4TYWA

Dead-box helicase mss116 bound to ssrna and adp-bef
Total Genus 182
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
182
sequence length
508
structure length
508
Chain Sequence
b'SKLIHVPKEDNSKEVTLDSLLEEGVLDKEIHKAITRMEFPGLTPVQQKTIKPILSSEDHDVIARAKTGTGKTFAFLIPIFQHLINTKFDSQYMVKAVIVAPTRDLALQIEAEVKKIHDMNYGLKKYACVSLVGGTDFRAAMNKMNKLRPNIVIATPGRLIDVLEKYSNKFFRFVDYKVLDEADRLLEIGFRDDLETISGILNEKNSKSADNIKTLLFSATLDDKVQKLANNIMNKKECLFLDTVDKNEPEAHERIDQSVVISEKFANSIFAAVEHIKKQIKERDSNYKAIIFAPTVKFTSFLCSILKNEFKKDLPILEFHGKITQNKRTSLVKRFKKDESGILVCTDVGARGMDFPNVHEVLQIGVPSELANYIHRIGRTARSGKEGSSVLFICKDELPFVRELEDAKNIVIAKQEKYEPSEEIKSEVLEAVTEEPEDISDIVISLISSYRSCIKEYRFSERRILPEIASTYGVLLNDPQLKIPVSRRFLDKLGLSRSPIGKAMFEIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ATP-dependent RNA helicase MSS116, mitochondrial
publication title Molecular insights into RNA and DNA helicase evolution from the determinants of specificity for a DEAD-box RNA helicase.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein/rna
total genus 182
structure length 508
sequence length 508
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2014-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
A PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4tywA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4tywA02
1G8GA 5FOUA 3WMGA 3ZS9A 1BYUA 2JLYA 2ZJ2A 3RC3A 2GCNA 2QP9X 2UVQA 5JSZA 2IS6A 1OJLA 1E96A 1XTJA 3WXMA 5TXGA 1P5ZB 1VMAA 4QGHA 4W7SA 2IS4A 1KY2A 1P4SA 2ZUDA 1UBEA 1GKYA 5E7JA 1U0JA 4D0GA 3VU9A 2ORIA 4GNKA 4HZUB 2H8KA 4DLZA 521PA 1ZMXA 6Q21A 1DTSA 2CCGA 4KV9A 4MRVA 2FJUA 2O8DA 4L5BA 3UXMA 3H1TA 4NCNA 4JSYA 3OE7D 4RY2A 2OCAA 2VHQA 5GJWC 3GLIA 2RKOA 3T35A 3GLGA 4GPTA 3ADCA 4NE2A 1G3RA 3PCRB 1Z28A 3ZD6A 1U98A 1GSIA 4XH9B 3FHCB 3QEOA 3TVTA 4LC1A 1X8LA 1V5WA 2X8AA 2GXSA 1DOAA 2QY9A 4Y0AA 3IGFA 4PSAA 1DO0A 4ITRC 3THYB 4Q7MB 3B9PA 3A36A 3ZDQA 3P27A 2J0VA 1N6NA 2XB2A 1H8HD 2WWIA 2WJVA 3UMSA 1OH5A 1FNMA 4TMXA 3U6BA 4DLVA 3SE0A 2MMGA 3IILA 2OBNA 4C4PA 4G5OA 3W8NA 3NEJA 4EJSA 3I5YA 5KSPA 4D0LB 3K0CA 4PSVA 3QXJA 3NIBA 4GMXA 4US1R 221PA 4MITA 1TU4A 4JKIA 2NZJA 1QHXA 3L0PA 4MA4A 1K6MA 3NVAA 4YXWA 4PFSA 1KDTA 3RSLA 1VECA 2ZS7A 2F7SA 2ANCA 4XD7D 1YZUA 1Q1ZA 1U2RA 5AR1A 4Z1MA 3ASYA 4UKDA 4DCVA 2B7BA 1E2GA 3MCAA 4P4SB 4YMSA 1TL7C 2O8CA 1JQJC 4ASUA 4B35A 1J8MF 2XZPA 1E79D 4M21A 4GBMA 4CDGA 4O25A 3KZ1E 4DUGD 1EK0A 2C9YA 1G20E 2D2FA 2G6BA 2GA8A 3ONWA 2ZSDA 4BZPA 4EPXA 1D8TA 4EPYA 2VP4A 5KSYA 1DADA 1Q1BA 2YKGA 1L4YA 1SKQA 4Q21A 4BRUA 3CRMA 1MRSA 1U9IC 3C5HA 4Q4AB 3KQHA 4AKHA 3IO5A 4MDEA 2GNOA 2OXRA 2B21A 2QN6A 2MSDB 2FSHA 1HE8B 1F2UA 5KNDA 2BOVA 1OE0A 4N0EA 2FZ4A 1Z6GA 4C0LA 3OEHA 1X86B 2DCUA 3EASA 2FOLA 3M4YA 3AB3A 4RFVA 2JJ8A 2QM7A 1DEKA 3DZDA 3GFOA 2Q3HA 4HDCA 1S96A 4TYYA 1NP6A 3TE6A 3Q7QA 2PZFA 1DE0A 1PZNA 1UBGA 3B85A 1P62B 4BQSA 2VPPA 2HF9A 1JBKA 2EYQA 4PC7A 3TW4A 2Q3FA 3CWZA 2R2AA 3O8BA 4LBZA 3EIHA 1UKEA 1NN1A 1CTQA 2HXYA 1R4AA 4NL4H 1KJYA 3BERA 4XVQA 4DXAA 2PX0A 1SVSA 3ND8A 2IYUA 3PXGA 2D2EA 2R6CA 4F4JA 3L0OA 2WPDA 1WBBA 1XXHE 3AVXA 2JIZA 2FF7A 4O2RA 2QE7D 3MJRA 3PUVA 3PITA 1CBUA 1TEVA 2GZHA 2Y8EA 4XWAA 4Z54A 4I1VA 1ZM9A 3EZ7A 4AURA 721PA 2JEOA 2V3CC 2DHRA 2YVUA 3P20A 3P4YA 4NCIA 5JWHA 1KK0A 1NN3A 2GAOA 1YR6A 1DVRA 2DY1A 5DYIA 2VHUA 3SS8A 3SYKA 4AYTA 2V54A 3ZIAA 4B2PA 2WSMA 3BB1A 3C4JA 3DEFA 2ZITA 4HAUA 4LI0A 4DLTA 3PEYA 2CE7A 1XZPA 2OE2A 3HU3A 4BLOA 1ZM4A 3CO5A 2JLXA 4UXJA 2GEVA 1XEWY 3TKLA 3CR7A 1JR3D 3AEZA 2HJGA 3C5CA 2A30A 1RVDA 1N5JA 2BBSA 1G3UA 2ZM5A 1H8EA 2OZEA 3WRXC 4C0AC 3NBXX 2ZRKA 4CF7A 2CL0X 1NJFA 4M4SA 3K9NA 4PQFA 3AVPA 3TMKA 3BOSA 2J0UB 1G5RA 4MKHA 4TYNA 3U44A 2AK2A 4I99A 2GK6A 4OI2A 4P0TA 3GJ4A 3LBIA 4Q03A 1E9EA 4D81A 1Z0AA 2XXAA 4P4TA 4DKXA 1XU4A 2OCBA 2CK3A 2REXB 1CU1A 3FVQA 3IEVA 3OEEA 3WY9A 1OW3B 1KSJA 4C7OA 1S9HA 2ZJOA 1Z6TA 1QVRA 1ZUNB 2VF8A 1KJWA 3QPUA 4JBWA 4YQFA 3CNNA 2CMKA 2GJAA 4TLCA 2EWVA 3RYTC 3VR6A 1HH4A 1NKTA 4YDHB 5FI0B 1W0JA 4GP7A 3AUXA 5EP1A 3RS4A 4A0FA 2HV8A 4PC6A 2A2ZA 2C9OA 2GRJA 5H8WA 1M7HA 1E9BA 3UK6A 1YHNA 1CR1A 1XRJA 2ZR9A 4BFXA 3FMPB 2QPAA 3NTUA 3FFBA 3IIKA 4QBHA 5FR1A 4EIWA 8OHMA 4B3FX 2QUZA 4PAMA 1E0AA 1NY5A 2VP9A 3FKSA 4A6XA 1S9DA 4IVPA 5FTNA 2J59A 1DAHA 2C78A 4Z51A 2LCFA 2FZLA 4NHOA 1LFDB 1AN0A 1P7CA 1KJZA 4D4KA 2BJVA 3IUYA 3B1VA 4Q4JA 5E7MA 5EE3A 4MYCA 4DDTA 4IOMA 2WAXA 4FIDA 2R44A 5DLQC 1NBME 2QRNA 1XTSA 3QVVA 5G40A 4K8OA 5A5GA 3GJ3A 3CR8A 4UQOA 1AKEA 4FMDF 3I5XA 1G8HA 2FN4A 3KDSE 4HZUA 4A8JC 3RDPA 1SHZA 1IY2A 1GL9B 4KJZA 3OESA 4PPQA 4R9UC 2AFIE 1AQYA 2AWOA 4HUTA 1E9CA 5J4VA 1E69A 1ZM2A 1B0UA 2JJ1A 5DI3B 1E2NA 3KJGA 4PC1A 2JGNA 5HCNA 1T8UA 4BUJA 3KQKA 1XXHB 1N25A 2ZSFA 2VHJA 2ZEJA 5FOSA 4A8JB 2QZ4A 2ZIAA 1BOFA 1N0VC 4B3BA 2PH1A 2R6FA 2WKRA 4OHVA 1IM2A 2XX3A 1JPJA 4BFTA 2QROA 4A9AA 5FTKA 3WP0A 1W7AA 1A1VA 1MO4A 1Q44A 5CM9C 5FPTA 3C15C 1Z6AA 5FPKA 4D26A 2P6RA 2GVZC 3A4LA 5JMTA 3GLIE 1R5NA 4BFZA 3GLGE 3K0SA 2NO9A 4I1UA 2XNDA 4CW7A 4MUBA 3BAFA 4JLPA 1DAEA 1UKZA 1WRBA 3FE2A 2WJYA 3LX5A 3L8YA 2ZAOA 1WB9A 1Z0KA 1T3HA 2JLRA 2DFLA 2W83A 4UNPA 2F1HA 2EW1A 1GOTA 5JEEA 1OIVA 3MFYA 4V03A 2ODEA 1K8RA 2H17A 2IYVA 3B1ZA 3EIEA 3EWSA 2FSFA 2ZE7A 