4UCWA

Structure of the t18v small subunit mutant of d. fructosovorans nife- hydrogenase
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
263
structure length
263
Chain Sequence
TAKHRPSVVWLHNAECVGCTEAAIRTIKPYIDALILDTISLDYQETIMAAAGEAAEAALHQALEGKDGYYLVVEGGLPTIDGGQWGMVAGHPMIETTKKAAAKAKGIICIGTCSAYGGVQKAKPNPSQAKGVSEALGVKTINIPGCPPNPINFVGAVVHVLTKGIPDLDENGRPKLFYGELVHDNCPRLPHFEASEFAPSFDSEEAKKGFCLYELGCKGPVTYNNCPKVLFNQVNWPVQAGHPCLGCSEPDFWDTMTPFYEQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYDROGENASE (NIFE) SMALL SUBUNIT HYDA
publication title A Threonine Stabilizes the Nic and Nir Catalytic Intermediates of [Nife]-Hydrogenase.
pubmed doi rcsb
source organism Desulfovibrio fructosivorans
molecule tags Oxidoreductase
total genus 78
structure length 263
sequence length 263
chains with identical sequence B, C
ec nomenclature ec 1.12.2.1: Cytochrome-c3 hydrogenase.
pdb deposition date 2014-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01058 Oxidored_q6 NADH ubiquinone oxidoreductase, 20 Kd subunit
A PF14720 NiFe_hyd_SSU_C NiFe/NiFeSe hydrogenase small subunit C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NADH:ubiquinone oxidoreductase-like, 20kDa subunit 4ucwA01
4.10.480.10 Few Secondary Structures Irregular Cytochrome-c3 Hydrogenase; Chain A, domain 2 Cytochrome-c3 hydrogenase, C-terminal domain 4ucwA02
3USCS 4UD2A 4C3OB 4UD6A 1UBRS 2FRVA 4UQLA 4U9HS 4UEQA 4UE3S 3CURA 4UPEA 3H3XA 2WPNA 1YQWA 1UBLS 4UE2A 4OMFG 1UBJS 3USES 1UBKS 4UCQA 3AYZB 1UBOS 4KO2S 4U9IS 5A4IS 5JT1A 1E3DA 5JSKA 5JSUA 3ZE9A 1WUKS 4UCWA 1FRFS 4IUBS 4KN9S 4URHA 4UE6A 4CI0B 3AYXB 5JRDS 4GD3Q 5A4FS 1H2RS 4IUCS 3ZE6A 1WUHS 3CUSA 4TTTS 1WUIS 3MYRA 4KO4S 3ZEAA 1H2AS 1CC1S 4KO1S 1UBTS 4KL8S 1WULS 3UQYS 4KO3S 3RGWS 3ZE7A 1WUJS 4UQPA 3ZE8A 5D51S 1UBHS 5A4MS 1UBUS 4UPVA 5JSYA 4UCXA 5JSHA 5ADUS 4IUDS 4UEWA 1FRVA 1UBMS 1YQ9A 1YRQA
chains in the Genus database with same CATH superfamily
1PQPA 2H7CA 2LIVA 2D5BA 2PGIA 3B3JA 4BBJA 5J47A 1EX1A 1GPMA 3PGMA 4N5IX 2H00A 4PYMA 1QAQA 3A9UA 3PRHA 4X8LA 4Q7QA 3RAFC 1Z6XA 1VCHA 3O47A 4AAYA 3DBOB 3H4MA 4M76B 5DCWA 1J1IA 4U9HS 2HF7A 2L69A 3E2PA 1AS3A 3HFSA 2O19A 4G5QA 3MRSA 1JSCA 5K0FA 1DC4A 5C7IO 2A9VA 2G0NA 3SLRA 2JLQA 3I62A 3THSA 3O90A 1K8QA 1E69A 5TB5A 2ZWOA 4LS3A 1I1QB 1GAXA 1FQWA 1QAMA 3HCBA 1L5FA 1VKZA 3P9SA 4Z9BA 4JH0A 4MDHA 3C5VA 3DEYX 4YQZA 3C16C 4WHMA 5ENVA 5DXFA 4KMRA 3BDAA 2G5CA 4II3A 2WSMA 3DLPX 2H9IA 3P2JA 1V11B 1QFXA 3IXQA 4HX9A 5BP7A 2BDTA 2QMZA 3BB3A 5FTWA 2NO9A 4GSYA 3T0IA 1U0SY 2PUTA 3TZKA 5J2TF 4BNIA 3CWZA 1UOOA 1J9GA 1SA0A 4C30A 4ZZ0A 1PJ3A 2Q4TA 3L7LA 1EBUA 1WEHA 1US8A 1YMVA 1SY7A 2BE7A 3DTYA 2P40A 3FBTA 3K32A 3R3YA 4G81A 4EFDA 4HR7A 1B0AA 3TTUA 1Z17A 2B4RO 3SBEA 3ZJ4A 4GLBA 1SQFA 1Z8FA 2V0CA 5EZSA 4FSXA 1L7VC 2QWXA 4UBOA 2AJBA 4NYIR 3WS7A 4YV1A 4G0PA 3V7NA 1XAJA 1KYQA 4KDCA 1ENPA 3WXBA 3TGLA 1ZVKA 2PGOA 3BHIA 2CF6A 4R41A 3WO0A 5BV1A 2AMLA 3WNQA 4HUJA 1NVTA 1E1NA 1OIWA 4KGVA 3HXMA 5CFPA 5LP6C 2WMYA 1GKYA 1W5BA 4C2TA 3VVCA 4OQXA 3BM5A 4MKXA 4N5DA 3VUFA 4IYJA 1A2KC 5EY5B 2ST1A 4DA9A 3CR3C 1GYPA 4FN5A 4MQEA 2WAMA 2P79A 4Y6RA 5CYGA 3HBLA 1DAEA 1GPH1 4Z9XA 1JKXA 3E8SA 1MVOA 2AHOA 2C7GA 1RRFA 5DBHX 3FKJA 1YHNA 4GGOA 2X0NA 4L85A 4MUYA 5G1NA 3K2BA 5AP9A 5C80A 5MFPA 3K0FA 2O8EB 2X8LA 3AKEA 3MT0A 2QHXA 3HUDA 4RTPA 4MUNA 1FUYB 1SKBA 1UMKA 2IEZA 2QKYA 4YT4A 3EEBA 3I32A 3TBHA 5DPMA 1NW5A 1F1BA 4HFNA 1PX2A 4AD8A 5E95A 2VF4X 4RHYA 1HWYA 3LA6A 1AUPA 2WTBA 4UHBA 3LA8A 4LVNA 4URWR 5BYJA 5FWXB 1R6XA 2H4WA 3PLRA 4P34A 1BJKA 4ZQFA 2QTVB 3ETEA 3NTXA 2PMKA 2BCJQ 4X54A 1RLUA 4Q3KA 1R2QA 4RTOA 3HCCA 3IALA 1LBEA 4M9UA 5GJCA 3T3PB 1OXUA 5FNZA 1RC8A 5ITVA 1EAYA 3FXAA 3IP5A 3DLTA 3WB1A 4U2GA 5CVTA 4D44A 4JOBA 1TT7A 3QMVA 4DLPA 5AVSA 4D4MA 1DBIA 4YRRA 2DVMA 3HXKA 3LP6A 3IEMA 4MZXA 2P9HA 1EM8A 1HEIA 2YW9A 1PTKA 1V4BA 3T7EA 4A6DA 4ZICA 4MHTA 3FTEA 3QBDA 3VYVA 3A04A 1CVIA 1XJQA 3HUEA 4G26A 4WCFC 3FN4A 1ISGA 2IUEA 3T5MA 4FIZA 1G3QA 3B12A 1HTTA 4LDAA 4BZPA 4ZOEA 1TM7E 1Y7TA 1G20E 2DFLA 1ZD8A 4Q3NA 4F9FA 5CA0B 5FHQA 1FPQA 1LI4A 1JLLA 4WOBA 4N6GA 9ATCA 1MQ9A 4EB6A 3WP0A 1ZCBA 1OXXK 2XX3A 3UA3A 3RVNA 5LP6B 1W5TA 2GFQA 3KFLA 3EG5A 2H7XA 2HXYA 3AVQA 4LJAA 3HM9A 2FWPA 1NVVR 3R9IA 2ZB2A 4LSWA 1EA5A 1FSFA 4R9RA 4QWMA 1F2TA 3WWPA 1XZBA 3UJ8A 3PXBA 2Z83A 1B23P 3LY8A 1GQRA 4U02A 5F78A 1CSEE 4OM7A 1I7SB 3AU8A 2R97A 4WGGA 4HB4A 2I8AA 3VVLA 1U1EA 1MO5A 5JO0A 4Z53A 2B1JA 1GILA 3K2EA 2HXGA 1G8GA 1Q19A 3K5IA 1JNYA 2LCFA 5EPOA 1EUQA 4B4UA 5I9IA 1MB4A 3CUUA 3I8SA 3LBFA 3QQ5A 3GLTA 5GADl 1NBWB 2XCTB 2I2FA 2FSIA 3HO6A 2IYSA 2A3NA 3C5HA 4MB0A 4RKFA 4PYOA 4RL4A 4N0PA 3GJ6A 3Q12A 4LWZA 2P7IA 5BNWA 1E1RA 4M54A 5B7GA 2NTJA 3KXLA 1BE6A 4CKEB 3E05A 3EPJA 4OGWA 1Y4ZA 5JNRA 1YFLA 1WMAA 3TJZA 1LTQA 5F64A 2WIAA 2CBZA 4MMYB 3O84A 3OY2A 4CDRA 3IOEA 4OI2A 4ZCLA 4MTCA 5EMLA 4E5DA 4F5EA 3KQHA 3LQQA 3RKSA 5IAAA 2PBZA 3AV3A 2C2KA 4O25A 4CQLB 2O8VA 4FKZA 2VRWA 4HADA 2OGZA 4LTNA 4A6EA 4OQYA 1G2IA 1YSCA 2BC9A 2J9ZB 3L7YA 2XVXA 2ABWA 3R3JA 4A2QA 2R8BA 5J4VA 3K2IA 5TQ0B 2FV8A 2MYPA 1Z4IA 1ZD9A 4TSFD 3GT3A 3FCOA 4HZUB 2XUAA 1GXSA 2Y2UA 1SXJD 3PSHA 4P4TA 1VP9A 1H2WA 2EKBA 