1UDWA

Crystal structure of human uridine-cytidine kinase 2 complexed with a feedback-inhibitor, ctp
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
212
structure length
204
Chain Sequence
EPFLIGVSGGTASGKSSVCAKIVQLLQKQVVILSQDSFYRVLTSEQKAKALKGQFNFDHPDAFDNELILKTLKEITEGKTVQIPVYDFVSHSRKEETVTVYPADVVLFEGILAFYSQEVRDLFQMKLFVDTDADTRLSRRVLRDISERGRDLEQILSQYITFVKPAFEEFCLPTKKYADVIIPRGADNLVAINLIVQHIQDILN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uridine-cytidine kinase 2
publication title Structural basis for the specificity, catalysis, and regulation of human uridine-cytidine kinase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 66
structure length 204
sequence length 212
chains with identical sequence B
ec nomenclature ec 2.7.1.48: Uridine kinase.
pdb deposition date 2003-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00485 PRK Phosphoribulokinase / Uridine kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1udwA00
1FP6A 3NG1A 3VFDA 4LI0A 4QGAA 2V3CC 4G5SA 1E4YA 1JR3D 1EFHA 2HUPA 3FB4A 1N0UA 4P3YA 4GT1A 3X1YA 1TU4A 2I1VB 5D3MB 4Q1AA 4LHYA 1JNYA 1SVWA 1S0UA 5FOUA 3K70D 4HAYA 4RY2A 2WPDD 1G5RA 3NVAA 3HWSA 1I4DD 3PUVA 4EFMA 4AKIA 2XOKA 2ONKA 4PAMA 3LY5A 3CX7A 3EG5A 1ZBDA 2OHFA 4YMVA 1GZSA 2X2EA 4UXHA 1XNJA 1Z22A 4ZCIA 3TH5A 2JDIA 3PENA 4CGZA 4AYTA 5J4HA 3QBTA 3U44A 2AK3A 2VHQA 1P9NA 1US8A 121PA 4LBWA 1A1VA 2ZJZA 1N6RA 3KB2A 4BUJA 4DLTA 2IXEA 2AX4A 2VHJA 1ONBA 2QMOA 3JVVA 2DB3A 5JJIA 5E7IA 3MMPA 5EUQB 3WXMA 2G88A 2GEVA 2DPXA 2OFWA 4LCBA 4DIEA 2FPKA 4DLVA 2ZRCA 3VMFA 4A8JC 1P73A 1XCGB 3B60A 3H84A 2XGJA 1OFUX 3V4RA 3CONA 2FU5C 3W8RA 1M34E 2IWHA 3W8NA 1E79D 3AKEA 4WXPA 1GNRA 3U44B 3IHWA 1US8B 2BJVA 2ZREA 3LD9A 4B32A 1FL9A 1I2DA 3IUYA 2IHBA 3KQHA 3SJBA 3QKUA 3X1ZA 1ZNWA 1AGPA 3HPRA 1N6IA 4ZCLA 4B34A 1D2NA 4IDNA 4EPYA 3WMGA 1N6KA 1NF3A 4C0AC 2D2EA 3FHOA 3GLHE 4OI1A 4Q66C 2G1KA 4DC9A 3PUZA 2XNSA 2PEZA 3W3AA 4O25A 4NH0A 4PHGA 4QHTA 3UG7A 4DUGA 2CJWA 3C15C 4JYBA 1CXZA 2QMUA 4F4JA 4Q4HA 2PJRA 1OIVA 3RWOA 3PITA 821PA 3IIMA 2WWXA 5SZHB 3LW8A 3PFIA 2ZR0A 3WY9A 2QM8A 1COWD 2QGNA 1XDBA 4ESHA 4DDTA 1Z07A 1KDRA 1AQUA 2RGAA 2ZJ8A 2QP4A 2ZRIA 2REXB 2C98A 3DO6A 4A36A 2XX3A 3OAAD 4B33A 4TSFA 1VIAA 3OF5A 1D5CA 4DLSA 2DBYA 4IOLA 2CJWB 2IYLD 2O0HA 3F0TA 3PUXA 3QG5A 2QA5A 3QIAA 1EWQA 3TSWA 5LD2B 5DISB 1XCPA 2IUTA 4C0BA 1E98A 4Q4HB 4V0MA 2J0VA 3QI2A 3UPUA 2ZU6A 2ZRLA 5JWHA 3X1WA 5J47A 3N2IA 5C18A 2W2XA 5FBRB 5LDDC 2QP3A 1N6LA 5L3QA 1TEVA 3PEYA 2QE7A 1M7BA 1NL3A 3ONWA 4NCNA 1W36C 1ZRHA 3GJXC 1MO5A 5GJCA 4C9BA 3VNVA 5IT5A 4HLCA 1G7CA 5EXSA 2KWIA 4JVLA 3FWYA 2PX0A 2B6HA 1GL7A 4BZXA 4CDGA 2AKAB 1CBUA 4XSHA 1XD8A 4FMDB 5DIFA 4ASUA 5EP4A 4AYWA 4Q9HA 2IYQA 3EZ6A 3U4QA 1CF4A 4IDQA 1OT3A 1JPNA 3U5ZB 1II8A 2FSIA 1U0JA 1UFQA 2Y8EA 3LNCA 1AZSC 1OE0A 3L0OA 5L3QB 3GEHA 2P6UA 4I99A 1CLUA 5FBLB 2REBA 3OHMA 1M6NA 2H7VA 2PZGA 1ZMXA 2J9RA 2QG6A 4JT2A 4PZYA 3GLFA 4AWXA 4V0LA 1D2EA 5EE9A 5E4FA 4BRUA 1KK1A 3QPVA 2WMNB 2WAXA 1RFLA 3U4QB 5TXGA 5EXTA 2ZM5A 2JLYA 1ZD9A 1II8B 2PZFA 3TAHA 2XB2A 3IPXA 3CPJB 4A8JA 3L82B 1E0AA 1E2LA 4YQFA 4TLDA 1YQTA 4AIIA 2V4ZA 2VQSA 3PUYA 3GLFB 4BLRA 2V1XA 5P21A 5KHOC 1NN3A 2B8TA 3K0EA 3ZD6A 1T4GA 2NPFA 4GFDA 3ZZ0A 4BFXA 2P6NA 3TUZC 4B44A 2IYVA 3FKSA 3MFYA 3RC3A 5J4LA 1TUEA 3Q72A 3FDIA 5FUWA 3IILA 1KI6A 1U81A 4IJMA 2GJ9A 3REFA 2ZUBA 2VSFA 4A8JB 1NKTA 1XXHA 4V0NA 3AVUA 5FR1A 4PC7A 4ZDWA 4A1FA 2AWOA 1JXMA 3L0PA 4KYIB 1YE8A 4HDCA 2V6JA 1BYUA 1KK2A 3EC2A 2NO6A 3KFXA 4ZDJA 1E94E 5JFGA 4LHXA 1N6OA 2VLIA 4ZI2A 2XB4A 2FGKA 1BH2A 2VBCA 1XEWY 4DVGA 1E9EA 2CLSA 2ZE6A 1VKJA 421PA 4L8GA 1KI6B 5JBQA 1RYHA 4TQUS 4DUGD 1G3UA 2ZI4A 1JEDA 1U8AA 4UXJA 1RVDA 4BPBA 1XXHB 2SHKA 4WBSA 5B2ZA 1NBME 4LBZA 4M1TA 4RD2A 4A82A 1KI8A 1ZYUA 2H8KA 2VSXA 1ZNXA 3CBQA 2XZOA 3L8YA 1P7CA 1XP8A 3R9XA 5KPDA 5BN3A 1BO6A 1Z0FA 2G77B 1GRNA 4CZ2A 5KPJA 5FPYA 1OIWA 2WICA 1U0HC 2HEIA 4LYFA 1JR3E 3G0HA 3BERA 2F7SA 2D74A 1SXJA 1H8EA 1QHXA 4M8NE 2BC9A 2Q21A 3QKTA 1R0YA 4XJXA 1GFIA 1G18A 4A92A 4A0GA 1SULA 4PANA 4V0KA 2OLKA 2WWFA 2ZRJA 1GWNA 3CX8A 3ZZUA 1R8QA 2GXQA 2CNWD 3PCRB 1OKKA 3O8DA 4R2IA 2HCJB 2YZ2A 5KSYA 2AXNA 4PPQA 2ZITA 4KXFB 3W5JA 221PA 5HCIA 4ZKEA 1SXJB 1L2TA 1DAEA 1W36B 4D6PA 1Z8FA 2EWWA 4HB3A 1G1MA 5AUQA 1FTSA 4DIDA 3KQNA 4ASUD 2WTUA 2KBFA 3JZMA 3K9GA 1GM5A 1YR8A 1H65A 2J87A 2FPLA 3DL0A 3B82A 3Q7PA 3CZQA 3B13B 3Q5DA 3VKWA 2NIPA 2W0SA 3C7KA 2RHDA 4JVSB 2GJAA 4JLOA 3W6PA 4JBYA 4F4CA 4CEHA 3CNNA 1ZM7A 3X1XA 3CWZA 5C4MA 1XRJA 4B75A 1O3YA 1G8HA 1KMHA 2CXXA 2OAQ1 2OG2A 1G19A 4NYIR 1JAIA 3TRFA 2YWEA 4KAXA 4HSEA 4A6PA 5G53C 1YZLA 2CL7X 2J3EA 3ZQJA 4HAWA 1R2QA 1ZC3A 4RD0A 4HZIA 4TMVA 3QEOA 4FMCF 4CEHB 1Z0DA 2C9OA 1E99A 4DCUA 1QHHA 4N3NA 1RYFA 3C14C 1JBKA 2JCSA 1KMHB 2QAGC 2EVWX 4RZ2A 5FPKA 2MMCA 1E9CA 4FWTA 3MLEA 3FKSD 4Z1MA 1TF2A 3U60B 3THWA 4DCTA 4YDHB 2LKDA 2YWFA 3AUXA 5JRZA 2ZSDA 3LDAA 5EP2A 1U94A 1XJQA 4IW3B 4LC1A 1T8TA 2O8EA 3EA5A 2NQ2C 2AL7A 4D4JA 4ARZA 4BFVA 2G0NA 4DRZA 4BECA 1XD2A 3B5JA 1QHHB 3OFND 4KFRA 5KNDA 1FFHA 4OQNA 1Z0JA 1S9HA 2ZUCA 5FFMA 4Q7LA 3GLHA 3THWB 3TSZA 3P1JA 3F3YA 1YR6A 5FH9A 1S3SA 3A58B 4PHHA 3RYTC 