2OFXA 4E5UA 1OH6A 4RFSA 1NJGA 1Q22A 2VRWA 1IY1A 2OCPA 4QXAA 4M1OA 1H65A 4OL0A 3CRRA 3L0SA 1FPMA 3W9YA 2E1RA 2CJWB 1Q3TA 1IHUA 4QFMA 5FR2A 3AV0B 4RD1A 1YZNA 4DCTA 5LBIA 2W58A 3HWSA 2DR3A 4XOIA 2ZQ5A 1WE2A 2RH5A 3BE4A 4P4SA 2D4HA 4KU4A 5AK0A 2QBYB 3CB4A 4KBFA 1N6PA 2CHQA 1MR3F 2WVJA 1T6NA 4DJTA 5DHAA 5CIQA 3KJEA 2GXUA 1GVNB 3RS3A 3GLFE 3EPLA 2HJVA 1IXZA 3A4MA 1XJCA 3A58B 3NBYC 4ZDKA 1FTNA 2EQBA 4LRWA 4R2HA 2CVFA 2ZETA 2JAQA 3SFZA 4TTRA 1LF5A 1ELOA 1T3LA 1JXOA 1N6IA 1P2UA 3ZQJA 4Q4AA 4M1MA 1VHLA 4LOAA 3AGPA 4A2WA 3BK7A 1XD8A 4S2EA 4TLBA 3A1WA 1RYHA 3FOZA 1S2MA 4LYJA 3SBEA 3OIVA 3THXA 1VCIA 3K0FB 5HZKA 3V4RA 3TH5A 1U9IA 2RHMA 2XOKD 3AVYA 2N42A 2F43B 3A4NA 3TQFA 4B34A 2G9NA 1E2JA 1ZJ6A 4MYTA 4BECA 1OXXK 2OESA 4PPGA 4LGMA 4TMWA 4BEJA 2QP3A 1M34E 1Q1EA 1N5KA 3CKLA 1DO2A 1GRRA 3T12A 4RD3A 2P67A 1XCGB 1ZINA 3EZFA 5DO9A 2AFHE 2KE5A 4QC2A 5L3SA 1E2QA 2HT6A 2OSBA 1RPZA 3QKTA 1QDEA 3AVUA 4JBXA 4DB4A 3D31A 5FUWA 1X8JA 1TADA 4V0LA 2O8BA 3GJ7A 3QJYA 1DG3A 2FE4A 4W5HA 5FTJA 5JSZB 2ZREA 4B2LA 2REBA 2AL7A 3CPEA 3AP2A 5IF9A 2C95A 1W1WA 1XJ0A 1NMZA 4C30A 3ZZUA 2AK3A 2F9LA 3HJNA 1F2TA 3OAAA 5HZHA 2B92A 4JZKA 5KPDA 3DVLA 1G8PA 1S8FA 3ETLA 1NRJB 2RCNA 3IPYA 1QRAA 2GEDA 1Z0IA 4DLYA 2O8DB 1PUJA 2VP0A 2QEQA 3LQRA 3QI2A 2QL6A 2BMJA 3MSXA 2H57A 1S1CA 3GLIB 5KHOC 1EXMA 4YMUA 1ESMA 1LB1B 3GLGB 2GJSA 1MO6A 5EXPA 5UKDA 1GL7A 1GWNA 1ONBA 3M0EA 3VHLB 2BDTA 3TSWA 1JNYA 3QQ5A 2ONKA 4DLRA 1ZYUA 1OV4A 1VYTA 4GI7A 4EJSC 1N6KA 3K0CC 4RZXA 4KLNA 2QG6A 4FD2A 1SXJE 4A82A 2VF7A 5J5CA 3SC3A 2IYTA 1KOFA 4Q19A 5H68A 1UDXA 3VX4A 1EFRD 2YWHA 1Z6YA 4JJZA 3MLEA 4JBYA 1N6LA 1OXUA 4EJSB 4FMBB 1PLKA 3CONA 3FDIA 1HURA 2BWJA 3I8SA 4LC0A 1KZ7B 1GILA 4US0R 3CX7A 1Z0DA 1BS1A 1IBRA 3U7HB 3SQWA 1KHTA 1IONA 4G5QA 3KQNA 4M1KA 1QZXA 2PT5A 4KAXA 3GJ6A 2IW3A 3EA0A 4QGFA 3EARA 1E2DA 3TRFA 1HTWA 3ZJYA 4BFYA 5EZ5A 1A2BA 3EIQA 3T1OA 3GLFB 1R0XA 1T9HA 3B2EA 3FHOA 2IYRA 2VO1A 4DLUA 3PFIA 3GEIA 1COWD 1FW6A 1ZC4A 1FUKA 3TUIC 3QSYA 2O8CB 4PX9A 5FBLB 5CYPA 5DN6A 4JLOA 1OYYA 2WWYA 4ZCMA 4Q4HA 3FPAA 5JLJA 2J9RA 4PC2A 1OB5A 1Q3HA 2XAUA 4HLQB 2GHIA 4C3ZA 1YRBA 1GTVA 1XTKA 3ZVLA 4C0HA 3AF1A 3U61B 2ZRIA 3QXHA 4NMMA 3MWJA 1W2GA 2JJ2A 1OH8A 1XMIA 3FB4A 2F55A 1UFQA 4Q9JA 4QGGA 1F2UB 5K8LA 3MWKA 4D25A 4Q66C 4TLAA 2AHOA 5IDVA 5A4JA 1KKLA 4TTPA 3K0AB 4PAQA 4LYFA 5CLQA 3OHMA 4IEEA 1VDZA 4AY2A 4JSTA 1T4GA 5DI3A 3L0IB 4TTQA 1YE8A 2GETA 3DDCA 2ZI3A 4FN5A 1TTTA 4CEJA 3CRVA 3LD9A 1E1RA 4JS0A 4B48A 4EDHA 4C2TA 2JATA 5EE1A 3OZXA 3AVWA 3W5IA 1G21E 4LX0A 1N6HA 1SKYB 3SYNA 5B58C 5C1BA 3NC1C 4KODA 5G53C 1G8YA 1L8QA 1OF1A 1YR9A 3EAQA 1JAIA 3L43A 1MV5A 4X8HA 3DKPA 2UKDA 4GZLA 5FH9A 5HKKA 1ZD9A 2PJZA 4I4LA 3KXKA 4D6PA 3T5DA 4L8GA 2OEPA 1RFLA 1ZNYA 2CLCX 3BWDD 3SJCA 3UANA 2EFEB 3LH5A 3G0HA 1SVMA 4TMTA 4NYJQ 1KSFX 2FFBA 1K5DA 1KAGA 2FFAA 5FUYA 2V6JA 2BIFA 1SXJC 1OPXA 4JLBA 3I62A 4QBFA 1IN4A 4L15A 3AM1A 2VSFA 1UF9A 2LWIA 4TT3D 3BORA 1E2FA 1R7RA 1TF2A 4KITB 2IK8A 1UAAA 5GADl 3T1TA 3K70D 2V1XA 2P65A 3Q9LA 4B3CA 2ZE8A 3OE7A 1S1MA 1W4BA 1SXJB 4B44A 2UZ3A 3IQWA 4B76A 1OHHD 2NTYC 4NDZA 1KK3A 1NLFA 3LO5A 4PQYA 1P3JA 2BVNA 2IF0A 4WW0A 1G6OA 5AJYA 4TL9A 2N1BA 3FHTA 4JKYA 1OFIA 1N5LA 2JLWA 4M1TA 2Q9CA 4FI3C 4A15A 1G7SA 5LB4A 1H8HA 2ZRCA 2W6JD 5JRJA 1HUQA 5CLLA 1M7GA 2ZRBA 2XXAB 2C2HA 3RRMA 3AVVA 4M9QA 2BM1A 1EFCA 3TAHA 3PENA 1LTQA 3AQ4A 3D7MA 4OJKA 4C7OB 2XGJA 3U2QA 1PLJA 4J0QA 1R0ZA 4FWIB 1QHHA 5BN3A 1XMJA 4OI4A 5C46F 2BCJQ 3DL0A 1HYQA 2OAP1 3U60B 3LWNA 1E2EA 2F3RA 1AJEA 5D3MA 3TK1A 2F43A 1Z0JA 4Y0VA 1G7TA 4RKEA 4XD7A 1IN5A 1XF9A 1Z22A 1XWIA 1ZNZA 4B47A 3RC8A 3EZ2A 3BXZA 4QJ5A 4YLGA 3IQXA 1KI8A 2QGNA 4QHSA 1CLUA 1Z0FA 1ZUHA 3M1IA 2IYYA 3NG1A 1RJ9A 1AIPA 1AS0A 4WZAE 1TPZA 4U7DA 3GJXC 1E79A 4U5XA 1NBMA 2W0MA 2ZVPX 4LYAA 2C5LA 2DYKA 1E2IA 2G1KA 3ICQB 3K9GA 2VBCA 1HQCA 4HAYA 4KVGA 3HU2A 3X1ZA 3SQXA 5SZIA 1S4QA 1UEIA 4FXPA 2NIPA 1RIFA 5E4FA 5K8TA 4Q4JB 5BYKA 2J3EA 4YMVA 3WYGA 3GLHA 4WXRA 1XX6A 5TMPA 1P9NA 3U7GA 3HP1A 5JJIA 2DPXA 5CM8B 4GOXA 2CNWD 2WKQA 4ON9A 4IW3B 4ZCLA 2RAPA 3LX8A 1X1RA 1M7BA 3IBYA 3PR1A 4ACAA 2NGRA 3CF2A 4A2QA 2GWHA 1QHYA 2Z0MA 5EUQB 1P6XA 5KOYA 3TR5A 4WZBE 1YZQA 2P0EA 4HYYA 4EAQA 1ZM7A 5G41A 3EPKA 4B71A 2OBMA 3I61A 4HAWA 2YHSA 2I4IA 2ODWA 1Z2CA 2QA5A 4RKFA 3E5HA 4IEIA 1G16A 4ABYA 3QG1A 4OQLA 821PA 1KAOA 3CIOA 2WMNB 4TSFA 2J7PD 1SVLA 5BW8A 3CF0A 2WOJA 4JIMA 3B5JA 4FCVA 3FTQA 5ELXA 2AR7A 4GMDA 4A0GA 5JEDA 3QKRA 4RCZA 4GP6A 5JS7A 1JB1A 1KI4A 2ORWA 1SGWA 2QE7A 1Z8FA 2IYZA 4NCJA 4WXPA 4CEIA 4TWZA 3DMDA 1IN7A 2QRZA 2QSYA 2VP5A 3UKDA 1AS2A 1OSNA 2FEOA 1KI6B 4RFSB 3WP1B 2IHYA 4CT5A 5FBRB 3GQBA 1ZU5A 3K9LA 3MGCA 2YOHA 3SN6A 1G64A 2Q0HA 5JFGA 1F60A 5EZ6B 4C0KA 3IO3A 1XD2B 3I32A 3GLFA 1E2HA 3K8YA 1DAKA 3B13B 1KKMA 2ZANA 5KSZA 1TX4B 1W49A 1TF7A 1N5IA 5KTYA 4DCNA 4MGYR 1YKSA 3A8TA 5FFMA 2GCOA 2PMKA 1JR3A 3PV0A 4DHEA 1XPRA 5GJBA 1TQ6A 1GP2A 5JJLA 1BIFA 3HYTA 3N5CA 4MKFA 1X8KA 1OFUX 3NDPA 4TQ9A 4JYBA 2FH5B 4Z8YA 2V1UA 1DBSA 1G5TA 1NVXQ 1BO6A 4Q5IA 3KQLA 4JVMA 4QG7A 3X1XA 1DS6A 2FSGA 3JZMA 2WJIA 2H7VA 2CEAA 4V0NA 4M9SA 4B3GA 1NVWQ 3K0AA 4GSYA 3THXB 4BLTA 2WJJA 3IEUA 4HLCA 1U94A 3LXRA 5KPJA 1FQKA 1N0WA 2ZU0C 5DI9A 4MUAA 1R6BX 4IHQA 4KFTA 4WVFA 