4TYWA

Dead-box helicase mss116 bound to ssrna and adp-bef
Total Genus 182
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
182
sequence length
508
structure length
508
Chain Sequence
b'SKLIHVPKEDNSKEVTLDSLLEEGVLDKEIHKAITRMEFPGLTPVQQKTIKPILSSEDHDVIARAKTGTGKTFAFLIPIFQHLINTKFDSQYMVKAVIVAPTRDLALQIEAEVKKIHDMNYGLKKYACVSLVGGTDFRAAMNKMNKLRPNIVIATPGRLIDVLEKYSNKFFRFVDYKVLDEADRLLEIGFRDDLETISGILNEKNSKSADNIKTLLFSATLDDKVQKLANNIMNKKECLFLDTVDKNEPEAHERIDQSVVISEKFANSIFAAVEHIKKQIKERDSNYKAIIFAPTVKFTSFLCSILKNEFKKDLPILEFHGKITQNKRTSLVKRFKKDESGILVCTDVGARGMDFPNVHEVLQIGVPSELANYIHRIGRTARSGKEGSSVLFICKDELPFVRELEDAKNIVIAKQEKYEPSEEIKSEVLEAVTEEPEDISDIVISLISSYRSCIKEYRFSERRILPEIASTYGVLLNDPQLKIPVSRRFLDKLGLSRSPIGKAMFEIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ATP-dependent RNA helicase MSS116, mitochondrial
molecule tags Rna binding protein/rna
source organism Saccharomyces cerevisiae
publication title Molecular insights into RNA and DNA helicase evolution from the determinants of specificity for a DEAD-box RNA helicase.
pubmed doi rcsb
total genus 182
structure length 508
sequence length 508
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2014-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
A PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4tywA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4tywA02
3IHLA 2ZR0A 4F93B 1SZPA 4PC3A 4LJYA 3A1SA 2ZR7A 1G18A 4NHOA 4D4LA 1Z6YA 4OL0A 3SR0A 4A1FA 4U00A 4KAXA 1P73A 1GRRA 1ZNWA 1KJZA 4US1R 3LY5A 3OAAD 4MUAA 2QAGA 5KHOC 2QM7A 4YMWA 1KMHB 4QXAA 1J8YF 2QP4A 2VSFA 1OE0A 2IXGA 5JS8A 1WBDA 1VTKA 3OHMA 4A0RA 1E2KA 1O87A 3HU2A 4OJKA 4B33A 1PVOA 1GL6A 3TUZC 1U0LA 1L4UA 2ZJOA 2QEQA 1IY2A 5CLQA 5EE3A 4TSFD 2W6IA 2JJ2D 3SHWA 2QENA 1GKIA 2ZANA 1M6NA 4HZUB 2OEPA 4QNMA 5AJXA 3GLFE 3U5ZB 1II8A 1Y3AA 3PUXA 4I4LA 2OFOA 2R6AA 1LS6A 4QHYA 4D26A 4E5UA 2GJSA 1UJ2A 3CH4B 4RFSA 2O8DB 4F4JA 4UJ5A 1P9NA 3B8HA 3GLFB 3AB3A 2X19A 2ZRCA 1DPFA 1OYWA 1NVXQ 1UF9A 4GBMA 4MKIA 121PA 5DISB 2GCOB 3QPWA 4EFMA 2W2TA 2V6JA 1JPNA 3CO5A 4B3XA 2OBLA 3GMTA 3DDCA 4ZIRA 3QKTA 2QP9X 3OEHA 2C98A 1ZJ6A 4F38A 3DZDA 1T3LA 1UBEA 2O8FA 2PX3A 1T91A 2Q9CA 1LF0A 1V43A 3CZQA 1E2MA 3ASZA 3HWSA 4TLBA 1AQYA 4DWJA 4WZAE 4BRUA 4ABYA 3IIKA 4Z8YA 4E09A 2ZI7A 521PA 4BFVA 4HAWA 3QXHA 4JBXA 4L4UA 2P2LA 4EJSB 4US2R 2GKSA 3LVRE 2BM1A 1G291 2Q3HA 2AL7A 2GHIA 4M1KA 1Q1ZA 1GUAA 3ZS9A 4JYCA 1ZM7A 3SN6A 1KI9A 1T3SA 3CNLA 1KI3A 3A58B 4MH0R 2OG2A 1BYIA 2QY9A 4B71A 3K70D 2WOOA 4ZCMA 4HAYA 5GVSA 3CB4A 4PQRA 2XOKA 1ZD8A 3AUYA 1NMXA 2G0TA 3AVQA 4BE7B 3H0KA 4Q21A 1LY1A 2PBRA 3TUJC 4UNRA 3AF3A 1E9CA 1G6OA 3AGPA 3U7HB 1ZIPA 5TMPA 3LBHA 1JJVA 1GM5A 2BBSA 4DLSA 2E87A 3E1SA 4XIGS 1NVVQ 1MO5A 2ZAMA 1GILA 1SKQA 1ZP6A 2ECKA 4OQLA 1SVKA 4D4MA 2F9LA 2ZSFA 3TVDA 3W5IA 3B1VA 4N0EA 4UNNA 1T4GA 4NYMQ 1NG9A 3O8CA 4A2PA 1AGPA 5EZ5A 2JLXA 2VSXA 3PFIA 4LX0A 1XFAA 3I92A 4FMCB 1Q3TA 1U2RA 4I1VA 3THXB 5BWMA 4URXR 3QE0A 3C14C 3LDAA 3AVOA 1T8TA 1SULA 2N42A 4LYFA 1XX6A 3D7MA 4UXIA 3EG5A 2V54A 1O3YA 2FEMA 3LO5A 4TMTA 1KO1A 2ZUCA 4OK3A 1W36D 1P61B 4M9XA 1X6VA 2N46A 3AF1A 1TF7A 1LFDB 1MOZA 1FQKA 3IGFA 2VP4A 2EFDB 4JLDA 4Q9IA 5DNYB 2JASA 2WZQA 3VQTA 1KO7A 5HCIA 3B1WA 3I5YA 1RIFA 1OF1A 3R7WA 1VG9B 1GL9B 4V03A 2BEJA 4NL4H 3REGA 1XTSA 4RSGA 2A78A 4EQ6B 2QN6A 1CS4C 4IW3B 4HB4A 5EE5B 5HKKD 4A8JB 1VG8A 2GK7A 1U0HC 4JS0A 4JVMA 3IIMA 3EZ6A 2RGAA 3NHBA 1G7SA 3ZDQA 4DLZA 4I1UA 3U3OA 2KSQA 5G53C 2VQSA 5CLLA 2PLRA 1S9HA 1KZ7B 4HZIA 2J7PA 2MSCB 3VR6A 2O8DA 3M4YA 2GVDC 2YINC 4PR0A 2ATXA 3I73A 1F6BA 2XTZA 2O0HA 2NOAA 5B57C 1OIVA 4K8OA 2FJUA 2VO1A 4Q18A 1JECA 3L2OB 2ODNA 1K8RA 2QT0A 2ZAOA 4Q1DA 1AKYA 3RVBA 3BC1A 1SKYE 3QXJA 1ZINA 4PPQA 5EXSA 4MDEA 4QBFA 1ODFA 1W4BA 3AP2A 4QJ4A 1YKSA 1ESMA 1RW4A 3ZIAD 3SZRA 3K8YA 4PFSA 1G20E 5HZHA 1GDDA 2IHBA 4B74A 2CHGA 4PO1A 3AVTA 1UEJA 1ZM3A 1NMYA 1KI6B 4ON9A 4TL7A 1E2GA 3EPKA 2BIFA 3UG7A 4IJMA 5FUVA 221PA 1WP9A 2QQ0A 2YHSA 2AWOA 1KKLA 1P9WA 2R9VA 4GL2A 1YQTA 4C0HA 5FPYA 2DB3A 2WWIA 1E94E 3I8XA 5FPKA 2AXPA 4OK6A 3FGNA 4GP7A 3IEVA 4OHVA 2W6JD 4Q01A 4A0HA 1T8UA 2J7KA 4HYYA 1U8ZA 4V0NA 5FH9A 4MA4A 3NC0C 4DSUA 5KDLA 2CXXA 3GCGA 2VP6A 3P32A 3BFXA 1G17A 1A2KC 3TNFA 4BEJA 4PO9A 4IOJA 3BH6A 3I4LA 2XB2A 2GJ9A 2WJHA 3VR3A 3VX3A 3I61A 2VEDA 4Q02A 4OQXA 4UQOA 4TYNA 4IKEA 3W90A 3GPLA 4LC1A 1XD2A 3SS8A 2J0UB 5EP2A 3UATA 1M74A 4BFWA 4EDHA 1OKKD 4XVQA 3AVWA 4Q1EA 1DAKA 1E0JA 1IJFA 5F9HA 3FFAA 1EFRD 1UKEA 1K5GA 1YE8A 1Z08A 3BB4A 1I4DD 3NG1A 4EPRA 1NLFA 1F2TB 4DVGA 1VKJA 3QF4B 5L3SB 2LKDA 2ZYTX 1G21E 2BMFA 4NMMA 1XEXA 3RS3A 2AFHE 1U98A 4LBZA 1YRAA 3A37A 3EC1A 4I99A 1ELOA 1VG1A 1Z63A 5EZ6B 3U7FB 4LPSA 4KSCA 1B23P 3EX7C 1XB2A 4PHGA 5DO9A 1X86B 3CR7A 2O8BB 1IHUA 4AWXA 1E9AA 4NCIA 3FMIA 2J87A 1XMVA 3F8TA 1ETUA 3K09C 4LHZA 2A3RA 2Z0MA 2O5VA 3B6EA 4LK2A 1UKZA 1CJVC 3KKNA 2ZU0C 4V0LA 3TE6A 4BGDA 1HQYE 1J70A 3SE0A 1EWQA 1FX0B 2QMOA 5H8WA 2XZLA 3Q3JB 2OAQ1 2J9RA 2BBOA 5K8IA 3AKYA 3RS2A 4DLUA 1WE2A 2CNWD 5FPSA 2XAUA 2QM8A 4PAQA 5G3ZA 1AN0A 5CJ2A 1L4YA 5KNDA 1GG2A 1JQLB 4H9GA 1ZU4A 1HYQA 5JHGB 3VU9B 1KJWA 1EESA 5IK2D 1G3QA 1KSFX 1LVGA 4M1SA 1G8PA 4Q1BA 4Z54A 2WPDD 4B44A 2J59A 3QI2A 2CJWB 1XCPA 5GADl 