1UDWA

Crystal structure of human uridine-cytidine kinase 2 complexed with a feedback-inhibitor, ctp
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
212
structure length
204
Chain Sequence
EPFLIGVSGGTASGKSSVCAKIVQLLQKQVVILSQDSFYRVLTSEQKAKALKGQFNFDHPDAFDNELILKTLKEITEGKTVQIPVYDFVSHSRKEETVTVYPADVVLFEGILAFYSQEVRDLFQMKLFVDTDADTRLSRRVLRDISERGRDLEQILSQYITFVKPAFEEFCLPTKKYADVIIPRGADNLVAINLIVQHIQDILN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uridine-cytidine kinase 2
publication title Structural basis for the specificity, catalysis, and regulation of human uridine-cytidine kinase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 66
structure length 204
sequence length 212
chains with identical sequence B
ec nomenclature ec 2.7.1.48: Uridine kinase.
pdb deposition date 2003-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00485 PRK Phosphoribulokinase / Uridine kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1udwA00
4IW3B 4PQYA 4URWR 2JLRA 3LV8A 1NIPA 3HU1A 1GRQA 2H1LA 4Q4AB 1N6NA 3RRYA 1E2GA 5JBQA 1ETUA 2ZI5A 2QG6A 2WWIA 2EVWX 4LDJA 1NMZA 5SZHB 3TBKA 4ASUD 1GG2A 1NN0A 4JL6A 4HEJA 2VYFA 2OLKA 2PX3A 2E87A 1ZU4A 4ARZA 3LA6A 1KI2A 2A5YB 2QMOA 2R6CA 1J99A 2OXRA 5EJEA 1JR6A 4WXRA 3B13B 5HCIA 5FOUA 4ITRC 4TYQA 4JLPA 3V4FA 2OFXA 2JEOA 1YZQA 4PC7A 1JXOA 3QKRA 1P7CA 3B82A 5JJLA 2NIPA 2OESA 2P2LA 4OKSA 3NH6A 4TQAA 5CM8B 2ZUBA 1BO6A 2YWHA 4B2PA 5JEEA 4I81A 4DT1B 2P6UA 3VNUA 1X3SA 2QQ0A 1HY3A 4PC2A 3VR1A 3QEOA 1YKSA 4Q9LA 2GBLA 3WNDA 1UADA 2FSGA 1OXUA 2ZI9A 4IFBA 4OHYA 4H1VA 2VH5R 3X1WA 2ZI3A 4DKXA 3QUSA 4DEXA 1P9NA 3IKJA 1D8TA 1ZNYA 4XWOA 3MUFA 4P4TA 2RHDA 1ESNA 2W2VA 2VL7A 2GESA 1AS0A 4KODA 1DTSA 4WOPA 4RD0A 4M1SA 4PAQA 2PT5A 1CRPA 1AGPA 4UNQA 4HB4A 4DIEA 3H1TA 1Z07A 2WPDA 4Q4JB 2ZAOA 2QNRA 4HYYA 4M4SA 3A1SA 4FD2A 4ZV4A 3THWB 1MRNA 1X1RA 3C5HA 4L16A 2DFNA 1XXHE 3DMDA 1U9IC 2RGNA 4IEEA 3FMFA 5JHGB 3TSZA 4BFUA 2ZRFA 1R4AA 1E2QA 1VCMA 4AC9A 4LJ4A 2IYWA 4C0AC 1NRJB 5KSOA 1W0KD 3CX6A 4E09A 1KI6A 1GAJA 1TQ6A 1YJ5A 3KKNA 4ZO4A 1J7KA 4YMUA 1TQ4A 4DHEA 2QAGC 2FV8A 1W0JA 3BERA 3GEEA 1EFTA 1KO5A 2D62A 2ZE7A 4M0LA 4P3YA 4MDEA 2QZ4A 2IL1A 4L15A 1E9AA 2CEAA 3B9PA 3QG1A 5CK4A 3PXGA 2XZOA 5CDFA 2CHVA 4NZYA 4G3XA 1ZIPA 5FTJA 1Z6GA 4E03A 1RRGA 3AP1A 2QT1A 4EJSB 4I99A 1R8SA 3GPLA 2H17A 1M74A 2CLSA 4CEIA 1D2EA 2VBCA 3L8ZA 5FTKA 4S35A 3U3JA 2VHQA 3GJ0A 2FJUA 1M1YE 4RKEA 3BB4A 2H7VA 2XOKD 4D6PA 1GFIA 2FF7A 2RMKA 4RCYA 3BJIC 3SHWA 1X8KA 4LHZA 5D3MA 1CEEA 3KUDA 5DI9A 3AVPA 2WJYA 1NVXQ 1UBCA 1II8B 1X8LA 2YYZA 4UKDA 4WZBE 3VFDA 1E32A 1R5OA 2MSEB 2GZAA 2RGAA 4UNSA 2WKQA 3Q3JB 1JPNA 4D81A 3QBVA 4MRRA 2IWHA 4M22A 2CJWA 2VA8A 1HQCA 3VMFA 5C18A 4BLQA 2J87A 1KSFX 3PUWA 1OHHD 3KTAA 5LDDC 2ECKA 4TT3A 1CXZA 5E95A 1YZTA 3W8RA 1I4LD 4XVQA 2D7DA 1XMVA 1QHXA 1Q22A 3C14C 4M1TA 1COWD 2PLFA 2ZRGA 3I8XA 3R9XA 1IQPA 1KMHA 1JAIA 1YE8A 1N0UA 1YRBA 2QMEA 3DM5A 3GJ6A 3PUYA 5KSYA 4GOJA 1KJYA 3K09A 2REBA 3NBYC 2IA5A 4PANA 1T91A 1O3YA 4GOKA 5DYGA 2H18A 2AKYA 4OJQA 1LF5A 4EPVA 3FWYA 3QKUA 1U0HC 5DI3A 1OSNA 1E99A 1KKMA 1W36D 3TK1A 4LBVA 4LYJA 1V5WA 3GFTA 3NEJA 5KUTA 4C0SA 1DBSA 4IVPA 5K8LA 4HAVA 1RKBA 4Q1FA 4Q00A 4ARZB 1JB1A 1AQUA 2BM0A 3CO5A 3SE0A 3K0EA 3QJYA 1CLUA 1R0ZA 1N5JA 3BS4A 4RD4A 2F9MA 5FBVB 2IT1A 4US1R 1NY5A 5JRZA 1OIXA 3BFKA 4FMBB 1OB5A 2VP9A 4QHYA 1XWIA 2XNDD 3PFIA 1UF9A 3AGPA 1TEXA 2GJAA 4Q7LA 1M34E 1XRJA 3D8BA 3QKRB 3A37A 5KHOC 1IY1A 2X1VA 5ANRB 1LFDB 2NO1A 1EWQA 2QTFA 1F2TA 4A82A 4BZQA 1MV5A 3R9WA 2JLVA 2PX0A 1JQLB 2MMGA 4PO1A 5TARA 1FL9A 1KDOA 1A7JA 3NWJA 3S1AA 1YZNA 1C1YA 3ZYCA 4MYHA 1T6NA 4B34A 2CCGA 4DDVA 3CWZA 3K70B 1DS6A 1VIYA 2O8DA 2ZS9A 4A15A 1ZD9A 4QM7A 2KBFA 3WHLA 1NF3A 3FPAA 2PBRA 5HE8A 2CLDX 4LJ8A 4B75A 1G7RA 4BFXA 4DLXA 3CWQA 3VKHA 4HZIA 3U61B 4BFWA 4Q9IA 2ERYA 1NSFA 1EFCA 2OO7A 3DEFA 1R2QA 2F9LA 1AKEA 4OHXA 3FMPB 5CLQA 2WVJA 3I32A 5JCZA 2XAUA 1YZGA 2Z4RA 3AV0B 1AA9A 1JI0A 1NSTA 1E1QD 4BECA 5KPDA 5DH9A 4I1VA 4JLDA 3RANA 3KXKA 3GLFE 3GD7A 4L9SA 1JAHA 3PEUA 3A1VA 3TR0A 3GFOA 5GVRA 2VSOA 2ZRMA 3IEUA 2JLWA 2GJKA 3LO5A 3E1SA 4PTLA 2ZRHA 2O8FB 2XJ9A 2P6RA 4JLVA 3CF6R 1QHHA 1GP2A 2BCGY 3HJNA 2OT3B 3CIOA 4G0NA 4XTRA 5TMPA 1FTNA 3BE4A 1XU4A 2ZJ2A 4OHWA 2O8BA 4JJZA 3EPJA 5FOWA 221PA 4LZZA 1CJTC 5DIFA 4HLQB 1UFQA 2VF8A 4DIDA 1JQJC 3THXA 1T5LA 2G77B 4LV6A 1XD2B 5LD2C 2W6JA 5P21A 2FX3A 2LWIA 2JA1A 3KQKA 2PLRA 3R8FA 4Q1BA 4B43A 1T3LA 4B3XA 3PCRB 3LBIA 4QBHA 5HTKA 1SXJE 1T0JB 1MO5A 4LK2A 1JR3E 2BKUA 2QU8A 4PPFA 1Q3HA 3U3RA 3WMEA 3EX7C 1G9XA 2IUUA 4EFNA 4DDTA 5B30A 1VYTA 1P9WA 1MO4A 2IF0A 1QDEA 4WXPA 3VHLB 3M1IA 1WCV1 2MSDB 3I5XA 2A2ZA 1OXTA 3LW7A 3E5HA 4JYCA 4MRVA 621PA 4G5GA 3KL4A 3AVUA 4IOMA 3V9PA 3KTAB 4IDQA 1LVGA 2I1QA 5G53C 4US2R 3PITA 4M1KA 3KQNA 3OEEA 2FOLA 3TE6A 3EARA 1OFUX 3WHKA 2CDNA 2G6BA 1KMHB 3V00A 2ZS8A 1W1WA 1NLFA 3T12A 2X77A 4JL5A 5KTYA 4F4IA 1ZINA 3U4QA 5BN3A 3RVBA 2G1KA 1XNJA 1AJEA 4FCVA 1XEWX 1RYHA 5JWHA 2ZI6A 2HF9A 1UKYA 3QVVA 2BJVA 1GDDA 1XTIA 4QRHA 5CJPA 2C99A 3GMTA 4LCBA 4LPKA 3FGNA 3IILA 1EESA 1IXRC 2ZI7A 3QVUA 4HATA 2CXXA 4DVGA 3VX3A 1XEXA 4D0LB 4AKEA 1TQDA 1EFUA 3UMRA 4M1MA 5JJIA 