FBRB 1QG2A 2VEDA 2B92A 3I73A 3DO6A 4R98A 4KVGA 4AWXA 3JZMA 1NL3A 4YMUA 1M1YE 3BIFA 1GILA 1N0WA 2WPDD 2ZJ5A 1JXOA 3OE7D 3A4MA 5JBQA 4ZCLA 4KFRA 4JLKA 1XMJA 4TL8A 3B60A 4BLSA 3IHWA 2VPPA 3AQ4A 2BM1A 5CYOA 5DSZA 4BEJA 1AZTA 1DEKA 4B3XA 2CNWD 3D8BA 3EC1A 4Q4JA 4A2PA 4K81B 3IEVA 4HZUA 4AYWA 3GLIB 1U0LA 5CK4A 4Q66C 4JLBA 1QHHA 4IXNA 1G17A 3QXSA 1Z0FA 1KNXA 2GJAA 3KXIA 4FIDA 1CULC 4L8GA 1NIPA 1ZIOA 4XWKA 2KBFA 3SDZA 1J7KA 3R7WB 1II0A 4G01B 1E2DA 3P1JA 2PZFA 5B30A 4IOMA 4B35A 2HYIC 3EC2A 4B3BA 3RS0A 4DSOA 3OHMA 1Z06A 2O0JA 4IDQA 2IYXA 4DCNA 4AI6A 4I99A 1KMHB 5C4GB 4YLGA 2DWQA 3K0EA 3GJ3A 3AF2A 4JZKA 3VR4A 3NTUA 3B7GA 4XJXA 3SOPA 1QHSA 3Q5DA 1E69A 4BZPA 4NCHA 1HUQA 2IUTA 3RSLA 4WZ6A 1CRPA 1R2QA 5BN3A 2DY1A 5DI9A 3WBJA 2QM8A 1TAGA 1VHLA 2EW1A 1Z8FA 1Z6AA 2BM0A 3QNUA 2C8VA 1S8FA 2XXAB 5E95A 5FI1B 1ZU4A 1DAKA 4A0HA 1FPMA 4RZ3A 5J4YA 2WTUA 3OIYA 1ZM4A 3ECCA 2G88A 3ZQJA 1KZ7B 3N2IA 1M34E 1ZD8A 5DISB 4D26A 1G19A 4JSTA 4HB4A 3ZVMA 2W0SA 3D3QA 3GEIA 1S1MA 2DB3A 3TAHA 1CEEA 3QENA 3U7FB 3ZIAA 1T0HB 1KO7A 2GK6A 2QI9C 1H8EA 3MG9A 4GMDA 3BWDD 5DI3A 2J0SA 1XF9A 4QM6A 4YQFA 5HZHA 5EZ5A 2PL3A 3ZZ0A 4HAUA 4M1TA 1SKYB 3AH8A 3REGA 2OM2A 1MO3A 2ZU6A 4DCTA 1NIJA 3TGPA 2NZ8A 1UADA 3ADKA 2V55B 2QZ4A 2ZRIA 2ZS7A 1IN7A 3L0SA 2GA8A 3B1XA 4TWZA 1SVOA 4A6PA 2JDIA 4IW3B 2OBMA 1ZVQA 3WMEA 1Q1QA 3QG5A 2FG5A 3LY5A 3K0FA 3NHAA 4TMZA 1MRSA 1NNEA 4LHZA 4KYUA 4WA7A 3RS7A 2FSIA 2AKYA 4A36A 2YC4C 5FBWB 1KO8A 4B32A 2ZI5A 2C9YA 3RRNA 3K0AA 1SKYE 2ZYTX 4ZKEA 4Q7JB 1DG3A 2GCOA 1UKYA 3Q85A 1AA9A 3TRFA 5TY0A 1KSHA 1LS6A 4JIMA 4LK2A 4V0MA 4PZLA 1W5TA 3DDCA 2XNSA 3QOFA 4WIAA 2ODNA 2PX3A 4CEIB 3G5UA 4HZUB 1WDTA 2A2ZA 2VHCA 2ZS9A 2FDCA 5AJVB 2DFNA 2PZEA 4U02A 4DSNA 1KKMA 4LBVA 2BKEA 1QG4A 5CYPA 5F98A 1DADA 4ZV4A 4NCKA 4YC7A 3PCRB 4DT1A 4Q18A 2NMVA 5AUNB 4RD4A 3AP1A 2ZROA 4NPHA 1G3MA 3W3AA 1P61B 1LTQA 2IA5A 1LB1B 1I2DA 3MWLA 1XTIA 3EZ2A 1O87A 4AD8A 3K09C 1S2MA 2BDTA 3AM1A 1B23P 1KYIA 2NO6A 3G0HA 1E9BA 2JJ1D 4F4JA 4G3XA 4JVLA 3TQFA 5EE1A 2QP4A 1E0JA 2QTHA 1ZMXA 2QE7D 4F4CA 2YWGA 3PR1A 1LY1A 2OLJA 1XXHA 4RKFA 2CVFA 2CJWA 3AKDA 5LBIA 5FH9A 4LHYA 1S4QA 4URUR 4BWYA 3J81k 1F5NA 3O8BA 4GZLA 1U94A 4LSGA 2JCSA 1RZ3A 2ZRNA 1E1QA 4EAQA 1J8YF 3PQCA 5KTYA 2ZR7A 2B7BA 2UVQA 3U3MA 3T34A 1W0KA 3FKSA 2IYRA 4KV9A 4MITA 1E2JA 1Q22A 2OBLA 1E2MA 5P21A 1JECA 1OSNA 1GNPA 1LV7A 1ZNZA 3BAFA 3C15C 3TKLA 1S3SA 4LI0A 5FL7A 3FGNA 3BOSA 2XJ9A 3AVTA 1IY2A 1E3MA 5DI3B 4PTLA 5DLQC 4LWZA 4BLRA 2ODWA 4C30A 3OZXA 4IJMA 2WMNB 1P2TA 2RGNC 4LJ6A 4BRWA 3GD7A 3MJHA 3Q72A 4M53A 4MA4A 3VHXA 5CDFE 3EPKA 2QPOA 4M2LA 2JLXA 3GLGA 1DG1G 1EG7A 2CL7X 2QMHA 1LF0A 3IUYA 3OEED 4PHFA 1CIPA 3K0FB 1W47A 2N42A 4JT4A 2GJKA 4CIDA 3HPRA 1SXJD 1AS2A 3QPWA 1G8PA 1G8GA 3CX7A 3VTKA 2ZR9A 1KI3A 2ZRJA 3K0AB 4GP6A 2B8WA 5JJIA 3CRQA 2GXUA 4M1YA 5LB2A 4LBZA 2GCOB 2F1IA 4DDTA 2VP5A 5FOSA 4HAZA 4Q4LA 2IXEA 4KJZA 5KPDA 4Q1DA 4NBSA 3LD9A 4JVSB 4QJ5A 1K8RA 1XJ0A 2WZQA 1LS1A 4IHQA 1EX7A 3L2OB 1PLJA 2DHRA 2YVUA 2C2HA 1XEWX 4BZXA 2PMKA 1H65A 2FMXA 1N0VC 3L82B 1PLLA 4M1SA 4DT1B 1KKLA 1JB1A 3LVRE 4IEIA 2NO0A 2PMDA 4LX0A 2Z5FA 3AVQA 4OHWA 1JEDA 1M7GA 1VYVA 5FOTA 2AD1A 3FMPB 1L4YA 3CF6R 4V0ME 1YZNA 4E22A 3BXZA 1RRFA 3LV8A 5D3QA 4MRNA 3LXRA 3Q5EA 4DHEA 2AD5A 2WWYA 2X19A 2FPKA 1MO4A 3LX5A 4JLJA 2NTYC 4W7SA 2OEPA 1US8A 3C7KA 2ZITA 3N2EA 1Z0AA 3CNOA 5A4JA 2V7QA 3A1SA 1NG9A 2QSZA 1G9XA 1CJKC 1SVWA 2IL1A 4PZZA 1UBFA 4QGGA 3RRZA 1ZBDA 3HPQA 5B58C 4JLVA 3LO5A 3A1TA 1HYQA 5E7IA 3SC3A 2CJWB 2GETA 3AEZA 3AF3A 4RFSB 2IYTA 3CF0A 3SI7A 3EPJA 4PHTA 3CX8A 3CH5A 5FL3A 5TVKA 2CDNA 2AHOA 4DKXA 4ZPXA 2W58A 2ZI3A 4GZMA 1KI4A 1KJZA 3W9YA 1GKIA 1VECA 4LC1A 4B34A 4YXWA 3SEAA 4KFTA 4IOKA 4D81A 4DEYA 4EKDA 3CNLA 4Z1MA 5AUOB 1OT3A 3HR7A 4AURA 3B78A 3AVVA 4N0EA 5GJWC 4TTRA 1YR9A 4BFXA 5C46F 1NLYA 1XXHE 3I72A 4G5QA 1YZUA 2ZTSA 5KO2A 1Q57A 4EPXA 1ELOA 2C9OA 1QHNA 2A5FA 3QY0A 2HLDD 5JEDA 1J99A 4EFNA 2O8CA 2L0XA 1P62B 3AVYA 5KNBA 1CP2A 5HPYB 3ZVLA 1T3SA 3SR0A 3TAUA 4Q7LA 2O8BA 2Q3HA 3KJGA 2BJVA 2R6DA 1KZGB 1E2HA 2J3EA 3WRXC 1MO6A 2HCJB 2ZUBA 4HDOB 2OE2A 1E94E 1F2UA 4TLAA 3L0PA 4W9MC 2W00A 2ZR0A 1I4DD 1MOZA 3D6TB 3I4LA 2RCNA 4MUAA 2HXYA 2H8KA 4BFZA 5TDHA 2C03A 1GSIA 2P0EA 1FX0A 1V43A 4HDCA 4FCTA 1NVUQ 3H0KA 1GNRA 4OHXA 4GRAA 1E2KA 1KO5A 5BN4A 4CEJA 3NKVA 4PFSA 3L0OA 2P3SA 3ZVNA 4M9ZA 3C16C 4LBYA 2XOKA 1EFUA 3GLGE 2A30A 1RFLA 4MKHA 2ODEA 2GZAA 4LBWA 4P4SB 1YZGA 1XCPA 3BBPA 3W34A 1N0UA 3RWMB 1JR6A 2PT5A 1TQ6A 5KNCA 4IFEA 1EX6A 4A2WA 1OJLA 5AR1A 1A4RA 3PXGA 5EXTA 4OYHA 1YHNA 4DLVA 2ZSDA 4ESHA 3A4LA 