4UCWA

Structure of the t18v small subunit mutant of d. fructosovorans nife- hydrogenase
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
263
structure length
263
Chain Sequence
TAKHRPSVVWLHNAECVGCTEAAIRTIKPYIDALILDTISLDYQETIMAAAGEAAEAALHQALEGKDGYYLVVEGGLPTIDGGQWGMVAGHPMIETTKKAAAKAKGIICIGTCSAYGGVQKAKPNPSQAKGVSEALGVKTINIPGCPPNPINFVGAVVHVLTKGIPDLDENGRPKLFYGELVHDNCPRLPHFEASEFAPSFDSEEAKKGFCLYELGCKGPVTYNNCPKVLFNQVNWPVQAGHPCLGCSEPDFWDTMTPFYEQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Threonine Stabilizes the Nic and Nir Catalytic Intermediates of [Nife]-Hydrogenase.
pubmed doi rcsb
source organism Desulfovibrio fructosivorans
molecule tags Oxidoreductase
molecule keywords HYDROGENASE (NIFE) SMALL SUBUNIT HYDA
total genus 78
structure length 263
sequence length 263
chains with identical sequence B, C
ec nomenclature ec 1.12.2.1: Cytochrome-c3 hydrogenase.
pdb deposition date 2014-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01058 Oxidored_q6 NADH ubiquinone oxidoreductase, 20 Kd subunit
A PF14720 NiFe_hyd_SSU_C NiFe/NiFeSe hydrogenase small subunit C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NADH:ubiquinone oxidoreductase-like, 20kDa subunit 4ucwA01
4.10.480.10 Few Secondary Structures Irregular Cytochrome-c3 Hydrogenase; Chain A, domain 2 Cytochrome-c3 hydrogenase, C-terminal domain 4ucwA02
4KN9S 4UE2A 1WULS 3MYRA 4UCQA 5JT1A 3USCS 4U9IS 1FRVA 4UPVA 5JRDS 4IUCS 5JSYA 4IUBS 4UCWA 2WPNA 2FRVA 1E3DA 3ZE9A 5JSKA 4KO1S 4KO3S 1WUKS 1UBMS 4UPEA 4UE6A 4UE3S 1UBUS 4URHA 1YQWA 5JSUA 4IUDS 4UCXA 1WUHS 1H2AS 1UBLS 3RGWS 1UBOS 3ZE7A 5A4FS 1UBJS 4UQLA 4KO4S 4GD3Q 1YQ9A 4UD6A 5D51S 5A4MS 4CI0B 1UBKS 1WUJS 3ZE6A 3AYXB 4TTTS 4UQPA 4KL8S 3USES 3UQYS 3H3XA 3ZE8A 5JSHA 1UBTS 4UEWA 4UEQA 5ADUS 1YRQA 3CURA 3AYZB 4OMFG 3ZEAA 4U9HS 3CUSA 1UBRS 1WUIS 1CC1S 1H2RS 4KO2S 4UD2A 4C3OB 5A4IS 1UBHS 1FRFS
chains in the Genus database with same CATH superfamily
1W581 1M67A 1CB0A 1QBKC 1I5RA 2O52A 3E3OA 2IUUA 4H9GA 3GFFA 4ZV4A 4FNMA 4MH0R 4B3RB 3OIVA 1LSJA 3PXDA 2A3RA 3PGKA 3QFSA 4J91A 4OGWA 2AFRA 4BFUA 4HOYA 1NFRA 4ZCLA 3RFCA 5I7EA 2IPMA 4H7FA 2JGRA 3E9RA 2NSHA 1H4TA 4FU0A 4UREA 3RSQA 1XU9A 4MP8A 3X1ZA 3OKAA 4PFJA 4HGOA 4C4ZA 2ZI7A 3GU3A 5JCOA 3E7FA 3RD5A 2GRJA 2KE5A 2JLYA 1I7LA 2PZMA 3MLBA 3OKFA 4KK3A 1J8VA 1D9ZA 1LLCA 3TTUA 5KNDD 1U3DA 4E5NA 4KI7A 1A77A 2I4NA 1P2SA 4Y1RB 5LOVB 2OAEA 3PYMA 3SYNA 1GSAA 1JHYA 2WPDD 3DE4X 5BURA 2CNOA 2FN4A 4DIMA 3S70A 5INTA 3DBRB 1MZVA 2YWXA 4ZMSA 3Q8KA 2YV5A 1L5SA 1OI2A 2W6NA 1EJ0A 3PGXA 3QXGA 4IHJF 1AA6A 2ETVA 3GPBA 3L18A 1FLVA 4YO7A 4AF6A 1PN3A 2BFEB 4UPEA 3F73A 1GJRA 4EHNA 1ADGA 3SIXA 3ZWKA 1RAFA 1JKJB 4YH1A 4IMPA 3JAMA 1H5QA 2GN2A 4HS9A 2OLJA 3FG9A 4YEDA 5E2BA 3R7NA 4CVNA 5KOYA 3ESBA 2GF0A 2HMYB 2R25B 1A2BA 1FNDA 2YMMA 3I6ZA 3L8GA 5C46F 1EIWA 4S1NA 2QUZA 3G89A 3F96A 1P4AA 1HA3A 3O26A 4G1VA 5EGNA 3KPJA 4Y67A 4DDUA 5JARA 2UKDA 2XMZA 1STOA 3QKIA 1XOIA 4JN6B 4Y0NA 3EA5A 4YAJA 3QKWA 1N5OX 4C6TA 5IKXA 4BATA 5E1BA 2ZCJA 2GJ4A 2Z2ZA 1OWMA 1EJ6A 3FVVA 2HFJA 4Q1EA 1M2FA 1Z06A 3HHPA 2Q5QA 2VXBA 1GSIA 3IL2A 2ZOSA 2YWCA 1NAHA 3VR1A 3O4GA 1O8CA 1PWZA 3KYCB 2XQKA 3KQQA 4JI8B 2VF8A 4IO1A 3UQZA 5A1JA 2J1LA 4JL5A 5LU8A 3UMSA 5GV8A 4BPRA 3C4QA 2XMPA 2HMUA 3R3ZA 3AXSA 4D4GA 1R0ZA 4DOMA 3OSZA 3DOCA 1JU4A 4TT3D 3NI2A 3UWOA 2A8YA 3IV6A 4RIEA 1HZZC 2ZYWX 1GZ4A 1G21B 4WOBA 1H4QA 1N1MA 2ZLBA 1Y3DE 1B93A 1IUPA 2FEPA 5H3HA 1CFZA 1DAOA 1ST2A 3RC7A 3WIBA 4D96A 3D3JA 2OP1A 1ZI8A 2OQIA 4QVGA 4DM3A 1E9SA 2IOHA 1RAGA 2QROA 1CF4A 2NO7A 3W9YA 1KP3A 2RG7A 3GUYA 5KJEA 2R85A 3O3MB 3KZMA 4FJ2A 3ZIUA 3UCXA 2HMVA 1WXHA 4IIHA 1THMA 3N5KA 3UGJA 1U0JA 3HDGA 2MYUA 1PGPA 4MIYA 3C87A 1WVMA 2ZTLA 1VJ0A 2FG6C 2R9VA 2ZCVA 3BWDD 2OHJA 4EG4A 5BUCA 3KVVA 1O3YA 4J0EA 5CB4A 4CG2A 3DNFA 1MNAA 1FMTA 4ZVUA 4UATA 1GV1A 3A10A 1U0RA 4EVRA 2W2KA 3KZVA 3JR3A 1SXJE 3MINB 5ILQA 3STHA 2OCIA 3QXHA 1ZVQA 1UJ4A 2UZAA 3QPBA 4TLEA 3DYVA 1NW4A 2NAPA 3P20A 3DLHA 2ALJA 1BHSA 4EUFA 5AHRA 4I1RA 3KLBA 3T3EA 3ILVA 2C8VA 2L17A 2W2OA 5CLLA 5LA6A 4CCAA 1RRGA 4YJ3F 1G20E 4KLZA 1RWBA 2FJ0A 4NMXB 1YQ9A 3TB6A 4JUBA 5B3KA 1Y6QA 5CIWA 5GTDA 2P11A 3HHEA 4LHYA 2O8DB 2QTZA 2Q2NA 4XEHA 4F5YA 3M6AA 4AICA 4PNEA 1SKMA 3DMDA 4RF2A 1OLSB 1PJQA 3GNQA 5FPKA 2EFYA 3R0XA 3NAZA 5FT9A 3G59A 1JPVA 3KQMA 3ZK7A 3W7BA 1PHRA 2FWRA 3KJFA 1C4XA 4D41A 3PXXA 2OYSA 3UATA 4MKZA 4YHBA 4RJLA 3E0XA 3QQPA 1FTWA 1I3NA 3R3YA 3KTOA 4DM7A 2C2BA 2ERYA 3N2KA 3PLNA 2BKEA 1O9BA 4YTEA 4F4JA 1RRVA 3ZCPA 3UB3A 4MB2A 3A05A 3MPUA 4AUKA 1E6MA 3CKYA 3H2KA 4PNHA 1KYYA 2YYZA 5REQB 1ODLA 3DOFA 4G25A 4PRLA 1PWEA 5C1PA 4QGHA 1YJXA 1NLMA 4UUQA 1VOTA 3CS3A 4LV5B 1J0AA 2DBRA 3I8OA 1FFHA 2G1UA 1RPJA 3GP5A 3TL3A 1T4GA 2ZYVX 3WL3A 5FEUA 2VQEB 4FGLA 4OHFA 1BQEA 2NNWB 5BSGA 4BLQA 2JW5A 4CMIB 2ZB7A 1C41A 3AOGA 3QPAA 3JD3A 3TLAA 1Z8HA 3FWHA 3ZJUA 1W85A 3NRBA 3FRJA 1Y1LA 4Q3LA 3DV9A 3GBSA 3HLTA 2G09A 1V45E 4ZQHA 1XD2B 2ZAGA 3K16A 3ZHVA 4HQ0A 4BV2A 1WEHA 3N0RA 3LUHA 1GPNA 1XBTA 4IDDA 4MS4B 2QVCA 2JAQA 2ZFUA 2YCBA 5HWSA 1X9HA 2WMNB 3QV2A 3UB4A 2H2HA 1QGAA 4RFSA 4D4KA 3A2KA 3MYYA 1AOXA 4LJSA 4N6NA 3AUFA 1QK5A 3AKCA 2WI8A 2H5JA 1A69A 4H60A 