4UCWA

Structure of the t18v small subunit mutant of d. fructosovorans nife- hydrogenase
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
263
structure length
263
Chain Sequence
TAKHRPSVVWLHNAECVGCTEAAIRTIKPYIDALILDTISLDYQETIMAAAGEAAEAALHQALEGKDGYYLVVEGGLPTIDGGQWGMVAGHPMIETTKKAAAKAKGIICIGTCSAYGGVQKAKPNPSQAKGVSEALGVKTINIPGCPPNPINFVGAVVHVLTKGIPDLDENGRPKLFYGELVHDNCPRLPHFEASEFAPSFDSEEAKKGFCLYELGCKGPVTYNNCPKVLFNQVNWPVQAGHPCLGCSEPDFWDTMTPFYEQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords HYDROGENASE (NIFE) SMALL SUBUNIT HYDA
publication title A Threonine Stabilizes the Nic and Nir Catalytic Intermediates of [Nife]-Hydrogenase.
pubmed doi rcsb
source organism Desulfovibrio fructosivorans
total genus 78
structure length 263
sequence length 263
chains with identical sequence B, C
ec nomenclature ec 1.12.2.1: Cytochrome-c3 hydrogenase.
pdb deposition date 2014-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01058 Oxidored_q6 NADH ubiquinone oxidoreductase, 20 Kd subunit
A PF14720 NiFe_hyd_SSU_C NiFe/NiFeSe hydrogenase small subunit C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NADH:ubiquinone oxidoreductase-like, 20kDa subunit 4ucwA01
4.10.480.10 Few Secondary Structures Irregular Cytochrome-c3 Hydrogenase; Chain A, domain 2 Cytochrome-c3 hydrogenase, C-terminal domain 4ucwA02
3CURA 3AYXB 3ZE7A 5JRDS 1FRFS 4IUDS 4UD2A 5JSUA 4UEWA 2WPNA 1YRQA 4CI0B 4UPVA 3RGWS 3ZEAA 3ZE8A 1UBUS 5A4FS 1CC1S 1WUJS 4UCQA 4TTTS 1WUIS 4KN9S 1UBJS 5JSYA 4KO2S 4U9HS 1WUHS 2FRVA 3CUSA 1UBTS 4UE3S 4UCXA 1UBOS 4UQLA 3AYZB 4KO3S 3ZE6A 3H3XA 5A4MS 3MYRA 1WUKS 4UCWA 4UPEA 4KO4S 1YQWA 3ZE9A 1FRVA 4UEQA 4U9IS 4UE2A 5A4IS 1WULS 5JSKA 1YQ9A 1UBMS 4IUCS 4UQPA 1UBLS 5JT1A 1H2RS 4KL8S 4OMFG 4KO1S 5D51S 1E3DA 1UBKS 1UBHS 4C3OB 4IUBS 3USES 4GD3Q 3USCS 4UD6A 4UE6A 4URHA 5ADUS 3UQYS 1H2AS 5JSHA 1UBRS
chains in the Genus database with same CATH superfamily
1XGKA 3EJ6A 2QZPA 5HOEA 4DV1B 1XELA 2GF9A 1L5SA 3M70A 1M8PA 2VUIB 4ES6A 3ADCA 2AN5A 2PKEA 3GBVA 4W8GA 5A4JA 3TMYA 1YE8A 1IU9A 2D3WA 4OBXA 4AYTA 1XTUA 2DVMA 3UH0A 1JR3D 2Q3BA 4L95C 2H31A 3IBSA 1U2GA 1DIRA 5A04A 4D42A 4Y0NA 1OIVA 3JQAA 3MJTA 1SXJB 2V3WA 4U2FA 4BQQA 3PQ5A 5AJUA 1ONBA 3T7AA 1IZ0A 1XZCA 4JYCA 1RXEA 2H7YA 2NU6A 3WLKX 4GOKA 2O2JA 3IUQA 5G2OA 3S99A 1SY7A 4EZBA 4F2DA 5G3ZA 1TIBA 1JLKA 3O75A 3AUJB 2X4DA 5DTRA 1TJ5A 1X7WB 2BKXA 1YL6A 1Y9DA 1MXFA 2VO1A 2PWBA 1PR1A 3ZLJA 1NIPA 1LK0A 4B84A 2YY5A 1OYWA 3HJAA 3IEMA 1V26A 3COPA 3MBIA 1E6CA 4TWJA 5IFKA 1I7QB 3FCOA 1A2QA 4J3FA 3JASB 5E7QA 4M8KA 3AUSA 1DFGA 1XI2A 3DE4X 4G5HA 4AJHA 5CVTA 2BDEA 1L4BA 1IN6A 3KU4A 1T4CB 2QRZA 3L6CA 4MUFA 4Z4EA 1M1YE 4IHQA 3UT5A 3D6MA 3DTYA 1QCDA 2G36A 2AQIA 5TJHA 1IVYA 1SKYB 1NMSA 4CKXA 2J0VA 3JQ7B 4RKYA 4CG2A 4DVJA 1EXWA 5FWXB 1RQNA 1K6IA 1I7LA 4J6FA 2VP4A 1UJNA 2BGRA 5DM0A 5EZYB 1DL5A 2KI5A 4BQIA 1ZWLA 2W6OA 2PA0A 3DWGA 1Z0ZA 1GNRA 3T7KA 1OXVA 1T29A 1Z36A 1P4AA 2FUEA 5FOSA 4CL2A 4PSCA 5ES3A 4RVDA 1OWMA 3ED1A 2P9TA 4IIGA 1W1WA 4RVFA 1F20A 1VJGA 1ZL0A 3H5VA 5FR2A 4F5DA 4R0NA 3TLKA 4YUZA 2HTFA 2R1VB 3FGNA 2OGZA 4KVFA 4ZRMA 1QHGA 3KB2A 1JVBA 3K20A 5AI0A 4ZAWA 4PHCA 2WZCA 1N9ZA 1SFRA 1G3UA 3D5EA 1V6CA 1D2RA 3CEAA 4AZ0A 1Q0QA 4RWEA 3ZE2B 2P4SA 2VK1A 2WVGA 4L07A 1G4UR 2DBYA 4EYEA 2JANA 3BZUA 3FROA 2XQKA 1Z3IX 3I1JA 4B2PA 4DF3A 2VZ9A 1S89A 2X3YA 3AY3A 4QQ8A 4X61A 1MO6A 2OAEA 4HQNA 4QYIB 3NJ8A 4EHBA 4IQ4A 4JQYA 2LE0A 4Y2QA 4D56A 4BMCA 5J1SB 2VRBA 4QJ5A 5A1TA 4XLTA 4BV8A 3H86A 2GAOA 3VDNB 3LRPA 4QTTB 3ZU6A 3ZQ4A 4GM0A 1JU9A 4AY4A 2WG1A 1PR6A 4UJ3A 4CKBA 4F4IA 3VR3A 1MPXA 4B6FA 1YQXA 2P0EA 3ETHA 4WOJA 4KRYA 2Q7OE 4KEAA 5ALRA 1V8OA 2I4RA 2JFPA 1ZIXA 3WSTA 2GA8A 3KBBA 5EMJA 4BQEA 1M2VB 3IKLA 1T3SA 1GNQA 2IHKA 2J3MA 1FQOA 2EFYA 4H7EA 4IIHA 4KVAA 5EJ4A 3RBAA 2FW7A 1VHTA 3R23A 4WXRA 1W73A 2C5GA 4LNUA 1NBHA 2R7KA 2QN8A 3F5DA 4TUYB 4UVGA 5ESDA 4BVKA 3HO1A 2AHOA 3LKDA 1M6VB 2WD9A 3EQ6A 1U28A 3FOWA 2A0XA 3HVUA 2IOFA 2XOXA 5DX0A 2HCJB 5ALTA 3T7IA 2YRXA 4JFRA 1DBPA 3TM4A 3UAXA 1DRJA 1MJGM 3TOXA 4IPTA 4BVBA 3RANA 3DMTA 3I2GA 3F3KA 2JVIA 3ET4A 4Q37A 4AUEA 5IJXA 5AJVB 1BS2A 5EAIA 4G0OA 2C61A 3IODA 1G0OA 2FPMA 1QPGA 4TTJA 1SOUA 3NHLA 4ZVMA 1B42A 5T3YA 5TMBA 1PEDA 1K08A 3R6DA 4HB2A 4PZLA 3U7GA 1EDOA 1CZUA 4LY6A 3RR2A 1Z47A 2P4EA 3H5AA 3LT2A 1XZQA 2ZYVX 1BDIA 1WAMA 4MV5A 3AV0B 3R7FA 3ICPA 1P17A 2HWUA 4DPKA 2ZTVA 1JR3E 1B2LA 3KQMA 2ZUEA 1ZD5A 3PXDA 1FSGA 1LC3A 3DDUA 2PZEA 4YJHB 1Y89A 5JV5A 2FCRA 3ASZA 2PN1A 3D4OA 3OF3A 2OXTA 4P86A 4U7FA 1F6BA 4LQCA 3DV2A 2B92A 2ZE7A 2HRRA 1N5IA 1NONA 1ESDA 4FCCA 4DQXA 3DEYX 4JIMA 4IQFA 3A4TA 4A0FA 1WXIA 3D5QA 3K1JA 2V7QD 1T26A 2VUHB 4YLGA 1RYHA 1L5GB 2I8CA 1AIPA 3D81A 3H1PA 4G0ZA 1D3AA 2FWJA 3R0XA 4NZPA 5B30A 2VWGA 4H3VA 1U2DC 2WYIA 2ZWVA 1G21A 1GZUA 1KK2A 1DOAA 2G0TA 1G17A 1AHNA 2R60A 3AQ4A 1XX6A 4M1KA 2V3CC 2H2FA 2ZIFA 3LW8A 3OQJA 3KZMA 2GPNA 1SBTA 4DM7A 3KXKA 1M72A 1EDZA 2B1JA 3H1TA 4S12A 3V8RA 4JITA 5ALZA 3ZWMA 2NO9A 4ARZB 5TVKA 1NTOA 1SG9A 3TX6A 4BFZA 1G8JA 3HYRA 3RS3A 2WQ6A 4DQKA 2NNLD 3BTSA 3GLTA 2PUWA 1XFAA 2MSKA 1V1RB 2YWJA 3IVGA 4HPJB 2IITA 3W3AH 4EYKA 1FSPA 2NLOA 5KTSA 4D4MA 2B1GA 3A06A 4ZGGA 