2FN7A 2RHWA 3TW8A 5KEIA 2BI4A 1KY5A 2WM3A 1L5HB 2EP5A 3U2QA 3NX4A 1JR2A 2X23A 3EZXA 3U4HA 3WDLA 1KTIA 1PGNA 4WCFB 3SR0A 2BM9A 1HY3A 4NFSA 5I4BA 3KZCA 2YIMA 3ZGLA 5HILA 1NVKA 3C8UA 3KJNA 5EJGA 1GRRA 1N3BA 3ANNA 5EJ9A 2O8EA 1T0IA 4AB1A 2HWUA 1CETA 3TZ6A 4P58A 2VBGA 2ZDQA 3PHLA 3W6OA 1YT5A 2ZIZA 1VG1A 4UCXA 2DUUA 1G2OA 2J5RA 3GJ0A 1FZTA 1QMPA 1WZUA 2VOEA 4HNAB 5BMOA 3EVAA 2Q9UA 3U3MA 4DBLC 3T52A 1XVLA 3AOGA 4EIWA 2A57A 4J7XA 3TG2A 4C89A 5CAEB 3QXSA 3R7BA 1RQNA 1G6Q1 2BFCB 2HA5A 3NBQA 3NU1A 3OIGA 3QTTA 4PWZA 2NSJA 3BE5A 3OQHA 1CRZA 1LTHR 2BLLA 4W5WA 4Q9IA 4ZYYA 3JASA 3GL9A 3IBTA 1PUIA 1KU6A 3VC7A 2OYSA 4UD2A 3IEVA 2BSQA 2B4KA 1XL0A 1XK6A 1K97A 2HEIA 3AI7A 1BX1A 3BSFA 3KR9A 3H1TA 3MGAA 3T3EA 3DTVA 3LVQE 4RKEA 4XFKA 5BORA 1LRKA 4GYWA 4LE0A 3V8MA 1C9KA 1QG4A 2FE1A 2OGUA 1QP4A 3EH2A 2QRUA 3RGGA 1MA0A 2X0FA 2J0EA 1TAHA 2ZBGA 1E1KA 2I2AA 2CJWB 4IDOA 3PNKA 5EWLA 4QECA 2Q9CA 1CF9A 1PJRA 2EKPA 3HDTA 1BXRB 2CLFB 4MJXA 2C0PA 5HGXA 3IEPA 4RVSA 3A6JA 1S3FA 2WJHA 3QGMA 1KYXA 4LPSA 4FC7A 3NP9A 5TVKA 3I09A 3M1AA 3SYKA 1S3SA 4GQAA 5CHEA 5C5EA 3A32A 2DBVO 3FWZA 5A06A 5EZYA 4IJ5A 2RMKA 4IZ6A 2ZAOA 1R8XA 3QVKA 1KDYA 3ZJYA 1G3MA 3ADCA 2IHNA 2PZ8A 1SUBA 3BIWA 5EIWA 4WACA 1YS2X 4PNHA 4QUHA 2LCQA 2RIPA 1QGOA 2ADFA 3W3ZB 4B4OA 2VYCA 3BD6A 1LBSA 3DW3X 4W7SA 2VQ6A 1LZLA 1H0HA 3SLKA 3Q7EA 4Q3DA 3VR2D 3VR6A 1PL0A 5FPYA 2FZVA 4GOND 2Z9DA 1DDIA 1WCXA 2GBIA 2PM8A 3DWIA 4LXYA 4O4IF 3UCXA 1D2EA 4QULA 4J0FA 1Y4AE 3IQWA 1LPNA 1N7GA 5DNCA 2OEPA 1NVDA 4RVNA 2HV8A 3ETLA 4OHRA 1KFEB 3HKBB 3C98A 2POQX 4NI5A 1J21A 5CHYA 1Z0SA 3MTGA 1WM1A 3CNBA 2FKNA 5MN5A 3HKDA 3LDFA 3RT9A 3KB8A 1WVGA 4KBFA 1H69A 2X5JO 5SV2A 4KSCA 1Z35A 1QGAA 2RJ3A 2OAQ1 4NBKA 1OH5A 5FCDA 3BMCB 5TVGA 4D02A 5L9AA 1T5IA 2OZKA 4N6OA 4NNPA 3ZU3A 4HRXA 3OCUA 2W2NA 1NBMA 1VSTA 2QP4A 3H75A 8MHTA 4TYQA 4V0KA 1UJMA 3GLUA 4G36A 1N4DA 1UDAA 2RG1A 3EQ7A 4JITA 1U0EA 3IEIA 1EX9A 5A7GA 3KQUA 3K9WA 1D03A 1OTHA 2EBHX 3JAWA 2G76A 1IN5A 2WUVA 4G3XA 4KXWA 1E2HA 4OHVA 5EP3A 3KSAC 1PUJA 5A7FA 1ZCFA 2GF0A 2BBSA 4TQ9A 3UYLA 1AHIA 5FBRB 3ACCA 5AVOA 2JLUA 1GAJA 3EIXA 1XQVA 1QR6A 2Q21A 3MELA 3WOHA 1ZISA 3E0XA 3FI0A 4IIJA 5JZSA 1T2VA 3S29A 3IV6A 3DDSA 4LZJA 4YAIA 2OCPA 3AL3A 4C4SA 3OOJA 1C9JA 4GPBA 3LPAA 4WK2B 3P9XA 1Q83A 2E6UX 4PC1A 1RVDA 2FN4A 1IHPA 3L8HA 4PGMA 3H6KA 5SYAA 1N6HA 4JU9A 1KDVA 4A27A 4KOAA 1Z12A 5DZSA 3ZV5A 1SU4A 4Q1VA 1J00A 1WDWB 1J0EA 4Y9UA 4QPNA 4KR9A 4DJFC 2QT0A 3A9SA 3S1AA 4TUYB 1V4VA 2DR3A 2PK3A 3BMOA 4PSCA 4AXXA 2WYOA 5KU1A 5LD2B 4LDQA 4FP9A 1X0XA 2DAPA 3OX3A 4F3NA 1LX7A 3U4DA 1DIHA 1O1YA 5E9AA 3NOVA 2J09A 3AG6A 2R1TB 4WY8A 1K6EA 2WHXA 4PSVA 3HY3A 1Q15A 3RC9A 1SVLA 3WHLA 2BKUA 1XQ6A 3PXEA 5DMXA 3CA8A 1H0KA 3ELUA 1H85A 1PJ2A 1P2UA 1Y89A 2I2WA 1II9A 3EWIA 1DAPA 1NVXQ 1ZOSA 4MV4A 4N5HX 5IDQA 4PYKA 4JB0A 1FS5A 1Q21A 5TMEA 1ZGBA 2ODNA 4WJLA 4MDEA 3DXFA 1KVRA 2WDZA 3PGXA 3K8YA 4WCDA 4XLTA 3SBDA 5AQ1A 4K88A 5AOBA 2Z8ZA 3ZX4A 3FCSB 1PV4A 2BSXA 4N3AA 3HA3A 4YVFA 3JQGA 3BL8A 4YDSA 1I2AA 3A8TA 1KMQA 4IQFA 4PIMA 4QGFA 5EVJA 1UXJA 3AUTA 1SUIA 4KH0A 1ZXXA 4KQXA 4CNBA 5H9WA 2I4MA 2GRUA 3PC2A 2YS7A 1MIHA 3AJAA 4OA5A 4Q82A 5MF6A 4S2UA 3ZC3A 4DBLE 3TMAA 3NT2A 2A92A 5F9MA 1XFDA 2Z4SA 4WVFA 5BNTA 1Z6GA 1ZXBA 1QTNA 5D85A 4N0QA 3Q3EA 2BPOA 2WB2A 2RGBA 4RPKA 4AKHA 2N0SA 2R4TA 2DWCA 3PJDA 5TE9A 4HQ0A 3BG5A 3EGXB 4CR8A 1YCFA 5F3DA 4K9RA 2J5QA 2QE7A 4DJTA 2BSAA 3CX4A 4HRYA 2REQB 2IP2A 3GA0A 1W85A 4XYBA 1P1IA 2EERA 4G8CA 5KAPA 4OBBA 3DMHA 4G86A 2JVIA 1Y8RA 4J1TC 5DNAA 5KVCA 4AROA 1RKVA 1TF5A 2PL5A 3GCGA 3NVAA 4LRQA 3OETA 4IV8A 1R3DA 5LWHA 4HUQB 2VEDA 3HHPA 1TJYA 4I9UA 1EUDA 2AJ8A 2QTLA 1XKLA 3KT6A 1W93A 4LBVA 2H31A 1JAIA 4PX5A 3X1JA 1O58A 3NTVA 4B82A 4EHJA 2D7DA 2V6IA 1FU7A 4B33A 1RLTA 1IPFA 1Q1BA 2IXFA 3D6FA 3M82A 4GOMD 4H60A 4UMVA 3IUEA 1MC8A 4NBTA 5HF5A 1EK5A 3WHKA 1R0ZA 2NAFA 2P68A 4RK4A 3WLQA 4YRZA 3FAKA 3N8DA 4FNGA 4WLUA 3GVCA 2G9NA 4ID3A 1LNSA 2HHCA 2EJBA 1XZAA 1CF2O 2XA1A 4LGYA 1W35A 4UBJA 4CV3A 4JA2A 5CLFA 5HKKA 4YI5A 1C9DB 2OZLA 2QAGC 4G1FA 1D6NA 1B6TA 4TLMB 3RWOA 3STXA 2YCLA 3QITA 3QEBZ 5B6PA 3CWQA 2BKVA 3M89A 4UTOA 1SUPA 4YJHA 3TRDA 3MTQA 4B80A 3CRQA 3MCTA 3ML1A 3V80A 4E5VA 2PXCA 3UICA 3LVBA 2PUJA 2XYVA 7REQA 1RWOA 3UKOA 1USUA 3G9ZA 3S8EA 2CXXA 2H5EA 3JZAA 1W73A 2PUWA 4KYUA 2AK3A 4X1YA 1BDBA 2WI8A 5IFLA 4M98A 3DHVA 2FUCA 2WEKA 3NDJA 1M73E 2Q1XA 4O0MA 4K3UA 3TINA 3VTFA 4CL3A 3UJ3X 4ND8A 3K9FC 2O5VA 3DWFA 2FVXA 1GUBA 1E2IA 2HMSA 3BAZA 1WA5A 1T2NA 4X45A 4KB5A 3R7LA 3GZTB 5C8DA 1N2ZA 5EJ6A 3PLAE 5CNMA 3L7DA 5IBPA 5H0IA 3PNMA 1ZDMA 2FRVA 3B6IA 3EDRA 1YAHA 3JYHA 3L4BA 3M6MD 2JJ8A 2E4VA 2WJWA 2WAYA 1GQQA 3B1ZA 1GYRA 3CH7A 4O4HF 2P9TA 5L3QB 1L7MA 1RAIA 4D9JA 3M3PA 2OFOA 5E6RB 1VBFA 1R8YA 2QRLA 4OJMX 3D6UA 2W6CX 1GPUA 1QHSA 3A9CA 2KLHA 3KJHA 1ZI9A 4HNSA 4K9NA 5HKLA 5LOVA 3ETGA 1VIAA 3WGMA 4I4LA 1PU2A 3UOWA 3TD2A 1DVRA 2ZSBA 4MGHA 4B3BA 5T67A 2BGGA 1MEJA 2D0PB 2Q1WA 4O2RA 4D6XA 1A4UA 4JR0A 1W2GA 3U3JA 1EVKA 3H8WA 4LTDA 5FT9A 4XB2A 2FG7C 3F71A 4ZU1X 3SI7A 1TCCA 3B1JA 4Z6KA 1S8FA 4PS0A 4IGFA 1XTBA 4JK3A 4F4JA 5LLTA 3R3UA 3CQ9A 1OB2A 2BN4A 1ETUA 2C9DA 3F2VA 3OLZA 4JOQA 5IDYA 3GLGB 5KUTA 4FOOA 1Y3BE 3OZ7A 4RELA 4Q4CA 5MN6A 3K16A 