5DO9A 3F0TA 4IRUB 1ZP6A 2WIAA 1Z0AA 3MGCA 4MGIR 4BWYA 1AKYA 1BIFA 4UJ3A 1P4SA 3SS8A 3D31A 2CCKA 3GEHA 4U7DA 5KPJA 4FWTA 2GEVA 1F2TB 5GJBA 1KK2A 4I4LA 4DJTA 1XMIA 4TZ0A 1P2VA 2CNWA 1L8QA 3S1AB 4IOKA 1G5RA 1DO2A 2DFLA 4V03A 3ZIAD 4PAMA 3UMSA 1Z6XA 2C9YA 4G1UC 1WE2A 2DWPA 4KFSA 1G3MA 2NPFA 2NPIA 1VMAA 2O0KA 3QPUA 1A82A 5FR2A 3TKLA 1GVNB 4GZMA 2N1BA 5TXGA 2FA9A 2VF7A 4WAUA 5BWMA 1XPUA 3LBHA 1XEWY 1F3OA 2JJ1A 4PZLA 3AKYA 1W5SA 1U8YA 2UZ3A 4TYNA 4QGAA 4QBGB 2IUTA 3RABA 4ZI3A 3U6KA 4KITB 5FPHA 2VP5A 3VKGA 5CDFE 3W5JA 4EQ6A 5JJKA 4JKYA 4ASUA 3ZZTA 2OUKA 3ZD6A 1NMYA 4EPWA 4K8OA 3UATA 4ZCMA 4NYJR 2HUPA 4KYIB 4IDPA 3CNOA 4C0KA 1Q1EA 1CTQA 3NDBB 2W2XA 4G5OA 3BH0A 2C78A 4AKHA 3QXHA 1H8HA 2F1IA 2QP4A 4DCNA 2RAPA 3IIJA 2VHJA 4TTRA 1P72A 2RGEA 5EXPA 2B6HA 4H9GA 1BH2A 4BFVA 1AK2A 4FCWA 1ZNXA 1VCNA 4BEJA 1OIWA 1G20E 3NVAA 4GFDA 2E1RA 1KI3A 2BBTA 1FZQA 1S9HA 2ZIAA 4LUCA 2AX4A 4II7A 1LF0A 1E2IA 1LV7A 3PJRA 2O8BB 2P65A 4ESHA 4RD6A 3CH4B 4L4UA 4Z8XA 2VP2A 1P5ZB 2J0UA 3EAQA 3EZ9A 4GMXA 4E22A 1SXJC 3T1OA 3LFUA 3QIAA 4Q03A 5DGXA 4RZ3A 1G3UA 3EZ7A 4IOLA 1PLJA 3A1UA 1Z0IA 4DSUA 3SZRA 2GK6A 2GCNA 3IPXA 4NYIQ 1U90A 1SVSA 2RH5A 3DM9B 1ZM9A 3HP1A 4KCGA 4C4PA 3L8YA 4LBYA 2WJJA 1YZLA 2XSZD 3NH9A 2IYSA 2A5FA 2R6GA 1PV4A 2IYVA 5AJYA 3GFPA 3WBJA 2IS6A 1DEKA 2GVDC 4NE2A 3OESA 3FFAA 5J4KA 4G01B 4JSYA 1NBME 4GPTA 3NHBA 5DNYB 3AF0A 4C0QC 3FMIA 1JJ7A 2OFWA 4D4KA 3AVOA 3PG5A 2QUZA 2ZJYA 4LBWA 5HZKA 3TUZC 5FPTA 3TMKA 4OYHA 1IHUA 3TVDA 2ZM5A 4IJMA 1CR2A 1CJMA 4G5QA 1Z29A 2SHKA 2DWOA 3QXXA 4AYTA 4RZ2A 1Q21A 1IY0A 2ORWA 1W47A 1W0KA 2ZYVX 2DFKB 1G8FA 5JS8A 1VHLA 3SDZA 2HYIC 2J0QA 1N6HA 2AN9A 4C2UA 3WRYC 4NYMQ 3NHAA 2ANBA 3CM0A 4QC2A 1R5NA 4CF7A 1CJKC 2FSHA 3RWMB 1Z0JA 1C4OA 1FTSA 3K0CC 1XDBA 3DKVA 1ESMA 1G41A 3RWOA 4JBXA 3I1FA 1VPLA 3GJ3A 3B1VA 3DL0A 4QKQA 2XX3A 3C4JA 2BV3A 2QRZA 2PZEA 3BFVA 2J7KA 4HLUA 3U44A 3ZD7A 1IOZA 3KKMA 5KDOA 1KOFA 1E2EA 1Z6AA 4R9UC 1O87A 4M9XA 3GLIB 3DMNA 3W6PA 3AEZA 2BOVA 2PZFA 3WBKA 2VLIA 2XOKA 4TYWA 3I73A 4Q7JB 4JL8A 4B2IA 1G3QA 4B2LA 4HUQB 3BFXA 1ZUHA 1ZUIA 5BXQC 2FDCA 2XZPA 3A1WA 3E70C 2JGNA 1FPMA 2HV8A 1G16A 3QXJA 2G0NA 1FP7A 3LX8A 4CT5A 5AR1A 4C2TA 2WKPA 4LSGA 3GQBA 4LHVA 4O2LA 4XVRA 3RS5A 3EPLA 1XB2A 4A2PA 3N2IA 5J4LA 4IVQA 1SVOA 3P32A 4TLDA 1OHHA 2ZYTX 3THOA 3KB1A 3IDQA 4B3GA 4A9AA 2EFDB 1QVRA 2Y8EA 2IXFA 2VTKA 5L8VA 1COWA 2FZLA 3ND8A 2BEKA 2IK8A 4RFSA 4HLDA 1OJLA 4TMKA 4TMXA 3T61A 1J70A 2GJSA 3LXRA 4NBSA 2I4IA 4TQ9A 5H70A 3ZQJA 3HPRA 4ZPXA 2WJIA 4GL2A 2J9RA 2W58A 1IN4A 121PA 1KI9A 4YMSA 1XTQA 1YR8A 1G3RA 4MH0R 2ZEJA 4TL6A 3GLHA 5FBQB 2BEJA 1QRAA 2R65A 2ZRPA 3K0AB 2G9NA 1G7SA 3CR8A 4DLUA 3LRPA 3T5GA 3TSOA 1G21E 2QTHA 4KJZA 4EQ6B 5EP1A 4DUGD 1KO8A 1M2OB 4XSGA 2C77A 1JECA 3KJEA 1ZM2A 2L0XA 4HAYA 4R98A 4HLCA 3T1QA 1ZC4A 5EE1A 2R6FA 1SVKA 3PV0A 2CE2X 1VG9B 4PSAA 1N6KA 2E9SA 3HR8A 4AYWA 1XCGB 2REOA 1G6HA 1G18A 3RSOA 2W0MA 1DPFA 1XMSA 1G8HA 1TAGA 3EG5A 2R44A 2YINC 2XNDA 1KY3A 3EASA 2O8EB 1W4AA 4Q1CA 4ZKDA 5L3VA 3TIFA 4TYPA 4EDHA 2VO1A 3X1DA 4MITA 2IS2A 1YR7A 4RD2A 2GRJA 4MUAA 2ATVA 1OKKD 4JT4A 3VR6A 5J4VA 1MRSA 2D2FA 4QFMA 2OG2A 3CX8A 2GHIA 2Q21A 4L9WA 1EFRD 4KFUA 1SHKA 2V7QD 4PC6A 5ELXA 4ABYA 1M6NA 2J0UB 1KNXA 1JJVA 4LV5B 1PZNA 4OI4A 4V0ME 1B23P 2XZLA 1H8HD 5B57C 4EPYA 2QY9A 4XSHA 3A1TA 2ZSBA 5TDHA 1P2TA 2WAXA 3TQFA 3O8RA 2EWVA 1LY1A 2D4HA 3BIFA 3SQWA 2OZEA 3L0OA 2K5UA 3WYGA 1AM4D 1YHNA 2G3YA 1SKYB 5DHFA 1AZTA 2WIBA 4ILEA 4AYXA 3EC1A 1Y3AA 4PSVA 4HSEA 2GCOA 3BBPA 2IYZA 1G4UR 1E1QA 2JCSA 4ZDJA 4AURA 3OFNA 1EG7A 4NDZA 3SNHA 2IS4A 1IONA 2QMHA 2HT1A 3LVRE 5F9HA 1XD9A 4P0TA 1DADA 5FOVA 3GLIE 2WJHA 4KVAA 1G19A 1FNNA 1P75A 1ZC3A 3QKSA 3PIRA 2BC9A 4DLZA 4GNKA 1PJRA 1RZ3A 2GKSA 1E79A 3AVQA 5CIWA 5KOYA 2WM9B 3SHFA 3LLUA 3NBFA 1JNYA 4KHZA 4F92B 4BLSA 2HDNB 2F43A 1OH6A 1ZCBA 2QRNA 2RKOA 1W46A 2WWWA 3BORA 3CBQA 4MA4A 4WW0A 3NG1A 1OT3A 1XF9A 3Q7PA 1VHTA 1TUIA 2YWEA 4FWIB 4TZ6A 3D3QA 3CKLA 4RVCA 3KXIA 2WWGA 3K9NA 1DAIA 2XJ4A 3QXSA 4Z51A 1GZSA 3U44B 2VIIA 1IJFA 5AJXA 2W2TA 4RD1A 2AR7A 2QQEA 3N70A 4DSTA 4B48A 2EYUA 3E2IA 4BRWA 2P6NA 2V4ZA 4BUJA 1OFIA 1W44A 3GJXC 4BZPA 3KFVA 1DAFA 1GL7A 4MKHA 5UKDA 5B64A 1IXSB 4QJ5A 2C03A 1KSJA 2Z6VA 4OHZA 3SJCA 4YQFA 5K8TA 3W9YA 3SFVA 3AF3A 2XB4A 1P61B 4B3BA 1YQTA 1FMLA 1NY6A 4JVLA 4Q21A 1G1MA 5IDVA 1GTVA 5EE5B 1P3JA 1TQ2A 1KI4A 2FPKA 2F1HA 3DDCA 1YVDA 1DAGA 2A5JA 3C7KA 2ZVQX 4DEYA 2DFTA 3I4LA 1F60A 1XZPA 1QHIA 3EPHA 3VR2A 2OAQ1 1KY2A 4IOJA 2NZ8A 4OJKA 2FFHA 4IFEA 2B21A 3KX2A 1E0SA 4Q9KA 2ONJA 3EIHA 3Q9LA 4PZYA 3TAHA 1KTVA 2OCYC 1N6IA 2I1VB 4RFSB 4U00A 4D0NA 3AVVA 1E3MA 3JZAA 4QGHA 3MMPA 3AP3A 3WNBA 4KVGA 4JS0A 3HYRA 1T8TA 3UIEA 3AUXA 3ZLJA 3GLHB 1HT2E 1KDPA 2QPAA 4DBLC 1X86B 1RYFA 1NN1A 3AGQA 3QSYA 1W36B 3ZVMA 2KI5A 3FDIA 4PHGA 4Q1EA 4URZR 1ZVQA 4DWJA 4NH0A 2P3SA 4PR0A 2HEIA 4JSTA 1RRFA 4JKIA 3MCAA 3RS4A 3KZ1E 2J59A 1E2NA 3IQWA 1AQYA 3ZVNA 3BB3A 3OIUA 1UBEA 4X8LA 1HTWA 4MDFA 3WP0A 1Z6YA 4A92A 1SKYE 4JVMA 2GXSA 4KU4A 4Q7MB 2DB3A 4DLTA 4ZKEA 1C9KA 2ZPTX 4GMDA 1MT0A 1XJQA 1OXVA 2QE7D 3QPVA 2FU5C 2GJ8A 3ZDQA 5A4JA 2YWGA 1KNQA 3FFBA 3Q5EA 1ZAKA 2GVZC 4YLGA 2HCBA 1SGWA 2KE5A 3ZVLA 