5FUXA 2CE2X 1XZQA 4KLZA 4PXAA 1XEFA 4YDSA 1NKSA 1P2TA 2ZRFA 5L3RA 2RGEA 2GXAA 4Q1BA 2QTFA 4KYUA 3WMEA 4XWKA 3KB2A 4BLRA 4LYHA 2FGKA 5L3SB 4A1FA 1IJFA 3VR2A 1CXZA 4H9GA 3VHXA 2DFKB 5IK2D 2O8BB 2ZUCA 3SU8A 5DHFA 1OKKD 2GESA 4M22A 2WIAA 4URVR 1JJVA 1XCMA 2OLJA 3AF3A 4JLAA 2YWFA 4S35A 5HE9A 4G5GA 1U0LA 3B8HA 3LRPA 4JL6A 3SBDA 4IDNA 2WWFA 2DWPA 1Z6XA 2FSIA 1F2TB 2R6DA 2IYSA 3MMPA 2PT7A 3IKJA 5KNCA 3REFA 2B6HA 4EPWA 2ZJAA 2JLZA 4AG6A 3PJRA 2Q9AA 3DHWC 4M2LA 3BH0A 2IBMA 5KDOA 2D74A 3CNOA 1HA3A 4HAVA 2IWRA 2BM0A 1SULA 3CNLA 4NCHA 3EX7C 4F4IA 1SXJA 1TQ4A 2QNRA 5JRZA 4MGZR 2CLDX 1AQUA 1YVDA 1P60A 2XJ9A 2Z43A 1KNXA 2TMKA 3BH6A 2CCKA 2KI5A 2L0XA 4WA7A 4OI1A 3SFVA 1E1QD 4EKDA 4KSBA 5JBQA 3ZD7A 1RC8A 3VR5A 1P61B 3GFTA 2AXNA 4A6PA 5C18A 2QAGA 5JJKA 2VHCA 2ZRNA 1Z83A 1OIWA 1XTQA 5B57C 5CITA 4HB2A 1M6NA 1XD9A 1W36D 4MDFA 4ZPXA 3P26A 2ZE6A 4PQRA 5AUQA 1KK2A 1J90A 1P73A 1TMKA 2J5XA 3GJ5A 4ACBA 1NVVQ 4OQMA 1F48A 1ODFA 4OK6A 3KKQA 5KU1A 4DIEA 4QL3A 2WSSD 3LFUA 2XEXA 3UG7A 1N6RA 3VFDA 2O8FB 2BHRA 3X1WA 1Z5ZA 4DDVA 5JHGB 3R20A 2ZRPA 4MGKR 3TNFA 4OQFA 1EWRA 1W4RA 4Q9HA 1RRCA 1CJTC 4LK2A 2H18A 2VYFA 3MWLA 3UIEA 3LV8A 4AD8A 1J70A 4XVUA 3OFND 5D3QA 1AA9A 2DFTA 4NTZA 2GVDC 4QOSA 4PHHA 4PPNA 3RRNA 2PL3A 3RS2A 2B8WA 4Q4HB 2QAJA 1E2PA 2GKSA 1XNJA 1NMYA 3EC1A 2GF9A 4B6EA 2JA1A 3ND9A 3TSOA 4URWR 3HU1A 5CDFA 3PUYA 4AYXA 1OT3A 4TLDA 3TQCA 3K09A 4Q7LA 1T0HB 2ZRLA 5FOXA 4EPTA 5JCPA 3VKGA 2Z6VA 1G4AE 2QMOA 3CZPA 4PHGA 4RD6A 2ZJBA 1HEIA 4AIIA 4BZQA 2ZROA 2OUKA 1G4UR 2H16A 2NO7A 2D3WA 3NBZC 1VCNA 4JLDA 1VKJA 4DB2A 3RVBA 5LD2C 1Y63A 5SZKB 1KMQA 1SVIA 1R8SA 1ESNA 3VNVA 4HUQA 2R9VA 3GLHE 3LAWA 5KDLA 4MH0R 2XOKA 3UATA 5DYGA 3ZYCA 3I4LA 4CEJB 2CXXA 1E9DA 1VG9B 2ZU6A 3BFXA 3IIMA 3HYRA 3KJIA 3SJBA 1NG9A 3GJ8A 4TMZA 4UXHA 2ZRGA 3LLMA 4HDQB 3SHFA 1N0UA 2J41A 2A5GA 2VQSA 3GD7A 4KCGA 4KXFB 1E0JA 3TUZC 1VTKA 3CW2A 3ZQ6A 4B32A 2WTUA 2WBLC 4FCTA 4B74A 1NIPA 4XVRA 1KGDA 1M1YE 1FP7A 2CBZA 4QNMA 4NYIR 1MKYA 2GJKA 4QNRA 5FUVA 1IY0A 2RGDA 2ZUBA 3KKOA 3AKYA 4RZ3A 2IEYA 4JLMA 3W6PA 3U7FB 2ECKA 3AH8A 1OXSC 3A37A 1XJQA 1P2VA 4LSGA 1CR4A 1KI6A 2EU8A 1U99A 4AWXA 1F5NA 1AKYA 4JT4A 4N3NA 3SOPA 1LW7A 2ZS8A 4B6FA 2FFHA 3RWMB 3MUFA 4F7WA 2YWGA 2ZRMA 5KUTA 4L16A 3IDQA 1XD2A 4GFDA 3NBFA 4JLKA 4XTRA 4MRNA 2CHVA 3T15A 3S1AB 2IS1A 2FWRA 3OF5A 1U90A 2C99A 5GJVC 1X1SA 3MWYW 4LHXA 5FOTA 1J99A 4KFUA 4PO8A 3MG9A 1KI7A 1RZ3A 1WCV1 2ZJYA 5FL3A 1VPLA 1E2MA 4ZKDA 5JHHB 2HCJB 4D80A 1I2MA 3ICEA 1UM8A 1KDOA 1W5TA 4IFBA 1YZKA 1JECA 1LS6A 1RRFA 5CB8A 3K53A 3QNUA 2H92A 2EFDB 5EE9A 4OK3A 5J40A 1TUIA 1E2LA 4DCSA 1EFRA 4B73A 1JR3E 2HLDA 3A1UA 4DSTA 5KSOA 3Q3JB 3P32A 2I1VB 1G7CA 1MOZA 4RJLA 1KZGB 1FOEB 1QHHB 3I72A 5EP2A 4JLJA 2HYDA 3MAAC 2R6AA 3IIJA 4DSOA 5D3MB 1Q57A 3AF2A 1YZLA 2HXSA 2VLIA 2ZXUA 4M9ZA 5BN4A 1RYFA 1KSHA 3E70C 4M8NE 5DGXA 2WMOB 1COWA 1RJ9B 1S3SA 3I73A 4FMDB 4IDPA 1G3MA 1R5OA 2NZ8A 3QG5A 1JPNA 2JJ1D 1ANKA 1KO1A 5FBWB 3RAPR 1GZSA 3FYHA 1FTSA 3UWKA 3U5ZB 3R9IA 1BYIA 1HQYE 2IUSA 1T91A 1GIAA 4BLQA 1BH2A 3GLHB 4D4JA 2BMFA 4ZIRA 3E2IA 5EP4A 4AG5A 4JVNA 1XPUA 4FWTA 1ZD8A 2IT1A 1CR2A 5KO2A 4WZ6A 4MKIA 1VYVA 2KWIA 2ZJZA 1SVOA 3NKVA 3SR0A 3TLXA 1P72A 1GDDA 3PG5A 2JASA 4P31A 4HEJA 1YZGA 4RD4A 3T5GA 1P75A 4LJ7A 4B3XA 1P2SA 2ASEA 1G18A 2JCSA 4V0MA 2A7QA 4JLNA 4NBSA 2PEYA 5IRCD 4ZDWA 1HT2E 5B64A 5L8VA 3I92A 4NZYA 3O8RA 4OHXA 4HAZA 1F6BA 3E1SA 2HT1A 5G3YA 4AI6A 2OO7A 4DT1B 2QPOA 5F2EA 1BMFD 1KDRA 2FFQA 4ZO4A 3QKRB 3ZVMA 5L3QA 2G77B 1O87A 4XTCS 1KMHA 2B8TA 4H1UA 1EX6A 5F9FA 1P9RA 1AZSC 1IN8A 4WOPA 4BGDA 1LS1A 4CEIB 4LJYA 1OIXA 4Q7JB 3QKSA 5IHPA 5AUNB 4E07A 2BCGY 3AKCA 4GDFA 5FL7D 1TEXA 1V43A 2FPKA 2LKDA 4OJQA 3KTAB 2N46A 2GAAA 1ZUIA 3UMFA 1Z07A 3EW9A 2O8FA 4ESVA 2R65A 3MJHA 1M2OB 4HB3A 4RD0A 4TT3A 2WWXA 1GITA 3BIFA 3RHFA 3KUCA 3VKWA 4URUR 3QXCA 2OLKA 4QHYA 3AF0A 3O8CA 1A5TA 2EYUA 1NSFA 3T61A 3LVQE 4DLWA 2VIIA 2ZRJA 1EFTA 2GCOB 4RZUA 2NO1A 3RS0A 4PR0A 1W36C 2JLVA 2NPIA 3W8RA 3QF4A 5LB2A 1J2JA 3K0EA 4M1WA 5BYJA 1NNEA 1ZW6A 2X2FA 1CJMA 1QG4A 3TBKA 2V6IA 2X77A 3PEWA 1D6JA 3PEUA 3QXXA 4DDUA 1UBCA 1XBTA 1W36B 2CDNA 2ZS9A 2HEIA 2W6JA 5JS8A 4CRWB 1XTRA 3IHWA 4H1VA 4XSGA 5J4KA 2ZR0A 5EUMA 1JEEA 4IOKA 1CJVC 3GCGA 4Q01A 2G3YA 2WAYA 4ZI2A 5CDFE 2YJTD 3B60A 3KKPA 1A2KC 2QI9C 2G0NA 2ZYUX 2K5UA 3ZGXA 2IL1A 3B1XA 3Q7PA 2ZYTX 2ERXA 1YR8A 1CIPA 3R8FA 3KXLA 4BASA 4PO9A 2UZIR 4A92A 4JVLA 4O2LA 3BFVA 3R9WA 2R6GA 4LPKA 3G5UA 2F1IA 3O8DA 4FINA 1VHTA 3ADBA 4BFSA 3FFAA 2IUUA 3QBVA 3C14C 1DPFA 4OHWA 2BV3A 3G82C 5H1YA 4AKEA 1T0JB 4GT1A 2ERYA 1G3IA 1FMJA 1ZAKA 4P33A 4DWJA 2RMKA 2YC2C 2J0SA 5K8UA 3BGWA 3Q8XB 4M1YA 2GJ9A 4C9BA 3A1VA 3P1JA 3ASZA 3KFXA 4ARZA 5B30A 2H1LA 121PA 2ZI9A 3BS4A 2FNAA 3PUZA 5BXQC 2GBLA 3U7EB 2IXEA 2RGGA 1RE0A 5EXXA 1DAFA 2KB0A 3EWAA 1NI3A 4IDOA 5DE3A 4KYIB 1NVUQ 2GZAA 1LY1A 4YONB 2HDNB 4MRSA 4Q7KA 3S1AA 1KIMA 4RVCA 3WRYC 4CT4B 3IBGA 4U00A 4YMTA 2QAGC 3N2IA 3EPJA 3W34A 1WXQA 3K9HA 3T1QA 1VIYA 3N2EA 5HPYB 1KO5A 4BPBA 3THOA 3SI7A 3U3KA 2OCYC 1KYIA 4PC3A 2V7QD 1KO7A 4L4UA 2J7PA 1R5BA 3TR0A 2QAGB 2AD1A 1CS4C 5CB6A 2W2VA 2ZRAA 2ZR7A 1Z08A 5FOVA 2PZGA 4Q48A 3KL4A 2F1JA 2A5YB 3FMFA 4TQAA 1L7VC 3WYAA 1XPOA 1U8ZA 4EQ6B 4QRHA 1DG1G 