3HPQA 2YOFA 1MRNA 2EFEB 3AP1A 2MSDB 5KUTA 3GP8A 2P6RA 1KAOA 4MYHA 3MFYA 3HJNA 3NBXX 4KHZA 3TR5A 3Q8XB 2G77B 1IXRC 3T12A 4ARZB 4KFSA 2WMOB 3SDZA 1NLZA 4JBYA 4C9BA 2DYKA 5EXPA 1ONBA 2DHRA 3QXCA 4IOKA 3T1OA 3FMFA 4A82A 2WIAA 1KYIA 1JBKA 4YMVA 5SZHB 2WPDA 1ZUIA 2KJQA 1RRGA 4YXWA 4Q00A 1ZM4A 4K46A 1DAGA 4D4KA 4CEIB 3V00A 3ICQB 3K0FA 1KNQA 2J46A 2DWPA 3U6BA 2FA9A 1UAAA 1PLJA 2VL7A 2V4ZA 3VKWA 1II8B 2RGXA 3MWYW 4KU4A 3N5CA 4AK9A 3I62A 2EYQA 4LCBA 2PT5A 3AVXA 5HE9A 2VH5R 2F43A 2WMNB 1FMJA 4TMZA 2JLYA 3AM1A 2EVWX 3T15A 3QEOA 3GD7A 1UKYA 4TTPA 2IEZA 3AP3A 3T1VA 1AM4D 4ZCLA 2WICA 1VDZA 1CF4A 5P21A 1FUUA 1GNRA 2HLDD 2YZ2A 2IS1A 2FZLA 1P75A 3BH7A 4R9UC 3RWMB 1S9DA 1R6BX 4FI3C 4EFNA 1KSJA 4LV5B 1SVSA 1G3UA 3BE4A 4FINA 3OAAA 1ANKA 4DDWA 2FWRA 1E2FA 2RHMA 4FMDF 1ZVQA 1YU9A 4ASUD 1M34E 2CVFA 2ZEJA 1JQJC 1COWD 1Q20A 2V3CC 3X1ZA 1QDEA 2ZQ5A 4DT1B 4F7WA 4OQMA 1E2JA 2GBLA 1L8QA 1ZC4A 5M04A 1W0KA 5DIFA 2VP9A 2ZJBA 1CLUA 4MGZR 3IKJA 1CKEA 2YWFA 3V4FA 2ORWA 2WJGA 4GZLA 2KBFA 3NKVA 1Z6XA 4Q47A 1WQ1R 4Z1MD 4JT2A 1N6NA 1J99A 3THXA 1DTSA 3RRYA 2CMKA 3C4JA 1KDPA 3MLEA 4IEIA 1FOEB 1P9RA 4FXPA 5KDDA 1U99A 1P4SA 1US8B 1LF5A 2BVNA 1D2EA 1ZU5A 4HUTA 1CR2A 4IRUB 2VRWA 5JSZA 2B8WA 5K8TA 1H8HD 3CZPA 3S1AA 5E4FA 2IYYA 1FNMA 1IN7A 4TT3D 2J0VA 3CX6A 3ETLA 3U44B 4Q5IA 1QRAA 4TYQA 1MH1A 5IRCD 2YWHA 3ADKA 3K9NA 4KYIB 4NCJA 3WRXC 5J4HA 2FE4A 2F9MA 3FKQA 1J90A 3C15C 3LQRA 4RFVA 3SI7A 4NONA 1TNDA 3KX2A 1GKYA 4L9SA 2ZETA 2GF0A 1EFRA 4DHEA 2BCGY 4F91B 5FTKA 4C0QC 2KBEA 1Q21A 1XZQA 2WM9B 1RRPA 2P5SA 4LHWA 4LHXA 4N3NA 2FPMA 2B92A 1RJ9B 2B21A 2CL6X 4P4SB 4RZ2A 4TMVA 3REFA 1PV4A 2CHQA 2GEDA 5CYOA 1W4AA 5E95A 1EX6A 5AUQA 4A8JC 4FMBB 5LB4A 1S3SA 4IDNA 1VCIA 4Q9KA 4EJSC 2AKAB 1XEWY 1YR6A 2IK8A 4URUR 3ZYCA 2QROA 1N0VC 1IN6A 1OH6A 3W3AA 2WOJA 1KO5A 1NMZA 3GQBA 3QG1A 2J45A 4G5OA 3QIAA 4LYAA 2UZIR 1XF9A 5KO2A 4MQBA 3RS4A 1R10A 4QGFA 4CEIA 1X8LA 1BH2A 3U7EB 5IT5A 5CITA 2RGDA 2FZ4A 5A0FA 3A8TA 1WRBA 1X8KA 2DWQA 5J47A 2G0NA 2YVUA 4LJ8A 4ERNA 4R7ZA 4D2IA 3X1WA 3SJAA 5FBQB 3SYNA 4B3BA 4B6EA 1KI7A 2ZJAA 4QNRA 4C7OA 4IVQA 3KQKA 2GJKA 3LNCA 5TARA 4DSOA 2C03A 1MABA 2ODBA 2F1RA 2W2XA 2R6GA 1G41A 2R2AA 5KSPA 2Z83A 3BORA 2JLUA 4WA7A 3UXMA 3JZMA 3TAUA 4A2WA 1D8TA 3AH8A 4DLXA 1DVRA 1NY5A 4R98A 4DLWA 1NNEA 4FD2A 1OH7A 2GJ8A 2HUPA 4WOPA 1W4CA 2XXAB 5B30A 3EPLA 2J5XA 4RKFA 1Z5ZA 4M1OA 3FFBA 2AXNA 4V0OA 5CK4A 2IUUA 1G6HA 5FOUA 2GXUA 3LV8A 2NPIA 2EW1A 1E96A 4O3MA 2ANBA 3ND8A 621PA 3HYRA 1R8SA 3TW8B 2CK3A 2BBTA 2GJAA 2Q9AA 1G19A 3KZ1E 5DHAA 3NVAA 1F2TA 1IJEA 2B7CA 2FX3A 1VIYA 2BDTA 3U61B 4LYHA 4P4TA 2W58A 3QNUA 1XEXB 1FUKA 2PZEA 2ZVPX 2RGEA 5AJVB 1OB2A 3R7WB 2RKOA 2XSZD 1DELA 2PEYA 4Q7MB 1G7TA 4NH0A 3WMFA 3TKLA 3LX8A 4RD0A 4Q7KA 4URYR 1HE8B 1EFUA 3R8CA 3EWAA 4RVCA 2H92A 3TH5A 3QJYA 4E07A 2FSGA 4MKFA 5FUXA 1Z0FA 1M1YE 3EIHA 2V7QD 5BW8A 3NIBA 1ZD1A 4GMXA 2IC5A 5C1BA 1OJLA 4NYJR 2PJRA 2XSZA 5FL7A 2F1HA 4Q66C 2QSZA 2AX4A 4C0SA 1CU1A 1QF9A 1OV4A 1JR3D 2ZS9A 4E03A 1NJGA 2QL6A 2KB0A 2XTMA 1E9RA 3OE7A 1CR4A 5F9FA 1U8YA 3U3KA 2QU8A 5GJWC 4M21A 1MO3A 3QF4A 1KMHA 5L3SA 5G41A 2GZAA 3K1JA 2AD1A 4IOMA 4WZ6A 5C18A 3U60B 1ZC3A 3GJ7A 3TRFA 3TW4A 3TR0A 1OSNA 1W5SA 3IIJA 4EPYA 3SBDA 2DR3A 5C46F 1G16A 2IYUA 3ZZTA 2IYQA 2WKQA 5EJEA 4I1SA 1E4VA 1N0UA 4JLAA 1OXTA 3WBKA 2O8BA 3P4YA 4AKIA 1LV7A 3PUZA 4J0QA 4QM7A 1F48A 1FZQA 4I81A 4XWOA 2PMDA 4TLEA 3ADCA 3PR1A 5HTKA 721PA 2BMJA 4Q1FA 1T3HA 2A7QA 2WVJA 2IL1A 3ZVNA 1FX0A 1A1VA 4RD2A 3MUFA 2ATVA 2C77A 5C4MA 3NEYA 1OHHD 4NYIQ 3GJ4A 4X8MA 3QXXA 2Q3MA 1U8AA 5LDDC 1SXJA 2CK3D 3K0CC 1FMLA 4TQUS 4NBSA 4PAMA 2IYVA 3VU9A 4KCGA 1GTVA 1XJQA 5FTNA 2H17A 4QL3A 2HV8A 4QRHA 3W6NA 3EARA 5AJZA 3PENA 2JIZA 4PQFA 4AKGA 4BZQA 4XJXA 4BLOA 3THWA 2JJ1A 1C1YA 3NXSA 1MABB 2I1QA 4P32A 1PUJA 5GJBA 4ARZA 3PUYA 1YR7A 1K5DA 1P60A 2KE5A 3QF7A 3LWNA 4QJ3A 3C8UA 1ZM2A 5GJVC 4RJLA 3CRVA 4PHTA 4Q4AB 1FNNA 3BB3A 5JBQA 2I4IA 1TU3A 1VCMA 2IYSA 2JLQA 1E69A 3EC2A 2P6NA 4GOJA 2ERYA 1M8PA 1OH5A 4W5JA 4DJTA 1NKTA 2ORVA 1QHNA 1OFHA 3ZVMA 2WKRA 2ZSAA 1KK2A 2AFIE 4HLDA 3ZS8A 3NTUA 4DCUA 5DI3B 3R8FA 4UXHA 1OT3A 2VHQA 1Z22A 1UBFA 4FW9A 4LHYA 4N0DA 1UM8A 3I5XA 3PUVA 4B34A 4G01B 4Q4JA 1N25A 2BKUA 3SFVA 2O0JA 1IN8A 1OXUA 2ZRBA 2IYTA 2B6HA 1YR8A 2WAYA 2X2FA 5B2ZA 5KSZA 4CEJA 2V55B 4RY2A 2QTFA 2ZXUA 4URWR 1OH8A 4PSKA 3K70B 4FMCF 1UBGA 4V0ME 2X77A 2RH5A 1HA3A 4D0GA 3IQWA 1YZLA 1T5LA 5FOXA 4YQFA 4HAVA 3U7GA 2JLRA 3F5FA 3DMNA 4O2RA 3JVUA 1S2MA 5JSZB 3QUSA 5CK5A 2DWOA 4B3GA 2GNOA 4O25A 1HT2E 1IY0A 1Y63A 3W9YA 2I1VB 3CW2A 4PPGA 1HY3A 1QHXA 2GZDA 4C0JA 3L0SA 2GETA 5AJYA 3L82B 3BOSA 4BLTA 5BN5A 2CJWA 3TUIC 3U4QA 2AWNA 4AG6A 3OF5A 2QAJA 2W83A 4UJ3A 4IOLA 2ORIA 1VCNA 1GITA 1QHYA 3D3QA 5KU1A 2IYXA 2P3SA 2OZEA 3DOFA 5FBVB 2C04A 1H8EA 2Z4RA 2C9CA 2VP0A 4PZYA 4X8LA 1ZM9A 2PMKA 3W6PA 2D3WA 1TPZA 4LJ7A 2ONKA 1LS1A 4LY6A 5FOWA 4BASA 2ZYUX 5DLQC 2NO9A 4LJ9A 2XITA 3QKUA 1SHKA 3GFOA 3LX5A 2PT7A 3LBIA 1VMAA 5DI9A 1ZNYA 2DBYA 2VHCA 2ZR9A 3SJZA 1RRCA 3E2IA 1E1QD 4DDTA 5JEEA 3U3JA 1EFCA 2B7BA 3RWOA 4NCNA 5KTYA 5L3QA 2I3BA 3ZQ6A 5JJKA 4RD1A 4DRZA 1XJCA 1WB9A 3W5JA 2ZRPA 3KUDA 5AUPB 1S96A 4LDJA 2QTVB 2VHTA 4PXAA 2ZYVX 3LA6A 1DEKA 3U6KA 1XPOA 5DN6A 1Z6GA 1S1CA 