4TYWA

Dead-box helicase mss116 bound to ssrna and adp-bef
Total Genus 182
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
182
sequence length
508
structure length
508
Chain Sequence
SKLIHVPKEDNSKEVTLDSLLEEGVLDKEIHKAITRMEFPGLTPVQQKTIKPILSSEDHDVIARAKTGTGKTFAFLIPIFQHLINTKFDSQYMVKAVIVAPTRDLALQIEAEVKKIHDMNYGLKKYACVSLVGGTDFRAAMNKMNKLRPNIVIATPGRLIDVLEKYSNKFFRFVDYKVLDEADRLLEIGFRDDLETISGILNEKNSKSADNIKTLLFSATLDDKVQKLANNIMNKKECLFLDTVDKNEPEAHERIDQSVVISEKFANSIFAAVEHIKKQIKERDSNYKAIIFAPTVKFTSFLCSILKNEFKKDLPILEFHGKITQNKRTSLVKRFKKDESGILVCTDVGARGMDFPNVHEVLQIGVPSELANYIHRIGRTARSGKEGSSVLFICKDELPFVRELEDAKNIVIAKQEKYEPSEEIKSEVLEAVTEEPEDISDIVISLISSYRSCIKEYRFSERRILPEIASTYGVLLNDPQLKIPVSRRFLDKLGLSRSPIGKAMFEIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular insights into RNA and DNA helicase evolution from the determinants of specificity for a DEAD-box RNA helicase.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein/rna
molecule keywords ATP-dependent RNA helicase MSS116, mitochondrial
total genus 182
structure length 508
sequence length 508
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2014-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
A PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4tywA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4tywA02
4PQFA 3LDAA 1SXJB 5JECA 1BOFA 2GNOA 3QKTA 4MKGA 1YZGA 3GFTA 4IVQA 3CNLA 3A4NA 3K0CA 4JVMA 3L43A 5AJXA 4A92A 4C3ZA 4RZ2A 2OO7A 2JIZA 4URZR 1DO0A 1G8GA 4XWAA 3NDPA 4TLBA 5B30A 3HU2A 2RGAA 1TEXA 2E87A 2NO6A 2OFOA 2VP6A 4RFSA 3KUCA 3AUXA 4BFXA 2IUTA 4AURA 2JIZD 2QM7A 4S2EA 1KK0A 1Y3AA 3VR6A 3EPKA 3ZYCA 2QP9X 4TZ0A 4A0GA 3PCRB 1E4VA 3FKSA 4P3YA 3FHTA 1F2TB 2PEYA 5H1YA 4Q4AA 4AKEA 4CEJB 1K8RA 1XEXB 1FQJA 5DN6D 1HE1C 4M9SA 1G21E 1GL6A 3QF4B 2A9KA 1G8HA 5FBQB 5L3QA 4DVGA 1S1MA 3AVUA 1M1YE 1X8LA 4PC6A 1X8KA 4B3DA 1NMYA 1G4UR 3CRRA 1ESMA 3CX8A 4TYWA 4HI0E 4P0TA 1YVDA 3CWQA 4MITA 5H68A 3AVYA 1IN6A 4GI7A 1T5LA 4OHWA 2BBSA 1E4YA 2CXXA 4EJSB 3OF5A 3MGCA 3W6OA 3MSXA 4TL9A 1QHNA 2HF8A 3CF0A 1E2DA 4HB4A 4M1SA 4Q66C 1FOEB 2QTFA 2R6CA 2VRWA 4IFEA 2VP4A 4RZ3A 4QOSA 1NMZA 2ZI5A 4IOMA 4O2RA 3QKRA 3F5FA 2ANBA 3TH5A 1W0KD 2V1XA 1Q20A 3I73A 4F4JA 4K81B 3LW7A 4DDVA 2QAGA 1CS4C 1MH1A 2V7QA 2VHQA 3B7GA 4B32A 1MT0A 4DRZA 4PTLA 4LC1A 1NBME 4KU4A 4POAA 1XEXA 3FMIA 4ZI2A 3GEEA 4LJ6A 2Q3FA 1FQKA 4OL0A 2JJ1D 4LV8B 1IXRC 2V7QD 3TW8B 2DPXA 2GBLA 1ZW6A 2G3YA 1DAGA 4B76A 2B8TA 4HATA 4JBWA 4KFSA 3MMPA 3B1XA 5A4JA 2FV8A 3D7MA 2FPMA 5AJWA 2FPLA 4M1TA 2RGXA 1RPZA 2FGKA 4JMPA 4ZCLA 4URWR 3UMFA 2Q6TA 3VHLB 1D8TA 4XWOA 1W4RA 3AF0A 3ICQB 1CJMA 1P60A 1TF2A 2H18A 1UBFA 2PCLA 3EW9A 1EFTA 3TK1A 3U44A 2CE2X 1S3SA 3CF6R 4X8OA 2BBTA 1A4RA 2GCOA 3E2IA 3LV8A 2R2AA 2V6JA 4TWZA 2RHMA 3OAAD 5B64A 5AK0A 