2QT1A 2NOAA 1X3SA 5EQTA 3RLFA 2VP2A 4O3MA 1E0SA 4K81B 1CJKC 5CJ2A 1D9XA 4TMKA 5TB5A 3OIWA 2CL7X 2GCPA 2FGJA 3HPRA 3Q5DA 4BE7B 2AWNA 3RS7A 4P3YA 1R2QA 2BJWA 3FGNA 1D2EA 2B7CA 1KNQA 3LVRE 4R7ZA 5EP3A 4ZV4A 4BFUA 2BC9A 4CIDA 3DMNA 3ZZTA 2RGCA 1W48A 4GZMA 1CF4A 4LV5B 3K09C 2VEDA 5F98A 3GJ0A 3ADDA 3CWQA 3SJAA 1M8PA 5G3ZA 1Z63A 1XEXB 5HR5A 4LDJA 4LBWA 2ODNA 3AUYA 3K1JA 4M9XA 4DUGA 4E22A 1RRPA 2KSQA 1CP2A 4D4MA 4TYQA 1DAMA 4QBIA 4UXIA 4WAUA 5GVRA 2W2XA 1XFAA 4C0BA 2ZRDA 3NWJA 2FDCA 3GMTA 3WNDA 2MSEB 2D7DA 3H4MA 4KBGA 4DC9A 1E6CA 2DFNA 4BLSA 2A9KA 4BLPA 2XSZD 4PPFA 3SNHA 5AUPB 3QPWA 1ZIOA 2P5TB 4X8LA 3QUSA 4WBSA 3BRWD 3FKQA 2QQ0A 1OYWA 2X2EA 3GFPA 4JL8A 3DOFA 3BB3A 1US8B 4HUQB 4NU0A 3EPHA 3X2SA 2HCBA 3QIAA 1IOZA 1EFUA 3LY5A 2Z4SA 2C96A 4DIDA 3JVVA 4MRRA 2VH5R 3VX3A 2ZI6A 3CF6R 3LW7A 1T5LA 3QPVA 1D2MA 2GZDA 3RANA 4POAA 2ZJ5A 1S0UA 2ZPTX 3BH7A 4HZIA 4A0RA 4F92B 4E09A 4ESHA 1OFTA 1J7KA 3OIUA 2FEMA 4DT1A 2EVWX 2XNSA 1SHKA 3KFVA 3VMFA 1EWQA 3HR7A 1W5SA 4DZZA 1GG2A 1A82A 1R10A 5IK2A 2ZI4A 3BFKA 4V0ME 2EFGA 4R2IA 3H84A 2C98A 4KFRA 1ZNXA 1OKKA 1W0KD 2OHFA 4EPRA 2W6ID 2P6NA 3REGA 3TSZA 2BMEA 2JDID 4F91B 4Q1AA 1ZU4A 2X19A 3OIYA 3AVQA 2V55B 4HDOB 3KTAA 4IKEA 2IXGA 3W90A 4HAXA 1GKIA 3B7GA 5GVSA 4KSCA 2ORVA 3T06B 1C1YA 1JR6A 2PBRA 3QXSA 2AKAB 3CPJB 1E4VA 4G1UC 4D82A 1TAGA 1QHGA 3A1SA 3LBHA 4D2IA 3C7KA 2QTHA 1G41A 4JLVA 2WOOA 3EG5A 1I4DD 4BWYA 1FMLA 4URZR 1I4LD 2VL7A 4TLEA 4IRUB 1ZP6A 1E9AA 2IS2A 4OBEA 2W0SA 3IPXA 1ZM3A 4OHYA 1E1QA 3KUDA 1GNQA 3CX8A 2RGAA 1WF3A 2F6RA 3FWYA 1MRNA 1E2KA 4DRZA 2OG2A 2BEJA 2O8EB 4V02A 5C2JB 4URYR 4LV8B 4IFEA 4PHTA 3U3RA 2Q3MA 5TV2A 2YNMA 1TF5A 1CR0A 4RZ2A 1R0YA 1UPTA 4CEHA 4OI0A 5E95A 2IF2A 2QMEA 2E9SA 4IXNA 1NBMD 4I81A 1E99A 3CH5A 1XTIA 5C4GB 3B78A 5M04A 4K46A 2QQEA 2WSSA 4DEXA 3BC1A 1U81A 1KTVA 1VCOA 1EESA 3QBTA 3TIFA 2IXFA 1SVKA 5EJEA 1Q20A 3AP3A 5TARA 2GJ8A 4N1AA 4LJ8A 5P21A 2YV5A 4HB4A 1JALA 1HE1C 4DLXA 5CK5A 3WMFA 3WHLA 2OXCA 4IJMA 5H70A 3OFNA 2PZEA 3QY0A 3KKNA 2DWOA 4E03A 2XB4A 3HR8A 4JL5A 4NYMQ 1RKBA 4HI0E 5FBQB 1LVGA 1D9ZA 3WHKA 1G8FA 1XDBA 3UWOA 4MQBA 2I1QA 4BZXA 1RW4A 1DARA 4AK9A 4MYHA 4C0QC 5FPSA 1LNZA 1WMSA 3DOEA 4LPSA 5EE5B 2P2LA 2PLFA 1XP8A 1LF0A 4ZIRB 5L3VA 1WA5A 4TSFD 5IT5A 2CHGA 1JJ7A 1NL3A 1QHIA 1ETUA 3U3JA 5AJXA 3RWOA 5FPYA 3ZZ0A 3AVOA 3F5FA 4QKQA 3SDZA 4W5JA 3D3QA 1FUUA 2WHXA 2WICA 4A36A 4XJXA 5TVKA 2R8RA 4PTLA 1IQPA 2FV8A 4PZLA 2GF0A 1C9KA 3CLVA 3F8TA 1G291 2VA8A 3NC0C 1YRAA 2FG5A 4JT2A 1NN5A 3BB4A 4ILEA 1IXSB 3QVUA 4WIAA 3A1TA 1AS3A 1NIJA 4IDQA 3VR4A 3B9QA 4A0HA 5JI2E 1NLYA 3WBJA 4YXWD 3CH4B 3PEVA 3SEAA 2HF8A 1ZBDA 4IVQA 4JJKA 3R9XA 2X1VA 4Q9IA 1E32A 1KY3A 1Q0UA 5DH9A 2ZI5A 2PEZA 4Z1MD 4GRAA 4I1OA 5JCZA 2YWEA 5L3QB 5AJWA 1KMHB 2PX3A 3CBQA 1GAJA 3PUWA 4ASUD 1FZQA 4EQ6A 1UEJA 5FPHA 1II9A 1II0A 3QKSB 2NQ2C 4IVRA 4UJ3A 2KBFA 2CL6X 3K70C 2PLRA 2J45A 3ZVNA 1W4CA 4TN1A 4DLSA 4ERNA 4F93B 3LLUA 4IDHA 2GILA 2ZI7A 5FTMA 4EUNA 5DIFA 3NHAA 4AKIA 1QF9A 1F3OA 2PCLA 2WWGA 4A2PA 2BBWA 2MMCA 3Q72A 1UBFA 4M1SA 5JI3E 4PHFA 3SYLA 3B1YA 4W9MC 2NMVA 2HYIC 3B82A 2VHTA 3K70B 4LBVA 3NXSA 3GPLA 4BFWA 2BEKA 4HSEA 4HLDA 5EE0A 4LUCA 4EFLA 1CRPA 4MKGA 2GDJA 4LJ4A 3OEHD 1MABB 4HLUA 4G3XA 3VAAA 2E87A 4P4UA 3B1WA 3ZLJA 1OFHA 4QJ4A 1G7RA 1NMXA 3PUXA 3QF4B 1XEXA 4Q1EA 2QT0A 621PA 4R71A 1W4AA 2VSXA 1A4RA 2OFOA 3EA5A 2F1RA 1FFHA 4GOJA 4ZDJA 4II7A 3QEJA 4DEYA 4EPVA 3V9PA 3UMRA 2FPLA 1CKEA 3FMIA 3Q85A 4FW9A 2P3SA 4G5SA 5CK4A 2XJ4A 1DAGA 4DBLC 2XTMA 3DO6A 3TGPA 4DSUA 4TZ0A 3UPUA 1PVOA 1Q1QA 2ZVQX 2WPDD 2KJQA 3THWA 2JIZD 1UADA 1LV7A 2A5DA 2BKUA 2V4ZA 4MYUA 2RB4A 4BFVA 2G83A 3FMOB 1US8A 1AZTA 5EXTA 1WQ1R 2G88A 4URXR 3R7WB 1FX0B 1II8B 2O5VA 1M74A 4JYCA 3MD0A 4ZKEA 1KDPA 4LWZA 4Q02A 2O0KA 2GK7A 5LD2B 1O3YA 2RGNC 2EWWA 1JQLB 1YZTA 3LNCA 3C8UA 2BBTA 4UNRA 1OB2A 1KI1A 3D6TB 3QENA 1AM4D 2GBLC 1MT0A 3ZIAD 2QP4A 2QU8A 1OH7A 1QBKC 1K5GA 4QM6A 5BWMA 1DAIA 3DKVA 3NH6A 1SXJD 3N70A 3CM0A 4ARZB 5F3WB 1NLZA 3T34A 4KI0A 1UKVY 1RRGA 1IAQA 2D06A 4DDWA 1G9XA 1H8ED 4QGAA 4EFNA 3SJZA 4AKGA 2P5SA 4CZ2A 3THYA 2JLSA 3SZRA 4B43A 1D5CA 4IOLA 1XEWX 3J81k 2ZSEA 3KJHA 3AKEA 3TAUA 1T5IA 2IA5A 4KHZA 1L2TA 2CK3D 1E94E 4QM7A 2BBOA 3OEED 3EC2A 5TY0A 2FX3A 2R62A 1KK1A 2V9PA 3QKUA 4NYJR 2XZOA 1VCMA 2FU5C 2XZLA 4TL7A 1W46A 3DM5A 1KSGA 3ZS8A 4RCYA 2QORA 5C4MA 2AKYA 1AGPA 1W0JD 3QF7A 4G0NA 1BMFA 2O8EA 3RRYA 1OXVA 4KVAA 1GRQA 3DM9B 4CGZA 3H0KA 4MGIR 3WBKA 4LJ9A 1ZNWA 2ZSBA 1KI3A 2YOFA 2XTNA 3C16C 1OXTA 1KO8A 2A78A 5F9HA 3RSOA 1DELA 2FPMA 1G5PA 3U4QB 2D62A 3NEYA 2OBLA 3QOFA 1Z47A 3VR3A 3BD9A 3FKSD 1EGAA 5FL7A 2HUPA 1R0WA 5HTKA 4LCBA 4ZI3A 3D8BA 1E98A 1ZC3A 5JZVA 1CEEA 5AWFC 1HV8A 1MO3A 2J0QA 4MRPA 3VKHA 1MH1A 5J4HA 4KO8A 2NPFA 3F0TA 2OILA 2QM8A 2VTKA 4QBGB 4TYPA 4UJ5A 4P32A 1G19A 3EXAA 2Z83A 1JI0A 1MO5A 4Q1DA 3LA6A 3F3YA 4B75A 3WNBA 4DSNA 5JWRA 1UJ2A 2RGBA 1D2NA 1G1MA 4D0NA 4U02A 2CCJA 2GXQA 2KBEA 3SHWA 3V4FA 4HATA 3CRW1 1SQ5A 1UKYA 3LDAA 1E9RA 1UDWA 2IUTA 3ECCA 1SVWA 2WJHA 3W6NA 2H5EA 4RD2A 2ZSAA 4PANA 2O0JA 1QHNA 1TU3A 1ZVQA 2REOA 1FL9A 4LHZA 2F9MA 5KDDA 1HT1E 2P6UA 5ANRB 2GEUA 5GJCA 2AX4A 3CX6A 1B23P 1W47A 1G6HA 1I2DA 5BQ5A 5CIWA 2OAQ1 4FMCF 4C2UA 2VSOA 3V00A 4AC9A 1E4YA 