1UDWA

Crystal structure of human uridine-cytidine kinase 2 complexed with a feedback-inhibitor, ctp
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
212
structure length
204
Chain Sequence
EPFLIGVSGGTASGKSSVCAKIVQLLQKQVVILSQDSFYRVLTSEQKAKALKGQFNFDHPDAFDNELILKTLKEITEGKTVQIPVYDFVSHSRKEETVTVYPADVVLFEGILAFYSQEVRDLFQMKLFVDTDADTRLSRRVLRDISERGRDLEQILSQYITFVKPAFEEFCLPTKKYADVIIPRGADNLVAINLIVQHIQDILN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the specificity, catalysis, and regulation of human uridine-cytidine kinase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Uridine-cytidine kinase 2
total genus 66
structure length 204
sequence length 212
chains with identical sequence B
ec nomenclature ec 2.7.1.48: Uridine kinase.
pdb deposition date 2003-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00485 PRK Phosphoribulokinase / Uridine kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1udwA00
2NO1A 1XB2A 3ZVLA 5CB6A 1N25A 5CLQA 1WXQA 3LX8A 4DDVA 1S1CA 2CEAA 5E7JA 2W2VA 3FFBA 4ZDWA 2FEMA 4NP6A 3RYTC 3T34A 3C15C 5KSOA 3U2QA 4JVLA 2OZEA 4XJXA 5UKDA 2W6JD 1HH4A 3VHXA 5BYKA 4OJQA 4M9SA 2YC2C 2V6IA 3AKEA 3WHKA 4XWOA 3SC3A 1ZU4A 1IXZA 1N6OA 3AGPA 5KPDA 1F6BA 3QUSA 1R8QA 4IDPA 4JT2A 4P4SA 3SFVA 4E07A 1EFTA 1P6XA 1K6MA 3HU3A 3ZDQA 2IUTA 3W6PA 1L7VC 2ZQ5A 1CR4A 4KI0A 4H9GA 2Q9BA 1KI8A 1U0JA 1T91A 3H84A 1HYQA 1UBEA 2CBZA 3LBNA 5CDFA 3C16C 4PQRA 3GEIA 2C9CA 4MRVA 3I5XA 4MGZR 1XEWY 2HJGA 5AUQA 4DLRA 2IHBA 4KFTA 2HUPA 4L8GA 4P33A 1NP6A 5L3SB 4Q1BA 4OK5A 2CHVA 2W2TA 5CITA 1E9SA 3QEOA 3MUFA 5SZIA 4V03A 4B75A 4TLAA 4GT1A 1VG1A 3DM5A 5HR5A 1W0KD 3P4YA 1Q20A 4EQ6A 2JGNA 2WMNB 1FNNA 4I4LA 4XTCS 4E22A 4LI0A 3C41J 3PVSA 4LJ9A 1BIFA 4EPXA 1E69A 1DPFA 2YHSA 5J4YA 1NY5A 2PZEA 4KODA 1XMVA 3SNHA 4JLBA 3GQBA 4OHVA 1N6IA 5C4MA 3GPLA 1DAFA 1VYTA 1ZD9A 2WSMA 3FYHA 3G0HA 2FF7A 4YDSA 1T5IA 2F1RA 3Q9LA 1PUIA 3BRWD 4I1UA 3U7HB 2XNDA 3TAHA 4DZZA 2ZPTX 3EZFA 4TTQA 2JLUA 3RC8A 4IDQA 2GEVA 4B76A 4CRWB 2IUSA 4LY6A 2ZRFA 3KJGA 2XJ4A 2Z6VA 4Q7KA 3U7FB 3U44B 2QMEA 3A4MA 4DLXA 3LD9A 5SZKB 2MMCA 1Z28A 4NCIA 4M4SA 4TMKA 2J0UB 4MUAA 1E96A 1ELOA 3FKQA 3TKLA 2P5SA 2A3RA 3VNVA 3PFIA 5C18A 3C4JA 2GJ9A 5K8IA 2IYWA 4D0GA 2ZRJA 4EFMA 4Z8XA 2QTVB 1YZUA 4LJ4A 2V9PA 4U7DA 1B23P 4C9BA 3TE6A 5ELXA 2DWOA 4PXAA 4DIDA 2DR3A 3VR6A 2UZ3A 2IEZA 2W00A 2PCLA 4RFVA 5KOYA 1SQ5A 4AKIA 1TU3A 4JYCA 3QKRB 2FN4A 4YMTA 5LD2B 3CNLA 1U8YA 4FWIB 1X8KA 1MO6A 3U3JA 2AWOA 2Q0HA 2ZTSA 3QBVA 1T3HA 5FPTA 2FPMA 2ZYUX 4NE2A 4PPNA 2HDNB 1CJKC 3IEVA 2GVZC 1RZ3A 1GL9B 2KJQA 3AKCA 3W90A 3P1JA 3ASZA 1IN4A 3PEUA 3QF4A 5KNCA 2WKRA 3OIYA 3W3AA 4LHXA 1W48A 3WY9A 1Q22A 3SJZA 1E2FA 4FXPA 221PA 2OG2A 5EXXA 3T1QA 3K70D 4LPSA 4OI2A 3KL4A 4OYHA 3X1WA 1KIMA 3QI2A 2ZSFA 1XBTA 2N42A 3MAAC 1CRPA 2OCBA 1GRQA 2BJWA 2ATXA 2P65A 3AVPA 1ANKA 4URUR 4CT5A 4A0HA 5EXSA 1GM5A 1QHSA 3I92A 2ZE7A 2ZRIA 2J59A 1E79D 4PAMA 2WM9B 3B1XA 2VHJA 5KNDA 5EE1A 1OXUA 1XCMA 5BQ5A 1S3GA 1N0VC 1L4YA 2IYSA 2IBMA 2GETA 3CX6A 1E98A 1JR3E 2GDJA 2BKEA 2V3CC 4WBSA 3D3QA 4OQLA 3K09A 1P60A 3LW8A 1XPUA 2ZJBA 2F43B 4BPBA 5FBRB 3EAQA 3HJNA 4KSBA 4PZZA 2PZGA 1TAGA 2ECKA 1DBSA 1DO2A 1UDWA 4MRRA 5JWOA 4E5UA 2J7PD 2F9LA 1XJCA 3QXCA 3P27A 2QY9A 2V8OA 2XGJA 2XSZA 1BOFA 4RSGA 1NLYA 3ECCA 1WDTA 2JJ2A 2PEZA 2ZVPX 3BFKA 1IY0A 3SBDA 3ZYCA 3I5YA 1XEXA 2VA8A 5IHPA 3CB4A 1FTSA 1FOEB 3GJ3A 5DHAA 4TWZA 3SI7A 5E4FA 4C0BA 3EZ2A 2V1XA 4CEIA 1TPZA 3SYNA 4BLPA 3FDIA 4BFYA 1YZQA 3LAWA 2BMDA 4IOJA 4QNMA 1H8EA 5DN6A 4EUNA 4MYUA 2CDNA 4MRPA 4M1MA 4BASA 5E7MA 1NN3A 2CNWA 2AD5A 2BBWA 2Q9AA 2C03A 1MO4A 2ODWA 4BLTA 2WJIA 2VTKA 1M7BA 2QUZA 3K09C 1V43A 3AF1A 2W0MA 2GJSA 3OIWA 1A1VA 2W6IA 4HDQB 1LF5A 3HPRA 5BW8A 3B5JA 1DAIA 2QTFA 3M4YA 1ZYUA 1XD8A 2V6JA 2VF7A 2IK8A 3AF3A 3HDTA 4URVR 4TYQA 2QBYA 1E1QA 2R2AA 2O8EB 2QPOA 4KITB 1GKYA 2RGGA 2BBTA 2GHIA 2O8EA 4TQUS 5EUMA 3UG6A 4FCVA 1Q57A 3OE7D 1JQLB 1X1RA 2WJJA 1JI0A 2DYKA 4XVQA 4IDNA 2B6HA 3O8DA 5CB8A 2Q3FA 4D26A 5HKKD 2R9VA 1NBMA 5HE8A 4QJ3A 1QBKC 4XWKA 5JLJA 3NC0C 1AN0A 1JR3A 3IIMA 4Q9KA 4DCTA 3LH5A 5JHGB 4AK9A 2BVNA 2ODEA 4L16A 4RKFA 2QROA 3T06B 4HB3A 4FMDB 4GOXA 3RS5A 1L8QA 1N6PA 2H7VA 4Q9HA 3ADBA 5E7IA 2NZ8A 1OFUX 4BLRA 1PJRA 1GUAA 2ZS8A 2QP4A 1Z29A 3ZVNA 2D2EA 3DEFA 1DOAA 2HXYA 4JT4A 1IY1A 4XVUA 4NONA 2ZAOA 3FE2A 3TW8B 5FBVB 4U02A 4Q7LA 2Z4RA 2CJWA 1G7SA 4QC2A 5CK5A 1OH5A 4X8OA 4F92B 3O8BA 2V1UA 1DAGA 4HAWA 4EPWA 2UVQA 2EYQA 4BEBA 4QG7A 4GP7A 5KSYA 1KI7A 1P9NA 5GVRA 1VYUA 4Q4JA 2OLKA 2XNDD 3BIFA 3FFAA 2AKAB 3RWMB 5ANRB 5J4VA 3B1VA 2WV9A 3D6TB 1SVLA 1J99A 3U4QB 2NPIA 4GSYA 3CKLA 2FGKA 2JJ2D 4P4SB 4PO1A 5FH9A 2OBMA 3K9LA 2YYZA 3BORA 1R4AA 3KFXA 1M74A 3EPJA 1RRCA 4HB2A 1BO6A 5FTJA 1G21E 4DSNA 1ZD1A 3G82C 4KFRA 1IN5A 3KTAB 1P9RA 1U8ZA 3UANA 4ZIRB 2ORIA 1KSGA 3ICQB 1XD9A 5HKKA 2EW1A 2IC5A 5H68A 2X2EA 1C1YA 4DLZA 3W5JA 3U7GA 1NG1A 1J2JA 2JAQA 1JEDA 1CR2A 2JIZD 2ZRGA 3AQ4A 3RRYA 2RH5A 4PO8A 3BOSA 1N6RA 2QQEA 1P7CA 1GAJA 2PLRA 1EGAA 1L2TA 4TT3A 3FGNA 1L4UA 1P3JA 3K0AB 4H1UA 4PR0A 4Q01A 1RIFA 1TEXA 4QJ5A 4B73A 1FW6A 3MJHA 5BN3A 3ZJYA 1QRAA 4P3YA 1U81A 1YE8A 2B7BA 1C9KA 3IHWA 3W5IA 4KYIB 