3RNLA 1PZNA 3SYKA 2O8EA 2J0UB 3WYGA 3T15A 4NYJQ 1Z07A 2C96A 1SVKA 3FMOB 1R5NA 1I4LD 1L8QA 1KI7A 2G3YA 2A3RA 2GRJA 4ZDIA 1D6JA 2KJQA 2QAGA 1US8B 4DRZA 5FBVB 1U8AA 2ZRCA 3LQRA 5CIWA 3IIJA 1NSTA 2A5JA 4NCNA 1AKYA 4DCSA 3F3YA 3IO5A 1EXMA 3AF1A 3FOZA 4UNSA 2QM7A 1KK3A 1NY5A 2PT7A 2NO9A 2ZRKA 1ZD9A 4UXHA 1L2TA 3VX4A 2BMJA 1NBMA 1IHUA 4OK3A 3QBTA 4LPKA 3T5DA 2Q9AA 2ZJ8A 4B6EA 4ZDJA 3K70B 3AVXA 2JAQA 1UKVY 3NH6A 1HTWA 1WA5A 4NH0A 1D2EA 1QHGA 4F4IA 2V1XA 2VSFA 1IOZA 3GFOA 1TADA 5HCNA 3KX2A 5DN6D 1U90A 1VTKA 1P60A 1VG1A 1JAIA 3RVBA 4PR0A 4ZO4A 1YRBA 2JJ2A 5FR2A 2ZRPA 2IYWA 4OQXA 2O8FA 1E9EA 4N1AA 3EZ7A 5FOUA 1ZNXA 2G83A 2XEXA 1P3JA 5FTMA 4F93B 2O8BB 3I92A 1BIFA 4JBWA 2QGNA 1GUAA 3GLHB 3MLEA 4MGYR 1Z2CA 3CBQA 3SE0A 2IYVA 1YVDA 3DEFA 3T1OA 2GDJA 2CLCX 3SFZA 3WNCA 3KZ1E 1F2UB 4LOAA 3RWOA 821PA 1F3OA 2XTZA 3GFPA 1OB5A 1EESA 5DH9A 3VR6A 4GDFA 2W83A 2W2VA 4BFYA 3RS3A 1E96A 1N6NA 4LV8B 4DJTA 3T1VA 3ND8A 1DELA 3DL0A 4GSYA 4QGFA 2V9PA 3IIMA 2KWIA 2VLIA 2XX3A 3BGWA 4DBLC 5LDDC 1FUUA 2P5SA 3GEHA 4FD2A 4ITRC 5FBQB 3K1JA 3CWZA 2AR7A 5GVRA 1TTTA 3ETLA 4CGZA 4JBYA 5EE3A 4CEJB 1DAFA 2VF8A 3KFVA 1KDPA 1ZM3A 1GRNA 3U6BA 1GP2A 2HEIA 2JIZD 4URXR 3AVUA 4QHTA 3QPUA 4EDHA 3UANA 4US0R 1DVRA 3WBKA 1JEEA 1L7VC 1OFIA 5JS7A 3Q9LA 4D80A 4US1R 3TW8B 4DIEA 2EFEB 2OT3B 3ZS9A 2G1KA 121PA 3SJAA 4DLRA 4B6FA 2I1VB 1W36B 1S3GA 1N6PA 1P6XA 4OHZA 1CF4A 1GAJA 4Q02A 1OKKA 3QPVA 4FCWA 3LFUA 2PCJA 3C8UA 4NONA 1VG8A 3B9QA 4UXJA 3KUDA 2A5GA 4L9WA 2GCNA 2FFAA 3FHOA 2O8DB 1MR3F 3KJEA 2AK2A 2JATA 2IYQA 2QAGB 4IVQA 4P31A 4RFVA 3SQXA 1ZP6A 3K9NA 1N6LA 3NH9A 4E03A 3S1AA 3ZH9B 3SS8A 4C0BA 2BBSA 2J7KA 1RRGA 2VP0A 1ZUHA 4B73A 2ZVPX 3U5ZB 2MSEB 4B43A 1ZM7A 5BN5A 4D4KA 2WJVA 3FMFA 3BJIC 5KPJA 1R0WA 3BE4A 1CR2A 3DOFA 3ND9A 2QAJA 1G3UA 4PO1A 1VIAA 3QKTA 1KTVA 1NG1A 5IK2A 2IHYA 2OO7A 1P73A 3MWKA 5BW8A 1CU1A 2GJSA 3O8DA 4TYYA 2WJHA 2OFXA 4KLNA 4AKIA 1GDDA 4M1KA 2I4IA 4EPYA 1YZLA 1S9DA 4H1UA 2H5EA 4O25A 1K5GA 4MKFA 4DLWA 3I61A 3CNNA 2FFBA 5JJKA 3IILA 5LD2C 4HYYA 4HUQA 1R0YA 2ZANA 2IK8A 4XD7D 5AUPB 5CM9C 4U5XA 3KFXA 1XBTA 4PQFA 4X8HA 5FOXA 1GZSA 2Z4RA 4WZAE 3GJ8A 3BFVA 4L5BA 4BFUA 4C2UA 1GRQA 1YKSA 2WWXA 4P0TA 1CR4A 1CTQA 3V00A 5FUXA 2BC9A 4CEHA 3CZQA 4A0GA 1D9ZA 4TQUS 3NBYC 2O5VA 2RGGA 5JWRA 2QL6A 1OHHD 1OPXA 2IYUA 4Z54A 5B64A 4B3CA 2BBTA 3BERA 2P67A 4K46A 3ZYCA 2I3BA 4G5GA 4M9QA 3AGQA 3CIOA 3MD0A 1R0ZA 3ZQ6A 3GJ0A 2HDNB 4HAYA 1QDEA 4A1FA 1DAEA 2Q21A 3KKPA 3KJIA 4QGHA 3K9LA 1JXMA 2BWJA 2MMCA 1NKTA 3HDTA 1E9AA 3DVLA 5FTJA 1U9IC 2IF0A 4AKEA 1OIWA 1TL7C 3PEUA 3SJCA 4D4MA 5J4LA 4CEIA 3A8TA 5KYKA 4QFMA 5JLJA 2JLZA 1Z22A 2HV8A 2P6NA 4MYHA 1BO6A 4RY2A 4OKSA 2W6JA 3T06B 1N6KA 4JLOA 4PPQA 4B33A 1P2UA 2X77A 1QVAA 4TMWA 1XEXB 3B1VA 2DCUA 3QF4A 2EWWA 1SHKA 4A8JA 4PO8A 2QNRA 4HB2A 2FGJA 3FVQA 3S1AB 2JLYA 3ZLJA 1AGPA 2Z6VA 221PA 5FTLA 5TB5A 4DB2A 1AN0A 3Q3JB 2XNDA 4NP6A 3WNBA 2O0HA 4CRWB 2R9VA 4ARZA 5JRZA 5F9FA 3I32A 1FFHA 4LYFA 2Y8EA 4DLSA 4JL6A 3U3JA 4TMKA 5DNYB 4KSCA 5JI3E 3IO3A 1GL6A 5FPTA 4DEXA 4W5JA 2QENA 4YMWA 4GL2A 3WYAA 2J0QA 2RGBA 1G1MA 1XMVA 2BMDA 1J8MF 4ZKDA 4AC9A 2IC5A 4Q9HA 2XSZD 4TT3A 1E1RA 2DFTA 3CM0A 4QOSA 3PITA 2Z83A 3IBGA 4GPTA 5FPKA 3MGCA 5EZ6B 1P9WA 2QEQA 4PPFA 4HLCA 2IBMA 2ZQ5A 4HUQB 1FQJA 4KFUA 4NYIQ 4NCJA 1R6BX 1I2MA 2P6UA 2WBLC 4EUNA 2HCBA 1XPRA 3DM9B 1P4SA 1CJVC 1KDTA 1X8KA 1KMQA 3W6NA 3KXLA 2ZYWX 4Q7KA 3THYB 1MABA 2FSFA 5SZKB 2GILA 2WJGA 3KKNA 1EGAA 4ESVA 2FWRA 3HWSA 4DDUA 4CEHB 4JLNA 1ANKA 2UZ3A 3KJHA 3D31A 1NVVQ 1X3SA 4QC2A 2YINC 3WMFA 4ASUA 3HU2A 3UG7A 2REOA 4GT1A 3GLIE 1E32A 2QT1A 5AJYA 1KY3A 1VPLA 4OI1A 1OH8A 2OCPA 4FMDF 1Z6YA 4A9AA 5TARA 3X2SA 5EP1A 1E4VA 4R9UC 1D2MA 1A1VA 2WIAA 1G3RA 1RRCA 3SHFA 4R71A 4P4UA 4WZBE 1CBUA 2VP4A 3H1TA 4RD1A 1ZU5A 1XZQA 2A7QA 2OSBA 1E99A 5CIQA 4DUGA 4EJSA 4Q21A 2F3TA 4PHGA 1XJQA 1AK2A 4EPTA 1E0KA 2GK7A 3LRPA 2HXSA 4QBFA 4NZYA 2DWOA 2ORIA 2CXXA 4Q1AA 3OIWA 1AS3A 5F9HA 4Q9IA 3TIFA 3EWSA 3GPLA 2HJGA 1H8HD 4RCYA 4LJ4A 2IWHA 4LYJA 3VQTA 1GL7A 3QUSA 1E98A 1X1RA 3GMTA 3KUCA 4BZQA 1CXZA 3BS4A 3KQHA 2FFHA 2WICA 3A1WA 4IDPA 1AGRA 1FP7A 3DPUA 1OXVA 4JLDA 1XD9A 2F1JA 3QF4B 1SVSA 4A8JB 3PEVA 2RMKA 2G0TA 4O0MA 5JEEA 1X6VA 5FPYA 3ZD6A 1GVNB 4O3MA 2R2AA 2OFWA 4WBSA 3CO5A 721PA 3ASYA 4ARZB 2CK3D 3W8RA 1COWA 2YZ2A 3KL4A 5HKKA 4KVAA 1HY3A 1CLUA 2BBOA 3FHCB 4OI2A 3B9PA 5AUQA 3P27A 2D62A 3EG5A 3QXXA 2UKDA 3MWYW 1SVMA 2X1VA 1NRJB 1TNDA 3EIEA 3W3ZB 1A82A 1XMIA 2VTKA 1N5LA 4UNQA 5FUVA 1P2SA 1SQ5A 2FOLA 3TUIC 2E87A 1NMYA 2J46A 4B44A 5DIFA 1GITA 1XDBA 4TZ0A 1GRRA 2ZUDA 