4IDAA 4M87A 1CS0B 4QBIA 1SHLA 4U6SA 4DQDA 4EO4A 1FYDA 2BHNA 3QM1A 4U39A 2ZIXA 4X63A 3M6IA 1Z83A 4TT3A 5A7HA 1E61A 1Q3KA 1W4BA 4PLVA 3TPCA 3TVYA 3L79A 4IFIA 1NVKA 2WD9A 4MR8A 4QYWA 3VU8A 5LZ2A 2X2PA 3AY6A 1NVMB 1AKNA 5IKOA 1X7XA 1JHAA 3MQ2A 5KNBA 4AKIA 2FUG6 3WYCA 2NUAB 1RC8A 2CUNA 4O08A 5DPMA 4ER0A 1LTKA 2DUWA 1I2ZA 2WZCA 3DVAA 5J63A 2EKBA 3OWXA 4KR2A 3KAJA 1PYOA 5J59A 3CT6A 2Y05A 1KK3A 3HADA 3MFYA 1V11A 4D45A 2ORIA 4OK3A 3U7IA 3RVNA 2HCRA 3O2SB 4TM7A 5LR6A 1DWQA 4IYJA 1UUFA 3U5TA 3OE4A 4J1QA 4L8YA 1JKJA 5TNXA 1G3UA 4K9KA 1PT6A 1ZGJA 4XW2A 2OXIA 1L7QA 2IU3A 1T1EA 2CXXA 1BX3A 4FCWA 1W0JD 5K4AA 3TN7A 3V7FA 3DL2A 3X1MA 4OHZA 5AESA 1Z6GA 3MS2A 2GXQA 1R3DA 1G4UR 2GBIA 2NQTA 4J0QA 1GILA 1Y7HA 3WKAA 821PA 2BR5A 2BFOA 1IYZA 3B3JA 1SVUA 5M34A 1JEYB 2BEKA 1L5MA 2IL1A 2ACVA 2XTAA 3MOIA 2GVZC 2W9XA 3GRKA 4Q93A 5HDQA 3SLKA 3L6OO 2I3GA 4DANA 4YV0A 3PD1A 1NONA 1QZTA 2JJ1D 5CG1A 2EV9A 2OG2A 4G24A 4RBNA 2IZOA 3HU3A 4DR1B 3QVGB 1BMQA 2ZRJA 4HMOA 3IT0A 4NAUA 3RQSA 4QQKA 1IPHA 1WHSB 3KL4A 4IBOA 4JT9A 2BF7A 4NIMA 1J2RA 3FCCA 4C3ZA 2ZSFA 3DHNA 3H16A 4PZAA 1IQ0A 1U99A 3PGA1 1NSTA 1WMSA 1IHPA 4IIEA 4MICA 1D04A 2F3TA 2QU7A 1MJGA 3GA5A 2C42A 2ORWA 3EGIA 3O94A 5G2OA 4BNGA 2O5EA 1JG6A 3NHBA 4DNFA 1JQDA 4GKBA 2Z2XA 1YR7A 4UTPA 3WLOA 4D97A 4H3KB 4RYLA 1QTIA 4TT8A 3AP1A 4OD0A 4NOLA 1VSVA 1LQUA 4LNHA 2RJNA 1TO2E 2NGRA 3Q0EA 5J5CA 1PUJA 1CT9A 4BRUA 4W5JA 4LF5B 4ZI7B 2Q3MA 2HBYA 1II8A 1YKSA 3JWGA 3NX4A 4ALNA 3CRW1 2Q3HA 1Q7RA 5L3QA 5I6DA 3FKQA 5H0IA 3EH2A 3I53A 5DYTA 2YICA 3DQPA 5K0EA 4DLLA 2OQVA 4LX8A 2WM2A 6LDHA 2JKZA 3JZDA 1CVIA 1ELOA 5CPBA 5ALQA 1K5DA 3QEKA 4DWOA 3U9LA 1GG9A 4CETA 2ZXFA 3UYLA 1ZK4A 9MHTA 2PKQP 2OBMA 1CLEA 1XN4A 3KOWA 3RHTA 2VHVA 2CUZA 3HP4A 1IOVA 1EUCB 4U2FA 1TECE 3WBKA 3C70A 3P5SA 1ZS9A 3HE3A 1SQ5A 1KPHA 3ZKWA 4B4VA 4LJ5A 5DHRA 4FDTA 3WZ2A 1GUYA 5HMLA 4QUHA 2YZ2A 1KQNA 3ZXIA 4D9JA 3HXOA 1UPXA 4XD7D 5AOCA 3MWLA 2VZLA 5CFQA 4JMLA 4OHKA 1NULA 3OZSA 1U2RA 3AZQA 3RWBA 3TCXB 3NP7A 4ZMBA 1PD0A 1GEEA 2Q21A 4IV5A 2B5OA 2K7FA 3NHPA 1WXEA 4UOEA 4JIGA 1C8LA 4UTVA 5HQ3A 1CJTC 5EUCA 4RTJA 1T3TA 4I2NA 3IPXA 4YMVA 1YR2A 3QSGA 4YIHA 3IBFA 4CKEA 1T25A 3LT1A 1TU3A 2QWXA 3OZXA 5KYVA 5FOUA 5AYVA 2DXIA 2ZW9A 3EWNA 4RPGA 4B3XA 3MHTA 4YRDA 1QIDA 5JH7B 2ZVQX 2I2AA 5A6SA 2PZEA 4M38A 1JSCA 1V8OA 4UVHA 3ZWDA 2ACKA 1EFPB 2WJZB 4ND8A 5LZ7A 3KHSA 4C3UA 4L4XA 2FMHA 2Z04A 3J7TA 1P61B 4LNUB 1NLZA 3I9FA 1ZM4A 4TMKA 3ENNA 3WV4A 3WMEA 2ECOA 3MWFA 4HG2A 2DPLA 4MRVA 5I9SA 1C8KA 1DWUA 2Y2VA 2QTCA 4LV6A 4JLWA 3UJ6A 1BVYF 3IVRA 4PSKA 1KBZA 4DKXA 1QQBA 2FPRA 5ENVA 5F3RA 3R77A 2PS1A 2XXBA 3EXHA 4O5OA 5I9NA 4C3OB 2XMGA 4ALIA 1I3CA 3NGXA 4MR7B 4CDRA 1RYZA 3DS8A 2DHCA 4XYBA 3R23A 3DFKA 5IWAB 2C3PA 2I7TA 5P8WA 3AJ8A 1T43A 2I3BA 2ZSHA 3OLYA 4DIUA 4FW9A 2C9YA 4BNLA 3HCRA 1D6MA 1OFTA 3QZUA 5CA0A 4NG5A 4TYQA 1TUIA 1UDCA 4G5XA 3JZFA 4HWGA 3GJ7A 4Q3OA 3WFZA 2OWDA 1E4OA 2RBKA 1ZIXA 5CT6A 4AUNA 1DO0A 3TF5A 2I80A 2IH2A 1QHFA 1SC1A 3L1HA 2C5SA 2J33A 5FKJA 4I4TB 1PJSA 3OQ1A 1AXGA 4HPJB 2BWJA 4TTTS 5JNLA 3IOBA 1ISJA 3E9DA 2VZ8A 1E1QA 4FBMA 2HTFA 3UWDA 4WCFA 4OMFG 2Q8PA 2MR6A 4TUYB 1L7VC 1F20A 1TAHA 2K5UA 4FMPA 3UG7A 1XVLA 1KGSA 2EJUA 2G6BA 2ZREA 3VV3A 4A0HA 4BXOA 3QPDA 4YQZA 2WP8J 1ZM3A 1OH8A 3ELYA 1KPGA 1N9KA 2FZKA 2AEEA 1N8NA 1YACA 3CZQA 3TR6A 2IDJA 2FQWA 1CEQA 3NHFA 3ZDQA 3I34X 4W5OA 4BKMA 3NRCA 2BGUA 4N5DA 5BXYA 3RYIB 1S2IA 2I3DA 1M1NA 3M70A 1UKVY 4S05A 1E4VA 1ISGA 1JMYA 4M9RA 1AKRA 1DKRA 2FY8A 4GL4A 4DY6A 2EVWX 1PLJA 4QXAA 1RPNA 4WJLA 1HM5A 3AWDA 2HJRA 2CJFA 2I6FA 3A1EA 4N5LA 4PFKA 4AUMA 2AFVA 3DVQX 4QXQA 4B0OA 2B8TA 2HQ1A 2AIRA 2JATA 2Y4NA 2FTKE 5CA0B 1P7YA 3HCFA 3RUHA 3MB8A 1R5NA 1OXTA 5H16A 1KJZA 3U4AA 5AJHA 3WGIA 4UMDA 4BJ6A 2P62A 5DI3B 3DOOA 2HR1A 3PUKA 3RKSA 3OT5A 1M7GA 1L7BA 5BV2P 3PJGA 4Q7EA 5E6RB 3AEUA 3AHGA 3ONVA 5EKDA 4FHDA 4Z4QA 1SKQA 3NHLA 1VMDA 4B74A 5BV0A 3ZWMA 2MSDB 3NHJA 2GBPA 4ZO8A 4AP6A 4OFBA 2F1RA 2VI5A 2GCNA 2C7PA 1EP2B 4Q21A 3K9HA 2WQ6A 2WFAA 5KBYA 4S1WA 2G9UA 1G2QA 1AKEA 3O3OB 2WWHA 5D3KA 2ID8A 1VBNA 4PF1A 4K2HA 4R9NA 4B81A 4PFQA 4BKPA 1WLYA 3GXOA 5KX5B 4TTJA 3LPDA 3QFRA 4MWTA 3IHTA 4DR4B 5K3AA 2ZZNA 4IM7A 2WYUA 5EXDA 4Z7JA 1M2VB 3JATB 1K6IA 1MUUA 2FN8A 3UBMA 1LDNA 3OQHA 3PXEA 1L8AA 4NENA 4BJ1A 4O3FA 1E0DA 2AX3A 3K8YA 3QU5A 2G71A 3SKVA 1CZKA 2UU9B 2PU5A 4QRIA 1E1CB 2BBWA 2CWDA 5AM0A 1WVIA 2EF1A 4F92B 3I72A 5CYOA 4KN8A 3ZV3A 1G20B 1T9ZA 2VZEA 3ZWVA 4LY6A 4BRSA 1RWKA 4JUDX 3VC2A 4EY7A 1PWHA 5LL6P 2XITA 1DTWB 4PLCA 1U1CA 5FD8A 1EWVA 1FK8A 3WQSB 4N5NA 2C3YA 1J07A 2AZTA 3IVGA 3U60B 3P9IA 4LRYA 1P0QA 4F4IA 5IZ4A 4YCSA 3BFKA 1V7CA 1UXJA 2ZPAA 4E94A 2WJPA 3IAFA 1KU0A 2QR5A 2GYUA 2VA8A 3KUKA 5AI5A 5EZ5A 3W6OA 4BFWA 3DKVA 3D6TB 3VJKA 4B3DA 2ZZKA 1XFAA 1DARA 4TL8A 3KVOA 2ZK7A 3I0MA 5BSVA 2G7MC 3BG5A 1DO8A 5FWDA 2ZS8A 1TF7A 2O59A 1U2QA 3AR2A 2YW2A 4HDSA 2JHAA 4BE4A 3K70D 4AVYA 2F2TA 4LYHA 4HNAB 5AUOB 2UVPB 2NU9B 1AKWA 2QIOA 3HYSA 4JB3A 3V4FA 1TX4B 4WK6A 1UADA 1ODSA 4JFAA 2VDOB 3OKPA 4HRAA 1YCHA 1P7PA 3U4HA 5HF5A 2XZOA 2D1FA 2QD3A 2PUBA 2G88A 3DMYA 2YRXA 5CR9A 5EY5B 2XHEA 4WFKA 2ZP1A 2EGHA 3G1UA 2WWGA 4HF7A 2BEJA 2BLNA 2ZRFA 1H2EA 1PTKA 3LX4A 4CU5A 5D86A 3CNBA 1FY2A 3MMXA 