3K8ZA 5BWNA 3WGVA 1RXVA 1FYFA 1JILA 4J49A 1DWUA 3KHSA 1O57A 1PLLA 5TY0A 1CTQA 4YGYA 3HJRA 1JVSA 3LYHA 1F2TA 4O4IB 5MN5A 4D9NA 1RRVA 1UXHA 5EE5B 3JQ9A 3PFFA 5COAA 2FUKA 3TPCA 3MTBA 3O47A 3OFKA 4FJ0A 2BTQA 2R96A 2W0MA 3DVAB 5ER9A 5J3JA 2C2XA 3ORRA 5L3ZA 3Q7QA 4U2GA 2VHWA 4LYGA 4I8DA 3T5MA 3BRCA 3GXBA 5L3QA 4TV8A 2EKDA 3VJRA 1D5CA 2C54A 3GJ3A 2IUUA 5AOAA 1M1NB 4JCCA 1J20A 4Y6LA 1LKZA 3C70A 1JKMA 3KJFA 4YHHB 3ZX5A 1O0CA 2IS4A 3TSOA 3ADOA 2H2DA 1AF4A 1TMYA 2QS9A 2XA1A 2R6DA 5D6OA 3VV3A 2XWQA 1A9YA 3G85A 2VTKA 4EGJA 2QVCA 1Y5LA 1S2LA 2EX4A 3U7IA 4CFZA 2PGIA 2Z6UA 1OTYA 2VPZA 3WJ1A 1CZNA 3NAZA 5KQLA 2OENG 1DO2A 1KR5A 1YHZA 1UKZA 2FW9A 4P7GA 1SVUA 4UBOA 1VI2A 3QYAA 4Y6QA 3N7UA 3ROZA 3D0QA 3WGGA 4YPVA 3UOGA 1UR5A 2CHGA 2UZ3A 3W4KA 4AZ3A 3H18A 3HVIA 2JGLA 4KH0A 4FCVA 4KOAA 2LIVA 3A9TA 3H5IA 2JFBA 3I0ZA 5FOVA 4JP8A 5AJTA 1FBNA 3ZY5A 1YFLA 1QU3A 5BMVF 1XJ0A 4R2IA 1X7XA 4Y2PA 4ZEWA 2NYRA 1Y6FA 1QYWA 3U5TA 1M75A 1BRMA 4IGAA 3UZUA 2ZIGA 4BS9A 5K0TA 1B0UA 4R2LA 1VYUA 4EGAA 4HMOA 1AHHA 2EL7A 1NL3A 5DGIA 4C78A 1O4WA 4COKA 5KNBA 2WSSA 4UFNA 3N1UA 2OESA 4YQZA 4KE6A 5FQNA 1O0BA 1P2VA 4G0NA 3IULA 2ATXA 2CBXA 3P4XA 1X7DA 1QF9A 3UCFA 5ALNA 1BX0A 1JIVA 2AG0A 1I3OA 2QVGA 3OT4A 1IL0A 1VGVA 4Q4JB 5L8VA 4XASA 1JA9A 1V96A 1UP7A 1O6GA 2VNKA 2WVHA 4GZ6A 3S2SA 4BLUA 3WRXC 1UBFA 4XQCA 2ZYGA 2O8NA 1T3LA 2XLCA 4KIJA 4RF2A 3RH0A 5I48A 1U8EA 2BJWA 3LUDA 1FNMA 2G5TA 2X5XA 3LWNA 3QBTA 4FMDB 4KBYA 2QG4A 4HAUA 2RGUA 3SPXA 3UMSA 2ODBA 4C4PA 2F1RA 4NNJA 1A5AB 1P80A 1VZ2A 4IIJB 5ARCA 4TZ0A 1JUDA 4EGCB 1SXJA 3UA3A 4AKGA 4MHOA 1XMQB 4H16A 4AP5A 1HSZA 1A04A 4YRQA 1YVDA 2F8MA 3ESBA 4PC7A 3OLQA 4IMRA 2C9MA 5FUVA 4BNMA 5K45A 1C0KA 1PZXA 2D1YA 2IZ7A 3JZAA 3JQQA 2IS2A 1QHHB 4Y2YA 1WD5A 1FLVA 2FPXA 2I6TA 3TLYA 5FWYB 4LF7B 4ALKA 1KQOA 5EC8A 5AKXA 1XDSA 4TX1A 4NK4A 4UNIA 4WCDA 1XJCA 2IXDA 1HURA 3G8CA 1XL1A 2AZMA 3L6BA 1GGMA 3ML1A 4I8IA 5GY7A 1Z5GA 2B9EA 5KCMA 1DGQA 1NE2A 3MVEA 1SBYA 1OJLA 2RB4A 3LXRA 3UWSA 3K5HA 1A8UA 1IOVA 1DBRA 3QYFA 3BSFA 4GVPA 3W90A 5JAHA 3JASA 5CCXA 4KO1S 1CIVA 5HBRA 5IHXA 4DV5B 3L4BA 3H2ZA 1EEXB 2X6RA 3BD7A 1GFWA 2C3OA 4ETIA 3W05A 1PJLA 3AJEA 3TF5A 4I8XA 4O2AB 4X91A 1GSIA 4FFVA 5H16A 1OZAA 4BLTA 2W4MA 5FWXA 3QXCA 1H1LA 1CZOA 5GM2A 4BYMA 4UNRA 4UC0A 3SJCA 3PGVA 2P2SA 4CL8A 3SM3A 1KRXA 3WY9A 2CBGA 1DQZA 4FE3A 2I2BA 4FXPA 3I9JA 2SKCA 2YC4C 5I8PA 2IYAA 4DKXA 1RU3A 4AUNA 1NI4B 2JCSA 3WLOA 1AD2A 2ODAA 5I7SA 2DFVA 4HKTA 2GPBA 3FNEA 4IFIA 3W2TA 4UEWA 4J75A 4IMPA 1F5SA 3KKOA 1YDGA 2PL3A 3N6XA 2R1VA 1V6SA 2AGVA 4LDNA 1U3WA 1YA4A 4H0CA 3I39X 1NDQA 1LX6A 1L8QA 1TKCA 4QBIA 5CNJA 1XG5A 4GC9A 3EYWA 3JQ8B 3I1IA 5EQTA 1PG0A 1QGOA 2HJVA 2X0KA 2VZEA 4RD6A 5L53A 3DP9A 2FN9A 1OF1A 4EW1A 2HLHA 2XOKD 3PT5A 3T15A 3WHPA 5EZ6B 3DPUA 4QYIA 3HJBA 1MAAA 5IU6A 4XA8A 3BF7A 2PUAA 3TEJA 5JU6A 1II8B 4ML3A 3MBKA 3EEQA 1E9EA 1K6MA 4UZFA 3HYSA 3PC8A 1Z2CA 2J7PA 2X76A 1SC1A 3K0FA 1SZPA 4QPJC 1YS6A 3RS4A 1BVHA 2YCLA 3FZQA 2Y0PA 3NTUA 2R7MA 3VVCA 1F0YA 3WGJA 1RRMA 2OEPA 1S8OA 2QT0A 3DZDA 3EN0A 4UNSA 4W7IA 2BCEA 4CW7A 3U1VA 2WJJA 5DGCA 3L41A 2R1ZA 5HSGA 4RIEA 2ONJA 4AG3A 1OLUB 3I6MA 5DWVA 1GTG1 5FUXA 1GAJA 1T8TA 4XE5A 2B98A 3L8CA 5MGNA 1RQRA 2PKRA 1AMOA 1WL8A 2GZ3A 2HFKA 2Q4RA 1Z56C 3B2NA 2QW8A 3GA0A 1UZNA 2I65A 1PJ4A 3EUEA 4RYLA 1PBTA 4K6CA 1P7ZA 3QVXA 2QTVA 5T6MA 1N7HA 3WGYA 1VPWA 2IE8A 1E0AA 3AO0B 3BDVA 1WV0A 5E2AA 3FY4A 3N59A 2JARA 1LQ2A 1M1YB 3IP8A 1Q1BA 4HJRA 2R6R1 2ZUWA 3FHLA 3CCCA 4TUYA 4WFQA 1SHZA 2N42A 3L3BA 4KMMA 2VQ3A 1M6VA 1R10A 3KBOA 1YMUA 4R1SA 3GMDA 5EQFA 4G0VA 5P21A 5I47A 2C88A 1E9FA 5D3ZA 3PUVA 4PAMA 2DE0X 5LZ4A 1X13A 4FMPA 1K6EA 2J3JA 1VPVA 4HLNA 4TKLA 1J00A 2VRCA 5F52A 1JEQA 1IY1A 1ONNA 1D1PA 1RLTA 3I09A 4KAJA 3ZV3A 3D2AA 4H27A 5TPZA 1L9XA 1AQUA 4GPZA 5BURA 5JATA 1TCBA 2VPPA 1AB6A 3JS5A 1WY7A 3B82A 3GFBA 4LJ7A 4TRJA 2GD6A 1JEDA 3RC3A 4XVUA 3MMNA 4XH9B 1QBKC 2CJWA 1M0EA 2IVFA 2ZJBA 3NTRA 4JUIA 4LFBB 5KYNA 5LDDC 2VSFA 2IEGA 1WPXA 1ZZGA 3HY3A 3WGZA 4A1FA 3V55A 3TQCA 2QXYA 4LMAA 4OQ4A 4IEIA 4Q3EA 4BMZA 1QYCA 3NXSA 1E6WA 1TAQA 2HUPA 3DBHB 1XN4A 2B4TO 3B1KA 3H9EO 3B6ZA 3JX9A 4RGQA 1RNLA 4ARSA 1FOEB 3P5BA 4LJAA 2WF5A 3HV0A 4F6RB 2AG1A 1IUPA 2QF7A 4RZIA 1C3LA 3EVNA 4C3OB 2I4OA 5F3RA 3WLSA 1PYDA 4D4LA 2POQX 2VHTA 1UM9A 1RCTE 4G1VA 3ZKWB 2ZRFA 2VBGA 2XEDA 1RKVA 3VDQA 4RIGA 5FTKA 1FDVA 2W98A 1JXQA 2WF6A 3BJEA 3FFXA 4FFPA 4DDMA 1FTGA 1RXCA 4XDGA 1UBRS 3QWFA 3TB6A 4AKSA 5CB4F 1TZMA 4NEGA 5AVJA 3DLPX 2GSWA 5JMWA 1B6SA 4FDTA 4BRWA 5J23A 4RKQA 4NYJQ 1OHHD 1H0RA 1CUEA 2WVAA 5KYVA 4AY6A 3PIDA 3ZJYA 2BBTA 3G2PA 4IS3A 4OX9B 5CDFE 1T91A 2ET6A 3DE2X 3LSTA 3PEWA 1Q0ZA 2VF5X 1F0KA 4RV9A 4OXIA 3RHTA 4ARZA 4DGSA 2PX8A 2BFOA 3L0BA 4Q5IA 1CJBA 2BF4A 3ENQA 1V1RA 4GLLA 3TRHA 3IMEA 4EHAA 5KVCA 5TLSA 3AI2A 1VMEA 2C5LA 4PW0A 4BU0A 2Q50A 3BOSA 4PAGA 3LP6A 4B8YA 2DCUA 1T4GA 1W9MA 3MTEA 3WXBA 5ETJA 5AQ1A 2HHAA 4M87A 1PZFA 3SDZA 4BDTA 1EVZA 4O4IA 5DI3A 3HCAA 3PEFA 3JTMA 3N2KB 3D8RA 3PDUA 4KXQA 4TKVB 1LI7A 2N3ZA 1M7GA 4EKGA 1KYIA 4U39A 4FCTA 3DJFA 1PJQA 4R2JA 1WZCA 3DVAA 2K7FA 3DSRA 4EB3A 5H3HA 1MXHA 2A7QA 2DBVO 2VZLA 4YP7A 4AJEA 4CM8A 2BMJA 1G9TA 2IXGA 1IWBB 1XF9A 3FSEA 3WMEA 5EIEA 3RRYA 3GK3A 3AMVA 2BGIA 