2A9OA 1J4AA 4NE9A 5FOSA 1W5EA 4L8WB 4HDOB 5BSUA 3GLQA 3AHCA 1FFAA 3DZGA 4WJZA 3OVMA 4HDMA 4EFLA 5KWJA 5T7BA 4CJXA 5CRIA 2PPLA 2JGIA 1DG3A 1JTEA 2QVCA 3U3XA 2GSWA 3DAHA 3OJWA 5DBGA 3B3GA 4RC9A 4GAEA 3DZCA 1DV1A 4JQSA 3VPCA 3BE4A 1OR8A 2RFLA 3N7TA 4BLTA 2AWOA 1VHDA 4WLNA 1QIKA 4ENUA 1BDHA 3SF0A 1I6WA 4YGYA 1IK4A 1NOJA 4XGNA 2CB9A 4XCQA 2YY6A 3P0FA 3RFXA 4UDYX 3X1ZA 4YCSA 3UGJA 3EXEB 1N7HA 3KV3O 4JU8A 1YB1A 3ODPA 3WQHA 4C3ZA 1O2DA 4J43A 1UK6A 3DVAB 1L9KA 1NASA 1NW6A 1U7XA 3QY9A 4KGZA 3BSSA 4NLLA 1JYEA 5GVRA 2GHRA 5HFNA 3SDSA 2P1DA 3D31A 4RF3A 1QFZA 5IRCD 2ERYA 4TROA 4B6PA 2GA9A 1MB9A 5G41A 1PO7A 1AXRA 3DSRA 1VKOA 3DEFA 3MLEA 2A9RA 3OPYA 5MDHA 2YXPX 3V48A 4RJLA 1CDDA 4FHZA 4KTVE 3CCBA 4DB2A 4WNAA 3HKCA 3BTOA 3F6YA 3X1KA 4X90A 3KAJA 2PT6A 2P5SA 3AM4A 5C8VA 1ZRSA 3Q3CA 3BWEA 2V1XA 3KWMA 3ZWVA 1CNFA 1LK5A 4U7PB 5KNDD 4FGUA 2PH1A 1NYLA 1QCZA 1PGPA 2Q0QA 3KIPA 4FD3A 1P7CA 4RV9A 4ZOCA 3NRJA 3SM9A 3WGTA 1EWTA 4FGKA 3PKIA 4HAVA 5CVVA 1SVMA 1C41A 4G5XA 2XB2A 5G4KA 3EY9A 4KLAA 4M0KA 2ODTX 2PLRA 3AFIA 4NL4H 1BXGA 3O75A 2OKGA 1Q7CA 3LLMA 4OTZA 2FWBA 4HQRA 5CEEA 1XDBA 2HCJB 3OM1A 1Q22A 4X64B 3NUQA 3PF8A 2EKDA 1W44A 4MQUA 1NQUA 4CXMA 2GXAA 2B1RA 3G2KA 1G3RA 3ZWQA 3O3NB 2A35A 4KGDA 2OO7A 2PKEA 3F4BA 1YMUA 1IEVA 4YJ3A 1CE8A 5ALTA 5HHTA 1FU8A 3P2OA 4DL9A 3SQDA 4OO3A 3FHCB 2VCHA 3QWFA 4FINA 5EJIA 2X9QA 3W3AH 4EHNA 4WZAE 1NXTA 1PDVA 4N54A 1WBJB 3H3XA 1YWGO 2WD8A 5DBFA 1Y4SA 4V39A 1T3GA 3OUZA 4ER5A 2GYUA 2BKLA 1KJ9A 2ECPA 1F48A 2X9LA 3CUTA 3FCAA 4R1LA 2F8LA 1JHUA 5ALDA 1TYCA 3OE5A 2O8BB 1KWGA 1Y5MA 3G49A 1IHXA 4MRSA 4EH1A 1DB3A 5L51A 5DH9A 3DF9A 3TLZA 1TE2A 2E55A 1DHRA 2QDKA 1EFHA 2CHUA 3MAGA 2RDMA 2Z8YM 1OYWA 3QFFA 4AF6A 4PVCA 3INRA 3H5AA 4HYEA 3QTLA 1BKYA 4D0GA 3K0AA 3ENNA 4DIBA 3NMUF 3IVAA 4LY0A 4KKXB 4M53A 3WMRA 3OE4A 2B7LA 1N4AA 3P94A 2F90A 4LN1A 5A9SA 3M34A 1OX5A 4XA8A 1BHQ1 3JQ8B 3CF0A 5ERXA 4NCXA 4QELA 3OOSA 5DW0A 3ZE1B 5KQPA 2AEEA 1OZGA 4P36A 3WNZA 4GEGA 3MHPA 4JDPA 4WUTA 2ZK7A 1NURA 1H23A 2Z3ZA 3BT7A 1EBFA 1FOEB 1N2SA 4OK3A 3O8QA 4WZBE 4I9GA 4DSOA 1B0UA 3TD6A 3AVPA 4RCYA 3LLSA 2A0XA 2PGLA 3F9CA 3VNRA 3D0RA 3TR6A 3U7GA 1OXMA 2DPHA 2UYCA 3DHEA 1W4CA 2OCBA 2KMLA 4V0QA 5IXSA 1R0CA 1YE8A 2YH2A 3BWDD 4Y1FA 5AI5A 5FUXA 3I4CA 1LQ2A 3AGQA 1PS0A 4KODA 1SUWA 3K35A 1V16B 4DDUA 3ON5A 5JQGF 5AJTA 5EUMA 1ATIA 1EXDA 1QTIA 2FW6A 4JJFA 4TYPA 1Y7HA 1DBRA 2BH9A 4XI9A 3U1BA 2QMEA 3EULA 4MDFA 4D6YA 3P20A 5GM1A 3WSTA 4LYHA 2IC5A 1QDEA 4I6JA 2VXCA 4ZOLF 5LLDA 4Q6BA 3HA7A 4PRKA 2FLWA 5KNBH 3U61B 2YVAA 2WUDA 1SEVA 4FCCA 2HRRA 2AZTA 4RA9A 1BD3A 2XHZA 5E1OA 5FOTA 1WCWA 1WVIA 1I01A 3GVPA 1UZNA 4LYDA 3WMWA 1NF8A 4OFXA 1OYOA 1TNDA 3W2FA 1YIDA 3EW9A 3WYEA 4V1CA 1EB8A 1H65A 1IYZA 3IUYA 1DG1G 2YZMA 3TTTA 3SGLA 1GTZA 2HIGA 1BS2A 2DXIA 4OB7A 2R8RA 6YASA 1BA3A 1SBZA 2ZTLA 3UGKA 5G1PA 5KYUB 5CB0A 3UBTA 2X0RA 4LE1A 3EAQA 3TQRA 3IPCA 4JC4A 5EHZA 2HYDA 4NK5A 3C85A 1QVVA 2BAGA 2PYZA 4QEZA 5IMBA 2CL6X 3GCZA 4HN9A 4XCVA 4C0AC 1GSAA 2QZPA 3RABA 2H06A 2A0UA 1IZ0A 3BZBA 4MW1A 4A8JA 3ESDA 1GP2A 1R9MA 2XE7A 5IFKA 2PH7A 4LOAA 3MTEA 2E49A 2NVUA 4TS3A 3F7MA 3LYAA 3ESAA 4PYIA 5IVDA 5A9TA 3Q3GE 4CKWB 4U3JA 1JHMA 1PGQA 5JC1A 1KOFA 1Q91A 3LLVA 4D92A 3QEJA 4C5CA 3CZPA 3WY9A 4BTEA 1E5VA 4MGZR 5K0LA 5IXJA 3ZD7A 3RASA 2C7OA 4IXWA 3QBJA 3E5MA 3FNFA 1C4KA 1J7JA 4I4TB 4GHWA 4I6EA 4X1KB 3EIWA 3QUSA 2X7XA 4JT8A 4BAUA 4E94A 1KEKA 3IEXA 3U9LA 4EL5A 4JUBA 2VTBA 4R68A 4I81A 4G0QA 3GFOA 1X7YA 2ZDHA 3DH0A 3C3BA 2EZUA 1AGYA 2GJ8A 3INNA 1T9GS 3BCRA 3MWLA 3V8NA 3KEOA 2FPIA 1GUFA 3BH7A 4W9NC 2N1BA 4GKJB 4BS9A 4NJEA 1VI2A 3AX6A 3ZWKA 2IP1A 3JWIA 7ADHA 4BWYA 2A9FA 3AFMA 3LM8A 4CEHA 2IZ7A 1SUFA 3QENA 5BYKA 3FCYA 4FFSA 1JXOA 3SEZA 3QNMA 4DC9A 3WGIA 1WG8A 2ZIAA 3KVVA 5AJHA 4HVLA 2VTBB 2XZLA 4QLAA 1UZLA 3A11A 2JGAA 3EPLA 1H0RA 2C5GA 3NJRA 4NONA 3H1AA 1RXIA 5KYXB 2ZETA 4C4ZA 1Y7IA 2C83A 3QLVA 1BDIA 5D86A 1LJLA 1PT6A 3AK4A 2CNWA 4XX0B 4WLOA 1M1NA 1QE3A 3AGPA 4EZIA 1Y7LA 4C4RA 2AFIB 2EFGA 4BQFA 1PD1A 5EUCA 1Y1PA 1A77A 5EP4A 2R6R1 3J7TA 3NJ4A 2ZUVA 3DCYA 5HQJA 1LPBB 2NU9A 3FHTA 3FJOA 5IC5A 2D54A 1A8PA 3R23A 5C8YB 2P35A 1U11A 1WV0A 1AX9A 2ZYVX 4XLZA 3VA7A 4QAQA 4AICA 1N57A 1YC5A 2X41A 3WKEA 1Q74A 1RYBA 5FA6A 5IJ0A 5SZJA 1VB5A 2PAFA 4G23A 5DP2A 4V2UA 1NRWA 5IT4A 1JHPA 2P9CA 4HS9A 2ZUUA 3OCWA 1DXQA 1II0A 1MXHA 3TZCA 3RWBA 4I5IA 3KAKA 2XY4A 1L3BA 2AFHA 2H5JA 4HQFA 4DNXA 5ETJA 4B3RB 1ZO8A 4FFMA 4GIBA 3HYRA 3UF0A 4I3FA 4EL0A 3EMBA 2AN3A 2NQ8A 1QHHB 3OPQA 3HDVA 3NJ8A 2R66A 3MA0A 4FZVA 3P2YA 1SG9A 1JXMA 1T8WA 3QLTA 2ZR0A 1KKMA 3MFQA 3C24A 2F62A 3QQPA 1ZH4A 4JLKA 5DF1A 3CV3A 1JEOA 4YUWA 3GA7A 2FPGB 3E15A 4GPZA 3SYMA 3ABSB 3DFFA 4Q4JA 4EG8A 2X42A 5KJ6A 1E2GA 3K70C 3DGFC 2Z30A 3ZOZA 1SOVA 5E2IA 2V7EA 5CNIA 4BB0A 3QVXA 4NXMB 3RQIA 3NAMA 2ZKLA 4II2A 1HT0A 1DP4A 2IUTA 1OXBB 1B43A 3DBHA 4QBIA 4N03A 4EJFA 3AV0B 3M4JA 2IPXA 4C6RA 1T6NA 1OX4B 5LYYA 4CM8A 3PJEA 3W4IA 5JZ9A 3PHIA 4QICA 2P4EA 2IVFA 3WNDA 1ZLXA 1D2CA 5BWMA 4YUXA 2OORA 3HO8A 2P9QA 2D0OB 3HJHA 3NKLA 4XJXA 1SQ5A 2X40A 3OM9A 2QN9A 5JLJA 4C05A 1TKRA 5ABPA 4TTQA 1MV5A 4MDYA 3GZNB 1ZK3A 3MCUA 2MSEB 3UKDA 3GN1A 2JGEA 4C0WA 2LNDA 3O5AA 4HTAA 4KYVA 3VKFA 4CM6A 3TLCA 1Z6TA 3HB0A 3AI3A 