1TF7A 2GVZC 3ICEA 1ZC4A 4DDVA 2BEJA 2ZRFA 4RZUA 4X8OA 5BYKA 3KQKA 1RW4A 3QKRA 2HF9A 2YV5A 1E0AA 3WY9A 1D2NA 1HV8A 3LW8A 2IS2A 4KO8A 1FL9A 3AP3A 2JLWA 1MABB 1OH5A 4M1MA 3TUJC 1J2JA 1FMLA 2ZRLA 1SKQA 1OV4A 2X2EA 2YHSA 3KB2A 4LCBA 4TLEA 5C18A 4M4SA 5KU1A 1NP6A 2BJWA 4J0QA 1XD2A 1OYYA 2ZSBA 4IFBA 5SZHB 2N46A 4OHYA 3C5HA 1TMKA 1KK0A 3NWJA 1E79A 1T0JB 4HLUA 4BGDA 3QI2A 1Z2AA 1T8UA 4JYBA 4FI3C 1TQ2A 4RFSA 3U3OA 5CB6A 1FTSA 4Q4HB 3ICQB 1N3BA 4EJSB 2FN4A 4ZIRA 2A78A 3U4QA 2VH5R 3BFXA 4LJ7A 2DBYA 4Q4AA 3THXA 1XFAA 2NPIA 4PC1A 3BH7A 5EQTA 3K0SA 3P4XA 2H7VA 2W0MA 4TYPA 2CHVA 4LJAA 3EPLA 3R9WA 3WP0A 2P65A 1N5KA 1OIXA 1Z3IX 1GKUB 2ZJOA 4LY6A 1W4AA 2ZJ2A 1TEVA 1OIVA 2VF7A 1VYTA 5A5GA 3CPJB 4URZR 4EPWA 3A1VA 1RPZA 4QHYA 4RVCA 2ZVQX 3C14C 3CR8A 1RJ9B 3NVAA 3CLVA 1D8TA 3ZIAD 2FV8A 2WAXA 4P3YA 1HE8B 4RD6A 1H8ED 2AN9A 3R20A 4JKYA 3UWOA 4GI7A 2YWHA 2WOJA 3F0TA 3IBYA 2P5TB 3ZJYA 4MYTA 1LVGA 1O3YA 2FZ4A 4LV5B 1WE2A 4JJZA 2BVNA 2GZHA 4FCVA 4S2EA 2FEOA 4ZCMA 4BLQA 4LJ5A 2ONJA 2MSCB 2JDID 2YOHA 3QXCA 2XZOA 4MYCA 2FE4A 2V3CC 1YR6A 2OXRA 1R5OA 1E9SA 2RHDA 1E2LA 3CRRA 1KSGA 1RVDA 2Q3FA 3QKSA 1QF9A 1SGWA 2ZI6A 4AYTA 3ZD7A 2ANBA 4C0HA 2ZE7A 1NLZA 2GBLA 5AJXA 4EPRA 4YMVA 2D4HA 2FNAA 4BRUA 1UKEA 1ZJ6A 2FPMA 2WKPA 2R6AA 2AWOA 3CR7A 3TQCA 4D6PA 2WJJA 4FW9A 1JR3A 2EFDB 1IONA 2F9LA 1P9RA 4P4SA 1BYUA 1R10A 1SXJB 3MCAA 2DFKB 2OUKA 1KSJA 3IHLA 3DHWC 1GG2A 3QKRB 5SZJA 1XCMA 4PSAA 5FPHA 4MRSA 1MH1A 5TMPA 1R4AA 1CJTC 1QHIA 1M2OB 2OILA 2PX0A 4KSBA 2AL7A 2D3WA 3CPEA 4Q03A 1ZRHA 4US2R 2P6RA 2Q3MA 2J0UA 4CW7A 3FFAA 4A0FA 1Z6GA 4MYUA 1N6HA 2ERXA 5G3YA 1IN8A 5CK5A 1FNMA 1XD2B 2QA5A 3BD9A 2AXNA 3QXHA 1U0HC 2BOVA 3TBKA 1XTSA 1KDRA 5KSZA 3OESA 3F8TA 1NF3A 5CJPA 4IKEA 4PQRA 2QTVB 2ZYUX 3NBXX 2VRWA 2ZETA 2ZUCA 1N2CE 5IHPA 2HUPA 2ZPTX 3PUXA 1HA3A 2D7CA 1SHZA 3PVSA 3RLFA 3U4QB 2WWHA 3PG5A 4ZIRB 3KQNA 4Y0VA 2FPLA 4F7WA 4TLBA 1X8LA 2QT0A 3TE6A 4Q4AB 2ZAMA 4DLXA 3THXB 4DLUA 5KDLA 5GJBA 2VP6A 3EZFA 1E1QD 1OFHA 3IDQA 3LNCA 1W48A 3FHTA 4NYJR 5FOWA 1W0KD 3FKSD 4IOJA 1KI8A 3A36A 3GLFB 5F3WB 2BCJQ 1G7SA 4ERNA 3OEHA 4Q19A 4V0NA 3TSZA 4Z8YA 4L16A 5FL7D 4FWIB 5JSZA 1WB9A 1U8YA 3GFTA 1ZM9A 3JVVA 4NDZA 1NKSA 3W8NA 2X2FA 4C3ZA 2CEAA 4ON9A 3AVPA 4LPSA 3OFNA 4BLPA 4B71A 5JZVA 5FR1A 2SHKA 3GLHA 4TLCA 1JNYA 2AFHE 3OAAA 4XSHA 4A6XA 3I1FA 3OIUA 1KAGA 5L3QA 4C7OA 2DR3A 1JPJA 2ZRHA 2WWIA 1EFCA 1G5TA 3CRVA 4F92B 2B6HA 4CVNA 5J4KA 4C4PA 1CS4C 1YQTA 1JPNA 3SQWA 1OFTA 3RSOA 1NI3A 3SBEA 1PUJA 1JQLB 1RYHA 3QKSB 3FPAA 2YWFA 4OQLA 3VKGA 4DZZA 2RGEA 5EXSA 2G1JA 3GJ5A 2XJ4A 2YOGA 1VCOA 1C4OA 3GJ4A 3T1QA 1NJFA 1E2NA 2HJVA 4E5UA 4KBGA 4MH0R 1KOFA 4G0NA 3AUXA 3IQWA 5FUYA 5JS8A 2J7PA 1AIPA 3EIHA 2ANCA 3PIRA 3UKDA 1BMFA 2WSSA 3VHLB 4KLZA 4LV6A 4W5WA 1IXRC 2ERYA 1G5PA 3AUYA 1OH7A 4EQ6A 1GOTA 1GL9B 1Y3AA 4QBIA 4HB3A 4D4LA 3K70C 4R7ZA 3VKHA 4B2LA 4PHHA 1N6IA 2QY9A 4WAUA 2WHXA 1JR3E 1NSFA 2O8DA 2FA9A 4OHVA 2CE2X 4LHVA 2G0NA 2IF2A 3UMRA 4CYMA 4II7A 3KKMA 3B6EA 2WV9A 1OXSC 2RGDA 5CB8A 2V7QD 4DLZA 5A0FA 3BB3A 1U8ZA 4B3GA 4X8MA 1XWIA 4QHSA 4S35A 1AS0A 2AFIE 2VBCA 4TL9A 1HEIA 4KITB 2DFLA 4BEBA 1VKJA 1IAQA 3I3SR 4BFTA 3K70D 2FJUA 4YXWD 3KKOA 3X1ZA 3EASA 2NG1A 4BASA 4Z1MD 3IPXA 1TQ4A 1YZTA 3BC1A 4A0RA 5K8LA 4WXRA 1U81A 2QTFA 3TH5A 4CF7A 1W4CA 5C1BA 3F5FA 2FF7A 1KAOA 2FSHA 5JSZB 3QEOA 3PFIA 3NIBA 4Q1EA 3LBHA 3EIQA 2PEYA 1A2BA 4KU4A 2QP9X 3B1WA 2DPXA 1OF1A 3AP2A 1A2KC 1ZINA 2V4ZA 1W44A 4QNMA 4XVQA 2ZRAA 1IJFA 2FFQA 4C7OB 2R6GA 5L3QB 1MV5A 3WHKA 5IRCD 4KI0A 3REFA 2QMEA 1JALA 3EZ9A 1UDWA 4EPVA 1W49A 1CJUC 2EVWX 2GAOA 2W6IA 3P4YA 3VU9A 1W36C 1P72A 4I1VA 4AG5A 3M0EA 2ZRDA 2GWHA 4Q9LA 2W2TA 3IEUA 5L3RA 4RCZA 1VHTA 4XTCS 5CLQA 5JHHB 1DO0A 2ZAOA 1YR7A 2BKUA 1QHYA 3U3KA 2GKSA 2QAGC 3GLHE 2ONKA 1IXSB 3IGFA 5ANRB 1MT0A 4LZZA 3W6PA 5H68A 3WRYC 2NZJA 2CCJA 3KB1A 2QBYB 2XOKD 1BKDR 2ECKA 1UAAA 1FZQA 1EFRA 4G5SA 2ZJYA 1G4AE 3LXXA 2Q0HA 4TL6A 3KQUA 3QXJA 1C1YA 4EIWA 4JJKA 4TQAA 1BMFD 4BFSA 2GXSA 1E2PA 2ASEA 1HURA 5FOVA 4EQ6B 2XTNA 3B8HA 3GJ6A 1FW6A 2ZM5A 1SVIA 4BLOA 1W36D 4JT2A 3M1IA 4B47A 3CRW1 2C04A 1Z0KA 5FFMA 5H70A 4TYQA 1XRJA 4IOLA 4TSFA 4P4TA 1E2IA 1XEXA 3WHLA 2ZSEA 5E7MA 4LYHA 4MRPA 1RYFA 2XITA 4N3NA 1NJGA 5J5CA 1IM2A 2ZSAA 4R2HA 4XSGA 3UMFA 3C41J 4Q7MB 2OCAA 1E2FA 1GTVA 4TMVA 1YE8A 3RDPA 2OAP1 4FN5A 1G64A 2PJRA 1ZNWA 2XGJA 1Q20A 2BHRA 2WWFA 2VYFA 4CDGA 1N5JA 5L3SA 1U0JA 4LJ8A 1DO2A 2MMGA 1NBMD 3I8XA 3LW7A 4GP7A 5KHOC 2QUZA 1T5LA 1E0SA 4Q01A 1II8B 4MDEA 3GJXC 4B48A 5CM8B 1Q1ZA 1GKYA 1W0JA 2RGXA 5SZIA 1XPOA 4LDJA 4HB0A 5JFGA 3U3RA 1L4UA 1UBCA 