1EG7A 5KYKA 2XNDD 5FI1B 2VP6A 1KI9A 1T3SA 4XIGS 5J4LA 3W3AA 2ZE5A 3RS5A 1GUAA 1SKYE 4LBYA 2YINC 4TYWA 3TJZA 3AP1A 4CYMA 3DZ8A 5FBVB 1JAHA 1Z06A 2ATVA 4I1SA 3VU9B 2YOGA 1IJEA 4AYWA 5LDDC 4PO1A 2FMXA 2QENA 2ZRHA 3M6AA 1C4OA 3VQTA 1GKUB 4OK5A 1KI2A 4NP6A 1QVAA 3VTKA 2WIBA 5FTLA 1ZCBA 2J87A 1G3QA 1FNNA 1PJRA 4Q9KA 1ZCAA 3GP8A 1CRQA 2DWQA 3U3OA 4BEBA 4L9SA 4F4CA 3TW8B 1NY6A 1FP6A 1XB2A 4C0SA 4YC7A 2SHKA 4LHYA 4LJAA 1Q12A 1N2CE 2C04A 4FCWA 2GTPA 1EFHA 2YYZA 1E3MA 2W00A 3U3MA 2ATXA 4RSGA 2C77A 2YZ2A 1ZIPA 5JWOA 2RHDA 1U8AA 3EZ9A 3PVSA 2JLUA 1G17A 5AJZA 3W3ZB 4D4LA 4PAOA 2J0UA 2MSCB 4OQNA 2HLDD 3T1VA 4QJ3A 4Q4LA 5A0FA 1PV4A 2CLSA 2OV2A 1Q21A 1WP9A 1YU9A 3Q5EA 1OHHA 1QHSA 1MABA 5CJPA 5AJVB 4US2R 3WNCA 2IYWA 2O0HA 2V7QA 3PQCA 1T8TA 421PA 2C8VA 5BN5A 1VYUA 2C9CA 3GEEA 2QGZA 2CVHA 1J8YF 4B33A 1OLOA 1NN0A 2G1JA 1KO4A 4LZZA 3C41J 4R98A 2J46A 4DCUA 1X6VA 3QE0A 3A6PC 2V8OA 1VG8A 4IXMA 2J1LA 4Q1CA 4EFMA 1HY3A 4NH0A 3HPQA 4CEHB 3JVUA 1A7JA 2ZAMA 1PUIA 4OQXA 4G01B 1NF3A 3O47A 4NKRA 3CUEF 1U0HC 1NG1A 1AK2A 1Y3AA 3WYFA 4DVGA 2AXPA 1JXMA 1L4UA 3IHLA 4W5WA 2IEZA 2WJGA 4NONA 1S3GA 2PMDA 3BBPA 5E3HA 3LQQA 1TQ2A 2EFHB 4TL8A 2G0TA 1E9FA 2PCJA 4Q18A 4LHVA 2J7KA 3AVTA 3R7WA 1FX0A 1II8A 3ADKA 2IYLD 3L2OB 1GRNA 1QG2A 5FOWA 4V0OA 1NSTA 2O52A 1IN6A 2IHBA 4PZYA 4XWOA 3TUJC 3VR1A 3OAAD 2ZYWX 3I1FA 4IOJA 3H86A 4TL6A 1JEDA 4FMCB 2NO6A 2QPTA 2Q6TA 1GFIA 3CRQA 3NHBA 5J4YA 1YQTA 1GNPA 3L82B 4NYIQ 3B6EA 4O0MA 2DBYA 4BRWA 1SZPA 1GM5A 1E0KA 1TQDA 3KB1A 2BKEA 4TZ6A 1XXHA 1ZRHA 1W2HA 2QSZA 2RGNA 3I3SR 4NCKA 4X8OA 3NDBB 5LPNA 4A8JA 2W2TA 2A5JA 1YR7A 2A5FA 3BJIC 3L8ZA 5KNBA 1WDTA 3CZQA 4C0JA 1TUEA 2D7CA 2LKCA 2CNWA 5HE8A 2XSZA 2AD5A 4N0DA 3GEHA 4NYMR 1VG0B 3TVDA 4B2IA 3I8XA 2IWHA 2ZTSA 4LHWA 4Q1FA 1U8YA 3KX2A 3P4XA 2ZJ8A 3RNLA 1BKDR 2FA9A 5K8IA 3W5JA 5SZJA 5EXSA 1TNDA 4UNQA 4LJ5A 3W6OA 1N3BA 2BMDA 1VIAA 2I3BA 2WKPA 2WWWA 4JMPA 3X1YA 4NPHA 4QHTA 3JZAA 4LY6A 3AKDA 1FQJA 2QMHA 2A3RA 2ZYVX 3AF4A 1EX7A 3NH9A 4ZDIA 2ODBA 3KXIA 2CJWA 2WWHA 1XMSA 2NG1A 3LW8A 2OM2A 5E7IA 1CJUC 1Z29A 4XSHA 3MRSA 1AGRA 2Q21A 3LXXA 1W0KA 5TDHA 1W44A 4OYHA 4JVSB 3R8CA 3EZ6A 2PJRA 2W6IA 2QBYA 1YJ5A 1P9WA 4KFSA 2OFWA 3RRZA 1R8QA 4UNSA 5DN6D 2Z4RA 3U4QA 2OT3B 2JDIA 5AUOB 3RABA 2IX3A 1I4TD 2JLQA 1E9SA 3ZH9B 4OHZA 1GNRA 3ZVRA 3KKMA 2EFCB 2IYQA 4V0KA 4CVNA 4HLUC 4Q00A 2QMUA 2XITA 1Z3IX 2WM9B 2WZQA 4OKSA 1CULC 2JJ2D 4Z8XA 3U44B 2F3TA 2Z5FA 5DISB 3HDTA 4ZCIA 2NO0A 3X1DA 2Q9BA 2XTZA 4PZZA 5HCIA 2WV9A 4LJ6A 4M0LA 1NVVR 5DNYB 2QTVB 4B3DA 5J47A 4M53A 2AN9A 2DB3A 3H2YA 3K0FA 5CYOA 3LBNA 4GL2A 1N6OA 5B2ZA 4X8MA 3VNUA 2IC5A 1XMVA 2ANBA 4LV6A 4YMWA 2RGXA 2IYXA 4UNNA 1E1RD 4Q9LA 1IXRC 1ZD1A 1PLLA 3CPHA 4G5RA 5DSZA 1GL6A 2C03A 3DPUA 4GOKA 4L9WA 4Q47A 1XCPA 4TQUS 2ONJA 3UG6A 4A4DA 3KQUA 4PSKA 4TMVA 1Z2AA 5JECA 3AGQA 5HKKD 5SZHB 3THWB 3U6KA 1WBDA 4HB0A 4F38A 3PIRA 1VG1A 2YC4C
chains in the Genus database with same CATH superfamily
4I1IA 1G8GA 2NNWB 5FOUA 3ZS9A 3BCRA 1FNSA 2AFIA 3CUTA 4V39A 1OJLA 1E96A 4Y6GB 4AJ1A 4S05A 5T8KC 3BMQA 1P5ZB 1U8XX 2H2WA 1RMQA 3AF5A 1P4SA 1SIUA 3I9JA 5E7JA 1GKYA 2GD1O 2ZWMA 3LFHA 3ZHXA 4B6OA 3IJEB 4X3PA 1FJXA 3JQRA 2BMAA 1LC0A 5D3KA 1U7HA 3G88A 1GGFA 4NC9A 1JGTA 1DTSA 4KV9A 4R5HA 1Z7GA 1AK9A 3IJRA 4Y9RA 4RTMA 2O8DA 2R7LA 4L5BA 2XNCA 5K1ZA 3WL8A 3H5RA 1L3BA 4FP9A 1V5GA 4RY2A 4Z1OA 5GJWC 2VHQA 3JQ8B 3OCZA 2ZUEA 3GLGA 9LDTA 4TKUB 2EX1A 4NE2A 4XVHA 3DE0X 5C8DA 3TW8A 1SRQA 1JF8A 1EA7A 1NJ2A 2BFDA 3RV4A 1A9YA 4QJBA 5GTDA 1U98A 2IBTA 2VNHA 3ZD6A 2M6LA 3AM5A 2XF2A 1NULA 4XH9B 1C9YA 4UVIA 3DHEA 2EBWA 1A88A 3S2GA 4CI9A 4DA7A 5C7LO 1X8LA 4IHJA 4MARA 1V5WA 3GJSA 3CS3A 5CU7A 1DOAA 2AF4C 4LY3A 5ALPA 3IGFA 4PSAA 4AULA 4YY3B 1N34B 1ZJZA 4RKRA 2AJBA 4Q7MB 2YXEA 3KVYA 4B6RA 3LZDA 5FFNA 2XB2A 2O8VA 2RKWA 3GH1A 2WJVA 1OH5A 1FNMA 4XDZA 4F6RA 4KRYA 1H66A 1K6JA 3DTVA 5F2OA 3W8NA 2XAAA 2NUPB 3NPAA 4MQUA 3FLMA 4BV3A 5U1PA 3AUKA 4QUDA 4IIBA 4JLWA 1QHXA 1F14A 1K6MA 2E5LB 3KYBA 3JQ9A 4IO0A 1KDTA 1KF0A 3HE3A 3ZWCA 3LKDA 4ZYTA 2WD9A 4B7AA 4C3OB 4V2IA 3ITNA 3WHPA 4XD7D 4PZEA 3L04A 3H17A 1YQGA 4J91A 1QG6A 3T3HA 4UKDA 5HGJA 2C5EA 3MWDB 1H4SA 2B7BA 2ZKLA 4HYEA 4ZCSA 16PKA 1AUVA 2WYHA 4E13A 1Z2DA 4YUXA 1I0LA 4YMSA 1TL7C 4MUMA 4DIBA 1J8MF 2CXPA 3QOWA 2XA1A 1RLJA 1ZRSA 4MR8B 2X2PA 3BGDA 2Q5FA 1UC5B 1M1ZA 3HHPA 3RTDA 3KZXA 4X20B 1OZGA 3PVZA 1WCIB 5E9QA 4B1FA 1D04A 5CDHA 2WJWA 2J6CA 5JALA 1OLUA 3L0CA 2XBUA 1EK0A 2G6BA 1G20E 1ULAA 2GA8A 3ONWA 4EPYA 1I2AA 4GYJA 3GLQA 2XXBA 2YKGA 3ZPXA 2GERA 3GEDA 4W8HA 3CRMA 3PC4A 4XKJA 1NE7A 4BRUA 1PWEA 3JQAB 4UARA 2AG8A 1U9IC 1OROA 3KQHA 3IO5A 4MDEA 3NBUA 4CG3A 1MA0A 1HE8B 3CRNA 2JLAA 3II6X 4N9QA 4XYBA 3O9ZA 3JQPA 2G7ZA 1U2QA 4C0LA 2WFMA 3THSA 4LMRA 1X86B 5A1TA 3LS2A 5TRTA 4B3SB 1M34A 2WNIA 3AU9A 1FNDA 3VVBA 4F86A 1DEKA 3DZDA 4YI5A 3TLZA 2JKYA 1S96A 1KYWA 4NV3A 2OA0A 1PZNA 1N1GA 4BQSA 4JFRA 2ATIA 2VYVD 1JBKA 4CM1A 5I7UA 1MG5A 5LZ8A 2R2AA 1LSUA 3QP9A 4LBZA 4NPCA 1QP4A 1UKEA 3KWFA 4OP2A 4J1NA 1R4AA 3DG9A 2QDKA 3EXHA 3VDQA 4YJ2A 3Q0IA 1KJYA 3BERA 4HWKA 1HYHA 5LC1A 3HKBA 3SSNA 7MHTA 2IYUA 3PXGA 2CXHA 2D2EA 3MBIA 4F4JA 1DIHA 4CTNA 1KQGA 2JGMA 3VDXA 2W2OA 4MS4A 3AVXA 2JIZA 2WU8A 3I6ZA 3KB6A 2FF7A 3K9QO 