1CR1A 1I2MA 2Y8EA 4DB2A 2TMKA 1JJ7A 4LBVA 3UMRA 1ZUHA 2WBLC 1QVRA 5J4KA 1KTVA 1S3GA 4Z1MA 1U94A 3QXSA 4BLRA 3VKGA 4GNKA 4XTCS 1IAQA 1W0JD 3AF2A 3DKPA 4OK5A 5BQ5A 4B3DA 3QKSB 1KK1A 1KDOA 2ZUBA 2O8CB 3AKEA 4G0NA 4DB4A 4JYBA 1A4RA 1IQPA 1MO6A 2V8OA 1T5IA 2IF2A 2Q6TA 4KO8A 2GBLC 2QGNA 5FL3A 2OV2A 1U9IC 2ZRGA 3GFPA 1XU4A 5AUOB 4BFSA 2BHRA 4GDFA 4HATA 1D5CA 3T06B 1TUIA 4BWYA 4NYMR 4V02A 1EFTA 3UK6A 1ZNXA 2JIZD 3RS0A 4ACAA 4JLPA 4R2HA 3GJ6A 3A6PC 2C9YA 1BYUA 2OCAA 4TL9A 1HTWA 1E2PA 5TY0A 4HUQB 2O8EA 4Q9LA 4HDCA 1XP8A 4WZBE 3TSWA 5HZKA 1J7KA 2C78A 5J5CA 3UMFA 1US8A 2Z4SA 1TL7C 4IVPA 1DS6A 1XEFA 2ZSDA 1IY1A 3B9PA 3H1TA 1E6CA 3CRQA 4Q4HA 3EZ9A 2AK2A 3CUEF 3ZIAA 3A1TA 4TQAA 3KQLA 4AI6A 4LGMA 1BKDR 2EWVA 3FYHA 1CXZA 2F3TA 2ZE7A 3DM9B 1COWA 2VA8A 5SZJA 4ZI2A 4JBWA 4MRNA 4JLBA 4ZV4A 3GEEA 4L16A 3Q85A 3QPVA 1EX7A 1VYVA 5CM8B 4P0TA 4B48A 4HEJA 4MUBA 1DAHA 2H5EA 1VG0B 1HEIA 2QMEA 1F3OA 1KI8A 1SQ5A 3IEUA 3PIRA 4L8GA 4PO8A 3ZGXA 1N0WA 1PZNA 1Q1BA 2DFLA 4P4SA 2N1BA 1V5WA 3GJ8A 1XNJA 2ZSBA 2HXYA 5TV2A 5FBLB 4QHSA 4ZDIA 4A6XA 1OXSC 3QPUA 1G64A 4DKXA 3C5HA 4LOAA 1BMFA 2W0SA 3A4LA 2XX3A 4TTRA 3CH5A 4XH9B 3SQWA 2ASEA 2VPPA 3A1UA 3DEFA 1JALA 1N5LA 4YC7A 4UNPA 1P2VA 1Z2CA 1XD8A 5DE3A 3ICEA 2FDCA 5FR2A 1CJMA 5FOVA 1E79D 3JVVA 3KUCA 1D9ZA 2WJJA 1IONA 4MKHA 4ZDJA 2R6FA 3B78A 4Y0VA 2ZITA 3CKLA 2A30A 3LLUA 3UWKA 3HPRA 4OI2A 3KDSE 4GT1A 2VYFA 1OFTA 3CX7A 2XNSA 3QKRB 5L3QB 3LBNA 4Q9HA 1ZBDA 4P31A 5GJCA 3A4NA 3GLFA 2VP2A 4A0GA 2Z43A 4AYXA 5SZKB 3BRWD 1SVWA 3VKHA 1GIAA 4NYJQ 4TL8A 4Q1AA 2IXFA 3T61A 2ZRNA 4CF7A 4JVLA 1Z47A 2WSSD 1KSGA 1YZTA 1VYUA 2CCGA 2RHDA 2A2ZA 3DOEA 4WVFA 4ZIRB 3SOPA 1W4RA 5CB6A 4LJ6A 5G3YA 5KDOA 4PZZA 2XJ9A 4DLVA 1Z07A 3BK7A 1BS1A 4MGYR 2FU5C 1SKYB 1WF3A 4ILEA 5JCZA 4BFUA 2IYLD 2O8CA 3PEVA 2HJVA 1S1MA 3DZ8A 2IYZA 4C3ZA 2XOKD 2EQBA 2WSSA 5AWFC 1CULC 3D8BA 3QVVA 4BRWA 1GWNA 4ITRC 4M22A 3EW9A 3A36A 2NZ8A 4R71A 4DDVA 2W2VA 1G9XA 2EFCB 5JCPA 4IEEA 5KPJA 4H1VA 1OFUX 2QNRA 5EE1A 3LAWA 3EPHA 4DIDA 3MWKA 1ZIOA 2CBZA 3R9XA 3MGCA 4C2TA 3AF4A 2QAGC 3UKDA 2WWYA 3WHKA 2XEXA 4KYUA 5J4YA 4ZKDA 1W0KD 1NG1A 4GOXA 2D7DA 5JMTA 1NJFA 3L43A 2JCSA 1XTRA 2IUSA 3AVPA 3QVUA 1N2CE 4M1TA 3IO5A 2HJGA 3MD0A 1BMFD 3IBGA 5C4GB 3K0AB 3IO3A 4Q4HB 1KO4A 1YZNA 2WSMA 3FTQA 4EKDA 3R9WA 1XTKA 4CEHB 1AGRA 3VHXA 2ZI6A 4YLGA 3RABA 2J0SA 4RCZA 4DEXA 3FB4A 3B9QA 3WYGA 821PA 4WBSA 5FUYA 1QBKC 2VF7A 2CCJA 1N5IA 2FV8A 5DHFA 4EQ6A 1XZPA 3E70C 1R5BA 1U0JA 2GCPA 1E4YA 1U9IA 3TBKA 2JLVA 2QE7A 3OIYA 4DLTA 3M1IA 4QJ5A 3MCAA 4POAA 2ZRHA 1P2TA 3DL0A 4YMTA 1WBBA 5IHPA 4JLJA 3EWSA 3PV0A 4JZKA 1NSFA 1P6XA 3EA5A 1MR3F 4KFUA 1AJEA 2NTYC 1FP7A 1E0AA 4HAUA 4YXWD 1UDWA 3AF0A 2BM0A 2G9NA 1W44A 4KV9A 3GLHA 3LXRA 1NF3A 1QHIA 1R2QA 3V4RA 1CRPA 1JR6A 1RFLA 2YOHA 1OXVA 3U44A 4C4PA 3W3ZB 2C8VA 4JLOA 4OBEA 2PL3A 5DYGA 2W00A 5EXTA 4DBLC 5LD2B 1YZQA 4EPWA 3BERA 4MYCA 4V0MA 5EQTA 4OHXA 1P2UA 2KWIA 4M53A 4I1OA 1Q22A 3FWYA 1AS0A 1Z0KA 1ZNZA 2FFBA 3BD9A 3KJHA 3VFDA 4EAQA 2BMEA 2OT3B 3QY0A 5FTMA 1HH4A 5KYKA 5JI2E 3KKMA 1A82A 4HZUA 1NVUQ 1T9HA 1KI6A 1IXZA 1HUQA 1HQCA 1ZUNB 5FBRB 3TSZA 4BLSA 4TZ0A 3WY9A 3K09A 2IEYA 1AKEA 1F2UA 1FP6A 2X2EA 2RGBA 4RCYA 2VHUA 2GXSA 3AQ4A 1E1RA 1DOAA 1ZCBA 3NBYC 3QKRA 4NPHA 3EZFA 3N70A 5CIWA 3M0EA 2GESA 3HU1A 3NWJA 2H18A 3K53A 4PC2A 3ZQJA 1YHNA 3FHCB 1GSIA 4CYMA 1W5TA 2PLFA 4M9ZA 3QENA 1G8HA 4KVGA 3RC3A 2BJWA 3DO6A 1R7RA 1TQ4A 3KFXA 1OXXK 3HR8A 2ZS7A 5DH9A 1GVNB 1TQ6A 2H8KA 4RD3A 1GFIA 2NO7A 2WHXA 1IM2A 2ZRIA 2W6JA 3KXIA 4LZZA 4QGGA 5HR5A 3W6OA 1G5RA 5DSZA 5D3QA 4LV6A 3WYFA 5GVRA 1ZW6A 4URVR 4PC1A 3MAAC 2JA1A 3G5UA 4M9SA 1E2IA 1E79A 1OW3B 3CF0A 1JXOA 4XWKA 5DN6D 1Q12A 1I4LD 5FI0B 5BN3A 2YYZA 4X8OA 1E9EA 1D2MA 2C96A 1KKMA 2ZIAA 1DBSA 1VCOA 3D31A 5TVKA 3BWDD 2GZHA 4JLVA 3NDBB 4JVSB 1AIPA 2HYDA 1CIPA 3CWZA 1DARA 4HUQA 4U5XA 1KY3A 2OUKA 3RANA 1RYFA 2CE7A 4MRRA 2IWHA 1R5NA 1D2NA 4LI0A 5L8VA 5IF9A 4BZPA 1G4AE 1AQUA 1H8ED 3FDIA 1WCV1 3KL4A 4UNSA 3PXGA 2WWGA 2C95A 1GNPA 2WWFA 1BOFA 3UWOA 4HLUA 5JHHB 3FHTA 3B60A 1Q0UA 4A6PA 3ECCA 3RRMA 1KI2A 4F4CA 4AG5A 2WWXA 4HLUC 4JKYA 1XJ0A 2IF0A 2P6UA 1XXHA 4PQYA 5HE8A 5SZIA 3VHLB 4A4DA 3KFVA 5L3VA 2QPTA 1TQ2A 1XXHE 5TXGA 1Q3HA 2ZREA 2ZRAA 3IILA 1MRSA 3THYB 1E2LA 3LLMA 4US0R 1VIAA 5EP4A 1AK2A 1NN3A 3PQCA 2NIPA 1ZMXA 1KHTA 5HCNA 2ZI5A 5TB5A 3EPJA 2DFKB 2HF8A 5EP3A 2REBA 1PLLA 4HDQB 3RSOA 1F60A 1TADA 2LKCA 1JEDA 3LXXA 3MSXA 2VSOA 1VECA 3THOA 4DT1A 1UEIA 2IYRA 2GTPA 2G6BA 4BFYA 2ZROA 2YNMA 3VR1A 5E7MA 2JAQA 3WNCA 1JR3A 4G5SA 1CRQA 3OEHD 2F55A 3P20A 4URZR 2CLDX 2RB4A 5CM9C 4PAOA 3WP0A 2Z6VA 4B35A 1M2OB 3CR8A 1HE1C 1Z6TA 1DAMA 1VHTA 3IHWA 1E2DA 2RGCA 5FFMA 3TSOA 421PA 3BGWA 3NC1C 4M2LA 3P26A 4LJ4A 3TGPA 2FGKA 1KSHA 3K0SA 4ZDKA 2AHOA 2GCOA 2ZI4A 1OKKA 4NZYA 1W36B 2IS6A 2FSIA 1ZYUA 4A2QA 2YC4C 3EZ2A 5EUMA 1NIPA 8OHMA 1TMKA 1II0A 4PHHA 2K5UA 2QPOA 2PCJA 3OEED 2P65A 4CVNA 2PZGA 3M6AA 2A5DA 1IN5A 2IW3A 2OAP1 5F2EA 2O8FB 1FTSA 2FEOA 3QOFA 2EFGA 5LD2C 1UPTA 4RZ3A 4B2IA 4DZZA 4JKIA 2G83A 3OIWA 4AD8A 4DSTA 5AR1A 3LRPA 2PJZA 5FTJA 1TAGA 4B73A 1OHHA 2L0XA 3P1JA 2ZJ5A 3RDPA 2FMXA 4JIMA 1NIJA 3OEEA 1KY2A 4YDSA 3F0TA 1OIXA 3LFUA 3WMGA 3U2QA 2D62A 1KZGB 1XTQA 1E1RD 2MMGA 4A0FA 4XD7D 