3RC9A 5BSFA 1JXOA 4OXRA 1CUHA 1V39A 4MUBA 3CMMA 2VYFA 3KXIA 4MQEB 4MLDA 3VC3A 1M1NA 4L4SA 3SSOA 2YJ6A 3GRUA 1VKZA 1TO2E 3I2YX 5K0EA 1Z2DA 2C92A 1C8LA 1JQKA 3MTJA 3HGMA 5I4KA 2EV9A 4D9MA 3RTGA 4CF7A 1J49A 3RFVA 3R7WB 4MVJP 2DKOA 3K94A 2JIBA 4D74A 1T4DA 2WIGA 3CXRA 1II0A 1T9GR 4MHSA 4B3XA 2I03A 3P19A 1ZP6A 1P1JA 4HZUB 4BRSA 2O59A 5KJEA 4G0MA 5IN5A 9ATCA 1T5OA 4COOA 3FSGD 4EMBA 4DUYB 3E8SA 3I73A 4DSOA 2GF0A 3C7AA 2PSHA 4YDHB 1IVSA 3NAMA 4F2WA 2HSJA 1OQAA 4M9QA 1YB2A 4PF1A 3WA6A 5KOHB 2WYVA 4DLYA 1EG2A 2HMYB 2FDCA 4G01B 2QTAA 5DTIA 4GXTA 2QQEA 2RHHA 4OYRA 4PZUA 3TINA 3U62A 1E0DA 2X5NA 3PLAE 3EGWA 1CQZA 3LSYA 2JLCA 1NU6A 4QICA 4GIBA 2R8ZA 3EVBA 1QK3A 5KDLA 3UHFA 2E4VA 1PDWA 1E3JA 2ANCA 3GLFA 4FYWA 4XAQA 4BMDA 2JRLA 4XGKA 5EKSA 2J9XB 4QARA 2AXNA 1K89A 3H87A 1BEEA 3TTXA 3ETDA 1J90A 4FLEA 3WGQA 1HTBA 2G1UA 3NGLA 3D6UA 2FZKA 3LTNC 3UC9A 3UG6A 1MT0A 2PRZA 3GIDA 1ODLA 3N58A 1DBVO 2IV3A 1ZLYA 5JANA 3G7UA 1ISIA 2XQVA 4Q4JA 1L3CA 3ELYA 3TJRA 2QYTA 1N0WA 4BP3A 2Y1FA 3ZJ4A 3P9QA 5B4TA 1Z0JA 5AW4A 1RPAA 2A0UA 2PXXA 2QLLA 3KQPA 4Q05A 4WNCA 4A5OA 4L5BA 2ZDHA 1JAHA 1TADA 2X5OA 2PTHA 1OD6A 3OHMA 4Z5XA 5IMBA 1M6YA 1DC4A 3TVTA 1W34A 3AIMA 4E22A 2QX7A 1P4GA 3JD3A 5FBHA 4G8BA 4NYJR 1VE3A 4MJ3A 5FYQA 5J2TB 1IPFA 2P6PA 2XMQA 2ZOSA 3MGCA 4AG5A 5CYGA 1MBZA 4OQQA 5AK4A 1X7GA 1AHPA 1EQUA 1GTVA 1H1TA 3LT5A 5E9WA 1R1DA 1WXXA 1AX9A 3EWSA 5ELLA 3F6RA 1HF3A 1QHHA 2X41A 2DSTA 4F6CA 1A2BA 5H68A 1R7RA 2WBLC 3TIFA 5FWYA 1BA2A 3AHFA 3HDYA 5EJFA 1ESZA 5BV8A 4C7KA 2WFMA 3URKA 4DCMA 1L5LA 4C0QC 1ZCZA 1EDDA 2XODA 4YV7A 2WLTA 1R4AA 2OK7A 3ILSA 3LD9A 4EUKA 1JJVA 1YZUA 4TMTA 1ENOA 1C1XB 1FPQA 2YV4A 2AB0A 4QNNA 4YV2A 2KLHA 3HNOA 4YJFB 1E3QA 1SA0A 3TECE 3UTDA 4WI1A 4M99A 2HMVA 4RTKA 2H8KA 4FINA 2A9VA 3W77A 2FMFA 4TRMA 4JLAA 3FH0A 3HCOA 1A4UA 1PV1A 4NFLA 3GGJA 1S2MA 3FCSB 3Q9NA 2C2GA 1QVAA 1L7VC 1VHWA 1ZJZA 1ZMBA 4KRGA 2YHBA 1RXSA 2P8JA 4UUOA 4DV6B 3HGQA 2XRFA 2GBLC 4W5OA 1E98A 4M1MA 3SDBA 3GDHA 4JVSB 4NIMA 1KEKA 3N76A 1M10A 3AWDA 1YJCA 4B6JA 1WHTB 2HYIC 1E32A 4FGKA 3HEAA 3PGA1 2NYVA 3EODA 1T8WA 1TNDA 1E8DA 1HZZC 4UEOA 4D8XA 2I1WA 2ZUUA 3AYZB 3HJCA 2DBRA 1MW9X 5H70A 4Y3UA 2P67A 1IUKA 1A8QA 1SHLA 3PICA 4Z9BA 1SCDA 3RC2A 1Q3HA 1PG2A 2ZRPA 4HADA 1BFKA 3D6FA 3V80A 2FQ1A 5D5HA 3FHCB 4F4CA 1W4BA 3X0DA 1KAEA 2GRUA 4MA0A 5FA8A 1KP2A 1P7PA 2W2VA 4D97A 4AU1A 3JQ8A 1I0LA 5F1YA 4C0BA 2JGEA 2G80A 4ONEA 1R9NA 1TMKA 3NWBA 3DCYA 1ZICA 4OPMA 3ACDA 5KHAA 2JD2A 2QRQA 5JFGA 2XSZA 2W7TA 2ZIZA 3LUCA 3G0HA 4FE7A 1VLZA 3LPAA 1T0PA 2WTAA 3L0DA 4J8PA 4MGIR 4RIHA 1NASA 1MHPA 3C0KA 4HNHA 5K0NA 1Z37A 1Y8AA 2B36A 3AH8A 4NKRA 3X1YA 3ZWAA 2QVXX 4MVJI 1U2DA 3FWHA 3KKPA 5D3MB 1JG6A 4BP8A 2OM6A 4LXUA 4Q1FA 5EXTA 5C5DA 3ZWBA 4YNBA 1YRAA 4PZCA 5HUHA 1OLUA 1Z88A 1ZNWA 5HPYB 4KNWA 5FUWA 1OYVA 1X3SA 1L7OA 1XQ9A 2D2IA 4WSOA 4CMBA 2P9BA 1HYQA 1CZHA 3RV4A 3WR5A 4MYHA 3VO8A 1JP7A 5G3YA 4LDAA 4FYVA 4RTPA 3JAKB 3COSA 1MIOB 1U7PA 1Y7IA 5H80A 1KVQA 3M9WA 3SE0A 3MQFA 3KE9A 5EWJA 4DA9A 5E9QA 2P0AA 4YPFA 4E14A 1YULA 2IDMA 3D9QX 2CNLA 5BSRA 4P9NA 2JCBA 3EG5A 1RRPA 3MJHA 2FWPA 4BFVA 3GCDA 4DT1B 4EG7A 1D4FA 1E1NA 1G6Q1 2AMLA 2H29A 4GU5A 1L9KA 1E62A 4KQ2A 4QOEA 5CMLA 4ESEA 4F3CA 1KS2A 3EPRA 4FQ7A 1S8NA 2NSDA 2I4LA 2ENWA 4JT8A 1JTFA 4PC6A 5AD1A 4YCLA 4EB8A 5IC4A 2BLLA 3L8EA 1KJ9A 3SOZA 2W22A 1DQRA 2HSZA 5KWJA 3NZEA 1L3IA 3IHKA 4Q01A 4WKBA 4UTPA 4GAEA 1VSQA 3S8MA 1OC4A 1R6AA 2BR4A 3G9UA 4DLZA 2WMDA 4QVIA 2RAUA 4P53A 3QX9A 2DU8A 4MV3A 2X0DA 1GXSB 3CWQA 4RHYA 2ECFA 4QGFA 3EARA 1H65A 1V2HE 2GN2A 1SCKA 1U7TA 3QMWA 2XV1A 1DKNA 4GOXA 1DAHA 4F6RA 2ACVA 2ZEJA 5FTJA 3A1TA 1C4OA 1S96A 1XD9A 1I7PA 1Q14A 2DWQA 1F0PA 1GZ5A 5HXAA 3ZKWA 3TOZA 4HVAA 1P4HA 4KTTE 3AUAA 3FNFA 4S3MA 1M8FA 5L7YA 3JSAA 5TS2A 1T8PA 3JZFA 3NHRA 3INGA 1ABBA 1LPOA 5LFAA 4RF3A 2FV8A 2QM0A 4OEHA 4Y2TA 4HWPA 2QW0X 2EQAA 2MYTA 3PUKA 5ICFA 1ZK3A 3SFTA 4E5NA 4Z2AA 4UOZA 3AEQB 1EM6A 2CXOA 5B58C 4FKZA 1USWA 4JOSA 2WE7A 1GGEA 4L50A 4KIWA 4FJ1A 4HNVA 3IB3A 1R6TA 3RSLA 1QHXA 3GMTA 1YQTA 2FNAA 4RZQA 3BTUA 4DWWA 4EG4A 1RKBA 3UF0A 5AQEA 2J5RA 1BCSB 4Z4HA 4A2PA 2QNIA 4I46A 5HF6A 5DBHX 1SU7A 2Q5LA 5HP4A 1Q91A 1XZJA 3BMCB 1RKXA 4RA6A 1V5WA 4O3FA 4Y9UA 1EFDN 1XRJA 3NRBA 1F4LA 4JT2A 3UCXA 4J03A 1ZXBA 5LSAA 3VR4H 4RTMA 4JKOA 3B2EA 5LM3A 2QMUA 3HCWA 4G4GA 4KXXA 1XP5A 3RSQA 2F1OA 3S40A 3O0TA 4DQUA 4ENTA 2J5QA 3FMVA 4LXQA 4JEUA 2I1QA 4EY4A 2XKJE 3C3PA 4TM7A 2FWIA 3RTAA 3BQ9A 3GFPA 1XDWA 4B2IA 5JS8A 2NUAB 2FOLA 4WV3A 3FI0A 4AWAA 4AUMA 1E77A 1CWUA 1KJZA 1OFHA 2H3HA 2LD4A 4J7CA 5LBUA 5FX2A 2C7RA 3EH2A 1VHLA 2XCIA 1QC5B 1FRZA 2RHMA 3IVAA 2H63A 2OWEA 3IIJA 3N39C 4DR5B 1JR3A 4MQEA 1EBFA 2OV1A 3FAZA 4JYBA 3JD1A 3RU7A 2UUBB 4LS3A 4FNGA 3GWZA 4MSUA 4QXOA 1M83A 4PQRA 1H8HD 1TVCA 3VU1A 4D9EA 4YT4A 1E3MA 1PJAA 3DUWA 3V8QA 5FPQA 4A6DA 3HCPA 1EESA 3KZCA 3WO1A 2FH5B 1XAIA 4JLKA 1PYGA 4JOCA 3OY7A 1XRPA 3GEHA 4HZUA 1SCAA 1NVDA 1ZXLA 3EJWA 3VMFA 2I1LA 2JLYA 2RSLA 4MYTA 3OURA 3BCHA 4UNPA 3RS5A 5EHZA 2B3DA 5LYJB 2YS6A 2J0UB 4HN4B 4PFSA 2HH9A 5IVIA 5J59A 2X8LA 3BF8A 3GEEA 2GBPA 3LX8A 3MD9A 5LZ5A 4YMVA 1QZZA 1KEUA 1XE3A 1XVIA 3AB7A 4RVNA 3EXEB 3LWDA 3TDNA 3DAGA 3GLIA 1U3TA 1Y5IA 5KOHA 1QDLB 3RHZA 3S3TA 4B3MB 