2IYOA 4F11A 1M6EX 1EM8A 1WXDA 1K68A 2XRZA 13PKA 1JFFB 3KPWA 4ZOAA 1JUDA 4V0NA 4G07A 2BDUA 3K92A 1W35A 1FP7A 3ELUA 1ISRA 4GPIB 4Q66C 3ZU3A 2VT2A 1Q44A 3WYFA 3PLRA 2FFJA 4JVOA 4KZKA 5REQA 1K9VF 5JR3A 1AQNA 1NX9A 1SVIA 1AGRA 2QHXA 2VR1A 3TM4A 1VIAA 4HH0A 3HVKA 3U4QA 1CDOA 2BDEA 2EFDB 1GTVA 2BAGA 3OESA 4MJXA 2PUGA 2GMWA 3HB9A 2VSFA 3NYRA 1PEYA 1QG2A 1R10A 2QK4A 2GN1A 2QN1A 3FUUA 3HEAA 4IJMA 4PPGA 1N8SA 2ONCA 2YBEA 1W5TA 3SYLA 2MCFA 4BX0A 2BE9A 2KLBA 4MP3A 4AO7A 4HVCA 2DECA 1MF7A 2E21A 3DHEA 1AIPA 1CJBA 2NO6A 1C8BA 1W25A 1W5BA 3HB1A 2F8MA 2XW6A 2WAYA 1OTYA 2NZVG 3N59A 1Z62A 1UDXA 4X84A 4LXIA 1G5HA 1QQ6A 5KYYB 1GXSB 4AZ3A 1OUMA 2M32A 5AVXA 4OJQA 1BAPA 2BFEA 1X94A 1OGJA 2DLDA 3PUWA 4O1HA 3Q6NA 4G0PA 3WLIA 1P29A 4EPXA 3DDUA 1ABEA 5JZVA 4XWKA 2JLVA 4RGYA 1ZONA 2Y71A 1DIBA 3OF5A 4RJIA 4A9AA 3ONNA 6NULA 5JI2E 1GYPA 3ICVA 5T67A 1AE1A 2FEKA 2FWPA 1PR9A 4L2IA 4MGHA 1YC5A 4PS1A 4BWVA 1Y6FA 3HNPA 1PJCA 1QANA 1Y8RB 1YR6A 1BS2A 2GARA 3EQ2A 2AVDA 2IHVA 3PIIA 3RWMB 1DSSG 2SBTA 2WK1A 1SCUB 3EE6A 16PKA 4H35A 4EGAA 5EHXA 4N0DA 3H9CA 1Z0DA 4RD6A 1WCV1 1KEUA 4L0MA 2YZGA 3VJMA 6Q21A 1QU2A 4B79A 2VYQA 3I52A 4P4NA 1M1NB 3WLQA 4FGJA 3W9SA 2QTTA 1M0TA 2W37A 3OAAD 2NXJA 1YWGO 1CERA 2A5YB 4UM9B 5CXQA 1RVV1 4WCVA 3LDUA 4PSDA 3G7UA 4W6QA 4JI6B 3TKYA 4OQEA 2XB6A 4ZU3A 3BVPA 3KHTA 5EFOA 4BQEA 4DMKA 4TZ6A 3EVEA 1XCOA 4HWRA 3BPSA 3AVYA 2LIVA 3TDMA 4BMNA 1T8UA 2OXTA 2OHIA 5DLQC 5DTEA 2EX1A 2H4HA 2P4QA 1EXVA 1J0DA 4URZR 2BCJQ 1JTEA 3O4JA 2EBHX 1GU7A 5MN6A 5LDHA 3P7MA 2XGJA 3LBYA 1MC1A 2AUTA 4IOKA 1KJ9A 1S3GA 5IFLA 1FX0A 3JYLA 3LQFA 3GMIA 5JAPA 4LF9B 1Q1GA 5DLYA 4JITA 1E2EA 3AFGA 2VOJA 2F8SA 4YIKA 1R5OA 2ADMA 2HK8A 2OB2A 2VRBA 1WSWA 5TGTA 1PTJC 1YL5A 4KH1A 3WIOA 5BRAA 1ACLA 2O2DA 1W36B 4GAEA 2H1HA 1RXWA 5BQFA 2CZCA 3HB0A 2V3CC 1SC3A 2G72A 3AHCA 4RQBA 4TWJA 3K71B 3QI7A 2VZ9A 3P0HA 4B2IA 4HRVA 3MQ4A 5GV7A 3LVFO 1YCDA 3E9NA 2BVNA 5HHTA 1PEAA 4J3FA 4BWYA 1K08A 3N2IA 1IIBA 1QG6A 3HP1A 5I3ZA 4XTCS 3U4CA 1Y6GA 3Q72A 1WXFA 1WQ1R 1LJLA 1WW3A 1ZMXA 2ZRMA 3M4YA 1P6QA 1WEKA 5HGJA 5JAMA 3I9OA 4FR5A 2G9ZA 2I33A 2YZ7A 3IDOA 3N8HA 3FCAA 3QKUA 2PIAA 1OLUB 4E4RA 3VPDA 2VIIA 1UQUA 2JF0A 2OCGA 2J9GA 1O6GA 2CL0X 2Z9BA 3C6MA 4RHYA 5LLDA 2JGDA 3SE7A 1C9EA 1Q0UA 1VIYA 4GM4A 3GHHA 1YDGA 4AKHA 2XZTA 3T4XA 2VP9A 4R31A 5KWVA 1JBQA 1P1BA 4FC6A 3O95A 4MEAA 2F43B 4MKFA 4AWAA 4EW2A 4OKSA 4WXMA 3LNCA 1TK2A 1RP1A 5FWYB 2EKZA 5IYZA 1VZ2A 3KYCA 4KIWA 1G6Q1 3FNGA 3ZHYA 1JJVA 1OT3A 2GZ2A 3F8TA 4INPA 3UF0A 2OCKA 3HNRA 4C4XA 4KAJA 1V3QE 5KTOA 1R66A 1W19A 2Z3VA 4YN3A 2X4DA 5ALPA 1P7VA 3H87A 4Z7QB 4F7DA 4Y2YA 4G8JA 3DDOA 2GHIA 4AWXA 5TSDA 2VH1A 4UTOA 3I9MA 3HKEA 2B6HA 1LH0A 3TSCA 1EUYA 4CL0A 4QUIA 5DYNA 4U9IS 2OXFA 2V6JA 1URPA 3Q1LA 4NOKA 1W94A 1F4PA 4F72A 3FLEA 3FMPB 1VRCA 1P5ZB 5H9WA 1JR3E 4INAA 1MVLA 2WMOB 4K9OA 3ZCTA 1NQXA 5B6JA 5CDUA 4WLUA 1I2CA 2KB0A 1G0OA 1S8OA 1BOFA 2NYRA 1W44A 2YN4A 4NMWA 1PR1A 4IUYA 1GQFA 1L7XA 3TS1A 1HE4A 4UASA 1MKYA 3V4LA 4WFIA 3OPMA 2PLRA 1QH9A 1ZVVA 5CLQA 4NBKA 3RJ5A 2PNFA 1OC4A 3G17A 3GJ6A 1HQDA 5KX5F 4L4UA 5BQXA 3D1JA 2HA4A 4BYMA 4L0QA 3LJKA 4UTZA 3CA8A 1UQTA 3CPHA 5HUQA 2VTVA 4MW1A 1P72A 3ODPA 2B2XA 3HLYA 3KZNA 5DGTA 1KEEB 3E84A 3I1JA 4KKVA 4UQLA 2FUKA 2C7VA 4IJ5A 3IEPA 3PLAE 2QKYA 2RI0A 1SQGA 4V0OA 3THWA 1DUVG 1J5XA 1KVSA 3L04A 4MQEA 3U56A 3PTAA 4U6QA 3LBAA 3GO4A 4G36A 1MIHA 2BFWA 1N6KA 3KEFA 3BULA 4FYIA 3T3GA 4QVKA 4KTTE 2C5LA 5A3SA 3HZZA 4FMBB 3QU7A 2XQFA 1QH8B 5CA0F 2RGDA 4F8JA 4OYRA 1OFHA 2Z4TA 4B33A 4O4HB 5JCOC 4ZYWA 2VYNA 3G6KA 4WZBB 1JDPA 3QGMA 3SMVA 1I4DD 1ICIA 3GK3A 2KI5A 4C2UA 5CFMA 2NP6A 4EGJA 5BT8A 2ECFA 2JJ2A 2NSJA 2QS9A 3H9GA 1R0XA 3HRKA 4IJ6A 2REOA 3ZV6A 2Z6UA 3X1WA 1E3IA 2RIPA 4XLTA 2Q9UA 5L95A 3WSWA 4MVJP 5HYVA 4Y2VA 1U4OA 1UZAA 3EVTA 1HO3A 1QIJA 1H05A 2A33A 1C4KA 2NTVA 3DGFC 3IA7A 3N0VA 3PFWO 5TJHA 2OC4A 2I4IA 5DEIA 5BN5B 4O2LA 1KEPA 2PNJA 1KOJA 2ZM6B 2AE1A 1YRLA 2XTNA 1EX7A 1M6WA 2CDCA 2CB0A 2ORED 1I3LA 1ZEMA 1U4SA 1NYTA 2YZKA 3LUDA 4NEQA 4ZD6A 3V7NA 4Z1MD 3FFBA 2O07A 5FBKA 5B55A 3D6JA 1UMKA 4H7IA 4Q9DA 3AJEA 3B7WA 4ENRA 4DUZB 1EVYA 4I8IA 3CZRA 4H16A 3INTA 1GDHA 4UMFA 4AK9A 2BGLA 5L40A 2HZ7A 5DNEA 3HO6A 3Q98A 4WACA 2FJPA 3SF8B 3UAVA 1FX0B 2V6BA 4OM7A 1QTNA 3B89A 3PP8A 4V0MA 1HNNA 1L4EA 2FSVC 2WIJA 2ZYSA 4JBHA 3PFKA 2Z8ZA 2RKWA 2EKQA 1NQWA 2JIQA 2UAGA 3NBMA 4AMYA 1T29A 2D4HA 2IGTA 1ZIYA 4MLZA 5EIBC 3L1UA 1FOEB 3HDJA 3MOGA 1M7BA 3O0DA 1TTTA 1NXSA 2AWNA 3O8OB 1F17A 3LCJA 3BJIC 3QVLA 3DAFA 1REQA 4ZVSA 1UAAA 4HN2A 4CEHB 1GM5A 3NWPA 1AHIA 4AZTA 4D6XA 3JD0A 3UAXA 1EHIA 1EGAA 1GUAA 2FP4A 1VL6A 1VXRA 4D25A 3LWZA 2VJKA 3MPOA 4KFUA 3UMRA 4I8XA 1A9OA 4MWOA 2GM9A 3TDKA 2ZXUA 1P60A 1RHJA 5BT9A 4RVOA 1CCWA 2I4LA 3QUTA 2Y92A 3S7ZA 4JVNA 4XWAA 4P4SB 1NI5A 2WKQA 4LOAA 1BXGA 2Q3DA 3WGLA 1M2OB 1L5RA 4K9MA 4DLUA 2WFLB 1U94A 1BKYA 1H9CA 1GPH1 1IWOA 1KR5A 2JI4A 1O94D 2C3MA 2OFPA 4E5KA 5JADA 1GPJA 2A88A 2DC1A 3CLHA 3JAWA 1JAIA 3OURA 1H0SA 4PQRA 1NY6A 1QRAA 2A9KA 2ZR7A 4IDFA 1KKUA 2GRAA 4TOIA 4YCJA 3SVTA 3DMHA 5ICEA 3EQ6A 3EGOA 3CMCO 5KEIA 3L0OA 1AQIA 4JROA 1BXZA 2WP0A 1EDOA 4ESHA 1X7YA 1ZISA 2B4YA 2BGRA 2YIMA 5ALNA 1GLNA 1KI6B 4RQTA 3EMKA 5IVPA 4MIKA 3HPRA 2O4CA 2Q4RA 4E1VA 