4BASA 5CITA 2QNRA 2WSSA 4URUR 1K8RA 1BS1A 3DMDA 3AVPA 4NMMA 2FV8A 5JSZA 3ZGXA 5JI2E 2JLRA 1RRCA 1VG1A 2J7KA 2VHTA 2YWHA 1G17A 5JCPA 4ARZB 2YKGA 3AQ4A 3SYNA 1XEFA 3U6KA 4OK3A 1MR3F 5J4VA 4AURA 3U3RA 2JLVA 4PFSA 2DWPA 4V0OA 1XJ0A 2VA8A 2VP2A 2BIFA 3GLHB 1C9KA 4CIDA 1PUJA 2A30A 1DOAA 5DO9A 2FWRA 1SXJD 2LCFA 1J8MF 2O5VA 1ZUHA 5A0FA 4URWR 3HU3A 3SYLA 2P6RA 5JSZB 1B23P 2E87A 1JJVA 2DWOA 4HZUA 4OI0A 3VKGA 1X8KA 4JL6A 4X8MA 3AVVA 4WA7A 4OI2A 1R5BA 1UAAA 3CB4A 4M21A 4DCSA 621PA 5FOVA 5ANRB 3WNCA 5J4KA 5GJVC 2P5TB 3ADBA 1E2IA 1Z0KA 2JIZD 2ZAOA 4EFNA 1FPMA 1XTKA 1ZCBA 2WMOB 1J8YF 3EXAA 1PVOA 5KSPA 4RD4A 3U2QA 2VO1A 3LFUA 1NMYA 3H86A 1VECA 1NKSA 1XMSA 4Q21A 1KSGA 1DAFA 1AQYA 3I73A 4MRSA 2QSZA 4BFUA 2ZI3A 3SDZA 4E09A 4DDVA 4BLOA 1PLKA 4DSTA 1XX6A 2JAQA 2FZ4A 2IT1A 1L4UA 4LJYA 4TMTA 2RGDA 3CF6R 2ANCA 3I92A 2ZRMA 4FXPA 5HKKA 2HJGA 4LUCA 2BMJA 5CM8B 5FUYA 2WJVA 4B3BA 2QENA 4QBHA 5H70A 2D2FA 3EPKA 1IY1A 2JJ2A 2BMEA 5CJPA 4WXRA 4F38A 3KXLA 4RZUA 5DYGA 3NHAA 4MYCA 4KVGA 1E9AA 1NMZA 2QAGA 1XFAA 3LV8A 2GETA 1KI7A 1KAGA 3CNOA 4XWAA 2OLJA 4IHQA 3VX4A 1CJKC 2K5UA 4II7A 4QL3A 3QXCA 2NZJA 3LW7A 3UATA 4KSBA 1O87A 4G5QA 4TZ6A 3THOA 3NC1C 1VTKA 3QVUA 3RAPR 2H57A 5EXXA 2DFNA 2CEAA 2QAGB 2ZYWX 4DCVA 1QVAA 1IXRC 3PQCA 1D9XA 3BJIC 3SE0A 2RCNA 1XTRA 4MYTA 2PMKA 2ZJOA 4WW0A 1UF9A 5CK5A 5CJ2A 3B6EA 5KYKA 1XD9A 4LJ5A 4ESVA 5JI3E 3UK6A 1H8HA 3M0EA 2ODNA 2Z4RA 2HV8A 4ACAA 2GEUA 3MGCA 3BK7A 5AK0A 1XBTA 4RD6A 2P2LA 2WSSD 3VHLB 3ZVRA 4R7ZA 2WWYA 1S8FA 2IW3A 2E1RA 2ZRDA 4LC0A 3NH9A 4NL4H 5FOTA 1XTJA 1NVXQ 4LPSA 4MGKR 4CEIA 2Z5FA 4QNMA 1DE0A 1GKUB 1N5IA 6Q21A 1F2TA 4TTPA 3W34A 5FBWB 5DYIA 4HDOB 5LPNA 4OQXA 3CR8A 1W48A 1VHTA 3PXGA 1G3MA 4JLMA 2C77A 2BKEA 2VHUA 3U6BA 1M7GA 3QVVA 1N2CE 4MRRA 4UNNA 2GXUA 4GMDA 2OAP1 4QHSA 3BGWA 2IS2A 5DN6D 3IIJA 3GQBA 4F93B 2JLXA 1U9IC 2RGCA 3Q8XB 1ODFA 2H92A 4CEIB 2QTHA 3AVQA 2IK8A 1II0A 3R7WB 2ZSEA 1I2MA 4QG7A 2FSHA 3NXSA 3VU9B 2JEOA 4UNRA 4JLDA 4B3DA 2WZQA 4TL7A 1Z29A 4JT4A 2NOAA 3TW8B 1FW6A 1UEJA 2IS4A 3MWKA 1AK2A 2JJ1D 1EWRA 2X77A 2QRZA 4PC3A 4A15A 4M4SA 2OXRA 2ASEA 3MJHA 2OXCA 4FMCB 4JLBA 2MMGA 3A1UA 4JBWA 3DDCA 2D4HA 3GJ4A 4BLPA 2WVJA 2P65A 5JWOA 3V00A 3PEWA 1GSIA 3CX6A 3C4JA 1VG9B 1R0WA 1LY1A 4M9XA 5JECA 2WKRA 1GIAA 3IEUA 4QGHA 1R0XA 2V7QA 2Z43A 1DO0A 1TQDA 3K09C 5G3ZA 4ZV4A 4M0LA 4KLNA 5B57C 2F55A 4C2TA 3L2OB 4IKEA 2ONJA 5K8TA 1XPOA 2CVHA 3GD7A 3W3ZB 1A7JA 2CK3A 2XTNA 2FN4A 4M1OA 1TF7A 3A1TA 4OL0A 3WMFA 1NVVR 4OK6A 2J59A 2QY9A 1OHHA 4Q02A 1G3IA 4B47A 1CJTC 3EZ7A 2W0MA 4JBXA 2AD1A 1FX0A 3KJIA 2VIIA 4AYXA 1XF9A 2RGBA 3BC1A 3TLXA 2FX3A 2ZR7A 4LV8B 4F4IA 2IX3A 4IFBA 1G7TA 2ZRAA 4KJZA 2C9YA 2BEJA 1NNEA 1RPZA 3PJRA 4LX0A 1LS1A 2AD5A 4MUBA 1FMJA 3MAAC 3I8XA 3EA0A 3SOPA 3GCGA 2GF0A 1W0KD 1FQKA 2EYUA 1S96A 1WRBA 4IVQA 1P9WA 3CO5A 2VP0A 1D2MA 1C4OA 5H8WA 2GRJA 1AS0A 3K0SA 2WOOA 1FX0B 2ZYVX 4Q5IA 4HLDA 1E32A 2XITA 3X2SA 4HDQB 4B2LA 1H8HD 4HLUA 2X2FA 3TNFA 3ZQ6A 1OB5A 1QHNA 5CLLA 3B1VA 1Q22A 1CTQA 1ZM2A 2J7PA 5CYOA 5JJLA 1KAOA 2A5JA 4EJSA 2AHOA 2ZRKA 2QSYA 3DZDA 1ZIOA 3EIQA 1KI1A 1XPRA 4MGZR 4NKRA 4Q47A 3DHWC 2N42A 4E5UA 1G5TA 4I4LA 5EE0A 4DSUA 2ZRBA 1VIYA 1IN7A 4C30A 1KZ7B 4TL9A 4CEJA 1LFDB 4DDUA 1OXUA 2QTFA 2JLZA 1E2KA 4TLEA 4PPNA 5CB8A 3A4MA 1T3LA 5JHHB 1ZJ6A 1V43A 4D0LB 4EJSB 1HQCA 2OT3B 3C16C 5G3YA 2IA5A 5AUNB 2WWGA 5HZHA 2OCYC 4QNRA 2ZETA 4Q19A 4I81A 3VR4A 2XAUA 2ORIA 4JLVA 5G41A 3BE4A 3E2IA 2VRWA 2R6AA 2DFLA 1S3GA 4XVUA 1JPJA 4M9QA 1OFIA 2GKSA 3I61A 1M8PA 3B78A 1W2HA 1HA3A 3SFVA 4CEJB 1AA9A 2ZRFA 3VR5A 3OE7D 2UKDA 4KFUA 4H1VA 3VKHA 2J5XA 3BORA 4U02A 1Z2CA 1D9ZA 1X86B 3PVSA 2CVFA 4NCJA 5FOWA 3WRYC 1R6BX 2R6GA 1R0ZA 1W1WA 1N3BA 4Z8XA 5FL7D 3M4YA 2YINC 2WIAA 4TLAA 3JVUA 3TVTA 1OXVA 2IXFA 3K09A 3TUJC 5LB2A 1E2GA 4QJ3A 1ZP6A 4RZ3A 3U7GA 3THYA 2OBNA 3OEHD 1P2UA 3E70C 1G16A 2A3RA 3WYAA 2IF2A 3SHFA 1N5LA 3WRXC 4R2HA 1UKZA 4PC1A 1T91A 3D8BA 1TL7C 4GSYA 4MYUA 5AWFC 3GLGA 1MT0A 3W6NA 1G20E 1W4BA 3LLUA 4D82A 1E9FA 3H2YA 4P4UA 4BGDA 5KO2A 2HXYA 4GPTA 4BRWA 4C0JA 1NP6A 1WE2A 1ZM4A 3QXJA 2EFEB 4DDWA 1T9HA 3ZIAA 2FZLA 1HT1E 1E2PA 3AM1A 1ZD8A 5AJZA 5J5CA 1IBRA 5EP1A 2B8WA 3THYB 2CK3D 3BFXA 2QRNA 2XXAB 2WBLC 3B2EA 1X8JA 3AH8A 4L16A 1E9BA 3RABA 4B3FX 1ZM3A 4JLKA 1OHHD 5AJXA 3MJRA 2QGZA 4C2UA 3GLGB 5EXPA 2RB4A 5L3RA 4Q4AA 3GFPA 2EFDB 4A2QA 1PJRA 1X1RA 4WAUA 3EPLA 1HQYE 3CRMA 4JKYA 2V9PA 1HY3A 5GVRA 4H1UA 2FNAA 1LTQA 5BW8A 3IIKA 3X1DA 2YV5A 1XZPA 3ADDA 1E9SA 3PR1A 1I4TD 1RRFA 4L5BA 2ANBA 1WCV1 3RLFA 4M1SA 1TQ4A 1M2OB 4FIDA 4GI7A 5HZKA 4A6XA 2G9NA 4NYMQ 4C0QC 3LBNA 2BEKA 3LXXA 3GMTA 3TIFA 5AR1A 4Q4AB 3ASYA 1IN8A 1X6VA 5DNYB 4ZCMA 1S4QA 2KSQA 2YJTD 4TLBA 3TGPA 4D4LA 5C2JB 4TTQA 1U99A 4OHZA 3NBYC 1T5LA 4EPWA 4FI3C 1E3MA 2F43B 2W6JA 4B35A 1GRQA 3KJGA 1E0SA 4AD8A 1AJEA 1Z08A 2IL1A 4TMKA 5K8IA 4GBMA 2H1LA 1LVGA 4EIWA 3CIOA 3QY0A 3OIWA 4KFSA 2F1IA 2WOJA 1N6NA 4TMZA 3K9LA 4HEJA 3VX3A 1G4UR 1TF5A 3ZLJA 1CIPA 4FCVA 2GCNA 1S2MA 4LRWA 1AKEA 1OYWA 1CR0A 3A4NA 1X1SA 2QQ0A 1ELOA 4GZMA 1UBEA 2XOKD 5AJYA 3R8CA 1BIFA 4LJ6A 4XOIA 2CHQA 2OILA 3CPHA 1M74A 1DVRA 5FTKA 1AIPA 1WF3A 4LJAA 4XWKA 2VL7A 3U7HB 2IS6A 2C2HA 1Q12A 4Z51A 