4MGKR 2R62A 3K9HA 1UBGA 2AXPA 2YYZA 4UNRA 3NBZC 4XOIA 3LH5A 4ABYA 2B8TA 4HATA 5KNDA 3B85A 4B76A 4MRRA 2JJ2D 1NBME 1MO5A 2WPDA 2J1LA 3OE7A 3PUVA 2MSDB 4P33A 1E2QA 1G21E 2LKDA 3THYA 3LAWA 4JLMA 4Q9KA 2F3RA 2B7CA 2FX3A 1G7TA 4NTZA 2D7DA 5FPSA 2CNWA 4DCUA 3V4RA 5KSYA 3DMDA 5G53C 3VMFA 4PXAA 1W4BA 4URYR 3T61A 1PVOA 4QJ3A 2ZJZA 3VU9B 4OL0A 2VHUA 2BMEA 2AX4A 3LBNA 1JBKA 2IEYA 1G8FA 1VCIA 1G8HA 2YNMA 5HZKA 4N0DA 1VCMA 1CR1A 2JA1A 1IN4A 5AWFC 4M21A 3R8FA 2ATVA 4PC7A 1J70A 1HH4A 3RS2A 3TNFA 4A4DA 2R8RA 4NYIR 2BV3A 2OLKA 4FMDB 1E6CA 1AJEA 2ZRBA 2YOFA 4AIIA 1Q1BA 5UKDA 2GXQA 3EAQA 1WF3A 4DCVA 3P20A 1Z63A 4RD0A 2CLDX 2JLUA 3U61B 3NXSA 4ZI2A 1NVWQ 5LPNA 3AVWA 4ACBA 3O47A 4FMCF 4KAXA 2NQ2C 4OQFA 3W90A 3QBVA 2ZEJA 2ZREA 5FTKA 3KQLA 3I8SA 5TV2A 2UZIR 2VHTA 1BYIA 1RE0A 1U99A 2A9KA 5ELXA 2H92A 1NVVR 3FB4A 4Q00A 5JHGB 3X1DA 3EA5A 3H84A 5EJEA 1FMJA 2V8OA 2W2XA 2IXFA 1OKKD 3A4NA 4QXAA 1OXXK 5BXQC 4PC3A 5HTKA 4V03A 5E7JA 4P32A 1MKYA 1Z47A 2GJ9A 4EFLA 3MWJA 4TN1A 5EP4A 2EFCB 5H1YA 5TXGA 1UDXA 3CX6A 1WBDA 3KDSE 5JWHA 4LYAA 3CZPA 1XCGB 3T5GA 1R8SA 1TUIA 4YDSA 1GNQA 4IVPA 4G5RA 2OG2A 3NC0C 2F1HA 2JASA 2C78A 4XH9B 3R8CA 3TW4A 3B13B 1CJMA 2TMKA 4GOXA 5L3SB 1F6BA 2HT6A 2C98A 2Z0MA 2WIBA 1OFUX 2VSXA 3PV0A 1D9XA 4H9GA 4HUTA 3U6KA 1VCNA 4KYIB 1DPFA 3LWNA 2Z43A 3MSXA 1Q3TA 5KSPA 5IK2D 1WBBA 1AQUA 1AQYA 1YJ5A 4NMMA 4DSUA 3UPUA 5G40A 3DKPA 3N70A 1G20E 4JVNA 1B0UA 1G291 1S9HA 2OZEA 2GAAA 3N5CA 5HE8A 3U2QA 4Z51A 4BQSA 2WJYA 1ZUNB 3SNHA 5KUTA 4QJ4A 4HI0E 4ILEA 2IYYA 2ZRMA 4JLPA 4V0LA 4HSEA 5D3MA 3K9GA 1WXQA 1T3HA 4XWAA 1NMZA 1YU9A 3RRYA 5EE5B 3GCGA 4PAOA 2OAQ1 4E07A 4O2RA 5DHFA 1QHXA 4IXMA 4QKQA 1XMSA 3CB4A 1DAIA 421PA 1UKZA 4RSGA 1QBKC 1TEXA 2GHIA 3TSWA 2EU8A 4B2PA 2OBNA 4Z8XA 2GJ8A 4GMXA 3HU3A 3PUWA 2VHJA 2QG6A 2QGZA 1SVLA 4Q1BA 2E1RA 3UMSA 4D0LB 4DDWA 5B57C 1KK2A 3R9IA 3C4JA 5H8WA 521PA 4RZ2A 2OHFA 1ZW6A 4UNNA 1TPZA 4GOKA 5DGXA 2CCKA 4Q4HA 4A8JC 3ZVRA 5JRJA 5EP2A 3O8CA 1QRAA 1ZYUA 1ONBA 4OQNA 2R6CA 5BQ5A 3GEEA 2F9MA 4FWTA 2JJ1A 2RHMA 2ATXA 5CJ2A 2IT1A 4OBEA 2EQBA 2QE7A 1LW7A 3P32A 2LCFA 1NLFA 5DE3A 2D74A 2VO1A 1WRBA 4DLTA 2CLSA 4IDNA 2IXGA 2IX3A 1CKEA 3WP1B 1QZXA 2G77B 3FWYA 3LQQA 3RS4A 1DBSA 3HP1A 4MKIA 4GBMA 4A2QA 2V54A 1YRAA 3AKCA 1RJ9A 4UQOA 1XNJA 4C9BA 2W6JD 4IVRA 4QRHA 4UXIA 1XB2A 3AF0A 6Q21A 2PCLA 3E2IA 2BBWA 3WXMA 4FINA 5CDFA 2I1QA 1XEWY 1BH2A 2OCBA 3TSOA 2CL0X 4GFDA 3K09A 4C0SA 2J41A 4TQ9A 2XNDD 4M0LA 2ORWA 2F55A 3CONA 1EWRA 4JS0A 2K5UA 4F91B 5GVSA 1D5CA 1E9DA 1IXZA 1Z28A 3KXKA 1DAGA 2GVDC 3H86A 3CKLA 3NEYA 2A5YB 4XVUA 4XIGS 3OEEA 4LHWA 4CZ2A 3UATA 2RAPA 2ZE8A 4YDHB 1G18A 5JCPA 4TT3D 3BH6A 1UEJA 1E1RD 1NN3A 1G41A 3WNDA 3U60B 3B2EA 4AYXA 4HZIA 3SBDA 3G82C 2XZLA 1SXJA 1GIAA 3NEJA 4TMXA 3MMPA 2BCGY 4KODA 4QBGB 1X1SA 1I4TD 1PV4A 2C9CA 3SJBA 1LNZA 2XZPA 4Q48A 2PJZA 1ZIPA 5D3MB 4OJQA 5G3ZA 4EJSC 3FFBA 1JQJC 1XEFA 3RAPR 3X1YA 1Q0UA 4JLAA 1E9CA 5GJCA 1KNQA 3E1SA 3HU1A 3MJRA 4H1VA 2FEMA 2BMFA 4PPNA 3T35A 4TYNA 1TU3A 2RGNA 1XTRA 3OF5A 3L43A 2QSYA 1G3IA 1VMAA 4Q4JB 1OLOA 2LWIA 1IQPA 2CE7A 3K0CA 1QHHB 2PZGA 4ASUD 3A1UA 2Q9BA 2NPFA 1HQYE 1SULA 4PQYA 3AF4A 4A15A 5J47A 4Y0AA 3RANA 5K8UA 1PJRA 2HYDA 1XD8A 5KDDA 1OXUA 3ZDQA 3HJNA 4YONB 5LB4A 1E9RA 2GESA 2NOAA 4DUGD 1N6OA 1QVRA 1OXTA 1T9HA 4QL3A 4D4JA 2PLRA 2QMUA 5CLLA 3EW9A 1KHTA 2IW3A 1GFIA 2EFHB 2PLFA 4TMTA 5DO9A 2PEZA 4HEJA 2JLSA 3GLFA 1KO1A 4JBXA 3I5XA 1FTNA 3B82A 1XTJA 4V0OA 1ZD1A 3M4YA 4AK9A 1HT1E 4TZ6A 4MQBA 4K8OA 4FMBB 1VIYA 1XJCA 3L8YA 4LJYA 3PEWA 4MUBA 2ZU0C 4C0QC 4URVR 4LGMA 1BS1A 1PLKA 4OK5A 1KY2A 3LA6A 3VX3A 4BPBA 2ZIAA 4O2LA 1Z0JA 2D2EA 2VHQA 3PENA 2AKAB 3PUZA 4PO9A 4M9SA 4MRVA 4PPGA 3FMIA 5J40A 2B21A 1SXJC 3EZ6A 1M6NA 1WCV1 3FDIA 3C5CA 4PANA 4MDFA 1YR8A 3MFYA 5DYGA 4WW0A 2KB0A 3AVOA 2JJ8A 5DHAA 4B3DA 1AM4D 4YMTA 4C0JA 2D2FA 2HLDA 1COWD 3LVQE 5HKKD 1V5WA 3LX8A 4AG6A 4V0KA 5JMTA 3BB1A 5L3VA 2EYUA 3V9PA 1M8PA 1Z6XA 1W1WA 4C0AC 3RS5A 2WMOB 3THWA 1U2RA 2BIFA 5G41A 4TL7A 3KTAA 1S1CA 1TX4B 1W2HA 1A7JA 1T4GA 2CHQA 3UG6A 3K0CC 4IDHA 1RIFA 2Q6TA 4M1OA 3SYNA 2LKCA 3QKUA 4HLUC 4JYCA 4ZCIA 1UJ2A 4JL8A 1KI2A 3MAAC 1W7AA 4HLQB 2IYLD 4BLTA 4UJ5A 5KOYA 2AWNA 1N25A 2NO1A 2VQSA 2QPTA 1K6MA 1EK0A 1HQCA 1DAMA 3TMKA 2QORA 3DMNA 3E5HA 3TR5A 5AJWA 4OJKA 5EE9A 2JLVA 4NCIA 1IJEA 2IYSA 5HCIA 5AK0A 3OIVA 1ETUA 1SXJE 1UEIA 1WP9A 2JLRA 3VR5A 4W5HA 2ZXUA 4AKHA 1R5BA 3CF2A 4WXPA 2O0KA 2RGAA 3R9XA 4RJLA 3A6PC 1W2GA 4OI4A 4POAA 2V1UA 1YZQA 1E79D 2VSOA 3QEJA 4LJ9A 2IS4A 3QVVA 4G1UC 4KCGA 4KFSA 2VA8A 2IUUA 2GEVA 3L0IB 4IEEA 1RC8A 4NYMR 2OCYC 3RC8A 2H57A 5KDOA 3MUFA 5AJZA 2G9NA 4D82A 1OH6A 1PUIA 1EFHA 2CMKA 1EFTA 3BORA 3EWAA 3FKQA 621PA 5HE9A 4B74A 1YZKA 1KK1A 3NBFA 5E3HA 1KI9A 2QQ0A 3FTQA 2PH1A 3FYHA 1NN5A 4PAMA 1XXHB 2WM9B 2R6FA 3BK7A 4Q9JA 5FUWA 2GBLC 4GOJA 3Q7QA 1P9NA 1RRPA 2ORVA 5IF9A 3GQBA 3DOEA 3Q8XB 4WOPA 3NDBB 2GTPA 2NGRA 2FH5B