3WNVA 2VO1A 5K3OA 3FTNA 3JRNA 2FEWB 2QP9X 1C8VB 4FK8A 4MV1A 4WERA 3W6PA 5IJ9A 3EISA 4NMLA 1UAAA 2J7KA 2P2ZA 1ILWA 2ZRPA 2QVZX 3L8FA 5TMBA 3OM0A 3WVNA 3ZNOA 4R1SA 4KRGA 3MC1A 2YMMA 2DHCA 3CZ9A 1GDDA 4Q01A 4DNPA 2DWUA 4AX8A 5CB6A 4YJ3F 1G55A 1XVUA 1B1CA 2BFWA 4N7MA 1IMJA 4Q12A 4B2YA 3I5YA 3ELWA 4XUCA 4HDRB 3ST7A 1ZCJA 4M7RA 5DXAA 1QCDA 3GZJA 5E6UA 4A82A 5JYCA 3ZWDA 1N36B 3ZJVA 3VYWA 1YI1A 4MW5A 2GZRA 2ID8A 3DTTA 2F59A 2J3LA 1T9ZA 3PRKE 1SUAA 2P8SA 4I8IA 3W1EA 4ZV4A 2GYYA 4GZ3A 4P38A 3EXFA 1PZHA 4MEBA 5ER6A 1KK3A 3G2IA 1KYTA 3BXZA 4C7XA 2AG1A 4AT1A 3CVYA 5JZMA 1MIOB 5LCXA 1P2BA 4X00A 4S1OA 4JQCA 5ALWA 1MRSA 4YRPA 4EW2A 1RQ7A 5A5DA 3T06B 3H9JA 2PS9A 1T9GR 4EGJA 3O82A 5JYDA 3L05A 2B8JA 5T4BA 4GDMA 1R15A 3K1YA 3K9HA 3MJFA 1W48A 2FN8A 2X2OA 5I9LA 1H8EA 4WKBA 2WIJA 1N5KA 5AJZA 5C4MA 4KHPB 1XO1A 5A0TA 1XMSA 3IAM6 3K1TA 3NC0C 3HM2A 4CM4B 3O1LA 1E7QA 1JA9A 2IPMA 2E4XA 3GPBA 4KO1S 3TVYA 4RD6A 2ZYUX 3VOAA 3B8HA 1CUHA 3GLHA 3MTBA 4Z9AA 3KU4A 3SQOA 2R62A 2B8WA 4KPEC 1EFVA 3DPIA 2BGIA 1U3DA 1KEVA 5CVCA 5EIFA 1M6YA 3FETA 5CGQB 2O1SA 1H5NA 2ILTA 5M04A 5IM4A 1W1WA 3SDBA 2OV6A 5BUZA 3LQ1A 2BMVA 4FMPA 1H66A 5IH3A 1K3TA 4TQGA 1AQNA 5C32A 3C3MA 2FPSA 1E7SA 3F97A 4KAAA 2FGJA 2AHRA 1IPHA 4FEGA 1N2IA 2BBTA 2VNIA 2BUAA 1J8DA 1B2RA 5IANA 1NX6A 1SIBE 1MQAA 4PFQA 4KTTE 4KXXA 4O4JF 4YUAA 3W2GA 1NIJA 1UP4A 2FPKA 3JARB 3O26A 3AMVA 3X43A 5SZIA 1Z08A 2ECFA 3D4PA 2HWYA 1RPNA 2IYXA 4HRAA 3ROPA 1ZESA 2C3OA 3A1FA 3U4IA 5DOVA 4R71A 1QAOA 4OMCA 4U2EA 3QKRB 3PXGA 1OUMA 3I01M 5CTJA 3ZN2A 1W4AA 4BO4A 3RYFA 1U8XX 2XYRA 3W2EA 2GZAA 4FFRA 3RAGA 4UOQA 2AN9A 4BRSA 2R6HA 1ECGA 5DCUA 1R4MA 1BSVA 4WMLA 4B8WA 2O0HA 3O73A 3IRVA 4U39A 2IH2A 4CMBA 2Z95A 1XXHB 1T8UA 3LDUA 1S8OA 3NDRA 1O96A 1Z38A 2H4XA 3IPXA 4C7OB 2HCBA 2YHBA 3G8AA 4X6XA 1ISMA 4ZI7A 5C51B 2DG2A 1E1RD 3EXAA 3EPHA 4YV7A 4F2DA 5TQJA 4EMSA 4FM9A 5LMZA 1E2LA 1LVUA 4FYIA 3SS9X 5B30A 3H99A 3UATA 4P35A 3IJEB 1IWOA 1WKCA 4MWZA 5FAKA 1Y8QA 4L0QA 3I05A 4P1ZA 1OV4A 2ZJBA 4M36A 2XTNA 1TA9A 3UV7A 3TNFA 1GT91 5BR4A 4OH1A 1PQYA 2MYNA 3K53A 3QBTA 2N46A 4QUAA 2NLOA 4L50A 3CSDA 1Z2EA 4Y98A 4GM4A 1NVBA 1VYTA 5KYYA 3VSAA 4BRUA 1EUCA 3W3AA 2CE7A 4WXMA 1L5QA 1ORVA 2SKDA 1IWPB 2O3SA 3T5TA 2R86A 2KE5A 3U4GA 2GN1A 2QSYA 4V3CA 2GILA 4CLXA 3QVSA 1JYFA 3IIJA 2PBLA 3DE1X 3OCJA 3MUEA 2ZAIA 5KQRA 1ZKMA 3KC2A 3WLLA 1ZU4A 1EINA 3BSYA 2OHIA 3KOZA 3LRTA 4G09A 3QKIA 5CLQA 1YCGA 4ZQGA 1HDCA 1T3HA 1FDIA 2VHXA 3TTVA 5HFJA 3EC2A 3OQNA 4RNCA 4MVWA 1U8AA 2AV6A 2WIGA 2BRUC 5H3CA 2SHKA 4FDMA 1TKCA 4MA4A 4BMNA 4LHXA 5ALQA 2A5FA 1QIJA 2FQ1A 2H4FA 1NIPA 1DUIA 2Q5QA 3RG2A 4FFBB 5CBKA 2J6CA 3BWCA 3JCZA 2C5EA 4QNRA 4BFXA 4TTTS 1JFRA 1GCUA 2UVQA 4ID9A 4X91A 3ADKA 1PVVA 4UNNA 4AF8A 4BJ5A 4C0KA 1DEKA 3MS7A 1FFXB 2RK6A 5G3YA 2AW5A 1FIUA 2H4ZA 2JLBA 2UXDB 1MABA 1HURA 3TLBA 1P6XA 1ZL0A 4JLJA 1W88B 3UAGA 2VRBA 4GWKA 3W8EA 4GGPA 2QT1A 3A6FA 4EM6A 1MGOA 1PIWA 2GK6A 2QQGA 1L5OA 2YVLA 2AJLI 1HM5A 4M1KA 3L1VA 1E0AA 2G5TA 2EJTA 3RFUA 1P9WA 4KLCA 3E7XA 1S4QA 3KTAB 4OUDA 1F2DA 1TUIA 4NKRA 2EP7A 4J6EA 3O2SB 3I34X 1R18A 2OV4A 2VJBA 2X0IA 3DTVD 3EW7A 1QM5A 3KALA 2E3JA 4U4AA 5I4CA 2HIAA 4MW4A 3QVLA 4Q1BA 2YN4A 2IYFA 1UBNA 3G2JA 3RKUA 4CUKA 5DLEA 4YXFA 1RWPA 2EGUA 1L1QA 1XWWA 4KWIA 2FFAA 4FWBA 2GBPA 4LZWA 2Q6OA 1BQ3A 5ILGA 3GAFA 3ECAA 3EOAI 4UEWA 4DLZA 1BFDA 5C5DA 6ADHA 1F17A 1BU5A 1SELA 2SKEA 2HA0A 2VHEA 5KNBA 2UV8A 3NIDB 3QSYA 1HFWA 5IVHA 4BP1A 3DEZA 3HNPA 1C7EA 1YQ9A 2APJA 1E3QA 4A6XA 2Q62A 1HTWA 1ZICA 5C8ZA 3QM1A 2OGTA 3NHPA 2ZS7A 3MJDA 3WIBA 3KHKA 4IHJB 1VLVA 3IQXA 1GZ4A 1WSWA 2VP3A 4AK9A 4C76A 4RTQA 1W6RA 3G8CA 5LZ8A 2RGGA 4ZCRA 3LW7A 5AM2A 4FCTA 1ESDA 3LY7A 2PZLA 3PKJA 3F78A 4TV9B 3VR6D 3PUYA 2C99A 2ZSUA 2CZGA 3CZMA 3ZUGA 4F4DA 1MP0A 1RM4A 2VN8A 2XMCA 3DLAA 1HH4A 2J3HA 4GS5A 4MLDA 5CK4A 5KQSA 2EKQA 2I87A 1N78A 1AS2A 3GUYA 3IDQA 5A62A 1OB5A 1WF3A 1J20A 1JMKC 5HIAA 1HGXA 2GCIA 2IPNA 2O6HA 1NFQA 4KQEA 4MI9A 4QDXA 4ZJPA 1IXZA 3KK0A 4BNWA 2ZB4A 3N7AA 2D8MA 2GF2A 2XZPA 4MPTA 3HDHA 5I48A 2X86A 1C4WA 1KRHA 2JFNA 4R7TA 2HLPA 4CN9A 1TM5E 2AVNA 3I9NA 4QOSA 3WV5A 1X9GA 3CT4A 3QX8A 4FFWA 3C3EA 1AF7A 3PCXA 4C4OA 4ZXFA 4BNFA 4EA8A 2YASA 3Q8LA 4P4SA 3EQZA 5DI3B 2CLMB 5T6BA 2KS6A 1ECBA 121PA 3JQFA 3FMOB 2MTBA 4K86A 5FEMA 2G9QA 3IKTA 3UGQA 3MG9A 4X84A 1XRJA 2DHDA 2E89A 2O2DA 4TS4A 3ZE9A 5D1HA 3LT2A 3AP1A 1NBMD 1EFPA 1BFKA 3AOEA 4QYWA 5DTJA 4I1SA 1K7CA 4NZYA 4I50F 3KKZA 3NCHA 1F0PA 2OESA 4ZZ3A 4LY6A 3LNTA 1XJ5A 1VFNA 4LCJA 3VKWA 3EPKA 1NJFA 2XUZA 1GPNA 3I0ZA 4J0IA 2IY7A 1FNNA 4BN4A 2O8NA 5CK5A 4FLFA 3RF6A 2E9SA 4AY5A 3L6RA 4MR9B 4ZO4A 1B0ZA 2C2WA 1RI5A 1ZGCA 3UMBA 3VC3A 3K8ZA 4MWCA 3O1HB 5JH7A 4DMGA 2CZQA 1X9HA 4FHDA 1ORRA 1KBQA 2QEQA 4NQRA 3STUA 1KDPA 1JEQA 1CUAA 1HDYA 1QYIA 1U0GA 3KSUA 5CM8B 3F4KA 2WQZA 3R5FA 3EQ8A 2P4UA 5AT1A 4DZRA 3PNYA 2GMWA 3BVPA 2EDCA 3R5XA 4G5YA 3ZEAA 4RHXA 4AP6A 1LDGA 4BNZA 2YHIB 1JW9B 4FILA 2I8LA 4RADA 4AKGA 3DL2A 3WTBA 2HF9A 4XWTA 2FDRA 1WXIA 1OXVA 4Y0NA 2Y1KA 1T2CA 3FLBA 4IIFA 4MCJA 4MS4A 3BCUA 1N75A 4HEA6 2MSDB 4JCCA 4O1HA 2WWGA 5DHQA 4B3HA 3AEKB 3HA5A 1U7ZA 3F3YA 4TSKA 3KL4A 2XIQA 2Z8YA 2PEYA 1TMYA 4XGIA 4KYTA 5KKNB 1V2HE 1NJ5A 2I9KA 4AWXA 4BVKA 4OKSA 3QTBA 