2PUEA 1F3OA 2GWRA 2H07A 2WHQA 3C1TA 4MB0A 4Q34A 4EYSA 5B7PA 3KT8A 2VK8A 3KUUA 3TNLA 1Q21A 4WNYA 1KPGA 4FGJA 3RUDA 5EJ6A 1DCMA 1J2UA 1GPWB 1KGSA 2QD4A 3FGOA 3HYNA 3N7TA 3NTQA 3SS8A 5KUTA 1MR3F 4V24A 3FYUB 1DX9A 4M53A 4BZQA 4CM5A 3LDAA 1KMCA 4GNKA 3GF4A 2PNJA 5EJMA 4E03A 5A4AA 5IBCA 1AXRA 4EAQA 3QX3A 2OLEA 2HEIA 2W6IA 1JHXA 4ODIA 3EXFB 2VZ8A 5KTMA 1N2XA 3WZLA 4CIBA 1XRSB 2GLUA 3O73A 2SECE 4NV1A 1YNSA 4PLHA 5TQVA 4HFJA 4C21A 2W2XA 1ZD4A 3PDHA 2W0SA 1VL2A 3KL2A 1XHLA 3OQHA 4WACA 5AOBA 1ZIPA 1TD9A 1VPEA 1T2CA 2BHTA 3I6ZA 3IR7A 4LHWA 1ZSYA 3LCRA 4KVZA 4AMBA 1EXNA 2BM8A 4RESA 4W5NA 3ZBPA 1GSHA 4OJYA 2AW3A 4S0ZA 1IIRA 3I4CA 5L4NA 1N92A 2B35A 2Z6AA 1SUDA 1QYIA 3LF2A 2J87A 1Q0HA 3RJ9A 2J6BA 5A7FA 5I4IA 5JSZB 2R6GA 4CTNA 1IZYA 1ORIA 5EKUA 4DV0B 1R37A 1HORA 4NICA 1U5AA 1CJTC 3OP4A 1D6JA 2I5PO 1R4NA 5FPHA 3TNYA 3QJYA 5EE3A 2G0AA 1C0IA 1VHJA 2IY8A 3Q98A 3GD7A 3DGFC 5IDYA 3TWOA 4DQVA 3RS7A 5CG1A 1WCV1 3RIHA 3O4RA 3U1TA 2V7XA 1SVWA 1H8ED 3NHKA 1K7SN 3TSCA 3GRZA 1CR0A 1OV4A 1XNQB 4RPGA 5D7NA 3V4PB 2R7NA 3GNSA 4KACA 3B1FA 1TKBA 5BUQA 2Y1LA 4JI5B 5TMPA 3KPVA 3PXAA 5FFFA 1CETA 1VGQA 4YRSA 2ZE8A 3EZNA 4JJFA 1OH8A 1WLYA 2IEDA 4IDAA 3TLMA 3JQCA 4JVLA 4JDUA 1ZJJA 1A72A 5JSKA 2WY2D 2Q9BA 2CJXA 3I6QA 3SS9X 1MOSA 1XAHA 1S8AA 3DOEA 5E3JA 1W36D 1M66A 1BVRA 2RHTA 5J40A 2IYRA 2Z6VA 2YDXA 1XYYA 4F56A 2DKNA 1RBQA 4N54A 4O02B 3V4ZA 4UUAA 1X9GA 1E0JA 1C9DB 3DE0X 4DFDA 3ZWCA 5KS2A 3RBVA 3KYCB 4KLRA 1PTJC 3ILVA 3KJZA 4ZU3A 4WBXC 4NZNA 3I32A 4TGLA 3T4EA 3BFPA 4H77A 1WHTA 3CE6A 3OCYA 3AINA 4FHCA 4PPNA 4YBZA 1B6GA 1QGYA 2FSGA 3DZ8A 2CLFB 4JUCA 4U5XA 5I7VA 3E84A 3R5SA 1D6SA 2XCQA 3E3AA 3L8YA 3R9WA 3I1YA 4OI0A 3LKBA 4DIBA 1OROA 4Z99A 2QTNA 1B1AA 4JT4A 5KWSA 3ET5A 3FR8A 1ZM4A 1OAKA 3ZHSA 2RH5A 3EGXA 4MRMB 1IHDA 1Z18A 4C7JA 3W5BA 4OGFA 2J9FA 1J07A 2J09A 3GEIA 3MW8A 4FQ5A 3VPCA 2VUTA 3KKEA 4CM1A 4X3CA 2AE1A 1XLUA 3CBGA 3R5XA 2DETA 3I28A 1N0VC 3PJRA 1XZKA 2WPDA 1AN0A 4E15A 2WSBA 2KYRA 1U8TA 1ZI6A 3DP7A 1H2ZA 4PO3X 2VXOA 3L04A 1UKYA 1VYHA 1N3YA 2J4DA 3LCCA 4FBGA 4PSKA 4U6NA 5I5GA 2P75A 3U7QB 1IDOA 2GEVA 3RAEC 1ZAYA 2FDRA 5H7XA 3OZRA 4HD8A 3ADBA 1GA1A 5KKNB 4OQFA 2C07A 4CIWA 2ACKA 4IWXA 1QM5A 4RQUA 2PGOA 1CUBA 2VAWA 4GLBA 4TTRA 5D3MA 2L42A 5JD5A 4H60A 5AKLA 1IPHA 1WPRA 3EZLA 5TT1A 1BU8A 5TIIA 4C7OB 2YYZA 2O4UX 4U8HA 4XIGS 4RVSA 3VKFA 1FTYA 4IRMA 4LJLA 1Z2OX 2E5FA 1N6HA 2BHNA 2J5XA 1V3TA 3DHWC 1EKXA 4URXR 4IDDA 5IRCD 4Q4HB 4X6UA 1FU4A 3R24A 4NJOA 1L1RA 3T9AA 4F3NA 2ZSUA 1Y9AA 4PN3A 5A2GA 5JS6A 2WJVA 3UMCA 2Z8ZA 3DAPA 5K8UA 5M2QA 2X1MA 4BQRA 2BGNA 1G8YA 3DYVA 1MIOA 3GP5A 3GW8A 5DPMA 1E94E 2OPHA 5BP7A 1J1UA 4IWYA 4NCXA 2ZREA 4BEBA 3R4CA 3OX3A 4AMYA 4RTNA 1QFYA 2AFVA 1C3EA 5HF8A 3TR0A 4DIOA 2HI0A 5KNLA 4JL6A 2C2BA 2MSEB 3ZXYA 4FZVA 4PYLA 2CV1A 1DAEA 1Z34A 3VR2A 4B4VA 4DT1A 2FPGB 5F51A 1OLXA 3IQZA 1F8YA 3DZGA 1MO4A 4EHFA 5HVNA 3S8EA 4PZAA 2CVOA 4G1EB 4RM2A 4ZVVA 5H82A 3W7AA 1ACMA 1SXGA 2WV7A 3KQWA 4YROA 3RD5A 2VRNA 4WKPA 1BWSA 4LHSA 3CS3A 5AVTA 4WZZA 3FPLA 4R6WA 5HWSA 3RF6A 1DHRA 2JJQA 1V25A 3E9QA 3KHUA 4DIDA 4BRZA 2PXCA 2HSWA 1NXTA 2Q6KA 1XLVA 3TLBA 2Z4TA 5BNTA 3OTIA 1GR1A 2HWKA 1DJPA 1Y80A 2IYSA 3G2IA 3NGMA 5FEUA 4R1MA 4XLLA 2CNWD 1GZHB 4HAVA 4KSYA 3RV3A 4AFNA 4QPCA 3RI3A 4A2CA 4U6SA 1BOOA 3LFHA 1J99A 2YDYA 4KO8A 1N2CE 2ZIWB 4EJMA 2XZDA 1CY8A 5B36A 4CL3A 1K2VN 4ZOLF 1G1MA 1JSZA 3L40A 4GZ5A 2G83A 1NY5A 3HWX1 2GJ8A 2L0XA 3RIYA 1EA7A 3CC8A 3WLRA 1ISJA 1UQTA 3ANTA 4HY3A 4JUDX 4MI9A 1BX1A 1E66A 3NASA 4P93A 3HG7A 1QVRA 4Q9IA 3ZVRA 1PZEA 1P62B 3D6NB 4X3PA 4Q6WA 1D04A 1A9XB 4BCBA 1UPFA 4PYNA 3VBCA 4KQEA 3LTEA 2WUFA 4LRYA 5A62A 2AKEA 3S28A 4PINA 4UU8A 5LB4A 4BN5A 1KE2A 1BCSA 1GPH1 2IYWA 1SVMA 4EF4A 3BMCA 2C2OA 3HJHA 3KLOA 2LZ0A 3IV9A 2JIOA 2G06A 1PGPA 5CLQA 3H4TA 2G8LA 3BXHA 4YCJA 2QL5A 3M1IA 3QU5A 4XRRA 4DDKA 3FJYA 3N2NA 2VR1A 3STHA 1HZJA 3PR1A 1ABEA 3IC5A 1RBZA 2VXYA 4PCUA 2LKCA 5AVZA 2H4XA 4BMPB 2VNJA 1Y1PA 1XWFA 2NUAA 4Y1FA 4D81A 2QMQA 2M6LA 3WKCA 3V8EA 2R3SA 3I9KA 2QN7A 2NP7A 4RY2A 3HBFA 5CD9A 1QP4A 1QC5A 2IZ1A 2XWSA 1KBZA 3LOQA 5BSTA 1JR6A 2IIBA 1NRXA 3GGDA 3OE1A 1N0UA 3MLEA 4KLZA 3HRHA 1TF7A 1GNSA 4KUHA 4RIIA 5HJ2A 4P80A 2HBQA 4C4XA 1R15A 5HKAA 4REMA 1T6BY 1NG1A 2B37A 2X0EA 1R27A 4RL6A 3WGOA 3M4YA 3K2IA 4W6ZA 1ZSVA 1ACJA 2P2ZA 4KO2S 4Q16A 3WYCA 4QXMA 1SNYA 3B1ZA 4GP7A 4BVEA 6ABPA 5BNZA 4KIGA 2QD1A 2W93A 2BEVB 1HFJA 4IIEA 3VR5A 3BCUA 2FFJA 3WJ2A 1UC8A 2VPXA 2ZAMA 3C1AA 1U7UA 1OWLA 1X7ZB 2REXB 3P2MA 4IXTA 1XLWA 3B9QA 1SR8A 2IU6A 3LK7A 2XWBF 1COWA 4WK0B 1PWXA 7ABPA 3HFRA 4OF4A 3BWYA 3EXEA 1EI9A 1USVA 4PX9A 4YQEA 1EBUA 2O14A 4MEBA 3ZV4A 1NDHA 1YKFA 4AJPA 1A5SB 5DGHA 4ZGWA 5L6LB 3A37A 3O7MA 1PFKA 1RQ2A 1EXDA 3VYUB 2P5SA 4BBJA 3T7JA 4QYWA 4WLNA 5ABPA 4U0JA 4L16A 1NPTO 2GBLA 5ICGA 1WBBA 4LHVA 2BFBA 4E13A 3GEMA 2JLZA 3DV0B 4EO7A 2QX4A 1H93A 3IH5A 4CT0A 1M76A 3DE5X 2XDAA 1G2IA 4IS2A 1YRLA 1UDXA 4CR8A 5KX5F 1HZZA 2W6JA 2YFKA 1NVMB 3EXFA 5IJ9B 2PKCA 4JC4A 2XB4A 4Y67A 1SQ6A 1V9LA 1ODFA 1WMAA 2AFIE 4Q4AA 1SG6A 3V3KA 4ZA2A 4LOIA 4AZWA 4YRGA 4I36A 4J91A 5C8VA 5KMGB 4W7SA 4RPLA 4FDAA 3GPLA 4LF6B 1GVHA 2X2EA 2OYRA 1H42A 1Z7YA 1YSCA 1ZNQO 3GNLA 4MR9B 3VTAA 2CXTA 1JLSA 2Y9PB 5K3FB 3V1UA 