3RFVA 1UZMA 5L4LA 3EDRA 3UCFA 2IY8A 2PUTA 3MJRA 4UDXX 3AHIA 1W2WB 4DMMA 1Q0QA 1OVGA 3PYLA 4I1VA 2A3NA 1ZM9A 4K6GA 2K4MA 3MGAA 4MEAA 1RXVA 4DR6B 4AURA 1DUVG 1VB5A 2JEOA 3D7SA 3F6CA 5FV7A 3RT9A 5ILOA 5AJTA 2V3CC 5JD6A 4RACA 4XJSA 1KK0A 2XMCA 3N76A 1OAOC 4GYWA 4WA8A 3IEIA 1ODIA 3D6NB 3LP8A 4NRDA 1FVHA 2FPPA 3L4BA 2V7XA 1OTYA 2NTEA 4MWTA 4OY3A 3SOZA 4CMKA 5JS6A 2G28A 2NLOA 4BQOA 4LI0A 3IV6A 3OU6A 2WU0A 4HX5A 5BW4A 1G55A 4BLOA 3HU3A 2NU8A 1ZM4A 2HJHA 2VDPB 3FDXA 1EBBA 4G56A 5CRIA 3EAFA 5JANA 4IS3A 4K9QA 3CR7A 3KT8A 4YALA 5ARDA 1JR3D 4G5FA 2O6HA 2ZQZA 1RVDA 1I7PA 1G3UA 1TZBA 1ZCJA 2B1GA 2VF5X 5CLHA 4ZD6A 5J2UB 5HOQA 3LCUA 3LPDA 2IXTA 4YJFA 1IATA 4M4SA 2IIQA 4NPAA 3VDRA 4BIMA 2QN7A 4PXYA 2YIJA 3BOSA 4QE3A 1A8IA 2AK2A 2I4MA 5KX5F 3OTQA 2WYWA 4P0TA 3GJ4A 2XXAA 1Z0AA 2FG6C 4PLPA 3DFUA 4XRGA 2CK3A 2D5LA 2REXB 2OXIA 3FVQA 3R5JA 3C3YA 4QFDA 4K05A 4Y6LA 1YBFA 1T1EA 4XX1A 1OYOA 4NG4A 5DSTA 3PF8A 1I30A 2YHBA 3MELA 2DTXA 2DKFA 4R1PA 1YQXA 1HMYA 1UQUA 3AEKB 3H8JA 2XUHA 3QPUA 1HTBA 5K0TA 1J1UA 2KS6A 3KZNA 2OQRA 1T25A 5JE8A 4ZVMA 2VPIA 4DQUA 4YDHB 3KM0A 3TQQA 5U4QA 3P5SA 1W0JA 1SUPA 2A86A 3A1DA 3AUXA 2NYVA 2BGWA 2AZMA 2VQ3A 1ZOPA 2OXEA 3D8NA 1L5NA 3JSXA 1NT4A 3DFZA 4J4BA 3I2HA 1W94A 1TO6A 1PGQA 4YMIA 1T36B 3KKLA 2PZ8A 1YHNA 1CR1A 2ZR9A 4BFXA 4B5KA 3FMPB 3ZLUA 1ZSYA 1VMIA 3OSZA 3DAHA 3VR2D 4EIWA 1E0AA 3VHQA 3EEBA 5ELMA 2B5OA 5PGMA 4QTUB 4YYEA 2H9IA 4OQDA 1K7CA 2AT1A 4PSCA 1AURA 1DAHA 4FNGA 4F1KA 3U4CA 3PTLA 2ALJA 4GYKA 1AHPA 1LFDB 3UWDA 4D4KA 4FQ7A 3VZDA 3IUYA 2ECQA 5C4IA 4Q4JA 3G2NA 2BP7B 2MR5A 3DOUA 4YWHA 1CV2A 5NULA 2XCOA 1KE1A 3KNZA 5HJ7A 5IUJC 4IOMA 2R44A 4IH1A 1NBME 5KEIA 5G40A 3TIXB 5JMPA 3HABA 3NHSA 1MQSA 1TJNA 2O7QA 2WIFA 2QMZA 3N8DA 3PHGA 4HFNA 4O1MA 4A8HA 3KDSE 4D74A 5I47A 3JZFA 1GPBA 2IYOA 1IY2A 3RU7A 5AICA 3RVNA 1AQYA 2AWOA 3LZ6A 4HUTA 1E69A 1JSRA 2HK7A 1IZ8A 2F1KA 5HJEA 3D6FA 3GT7A 1SWWA 1XXHB 2ZEJA 2EZ9A 2PKRA 2Y0BA 4ZVUA 5BT8A 1QRTA 4A8JB 1OXBB 1IQRA 4DW8A 7AT1A 5KVQA 2PH1A 4OHVA 2WKRA 2ZB4A 4B3BA 4BFTA 1JPJA 3LUKA 4RADA 5JJBA 1W7AA 3PWTA 1Q44A 3TEMA 2REQB 4X1IB 1PZHA 3T3NA 3KTFA 4ARBA 1WEKA 2QY6A 3INRA 4PIVA 3R7FA 4AJPA 4D26A 4ETWA 1QQBA 1JEYA 3SC2A 5JAMA 1R5NA 4BFZA 1WVMA 4DARA 4JP3A 5KTTA 3K0SA 1T1RA 3R7DA 4YX9A 3OQIB 2PM8A 5KJEA 1DAEA 4CCAA 1MD9A 3VVCA 1JP7A 3ZWYA 3L8YA 5C80A 1Z13A 1WB9A 2JLRA 2I91A 1TA0A 5CLGA 3K4QA 2EW1A 4GWGA 3QUBA 4OH7A 1OIVA 5JYCA 1SZDA 2FQWA 3SZ3A 4GE3A 4LMBA 4ZGGA 5KTSA 2ZE7A 2BH9A 3PT5A 2CGEA 4RFSA 4F9TA 2J5KA 4N9WA 2OCPA 1TM2A 4UASA 3GY0A 2XUGA 4MJLA 3PEFA 1CUSA 4GD3Q 4DM3A 3D2BA 3HN7A 4E21A 1Q3TA 2KQUA 1XQWA 3N6VA 1DEXA 2YZMA 3PQ6A 1YZNA 4G2TA 4MEBA 4QBKA 4RD1A 3KSDO 2W58A 4B45A 2DR3A 3TZ6A 1FNCA 1K9SA 4MS1B 4CV0A 3BE4A 3G8DA 1I0IA 4LCJA 3S2SA 2GPAA 2F2TA 1R9GA 3CA8A 1HFEL 4IDAA 4DMHA 1N6PA 4MA5A 4TTIA 1MR3F 2XD9A 1T6NA 4UBJA 1RKVA 3RFCA 2R4TA 1FTQA 3VU8A 2IPXA 3RS3A 1Z3CA 3U7QA 2HJVA 1IXZA 2PBZA 2Z8YA 4MV7A 3UFXB 4B3MB 1GPYA 1DQNA 2YHIA 4ENPA 2QXTA 4GXQA 4WN9A 1JQDA 3IVAA 4QGSA 3OJWA 1LF5A 2YN2A 3WLFA 3ZH2A 3EH1A 4KRGA 2VHWA 1JXOA 2W6MA 2CKMA 1LQTA 2AA3A 3MTBA 4G24A 4J29A 3ROKA 3TJMA 3ZQJA 2Z6AA 1DO8A 3AGPA 3UJDA 3DLCA 1LBHA 1MGPA 2AJCA 3HL4A 1JIJA 2IJGX 4S1VA 4KG7A 4S2EA 5CP8A 2FPSA 3A1WA 5FBHA 1K8YB 1RYHA 3LKVA 3MOIA 2V03A 2JJYA 1P0MA 3SBEA 2DSNA 2XPCA 2YWDA 3OIVA 5F3RA 1Z0SA 2AIRA 1VCIA 4XCVA 4XFDA 4BBJA 4EUFA 2ZUWA 4KI7A 1U9IA 1BEZA 4IV5A 4R1QA 3U7RA 1ZIYA 3NC4A 4B34A 4XJTA 3U1TA 2ZYAA 4RANA 1U7UA 2G9NA 5IW8A 2JLCA 4EO7A 3OBBA 4CCWA 4Z7OB 1IUOA 1YJBA 2OESA 1QZZA 1KP2A 3C0KA 3WRWA 4TV9B 4BEJA 5HOEA 1OTXA 2GSDA 3UKJA 3WGGA 1DTWA 2MSNA 2CF6A 2PWPA 2P2SA 2II6A 1Q1EA 1N5KA 1SD2A 5IXYA 1F38A 1ZINA 5EJ6A 1I94B 5L3SA 3VKFA 1FJHA 2HT6A 4O33A 4XR9A 3HXLA 3PC3A 2VXOA 2XEDA 2ZYRA 3L0BA 2C20A 4DB4A 1IAVA 3FGZA 1X8JA 1N2GA 5C37A 2Y77A 1DXHA 3BCUA 3GG9A 3HZHA 1N9KA 5DGCA 2ZREA 1BXRA 5EMLA 2HSZA 3G9TA 1H9AA 1V5EA 2G71A 4AQDA 3FZGA 3LHDA 3DLPX 4I55B 2FRXA 3AP2A 5BQFA 1VLLA 3HACA 3KHTA 2PHZA 2PVSA 4MR9A 1E6WA 2AK3A 3PXEA 3KHUA 3SHVA 4EHNA 2ZT7A 3MJSA 2QI9F 1ODCA 4GPIB 3HJNA 3WYCA 2PGNA 4KUEA 1F2TA 4R2KA 4OA5A 2B92A 3DVLA 1G8PA 1I7NA 5DLYA 3WLQA 1CUXA 1OBCA 4IV8A 5DW0A 1QRAA 4H4DA 3KOWA 2IPNA 2C92A 4F9EA 3LQRA 1Z8DA 1CX9B 2QL6A 4PIPA 5ITVA 2H57A 5K0JA 1S1CA 4YACA 4BLWA 5GZ3A 3KR9A 3GFRA 2QJOA 4BMXA 5A71A 4XLLA 4JD5A 4F97A 2Z1NA 4MVJG 1ONBA 2B69A 1RI1A 1H0SA 4H77A 1H6CA 1AY0A 3G0BA 1RWMA 1N9GB 4DLRA 4PYJA 4F85A 3Q11A 2VS1A 5EZQA 1VYTA 2BKAA 3Q6IA 3UT5A 3L8CA 3ON5A 4I36A 1D6SA 3NNDA 4RVFA 3EXFB 1DJPA 2HU5A 4LHSA 1RZUA 2BGRA 4KLNA 3WIEA 2VF7A 5J5CA 2I6TA 3EULA 4HNVA 5FWDA 1F20A 4E12A 4Q19A 5H68A 1ONPA 2VZLA 3KQYA 4JJFA 4BNTA 4F3NA 3O4IA 1EFRD 1RIIA 1ZRMA 3KQWA 1Z6YA 4KTTE 2RJOA 1F51E 3PGLA 5REQA 1NVBA 3Q7TA 1ZFNA 4WFJA 4F1JA 2FRDA 3K2BA 4EJSB 3BULA 3UQYS 5IASA 1V26A 4D3YA 2QRGA 1YI0A 4ILKA 1U5BB 3CX7A 3L8EA 1KERA 1A5AB 1UZUA 4IMJB 4IJQA 3FOAA 1SOVA 2R2GA 3SQWA 1IONA 4G5QA 4M1KA 3GDHA 1QZXA 4FKBA 1LDYA 1P31A 4KAXA 5ALMA 3EA0A 1CYEA 1E2DA 3ZJYA 1HTWA 3LY8A 2X9NA 3NDIA 3EIQA 4L72A 5C8ZA 1XRNA 1R0XA 2QTBA 1G20A 1VLZA 3JRXA 4PLFA 2E6KA 1PEKE 4YP1A 1L5HA 3ZE1B 1COWD 1ZC4A 2IH2A 1BRTA 3WGOA 5FBLB 4RNDB 2P3QA 2B98A 3N2YA 