3CLSC 1W47A 3IPAA 3ND8A 3PQ7A 5EJEA 2G82A 4UOZA 1U7HA 4FQ8A 4ND2A 4RYLA 3LUAA 4B0PA 5K8VA 3C45A 2CVFA 3RVLA 4ACBA 2PHZA 1EX7A 2RG7A 4F1WA 4ARSA 2BF7A 2EFCB 3OOWA 1SZDA 3M4YA 1UCFA 3KUKA 3L93A 2AI1A 4ZGWA 2VDOB 2FMFA 3GRAA 5IM4F 3IP6A 3UJAA 2I8CA 1VLJA 3NHKA 3L77A 4N18A 4D4KA 2HGSA 4HDNB 1YL7A 1O0SA 1UODA 1KDZA 5KTNA 4FDUA 4WFIA 4DRXB 4PR0A 5LYJA 4KJZA 1SRRA 3PPXA 2D06A 3C3KA 3HCFA 1SXJB 1TIKA 4GUDA 1QF7A 3SPXA 4DQDA 3WO1A 4BV9A 2NU8A 2IH4A 2RH9B 4JSYA 2DECA 3SXUA 2KYRA 4JLBA 4G5SA 2V7QD 1N7JA 2DCUA 2HBYA 3PGLA 4GM0A 4Y67A 5TPWB 4A1OA 3CTPA 1XLWA 2LGJA 1ZIOA 1QV7A 4U5XA 4Q9HA 4I1IA 1XYVA 1YQDA 4LMRA 3ZNNA 1PJQA 3VDQA 1X9IA 3E58A 2OILA 1QJCA 1J5PA 2QE7D 2NZ2A 3M1YA 1M7GA 1U31A 4I5EA 5IDVA 4FDTA 3VU1A 1DAHA 2AEJA 2H17A 4DMKA 3THWA 5F7JA 4LDNA 4P93A 4P4UA 5SZHB 3T7AA 5IYZB 2C4HA 2O7VA 1TA4A 4QX6A 4N01A 3ZV4A 3QF4B 4H3KB 3A05A 1CIJA 3BL5A 5KMGA 2DPMA 1Z25A 2P2NA 4WGFA 4WPGA 4DV7B 3U6BA 3FCXA 2G83A 2RHDA 4PTZA 2WKPA 4OKIA 2PZGA 4ZI7F 2KQUA 2GM9A 5LXTB 1PWYE 3IYLW 3IQFA 4W6ZA 2I67A 1PNOA 3ICVA 4F6RA 4Z3OA 1N6RA 4C7MA 5FPSA 5EEGA 1EHCA 1MXFA 4H7DA 1JIVA 3ANLA 4JLPA 5EKXA 4DA7A 1U0RA 4MEAA 4WT7A 4UE6A 1P44A 1J2EA 4DM4A 5FUQA 2MMCA 3SWWA 1I7NA 2B2XA 2XV1A 4ZEWA 3M1LA 3TDMA 5EGNA 1RAEA 4XRRA 4RE6A 5HKKD 1QO7A 3W5HA 4EENA 1P5RA 3MIZA 2EX1A 8ADHA 3RVDA 4Q48A 3MB8A 2W2PA 4E30A 1NATA 1WR8A 3DUFB 1E9EA 4HGOA 2GQ0A 3OIYA 3L2OB 3A9VA 3PFNA 2J59A 1XBTA 1WSDA 1CY8A 2J4DA 3O4HA 3T0FA 1Z16A 2CNDA 2XBLA 3DCNA 1VPWA 1ZITA 3LQYA 1HZZA 5FF9A 4MR8B 1COWA 2D5IA 2ORWA 3W4JA 4A73A 2C20A 4MI3A 4IX9A 4TVKA 4DAEA 3TRKA 2VDPB 2RKWA 3SQNA 3P71T 4XM1A 1FUIA 1E9SA 2C03A 5PNTA 1YU6A 5KPJA 2DBYA 3VH3A 1OFHA 1UT5A 4PO8A 3QYJA 3OX2A 4ATNA 1OH6A 1XDWA 1WLSA 3HI4A 1XMPA 1ZK2A 4E33A 2GR9A 4QTZA 5CDSA 3OPVA 3H1FA 3QV2A 2C4WA 1D09A 4QYIA 3PRYA 4EQ6B 4HFJA 4C7VA 3ZHZA 4YWJA 4EHLA 4MS1A 5F4ZA 2QW1A 3O31A 4EUHA 1KERA 2CJXA 4CU5A 4NZOA 1EU1A 1CS0B 1H2ZA 4W1PA 4CYMA 3Q88A 1VC2A 3A4LA 1BTOA 1G20B 1ESEA 2YZ7A 1FFDA 4OQZA 1U7UA 4XPIB 5AIAA 5K3FB 3STWA 1ISHA 1GTRA 4IG4A 2ZRJA 3AZOA 3KSZO 3OFJA 3P2KA 4GLLA 4H7HA 3ZY4A 4E5NA 3OZEA 2F1IA 4L6AA 3SSNA 2JBHA 1X0VA 3C3XA 4IP0A 4JJEA 2WTNA 3F8TA 3TQQA 1ZX1A 5TGTA 1TZJA 1E98A 3EIFA 2JGLA 3KOOA 2H08A 5DVZA 4XOUA 3JS5A 4NC9A 1UXGA 5AKLA 5B1YA 1C9MA 5C1DA 4OHYA 4AG5A 4C3OB 1ACLA 1QHFA 1S3IA 1AB5A 2VPQA 3E3AA 2VXBA 3GNSA 4OHMA 4MV8A 4MOWA 4EPYA 5TIIA 1YVPA 3RS2A 1P7VA 2RGNA 5EOVA 3DZJA 3I2GA 3C0KA 3IT3A 4RH3A 3SR4A 2R96A 1OWPA 3S7ZA 4I1PA 2HA4A 2PH3A 2ZIFA 3H5NA 3ZPXA 4ZQIA 5JALA 3KQOA 2WVAA 4XX1A 4NBNA 4I08A 2Y71A 2OLJA 3CH4B 4CF6A 5CDTA 3QE0A 2UZ1B 1RHKA 3LECA 3NLLA 1Y1KE 4HGQA 4IKEA 4OG2A 4QODA 5ALHA 1NV9A 4Y2RA 1TK2A 2FWJA 1O8BA 5HE9A 1ABBA 2C4VA 3NV9A 1UXHA 2WFLB 1PAUA 1TAGA 1A7AA 1S9DA 3C2QA 4NU0A 1CERA 5I9SA 1Z5OA 1X80A 2RC6A 4PZZA 3AB7A 3LPNA 3FW1A 5CX4A 1LZKA 1W9HA 1KZHA 5AXAA 3ETDA 3WGJA 3PD0A 4EO4A 4YJDA 1MB2A 2A4KA 1JI0A 4MVJP 4D42A 1RYMA 1V5GA 2WYWA 1V5IA 4DRYA 1H05A 3JVVA 2PX5A 4INPA 1HEYA 3ZU2A 3KETA 4OAQA 1K88A 1FTWA 1SXIA 3I2FA 3QRWA 4RY0A 3W06A 2OC4A 4TWBA 3OLVA 3RS4A 3SN6A 3R0QA 5K4HA 4I8XA 2QBYA 4IV5A 1U8TA 2X0KA 4KXNA 3EARA 1LNQA 1EPUA 1JGTA 2PVPA 3C6QA 4BKMA 1X1QA 5DX0A 4K9KA 1S5PA 2OK8A 1KYZA 4HY3A 1AM4D 3F4LA 1ZI6A 5KKCA 4BVGA 1W0CA 3W5DA 4EA9A 1AA6A 5IVKA 1KVUA 3FTQA 5BSWA 2ACKA 1URPA 2PS3A 4ZYUA 4G0MA 2QYTA 4K6GA 2ATXA 3S1SA 4LF9B 1NAIA 4RHFA 3LCCA 4ETWA 3VR3A 4UVHA 1B16A 1NKVA 3H2SA 5KX5F 1CZRA 1GEEA 3HJCA 2QPAA 4WEQA 1P0IA 5GOZA 4WA8A 3QLEA 2ZCJA 1L5WA 1Z0UA 1BA2A 1F3LA 4M55A 2VHYA 4G9BA 4LOHA 4UW9A 4D9KA 4CM1A 3GGDA 4J0EA 5BN5B 1M3SA 1NQXA 2PQ6A 4B7AA 1JWLA 1E1LA 2IW3A 2WVHA 3E4CA 3HVUA 3N76A 1UDRA 1DCFA 1M1YB 4Q02A 3NHAA 4RFVA 4I7EA 4UASA 4BX9A 4ML3A 2HM7A 1I4TD 3GMIA 2GEFA 2QLTA 3PUKA 2YN0A 3WLHA 1GA6A 4X20A 1VJGA 2YFYA 3GN2A 3R3ZA 4QSMA 2FEXA 1TZ2A 2HAEA 4GR4A 3FGZA 4KE9A 3DBRB 1QG6A 1T36A 3O74A 4FD2A 1N1MA 4B3CA 1JHAA 1QZXA 2WSBA 4F5YA 1T5TA 4DDWA 2FG6C 2QGZA 1KHTA 3R7NA 2HMTA 2XVYA 4JROA 4JEHA 4U7TB 5IT5A 4K9DA 1ADCA 3KOUA 2A84A 2PLAA 4MV6A 5CP8A 4AMBA 4R31A 3HBMA 5JDIA 1A9YA 1JDTA 4JBWA 3YASA 2Z0MA 3HN6A 1F06A 2ZT6A 4BAGA 1LBTA 1SVNA 1V11A 3HJNA 1KOJA 2HWKA 3HKEB 2Q41A 4R6XA 4TXHA 4X7MA 1P9RA 4CE6A 2AQIA 3L04A 5IAKA 3IVGA 1R66A 1FNDA 2QI9F 3E3OA 4RPLA 3CBQA 3FMFA 2E85A 4C0HA 5JMTA 2OY0A 3BXEA 3QPBA 4IGEA 2QROA 3DE5X 3ZHQA 3DEKA 2JHGA 1XQWA 4YP9A 2HIMA 3KSRA 3KQSA 3VR1A 2YJZA 3FWPA 4J7CA 2I22A 3VHXA 2CVHA 4ZEVA 2RIRA 2SNIE 4G07A 5H16A 2O5RA 1DEXA 4DANA 2JZOA 1SQGA 2PD6A 2WP0A 3DA8A 4H3SA 2YJGA 4O8ZA 2WFZA 3CF6R 3KXIA 5JNTA 1YC2A 1Z0FA 4AJ1A 3O8OB 2QRMA 3GJ4A 3P52A 1Z6YA 2DZDA 2VA8A 4LW8A 4Y9TA 5EE5B 3ABOB 2XXJA 1WV1A 4H6VA 4UM5A 4JCOA 1RI1A 2C8JA 3QOWA 9MHTA 2JRLA 4A9AA 5HA5A 2UUOA 4RY8A 1P3Y1 2II6A 1GJRA 3FM9A 4KWTA 4TPKA 3TSWA 4F97A 1K06A 3UCEA 3WDMA 3ED1A 3QF7A 4I9FA 1PDOA 4A03A 3ANXA 3FH0A 3C8HA 4DLBA 2HU8A 2HUNA 1T25A 4LWPA 4DC1A 9LDTA 3G2NA 1CYEA 5DWVA 4B09A 4JI6B 3FNIA 4XVQA 5F73A 1F5SA 6PFKA 2VYND 2ZQ5A 1T4MA 3KQTA 2OVFA 4FGWA 4Q39A 4B32A 4BN5A 1N2GA 4PLCA 2ZUWA 4E03A 3NYIA 2XCRB 3SQXA 5IG2A 3ACBA 4US0R 3B78A 4D7AA 5BN4B 4AF7A 3HJRA 3SMVA 1QVWA 3FSRA 3SM3A 5JFTA 1UPUA 2J5KA 2ZWAA 5EG5A 4KPYA 1CFZA 