2HXSA 2GEDA 3IIJA 3T35A 3AEZA 4DT1A 4R7ZA 4GOJA 3B2EA 4PC7A 4Q21A 3GLIA 3UWKA 3B9QA 2XITA 3L43A 1J70A 3KUCA 3LRPA 2KSQA 5CLLA 3HP1A 3M1IA 3MWKA 2CMKA 3GLIB 2EFHB 3K0FA 1TUIA 1TQDA 4I1VA 4M1TA 4AKHA 3HWSA 4F7WA 4Z1MA 3ICEA 1RVDA 4TYYA 2H8KA 5DGXA 1P9WA 4X8MA 3W6NA 3ZS8A 3THXA 5CM8B 4B33A 1XTIA 3WMFA 4JLDA 3DMDA 2IXEA 2ANBA 3BB3A 3SHFA 4B2IA 1Z0DA 3CUEF 5AUPB 4JS0A 2W83A 3NEJA 3U60B 1KK1A 2YWFA 4KYUA 4TMZA 3THWA 4W5HA 1IN8A 3Q7PA 4PSAA 4RD3A 3TSOA 2F3TA 2FU5C 1JB1A 4QGHA 2ODBA 3PITA 2YJTD 4Z8YA 4HATA 2OBNA 2NOAA 1BMFA 1IHUA 5AJYA 4D0NA 3A1TA 2G88A 3VHLB 1Q1EA 3UMFA 1MOZA 3MMPA 3IDQA 5CDFE 2X2FA 3LVRE 4AIIA 3CM0A 2WSSD 1D6JA 1FUUA 4MYHA 2QEQA 3QKRA 1CRQA 4KBGA 3QBTA 1T6NA 3UATA 2BV3A 5FOUA 3IIKA 3F0TA 3S1AA 2FV8A 5EP1A 3OHMA 5F2EA 4WZBE 1UFQA 2ZSDA 1E2JA 2WAYA 5LBIA 3WNCA 4L15A 3S1AB 1XTKA 2KBFA 3Q8XB 4DLWA 1K5GA 5LPNA 1KI1A 4HAUA 3DOEA 5JJLA 1NKSA 1JBKA 1E6CA 1NF3A 2LCFA 2AK2A 2MSDB 2GXAA 3I32A 4AURA 1YZGA 2IYLD 3HPQA 1MH1A 5IDVA 2J1LA 1KSJA 1Z08A 3CZPA 3U5ZB 3FHCB 1CJTC 1Y63A 1U8AA 4JL8A 4V0KA 721PA 4JJZA 1X8LA 4US1R 1QHYA 1G3MA 1VDZA 4A15A 3MFYA 4PQFA 2OESA 2MMGA 3N2EA 1E9DA 4KFSA 5EP4A 1II9A 3KQKA 2OAP1 5CYOA 2FG5A 1QHGA 3PUYA 3BE4A 5L3QB 4PPQA 2QQ0A 1P2UA 1P73A 2ERXA 2FZLA 3KXKA 3PR1A 4KXFB 5L3QA 4D4JA 2J5XA 1N0UA 4XVRA 4A6XA 5J40A 1G19A 4OQNA 2G0TA 2QAGB 4TLBA 1E2IA 2OUKA 2I3BA 3VKGA 1KNXA 2JLYA 4PTLA 4M21A 2FH5B 2VPPA 2WWHA 4IOLA 4Q4HB 4HUTA 2IX3A 2WJYA 5FI1B 1NKTA 3FMFA 1EFUA 2A5GA 4JLOA 1ZRHA 4RFSB 1Z0IA 3WHLA 1S3SA 5F3WB 5FR1A 5FTNA 3N2IA 1NSFA 4QNRA 3VR5A 4GI7A 1ZUNB 3U3OA 4HLQB 4LPKA 2PT5A 3LY5A 4W5JA 2XB2A 1JNYA 3LNCA 3O8RA 1ZC3A 4LV5B 3EZ6A 2GBLA 1CJVC 2OEPA 4DSUA 4FCWA 5BWMA 4QBIA 3CPEA 4R71A 2NG1A 3B13B 3QXHA 1B0UA 3UKDA 5HCIA 3A8TA 2XAUA 4IDHA 1E0JA 4U5XA 3I73A 4XTRA 1VG0B 2AL7A 2CL0X 1SVIA 2E87A 5TXGA 1WCV1 4ZDIA 4RD0A 3EXAA 4CEHB 2GJ8A 1ZCBA 4OHWA 2FFAA 3O8CA 1Z07A 3DZDA 3L0OA 4YDHB 2BKUA 2J41A 4A2WA 4MDEA 2IW3A 1FTNA 3VAAA 2ZRHA 3CR8A 2BM0A 1KNQA 4CZ2A 1QG4A 1BH2A 2OBLA 1OXXK 1NN0A 1Q1QA 3DKPA 1XXHA 2H17A 2GAOA 4YONB 2LKDA 4HLUA 3PEYA 4QGFA 4P0TA 2W2XA 2ZR0A 1Q3HA 1G8HA 1M8PA 4TSFD 1AQUA 4OQMA 1E1QD 1SXJE 4B34A 2SHKA 3QPVA 1VTKA 4JKYA 4NPHA 1E99A 1W4CA 4V02A 3FHTA 4NH0A 4I1OA 1OF1A 4B71A 2BEJA 3R20A 1SVSA 1R6BX 1BYIA 5TVKA 4LHVA 4AYWA 3TVDA 4CDGA 1KSHA 3C7KA 1E0KA 4OHXA 2YOGA 2VSOA 1E9CA 3L8ZA 4RZUA 2ZRNA 1EWRA 4US0R 1K8RA 3AF4A 3UMSA 4G5SA 1OPXA 4ACBA 1P2TA 3NDPA 5G40A 5DO9A 4DEYA 2DFKB 4PX9A 5L3VA 4L9SA 2J46A 2YKGA 4DCSA 4MKHA 1DE0A 4DLUA 2HLDA 5LD2C 2VLIA 1YQTA 3H2YA 1GRNA 1ZU5A 1OHHD 2I1VB 2W0SA 2GF9A 3L0SA 4IOKA 5JBQA 1UKVY 2FSHA 2QZ4A 3EA5A 4QJ4A 4A8JC 1G20E 4BFXA 4EDHA 4JL5A 5DYGA 1MRSA 1Q21A 3TBKA 1T5LA 3RNLA 2H5EA 1VKJA 2GF0A 4B3GA 1H8HA 5D3MA 3A37A 1UPTA 5GJBA 4BFUA 1W4BA 3I72A 1JQJC 1OH6A 4BGDA 1DAHA 3VFDA 2A9KA 4IOMA 1YZNA 4HAXA 4M1OA 2ZR7A 2JJ8A 2PMDA 2Y8EA 3Q5EA 3FB4A 2ONKA 4WXRA 1YR7A 4RZXA 4ZDJA 3TSZA 2J7PA 1KMQA 2IYQA 3PEWA 1GKIA 3WXMA 1UADA 4F38A 4DCVA 2AXPA 2F43A 2OILA 2OCAA 1G8YA 5AJXA 1SHZA 3RRNA 2W58A 3KTAA 4ZIRA 1W4RA 4DUGD 2GCOA 2WWGA 4LJ6A 3VU9A 3B7GA 4A0GA 3PUZA 1NVUQ 2P6NA 4UNNA 1KGDA 2FPKA 4R9UC 3D31A 1J8YF 1P2SA 2N46A 4MITA 4ZPXA 2IUUA 5D3QA 4B74A 1WBBA 2G1KA 2D2FA 1X1SA 5JWRA 3BFVA 1QF9A 2RHMA 4IW3B 5KO2A 1YZLA 1TU4A 4K81B 1E79A 3GFPA 3P20A 4LOAA 5FL7A 5J4HA 4CEIB 2CVFA 3Q72A 4CGZA 4XOIA 2C9OA 4UXHA 5B30A 4QFMA 4DDUA 3QG1A 3WMGA 3SYKA 3TLXA 4EAQA 1H65A 1IQPA 4GMXA 2WHXA 4QKQA 1CJUC 5FFMA 3KKNA 4Q19A 3U3RA 1FNMA 2BWJA 2QU8A 2WJHA 3OEED 2XTZA 5SZHB 2JA1A 2NPFA 3VR1A 1HT2E 1OFTA 4POAA 1OSNA 5JRZA 2A5YB 1GITA 1GL7A 4NCNA 2ZJOA 3CW2A 4C4PA 2F55A 4P31A 5KDOA 2GK6A 2ZJ8A 4IDOA 4QBGB 5C1BA 3TIFA 2AFHE 1U2RA 4CVNA 4F4CA 3LFUA 5P21A 4M2LA 1NY6A 2AFIE 2QT1A 5G3ZA 3TNFA 2R6AA 4BEJA 2N1BA 2Q6TA 1XP8A 4UJ5A 3U3KA 5TDHA 2AR7A 2PCJA 2R62A 4LBVA 4GRAA 3VX3A 2F1HA 2VYFA 4C0LA 4TMTA 5EUQB 2V55B 4G5QA 3W34A 3WYGA 1W47A 1A5TA 1YRBA 3UMRA 3NIBA 3E5HA 4LDJA 2UKDA 4DUGA 3OFNA 4CEJB 1Z0AA 5L8VA 1D8TA 2ZJ2A 5FBWB 2R65A 1GNPA 2OSBA 4TL6A 4KJZA 2GKSA 4PANA 3KDSE 1F48A 3K0EA 3K8YA 4JBYA 5JS8A 2WTUA 4FI3C 3ASYA 2ANCA 4LBYA 2J7KA 3RRZA 4O0MA 1PV4A 4BFWA 1RKBA 2VP9A 2WWFA 2FWRA 4Q9IA 4PPGA 1CR1A 4PHHA 4YMSA 1E2NA 4FMBB 421PA 3KQLA 4A36A 1UEJA 2J0VA 1JALA 4W7SA 2OT3B 2A5FA 2VP0A 2O0HA 3IBYA 1G5PA 1HTWA 2GA8A 4PSVA 1JJVA 4ARZA 4Q7MB 2ZRDA 1SKYB 3H1TA 3W3ZB 1K5DA 2ORWA 2J87A 4KHZA 5JHHB 1FMJA 4DC9A 2D06A 3DL0A 4HUQA 4A1FA 1CF4A 2ZSEA 1G4AE 2EFGA 2PZFA 4E09A 3M6AA 2O8BB 3IKJA 3CBQA 3CRVA 1W1WA 4HSEA 4B3FX 2VHTA 1COWD 4G3XA 5J47A 2NO0A 3SYLA 2O8BA 2HYIC 2IF0A 1SULA 4UNRA 2JLXA 2GJKA 1NBMD 1XXHE 4MH0R 3AP2A 5JECA 1LNZA 1E1RA 2CL6X 2ZI5A 3O47A 3SBEA 4ZI3A 1MO3A 2CK3D 3D7MA 3ZQ6A 4EJSB 1EFRA 2VF8A 3K53A 4PZLA 3TAUA 3ETLA 3NBXX 1U90A 2Q3HA 2FFHA 1VCIA 3BB1A 4L4UA 1OIWA 3QXSA 3UXMA 5JRJA 2JLWA 2I4IA 3KQNA 2JDIA 4IVQA 4EJSA 4R2IA 2GZDA 4HB4A 1DG3A 3GLHB 4M1SA 1S96A 4N3NA 4C30A 3QOFA 4GMDA 4F4IA 1UAAA 1VCMA 2P6UA 2BC9A 4M1KA 5KUTA 2QI9C 3GLHA 3AVUA 4JVNA 4NTZA 4Q47A 1G8PA 1XPRA 2WKPA 4LHWA 4AYTA 4NYJR 4EQ6B 2DWPA 4IFBA 4OBEA 3FTQA 1NBME 1VG9B 2R6GA 3K0CC 1P5ZB 4XSHA 4EPTA 