3NC0C 4S04A 3VKWA 1EX9A 4MPPA 1N2OA 4UDXX 4QM6A 1W19A 3LX6A 4RKWA 4DCUA 3M82A 2ETXA 4HDAA 4AZSA 4M3NA 2PZJA 4X71A 2V6GA 3MYYA 3UQYS 2BMVA 5B7QA 3AJ9A 4N40A 2IV7A 4F04A 2WJZB 3DOUA 5G0TA 5CD1A 2XOKA 4MR8B 3QVGA 5DBOA 1NXSA 2OFPA 1B3BA 4MUXA 3SOPA 3UXMA 5EJ5A 1D8AA 3QRWA 4ZYUA 1Z6XA 5HGXA 4TYMA 1A7UA 2JATA 4BASA 4MUIA 2CVZA 1BN6A 2MWMA 1OYYA 2G76A 3NHUA 3Q9SA 4L8VA 4R7TA 4R1OA 2IWHA 1G7TA 1VBFA 1YJBA 1OI7A 3AWIA 3KKZA 5A3VA 3E3OA 5C37A 1MV5A 3ND6A 4NE9A 5FOQA 3LPNA 2X0NA 2VDVE 4FB5A 1CYEA 3GLKA 5JNLA 3S44A 3SMVA 1XXLA 4LV8B 3HM9A 1A9QA 5GOZA 4B5KA 4R2MA 1CV2A 1D1SA 4HQ0A 2QYSA 3MMZA 8AT1A 1SOWA 3ZE8A 2WAYA 2BSQA 3VPAA 2WP8J 4TZ6A 3KO8A 4PR3A 4M8IA 5I7AA 4KQGA 2JEZA 1ZO8A 1RACA 2ZSBA 2JFOA 2X2FA 2JLSA 3KYCA 2DMRA 2X3FA 2XYPA 2VYND 3BL6A 3L8FA 4RH3A 3TZBA 1ESCA 1VP3A 3BH7A 1KSFX 3WWOA 4Z4IA 2J48A 2ZQYA 3NGXA 3HK2A 1NLFA 2GSDA 4DABA 4INAA 4E30A 5FI3A 4C4YA 2O2HA 1P91A 4K9RA 3GPIA 1H23A 1Z68A 3IP5A 4MIOA 4X6YA 5IKMA 2ZRNA 3NAGA 2BT4A 4MAAA 2RB5A 1IQPA 1Y7LA 3LBNA 3HR8A 3OCJA 4MRMA 1G3MA 1UZUA 4QATA 3R76A 3UCEA 1IN7A 2DFNA 2FHSA 2FQXA 2X8JA 5FWAA 4IGEA 3G82C 3E27A 5BW8A 1Z4MA 1JKJB 3EMDA 4TWIA 5C8YA 2JAHA 3H16A 4KPEC 4N12A 4X65B 4JQZA 1NSFA 3ZWXA 2J8ZA 3MMPA 5B1SA 4ZIRA 1DO0A 5CEJA 3U7QA 1APBA 2AVNA 2WWGA 5DM1A 4X62B 2HHJA 3RVPA 5TT0A 2BVNA 2JHCA 3N8GA 2PUTA 4D43A 1ISPA 1G2PA 3CLTC 3RUCA 2FG5A 4IDQA 2ZZKA 1THMA 4MUGA 1VP9A 2K6GA 1ZUHA 4EZIA 1U90A 4C7OA 4C0JA 5A3RA 2FXVA 2E4XA 5AHKA 2I6XA 3PDWA 3A9RA 1SUEA 1WX1A 4UQPA 3LT0A 4DNXA 1LLQA 1PJTA 3DT9A 3RVSA 1SC6A 5HIAA 2UXCB 1FJXA 3WWCA 3D3KA 4FDVA 5IKXA 1TM2A 4Q4HA 1G8MA 1N25A 2JI4A 4K81B 1ZGZA 1RPZA 4K8OA 2B0JA 2P40A 5AJXA 2VF4X 1Y3HA 4G5SA 4KK4A 4BLPA 5ERYA 1UWLA 1BXGA 2EFHB 4DA4A 3B51X 4ZI7F 4P22A 1TKRA 4D80A 4F8EA 1X1AA 1XVAA 2H7XA 4FZJA 4AJ2A 3D54D 2O2XA 4B3GA 1TQ4A 3LGXA 1PEKE 2QGNA 3QEMB 4RKRA 4MLCA 4FGUA 1T5DX 5DKFA 4YV1A 5AESA 3IMGA 2XMPA 5IK2D 1SD5A 1NU8A 2H4WA 3ND7A 4L3OA 4M98A 5DLDA 2Q27A 5FCDA 4ZEXA 3V7NA 2FPGA 7MDHA 2CK3A 1QS0A 2HY7A 2KBEA 1V9SA 2RJOA 5JCJA 4MWZA 1JX6A 2A5YB 3BSWA 2AHRA 1ZCJA 1K8ZB 4KAAA 2CDAA 1EFLA 5C5IA 3P9ZA 2QD2A 5J4LA 5EI5A 1KOJA 3KZVA 4IM7A 5JSUA 1HE3A 2C1EA 3OQIA 1ZIYA 4D1YA 3LY5A 1JHOA 4P54A 4IHJB 1U1CA 2PGJA 3NKFA 3I2KA 5JDCC 2DY1A 2VJAA 3QV2A 3C1UA 2NUPB 2J0QA 3FBTA 1U0EA 1U4NA 4XWWA 4KAXA 1A7AA 2PZBA 3ZZ0A 1N1MA 3AF2A 1KZ4A 3F9RA 3ETGA 1M34E 4D5GA 4NE2A 2I33A 4ZCIA 3PE3A 1HNZB 3LBFA 2R2AA 4UEJA 4G1CA 1WA5A 4HBZA 4L4ZA 4X41A 3W5DA 5C3UA 5IC5A 1DDOA 4JLJA 3KHTA 6GPBA 2XYRA 4C05A 4NPAA 3FA2A 3KM0A 2J3DA 3R7NA 4RXMA 2FMIA 4PLFA 4TLDA 1KMMA 1KQGA 1PR9A 1X92A 3IT1A 4E0BA 3QXSA 1KO8A 1GPMA 1LLUA 2G72A 4IGFA 4IDOA 3AF5A 1Z29A 1XVVA 2A5GA 2PH1A 3R7SA 3STUA 3FSGA 3S70A 2AMFA 3OECA 3D3QA 5LMZA 2X2PA 2CZQA 5EE9A 5JG7A 4WEOA 1AUVA 1HH4A 2X1HA 1E59A 5JCZA 2BGTA 1TCAA 3L9WA 4MS4B 1W8DA 1ZGCA 4GYKA 2J7KA 3ZVKA 2P5UA 3A1NA 4R3WA 3KV1A 2GXAA 1TA0A 2CB9A 4L72A 1ECFA 2IYTA 3AR2A 1KU0A 3H1EA 1RPNA 2VYVD 1VMIA 4PICA 1VA4A 3K9HA 1GG2A 2YOHA 2ZI5A 1T9AA 3PJEA 5CEEA 3H5NA 1C50A 3C14C 5JAIA 3PNOA 3PEUA 4PSDA 4QELA 3UM9A 4AWBA 1ONSA 5P8WA 3DAYA 2AXEA 4V03A 5IJ0B 1E69A 3W1EA 2GH1A 3JAWB 4UXHA 3WBJA 1FSSA 3ZNQA 2QPLA 5FB3A 1Y1SA 2ORIA 2Q1XA 1FDTA 1WW3A 1Y1RA 4NG5A 3CLSC 2ECOA 1XVLA 4RE6A 1DNPA 3LC2O 3VC1A 1E3WB 2PUVA 5F7XA 4M6WB 3UAOA 2C04A 1YI0A 2WINI 4JR2A 1A8SA 1E2KA 4LY0A 1FYEA 3ETLA 4WOKA 4N7MA 2FWRA 1DT3A 1TAHA 2V4UA 4Z54A 5HTOA 3F73A 4QRIA 4GDFA 1MO3A 4CMJA 1P4RA 5BUZA 4OQEA 2PZAA 4H17A 5IF9A 4EPXA 2JLVA 1S5PA 2QSUA 5BVHA 3QKWA 4GZLA 4RCZA 5CCEA 2WTNA 5JY6A 2EKZA 1SHUX 2QR3A 3LT4A 3MB5A 1W47A 4BO2A 4LC1A 1N2CB 3T35A 1TYEB 3KJQA 4BNWA 2BP7B 1HLPA 3PSHA 5CUQA 1TT5A 2ZYRA 4S05A 1YR9A 3ZCXA 3OH8A 3AERA 1IHPA 1J09A 3AEXA 1EHYA 1TECE 3KB8A 3NT5A 3BFVA 2R4UA 1YMQA 1RZVA 1KBQA 3D02A 2XBMA 1YASA 4BKUA 4YP6A 1T9ZA 1WXQA 1YJAA 1GGHA 4GWLA 5LB2A 5JEDA 4QXAA 3KSBC 4KAFA 4WLUA 2G4CA 3H9UA 5KQGA 2DQYA 3OX4A 2EC5A 3QE3A 4GVLA 4ZDWA 4JWKA 3QVJA 5GZ1A 1W36B 1NUPA 1R88A 2J3EA 2Z1NA 4MEJA 1PTJA 3D0KA 2CWDA 3WI7A 2Q21A 1KYQA 5DSTA 4BWYA 3DV0A 4EUEA 4QGSA 1H2HA 4L8YA 4ND8B 1FQJA 3HPQA 3LQ2A 3IXQA 3CUKA 3CRMA 3NYRA 4KPGA 3M34A 4LHEA 4N76A 5IJ9A 4XYBA 1JBKA 2JG3A 3CSUA 1UXJA 5DI9A 1GN8A 4OXYA 4HDOB 2CL0X 4U2CA 2HNAA 3ZEAA 5SICE 1M67A 3H9CA 5DEOA 4O6VA 5HZMA 4OM7A 4O2RA 5GVRA 3B6KA 2YYSA 521PA 2Z8XA 1NBWB 2H1RA 4ILKA 2QRPA 4ZTBA 1VE7A 5LD2C 4MR9A 1M33A 2C0QA 4J3NA 4TMXA 4FFBA 3QVKA 3M81A 4JB3A 1OLSB 4UBKA 2ODQA 5DYNA 5K3FA 4FILA 1D4AA 5CU7A 3TL3A 2NQ8A 4CQMD 2RGWA 3I9OA 4QNRA 5KCZA 1UDCA 3U7RA 4MTLA 4QQNA 4MUEA 3R9XB 3P97A 3T95A 2PMKA 1JHMA 3IIEA 3L0IB 4F5EA 5EJGA 4AX8A 1C29B 1YGYA 3OFJA 4XUGB 1UAGA 4H35A 3ZUPA 1QANA 3A58B 1G6KA 4YJDA 16PKA 5FOUA 1NJ6A 1SRRA 1W94A 2RHGB 3KDPA 3PX3A 4RQAA 3U4DA 721PA 1KFEB 4F60A 1FW8A 1KXJA 1BN7A 3HACA 3JVIA 4EHDA 3OEWA 4IZ6A 1QRSA 3WO0A 3ZS8A 3K2EA 3ZQUA 2DFPA 1LBSA 2ONZA 2PZMA 3GH3A 3THSA 4DARA 1VLLA 1EFRD 1ZQ9A 2P9JA 4PPYA 4C4RA 1GLGA 1LVGA 4AQ7A 2R84A 1JDNA 3OF2A 1X2BA 2C5SA 1LB1B 4QGAA 1TVEA 4CCYB 3O8RA 1C0EA 2VPIA 3PK0A 4M37A 2D5CA 3RRZA 2PZKA 5CFRA 2ZDGA 3QE2A 3ECCA 1DQNA 4BC0A 3I62A 1ZONA 2ZS7A 4G84A 3VGJA 3LY9A 3HI4A 3RFFA 3DXXA 5AVRA 3U6KA 