4GL2A 2PLRA 3RS3A 5IF9A 2MSEB 3CZPA 3H0KA 3T5GA 4BZQA 4BLRA 1KI1A 1Q1BA 2DWQA 4IEEA 3BIFA 1LNZA 2FFQA 2JLUA 2J87A 3SQWA 1YZTA 4W5JA 5BQ5A 3KKNA 3PG5A 2ZRGA 5F9FA 1JB1A 1NF3A 4DDTA 2CNWA 5JRJA 1FW6A 4BQSA 2VP5A 1XTQA 2F1JA 2JATA 2O5VA 1E9SA 3BOSA 3RSLA 2DR3A 5HCIA 4Z54A 4CT5A 4C9BA 3FFAA 4D0LB 3DPUA 1E9BA 1KI4A 2B92A 3WRYC 4ZV4A 2LWIA 2J0QA 1XCPA 1L7VC 1OXUA 2YZ2A 4TTRA 2FEOA 2BM1A 3IHWA 3QPWA 1PVOA 2OAQ1 3KZ1E 4TYNA 2C04A 1KAGA 1E96A 2ZSBA 3ZDQA 3T5DA 2QQ0A 2AX4A 2CE7A 1FFHA 2EYQA 2IL1A 3H86A 3L8YA 3P4XA 1MO3A 2IEZA 1XMSA 3AF4A 1VG9B 1VCOA 2F6RA 3KKMA 2TMKA 2WMOB 4ZPXA 5G3YA 1XTIA 4CEIB 2OSBA 3NKVA 1VYUA 4OI2A 3LX8A 2G1JA 3DKPA 4C30A 1R5OA 5FI1B 3ASYA 3RDPA 1FP6A 1NVXQ 1NN5A 4HLUC 4R9UC 1T3SA 3B82A 3THWA 1ZM7A 3CW2A 4DCUA 4KHZA 4EQ6A 4LPKA 4XVQA 3W6PA 1OT3A 1BIFA 4LDJA 4KFTA 4MRNA 2HXYA 2KB0A 4GP6A 2GEUA 5FBRB 3GJXC 1N5LA 5FBWB 1ETUA 4S35A 4AC9A 5E3HA 2BMJA 2FSFA 2P5TB 2XNDD 5DHFA 2X2FA 2ZJZA 1LF0A 2J59A 3PEWA 1N0WA 1LY1A 4MQBA 2QG6A 1UKZA 3EPLA 2B8WA 1T6NA 2KJQA 1CF4A 1E3MA 1T0JB 2C77A 2A7QA 3BERA 3BRWD 1XTRA 4GDFA 1NKTA 3U4QB 1X1SA 1KNQA 2ERYA 4PSAA 2V54A 4FCTA 2GK7A 5D3QA 1G7RA 5BN3A 1XEWX 2GBLC 2HJGA 5FL3A 1QRAA 2WHXA 5JWHA 3O8RA 1NP6A 4A82A 3P20A 4MGKR 4LI0A 3HDTA 3CO5A 2YWEA 5EUMA 2EW1A 3SYNA 2ATXA 2JLZA 2AXPA 4JYBA 4HB0A 2WJHA 4JL8A 1N6HA 1QVAA 3X1ZA 3O47A 3RAPR 1KKMA 4TYQA 3TR0A 1W46A 3VR5A 4I81A 1DARA 2V8OA 2XZOA 4Q1AA 2AKAB 4LZZA 3VQTA 4B6FA 1E2LA 1EWQA 1ZM9A 2G9NA 4KAXA 3C8UA 1PUJA 3U7GA 2IF2A 1VMAA 2V55B 2ZUBA 4W5WA 3RRZA 3SR0A 1GFIA 1CJVC 3HJNA 3CH5A 5JSZA 2ZETA 1T91A 5HE8A 1XRJA 3VU9A 2AKYA 1S96A 4M2LA 5CITA 2FH5B 1S9DA 2W2VA 1JJVA 2YWGA 2H57A 3C5HA 3NH9A 3NVAA 3UG6A 4MRPA 2KWIA 3ADKA 1UADA 1UBCA 4KFUA 3FMFA 4PPFA 2IYTA 1JNYA 4DDWA 2J0VA 1OPXA 2WWFA 3RRYA 4RCYA 1D9ZA 3CRQA 2RMKA 3QXXA 4MYHA 1ZNXA 4CEHB 2VP9A 5SZJA 3DM9B 1MABB 3OIVA 2PMDA 5E95A 1X6VA 2ZITA 4LWZA 2ZRCA 1ZD8A 3CPEA 2A78A 2A5YB 3K0CC 4M21A 4CGZA 4WXPA 2C8VA 1M7HA 2JLVA 3U5ZB 3UANA 1UEIA 1ZRHA 4LBVA 1AGPA 1P75A 4M1MA 3R7WB 4I1VA 1E0JA 1ZIPA 1YHNA 4OQMA 4Y0VA 1AJEA 2XXAB 3A4LA 3JZMA 5KSOA 2LKDA 3EC1A 3TNFA 1R7RA 3WYFA 1VECA 5BN5A 1XF9A 4H1UA 2GDJA 2ZJAA 2CMKA 1QHYA 5CK4A 3ADDA 1DO2A 5J5CA 1HE8B 1TPZA 2Z4SA 2YINC 3H84A 4RZXA 2BEKA 1CJTC 3GJ8A 1KO7A 4IOJA 1JI0A 4DDUA 2O8CA 2L0XA 3TRFA 3V00A 4HEJA 1SGWA 2QAGC 2WVJA 4F4IA 2CL0X 2AD1A 4DB4A 1T3LA 2PLFA 5IK2A 1HTWA 4II7A 1U0LA 2JLXA 3A6PC 1Z5ZA 1KK1A 5AJVB 5EE3A 3IBGA 4R2HA 3X1WA 1FZQA 1E2MA 4IOKA 1TUIA 4NZYA 2ODWA 4QGGA 1SKYB 3TR5A 2WWIA 1OB2A 4TL8A 4R7ZA 1U9IA 2GTPA 5J40A 2FFBA 4Q9KA 4C0KA 3I3SR 1TQ4A 2IXFA 3RABA 5GVRA 3DM5A 5JI2E 1OIWA 2DFTA 5KDLA 2P67A 1IM2A 2ONKA 4WA7A 4AG6A 4DCVA 2YOHA 3T15A 2GXSA 1IXSB 4C0QC 5JJIA 4NYJR 4TLAA 4PAQA 2XJ4A 1D2EA 3MWLA 3SZRA 4EIWA 3N70A 5FTJA 2CCKA 