2R4UA 4CR7A 1CS0A 2HTEA 1RWXA 1H6AA 4F9EA 2O8FA 3UT0A 4LF7B 3BD6A 1QHSA 3VYTB 3M3DA 5FA8A 3H8SA 3ASVA 1P0MA 2JFOA 2C97A 4YWHA 5C4MA 1XE3A 4BVHA 1SKYE 5DMXA 2EBUA 3LLMA 1U9IC 4KU4A 2B98A 1RJDA 2HPHA 2SCUB 2WICA 3D8NA 3L7BA 1T1IA 1XD9A 5KCZA 1IJBA 4H0NA 2VPPA 4ZJYA 2Q6VA 2J59A 5TS3A 4PYMA 2YY5A 3EVZA 3HDYA 4GGOA 4PY2A 5EKSA 3F9RA 4BMPB 1VJ5A 3V1LA 1JIUA 1S02A 2Q9CA 5JI3E 4TRMA 2IE0A 4J29A 4QECA 2V45A 3M9WA 4M86A 1GGHA 3OM1A 4MV3A 4RDIA 5CT4A 1JXOA 5AFSA 3CNLA 2V3WA 3HUTA 4DXAA 3SEQA 5T6MA 1K97A 3OFND 4YUAA 3AYXB 4YQEA 1KH2A 3EULA 3GOQA 3HN6A 1KK1A 1Z3CA 5FPSA 5GONF 1WZUA 3WGHA 4MPTA 2DHEA 3VAZA 3T06B 1XRPA 5BSEA 4Y6GB 2CK3D 3IR7A 4Y30A 1A7JA 1BHO1 4PZLA 4UNPA 4DZTA 3GXBA 2IYUA 4MVJE 4YROA 3WAKA 1JEYA 4MV1A 4B40A 1FNSA 1SQ6A 1W29A 1YMUA 1J9ZA 1G9TA 1Q84A 2HO5A 1DTSA 2R86A 3KB2A 3C8ZA 3L84A 4LTNA 4N40A 4WWHA 5IAGA 2BCGY 5ENZA 1QYCA 1I10A 2Z5VA 4MQBA 4JCOA 2QPTA 3TZCA 3AR7A 4HAOA 4WA8A 4BNWA 2R65A 2DTDA 4PM4A 1NQVA 3F7NA 5JAQA 4EB0A 1O6ZA 1R7RA 1ATIA 3X1YA 4HQLA 3WNCA 3WIDA 2SICE 1GPDG 4O2RA 3FSJX 4QSMA 3GLIB 2L2QA 2ZWIA 2X1MA 5THKA 5LQRA 5FPQA 5EJ6A 3D3WA 4RTPA 4FONA 1U8TA 5IT5A 2Q5IA 2P9HA 4JP1A 4K6GA 1JEAA 1VI5A 1L9KA 1EYZA 2MYNA 1YUMA 3ELDA 2PH7A 3AF1A 4RPLA 3AF4A 3S27A 5EQTA 1FUEA 1AUXA 3W6ZA 3LUFA 4E5SA 1RBMA 4O4HF 4F45A 3TJMA 1U8AA 2Q3BA 1RI4A 1VLZA 3TUIC 2Q3LA 2YWEA 2VCEA 3CCCA 3GQBB 2PCLA 3H2GA 3KBOA 3RRXA 3F6CA 1CJUC 3NHSA 4XM1A 2B4AA 2PXCA 3IQHX 1EK0A 4LVCA 3DLBA 2YJ3A 1RM4A 1ONBA 3KXLA 2R6HA 3T0IA 5K8LA 4HLCA 3UMGA 3S81A 5KQSA 2C5HA 4DV3B 1ZWLA 2VUSA 3LDGA 3OWHA 3NDIA 3T1OA 2H29A 4CM3A 4C76A 4D26A 1Z2EA 4ZOLA 1GPYA 3NHAA 1AO0A 3HI6A 4YC7A 1EGHA 4C0WA 2PSEA 1PAUA 3W9BA 3ZK9A 3HYCA 4BASA 1JHQA 2I6QA 1BYUA 4HN9A 5CXUA 3C6BA 3TCKA 5HF8A 3KHKA 5IT9A 2D3WA 1L5GB 4C1NA 3TCNA 1KH1A 2HJWA 5AQEA 1QG4A 3V4OA 5DW3A 4JU8A 5EJIA 2FRVA 4HGRA 2OAQ1 5ECYA 1TTPB 2LV8A 2XECA 2ZDQA 3IAEA 1YR8A 3MUOA 5JH7F 1B7GO 3L77A 2NU9A 2UVPA 5KVSA 2E18A 4S1VA 2H1VA 2AKAB 4QU0A 5DKFA 1Q0TA 4LFAB 1ZSNA 1N0IA 1SBTA 2XBLA 2BV3A 1IC6A 4IIVA 3C3KA 1X7ZA 4FDAA 1VE9A 3NHMA 5DOVA 3IQGX 3P0IA 3WL8A 3F47A 3OCWA 3JS5A 1H2WA 2C61A 2Y0EA 1DZIA 3MB5A 4F4DA 2BFPA 1IOZA 4IIXA 1U3TA 5LB2A 4FFRA 2ZUBA 3AY7A 3S8MA 1AHNA 1Z25A 2QZZA 3A4LA 4I3FA 4R54A 4FMDF 5EUMA 4EY6A 5KC9A 2ZYAA 3EIWA 4Z9AA 1E1YA 3UK2A 4I1SA 4WLVA 1W4ZA 2ZI6A 3AOEC 2GOYA 3LY7A 4GZLA 4PZ9A 5LB4A 1XO1A 3P2JA 3ORQA 3R8FA 3DGEC 1ANKA 1UJCA 2QD1A 3KPUA 4YBRA 4B80A 4ID3A 5LQMA 1E7YA 4WXRA 1FP6A 2C7RA 2C2GA 1UJ6A 2WHYA 1DBSA 5CB4F 2VFAA 4HAVA 4ND7A 1J20A 1TEVA 1CUVA 4WKOA 4NZ9A 1E99A 4F04A 2ZANA 4IHQA 4GR5A 4XIFA 5BYJA 1RQXA 1MX9A 4R5HA 1Q6YA 4GKJB 2XOXA 1DIGA 4E1BA 2C29D 4IWXA 4J3NA 1RZ3A 4XB2A 2FW8A 4V1CB 2VRWA 2A9OA 3E3LA 2OYRA 1EVEA 4XFKA 3HXMA 5LMCA 5CMLA 5EVCA 2GZAA 4QQNA 1JV2B 1PQYA 3KKOA 1SGWA 4M7RA 5GGYA 3VFDA 2TMGA 4GW3A 5KYXA 3HZOA 4NZPA 1CUSA 2GN4A 2C9ZA 4YDRA 2QN9A 2H4YA 1Z7EA 3CVXA 1CUEA 3EZ2A 3HMQA 4ALJA 4ARVA 3IODA 2OHVA 3CRZA 4LX0A 2VRCA 1EE9A 3FNIA 1DT3A 3A3OA 3TL6A 3ZGYA 4YLYA 5EWJA 2Z98A 1WIWA 1JDJA 5EXXA 1SCJA 1UKBA 3TOCA 1FJHA 3FYUA 3ROFA 1JN0A 2NYAA 5EHZA 4PGAA 3WO1A 4ALMA 4MW6A 4IIUA 1VKHA 4NX2A 3W8NA 4UAJA 4WEOA 4DG8A 2V65A 5CDFE 3KYBA 4WCFC 1N32B 5DK6A 2YHIB 3OIYA 2NVUA 4C0QC 5CLHA 4EUEA 5ISMA 3ICCA 3DMNA 4JQYA 4O59O 3RUPA 4OHBA 1SM4A 1L7DA 3KXPA 3IBYA 5DASA 1E96A 4MVJI 3GIWA 4BZWA 3RYFA 5HW0A 3PUHA 2AE2A 3RKRA 4S35A 2E82A 4GDMA 4G4JA 2MSNA 3QE3A 3T1VA 2HOQA 3UT6A 3FTNA 3N75A 3O90A 3DR3A 4L6AA 1U6JA 2OHXA 3NRJA 2G25A 2FSIA 5JSFA 4BFYA 3IFSA 3BK7A 2AL7A 1I4TD 1VL8A 4Q12A 3FD8A 1U4NA 2NACA 2Q28A 2XDYA 3L7OA 3R7WA 2QTAA 5KNDH 1AMUA 1Z2PX 2Z95A 4X65B 2HF7A 1KKMA 3K53A 3NHYA 3DKRA 3SK0A 1XNGA 3B6IA 1JW9B 3B6JA 3IAXA 4IHJA 3CB4A 3B6EA 5F2OA 3T7IA 2YXNA 2ZSBA 1H8ED 3OCJA 3TGPA 1V7QA 2ZYDA 3UFXA 1O7JA 4N5HX 3NDJA 1G7TA 1V5IA 4CL2A 5I9BA 3R4VA 5IMSA 1Y8CA 3QMVA 1XLTA 4NXMB 2PX8A 3FTQA 4D4HA 2X13A 2J5QA 2ZTVA 4KQEA 1U0LA 2EX0A 3BN3A 1NUUA 3SXPA 1GNSA 3WLNA 4CLHA 5EIXA 3DBRA 3B1ZA 1SRQA 3IB3A 3MGGA 1D2MA 2WIAA 4M0EA 5CG2A 2BEWA 3SPXA 3LYLA 4ZOQI 1DRWA 1NU8A 3SZUA 1DEHA 2F3PA 2M2IA 4LJ6A 3WADA 3ZHSA 3I9LA 4HX9A 3KU4A 2JGJA 2OLEA 2P9EA 4QBFA 2QUHA 2K2QB 5D6NA 4KQKA 3RS9A 1B0PA 3EZLA 1UDAA 3FWPA 2FSUA 2J31A 4KX3A 4U0KA 1T0UA 3FVRA 1F2UA 4RAQA 2E4UA 1GV0A 1E4YA 3SMQA 4BNUA 4UUMA 4WZAA 4XFJA 4OQPA 5FEMA 1AQUA 1CUUA 1JHDA 2PQMA 4G0YA 5LBTA 3VPBA 3D6AA 1NX6A 3BERA 4JP8A 1SU6A 2P5YA 1EUQA 1ZD2P 2GN0A 1GLGA 2R5FA 3MZ0A 4TWBA 5HEKA 1QJ4A 3RS3A 2CV2A 3PDJA 4BWFB 3P9PA 1NRJB 4TLCA 5KJFA 3NPMA 1CJMA 1V7PC 5F35A 5EGSA 1RAHA 4RXUA 3T9AA 2PZAA 3S5UA 4E2YA 5BSHA 3ANMA 3PKZA 4BO0A 4LOIA 1R0RE 3I83A 3GAAA 2JAOA 3BJRA 3C8HA 3PTLA 3Q3JB 4HLDA 3AF0A 5DWQA 4AQYB 3V7UA 1IHUA 4RVUA 2ZUCA 5TT1A 4F1WA 5BN3A 5D7BA 5HIMA 4WJKB 3H2ZA 4MITA 4BNVA 3W34A 4Y1FA 3TUZC 2ILTA 1V3VA 5SZKB 1YUBA 2Q5EA 2B9EA 1FYXA 2PD3A 4NBRA 3SZMA 2O3RA 1NVBA 4MK4A 3SOPA 2ZRAA 3WR5A 3ZCRA 3A14A 4CJXA 3BCRA 4FUQA 4D3SA 1M2GA 4JEHA 2AOUA 2RCYA 3W2IA 3LWBA 1R37A 2JLCA 4FI3F 4YCDA 1NQAO 1PBNA 2ZI5A 3SC3A 4ZYXA 4X91A 4DSTA 1MXHA 3O8RA 3VNUA 1LPMA 3G88A 1UK6A 2ZJ5A 1B6TA 4QOSA 3W1VA 1MTZA 2YX1A 4OFZA 4P83A 2X86A 3KUXA 3H13A 3QLVC 4JJFA 4KGVA 4LJ9A 