2AK3A 3KKQA 2GILA 3AKCA 4WAUA 2GWHA 4NKRA 4XSHA 4OHWA 2QBYA 5H70A 3B82A 4KVAA 1RJ9A 2J0QA 1NN1A 4GSYA 4RZXA 3W8RA 3FKSD 3MRSA 2OCBA 4CT5A 2HCJB 3NBFA 1SXJB 2IA5A 4M1YA 2A5JA 5JRJA 3PITA 4AC9A 2C5LA 1EWRA 3NBZC 2DY1A 3MJHA 3ZZUA 3EASA 4A15A 4XVUA 1LW7A 2V7QA 1TTTA 2FSFA 4YMUA 3ZD6A 3NH9A 1TEVA 2IS2A 4GRAA 2JJ8A 3WRYC 4NCHA 4KJZA 2Q21A 3VR5A 1AA9A 1XD9A 1DG1G 1Z0AA 1NLYA 3SJCA 1CJTC 3K70C 4UKDA 4BPBA 2GEVA 4Z51A 3TAHA 1E2HA 3I8SA 4B47A 5BN4A 2ZJ8A 4IVRA 3CM0A 3OFNA 3RLFA 4TYWA 3A4MA 4KFTA 4BFTA 2XGJA 3OZXA 1F5NA 4TLCA 6Q21A 2ZSEA 1B0UA 4ZPXA 3KTAA 4ZDWA 2IWRA 3VR2A 3AVVA 3D6TB 4ZKEA 1NN0A 3QBVA 2ZYWX 4PPFA 4C0BA 5FUWA 4B32A 5ELXA 1MO4A 2QPAA 1SXJD 5CIQA 2WWWA 1L2TA 1KAGA 2IBMA 2GK6A 4C0LA 1MV5A 3EAQA 4HSEA 1W0JA 3SC3A 1P5ZB 2Q9BA 2J7PD 1N3BA 1PLKA 1SVIA 2W0MA 4CW7A 3Q9LA 4B75A 1NVWQ 3WHLA 1SVOA 4HDOB 2G1KA 2YWGA 4MGIR 5BYKA 4QBIA 2JEOA 1FFHA 2KI5A 4JJZA 4A8JA 4C0KA 2ZU6A 2HLDA 1ZCAA 4M8NE 4M4SA 2PCLA 1J8MF 1KMQA 2GXQA 1LNZA 1X1RA 1X1SA 2OE2A 2H16A 3LW8A 5H1YA 3TLXA 1W36C 5EE9A 1SHZA 3ASYA 5JZVA 4AY2A 5G40A 3B85A 4JL6A 3C7KA 3SFZA 3N2IA 3JZAA 4A92A 1DAIA 3Q7PA 2QAGB 1RC8A 3T5DA 3B1YA 1U90A 3HP1A 3K9LA 3MG9A 2BCJQ 2BC9A 2J0UA 4IXMA 1RPZA 2IXEA 4C2UA 3K0EA 4N1AA 4TTQA 4HAZA 1C9KA 2G3YA 1R8QA 4GI7A 3A1VA 4DDUA 3CRRA 2UKDA 4PX9A 4TL6A 5HPYB 1P3JA 4D0NA 4Y0AA 4II7A 2QTHA 4CGZA 2ZPTX 4M1MA 4BFXA 4XTRA 1E3MA 1XWIA 3PEWA 5IDVA 4Q7JB 3BFKA 4Q03A 3CLVA 4FMDB 2ONJA 3I1FA 3KB2A 1OB5A 5FPTA 3ADDA 2IYWA 3EIEA 1CJUC 1GRNA 1QVAA 4TSFA 5E3HA 2YC2C 3IUYA 2CVHA 3P4XA 4QGAA 4B6FA 4HB2A 1XPUA 4QM6A 4ESHA 1AZSC 2GEUA 2ZE6A 1A2BA 5FPHA 4BUJA 5JEDA 1TUEA 5KSYA 4D82A 2SHKA 3B7GA 4JL5A 3Q5DA 2BEKA 4NU0A 4JSTA 4KXFB 4AURA 3BFVA 3PVSA 4G3XA 3CONA 1WA5A 1XCGB 2FG5A 3QEJA 1N6RA 3L0PA 3ND9A 4NTZA 4OKSA 3K0FB 4UXJA 1R0WA 2OXRA 3T1TA 2ZTSA 2CHVA 4XD7A 3DMDA 3K0AA 4OI4A 4LSGA 1KDTA 3WMEA 1G3MA 3QKSA 4JLNA 5KNCA 5DYIA 1GAJA 1NP6A 5EXXA 1T6NA 1N6PA 1BIFA 1UKVY 4IFEA 5K8UA 5KSOA 4C7OB 1KK3A 3RHFA 1E0KA 4FN5A 3BS4A 4MDFA 4GFDA 3HDTA 3GJ3A 4C30A 5EP1A 2CE2X 1IN4A 3AV0B 4B2PA 5D3MB 2D4HA 1NBMA 4HB0A 1UADA 2DFNA 3ZD7A 3UIEA 5E7IA 1D9XA 2QSYA 3O8RA 2VTKA 1CR0A 3RSLA 2CCKA 4K81B 2OLKA 1I4TD 2ZRFA 4MRVA 4P3YA 1KK0A 4FWTA 1DE0A 3C5CA 4B43A 1QZXA 4ZO4A 3K9HA 1XXHB 2GDJA 2F1IA 4TMXA 1S4QA 3BJIC 4U7DA 2JJ2A 2BV3A 4Q9JA 4KI0A 3DM5A 3GLHB 2P0EA 4TQ9A 1VYTA 4Q48A 3FPAA 3FMOB 4L15A 1TU4A 3AVUA 1EXMA 1P62B 4JL8A 2ZRMA 3CF6R 2R8RA 1XMJA 4LJ5A 4LPKA 5FL7D 1KI4A 4ASUA 5JJIA 2YJTD 2CL7X 3VX4A 1RVDA 1Z06A 2F1JA 4ESVA 1TX4B 1YZUA 2A9KA 3KXKA 1Q1EA 1D6JA 2DCUA 2IUTA 4DCSA 3OESA 2R62A 1OPXA 4KLNA 1YRBA 4XOIA 1K6MA 4IDPA 4S35A 1Q57A 2HT6A 3AUXA 1T0HB 3T35A 3AKDA 3ZZ0A 3IPYA 3VR4A 2XNDA 1NL3A 4Q4JB 1Z0JA 2G1JA 2FGJA 2RGNC 1RZ3A 2YWEA 5EE0A 2Q3FA 5LBIA 3VAAA 3GLGA 3QSYA 2BJVA 3LH5A 1E2NA 1GL7A 4NE2A 1IBRA 1EGAA 2OCPA 3IBYA 3R9IA 4A9AA 4QBHA 3I3SR 1JB1A 4S2EA 4TYPA 2QT1A 2ZE5A 4HLQB 3KJIA 1N5JA 1LTQA 1YZGA 2MMCA 3GJ0A 1N6LA 4CRWB 3IQXA 3KJGA 3A1WA 4TMKA 1FQJA 4G5GA 2H1LA 1CP2A 3EZ7A 1KJYA 2PZFA 1KOFA 2OFXA 2UZ3A 2QGZA 3DHWC 1HT1E 3MMPA 1T0JB 1FTNA 1G8FA 1NI3A 1ZAKA 3BIFA 4RD4A 3QQ5A 4LWZA 1GRQA 3KJEA 1M7BA 2NQ2C 3WNDA 1KO8A 2CLCX 4EFLA 1E0SA 1XPRA 3TK1A 2HF9A 3DPUA 4AYWA 1SVLA 5FBWB 2WJVA 3GLHE 4X8HA 1CEEA 4P33A 4XSGA 1GOTA 1VHLA 4KBFA 3SEAA 2QE7D 2QI9C 1Q44A 1YR9A 2OO7A 1XEWX 2AKYA 4QBGB 1Z3IX 2PEZA 5FI1B 4QG7A 2XZOA 2QBYB 1N5KA 4ZCIA 2HT1A 1NRJB 5CDFA 5AJWA 3ZVRA 4XWAA 4UNQA 1FL9A 4M9QA 3GLIE 2EFHB 2VP5A 1L7VC 2VHJA 3OIVA 2R6DA 1G7CA 3AVYA 3RNLA 2EWWA 2ZUDA 4JSYA 2A5GA 4PC7A 4LBYA 4D80A 2UVQA 1P2SA 2C2HA 3ADBA 2OFWA 3L0IB 2JDIA 3VTKA 2ZVQX 1BO6A 1OYYA 3L0OA 5K8LA 1G4UR 1RE0A 3SNHA 2E9SA 2GVZC 3BBPA 3Q72A 1E9SA 1KGDA 2V9PA 2D74A 4MITA 4Q19A 4OI0A 1OIWA 4RKEA 2D06A 1TQDA 5FR1A 3CIOA 2VLIA 3KB1A 5KOYA 2FF7A 1DO2A 1OLOA 3KXLA 2W6ID 2D2EA 4W5WA 5J4VA 3THYA 1II9A 2OESA 3KKPA 5CDFE 3EIQA 1R0XA 3PUWA 2HEIA 4BECA 1QG2A 1R4AA 3GLIA 4DLYA 3DKVA 2FPKA 4DEYA 3Q7QA 1VPLA 4BZXA 2WIBA 1DAFA 5B64A 3GJ5A 3W34A 2R65A 2F7SA 3KKOA 5AUNB 2G88A 4JT4A 1H65A 5EUQB 2WJYA 3WYAA 3QBTA 4LC0A 4MYUA 2VIIA 5HKKA 2R6CA 5B58C 2FNAA 2E1RA 1J2JA 3C16C 4TYYA 3LW7A 3UMSA 2VBCA 2FPLA 3L8ZA 4JLMA 1ZD9A 4YONB 3CNOA 1AZTA 5BYJA 1H8HA 3MWLA 4WXPA 3MWJA 3R20A 1RYHA 4E22A 3FE2A 2ZM5A 3H4MA 4TT3A 3K9GA 5IK2A 3P27A 4GMDA 3B1XA 3NH6A 1R0YA 1SXJC 2D7CA 2QZ4A 2XB4A 3K0CA 3LVQE 5JRZA 3Q5EA 2AR7A 4KODA 3VMFA 2NMVA 3HYTA 2YOGA 3AGQA 4R2IA 1HURA 1NBMD 3RRZA 3ZVLA 5KNBA 4FCTA 4NP6A 1JNYA 3GLGE 4YDHB 1WDTA 2YV5A 4F92B 4Q7LA 4D81A 4GPTA 1CJKC 3CPHA 4BLQA 4IDOA 1S0UA 4Z8XA 3PJRA 2JLWA 4CDGA 3AEZA 2O52A 1IOZA 2QA5A 2ZJYA 1TF2A 3EA0A 2NO1A 4BQSA 2GRJA 3HU3A 1W48A 4DCTA 2JATA 3CWQA 2Z5FA 2FFQA 1Z28A 4D0LB 2OXCA 3X1XA 1JEEA 1W49A 2DFTA 3CRW1 3ZJYA 3CRMA 2OM2A 1TEXA 2H57A 3RYTC 2JJ1D 3NEJA 3O8BA 3QG5A 3RS7A 2QQEA 1A5TA 2QG6A 4GP6A 3TJZA 4AKHA 4EPVA 2GF9A 2DPXA 3T1QA 4FCWA 1Z6AA 1E9BA 3TQCA 3VNVA 4W7SA 2FN4A 3B2EA 3LQQA 4O0MA 2F3RA 4EPTA 3PG5A 4IDQA 4JLKA 3CX8A 4XVRA 5TDHA 3CNNA 4CT4B 2NO6A 4DUGD 3WP1B 2O0KA 2XNDD 4OI1A 4PPNA 2QMUA 4IHQA 3RAPR 4CZ2A 2HCBA 4LUCA 3W8NA 1Z2AA 2REOA 3CPJB 5C2JB 3GJXC 2ODEA 3TMKA 2OBMA 1JPJA 4PHFA 2QRNA 1QHSA 5CJPA 4U02A 3ZH9B 