1JJIA 2HU8A 2IH2A 4BGEA 2QYHA 3H7IA 3D43A 2N9UA 1NMXA 4LRTB 1HTTA 3N70A 2H1IA 2XUAA 3NHZA 5HK9A 1LD3A 4EI2A 3S7TA 5CFPA 3TCXB 3N2GB 3MF4A 1DPGA 3HVHA 2AFIB 3L43A 4XGIA 1EP3B 1SIUA 1SVKA 1WW8A 4LE2A 3PS9A 1Z4IA 5LMCA 1T9DA 1PN3A 1ZESA 2B3TA 4D98A 2O0MA 3HYTA 1O6ZA 2ADMA 2L82A 1DSSG 1Y98A 2RGCA 3KZKA 2Y27A 3MZ0A 3PNQA 2BISA 4J1QA 5LBIA 2GRJA 3RUEA 1L8AA 4HEQA 4HDSB 4QDKA 3OZBA 1UDRA 4U4AA 5F9MA 4DBLC 2WTBA 1W8IA 3L6RA 2Y67A 2X19A 1FFSA 1N5KA 1ECGA 1NJ5A 1VE1A 2QQGA 1RKQA 2VTDA 4UUBA 3V8PA 4YLYA 3VC7A 1K0FA 5FTLA 1XK7A 4RJKA 1QRAA 2HLPA 2V03A 1WO8A 3U80A 1Q7CA 4RD2A 5H0IA 1MCZA 1C9KA 2B8WA 1Y5NA 3GLUA 5C1OA 1NURA 3B53X 4ZCLA 4YAKA 4BAZA 4L75A 1VLJA 4RF4A 2FB9A 4QUHA 5DBFA 2HSEA 1L6RA 3V7WA 3IDAA 3K6KA 3SYNA 2JGKA 5LZ2A 2QBYA 2RI6A 3C3DA 3DXFA 1V4VA 4IRUB 5TJ9A 5LQKA 1R5NA 5F7ZA 1V8PA 2F00A 3IMKA 4RZ2A 3F67A 4RA9B 3F9IA 4LGCA 3HXPA 4ARUA 1Z4OA 3IB6A 3Q3EA 4K9PA 2O0LA 4ZQCB 5CK4A 2YV3A 1IQ0A 2C29D 3ZI7A 2GD1O 1JDBC 1Z0AA 3CGGA 3N2LA 4BEWA 4B44A 4QD3A 5JJBA 2Q0XA 4ZVNA 3RVRA 1F4PA 1XZGA 2HTEA 2MYPA 2PS1A 1S3IA 2OD9A 4TQAA 5A1JA 4TS9A 1I4WA 1QO7A 2BEKA 2H2AA 2HMUA 4ZARA 1AS0A 1TD1A 5HF5A 4QKQA 2C42A 4ZOBA 2DF8A 3EC1A 2FVXA 3QV1A 1J70A 1GU7A 1THGA 2C5EA 3AJDA 3L7MA 2QY9A 5ALOA 5K3SA 2XD9A 1IAVA 5ALGA 3GEBA 4UCXA 4Q3AA 3N7AA 3A32A 4XB6B 5JROA 2HWXA 2ZVDA 4C5AA 1NF8A 1N6RA 1H3NA 3INTA 4CUJA 1JALA 4TN1A 3RKSA 4WQMA 2V1UA 2P3SA 2EL9A 2AF4C 4A7PA 4AM8A 1ULAA 4OQPA 5IS2A 1KL7A 4RPCA 4NJMB 3U44B 2GILA 4LVUA 3L05A 4AD8A 1D7AA 2HGSA 2W6CX 5CDYA 1MQ8B 1U3VA 1SD2A 4FT4A 4HZIA 5AXBA 3ZU2A 4DUZB 1EVIA 3ZE9A 4ENUA 1QJ4A 1PSZA 3FB4A 2Q9AA 1DJNA 3DCJA 3L0SA 4R54A 1BROA 5EJ2A 3PQFA 1R0RE 1SBNE 3OM1A 1LDMA 1LW7A 4JI1B 4F91B 1RCUA 1G16A 4NZOA 5IZ4A 2YJZA 3V4RA 3L8DA 1ABFA 2DGDA 1W5BA 2EBFX 5F4BA 1H9CA 3B3GA 2VDKB 2EBUA 4UEKA 3DBRB 5CJJA 3CGWA 2D6FA 1EX1A 4RTJA 1N8SA 3KQSA 3HDQA 4QU5A 1TYAE 5CRIA 4BO6A 4FC6A 2VNAA 1DS6A 4H7KA 5HQ3B 2DXIA 5JEEA 1XPJA 3E6AA 4KUGA 5IASA 2GM5A 3KZOA 1RI1A 3W5HA 4B7CA 3EIFA 4O59O 3E3NA 4PTYA 1RJFA 2YWEA 2Q6LA 3GCWA 5D3QA 1GUDA 5FD8A 1NQTA 2WU1A 4B9EA 3K53A 3TI7A 3F8TA 1Z6YA 3CLHA 5E9AA 4QUAA 5IWCA 4LRSB 3AC0A 2ISSD 2JFUA 3NKLA 5EKXA 5EYPA 1K5DA 3JWGA 4NI5A 5B4VA 1N3BA 1XEAA 2CE7A 2JFWA 3MOGA 2EZ4A 1ZD8A 2OCBA 4OYHA 5K6AC 4DR3B 2RHBA 1C30A 1CDDA 2AJDA 1JAIA 3CZ4A 3EF0A 3PXBA 2RMKA 3MAAC 4PR0A 3P9KA 3MXTA 1YVUA 3MG9A 2WSLA 4XIIA 4YP1A 5B3LA 1ST2A 4CLRB 2VJPA 4P2BA 1BJRE 4GDMA 2QUAA 2H2IA 3G2JA 1BXZA 2NM0A 2VJLA 2A67A 2G5GX 3IEIA 3IE2A 3JAWA 4HWTA 4NCHA 4HT3B 2J1LA 4HQ6A 5BMVB 3KQUA 5IEBA 3H2GA 3O21A 1RYBA 3SC6A 4F12A 1UH5A 8LDHA 3JD2A 1JHAA 2H0AA 2VAMA 4MW2A 5ENDA 1M2GA 1IZZA 1OBOA 4DTCA 2YVQA 1JU3A 3SLKA 5FLYA 5JLJA 1E3WA 2OBYA 4A0GA 1SUCA 5HRAA 4P5PA 1MHTA 5IAOA 3AZPA 2BGLA 1JN0A 4IV0A 3TEFA 3ZCUA 3HKBA 3I23A 5AKJA 2IUEA 2F3RA 1XOIA 2OBNA 3SHFA 4E07A 5J2UF 1WXHA 2JK0A 2Q28A 3VR6H 4DIMA 2H48A 4DRXB 1ZJ4A 2GLTA 1Q15A 4I50A 4RTSA 4B87A 4ZOCA 2JLWA 2OILA 5KTPA 3FVWA 1M34B 1LI5A 4BV3A 1VXRA 3WAGA 2PHZA 4TROA 3S1LA 4E11A 2OC9A 1RI2A 5KDOA 1BMQA 2HSGA 2HXSA 3JQFC 2BP7A 1RJ9B 1XLTC 5CLGA 1FTSA 4EBFA 3FUXA 5C7IO 2RH4A 1A88A 1FJHA 4TV8F 2QPOA 4KXVA 1QFJA 3UMRA 4US2R 4P4GA 3I2HA 3QA9A 2A92A 3OZTA 4W9MC 3EVGA 4JENA 1CG6A 3JWIA 3LPMA 3RLFA 3T5DA 4JSRA 1BQEA 1NV9A 4NHEA 2IYEA 3NTVA 2FSIA 3K3PA 2Y77A 1P7WA 2ZZNA 4RAOA 3IVXA 2WJGA 3NDJA 4PY2A 4WZAE 1AM4D 1JIJA 2EYQA 4CDGA 1IN1A 5KQMA 1SEVA 2R1TA 2POCA 4FNMA 1VDZA 4J2HA 2HA5A 1E0KA 2GARA 2RHDA 2ZIVB 4GH5A 3B7PA 2XPCA 4ND8A 5HG0A 3ROMA 4YA6A 3YASA 3ICOA 4GR5A 4PBTA 5BN3A 2D8AA 2WTXA 2CJFA 3MTGA 1OWNA 4BBZA 1ECLA 3D8TA 3NHFA 1JEAA 3TS1A 1E2IA 4JJZA 1Q0LA 4EUHA 3KYIB 3W8DA 1EU1A 2X5KO 4KC0A 4PIPA 1FZTA 3BXGA 2F4VB 1IE3A 3E9CA 1MP0A 4TZTA 1DIOB 1WSWA 3RVKA 4N9WA 1P5HA 3R6WA 5CXXA 4W1PA 2G5PA 4B3CA 3SXUB 4EQ6B 2JLQA 1GPJA 4LDJA 4QXPA 1XD2A 1NQUA 3HXLA 4FX2A 3WK9A 5CITA 5KKAA 1BKYA 1VL8A 3L4EA 5ICEA 4UTRA 3T1HB 1E0SA 1Z7BA 4LJSA 3G88A 2XGOA 1V8ZA 2JS7A 4O4LF 5T64A 4QTZA 2ZJOA 4YJGB 5JNVA 3H11B 2WP0A 4QPDA 3QG1A 4ZPXA 2OVFA 3IP7A 3QEKA 3SYKA 3VH2A 4GPAA 4OBWA 4DL9A 5C5EA 2R87A 2V8BA 4MARA 2QTBA 2WUVA 4C06A 1KZ1A 1YQQA 1ZD9A 3KQKA 3USES 4W6QA 3OBBA 3R3SA 1M2OB 2YV2A 4TXJA 4EY7A 3CX8A 4URHA 1EQ2A 3HCDA 1FFGA 4JEHA 1IY9A 2DPHA 3D2CA 3ZI0A 1Z17A 4PQFA 2DTXA 4I6GA 2B2NA 4PYMA 5FJJA 4I1YA 3ZWDA 2NSYA 1GQOA 1UPCA 1Y3DE 1YO6A 4EG6A 4IVPA 3QYPA 2YYAA 1CFZA 3LUJA 1DO8A 3OIFA 3HCCA 4IUDS 1XD8A 2AKYA 3R6TA 3MCZA 3AF4A 2TMGA 1JIIA 1N0IA 3BFJA 2BZGA 4YRKA 2Z1MA 1SKQA 3AR8A 3OT1A 1TYDE 3EZ2A 3ZBUA 4EKIA 3FPBA 5IABA 1JDBB 3WK6A 1O96B 3CSDA 5DJ5A 1KF0A 4AJ9A 4EDFA 3WLJA 1ZCBA 1KQNA 4NJEB 4Z3KA 1LLFA 3ETJA 2IVZA 3A3NA 4FR5A 4NS4A 4OHFA 3CKMA 2ZJ1A 1WQ1R 3MELA 4EJSB 1NZJA 1U2QA 1QIJA 3F4BA 5CCBA 2QVLA 1ICIA 3V4FA 3V3TA 1FXWF 2UYHA 2Q8QA 5ECGC 1KERA 3CW9A 3VR6D 1RYYA 1ZRHA 3A1CA 3A6JA 2KB0A 2BW0A 1A9RA 3N2GA 2VFAA 4CMCA 2ZI9A 2AFIA 5D87A 4PG6A 5K3DA 1NE7A 4JEIA 4MHTA 3DF7A 2FCAA 4QOIA 1B93A 4J76A 2RGAA 4X85A 1RTKA 1U7OA 1HMYA 3VX3A 4EY6A 5JDCA 2Y9MB 3ICCA 3MK31 2VBFA 1C3VA 1X1TA 3R3WA 1KXZA 5LU8A 4B3HA 3HSSA 3ZW7A 1AZWA 1C5KA 4CU5A 3KSMA 3GUVA 2H0QA 5BV0A 4HDSA 1O5OA 5HIMA 2YJNA 3JD4A 3U3RA 3C8UA 3AETB 3HRIA 