3IKMB 3HCCA 5BO5A 3WVNA 5ARBA 4YAKA 1EXNA 2XQVA 5J5VA 2F3SA 1YBHA 4WNIA 2CV0A 2RGEA 1QE5A 1QFSA 1A4XA 4ZDJA 2ZUUA 3GLHB 3Q40A 4DG5A 2HDWA 1DJQA 5CK5A 1DCFA 3AR6A 3DPIA 4MQFB 1XEXA 4LZLA 4D3YA 1PJ3A 1J6UA 4RK5A 4CN8A 4YAFA 4IKOA 3K32A 2CJYA 3SQWA 2H51A 1EUCA 1SVOA 2A0XA 4U9HS 5U4QA 3E3NA 5EI5A 2HT6A 3ZWCA 3MWGA 3PHJA 4Z0HO 4UUBA 3UK0A 3ND9A 3DUFA 1TRHA 3B8EA 3H6GA 4HXFB 4PW0A 3KALA 3UGKA 4UCWA 2QYSA 3F7TA 3CUYA 4TRJA 4B6GA 1WOYA 1XTBA 2VQ6A 2H1FA 3OJEA 4OJMX 4U0JA 5C7YA 2C0CA 4XVCA 2AS0A 1DBQA 2H9IA 3N3AC 2VUHB 1PT9A 1A8IA 4QPCA 1QVZA 1JZSA 4RACA 4TLAA 4JYCA 2AHRA 4R1NA 1YS1X 4MB6A 4UM7A 4X8OA 1G60A 1JAZA 1THZA 3C8MA 4HLUC 4P84A 3TKAA 4BEBA 4NSNA 2X8BA 3ZBTA 4D57A 4D0SA 3U7HB 3NDRA 1ZCFA 3G0IA 1H85A 1NBMA 1V11B 1VG1A 4Q4HA 3GIDA 2H8GA 3AVTA 1RKUA 1SUEA 3QNWA 3L92A 2OOSA 4XJVA 5HE9A 3JU3A 2GO7A 2IOFA 1JGTA 3KEGA 2V4UA 4XJTA 5JMWA 3K9GA 3CG0A 1F8YA 1R50A 4LGCA 2B8NA 3RREA 1U11A 2C54A 1EVIA 2FE4A 4QFDA 3EUFA 2XB2A 3VOSA 1SA0A 2W0SA 3PNPA 5GINE 2K4MA 2VWPA 3B2QA 4LOKA 4Y0VA 2DFKB 1HTTA 2D5CA 1I8TA 3FB4A 2IF0A 2YV1A 4LZPA 1WY7A 3Q3HA 1G66A 5DNVA 3UAWA 2WTEA 3BEDA 1WHTA 4QHSA 4W63A 2VTBA 4QASA 3VU0A 2HU2A 4LF8B 3VXKA 4KWTA 4FLEA 4CUJA 1DG1G 3ROEA 4ASUD 2P2LA 3TZLA 3P8ZA 4JJZA 1EIZA 4G0OA 5J2UF 5TEWA 2CT8A 3BGOS 3KUDA 2J3QA 3BTVA 4KO8A 4LQLA 3P94A 2PZBA 3VH4A 3FDJA 3NKFA 3R0ZA 5CXXA 1TTQB 2XRFA 1AGNA 3F3MA 3K1ZA 3G5UA 3ND8A 4OJKA 4Q4AB 5AKZA 2ZCUA 4OP1A 5FF9A 4D3XA 5I7RA 5FR2A 1T9DA 4JWTA 4RSGA 3W5CA 4I66A 1N36B 1DADA 4L4ZA 4FC7A 5B6IA 3H9BA 4ZYTA 4F9TA 3LS2A 4KK4A 3R0JA 3T4EA 2VCYA 2BUAA 4DUPA 2R6CA 4PAWA 3DWFA 3U7RA 4QPPA 3BTUA 1L4MA 2I4RA 1BEEA 4LHSA 5EJ4A 4BWGA 3ITDA 4FJ1A 2RC5A 4MCAA 1W49A 2JLQA 2PS9A 2P0EA 2WYWA 4N9QA 1A4UA 2YXDA 4V0SA 1BA2A 1BCRA 1DKMA 1HDXA 3CNNA 4QELA 4WTOA 3TRIA 1Z0IA 4D9FA 3UWPA 3I23A 5DHFA 2GR9A 4O5AA 1GPLA 1RI3A 1Z6PA 4O0LA 3D3NA 2DH5A 5J5AA 4Z3DA 1T5DX 3SKXA 2P9JA 1E9CA 2C8KA 5K0ZA 1FU4A 1NHWA 2C2WA 3LM8A 4V2UA 2PX4A 3HY6A 4DQ0A 3B60A 5A3JA 2GBFA 4CNBA 3QEOA 3PC8C 4J0GA 4H1WA 2Y4OA 5AUQA 2PH3A 1KS9A 4MW4A 1AXRA 1O97C 2AFIA 1UFOA 2ZR8A 1K8QA 4P4GA 2WSLA 4UEQA 5C0OE 1TGYA 3WGZA 2NVWA 3W2TA 4A8TA 2NV6A 4ZT5A 3WYBA 4L3WA 4CBVA 1O57A 1USVA 4NL4H 4JFRA 4EI7A 1DWOA 4TYNA 2YHBA 5FL7A 5E9WA 1AGYA 3Q7SA 1VCOA 2BI8A 1FUKA 4OLFA 4D7AA 5IDVA 4F2PA 2WEKA 4I4TA 3H6KA 4RLHA 4MDFA 3VR3A 1NQ5A 3CPJB 2FWJA 4WY5A 4BGDA 1Z07A 1OROA 2B20A 4ZYYA 1OILA 4FILA 2A0YA 3U3XA 4BTEA 3WJAA 1DC5A 2GPYA 1E9DA 3ZCUA 4GMGA 1ISFA 2O0KA 3AINA 4US1R 2WD8A 1R0CA 1UDWA 5SYNA 1AF4A 1L5VA 3NQ41 4IX9A 1D4FA 2A5GA 4M9CA 5J4HA 1B6GA 4G84A 4YCNA 4PGGA 2EQAA 3TJZA 4LVOA 1FFBA 5T41A 2PZGA 4KFSA 2X8LA 3MYRA 2D5LA 3LKZA 3W1WA 5K0GA 2J0VA 3GW8A 3OEHD 4RA6A 4BJ5A 5TLSA 2RONA 2EG5A 4DGQA 3F7OA 3T3OA 2HHLA 2NUAA 1P7CA 1W5EA 1N2BA 4LXYA 2E1RA 3G0DA 4ALLA 1P2VA 2DG2A 3DEAA 2XVXA 2GLXA 2RHWA 1V96A 2VP2A 4HGPA 3C4JA 3WMFA 4EGCB 5AICA 5KNCH 5JJKA 3CKKA 4QDTA 3FW1A 1QYWA 4QXPA 4BMYA 2J48A 4UARA 5JLAA 1V43A 4ZICA 3R3JA 4KJZA 3WGNA 1Q6ZA 3ZHBA 4TROA 4TTRA 4EM6A 3HGQA 1OXBB 1T8TA 3JZAA 5CCDA 3TAUA 1EQUA 5EE3A 2EQ5A 1MXFA 3ZNQA 5HSGA 4OK6A 1R4NB 3SEAA 3CZPA 1YFKA 4WW0A 4UCQA 2NW6A 3EIEA 3I8XA 1VCMA 3M89A 5CT8A 5FOSA 2CNBA 1MDBA 1ZZEA 1EBFA 3EDRA 2ZG6A 3R4CA 4JL8A 1EK6A 1PW5A 1T2AA 1JL3A 5G1NA 4OKNA 1VGQA 1EVLA 5U1PA 4CMIA 2DYKA 4CV1A 2ACWA 4H1HA 5F1YA 2E89A 4EK9A 4QEZA 1CTQA 3FOWA 4QRHA 1J2EA 3OA2A 3ICQB 2V0CA 3RHSA 3HU1A 2Z1DA 4AFNA 2X2OA 4MWBA 1O5OA 3BKXA 3THWB 3WGTA 2JARA 3F6PA 3H83A 4OI2A 2DX7A 2P90A 4EHDA 2E1PA 1KVTA 5BMVA 4D5GA 5C5EA 10MHA 3W06A 3PX3A 3GLGA 1TI7A 3Q3GE 2XUAA 3O4HA 2CNDA 1KOLA 2HSEA 4EY4A 1BX1A 2EFEB 3H5RA 4MGIR 4QATA 5DTMA 4RNDB 3GEPA 1K8YB 1XQ9A 5DJ5A 3RHFA 1P1CA 4YONB 1PR6A 2PX6A 5EUQB 5FYQA 4OAQA 7YASA 3WK7A 1ML4A 1VRVA 5TF0A 3WYEA 1PZFA 4Q7JB 5AKLA 5MHTA 4WNYA 3UZUA 1MEJA 2JRLA 5AVZA 5IJ9B 3UTDA 4UXJA 4HNGA 1JH9A 1PGOA 1V26A 1IIRA 4OOEA 5IKMA 2BN4A 3N2GB 4QNRA 5BWBA 1ND6A 4FFSA 1TW2A 1RZUA 1OASA 5LXTF 2W4MA 3PUXA 5K3FA 3W90A 1SO8A 2H4XA 4M60A 3LK7A 1JHMA 1Z8DA 2DUUA 3PF8A 4R3UC 4YCBA 1LNZA 4YRTA 1ZHFA 2EBWA 3L7KA 4N82A 3WGUA 3FETA 1KDTA 3GVXA 1SC9A 4HDMB 4MW9A 3N8KA 4R6WA 5AW7A 1D0SA 1NSFA 5C1BA 1Q1NA 1MH9A 2QR2A 1JHPA 1H9AA 2NO1A 4IJVA 1SJ9A 2ZJBA 4BEJA 4FOOA 3ZCXA 3E1GA 2UZ1B 4URHA 2JCBA 5EEHA 2IS1A 1M0WA 3HL4A 4UCXA 1TA4A 3O9ZA 4OHWA 4CM9A 4E22A 1O8BA 5ECDA 3FTEA 3UV7A 2DFTA 1E2NA 4G4IA 5DP1A 4GI5A 1Q19A 1R1DA 1Z82A 2IY9A 2QD2A 3CRNA 1V5EA 2WV7A 3FOFC 3M2TA 1RRFA 3DFIA 1WTAA 3H3FA 1VGRA 3RUAA 4JJ8A 1N4DA 1G2OA 4YJHB 3OP4A 3GWGA 4ZVNA 1E8MA 2ZT8A 3LXUX 3CLUC 3F67A 3O8OA 1CRPA 1XVTA 1JU3A 4JQOA 2X7XA 3BGVA 3OM9A 4PYJA 1OF1A 4M0UA 2GPBA 4YYZA 2DCUA 3DBHB 5CDYA 3LE8A 4MHSA 4KNVA 1H93A 1I6KA 2QLTA 4NMHA 4QOFA 1DCTA 1YGYA 2FRXA 1KYXA 4KQFA 1ENZA 4DCJA 1CG6A 3LDHA 1BA3A 1ENOA 3EYAA 5IJAA 1J0XO 3GJXC 2BD0A 3U3JA 4F0JA 5B1DA 4MYDA 1U2ZA 3W5DA 2EX4A 2ATIA 3DDWA 3IPYA 1KP9A 4FR2A 3EMVA 4CDNA 2VEDA 4CKBA 3OD5A 1NHGA 2XWPA 3DCJA 3AH8A 1X1QA 1G2IA 3CH4B 3A58B 4ODIA 1BE8A 1JDTA 1F6WA 2EJTA 1PUXA 2H8KA 2I7VA 2RFLA 1YTLA 3L6DA 2IY8A 3MNFA 1GZ7A 1FRVA 1GA6A 3NC4A 4LYDA 5LCXA 1AHPA 1KH3A 1TT7A 5KQLA 1XUOA 2PQ0A 2NUPB 2AWOA 5BYAA 2YYYA 4R2WA 5D3MB 3ZZMA 