3HU3A 3LW8A 5C2JB 3TSOA 1SKQA 1L2TA 2VF7A 1C9KA 5B2ZA 2ZI6A 1UKVY 3GJ4A 8OHMA 2OG2A 2H1LA 2IWRA 5E7IA 4DBLC 4QBFA 3BB1A 3VFDA 2I1VB 1Z06A 1D5CA 3QUSA 4C2TA 1CBUA 3NC1C 4WIAA 4G5GA 1PV4A 2ZTSA 1F60A 2XJ9A 2V4ZA 1QHSA 2X8AA 1Z0FA 2JAQA 3I8XA 3LVRE 1E99A 2D06A 1KI2A 2FN4A 3KQKA 2P5SA 1KDTA 1JAHA 1ZU4A 5SZIA 1XPRA 3I62A 3LA6A 2JJ8A 2QL6A 4XH9B 1OXXK 3ZLJA 1EGAA 2WMNB 1GNRA 1E1RA 1GAJA 2GCOB 3A1VA 4ITRC 2WTUA 2ZU0C 2H8KA 4A6PA 4LHYA 5AR1A 2PZEA 4BLQA 4E03A 3SYLA 1ZCAA 3UG7A 1K5GA 1S2MA 1J7KA 2RGNA 3ONWA 4HLCA 4NCJA 3T34A 4QJ4A 2OE2A 3LY5A 3CX7A 2ZI7A 4GZMA 3DOFA 5EQTA 4PZYA 5KUTA 4KLZA 2JLSA 2ORIA 2Q21A 4Q5IA 5CLLA 4RFSB 1KYIA 4D2IA 4OYHA 1E2KA 4FN5A 2IF0A 4MRVA 4XD7D 3RSOA 3WHKA 2R9VA 1E0KA 2BWJA 4NCIA 5JZVA 4LUCA 3T1QA 1QHHA 1OH6A 4I1SA 2ZI4A 3K0SA 3E5HA 4H9GA 4XWKA 4UNQA 3D6TB 1GRNA 3LBHA 1ZIOA 1ZNZA 2JGNA 4KITB 1E2FA 1JXOA 1Q1QA 3S1AB 4HLQB 3W9YA 1CRPA 4XIGS 3RS0A 3CPHA 4C0JA 1Q3HA 5CLQA 2OXCA 2WJGA 2J45A 2ZJ2A 1SVOA 2MMGA 2WJJA 4NH0A 1ZD1A 3BH7A 1P3JA 4RD1A 4AG5A 1Z0JA 4DUGA 4NYMQ 3GLIA 1N5JA 3BJIC 1OXTA 3TUIC 5HZKA 1GILA 2D3WA 1E9RA 1U8YA 3NHBA 2X1VA 2OZEA 1N6NA 4MKHA 1KY2A 4IFBA 4YC7A 2WJYA 2ZR9A 3NG1A 3KXLA 1DE0A 1E98A 2FX3A 2ZRPA 3ECCA 2BEJA 4NP6A 3GLGB 4A36A 2HEIA 3B1WA 3WNDA 5L3SA 4JLOA 2J5XA 2A2ZA 2Y8EA 5G40A 4DEXA 2W6JA 4QHTA 2CLSA 4NTZA 2WICA 3OEHD 1Q0UA 4W7SA 2JJ2A 2QAGB 2XOKD 2ZS7A 2RGCA 1ZU5A 5AJYA 4J0QA 3CNNA 5FOUA 4XVUA 1A2KC 2Q9AA 1CEEA 1XTKA 1E1QD 3QXHA 4EJSA 5EE0A 1G20E 1DG1G 1DG3A 3AKYA 2OBNA 2OFWA 4DB2A 4M0LA 1XXHB 3PEVA 2QROA 1P9NA 3Q7PA 4NYJQ 1XCMA 5C4MA 4QM6A 1KGDA 1NY6A 1E9EA 1RW4A 2A3RA 2OAP1 3THXB 1T8UA 1FMJA 3NHAA 2BCGY 1KOFA 1SVWA 4V0OA 3TVDA 3B8HA 2W0SA 5JCZA 3WMGA 3HYTA 5KYKA 3AF2A 4C7OA 1WF3A 4X8MA 1G7CA 1BYUA 4PFSA 4PO9A 2IT1A 2VSXA 1MO6A 4MDFA 4C7OB 4A8JB 1BKDR 221PA 4I1OA 4TT3D 4GMXA 4Q9HA 3WBJA 2QU8A 1G5RA 5HKKA 4EUNA 1YZUA 1W4CA 3CBQA 2GCNA 4QNRA 2CJWB 3OFND 3T35A 3QG5A 4TQAA 2RAPA 4CW7A 2IXEA 2W6IA 2QPOA 2EQBA 1VKJA 1JPJA 2ZI3A 1ODFA 5C4GB 1U8AA 3L0IB 1W7AA 1QF9A 2FU5C 3CNOA 4HZUA 2QQEA 1OH7A 4PQYA 3LFUA 2XX3A 4LBWA 2C99A 5GADl 2QI9C 3REFA 2IC5A 3PUWA 3V9PA 2O8DB 3D8BA 2ZANA 1WQ1R 3B13B 1AGRA 4PC3A 4IXMA 2HLDD 4LJAA 1YKSA 3T61A 3ZVMA 3WBKA 3DHWC 3MLEA 2QRNA 3AKEA 1BMFA 3EG5A 4V03A 2VL7A 1GUAA 2BV3A 3FTQA 5DGXA 3KFXA 2OCAA 4NU0A 3P27A 2O8EA 5AJZA 2HLDA 2VF8A 1IXZA 4MKIA 2D2FA 3LXXA 2IW3A 3R9XA 1C4OA 4IW3B 1NN0A 2DHRA 3SQXA 2VTKA 3CLVA 4KVGA 4FINA 2XTNA 2FFHA 2H5EA 2Q3MA 1CP2A 2WOJA 6Q21A 2OM2A 3AM1A 3U3KA 2GEDA 1SVMA 1H8HA 1EESA 4ZDKA 1O87A 4EAQA 5LD2B 3GJ0A 2IA5A 3KB1A 1TAGA 4BEBA 1RRPA 1F5NA 2XAUA 5FUXA 3VX3A 1DEKA 3DOEA 3QKSA 4DSOA 4GFDA 3EA0A 1OH8A 1T0HB 2NPIA 5F98A 1AIPA 4KSBA 1LVGA 3TIFA 5CM8B 2FG5A 1G16A 4ZKDA 3QNUA 4ACBA 1XNJA 4PSKA 2ZSFA 2AK3A 2BKUA 4OBEA 2O0HA 