chains in the Genus database with same CATH superfamily
4FFBA 4UNPA 1O8BA 3DWEX 4OHOA 4F6CA 4C07A 1TYEB 5EXPA 3WOVA 4TLDA 4RS3A 3OQHA 3U37A 5HTOA 2PUBA 2HBZA 4D25A 5DM2A 3KSMA 2UYHA 2H16A 2HCTA 3FNEA 5A6SB 3PUKA 2F6RA 2BEKA 2MOKA 3LWBA 3UXMA 2ADOA 4RW0A 1LJ8A 2VH1A 4B17A 1LLUA 2IDJA 3ONNA 5JAHA 4FI3F 5JECA 2ZE6A 4RK5A 4WBNA 4PYOA 3PTAA 2FZKA 4R7GA 4DC9A 2ZLBA 4WCVA 5E4FA 1HNXB 1NC1A 2ZI7A 1CFJA 2JHGA 5KJEA 4GZ6A 5A4DA 3T1TA 1JIJA 3ER8A 1O9HA 1PR0A 3CVYA 1U2SA 3THWB 5I7EA 2GNOA 2GYUA 2EG9A 2QTAA 4NHOA 4JL5A 4LQ4A 4UBJA 4X71A 1ADGA 1RQGA 4X3CA 1XLUA 3QITA 5CDYA 1HI9A 1RCTE 2ZI4A 4KBFA 1D7AA 1VDZA 4MLPA 4GE3A 3CVUA 1WPRA 4I81A 4O4LA 4QG7A 3TFWA 3I3OA 1OFUA 1WS6A 3FE2A 5IDVA 3ZZTA 5A03A 1TQHA 1IBSA 1ZCAA 3JPWA 2QZSA 3NTVA 4YAIA 2Z56A 5J63A 3BL5A 4U2KA 3TEMA 1WQ1R 4NYMQ 4Q3LA 2P62A 3DZIA 4XJTA 1R6XA 5DDIP 1M2VA 4C04A 5ALZA 3KXPA 4M7OA 4HAWA 5ITZA 3CC8A 3AL0C 3RNOA 2W70A 5G4LA 3TSCA 3H9UA 1H6BA 1PSZA 1X86B 2C77A 3HYTA 3CA8A 3PB3A 4IIUA 5AH0A 1D2RA 3OQVA 4HV4A 1C0KA 1HYGA 2VF4X 1A76A 1I5OA 2PL1A 2BM9A 1XUOA 2NXCA 3SN6A 3WYFA 4Z7JA 4AZ3A 1H1LB 1W5SA 1LVHA 3L93A 2UYGA 3BIJA 3D1VA 2KBEA 2O7VA 3JVUA 8AT1A 5AVXA 1KSFX 1KJIA 2O07A 3IOCA 1E20A 3R9XB 1ZUD1 3RHFA 1M2GA 4YVFA 3H99A 4DA9A 5IBQA 3DZ8A 1IJKA 3K2EA 3V33A 1DGQA 1IY1A 2TMYA 1ZAKA 2QN6A 3C5VA 1MA3A 3PC3A 2BW0A 3JZAA 5IDXA 5JR3A 1P7CA 4EO7A 1NV8A 2GSWA 4PSVA 4QOHA 2EWVA 4DG5A 3ND6A 3GOHA 4P35A 4ZJUA 4UBKA 3MWGA 1HDCA 1Q83A 5C8YA 3SIXA 4JXXA 1W29A 1JU3A 4RDCA 3X1XA 1MO2A 1XVVA 4UHFA 4DWVA 4G63A 4MNTA 1HL3A 3GZJA 1V8PA 5J5AA 3B2QA 4BL5A 3H5WA 4F72A 2X8LA 3CCBA 1NUQA 2UYQA 4C3OB 2FR0A 1GARA 3VDRA 4ZDKA 3I9MA 1UFQA 3MT8A 4CDMA 5E2AA 5I5EA 5JFOA 5C53B 2AFVA 2H9AA 4QGAA 4YLYA 3BSFA 1MIHA 3NOOA 2NACA 4ZI7B 3IT2A 1REQA 2VXOA 2TYSB 2MYPA 4MB6A 4ACAA 1UWVA 1ZD2P 1NONA 5SYMA 3WMXA 2ZAIA 3JQRA 4RTLA 5C51B 1BDIA 4WZAA 1DCTA 4IWNA 4QYIB 2J9RA 2WJIA 3KXDA 1SCNE 5AVOA 4HNQA 1N9GA 4DZRA 3HK2A 2O2YA 3DZFA 3SF8A 2GEBA 3DZKA 3JYQA 4S05A 3ZD9A 3PEYA 3FPSA 4ZO6A 4XLZA 5FADA 3RFVA 2LCQA 5IULC 2NU9B 3SBOA 4I9GA 4QWMA 3URKA 4XD7A 3VOAA 2F7SA 3P9KA 4YR7A 1O95D 1MGOA 5BW4A 3IH5A 1MOQA 1Z6TA 1RADA 1U6IA 3QG1A 3BFJA 4WKGA 1EAYA 4BVHA 2IS6A 5LL6P 4JODA 5FPPA 4AQDA 4BAUA 1JTEA 1ZS9A 1IAVA 1EYZA 1JQEA 1SA0A 2C31A 3B9RA 3QYAA 2D4AA 4D0GA 3EVDA 2CBZA 3HKCA 5JCZA 3B6JA 3INTA 2YKGA 3G2NA 4UPEA 1L7MA 1AF7A 2ZJAA 3KYCB 2AZXA 4DLYA 5CUQA 2R79A 3ER6A 4M0KA 5BV8A 1P39A 2GEUA 4NU5A 4IHJF 1CR6A 5CEJA 1NVKA 4MR7A 1Z62A 3DUFB 3G2LA 3WK4A 4NBTA 3VVCA 3OY2A 1JAHA 3C87A 3CH7A 1NMSA 4HLDA 4EFMA 4J16C 1FX0B 3TR6A 2A33A 1MRNA 2ODBA 2P77A 3AIMA 3EY9A 3PJGA 3QWBA 4KQIA 3K53A 1RXIA 4RK1A 1JHPA 1EVQA 1BOFA 1WXEA 2LE0A 2RGCA 5BWMA 4V1CA 1S2LA 4KXQA 2LUOA 1ZIYA 1GCUA 2ACEA 3X3HA 4F04A 1C9KA 4FFVA 4GWKA 2VL7A 1UBLS 2Z2IA 2I6TA 3I01M 3RQIA 4J2OA 5EKTA 5BQ3A 2WQZA 3KS9A 2J6IA 4FJ2A 4HMOA 4ZN6A 4LRWA 2IOYA 3PWTA 2C99A 4MLDA 5FBLB 1N75A 3DM5A 1G2OA 2PKRA 4GNKA 3BICA 3EQ7A 1SCAA 4CIAA 2WWGA 1P4GA 2WDZA 1PZGA 3JYHA 3PXEA 4A92A 3DXFA 3IHTA 4DMMA 1XTKA 4KXWA 4C2TA 4OQMA 4K9OA 4X97A 4X8LA 3LBIA 2V8BA 2YJ6A 3K94A 3LUGA 3Q0IA 5FTNA 4BFWA 3WYEA 5ALSA 1UMKA 1Y5RA 4YCLA 3U4HA 2HMYB 3OCUA 4E4YA 2VIIA 2ZE5A 3EDRA 4PC2A 3RKUA 4CL2A 2YJZA 1XTQA 1XZGA 1RWXA 2Y9MB 4RD3A 1NXWA 4D0NA 2NU6A 2F1RA 2WJ6A 3W5BA 4LKOA 2O2GA 4IH1A 4IWXA 1DOAA 2WF9A 1VYUA 2AV6A 3U44A 3MCZA 1SZJG 3NAGA 2EFGA 3NQ41 1WU8A 3UYLA 4CR6A 2G0AA 4D43A 1IY9A 1U8FO 2HF8A 2ZSIA 2OQ2A 1PBTA 3IP6A 4YRLA 4RLHA 1F6DA 2YHUA 4QRDA 4LVCA 3J80A 1G8YA 1P1CA 1F2TA 2VAPA 1O5OA 4GKBA 5B2ZA 5B36A 3PNQA 4W5RA 1ADBA 1E4YA 1PK8A 2AK3A 1ZCBA 3OLWA 1PW5A 1EEXB 1BWQA 1P1KA 3QV1A 3TI9A 2G17A 4QDKA 3G5MA 4P7GA 4UD2A 3RC3A 1J90A 3FIJA 3T12A 4RJ2A 3VAAA 4L5CA 4MDHA 4NL4H 4DLAA 4UAGA 2PAFA 3OA0A 2NUBA 3L1VA 1ESMA 4QOIA 2WZDA 4WERA 2RKOA 3IVRA 3ZBPA 1B2RA 3IP7A 4IF6A 1Y1TA 3NRJA 5CW2A 1M7HA 2FZLA 3PEFA 3AY0A 5G02A 1P75A 4AUEA 1K68A 4O5OA 3L6DA 4ZYZA 3PTLA 5JASA 1O03A 4CFZA 2O8FB 4I08A 1OYWA 4TVBA 1KO4A 1U2GC 1G7RA 1TQDA 3MQ2A 3TE7A 1NNSA 3AJ9A 1VL1A 2YBEA 3AW8A 4EG4A 3TK1A 1K6EA 2I6XA 5DTJA 4LG1A 2RGRA 4MPDA 4FS8A 3VC3A 3V80A 5JSFA 1E5TA 2R6JA 2FP3A 1A5TA 2GLXA 1JHYA 2H00A 3DZDA 3QA9A 4D57A 2FGKA 4WZBA 5TT1A 2VP3A 5IYZF 