3MGCA 1S8FA 2O8FA 4NL4H 1FUKA 4PQYA 2OFWA 2NQ2C 2ZS9A 5BXQC 3A6PC 3WNBA 6Q21A 1R0ZA 2OHFA 2ZJAA 1CTQA 1IM2A 1PZNA 3BH7A 4WZ6A 4DHEA 1NLZA 1OB2A 2ZAMA 1F60A 1LF0A 5F98A 1MR3F 4V0OA 3CONA 3QKUA 1JXOA 3R9XA 1HURA 1COWA 2QL6A 1Q0UA 3OEHA 3B85A 3QY0A 4HLUC 4ZO4A 4AG6A 3NHAA 1UBFA 2J0QA 1LS1A 4UNSA 2IYUA 3SN6A 4LHYA 2FA9A 2FDCA 2JIZA 2AN9A 3I61A 4AG5A 3H0KA 2NGRA 4MGYR 4YXWD 4CEHA 4GPTA 3EC1A 3GLGE 2NIPA 4C2UA 4D6PA 1ZP6A 4G5OA 2CLCX 5JWHA 4LJ5A 1OFIA 3V4FA 2XXAB 3KKQA 1M2OB 3THXB 4D25A 1UJ2A 5JSZB 621PA 5DI3A 3BWDD 3K9HA 4C0KA 4LUCA 4BFVA 2XXAA 3AF2A 1OXSC 2CVHA 5JSZA 2RGCA 3THWB 1OXVA 1ZVQA 1T8TA 4TL9A 2Z43A 3U6KA 2FFQA 3PUWA 2VHQA 3LO5A 1U9IA 4JLKA 2AK3A 4R98A 3AB3A 3X1ZA 2ZRCA 3AGQA 5TB5A 4C0JA 4WVFA 3J81k 1KKMA 4Q1FA 4BFZA 5JCZA 2R8RA 1E3MA 1U99A 2ZXUA 3GMTA 1Z5ZA 3AH8A 2FOLA 3GJ6A 1IXSB 3I1FA 4IRUB 4BUJA 2G9NA 3AVVA 2XEXA 3T1TA 5HTKA 1OW3B 1FL9A 4A0RA 1E1RD 5E3HA 2H16A 4YMUA 3KB1A 4PZYA 4UQOA 1DARA 2V54A 2X77A 4M0LA 2H18A 3CH4B 2GTPA 4F91B 5FOTA 5DN6D 5JMTA 2R6CA 4LYHA 4OQXA 1XZQA 3LVQE 1XD2A 1CEEA 3LXXA 2WJGA 1DAMA 1KZ7B 5KPJA 4PO9A 4URYR 3LDAA 2ZREA 4Q1AA 4PC3A 5B58C 3KKPA 3QE0A 2F1IA 1GG2A 5CJ2A 3AVWA 4GL2A 4ZKDA 3GJ4A 2XZOA 3AVQA 2PX3A 4FWTA 2CL7X 3NKVA 3CPJB 1EFHA 4Q1CA 5FUVA 4OHYA 4GBMA 2C78A 4II7A 5FUXA 2LWIA 2OFOA 3REGA 4HLDA 1JEEA 1ZMXA 1RRPA 1WMSA 3IO5A 2PLFA 4TQ9A 3CRW1 1F3OA 1WP9A 1G64A 4IVRA 4GFDA 3SFZA 3B8HA 1D5CA 2ZETA 1D2MA 2OAQ1 1TQ2A 4M1YA 4XD7D 5EE0A 1Z0FA 3WRXC 2QENA 4NYIQ 5FBQB 2ZUDA 3D8BA 3JZAA 3PG5A 4TL8A 4LSGA 1QHIA 1YR9A 1W5SA 3OE7A 4DLTA 1OB5A 5DHFA 1G9XA 1CLUA 3NWJA 3DHWC 3SDZA 2PJRA 4O2RA 3GCGA 2REXB 3MWLA 4G1UC 2QMHA 4RFSA 5KTYA 2BMEA 1OIXA 1XEXB 4TYNA 5B57C 1KO7A 2GAAA 2O0KA 2C9YA 5EZ5A 1F2UB 1N0WA 1NVWQ 3OEHD 3QJYA 5FPHA 3TMKA 1IAQA 3IPYA 3VX4A 4LJYA 5KSZA 1XMIA 3M0EA 3ADCA 1OE0A 4RVCA 4KVGA 1UBGA 1F2UA 2E9SA 2FX3A 4GOKA 1KJZA 1S1MA 1YZKA 2ZUCA 3IEUA 4MYCA 2W6JA 3CLVA 3QG5A 5FL7D 1VYVA 3FHOA 4NCHA 2VQSA 5AJZA 2ZRLA 5EXPA 1AM4D 4TMVA 3R8CA 2A78A 2ZJYA 5DI9A 2QP9X 4B44A 1ZJ6A 1M7GA 1KK3A 1E2HA 3CX7A 1W46A 2RGEA 4RJLA 3OEEA 3AVTA 1IONA 1UKZA 2WOOA 3NBYC 2D62A 1EG7A 1W2HA 1VHLA 5EZ6B 1T9HA 2EFCB 3EWSA 3KUDA 1LB1B 4DWJA 2P2LA 4YLGA 2DB3A 1EFCA 4KSCA 1YKSA 2XZPA 1RFLA 3X1DA 4O2LA 521PA 5FOSA 2C77A 4NZYA 5LDDC 3B1YA 4CF7A 3KJHA 2QRZA 2K5UA 1DAEA 5SZJA 1M1YE 2XTNA 3SHWA 3SJCA 1N6KA 1JPNA 1NL3A 1W0JD 1W44A 3WYAA 2WWWA 3T1VA 1G1MA 4G0NA 1IJEA 3U6BA 4JLNA 4A2PA 3ZS9A 3K9GA 3AP3A 5KDDA 1DS6A 4MKFA 1E9AA 2YNMA 1KSFX 2D4HA 1TUEA 1FQJA 1TTTA 1XF9A 1H8HD 2AXNA 3R7WB 2QT0A 3EIEA 4US2R 3GFOA 2H57A 3RS4A 4C0AC 3R7WA 1Z8FA 4RY2A 2QORA 2G77B 3F3YA 2BBOA 3KFVA 3ND9A 4ACAA 1WA5A 2O8CA 1E0SA 2E1RA 1BKDR 4IHQA 1QG2A 1Q1ZA 3LX5A 1I4TD 1R5NA 3TW4A 3WP0A 4I99A 2PH1A 1G3QA 4OL0A 3QKTA 3SU8A 4D82A 2GWHA 4LBWA 2R6FA 2HT1A 3GJXC 1II8B 1Q3TA 1E4YA 2ZR9A 2GK7A 2WZQA 2RMKA 5KDLA 5G3YA 1GP2A 3IILA 5AJWA 4E03A 4Q4JB 1KKLA 1WB9A 1ZD8A 2BOVA 2C95A 1AK2A 3MD0A 2CCJA 1XEFA 1ZW6A 1IJFA 3U4QA 1E0AA 2JEOA 3TR0A 2I1QA 1GTVA 1RRGA 4N0EA 3GD7A 821PA 5KHOC 3CF2A 3V00A 3CRQA 4L9WA 1AZTA 4Q4LA 4W5WA 1NRJB 5FI0B 3VQTA 3DKVA 5JJIA 2ZU6A 1OIVA 2L0XA 4Q48A 4YMVA 1SHKA 5EP3A 1W0JA 3ONWA 2IF2A 2QSYA 2A5DA 2JJ1A 1T3LA 2IS2A 1C4OA 2XOKD 3F8TA 1JR6A 3PJRA 1KO4A 1UM8A 4ZCLA 3LLUA 1ZAKA 3VR3A 3OF5A 4DSOA 3OAAD 1GNRA 2X19A 4BECA 2GCOB 3VU9B 1EFRD 4TMXA 1SXJC 3P4XA 1DAKA 2G83A 3CO5A 1W5TA 4TTRA 1TEVA 1I2DA 4G01B 4NMMA 1KDOA 3U7EB 4OHZA 3THYA 2ONJA 1G7RA 2ZIAA 5CJPA 3EA0A 3K0AA 3MCAA 5F9HA 3SJAA 1ZNYA 2A5JA 3I3SR 3NXSA 2WICA 4JVSB 2RGAA 1J7KA 1UKYA 3GLGB 3JVVA 2F1JA 4DLYA 2ZE8A 3N70A 1G7CA 1KI9A 2WIBA 4RD2A 4IVPA 2HCBA 3RHFA 3L82B 3GLGA 1I4DD 4Q1DA 1PUJA 2O8FB 1DVRA 1ZBDA 4ASUA 3H4MA 3MRSA 4ILEA 1KMHA 2GXSA 1N5KA 1AGRA 3TRFA 4N0DA 4RCZA 4WW0A 3RRMA 2G3YA 3QPWA 5AR1A 2H92A 1F2TB 3WRYC 4B3CA 2ZRAA 1IN6A 4MUBA 1P75A 3TUJC 2HEIA 2B92A 1SZPA 4D4LA 3WMEA 4TYPA 1E4VA 3K0FB 3LV8A 1RYHA 5GJCA 5A4JA 5JZVA 2AD1A 3RSOA 5K8TA 3ZQJA 4FD2A 2NO9A 5DH9A 3UG7A 3BBPA 4QGGA 2HCJB 3VR4A 4JLAA 1KO5A 3AVYA 1DO0A 2VSFA 3Q7QA 2VRWA 4Q18A 3T15A 4JSYA 4AKEA 4EIWA 5DISB 3AM1A 5FPKA 2R44A 4CEJA 1KI6A 1KK2A 1RJ9A 1NJGA 3DZ8A 5DI3B 4PSKA 5BN5A 1NLFA 1QVRA 4Q4AA 1XEWX 4X8HA 2P6RA 1EK0A 1RJ9B 4MQBA 3GLHE 3HYRA 3GLFA 1KI4A 1G3RA 2GEUA 4DIEA 2JLVA 4S2EA 5JEEA 1RPZA 4M9XA 5LB2A 5JJKA 1GZSA 1R5BA 1S2MA 5FPSA 2PT7A 2RGNA 2QPAA 4A8JA 3QPUA 4UXJA 5AJVB 3E70C 2EWVA 4Q9JA 2OO7A 1MV5A 2XZLA 4TZ6A 4A8JB 2XJ9A 4NCKA 1T3SA 4PHTA 3A1SA 4GZMA 2HLDD 3HU1A 4DLSA 4OK3A 4KO8A 2BMJA 4M9ZA 1KYIA 4P4UA 2ZE5A 3EX7C 1T0JB 2W6ID 3TUZC 1F5NA 5IT5A 2HJVA 3HU2A 4BZPA 4CYMA 1YZTA 2VL7A 4JBWA 3WYFA 4A0FA 3QVUA 4B48A 4LYAA 2IEYA 2YC4C 4QGAA 4FMDF 2O52A 4LV8B 3W8NA 2GZAA 2ZJ5A 1FQKA 1XTQA 1KI3A 4XWAA 3VKWA 1Q44A 1P4SA 5H70A 3WP1B 3LXRA 1W2GA 3JVUA 4IKEA 3ZGXA 1ODFA 2KB0A 1WQ1R 3ZVRA 3K1JA 2X1VA 4HZUB 2ZEJA 3SR0A 2ZM5A 3W6OA 2GCPA 3CIOA 4OK6A 4LK2A 3AKDA 3IGFA 4RD1A 1T4GA 4HZUA 2ORVA 3EIHA 1YR8A 1OV4A 2B7CA 2QAGA 4IEEA 1Z6YA 4HEJA 4B35A 2G0NA 3U3MA 3GEHA 2A7QA 1QVAA 1ZINA 2X8AA 1Z63A 3BERA 1TQ6A 4Q4HA 1E2QA 5DIFA 2WKQA 3UIEA 1Z47A 1ZM3A 4A92A 1LY1A 3G5UA 3HYTA 4XH9B 