2IDKA 4O0LA 3VBEA 3VX3A 5FH9A 1ARZA 3QVWA 5L7TA 3C8DA 4KXMA 5A4KA 4J3JA 5EJ4A 3AU9A 2QQ5A 1OLUB 2UAGA 5J2UB 4FZ5A 2HFJA 4PLWA 1Y8ZA 3KJZA 1X77A 5ALFA 2VQ3A 3AINA 1TX4B 1E8MA 2Q27A 3GAMA 3IPRA 3QLUA 4OL0A 1EJ6A 1JR3A 5KPDA 2QTVA 2XUGA 2FWRA 5KYWA 1TPYA 2JLCA 4KQMA 1DDGA 1FEZA 3C7TA 3OIDA 4F4UA 4NCBA 1YR3A 2FPUA 2PWPA 1W87A 4LRUA 5FL7A 3RSCA 621PA 3MWKA 2DPXA 4UKDA 1ZD4A 2ES4A 4BO5A 4MGKR 1QX3A 3CEMA 4E4YA 3LQKA 1GNTA 2QMOA 4QPPA 1O5OA 1N6NA 3PR3A 1GGMA 3GDWA 1LD3A 2XTAA 3IVMA 4KQ6A 2RARA 3HFJA 1P6UA 4LZLA 5EIEA 3L1KA 1RRKA 3EN0A 1S2LA 4XDGA 5LQKA 2CK3A 1HQKA 3PDCA 2ZB8A 1ZH6A 1PS8A 1JT9A 1U7TA 1SOWA 1WLYA 2FSVC 2W22A 3H0CA 3MT8A 3TEFA 1E58A 2H3HA 2QTNA 5EKDA 3D64A 4X1IA 1UJNA 3UB3A 1ZW1A 4E08A 4DR6B 1ZK1A 4BCCA 1B3RA 2NO4A 3SZRA 3ZQ4A 3FPFA 1FMTA 4XGRA 4LXQA 2BMWA 2K7ZA 3UEOA 3LCVB 3O3CA 5BQ5A 3RYHB 1P91A 1PHPA 4KQGA 2ODBA 3K5HA 3RYCB 2BYTA 4LYAA 1R88A 5EP2A 1XA3A 2Z5LA 4L9SA 3F5MA 4HSGA 5DT2A 1GPKA 1ZD5A 3TCNA 1A2OA 5H68A 5DB4A 2BH2A 4MEJA 3HSYA 5GONB 3IDSA 3K0HA 3PXDA 2QAIA 2C1ZA 1G60A 4QOJA 4CT5A 4H3HB 5EESA 5AFSA 3ZZ1A 1RCFA 4WE3A 5IKXA 3B36A 4J94A 1E96A 1LLFA 2GK4A 1ZH8A 1FTNA 2OHXA 3M6IA 4DM3A 1JSRA 4Z49A 3KEQA 5IWCA 5ALLA 1VSVA 1YIOA 5ECWA 1V1RA 3OWXA 2NUPB 2CNWD 5BV7A 3A1VA 3DQQA 2HRCA 4RFSB 4AKSA 1HLPA 1K8XB 5EERA 4J16C 1IJBA 1FFCA 2FZEA 4NULA 2Y68A 5ILQA 1U9JA 4JOSA 3Q2KA 1BCSA 4MK4A 3UMJA 1JRLA 4LQDA 4OOEA 4RWZA 4M0UA 3TUJC 1L7PA 1ONNA 2IZ1A 1GQSA 2XCQA 3C4QA 4FYPA 4UUOA 1VIYA 3AB8A 2AOTB 2J6HA 4BVLA 1IVSA 3HH8A 4GH5A 4M9ZA 1HNXB 2ZJ2A 4WXRA 4ARZB 1PDWA 2GAIA 1JB1A 3QWHA 5GZ6A 3WTCA 2VDJA 4AJLA 4C6HA 1D2HA 5K3BA 5CFZA 4YC7A 2WLSA 5TX7A 3ASYA 2HQOA 1PFKA 1AUOA 3PICA 1H2HA 3KP1A 4PC3A 5KKAA 1K6JA 4K3VA 1XSEA 3C14C 4JZKA 2GM5A 3WLNA 4KLZA 4ZD6A 2E7ZA 2FEPA 2VP4A 4UXHA 3TNYA 4BX3A 2HJRA 4RVUA 5FLEX 4JXZA 1DE0A 1SEPA 2IIQA 3OWOA 1F1JA 1DKOA 4L5CA 1JBKA 2BFDA 3D3EA 5IDWA 5DTIA 5BW5A 1UDXA 2KPOA 2X4IA 4L78A 3CXUA 4PIVA 4ZO7A 3OZGA 4LXXA 4Z1MA 3U3KA 3WLPA 4B76A 4CQNA 2Q3CA 2HHJA 5I7UA 5FBQB 5IEBA 1S1MA 4ER3A 5CAEA 4G0VA 4ZOQI 4JSRA 1XRRA 3ASZA 4RTNA 3NUGA 4PNEA 1FDRA 4ARCA 2ZZNA 4M8NE 4DV2B 1RVV1 1VB3A 4GXRA 3WKCA 4R3NA 2I4RA 3WQQA 2ICAA 3SHTA 1TU3A 2CXSA 3CN9A 2WV7A 3VX4A 4B31A 2BM1A 4MIKA 2KB0A 1EQAA 1B6SA 3D2CA 1IUPA 4MRVA 4RDCA 2F4NA 5NLLA 3UMGA 5JATA 1X1CA 3FWNA 2CCGA 3HQ4O 3FKSA 3O0DA 4JVMA 4P4NA 1NMQA 2CLIB 2ZULA 4BKRA 1N92A 1Q3HA 1Z06A 3DLIA 5DX8A 3RBXA 4ZGBA 2PUHA 4AECA 3T4PA 3TI7A 4DREA 1Z18A 2XMPA 4S0XA 3MOGA 2FQYA 2CJWA 2V6FA 2PKRA 1GY8A 4FSHA 5AM0A 4O2BF 4ZC1A 5I4IA 2CEAA 2W6OA 3G0GA 3GMSA 4E4RA 1LLCA 2BI8A 4J90A 3FOBA 1K6IA 4NCIA 3LL4A 1CY1A 4YMWA 3LF1A 4A2CA 4H0NA 1VI5A 1SHKA 3D6VA 3ZWCA 3M6LA 4G5RA 4Z4IA 2XBUA 3IEUA 4L3OA 4XIFA 5ALNA 1FTGA 3M49A 1N5JA 4JMPA 3TLEA 3BKWA 3BQNB 4RS4A 1D0SA 2H1HA 1DX4A 4FW8A 3AIIA 3NBFA 1JKIA 3GWGA 3RTCA 4HWPA 2P9JA 2ZR8A 5FA5A 4OHBA 1PD0A 4JODA 1UFKA 5G40A 2XMGA 4NMMA 3DFIA 2YFHA 1NJ6A 4K7JA 4QQRA 2B94A 2J9GA 2CDNA 2PXXA 5GWXA 2ZPAA 4HNGA 3WIDA 3TTXA 3X1XA 1G16A 5JS8A 4X85A 5IUKC 2XQVA 3PC3A 3J7AC 5AR1A 1UFRA 2FQXA 3FDXA 4XB1A 2G1AA 3IURA 4QTYA 3GT4A 4QE3A 1VSUA 3ZW8A 4PPQA 1G9SA 2FSGA 3AJ9A 4MQFA 4EG1A 4AKEA 1MX9A 3HR8A 4IHAA 2REOA 3LJKA 2J08A 1TUBB 5JS6A 4TN1A 4WXPA 1VLHA 3TIXB 1ONPA 4IS2A 4HZGA 3HKBA 4K8OA 1JUDA 5JD5A 2GPSA 4LNAA 3HV2A 4WW0A 5BNIA 1JB9A 3ZE0B 2HCTA 3BX1A 4ILEA 3ONEA 2XUHA 3HVIA 3VJKA 2JGRA 1IHDA 4YB8A 3FCEA 1H8ED 3HBNA 4DNQA 4HYYA 2J67A 1MG0A 3N2GA 4K9LA 3A1WA 4HHEA 2YIDA 3PQ6A 2QY6A 4LNUB 3RRZA 4BNLA 1RJ9B 3KJFA 5CVEA 3DKIA 5K8JB 4TYNA 3STHA 1AVTA 1XZJA 2JGDB 1LJ8A 2QL5A 3VI3B 1I6KA 1QFMA 3SICE 3V3KA 2AFVA 4UVGA 5KX5B 4EEZA 2X13A 2RHHA 3MWJA 4TRNA 1HDOA 1SBTA 5H80A 2E1RA 3RSSA 3S2GA 1MGPA 4N5LA 4YROA 4D9CA 1GNPA 5DN9A 4KNVA 2EGHA 2PLNA 1T0UA 1GPAA 3MSXA 5A05A 5LSAA 1WW3A 1KR2A 4C87A 4R8LA 5JRDS 4ENPA 4ZZ1A 1E64A 3A1UA 4WKPA 1E7RA 4RU1A 4CR7A 5EHXA 1E0KA 1TYEB 2B2CA 3UHAA 3EXIB 3VU9A 3DBLB 2YL2A 1VIDA 3H83A 1BQ4A 1IG3A 4YV2A 3RAJA 3RLIA 2PT5A 3DBIA 3HV0A 5BYAA 2H8KA 4IKOA 2O50A 1FPMA 3LGAA 4QDZA 3HWWA 5G53C 1TQHA 3ZLUA 2PGJA 3FMVA 4G0UA 1JQAA 1L7DA 1KH1A 1HKHA 3DE6X 3GJQA 4PG6A 1OFGA 1GG5A 4C0JA 5KYGA 1S7GA 1Z15A 4K0KB 2WJVA 3BGDA 3NHRA 4KFRA 4TX1A 5EJFA 4OSEA 4DUYB 4DIMA 1AZLA 1A5SB 1GVNB 1V8DA 2FMUA 3LCMA 5EIBD 2OYCA 4YP0A 3AF4A 3B3QA 4DIUA 5LQRA 2AGVA 3EG9A 3Q40A 2JGNA 3DHYA 1GZVA 1QS0B 3CEPB 1GSHA 2QQ0A 3QXHA 1SULA 2R1TA 4DS3A 5FWNA 1ZK0A 1UBCA 4TXJA 1T2AA 4TZTA 2NPFA 1K6XA 3T9CA 1Q1QA 2G1PA 4NQZA 3UPUA 1WX1A 3D81A 1R12A 3D0KA 1ZQ9A 1F38A 3T3NA 2H18A 1ZJZA 2YRXA 3IGFA 5FIUA 1J6UA 1PEKE 2VPYA 4BMPB 5LU8A 3P4XA 4JA0A 3UUFA 3V1NA 5ALRA 3ZVMA 1KDOA 1ZN2A 2ZI4A 3F9IA 3G2QA 4ZZ2A 1G1AA 4Q1EA 2WSIA 3ZK9A 4LHWA 3GRCA 1PHRA 3A9TA 2XVMA 1DBSA 1SK9A 4OJQA 2EW1A 5KZMB 4AG6A 5JSFA 2L82A 2Y93A 3MQFA 3NWJA 7YASA 1YR7A 2EQBA 1W52X 4JR2A 4DEXA 3J81k 3W3AD 2YYZA 4IJQA 4WEOA 1W1IA 1J2RA 2D1SA 1IZ9A 2HA6A 3KQYA 2YJNA 2R751 2C2BA 2JI9A 5HRUA 1LRJA 1G18A 1WXFA 4JT9A 1ULZA 4S04A 2E5LB 3HVKA 4Q9JA 3A1CA 3WFJA 5HS4A 5JV5A 2QJFA 2NZXA 721PA 2REQA 4LOKA 3TXAA 3NXKA 4U9UA 4WZBB 5JPIA 4OGKA 4BQSA 1C80A 1XLVA 5BN1A 1PL6A 5AICA 2AMJA 4ZAVA 2F8MA 1YZNA 3BXOA 4AZWA 5B4VA 3L06A 