3B51X 4DN6A 5LOVA 1P81A 3H75A 3VVMA 1WSBA 2D5CA 4DSTA 5DTRA 5L8VA 3EUAA 4JENA 1CLEA 1QGAA 4GXRA 3ON5A 1MJ5A 2ESRA 2I54A 1XKQA 5IN5A 3TOZA 2G40A 5CDTA 1MAWA 2NYVA 2O7NA 1FQKA 2QP3A 5E1MA 1OY1A 1OFVA 4XKJA 1S0UA 3SKYA 3E70C 2XYGA 3KHTA 3DO5A 4ZARA 3BFKA 4CV3A 4R2JA 1P2GA 3O9ZA 5HF6A 2DT8A 1RKBA 1U2QA 3IPYA 3ZY3A 3ZXIA 3V4PB 4U00A 1Z0IA 4KXUA 1TCAA 4BKRA 1JI0A 5EFOA 3OD5A 1XDDA 1PBNA 1UJMA 2A9VA 4A82A 5GADl 4L4ZA 3NHFA 3PRYA 3OQ1A 1ZH6A 2OFOA 1FE8A 3LDUA 1NR7A 2EQ5A 4Y1EA 3WB0A 3BWVA 4ZXPA 1G2PA 1TUEA 3EARA 4PLGA 3QH4A 3RHZA 4DRXB 4KFCA 2OD9A 2O2HA 4X00A 1KJQA 1EWQA 2VR1A 5EJ8A 4QTTB 4IF4A 1Q6ZA 4G8BA 1JJVA 3DBRB 1FUYB 3OKCA 4DM7A 4LRSB 4UE2A 2CSUA 2GF0A 4EF5A 2EKQA 1W46A 2Q9CA 4LSWA 5J4HA 1NXOA 1FLVA 2OV2A 3LLUA 3TTYA 2GVNA 2QTBA 3GUVA 2F3PA 3EBLA 4MDYA 1S96A 4HUJA 2VNHA 4X90A 5F35A 3PUYA 8MHTA 3LHFA 2CK3A 2ZDGA 2NVWA 4S04A 3PL5A 1IN5A 1KBQA 2EV9A 4WDRA 2A6PA 3D4PA 4TV8F 2AKEA 2F8SA 3MQ4A 4YP7A 2H18A 1EFKA 2UV8A 2VJQA 3VNRA 5KYTA 5CT5A 3LRXA 3Q2OA 4R9RA 5FBRB 4ROTA 4HWPA 3KT3A 2B2XA 4R98A 5L7YA 1ARZA 1NXQA 3GAMA 1CUIA 1AXRA 2GN6A 3D7LA 2HLPA 2VQEB 4I14A 5JBQA 1VLZA 2W37A 3CEJA 4IQ8A 4ZCRA 3LVBA 4JJ6A 1IXYA 2VDWA 1N8TA 3OCXA 3AQ4A 4GUAA 5DSZA 3PE4A 4WEOA 5JBIA 1IRIA 5LP6B 4A2PA 5JXHA 4Q82A 1R27A 4HZUA 3N6VA 2RH4A 2XKBA 3MOSA 2R8BA 4RFLA 2H4ZA 4IXNA 1D5WA 1L6RA 2PWAA 4AMYA 1E62A 1KNXA 4FIDA 3SXJA 2GHQA 1NIPA 2C5SA 1EWKA 4OG2A 5EXEA 3ZWMA 1JQBA 1U65A 2QYTA 3A1DA 3AHGA 4LNUA 2FOIA 4G01B 4YB8A 1ACMA 2PZFA 2DTXA 2GN4A 3D3EA 3E6AA 1GADO 3HYLA 5B30A 1Z4OA 4MWCA 3EC2A 1FVXA 4I5GA 5EMKA 3TZLA 2Y71A 3ETEA 3UAOA 4M9UA 3KZCA 1KMHB 3A2LA 5C4GB 5JZMA 4AICA 1LXCA 3FJOA 1C3LA 3GLTA 3ESCA 2OGTA 2VXCA 4YLGA 4JZKA 2VKTA 3VR4A 4DR4B 4IUYA 4XI9A 4I4NA 3CN7A 1SBIA 3AEQA 4ZCQA 4NMHA 3Q5DA 5CVCA 2YMLA 4DA4A 1GUZA 4NARA 1HUQA 4XPZA 4HPXB 3RSLA 1C7IA 2FQQA 2DY1A 2BHLA 2F90A 1P1HA 3RK4A 3C7TA 4RLFA 2FK7A 3OCYA 1CY2A 1VHLA 5T4FA 2GM5A 1QIMA 4JJFA 1RQNA 2BM0A 2YHIA 3TQTA 3UJ6A 3PIIA 2C8VA 1S8FA 2AEMA 2BN4A 2P9FA 3OJOA 4JLWA 4YGYA 4FILA 3W4KA 1DAKA 4NFLA 4DZTA 3RCBA 1JXAA 5M5BA 3PKIA 2WTUA 1ZM4A 2B34A 4MW6A 1EAMA 2YY6A 3IV9A 2J3JA 2XBLA 1G19A 1TB4A 5AKYA 3ZVMA 3NPMA 3VYTB 1KYTA 3RYFB 3PRHA 1T0HB 1BXGA 1KO7A 2GK6A 1JNXX 2QI9C 1H8EA 4QM6A 1XF9A 2CHUA 4PYNA 3G7NA 2CV0A 3G2QA 4H6WA 4F6RA 5JCJD 2X0KA 3E7FA 3TQHA 4M1TA 4REQB 4WY5A 3AH8A 2C94A 4TTJA 5A71A 5HIAA 2X4IA 1R6UA 1OX4A 1NIJA 1MB4A 4OM7A 1SB9A 2BGIA 2WT4A 2C5EA 5DM4A 3OUUA 2IIBA 1KRXA 3UYKA 1U2PA 5C4IA 3RADC 2CN1A 2IY8A 2JDIA 5DBIA 1BGXT 4IZIA 2GPTA 3C1AA 1K7YA 3F6BX 2FG5A 4ITVA 3LY5A 1FS4A 2V6MA 3HDVA 4UREA 3LTEA 3NHAA 5ALOA 2YXNA 1JAYA 1M8KA 2AF4C 2AKYA 2FSIA 4MSUA 4WA7A 2ZB4A 5DTIA 2GBIA 5D3KA 2LPMA 2ID9A 1LBTA 1BROA 2L19A 1ORDA 5JD3A 1E5LA 2VDRB 1J00A 2HOQA 3B6ZA 2ZYTX 4RYLA 1BW9A 1O54A 4Q7JB 1DG3A 3E27A 4HYEA 3QVKA 5BT8A 1VE7A 5DNDA 1WLSA 3GRUA 4OXRA 2R00A 5TEVA 4M0FA 3ROGA 1H9AA 1VKRA 4V0MA 4PZLA 1W5TA 3O3NB 4G0OA 1JN0A 5EVCA 3X1KA 1TYBE 3NKFA 3SJUA 1TTHA 2RHRA 4Y6OA 1ZK0A 4OX9Y 4WCFA 1J0CA 1GRCA 5T8KA 1JAXA 2A2ZA 2BJHA 4KOEC 2FDCA 1GUFA 3TTUA 4QREA 4DSNA 1KKMA 3H3XA 4LBVA 4N3AA 4B79A 2HQRA 4D42A 4YUAA 1JGTA 3F9IA 1PL7A 4JBNA 2F8TA 3K6RA 2QG9A 3PCRB 4RH0A 3DC2A 1JVBA 4Q18A 3VDMA 5AUNB 4RD4A 2F64A 1KPGA 2NMVA 1PS0A 4NPHA 1X74A 4NZZA 3TDMA 1FU7A 3U4CA 1F7UA 3HBJA 5AVWA 2C5FA 2DUJA 2C92A 2EIHA 4PGHA 3TN7A 4D8XA 4G0UA 4DLNA 4X64B 2E2WA 1FYVA 4BNTA 4EW6A 1UQRA 1H1TA 2HBRA 3ZWPA 3IE1A 1B23P 2NO6A 1XROA 1E9BA 3I6MA 4M46A 3GMSA 3WGQA 5LKAA 2JJ1D 1OC2A 2PX2A 3ANYB 1VLVA 2E4ZA 1BFKA 1A72A 9MHTA 5FORA 2WT9A 3BMNA 4Z7QB 2QP4A 3SWWA 4BEVA 3GL9A 4L76A 2ZUFA 5CFQA 1Y6GA 3GNLA 5DHPA 4LNAA 3AKDA 4RLSA 5FH9A 4LXUA 5IH7A 5HIIA 3GRFA 3H2ZA 4ZYUA 1DKLA 4YR9A 3CY6A 1UIRA 1E1QA 1GPKA 1J8YF 1PJCA 3DAFA 4OUDB 2BRUA 3U3MA 4B8YA 4KJXA 2R97A 4E7PA 2XXJA 4LRQA 1K9VF 1WSAA 4QDOA 3HXKA 4I9UA 3Q1KA 3JQBA 1Q22A 2XOXA 1QUFA 2CLFB 5P21A 3VAYA 5HXAA 1MNQA 3B5IA 1GQSA 3IJEB 1PJTA 1UODA 1Z2DA 3QUTA 4MWSA 4RVDA 3TIXB 4H3KB 4LI0A 1DRVA 4WLFA 4HVLA 4NC9A 3R8XA 2OB1A 3CLKA 3FTFA 2Q3CA 1LZLA 1YRQA 2Q8PA 2VHEA 5B3LA 2GO1A 1E8MA 3GRKA 3LUPA 3QJ5A 2QLBA 4Z49A 4RK6A 1FFXB 1EVLA 1QG0A 2QVCA 1YK0A 3N0TA 4N54A 2WMNB 2P0YA 4BNYA 4D0SA 2O19A 4WNAB 4M53A 1TT5A 2FWJA 1K86A 1NGSA 2XWBF 1YDWA 3HB5X 3EVZA 4OJNA 3RHSA 3ELYA 2HA4A 1EBBA 2QMHA 4PHFA 1YOBA 5AKXA 2PVSA 2E3JA 1N4DA 3OQIA 4IUBS 4P98A 4NAUA 1W47A 1W8DA 1DX9A 4JT4A 4NZPA 3H04A 3HUTA 1PVDA 2BI8A 4IHJA 4LVOA 1SXJD 1AS2A 1R4MB 3VDNB 3VTKA 3CTPA 4JI7B 4IHKA 4K5QA 1HFWA 1NVTA 3K0AB 1LSJA 2VPTA 3FDFA 5CHYA 