4B6FA 4LC0A 4Q7JB 4JZKA 1M7HA 3R9IA 4H1VA 4NYIR 4C0SA 2QM8A 3FOZA 3W9YA 1N5LA 3VMFA 2Q21A 3K0SA 3ND8A 3OESA 3ZH9B 5F9FA 3B6EA 1BS1A 4WZAE 4DKXA 2IS4A 1US8A 2PL3A 1XJQA 2ZJZA 3PUVA 1R8SA 2QG6A 2V4ZA 5CIQA 3V4RA 2WOJA 3SJBA 2AWNA 1ZC4A 4FMCB 2A2ZA 1NVVQ 2QMUA 1XX6A 3QKSB 3Q3JB 5AK0A 1A2KC 4CW7A 4FMCF 3T12A 3AVOA 2FJUA 1TNDA 1II0A 2ZI4A 1E2PA 4EPRA 1Z22A 2GILA 3EPHA 1S4QA 4MGKR 3NH9A 1XJ0A 3EZ7A 1AS0A 4QRHA 5IK2A 3KJIA 3AVXA 4AWXA 1ETUA 3CF0A 3R9WA 5CIWA 4B47A 1JECA 1Z06A 1ESMA 2DFNA 5CM9C 1EESA 2ZI3A 2UZIR 3R8FA 2ZROA 1ZM4A 3OIVA 4HAVA 4NYJQ 4BLQA 2QP3A 1HA3A 1IBRA 2EWWA 3TK1A 3SS8A 4M22A 3RAPR 2JASA 4BQSA 2YVUA 1XCGB 4PHFA 2ODNA 1P61B 3ZIAA 4DVGA 1NSTA 2CXXA 3A1VA 3MSXA 3LQQA 1U0HC 3QVVA 2BCGY 1E9RA 3CNNA 2WWYA 1JJ7A 1LW7A 4AD8A 3RDPA 2VP4A 2F7SA 2YOHA 4Q03A 4TL7A 5C46F 1RE0A 1EX6A 3TQFA 1CULC 2EFEB 1AQYA 1KAGA 1XDBA 4FCTA 4LYJA 4LC1A 4TYWA 3CPHA 1TX4B 5J5CA 2IHYA 4RZ2A 3PQCA 4ZCMA 4KFUA 1FP6A 1ZNZA 4C2TA 3I8XA 4HB0A 4EPVA 1Z6GA 2F6RA 3ZZTA 3V9PA 3B82A 1HE8B 3QF4B 2CCKA 4NU0A 2VIIA 1OJLA 3B9PA 1XD2B 1CJMA 1D9XA 1G16A 1GFIA 1MABA 1N6NA 1CBUA 1HV8A 1II8A 1LVGA 4PC6A 4ZI2A 1MABB 2NTYC 3KXLA 3NTUA 3JZMA 4QHYA 3EIQA 3RS2A 4B2PA 2OCPA 2IYTA 2CLSA 1VCNA 4JMPA 1RYFA 4Q00A 4C0QC 2WVJA 3IO3A 4CIDA 1Y3AA 2CCGA 5HZHA 3MWJA 3Q85A 3GLFE 4IXNA 3A58B 3C8UA 1H8ED 4S35A 1ZM2A 2OCYC 1HE1C 2ZI6A 4Z54A 1XRJA 4FIDA 1CP2A 5KYKA 4Q5IA 1MT0A 1UBCA 1XWIA 4UNQA 1W0KA 1JAHA 1OYWA 4LYFA 1NVVR 2IXGA 2D7DA 4IJMA 3DMNA 2XTMA 4ERNA 1NG9A 1KJWA 2VO1A 2IS6A 2CK3A 2JJ1D 3OIUA 1A4RA 4LCBA 1CXZA 1X3SA 1ZUIA 5FBLB 1R10A 1T8UA 5DNYB 1QDEA 2QNRA 3VR2A 3NC1C 2J45A 1DG1G 1LS6A 1AZSC 1GKUB 2GVDC 3IQWA 4C3ZA 3E1SA 3IHLA 5IK2D 1GNQA 4D0LB 5IF9A 1W36D 3TSWA 5FPYA 3KXIA 1YHNA 4QBFA 4BFSA 4IFEA 1G18A 1KO1A 1ZM7A 2OE2A 2QGZA 3C14C 2YWEA 2ZYTX 1KY2A 4MKGA 1UKEA 4FN5A 5M04A 2B21A 1P62B 1U94A 1RC8A 3PENA 3TVTA 3AUYA 4TZ0A 4ESVA 1SVOA 2ZYWX 1Q12A 3BJIC 2FZ4A 5DLQC 1W7AA 1F2TA 1KZGB 1NN5A 2C8VA 2D7CA 3FVQA 4PC2A 2BMFA 2GZHA 3NEYA 1EWQA 4DRZA 2QPTA 2Z0MA 1ZNXA 4ZCIA 1YU9A 2C98A 4HAZA 1G8FA 4JLVA 5C4GB 4BZQA 3L0PA 1AJEA 3ZLJA 1SVMA 1A7JA 4Q02A 2GCNA 2ATVA 4PC1A 2IXFA 1TQ4A 2FSFA 4JSTA 3DOFA 2CE7A 4HAYA 5JS7A 3UWOA 4AYXA 1OT3A 2XX3A 1GRRA 4YQFA 1N5IA 5H8WA 3BS4A 1XTJA 1O87A 2YINC 4XIGS 4D4MA 4DBLC 1E2MA 3A1WA 5LB4A 1W4AA 1KDPA 3QEJA 1XMJA 2JDID 2P3SA 2QMOA 4HZIA 1NIPA 2FMXA 1LFDB 2GJAA 4LJ8A 4DCNA 1AS2A 2YOFA 2JATA 5EXTA 2ZI7A 2REBA 3C5HA 1WE2A 5GVSA 3GLFB 1E94E 3B1WA 4KLNA 4C0HA 2ZUBA 4P4TA 5K8UA 4Q66C 2QSZA 5JCPA 4G5RA 1N6LA 1Z2AA 2O8CB 3ZVMA 1PLLA 4MGIR 5A5GA 2PMKA 4ARZB 1QHNA 1VPLA 3PUXA 1N5JA 3EG5A 4EKDA 5G53C 3OZXA 5EE5B 1YJ5A 3K9NA 3ZZ0A 3ADDA 2VSXA 2FEOA 1RRFA 3T1OA 3RLFA 4HUQB 1ZCAA 3SZRA 3GEEA 1CU1A 2C99A 4LV6A 3ZZUA 3FMIA 1VCOA 3I8SA 2QE7D 1SVKA 3P32A 1KHTA 4GP6A 4M1WA 4WXPA 3FKSA 4A6PA 4JLJA 2F3RA 2XNSA 2OXRA 4EFNA 1KY3A 3H86A 3K0CA 4JKIA 4YC7A 1R0WA 1I4LD 3BXZA 3LWNA 4UKDA 4URXR 2VP5A 2ASEA 1IY2A 2PBRA 3QSYA 4PHGA 2VH5R 1SVWA 4JVMA 5AUOB 2QAGC 3OAAA 3W8RA 3DDCA 3QQ5A 1SXJB 4GNKA 4HYYA 4LGMA 4UNPA 1Z6TA 2FSIA 4PFSA 2PEYA 3CF6R 4L5BA 2GESA 1FX0A 3AF0A 3LBHA 4MKIA 2V7QD 2QTHA 2YWHA 3VTKA 1NNEA 3SEAA 1SXJA 4URZR 4KBFA 1JAIA 3GLIE 4K46A 2CLDX 4XD7A 2C04A 2HYDA 1ZIOA 3AP1A 1CS4C 4RCYA 2QA5A 3VKHA 2R6DA 2EVWX 4NKRA 3X1XA 1R0XA 2BEKA 3THYB 3REFA 1QZXA 3DPUA 2FFBA 4V0LA 2QM7A 1WRBA 1AGPA 1J8MF 4M9QA 2D74A 1QHHA 1ZM9A 5C2JB 4OQFA 4A9AA 1TF2A 2QE7A 3WBKA 4TTPA 5HZKA 4TN1A 1DADA 3BH6A 1GSIA 1KOFA 1QHXA 2FGJA 3DVLA 3CWQA 1X8JA 4KAXA 1G7TA 1JPJA 4MRSA 5EQTA 3LBIA 1D2NA 121PA 4BRUA 1KMHB 2CNWD 4LX0A 4A82A 2O8DA 1HQCA 2WWXA 1KI2A 4KLZA 3T5DA 2OM2A 4IXMA 2FSGA 4JIMA 1T0HB 2IA5A 4BWYA 3T61A 4DT1B 2O8DB 2QRNA 3LA6A 1GOTA 3PIRA 3PV0A 2G1JA 5FTLA 4O25A 1XTRA 5AUNB 1VECA 5FOVA 1G6HA 1NIJA 4OKSA 1CIPA 4RD6A 3SOPA 2RGXA 2FPLA 2RGDA 3IPXA 2QN6A 3A1UA 5DE3A 3WNDA 4EPYA 4DJTA 1PLJA 2ZRKA 3HR8A 3KQUA 4QM6A 1KDRA 2GXQA 4TMWA 3VNUA 3F5FA 1HY3A 2ZYVX 3NH6A 4MYTA 2WPDA 3KX2A 3TQCA 3E2IA 5CYPA 4IEIA 2ZANA 4B3BA 3QF7A 2LKCA 1PLKA 4NCJA 2WAXA 1KI6B 3RS3A 1FMLA 3L8YA 3CRMA 4ITRC 4WAUA 4NBSA 1E9EA 4KU4A 5FOXA 2IWRA 4BLSA 1I2MA 4LJ7A 3RC3A 2F9MA 3PEVA 4Q4AB 2Q3MA 1NI3A 2YZ2A 3EWAA 4QHSA 3MJRA 1UEIA 4C7OB 3ZD7A 4A2QA 4KVAA 1OKKD 4R2HA 1PVOA 1J90A 2CE2X 2CHQA 2BBSA 2RGNC 4ON9A 4D4KA 3LLMA 3EPLA 1GVNB 1VHTA 3A4NA 4HDCA 5FUWA 4C7OA 4A4DA 4DEXA 1D2EA 2DPXA 3HR7A 5FR2A 4YXWA 3GJ7A 1MRNA 4DXAA 4JL6A 1MO5A 2P5TB 3SQWA 1Z0KA 3KKMA 4OJKA 4PPFA 1G3UA 3L0IB 3KB2A 4DCUA 1NN1A 2IYYA 4I1SA 2Z83A 3LW7A 3BH0A 5KSPA 5DSZA 5TY0A 5AWFC 1WF3A 2B8WA 4XSGA 1OLOA 1X86B 4HDOB 1XPOA 1W36B 1GL6A 4WOPA 2IYXA 4OI0A 1OYYA 4K8OA 3BGWA 2EYUA 4M8NE 5JFGA 1V5WA 4KV9A 1FP7A 1Q1BA 1Z6XA 1AS3A 3UPUA 3I4LA 1TMKA 5FL3A 2OLJA 1ZUHA 2ERYA 4LRWA 4DSTA 2VEDA 1NVXQ 4YMWA 4BZXA 2HF8A 4UXIA 3TR5A 4LWZA 2Q9CA 3GFTA 1SKQA 2IL1A 3Q5DA 4DB4A 3EZ9A 4MA4A 4B43A 1AA9A 4ZDKA 3LQRA 3X2SA 2VP2A 1R5OA 2EQBA 4X8LA 5EP2A 4B3DA 1G291 3CR7A 2RB4A 4ABYA 4U00A 2JLSA 5L3SA 1IOZA 2BHRA 4JLPA 5EE9A 4MRNA 1KJYA 3NHBA 1XMSA 1NMXA 1YRAA 2C2HA 3TJZA 4B2LA 3GJ5A 3EPKA 4GDFA 5JEDA 4ZKEA 4FW9A 3AV0B 2WBLC 2BJVA 2B8TA 3OFND 4D2IA 