3Q7QA 2ZXUA 4JLJA 1AKYA 4C0SA 1WP9A 2JDID 3LO5A 4I1SA 4Q1BA 4ZPXA 2NTYC 3C8UA 3U7EB 4YMUA 4QXAA 3DKPA 1X8LA 2ZROA 3QPUA 1AS3A 3BFVA 1MV5A 4QGFA 2VPPA 4TTRA 1FMLA 4IVPA 1KO5A 5FPSA 2F9MA 3U3MA 3MG9A 4TWZA 1CRPA 3PUWA 4ILEA 4KHZA 4TLCA 3AVWA 4AKGA 1OH5A 4D0GA 2G0TA 2XJ4A 4Q1EA 5IK2A 3CRRA 5A5GA 1ZC4A 8OHMA 3D31A 1HV8A 2GCPA 5CDFE 2GZAA 3WBJA 2G6BA 1AN0A 2BDTA 2HLDA 1IJEA 1FQJA 2R8RA 4GZLA 4JS0A 4OQFA 4KSCA 1U90A 2HDNB 4CRWB 2IC5A 3T1VA 5JZVA 3DZ8A 3OIVA 1Q3TA 3Q5EA 4FCTA 4PC2A 3AP2A 1TQ2A 3UIEA 3P4YA 1YJ5A 1GP2A 4A2WA 2QI9C 3KZ1E 4ACBA 4YMSA 1EX6A 2CCKA 2JGNA 3SNHA 3BH0A 2W00A 4UNSA 4AG5A 4P31A 3AVYA 3TSOA 1Q20A 2FOLA 3P27A 4PSVA 3ZIAD 4DSOA 3NHBA 2QPOA 1CRQA 3ETLA 1KYIA 4MKGA 2IUSA 3MWJA 1T0HB 3RHFA 4AG6A 4OYHA 3SJCA 1VYUA 3T1OA 1OV4A 3TUIC 5FBVB 4Q4JB 1UBFA 1W0JA 5J40A 2XTMA 2RMKA 2QTVB 1CJUC 3TAUA 4JJZA 2CDNA 4M1MA 3RS4A 3IKJA 2CLCX 2NGRA 3WNBA 521PA 3NH6A 2C96A 2PEYA 3N5CA 1GKYA 4MRVA 4TSFD 4DEYA 5AUOB 2HYDA 2R65A 5FUXA 1Q0UA 2G3YA 2XJ9A 3RRNA 1NJGA 2ZU0C 1OIXA 4U5XA 3OIUA 5TMPA 3CH4B 3KL4A 4DJTA 2CE7A 4EKDA 3ZH9B 3GJ8A 4MGYR 4CW7A 1BMFA 3CWQA 2QPAA 1T3SA 2BKUA 5TY0A 4B74A 4TQ9A 3SBDA 1DG1G 2O0JA 2OUKA 2QE7D 2KI5A 1KO4A 2GJSA 3A36A 4BFWA 1UPTA 3L0IB 4PXAA 2O8FA 4G0NA 2GNOA 2ZJAA 4PSAA 4MRNA 4PO8A 4CVNA 4KCGA 1K6MA 1W47A 4XVRA 4JMPA 4ZDIA 3NBZC 5IDVA 2N46A 1N0WA 1NN1A 3NKVA 3VR6A 1E2NA 2B21A 1KSHA 3VAAA 2Q3MA 3QF7A 3RNLA 3WHLA 3T15A 4Q9IA 3RRMA 3WP1B 1MRSA 2DR3A 4AY2A 1E9DA 1L4YA 3AF4A 1FTNA 2ZR9A 2QROA 4A0RA 1KI2A 2XSZA 3AGQA 3FPAA 2HXSA 3GJ6A 5FR2A 2GEDA 3I4LA 1FUKA 2J0UA 5FOSA 2O8FB 2RGEA 5GJBA 3MUFA 1Z6XA 3M6AA 1W4CA 2WJGA 1SHKA 1AGRA 2HJVA 2ZJ5A 3HJNA 4YC7A 2N1BA 4FW9A 4DLWA 5KTYA 3L43A 3FE2A 1J70A 1TAGA 3OEEA 4DB4A 2IF0A 1DBSA 3SJAA 4NTZA 2J0UB 2GTPA 1IN4A 1R10A 1LW7A 3LLMA 2ZEJA 1A5TA 2GVZC 4HB2A 3A1WA 1Q44A 3SHWA 1OF1A 2OZEA 3HU1A 1XMVA 4IEIA 3CRVA 2G1JA 5EQTA 1G8FA 4IDPA 5IK2D 4C7OB 2FDCA 1KSFX 2PBRA 4HATA 2A78A 5JEEA 3T5DA 1P2TA 2ZS7A 3TQCA 1DAGA 4EDHA 2FFHA 4KFTA 2J41A 4TYQA 4UQOA 4JLNA 1II9A 1CR1A 2PLRA 5DHAA 2GXAA 1RE0A 2NMVA 2UZIR 1NVUQ 1OLOA 1R4AA 4URYR 2D7CA 2OBLA 3T5GA 4B2IA 4TZ0A 2F9LA 1MRNA 5BYKA 1GUAA 2IS1A 2WWIA 4BLQA 2IUUA 1RW4A 2WJYA 4TYPA 2EFCB 4M1KA 3KFVA 4NDZA 4Y0VA 5KNBA 1F5NA 1SVSA 4RFVA 3GJ5A 4URVR 1Q1EA 4G5RA 4Q9LA 3ZDQA 1RC8A 1ZVQA 2RH5A 3VHXA 2ZRGA 1SQ5A 1VCNA 4OI4A 3REGA 4BEJA 4WZ6A 3HDTA 3CF2A 1KY3A 4GOXA 1IONA 1BKDR 3C5CA 2IYZA 2GCOA 2X1VA 3B1XA 1P3JA 1DARA 1T3HA 4MKFA 2FH5B 2CMKA 3PV0A 1H8ED 4P4TA 1W36D 3U3OA 1UBCA 3AUYA 4EQ6A 2IYTA 3N70A 4IVRA 2PMDA 4M9SA 4B73A 3NDPA 3B1WA 1SKQA 1Z28A 2NPIA 4P4SA 1KJZA 1KO8A 2PX3A 1E2HA 4TYNA 4LWZA 3TR0A 1ZNZA 2WJHA 2GCOB 2DFTA 1OKKD 1T5IA 4E03A 4QM6A 1DAKA 2YOGA 4A4DA 2RGNC 1HYQA 2WV9A 5KDOA 1CU1A 1RZ3A 1VPLA 2D62A 4DB2A 4PR0A 1D6JA 1T6NA 2ZS8A 4QBGB 3K70C 1RRGA 1Q1BA 1E2MA 4EQ6B 1G8GA 4I1VA 1XEXA 1L7VC 1Z6YA 1DTSA 1MKYA 2PT7A 2HT6A 2F3TA 4B2PA 2ZSFA 1TADA 2V54A 2FGJA 4P4SB 3S1AA 1S1CA 1G4AE 1QHYA 4UKDA 5JWRA 3HYRA 2XSZD 1Z0IA 4BWYA 3UMFA 2HF9A 2PJZA 4NCIA 1WMSA 1NLFA 2QL6A 3BFKA 2ZYUX 1VYTA 1VCIA 4CYMA 4YXWA 3BAFA 2JLWA 3TQFA 2IXGA 2GA8A 1KKLA 1XEXB 2ZVPX 4IOKA 5AJWA 5AUPB 2P67A 4U00A 1Q57A 3I5YA 4PZZA 4GOKA 4US2R 1KJYA 4DT1A 5CYPA 3S1AB 3OEED 4OK5A 1A2BA 2DHRA 4MQBA 3TE6A 2OO7A 1DPFA 2O8DA 4LJ7A 1E6CA 4NPHA 4UNQA 4Q7MB 2R6DA 3BOSA 2WSMA 4GP7A 4N0DA 1R5OA 2QM7A 4D81A 1ETUA 1L8QA 2ZE7A 5IF9A 1V5WA 1EGAA 4YDSA 4MDEA 1I4LD 3CRW1 4C0KA 3W90A 4C0LA 1VDZA 3QUSA 3KDSE 4XWOA 3T12A 2H17A 4Z1MD 3SQWA 3VR1A 4LSGA 2C78A 3K1JA 5CDFA 1RJ9A 2I1QA 3PG5A 4NYJR 2LKCA 2YOHA 4DT1B 1E96A 2JLUA 3E5HA 1UDWA 5ELXA 2BM1A 2TMKA 2I4IA 3LXRA 2GZDA 1KMQA 3AP3A 2BJWA 2O8DB 3KQKA 2J45A 1JALA 4PPFA 1GDDA 2ZI5A 4KITB 3DEFA 4Z8YA 1CR2A 1J99A 3QXSA 4PQYA 3ZYCA 2ZJBA 4TYYA 2W2VA 1GNQA 2ODEA 1G8PA 1RJ9B 4Q9KA 4ABYA 1N5KA 4KBGA 3KXIA 4JSYA 3ECCA 1NBMA 1GTVA 4P0TA 3KXKA 1JI0A 4LY6A 5B30A 3KJEA 3B85A 2J0SA 1SHZA 1EFRA 2O0KA 3QQ5A 2BWJA 1DAHA 1Q3HA 3LX5A 3R7WA 1XTQA 5EE1A 2OCAA 3VU9A 1G7RA 3DVLA 2VH5R 5FUVA 2WWWA 3SZRA 1X3SA 1JR3A 2PL3A 5DI9A 1PLLA 4DLUA 2QMEA 3WYGA 2BBOA 3QF4A 2VP9A 2R62A 1DELA 1GKIA 4M22A 3DM9B 2PLFA 1E2QA 2VP6A 2BMFA 1KK3A 3RS0A 2NO9A 2OFXA 3BB4A 2WPDA 3SU8A 1KNXA 3GLFE 1QF9A 4M1WA 3SYKA 5KU1A 5FBQB 2OV2A 4O2LA 2GBLC 4D4KA 4IOJA 5E7MA 3BD9A 3AP1A 4J0QA 1FNNA 4GOJA 1T0JB 2W58A 4JIMA 1KI4A 4RFSA 4EPRA 2FFQA 3QF4B 4WOPA 4HAZA 3TK1A 1XZQA 1XU4A 3FMOB 4HYYA 3T35A 3K70B 3WMEA 1AZTA 4GP6A 5FTNA 1ZM9A 2J1LA 1WBBA 4A2PA 1Q1ZA 3L0SA 1BOFA 4D25A 3VR3A 5HKKD 4EPTA 1NIPA 3DOFA 2C8VA 5C1BA 1Z3IX 3HPQA 2JJ2D 2CHGA 3EPHA 3K9HA 4RFSB 1XEWX 1JB1A 1A4RA 2QMHA 3D3QA 3NBFA 3EZ2A 4ZIRA 1E79A 1M1YE 3A8TA 2VEDA 5KDDA 3B1ZA 3BS4A 3TBKA 4Q7JB 1UBGA 5KDLA 3CM0A 3EPJA 3TMKA 1S9DA 1R5NA 2FE4A 2GHIA 3BIFA 1P75A 2YC2C 1ZINA 3BRWD 3K0AA 1OB2A 2WAYA 1F3OA 4C3ZA 4FCWA 2V1UA 3THXB 1YZKA 4R71A 4HB0A 5KSZA 3AVXA 4NU0A 1NN0A 2HF8A 2F1HA 2NG1A 2Z6VA 5FPHA 2A7QA 4NCHA 1OXTA 1CULC 1JXOA 5JS7A 2OEPA 5CIWA 4ZIRB 2NO0A 4G01B 1YHNA 4F92B 1YZGA 2ZJYA 3DKVA 1GVNB 3FTQA 5TARA 4PHTA 1S1MA 4XIGS 1LF0A 3EW9A 2ZSBA 4LYHA 3AF2A 1NVVQ 1Y63A 3HR8A 2ZE8A 1CR4A 4CF7A 3LH5A 3K0AB 