2QRKA 4HUQA 3FRIA 4K46A 2EXXA 2C97A 4UCQA 1K2WA 1I3CA 3CISA 2X4DA 4XEUA 3D4OA 3OPMA 4CBVA 1UXOA 4EG6A 1TJNA 3WL8A 4CGYA 3DO8A 3BRSA 3BK2A 4HATA 1Z0IA 4R9VA 4A8PA 4YV0A 2J3JA 2YTZA 3NHLA 2HU5A 3KXDA 3V4VB 4DWJA 4ZMSA 1A9ZA 1IHYA 4BAZA 4ERNA 2JJ2A 2HTFA 2ZWVA 3CIFA 3EVBA 3IP1A 3WLEA 5C3MA 4Z4QA 5E0OA 3GAAA 3S0JA 3TX2A 4OBEA 1DNPA 3VYSB 5K05A 2WYHA 4DILA 4KK3A 1E89A 2IYQA 1P8AA 2OBYA 3D7LA 3O4JA 1U90A 1TUGA 2DH6A 2YWCA 3OJCA 4GPTA 4OJKA 1VBMA 1KZ6A 2I2DA 1J99A 3F6RA 4EO9A 4F85A 5A9RA 3H86A 4QJ4A 1E2DA 2V54A 3UUGA 1WB5A 3TNJA 5F3WB 4MLZA 3OJOA 4MLCA 4B6JA 1YF3A 1G6KA 2GEKA 2FEMA 3Q3JB 2G1KA 3LQ4A 2OWDA 4D4HA 3ASUA 4LSMA 2YV1A 2ERCA 2OT3B 1F14A 5KNBD 5A3RA 4PN3A 2R6ZA 2C8VA 1Z88A 2F1HA 3FRHA 1Z47A 1RHRA 4MQEB 5B2FA 2HREA 4E0BA 2JFBA 1SC1A 5LQSA 1P80A 2FPLA 3UK2A 3KKPA 4U6SA 3MPUA 4AN0A 3MWYW 2UXBB 1OROA 2BWJA 3CUEF 2QPOA 1Z0KA 1CIPA 2RGYA 1WMSA 2H07A 3B38A 1L5YA 3ESZA 1Q1NA 1O4WA 5CDYA 1AKTA 1H5QA 2JEYA 1BJTA 3E9DA 2PGAA 4PAWA 1Y8AA 4D9HA 2FVYA 3EZ7A 4M1QA 4YO8A 3KEMA 1XTRA 4NV3A 5CURA 2B20A 2JAUA 5CYPA 4FUTA 3TSAA 3VPAA 1GVHA 1R9JA 1MC1A 2CVQA 2HFKA 3G79A 3R0JA 4P9NA 5E6RA 3T94A 4ER6A 4US2R 4GXNA 3PFIA 1R27A 3HR7A 4HLQB 4OHWA 1KJJA 3AL2A 3AJDA 3U4AA 2NW6A 2GJ9A 4DJEC 3EXHA 4B7UA 1WCV1 1HNNA 1Z39A 2GXUA 1I1OA 3INYA 1G5HA 3DQPA 4MICA 4R54A 2VYVA 4QPZA 5JXGA 1Q1GA 3DAYA 4CIDA 2Q5CA 1YL5A 3CWCA 3LUJA 4UPDA 2BEKA 4RGQA 2GZ1A 4REQB 3GNQA 4OK5A 5E4JA 2GT1A 4L0MA 3USCS 1GADO 5CFMA 4FT2A 2MR6A 4BGEA 1XKXA 5JDCC 1QLWA 1OZHA 3X1MA 1WSAA 4BIIA 4RPIA 1YZVA 4G5OA 1Z0JA 1SG0A 2WHYA 4F71A 1RXVA 1V8ZA 4G1UC 4JJAA 5BXQC 1P2VA 1M2GA 5C7YA 3BJZA 2GCOA 3N7UA 3MJ4A 3WFIA 1GNLA 4YJ2A 1UK7A 5GGXA 4RZQA 1PSDA 2I3DA 2PEZA 1JHVA 1Z33A 1FYXA 3CX7A 1NSYA 1IUNA 3BOSA 4H08A 1NJ2A 3WQRA 4EUKA 4TMYA 3WAJA 3HJGA 1GQ2A 1G66A 4BDSA 1PGOA 2IX3A 3UMYA 2DE0X 5JANA 4B6SA 2RBEA 1YR8A 3HYTA 4JV5B 2PVSA 4Q7LA 2O59A 1JE0A 1JLLB 3QU9A 1AURA 4EB6B 1U4NA 1RZ3A 1XMXA 4PEVA 2NO7A 2JF0A 4L72A 1HV8A 4ZQHA 5EE3A 3SXPA 4EYEA 3Q5GA 3RD5A 1EVJA 3ANTA 4M37A 1J22A 4AZSA 2ZRQA 3L6CA 4H4EA 4PLVA 5F7ZA 3THXB 1KAOA 4M60A 3KQKA 4R9NA 5KNLA 2XDAA 3FLAA 2WKSA 4PZPA 1NPTO 4P81A 2DY1A 2ZUSA 1I9CA 3DVAA 3IAS1 3SCZA 2LD4A 4HDKA 3V2GA 3O9MA 3OLWA 2IV2X 2I65A 4RZHA 5FP0A 2CN1A 3GBPA 3VO8A 2VKTA 1YZKA 1CYDA 4KIWA 4HLUA 5C81A 4CETA 2RE8A 3K1AA 4U7FA 4Y2QA 2FMKA 3ZDDA 3UXHA 2BR3A 3OTGA 4DPMA 3FNBA 1ILEA 2YVQA 2R44A 3BWVA 2J1LA 1AK1A 4UHFA 3RS0A 2JI6A 3S6JA 1LI7A 1U02A 4ZQBA 1XHFA 3P5BA 1UBGA 3CG4A 4TYWA 3TLKA 2FFBA 2XMRA 4GXQA 3NTUA 3FOFC 2EBFX 3TJMA 1VE3A 1K08A 3PC4A 3F73A 3RM3A 4XQEA 2ZT5A 2CMKA 4HGNA 4XZ3A 2WJAA 3Q2IA 3MJCA 4LSGA 1TECE 1T1GA 3R20A 4BGDA 2ZTSA 4EJSA 1CDOA 2GNOA 3E18A 2F3RA 5EXEA 4BE7B 3GMTA 1FP1D 1GCIA 1ULSA 4HNTA 1UINA 2ZYGA 4FEAA 3CR8A 4D74A 5KTYA 4G5FA 1LLUA 1QNFA 4OIMA 3MAJA 4IZHA 4HH0A 4MPRA 1ULBA 2PMWB 1SZPA 3FWHA 2JH8A 4KO3S 5COAA 3UQYS 1GXSB 1EFTA 5HJ2A 1PK9A 5B1EA 4BBZA 2IGTA 3F3KA 4I9NA 1U8FO 5E9JA 3M3HA 5F35A 3K30A 4IEFB 4TL9A 3ZBQA 3RVBA 1T3LA 2W9XA 3OOEA 5EQDA 1FDUA 4U2KA 1P0QA 4EHHA 2I1QA 2Z2XA 4W8OA 5CYOA 2D1RA 3TW6A 3WIUA 3CG0A 4XYLA 1GTMA 1F12A 2VBIA 3QVVA 2ZS9A 5HIMA 5FJIA 4MWEA 1DQYA 3TECE 3LUHA 3IA7A 3JU3A 1DRJA 1KK0A 4YP5A 2XOEA 2HOQA 3PEYA 1X2BA 5IVPA 3CX3A 1C2YA 3IB6A 1N0UA 1UP6A 4RJKA 5TSDA 1PK8A 1R5BA 5BQ3A 5AI0A 3Q2OA 2LBPA 3A6EA 4MV9A 1WHTB 4QBKA 4YCDA 5BRAA 4ABTA 1H6CA 2Z1DA 3DDWA 1NBEA 2C58A 2H1WA 2OG2A 1EQ2A 4O4HB 3LBNA 5A03A 1DADA 3LFUA 4MKZA 3GPCA 1B41A 4J1NA 2C1XA 5JI3E 5LVAA 1GKLA 5KTTA 4BVBA 1UWLA 3JQ8A 3KAPA 4F91B 4Z86A 2EG5A 1GG9A 4PCVA 5JROA 4JFRA 3GHYA 4W7IA 3REOA 2PBFA 2ZXFA 2A1UA 2L17A 3HU3A 3KZKA 3TO5A 2EYQA 3AF6A 4KQ1A 4TKLA 4D0SA 1YUNA 4AG3A 2DEUA 3DTVB 2AE1A 1YDGA 1YULA 4BC1A 2XMSA 5JCPA 5DASA 3ASVA 4NWIA 1JALA 1HDEA 1VYHA 5BWOA 4GM1A 2X19A 5ALXA 1AKVA 3L8GA 5GZ3A 3HLTA 2YHUA 3NM4A 2GEJA 2QN7A 3OQ1A 4PSAA 3D4NA 5EHIA 5EWLB 2J6BA 4EI2A 3OU6A 1YVDA 1TAUA 3CUYA 1RBZA 1NNUA 4NDZA 4DHEA 3FSGA 3PQ2A 3CH5A 4QXMA 1TADA 1WSBA 4OLJA 2GDJA 3AUUA 1ACMA 4ZAZA 1Z62A 4IMIB 2ZBQA 3KFVA 1CUIA 5JCZA 2NSHA 3VDXA 1B42A 1V16A 4NOLA 5KB3A 1M6VA 2P3QA 3E03A 4YAUA 4J9UE 1ZQ1A 4YRCA 4YRMA 3V4OA 5DTQA 4FFOA 1HSOA 3K0EA 5EZYB 5JSKA 4ND1A 1P4AA 1A82A 1AV7A 1COWD 1PWXA 1RYFA 3MSCA 5FB3A 2HU7A 2ZJ3A 2BZ1A 3EWSA 3PWZA 1F6BA 1KKUA 4QVKA 1CJKC 3WLTA 2FLVA 5LD2C 5BWCA 4H1VA 2IHKA 3BULA 1WPRA 3COYA 2PUVA 1RRPA 1DO8A 1H5UA 1OZ0A 2QTZA 4H4DA 3GLIA 1T8RA 4J2HA 3OO1A 5DULA 1SCDA 2VQFB 2GI4A 5I47A 1KYVA 4ZVPA 3HBAA 4DBVO 5K9ZA 1E79A 1RKQA 2ZBEA 2ZQYA 3PE3A 1XNQB 5LQNA 2AKAB 1Z0DA 4GR5A 4PVDA 4RDXA 3TRJA 2PRYA 3I5MA 3MT7A 4Q7EA 1WTAA 2CCJA 2VLIA 3L84A 4EY3A 3SYLA 4FKMA 2J41A 5HZKA 3KDPA 1UANA 4ZV7A 2QTMA 5KTRA 1T91A 2PMBA 4B6QA 1QPZA 1WXGA 3D2AA 2O8FA 5SYNA 2XB4A 1LFDB 4KXUA 3I6ZA 2PJDA 4LHEA 4B5KA 1X3SA 1IHUA 3PJFA 3ROZA 2FK7A 1N2XA 2ODWA 2I55A 4PHCA 2O0KA 3KLPX 4Q18A 5JSZA 2IU4A 4I36A 3RGWS 4D5EA 1ZR4A 1IWBB 3FOEC 1NG9A 4NMXB 3UYKA 1XZCA 1IDN1 1NKSA 1DT5A 5BNFA 3RK4A 4JZYA 4M1ZA 4S1PA 2Y1EA 5KC8A 4A0QA 2C3YA 1G5IA 1H3NA 3IJRA 2M1ZA 4EKYA 5LMNB 2FJUA 2XYHA 4OLBA 1CUEA 2RBKA 3DE4X 1OMOA 3GJ8A 4IWNA 4BPRA 5FFMA 3O9ZA 1PEYA 3IAAA 4ZOBA 4ZK2A 1SURA 1Y4UA 2GF9A 3DOIA 3QFHA 