3CZQA 2VHCA 1YVDA 1CR0A 2MSEB 1G4UR 4ESHA 1Z3IX 1KDTA 1E2GA 2J9RA 2ZSAA 8OHMA 4F4JA 1VMAA 3EASA 1FZQA 3N5CA 4Q1EA 2DHRA 5G41A 1BYUA 5GADl 1R2QA 5GJWC 1G41A 3BAFA 1G5TA 1KO8A 2WJVA 1ZIPA 2ZVQX 3QENA 2RCNA 2AKYA 3X1YA 5FOWA 1W36C 3ADKA 1US8B 3NG1A 4LJAA 4ASUD 2AX4A 1EX7A 5IRCD 3RS0A 4JLMA 5KNBA 2IS1A 2DCUA 3KZ1E 4DDTA 3QNUA 4GZLA 4JJKA 4V0MA 3WBJA 1LV7A 3SE0A 3QKSA 5HCNA 1A82A 3U44A 2P0EA 3TH5A 3IQXA 1KK0A 4EFLA 4WIAA 1VIYA 3FMOB 4HI0E 5B64A 3MG9A 3B78A 2YV5A 4UJ3A 2J0UA 4W9MC 1N6HA 2GXUA 2VP6A 3CH5A 1G17A 1D9ZA 4PAOA 3I62A 2EFDB 1DEKA 2RHDA 2O0JA 2ZE6A 5HPYB 2RKOA 3GJ0A 5FUYA 3ZIAD 1OKKA 1WBDA 2ZRPA 1N2CE 2Z5FA 1BMFD 3DO6A 1XXHB 5H1YA 2VHUA 1XCPA 1P2VA 2WMOB 3TGPA 2WIAA 1A2BA 5CK4A 2XOKA 2WSSA 4FINA 3C5CA 1OFHA 3K70C 1FFHA 5TMPA 1Z6AA 3KJEA 1FPMA 1N3BA 3QXJA 4BRWA 3IUYA 1SXJD 1Z2CA 3PXGA 1HT1E 1Z83A 2QGNA 5L3RA 2DFTA 2OXCA 4LZZA 2HV8A 2HT6A 4QOSA 4Y0VA 1GILA 2C5LA 2NZJA 2OFXA 1X6VA 5FTKA 2MSCB 2C96A 4NDZA 3NBZC 3BC1A 3T5GA 3SQXA 1JXMA 2HF9A 5EE3A 1E32A 2FNAA 4JBXA 4RZ3A 1VIAA 1XTSA 1CKEA 4D80A 2JLQA 3K70B 1E2EA 1ONBA 2ZSBA 3THOA 1E9FA 1S0UA 2RGBA 1RW4A 5DYIA 3RSLA 3MLEA 2KBEA 3RWOA 4B32A 2CJWB 4Z51A 2NMVA 2GNOA 1TL7C 2TMKA 1UF9A 2O5VA 3DM9B 5A0FA 3KQHA 1HUQA 2DY1A 1JR3D 2GRJA 4TT3D 1P72A 4PAQA 2PJZA 4P32A 1TF5A 1XZPA 4DDWA 4QL3A 4QXAA 2PX0A 1HQYE 1YR6A 5D3MB 4N1AA 4BE7B 4BFTA 3P26A 1XNJA 1OXTA 4M53A 2RAPA 2DBYA 4RD4A 4TQAA 3RABA 1XU4A 4QM7A 3NDBB 4AKGA 2G6BA 4QHTA 4O3MA 2Z4SA 2A30A 5J4KA 2IYVA 3EARA 4Y0AA 5B2ZA 4I81A 4QBHA 3A36A 5K8LA 3GP8A 4TLCA 2DWQA 1SKYE 2JCSA 4TLDA 4HLCA 2IWHA 1S9DA 1KAOA 1S9HA 2VBCA 1FX0B 1XFAA 4J0QA 1IXRC 2AHOA 1AKYA 1GDDA 4LHZA 2ZU0C 2P67A 2XSZD 2GBLC 4KCGA 5J4LA 1O3YA 3PCRB 1E2DA 2V7QA 1DELA 3FMPB 2ZRBA 5FTMA 3NVAA 1M34E 2BCJQ 2IYRA 1U9IC 2REOA 1U0LA 3KKOA 5JI2E 2KWIA 1EXMA 4OI4A 2EU8A 1IN7A 2IYZA 1NMZA 3RS7A 4Z1MD 4V0NA 4NYMR 3BK7A 1Z0JA 4JYBA 1M6NA 5HE9A 3RANA 4B3XA 3BD9A 1R7RA 2NO6A 3IBGA 3CNOA 1HEIA 2NO7A 3A4LA 4D81A 4URWR 1TF7A 1QHHB 4DB2A 2ZI9A 2JLRA 4MDFA 2BIFA 3NBFA 5KU1A 2IT1A 5JI3E 1MKYA 5BYJA 2WWIA 1NJFA 2OV2A 3AUXA 1OHHA 3EW9A 3FWYA 3GJ8A 5BN4A 2QAJA 2KI5A 3QXXA 1NMYA 2JLZA 1SGWA 3BB4A 5E95A 3B60A 3RVBA 2J3EA 1LTQA 1ZNWA 1G5RA 2KE5A 4NHOA 1OH8A 4DLVA 2BDTA 1ESNA 4TLEA 1OH7A 1R0YA 1E2KA 2ZRMA 1W49A 1AKEA 4OI1A 1E9BA 3L2OB 4V0ME 4F93B 4LBZA 2QBYB 1TADA 2H1LA 1VG8A 3MWYW 5TARA 1U98A 2BM1A 3TUIC 3CX8A 1G3IA 4AC9A 5EJEA 4NYMQ 4TSFA 4WA7A 1UDXA 2XB4A 3CWZA 3AKYA 5GJVC 2ZS7A 2DFLA 1GIAA 2D3WA 2WPDD 3U61B 4AY2A 2CHGA 4G5GA 1G6OA 5TV2A 1G8GA 4ZV4A 1E2LA 4BLOA 3ZD6A 4Q9LA 2YWGA 2J0SA 4CT4B 1DTSA 3BFXA 3B1ZA 1KTVA 1AIPA 4AI6A 3FKSD 4EJSC 4B6EA 3CRRA 3QIAA 1GWNA 3FPAA 3UK6A 2FE4A 4RKEA 3EC2A 2ZITA
chains in the Genus database with same CATH superfamily
3KV3O 4B79A 3OSUA 3ZVLA 1WZNA 3KD3A 2ZPUA 2FWAA 4DDVA 1WXQA 3INGA 3LX8A 4M0UA 4OATA 2QXTA 4N5NA 3I5UA 1B0PA 1GPAA 1WCYA 2W2VA 3QVSA 4L0DA 1D4FA 2OMEA 3NTOA 2FEMA 3NVKI 4WCFA 3RYTC 3I5YA 4N41A 3MINA 4G81A 2PIAA 2QQFA 2YWRA 4ZO9A 4BEVA 3VHXA 2ZTVA 5DN9A 4PIMA 2PJDA 3BG5A 4HUJA 4M9SA 4N7MA 3STVA 3WHIA 4D8WA 2VWQA 4DM3A 4QG3A 2W93A 3COPA 3SC3A 1ZU4A 2Q4OA 4PZUA 3DPIA 1V11B 3HJFA 2ABWA 2I1WA 5KYWB 1M0SA 2IUFA 3JQAD 3WWOA 5LWHA 4NFLA 4C7XA 4E07A 4CKCA 3LO8A 3H5NA 3QI7A 2Q2NA 4ZC1A 1R9JA 2OLEA 2IUTA 1GV0A 1BKYA 2WD7B 2ZQ5A 2OOSA 1ETHA 1VGRA 3SS9X 3O90A 2RD2A 1PGJA 1IUKA 3VC7A 1RQPA 1HDEA 2V6GA 2XE6A 3L7AA 2CBGA 3NLLA 4HCJA 3W05A 3LBNA 1HYQA 2II6A 1N33B 3CU5A 3GEIA 1G20A 2C9CA 4MRVA 5BYBA 2V74B 3I5XA 5F78A 2O2IA 4WN3A 1C7EA 1QHFA 2HUPA 1IZ8A 1VE1A 7MHTA 4KRYA 2ORYA 1ULHA 4CTJA 3NCHA 3HL0A 4IBOA 2W2TA 3QJGA 1GZ4A 4GE3A 3QEOA 5THKA 1EE1A 1JHMA 1IRXA 1KEUA 4RMIA 4XX0A 2OO5C 1E7SA 1WCIB 1ZD2P 4F85A 1LRLA 1WKVA 4C7MA 1YD7A 4Q3KA 1QAQA 4CPDA 4M0DA 3ZW7A 3DBRA 4MZDA 1T3TA 5JADA 5DU2A 1FU8A 3JYLA 3HRHA 3PVSA 4BLSA 1OFGA 4M0CA 5AVOA 1BIFA 2M6RA 1E69A 1NC3A 1DPFA 2YHSA 1V95A 4UTOA 3V6LA 1VRWA 4H2DA 2Z8YA 3D0RA 2NZ2A 1XMVA 4J07A 4Q4DA 3SNHA 3PQ6A 1PR1A 2X42A 3ZHOA 1VYTA 4LSZA 2W2PA 2WSMA 5CVTA 2FF7A 3OG9A 2FY8A 3Q9LA 4IH9A 1JG7A 1XLVA 1NNSA 2ZB3A 2XNHA 1KF0A 4JXXA 1VI6A 5EJAA 2ILTA 3QP9A 5DCYA 4DZZA 2ZPTX 3BMQA 5JVDA 3HB4X 3R9XB 3JPWA 3MFQA 2A0WA 3LCJA 4QDUA 4XYLA 3L0CA 1JDZA 3T7IA 2ZRFA 5D87A 3TQIA 4HRVA 4ZV7A 1XQYA 2ZSKA 1DKPA 2QMEA 2PKYX 4IJVA 2GCEA 4XYMA 2H54A 2X9LA 1W88A 2H4XA 2HA0A 3IP7A 2GO1A 4BLUA 3MHTA 2QDKA 2MMCA 2H8GA 3U39A 2YYYA 4NS4A 2J0UB 5DGCA 1ZNQO 2WVAA 3FZQA 4M76B 2BI7A 2B98A 3O74A 4F5ZA 2WB4A 4M7WA 2A9QA 4IEFB 4MUAA 2FX5A 2R6JA 4QRDA 4RAOA 3FKQA 3NAZA 4EECA 3PF9A 4OHKA 5JW6A 1SG9A 3VNVA 3C8ZA 1I1HA 2QMQA 2XIQA 1Y48E 3MEQA 3OZUA 4EFMA 2IU0A 3RH0A 1ZGZA 1B23P 1XU9A 4C9BA 4GPD1 1KEWA 4PIPA 4GX1A 5SYAA 5CA0F 2ZATA 3D0QA 3VISA 1K4KA 2H3HA 4CKWA 3BXPA 2DR3A 3ACDA 4GUDA 3AI2A 4RABA 3VR6A 4RFVA 2IU6A 1GADO 1FYEA 1QVZA 3M6IA 4DNXA 2R1VA 3KTDA 3G8BA 5CVDA 1Z4NA 4YJGB 3JQAB 1HR0B 3QW4B 2V0GA 2H2DA 4FFMA 3U3JA 4FEAA 1U1EA 2MYUA 1D0VA 4UU7A 4YXFA 3ESRA 4FEEA 3QBVA 1WJGA 2GFQA 3F3SA 2X9QA 1Z0ZA 3PZRA 4MQFB 2HDNB 5FHQA 3IEVA 2GK4A 4GLFA 5CCBA 3QWHA 1OLXB 1JIIA 1Z4QA 1GGVA 1JQEA 1Z88A 5LQAA 1IN4A 3K0KA 3PEUA 3QF4A 