3GLIE 2VHCA 1ZIPA 1COWA 1JEEA 4HAVA 3W9YA 2VYFA 4YLGA 3QSYA 4TL6A 1Z6AA 4F7WA 1E2DA 2D3WA 1KO1A 4B43A 3W5IA 4HAXA 3OESA 3H1TA 4BLSA 2D7DA 3OAAA 3I62A 1YKSA 4NZYA 4BEBA 1SXJE 2QP9X 1JR6A 3KTAA 3D7MA 1ZUNB 2YOFA 1ZU5A 3ZVMA 1F6BA 1G21E 1BYIA 3MWLA 4M1YA 4QOSA 2BBSA 2ORWA 3EIEA 1NBMD 1LS6A 3RRZA 3HP1A 4DLYA 4PSKA 1Z6TA 1IAQA 2HCBA 2QPTA 3U61B 1G5PA 3FOZA 1FZQA 2ZIAA 4TMXA 4OHWA 2FG5A 1G64A 3DMNA 2IYWA 2QBYA 2R9VA 4JZKA 1G9XA 5KSOA 2XTZA 1U9IA 4DEXA 3KTAB 3QJYA 3SJZA 5GADl 1G3RA 5HPYB 3CRQA 2XZPA 2ZUDA 2CCJA 4B71A 2ZAMA 5FTJA 2GBLA 2QT0A 4N0EA 4BFYA 2RGGA 3B1YA 4LZZA 1YZNA 4W9MC 1QZXA 4X8OA 2WKPA 5DH9A 1C1YA 3UANA 4GL2A 2D06A 4LJ8A 4ZO4A 4OHXA 2CE2X 2QBYB 4PX9A 3T06B 1YZUA 2YWGA 3KKOA 3ZS8A 4DZZA 1JAHA 2IYRA 1WDTA 2O8CA 2P0EA 3UWKA 5DLQC 3LA6A 1GG2A 1OXXK 2AKYA 2BVNA 2DCUA 5TDHA 4JSTA 5KNCA 2O52A 3BXZA 3KKQA 4O0MA 4WZAE 4BFSA 5M04A 2IWRA 3LQQA 1GNPA 2GJKA 2R6FA 2B7BA 3R9IA 4MDFA 1Q21A 2KB0A 1SVOA 2O8BA 4H9GA 2XXAA 3D6TB 4QC2A 1OJLA 3TR5A 3I5XA 2OE2A 3KB1A 2IYYA 3PIRA 1HE1C 4XTRA 1KJWA 1TU3A 3UG6A 5FTLA 3SQXA 2FPMA 2W6IA 2OESA 3ADKA 5BN4A 1NVWQ 1HE8B 1GAJA 3NC0C 2O8CB 2V7QD 1PUIA 1OYYA 1WB9A 2C04A 1E2EA 1JQLB 1LB1B 3RC8A 2IEYA 4RD1A 2A5DA 5FOXA 4I1OA 4WVFA 5SZJA 2O8BB 4IXMA 4BFZA 5FTMA 4GDFA 1P60A 4MGIR 4YONB 3B8HA 1F60A 3CLVA 3KKNA 2F1JA 2DWQA 3QG1A 1YRAA 1ZNYA 2IBMA 2EU8A 2QZ4A 2WIBA 4NHOA 3M1IA 2GDJA 5HCNA 2FF7A 2ATVA 4KV9A 4W7SA 1ESMA 1UKVY 3VQTA 1W46A 2BCJQ 3AKYA 4QBIA 2BOVA 1XMJA 1KIMA 2F43A 3B9PA 1IN5A 2ZQ5A 1EFUA 3G5UA 4GMXA 2PCJA 3A37A 3IBYA 1JJ7A 2KE5A 3BH7A 1XPUA 2BHRA 2CL6X 2KJQA 4UXIA 2A9KA 1G6HA 4NE2A 2GK7A 4AKEA 3FHCB 4NYMR 1NI3A 1A82A 1GL6A 1OFTA 2R44A 3KUCA 2XNDA 4Q1CA 3IO5A 3TW4A 4BE7B 4Z54A 1N0VC 1E69A 1DAIA 3FFBA 3PEVA 5KOYA 4AI6A 4ERNA 2J7PD 1F48A 1KY2A 3EARA 3F8TA 3LBHA 1KZGB 3RVBA 2ZPTX 4BZQA 4OQMA 4Q1FA 1YU9A 4DCNA 5JLJA 4QKQA 3ICEA 1UKYA 1HURA 3LBIA 3WHKA 1OH7A 2WWHA 1YZTA 4PAOA 4JLPA 1J7KA 2BV3A 2CNWA 1IQPA 1SXJC 4URZR 3BBPA 2J46A 1VMAA 2Z83A 4RCZA 3TJZA 2H18A 3K0FA 2A2ZA 3FVQA 4RD3A 2YHSA 4ON9A 2QT1A 4QBFA 2V55B 5IRCD 4JYCA 1R8SA 1TX4B 3GJ3A 3GEIA 5D3QA 1NJFA 2QORA 5EZ5A 1W7AA 2Z4SA 3T1QA 2WJIA 3FKQA 1UDXA 3LAWA 5EE5B 3V9PA 1EK0A 4NONA 4HUTA 3KKPA 5L3SA 4RCYA 4DWJA 4POAA 4IOMA 4LBYA 3T34A 3K0FB 3MD0A 1P5ZB 1P61B 2JASA 2VTKA 1ESNA 4IFEA 4KVAA 1OH6A 3KKMA 4L9WA 2WKQA 2ZYTX 5JS8A 5C46F 2ZI9A 1KHTA 4LHZA 3MRSA 2ZJ2A 4Q03A 2C9CA 2GF9A 4KI0A 1QHIA 1G8YA 2QQEA 5EE3A 4C4PA 3T1TA 1SKYE 1N6HA 1N6PA 2C5LA 3F5FA 3C41J 1RRPA 2FSGA 4FD2A 3UKDA 2E9SA 4DLRA 4KLZA 2FFAA 1OW3B 5L3SB 1EXMA 2KBEA 2YC4C 5CB6A 2GAAA 3O8BA 4DBLC 3GP8A 1TPZA 2Q0HA 4KBFA 4Q4JA 5FI0B 2WM9B 4QGGA 3T61A 5F9HA 2IYSA 3JZAA 4TT3A 1G41A 2W6ID 1IXSB 5TB5A 3O8CA 2CL0X 3RANA 2REOA 1J90A 2WHXA 1LV7A 1UEIA 4RSGA 4F91B 3AVTA 4D80A 4B6FA 3RSOA 4KO8A 1TQ6A 3SR0A 1EESA 3ICQB 1CS4C 2FEOA 4QM7A 2P3SA 4E07A 3PEUA 1T8UA 2ERYA 3GFTA 1EX7A 3QXXA 3OIYA 2VF8A 3R20A 4Q7KA 1EFTA 3ND9A 4MITA 1P2SA 2QUZA 2CCGA 2DY1A 3OFNA 3QPWA 5FPTA 3RWMB 5JRJA 4D26A 1P72A 2YNMA 4R98A 1M7HA 4CT5A 1J2JA 4KYUA 4YMTA 1WBDA 3AF3A 5UKDA 4FWIB 1OPXA 5JMTA 3AEZA 5K8UA 2DFKB 3EAQA 4K8OA 2YVUA 2NO7A 3LX8A 2JJ8A 3L8ZA 5DSZA 4XD7A 2GJ8A 2LWIA 2GXSA 1TTTA 3EZ9A 1P62B 4Q1DA 1TUIA 4M9ZA 4HB4A 1N5JA 2AFIE 4DLXA 2F6RA 3TKLA 2JATA 4WIAA 1RKBA 3GLIA 4EFLA 1GITA 3BB1A 3UWOA 3FMFA 3SI7A 4BFTA 1P9RA 1QHGA 2JA1A 4JKIA 2H16A 2XNDD 1KSJA 4L9SA 5JJKA 1HTWA 2Z0MA 2Q6TA 1SVLA 2W6JD 2XEXA 4MRPA 4E22A 1IN6A 1OFHA 1TNDA 3CF0A 4UNPA 2EYQA 1GILA 4TQAA 3P20A 5DGXA 2QAJA 1E1QA 3GPLA 5DHFA 4ZI3A 5J4YA 2PT5A 1U8YA 3A1VA 2A5FA 1QRAA 3GLIB 1MO3A 4R9UC 1KO7A 2V8OA 4P32A 1Z06A 3RSLA 3GFOA 1WA5A 2VP4A 5H1YA 1IHUA 3K8YA 2JIZA 1PV4A 1F2UA 1FP7A 4W5JA 3SFZA 3R8FA 4B48A 5B58C 4KODA 1B0UA 1E2FA 2AK2A 2GESA 4K81B 1XJCA 4OHYA 1W4RA 2BM0A 4A0FA 2HT1A 4C7OA 2ORVA 3W6OA 4A0HA 4NP6A 4QFMA 3CR7A 4ZDKA 2ERXA 5GJWC 2Q9CA 3EWSA 1JQJC 5IHPA 3R9WA 3A4LA 3RS7A 4IEEA 3EC1A 1QDEA 3P4XA 3EIHA 3WYFA 3FMPB 4DHEA 3KQUA 1UJ2A 5HR5A 2FFBA 3NTUA 1HH4A 1NG1A 1F2UB 4MA4A 3AV0B 3QXHA 4LJ4A 5HE8A 4XSGA 3RS5A 4QRHA 4IRUB 2RHMA 4S35A 4NYIQ 4LOAA 1HEIA 3A6PC 3AB3A 4S2EA 4RZXA 2AN9A 2UVQA 1VG8A 1U2RA 5FL3A 1EG7A 3N2EA 1IJFA 5LB4A 2HLDD 2J0QA 3O47A 3BWDD 3GEEA 5EZ6B 1Z5ZA 1GRRA 2EFHB 4RKFA 4YMWA 2CBZA 1VCOA 1NSFA 5CM9C 2A5GA 1NSTA 1DS6A 1NLYA 2AR7A 3ZVNA 2RGXA 1MABA 3I8SA 3AGPA 1NIJA 3HR7A 4TT3D 4AC9A 3GJ0A 2X19A 2RKOA 4C0HA 1E1RA 2C95A 3I1FA 4LPKA 3UMRA 1P2VA 1W49A 3I3SR 3OZXA 1MOZA 3AVOA 3ND8A 4ITRC 5EUMA 4LDJA 5B64A 5BYJA 4JLAA 5TV2A 1DEKA 4PPGA 3EZFA 3FFAA 2JLQA 1JECA 1W2GA 4US0R 1W0JD 2QEQA 4PAQA 3HU2A 4NCKA 5JCZA 1MABB 3P26A 2EWVA 2F3RA 2C03A 1YZQA 3LVRE 2OCPA 3H0KA 3VTKA 2FEMA 3QNUA 3ZJYA 1KDPA 3LWNA 1YRBA 2UZ3A 4XTCS 1Z47A 3K53A 1VG0B 2EW1A 3RS2A 4FMBB 3LRPA 2EFGA 4NBSA 4XD7D 2O8EB 1P4SA 4OKSA 2HYIC 3IPYA 2P5SA 4M53A 2W2TA 1BMFD 1P6XA 4G5GA 1XD2B 2GVDC 1KI9A 3Q9LA 4Q48A 4LBVA 4DLZA 3FHTA 2ZSAA 3AF1A 2R6CA 3EWAA 2CLDX 1VYVA 4KU4A 2ECKA 3K0CC 4IDOA 1KNQA 3I72A 4PQRA 3UXMA 5KUTA 2A5YB 3IBGA 1EFCA 2BBWA 3AKDA 5H68A 4A9AA 5G40A 5K8LA 1Q1QA 4OQLA 4X8LA 3U3JA 2I3BA 2VP5A 4P33A 4QHYA 4TYWA 5L3VA 1QBKC 1E1QD 2C99A 5DN6A 