2ZXEA 5L40A 2GXUA 5JJIA 5AK5A 4EUHA 2JBAA 3AI3A 3C74A 4DDTA 3OSUA 1QIGA 4I7EA 2ZB7A 2POQX 2IXEA 4KJZA 4Q1DA 2CMGA 1J2EA 4C3UA 1I1NA 2OLEA 3PVCA 1K8RA 2WZQA 1Q1GA 5I9TA 1Z74A 4AX4A 2W6NA 1W94A 4ZU1X 1PLJA 1FW8A 2DHRA 3OBIA 4KGXA 5AM1A 5FOQA 1PFUA 2RG1A 5AHXA 2Z1DA 1H65A 1NOJA 1C0LA 3DLHA 4KTVE 3R0JA 4AJNA 4MLCA 1JB1A 2IP4A 3EIUA 1QZTA 1Q6YA 2PMDA 5AOCA 5F51A 4OHWA 4UFOA 1J0DA 2PUJA 1VYVA 4XDGA 2HT1A 3FTPA 4JHXA 2AD1A 3CF6R 1R0RE 1F4LA 3LV8A 4G1FA 2Q5QA 3LXRA 1V8DA 3GPBA 2HCFA 3TRKA 4DHEA 3G9XA 4RVFA 5CAEB 3AHEA 3IUJA 4JLJA 5TQJA 2NTYC 4BDSA 2OEPA 3C7KA 3PDWA 2ZITA 3USCS 5A4JA 3EPPA 2FW6A 1JFSA 2HC9A 2C1ZA 3A1SA 3PNPA 1JDTA 2QSZA 4V0SA 2ECQA 2RGYA 1SVWA 3LG2A 2GM4A 4HMQA 1ZQ1A 1BQ3A 1UBFA 3RRZA 5ICEA 5B58C 4JLVA 5A1TA 3SC3A 1RTTA 3PDUA 3RODA 4CLHA 4D9IA 2CJWB 1ZISA 2I6UA 4RFSB 4Y9TA 2IYTA 2YYAA 4PZPA 3SI7A 2AGVA 3CX8A 5FL3A 4E13A 1DP4A 3IUEA 1L5FA 3S3TA 4DKXA 1GXSB 4I4TB 2NLOA 2WWRA 5D6OA 1GZ7A 3V8EA 1P4RA 1S7GA 3JPYA 3W9YA 1GKIA 2XD9A 3LECA 4FOPA 4L27A 3E4DA 3CNLA 4Q9NA 3HR7A 2OB2A 5JDIC 1JS1X 1WD5A 1HZZC 1KERA 3IDAA 4PE5B 2CNLA 3QLJA 5LQKA 3PHCA 3O92A 3QX8A 4JI1B 4AMBA 5LR6A 1CUYA 4R1PA 4B0PA 4KO4S 4KC0A 2PS9A 2BHSA 1YZUA 2EX0A 3RROA 5KO2A 4BB0A 3H1PA 2I2AA 4EYGA 2C9OA 2EBHX 1QHNA 1VJTA 4YPOA 3RYCB 1DB3A 2A5FA 3HFRA 5K4AA 3JD3A 1YB4A 2P9QA 3AV3A 4EFNA 2OO3A 3AL2A 5KNBA 3P0EA 3AL3A 3KQPA 4NU6A 5HPYB 1U7OA 1EKXA 4Q7LA 3AMVA 1PD0A 2JGLA 3JTEA 3KJGA 3A04A 1L4KA 2AZMA 2R6DA 3K9QO 3KYCA 4FDLA 4RIIA 5FXMA 4IV0A 2O5CA 1JT2A 2NV2B 3G5AA 3TB4A 1RI1A 4HDOB 4B3HA 3ZY2A 1E94E 3HDHA 3L0PA 3ZDCA 4YQZA 1H9CA 1WO8A 4W9MC 4YK7A 5KKNB 3NAMA 3VSDA 4L2IA 3HYSA 4RM3A 1OC4A 4M0PA 3PP8A 1V1RA 3D6TB 1HDXA 1KARA 2ZBEA 1I10A 4LF9B 3M9XA 3MCVA 3DUFA 2Q5HA 1GTZA 4JDPA 4L0DA 2N1MA 5ALKA 3OKAA 2P1RA 1FX0A 3P45A 1V43A 1CUUA 3ENNA 5KCZA 3GF4A 3DAHA 2P1ZA 2QN8A 1E2KA 4A2CA 1GGNA 1M83A 1G5IA 3UAYA 3B6KA 3VNQA 3UH0A 5NLLA 4DV4B 3FAZA 3C16C 4M9ZA 3UJHA 2BGKA 1VCHA 5IJAA 4D8UA 2A30A 4FHDA 2ODEA 2JBWA 1YZGA 5J9FA 4YJ2B 4YY3B 2QVYX 1N0UA 4R4JA 3R3WA 2JCVA 2EKZA 2PT5A 2PA3A 1SBTA 1TQ6A 3H5RA 3NHKA 3MJ4A 4NRDA 4PX5A 2NTNA 2V5UA 1EX6A 4YPFA 5EC8A 5CW1A 4YMLA 4BGEA 2J4CA 2PKXA 3FNHA 3OMWA 3JYLA 1T29A 4M83A 3PXGA 3CLHA 4DR5B 4BNGA 1E18A 1YHNA 1C0PA 3DF7A 2H4FA 3KEOA 4UVEA 5EIAA 3RTEA 4ALMA 3ZI0A 1PZNA 2LDXA 2FSUA 2AFIB 4M87A 3FGPA 3WYGA 4FSHA 2C84A 3IAHA 4NYJQ 4ANFA 4Z0HO 4K2HA 1W8IA 1ZA2A 3T5TA 4GE0A 1Z25A 4FHFA 4JEUA 2AN5A 1IG0A 2NU7A 2A3RA 2KJQA 2QAGA 4FR0A 3DYVA 1US8B 4Z3OA 1KJNA 5KQRA 4NK4A 1IHXA 5FBVB 1U8AA 2ZRCA 1A4UA 5CIWA 4CN8A 2WNSA 1XMPA 1ADCA 1BU8A 1RJDA 4GEKA 2A5JA 4YN3A 5ADHA 3KQVA 4WH0A 1U7PA 2IGTA 2HMTA 1WVIA 4HQOA 1U7UA 4ZHQB 5CFZA 2HRCA 1ZD9A 2AXEA 3FUWA 2G06A 4NPAA 4BJHB 2X9QA 3IKLA 4OK3A 2HIAA 5TF4A 5IAKA 1QDLB 4BNZA 5A4FS 1DUSA 2H1VA 2R8OA 2ZJ8A 2VQ3A 4AP6A 3AVXA 3IS3A 1MNAA 2BGWA 2EQAA 1WA5A 2K6GA 1QHGA 5CBPB 1RABA 1TADA 1I13A 1XZCA 4ITUA 4DTCA 5IJZA 1Z5OA 1X3LA 3ESYA 3O1LA 2Q5IA 1YIOA 2C5GA 3K5PA 5DXJA 3HBLA 3O7WA 3ZE9A 2W2OA 4TRRA 2HXGA 3MWDA 1P0CA 2J0EA 2IXBA 2ZRPA 2O8FA 2AMYA 4PLCA 1E9EA 5B3AA 2MT9A 1JDJA 4MRMA 2ZK7A 1SBHA 4U39A 4R81A 5KYNA 3C1UA 1PQUA 5HKAA 4KQWA 3CVJA 5JH7B 5FTMA 4F93B 2O8BB 4G6ZA 2P7IA 2XTJA 3QX9A 1AQIA 1A95A 3GLHB 4YWJA 1Z2CA 4HHEA 1YVDA 3MPUA 2GNAA 3WNCA 3WG9A 1SVUA 3RRXA 3GFPA 1K5PA 3NBAA 4KK3A 3TEFA 1OB5A 4UCXA 4GDFA 3H87A 5A04A 1RHRA 2I65A 2GKGA 1E63A 3I04A 1EVIA 4HXFB 4ZOLF 4KMRA 3ND8A 4GSYA 3V3TA 2V9PA 2O3TA 1N2ZA 5ED0A 1G1AA 2QTRA 4NE7A 5FLEX 4DBLC 3OWXA 3VC7A 1FUUA 2P5SA 4FD2A 4KN6A 5GVRA 4QODA 3K1JA 4KIJA 2PZKA 1Z88A 3E18A 5EE3A 1M8GA 3BMCB 2CD9A 3BN3A 3LJKA 3COSA 1KDPA 5JAPA 1ZM3A 4CKBB 2HA7A 4URXR 2QX9A 4LIPD 1L5LA 3L7OA 4ZHSA 2FF5A 4B84A 3H3JA 4QHTA 3FF4A 5KNCH 2XLBA 4HGPA 3QVLA 3WBKA 5BV0A 2J5BA 4KSYA 5EKSA 3TW8B 2PZLA 3VC1A 1GGEA 3IJPA 3R40A 2OT3B 2ZUSA 3OTGA 4HH4A 4KAFA 4XQEA 5ALFA 4IXTA 121PA 3BIWA 5DTQA 3GJRA 3BUSA 4XIYA 2FTKE 5ENZA 4DRXA 2I1VB 3RVDA 1S3GA 1TOAA 5KEIA 1BXZA 3OO0A 3UT6A 3WWDA 1OKKA 3B1FA 3WO1A 1DTWA 4FCWA 5LN1A 3HQ4O 4WI1A 3MC1A 3QA3E 4F11A 2A5GA 2QZ9A 2WD7B 4J76A 4L9WA 3I6QA 3OEWA 1UWCA 1M3SA 2ZVJA 3UVEA 3FJ1A 4HNTA 2JATA 4G41A 2BMVA 2E18A 3AYXB 1GQFA 1UBTS 1Y4DE 4NF2A 4QICA 3S1AA 2INGX 2JGRA 2PX4A 3SS8A 4TOIA 1X38A 4DAOA 2BBSA 1P0MA 4H4CA 4MUKA 5BR7A 3UXYA 4MGKR 5E4TA 5BN5A 1M6WA 3O91A 2E89A 4ENUA 4EMTA 1RFGE 2YUTA 3GEDA 2OP1A 3T99A 5JJ5A 3IP1A 2VDVE 3PLNA 3RGGA 3IMFA 4PO1A 4WOCA 3P0FA 3NHUA 4U6NA 5JNRA 1GUBA 1IM5A 3JASA 1ML3A 4WCDA 1F4VA 3TJRA 2HY7A 2W71A 1CU1A 3L7MA 4HADA 3O8DA 5A62A 