2WY2D 3RT7A 2FPOA 4S0ZA 3EH1A 3SJZA 3TFOA 1NBHA 5A5FA 4CLXA 3DOJA 221PA 4YDQA 1ULUA 3AESA 3OPQA 4LZOA 4ZOLF 3WK8A 1T0UA 4D7AA 1R37A 3B7WA 4HT3B 3DUFA 3K70D 1FFXA 3TTTA 2PX6A 4OYHA 3CVYA 1JLLA 1SBNE 1KIMA 2ZSFA 1OTYA 2Q8NA 3MAAC 4ZYTA 1CRPA 1SC3A 4AJ1A 1GRQA 1P4HA 2BJWA 5I01A 1JA1A 1TA9A 2CYCA 2OCLA 4M8KA 1UBJS 3MQ4A 5JPDA 3OICA 1QQTA 1QHSA 4QWMA 3I92A 1X1BA 5DTIA 1QOQB 4WESB 3ZNPA 1ADJA 1CUHA 2JNWA 3D7LA 5JXJA 4F46A 3BXXA 3JYNA 3HN7A 2VHJA 2PXCA 2Y9MB 2LTAA 1DU4A 2ZXEA 3OZGA 2Y05A 3WDKA 5KQLA 4L7VA 5KYGA 1WDWB 4XPIA 4E12A 4X90A 1FLVA 1OV6A 1JR3E 4IFIA 2V98A 3V2HA 2BKEA 1AHPA 2NVUA 3DDSA 1YRYE 3GCWA 5H9WA 1P0QA 1HTBA 1FJ2A 1HDZA 4HFJA 4YJ3B 4BPBA 1RR6A 1V1MB 5LDHA 1U0BB 5FBRB 2X0EA 1JYFA 1MFPA 4ZQCB 2PZGA 2VLBA 4C29A 1YVPA 3ZDXB 4AQDA 4E5UA 2J7PD 2VJMA 2ZDHA 2F9LA 4HH1A 2P9TA 1AUXA 5CW1A 4DADA 4WOCA 3DTNA 4C89A 1XQWA 2V8OA 1N77A 2ZIXB 3MCZA 4QOHA 2XGJA 5B55A 1R0CA 2Y6VA 5KYYA 2XMZA 1WDTA 4K3VA 3CXUA 2YXNA 3LCCA 2I4OA 3BFKA 1C9JA 4B82A 4KDFA 4J0DA 4RLQA 5AW8A 2ON6A 2DHQA 3O38A 6GPBA 5ECWA 4QIHA 4TWZA 4O5OA 1PZXA 1KBOA 1M5RA 3EZ2A 1TVCA 3GNLA 4CEIA 4CLOB 4BLPA 3EEBA 2VBIA 4NJOA 2DHEA 1V6SA 1YZQA 2OVBA 4IOJA 3PNPA 1GQQA 4OAQA 4GM1A 4K88A 3DE4X 4L6IA 5DN6A 3TB4A 2BAGA 4GOND 1F8UA 1DO8A 2CDNA 2YUIA 3GEDA 4EA7A 4F9TA 3GLQA 3KTOA 1JR4A 1NN3A 2CNWA 3HUUA 1MW9X 4JODA 3NWPA 4IHAA 3LDHA 2OUIA 2HLNA 5IANA 1MO4A 1P7PA 3AL3A 2YBDA 3G2MA 4YH1A 2G7ZA 3RWBA 1PJCA 4DOMA 8MHTA 1G2QA 3W1EA 1L4NA 5AOCA 3R7DA 4OQQA 3NHKA 3KAKA 1EDDA 2XGMA 3FUWA 4HDQB 4D9JA 1ZW1A 4KGVA 1RHUA 3NT4A 1MNQA 2YQZA 3HKCB 1EK6A 3HPRA 5TEWA 4BNIA 4PR3A 3ZVNA 1SU8A 4AF6A 4KMMA 5IYZF 3BKXA 3AZPA 2HA3A 1ZYUA 3RYIA 1K4MA 2IY9A 3LECA 4JI6B 3F90A 2MYTA 1V4BA 1ESZA 2XRMA 3HDTA 2R2AA 4KITB 2RGGA 5I7SA 2QL5A 5JMPA 1ABBA 1A9ZA 1P1BA 1CB7A 1GNVA 1OGIA 1CDDA 5IAJA 4TQUS 1XTZA 3SLGA 1EAYA 1QOZA 5EUMA 5D2CA 3V5NA 3NTXA 2W22A 3UG6A 1T6YA 4ZQHA 3H4IA 4FCVA 1WX1A 4ZQFA 4UREA 5DT2A 1JQLB 1X1RA 2GD6A 4GX0A 4OHUA 2SKCA 4WMLA 3ZY3A 1PBNA 2B6HA 3O8DA 1AB5A 5JZOA 4PWZA 4HXEB 3GDFA 3MLBA 2LCIA 1TZMA 3WGKA 4LY9A 3FVRA 5JLJA 1JR3A 5KYTA 4KQGA 4DCTA 1P1CA 3IOMA 2BVNA 2PGJA 3T06B 4FMDB 3I28A 3RS5A 2GN6A 4LVOA 1ZWLA 4CMBA 2VXOA 1GSHA 1YA4A 1YQEA 2YJ3A 3GN2A 1BHSA 3ZIDA 1TCAA 1Z4JA 1UOEA 1TTQB 2Q45A 4XXHA 3VR0A 4ZEVA 3S28A 1P80A 4MW0A 4YMHA 5JT1A 5E7IA 2NZ8A 1OFUX 3H04A 1ZI8A 3ODGA 4BLRA 1DQNA 4E5KA 3DT9A 2C31A 4L74A 2QTBA 3OFKA 1RYBA 5HA5A 1KEKA 4Q7LA 2QD1A 4QC2A 2CJWA 1G7SA 3AY0A 3ETHA 5CK5A 3DDWA 3V4OA 3KSAC 1E18A 3PLRA 4X8OA 4F2PA 2V1UA 5IDWA 4DQ0A 2VDWB 3AJEA 1DAGA 2ZTUA 5DP2A 4EPWA 1JV2B 3O8LA 1L9XA 3EFOA 4YRIA 1VE5A 4GP7A 1P9NA 1TI7A 4EG1A 3VHXB 4R8KA 4RQAA 3ANSA 1WXHA 3TG8A 5D86A 4TGLA 5ANRB 1J2UA 1SVLA 1YGYA 3IFSA 3DT6A 2O1WA 2NPIA 4IIUA 3CKLA 2FGKA 2JJ2D 2JPDA 2CHEA 4KMSA 1UMCB 2CLKB 3IR6A 4QPPA 2Q1XA 4Z1OA 1SC1A 5JATA 5JMWA 3AK4A 3ZE2B 3W3AH 2XUGA 4YEDA 1EUZA 3BORA 3UBMA 4PVDA 4QPDA 3S29A 3F46A 1W9MA 2J4FA 5JSHA 5FTJA 2C7VA 1ZK3A 3NGLA 2P1ZA 4LA4A 1OZ0A 5DK4A 2AN1A 2XMBA 2W2LA 2FW8A 3ESBA 4PQGA 3KTAB 3BHNA 1B8PA 3RRXA 3ADOA 1KQOA 4MB0A 2IC5A 3PQ5A 4FTWA 4AZ0A 1MRZA 1VCHA 2X2EA 1C1YA 5H68A 4AY3A 4LF6B 3H5AA 3W5JA 2NUBA 1NG1A 1NPYA 5HKAA 1VSTA 1YNOA 4LQCA 5AICA 1JEDA 2Y99A 2DWUA 5ADWA 4XWTA 4R3NA 4CL8A 4BBZA 4CR8A 4ZXFA 2HTEA 3CQ9A 1ZA2A 5A71A 4YLEA 4EKNB 1P7CA 1CUDA 4ALNA 1SC6A 5TGTA 1L2TA 5WRFA 2HZ7A 4MVJD 1TU0A 1N2GA 4NFHA 4TT3A 1QC5A 4O08A 1HEUA 1YJQA 2XXBA 4S1OA 4PLYA 1H4TA 2C3UA 2VDUE 3KU1A 4OD0A 4RO0A 4C7JA 1RIFA 4Z4IA 1KMMA 1TEXA 1A9OA 4QJ5A 4B73A 3MJHA 4G9BA 2QPLA 5BN3A 4ZVVA 3ZJYA 1Z36A 1YDEA 3FSGD 4V1CI 3H5TA 1RJEA 4RLHA 1EFDN 1U81A 4B6RA 3HUEA 3OC6A 1L5ZA 2QS9A 2XDQA 3G5MA 2B7BA 3GPCA 4NG5A 3QZUA 4EHLA 4RJTA 4KTTE 4IQ4A 4KYIB 3ZDCA 1NVFA 2JGLA 5HS6A 4OXNA 3G9UA 1C7IA 4DNOA 4R7ZA 5BVHB 1AA6A 3MTQA 1LPSA 3M5CA 4GQIA 4O4HA 3GLIA 3DBHA 4PZCA 1TO1E 2PWPA 2V7WA 4YY3B 3T0GA 1J70A 4WWHA 4DUGA 3VR6H 4BKMA 4RETA 3MWKA 4V1CA 2EFHB 1C1XB 1EMDA 4FKBA 1C7ZA 1U9ZA 1TQDA 3JARB 2J32A 3UUEA 1XALA 3EG9A 2CSUA 2C4WA 1IY8A 2RB5A 4BVEA 3RAGA 3VA7A 5BR8B 4IJKA 3H1FA 4WZZA 5DGXA 1HEYA 1P9WA 5FYQA 3NJ4A 4X8MA 1VSBA 2OKGA 3GDWA 2JBAB 4JJEA 3ZU3A 2WV7A 4F2HA 3OZAA 1Z6ZA 3IPAA 3DMDA 2IXEA 2X8JA 1L4MA 2ANBA 3P0HA 1KJQA 3AIOA 4WY8A 3N6VA 1Z37A 3QX8A 1PI3A 1XQ9A 5CYFA 4W5HA 4E51A 1K7SN 1UOQA 3TSOA 2F3TA 1ZJJA 4CFZA 2ODBA 4NY1A 3G0OA 1PBTA 2AZTA 3HFGA 5ENZA 4ZJPA 1SN7A 3A1TA 2CXQA 2PY6A 2OORA 3DC7A 1N2SA 2SECE 2L17A 2X2FA 3IDQA 3MMPA 3AUJB 4AIIA 4E31A 1JG2A 1DKQA 1QK3A 3LC0A 4MV8A 5ABPA 5K0ZA 1FUUA 5KTTA 3TPFA 4KBGA 5DXJA 4EGFA 3WK6A 5KJFA 5AM4A 1DSSG 3Q1LA 3QBTA 5TPWA 2B6NA 3U9TA 3HVRA 2W2QA 2I7DA 1N7HA 2Q4EA 1A04A 4UMFA 3UW3A 3F0TA 1RHJA 2WT9A 5EP1A 2JFNA 1EX9A 3ER9A 1NVBA 1UFQA 1FVHA 5I7FA 2BH2A 2DTDA 3OQIA 3BGSA 4L15A 1R0BA 2SCUA 1XTKA 1KE2A 3S1AB 4JI2B 2I3DA 1OLXA 3Q8XB 4DLWA 1XTPA 1T5HX 1WUYA 4BCCA 5ALFA 3DOEA 2BFBB 3GJTA 4XR4A 1K3FA 3U3ZA 3FSJX 2AK2A 3FDZA 1DEHA 2QKYA 3RG2A 3TIGA 5E2AA 2AXQA 4WKCA 2IPMA 4QUAA 1YR3A 5I9IA 4RH0A 2J1LA 3FYTA 3FHCB 4GMFA 721PA 2C4HA 1TZKA 2ZRQA 3FNFA 3HVJA 4ZAWA 1EJ6A 1EVJA 4QOEA 4QUDA 1VDZA 2HRQA 2J9YB 4RA6A 3MFYA 4NEGA 4DWWA 