3MCUA 4QU9A 1EK0A 1IAQA 5EQDA 3LLUA 4XW2A 3ZIAD 1YRYE 2IHVA 3WNBA 4A8TA 1CY6A 5C4GB 2MTBA 5G4KB 5JNSA 4OQDA 1VB3A 4EY5A 4BO5A 7YASA 1SELA 4Q3CA 4YMSA 3VHXA 2O2ZA 3LUPA 5FTNA 1MAWA 5LU9A 3T9DA 1AO3A 4DS3A 4A0QA 4BZZA 1GYRA 2PLRA 2JH3A 2ZBGA 1P1BA 4EGFA 3KTFA 4LTNA 4L22A 3BMOB 1I6WA 3ND9A 1YC5A 2ZUTA 2I2CA 4DCTA 5F77A 4UATA 3HZOA 3MT7A 4F7WA 4Q66C 1Y3AA 4LYEA 3TKAA 3VNUA 3KC2A 4JP2A 5EWMB 5ERGB 2YHAA 2ZSFA 3DC7A 4KBGA 3STYA 3DEIA 3UV7A 3KJHA 4HB3A 4RA9A 4H7HA 4JJIA 1JHUA 2HGZA 2LPMA 4UTVA 5DNCA 2HPZA 3PNLA 1NW3A 4CBVA 4BMNA 2MINB 1YFJA 1DINA 1QONA 2WLSA 2BH2A 1YB4A 1XR3A 3R6LA 4OMFG 1KSJA 2A8YA 5CB4B 1N6KA 1JA1A 3WFIA 1M6EX 3HBNA 4NAHA 2IYOA 2V7PA 4DANA 2VYCA 1RE1A 1GTL1 3OTQA 2G28A 2I66A 3PV0A 3BSYA 2FPRA 3IAS1 3KJIA 4UXIA 5E6UB 3RE1A 3U3MA 4QM7A 2NVUB 3FPJA 1Z38A 4NBUA 2QEQA 4CV1A 4D5EA 2DQZA 3NHMA 4RJJA 2ZYSA 2WJPA 5FQOA 9GPBA 3QW2A 4YREA 1XZNA 4B2LA 1XCJA 2AC4A 4FEAA 4XDZA 1QGUB 4H3KB 3GLQA 5DU2A 2VJNA 3RU3A 4MQMA 5ALEA 3PQCA 4NJMA 3IPLA 4RD1A 3U44A 3TAUA 3W1WA 3ESYA 4MCIA 1W6RA 4JJ7A 4PS1A 4BJ6A 5IWAB 1YAHA 4TS1A 1RRGA 5ESRA 2BGGA 4RX1A 3C6KA 4M7RA 3K8QA 3O4FA 4H9GA 3U0BA 1Y8RB 1ECJA 4AS3A 5BSKA 2QR2A 5KQRA 1FUIA 3L0ZA 3EPKA 3GUCA 5C1DA 1I3KA 1S2GA 5LZ7A 5AI9A 3DAOA 2ZYIA 4M0DA 5IAJA 4ZJZA 4PBRA 1O4VA 3PNYA 3B78A 2IXFA 4HH3C 1WMEA 3KHKA 4M8NE 3UWDA 2K2WA 3CE9A 5SYNA 5ERXA 2P1DA 4N8EA 5GJWC 4DRYA 5LQCA 2HU5A 3T7TA 4CMAA 2BTEA 4TPKA 3WDMA 4R2KA 2WHYA 1AKUA 4MQ5A 2A9FA 4R3UC 5BN4B 1WW2A 2QT9A 3BIJA 4MKFA 4C4TA 1YQDA 2A0WA 4XQ9A 3CWZA 4OFZA 4R4JA 4POOA 1W93A 1U0TA 2YVAA 4WXMA 3EEYA 1KO7A 1T5BA 1RC0A 3SKXA 1Q0UA 4PFKA 5KVSA 2DHRA 2DUMA 2H4FA 3AJRA 5F7JA 3RSZA 4C43A 2VHCA 2ZJFA 4JODA 2PT5A 1UK7A 1Z6AA 2HQOA 5AW5A 3NO4A 3AJ8A 2ZJ3A 4NCBA 4XQGA 1SG0A 4CIDA 3K1AB 1QHYA 1HYEA 1ZKDA 2CC2A 4MGZR 1LBEA 1DAIA 1GGKA 2C7BA 3RWBA 2XXAB 1MTOA 2HWYA 1WNTA 1U80A 3IJRA 1W85B 3GUHA 3MWLA 2XT9A 5ICSA 1P3DA 4K6KA 2V4ZA 1YB5A 1ADJA 1Y37A 3LKZA 3PHJA 4JT9A 4OYYA 2JZOA 1P9LA 2JFXA 2R68A 3GFRA 4UBNA 5SY9A 1T2NA 2WU4A 1T5TA 2PD4A 4M1OA 3VU9B 5IXJA 2A4KA 4HP8A 1CUJA 1Y6GA 4CLRA 4C3UA 3RF7A 2XX3A 1I2AA 3LPCA 3H65A 1NUUA 4IF4A 2QZ4A 2AD1A 2E2WA 5BMVA 1J9EA 1NMEA 3M9LA 2GD2A 1LZKA 2MYUA 1E5TA 1PK9A 1UJ5A 2FG7C 2SBTA 3E35A 4P98A 4RK4A 3T6KA 2JFNA 4CEIA 1YNOA 2F4NA 2X42A 4G4SO 4HNAB 4OHBA 1WEHA 2IPAB 3KZXA 1KP3A 2B21A 3PGMA 3TXYA 5CBPB 1NJGA 5M3BA 4LJYA 3TIXB 1T1IA 3SKVA 3HHPA 5ALHA 2F48A 1CR6A 4CQMB 1XROA 1NNLA 4PGMA 3D7SA 4QSHA 3RJZA 3REFA 4DCCA 1FDSA 5FIUA 3NEPX 5TSDA 1KRHA 1E1QA 2OWDA 3DUFB 1VG0B 2R79A 1T1JA 1OPXA 1HYBA 3DEKA 1Q12A 2HPHA 4K7JA 2ODNA 3ZD8A 4ENWA 3SQXA 1KYVA 2R7AA 4G81A 4YEDA 3TTWA 4AICA 3PA8A 1UBLS 2XUDA 1OX4B 1RWXA 4B0OA 2JI8A 3AKCA 4JJ8A 4HX5A 1EB9A 4ANFA 1RJ9A 5B2EA 5JFOA 4ZTUB 1MNAA 4DSNA 2IZOA 4JVNA 2FE1A 4BP1A 2YYYA 1CD5A 4DNQA 3PD7A 3WHKA 4XD2A 5E7IA 2H4JA 3TQTA 1DDGA 3HVJA 2VJCA 1IZ9A 3RDPA 3DNMA 4I3HA 1MV8A 5A5EA 4QG7A 5GIPE 1SU6A 1GV1A 5DBGA 2XRMA 2BUBA 2XBUA 1CUAA 2FZ4A 3IAHA 4IXNA 1OCEA 4PTLA 1EGQA 3QFRA 3RYHB 4AO6A 1T2DA 2P9EA 3QBDA 3TMKA 2BGJA 1AT1A 3G9QA 3VNAA 1EZZA 2Z2XA 3IAS6 2EGUA 1RSZA 3SM9A 1XNHA 1NAHA 2QLBA 4E5KA 4E7OA 4DILA 1LRKA 4YRZA 4B6EA 1YCGA 3C4VA 3TW4A 5CVUA 1Q19A 3IL2A 1U2TA 1USUA 3S2UA 4QASA 1J24A 3LECA 3S2GA 4DXAA 2PCJA 2VYNA 1G3RA 3LFUA 4IO1A 3KAJA 4MRRA 1A7JA 2QN9A 2QTZA 2E0IA 1OUMA 2F3UA 2YXEA 1ESMA 2OPBA 1LBIA 4B73A 2ID8A 1N5LA 2A5FA 3MWJA 4X7PA 3PYXA 2XUKA 3UXYA 5K05A 3L4SO 5DTEA 4ARBA 3M5WA 1PT8A 3SXUA 1Q92A 3SQLA 3CJRA 1XCGB 1OMOA 1I3MA 2FUG1 1AQLA 4GBED 4CM9D 3B1VA 1S2DA 1P1KA 2WD7A 3EGIA 4OMCA 1PFWA 4ZFNA 2UXDB 4LZNA 3WGHA 1RYNA 1GSOA 2AFHE 4YJGA 4ZT4A 3ZHBA 4TYWA 3H11A 1JXMA 4L2IB 4NTZA 3X1WA 4EA6A 4V2UA 1E2FA 3QVLA 4F97A 2ZJ4A 3SZOA 3WGNA 4AULA 2KE5A 1W1UA 3FPHA 1FCJA 4H7FA 4G24A 4CF4A 3EZ6A 3Q9UA 1V41E 4GI2A 3EQ8A 2OAGA 1E2EA 1N2GA 2PQ6A 3R5TA 4RY9A 3W9BA 3WYNA 3D1JA 3L7CA 4DLVA 1Z35A 1CUVA 2CZGA 4OHYA 3BCRA 2WMYA 4BX9A 2VSOA 3N3AC 1ZOIA 4PGHA 1P1HA 4KDRA 4BMSA 2LCIA 1JEOA 2CL7X 5TQ0B 2P6RA 1TUGA 5CH5A 1T35A 5SZKB 3SJUA 2RJ3A 3C6ZA 4IIXA 1XEFA 1H5UA 2VBCA 2VP3A 4L4YA 2WJ3A 4JV5B 2NN3C 2HU2A 4MIYA 4EKEA 3TGLA 4KXMA 4XIJA 2ZYUX 4AN0A 4ITVA 1I51A 4UFOA 2H51A 2EWMA 1W5TA 3GIWA 1KO1A 1ISHA 1TL7C 4U3JB 5HILA 4RTLA 821PA 2ZSKA 4M9SA 2VXBA 4WVFA 4KPYA 1BH6A 1Z5ZA 2BFCA 4PWYA 4Y6RA 3UFXB 3ZXSA 5A5DA 4WZAB 5C80A 2OZLA 3DL2A 3OM8A 3Q2IA 3CH5A 2I7CA 1BGVA 3FMFA 3H99A 3IKJA 4FFSA 1U9JA 2W8BB 5EXXA 4E09A 3LM8A 4Z86A 5C1IA 2K2QB 3BIOA 3E3LA 3KV3O 1UT6A 2P9HA 2Q3LA 2G5CA 5CVEA 4ZO6A 3L07A 1FS4A 2ZVJA 5BSVA 3TD2A 3F6SA 3WBFA 2HR1A 5DNAA 4JSTA 1NQ5A 4WDQA 3G8AA 3HV2A 3JALB 3EZYA 3RRJA 3PC6A 2HDHA 1NP7A 2C5HA 4PLGA 1F2UB 4KYUA 3ZC3A 2JRCA 1YTLA 1AQJA 1CUFA 1DRKA 4YVFA 5H02A 1Y4UA 3AM3A 3DDOA 3D31A 2BSAA 1YIAA 4RVOA 2GHRA 2XEXA 2ZR9A 4LXYA 4C6HA 1H94A 2WJWA 4E46A 1SK8A 4ZAZA 5LIRA 5CYPA 2OD7A 3KXDA 4GMGA 2YNMD 5B3JC 3UA4A 3G59A 1DBSA 1JJFA 3CR3C 4FOTA 4PYOA 2BEUA 1PUIA 3PLRA 3SIRA 3TCKA 4DAOA 5L40A 4A6PA 3KLBA 1I80A 3EOAI 3M2PA 1RXIA 4LBZA 3T52A 4N03A 4ADSG 1TTQB 3C98A 1ZMOA 1NBEA 5AVOA 4DIKA 1I6MA 4C0KA 3U49A 3HB9A 4G0XA 2QL7A 2ZIUB 5AI5A 3ZXIA 1FF9A 5J4HA 2JDID 4MKGA 4EK9A 3TGPA 4CEIB 1H5NA 4P7JA 2B6NA 