5HZHA 4LX0A 3ZS9A 3F8TA 3ZZTA 3ASZA 3AKCA 1DAHA 2OEPA 2CHGA 3SHWA 3TQFA 1LW7A 4U7DA 2FSHA 3BC1A 4OQNA 4OHXA 1TF7A 3VKGA 3L2OB 1OYWA 1GWNA 1T4GA 5J4VA 1KMQA 2LKCA 1AKYA 1BS1A 5J47A 3FWYA 4FMDB 3CRVA 4NYMR 3ZZ0A 3FMPB 2ZYWX 5FR2A 1J2JA 2XTZA 1NBMD 1XJ0A 4HAYA 5IK2D 3K9HA 4A1FA 1KJZA 521PA 1NIJA 2CEAA 1G6OA 4JT2A 4F38A 1IONA 5AUQA 3SU8A 4N0DA 1G5PA 2CVFA 2NZ8A 3RS7A 4ARZA 821PA 4GBMA 3WP0A 4CIDA 4MYTA 3QE0A 5LB2A 3BXZA 2ZRJA 2YJTD 3E1SA 3QXSA 1VIYA 4YMWA 4Q7KA 4TL6A 4DT1A 5G41A 1E9FA 3R7WA 1MR3F 3EIQA 1SKYE 3A1SA 1WBBA 2VHTA 3CIOA 4JLBA 5CDFA 5JWOA 2HJVA 1RIFA 3A37A 1NLYA 1X3SA 3QG1A 3TSWA 2ORVA 4B34A 1VYVA 2QPTA 1KO8A 2YV5A 5BYKA 1TUEA 5KPDA 2YHSA 3VTKA 1WBDA 1FUUA 4WZBE 2REXB 1N0VC 4QBHA 1OB5A 2IS1A 5HPYB 2I4IA 1Z47A 3EASA 1JBKA 5LB4A 2CCJA 2F43B 2J3EA 2RGDA 3ND8A 2WWHA 1KI6B 4Q19A 1WE2A 1KI7A 1QHXA 4DLXA 2HCJB 1YRBA 3K9GA 1ZUNB 2NO7A 4MKFA 4FMCB 2ZQ5A 1ZUHA 2R6GA 4EFNA 1IY2A 1OFHA 2IXGA 3OFNA 3LQQA 2GILA 2ZVQX 3K70C 4B3XA 1Z8FA 1W2GA 2N46A 3QEJA 3C16C 4U02A 1LTQA 2P6RA 2P6UA 3X1DA 2NO1A 1KSGA 3AP1A 4AY2A 4TMKA 2F3TA 4ILEA 2CLCX 4LRWA 4UNRA 2WZQA 1UM8A 2PBRA 1E1RD 4Q48A 4QGHA 3AVTA 4PZZA 1E32A 1QG4A 1HEIA 3EZFA 1P2UA 3LLMA 4A0FA 2XTMA 2ZUCA 4PAMA 3GP8A 1OKKD 1P62B 1W0JA 2H7VA 2ANCA 3W3ZB 3FKSD 2FDCA 4KVAA 1G17A 3PQCA 2FA9A 2ZROA 5D3MB 1M74A 2ZS9A 3K0AB 2CL6X 1GKYA 5EXXA 2AFHE 1M2OB 1Q1EA 1SULA 4GRAA 3L8ZA 2VHUA 5DN6A 5BW8A 5HCNA 2Q9BA 4GT1A 4QXAA 1P9RA 4F91B 3FOZA 2O8BB 3EZ2A 3IEVA 2ZIAA 2OLKA 5E4FA 4OK6A 3ZJYA 4URYR 1M8PA 3FHCB 2BKEA 1LS6A 1OW3B 4HAVA 2XNDA 4PC7A 3I32A 2QTVB 4A8JC 4HDQB 3AGQA 3DMDA 2DY1A 3THYB 3QQ5A 3X2SA 1XJCA 3MG9A 4TTQA 4G1UC 3NWJA 5TVKA 1KK3A 5L8VA 3CB4A 4QBGB 3JZAA 5FTKA 3B9PA 1AQYA 1XDBA 4ACAA 3OESA 2FE4A 5KPJA 1TADA 4YMVA 1GOTA 4DUGD 3RS4A 2I3BA 2ZM5A 1T9HA 2IWHA 3GLFE 4NCHA 2F1HA 3THWB 5CB8A 4JVLA 1L8QA 4BASA 2EFGA 1F2UA 1I2MA 3C15C 5JSZB 4IDOA 3NC0C 1RVDA 2I1QA 2IYWA 1QHGA 5KSZA 4CEIA 1S9HA 2HDNB 2WWWA 1E2JA 1YRAA 2WIAA 3K9LA 1S1CA 4FWTA 3EPJA 3R8FA 2VYFA 4U00A 3K9NA 4PC1A 1Z6TA 2X19A 2BOVA 2QY9A 2F3RA 4F4CA 1CTQA 2PJRA 1FP7A 1G5TA 2VIIA 4DLTA 1UKEA 1ZM4A 4GZLA 3PUYA 3NBFA 4Q4HB 5M04A 5CDFE 5DIFA 3R9WA 2V3CC 3BH0A 2GVDC 5C1BA 4DLUA 4UXJA 4ON9A 4NE2A 5K8UA 2OV2A 2YNMA 2QE7D 3EAQA 3U61B 4AYXA 1R0YA 5FL7D 3WHLA 1HQYE 3BE4A 3REGA 1KDOA 3VU9B 5TV2A 2YOFA 4ESVA 4BFYA 3K0FA 4R98A 5C18A 1KHTA 2C9YA 2JASA 1HURA 3KTAA 1S0UA 1IQPA 1R0XA 3T06B 3A1UA 3RLFA 4DIDA 1RRCA 2YOGA 4DJTA 4LJ9A 2GJ9A 1AK2A 3I1FA 2YVUA 5EJEA 4V0KA 3D31A 2XZLA 5EZ6B 1NVVR 3OIYA 3U3JA 2CHQA 4AKIA 5F9HA 3LBNA 4IKEA 3QVVA 3PFIA 1GNQA 4HDOB 5L3RA 4D4LA 1G8PA 1XBTA 3A8TA 1GG2A 4GP7A 1I4LD 4BPBA 1CR4A 2IS6A 2FZ4A 1CXZA 4PSVA 2QMHA 4DWJA 4JSTA 5JJKA 1NLZA 4IVRA 4ZCIA 3DKVA 2O8BA 4JS0A 2NO9A 4AI6A 3VMFA 2A5GA 2J0UA 2UKDA 