2DVMA 4ZZ2A 3OPYA 3G6WA 2JAHA 3BXOA 1KY4A 4Y6QA 2H4WA 3SJAA 4C6SA 1MRNA 2ZRQA 3PL5A 2FQ1A 3ME5A 5GVRA 4ECEA 1PZHA 3RTBA 3X1DA 5AJWA 1Z38A 721PA 4WL0A 5KYUA 3HM9A 3I6IA 3OZFA 5CYPA 1Z0ZA 3SBEA 5TXGA 4ND8B 3OQMA 1JIJA 1HKHA 3PNKA 2B0JA 2W6ID 1Y48E 2ZULA 2GSWA 2HUNA 1FVXA 2UUOA 5KTPA 2XTZA 4JP3A 1GYQA 2I6UA 5IC4A 1YFJA 4Q7KA 3V8MA 2LPMA 4UHFA 3SSOA 4PG5A 3GUVA 2Z6QA 1C5KA 2UVQA 2XAUA 3C85A 2BTOA 4JSYA 1KAOA 3GGSA 3FMIA 3NT5A 4PU0A 5AKYA 3RFFA 4BO7A 1YB6A 3L4JA 3LW8A 1K7EB 1Y3IA 2O1XA 3U39A 5LWQA 1U63A 5E1MA 2P7HA 1RM3A 2UZ4A 4UFPA 1PWYE 2OCAA 2HBQA 4OGLA 2BFAA 2W8BA 3CLSD 3OA0A 5D51S 3DPSA 1OBHA 3DKIA 4R01A 2G9NA 1NA5A 1WCYA 4YRBA 3ZR4B 1IUNA 3TFQA 5J4KA 3KETA 1NW3A 4NZZA 2A14A 4JGIA 2V7QA 2WB2A 2QP3A 4PLGA 3U2QA 4E6EA 4YMUA 4ZK6A 4GQBA 3E48A 1QAMA 1WULS 3L07A 4RDXA 3GJ8A 1CY4A 1WD5A 3S6JA 3W6NA 3K9FC 5ECGC 4A2PA 3M5CA 1S5PA 3GFVA 4MVXA 1Z4KA 3IP3A 1YA6A 2J3KA 3IP1A 4OFXA 5J2TA 1GL7A 5JSKA 5BQ3A 4D98A 1UCFA 4RZSA 2IIBA 4U63A 1C3OA 2J7PA 3DKPA 5L7YA 1WETA 4QUEA 5I3CA 1BKSB 2P6PA 1XV5A 2VF7A 2XUIA 2OXEA 1WXIA 1QRRA 1FS6A 1X1EA 3BD8A 4W7IA 5I5GA 3ZDXB 1S3IA 4GOOD 3V4SA 2WRZA 3H1AA 4E5MA 2YN0A 2VBGA 2IH4A 3PPWA 1KIAA 3AETA 4CIXA 1O87A 1E2BA 5CX1B 2YC4C 2ZRHA 3ZI0A 1TYBE 1VHLA 3NYQA 2UYOA 1JDUA 4Y6OA 2F8TA 2CHUA 2NLOA 2O2SA 3G9UA 4ZT7A 3K15A 2HDOA 1KS2A 1GPAA 3B85A 1N6RA 2LDBA 3HLKA 3IV9A 3IAM6 3TTVA 1M1YA 3R6LA 4N01A 4YP1A 1ABFA 5JE8A 2ZRKA 3ZHRA 3SNKA 3OICA 5A7FA 5HJ5A 4C7OB 2C95A 3GEDA 3L4BC 5FNZA 4D0GA 3SP1A 6GPBA 2ZJ7A 4P4TA 3GFPA 4OUDB 3FUCA 4DPMA 4DYHA 1CRQA 2P67A 1AHHA 2FK8A 2WUGA 3WLMA 3PFIA 2RGAA 4LY9A 4ACBA 3HJFA 3BRSA 1B0ZA 2IZ6A 4FN5A 2WJWA 4WFJA 3SU8A 3JRXA 3HCNA 1TM3E 4FHZA 4EHIA 2WJJA 1XELA 2JL1A 3K4QA 1NF2A 1WPGA 3I2FA 3NJ8A 2JGEA 1FFWA 2J87A 3M4XA 2DY0A 1Q0HA 1VGVA 3PPXA 2G1KA 1UT5A 4WECA 3TXXA 1U3CA 1Z7WA 1PV2A 2YNMD 1N7JA 3WJ7A 3AESB 3QOFA 2FPGB 4C0JA 5A4AA 5A0VA 4Q5IA 4F06A 3PIDA 3CEAA 1G8HA 1ZMRA 3LSYA 4PIMA 1Q91A 1YBAA 2Q6OA 4LJ4A 4IX1A 2GD1O 3SR3A 1GTSA 5F77A 1O4WA 1TMGE 4E5UA 3TGLA 1M1XB 2PMBA 4HAZA 3EN0A 1GZ6A 3AEYA 3RRZA 4FCVA 1M0SA 4H18A 3U4IA 4FSDA 2PK3A 4F5DA 5JSQA 4TLLB 1I1OA 1M66A 2J07A 1EZZA 2Q2QA 3NFRA 1CUZA 2XEDA 4K28A 3N7AA 4MA0A 4NU8X 1DDOA 3CEHA 1EVQA 1QHHB 1A8UA 1BW9B 4EPVA 2QP4A 1XRJA 3DWIA 4PZPA 4I9GA 2VT3A 1YB4A 1U8UA 2FQYA 4NECA 4KR9A 3VC1A 2ERXA 2PM8A 3PNOA 5BQ5A 5F23A 3MM4A 4HLUA 2J08A 5FNVF 3HKBA 4C0BA 5JS6A 2VPYA 2FPLA 3VU3A 5HS4A 3QXXA 1QH1B 1JQAA 5ALDA 1T2CA 4D42A 4B0PA 1R00A 3B3QA 1NIPA 1KORA 4J0CA 2IBSA 4O63O 1XU4A 2EKPA 3FNQA 4ZZ3A 3ZUGA 1AUPA 3H11B 2TMKA 4HDRA 3VUFA 1R8JA 2Z2IA 3Q2IA 4X61A 3QE0A 4A8JC 1GAQA 3NHRA 4Q6BA 2JFVA 4G1EB 2ZE6A 2FN3A 2PR7A 2WIKA 3NU1A 4IILA 2NV0A 3A6HA 4M8NE 4Y2QA 5A0FA 3LQQA 2RCNA 2ZJFA 4FX5A 4REOA 1ZXLA 4E2ZA 3ZQUA 3KQKA 3RODA 4M0KA 2FB9A 4US0R 4IUCS 1U9YA 4PBSA 2SKCA 2VT6A 1RYBA 4KZPA 2C92A 3V80A 5EP2A 1P7WA 2PT6A 1IL0A 3KXIA 3OQIA 2OZKA 3JY6A 1Z2AA 4AJ1A 4DNQA 2B30A 1EFLA 4J07A 2GKSA 3EQZA 4GL2A 1Y8AA 1IY1A 5DYGA 3SIPA 4MV6A 1ADCA 2FGJA 1WSAA 1EX6A 3P96A 1DGQA 1FVFA 1QH1A 2HZBA 3B3AA 1LC0A 1EHYA 1V8ZA 3IBTA 2EIHA 2HA2A 3QA9A 1G9SA 1W1IA 4XUCA 3ZX4A 1SQSA 2JIBA 3AG5A 3VHRA 3C5VA 1UBHS 2PO5A 4EA7A 3D43A 1YZLA 3ESRA 3WNQA 4EDHA 4CMEA 3EHEA 3QOWA 5DISB 4TKZA 5THQA 2QZ4A 1JVSA 1HETA 2D2EA 4L2IB 2OGTA 5FHRA 4EBBA 3L0CA 4ENVA 4RHTA 2Q0SA 1IZ7A 4BP3A 3TIIA 3TOVA 3KDPA 4TMFA 5F2NA 4NU5A 2JJ1A 2PKRA 1MJFA 3TQTA 3B9PA 4YRCA 1HLPA 4N18A 4QUKA 2IDZA 3MFQA 3O5AA 2OR3A 3EGWA 2YV3A 2QW1A 2WF8A 2R7NA 3TLEA 3WGVA 1S2GA 2H0AA 2H1SA 3AIMA 1AUOA 1TPYA 3E15A 3JQ9A 1RXEA 1P8AA 1ZRMA 1LDMA 1J0BA 2AZDA 3EG5A 3LYHA 4OL9A 8ADHA 5HQTA 3DE3X 5LKRA 1R6XA 3K96A 4WK2B 5CVUA 1YUNA 3A9CA 3F5SA 4V0KA 2ZIAA 5ALJA 3G2PA 3I92A 2R4TA 3G8CA 1S2NA 1SVKA 3OLQA 1XMPA 3HA5A 1UBUS 1RQNA 3IO3A 1Z5GA 2NO5A 4KXNA 4XOUA 3EA0A 3K4PA 1JDBB 3EIQA 3OVMA 4ZOEA 5IF9A 1W46A 2A4MA 4GR4A 4DCTA 1MO5A 5FLXA 1OX6A 3ASZA 2IPXA 5HBGA 5AW3A 4YT5A 3JASA 3W8FA 2I6GA 4XWYA 4F12A 5DX0A 2CV1A 1KAMA 5IXSA 1TYDE 4KP7A 2OBBA 3EPPA 1OC2A 3F90A 5JNVA 3TZKA 3D7MA 1K5HA 1EP3B 4L51A 2H65A 4RXTA 4ZVPA 4A6PA 3Q5GA 2HIHA 4E7PA 2B8WA 4GC5A 2JFXA 2P4UA 4BHTA 3LECA 5F5XA 3CR3C 1ZNWA 2FF7A 3LLSA 3MGCA 4ISCA 2P3QA 4Q00A 5LC1A 5TQ2B 3BRCA 4BLWA 4KXLA 4I6JA 1Z2OX 4UAGA 5FUYA 2BH2A 2B37A 5DULA 3EEFA 2IPOA 1M83A 4MJLA 2DPGA 3KWFA 1U8XX 1IAVA 2CBZA 3JX9A 2YWHA 3AR4A 2PQ6A 3RU9A 1M76A 3U3OA 3U7QA 1OYOA 1SN7A 1YXMA 1O6CA 1R88A 1VSBA 3BIOA 1OYVA 1Z9BA 3HU2A 3INRA 3OJFA 5DTQA 3AEUB 1IONA 2XV1A 3KEMA 1PS0A 2ISSD 3U81A 3NHWA 2OZLB 2XNJA 3RUFA 4DV2B 1F7VA 1RWPA 2HRBA 3EEIA 3DJYA 5DE3A 3I9KA 2FZ4A 2H11A 3K0BA 3QQ5A 1JDSA 4OF4A 4ABYA 4RELA 2XQGA 4YPVA 4FZVA 3KS9A 3C5WP 1XF1A 3MMPA 1QZZA 2H7CA 1JBEA 1CVRA 2GNPA 1YI8A 2QTLA 3IE2A 3OQJA 4GP6A 3WHPA 5KIAA 4X95A 1JEQB 1QYXA 3HNOA 3TIGA 4OJYA 3SI7A 3THRA 4LS3A 3ZGXA 3N0WA 4L9WA 4O1MA 5C8VA 2QM7A 1AQJA 4DCNA 4HNAA 2HL6A 3AVUA 4PRYA 1BJKA 1Q1ZA 2AEMA 4YP6A 4O6VA 2CFTA 2QPAA 4E5PA 2R5NA 3O31A 2FWBA 5C32A 2VDQB 1I2AA 1SHTX 1TJNA 4JLNA 4LCJA 4ER3A 1EWRA 5IXJA 2ZWPA 1TAUA 1LJ8A 3BDIA 5WRFA 1BHQ1 2J6IA 4DEYA 5GIOE 5DNAA 1UF9A 1JIXA 1OZFA 4NS4A 2C4WA 1YE5A 5JYCA 4X3PA 4DIFA 1LRLA 3OKCA 2J9XB 2W2MA 4MQ4A 