3OU7A 1P5FA 1ZK4A 1H4VB 2FQ1A 2Q5IA 2P0AA 1ACLA 1DX6A 3QPBA 3ZH2A 3GZJA 2EZTA 1L5HA 2LXNA 4MPJA 4RGBA 1B93A 1DKRA 3BE4A 4Y1GA 1JXQA 2OBFA 2W2MA 2WJZB 4FR0A 4L9AA 4QFBA 5KB3A 1J5XA 5CJJA 4YMIA 2FZLA 5T6MA 3PR1A 5ITSA 3NOQA 3ONVA 5L3QA 2J5XA 3IA7A 4LVCA 1ZGCA 5LN1A 4I55A 3I30X 5K0CA 1C3OA 1CP3A 1EZ1A 1MJNA 1USWA 2BR4A 2VWPA 2PD4A 4JZYA 3ZIUA 4YRCA 5BVGB 2OUKA 3CN7A 1SXGA 3A1EA 5D7BA 1OAKA 1SCUA 4EUEA 3W34A 5JCOA 4U2EA 3S0JA 2VOEA 3L18A 1OXKB 1PYDA 4RVUA 3WZMA 4HUTA 3DBRB 2WJYA 2O19A 1YR1A 3DB2A 3RUIA 3FMFA 3FR8A 4UTXA 2B8NA 2G80A 4IG4A 3E2PA 1S3SA 3PFFA 3MCWA 4WXHA 1DCKA 1JDBB 3T5AA 5KINB 4KGXA 3SPXA 1Q7TA 3BGOS 1OWLA 4JVOA 3TI7A 1NU6A 3W0LB 2BF4A 2FPSA 4HQKA 1QQAA 3S8EA 2PT5A 1E4EA 3LY5A 2PGDA 4UTRA 3UC9A 4B3MB 3RARA 3JWJA 1GZ3A 1XZHA 3WV4A 4AFNA 2MDTA 3CIFA 4L8FA 4ZT5A 4FGSA 3ILXA 3HXPA 4LV5B 5BSEA 2GN8A 2OEPA 5BWMA 4DSUA 5IEBA 4EY6A 4R71A 2B4RO 4OOEA 2V6FA 2VAVA 1K8ZB 1B0UA 5HUHA 1M3SA 3DB1A 4HGNA 1C14A 5HCIA 3ZY6A 3EVGA 4JQOA 3VYRB 4U5XA 4XTRA 2E87A 2CL0X 2E1PA 1DWQA 2DX7A 5DWDA 4ZDIA 2HIGA 3EXAA 4UUNA 2I7VA 3IXLA 4XM1A 1E1CA 3PVCA 3SSAA 2VDLB 1GGEA 1ZCBA 4X85A 3QU2A 4OHWA 4BO0A 2HMWA 1Z07A 2XHZA 5JPIA 1I7LA 3REOA 3I0ZA 3O2JA 2X0FA 3HKCA 4BJHB 4MDEA 2FJPA 1J09A 1IU9A 2EHJA 3IP5A 3K8OE 1TJNA 2RGWA 4H08A 4KL8S 5K2MA 1LPPA 4BEWA 1CDZA 1D1SA 1YS9A 1CUWA 2EJCA 2GAOA 1XFDA 1SUFA 2G82A 2H2HA 3C85A 3RYHA 3RVSA 5B4UA 3PEYA 4GRIA 3OJLA 3F1LA 1G8HA 2RAUA 1M8PA 2J3HA 2WIJA 3D59A 3O3NB 3OLQA 1AQUA 4WN9B 1ADCA 5E6UB 3EZNA 3A3KA 2FWMX 2EKLA 1LNQA 2WQ6A 4YUWA 1VTKA 4LEIA 2OPHA 1NX6A 1W4CA 4NPHA 4F4HA 3FHTA 3H0CA 3QLVA 1OF1A 3EB9A 4LDRA 2HFJA 5TVKA 5HF8A 4ISCA 2IV7A 5EXDA 1TIKA 3C45A 2GMWA 3SZGA 1QIDA 2PUJA 4YASA 3NASA 2XT9A 3L8ZA 3OOJA 2ZRNA 4RZUA 4B6SA 3AF4A 5C7IO 4YRTA 2R8YA 3D6UA 1ZZGA 5LA6F 2UZ1A 3IP8A 1R88A 3DQQA 3OZIA 3RS9A 2DFKB 2NV2B 4MPDA 4FJ2A 1Z4IA 2J5BA 1Y5LA 2HHLA 3GN1A 5HIAA 1YQTA 4Q0MA 4NBVA 3H2YA 5D85A 4B7AA 1B8OA 2I1VB 3DBVO 3FPGA 2GF9A 2IY7A 3L0SA 3DD1A 4DNPA 1UKVY 1Z4KA 3N0VA 2EW8A 4F84A 4A8JC 1A2OA 4UBKA 3NQ41 3ZDFA 4A8TA 3HWX1 5JQGF 2HRZA 4MI6A 1NLUA 1Q21A 3EGWA 4XQCA 1PK7A 5D3ZA 2GF0A 4YO7A 4CNQA 1PAUA 1QIMA 4BQFA 5B4VA 3A37A 3CVVA 4Q4CA 2LD4A 4MWZA 1R5JA 1RAEA 2WA1A 2NQTA 1UMDB 4IHKA 3T9EA 2JCGA 1JQJC 3UOWA 3B38A 1L1FA 1WMEA 3W7VA 4AWBA 3VFDA 4NQZA 4GR9A 4IJQA 4M1OA 1J21A 1PEDA 4RKQA 3EYAA 3MTDA 3TZKA 1O6CA 2PG3A 2HXGA 4V38A 3KDAA 5JD5A 1TA0A 3IJRA 4WXRA 2O20A 2VZLA 4RXMA 3AUAA 4R16A 1IDN1 3ZKWB 2FTKE 1TCCA 1FFYA 2IYQA 1SQ0A 1ZAYA 5SICE 4J0CA 1Y4DE 3A10A 1NE2A 4IGEA 4DCVA 2AXPA 2F43A 2VYQA 2OCAA 1BW9A 4TKVA 3HCOA 2PU5A 5I4KA 4N3GA 1KBQA 4DV2B 4IV5A 3DYVA 1SQ6A 3H11B 5FV7A 1W4RA 2OPBA 4LJ6A 3FI9A 4MYRA 2Z4TA 3RC2A 3WLLA 3DFUA 3K5PA 2FPKA 1NJ5A 4PYJA 1JIQA 5M2QA 4ZPXA 2QUJA 1ZN2A 3ID6C 5EFZA 3TQHA 1KYXA 4B74A 3LQ4A 2R8OA 1O0SA 3E23A 2D2FA 4ES6A 2FQYA 5HQ3B 3B6ZA 5JWRA 3BFVA 1QF9A 3E7PA 4PLZA 1VBNA 4LOAA 1RP7A 4OMUA 3GFPA 4CEIB 3OA0A 4CGZA 4Y2UA 2IYAA 4XOIA 4BO2A 1KP3A 3C1OA 3GLTA 3KKEA 3OX1A 4DHWA 4EAQA 4GMXA 1UPXA 1DZ3A 4QKQA 3KKNA 2IPAB 1BE1A 2X4GA 3K20A 2BWJA 4ETMA 1W5EA 2JA1A 1PT7A 4JR1A 4KLAA 3L8MA 3ZHZA 3PNQA 3SVZA 4NCNA 2VJYA 5KDOA 4MUFA 4P4NA 3K05A 5I6DA 5FX2A 2IBTA 3FWNA 3TIFA 1O6BA 1P1RA 4O2AF 4F8EA 4F4CA 1CQPA 2O9JA 5P21A 3D4IA 3NALA 4M2LA 4BO7A 1SKAA 1HPLA 3DBHB 4LDNA 3A9UA 1M6VB 3OTHA 4BMOB 3TNFA 2VRCA 3DLCA 3OU6A 4BEJA 3LOUA 1FXWA 4IZ6A 5DEIA 2ZBVA 4U7FA 5TDHA 1ENYA 4LGYA 1T5BA 1F7UA 2PCJA 2R62A 3G0GA 3OM9A 4GRAA 3EQ6A 3VX3A 1ITZA 3T1NA 5FUQA 3A7EA 5F23A 5HM6A 2VHZA 1V7QA 5REQA 3WYGA 3MBOA 1WCXA 1AZLA 3CFYA 1ODIA 3LX6A 3E5HA 4LDJA 3OWHA 5ALHA 1CVIA 2FG6C 3OFNA 5L8VA 1XMPA 3U31A 3ELWA 2I4LA 5AHXA 2OO3A 2QW1A 4EO9A 4PANA 2ONZA 5FLEX 1F48A 2IW1A 2JKZA 2P3LA 3FPLA 3E7WA 3K8YA 3OLVA 4JBYA 1M2WA 4FI3C 4Z2YA 5C8DA 1G8AA 4Q3CA 4ENVA 1QIJA 4R6WA 3PFNA 1RPTA 1XDZA 3TBHA 3W9SA 4BFWA 1P17A 3EIUA 3ZDEA 3ZD8A 5EUCA 1CR1A 2OGZA 2VT6A 2XKKA 4C88A 2Z6QA 3QFSA 1POXA 2ILVA 4AJEA 1AN9A 1JALA 1R4NB 4EM6A 4IJUA 5AT1A 2OT3B 1I8TA 3L1JA 4GPAA 3ZI0A 1CEYA 2WIKA 4YV1A 2XTAA 2O0HA 1ZX1A 3ZXUB 4RHEA 1YDHA 4I9HA 1ZZEA 2HMYB 1V25A 5IG2A 3KFLA 4UD6A 3UMGA 2WT8A 1RI1A 3H1TA 3NHFA 3UK0A 1K5DA 2FK8A 4DMKA 1JFVA 1FRVA 2J87A 1LDMA 1VE7A 2Y1FA 1FMJA 4W9NC 4KEAA 4B6OA 1GTJ1 1RI3A 1S89A 3DCYA 1YFZA 1PWZA 3IKJA 1F0YA 5CT6A 5ECGC 2BEWA 3TL6A 3AC0A 2VHTA 2PDAA 2ZCJA 4DJAA 9GPBA 3JQGA 3CN9A 4UNRA 1I80A 5ICGA 4G86A 2GJKA 1XXHE 2ZZNA 4MH0R 3NR2A 3URKA 4FLFA 4ZI3A 1MO3A 1SQGA 5CLHA 3EDMA 4UHBA 2SICE 3D7MA 5B12A 4C3UA 4LKRA 4LY0A 1EFRA 3DE6X 4KQ2A 3G79A 3NBXX 3TAUA 1HM5A 3FRIA 3I53A 1LPNA 4WTOA 5A4IS 1OIWA 2I4IA 3TG2A 2O2DA 2JDIA 2HA7A 4FYIA 4BNFA 3C3XA 3GLHB 4C30A 4QPCA 5EGNA 4BX3A 1SA0B 4XX0B 3KYCB 2BC9A 5DVZA 3LS2A 5DT9A 5KUTA 2QLNA 4JVNA 4NTZA 3GFBA 4V0SA 3KU4A 3TJRA 2Y3IA 2WKPA 4JBNA 4PYKA 4ANFA 5CBPA 3EZYA 3GX1A 3DAOA 1N9GA 1RM5A 2WVHA 2ZXFA 3BQNB 4WA8A 5ED4A 1GKLA 1VG9B 4BS9A 5C8ZA 2QW0X 1HDIA 1JIKA 2YH2A 1RYEA 2F48A 4Z53A 5DCUA 2ZS9A 4I3HA 2QSUA 4EUFA 1USVA 5EJ8A 1RKQA 4DV5B 4MPTA 3BH7A 4DHEA 1NLZA 3QOXA 2RFLA 1OB2A 3AW9A 2QL7A 4V0OA 4X20B 3ZE6A 3QKUA 3L01A 1T0BA 4FFNA 3D43A 4DUPA 3TZQA 