4D25A 4L5BA 1M7HA 3RNLA 2DWQA 4CZ2A 3ZIAA 3NEYA 1VCIA 2O0HA 4XOIA 2R9VA 2G88A 2P0EA 2D06A 3RSLA 2XTNA 1WB9A 1NKTA 2ODBA 3TJZA 2J41A 3KQLA 4RSGA 2OBNA 2QL6A 1AGRA 1US8A 3JZMA 3B1YA 1GILA 1UAAA 3LAWA 2QBYA 5CYPA 5CJ2A 1GL6A 1P73A 2EFCB 3GP8A 3L0SA 4BFZA 2FFQA 3TGPA 3EC2A 2GCOB 3EZFA 1AN0A 1FP6A 5FPKA 2OILA 3W3AA 3RDPA 1G7TA 2ZANA 2FPMA 2FNAA 3VR5A 4DRZA 1DE0A 2O52A 2OEPA 1KYIA 1U99A 1SXJD 2DBYA 2QP9X 4JLNA 4C9BA 1SHZA 1KJWA 3CRW1 1U2RA 3IHLA 4M1YA 4PQFA 5FBLB 4UXJA 1NLYA 2F1RA 2AXNA 3QKSB 2DCUA 2ZU0C 1E6CA 4Z54A 3QXCA 4M1OA 2QORA 5KU1A 1QBKC 3TH5A 4IVRA 1SKQA 4HZUA 3FHTA 4MYCA 2F43B 1BYUA 5KNCA 3QF7A 2C8VA 3OAAA 3MJRA 3SOPA 4Q9JA 1NG9A 2GDJA 5BYJA 1W48A 1U0JA 2PL3A 2BWJA 3OFND 2REXB 5FBRB 4JLBA 1R7RA 5FOSA 5M04A 1J8YF 1X1SA 3BH7A 3DVLA 1NMXA 5FTNA 1GL9B 3GJ7A 3MJHA 3LQRA 1U9IA 2ZJ5A 3VNVA 2JDID 4GT1A 3KJIA 4US0R 3UWOA 2J3EA 2V54A 2V9PA 2VHUA 1E2LA 3AB3A 4NONA 3RRMA 4A8JC 3UPUA 1E79D 4MKFA 1GUAA 4MGZR 4YXWD 5JI2E 5FH9A 1I4TD 2J7PA 3RYTC 2XTZA 1OLOA 2BMDA 3LX5A 1CJUC 1KI6B 2JLQA 3MWKA 2XSZA 3GLHE 2QAGA 3AP2A 4O2RA 1KK0A 2WMOB 1LW7A 5F3WB 5KNBA 4CDGA 4CEHA 3I8SA 4LHYA 4B6EA 1E0AA 4BQSA 4CRWB 1CIPA 2Q9CA 4PSKA 1G8GA 3LVQE 4UXIA 1CF4A 3PVSA 4PO9A 3BXZA 5SZJA 4FMDF 2QTVB 3PEVA 4FCTA 4GOXA 1NVVQ 2AHOA 3IBGA 5E3HA 5HZHA 5JSZA 3RLFA 1K8RA 2Q3MA 2VEDA 1KZ7B 2CBZA 4PPQA 4CEIB 1MKYA 2P5SA 4JLOA 1BMFD 2J1LA 2IF2A 1S1MA 2H92A 4ON9A 1Q44A 3Q85A 4R7ZA 5HKKD 4X8OA 4DCVA 2AD5A 4FMDB 2FGJA 2YV5A 2R6AA 5D3MB 3AF4A 5C4GB 4NTZA 3I62A 1TF2A 2HJVA 3T34A 1LB1B 2ZYWX 2FG5A 2NMVA 3U2QA 1NVUQ 2F55A 1PVOA 4YDHB 2IS1A 5C46F 1BKDR 1N5IA 5HR5A 1Q0UA 4AKIA 3MFYA 2OLJA 2IXEA 4GP6A 1QF9A 2CJWB 4YONB 3BOSA 1E0JA 2AK3A 1LTQA 1OE0A 1U0LA 1NKSA 1XTJA 3CPHA 4JLJA 4V0KA 2BMEA 1ZCAA 1Z06A 5LBIA 3A4LA 1E98A 2ZETA 3T15A 3CX7A 2NGRA 2HXSA 1ZNZA 2KSQA 5HCNA 1ANKA 1ZD8A 4YMTA 1V43A 4YMWA 3Q72A 1ZYUA 2IW3A 2VSXA 2GXUA 2W00A 1N6PA 3CZQA 3TAUA 1W5TA 2PMDA 1WF3A 3CF2A 4B47A 4RKFA 4DDWA 2ZJBA 1UBFA 1ZD1A 3QI2A 5DI3B 4A6XA 3SJAA 2QN6A 5JHHB 4MRSA 4XTCS 4GBMA 3QBTA 4B35A 1VCOA 4EIWA 4BEBA 5EZ6B 4TLCA 3QENA 2IHYA 5BN5A 3BB1A 4A0RA 1GNQA 1WP9A 1DAKA 4B3CA 1XPOA 1PUIA 1EFHA 2G0TA 3A58B 1ZMXA 4GP7A 4OBEA 2AL7A 2CK3D 3B85A 4OL0A 3DZ8A 4QJ4A 3G0HA 1KDRA 2ODWA 4UQOA 4C0BA 1US8B 4BLOA 1N2CE 2VHTA 3NTUA 2MMCA 3IPYA 4Q18A 3MRSA 4IDNA 5AUQA 1VYUA 1XTRA 3KKOA 4AIIA 5L3RA 4AG6A 3A6PC 2ZRAA 3EZ6A 3GJ5A 4PX9A 3NBXX 4CT4B 1RPZA 3SU8A 1L2TA 4CW7A 4FXPA 4DUGA 4NHOA 5EXSA 5JRJA 2IYXA 3UG7A 2C04A 3FVQA 4RY2A 2BIFA 3VKWA 3H86A 4LBZA 1Q1QA 4D4LA 3FHCB 2ORIA 5FL3A 2O8DB 4M1WA 2RGGA 5DYIA 4F38A 3OIYA 4IEIA 3T1TA 1H8ED 1EK0A 4PHFA 4OQLA 1CRQA 4IDHA 2GAAA 4IKEA 4M8NE 2EWWA 1RC8A 2WHXA 3LNCA 3TUIC 1X6VA 4N1AA 3M6AA 2HCJB 3B5JA 1FNMA 1RE0A 2GZHA 1WMSA 4EJSC 1KSHA 1WXQA 2VP0A 4HI0E 4NCHA 1NBMD 3BH6A 1J8MF 3ADKA 2RCNA 3M0EA 3I5YA 5CYOA 2AK2A 1RRCA 4OQXA 2A9KA 5JLJA 4DDUA 1OKKA 3R7WA 3HWSA 3LBNA 2WTUA 1E96A 2NO9A 4DLSA 3ND9A 1EFRA 1SVMA 2V7QA 4Q19A 3ICEA 1RJ9A 2LKDA 4D2IA 3FOZA 4NKRA 3VAAA 3DHWC 4HDOB 3SJZA 4NPHA 1NG1A 4M9ZA 1D2MA 2FPLA 3R8CA 4LWZA 3CW2A 2KWIA 3CB4A 4XH9B 5CLLA 3TSWA 2QM8A 3CUEF 4KV9A 4NYIR 5EXXA 1FX0A 3REGA 4ERNA 5JZVA 2ZR7A 4EAQA 1OYWA 5CITA 4OK5A 1QHHB 2ODNA 3U7HB 4LGMA 5J4HA 2YZ2A 3ASYA 4TMTA 1RRPA 2QAJA 3OAAD 1GNPA 2QAGB 1QG2A 4PHTA 3VQTA 3WYAA 4URVR 3I3SR 2F3TA 1QHGA 4JIMA 4BLTA 4P4UA 4N0DA 3UKDA 3MWJA 4BFYA 3OZXA 2ZXUA 3P4YA 4EFMA 3THXB 5FPYA 2ZJZA 1KDTA 4LX0A 4JBYA 3KQHA 5IRCD 1IBRA 1S1CA 1D9XA 2YVUA 3UK6A 2R62A 4DSOA 8OHMA 5EP4A 4Q4AA 3T35A 4G5RA 5AUPB 1IJEA 5F2EA 5C2JB 4Q1AA 1XEFA 2FZ4A 2QROA 2J7PD 4PC3A 3ASZA 1E9DA 1JEEA 4X8MA 3B7GA 1EX6A 4NYJQ 4NYMR 3IUYA 3RS7A 2PCLA 1XX6A 3AUYA 4EUNA 2ERXA 2KJQA 1A2KC 3QKTA 5JWOA 3O8BA 1EX7A 2P67A 2GF9A 1D2NA 1SVLA 4FIDA 4MKGA 2QGZA 1KSGA 1HT1E 3I61A 3F3YA 3IQXA 1UBGA 1WDTA 4C0HA 1LNZA 2B8WA 3NKVA 3AVYA 2BBSA 2GCPA 1NN3A 5J5CA 3OF5A 3U3KA 1T8UA 3BD9A 3UMFA 3TQCA 1QHYA 1Z0FA 3P1JA 2ZI4A 2ZSDA 1S4QA 4LJAA 4GSYA 2OCBA 2CVHA 1E9SA 4PPGA 2ZR0A 5LB2A 4HDCA 4DT1A 4AY2A 1G5PA 1NI3A 2HF8A 1U8ZA 2FWRA 2JLUA 1XZQA 3ADDA 5GVSA 3QPWA 3I72A 3TW4A 2GBLC 3REFA 4OI1A 3U4QB 2DR3A 3UXMA 1WBBA 2GK7A 2JATA 3AVTA 2A3RA 1NN5A 3X1XA 3K70C 4V0LA 2B7BA 3WY9A 1Z6TA 1XMJA 1F2UA 2V8OA 2ZUCA 4Q4LA 5KSZA 1R0WA 2LCFA 3HU3A 4P31A 3WRXC 3WMGA 3VR4A 4LI0A 3JVVA 4BZXA 4KLZA 1G4AE 1XEXB 2R2AA 2XITA 3UG6A 3AF2A 3TNFA 4B74A 4QOSA 4MKIA 4LOAA 2ZSEA 4UXHA 1ZUNB 5TY0A 3MWYW 3C15C 1UEJA 5GJVC 2EFGA 3CLVA 4DLRA 1JXMA 1YR9A 4DB4A 4JVNA 4WBSA 5LB4A 2HXYA 4C0LA 4Y0AA 2WICA 2P5TB 4E5UA 2J5XA 2IXGA 1CKEA 1KAGA 2A78A 5GJWC 4DLVA 1KZGB 1W2HA 5FOTA 2RGNC 3N2EA 3ECCA 2XEXA 1D5CA 5L3QA 4Q02A 5EP3A 1I4DD 5DSZA 3LLMA 2ZRCA 4JT2A 4D4MA 5JCPA 2WSSD 2PEZA 3B9QA 2G83A 4Q7KA 1PUJA 2C96A 2HYDA 4HAWA 4TL7A 4XD7D 2V55B 3CRRA 1HYQA 2FFAA 1IN6A 3PENA 1D9ZA 3QNUA 1FW6A 1OF1A 1R0YA 5CB8A 2QP3A 2IC5A 2GETA 2QE7A 4RD3A 2GEUA 4N0EA 3GLFA 1E94E 2NO6A 2WWXA 3B8HA 1JPJA 4A2WA 5KYKA 3F8TA 4QNRA 3B1ZA 3QOFA 1WBDA 4Y0VA 1G17A 1S3GA 5EE0A 2WMNB 4MYUA 2UKDA 1VKJA 3O47A 3B2EA 4U5XA 1SQ5A 2C95A 1II8A 1H65A 2B92A 4LHWA 5JMTA 1TEVA 4K81B 1GKUB 2YOGA 3OHMA 4KSBA 2H16A 1GWNA 2ZJOA 