2FMXA 4D46A 1PBTA 1U3FA 1MAVA 4MRMA 2PMFA 5KWSA 4GF5A 3LK6A 4KQMA 1RYYA 3M33A 3TBKA 3TJRA 2NQ2C 4L9SA 2IW1A 1NTRA 4RH1A 5ELXA 1Z4OA 2G17A 4OSPA 4Q34A 3UWKA 2YJNA 5JPCA 2BFMA 4YRQA 1W34A 4F46A 2W90A 5JO0A 1J99A 1XWFA 3K09C 1CR4A 4IAOA 4WBNF 2HSDA 2P30A 3PX2A 2W5UA 2PYZA 4NESA 3GUUA 3PRYA 4E33A 3K7EA 1J7JA 3COYA 5AHOA 3RGGA 4J8PA 4RZXA 3U31A 5BR4A 4URVR 5I4BA 3QEJA 4XWWA 1Z22A 1K75A 2C5BA 3VU9A 1D2CA 1CR2A 2H59A 3D0QA 2RGRA 1WB9A 3GBPA 2A1UB 1LLFA 3UMJA 4A0QA 1QFXA 3TKLA 2ZVPX 1ZWKA 1V48A 2GQ0A 4OYHA 1RCUA 1GPBA 3QW2A 1UJ2A 2HNKA 5JTUA 4A0SA 5IVDA 1VFNA 3EUWA 1M8KA 5AXBA 4JXZA 1SQFA 1H0HA 3DBVO 5ER9A 2R68A 4BZQA 1JQ5A 1ZJ6A 5DYIA 3HFRA 3V1UA 2P3LA 1TK3A 2YKGA 4E31A 3FRHA 4ZCIA 3CXRA 1S4MA 3JALB 5JH7A 1PX0A 4MGZR 3SQLA 3AHHA 3AUAA 5LQNA 1P2GA 1MLDA 2JH3A 4IGEA 2OD7A 3QEBZ 3BFXA 3EGDA 2X0RA 2O0JA 2D1QA 4GMHA 4BX9A 5H3CA 1WCWA 3NALA 1A9RA 5A5VA 1JI0A 3W0LB 5AM4A 3COVA 2F64A 3AZOA 1GDTA 1P2BA 4PPYA 2UXDB 5E8RA 4DJFC 2XB4A 4JC5A 1KHTA 4CQNA 5HIKA 4BLVA 3EDMA 1WE2A 2VNIA 3QPUA 1UC4B 5EIAA 3VSCA 1VIMA 1Q1EA 3PR3A 4AU1A 3S7TA 4WUTA 4EECA 5HOEA 2R0QC 1W0JA 1UOOA 2GYVA 6AT1A 4R84A 1JKFA 2GFHA 3LQ1A 4RA9B 3UT5A 4HT3B 5KSOA 1DUSA 5I51A 3OHPA 1R3UA 4KXMA 3Q2KA 4PX9A 2GA9A 1I1HA 1DNPA 1DOAA 3EB9A 1D9XA 3I01A 6REQB 3EQ7A 3R5KA 4FEGA 1GAWA 2P65A 1IRIA 1D0VA 1KHHA 1MDFA 2A5DA 3AK4A 3ETEA 1IQUA 3UNXA 3VJLA 5BOSB 2UXBB 1YNSA 5F52A 3W79A 5H02A 3CNOA 3WI7A 1KZHA 3F97A 1LW7A 3IR6A 2BJVA 2CGEA 3VH1A 5KMGA 3BF8A 5HFJA 4YRNA 4CLOA 4E32A 1U2PA 5LKAA 1QB7A 1N0WA 4RJJA 5PNTA 5K6RA 2ZYUX 2HAEA 2V7UA 2BEVB 2ZIGA 3OJWA 2JD1A 4JR0A 3W1EA 1GCIA 1PFQA 4JODA 5A5FA 5A6SB 1CZHA 3IVMA 4M6WB 4O4JB 4JP2A 2AG5A 3OMWA 4O4LB 1TUBB 4MOWA 5IBRA 3W5HA 1PWXA 4BX2A 3CX4A 1FA9A 1KIMA 4N48A 1CJKC 2A6PA 3KQWA 3RSFA 3UJHA 3PRKE 1CIPA 2JGAA 4PC1A 3QSYA 4DLAA 4DLRA 4FIZA 2QN8A 3OSUA 4JB8A 2X8JA 3GVHA 2G4CA 2J9YB 5LQKA 3WLLA 2QVGA 3ZY5A 1XLUA 3B1XA 2OAP1 5TQ2A 1I4OA 2WZBA 3BWCA 4M1WA 1LKZA 4MVWA 1YFZA 4AMZA 4RF3A 1NPDA 1TGVA 1LF0A 1VP3A 2OV4A 3H19A 4GGPA 3E2IA 3FLBA 5SV2A 1Y82A 4EUKA 4M8IA 4CWAA 1L6IA 5CB0A 1IN4A 1PR4A 3CRMA 3M5PA 1YD7A 3Q3IA 3FI0A 3DZIA 4NCIA 2ZATA 5ALSA 4Q3KA 4ND6A 3CUKA 2YASA 3P4UA 1QHNA 2R79A 4PANA 3KSBC 2V7WA 3FYTA 5HMMA 2RHOA 3BXPA 4FN4A 5SZIA 3ST7A 3U3KA 2QQ0A 4OK5A 5GONB 1NC1A 4KYVA 5DM2A 4JI3B 4G2TA 2IYAA 1YIAA 1QCCA 2O5VA 4GPZA 2RHTA 4ICIA 2BKAA 5JUWA 4YAWA 4E13A 1LK0A 1C30B 3A6KA 3NR2A 4JNKA 3WTCA 1C0KA 2WUVA 4KLNA 2YDXA 1LZLA 2CMGA 5JDCC 4L73A 1CY7A 3OJXA 4EI9A 4DAOA 3EZ6A 3T38A 1HEIA 5JG7A 3D6UA 2VQSA 4C0SA 2HIMA 3C7CB 3M4ZA 4D99A 1KMHA 1XZBA 2CCJA 1PZEA 1VSQA 1G7CA 1MRSA 1MRZA 3A4TA 3QEAZ 4WOPA 3EQ8A 3ESYA 2E6KA 1U5BA 3PQCA 3DE0X 2HRDA 4HDQB 3DA8A 2C83A 2NU7B 1FUUA 1RTKA 2X8AA 5CK4A 5IF3A 1QC5B 1G98A 4RW0A 2KW5A 4XDHA 1PLKA 1Y3HA 1Y1SA 3L49A 4DA8A 1CEEA 3AWIA 3KJXA 4P7GA 4MRMB 1MOZA 2GKOA 2GXAA 1PK7A 1AB5A 2AI3A 5CM9C 4ZMRA 1N6HA 2G36A 2TECE 3ABOB 1F0PA 3KM0A 3O6VA 4QGSA 1KI6A 1K86A 4H4DA 1L4BA 3MS7A 3DFFA 4NDNE 3STXA 4AB1A 2R8OA 2I7DA 5CEFA 1HGXA 4MQMA 5ADHA 5HP4A 1IM8A 4PX3A 1ZJ4A 2DPMA 3U4QB 1SVMA 4G0NA 3B1KA 3ZHUA 2HGZA 1RNLA 3KYIB 4LZNA 1SVLA 4NRDA 1P9LA 5HUHA 1G38A 3HKCA 3D8RA 4UU8A 2JIOA 4J7AA 1SOVA 1XYVA 2DQKA 2VDUE 3A1NA 5JRJA 5L45A 2HQRA 3BKWA 4DLWA 4EA8A 1OW3B 1X7GA 2ZJAA 4IMIB 2F3QA 3I39X 4AZWA 1N5KA 3NONA 3TLZA 4TXHA 4DUGA 5CNIA 4P35A 1HFEL 3RJ9A 1Z0UA 3JARA 5DBIA 4QTYA 1L4GA 2FW7A 2WUFA 3BDVA 4HYEA 1M3SA 3V4PB 4I55F 1GNVA 2QY9A 3HY3A 1XB2A 4BVKA 1R74A 3FRIA 4B3JA 3HI4A 1NU6A 1JR2A 3FJOA 4UPVA 1CQIA 1LX6A 3K2QA 5LQJA 1SIUA 2BMFA 2KBFA 3ETNA 4ISBA 2G28A 2ZJZA 3JQQA 4Q1CA 3AUYA 4BIMA 1AZLA 5TVKA 4ARAA 3K9QO 2YINC 4X54A 1ESNA 1WUHS 2XSZD 1U0FA 3R3VA 1QO7A 1OVGA 4A8JB 1SURA 3IP8A 4G5FA 1IAQA 4LJ8A 5K0TA 4GLOA 1QPBA 4LKRA 4LXTA 1GEGA 3WRYA 3Q0TA 4BB5A 4BMSA 5ITVA 3RANA 1L5KA 3AYZB 3JAKB 3VO1A 4KIFA 4IIDA 1E89A 1HE8B 2E9SA 2JFHA 5A4IS 3WRXA 1NQUA 3TW4A 1UBCA 2FPOA 4B3IA 4CDGA 5L53A 1W2HA 3EVCA 3BXGA 3JAWB 1RWMA 4ZCRA 4BKOA 4ZYLA 3R6WA 3FDZA 4ZI5A 2J7KA 1QCDA 4E5VA 3GNTA 5I47A 2QMEA 4UJ3A 4IGFA 1QIFA 1XHLA 1YZHA 2AYYA 2Y9MB 3BMNB 2G63A 3INGA 1E4EA 4K9LA 1WVGA 4DLYA 3SVLA 4KO1S 2VF2A 5EG5A 2GM5A 3VSAA 2CVOA 1QOQB 1RXYA 1E6CA 1K06A 1QVAA 1Z56C 2D2IA 2OM2A 5HILA 4R8SA 5NULA 3ZQKA 4NEGA 4PZDA 5IT0A 1BS1A 4IW3B 3FOEC 5KYWB 3MCTA 5G0TA 3RFUA 1NXXA 4NK5A 1JB1A 1GTL1 5EXPA 2BI7A 3C3YA 1E1QD 4UNQA 5SYAA 3ZX5A 3KOMA 3FMFA 2FA9A 3STVA 1WBJB 1Z5ZA 3OT1A 2HH9A 3T0GA 1G21A 4MGEA 4WK4B 1UC8A 3DM9B 3SGLA 2GM4A 1U2DA 2VAVA 4OXQA 2H4JA 1JYFA 1XCMA 1N0VC 3OX4A 5LNK1 1SG0A 4KPFC 3T6KA 4IOLA 1NVUQ 3UT5B 4F7WA 2H16A 4ZGWA 4NCBA 1DBRA 1CY0A 3RK0A 3VISA 4UNIA 1A8QA 2PVSA 3T5MA 1N3IA 3SAJA 5KX5A 2IYVA 3DQZA 2V7PA 3RAJA 1LD3A 1WHTB 4NCXA 1PZGA 4IJUA 3MELA 3P9XA 1IE3A 4X1OA 2W70A 4F8YA 1IXYA 1C1DB 2FFQA 4CTMA 1X8XA 4LRSB 2IIVA 5DHAA 2QN3A 3NHKA 2HB6A 2RKOA 2YL2A 3FNEA 5JNWA 1KEZA 2G80A 3LP8A 2A9PA 4IVNA 3QWBA 4N12A 4WASA 4NS1A 1KEVA 1ZY2A 2PH5A 1BDBA 4QU5A 4YYEA 5A2QA 1YI0A 2Y2UA 1Y8QB 4JASB 4B3FX 4AKTA 1DXYA 4AG5A 2DB3A 3X2EA 3GHYA 1S3SA 2PKCA 4JLOA 1J42A 4NI5A 4RABA 4XVUA 4C6RA 1GZHB 2A4KA 3H0EA 3QXCA 4ZP1A 4EGSA 1KBQA 2NZYA 3ZVLA 1NPYA 5I4KA 1E3DA 2HA0A 2Q6IA 