1JIUA 2WU8A 3X1JA 2D3TA 1FW8A 2VKTA 4UTZA 5AH0A 4ZZ2A 2B34A 3QEAZ 1BROA 3QY0A 2GA9A 2HOQA 2DWCA 4P3XA 4XIFA 5B2FA 2OHGA 1TYEB 1UBFA 5G4KB 4E5VA 3IXQA 5ALTA 4LHYA 4MQEB 3GT3A 3JR3A 1XUOA 2BONA 3PT9A 4IH4A 1OLUB 1MJFA 1FNBA 4HFMA 4N54A 1ISJA 4GPTA 4AF7A 2ZQZA 3GLGE 3PICA 4D6PA 1LSUA 1SOWA 1ZP6A 1XJWA 2X15A 1MDFA 4PNPA 3THXB 1M2OB 4D25A 1UJ2A 1PTJC 1W19A 4PCAA 5JSZB 1MZPA 5DI3A 3K9HA 3GK3A 4BFVA 4G4GA 2IPXA 2VJBA 1LU9A 4UCWA 3OQNA 2XXAA 4L76A 1JU3A 4U5QA 3R0QA 1RHMA 3CNEA 4KW7A 3GEGA 5BMVF 1QF6A 3T5PA 5A9RA 2Q5EA 1AK9A 3LO5A 5YASA 4R98A 3ANNA 3HJBA 3AGQA 1NJ1A 1GQFA 4YN3A 4WVFA 2XDWA 4Q1FA 4YJGA 4BFZA 2GNPA 3NHMA 1FRQA 2GPNA 3WIDA 4AP9A 4DCCA 3DWFA 4MLZA 3PI7A 3D5QA 5EZQA 2HPHA 3I1FA 4PF1A 1Y80A 2C57A 2QU7A 3JCZA 6YASA 5MFZA 3HQ4O 1D1TA 1OW3B 5D00A 1E1RD 1EK5A 3INTA 3M89A 4GXTA 2ADFA 1Z6PA 4PYLA 1WY7A 3U37A 1QK4A 1THGA 1IIRA 3FOFC 1PT6A 4G1CA 4OQPA 1O03A 3VPAA 1PFYA 3NP9A 1CFJA 2VZ8A 1XD2A 1XNQB 4S1VA 1UQUA 1DAMA 3RC9A 1KZ7B 3KPYA 1UUFA 3HSKA 3VH4A 5KPJA 3S2ZA 1P45A 3P96A 3ZBQA 4URYR 3IRVA 2AMJA 4D0RA 2ZREA 3DL2A 3QITA 1U0OC 3D8NA 1N32B 2WZDA 3KKPA 2A14A 2P8SA 2VQ6A 3CURA 3QE0A 4NABA 2GD1O 3PRHA 4TWAA 2IYOA 5SYNA 3ZD9A 4DIBA 4IWYA 4FWTA 2JVKA 2P5YA 2A1TR 2HBYA 3UFXA 3CPJB 1EFHA 4CMIA 4MQ6A 2C78A 3FGPA 1N0IA 1DINA 2LWIA 2OFOA 1JEEA 3E3AA 1ZMXA 1RRPA 1WMSA 4PG6A 1SC4A 4GGPA 3I3OA 1WP9A 1BKSB 1Z8NA 4GFDA 4CG3A 3SFZA 4C7VA 4XUCA 2W6OA 3RRFA 4X94A 1HBJA 1TQ2A 4KK3A 4CM3A 1G59A 1KZ6A 4REMA 1DIBA 2QENA 2FK7A 2NTEA 4K0RA 1YMUA 3FHJA 4LSGA 3L92A 4H77A 4BDTA 2R1TB 1W5SA 2X0JA 1G9SA 3OE7A 1GVHA 1P1IA 2IOYA 4FK8A 4H17A 2V9CA 5IT0A 1VP3A 4JI4B 4C7KA 5B36A 1KS2A 3T7RA 1HK7A 5DXFA 3BD8A 4AW9A 5FUMA 2JH3A 5KYYB 5HDBB 2DKNA 1T9BA 5IKMA 4G1UC 1FIUA 1QKIA 3C3JA 2X6TA 4TYNA 2N3ZA 3AEKB 1AT1A 3DTYA 3GZNA 3RSGA 3ZGYA 5B57C 3CLRD 2O0KA 5TGDA 1M66A 3OEHD 2XYQA 3RUCA 3IH5A 5B4TA 1IAQA 5KSZA 1BFDA 3H3FA 1S8OA 1OE0A 2ID4A 2BUBA 3VNQA 3MCVA 3NHZA 3O73A 1F2UA 3K94A 3PGJA 2FX3A 3GMDA 4KVGA 3RM3A 3WR5A 4MYCA 3E9YA 3MUEA 4GZ5A 1VYVA 1X87A 4NCHA 2VQSA 3D0KA 3H87A 3FTCA 5AJZA 4ZAXA 3S44A 2Y76A 2A78A 3ZCTA 4B44A 4I66A 1KK3A 1X80A 1E2HA 4DBVO 1W46A 4OGWA 1BE6A 4AL4A 1SMKA 1WTCA 4HPJB 4MCIA 4HGQA 4RJLA 4RKRA 4CUZA 2QL9A 2DBRA 3EY4A 3OTQA 5I5EA 2OR3A 3FRHA 2VR1A 3DA8A 4G1MB 5K3AA 2OZLA 1I33A 1S7CA 2JCVA 1VHLA 1L3IA 1M8FA 4L22A 1V45E 2EFCB 1TFRA 2W6MA 4G1VA 1Z7YA 1XHEA 2JEYA 2P2LA 4YLGA 4YPOA 3CISA 3SQLA 2X3YA 5KQGA 5LNK1 1GCIA 3QSGA 1YKSA 2XZPA 3ZZ1A 3X1DA 2C5HA 4PPYA 5MN6A 4D98A 3N0RA 4LJSA 5FOSA 5GIOE 4HQNA 3BTOA 2Q29A 3KJHA 3NKFA 4GLJA 5DDIP 2K5UA 1DAEA 2I67A 5SZJA 4DF3A 4BE4A 1NRIA 2RHOA 4EYEA 3RIXA 1NL3A 2XNCA 4AM8A 3WYAA 5COQA 1TO2E 4FC6A 3FFWA 1IJEA 2NXWA 4B4VA 4JLNA 3CZ4A 1L7DA 4Z3OA 3AP3A 4EJ2A 3L7YA 1GJRA 2KQUA 2WI8A 2YNMA 1U7HA 2F00A 1YWGO 4L8VA 2D4HA 1TUEA 4R84A 5JZMA 2PSJA 3ICWA 3RLIA 3UB2A 3VRHA 4MV5A 2R1UA 1CE8A 1SB9A 4PSDA 4DA0A 1U8EA 2WZBA 3G6WA 1JFTA 4GPZA 5AP9A 1PX2A 4JDPA 4MZXA 1CUVA 3GFOA 4F2GA 3RS4A 3T3OA 4GOMD 1IUPA 4C0AC 1JFSA 3R7WA 4F1JA 4NECA 2W4IA 2V5UA 2YV2A 3SJUA 4DR7B 1QG2A 1Q1ZA 3ZX4A 3WWEA 1R5NA 4RY8A 3TW4A 2Z8ZA 5EIXA 2C2YA 1QJ4A 1COZA 4D82A 1R4ZA 4LBWA 1NNUA 2R6FA 3GF4A 3WLOA 4BWVA 3H9CA 4MEJA 1QYVA 2AJLI 2PSDA 4L8YA 2JL1A 1JRLA 2CLFB 4KXVA 1L3CA 2RMKA 5ESXA 2JJQA 3EXHB 4R0MA 4EY8A 4RE6A 1GP2A 1OD6A 1RKUA 4FEGA 2MYPA 5ERXA 1CY6A 1QV7A 1N7IA 5EVJA 4ITVA 1UMDA 2I9KA 2E6KA 3EWIA 2C95A 1QQBA 4MCJA 1AK2A 2MSLA 4JUFA 2CCJA 4O59O 3U4QA 3DGFC 1BWQA 2BEWB 2JEOA 2P9EA 3LCUA 2NZYA 2I1QA 1QE5A 3OY7A 3OTIA 1WMDA 4N0EA 4DLLA 1C7FA 1E1YA 2HA2A 4QTZA 3CRQA 2JFVA 3REQB 5FI0B 3EEFA 1NRJB 3KB6A 3LP5A 1U9YA 1H2RS 1QX4A 2NU9B 1X0XA 2BF7A 4FQ7A 1H23A 1M83A 2L0XA 4YMVA 1U8FO 3ONWA 4U6NA 1QB8A 2MINA 2A5DA 4KAJA 3IALA 5AKIA 4NDNE 4WFJA 2NVWA 4IDEA 2XCOA 1C4OA 2C3OA 2XOKD 2BEUB 3CGGA 4B85A 1KO4A 1VFNA 4DSAA 5JBIA 1OOEA 3PJRA 1MC4A 2PO5A 4ZVUA 4QVGA 3O0TA 2XYHA 2GT1A 4O2AA 4L7QA 3UTDA 1IXKA 1ECJA 1DAKA 1J9EA 1QHEA 4TTRA 2PPVA 4K2AA 1TEVA 1I2DA 2R5WA 3HJRA 4G01B 1RP1A 5JD6A 1IEVA 1KDOA 2PKWA 1LVHA 3FZNA 3WDMA 4EKEA 4KUGA 3IX7A 3KWJA 1JQ5A 1NF9A 2GM3A 2MYNA 1QC5B 3MCAA 4CKZA 5MGNA 4LISA 1WOMA 3B1KA 3I3SR 3DZKA 4RLSA 2XCQA 1YT5A 4EB6B 4QTYA 4EGAA 5LSAA 1R0SA 1ABEA 3JQBC 3JVVA 1E5DA 3C7TA 1AB6A 2ZE8A 3IVMA 3MWFA 4PG8A 4IQGA 5G0VA 3ZV3A 1FDUA 3RHFA 3L82B 5ALEA 4EARA 5GAJA 1QSGA 3CH6A 4II2A 3KRTA 4FC7A 3K32A 3SYRA 4ZAFA 3L0YA 1DVRA 1K9SA 4ZVNA 5BYAA 1GFWA 5G1NA 4JHXA 4Y67A 1LQ2A 2O2GA 4D3DA 4F3TA 2C3MA 2R5NA 1PJTA 4IF6A 4JD5A 4ILEA 4MLDA 4NG4A 4XDYA 3LC7O 3TD9A 1ZXXA 3WO0A 1CS0B 1ID1A 4DIUA 1AGRA 5BNTA 1GNTA 5IXYA 2P2CA 5HXAA 5AR1A 3IUSA 4P2GA 2FR0A 2XD4A 2BGJA 4X20A 2ZRAA 4Y9RA 3VU8A 3P9XA 1IN6A 2RJ3A 4MUBA 3IV6A 4PAGA 3I1IA 1P75A 2IX9A 4LVNA 3TUJC 2AXEA 4KDRA 2B92A 4LXHA 4ZCSA 5H02A 2AMLA 3GGDA 5THXA 4V1CB 2IFTA 5A4DA 5JZVA 5LXTB 3A6EA 1T2AA 3A6DA 1M1XB 3JARA 4QX6A 4RX1A 3USES 4GX5A 2AOWA 3RSOA 5AO9A 2OHOA 3CR3C 2NO9A 4C08A 3IMCA 4M1EA 3ZK8A 2K4MA 1K08A 4E08A 3BWYA 4NOJA 1C2YA 3ASVA 3AOGA 3JVIA 1KO5A 4FJ1A 4UM9B 4MW6A 3HG7A 4CN8A 2PFGA 4O2BB 1WMAA 4HMQA 4Q18A 3LPDA 4JSYA 4BB6A 5KX5B 5IVKA 1QZTA 5K6TA 3AM1A 5FPKA