1QU3A 2OFXA 4KLNA 4PR3A 3R5KA 4M1KA 1VBFA 4EPYA 1HT0A 4MMZB 3M8KA 2Z57A 4YO7A 2H5EA 1K5GA 1PAUA 4FEAA 5LP6A 1MIOB 2DJ5A 4MYRA 2P3OA 4HS4A 4HYYA 4P7BA 1ZCZA 5DYWA 2JH3A 4E2FA 3MT7A 2HL6A 3P2OA 3OETA 2W2KB 1HX7A 1VHQA 1BE1A 3I28A 1JHOA 1GZSA 5FOXA 5G1NA 4EMSA 2Z4RA 1WG8A 5J2TF 2YHBA 4EX6A 3FD8A 5E4JA 1YKSA 2I8CA 4JP8A 4KB5A 4A8JA 1RXCA 3VYSB 3KM0A 1X87A 5ICCA 3Q10A 3JXEA 2W6QA 4MO9A 3KV1A 5E9WA 2IIQA 3SZ3A 4A0GA 4LA4A 1YF3A 5SY6A 4DANA 2O5VA 2PNFA 2RGGA 4PX2A 4MYSA 5C3UA 5JWRA 5J2UF 1NI5A 1H69A 3MB8A 4LF7B 2YZ7A 4Z54A 2A4MA 2CWWA 3AUTA 5D8DA 2XCOA 5FA6A 1VL8A 3HKEB 2P67A 2I3BA 1N7HA 3P7MA 3IPLA 4F5WA 1GUYA 2ZYDA 4G5GA 4LW8A 4PZUA 4XYEA 2JH9A 4HDAA 4N8DA 3MD0A 1R0ZA 1OBCA 4X1OA 3P9ZA 3RFCA 5DFAA 2W6PA 2Q49A 4A1FA 1XNGA 1NA5A 3RTAA 3I62A 5JYDA 3K0BA 5ALVA 1NKTA 3HDTA 3RQSA 3KUXA 2G7ZA 2HO5A 3QTBA 4NCBA 5HYVA 3QYJA 5AHWA 1H1DA 3PGJA 2G4LA 1EWYA 2WF6A 3SJCA 5FWNA 1CUSA 1G9TA 3GUZA 4O59O 1KOJA 3V2HA 5EGNA 5H83A 4HSGA 2PHZA 4J03A 3V46A 1K9SA 1JG1A 2O05A 2P6NA 1CB0A 1L9KA 2HNAA 3LA8A 4FZ3A 1FDOA 4GRIA 4LQDA 4RKYA 2C29D 3BPSA 1F06A 1PUXA 4JLOA 4B33A 1F0NA 1Z7BA 3DMRA 4U8GA 4D92A 3W2HA 4BC1A 2VWGA 2FMFA 4QQKA 5IJ9B 4REQA 3U4AA 5J43A 1ZONA 2FP4A 4EABA 1UC5B 3C4QA 1I6KA 1GJRA 5HDBB 2OKCA 5JJCA 4UU8A 1V5FA 4NV1A 5FTLA 3ZHZA 2AG1A 4DB2A 3K4HA 4KZKA 4KZPA 5EWLB 2R9VA 4CRWB 5JRZA 4CJXA 5BWNA 4HLNA 2XCIA 3DKRA 3N7TA 4YRCA 4DLSA 5CB4B 4J2TA 3U3JA 4MZXA 5HBGA 1NR1A 3H0CA 1YB7A 3IOMA 4U7GA 3IIIA 3SXPA 1U1GA 5A3RA 4GL2A 3KU4A 2MINA 3WYAA 1TO2E 3ZQUA 4G36A 2RGBA 3OZCA 2E82A 4CQMD 1FFDA 1G1MA 4XGRA 1L5RA 4NMLA 3IL2A 5EWMB 1CB7A 1ECPA 3SZMA 1LA2A 1DLIA 3D5TA 4C0WA 1MBZA 2DFTA 1K8XB 1I01A 1S8NA 2AQIA 1OBHA 3ES9A 3LBAA 4GPTA 1JEQB 4W6QA 3RIHA 2XHEA 1RHKA 2QEQA 4HUQB 4FYPA 4MAAA 3W5SA 3WQRA 4EFDA 2CFRA 1L5SA 3CNHA 4G4JA 4CTMA 1AHIA 4CMCA 2ISQA 1FQJA 4I9HA 4JQYA 1WCWA 1XKLA 3G23A 3NTXA 3PPIA 2PKQP 1R6BX 2H2IA 2RK6A 2VNIA 1I2MA 1GGJA 2O0MA 2P6UA 3EXHB 4YH1A 1X7YB 3DM9B 4RGVA 4WECA 5JCOA 3OIFA 1XPRA 3KXLA 3WWCA 2ZIXB 1ORHA 2FSFA 4B9AA 1XALA 4X85A 2EZUA 2VQDA 2BUAA 3I2JA 4Z9AA 4BV9A 1XQ9A 3DTVD 4EX7A 5AVSA 1DQZA 4ESVA 3TFOA 4KQ2A 1EIWA 1OA1A 3VAZA 1A9TA 5EQFA 1C30A 1ANKA 3ZNOA 1T3ZA 2QU7A 4QC2A 2YINC 2I2WA 2HA5A 2YXDA 3KT0A 1P6UA 3HU2A 2HADA 3UG7A 3WQQA 1N8SA 2EFJA 4HNHA 4OI1A 4D74A 3EC7A 4EKGA 1Z6YA 1VJRA 1LC3A 1DUIA 1JZQA 1YB6A 1Z56C 3MUNA 4I9FA 4O29A 5GONB 1KVQA 4MV1A 3WFIA 5JW6A 5A05A 4P4UA 1NQTA 5A4KA 3NIGB 4RD1A 1TTPB 3OZEA 1XZQA 4UUMA 2YS7A 4Q21A 3KQOA 3H83A 2Y67A 5GIOE 4EPTA 4TPKA 4J0JA 1E0KA 1V96A 1IZZA 2GK7A 4YAGA 2IOFA 2JI7A 5KTOA 1AQLA 1K88A 3OTIA 4Z4IA 3NETA 1EFVB 2Z08A 5EN4A 4G1BA 1NMEA 1Y82A 4D6YA 3F49S 2JHFA 3M2TA 3HEMA 3ME5A 4O4JF 2HJGA 3S2EA 4CEIB 4U8HA 1KQPA 3QUSA 1Q84A 1V0JA 1X1RA 5H02A 1KE2A 3I6ZA 4CMHA 4X94A 3KUCA 4BZQA 1EFPB 1CXZA 3BS4A 2FFHA 2HA0A 2WICA 3A1WA 2Q50A 3PFGA 1L4HA 2ZJ0A 5C37A 1X1EA 3DPUA 2C7QA 2HHLA 4LY9A 4X7BA 4NATA 1BWPA 1OFGA 2RMKA 2Q7OE 1R3DA 3BXHA 3K35A 3NCHA 5JEEA 1GVNB 2I6GA 4MJ3A 3ZD6A 5GY7A 4TTSA 721PA 2R7NA 5K3OA 1ABEA 4V3CA 1I1QB 1IWPB 3ASYA 3W8RA 4BEWA 1UZMA 3G0CA 4KK4A 5C7IO 4TKVB 3UJ8A 1HY3A 1CLUA 3G8DA 1I6MA 4FCCA 3B9PA 4BO4A 1T4DA 1B6SA 3OZTA 1U3CA 2QRLA 4RTKA 3FMGA 3DFZA 3EVEA 4W7HA 2R11A 3PEWA 4K8RB 3EIEA 2FSSA 1A82A 3HCWA 3TW6A 1Y48E 1AGYA 5IKOA 4RNCA 4IX1A 5EIXA 2MR6A 3L0YA 4UNQA 4TS4A 3OJ0A 2PMBA 3WADA 1SQ5A 3PEEA 2EBUA 3FVVA 3TDKA 5LFAA 4DILA 1WXIA 4B44A 1VKOA 3GCWA 1QANA 3D8SA 1ONSA 2WG1A 1N5RA 1PWYE 4ZI5A 4FFWA 4CQLB 4IICA 5JXGA 2CBGA 1BXRA 1L3IA 4N0QA 4RVNA 2REQB 4R9NA 2XRZA 2BEJA 2P0AA 4X45A 1NF9A 2Q4BA 1RE1A 3BX1A 3O75A 3HRHA 4AT1A 2GF2A 2MSWA 1BSVA 1KPHA 3DE0X 4DQDA 3D0QA 1ECJA 5C52B 3ORHA 3BK2A 1FL9A 3CUSA 3IVCA 2JLWA 4DKJA 1MABB 1OH5A 4M1MA 4YRPA 3C98A 3ZDYB 4PCLA 1J2JA 2XBUA 3TUJC 3PC8A 2E5WA 3KB2A 3Q8KA 3KOMA 5C18A 3WWPA 3ZLVA 2C1EA 5DYTA 1C5KA 1LPOA 2BR5A 2SICE 1GQ2A 2X5OA 3GHYA 3GVXA 3H05A 3UZUA 4FMPA 1FTQA 2B5OA 1E6KA 3JYPA 3CF4A 4J0QA 1W4LA 1XD2A 5ILQA 5A4MS 3CT6A 3BTUA 6LDHA 2N46A 2A0YA 3C3XA 4YRMA 3VO1A 1TMKA 1KK0A 3NWJA 3GLSA 2WWVD 1MW8X 3QI2A 2DFDA 3HBFA 4JYBA 1QORA 2D1QA 2JGDA 2RC6A 3ASUA 4LOHA 4IIEA 4F71A 2CKDA 3T0GA 1D1TA 1TQ2A 1P2BA 4RFSA 1T35A 4HFJA 5SY4A 3N53A 2VH5R 3I39X 4BNJA 5H3LA 1GXSA 2GARA 2I78A 4OGLA 2HH9A 4D8VA 5HHTA 2NPIA 1LLQA 1SCKA 4WK4B 4KYVA 5JD5A 5EQTA 3P4XA 2H7VA 4B6RA 2EKBA 3KPVA 4M7WA 1DFIA 2CHVA 2OGUA 1T1IA 4MQ6A 1SCUB 4ZI7F 3U40A 2WIKA 3SHTA 1W4AA 4LXXA 4AUNA 2ZDQA 3ZWBA 3HCBA 1VYTA 5LWQA 1XHFA 1SURA 1M5RA 3CPJB 4URZR 5BY2A 4AN1A 1MAVA 1K4MA 3NJ4A 4ERXA 2C42A