2VBCA 3K5PA 3M3PA 5CVCA 2DPYA 3IESA 1I4EB 1BDIA 3HBFA 5T7BA 3D1LA 4YJ3A 3E5NA 3ZDEA 1YQWA 4CIAA 1J5PA 3ETDA 4TLDA 1UBLS 5EJEA 2AZXA 1G3IA 3DC7A 3FNFA 2DFDA 3PKJA 4AIRA 1UMDA 4XVRA 5FDFA 5JJCA 1TIPA 1T35A 3T7TA 1E7RA 2XTMA 3SDZA 4A16A 2FMTA 3RBVA 2ZE8A 1VHWA 5CLIA 4MRPA 3DEHA 1MH1A 1N1GA 3O2QB 2LCIA 3R3HA 5BRJA 4Z5XA 4QWWA 1NFFA 5FB3A 4B34A 2I87A 1H69A 3MAAC 2A5FA 3FI9A 1QCYA 4GBJA 1OJ7A 3CVOA 1QKKA 4BB0A 2RH9B 2WKPA 4PEVA 3SXUB 2XJ4A 2B4KA 1Z28A 2O1WA 2A0UA 4Y1RA 1FU7A 5E7QA 1LVGA 4ZT3A 2WF6A 1UZMA 3M4JA 1YIDA 4BLPA 1D09A 4MA4A 2JG3A 5JU6A 1O95D 1OXKB 4R98A 5A9RA 2WKSA 3CUUA 1YRWA 2JVJA 2YHAA 4JOBA 2YS6A 2A92A 4Z54A 1PO7A 1VE7A 2QUKA 4G97A 2H31A 1GGFA 4I4TF 5C1IA 2VQFB 4BNNA 4HEA6 2BGTA 4QOGA 2MSLA 2XGMA 3HUUA 3U0BA 4CG0A 1P4GA 2FRDA 5CT9A 4ZCQA 2DWUA 1T6YA 2P6OA 4N3GA 2ORVA 2XF2A 3ZZUA 4G6ZA 4BQQA 1T4CB 3GRVA 1TZMA 4LMBA 1KJIA 4HQFA 1E2PA 1XZIA 1YBFA 2VS1A 3IDAA 1EAMA 5A02A 4ZJUA 4GMDA 3R7BA 1T2UA 3QTLA 5AVVA 5LNK6 2I2CA 5FWAA 2R8ZA 2YJTD 5F4BA 1U8FO 3GLUA 1KVQA 4L7QA 3REFA 1YFLA 4OSEA 4OVKA 1SZJG 5AW4A 2ZSAA 1RWWA 3R09A 4X0EA 4QO7A 3KO8A 2WG1A 2FWMX 3U3DA 4CMEC 2AW5A 5I9MA 5TPWB 3RCBA 1O9GA 1SEVA 3SD7A 3TQSA 4BCCA 1RKBA 1WD7A 4M1KA 2NXWA 5KWEA 1VPLA 2WKRA 2NMVA 3JYOA 1KE2A 3SXJA 3TTWA 1Y6RA 3OFKA 4KCGA 1DEXA 1SVWA 4AROA 3KSZO 3MEQA 1IG3A 3FPBA 1E3QA 1ECPA 1YBVA 2QG6A 1WBBA 3FOBA 2JLSA 1DBVO 2R60A 4C06A 2WJVA 2O8EA 3R74A 1AA9A 4CKEB 1PFGA 3OZUA 5DWDA 1YU9A 4CKXA 1OX4A 1BN7A 2EL7A 1Y9ZA 2RH4A 1EUZA 4KLRA 4EPYA 2WIFA 3C2QA 4OQYA 5EOVA 3VDNB 4MSUA 2ZRNA 3DO8A 3DE2X 2AG0A 4GC9A 3V1NA 5D84A 3C74A 1P6XA 4X6LA 5TMDA 1LV7A 4ZU1X 4S0XA 3OOWA 9LDTA 3EZGA 3H65A 4AQ7A 1N2JA 1WUJS 1JWAB 1SBCA 2OV1A 1QP4A 4Z8XA 4AJ4A 4Q6WA 4EAAA 1LDEA 4UD2A 2XOKD 3SIRA 2ETXA 1W87A 4K40A 3WICA 4H0CA 1TZKA 4I3GA 5F2EA 4BQSA 5H8WA 2C2KA 3CB2A 5AHWA 3HTXA 4LOHA 1HE3A 3BIXA 3L8YA 4YAIA 3P9YA 4ZYUA 3WBBA 4MR7A 2V7VA 4AJLA 1NSYA 5AR1A 3K4HA 1ISPA 2XXAB 1N9GA 3F8WA 1P2UA 2MSEB 4M8SA 1VFPA 1D6JA 5DM1A 1DAEA 2HLDA 4ZXFA 1YVRA 3ZHQA 1F2DA 4KQIA 3NV9A 2PJZA 4KGZA 4UTXA 1MB2A 2AT1A 2WUWE 3D4NA 4HTFA 2UUCB 5DNWA 2GJKA 3HN7A 2AN4A 3G0OA 3I8SA 3AG6A 1T6BY 4IHKA 3F6EX 2HQBA 3PVSA 5DDIP 3RM3A 3I5XA 2C4KA 1ULZA 1NDQA 1L1QA 1P91A 2X0IA 1KDPA 8ABPA 3W2EA 4H6WA 4EJSA 1QPZA 4LDQA 3A4VA 1MOQA 3UICA 2DR3A 2WFMA 5COQA 3A1TA 4J0FA 4LJKA 1IPEA 1VECA 2VQ3A 3UY4A 4CIYA 2WYVA 3DZBA 5K8IA 3MSCA 4J9VA 1JG1A 1QO9A 3BCHA 4JL6A 4OU5A 3AEQA 5B1IA 5IH7A 1IUKA 1LBTA 3U44B 4YMHA 3TW8B 3OO1A 4FDMA 3KR1A 4RGVA 3DHVA 4BX3A 2HI0A 1E7MA 1NBME 1Q95A 4XIJA 1AD2A 1YJQA 5F1OA 3SC4A 5TR9A 2XNDA 3L6CA 4QYIB 4GVLA 3U09A 3OQOA 4OQLA 1FBNA 2IXAA 1Z3IX 2GN8A 3GT0A 1WNFA 4MLDA 3ROQA 3P9CA 1BEZA 2DAPA 2RG1A 5H4HA 4UDOA 2Q29A 4F6RA 3U4MA 4JY7A 2BBTA 1PK8A 2C88A 1US8B 1DOZA 1PV1A 4YJGB 4BMXA 4C3VA 4FLFA 3WYGA 1G291 3NVMB 1T15A 1WDLA 5D2CA 4J16A 4CM4A 3I5AA 3IRUA 4A36A 1ES9A 3R76A 3RT9A 2Q45A 4AJHA 1AT1A 1VCHA 2P6UA 4AMVA 5C37A 1BROA 3Q5EA 4PYLA 5G3YA 2WHEA 2H2GA 2B0CA 1PSZA 2YXLA 3TE7A 3ZNNA 4I55B 1R6VA 3CT4A 3QBJA 1QR6A 4MB0A 1WUKS 2OMKA 2XCUA 1JG2A 1UM8A 2I7CA 3G02A 1RADA 2J4DA 4FFVA 4GKAA 1LJUA 2PVPA 5FJIA 4NR0A 4RTNA 4JI7B 5CDFA 3SM9A 5CDTA 3MWEB 3U4GA 1ISSA 5A2GA 1EEHA 4R8RA 3UKOA 3SC2A 4ZFNA 2F4NA 5EP4A 1T4MA 4UU7A 4JVSB 1EWKA 1ZC3A 2X6TA 4TZTA 4KE6A 5CA1A 4FFBB 1JDVA 5K20A 4O2BF 2NX2A 1C2YA 2IYWA 1EM8B 2V3VA 2JEZA 5FI0B 5LP6A 1CE8B 1O9HA 3ZNPA 3DKKA 3FBGA 2IS4A 2XADA 3K6SA 2QRHA 4DBLE 5I7OA 2QTVA 5CBKA 2PMCA 5EMKA 1KERA 2JK0A 2DUJA 5DOZA 1KF0A 3VYRB 5LDDC 3TQCA 2YNMC 2JFBA 2AFHE 2I03A 3R9XA 5LMZA 5CVJA 1CQJB 1FTSA 1PVVA 2K2WA 4B75A 3DXFA 4RD1A 3OCCA 1RVDA 3VPAA 3AONB 2VBIA 1R0WA 3VR6A 4DIKA 1OFIA 1KDRA 2QRZA 4E14A 1K3UB 5F7XA 1SBQA 1MO2A 2WTBA 3A7DA 4U5QA 4AD8A 1JFTA 1ZIPA 1R9JA 3R3XA 5FORA 1TD1A 4HWKA 1F8FA 2HK7A 4F93B 1IB6A 2VNKA 2FPPA 3IT1A 4EG7A 3REOA 2EBFX 3TIXB 1HTWA 3KSMA 2WAXA 4ZHQF 4IGKA 1GU0A 3QUQA 4O25A 1VJ1A 1T4CA 1DQYA 1X92A 3EFOA 2OZEA 1KDZA 2I8AA 3HA3A 1Z4MA 1SHZA 3HRHA 1T0BA 2PXAA 3NM6B 3T4UA 2OGSA 4JV5B 5ICFA 2NYUA 4JVLA 4DDKA 4L50A 4LZZA 3L6RA 1DKPA 4OL0A 2VKQA 3RGWS 3I2YX 4L5CA 1Y9DA 2WWFA 3GEGA 4C4PA 4GOND 1CZRA 1FP2A 1UWVA 3IP6A 1K7XB 2PEZA 1R64A 3AVPA 3E82A 3LF2A 2GO1A 4XPIB 1QFYA 2ECQA 1VMKA 3MIZA 3X0DA 3HR7A 1PG5A 1TZJA 1RE1A 1Y8RA 2XKBA 3K2BA 3L93A 4U7JA 4EI8A 1RS0A 3CBQA 3L46A 5TGZA 2ZYIA 1XMIA 3F7MA 3U3RA 4RO0A 1VHQA 3B6ZA 3IB6A 3OTOB 1E63A 1YDFA 1GKLA 2O8EB 5TT0A 1L9XA 3CO5A 1XCBA 3GWZA 3Q7QA 4FGKA 4DLSA 3PNYA 1XXHA 2QQFA 4DJAA 4CCYA 3GA0A 1DEAA 5CH8A 3JD1A 2QN2A 2R7MA 3HJBA 3LCCA 1HZZA 4Z4CA 3LCRA 3DZFA 1N2CA 1QMGA 2P9FA 3FVTA 2NM0A 5K05A 5K2MA 2XDAA 4ZC1A 3A36A 1NIJA 3MRTA 4PWZA 1R9GA 4H3VA 2GWHA 3FN4A 4BB9A 3K6KA 4NTZA 1B1AA 2A1TS 2Q3CA 4LY3A 2DWPA 2HHCA 2IYEA 2H9AA 3I4FA 3O8QB 1J8DA 4RLFA 1PT8A 5I8WA 3FJYA 4EX7A 4IIJA 2IK8A 2O7SA 4IZ6A 3VX3A 2DQZA 2GAFA 4J0IA 4AZ0B 2H1CA 3E9MA 3L0SA 1XCPA 1JA1A 3L8CA 1P80A 1R0YA 4WN9B 3HWSA 1O97D 1RBZA 2HA7A 2P8JA 3F0TA 2OO5C 3V1TC 1NVXQ 4IICA 1QFMA 3FTPA 4GMKA 2NYVA 3WE7A 2Z0MA 1GAXA 2O57A 3QI2A 1AZTA 4X6XA 1PFVA 4J3JA 1GAEO 2WIGA 5D85A 1SHJA 5DHQA 4TXLA 4P7JA 3ABRB 3IAS6 4NZOA 4WEQA 2X5JO 4RC9A 3ZCQA 5ICSA 4ESEA 4X66B 2G9RA 4TWZA 2J5KA