3KJHA 3KUDA 2IHYA 2V6IA 1K5DA 2JLSA 1CP2A 2B7CA 2W83A 4LYJA 4N1AA 5F3WB 4MH0R 4B3CA 3FYHA 1U98A 4BLTA 1ZU4A 5L8VA 2Q9AA 3Q85A 3VNUA 3KX2A 4BZPA 4AK9A 2DYKA 3IHLA 3CZPA 3CNLA 1AS2A 4G5OA 4RKEA 5CLQA 4PO9A 4UJ3A 4PQFA 3WP0A 4O3MA 2JJ1A 4HUQA 4RVCA 3QKSA 2H5EA 3NEYA 4LJ9A 1Z63A 4HZUB 2ZS9A 1UKEA 721PA 3IEVA 4Q4LA 3QBVA 5CIQA 3SN6A 1MH1A 4LK2A 1NN5A 4PTLA 4L15A 3WBKA 5F9FA 2L0XA 4G3XA 1KDTA 4JL8A 4OBEA 2ZANA 5E95A 1WQ1R 3MSXA 5DI3A 3GLGE 4MKHA 5HE9A 2FSFA 5AJVB 2BCGY 1HUQA 5C4GB 3AKCA 2VSOA 1R7RA 2R2AA 4HUQB 3QKSB 4I1UA 3U3KA 4GRAA 3ZS9A 5F98A 1KDOA 1CEEA 2GK6A 5LBIA 4LHVA 1IM2A 2MSCB 3GJ7A 4V03A 4RJLA 2ZRPA 3RDPA 1W5SA 4EPXA 3RRYA 5A4JA 4LV5B 3DOEA 3O8RA 1QHSA 1SVKA 1E0JA 4PZLA 4PHFA 1XMIA 3G82C 5DI3B 4BQSA 3AF0A 4B3GA 1TEXA 2MSDB 4D0NA 4JJKA 3LQRA 1KGDA 1DG3A 5E3HA 1UM8A 1W5TA 3EX7C 1D8TA 1K5GA 3NEJA 5BQ5A 1A2KC 1NRJB 1E1RD 4MUAA 4DSNA 1PZNA 1WXQA 4NYJQ 1QG4A 1SKYB 4QJ5A 4V0ME 4D2IA 2FMXA 4TMWA 4W5HA 3KQLA 1W0KA 1G291 4GNKA 2MSEB 2GAOA 3SEAA 4CT4B 3B7GA 3B9QA 1KOFA 1LNZA 2ATXA 3VR2A 3SC3A 4EAQA 1MO6A 3A1SA 2AXPA 1FUUA 1IY0A 4LYAA 5SZKB 5BXQC 4B6EA 1KI3A 5TVKA 4B3XA 2ODWA 1RIFA 2Q3HA 3Q3JB 1LF5A 3IQXA 3ASZA 2OSBA 4JVMA 4PC6A 3E1SA 3K0CA 2BMDA 5GVSA 1Z6GA 4HLQB 1E2JA 4XH9B 4QJ4A 2Q3FA 2RGNA 2BBTA 3FGNA 1CJVC 5BWMA 1DAMA 1IOZA 3QKRA 2IYUA 4TL8A 3DM5A 1QVRA 1AM4D 4HLUC 2PH1A 4V02A 2ZTSA 4K46A 1N25A 3FMIA 2ZVQX 2IYXA 1NY5A 2EQBA 2OM2A 1E0KA 4EJSC 1YVDA 1KKMA 3NWJA 2ODBA 4B76A 5DE3A 4IDHA 1XTIA 1SVIA 4LGMA 4US1R 3K9NA 5JHGB 4FN5A 4Q00A 1VHLA 2GZHA 2OBMA 4Q9JA 3RS3A 2OFOA 4EPVA 2ZRHA 1OSNA 1VCMA 1CKEA 5SZIA 3QKRB 5F2EA 2OCBA 5EJEA 3CH5A 2ZI6A 4FMDF 4W5WA 3BB3A 2WJJA 1ZD1A 3ADCA 1PLJA 5EP3A 1CJMA 2QU8A 2IEZA 3DPUA 3OE7A 1Z83A 4LV6A 1DADA 4OJQA 2XZLA 1F2TB 2YYZA 4MYHA 5JEDA 2AWNA 4UJ5A 1KTVA 1YR9A 2FJUA 4OHVA 3THXA 1QG2A 4TN1A 4LHWA 1E9RA 4D4MA 1OH8A 3SS8A 1NY6A 1GOTA 3ZZTA 5FL7A 1MO4A 4YXWD 3H4MA 1ZAKA 3TVDA 1HT2E 3MWYW 4HI0E 1U0LA 1XXHE 1SVMA 3OEHA 3IO3A 4JL5A 1G7SA 4JVNA 1SZPA 3V4FA 3CW2A 1Y3AA 3P32A 2F1RA 2GILA 1FNMA 2PCLA 5HTKA 1KK0A 3CUEF 3WNDA 1UADA 3QE0A 2ZRNA 1OXSC 1U8ZA 3QEJA 4G1UC 4FINA 1NMXA 2ZI7A 1NLZA 4OJKA 1G3QA 1W44A 3ZD7A 1TMKA 1XTSA 4Q18A 1Z2AA 2B92A 3BH6A 3NIBA 5FI1B 2QN6A 3IDQA 1SGWA 4XVQA 3SBEA 3HYTA 1IY2A 2NO1A 1XB2A 4HAUA 1Z0AA 4AKHA 3C5HA 1FOEB 2RAPA 2VF7A 4L4UA 1E4VA 4M2LA 3J81k 3MCAA 5LD2C 1DO2A 5CK4A 2ZE5A 5BN5A 4O2RA 1XWIA 4U7DA 1IXZA 1GL9B 2G83A 1ZUIA 4DKXA 4Y0AA 3QOFA 4DXAA 1G6OA 4ZKDA 1ZW6A 3ZVLA 3CPEA 5E7JA 2AFHE 2NZ8A 3I32A 3UMSA 4IXNA 3CKLA 3U7FB 2Q9BA 1YR7A 5D3MA 4URXR 4MKIA 2CHVA 1W4AA 3NBXX 1ZCAA 2FA9A 3IGFA 3EASA 4Q01A 4PO1A 1XCMA 1NG9A 2GWHA 1EFRD 3NDBB 3QENA 2X8AA 1ANKA 4X8HA 3IQWA 3LVQE 4EUNA 4WZBE 2PZEA
chains in the Genus database with same CATH superfamily
1FP6A 2BMVA 3VPXA 1NNI1 3VFDA 1B43A 1C0KA 2HLNA 2Q2NA 4G5SA 1E4YA 4OM8A 1GAEO 4S1TA 1NC1A 2B8NA 3A9CA 3F78A 2OBFA 2FETA 4UCXA 4YRPA 3W5AA 1HYHA 3OX4A 4P3YA 4N76A 3EFEA 1WZUA 3FSEA 2DX7A 1NJ6A 4GT1A 3ZK9A 2JH8A 3HE3A 4BMYA 2I1VB 1QG0A 4YJFB 3Q9NA 4WDQA 3K2QA 5KI6A 3AY6A 1KU0A 2DZDA 1JNYA 3W5UA 1S0UA 1N2IA 3ZWYA 4CMAA 4E2XA 1PNVA 3UVEA 1K6XA 4HAYA 1YZYA 1LPSA 4RY2A 2FOIA 2G9ZA 3BWXA 4NU5A 1I4DD 1O97C 4RLFA 1ISMA 4GZ5A 4M6WB 2ONKA 3MJEA 4PAMA 4K6GA 2DTXA 3FCXA 4GICA 4L3VA 3LY5A 2YWCA 3HKDB 5CH8A 4UMFA 1HOXA 2G08A 2OHFA 3NBKA 1VZ2A 1M8KA 2R6ZA 2X2EA 3ZYZA 4OFZA 4UXHA 1XNJA 4D41A 4F1KA 1T43A 1B1AA 4M9RA 4P5DA 5DM0A 3UT5B 2Q4DA 5IAOA 2OV4A 4CGZA 1WPGA 5LQMA 3DFIA 3NGXA 3U44A 2AK3A 1LVHA 1US8A 121PA 1EDEA 4WLEA 4ZQIA 5B53A 4YAJA 2CBXA 3V3TA 3ZDBA 3GA0A 2WYUA 4Y3UA 3SP1A 1N6RA 3CR3C 5C1PA 4WCFB 2WF6A 2RAFA 2A5LA 2IXEA 5E2AA 4E46A 2DB3A 5TPWB 3A1FA 3MMPA 3VSAA 3WXMA 5I6DA 1RI4A 2GEVA 2DPXA 1XF1A 1ZO8A 4ZJUA 4KAJA 1GDTA 2GPJA 1UJ4A 1RMYA 4OIFA 1F4VA 4TKMA 5ELMA 2QX6A 1E79D 3QU9A 1HYGA 1R8XA 2B2NA 5G2OA 2KLHA 3DXFA 4WNIA 3ACDA 4Z4CA 2BJVA 4TVKA 3CVYA 2IHBA 1C3JA 3CNQS 1SKUA 4FHZA 2R5NA 5EJMA 1DKLA 5DGIA 3TTVA 5DBHX 1N6IA 3WRWA 4UVDA 2LVBA 2P90A 1TEZA 1D2NA 1XJWA 2B37A 4IDNA 4EPYA 1CY0A 4YH1A 1XN1A 1DRVA 1NF3A 2D2EA 3QITA 4TSRA 1K0FA 4DC9A 2UUCB 3L79A 1JMKC 4G25A 4QHTA 2WJAA 4KXQA 4KQHA 4MW9A 1ABEA 1YUMA 3OJLA 3AB7A 1ESDA 4JYBA 4LXXA 3TNLA 3KJXA 5BPFA 1JEJA 1U02A 2HK7A 2XQKA 4EZEA 3G2NA 5GONA 3HACA 4C1NA 1TGYA 1YZFA 2H11A 3NXKA 2WKWA 2MYTA 3TSAA 2WWXA 4OGGA 1VJRA 3PFIA 3RRXA 4I3FA 4C20A 1COWD 2V9ZA 2C0QA 3FKJA 3ROZA 4BLUA 4YXFA 4ZK2A 4U2FA 2H7YA 2RGAA 2XMZA 1V48A 3DEHA 5FWXA 1QNLA 2REXB 3V8BA 2Y68A 5KU7A 1S5PA 5B1SA 1JFFA 2XX3A 4MAMA 4B33A 4JWKA 2QSUA 3IXLA 4GECA 1IG3A 3K6KA 1EWQA 1PQUA 2CJWB 3QG5A 3TB6A 5ALPA 3VI4B 2O3TA 2Q07A 3DL7A 1XCPA 1JDPA 5DISB 4Q4HB 4C0BA 4V0MA 3I9NA 2ZU6A 4MW2A 4GYKA 1KH2A 5J47A 3D43A 3E22B 3NP7A 4L8WB 5C18A 2W48A 4V24A 3QTBA 3OTQA 3F1KA 2O06A 4R41A 5C0OE 1MX9A 5AM0A 5LDDC 3O4FA 4ZMBA 3R7AA 1XYYA 3A1DA 4CM9A 3O0TA 1N6LA 5L3QA 1N7GA 1TEVA 3H05A 5AI4A 2IEAA 4FGSA 4EWLA 1W36C 1UJ6A 1FLAA 3VNVA 4O8CA 3O4IA 2ZJ7A 4ZGGA 4Y1RB 2HPVA 1OI3A 1TPYA 4YLEA 4V1CB 2X0DA 5C5DA 2B6HA 3T0IA 1IWPB 3E8MA 3L6DA 1XD8A 2Q2OA 3MYYA 5EIBD 4FMDB 2BEUB 5EP4A 3LM8A 2HTFA 3S2EA 2G5GX 4XIIA 3HV0A 1JPNA 