3IGFA 3SEAA 3PUZA 1ELOA 1K6MA 1E2KA 1DVRA 1W7AA 2JJ2D 4D4JA 4QM6A 1N3BA 2NTYC 4JLMA 1CR4A 4QGFA 2BCJQ 4J0QA 2FSFA 2EFEB 4IXNA 3HU2A 1TL7C 1T3HA 2RGDA 3BK7A 4WZ6A 3C16C 5DN6D 1Z0KA 3HPQA 3R20A 5J47A 1SXJA 1AZSC 5LD2B 1JR3A 1WRBA 3D6TB 3H0KA 4PPNA 3K0FA 1W49A 4JMPA 2W83A 4HB2A 1L7VC 2RB4A 821PA 4F4CA 5DHAA 4I1SA 1AS2A 5C4MA 2F7SA 2Q6TA 2ZRJA 1A4RA 1GOTA 3BWDD 4URUR 3QF4A 4TQUS 1E4VA 2QSYA 4F4JA 1II9A 3BAFA 1WQ1R 1JALA 1NLZA 1SVWA 2IHBA 3K9GA 4KFTA 3WNCA 5HPYB 4Q66C 1IN5A 1KKLA 3B60A 1W4BA 1ONBA 1U81A 5DISB 4V0NA 2QI9C 3W8NA 2NO0A 3LQQA 2C9CA 3RHFA 3LXXA 3SQXA 2QEQA 3SBEA 1SVIA 4A36A 2WOJA 4TMZA 1QHSA 4M2LA 1PLLA 1U94A 2JDIA 2ANCA 1UM8A 2DYKA 1X8JA 2GEDA 1MOZA 4LJ9A 2I3BA 1R6BX 4URYR 2UVQA 2WBLC 4Z1MD 4NCIA 4YXWA 1E69A 3OIWA 1P6XA 2QA5A 1OFHA 3KB2A 5EP2A 2OV2A 1E0KA 2F6RA 2PZGA 1RFLA 3DPUA 3ZVRA 1DELA 3RS0A 1GNRA 3EPKA 2TMKA 2YC4C 2FGKA 4W5WA 3ZZUA 4KBFA 2Z4SA 3SJBA 3K0CA 1Q12A 5FUYA 1P9RA 3EA5A 1Z08A 1F2UB 3TLXA 2FFBA 1JBKA 3OE7D 2ZE6A 1N5LA 3A4MA 1ZNWA 3CH5A 1G8PA 3P27A 5CM9C 3PEYA 1MABA 1N6LA 1KAOA 5LPNA 4NCKA 2BMJA 4A1FA 3DO6A 5JS7A 2J45A 4B44A 1BMFA 3THYA 4JJKA 1ZM7A 2OCAA 5HKKA 3AVXA 2OFOA 2ZSFA 2VQSA 4R71A 1Q1ZA 5EUMA 5CB6A 2J0SA 3DOFA 4AKGA 5EXTA 1JEDA 2CHGA 5TVKA 4PZZA 4KLNA 3HR7A 4N3NA 2VPPA 1YZUA 2ZJ8A 5IF9A 3H4MA 1QHNA 2CVFA 5EZ5A 3EA0A 3L2OB 3W90A 4BFSA 1S0UA 1LS1A 1R5BA 2CE7A 2ZR9A 5E7IA 3TRFA 5L3QB 2LKCA 5KO2A 1AIPA 1B0UA 5HE9A 3WYFA 1IN8A 2ONKA 1F6BA 3AH8A 2O8FA 1EWRA 2ZRKA 721PA 3QQ5A 3TVTA 3FKSD 2WWYA 1DARA 2NO7A 3BGWA 1CJVC 3L82B 4QHSA 2XGJA 2NQ2C 3A4NA 4RZXA 2YWFA 3QEJA 4QGGA 2YJTD 3IIKA 3L43A 4LRWA 4UNNA 5B58C 4TTQA 2WOOA 2XXAA 1XD2A 1HEIA 3GLFB 5C1BA 3RAPR 4P32A 5A5GA 5IT5A 2OBLA 3F5FA 4IHQA 1QG4A 5GJCA 2B7CA 5G40A 1HV8A 2ATXA 4BFTA 2A7QA 4CGZA 5EE9A 3TR5A 2FMXA 3KUCA 4A4DA 1E2MA 4L8GA 1Q57A 1W4RA 4XJXA 2JLYA 1OH7A 3SYNA 3FMOB 4BLPA 5FFMA 4PXAA 5BN4A 3CPEA 2CK3A 2OXCA 1P2SA 2QSZA 4LHXA 1ZBDA 1G8YA 1E1RD 3B78A 4Q47A 2IWRA 3MG9A 4B3DA 2H8KA 3MLEA 3EIEA 4WIAA 2ORVA 1T0HB 3VU9A 2KBEA 2OM2A 4JYBA 3T1VA 1KK3A 2Q9BA 1IM2A 1OV4A 2IYLD 5KDLA 2GA8A 2RGBA 1KO7A 2GNOA 5BQ5A 2HJGA 5EQTA 2D74A 4PC1A 3GLGA 4B6FA 1VG8A 1E9BA 1IAQA 4HB3A 1HH4A 1P2UA 2AKAB 2DY1A 2O8CA 5FTMA 2X19A 1SXJB 1VG1A 5FI1B 1OXSC 4GI7A 1A5TA 3K0FB 4B73A 4C7OA 1H8EA 3OEHD 2QM7A 2GXAA 1HURA 4FI3C 5BW8A 2IEZA 2PH1A 1MO3A 2BBOA 2ZQ5A 1GRNA 3FYHA 4P33A 1N0VC 1E4YA 2QMUA 4M53A 2JLZA 4ACBA 5J40A 3GJ8A 3CRMA 4LC0A 2HLDA 3QF4B 4RCZA 4TSFD 5B2ZA 4MGKR 3ADBA 3LH5A 1NBMA 1U8AA 2PCJA 3WXMA 3MAAC 1PLKA 5IK2D 4AK9A 4DB2A 2FH5B 5FL7D 2EQBA 4ACAA 3CPJB 3SC3A 4DCSA 2CL0X 2FEOA 3GJ4A 4DCTA 3TUJC 1OW3B 1CR1A 5JI3E 4BGDA 3U60B 1JR3D 1ZU5A 1Z83A 1KI7A 2NZJA 2KB0A 2O0JA 4NL4H 4QNMA 1KK1A 4U02A 2WJGA 1GKIA 3H84A 1NJFA 1GIAA 3KXLA 1A1VA 1II0A 3EWAA 1VTKA 1Z28A 5EUQB 4G5SA 1S8FA 3PUXA 4B71A 1UDWA 1MO6A 1S3SA 1I2MA 4OHVA 2A5DA 4TLBA 4ZI2A 4TWZA 1BOFA 1TNDA 3CRVA 3LW8A 4D26A 3W5IA 2IBMA 2J46A 3IO3A 2PT7A 2MSCB 3W3ZB 4CEJA 3U3OA 2EW1A 1KO1A 1S9DA 4TL9A 3C41J 1NVWQ 4GRAA 4NCNA 4WVFA 4OK6A 3ZQ6A 2ZRIA 5FUXA 1NVVR 2GJ9A 2CL7X 4NCJA 4BLRA 3J81k 3NXSA 1MABB 1Z47A 5JEDA 2ODEA 4XWKA 3K0SA 5DE3A 3THYB 3RS2A 2DPXA 3ZS9A 2XTMA 2F1JA 4HB0A 1CBUA 4I1OA 3CZPA 1GSIA 5F98A 3SN6A 4POAA 1Q3TA 2V3CC 4BRUA 4C30A 4YDSA 1TTTA 3EWSA 3ZZ0A 4DLYA 1D6JA 1XTSA 3RRZA 5K8UA 2WAYA 4O3MA 2NG1A 1UDXA 4PFSA 4B76A 3K70D 1G7CA 5CIQA 2WKRA 1GITA 3IIMA 4ZDKA 4EKDA 1DAHA 1KI8A 1Z5ZA 3DOEA 3G82C 5KNDA 1J2JA 4W5JA 5KDDA 4KFRA 1BYIA 1DG3A 2R6DA 5H8WA 4ESVA 3B1XA 2OHFA 4LJYA 4Q9HA 2W6IA 1ZW6A 4FW9A 3CRQA 4QXAA 3SBDA 2PMKA 4P4SA 2AFHE 4IXMA 4LYAA 4O0MA 4MRNA 4B33A 3O8DA 4V0OA 1F5NA 1G3IA 2ZUDA 3NC1C 5AK0A 5L3SA 1KI1A 3U6BA 4HAUA 1HUQA 2YOHA 1E2PA 2WPDD 3K53A 5GADl 2HT6A 1S2MA 3KKPA 3EW9A 4M9SA 4A0FA 3B6EA 4TYYA 3GEIA 4F93B 3P20A 2XXAB 1CR0A 1G6OA 1OH5A 3AQ4A 2ZU6A 3VTKA 5FOXA 4A2QA 3N5CA 3NC0C 1UJ2A 2CHQA 5AUOB 2J0VA 1VIAA 2H5EA 4TMWA 1E2HA 1BS1A 4DSNA 1XTKA 5FUWA 1GKYA 3NDPA 3SR0A 4A0GA 5G3YA 3ONWA 3L0PA 4AG5A 1XP8A 1DG1G 2WSMA 2GZDA 3P4XA 4RJLA 1ODFA 2JJ8A 4ZDWA 3DZDA 4FN5A 1W2GA 1W0JD 4LV8B 3M4YA 2FE4A 5SZKB 1XJCA 2JAQA 1ZJ6A 2O5VA 1P60A 4TL8A 2RGXA 4Q4HA 1ZM3A 4ZIRA 3C5CA 3VU9B 1AS3A 2H57A 3U7GA 5AJWA 2EU8A 4B3FX 1N6RA 1KIMA 4JZKA 1EGAA 4V0MA 1OFTA 2WWHA 4D80A 1Z22A 3GLGB 4JVSB 2WSSA 1UPTA 4GZLA 5DLQC 4TTPA 2O8CB 3H2YA 3K9LA 4KI0A 3SI7A 2BMFA 2VRWA 2WV9A 4AWXA 4ZCIA 1K5GA 4XD7A 4LYHA 2C5LA 2AXPA 3K8YA 4DC9A 1Q1BA 4C7OB 4HAXA 2X2FA 5D3QA 4KXFB 3O8CA 6Q21A 1Z0DA 2PJZA 1LS6A 4R2IA 3EZ2A 3Q5DA 1TMKA 2VP6A 2QBYB 5E7MA 2Z0MA 1NIJA 5JFGA 4CYMA 4HLUC 2DHRA 1TPZA 2JASA 4TT3D 4B32A 2BJWA 1F48A 1HA3A 4V02A 3W6OA 2Q0HA 5G41A 3GLIA 4R2HA 2AWNA 1OH8A 4JLAA 4HDQB 4DCUA 2FEMA 3KKQA 4XIGS 3FE2A 3KJGA 4RFVA 4C3ZA 4MGYR 4QJ3A 4HUQA 4IDOA 2X8AA 1R0XA 2JIZA 3C8UA 1M7GA 1GRRA 1YR6A 2N42A 2Q3HA 4Z8YA 2IYYA 1TF7A 4HUTA 1FQKA 3CF0A 4MQBA 5JWRA 2UZIR 4OI0A 2IYTA 4TN1A 3NIBA 4D0GA 2HLDD 3VR3A 3PQCA 1FMJA 2BBWA 1DO0A 2CLCX 2JJ2A 3A8TA 4HZUB 4E07A 1T3SA 3ICQB 5FR1A 4QHTA 4ZCLA 3U7FB 1N25A 1XXHA 2JLXA 4QBFA 5KSPA 2EYQA 3FB4A 5H1YA 3AVWA 5IHPA 3L0IB 4W5HA 4CEJB 1DAEA 2GILA 3BRWD 2IUSA 2ZE5A 4FINA 521PA 