2QRZA 3AUYA 2DYKA 1KY3A 3QEOA 2P3SA 1GDDA 4IVPA 4B3BA 2KI5A 5KO2A 2QBYB 4CZ2A 1WMSA 2HCBA 1YZNA 2CNWD 3D3QA 3GLHE 1V43A 3CH4B 1FX0A 3SHFA 4FI3C 2WKPA 3SJCA 5JHGB 3QBTA 3SN6A 4F92B 2EFHB 5BYJA 5TB5A 2OCYC 2O8DA 1QZXA 1K5DA 3SBDA 1RYHA 2YWFA 4DLYA 2OBLA 4QHSA 1US8A 2ZREA 1U2RA 2FJUA 4BE7B 1OKKA 5DSZA 2BHRA 1N0UA 2CHVA 3IPYA 1VG0B 4QFMA 4V0LA 2WPDA 4G3XA 2YWHA 1SVLA 2NIPA 4NL4H 3KQUA 3RS2A 5BXQC 2C78A 4QC2A 2OESA 5FUYA 2A5JA 1H65A 3ZVRA 3NTUA 4AIIA 4DIEA 3QI2A 1XTJA 3QPVA 1X1RA 4B2PA 5FPSA 2KBFA 3CF2A 4O2LA 2GJAA 2RH5A 3SJAA 4PR0A 1Z6AA 3EWAA 1KKLA 1KO4A 4HAUA 4L5BA 2IS4A 3GLHB 3GQBA 3I8SA 3CR8A 3VKWA 2QSYA 2VP0A 2NOAA 5KU1A 4PC2A 1E2PA 2V9PA 4C0HA 4WBSA 3IQWA 3FKQA 4YMSA 3GLGE 3EA5A 3ZS8A 1SXJA 4KJZA 4DLSA 2ZRAA 1Z63A 3JVVA 5JMTA 1RE0A 1QHIA 5FI0B 3THXA 2E1RA 3QKSB 4RD2A 1G7SA 1PZNA 2X2EA 4PX9A 1IJFA 4G5QA 1W36C 1J8MF 1JAIA 1TQDA 5J4HA 3UK6A 1L4YA 5F2EA 4LYHA 2XB2A 1NLFA 1JR6A 4LJ4A 4M1OA 1B23P 1LFDB 2CL7X 3N2EA 3O8DA 4JYCA 4Q4LA 1WRBA 3KJIA 1ZINA 4YXWD 3K1JA 1WDTA 1IN8A 3MFYA 4PQRA 4AYTA 1KSHA 1XU4A 2F1IA 4JVNA 2WOOA 4IDPA 3GJ5A 1JEDA 1E9DA 1G3QA 3OEEA 5G53C 2HV8A 4Q7LA 2OLJA 3V4RA 2FSIA 3GEIA 3T12A 3IPXA 5TXGA 4BFVA 5DYGA 4BLPA 5LPNA 2ZXUA 2FWRA 3WP1B 4YXWA 1A1VA 3BBPA 3QY0A 1Y63A 1GITA 1E6CA 1R0WA 2PZFA 1U9IC 4KYUA 3WMFA 4MYCA 4EJSC 4C2UA 3PUZA 1SHZA 1Q57A 1YU9A 2XB4A 4JBXA 4LYJA 2W2TA 2OXRA 1KIMA 2QM8A 2WKRA 2GXUA 4ERNA 4G01B 2EU8A 1JPNA 2NPFA 1R5BA 3CPJB 3UMRA 4JLNA 2DBYA 3SJZA 3QOFA 1COWD 4M9QA 1D2NA 2QENA 2ZJBA 1UKYA 2NTYC 1R5NA 2P65A 3GCGA 3OE7D 4EPTA 4JLKA 3PEYA 3KQHA 3MJHA 3TVTA 1K6MA 3IEUA 1G3MA 1V5WA 1ZNWA 3MWYW 3NBYC 4LCBA 4TQ9A 3W6NA 4Z8YA 1VDZA 2F7SA 2OHFA 4KBGA 5EUQB 2QGNA 1X8JA 1DPFA 1KI9A 1W5TA 2ZE7A 4D25A 5IDVA 1AN0A 3WMEA 4JLDA 2G77B 1RRGA 3ZQJA 1F2TA 4FCVA 5FPHA 3VX4A 1C1YA 5FPYA 4LJYA 1ZBDA 2VBCA 3DDCA 1N2CE 1G7TA 4JLJA 1NNEA 2UZ3A 1M34E 1XX6A 1A5TA 4OK5A 5B58C 4CEJA 1YZKA 2ZJYA 5KNBA 3M6AA 3UPUA 4XVRA 2ZI9A 2NGRA 1FUKA 3GJ3A 3IIKA 3K0EA 2AHOA 4PO1A 4OHVA 1P2SA 4TMXA 4ZDJA 1VHTA 1IY1A 2EYUA 2ZSDA 4TN1A 3HYRA 1IN4A 1NJGA 2O52A 1XMIA 4HUTA 3RNLA 3RANA 5AUPB 2W6JD 2J46A 3IO5A 1XWIA 1U8ZA 3AF1A 4HZIA 4UXIA 1ZD9A 3UKDA 3ETLA 3OEHA 3CWZA 5KTYA 4IHQA 1Z22A 2DFLA 1EX7A 3KB2A 4D4MA 1E1QA 4DCTA 1KSJA 3L82B 1LS1A 2WJIA 3FMOB 3QKRB 1OLOA 3IHLA 1Q1ZA 1BYIA 1NMXA 1AZTA 2PMKA 4I4LA 4XSHA 5SZKB 3CM0A 2NMVA 3LO5A 3QIAA 2AN9A 2QMOA 1TNDA 4Q4JA 4BZXA 2DFNA 4G5SA 1UFQA 5TY0A 2CJWA 1W36B 4IRUB 3AVWA 4B3GA 3RYTC 3KXIA 4I99A 4NPHA 3VNVA 3IUYA 2XSZA 4TYPA 2WKQA 4JKIA 4NDZA 5JEEA 4A6XA 2OCPA 4PPQA 1XEWY 5EXTA 3VR4A 3AQ4A 1QHHB 2AR7A 3L0SA 3EIEA 4MYUA 5DE3A 5DO9A 3AVQA 2VSOA 2ATVA 3TUZC 3QF4A 5HE9A 1OJLA 3EZ7A 4N3NA 4AWXA 1G18A 4P4TA 4TMZA 5HKKD 1A82A 1H8HD 1OSNA 2ZRIA 1T3HA 4NHOA 2ZRMA 3MUFA 3NEYA 4A15A 4ZI3A 