2PGJA 1TD1A 1JPVA 1WKBA 3NTLA 3RAFC 3HDQA 2HC9A 3H04A 1BTOA 1N77A 1Y1KE 1SZJG 4JLOA 1L7AA 3UWSA 1VDMA 4K6HA 2WWYA 1FSSA 1FU7A 3BHIA 3Q9SA 1KHHA 2XAUA 1E5LA 3GCWA 3MTGA 1SKMA 2G5CA 2YJ4A 4HGPA 4XYLA 1YRBA 1GTVA 3ZVLA 3CVOA 4C0HA 5JJ5A 2X13A 1OLXB 3ZKWA 2YQZA 3QXHA 3C87A 4W8GA 1OH8A 3BQNB 2QTCA 1DRJA 3FB4A 2HH9A 4OYYA 4C07A 2MIIA 3MWKA 4D25A 2H31A 5JC8A 2JVIA 1DTEA 1NJSA 1RKQA 3OJEA 3DEYX 2AHOA 2C7VA 4TTPA 5IVKA 4NJEB 2ISCA 4RPJA 4LYFA 1C81A 3OHMA 4XEHA 3PLAE 2WE8A 1VDZA 3IAUA 1D4FA 1CUBA 3PFCA 5JNVA 3F90A 2AFHB 2J3DA 5IAOA 4JU9A 4BYGA 1AB6A 3ZD8A 1BS2A 1MOQA 2JGFA 4OXRA 4TV8A 1SIOA 4A1OA 3I28A 5JD4A 3DDCA 2ZI3A 3ZHCA 4QVGA 4RPLA 5AVJA 2FPIB 5AHWA 4FGKA 3TUJC 2WWVD 2H4XA 3IQGX 4EDHA 4P2GA 2AOWA 1Q7GA 4JQOA 3JYOA 3W5IA 5DEIA 5E4TA 1SKYB 3SYNA 3JASB 4KODA 3CU5A 4TUYB 3ZJ4A 4NCBA 2AC4A 3DKPA 1LVUA 3VHXB 4B83A 3K71B 1ADFA 1GFWA 2QD4A 1AMUA 3I58A 1ZD9A 1USWA 4D6PA 2IZ0A 3GBVA 2B9VA 1PHPA 2GBCA 3Q3CA 5I8WA 2CLCX 2QN9A 3BWDD 3CY6A 3UANA 3ZWWA 1E60A 4HJRA 2QF7A 3TZEA 2CNBA 5CEFA 4TT8A 3MJEA 1HX7A 1X7WB 3AEUA 3DAPA 4NYJQ 5IAGA 3VZRA 1NYTA 1N2HA 3EDMA 2XBLA 1NM5C 3RSSA 2NPOA 1C30A 1OPXA 4JLBA 4NFYA 4QBFA 3UB3A 3I62A 1Z4LA 2VSFA 3S8YA 1UF9A 1E2FA 4KITB 4EI9A 2OFFA 2IK8A 1BMDA 2PSEA 4FXOA 5LQSA 4DM4A 1PZEA 4IM7A 1PJ3A 4DJJA 4I08A 3AUTA 4MICA 4FPXA 3UF0A 4YRAA 1PKXA 2Q7XA 4XWWA 2FRVA 4LDQA 1PJZA 3PVCA 1A5ZA 1W4BA 4Q3AA 2DHDA 5G0SA 3WKEA 1DFGA 4GG1A 4B44A 5J58A 2FR1A 3AWDA 4CLXA 1X1DA 2NTYC 4FGUA 3DF9A 3NW9A 1DCFA 2WPNA 1IJBA 1NLFA 3LO5A 4PQYA 1QH1B 2P9FA 3ZU4A 4F8JA 2PDAA 2CKDA 4EY8A 5GY7A 2BTQA 4HZGA 1GPKA 2RD2A 2HBYA 2UAGA 3C2QA 3UMVA 5M29A 1WO8A 2PA0A 2QSJA 1PS0A 2N1BA 4PNHA 1I4WA 4HF7A 5D51S 4B79A 4HV4A 2JLWA 3HTXA 4M1TA 2Q9CA 4FI3C 3GUHA 3IEXA 2VBGA 5LB4A 1NBOA 3F5MA 4OVKA 5CBKA 5JRJA 3PNPA 4H3VA 4HGNA 4XB2A 2OD2A 4ZT5A 1MC1A 3Q1KA 1EFCA 5IM5A 3RIGA 2FVYA 3TAHA 4PCLA 3PENA 1FFBA 1LPMA 1O6BA 3MS7A 2Z8YM 3NRBA 4QXPA 1V3VA 1JU4A 1PLJA 1NDUA 3ICOA 2E85A 3KZCA 4P4GA 4FWIB 4D97A 1QHHA 3U4AA 5BN3A 1TC1A 5T3YA 1C1DA 1KYYA 4IGFA 4OI4A 4RZQA 3GB9A 3FCSB 3LWNA 1CJCA 2PKWA 1AJEA 3QV2A 1Y6QA 2VSNA 5D3MA 5IDWA 3LCMA 3NHWA 1H22A 2Z98A 4Y0VA 1DWUA 3V2HA 1HSZA 3LC7O 1LI7A 1NAIA 2C3UA 3F6PA 2JANA 2VZ9A 3BXZA 4B47A 1NX6A 1WUTA 3DA8A 3RC8A 3HA5A 1PJ2A 1Z0FA 4QHSA 5BO5A 4OUDA 2GBPA 3HDYA 1H85A 4L3WA 3GLVA 1L5KA 1JKXA 4CCYB 2QTAA 4YPFA 2BZSA 1JNXX 2TECE 3ENNA 5FA6A 2GN9A 5EIXA 2WJ6A 4P4LA 2X5OA 1NBMA 1BDHA 3DOHA 1T29A 3T5PA 5CDUA 4LKRA 2N0SA 5ADWA 3ZHUA 1U3GA 1NVDA 2G1KA 4WDQA 3NEPX 1E61A 2VBCA 1FDTA 4I9UA 2QM3A 3RREA 1ZH8A 4JYAB 1C3OA 3DFIA 3IQIX 3P9NA 5EVJA 1SRRA 4RTNA 2C0QA 2CFCA 3HWX1 1C8KA 1GPJA 3B6JA 3PX3A 3TYXA 3ZGOA 4D4GA 1GU0A 4IIJA 3U7GA 1GPNA 2CY0A 3HP1A 2HBRA 2Y76A 1M9NA 5EIBC 5CM8B 1B74A 2R7AA 4RK4A 1GG5A 5FLYA 3WQRA 4CM8A 5ES4B 4GOXA 3ER8A 2WKQA 8LDHA 3KSBC 2ZXFA 2VT6A 1QP7A 1E58A 3LX8A 1X1RA 3R6DA 1VMEA 2P69A 1DHRA 3TR6A 3TZHA 1U0BB 1H3FA 3PR1A 1OLSA 3QVTA 1QK4A 3MTEA 3RHTA 4IX1A 3O4HA 4A2QA 5JYBA 1NJ8A 1MHPA 4RENA 3R7LA 2HHJA 4WZBE 2J9GA 4HYYA 3I9MA 3LKZA 4IRMA 3EPKA 4B71A 3CEPB 4R8RA 4HAWA 4RTPA 4WPGA 2FUNB 2I4IA 2NSHA 1M1YA 2QA5A 4S1OA 3OA0A 3ACCA 2EDCA 1KAOA 2BHTA 5D00A 5DGTA 1DJMA 2P9EA 1S6YA 2ZB7A 3FUXA 4ZHQA 4OV6B 2CLLB 4YMGA 5LYJB 2AYYA 5B1EA 4LG1A 2CVZA 2P7IA 1UPBA 5ELXA 3A27A 2AR7A 3HBJA 5ADVA 5JEDA 5ED4A 1EZ1A 3IH5A 3M49A 4XQCA 1L5RA 4LNUA 1P2BA 2OXFA 4X91A 3UENA 5ICSA 4BXOB 3OCWA 1M5TA 1ACMA 2XIQA 5JQGA 4C04A 4NCJA 1JLLB 5JS1A 3ZIUA 4DA0A 2QRZA 4DR5B 2XKKA 1PJTA 2C84A 2VI5A 1KI6B 4UTPA 2IHYA 2PO5A 2ADMA 2D1YA 3GQBA 5FBRB 3DTYA 3NGMA 3Q5GA 3SDBA 4L50A 1ODKA 2Q0HA 2Q1YA 2BGIA 2ZYDA 3VPXA 5LWHA 5JFGA 3ZE8A 1GN8A 1O58A 2H1IA 1XD2B 3I34X 5F1YA 1DAKA 4RLFA 1FXSA 2RAFA 2JF0A 1NW9B 1NFQA 3FCOA 3M3HA 4Y67A 4FFDA 3KTDA 3FCEA 5A05A 5DTQA 1NI4B 1TF7A 2DT5A 3QMMA 1EWKA 3M2PA 1P0CA 3W8EA 1X74A 3C8HA 1O6GA 4UC0A 1P7VA 4H3HB 2CV0A 1S3FA 2I7TA 2PMKA 4U3JA 3PV0A 5HS4A 2I3ZA 4O1HA 1AV6A 2WHPA 1I80A 4L51A 3UK2A 1XPRA 4U2KA 1TQ6A 4WDRA 1GCAA 4UPVA 2NU7B 2G06A 1TJPB 3E3MA 1SO8A 1JQ5A 3TPFA 5KC8A 3TVYA 4QOJA 4Z8YA 4DG8A 4KOAA 4Q5IA 3BSSA 3UV6A 3AILA 3FMVA 3N0RA 4YJKA 1QGED 3D6JA 1T5DX 3UQZA 4KSYA 4RABA 2EERA 2B20A 2H7VA 2XY4A 3G9UA 3V48A 2O05A 1ABEA 1T43A 1NVWQ 4GSYA 1OX6A 1T9KA 4TSRA 2YZNA 3IPLA 3L7AA 1WW8A 1PBTA 2RK4A 3GOHA 1VGQA 3BGIA 4DLLA 5BWOA 3SWWA 3LKBA 4N5LA 1FMFA 2ZU0C 3D3WA 1QFMA 4Y2YA 4P3OA 4WVFA 4IDCA 5CDTA 4KLZA 3H1FA 4QAJA 2GYVA 1NOIA 3AR4A 4LZPA 3VR1A 3R3UA 2D4AA 2BTEA 3RRXA 1L4KA 1NBAA 2AMJA 4J2OA 4DSZA 3QQPA 3VVMA 2GPWA 4YUYA 2GXAA 2QTFA 4HFRA 5CURA 1J2RA 1CK4A 3B1JA 3WMEA 4XWKA 2AH5A 2J9FB 3KB2A 2UXCB 2CLKB 2FGKA 3I2KA 1NVKA 5FEMA 1NVMB 2HGSA 5JXJA 1IJFA 3M89A 2PKXA 3ANTA 4QLOA 4UM7A 1NBWB 1NPDA 4Z4IA 4PYKA 4X6XA 4GYYA 2ZUCA 3T3EA 2FWAA 1TKBA 3AFNA 4EKYA 5KKCA 2O8BB 2OGTA 2JBAB 4PX3A 4ZP1A 4M22A 2LXNA 4YP5A 1MG0A 2EEPA 1JJVA 5BT9A 1VL0A 1G66A 1ZOLA 2WJZB 4NV1A 3V8EA 4URVR 1XTVA 2YWFA 3HG7A 5JDCC 3M6UA 5HE9A 2PX2A 4WESA 3RARA 4OYLA 3HB0A 3ZHZA 2BFAA 2FSUA 3H2JA 3LRPA 1QH0A 5HRAA 2V96A 4ZQFA 1H5NA 1Z6XA 2R6DA 3O8QB 2IYSA 3IKJA 5KVVA 1PZMA 3H0EA 4OU4A 4N41A 1SUDA 3DLAA 4XDGA 1NP7A 4LE2A 4EPWA 2XQIA 3PJRA 2IZ5A 3NM5A 5U9CA 3EJ6A 2IBMA 1N7HA 