3H6KA 3U5ZB 4QOJA 4X3CA 4KUHA 1UFQA 3RUEA 5C9ZA 3LNCA 1M2KA 3ZLVA 5DGDA 1WPQA 1OE0A 1H22A 4MS4A 3G9QA 4HNAB 5FBLB 3X1ZA 4IIHA 4RMIA 1ZMXA 1A4UA 1QFSA 5T4FA 5AQ1A 5FFNA 3UA3A 4CMBA 1JWBB 2UUPA 3H0CA 3H9UA 3PX7A 1AB5A 2GYWA 4XSVA 2F64A 2SKEA 3JAWA 3NORA 2X23A 3QPVA 1BVUA 5F1KA 2CUZA 2QVCA 2VDWA 1MDBA 4HAIA 1DC3A 4FLEA 5EXTA 2XCQA 1CR6A 4BP8A 4FB4A 5KNCD 4IMJB 5HOQA 1WEHA 1II8B 1LJ8A 2PZFA 2H08A 2VRCA 1P81A 1YB5A 3DKKA 1E1NA 3T41A 5JY6A 3DDUA 3IPXA 1AK9A 2WTAA 4FC7A 2RJOA 3C3XA 3KSUA 3M6LA 1E2LA 3M3DA 3EMVA 3K9WA 4YQFA 3O7WA 3PC8C 3CS3A 4ITVA 1OPRA 2PD4A 4N03A 1JGTA 3RSZA 3W7AA 2RI1A 3ECAA 3HK2A 4RAQA 1NN3A 2R1TA 4B7AA 3R5HA 4C14A 2X86A 1T4GA 1U5CA 2NPFA 4H1WA 2UVPB 4RDHA 2V6MA 2ZUVA 4CUKA 3SDSA 2A9RA 5D87A 4E33A 4X66B 3EDRA 3QH4A 3W2GA 2PUJA 3D54D 1UBRS 3GF4A 3RC3A 2BN4A 3IILA 3HVUA 4ER3A 1U81A 1QC5A 3R7LA 3RRFA 3IRVA 2X1LA 3LSTA 3BIJA 4G84A 1M1YA 2VSFA 4R1NA 4A8JB 4DMKA 2VDLB 4LOHA 5K0NA 3URMA 4GI3A 1TJ5A 4PC7A 3D1JA 3GBVA 2IKQA 4AN4A 2AWOA 2G1AA 1FYWA 2GPTA 2ZBUA 2Q1UA 3AR5A 3D7RA 4ZCSA 4AICA 1ORHA 5DBOA 1Z4OA 1U7ZA 1VJCA 3TR6A 4CM8A 2R1VA 4R69A 3TG2A 4ND3A 1RMQA 2N75A 1P44A 1L5WA 4C05A 2NAPA 3PS9A 2Y4OA 1PWZA 2VBCA 3WTBA 5KQRA 1E9EA 1TYDE 1T5SA 2VJBA 2ZE6A 1IRXA 1D2RA 1E1KA 3OLZA 4ZAVA 1RYHA 1OX4A 4PTZA 2VJQA 3FGZA 5H59A 1JEDA 1G9TA 4UXJA 2JFWA 3ZV7A 3A4IA 4AS1A 1T29A 2D5BA 2IOYA 3VVLA 5H4GA 1GPAA 4WBSA 3D0RA 2V03A 4RD2A 4JJ6A 2C5SA 1WP4A 4BMOB 1EMDA 1KEWA 2DG2A 2XGOA 2FPGA 3R6DA 1NBWB 2H8KA 4WY8A 2E49A 2XZOA 5THXA 2WUFA 1M0SA 3GAMA 5J5AA 2VBGA 5LU8A 1IATA 4XE5A 2G77B 1GRNA 2PFGA 3C8HA 4K3VA 2C9DA 1OYVA 2VT3A 4AZ3B 3GB9A 3TW0A 1JR3E 2XT9A 4OATA 2F7SA 2QRVA 1QHXA 3W6ZA 3FUVA 3NBAA 1U31A 2JBHA 3B1KA 3QKTA 3TZLA 1R0YA 4P83A 5ULLA 1C41A 1O57A 1X9GA 2AOUA 2HJ9A 4XJXA 3ZDRA 1M6HA 1GFIA 3QTLA 4YY3B 3A6DA 4DUYB 4ZO9A 1G21A 1KPIA 5A2QA 2FQYA 3N2NA 1OWLA 3NGMA 5A0VA 1VZ3A 3GUCA 5FNVB 2QTAA 2OLKA 4NECA 4ZVTA 3EZNA 3ZHVA 5HP4A 3EGWA 3R9XB 1A7UA 3PCRB 1UXKA 5KSYA 1SB8A 1I6KA 1KBZA 2ZITA 1TUGA 4KXFB 5E6UB 2Q4RA 3SZLA 1ZK2A 1ZH4A 4AP5A 1NURA 2OTCA 2H1OA 3Q2OA 4QPDA 4FEAA 4O0LA 2FUKA 3VVBA 1L2TA 1DAEA 2M2IA 3E7PA 1E2UA 4U5QA 1G1MA 1DJPA 1FTSA 2FI1A 4FFPA 4ZO6A 3SSNA 3K9GA 4FFLA 3UV7A 4YB8A 4ASUD 4OPMA 4YT5A 4D44A 1WQ4A 3F2IA 1XDZA 2GD1O 3DF7A 3FRIA 3HUFA 3B82A 4KR0A 2Q3JA 4KQCA 4QVGA 4IZOA 4NZOA 1A69A 5K0CA 4WMLA 3B13B 1YDMA 4F9EA 3RC1A 3PU6A 2C3OA 5ENDA 4GDMA 4GMGA 3OHPA 1XG5A 4JBYA 3HDYA 4LXQA 3KEMA 2OENG 3DGEC 3ZCRA 1ODJA 1XRJA 1HE4A 1ID8A 1BOOA 5FJJA 2P9TA 2OG2A 1EVYA 4BGUA 1KEVA 2JIPA 1YFKA 4KAXA 1SC6A 4RACA 2GUGA 1ZSYA 4PWYA 2CLKB 5B1HA 5G53C 4A6PA 1FYEA 1G4HA 4MAAA 5JZMA 1XVAA 2W2PA 1YI1A 2FMFA 1Z5WA 2IUFA 3TGWA 2PUDA 3W04A 3ITEA 1FSGA 3U17A 4UREA 3V9AA 4L57A 4RD0A 1B8UA 3CLRC 1T2VA 4HNQA 3PJGA 4EY8A 4IMIB 2EQ5A 2J48A 2HSJA 3FMVA 3NBUA 3TZQA 4BMNA 4ZJYA 3GPIA 4DCUA 1Z73A 1RYFA 3C14C 1U6JA 5F4BA 1JBKA 1ONSA 3QMPA 2JCSA 3Q3VA 3I12A 3L06A 2VQ3A 3KD3A 4N18A 1E9CA 1IY8A 3JD0A 5JE8A 3UWPA 1LJLA 3WICA 2XKKA 3BF7A 1TF2A 3VYTB 2JI9A 1XUOA 5FLYA 3V80A 5CYGA 5JDCA 3U60B 5TT0A 1TQ8A 5DBGA 2VSNA 4MWTA 1L6IA 4IW3B 5KYVA 4UUNA 3RGGA 4E1VA 1I6WA 3K1AB 1YB6A 4D4JA 1UOOA 1OY1A 1Q1GA 3FPCA 4N8SA 5F77A 2FXVA 4BFVA 3H1GA 5HUHA 2SCUA 3FIJA 3KOZA 3AY0A 4F8JA 3LKDA 3QFSA 1LX7A 1TRKA 1QHHB 1Q0ZA 3HWRA 4KFRA 4RNDB 4Y2QA 5KNDA 1EZ4A 4MQEA 1QX3A 3CGWA 4NABA 3TPZA 1S9HA 4E5KA 4HLNA 2E18A 3MXTA 3P2JA 2GEFA 3OPMA 4PGFA 1Q19A 4UEQA 1EIWA 4FEEA 4Q7LA 2HM7A 4QLAA 2CNNA 2JVJA 2I87A 2XIQA 1V7ZA 1XRLA 3P1JA 3QMWA 3S0JA 3TSZA 1S3SA 2OZKA 1PJ2A 4PHHA 4BP9A 4IJKA 3GC6A 5TIIA 3I34X 2GPWA 1L7QA 2FV8A 3ER6A 3L40A 1NTRA 1TCVA 3ZGXA 4DYDA 2JLRA 4O2AF 1Q0QA 2VHTA 2J7KA 3IV7A 3OZIA 3LBFA 2OQVA 3LI2A 2BFCA 1QYRA 2IH2A 2WM2A 3HKBB 3NNDA 1E9VA 3U6KA 4OK3A 1CUYA 4JEMA 2B4KA 3DJYA 5DU2A 3U4GA 4ZCTA 4ZQHA 3AIIA 3H04A 3U3RA 3HYNA 5LKAA 1Q95A 3JYHA 4I6JA 5A4MS 2VA8A 1CZNA 2AN3A 2BIFA 2VP2A 4WJKB 1C9KA 1IY9A 4FD3A 5JXHA 5IC4A 2B4YA 3OCVA 4PFQA 1Z16A 2HRZA 2IDZA 1SXJD 2LCFA 1SBIA 1GL3A 1SXGA 1ZUHA 4URWR 3QVXA 1I2CA 3JQQA 5JSZB 3NCTA 4HFMA 4L85A 1HTBA 3N28A 4OHPA 2WF8A 4X8MA 3Q7IA 4JL6A 5DCYA 1K92A 3AVVA 1EYZA 4OI2A 1OVMA 5F35A 3U7IA 1YHYA 1UAAA 2IV7A 3CB4A 4N65A 4DCSA 4GX0A 5FOVA 2ZGVA 4LF4B 2I62A 4AP9A 4K9QA 2PLWA 1BD4A 2Z56A 4L0QA 3ZDDA 3ADBA 1EGQA 1Z0KA 2WTNA 3TLAA 4L8FA 3DE3X 1XTKA 1DBPA 3WJ2A 2AVNA 1C4WA 1FFXA 1VECA 3D59A 4UD2A 3JWEA 3SDZA 5BRJA 3OJCA 4E09A 1USWA 2XE4A 4BLOA 3KYJB 2B61A 4DSTA 4AIRA 4Q0MA 1EFVB 2DWCA 1E3JA 1Y8RA 1L4UA 5H3CA 3D4LA 5G4LA 3I92A 3C3MA 4FXPA 1H6CA 2HJGA 3KCQA 2BMJA 1MAUA 4JP8A 2WJVA 4QBHA 5MGNA 3DZJA 2D2FA 1NFQA 4ID3A 2EKBA 1X7WA 2JJ2A 3ROMA 1AQ6A 1ISFA 1QGZA 2CW5A 2BMEA 2VK8A 3AESA 4LXHA 2PS1A 4MA5A 4UM5A 3STHA 3ZHYA 3EFOA 1UPUA 3AW8A 2OGSA 2RKBA 4RZUA 4KR9A 4DVJA 4LRTB 3AG5A 5DYGA 1IQUA 4JFAA 1VE3A 3DPSA 3KPYA 4Y6PA 1E9AA 3OPYI 5F7XA 4I3GA 3TW6A 3TPCA 4UTPA 3ZWKA 4AAYA 3E7FA 3J7TA 1F0KA 2GETA 1KAGA 2LTAA 1IM5A 3BRWA 4IDEA 1W6RA 1GN8A 1I9GA 1PT6A 2X0NA 2E21A 3DT9A 3ESZA 3SQNA 4JLSA 1UPBA 3HG7A 4IHQA 2K5UA 3MNFA 4CMCA 4QL3A 3SSAA 1X1DA 1DJLA 2X2OA 4KE6A 3C3PA 3QXCA 5E9JA 3ZR4B 4AM8A 4KLAA 4XYGA 1M76A 5HCNA 5LWQA 