1RRFA 4QC2A 5A4JA 1XCMA 1EK0A 4JMPA 2HDNB 4QKQA 4W9MC 3OIUA 4QGHA 3UANA 4DSNA 3EXAA 3I72A 1P7CA 1DG3A 1RKBA 2V1XA 4NYIR 4D6PA 2HYIC 3SHFA 4B2LA 3B13B 1JAHA 3NHAA 4DUGA 2ANCA 2B8TA 3O8DA 1G8GA 1DO0A 4TMWA 2XXAA 1Q1QA 2F43B 4IDHA 2R44A 3F3YA 4O2LA 3KQUA 2QRZA 5AK0A 2FFHA 4V0KA 2QP3A 3KTAB 4LRWA 3ONWA 4DC9A 4AKEA 4FCVA 1XDBA 2NG1A 2C99A 3SJBA 5BXQC 1GKUB 4OYHA 1PUIA 3DVLA 2ZRLA 1EFHA 2ZJ2A 3BAFA 4DXAA 1SXJE 3G0HA 3CPEA 2ZI9A 1E1QA 1N6IA 1R5OA 4MGKR 4MYTA 1Z29A 2D2FA 4LHVA 1SVMA 5CB8A 2XZPA 1GP2A 1NKSA 1M7HA 1CTQA 3U3RA 3GEHA 1KIMA 4PSVA 1NBME 5JWHA 4HB3A 4NCKA 1JXMA 4TN1A 4ACBA 4AYTA 1UBCA 2OCYC 4TLAA 3H86A 2J1LA 2J41A 2X8AA 4B3FX 2BMDA 1P72A 2IT1A 5KPDA 4OHYA 2WTUA 4RD6A 2A5YB 4WW0A 2HXSA 1UDXA 4G5QA 1DADA 5JI3E 2EYUA 3BXZA 1X3SA 2FFAA 2CNWA 2GA8A 5FTLA 1W47A 4M0LA 1NN5A 3CBQA 4JVNA 3WXMA 2GXAA 4OHZA 4OJQA 2QUZA 2RMKA 2ERXA 2BKEA 4HAXA 4DCNA 4ZI3A 1TF5A 1X8JA 4KITB 4PZLA 3WBJA 4F4IA 1XTIA 3G82C 3THWB 1LB1B 1XBTA 1YJ5A 2AD5A 2ZS8A 1IXSB 1AS3A 1E99A 1DAEA 5D3MA 4BLPA 4YMSA 2Q0HA 5F3WB 4H1UA 2JGNA 4LJAA 2ZRDA 4Q4AA 1G3RA 3OE7D 4TLDA 3IPXA 1N6KA 3PCRB 1JI0A 3S1AB 1N6OA 1ZRHA 1N6HA 1MKYA 2PX0A 4D25A 1QHHA 5F98A 1WXQA 1AS2A 4A36A 1E2QA 4L5BA 1E9DA 1XTJA 1Z8FA 1FW6A 4D4JA 1XD2B 4TWZA 2NPFA 1KI1A 2P67A 2ZRKA 4HI0E 2GCNA 3RRNA 5DI3A 2LWIA 1M7GA 2WKPA 2EU8A 3TVTA 2LCFA 2J3EA 2OHFA 4MKGA 3SQXA 1E98A 3SU8A 4FWIB 1U81A 4QOSA 3LD9A 3B1ZA 1PJRA 3TQFA 4CEJB 2A5FA 4GZMA 3TIFA 4WXRA 4KFRA 4DCVA 1C4OA 4KSBA 2YKGA 2XJ4A 3FOZA 1WMSA 2WV9A 3IDQA 3T34A 4DIEA 1E32A 3HR7A 4BEBA 3L8YA 3RC8A 4B76A 2BWJA 4OQNA 3N2EA 1E9FA 1W2GA 2ODWA 4PC6A 4Q4LA 1I2DA 1W1WA 3CF2A 5J40A 4EUNA 1Z0IA 3H2YA 3SYLA 2OBNA 2WWHA 1XMSA 1E2EA 2FH5B 3GLGB 1HV8A 1GNQA 2CL0X 2ZI3A 3BB1A 1XRJA 5DGXA 4RFSB 5JFGA 4LV8B 2AN9A 2QORA 3PEUA 5LB2A 1FPMA 2OILA 3X2SA 5JS7A 3U4QB 3FVQA 3WNBA 1W2HA 1R0ZA 5H68A 3UG6A 4RZUA 1XMIA 3J81k 2NZJA 4GOKA 2BBWA 4IXNA 1QHGA 4HLCA 1JAIA 2ZJZA 2MSEB 1KDRA 2NO0A 5ANRB 4TZ6A 3C41J 2IHYA 2V6IA 4M1WA 4LYJA 3U3MA 1A7JA 2CEAA 2JLZA 2JDID 3ZLJA 2F6RA 3O47A 1F2UB 4PANA 4OQFA 3T5GA 3KQNA 3I32A 4MRSA 4C0AC 1YVDA 2FOLA 5FOSA 1NY6A 4CEHA 2RCNA 2GAAA 2IX3A 1G5PA 1S8FA 2XTNA 5L3RA 3X1DA 3H84A 2VF8A 2C9OA 1UFQA 2WAXA 1Z83A 3KQHA 4KBGA 1ESNA 1CBUA 5CYPA 2RGGA 5UKDA 1G7RA 4EPXA 2CLSA 1YZKA 4EJSA 2BOVA 3OFND 4KLZA 1MT0A 3BH0A 4G5RA 3MJRA 5JJLA 3UPUA 3VNUA 1OFIA 3FHOA 4CIDA 4DLRA 3B5JA 2WJIA 4P4UA 1NVVR 5FOTA 1G3IA 3GEIA 4QHTA 2RAPA 4IFBA 1G8YA 3E5HA 2REXB 3GFTA 4FIDA 2X1VA 4NDZA 5JECA 4JJKA 1SGWA 4EIWA 1QG4A 1NSTA 2OLJA 3RS5A 5J4LA 5LPNA 4MRPA 2P5TB 1Z0DA 2V1UA 2PH1A 5JWRA 1G5TA 2CDNA 2RGNA 2OSBA 1GZSA 3FKSA 3NDPA 5E7JA 4PTLA 4BFZA 3X1YA 5JWOA 3SBEA 2NGRA 1W7AA 1EG7A 5JLJA 1JR3E 4B3CA 2QMHA 3FMPB 4G1UC 3SYKA 4Q1CA 4WIAA 1KNXA 3GLIB 2ZE8A 4AIIA 3V9PA 3PEYA 2IS4A 5A5GA 2O8EB 4LBWA 2ZRJA 2H7VA 4QFMA 1QHHB 1G1MA 4L9WA 2GAOA 2JLSA 4W5HA 4PSAA 2FSHA 1W46A
chains in the Genus database with same CATH superfamily
3E53A 4KXMA 1LSOA 1SZPA 1T1SA 4LJYA 2DPYA 1KC3A 1X74A 1G18A 2ZR7A 4PC3A 4RHCA 4WXYB 4D4LA 1AURA 1Z6YA 2NT3A 3A70A 4BQIA 2WHRA 4OL0A 4A1FA 3ILYA 1X87A 2Z1MA 4U00A 5EEGA 4WXEA 1CVLA 2IYOA 2ZB3A 1ZNWA 3C3PA 5FBKA 4B45A 4I1PA 1VI2A 2P5UA 1ZI6A 2WYUA 4R1SA 1WEHA 1CRWG 1J8YF 3F1KA 1FK8A 2QRMA 4WGFA 5T8KA 1FQWA 1VTKA 2JGKA 4KWEA 1E2KA 3RAFC 3HU2A 4XYLA 2YZ7A 1PK9A 3V6LA 1JILA 4OJKA 3TJMA 4B33A 1IBMB 1GL6A 5C1IA 3TTVA 3TUZC 1L4UA 2ZJOA 1IK6A 5A1TA 3FPLA 5EE3A 2NUAB 1SCBA 1OBFO 3SHWA 2C3OA 4Y6GB 1U7TA 2ZANA 1M6NA 2ZVDA 1IY9A 1PL0A 2PQMA 4REQB 2VHWA 3G1WA 1ZZEA 5C31A 1II8A 4I66A 4RCVA 1U4NA 3DL2A 5LDHA 3ZUPA 4DJDC 2ZBDA 4NFLA 2I80A 1KFEB 2P2DA 2R6AA 1Z39A 1RI2A 4NZOA 1UJ2A 1F51E 4G0OA 3KK0A 3D0KA 3L4BC 5EWJB 3DPSA 5MN5A 3PX2A 2OBYA 1JIJA 5IWCA 2PKQP 4Q9NA 1L7MA 4CCAA 4EL0A 5REQA 1XDGA 4BYMA 1SZCA 2X19A 1JDJA 4O4LA 4MKIA 5B4VA 5DISB 2GCOB 4OMFG 4PFKA 2ALJA 3IAS6 1L4HA 3GEMA 3DDCA 3IEIA 1XQXA 4V1CI 4QBTA 2W98A 4AJ2A 2IY9A 5IBCA 3V1TC 4X1OA 2HNKA 4F38A 1E4EA 2QJRA 3KDAA 4U7JA 4ZC1A 2PUBA 4PN3A 1RYDA 2PKYX 3EDOA 2A5LA 3GCXA 3CZQA 4EELA 3MPUA 4CKYA 1VBNA 4RHUA 4TLBA 1U8XX 4MROA 2I2XB 1N7HA 4KQCA 2C2XA 2NZUG 2ZIVB 4BRUA 1KARA 3LKZA 3UHOA 4Q82A 3AHJA 1L7DA 2DOKA 3OT5A 4DCJA 3D3EA 4IUCS 1T2DA 2C9DA 2J30A 3BZBA 4L4UA 3VAZA 3IMEA 4EJSB 2UU9B 1SWWA 5L7TA 1XV5A 4EW6A 5F35A 1G5IA 2R11A 3ABQB 3HRHA 1Z8HA 2BP7B 3UPDA 3PWKA 4KSYA 2GPBA 4DOMA 2YUTA 5C1DA 1ZM7A 2C8JA 1T9GS 2IIBA 1KI3A 2RCYA 3A31A 3A58B 4MH0R 4ZT3A 3IUSA 4XZ3A 5CFQA 4B71A 2WOOA 1UFRA 3AESB 2QR5A 1DIAA 5GVSA 1KU6A 3VR6H 1L5LA 4Z53A 1YR1A 2AFHA 2XOKA 1QONA 1UOQA 1ZD8A 2HU7A 3AUYA 4BE7B 3D6HA 5LQCA 3M5WA 2HIGA 3F2IA 4PBTA 1E2BA 3AYZB 3N8IA 4PYMA 1TAQA 1ZIPA 5TMPA 3L6BA 5IMSA 1JJVA 5LOVF 3UJ9A 1K7EB 1GM5A 2E87A 3E1SA 2RIPA 5PGMA 2OQIA 1EBBA 3E5RA 3E58A 4L4XA 1O96B 2DERA 2VRCA 4OQLA 4IS2A 1CRLA 3B1VA 4N0EA 4MDYA 5F1PA 4EG5A 2FRXA 1T4GA 3GELA 3VOAA 3ZHOA 1SUBA 1WMEA 2IYPA 3V5NA 4ZQCB 4A2PA 2C7GA 3A9TA 3IR7A 2PGAA 1D2CA 1Q3TA 1HG0A 1FJXA 2OV6A 2QR3A 1MXHA 3U62A 1J7JA 2QL5A 1JMKC 2B36A 5EWLB 1EUCB 3R3UA 4WSOA 1E63A 1XX6A 3D7MA 4ECEA 5IKOA 3QLEA 1P7VA 2C5FA 2TMYA 3MEQA 4YRMA 4JI2B 4TMTA 4GEGA 2FEMA 4HPJB 4MI3A 3W3AH 1KO1A 1GFZA 2FW7A 2ZUCA 3K9BA 1R6VA 