2H65A 3F96A 3SMQA 1DXQA 1F7UA 2XVAA 4QEZA 5E4YA 3PC7A 3JR7A 3BMOA 4MVJF 1ZU5A 3EIQA 3B60A 2YUIA 4C04A 3S68A 2GF2A 4DJAA 2JAPA 1HL7A 2WWIA 5FTWA 3F5MA 5DCLA 2XMCA 4FEEA 1HT0A 2JAXA 2EQBA 2NTNA 5AW3A 1O77A 4B3BA 2BDUA 3B85A 3H42B 3MUOA 4UZSA 3R40A 4JGBA 3EWAA 5G0VA 1JI3A 2R47A 1GQQA 1MB2A 2CXHA 1EUCB 2MINA 4HN2A 3BBLA 4IYJA 2FUG6 2JH9A 1RWMA 2P9ZA 2XYVA 2QTRA 1BDMA 2PH7A 1XA3A 1R0WA 5BN3B 4K0RA 1EJ2A 5E6UA 5DB4A 4CMEC 2NVUA 1FC0A 3GCXA 2R62A 3IESA 1EHCA 1N7GA 5G53C 1MG5A 1WP9A 2G9ZA 2W90A 4ALIA 4LDPA 5DTMA 1KAHA 3UVEA 5JBQA 1CP2A 4EG0A 3WAKA 2OHOA 4LZAA 1QGUA 3O91A 1JJAA 2VPYA 4JDPA 1T6NA 1ORDA 4QEKA 3QTBA 5JI2E 1N2ZA 2GUGA 3AIIA 3GGCA 4Y9RA 5BYKA 4C7MA 3DHYA 1K8QA 5LN1A 3AR6A 2W2TA 5JDIC 2D59A 2DH6A 3I4FA 1PFUA 2QZJA 2GAAA 3FDXA 4D99A 1EXMA 1V3VA 1DC7A 1Y8RA 3GT3A 4IG4A 4BVAA 1SURA 5C0OE 3JVDA 3ZIUA 1EWRA 4HG2A 4BCDA 1XDDA 3SVZA 1UBGA 3JQFA 4UPEA 1XLTA 3LBHA 4IH9A 1KVSA 1VBKA 3FLAA 2Q2WA 4TT3A 5HE9A 2OE2A 3E8XA 2PIAA 1G8HA 4NG4A 4G2TA 3REQA 4DCOA 3KCQA 3AFMA 2XZTA 2ST1A 3ZDZB 3X1XA 1KI7A 3T54A 1L7BA 1NVTA 4Q7JB 1AE1A 3RARA 4DLSA 1QV7A 3IUMA 1Z0IA 5TQ2B 1LCIA 1OXSC 4ZQHA 5T5QA 4W1RA 4KHPB 3K0KA 4HRVA 2C4WA 4G5YA 4CDMA 1KRWA 3JPYA 4HN9A 3RPEA 1R3DA 4LF5B 3ZY6A 1FMCA 2Y2UA 2O2CA 3K1AA 1PVDA 5I9BA 2JIQA 3I37X 3ZWNA 3TG8A 2XXAA 2V5UA 3HTXA 2QW1A 1W85A 1WCYA 3GFFA 4X9XA 2GFQA 13PKA 1NUTA 1EFVB 3RUFA 2HBRA 4D0LB 4YH1A 3H9QA 1R5BA 1PDOA 1UBHS 2E4AA 5K0SA 4L0QA 1Z7EA 4FHDA 3SBXA 3VU9A 3C3EA 3DMDA 3FTPA 2B4YA 2FFRA 4DMUB 2BJVA 5KWVA 1JFTA 1FIUA 4FIZA 4MCHA 1GA4A 1QAMA 1NVEA 3WKDA 4F93B 3MRXA 1P39A 3KT3A 3H75A 2HPVA 4LY9A 1KTIA 3TFWA 2PQMA 4IVQA 4BJ5A 1YUNA 2IOFK 1CRPA 1F60A 3QKSB 5TMEA 1N5MA 2Q5CA 4WPGA 4DEVA 3SE7A 3UWPA 4Q48A 5AK0A 4I5FA 3CZQA 4HNAA 1L5RA 3CH7A 2UZ0A 1C8BA 1O8CA 3HE3A 1KI4A 2AYYA 1HG0A 1RHJA 2OHVA 2DAPA 3GRPA 1YFKA 3TMAA 4OIMA 2HIHA 4ZEMA 3ZKAA 2GESA 3PNMA 4CQMA 5IM4F 4MITA 4IJ6A 4C89A 4C1NA 2QE7D 2W2KB 4C6SA 1QUEA 3JYPA 3UOAB 5JNUA 1JJ7A 4H08A 3ODGA 4URWR 5KI6A 3EIEA 4L78A 2GTHA 3NBMA 3K0HA 4RJIA 2QV7A 3KL4A 4R8MA 4NENB 1PD1A 3U26A 2QD3A 4U02A 5KNCD 2HIGA 3H2IA 5KTTA 2A5DA 2YZGA 4MMZB 1OX4A 2RH8A 1A4RA 5EWLA 2CFIA 5AK6A 1SQ0A 3PI6A 1TRHA 3F98A 2ZB2A 4AO7A 2O5CA 3SBEA 3MNFA 1UK6A 2EERA 3F7MA 1U3DA 4PAWA 1ECBA 4W82A 4BECA 2VJKA 1MVOA 4YMIA 4EHNA 4MCJA 2R1UA 4MUYA 1I1QB 5CPBA 3UXHA 3HXOA 5DISB 4B7ZA 3BK7A 1OY1A 2HMWA 3NCHA 2PAFA 1G42A 2CCGA 4KFUA 2VTEA 3RYHA 5HQTA 3RBXA 5EUBA 5LWHA 3HFSA 2ZVQX 1N4AA 4NBKA 2V55B 4BQOA 2P5TB 3BORA 5YASA 4ENSA 4TLMB 1G20A 1BFUA 4JI2B 5AK5A 1T1EA 2X23A 3M0EA 4D2IA 1HPLA 1JPUA 2PXAA 2GKSA 1QG0A 1T6YA 1RHQA 2BONA 4B4DA 2WDZA 3M4NA 4RANA 5L3VA 4C29A 3HB4X 2J0EA 1BQ4A 2CEAA 3O2JA 5EPOA 4AJKA 3E1GA 4MKHA 4UNNA 3WWDA 3IRVA 5CM2Z 4B80A 4BKRA 2BZ1A 4F4FA 3J80A 4N48A 1E79D 1FQWA 5DM70 1EJBA 5BUSA 4HUQB 4WESA 2XNHA 2HO5A 3RS9A 1W2HA 4BZWA 5HR5A 3VZCA 2PCLA 4V0RA 2YVKA 1JTEA 3FNHA 1W2GA 2GHQA 1Y6JA 4IXMA 2BYTA 4L2IA 4YUWA 5HCUA 1JNYA 1P0CA 3TQOA 2Q6OA 3CEPB 1G5PA 1JHQA 4Y18A 4Y7CA 1ONPA 3MUNA 2HA3A 3PUJA 2XDQB 2HV8A 5CIQA 3RIGA 3Q4GA 3GROA 4A9AA 4L4XA 3NORA 4N0QA 2A58A 2HA7A 3BIFA 4PBSA 4P3OA 3OCUA 5JZSA 2J30A 1UC9A 1XMOB 3Q7SA 1OTXA 4YP9A 3VM6A 1QH8A 1E1DA 9MHTA 4F5ZA 2B94A 2XF2A 4UVEA 5HKKD 4K6GA 4K40A 5CX1A 5DRYA 3RADC 1NYTA 3BPSA 4N3NA 2WQZA 1TTTA 2GXSA 1OT5A 2YY6A 2CDCA 1LS1A 1M73E 4RLHA 2PGXA 3ZDEA 3CF2A 2ZBUA 2AR9A 5JNWA 2O8FA 1NHWA 2Q0QA 5T4HA 1QHFA 1X14A 1L5KA 3T0FA 3ZZMA 4OAQA 3O84A 5EN4A 5FH9A 3S81A 1ZVVA 1FX0B 4UTOA 1KYYA 1VG1A 5ADWA 1FFBA 3AF0A 5JHGB 5K5EA 3UFXA 1G18A 4WZAA 4EGQA 2CHVA 2HCTA 4KU4A 4MWOA 5HKLA 4YMLA 1P29A 3PT9A 5DIFA 1OT3A 3KLPX 1VCNA 4Y9DA 4BUCA 3WK4A 3UAZA 3HBAA 2BHLA 3OLYA 1Q44A 4ZREA 4B47A 4N41A 4RK1A 1GPDG 2G8NA 1QR2A 3HWWA 2IHTA 2J9RA 2Q4EA 3QVVA 5CVCA 4ZDKA 1G8SA 2B20A 5G0UA 4IFTA 5DYIA 3HCEA 4GOMD 3ZCRA 3H2BA 1T0JB 3EHDA 1PT5A 3C6QA 4QUIA 2VP6A 1JHDA 3D3WB 3IR5A 3KUXA 2GBCA 1CS4C 1E63A 5D7BA 4OHUA 2O5VA 2XDWA 4HTFA 3OSUA 1AKTA 2ZT5A 2XYHA 3V4LA 5HJ7A 3LYUA 5GPBA 1NNEA 3DFUA 1E1YA 2PKQO 2RKOA 3H17A 1TC2A 4GMXA 2AFHB 5HS6A 3Q15C 1QH0A 3B70A 1OFIA 4PG8A 1PR0A 1V4NA 4Y1RA 3VYVA 1XFDA 3QU9A 3SF0A 1QO0D 4HAXA 3BE4A 2SCUA 3M83A 2JKVA 1MB0A 2WIJA 4Q12A 4WOBA 3ZR4B 5KSWB 4Q82A 3GCZA 4WY8A 3IHWA 1N3IA 1EWTA 1VGRA 3BTVA 1SH7A 2Q41A 1VJCA 1B16A 4HGQA 4MA4A 4NYIQ 3MA0A 1GIAA 3DMHA 2IHJA 4WD3A 5TR9A 1UCFA 5EMMA 2OOKA 4MPRA 5I9TA 4BIIA 3FI9A 4QUJA 3TD9A 2ZYAA 4MVYA 3Q8KA 2VP0A 3DL4A 3IQIX 4Z0PA 3AVPA 3HCNA 5JO0A 4YR9A 1DAGA 1M2WA 3NU1A 1VLHA 2L18A 2HDNB 1D2AA 1OFVA 3OJEA 4PX3A 1ULSA 3LUBA 2JH8A 1NW7A 4PSAA 3H3JA 3MJDA 4Z4QA 4TVSA 3CX4A 2V4MA 2MU1A 2YN2A 3U4QB 3AU8A 3O2QB 1NF9A 2G71A 1YQWA 2I6UA 4FYHA 5EJ7A 3DFFA 2UUOA 4RPKA 4A6EA 2ID9A 1QTIA 1T3ZA 2NUTB 2D2EA 4CKWB 3DO5A 4LGYA 4QJBA 4Q9JA 1TE2A 1ZYUA 4PNPA 3EC7A 4XVQA 3RKRA 1EUCA 5H9VA 1TZKA 4BJHB 4ER3A 3KVRA 3QFFA 3U81A 5BNFA 4UBMA 2II6A 2JIPA 1Z45A 5DNWA 5SYAA 3OCXA 2AA3A 1OFUX 3K6RA 3PFIA 5CHEA 3JARB 3K4HA 4EF6A 1I10A 1UWCA 2CUTA 5DLPA 3DW1X 1M54A 2O1SA 3PYMA 1EFTA 4URUR 1QBGA 1SIOA 5BQ5A 5I4BA 3QIAA 3U17A 1E1RD 3RVJA 3T1OA 5KDDA 3UMJA 1Y6QA 1MFPA 3BMNB 3NAQA 5DNVA 3L6DA 1E1KA 1MEEA 4CM7A 2WSIA 4LDQA 1UMCB 3EUWA 4E88A