1ECJA 4BO3A 2AUNA 3OE1A 3OY2A 4R8LA 1VTKA 1X2EA 1YJCA 2ID8A 3FNHA 1IPEA 3SEZA 2DFNA 2HIMA 2QAGB 2ZYWX 3F1LA 4KAFA 3VR0A 16PKA 4F21A 2GPNA 2FKAA 3L0ZA 1RZRD 2CBGA 2ZSUA 3LT0A 3PTAA 5IVIA 3PC3A 2XDAA 4L5IA 1I0IA 1T9DA 2LV8A 3QYFA 4Y2GA 1JHYA 3CN7A 3JTEA 4JNCA 1ZX1A 2JC3A 1YQXA 1HFWA 2A33A 2EJVA 3JCZA 4RTKA 1TT5B 3HLKA 1H05A 1CUWA 1TM7E 3JXEA 2FCAA 1R4MB 4IKPA 5CVJA 3ZXYA 1MB3A 2ODNA 1H4QA 4J90A 3W2IA 1Q7EA 1X80A 3ZY4A 4ACAA 3NWEA 2QYHA 5AK0A 1XBTA 2BDEA 3D02A 4BAGA 4EFKA 1XSEA 4CM5A 5KNCH 2P2LA 1M1XB 4ICIA 3F3SA 1JA0A 1XKLA 1UBSB 1S8FA 2WR8A 2E1RA 5JBIA 5DYTA 3IVRA 4WESA 4RS4A 3CVUA 1Z7GA 1TZCA 2RSLA 3GVPA 3NH9A 4MVJE 4O29A 1XTJA 3N2YA 4ZAYA 5HF5A 3UGKA 1AF7A 3WGUA 1NVXQ 4HXEB 5JR3A 1T0BA 2V4UA 4LPSA 3LDUA 2CNDA 4MGKR 4BE9A 5LZ2A 4CEIA 1AA6A 1EVEA 4ALKA 1FP4A 1OA1A 3E4DA 2XRYA 4G4GA 4QQKA 2ID4A 1VBNA 5CHYA 4TTPA 1D4AA 1V1JA 4CMGA 2B1GA 2ENUA 3CQ9A 2QTTA 1KZ9A 2CUKA 3EQ7A 5JROA 1GZ5A 1DDIA 2BKEA 2H8GA 4MO2A 1M7GA 3QVVA 3PFFA 4NBLA 3U6BA 2OAP1 3S5UA 2PKRA 3NP9A 4U1RA 1U3TA 4ALJA 4B3MB 3HDGA 5EZQA 4WN9A 4XYMA 3INYA 3ZQKA 3JTMA 3BPSA 4CKZA 1ODFA 4J49A 2JAHA 4ZK6A 2QTHA 5EFZA 3AVQA 3O9ZA 1II0A 4IS2A 4GEGA 1TIPA 4KH0A 2FSHA 2G76A 3N76A 5A7HA 4ASUA 1RHQA 2HGSA 4B3DA 3EQ9A 1HO3A 3LGSA 4L0CA 4MUKA 2J8ZA 4MV3A 4JI0B 3TLEA 1H2RS 1RAIA 1AK2A 1GAWA 1WR8A 2JJ1D 2UAGA 1EWRA 3JQ9A 3MWKA 4Y2HA 2JGEA 1FBTA 2XODA 4PC3A 1RJDA 3PPYA 1JF8A 1E63A 3F71A 4M4SA 4KXNA 4EGJA 2IYEA 4XPIB 5A4FS 1TVKB 3MJHA 3OH8A 3WLLA 2QJOA 3DDHA 4GYJA 3A1UA 1H4VB 2D4HA 1YTUA 1S01A 3CEPB 3JRXA 2P65A 4EYOA 4LEIA 1A8HA 1TB4A 3V00A 3ZWQA 1JG4A 1VG9B 2C4HA 2YASA 2ZBVA 3C4JA 4JEHA 1R0WA 4CQMD 2ZIZA 5JECA 1XGKA 2WKRA 3CRNA 3K0HA 9ABPA 5FA6A 1VSVA 1XRNA 2V7QA 1O94A 2Z43A 5G3ZA 1GT91 2CDRA 3BIOA 3K4HA 4Z0HO 2BISA 1R0BA 1LZKA 4DQ0A 2JD1A 1EWTA 2SECE 4G1BA 5JAHA 4CNBA 3W3ZB 1LDYA 2GZSA 3MTDA 4MWCA 4BNTA 4R5HA 4EY5A 2YRFA 2CK3A 2XTNA 3DBRA 4A0QA 2ACEA 1Z9BA 2H2WA 4E5YA 3C3BA 4CF5A 1VXOA 4XDYA 3ENVA 2QY9A 4PLTA 1G3IA 2G9RA 1L7OA 1PK7A 1C3OB 1CJTC 2QMZA 2MYNA 2X9NA 3CVOA 4J16C 3W4JA 3GDWA 3P45A 4E7PA 1FX0A 3F98A 1JIXA 4AYXA 1U04A 3HCDA 4BPRA 5T57A 1VHWA 1N9KA 2HN9A 2JIQA 1T1GA 3R3ZA 1WHSA 5CCXA 2G04A 4C3UA 4CV2A 4F4IA 4CLRB 4DWVA 2ZRAA 4KJZA 1JYEA 2XHEA 3I9JA 1NNEA 4RLQA 3PJRA 5IKPA 3SHOA 2CXOA 2DC1A 4AMUA 1RXVA 4IQGA 2AD5A 1FMJA 1W85B 3I8OA 1FQKA 2NAFA 2NZUG 2DOKA 4IVQA 3KZCA 3VR2D 4D92A 5J2TA 1SO8A 4II2A 3LFTA 3IP9A 3PJEA 5I45A 4RTRA 2GRJA 5FWYA 1OAKA 5E6RA 3L6OO 2XITA 4QJIA 4K9RA 4X41A 5BRNA 1H8HD 1ZRMA 1OB5A 2NP6A 2Q6KA 4HQRA 3B1VA 1Q22A 1V1RA 1ZM2A 5CYOA 1THTA 3KVOA 5JJLA 1NBIA 2D5AA 2KW5A 4B4UA 4LYGA 2Q6LA 3EF1A 1LDBA 3OLXA 4CLOB 4J2HA 1RZVA 2AEFA 3HY6A 4OKNA 3IC5A 2HBQA 1WU8A 2E4YA 3LT4A 1QE0A 3PD1A 5BP7A 1N36B 1LJUA 2N42A 4E5UA 1J1UA 1G5TA 3URKA 4W9NC 3UN1A 3VDMA 3G2JA 4DSUA 1M6VB 5KYGA 3AERB 4HSGA 4Y7DA 1FDSA 2VK4A 4LC9A 1EHYA 4E11A 2WYOA 2JLZA 2OG1A 1E2KA 2PUTA 1NYTA 2PWYA 4N7BA 2QJRA 1IZYA 2XDQA 5CB8A 3D6NB 1DBVO 1URPA 1Y1KE 4D9NA 5AW1A 2PUFA 3A4MA 3DYVA 1T3LA 2G8NA 2JFVA 3OJWA 2WLTA 2AV6A 3HGQA 5AUNB 2YFYA 1G2OA 3RU3A 3WGZA 4KQWA 4O4IB 4AF8A 3A0RB 3Q0TA 4I81A 3VR4A 2XAUA 4JLVA 1A8SA 2G25A 3E2IA 4TQGA 4C88A 3SVZA 3PR2B 1S3GA 1O6BA 4RADA 1ICIA 1JPJA 1JHMA 3EYAA 4XVUA 4KPFC 2P68A 3SFVA 5F1YA 1WDWB 5DK6A 1BDMA 3CXUA 2WVHA 3H18A 5I7WA 1SBQA 4H1VA 1V9SA 3WWPA 5EHQA 3U81A 2Y1FA 4U02A 1VYHA 5LSAA 3VKHA 1XRRA 1GCOA 5D6OA 4BDTA 4R8SA 1F0PA 1OA0A 3EXIB 5FOWA 3DXZA 3RIGA 4GI2A 1R0ZA 1YQDA 2NZWA 2H85A 1N3BA 2P4UA 3T9BA 3SBOA 4Z8XA 4CTNA 5LM3A 1XDUA 1EFPB 3JVUA 2WYWA 3IJPA 3ZWDA 1YNSA 2M32A 3TUJC 1J24A 1RLTA 5LB2A 1NQXA 3VJMA 2W42A 3USCS 3Q7EA 4HDNB 4NSNA 3CRZA 1CE8B 3FYCA 4OO3A 2W2LD 1SEVA 2IF2A 1QYWA 2PY6A 3FBGA 3H9JA 4TROA 1NE2A 5WRFA 3NM6B 4AJNA 1QAQA 1N78A 4R2HA 1UKZA 1EXWA 1YT5A 4XFKA 2C4KA 4PC1A 3LT5A 1T91A 2Z09A 4UTOA 5AWFC 4GSYA 2ZBRA 1RWVA 1BRTA 1QWSA 2QUAA 4QYSA 1TUBA 3RO7A 3SKVA 4D82A 1E9FA 1R12A 2ZXFA 1C3EA 3WLNA 5CVVA 1JPUA 4RHTA 5EWMB 3ISTA 1FEZA 5COBA 5A4AA 3P2OA 3VSCA 2PTHA 4CFYA 5HIKA 3ZIAA 2FZLA 4NNJA 1WVGA 3EGEA 5J5CA 5EP1A 2B8WA 1KETA 1N2GA 1C1DB 2W90A 5TS3A 2QRNA 1JRLA 1NVDA 2BR3A 2WBLC 1X8JA 3VZCA 3IJRA 3SZUA 4CG3A 4JAVC 3W5DA 2JG3A 1BGWA 1GLGA 4B3FX 3B7WA 4IHJF 5AW8A 3E9MA 5DMHA 2JGKA 2ZZMA 1N7HA 2JCGA 5AJXA 4JVOA 4BUCA 4RXMA 1XZNA 1T5DX 2NU6B 2P4HX 2YIDA 4J3JA 2RB4A 1N3LA 2D54A 2XKAA 2J85A 4HF7A 4Q4AA 5EJFA 4A2QA 5CVDA 2VT7A 4MRMA 4RY8A 2AX3A 1M0TA 4WAUA 1KERA 3NYWA 2V9PA 4BNJA 4H1UA 1ZKDA 3WOVA 1I4WA 2RGUA 2OP1A 4PYOA 1LTQA 3F6YA 4WOBA 3VJLA 4FPXA 3PQ8A 1XZPA 1PZGA 1TI7A 2OV3A 4IFIA 3PR1A 1DV2A 1I4TD 2G7ZA 1PL7A 3IV6A 3RLFA 2C84A 4M1SA 1TQ4A 5EXEA 2AGVA 1NQTA 3PYXA 2YDXA 4D9GA 4NBNA 4FYIA 2HNKA 2IJGX 4RMHA 4XLZA 1J2EA 2E4ZA 4NYMQ 3RKSA 1OU0A 4XCVA 1KKUA 2BEKA 3LBNA 4C0QC 3PNYA 4RK1A 2Q5EA 3IOYA 5AR1A 4CQLA 4DM4A 1VA5A 1ZW1A 2BGLA 1JDJA 2J9YB 2KSQA 3TGPA 3RQSA 5C2JB 3OEWA 4TTQA 2MSKA 4OHZA 1T5LA 4FI3C 4NFHA 1E3MA 2VZ8A 3MS4A 2H2AA 3UWSA 3E9DA 4ZYWA 4AD8A 1SCAA 3LUJA 1MTOA 4XRRA 3QPAA 4G8DA 4TMKA 4XGNA 1EUYA 2I2FA 2YS7A 1VE1A 2C82A 1X87A 2VOJA 5DX1A 3ER9A 3OIWA 1H5NA 4KFSA 2QLJA 4MHSA 1BXRB 1R9NA 3V8PA 5IJ0B 3NYQA 