3LOQA 3RVMA 4DLRA 1ULAA 2NWQA 2AJDA 1KF0A 1TTHA 1V43A 2TS1A 3II6X 4IIJB 4D45A 3NBUA 4J7AA 4S1VA 4LY3A 1R00A 3U39A 5BVGA 1YBAA 3WJ1A 4F4FA 1UJCA 2A78A 5GIOE 2VHCA 1WXHA 3TOVA 2G71A 1Z82A 3NVKI 3DMYA 1VBKA 1ZKDA 1FYFA 3W79A 5K4GA 1QTRA 3EDYA 1PWZA 3EEYA 1YHYA 2VPTA 3VZRA 2EW8A 1KAHA 1U8UA 3S1AB 2DFDA 3EGIA 3BMOB 2NYVA 5AUOB 2C31A 3I8OA 2P2LA 3RSOA 3WGQA 5A71A 5KYXA 3ZYZA 2A5YB 1WS6A 4L15A 3PFBA 1CB0A 1RWBA 2AXPA 2ZUBA 3OZWA 3PX2A 4HGYA 3QXXA 1OGIA 3UK0A 1KI4A 2W93A 1HC7A 4JAVC 4G25A 1SUEA 2I78A 5ERYA 3H0EA 4LSZA 4BJ6A 1DG9A 3NQ41 2HI0A 4RHUA 3FPSA 3TSYA 4TL6A 1QONA 3WLRA 3DLHA 3KR0A 3I83A 3FFBA 4GZ6A 4M0FA 5LUBA 3GROA 4ZANA 1STOA 1XCOA 2V55B 3NDBB 4PZYA 4IVPA 2WKQA 4Q34A 4KSBA 2PGDA 1PR0A 5CH5A 1H1DA 1WXDA 4YJ2F 1CR6A 3PCRB 5LN1A 4Q1FA 4P3OA 4YT5A 1R5NA 3JQGB 5CM9C 1MX5A 2WK1A 4LEIA 1L8LA 3RC7A 4U9IS 3AQ4A 2QPTA 3NYWA 2BMJA 3IAEA 3RC1A 3L6OO 3HB9A 2ZTMA 1BMDA 2QXUA 3L82B 4CL8A 2XOKA 5CCXA 4YBRA 2M6SA 2ZJAA 4R3UC 1O4VA 3STVA 5K8CA 2CB0A 4GC5A 2YNMA 1TLFA 2BKAA 3RW9A 2D2XA 2X5KO 2NZWA 3DDHA 3JD1A 2G5PA 1A3CA 1PT7A 1ECLA 1WABA 1YJBA 2Q0XA 4Z0HO 3TQCA 3WK6A 2PJRA 2K7FA 2EZ8A 1D1PA 2ZW9A 4JYBA 4ZRNA 1Z45A 3L4BC 3U3RA 2VOJA 2BF4A 2FPGA 2IHYA 2MYTA 2YVUA 2TRSB 2FXVA 3V4SA 1QIIA 5JQGB 4A5OA 4CLEA 4CGZA 1S1CA 3BDVA 1PJAA 3EIEA 1HL3A 3JY6A 4HDQB 2LTAA 1XXLA 1Z4KA 3JTMA 4DTCA 4F96A 2JIQA 1AS0A 1THTA 4UHHA 1EFLA 4HAOA 4Z4HA 1W85B 4FC6A 3VPGA 5KWSA 1KMCA 2WYUA 1L5GB 1A5TA 4FYKA 1Y8RB 5BMVA 5EPEA 4FCVA 4QIHA 2UZAA 2YXNA 1RU3A 2ODEA 3TVTA 3FPKA 1PR2A 3IT1A 1JIIA 4PYLA 1E9FA 3LKZA 1ORWA 2QR2A 1ENZA 2YWJA 1PL8A 4YRFA 5EL0A 4I2NA 3DFMA 1CUDA 3BA6A 1VL6A 3P4YA 3ICEA 3ICPA 2GZHA 3L7CA 4PLHA 3ZOKA 2XSZA 4EVQA 1A5BB 3VBCA 2G08A 1Q1AA 3GZNA 2WPDA 4JGBA 4LDJA 4L4SA 4XIIA 4CRWB 3JAKA 5H5JA 1EG2A 1ZZGA 3G88A 5BV8A 5BV2P 1PN3A 3FB4A 3R5SA 3TIGA 2H9YA 4C08A 2DOKA 2LCIA 1E1QA 2P9ZA 4ARBA 4F3CA 4EUFA 1EXNA 2OZLB 2XUQA 1XD9A 2QN3A 3DMNA 4XWGA 5B53A 4D9EA 2Q8NA 4A3SA 1DL5A 4POOA 2O5CA 3KQPA 1BGXT 2YRFA 4HH3C 4ISBA 5JJIA 4Q66C 3RRNA 4YQYA 3I2IA 2O2XA 2AJTA 2MDTA 5K45A 4D8YA 4OFZA 1E2PA 4TTVA 3V7FA 4JBIA 4D8TA 2PS1A 1UADA 3FZGA 3JWGA 3HYLA 4HDRA 4BV3A 4X1YB 1GZDA 4YREA 2B92A 3UJ9A 3UH0A 5JVDA 1YQUA 1RADA 3C48A 4HMPA 2MIIA 3ESXA 3KTFA 4RY9A 4K5QA 2R7NA 4DQLA 1H9BA 3JVEA 2CL5A 4HLNA 2W2MA 1JAZA 1XJCA 2P90A 1KBZA 2CUKA 4JBLA 5ISMA 1M8JA 4R2WA 3GUHA 3WL7A 1ZMOA 4PO1A 2F8SA 4TGLA 2PH5A 3OQBA 3JQCA 3E5NA 5BSHA 1JLMA 2CHEA 4WXEA 1YDEA 1U94A 3KLOA 1WO8A 4MVJE 2ZYSA 4ZP1A 3PNVA 3C6ZA 3R7AA 1GO2A 1JJFA 3PI7A 4IJVA 4EGCB 4S05A 5EQJB 3BA1A 4M0EA 4GEKA 1J2TA 3CLUD 1XL1A 3AR5A 1K5DA 3BDIA 1SK8A 3PQEA 4YT8A 5JEDA 1Z5ZA 3FBWA 1XMIA 3TJRA 3SKYA 4PO3X 1EVEA 1DQZA 4RQUA 5LOVB 3QJGA 3JD2A 4MVJG 5K8UA 5ICFA 2RHLA 3GHHA 5G4LA 1EM6A 4CKCA 1VLMA 2FA9A 2Z58A 2Z5GA 5EHQA 4W5RA 3OHPA 2VWPA 4XQ0A 1GYQA 1YIAA 5FL7D 5GPBA 2Z3WA 3EBOA 3LPDA 4AUEA 1M34E 1RAGA 1OWMA 1E3DA 2OCKA 3KJGA 3E82A 1L1FA 1SCJA 3N1UA 5TEWA 3ZWWA 2Q3LA 1GA4A 2CNOA 1PZGA 2FOIA 2YYSA 3NBXX 4FI3F 4L4ZA 4C01A 3TXYA 4PNPA 2P4SA 3GPDG 3QZUA 1CW2B 1PR4A 2A0WA 2IIVA 1PF7E 1MMFB 4O02B 1DJNA 1SVOA 1KJQA 2GRJA 3GGPA 4CV2A 1F4PA 4JB2A 3S8YA 1ZPDA 2ASVA 2CK3D 4Y0VA 3PEWA 1UPBA 2FFHA 4QASA 2B83A 2CMFA 3JZFA 3AESB 4J4HA 3NR2A 1OX6A 4MGEA 4BB6A 4CTMA 2VP0A 4HN2A 1ID8A 1I0LA 5EZQA 5IARA 3FOZA 3A28A 1EVYA 3L0YA 4WK4B 3TMKA 1UM8A 3NGMA 4IVRA 3DB2A 4BVHA 3QKRA 4MYHA 3GGCA 2A1IA 1CVLA 3Q87B 1ZFNA 2V7WA 1YOBA 4RGYA 1GLNA 2KBEA 1CZNA 1T26A 1V3QE 1J1ZA 3BS4A 5FWAA 1WULS 3NTLA 1JZQA 1PJCA 3UHOA 5I8WA 3SIPA 3RYIA 5DNVA 3T7CA 5BSEA 1Y3FE 3AY3A 5KVVA 1JEDA 1JHQA 1J39A 1RM5A 2C5BA 2IVZA 4Z0PA 1XTQA 1XXHA 1CY2A 1UWVA 2QXTA 1CUXA 2XMZA 3H16A 4QJ5A 5DHUA 5K3CA 3SOPA 3R1IA 2PKYX 2W42A 2IYYA 3FMGA 4DQVA 1SBHA 1NLMA 4C7OA 4QUIA 2ZUFA 4UJ5A 2JAXA 5LZ5A 4HWRA 4ED9A 3H2KA 3DV9A 4MRMB 5JSHA 1WDMA 3LX4A 1EJ0A 3Q7QA 3HSKA 1K7EB 4WNAB 2FQQA 1C30A 1Z3IX 2B69A 2VDQB 2YWXA 3PUVA 1ISFA 3OH8A 2Y05A 3GRZA 4UNRA 3K0SA 2HIHA 1B7GO 1ZWKA 1HL7A 2G07A 4OLFA 4P5DA 3S2UA 3NH9A 1R5JA 2IA5A 3SVZA 4N8DA 1U0HC 1K7XB 2JCBA 2PSSA 1AKMA 2R2GA 1DFIA 3KBBA 3RU3A 1MG5A 3PFHA 1S2IA 4CR6A 2YINC 1HR0B 2OAEA 3A3KA 2H1LA 4HJRA 4E5KA 2PQMA 4GI2A 4W9RA 2D1TA 1ZG3A 2HA3A 2Y67A 4TSRA 4AQDA 4YDQA 3N2KA 1BXGB 2CHVA 3GH3A 3LXXA 4YH1A 4CUJA 4BX2A 2W4MA 4CMIA 2ETXA 2J3KA 3NOQA 2H7VA 3OSUA 4DJAA 2F4VB 2A0YA 4TTJA 1DBPA 1EA7A 4JL6A 5ECYA 4EZEA 3P0IA 4IDHA 4RTMA 1OFVA 1A2BA 1QHXA 3HZZA 2ZJ1A 4GBMA 1ZU5A 2ZJYA 4YJ3B 3H2HA 3ZV7A 3SEAA 3ECSA 3V7UA 1M2FA 1XMJA 2IYTA 3AW8A 1HE4A 2BMAA 3QPVA 4QHSA 3A3NA 4UUMA 3OMLA 1XD2A 2DQSA 4CCYB 5BXYA 1OV6A 5EMHA 1PFYA 2YUIA 1II8A 1QGYA 3VPHA 3CRMA 1DQRA 1PKXA 5B3JA 5JAQA 4TOIA 5K0NA 3VNQA 2W4IA 2HBRA 3AUKA 3AHFA 4G65A 5IHPA 2FSPA 3LPMA 4Z1MD 3ZKWA 1Z3CA 2ISSD 1EP1B 1FFXA 3BCHA 1HETA 4K6MA 3QU5A 4XJSA 5CLGA 5ALGA 4YRQA 1DRUA 3ZVKA 2PR7A 1W88A 4ZIRA 2BT4A 4A8JC 2NAPA 5THKA 4DKJA 3S44A 4QA9A 3VZPA 3ND9A 4LHSA 1G19A 3LL7A 4AO6A 3K9CA 4JVOA 5B64A 5AW1A 1NXWA 3HCPA 1KKLA 2JKZA 2ZSFA 2V8OA 1MA3A 4BVJA 3FKSD 5HEKA 3ROQA 2EFHB 1NXOA 1GN8A 4CLDA 4MQMA 1EHIA 1UPCA 2J31A 3K72B 4KI0A 4EK9A 2IXGA 4PYQA 1JF8A 2RI1A 2AH5A 2NT3A 2VDRB 5CTAA 1JIQA 4BE4A 1ODKA 1WDLA 3EVCA 2JAPA 4HXGA