4DQKA 4HAVA 3SVLA 2B8NA 3D0QA 1ZW1A 3MT8A 2IWRA 1ZVVA 4QPDA 3QA3E 4F4IA 3UBTA 2Y71A 3DTVD 1TQ4A 3U9LA 3I53A 4BUZA 3HXPA 5IU6A 1NX9A 1P60A 3N86A 1GTG1 2OENG 2XWBF 1KNXA 2ECPA 3BSYA 1PRYA 2QX7A 2L0XA 3R6TA 4HAIA 4P1ZA 4WA7A 4QG3A 2EKPA 4Y2QA 3UNXA 4QEKA 2HRZA 4WN3A 3BDVA 4WBXC 4YH1A 5EL0A 3VR5A 1RC8A 3SXUA 1P0QA 3JWEA 4BL5A 2J67A 4KR7A 5HF5A 1I9CA 5EJFA 4C88A 5ECGC 1M6HA 2O2JA 1OIWA 1XTQA 4FOTA 3PFHA 3DEZA 3I64A 5ALEA 4MDFA 1QIHA 2YNMD 3UV3A 4GEKA 2ZE6A 3GIDA 3F98A 4IO1A 4O2AA 4OIMA 4XSVA 2OD7A 1P73A 3ET4A 1XK7A 1F8XA 3QU5A 3QVSA 3VU1A 1TIBA 3OCCA 3ZHVA 3GRYA 2RHGB 3EXG1 3K1TA 4BNKA 2CUZA 4EUHA 2UYQA 3JTEA 4M3NA 5A6SB 1GYQA 2VHZA 4OK6A 2C97A 2WSSD 3UG7A 1ACJA 2DLNA 1N6RA 2VCHA 4PX5A 3RU2A 4MLZA 1PJBA 4FGJA 5AI4A 4C2AA 1EB8A 1KOJA 2X0RA 1YQEA 4DDVA 4O4IF 1MVLA 1TGVA 5JHGB 1LDBA 2JFVA 3DD1A 3RTCA 5E6SB 3IAEA 2ZPUA 5KJ1A 3F71A 2B3TA 2VYFA 3QVWA 5D1NA 3T9FA 3DLHA 1DINA 1S8AA 3FWZA 4G1BA 5DHTA 4RU1A 4YBRA 3AEQB 5JBNA 4BKRA 3V97A 5ALKA 3GARA 5A9RA 2VZ8A 4INOA 4PPNA 3RRNA 3EIFA 3T4PA 5A0VA 3RS2A 4EF4A 3TQTA 1F0YA 4UBOA 1S2DA 4IZOA 4TXLA 1O9GA 2GKSA 3UMBA 1NMYA 3EC1A 4BOYA 2GF9A 2JA1A 4URWR 3HU1A 2XHZA 4LVCA 4AFNA 4OHCA 3PUYA 3CC8A 3LO8A 4RA9B 4UTZA 5K3SA 3TQCA 1T0HB 5FOXA 1ZSNA 2TRSB 4FBGA 3AIMA 2DECA 3CZPA 4UCXA 3BIJA 2HWKA 2O1EA 2J48A 1K3TA 1VKRA 2XYRA 3G3EA 3GGOA 3SXJA 4LISA 1DQPA 2H16A 3ZQKA 3NBZC 1HRDA 4Y6OA 2BFEB 3K5HA 1TJ3A 4BJ1A 4L7QA 1Y5LA 3KPWA 5LD2C 1TEZA 3TM4A 1WDKA 3K30A 5IKMA 1KMQA 3UGQA 4DEVA 1ESNA 1L8OA 3UJAA 4M8IA 2FCAA 3IQEA 3TOSA 1O6ZA 4DG5A 1ECLA 3G0IA 3DB1A 2ZTUA 3AESB 2C9ZA 2TSYB 3N6RA 4KN9S 4N3GA 1MU0A 3KVVA 4CMIB 3W06A 1JG3A 2CXXA 3IIMA 1EFKA 5ARCA 1CEEA 4GPEA 2NVBA 1KXJA 3SJBA 3VO9A 4UXHA 5G1OA 4HDQB 1O96B 2H08A 1P1JA 1VGVA 3LLMA 4OP3A 4WECA 3FM9A 3T3GA 2C42A 2WTXA 1P1KA 2MT9A 2F9FA 3C3JA 3O4GA 5J59A 1D1TA 2Q2OA 2QX8A 4TRRA 1MB9A 1B8OA 1E0JA 5C31A 3ZZ1A 1VTKA 4B32A 4BLUA 4JROA 5CA1A 4GC5A 1R18A 1UMCA 5BWBA 1KGDA 1ULBA 3AJEA 3EAGA 3L6CA 1EWVA 1X87A 4CCSA 3GFFA 4QNRA 1WIWA 5KYUB 3BWXA 3QVJA 2ZUBA 3LY7A 3ELWA 1A5SB 3MCTA 3ICCA 3GLTA 1T2UA 4OAQA 2A0YA 1OWNA 3LL7A 3W6PA 1KAEA 2B3DA 3AH8A 2ZBVA 1OXSC 2R3SA 4AF8A 1R1DA 2B78A 1IVNA 2GVNA 4LSGA 2XUJA 4C1NA 1D2AA 2P2YA 3TFWA 3PX2A 3ZDFA 3L4SO 2FR8C 2A0WA 5LLDA 1VOTA 2QMYA 3KP1A 3JR7A 1LW7A 4B6FA 3VAYA 3EHDA 4PWZA 4CQMD 5AVQA 1C7IA 3MUFA 4RK7A 3CZRA 2K2QB 1M1NB 2IHUA 3IDQA 1EIWA 1GO2A 4A0SA 4JLKA 2YUIA 2A57A 2VQDA 1J7JA 4U7FA 3T15A 3S1AB 3KG2A 2IS1A 4ZTZB 5HS6A 2FWRA 3NYRA 5EHXA 4FOOA 1U90A 3ORHA 1O5IA 2H07A 3OKFA 3MWYW 2OD9A 3EJWA 5TQ2A 4J7UA 5FOTA 1J99A 1K0UA 3GFSA 4D4IA 3T0FA 3T1YB 3FPLA 4FZ5A 4ML3A 4RJJA 3PICA 1Q83A 5MN5A 4XD2A 2I66A 2VH2A 4IKPA 3WNZA 3AX6A 3ICEA 1KDOA 1W5TA 1HL7A 2ZZKA 2G8LA 2DUWA 3GP5A 3UPDA 4NU5A 3JAWA 3B20A 2DLCX 1W19A 3G2LA 2EFDB 5E9AA 2DBRA 1VPWA 2JRCA 4JHLA 3WQBA 3FZYA 4RDIA 4L0MA 3VSAA 3H2IA 4Y0NA 3A1UA 1DX6A 2VK2A 4AJNA 4BN4A 2ONZA 3Q3JB 3AMVA 3HFJA 1MJNA 1G7CA 1MOZA 1ODSA 2RHCA 2RGRA 4GBED 3W5SA 5JH7A 2P9GA 4I0WB 1KZGB 1RBMA 4OLFA 1N1MA 5BYAA 1FOEB 3W2FA 4ZALA 3FVWA 1T4CA 4IGAA 1L8LA 4X61A 3V1NA 3WNVA 4DSOA 5TMEA 4RY8A 1Q57A 3AF2A 1YZVA 2HXSA 3IR6A 4LQLA 1PQUA 1Z7BA 1V4BA 1PV1A 5T6MA 2FP4B 4M9ZA 1SU7A 5K51A 4E5VA 4EYKA 4C3VA 3E81A 4I50B 1NZFA 1I6WA 3E70C 2BELA 2IP2A 3FR8A 3R3XA 1MJ5A 4EKIA 3OO0A 4BRSA 2XD4A 3EFOA 1RJ9B 5KQPA 2DY0A 4BX8A 3OTWA 1PWZA 3I73A 1ITZA 4YO7A 1D8AA 5HBGA 3NRCA 1ISIA 4UDOA 1R5OA 2L18A 3AHGA 3D8HA 3IX7A 4CKBA 1WV0A 1JPNA 4YRDA 4KVZA 3STHA 5KQRA 1AD2A 3AIKA 4OQPA 1GZSA 3G7SA 1L5YA 1ZONA 1AUOA 3C3DA 3FYHA 4WBNF 1FTSA 3QE3A 3U5ZB 5HP4A 4J0JA 4YWJA 1HQYE 3N75A 1T91A 1QIFA 4UHFA 2IZ1A 5AW7A 4D4JA 1CRWG 2BMFA 1WZEA 1YC2A 2AC7A 2EGUA 3E5MA 4RA6A 1JG7A 1B16A 4BTEA 5C81A 1H2ZA 1ZITA 1AF4A 2Q6IA 1EQAA 2XVXA 3DJFA 4JU8A 2DBVO 1T9CA 4R8VA 4CU2A 4HQFA 4W6ZA 1E6MA 4GR5A 4F5EA 2AQKA 3L7BA 3WKCA 3CT4A 2AEFA 5DW3A 3SSAA 2G17A 4QU0A 1RBQA 1VCHA 1SVOA 2P0AA 4Z7JA 5IS2A 4NXMB 3RJTA 2YICA 2JASA 3A4TA 2QZPA 3MUNA 1LRKA 2OQVA 5LP6F 4L0CA 4B3XA 3NS7A 2O3QA 3E3LA 3FPBA 4UQPA 3V42A 1X13A 2ENUA 1G8MA 2PEYA 3M6XA 4GI1A 4NBSA 3QNWA 4X5OA 5IRCD 3H2KA 1YNOA 2OB1A 3QLEA 1RHQA 3FFTA 1HDRA 3E1SA 3VU3A 3ICVA 1DEOA 3BDAA 2OO7A 3ENQA 5IEJA 2K7FA 2QPOA 2PRZA 1BMFD 3FOBA 3KQMA 1WMFA 1JTVA 1KDRA 1RCFA 2I4LA 4YEDA 1YRQA 2QSUA 5LCXA 1SCNE 3KDPA 5WRFA 4BO9A 4EGJA 3ZVMA 3PXCX 3RV3A 4B3IA 3NHUA 2VWPA 2JHCA 2A0XA 1JJIA 1PWHA 1C2TA 1CVRA 4ZVLA 1FNBA 1U3VA 4CEIB 1RCTE 1SCUA 1OIXA 3V6LA 5A2GA 4R1UA 4WX2B 5BUCA 4A10A 2G4VA 3CSDA 4E07A 3O03A 4CM4B 4F4FA 4DV5B 1N1EA 2I22A 2PLWA 4Q6WA 3QEAZ 2R25B 1SCAA 1TEXA 2VDJA 2ZCUA 2FPKA 1FRZA 4IXDA 4OJQA 4UUNA 3DFFA 1DWOA 2N46A 1IBLB 3PNLA 1XSEA 1Z37A 1ZUIA 3EW9A 3GHYA 1PR4A 3OBIA 4FW8A 4ES6A 4ESVA 2O8FA 1M2OB 1V5FA 4RD0A 1QHEA 1ILEA 3DDOA 3DDNA 3BXHA 2OG1A 2VUHB 1U2SA 1Q2XA 4B8WA 1U2TA 2LR0A 4RV9A 2R1UA 3UHAA 5DASA 1XQ1A 1EZ4A 2EGHA 3A9RA 3GQVA 5CFRA 5K7SA 4HUJA 5TF4A 3FOFC 1LNQA 1QTQA 1B3BA 1TC2A 3FDZA 1Q15A 1REQA 4WL0A 3KR0A 3VDMA 2FEWB 1NSFA 3T61A 3GNTA 4ND8B 1X19A 2B4RO 5JD3A 4DLWA 1W35A 5LDGA 4C5BA 4UM9B 3UXYA 1EFTA 4RZUA 5AW9A 3TLCA 1CVLA 1MAHA 2PMWB 4PR0A 1W36C 4BAZA 4KQKA 2XNHA 4S2UA 5CLFA 2NPIA 2XF8A 2V5AA 1MJFA 3E9RA