2IYUA 1E2DA 5DN6A 1HQYE 2WWFA 2QGNA 1E9FA 2FN4A 4LPSA 2YKGA 5H68A 1Z2AA 3RC8A 2WJVA 3LDAA 2XB2A 2IYQA 2ASEA 5SZIA 1VYVA 3TW8B 3KQUA 5FI0B 4OK3A 3WP1B 4A8JA 3K0AA 3FKQA 3RS3A 3ZH9B 1W36C 3X2SA 1UKZA 2ZRDA 2JLSA 1XBTA 3HDTA 3Q7QA 1K5DA 1J90A 2YOFA 2ZREA 4AI6A 4NP6A 2Z43A 2CMKA 1HE8B 1NP6A 3RRNA 1KMQA 2ZYUX 3QG5A 3DKPA 4XWAA 1RW4A 2RHMA 4DZZA 4WZAE 1I2DA 1XCPA 3IEVA 2XNSA 3SFZA 5J4YA 1TADA 3CR7A 3LD9A 4CEHB 2ZVPX 2AD1A 2ZTSA 4FMCF 2WZQA 2GF0A 2AFIE 4QG7A 3BC1A 4NU0A 4O25A 4BE7B 1DAMA 3CNNA 5AJVB 3IHWA 2ZSAA 4LJ7A 5CK5A 5JSZB 2O8EA 3UWKA 2C98A 4KSCA 3MSXA 4EFLA 4OQFA 4I1UA 1UEIA 1QVAA 3I92A 1TUEA 4P4SB 2VSFA 4FMCB 3FTQA 2ZRBA 4Z1MA 4A0HA 1MH1A 2YHSA 2ZAMA 3U5ZB 1OPXA 4URXR 5L3SB 1Z63A 3AKEA 1YZKA 5F9FA 2BVNA 3ZS8A 3K1JA 2AWOA 2VP4A 4KO8A 1VDZA 4Q48A 3AM1A 4LJ5A 1FUUA 1R8QA 1GM5A 4UNRA 3T5DA 4TMVA 5FPSA 3B1WA 4C0JA 1NJGA 1HE1C 3ZJYA 3FHOA 5E4FA 3RC3A 2OSBA 3GLGE 3AKCA 3OE7A 3IO5A 1CU1A 2CCJA 2X2EA 4K46A 1KJZA 3VHXA 1TF5A 2BHRA 2W6ID 4M21A 1FOEB 4LY6A 2ZJAA 5EE3A 1G64A 2ZITA 4AD8A 1IY2A 3U7EB 1ZIOA 3CNLA 3T06B 2IEYA 2W0SA 1OIVA 1ZRHA 2BKEA 3W6NA 1N0WA 1Q20A 1XFAA 4DXAA 2YNMA 4PO8A 1UKEA 4Q4HB 4ZIRB 4OI2A 4S2EA 2PJRA 2OAP1 3PUVA 2IX3A 1R10A 3V4RA 1Z8FA 2C9OA 1UKVY 2W6JD 2ZROA 3MWLA 3OIVA 3ZGXA 1OXXK 4UNPA 1NNEA 3JVUA 4Q1DA 4PAOA 2FSIA 2B8TA 3X1YA 1KGDA 3QY0A 4WA7A 4MUBA 4LC1A 4QL3A 5TV2A 2R8RA 3PR1A 2QPTA 4BASA 5FBWB 2GTPA 1G291 5FTLA 1E9EA 1CS4C 2ZE8A 1FUKA 4XVUA 3FKSA 4Q01A 1VG0B 3Q8XB 4M9QA 1G5TA 4Q4JA 1A2BA 4F91B 3THWA 1T5IA 2QPOA 4JLKA 2Q9AA 2CL6X 4W9MC 3AF1A 3QE0A 2V6IA 4EPRA 1L4YA 2OBMA 5AJZA 1CP2A 4ZDIA 5AUNB 1OB2A 2ZS7A 3OEED 421PA 1IXZA 3P26A 4PQRA 3KJHA 4TLAA 2Z83A 4F7WA 1E9CA 3K9HA 4MYTA 2A5GA 2C2HA 1Y63A 1DOAA 2BM1A 4Q5IA 2NOAA 3G5UA 4OQNA 2N46A 4MRPA 1QZXA 1KO4A 1MR3F 4OQMA 2IYRA 2A30A 3PEWA 1L4UA 2YC2C 4BPBA 4CIDA 1E1RA 1CULC 2GWHA 1XJ0A 2OCPA 2V1XA 2PEYA 1XCMA 1Z3IX 2OE2A 3X1ZA 4KBGA 3IBYA 1EXMA 2D7CA 4EJSA 5BYKA 1N5KA 2ZRNA 1M8PA 4EPXA 3EXAA 3U3MA 2V1UA 1P62B 2D3WA 1S96A 3KDSE 2ZRLA 1XD8A 1XXHB 4KYUA 2Q3FA 3HYTA 3R7WB 3VX4A 2G1JA 1T4GA 4CVNA 1SZPA 1W4CA 2BDTA 4D82A 4A6PA 2JIZD 1RJ9B 1WA5A 4LYFA 4X8HA 4DLWA 1TX4B 4GDFA 4YC7A 3LWNA 4TLEA 1FFHA 1TU3A 3UANA 1RIFA 4NMMA 3OEHA 4HAZA 1T9HA 2QENA 3AKDA 1U98A 4UJ5A 2V6JA 3W34A 4A8JB 1XPRA 5A0FA 1FX0B 3ADCA 2CNWD 2GAOA 4TSFA 1KHTA 1YRAA 1E2FA 1ZM4A 3NBZC 2GXQA 3GCGA 1E9RA 5JECA 3WMFA 3A36A 3MD0A 3SYLA 5AWFC 5IK2A 2Z5FA 4YMVA 1OYYA 1N6OA 4JBWA 3KFXA 3CONA 1FQJA 4QBIA 3SYKA 2EFHB 5FL7A 5G3ZA 5E7JA 2QT0A 2RGCA 1M7BA 1NL3A 2VHCA 1YU9A 4RZUA 1TU4A 3K09C 1IN7A 5FUVA 5TB5A 4LJ6A 4EPTA 2D2EA 2F3RA 4H1UA 1RVDA 4KAXA 4W7SA 1E2JA 3D7MA 3EIQA 4PHHA 3R9IA 5K8IA 1SULA 3ETLA 2JJ1D 1Z2CA 3LY5A 1VECA
chains in the Genus database with same CATH superfamily
4IW3B 5E2BA 1CUCA 3GEMA 4FZVA 3DHNA 5BV1A 5J1SB 2X5NA 4M0EA 4Q4AB 1QRTA 1N6NA 1E2GA 2OQVA 5JBQA 2Z6UA 5DHRA 4CODB 2QR5A 2BHTA 2APJA 2QG6A 2WWIA 4BJHB 4TKVA 3VZSA 1PJSA 1IE3A 1F12A 1SWWA 1NASA 2B3DA 3URMA 5LKAA 2PX3A 3GDGA 1NUQA 1ZU4A 4ARZA 1TYZA 3AXSA 1PZXA 1XCJA 2OZPA 3WLOA 1H0SA 2R6CA 1LJ8A 3LIIA 1CRZA 4CKCA 1JR6A 3E5NA 3KB8A 2GTHA 4WXRA 3S29A 5HYVA 4TYQA 2HMTA 2E48A 1PGQA 3Q4GA 4UM9D 2B1IA 2OFXA 1JKIA 4X44A 2WRZA 3CSUA 1JXOA 2XV1A 3UYKA 1ZMBA 4JJ4A 1XT6A 4X41A 5LLDA 4KR3A 1E6UA 5JJLA 5AOAA 2VDNB 1COZA 2EHDA 3HDGA 4IRXA 4B2PA 1EWKA 2WDZA 1CETA 4I81A 2P6UA 1DRWA 3WB2A 5IZCA 4DV1B 1GNSA 4OCZA 1B4DA 2ASVA 1IBLB 4PC2A 1TVKB 3V5NA 3QEOA 4ZHQA 5J2TF 3VSEA 2IQ5A 2JAHA 2ODQA 1P3DA 2GBLA 2BE7A 4KYTA 1IH8A 3SQLA 1UADA 2ZJ4A 4G26A 4H1VA 3H3JA 1RHKA 3X1WA 2F3QA 3JYQA 2ZI3A 1MA0A 4YYEA 2WE8A 4HL6A 4BNFA 4H3VA 2VN8A 3IKJA 4UM7A 2Z1MA 3WRXA 3MUFA 4E4TA 1P4GA 1ORWA 1WF6A 2P69A 1ZOPA 5I45A 1ESNA 2B78A 4OSEA 1WWKA 1BE6A 1GPJA 2ICAA 2PFGA 4BO7A 2YRXA 1JEQA 1E3LA 4M1SA 3ZWKA 4PAQA 1U2ZA 4DG5A 1O95D 3N7AA 4RKYA 1CRPA 2BISA 4GRIA 2OA0A 2BN4A 1L5KA 4DJEC 1ZR2A 4P4LA 2ZIVB 4UE3S 4C7XA 2WPDA 2VK4A 4FR5A 2X1MA 3EXG2 4MUGA 1EFPA 1HE2A 1YDEA 2YJZA 3AY7A 1ISSA 1ENOA 2VC2B 3Q6IA 3C5HA 1U7HA 1YB1A 2CNNA 2PGJA 3OZGA 4EGFA 2NYUA 2IEGA 1XXHE 2P7HA 3DMDA 2MR6A 3CINA 1U9IC 2XYPA 3H5WA 4G9EA 4TV9B 2YDXA 2I8LA 3FMFA 4BFUA 2ORED 1N75A 2WLSA 1YRQA 1LK5A 2VATA 2ZRFA 4NESA 4IH1A 1EUQA 1CUAA 1VCMA 4F3YA 1PFWA 2FRXA 4LJ4A 1AO0A 4IDEA 1ILEA 4GX0A 2Q1TA 3NTLA 4GLFA 4UU8A 4RQUA 4WZZA 5KSOA 3QELB 3E5RA 2O1EA 4UTNA 3VH1A 3DNFA 2HHAA 1P4JA 1TRKA 1E58A 7MHTA 1TQ6A 1XTVA 1Y8AA 3G3EA 1J7KA 5DW0A 4YMUA 2HLNA 1TQ4A 4EY7A 3O4RA 5I7VA 2GFQA 1P19A 2QZ4A 2H1OA 3CB2A 2IL1A 4L15A 3N76A 4ZMBA 2EHJA 5CNKA 2A0FA 4LZWA 9LDTA 4ZVKA 2GPAA 2H08A 4OHKA 3GYBA 3WMWA 3FCXA 5DZSA 2K7FA 1RBZA 2WYIA 5TT0A 4R41A 4DQDA 3AP1A 3TOVA 4I99A 5HM8A 2H17A 4CEIA 1DQYA 1KAEA 1P2GA 2WM8A 2P9ZA 2OD7A 2VBCA 4UBMA 4S35A 5FTKA 4C7VA 4F2GA 3V1NA 4LE0A 4R1SA 2QN1A 2F17A 2YIMA 2Z6AA 2QR3A 2ZPAA 4BRZA 3JZDA 5I7HA 4JASB 1U8TA 2RMKA 3AL3A 3M70A 5KMGB 1V7PC 1F4VA 1CEEA 5DI9A 1DFHA 4HDMB 3AVPA 2WJYA 4KQXA 5JAHA 1UBCA 3GC6A 4F12A 4KNYA 1NZJA 4WZBE 1OU0A 1G6KA 2AUNA 4E2FA 3O7WA 5JH7A 2WKQA 4QUGA 1FUYB 1Q0RA 3ONEA 4V24A 5JQGF 4G4GA 2A88A 2IWHA 4FGLA 4EBFA 5DCUA 4Q15A 4ZFNA 1EVEA 5C18A 