5C3MA 1DJPA 3L6UA 3E7XA 2G25A 1X6VA 1DEXA 2N46A 3AF1A 2H4FA 2OGWA 1NBAA 4QU5A 1KEUA 1LXCA 1L7AA 1UBHS 1UKBA 2EKPA 3QXGA 2WE8A 1TAUA 3ZHBA 1NI4A 3JARA 1GVHA 4HS4A 4JLDA 1NU8A 1EUQA 1K3TA 3TRIA 3VQTA 1KO7A 5HCIA 3D9QX 1S3IA 4JB3A 3B1WA 1PNVA 4L8FA 1XZIA 1YOVB 1QR2A 1OF1A 5E2AA 4ECAA 4H59A 3I5YA 4BGEA 4IDAA 3ZTTA 4OOEA 3CSSA 1F9AA 4U2FA 1CCWA 4OIMA 1A8SA 5E2IA 3DDHA 2QN6A 5EE5B 2WT4A 1N2ZA 4YP0A 3QIVA 2AMVA 2M98A 1H3NA 3CJRA 1MOPA 3ZLTA 2AX3A 1E2UA 1U0HC 1D03A 4OP1A 3NBKA 3WFZA 1XROA 2C8KA 4XIJA 3BQ9A 3GYGA 3WFJA 3EZ6A 1OD6A 2IIVA 3DMGA 1XDSA 2BH9A 4ZO9A 4B4OA 2KSQA 4P35A 1U7XA 2H48A 5LIPA 1ZONA 2VQSA 1ZLYA 3G17A 1ZGBA 5CLLA 3TNLA 1KZ7B 3T1HB 3AHHA 2CKMA 2MSCB 3B2QA 3M4YA 3FNGA 2EJCA 4D98A 2GVDC 2YINC 4TM8A 1YB4A 2ATXA 3IT2A 4BJ1A 4Y2HA 4UDOA 3BILA 2P9JA 7REQA 4O4LB 5HFNA 3V7UA 2C9MA 5E6SA 1OIVA 4K8OA 1I5OA 4L0QA 5IAGA 4R84A 4L78A 1LEHA 2PSFA 1DBPA 1JECA 2ZSJA 3M5DA 4UMEA 1XYGA 2ODNA 3RODA 2CLMB 3BC1A 1D7OA 3GLTA 5EXSA 3A3OA 1B4DA 1OGYA 1ODFA 3EVBA 3AP2A 3DC7A 2UVPA 5F77A 3FJOA 1LLCA 1V47A 4O4JA 3ZIAD 4O4IB 1IOVA 1JR2A 3K8YA 4DS3A 5DEOA 4J0EA 4Y6LA 1GDDA 2X0NA 3N87A 3OLVA 1V11A 2QQ5A 1HNWB 1VI5A 1GPBA 3WA6A 1P4AA 2P7IA 3LPAA 3AVTA 5KTTA 2PUHA 3ABRB 3OM8A 3PLNA 2J3JA 1MTOA 1TMGE 5C35A 2J0EA 5C3UA 3EPKA 2BIFA 1QAOA 3D1JA 3MA0A 2HL6A 3EE6A 3OJWA 4FI3F 1T35A 3ZY6A 5CBKA 2FVXA 2E82A 3SYTA 3QVMA 2BFFA 3SMQA 5FPYA 3ONNA 3VDNB 1E94E 2HSEA 3I8XA 4ZQHA 4ZZ2A 3U7QA 4BV9A 2AXPA 2EKBA 2GAFA 4OK6A 2Q1SA 1J8FA 1NWCA 3DF9A 4XGQA 4GPBA 4C14A 3FDXA 2IHKA 3E9MA 4DV3B 2R751 3IT3A 4A0HA 2EWMA 2J7KA 4L07A 2HU2A 1RCUA 3HNRA 1XQ6A 2QLNA 3AYXB 4IIGA 2FZ5A 5KDLA 4LDNA 2A9JA 4PWZA 4A8PA 5BRAA 4ZXPA 4BEJA 1I6LA 1JYEA 1Y8QA 4PIVA 4L50A 1UZLA 2VBGA 4D9NA 4DABA 2HDHA 4V1CA 4TYNA 4IKEA 2A8YA 1XRQA 3VPGA 1Y8RB 1XD2A 4BFWA 5EP2A 2C7QA 1M74A 3NORA 4GG1A 3GWGA 2OYRA 1PU2A 3ICWA 1OKKD 1N2HA 4N01A 2NQ8A 3ANXA 1DAKA 1Z7WA 3OOEA 4Q1EA 4XVQA 5FBZA 4G0ZA 5F9HA 3FFAA 3GY0A 4X66B 4TXNA 1N1DA 1PD1A 1XZFA 1PF7E 5TC4A 4EPRA 2P9FA 3H97A 3FUCA 3NG1A 1JG3A 4UM9B 2PQ2A 1NLFA 4BC0A 3HN2A 1XTTA 1JV2B 3ELYA 4DVGA 1CQJA 1YACA 1W35A 2QRVB 2XE8A 3QF4B 4MQMA 5E7QA 4HDKB 4U2CA 4K40A 3RS3A 4DLAA 3UUGA 1AHIA 2X5NA 4DA4A 3QI7A 5GONF 3B2NA 3UT5B 4LBZA 3EC1A 5IT4A 2CMGA 1YK1A 1P1JA 1U2PA 3VAYA 3PKIA 5CVUA 1B23P 2VK4A 3ZV4A 2WB2A 2D1RA 1GSHA 2XUDA 3I45A 4EUHA 2XWBF 2AEMA 1E66A 1CQWA 1OX4B 1AVTA 1A04A 1Q1NA 2J87A 2ZBRA 3KXDA 5ENDA 4AKSA 4DPMA 4EHBA 1OZAA 3EXHC 2AYYA 2XBLA 3K09C 4LHZA 4C4YA 3OZ7A 1B3BA 3B6EA 4LK2A 1CJVC 2R7LA 5JATA 2V7VA 1HQYE 5B7QA 1KZHA 3RUEA 2OHVA 2Q2VA 1FP4B 2IDMA 1PZEA 2QMOA 3PC8A 4HPWA 5H8WA 2XZLA 2FZKA 5I4BA 2B5OA 2GUWA 4R01A 3VH1A 4BYGA 1YJXA 4ER7A 4MUJA 3RS2A 1BKYA 4DLUA 1R18A 1AZLA 2GASA 2XCRB 2RGRA 1X15A 1V2GA 4BRSA 2ZZKA 5G3ZA 1DQPA 3O8NA 1TTQB 3DEJA 4UUBA 1UANA 4G24A 5AI9A 5F2NA 1H4VB 3DYBA 2P1RA 4RVFA 3HVIA 1NQWA 3N6XA 3MLBA 3P2YA 2RK4A 4ZGGA 3L4EA 4M1SA 5BSUA 1LVGA 4C7KA 1R6AA 1RS0A 2PYIA 3H8JA 4U7FA 3T6KA 4YUXA 4Z54A 2WPDD 5I48A 1B15A 1IG0A 2J59A 3J80A 2PQ6A 3HFGA 5GADl 4HGQA 3R23A 1Q0TA 2WJWA 3GPIA 1Q0QA 3IUPA 4G67A 1NE2A 5JU6A 1O0CA 2Z2ZA 3TWOA 1SCIA 1KAOA 3MAJA 4MYHA 4UFOA 1XCJA 1SXPA 3KPYA 3GFBA 3W7VA 4ZQEA 5LMUB 1FDWA 4KQ9A 2WMOB 4KDCA 3MVEA 4H0FA 3GFGA 3RBZA 3PR2B 1KEWA 1NLZA 4BMDA 3CVOA 2DYKA 4C9BA 5KTMA 3U16A 3RGWS 3ISTA 2FZCA 2P0YA 3OIGA 4IOKA 3FMFA 4GVLA 4HFRA 1KYIA 4O5AA 4PR3A 4R68A 2D1FA 4LC9A 3K05A 5EGSA 2BFOA 4CWAA 4LXGA 4KFCA 1FUEA 1I9CA 1ZM4A 1DAGA 3DW3X 4BTVA 3FXAA 2R7AA 1RWVA 3PNPA 3QRWA 2I54A 1KNQA 3HSKA 3ZE6A 5ADWA 1G8SA 3P97A 3VTFA 3U6BA 2V0GA 3VKWA 1M75A 4JB2A 2DULA 1I3CA 1KA9H 3LKVA 4KU4A 4KUGA 5IAAA 3LT5A 3OVMA 1ZGJA 3DEZA 1SZDA 3CLHA 3VV2A 2F00A 4TMZA 2QHXA 2AJTA 5A06A 1YASA 1XXLA 1YDMA 2QTMA 3DD5A 2IEZA 3OE5A 4MWGA 5AVOA 3SC2B 2J8ZA 3AP3A 4UBIA 4BLVA 4I3GA 3M9WA 1H2FA 5C8YA 4CMGA 4KLRA 1U4OA 3WBBA 1PNTA 3MMNA 1FUUA 1GNRA 1PUXA 2VBIA 3BH7A 1P75A 4M7WA 1UZAA 1S9DA 3IP8A 5FQNA 2C59A 3KR0A 4RYDA 4F3CA 4LV5B 2FWIA 3BE4A 2ZCVA 1ZD3A 1DBWA 1JHVA 1M34A 2FWRA 2IP4A 3AZQA 2WLTA 3F7NA 4GX5A 1ZVQA 4Q6WA 1T1RA 3WAKA 1RXVA 3V2UA 3KJQA 4DYVA 3R1IA 4WUVA 1JKJA 4ZVUA 3WB1A 3ZE8A 2ZQ5A 4OQMA 4FK8A 4IV5A 4EECA 3HKEB 1L8QA 4FFRA 1NC3A 1YDFA 2H5LA 3LL7A 1W0KA 1OTXA 5KOIA 4MGZR 3DBHB 1CLUA 2PG3A 1J42A 1CKEA 3ZWYA 1T5HX 1I3LA 1WHTB 2CY0A 2ORWA 4UTOA 4ZK6A 2HDOA 1HK7A 1QXSA 3L7NA 1Y6JA 3NKVA 4EJMA 1QFSA 3HRKA 3Q3HA 4BNYA 2P2NA 1P1BA 4XRGA 3MJVA 2JGAA 3NHPA 4L4YA 4ZT6A 3S8YA 2F64A 2DUUA 4GEKA 2X9GA 3ZU2A 1Z4NA 3NIWA 1LCIA 3E22A 3GRCA 3QMWA 4HNAB 4NDNE 3MLEA 2RK6A 3UT5A 1CVRA 5F7JA 3QPBA 3CLRD 1YJ8A 2I76A 2VDWA 1GTZA 1LF5A 1T8YA 4OSEA 1JQ5A 1ZU5A 3PZRA 3NV9A 5I8ZA 4HUTA 1SCKA 3DZFA 1J1ZA 1KKUA 1N2EA 3DXZA 1ZVJA 2F3QA 3EGOA 3H5VA 1GT6A 4MVJM 5E4FA 1DKRA 2IYYA 5EKSA 3SMVA 2J32A 1H93A 1N7GA 3VBEA 1TECE 2QUAA 4XQCA 4MR8A 3CX6A 1ZISA 2O2CA 3ETLA 1CYDA 3L8FA 4R3NA 4ZGBA 4WHMA 4TYQA 3MINA 5BN5B 3IQHX 1VSUA 1SK8A 4NCJA 1N2CA 4GOOD 1J8VA 4KYIB 4F46A 3S81A 1QP4A 2F9MA 1KPIA 1T4DA 3C15C 4K0RA 3LQRA 5F23A 5H3HA 2XCIA 4FHEA 2B0JA 1M1UA 4L9SA 1GKYA 4WNAA 5EFZA 2ZETA 5FD8A 5DM70 1EX1A 1OU4A 1M2VA 3GT0A 3OMWA 1EFRA 3G2HA 2I22A 1KOJA 2BCGY 1X1EA 4OSOA 3TW0A 4DHEA 4C0QC 5CNJA 4F91B 