2ZU6A 2AWOA 1YR9A 1I4TD 1HQCA 2VSFA 3NDBB 1PUIA 4WZAE 2MMCA 2NG1A 2ZRNA 4KBFA 4N1AA 4OHZA 4B48A 1UEJA 1I2DA 1W0KA 4QL3A 1G291 1VG1A 3RC8A 2JEOA 3OIUA 3ADBA 5CIWA 2QN6A 2VHCA 5JRZA 4G5RA 2IYLD 4P4SA 3UMSA 1M7GA 2WSMA 5FOTA 1OFTA 1XTSA 2W00A 1SHKA 3PITA 4JJKA 4MRSA 2BM0A 3V4FA 2WV9A 5DHAA 4M4SA 1KI3A 5A0FA 2JDID 4C0SA 2IBMA 1YZQA 2F9MA 1ZUIA 3R20A 3P4YA 4I1UA 1GP2A 3RS5A 3EZ9A 4DLZA 3K53A 5HTKA 2GESA 4AKHA 4B3CA 2ZVPX 2E9SA 1HH4A 1H8ED 2R6FA 3A36A 3W34A 3G0HA 3ZIAD 3I4LA 1MV5A 4MGIR 4NCNA 4G0NA 4RD3A 2J0UB 3QF7A 1COWA 4TMTA 1DAEA 3CONA 4L4UA 3W3AA 4B47A 1GM5A 4XSGA 3SYKA 4FWIB 2IUUA 2BDTA 3M1IA 3PIRA 2OT3B 3O8BA 3P26A 4O3MA 1FPMA 2R8RA 2QORA 2XEXA 5J4KA 1W49A 4FW9A 4HLDA 5FOVA 4B44A 4CEHA 5BN4A 4PZLA 3IBYA 3RWMB 4TYYA 1CJKC 3U7HB 4MRRA 3RWOA 2EVWX 2CCGA 1I4DD 3AP3A 1UDXA 4HLUA 1VCNA 1ZJ6A 1U90A 3CRMA 4OI0A 3SJBA 3W90A 3DVLA 3FVQA 4QNMA 3QJYA 2BCJQ 1WXQA 2BMFA 2GRJA 3K0FB 4TL7A 3SE0A 1E0AA 5H8WA 1XD8A 1EK0A 3BAFA 1OV4A 5GJCA 5DI3B 3BB3A 4OQXA 5CYOA 3K09A 3K09C 5KSYA 5LDDC 1UF9A 1S3GA 1KMHA 1XD2B 1T5IA 3CRW1 3ZVLA 2BBWA 4MH0R 4HAWA 3RHFA 3T1TA 1ELOA 1DELA 1XD9A 3KTAB 2RCNA 1KMHB 3UATA 3FDIA 1HY3A 3SS8A 3I61A 1S8FA 4WZ6A 4QJ3A 3TE6A 2B21A 2O8CB 1G19A 2J9RA 4FMDF 3AVVA 4B73A 4OI4A 5K8LA 1Z0KA 2DWPA 3LAWA 3FGNA 5JS8A 2RB4A 5JLJA 5FUVA 4RD4A 1JR3D 2GZDA 3MWKA 2F1RA 3U4QA 4L8GA 3EXAA 1BO6A 2YKGA 2QUZA 3LX5A 1EXMA 1F2UB 2JJ2D 4A4DA 2DFKB 2QPAA 2C95A 2GEVA 1GL7A 1G3UA 4L9SA 1WB9A 2EFDB 1ONBA 1SXJC 3KKOA 2G83A 2GAOA 2SHKA 1KO5A 1DAKA 3HR8A 2QMUA 3LBIA 4BZPA 3HR7A 1E69A 2VH5R 4JIMA 4B2IA 1ZC3A 3AGPA 1OH5A 1NIPA 4BFWA 3EARA 5FR1A 2MSCB 4BLTA 4HB3A 2EFEB 2KBEA 3LVQE 3I72A 4R2IA 5GJVC 1XCGB 5JI3E 2ODNA 1M6NA 1KAOA 1AS2A 2ZJ5A 3BFXA 4D4JA 621PA 3LD9A 1F3OA 5FPKA 4ESHA 5GJBA 2ZAMA 3DZDA 5D3MA 3TJZA 2G0TA 4DLVA 3AEZA 1R0ZA 4YMUA 2J7PD 1IY0A 4A2QA 2K5UA 2PZGA 2DB3A 4NBSA 1YR7A 3BS4A 2UVQA 1JXMA 4LOAA 1YR6A 2IYVA 4TMWA 3W8RA 2ODEA 4FMCF 1R10A 2KSQA 3EZ6A 1MRSA 2FEMA 4ZDIA 1W4BA 4WOPA 1JQJC 4M1YA 2J7PA 4ABYA 3GFPA 4E09A 4TQUS 4Q9IA 3BGWA 4TZ6A 3BH6A 3NEJA 2AWNA 3Q3JB 1MO4A 2A30A 1KTVA 3Q5DA 1PLJA 4LJ7A 1EFRD 4MDEA 1TF5A 2BJWA 1SZPA 4HUQA 4Q00A 2RHDA 4JVSB 4K8OA 4PPNA 1EWRA 2GJKA 1XJQA 4RSGA 3F3YA 5H70A 1KDPA 3U60B 3TSZA 1ZM3A 2GAAA 2LCFA 2NQ2C 1II8B 2H17A 4TSFA 2BIFA 3X1YA 1EFRA 3OZXA 4WW0A 3W5JA 4R71A 4BGDA 2QT1A 2DWOA 1Z08A 4Q9JA 4RD6A 2X77A 2PX3A 2C5LA 5TARA 2G6BA 1E2HA 2G1KA 2G88A 1CULC 2ZYUX 1Q22A 3BK7A 5SZHB 3NBXX 2BJVA 4L16A 4B75A 4E22A 5EZ5A 4UNSA 5KSPA 4LV5B 3PEUA 2QGZA 5EXPA 5K8TA 4LJ8A 2QSZA 4KLNA 4NYIQ 4B33A 4BLSA 2C2HA 4LY6A 2P2LA 3C7KA 3R8CA 4QKQA 1VYTA 3SC3A 5JWRA 4BRUA 4C0LA 1QG2A 2PX0A 4XJXA 2FOLA 5L3VA 1HYQA 2BMEA 2RGBA 1IN5A 4JLPA 5DNYB 4EDHA 4LSGA 1ZM2A 3TLXA 1MOZA 4GOJA 3A1TA 3N5CA 4EPRA 3OAAA 2VA8A 3U6BA 