3KWLA 3CN7A 5KJ6A 1JDNA 1OHHD 4XB6B 3SKVA 1HDRA 3WHPA 2XUFA 3PXEA 3OECA 3IQFA 1ZBQA 4GMGA 2PTHA 2BMVA 2CFRA 1I4LD 3ZHCA 2BW0A 3RYHA 1L5QA 4DARA 2I34A 3C14C 4OTZA 5JCZA 4IIYA 2PLFA 3I8XA 3WBFA 1KMHA 1UT8A 1Z0ZA 1BE0A 1JAIA 1YRBA 3BG5A 4HGRA 3PUYA 4HX5A 4B7CA 5KSYA 1UMBA 2CZQA 1KJYA 3IAAA 3OLQA 2D0DA 2EKLA 4JNCA 1M0SA 5FHRA 4D0RA 2BR3A 4OJQA 1LF5A 3H11A 4BCBA 3FWYA 3QKUA 2CB9A 4NBUA 5JY1A 1P39A 1MDBA 1AQLA 1FYXA 1E99A 2WR8A 3RO7A 4NJMA 1W36D 2FETA 2P91A 4OB6A 3FOAA 2AW3A 1EVLA 2AT1A 3NEJA 4RTKA 5LQUA 1C1XA 4PNPA 1CUJA 1YDMA 3AEQA 4LVNA 1JDSA 4B6SA 4CKYA 4D79A 4E1AA 3IRUA 5TIIA 1RJFA 1AQUA 1T35A 3CO5A 2XUZA 1DUSA 3K0EA 3A3OA 1R0ZA 2BEWA 1N5JA 3BS4A 4I55F 4L07A 4OQPA 3V1UA 2Q5JA 4HDKB 5FBVB 3RU7A 3R41A 4QTXA 1OIXA 4WY2A 5JRZA 1OB5A 1ZLYA 3LY7A 2EBUA 4M7WA 2AE1A 4L76A 3QPCA 1ZICA 1A5ZA 4AW9A 3QKRB 1Z8HA 5ESDA 3BWYA 5K3FB 3ZHUA 4DY6A 5KHOC 4LF4B 1LFDB 3DBLB 4Z9BA 1B7GO 2NO1A 1C8KA 3K16A 2IKQA 1UPUA 1VI5A 2HK7A 3C1AA 3ONFA 2A9VA 4OAPA 1JGTA 4IQGA 4BZQA 2JLVA 4PZAA 1IEQA 5EG5A 1TTHA 3SHVA 5TARA 2XQKA 1I3NA 4J94A 1QU3A 2X0FA 1R4MB 2ZUSA 3ST7A 2Y05A 1DXYA 5CH3A 5BSMA 4B34A 4O4LB 2CCGA 3RJZA 1LBSA 4DDVA 4IO0A 4LJRA 4E1BA 1Z5UA 2LRHA 2NUAB 2O8DA 3IAM1 4QM7A 3BJMA 1J25A 1AUXA 1GTMA 1NF3A 2EV9A 3VYRB 2IHVA 2UVDA 1G7RA 3EH2A 3OEWA 4OXIA 2C9ZA 3MBKA 4Q4DA 4ZT5A 1GL3A 2OXEA 2XRMA 4DLXA 4PBTA 5AM3A 4BFWA 4FDLA 3Q7TA 1EFCA 4Y2TA 4ESOA 1QAMA 2F9LA 2P7IA 4EARA 1U0GA 3AL2A 4U5QA 4AG3A 1EHIA 3I32A 1QSGA 4QNNA 1FJHA 3DAPA 1AA9A 1JI0A 1GXSB 1I24A 1A8HA 1NSTA 2HFJA 3P9YA 2IW1A 4INPA 1E1QD 4D9BA 1XRPA 4L73A 1UWCA 4LOIA 3KSRA 5CTAA 3R0VA 5KPDA 2VRBA 5YASA 3EAGA 1N9GA 4XQ0A 3LF2A 4L9SA 4J7UA 3FAKA 1T3ZA 4BNWA 4KKVA 1ZCZA 4YT8A 5INTA 1EEXB 1J23A 1SZCA 5KVCA 3WC4A 1L1EA 4KUEA 1RI4A 3COVA 1ZPDA 3ETCA 4M88A 3GFOA 3HXKA 1UFOA 1IIRA 1EJ6A 4XQGA 3IEUA 1P9OA 2IY8A 1RZUA 4YI5A 3Q9NA 1IUNA 4RSHA 3E1SA 4PTLA 4KR7A 3ZUPA 2ZRHA 1JLLB 4GH5A 5ELLA 2BCEA 1QHHA 1XL1A 4E51A 3B1KA 1PQPA 2A1UA 3PX7A 5KAMA 3WL4A 4KIWA 3KPWA 3PGA1 5TMPA 2F8SA 3OZEA 5L45A 4KLCA 4HH1A 3MCUA 4LRUA 4HVCA 1UMDB 1XU4A 2J3LA 3AINA 1TYBE 3FFTA 5TNXA 5BRJA 5KREA 4CQMA 3HJUA 2XUKA 4LZNA 1XZGA 1QH8B 4RY9A 5FOWA 2PN1A 2IYEA 4KQFA 1A76A 3FJOA 4WHMA 1QR2A 3ZV7A 3TLAA 1UK9A 4DIDA 3L1VA 3IA7A 3D8SA 4LV6A 1UBMS 2WDPA 1XD2B 2LGJA 1P5JA 4FYWA 5LD2C 1S5PA 2FMIA 4BQNA 1QKJA 1T5BA 5KI6A 2HXGA 2LD4A 1ODKA 5TC4A 1MW8X 3CUUA 5KTRA 4MVWA 3OE4A 4S0ZA 1T3LA 1KETA 3SVZA 5L53A 5HTKA 1SXJE 1T0JB 1CP3A 1JR3E 1PUXA 5C51B 1EHYA 4L22A 1VJRA 1P6QA 1HE5A 3GUYA 4EHLA 3E9EA 2PRYA 1G9XA 2J3JA 1OAAA 3DE1X 2E2WA 3X1JA 1VYTA 3FFWA 1MO4A 1U8CB 3AOEC 3LSYA 2GH1A 1CHNA 4QBTA 3VHLB 1BKSB 4WERA 3SIPA 2KQUA 4UPDA 4QYWA 2MSDB 2ZW9A 1YTUA 3MIIA 2QUIA 5C1DA 2A2ZA 3H6KA 1NVMB 3CVOA 3LW7A 5I51A 1WX1A 4JYCA 2PZ8A 1M2FA 1EVKA 4J3NA 3KL4A 2D6FA 4LMBA 3KTAB 3OPXA 3U9SA 4CCAA 1WB4A 5DM4A 3VR2D 2QYHA 4M6WA 2Q4EA 4FMPA 3UUFA 4CIYA 2CHUA 3NHPA 5C7IO 1RM4A 3OEEA 2FOLA 3BXEA 3TE6A 2JFHA 2UAGA 3WHKA 3LC2O 1CS0B 3ZD9A 2RGYA 3V00A 5LXTB 5FHQA 3FLMA 3T94A 4C4OA 5LQAA 3T12A 1JIVA 2IPLA 1ZY2A 3JR7A 3WIOA 1RP1A 4B5KA 3F5QA 2CUZA 4JL5A 4JI5B 3AX6A 4AF6A 5KTMA 4S1VA 1JQEA 2O5EA 3GT7A 3U4QA 1H85A 3RVBA 3I37X 3D59A 1RYHA 4CBVA 2E4UA 5AVUA 2HF9A 1H2WA 5IDYA 5CJPA 1XTIA 4HDSB 4YQEA 2QI9F 2VJMA 3GMTA 4OGKA 3EG9A 4R1LA 1XMQB 2LE0A 4QOFA 3X2FA 1A8UA 1IXRC 3NTQA 3RUPA 3KTOA 2AUTA 4FT2A 3RRBA 1R64A 2G5PA 1Y82A 2AI2A 4DVGA 1KKUA 4ZVMA 1OVMA 4XM0A 1TQDA 1EFUA 3UMRA 3D2CA 4OP1A 4E2WA 4IRUB 4WOJA 3G8DA 4C4AA 4AICA 2JJYA 1DZIA 3FHLA 1Z0AA 3X3HA 1IB0A 2GLUA 1UBKS 1AKYA 3RYCB 1QTQA 1GFZA 4PG5A 3E15A 3V3KA 1BIFA 1J2EA 1PYDA 2C8LA 3NU1A 5FAXA 1FDRA 1I6WA 1QTIA 4XX0A 3P0HA 4WJZA 5IP5A 2L2QA 5JBIA 2EBFX 3DP7A 5KWEA 2CCKA 3HXQA 3DZJA 4JUAA 5KPJA 4FWTA 2GEVA 1F2TB 2P9FA 4V39A 3DFZA 1KK2A 2X2PA 3BMXA 3QU9A 4RA9A 4RULA 4F9TA 4CIWA 2CNWA 1PJ4A 1ZS9A 2WNSA 4ERXA 4RTNA 3WADA 5HF8A 2DFLA 2PUWA 2BFDB 1OCEA 3HWWA 4PAMA 4U7FA 3UMSA 1JLKA 3BJEA 3DUFB 3IT2A 1NPYA 3R5XA 3SEQA 3L4BC 3UK1A 3PXAA 3DV0B 2VPZA 4H08A 3DJFA 4OQYA 5IULC 5F1PA 1VHQA 1CT9A 1GVNB 1BX1A 1M5UA 3A6HA 3DT6A 2V3WA 2IELA 2NSYA 2H11A 3LP6A 4WAUA 3A3PA 4WBXC 1GEEA 3BXPA 4RE5A 4KMRA 1XEWY 5KTTA 1U6JA 2VDWB 2VDVE 2I78A 1U8YA 3H4IA 1EXVA 1EUZA 4JY7A 1SUPA 4FGSA 2ZBEA 1SCAA 2AEEA 3Q3CA 1PQWA 4X85A 3OSZA 4Q37A 5GTDA 5CDFE 2M6SA 4UUOA 3MBOA 3W5JA 5HWSA 5JJKA 1YL5A 1JHDA 3W3AD 3AM4A 1VL2A 3ZZTA 4DYDA 5LM3A 5M34A 2JGKA 5GMOA 2HUPA 4IM7A 4IDPA 3WQSB 3DSRA 1YUNA 1TW3A 2QRVB 2DHCA 2VDJA 1WAMA 3QXHA 2J3MA 1I0IA 3H0CA 4DCNA 4JI2B 3COYA 2VHJA 1ETHA 2AJBA 1D1QA 2P62A 3HJGA 2BGUA 3N2GB 5DM70 4EKIA 1ES9A 1NGSA 4DBZA 3P19A 2ZAYA 3IKTA 1ZNXA 4MR8B 4C4SA 1ABBA 2WHEA 2R4UA 1CEQA 4IY1A 1CDDA 4H2DA 4O8CA 5F2OA 4BEJA 4CLRA 2CF5A 2PO7A 1OIWA 4JUBA 4MW6A 3UC5A 2E1RA 3VBCA 5KNCD 1FZQA 3BQMB 1T1JA 5CTJA 2ZIAA 3FPHA 3BFPA 2GTIA 3DDNA 4Q6BA 1SC9A 4BNVA 4DZRA 3T1YB 1MQ9A 3L06A 3ZV5A 1K7XB 2P65A 4PYNA 3JVIA 2IDZA 1B73A 5D7BA 3EAQA 5JAQA 2AZDA 4CCYB 3DC7A 3EZ9A 4YGXB 4GMXA 1FSGA 5B1SA 2NNWB 3NZEA 1SXJC 1FDOA 4F72A 1GPYA 4E5DA 4RZ3A 3WB0A 2FWIA 3E7FA 4NBWA 1Z0IA 3VDMA 3MT9A 2VJCA 3QTTA 1EFDN 6CHYA 4NYIQ 3GDFA 2DU8A 3EVGA 