1HQDA 3O8QA 3K30A 1S2IA 5GONA 2IXAA 3NB0A 3RVOA 2IPLA 2P5SA 3SVZA 1LPAB 3K5PA 4ZTBA 4PCLA 5K0EA 1Q1GA 1ID8A 4TMVA 3REFA 3MB8A 2WABA 3F6YA 1X1BA 1PV4A 1HFKA 2C88A 9GPBA 2BZSA 4RLSA 1G1AA 1U8UA 1EX6A 1ZGAA 1GG5A 3EYAA 2VF2A 5LB4A 3MERA 3KOYA 4LZPA 3JY6A 4J1NA 3HKBB 4URUR 3U4IA 1N2OA 3A1FA 2NYUA 3AXTA 1IN6A 4LSZA 4AMYA 1EB8A 3EDQA 2QE6A 4NRDA 2A6PA 4TKUB 4IDCA 4M60A 1JFFA 4PYQA 3D43A 1LPBB 2JGMA 5HQJA 3EXHA 2UZIR 1QQ6A 4KN5A 1AN9A 1W5BA 4QOJA 2NP6A 4XFKA 2C4KA 1SFRA 5G4KB 3ZE7A 4HNVA 4IMPA 3RS4A 3WL7A 3L92A 1YUNA 3TLBA 2HGZA 1X8LA 4AX4A 1P7YA 3SBXA 2VXBA 2XPCA 4P9NA 4BX9A 4CU5A 4LDRA 4YGXB 3MLAA 4FOLA 2QLMA 2Z2JA 3L7IA 3NYRA 3QPDA 2RGDA 5GM1A 3HACA 5A0FA 1GGMA 3UTCA 1X8KA 2DWQA 2I4LA 2WB4A 3ECAA 2G0NA 3ZEAA 2QMQA 3DSRA 3BL5A 4FE4A 6ADHA 4TTTS 3N9IA 3SJAA 3DMHA 1K97A 4BCBA 2UXBB 1OYVA 2ZJAA 1L0BA 3O4VA 4IVQA 1D0SA 4PICA 2PRJA 2C03A 4P3KA 2HGSA 1MABA 2ODBA 1S7CA 2JFVA 2W2XA 3JW8A 2R6GA 4LAFA 1VI6A 4C7BA 3VZRA 5KSPA 2B8EA 2Z83A 2YIDA 3QVSA 2B4RO 3MAGA 3JV7A 5BV1A 2EARA 3JZMA 3R7AA 3HYLA 2XMCA 4GXQA 3AH8A 3VVCA 3PTZA 5JISA 1C3JA 4DV7B 1GGNA 3BMCB 1CR6A 4E33A 2XLCA 3M3DA 1OH7A 4YFVA 5GV8A 1IZ0A 1UMKA 3ZCPA 1D8AA 3KRTA 4GMKA 1IOLA 1V7ZA 3HP7A 4Q3BA 5B30A 3ENNA 3QVGB 4LHSA 3P2OA 5CYFA 4HGNA 2AXNA 3CH6A 3VVMA 4AICA 3B9BA 4D8YA 4CM7A 1FXWF 3BIJA 2NPIA 3M83A 2R79A 2PUEA 1G59A 1UWCA 1Z7BA 3ND8A 4QU9A 2CK3A 1K8QA 1ADGA 1X80A 1YJBA 2GYWA 2Q9AA 2V97A 3K1AB 3KZ1E 4JBLA 2W2LA 2Q7DA 3ROKA 3RROA 4IDGA 5KVSA 1QH1B 1V3TA 2VQEB 2WNSA 3BAZA 3WX0A 1VIYA 3PGLA 4X6LA 2GBFA 4P92A 1XEXB 4RPJA 1U7ZA 2ZJ1A 3AI7A 4N65A 2RKOA 3KNZA 2XSZD 2PEYA 2JRCA 1ZUD1 4QUGA 4JELA 2ZIXB 4NNJA 3NPMA 3LHIA 2XRFA 3ESBA 3EMKA 1A5AB 5FULA 1EFUA 2ZTLA 2WTBA 1CLEA 5CCXA 2W4MA 3TH5A 3LCVB 3MGBA 1M0WA 1Y6RA 4KWCA 5FUXA 3A6JA 4Y9TA 3HADA 3ILVA 4J3JA 1HFJA 4R9RA 5BW8A 1HT3A 3NIBA 4G1FA 1F6WA 4GMXA 1FFCA 5C1BA 4MR8B 4IG4A 3PDUA 1RNLA 2FSVC 5FL7A 1K63A 3LUBA 3ZHCA 3WWPA 3R6TA 3VR6D 3PC8C 3HCFA 1IUOA 1PQUA 2QSZA 1ECGA 5HUJA 2LIPA 1MJNA 2WTEA 4H7PA 1V39A 5BORA 2VATA 3GG2A 1O6ZA 3LQYA 4PTZA 3MT7A 4HDNB 1L5RA 1X19A 4ML3A 1E9RA 2BFCB 3MTBA 1J5EB 2R8OA 3QFHA 1CS0A 2WU8A 2EG5A 4KK3A 1KMHA 4YFYA 1K7CA 2GZAA 4CMCA 1OJ7A 2VDRB 2AD1A 4QPCA 5AI0A 2BTOA 2VAVA 1NYTA 3KT3A 3UUWA 3EQZA 4DYDA 5IYZF 3FWNA 3GJ7A 4JBGA 4C4XA 5I5EA 1ABBA 3I01M 3WKDA 4EMSA 3IIJA 3ZZNA 1LLQA 2P6MA 1S2OA 1FLVA 5BNTA 1TYAE 1IVYA 2WVGA 4YJ3A 2Z5VA 3PQ2A 4PAWA 4I1SA 4C5BA 5EJEA 5BMVF 1HEUA 3OJLA 1E4VA 3TIXB 5DIZA 1K68A 3OE1A 1RKUA 2AQ8A 5CAEA 4E94A 5HG0A 3P4YA 1X7WB 4WBNA 4R51A 3PUZA 1QCZA 4K6OA 4XWOA 2UYQA 4MK4A 3HJCA 2BFFB 3ZWWA 1A88A 4OVKA 3PR1A 5TMBA 3VU8A 2FPSA 2ZWAA 3LC0A 3PNKA 1LK0A 1NT2A 3VVBA 3CTMA 1FX0A 4HG2A 4HEA1 3ZVNA 3QVLA 3MXTA 4L5IA 1PS8A 2PFKA 4ER0A 1JIVA 5GINE 4RMJA 3GCWA 5C4MA 1NATA 5FUQA 5JVDF 2QVLA 4NYIQ 3OQ1A 4ROSA 4DDHA 1A96A 1U8AA 3WMRA 4DQXA 1PZXA 3D5EA 4A6DA 5DTRA 2WDZA 3K0CC 2CK3D 4MW0A 3K4HA 4JA0A 4F4HA 3GJZA 2P0AA 4X6UA 1C3LA 1U2DC 2IYVA 3ABOB 4RJIA 3VU9A 4MW2A 4P2BA 5EJIA 1I6KA 1QE0A 2ZIUB 2V7XA 4QL3A 4QRHA 3W6NA 3N8DA 4YBZA 2FPIB 2PZAA 4D9MA 1FTGA 4ND6A 4AKGA 1XC7A 4N6NA 3V2IA 1Y8RA 2H2GA 5EMMA 4Y1RB 4BLOA 1LX7A 1YVRA 3ELWA 3HCRA 1EXVA 1L4FA 4Z3OA 4ZALA 3FYDA 4BO3A 1KVTA 1MABB 2YXLA 1PIWA 1CRPA 4PLGA 5JH7F 3CKMA 3PUYA 1U3FA 5F76A 3C1TA 1ZN9A 4JX8A 2G4CA 1H9AA 3DCYA 2R1TB 4FGLA 5HZMA 1S8AA 3CRVA 4PHTA 1ADFA 3BMQA 3BMCA 4ZARA 5HIMA 5JBQA 1T2AA 2P9ZA 3UA4A 2JHFA 2ZYSA 2JFYA 1SHLA 3EC2A 3EZNA 2GSWA 3AG5A 4KQEA 1TT7A 2ERYA 4GOJA 4YP6A 3SK0A 1N2XA 2ORVA 3ITNA 3FOWA 2WM2A 1JFTA 2ZSAA 1NZJA 3GEGA 2AFIE 3B7WA 4HLDA 4TV9F 4UD2A 5HVNA 5DI3B 2QTTA 2ROQA 3IA2A 4EDFA 1OT3A 1C9JA 2NX2A 1Z22A 2FY8A 3I9OA 1CIJA 3H17A 3Q88A 4IIHA 4LHYA 4RW0A 5DK4A 3Q3IA 3TF5A 1S2GA 2FKAA 4B34A 5KTKA 4G01B 3SM3A 1N25A 2BKUA 2X3UA 4RK4A 4GKJB 1PJTA 1NAIA 3USZA 2ZRBA 2OMKA 1V7PC 2J08A 2B6HA 5EKTA 4DM4A 1X94A 4OX9B 1PZMA 3DV0B 5KSZA 2V55B 1AG9A 3BFPA 2C7RA 2ZXUA 1U9YA 3JZFA 3OH8A 5F5LA 1PSDA 1RQPA 4EG8A 5BVGB 1BQ4A 4P3NA 2QLFA 1DO8A 3QX7A 1V5GA 5EERA 5AVUA 3TGLA 2RH5A 3INRA 1IIRA 4D0GA 3W5AA 3A6ZA 1YZLA 3IOMA 2QL9A 3EZYA 5EKUA 3UAOA 1LC3A 1N75A 4IJ5A 1WM1A 5K0FA 4BMCA 4ZZ0A 4U7WA 2C4UA 4O2RA 4YYZA 3ZY5A 3ENQA 1M6VB 1Z2DA 5CDSA 3V8NA 2ID9A 1USVA 2BFBB 3PLAE 4YK7A 2C3YA 2DWOA 4UTZA 4EEKA 2W2OA 3LUHA 2GNOA 4B85A 1P81A 4WFJA 3ROXA 1IVSA 1AUOA 3MPOA 1CY1A 3UUFA 1YOBA 2A0KA 1PZGA 2I1VB 1UC9A 2Q0XA 3JYNA 1XMXA 3L0SA 3NNDA 4J0KA 4Z99A 5ELMA 3CC8A 5C5DA 3TEFA 4BBJA 1YBVA 3TUIC 4ZAVA 5BRNA 4DMUB 1LSUA 3AU9A 1APBA 5DHRA 1XNGA 2PWYA 2G6TA 2QAJA 2MDTA 2W83A 3AETA 5THQA 1RJGA 2M6LA 4O1HA 4UCFA 4KE6A 3O4RA 2IYXA 1XIVA 5A9RA 5BQFA 2OXEA 4C2BA 2C04A 1H8EA 2R47A 5DZSA 4DBVO 1Z4IA 2MHCA 1D6SA 1A71A 2WFLA 4AJLA 2L2QA 2OK7A 3C24A 3VZDA 1ZM9A 3IP5A 3TE7A 3W6PA 4JC5A 3OHPA 1A8QA 4BO1A 3UBTA 1TPZA 2SKEA 1WSDA 4RANA 3L06A 4CQLB 1Z5NA 2CYCA 4BASA 5IP5A 4WKCA 5AICA 3VR5D 1SHKA 1BAPA 4DMHA 2PT7A 3LBIA 5CT8A 4KXWA 1ZOOA 5CEFA 1VMAA 5DI9A 4YHBA 1MO2A 2NYRA 1ZNYA 2PFGA 3O4JA 1XTZA 5CNKA 1Z5UA 2HA6A 1KERA 1XKLA 3E2IA 3P5BA 4KZKA 3F5SA 5IEBA 1U8CB 3P0HA 2C42A 4KXXA 4GC5A 4Q3CA 3VGJA 1EFCA 2B7BA 1O0SA 3K6RA 3RWOA 4BMZA 4EJ2A 2HHAA 2ZBPA 3O31A 3SDSA 1LZLA 1ES9A 3A9RA 3BIWA 