1E2NA 2P6NA 1SVIA 2IYQA 1ESNA 4OQFA 3X1XA 3R9IA 1Z29A 3G82C 4EQ6B 2CVHA 3PUXA 4M22A 1M7BA 3RC3A 121PA 2WIBA 2GK6A 3PENA 3MAAC 3U6KA 1DOAA 2R44A 4LC0A 4LBYA 4DKXA 2GJ8A 1NSFA 2ZYVX 1Z3IX 3GLIE 4UXHA 1SVSA 1N3BA 1O3YA 3EWSA 2FSGA 2B7CA 1D6JA 2W58A 4HAZA 3A4MA 4Q4JB 4OK3A 4QHYA 3LWNA 2OFXA 1XD2A 4AK9A 1XB2A 4HYYA 5GVSA 2GJSA 2VHJA 3KFVA 4TMVA 4HZUB 2C96A 4C4PA 1A7JA 2BBOA 3WNCA 4EKDA 3LXRA 2O8EB 1SQ5A 2WAYA 4WAUA 1DTSA 3DO6A 1QBKC 1X86B 4RVCA 2YYZA 3H1TA 3LLUA 3GJ6A 3GFOA 2ZAOA 4Z1MA 2Z83A 3PR1A 2D4HA 4Q7JB 4O0MA 2XSZD 4Q1DA 1RJ9A 1W44A 5IRCD 1KI8A 2OBMA 2J0SA 2IHYA 3TMKA 1P2TA 3ZD6A 1W48A 2OILA 4QGFA 2ZSAA 4Y0AA 3GLGA 3PJRA 4LBZA 1CLUA 3THOA 4AD8A 1TQ2A 5BWMA 4GMDA 1LF5A 3PVSA 3SBEA 3HPQA 1W5SA 4EPVA 2ZRDA 2JA1A 3BFVA 2ZRBA 4KCGA 5P21A 2FNAA 2VO1A 1GRRA 1DAIA 4EPYA 1RKBA 5DLQC 4RD0A 1QDEA 1CU1A 4FIDA 1FNMA 4FD2A 3VNUA 1FL9A 1ZVQA 1SXJD 2UZIR 1L4UA 2GVZC 2FGJA 4PHTA 5DI9A 4DXAA 1CR2A 3MCAA 4IDNA 3I5YA 2CDNA 5CJ2A 2ZRFA 5FH9A 1CJUC 1P4SA 3S1AA 2AL7A 4NYIR 1VCIA 5CJPA 1DAFA 2HYDA 4D80A 3O8CA 2G0NA 1AS0A 2MSDB 3EX7C 4CYMA 4DSUA 1UAAA 4ZDWA 1XPUA 3IQXA 3K70D 1N6OA 4P31A 2W83A 3ZGXA 2ORWA 4LPSA 2WM9B 1UPTA 3L0PA 4CF7A 1E2IA 3H4MA 4L9WA 2PT5A 1G9XA 1KO1A 4M53A 1J8YF 3GLFB 3U2QA 2H16A 5DISB 1GVNB 1Z07A 5GJWC 1H8EA 1G6HA 1OXSC 2EFCB 2HUPA 3HP1A 1YR8A 3GLFA 1DBSA 4DHEA 2WSSD 3GPLA 2XZPA 2JLRA 2PJZA 3CKLA 1W0JD 4DLWA 3ICEA 5JJLA 3WYGA 5FTNA 4BRWA 2JLQA 1TU4A 2GHIA 1JEEA 1OIXA 1NKSA 1XEFA 4RZUA 4DLRA 4CT4B 2Z6VA 2D2EA 2GZHA 1RRFA 2VP2A 3SEAA 4URVR 2ZJOA 3BB4A 5EXSA 4EFLA 4JKYA 1XMVA 4AYWA 5KOYA 2ECKA 4Q1FA 3W5IA 1FX0B 5IT5A 4PXAA 1W2HA 1J90A 1N6LA 5FOWA 5KDOA 3K70B 1EFUA 3B9QA 4JSYA 1P61B 1RFLA 2GA8A 3AB3A 1ZYUA 1HV8A 1G8YA 1Z0DA 1Z6XA 4P32A 4M9XA 2GWHA 4Q4AB 4V0ME 5JEDA 3GLIB 1N6PA 4GOKA 5TMPA 4URXR 1ANKA 2HT1A 4V02A 2C9CA 4DSTA 4ASUD 1XZPA 3TGPA 4XTRA 4LHXA 2ZRKA 1RZ3A 5EP2A 3EC2A 2R6AA 2XNSA 1OIVA 1E2QA 4DZZA 3U3RA 4M8NE 3NH6A 1KZ7B 3TKLA 4UKDA 4IDQA 3Q9LA 4X8LA 4A8JA 1AA9A 1NVWQ 5L3SB 4OI1A 2ONJA 1SXJE 2R65A 3U7EB 2JJ1A 4Q21A 4IJMA 3ZH9B 1N6RA 3QBVA 1U94A 2FPKA 4Q1EA 1NN1A 4A2WA 1J70A 2VLIA 2ZR7A 1GIAA 4UQOA 4V0MA 1E79D 2R6DA 2QE7A 4PANA 5EE1A 2ZEJA 1UDWA 2IHBA 2PT7A 2J41A 4A0RA 5FL7A 3IKJA 2D74A 3NIBA 4PPGA 4LJ5A 4BFSA 1N6IA 1N25A 2ZR0A 3FFBA 1XXHA 3J81k 2AFIE 3SI7A 1GL9B 2C98A 2W0MA 1XZQA 3ZVNA 1JR3A 2QTHA 4Q18A 2FFAA 4WXRA 3TW4A 5HR5A 4OKSA 1E79A 5CYPA 2W2XA 4LHVA 1LV7A 3CX6A 2BVNA 4TLCA 1P7CA 2QNRA 3AVOA 1VIAA 3NXSA 3OE7A 1HT2E 4IEIA 4LK2A 4XOIA 1VTKA 1NVVQ 1WA5A 3B2EA 4QBIA 1IBRA 3ND9A 4PO8A 4Z1MD 4B6EA 5JS7A 5FUWA 2HXSA 3P1JA 4PHFA 1DADA 2AK2A 2IEYA 1XP8A 4FMBB 1S4QA 4NKRA 1US8B 4JL5A 3GD7A 3TAHA 3AH8A 2QBYA 3MWJA 2GZAA 1ZAKA 1Z83A 1OYYA 1RJ9B 4YMTA 3IGFA 4EPXA 4BEJA 3WYAA 2O0JA 3P32A 4D82A 1TX4B 2VPPA 1DAMA 