1JYSA 1SVSA 2RH5A 3G68A 1ZM9A 1KH1A 3BRCA 4LZPA 1VHWA 4L75A 5CD9A 4ZYLA 1A4UA 3DE2X 2XBLA 4MW9A 2BHNA 2A5FA 3PXCX 1ZI6A 1GRCA 3OT1A 5AMXA 1G98A 1NM5C 2DFVA 2OY0A 4L78A 3N8DA 4X1YB 1FRFS 4DCGA 4JOQA 2L42A 3LUFA 2R4TA 4G01B 4J0JA 4NARA 4BCDA 1NBME 4UBLA 3KT6A 4D4KA 2A84A 1JJ7A 1SC1A 1AURA 3ITEA 1M2GA 3GLUA 1Z73A 3HHPA 5ER9A 4QU9A 2QD3A 1BE1A 1CB7A 1CR2A 2CNDA 1V41E 2VSNA 3B7WA 4ONEA 3S7TA 3S7ZA 5HM6A 2R00C 3AUUA 5I47A 2VUIB 1Q21A 4FI3F 4MJ7A 1VJTA 1T9DA 4PYKA 4WECA 1W47A 2ZYVX 3H17A 4RENA 2HYIC 1VHLA 4AXXA 1MD9A 2O0LA 2ZDGA 3Q3VA 4BBAA 3ABRB 4C2UA 1OYOA 3DV2A 3OKCA 5CA0B 3TLJA 2VOJA 3CM0A 5JFTA 1R5NA 4CF7A 3I01A 4FYXA 1E20A 3KYJB 1Z0JA 1QFZA 3GOQA 5FWXA 2O8VA 1ESMA 4JI4B 1YGYA 4RHCA 1VPLA 3GJ3A 3B1VA 4R0VA 4WT7A 2O2IA 2QRZA 2PZEA 3EXHB 3OX2A 1OZFA 5F78A 5LA6F 4GP9A 1KOFA 4NPAA 3ZWNA 4OLBA 2VRNA 4Y9DA 1GGMA 3EQ2A 4L3OA 1BHQ1 4MA5A 3RT9A 2AI1A 1O87A 1SFRA 3EFOA 3S40A 3UCFA 3GLIB 5HUQA 3O8OA 1LGYA 1V6CA 1QB8A 4TYWA 1L8XA 2PGLA 1PWZA 3HRIA 1BWPA 4R31A 2H3HA 3LWBA 4GPEA 5E6RB 2FPIA 5DNWA 2P75A 4F3CA 3ACBA 1AV6A 2JANA 3CNEA 1O6GA 3WLNA 1SURA 2V6GA 1FP7A 4CT5A 2A9QA 3HBLA 5HHTA 4ZQFA 2F9FA 1PW7A 1RR6A 1XVLA 1RXCA 3EA4A 2WKPA 3U0BA 1IVSA 2GUWA 3A14A 1Y1LA 5LBTA 1N7IA 4C7BA 3OZIA 1WXGA 4HQKA 3BCRA 3N2IA 5JATA 3L79A 4PGMA 3P32A 2XYGA 3DO5A 3JWGA 4LQDA 2ZYTX 4JUDX 3WGQA 2C0CA 2Q3JA 2C4HA 3THOA 3PF8A 4Q12A 2WAAA 4B3GA 2ZCVA 4WD3A 2EW2A 1H3FA 4YDRA 4A8TA 5L8VA 1FDSA 1CUEA 4QE3A 1P0CA 2BEKA 5FBZA 4CT0A 1ZEJA 4P5PA 2I2BA 1OJLA 3GK3A 4TMXA 3T61A 5CCBA 3WWZA 1S01A 4F1KA 2C3YA 2GJSA 4OHBA 4R83A 3T3NA 4QIHA 1QFJA 1O8CA 4ZPXA 5C46F 1YL7A 2Y9MB 3ESZA 3OQNA 4YRDA 1ZWLA 1KI9A 1XTQA 4CNQA 1LDNA 1Z7GA 4UFNA 1N77A 4QDZA 2ZEJA 1TD1A 3GLHA 2W93A 4KRXA 5FBQB 3WQRA 4EM6A 2G9NA 3K15A 1J33A 4N0MA 1P77A 3LRPA 2QYSA 3DFMA 3T5GA 2P68A 2BM9A 3HCRA 5REQB 2QTHA 4KJZA 3PTZA 1HE3A 3C45A 3BDVA 3KPUA 4Q7EA 3PHBE 4XSGA 2BTEA 1WULS 4K5QA 4OHCA 5M29A 5FD8A 1TIBA 3KJEA 4DMMA 3OMXA 5CYFA 5JPCA 3NOOA 4R98A 3T1QA 1ZC4A 4RANA 5ALOA 5EE1A 2CE2X 2Z3ZA 3KG2A 2E9SA 4KO2S 5EUCA 3HR8A 3UMCA 4DIFA 3U09A 1XCGB 2REOA 1ZD5A 1ORDA 1TO6A 1UFRA 3HZHA 2W0MA 3S28A 5KX5A 1TAGA 1D7AA 2FCRA 2NU7A 2QW1A 4HGPA 4BNTA 2FEXA 4Q1CA 4GGPA 4OUDB 3VH2A 4EDHA 2VO1A 4IV5A 1KH3A 3X1DA 5BWLA 3VPBA 1XMOB 1YR7A 3HBFA 1XRRA 5ADHA 4EH1A 4ZI7F 4MUAA 2QM3A 3A4VA 2QLTA 2AX3A 4EI7A 4UTPA 4WKPA 4XQ9A 1PT7A 1MIOB 2PHZA 4KTVE 2AF4C 3R76A 5I7AA 5BW6B 3VR6A 4YJ2A 4GZ6A 2OG2A 3CX8A 4JXXA 1KEZA 1YK0A 2Q21A 1KA9H 4L9WA 3W1WA 2V7QD 1N2HA 1E1MA 2I67A 1M6NA 3INYA 3K1ZA 5CX4A 2VPXA 1KNXA 2GI4A 2ZBFA 3P2EA 4RF5A 2PRJA 4HT3B 4W5RA 2XZLA 2ZBRA 5F9MA 4XSHA 4XWGA 2HCRA 1CDOA 5TDHA 1SCIA 3BL8A 4XUCA 4KE9A 3OX1A 2R7NA 2EWVA 5KTNA 1KAHA 2IYFA 3L0OA 5CFNA 3PPVA 2K5UA 2RHCA 2AG1A 1FVOA 1PGNA 1BU5A 1DP4A 1ENZA 1SKYB 2GZMA 4INZA 4BNNA 3EC1A 1Y3AA 4IS2A 2HM7A 5GZ1A 2YCBA 1LLQA 3BBPA 1APBA 1OT5A 4P3NA 4OU5A 3F98A 5LSAA 1GV0A 4ZDJA 3KR0A 1Z15A 5F21A 1ONSA 3GGDA 1E7YA 3LZDA 3L7AA 3SNHA 3KQMA 3RKSA 5CX1B 4OLAA 1WQ4A 3LDUA 1QQAA 2QMHA 1TQ8A 2VNIA 4FHZA 4NU5A 5JS6A 5IM4A 2HT1A 2CNOA 3DEYX 1CZUA 1KAQA 4P0TA 5F76A 3U39A 5KCMA 5F9HA 3MCZA 2WJHA 4PGHA 2QIOA 3KKEA 5B3AA 5AW3A 2A14A 2Y2UA 2BC9A 1P4AA 1PJRA 1RZ3A 4QOHA 5KOYA 3SHFA 3SK0A 4EY8A 1AB5A 1NBHA 1JNYA 4GBGA 4LVUA 2IE0A 4N5MA 4BLSA 3S8MA 2HDNB 3RC1A 2ETVA 5BQXA 3PC8A 5ARDA 3M81A 4NX2A 4OFWA 3HCDA 2P5YA 4YT5A 4E7OA 4ECAA 4DRXA 1UIRA 2FW6A 4JI3B 5LNK1 1U0NA 3M9WA 4G0ZA 2VH2A 2OK8A 3IERA 3NS7A 1N7JA 1R9JA 3N8NA 1SUBA 3NPAA 1SQ6A 1GGHA 3HB5X 1TUIA 2FQYA 4AL4A 3D3QA 2X5JO 3I9MA 3L1KA 3UQYS 5MN4A 2ACEA 3AR5A 1BWSA 1GZSA 4ND3A 3D81A 4Q3AA 1M75A 4PG4A 1P1JA 2QTAA 4DSTA 1O6FA 3LT2A 1XZAA 1T0BA 2OB2A 1YQXA 3E2IA 5EMHA 4WN9B 2V4ZA 5I3ZA 1W44A 3UWMA 2CNKA 1FTQA 1C8VB 1GL7A 1X74A 1Y3DE 4FYHA 4H4EA 4QQRA 3OOWA 8ADHA 5DHTA 4Y6OA 3SJCA 2Z6VA 4CM3A 2FZCA 4DQUA 2ZZMA 2YFKA 3SQMA 2BH9A 1VMIA 1RRVA 4BXOB 4M9UA 1WV1A 5JQWA 4TWJA 2XB4A 4BKMA 4BC1A 4Z53A 5KEIA 1FMLA 2XRYA 4XEUA 1FCJA 4W8GA 5IDVA 2A0UA 3IAHA 4BQQA 2ZJ7A 3CC8A 4BVGA 1P3JA 2FPKA 3DDCA 2F1HA 4EKEA 4ZVVA 5IJZA 1DAGA 3BIJA 5I8PA 5IUNC 4L27A 4L4XA 1HQDA 3H7AA 3CVJA 3H65A 3I4LA 2EW8A 3VGPA 1OY1A 2JFPA 3DW1X 4Y6QA 3GBSA 3EPHA 3GARA 2G08A 1ZGBA 1IATA 5EMMA 1DIAA 1ZIXA 5F52A 4UEWA 3TPCA 3I39X 5KQSA 1NI5A 2FFHA 2JH3A 1BMTA 3I6QA 2B21A 2DH5A 2PU7A 4IFEA 3UOGA 3AOGA 4KE6A 3TI7A 5FADA 3EIHA 2W2MA 3Q9LA 4ZVTA 3DWIA 4E6PA 7ADHA 1MQSA 1WP4A 2IXAA 4MV6A 5EOVA 2FVYA 4KVGA 1O57A 1KRWA 4H1HA 2HY7A 2D1QA 3ZLJA 1R6AA 4NABA 4Q16A 3TI9A 1YXMA 2QPAA 1M8KA 4DBLC 3K4QA 3N0WA 4MWOA 4N3CA 3V4SA 5CPBA 4YRKA 3OD5A 3FDIA 4U7TB 3WNZA 1YJ8A 4PHGA 4S12A 1ZVQA 3UF0A 4NH0A 4B6JA 4DWJA 1TT5B 5THQA 4PR0A 5ALTA 2Y92A 4OOEA 1JA1A 2AFIA 3BSFA 3DS8A 3NWBA 3B70A 3ZW7A 1GPKA 3LUDA 2XUIA 4WASA 1QR6A 2C2XA 3GGPA 3Q8MA 4IQ0A 3AU8A 3OM0A 4EJ0A 1Q3KA 3CUVA 4A8PA 3ZVNA 3I53A 4WLOA 3RQIA 3VNBA 4ZYUA 3FPJA 2DBVO 4X8LA 1XK7A 3IUJA 5DNAA 1Z6YA 4QPZA 1HDCA 3ENQA 2IPOA 4F60A 3WYEA 2IUFA 3T7TA 1R6VA 4YJ2F 2WFZA 1GUDA 1RM0A 3KB6A 3Q6MA 4ITVA 2IOFK 4XGQA 4ZKEA 1C9KA 1E59A 2HZBA 1SU8A 2QIPA 4GMDA 5JXGA 1GTL1 4GI5A 1THMA 4MYDA 2M6RA 3QPVA 2C31A 2FU5C 2GJ8A 1MOSA 