1P1KA 1CQWA 1H9BA 4YAFA 3TBHA 3U80A 1FS4A 5CJJA 2QXYA 1S2MA 2AFRA 2EZ4A 1N7JA 5DXAA 5BORA 1OYWA 3A4NA 3R8CA 1ELOA 2NQTA 2XOKD 3S4YA 1QVWA 3D3KA 2FP4B 3E9RA 2GFQA 5GY7A 3NEPX 1Z8NA 3KYIB 2FEPA 4P54A 1QAOA 1WWKA 4AU1A 1AIPA 2AHRA 5SY9A 3C24A 2AEEA 3UMMA 4QDTA 4XUDA 3RYHA 1CUEA 1NVTA 1Q12A 3AIMA 4Z51A 4LECA 2VQEB 2JDID 4YMUA 3I6IA 1U0EA 5J43A 4O4HF 1MW9X 3GJQA 5JSKA 2D1QA 1WQ3A 4PS0A 1T34A 2ZIXB 3ETGA 2Y0EA 5I9LA 3EQ6A 1O9HA 1MV5A 1V8FA 2WILA 5DYWA 3BWBA 1FMLA 1G1AA 3EMBA 3U3MA 3WXBA 3DLTA 3F97A 3RUCA 1WB6A 3R3YA 2NSHA 4ILEA 2YXBA 3D8NA 4Q9DA 3KETA 2AA3A 4IG9A 4TKZA 1OH5A 2XJ4A 5IK2A 5TMDA 5E6SA 4FJ0A 5EYPA 4CI9A 1ZC4A 4JXKA 2XUHA 2GCPA 5CDFE 1N2CB 4KACA 3RK1A 2VDPB 3QLEA 5CXQA 5KZMB 3BD6A 3Q7TA 2G6BA 1R0SA 2BDTA 3E53A 3A1NA 4OQFA 2BRUA 4EX7A 3PHBE 4NQZA 4YJ3B 1LLFA 2ZK7A 4EO9A 1JW9B 4CRWB 1BCSA 2KM1A 3DB2A 5CT9A 3T1VA 1FYVA 1LPOA 5CLHA 4W4TA 1Q3TA 1TJ3A 4FCTA 4PC2A 1EINA 4AF6A 5JRDS 1TQ2A 1J8DA 2UZ1A 3OWHA 1YJ5A 3KUUA 3UHPA 1NF2A 2OQ2A 3KZ1E 1GFWA 2RKWA 1H2AS 5FPPA 4YMSA 3KSBC 1BMDA 2RAVA 2CCKA 3SNHA 4PZAA 3V1MA 1Q3KA 1Q17A 3T9FA 4ND8B 3TL2A 3WO0A 4BL5A 4N3BA 1ZMTA 4K9SA 3TFWA 1MNAA 1Q20A 4DSOA 4PSVA 4L50A 4EKEA 3VAYA 4L2IB 1SZJG 1XP5A 2QPOA 5KYXB 2WU3A 4QTUB 1NGSA 3EAGA 2BT4A 1IHDA 1N2BA 3A6FA 4OYHA 1UZLA 4F9TA 4O4JB 2AI3A 1X1TA 3VM6A 4I8IA 3TUIC 4GXQA 5BV7A 1W0JA 5JMOA 2XTMA 4ZARA 3WLEA 2O50A 3DZGA 3X2EA 1NLUA 2FPPA 3WSWA 4C2AA 3FAKA 2GRUA 1NONA 3LKZA 2X0KA 1DKOA 4H1HA 1YI8A 4ZZIA 1YJ8A 4MRVA 3N5CA 1FDRA 1DSSG 5FUXA 5ICSA 3V6MA 1XO1A 1CT9A 2QT9A 1NJGA 1OREA 2ZU0C 2B78A 1P74A 1BHJA 3CNBA 3OIUA 2FR0A 4Y2SA 5KCMA 2V6FA 3F67A 4CCSA 3I9V1 1U2QA 4EHKA 1ULSA 4A5OA 5FBKA 3ZH9B 4MINA 1H6DA 1QPBA 1BMFA 1ZSVA 4AX8A 2QPAA 3SY8A 2BKUA 3CXRA 4GEKA 4PNPA 5JYDA 1YQWA 1CK4A 2XMRA 3P9PA 1MEEA 3GU3A 2O0JA 3E8SA 2GJSA 5IN5A 2AQKA 4HTFA 4HPJB 4JUCA 1GPNA 1HLFA 3L0IB 3C85A 1TA9A 3PT5A 2BGJA 4ALMA 1YB4A 3CWCA 4MRNA 1V11A 4XX0A 5CLFA 1T9GS 1G42A 1VJGA 3KTOA 1K6MA 1GQ2A 1PGQA 4D74A 5KYYB 1NXVA 3CUSA 4JMPA 5JAOA 1H2WA 4HT3B 5AM4A 3NBZC 2C7RA 4QOIA 2YBEA 4N49A 1IUPA 3NKVA 3VR6A 4D3YA 2GBIA 4QE3A 2MOKA 3RNLA 2BEWA 5F23A 2AFHB 3RRMA 1MRSA 5DIZA 1UMCA 3ZZNA 1PS8A 1HYBA 3GGCA 3O1LA 3RBAA 4Z9FA 5CA0A 2GEDA 2J0UA 2Y71A 2P9FA 5FOSA 2O8FB 2RGEA 2I8CA 3LOPA 5DN9A 3RK0A 2Z2ZA 4QD3A 4WZBB 1WCXA 4M86A 3PEWA 1JQEA 3NHUA 2B5WA 5CMLA 2QTLA 1I3LA 2NV6A 1IYZA 1W4CA 2XCLA 3M6AA 1UJBA 3KPVA 4G0QA 2E4VA 4YC7A 5E1BA 3SBXA 3VBEA 4EG5A 5EZSA 5ILQA 2QX8A 2XD9A 3L4SO 4NPCA 1ZGAA 2RI6A 1RI2A 3ESRA 1CY7A 1D03A 2DUNA 5JZOA 1A9QA 4E5VA 1TIKA 2XVXA 4IHJA 1TAGA 4ZU3A 4WNYA 5CLIA 4DB4A 4QVKA 4B3HA 3TGLA 4RK0A 4HYEA 3ED1A 3M34A 2WFLB 1JB9A 1LW7A 3HM2A 3LS2A 1X1BA 3HFSA 4ZA2A 1QO0A 4RHFA 2CVOA 3UHFA 1V25A 5I7AA 1EQUA 4IKOA 4F5DA 1R4NA 1G8FA 1RWXA 3RTDA 5I7HA 3DW3X 3M2PA 4FGJA 5CA1F 4C7OB 4RA6B 1KSFX 2PBRA 2V7EA 4WUTA 2MYUA 1B2LA 4BRSA 5KX5F 1P2TA 1E3QA 1QLHA 1WUJS 1SUDA 5HGXA 2BTQA 4KFTA 2JHAA 1II9A 1D2GA 1CR1A 1YS9A 2M98A 5CVEA 1JSZA 4YVFA 5DHAA 5BUQA 2GXAA 1YQGA 3DHEA 3IDZA 2I7DA 3PQDA 1OLOA 2IIBA 2V7WA 4OP1A 2D7CA 4DJFC 2UXDB 4TZ0A 1MIOA 2F9LA 3SBDA 1GUAA 4J75A 4RC9A 4X20A 3DVRX 4W7IA 3IHKA 3VOTA 4BLQA 1RW4A 4TYPA 2DPHA 2H0RA 3MWEA 3EXG2 4M1KA 1O1YA 2A1UA 2DLDA 4C04A 1WKBA 3IE2A 1RBYA 4G5RA 1K9VF 3HSKA 4KFCA 4IAOA 1M34B 3M4NA 4AULA 5CX1B 5LYJF 4OHKA 1WY7A 3I9FA 3VHXA 1Y5LA 2PL5A 2ZRGA 5DXFA 1SQ5A 3CKKA 1R5JA 1U7HA 3VZBA 2ZB3A 4OI4A 3QNMA 4ZP1A 2VWGA 1QFZA 2P2YA 4H31A 4BEJA 2UUBB 4WZ6A 5K0TA 1DL5A 1QANA 1IONA 2II6A 2TMYA 5T7BA 1BKDR 4AN0A 1DC5A 1LTHR 2IYZA 3KUKA 3MWDA 4L5AA 3TRJA 2FJ0A 3LO8A 2J30A 1WCIA 1T3HA 4OA8A 4MKFA 2O1SA 3GUVA 3RC9A 2CMKA 1IRIA 4DMGA 4MHTA 3PV0A 4RGQA 4AQYB 1Y4UA 4KVZA 1H8ED 2A9VA 4CCYB 3I45A 1V3UA 4MZXA 1AOXA 4O4HA 3N70A 4B87A 2GHQA 2HJWA 2VPZA 4WLNA 1YVEI 1J2RA 1A9XB 1V9CA 3DBVO 3IPCA 3KYCA 2FZKA 1GUZA 2EX4A 2EAUA 3R0JA 1CQIA 2EARA 3N0VA 4M98A 3W4KA 3L9XA 1YIDA 2F2TA 4F56A 2PX3A 1E2HA 4TYNA 1ZSNA 2WJHA 5CFNA 3ITDA 3MQ4A 4GYYA 3TMYA 1JG6A 1A98A 3ZH2A 1DAKA 2YOGA 5B3JC 5HUQA 1L4FA 1HYQA 1O4WA 2PUCA 3ZLBA 1RZ3A 4WDRA 1TC1A 3DC7A 3OTOB 1LDEA 1MAWA 3K70C 1L8OA 1ZKMA 4M89A 4EQ6B 1QKJA 5IYZB 4EG7A 3X1MA 3GT3A 4LDZA 2PT7A 2RONA 4U9IS 2B3DA 4Z2YA 3BD7A 1S2OA 1QLJA 3GRYA 3HBAA 3G9TA 4P4SB 1BE6A 1AE1A 1S1CA 2CXRA 1QHYA 4XQ0A 2WD7A 3IOEA 4YRSA 3HYRA 5JWRA 3QKIA 2XSZD 3C3KA 3ND6A 4BWYA 3UMFA 1EDDA 2YVQA 2I3DA 4L5CA 1J9EA 1THGA 2ISQA 4DLLA 2EW8A 2HF9A 4MWGA 3CLUD 5FO1A 3H7IA 4IIFA 3GPBA 4XVHA 4CTOA 3LBAA 1RBQA 3EGXA 1U3GA 1VCIA 1ZJWA 4GC9A 1BJTA 3NHRA 4YXWA 1J22A 2JLWA 3V4ZA 3ROXA 1ZK0A 5EVJA 3I04M 4X5OA 5AJWA 1BW9A 1Q57A 4DS3A 4PZZA 1KU6A 1TA4A 2YHIA 4FT4A 5CYPA 4X1KB 3UGQA 1CUUA 1DFIA 1U9YA 2A1TS 2JFOA 4OK5A 1RLOA 1S02A 1ZMOA 2FZCA 2PU7A 2R00A 4ECAA 1ADGA 1CNFA 2AOXA 2NW6A 3H5VA 5IPFA 2AR0A 1A2OA 3MRXA 3PSAA 4TLLB 1V95A 4UNQA 2ZWAA 4M55A 4N0DA 4BQIA 1R5OA 2QM7A 2ZTUA 3VPDA 1L8QA 4JUFA 2GBFA 2N0SA 3P2EA 3I04A 1I4LD 4UPEA 3JQ8A 1IL0A 1RSZA 3CRW1 3W90A 2QDKA 2R5WA 1VDZA 3H17A 3SD7A 4C0KA 3SQWA 3O1HB 1DC6A 1VL2A 4H1TA 4LSGA 3K1JA 2C07A 3A04A 4MWOA 2PKYX 2V7PA 2ICAA 1U0OC 4DV6B 2Q8PA 4UBMA 4U4AA 5ELXA 2H4YA 2TMKA 3E0XA 1SCDA