4W9RA 4H3VA 1DCFA 1WB9A 1G2QA 2B5VA 3C3DA 3W5JA 1UFVA 2ZRPA 3AEKB 4TTJA 3SR4A 4EMBA 3PHHA 3LRXA 3T7SA 1A8IA 1XPOA 5FP0A 2FMKA 4IH9A 2Y8EA 1DT3A 1Z35A 1WV0A 2AR9A 2TMKA 3GRZA 2BR5A 1VE9A 3E84A 3A6EA 3SHOA 4C05A 2FWJA 5JROA 1NBEA 1NW5A 2BGKA 2WU0A 4P4NA 3FM9A 1IAQA 3VKGA 3DKPA 3FCXA 2B4AA 3SXUA 1C81A 5FWDA 1JLKA 5BQ5A 3SFTA 3QKSB 4U2GA 1KK1A 3VR0A 1A4RA 1XQVA 1SBYA 3NBUA 4BP1A 2G0AA 2IF2A 2AFIB 1L4GA 3H5RA 3LCRA 3R7FA 5K20A 2DVMA 4QASA 1GNSA 3R24A 4RKQA 2EBHX 3JQFC 2BM8A 3CXRA 3I09A 3NHMA 1F8YA 3OQIA 5AUOB 4BFSA 2BHRA 3R8XA 1AB6A 3T06B 3U56A 2Y0PA 4YJGB 4V02A 3U48A 2QV7A 2YASA 4LX8A 3UK6A 2JK1A 3SE7A 2A0FA 2C9YA 2OCAA 4TL9A 2WTNA 3F1LA 4H0CA 2QW0X 3S68A 2X4LA 4WX2B 4Q9LA 1P18A 7ADHA 3K6JA 2X7JA 2R5WA 4AUEA 2G4VA 4WZBE 3EIUA 2HREA 1HE2A 2C78A 5J5CA 4JI0B 2ISQA 1TL7C 4IVPA 4M36A 1DS6A 1Z88A 2ZSDA 1UJ5A 4BNLA 3CRQA 5HJ5A 3O75A 4Q4HA 5FADA 2PS1A 5BMVB 2AK2A 4IBOA 2OPHA 3UK1A 4TQAA 4JXXA 3KQLA 4PRLA 4Z5XA 3DLBA 3E9RA 4JI6B 3OPVA 4X60A 4XA8A 1YF3A 5JPIA 1MUUA 2ZE7A 3DB2A 3DE4X 3DM9B 1COWA 3ZY3A 4XIFA 5SZJA 1ISFA 4ZI2A 5LQKA 2BH2A 4D25A 4HL6A 4FFBA 3F5DA 1RYNA 2O4CA 4OQYA 4ZV4A 5L40A 1M2HA 5KCZA 2H59A 3F7OA 4TKVB 3DTYA 4NK5A 2O59A 3LDFA 2JB9A 3JQ9C 1VYVA 4JAVC 1T1GA 4B48A 3EDMA 4MUBA 3OA2A 1JHPA 3ENWA 1YH3A 2O2XA 4HWTA 5IPFA 5JQGF 1F3OA 4MV3A 3U40A 3IEUA 2GZ2A 1X2BA 1U8EA 2XNCA 4FPXA 4LIPD 1T8RA 4HTFB 2DC1A 2OC9A 1GNLA 2BRUA 1CY8A 4HQNA 1NQXA 3TCKA 1PZNA 1RC1A 1GTRA 3I2GA 4TM7A 3BTUA 2N1BA 4BJHB 3GJ8A 4MUGA 2VYVD 4OQPA 4C6TA 1K27A 2JGRA 3RC1A 3T94A 4PYRA 4DQKA 1BDMA 1Y3DE 1P3Y1 4KE7A 4ZDIA 3TQSA 4A6XA 2ZWMA 4DADA 3QPUA 1KFJB 3JYPA 4NEGA 4DKXA 2JW5A 1K0UA 5ITZA 1EP1B 4XH9B 1QU2A 3SQWA 2LTAA 2XYHA 2JIMA 3C3MA 2QGFA 3G88A 2IEAA 4J0GA 1U0TA 4Q3DA 2VPPA 3L5OA 2YL2A 3KSBC 2ECFA 1TZJA 4HBZA 1JALA 4X41A 1E1YA 5DGDA 5KKAA 1V26A 2OQRA 3EXHB 4LTMA 5DE3A 5KS2A 3SZLA 2FDCA 2PWBA 4UD6A 3TOVA 4D74A 1EI9A 2Q5QA 2P35A 3NPAA 1E79D 1GZ4A 1P1IA 1Y9JA 2W8BB 1UIMA 1VMDA 5KB3A 3KUCA 1HMYA 4MKHA 2Y99A 4ZDJA 4N8SA 3IVAA 1KEEA 1NRWA 2ZITA 1MLDA 5FCDA 4EY7A 3KDSE 4I4TF 4U9UA 4S1NA 2OORC 3JAKA 2G9ZA 3CX7A 3EH1A 4P31A 4I4TB 1IM8A 2PS0A 4WKBA 1CY4A 2QLBA 4Z9XA 1P39A 3W77A 1GCOA 1QOZA 2YICA 3BK2A 1PHPA 1V3QE 4A5OA 1SU7A 5IUNC 1SUAA 1JFVA 2VDVE 3UV3A 4E6PA 4M9RA 2JZCA 3T61A 5ENVA 4JVLA 5E1BA 5LMNB 1TYCA 2CCGA 2A35A 2RHDA 2JF0A 2Y76A 5F1OA 3WK4A 1AK9A 4LRUA 3V8RA 4A1OA 2CLFB 1IL0A 3DHNA 5CB6A 3N39C 4LJ6A 3TSYA 4BWFB 4YAOA 4PZZA 1DOZA 2XJ9A 2QJFA 3SCZA 3T0IA 4DLVA 3BK7A 2HFKA 5K1ZA 5A5FA 2FU5C 5HKOA 5JCZA 3KSUA 1TCCA 1U6KA 4MVXA 1WKVA 2BPOA 2RBGA 1Y1QA 5FV7A 4BFUA 1E77A 4R1OA 4FVTA 4RTSA 3HH8A 2OWDA 4HNGA 3RBXA 4RE6A 4EZBA 3WQQA 5AWFC 4COOA 2OHGA 3O0TA 1AKMA 1GWNA 5FWNA 2O8EA 4DDVA 2Y1EA 1OI3A 3K1AA 2W2VA 4PGMA 4BNDB 4ND8B 3WRWA 4IEEA 2PT9A 1PR1A 3BE6A 1MJGM 4JODA 5EE1A 3LAWA 5HQ3B 4GBGA 5CX1A 2PK3A 2WILA 2UVPB 4ZQGA 2OHIA 2LCQA 5H59A 2CBZA 4K1LA 3DGFC 1RKQA 4IHJF 1L8LA 3NHJA 5IULC 1J22A 2VZEA 4IGIA 4IQ0A 1WMDA 2P30A 2GKGA 3GVCA 2AF3C 1Q74A 2Z2YA 4TVBA 4XYMA 3UH0A 1QH8A 5GZ3A 2H1OA 1R00A 5CFZA 4MUKA 1PV1A 4GOXA 4R0MA 3OU6A 4EY8A 1NJFA 3L43A 1BX0A 4G25A 4Z0TA 3AVPA 4IGFA 3FNQA 4KPUA 4WV3A 3BT7A 3LNTA 4BKOA 1QF6A 3NOQA 1MT3A 1LBEA 2YIMA 3GA7A 2X9QA 3BD7A 4OM8A 3K0AB 4TRRA 4UULA 4D9GA 3TFOA 2IYFA 4Q4HB 5BMVA 1N33B 3R5TA 2Q4BA 4WMLA 3QUQA 4HV4A 3M3PA 4EKDA 1XTKA 3VBCA 3OLYA 3OZTA 1DDGA 3HS3A 4L7VA 3SBOA 1IWOA 2WYHA 4XYBA 4WBSA 4YAJA 3FD8A 3ACBA 2GN0A 4HYEA 4L9AA 4YRZA 3W2GA 5IJXA 5BSTA 3UYLA 1QZUA 3T0GA 4EQ6A 3FB1A 3HCPA 3EQ7A 3P5SA 4OAQA 1C1XA 3WGVA 3B6ZA 1E4YA 1OA1A 2VT7A 3RTEA 3WA7A 3KM0A 1J2RA 2PX5A 2VJMB 2JAUA 2A9FA 5EIXA 5BYBA 2QE7A 4ND4A 4IZHA 1A2OA 3TTXA 4QJ5A 2JH3A 2ZYGA 3MCAA 4POAA 3NALA 5CMLA 4YMTA 4YR7A 4QUKA 1QNLA 3AEXA 3EWSA 1QJCA 1NSFA 2XDAA 4HEQA 4JZKA 4TV8A 1K9VF 1L7RA 3EA5A 1NR7A 1X9GA 4NBNA 1AV7A 1WSAA 1CHDA 4G2TA 1E0AA 2YMMA 4LOJA 1GA4A 2DT8A 3AF0A 2BM0A 4MRAA 1Q16A 2G9NA 2A4MA 2J5KA 3JPYA 4EO9A 3LXRA 4UFPA 1Y0BA 1ABFA 3HB9A 1QHIA 2GNPA 2AC7A 5FYDA 5LC1A 1PE0A 2E7ZA 4FSHA 4LECA 4OLFA 1WTAA 1HDIA 1OXVA 4ZYVA 3U44A 1M2KA 1FNSA 5DX8A 2C8VA 2Z3WA 3EZGA 4JLOA 3RHZA 5LD2B 1UXGA 4R9NA 3N2KB 4OHXA 4CGYA 3B7PA 4M53A 3FWYA 4G4JA 3DFUA 5DB4A 1BZYA 2BMEA 3QY0A 4I3FA 2POQX 5KYKA 4W1SA 2PNFA 2O14A 4Y9RA 3WWDA 4EM6A 5JI2E 2HHHB 1E7SA 2W8BA 1HUQA 1YU6A 4BLSA 1HQCA 4EI7A 1ADBA 1UFOA 5JYDA 4LF9B 2C5SA 3WY9A 1WMFA 2HMTA 2IEYA 4KXUA 5CDYA 4GE3A 1LLFA 1WHSB 1JBEA 1L1EA 1AKEA 1SA0A 3IB3A 3P52A 1DWQA 1YB5A 1SKUA 1JGTA 3D4OA 4XDGA 5ERYA 5F4ZA 2WHEA 5CG2A 1GTL1 5AM4A 3HCOA 1C9YA 1ZN8A 4M8IA 2FPIA 4B1FA 3EZFA 4N41A 2AOWA 5FORA 1B8UA 3M0EA 4MI1A 1QP8A 3OICA 4E4TA 2C54A 3K53A 4PC2A 3P2KA 3TR6A 4GWGA 4EA9A 3CRNA 2DLDA 1JLLB 3NOOA 2XUJA 3QENA 4A03A 3DDWA 4LJRA 1SC4A 4KX5A 2QYHA 1T10A 1P1HA 2BFPA 3DO6A 2BGGA 4BU1A 2Q6IA 3ZBUA 1TQ4A 3QU5A 4CKBA 3EXIB 2HWWA 3Q9UA 4PG8A 4QODA 4CLHA 4UAUA 4NS4A 1PR3A 3HR8A 5DH9A 3RQSA 2H8KA 3FUWA 3URMA 1Z4QA 1VSTA 3KXIA 3RSSA 1IM2A 3KC2A 2W6JA 4BNWA 4BVHA 5B6JA 4DANA 1J09A 3A0RB 1ECCA 5DSZA 3OMLA 3LDUA 2M9MA 2BJHA 5D3QA 9ATCA 4HVLA 1Z5PA 2ZXFA 2O4UX 3HA5A 2E4UA 4C43A 4URVR 4FW8A 2CW5A 2VJAA 1PR2A 3ZDZB 4P81A 5BSWA 2R66A 1JXOA 2JLCA 1UBLS 2VDUE 2LZ0A 4IIYA