2PG3A 4J75A 1M6EX 4I1PA 1E66A 1EFLA 2YWGA 3JQAA 5DPMA 1USWA 2GVZC 4YLGA 3AERB 4GXNA 4MNTA 3DR5A 1V45E 4ZODA 4YR7A 1V37A 1RQ2A 1UZAA 3BIXA 4UDNA 1E8MA 4CQJA 3L0BA 3K6KA 5JTTA 3I2YX 1YQWA 3T7DA 3ISVA 3LDHA 3P0IA 5JD3A 4W1PA 1VP9A 1CQIB 1IUKA 1RQGA 1GPBA 1KY4A 3NVMB 4RV5A 3RSLA 2XTNA 3SC2B 4CKEB 2C2GA 1EKXA 3TJZA 1N5MA 3VVCA 2LDBA 4RSGA 2JI7A 3BM5A 4XB1A 5AXBA 2QL6A 3C3JA 3Q7SA 1A8PA 1DMSA 1UP4A 2GRUA 3D6UA 2WE7A 1JG3A 4FFDA 4JEIA 2DLCX 1GILA 4MVYA 4R40A 4RLHA 1PVDA 4LJSA 1QC5A 1V6AA 4L0MA 4WLNA 4JR1A 2GHRA 4EWLA 5CJ2A 1P73A 1UXOA 2EFCB 1L5SA 4U6SA 5KS2A 5IM4F 2IU4A 4AIRA 1GLNA 1QWSA 3TGPA 1NUTA 2GCOB 4OQEA 4AULA 3PQ8A 1JDBB 2W5UA 5HKOA 3A10A 3PHCA 4KZPA 2OILA 5EEHA 1KFBB 2FW8A 1NX6A 4I5FA 2CFSA 4H18A 4YXFA 3GT4A 1O94A 3H8WA 5HIAA 4YWJA 1DE0A 4ZU3A 3DQQA 4X1IA 3BCHA 4B7XA 2CXQA 1W6RA 3WO0A 5A9SA 2HMWA 3FRJA 3PKZA 4UMEA 1OFVA 4UXJA 1NLYA 1KY5A 3LHFA 4KB5A 4B2YA 5B3LA 1EMDA 1E6CA 3O26A 2P4EA 2FK7A 2W98A 4WLEA 4LXYA 4YV0A 2QORA 1CD5A 4HH3C 3W4KA 1RYEA 1GSOA 4IINA 3TH5A 1PL8A 2BTQA 3F3MA 3NBUA 4OXQA 3O91A 4HZUA 5LCXA 3EYWA 1EAMA 2F43B 1BYUA 4M7PA 4MYCA 4MW4A 4O4IF 2Q9UA 2C8VA 3FGPA 3SOPA 2GDJA 5BYJA 1W48A 3LOPA 5ESXA 1B8NA 1QOQB 4JCOA 2PL3A 4URHA 5K2MA 2VJBA 1MJFA 3QLUC 3H1BA 4U6NA 1R7RA 2XXJA 4QUJA 4Y6LA 2WHRA 1S2IA 5M04A 1J8YF 1X1SA 3FYUB 5F3RA 2A1IA 2JI6A 2RC6A 2YWCA 3KHSA 5FTNA 4Z4HA 4J29A 2NQTA 2JDID 4GT1A 4US0R 4NZOA 5CA1A 2J3EA 4R2MA 4KQ6A 5BQPA 2J9GA 3NI2A 1E3WA 4EG7A 2VZ8A 3PE4A 5FLYA 2GEBA 3VSBA 3QU5A 3UPUA 3OZTA 3DDOA 1GUAA 2VTEA 3P2JA 4MGZR 4ZARA 4PVCA 2R7MA 1LK0A 3CLSC 1BJKA 5FH9A 2C3UA 3QVTA 3H2JA 1I4TD 4GE3A 4IQ8A 4Z49A 2XTZA 4AP5A 3MRTA 4L02A 1RC1A 1NBEA 3IOCA 4P2GA 1QIJA 3DZCA 5C80A 4KVZA 3TIIA 2W43A 7AT1A 1H1TA 1QQ7A 1YVRA 1P2FA 4CDGA 5IKXA 4B6EA 3ORYA 3O74A 4U2FA 4BQSA 4HQRA 2J30A 1ZGGA 3PVSA 1RYDA 1VE3A 1ZITA 3KEGA 3PEVA 1XNQB 4GUDA 1NVVQ 4E12A 1N4DA 3F9CA 1UMCB 5BVHB 4UZEA 4PPQA 2GEFA 3AUSA 4V0SA 3TSAA 2YV4A 1EHCA 1J8VA 1NBOA 3ENWA 3TNJA 4H16A 1EEHA 2BDUA 1A69A 2HBQA 4R84A 3ZJ4A 1BMFD 2J1LA 4YB8A 4EB8A 4UM8B 2CXNA 2H92A 3Q85A 3NB0A 2X58A 3IQEA 4P7FA 2JBAB 3ADPA 1XTUA 2AD5A 3CE6A 1LQ2A 1PT5A 3JD2A 2FGJA 3R0ZA 3TLKA 2FOIA 3PU6A 2BZGA 4F1JA 4PYMA 5C4GB 4NTZA 1YASA 4YRCA 2AMFA 2OCLA 2QVLA 3FBWA 4ALIA 1FNDA 3RUCA 1NVUQ 1GLGA 2J3QA 4Z1OA 3BXOA 4YDHB 4GWGA 1WXWA 5CLHA 3RUHA 3ZKWA 4AQYB 4PFKA 1ZI8A 5BSWA 4AKIA 1TQHA 2IXEA 3KT3A 3PICA 1Z33A 5HOEA 5I7FA 3UWSA 1LTQA 2H85A 4GPZA 2ID7A 1Y5MA 5JNLA 2C9DA 1F0PA 2VJQA 2BMEA 3NVDA 1HK7A 3EEYA 4JLJA 3A4LA 2I8AA 2W6CX 5LBIA 1Q74A 2ZETA 3T15A 5J58A 1X2EA 4RPHA 2CVOA 5I7OA 1ZNZA 5HCNA 3JVEA 1ANKA 1ZD8A 4HWOA 1AUQA 1V43A 3EFHA 1LSOA 1I8TA 5TS3A 1ZYUA 3GCZA 4LTDA 2IW3A 2GXUA 3FR8A 3MGAA 3TJMA 2AQ8A 1L5ZA 2P3OA 3TAUA 1W5TA 1WF3A 3CF2A 3RRFA 4RKFA 4B47A 5AVRA 3NIGB 2G5GX 4OG2A 1ZD1A 4G24A 1O58A 5BY2A 1HQKA 1RQXA 1NLUA 5F77A 4ZWNA 1CQJB 3OY7A 3QBTA 1EQ2A 2HC9A 4II3A 2H1FA 3BDIA 3GG2A 4NNJA 4BEBA 4WBNA 5E9JA 2V9ZA 1PTJA 1C30A 5HEKA 4BO2A 1EXWA 2IHYA 3CNQS 3PWKA 2WFMA 3GNSA 1DAKA 5AW6A 1B1AA 1PUIA 3QQPA 4J2HA 3GELA 1XVVA 1J97A 4GP7A 1PR0A 2AL7A 2CK3D 4PLZA 3B85A 4QJ4A 2XLCA 3DZ8A 4BMNA 5BW5A 1KDRA 5HFAA 2FWAA 4CKWB 3C4QA 3TZLA 2ODWA 1WVMA 3FNFA 2OAGA 3I9V6 4UQOA 2QTGA 4BLOA 4ES6A 1NMSA 1P5HA 4UDYX 5AH0A 4ZCTA 4IWYA 4LF9B 4F3TA 3MRSA 4L4RA 3NW9A 1VYUA 1A50B 4FHEA 5HJEA 1Y3IA 2XA1A 3ETDA 4FOTA 4XEHA 2HQ1A 3GGJA 3PR2B 3HE3A 1CJBA 1TW2A 4RXUA 4ZAVA 3ZY5A 4ND6A 3QU7A 4GOOD 4A5OA 1K06A 4LAFA 1U0OC 3KEFA 3SU8A 2VNSA 4CW7A 1TKCA 2IYNA 3AESB 3THRA 2GN0A 4DUGA 3BSWA 1X92A 3WB1A 5IN4A 3AWIA 1EDEA 1NNUA 3BD8A 4GW3A 3U4DA 1Y33E 3TOZA 2HPVA 1C9MA 5BUSA 2W2LD 3O2QB 2OGZA 3OT5A 4V1CI 3PC4A 4LGYA 4ZZIA 5BOSB 1AKRA 2D5BA 3DOUA 1H8ED 4TZTA 5DJ5A 4L51A 3TJRA 1CUYA 4GWLA 4K9PA 1XJ5A 2EWWA 4YTEA 4UCWA 1JLRA 3U37A 3DFFA 4CMJA 5IEBA 2JK1A 3ZHXA 3UC9A 5E7QA 4N1AA 1FNMA 1HGXA 5I5GA 2ZIXB 1LDGA 1WMSA 1W9MA 2IU6A 2VP0A 3C7CB 1KVTA 1GAQA 3DT9A 3PX3A 5EWLA 1QDUA 2WU4A 3M3PA 3NHRA 4ZCPA 1GDTA 2RCNA 3I5YA 5GV7A 2PM8A 3PJGA 2GAJA 5CA1F 4CMBA 1RRCA 1PJ8A 2NZ2A 1OKKA 4YRRA 5DASA 1VHJA 1E96A 3QUQA 6ADHA 1JJFA 5BNZA 3QLUA 4P7JA 4Q19A 2YZ7A 1V16A 1JXAA 4DR2B 2HX1A 1RU3A 3ZCPA 1B93A 4L8WB 1HWYA 1YQQA 1EM8A 1SCBA 2Q2QA 4C89A 1ICEA 3EGXB 4A0SA 1Y8QA 4LWZA 2KWIA 2CDRA 2NSLA 1BA3A 3GP5A 5AVVA 4TWBA 4KV9A 4RGQA 1FX0A 5EIOA 4ERNA 3M6VA 1MO2A 2ODNA 4OK5A 4G5HA 2H6EA 2QAJA 4URVR 2GEKA 4JYMA 4PHTA 1QG2A 2XVXA 3WYAA 3Q11A 4UDOA 4A6DA 1FVHA 4AS2A 2GT1A 2F3TA 2RHTA 2R1ZA 1AN9A 3IDAA 3WDSA 5CU7A 4ALLA 4ANFA 4P4UA 3N8HA 3G89A 2I4MA 1KZ9A 5BMVA 3EH1A 3EJ6A 5ICGA 4BMVA 3MWJA 3L7YA 4ZA2A 4ZCRA 3WYDA 2BLLA 3TTXA 1ABEA 4EFMA 4DIMA 2ZJZA 2F8LA 3FPSA 4ETWA 1XZNA 3B1JA 2WD7A 2XMCA 3DYBA 3H5RA 4N5HX 5JJCA 3UK6A 3SZOA 3OBBA 4Q4AA 4N5DA 3T35A 3P96A 3EDCA 5EIEA 1IJEA 5F2EA 3TPFA 5C2JB 1XEFA 3IV6A 1V11B 2I65A 3LQKA 3JQRA 3ISJA 1Z0SA 4NR0A 4NZPA 4TKMA 3REOA 4X8MA 2A6PA 5EHIA 1P44A 3FHJA 3MK31 4NYMR 3UBMA 2CUTA 2HDOA 1B8UA 2JAPA 2ERXA 2KJQA 2EFJA 3NALA 3VJRA 3KE9A 2HSDA 4EHJA 1D2NA 3L46A 3OCVA 4ZVOA 1WHSB 4FIDA 1N1MA 2FLWA 4IDCA 5AI4A 3B3JA 1HT1E 1B14A 5JSYA 4Z4FA 4BBPA 3JWHA 1Z25A 2P1ZA 2WVGA 1HZZC 5E6UB