1OFUX 3KKPA 1XXHE 3DZ8A 3QPUA 3RRNA 1UJ2A 4D0GA 5TDHA 1WCV1 2BMDA 5KHOC 1E0SA 2ZE8A 1KDRA 1AM4D 3Q8XB 1TEVA 1KK2A 2CBZA 2IYXA 3SOPA 4Q1BA 1SVKA 3PUVA 3I92A 3LNCA 4A0HA 3GJ7A 5A5GA 5KDDA 1GTVA 2V1UA 5AWFC 2WWXA 4Q4HA 4L15A 2REBA 1T8TA 1NY5A 1XPOA 5EP4A 1TTTA 2ZRLA 1P2VA 3CZQA 1W47A 4KFRA 5FTMA 2JCSA 3SFVA 2NZJA 2H92A 1CR1A 3OHMA 1EG7A 4DC9A 3AF3A 2IX3A 1NI3A 4DCNA 2O8FA 3GLHA 2WJVA 4IXNA 4V0NA 3EPHA 2Q9CA 2RGGA 1PLKA 1ZNYA 4D0NA 3JVUA 1Z2AA 3N2IA 4YDSA 1Z2CA 3KQNA 1TMKA 2Z0MA 4OQLA 4M9ZA 3VR1A 2REOA 2ZUDA 1R2QA 1XFAA 2GF9A 3HU1A 4KV9A 3WY9A 5KNCA 2QZ4A 1TQ6A 3UWKA 1WP9A 1Z6GA 4FCWA 4HDCA 4W9MC 3KX2A 3M4YA 2JDIA 1AQUA 1CKEA 4JZKA 3W8NA 2IS2A 2AXNA 2CLDX 3BORA 1OFIA 1DS6A 2EWWA 3B5JA 3I5XA 4QRHA 1YE8A 4A2PA 4U5XA 1FTNA 5ANRB 5EE5B 4MUAA 1NRJB 3SNHA 4BWYA 4FXPA 4EPWA 1GZSA 4YLGA 5EE9A 2QA5A 3BFKA 1Z0AA 5IHPA 4TLEA 4H1VA 4G5OA 4Q02A 5JFGA 2AD5A 2XXAA 1G4AE 1AKEA 5JCPA 1W4AA 4Q9LA 5DH9A 1W1WA 2GXAA 1E94E 4DEYA 1NL3A 2ZRHA 4RJLA 2ZE6A 3TQCA 1QVRA 3B1YA 3Q72A 5J4LA 2IYYA 3FHOA 3OEED 4Q01A 1Q3TA 4ASUA 2HYIC 2GETA 4HUQB 3AVXA 4GOXA 3KXKA 4JJZA 1KNXA 1RC8A 1Q44A 2V6IA 2VEDA 2F43A 2Q3HA 4WVFA 5JHHB 2FZLA 2IYRA 5B57C 5FTLA 1A2BA 4QM7A 2PCJA 1JJ7A 1E9CA 421PA 4BUJA 1EFHA 2QEQA 3BWDD 1EFCA 4RY2A 1KSFX 2Z4RA 1W36D 5KNDA 1HA3A 3WNBA 4LYFA 2DCUA 2IYUA 4AKGA 1KJWA 1Z0IA 3K8YA 1OXVA 4JL6A 3T1VA 5AUOB 2J7KA 1MABA 3Q5EA 5J4YA 3OIWA 4X8HA 2IUSA 2GCPA 2WWGA 3H2YA 4ZIRA 1VG8A 4KXFB 1YQTA 2Z43A 3MRSA 3K0AA 3ADCA 2PEZA 3DL0A 5E7JA 2C03A 4BFZA 4ZIRB 1II8A 1N5IA 3B60A 4JBYA 3RVBA 3QSYA 1P72A 1VHLA 5E7MA 1II0A 4Z8XA 3ZQ6A 1NG1A 1NG9A 2Q0HA 3AP2A 1D2MA 4D81A 4E5UA 4A9AA 4B71A 3PXGA 3C14C 1MRNA 1JR3E 4TT3A 1R6BX 3A58B 1P6XA 2QP4A 1U0HC 2OCBA 4DSNA 5AUNB 2IYZA 3L0OA 2JLWA 3WRXC 2J1LA 5LBIA 1N5KA 4KSCA 1IHUA 2GXQA 1LB1B 3GEHA 3EIHA 4Z51A 4PHGA 5EP3A 1J99A 1HT1E 1EX6A 3U3MA 4P33A 4Q1CA 1KJYA 1G41A 1BH2A 1G3IA 2WBLC 2VQSA 3VKHA 3B1ZA 4OHYA 1P5ZB 3VR2A 1MKYA 2WAXA 4JLVA 3KQLA 3NBZC 3CR7A 4LYAA 4D6PA 3KUDA 2R62A 1NSTA 2B7BA 1DVRA 2PL3A 2B6HA 4HAXA 1Q12A 4NONA 5CM9C 4D26A 2NO0A 3AKDA 2FF7A 2O0KA 4PHHA 3FYHA 2QP3A 3VR3A 2D62A 2WWYA 1E2EA 4BFUA 2EWVA 4E07A 3KKQA 1GSIA 3UXMA 4UJ5A 4ZO4A 1JALA 1VPLA 5FOSA 4RKEA 4UJ3A 1TU3A 5FPTA 2D7CA 3KJEA 3T1OA 1IN7A 1IOZA 2ZYTX 2RGEA 1GKUB 5FBLB 2A5FA 5DYIA 3RRMA 3Q7QA 3A1WA 4B43A 4CVNA 3E70C 3GMTA 1RYFA 3C41J 1Z6YA 4P4UA 1AZSC 2WSSA 3CUEF 4QGAA 5ELXA 1ZMXA 3QKUA 4IDHA 5FOXA 3TAUA 1KZGB 4GPTA 4O25A 4F7WA 2N1BA 2C9OA 3DMNA 4Q03A 3SDZA 1YJ5A 3IO3A 2WPDD 1BMFD 4C0BA 1OE0A 1NJFA 3QVUA 3TUJC 3UWOA 4YQFA 1KI6A 2HF9A 1P73A 1NN3A 1R8QA 4KODA 4LHWA 1U98A 1F48A 3QXJA 4CDGA 4LHZA 2CK3A 2FMXA 2KE5A 3U7FB 1R8SA 4KYIB 3TBKA 4UNNA 4NCKA 4M1KA 2JLYA 3Q85A 3LRPA 3LQRA 1IAQA 2XGJA 5CB6A 4RKFA 1VCMA 1JQLB 3UIEA 4B3FX 4BECA 1MO5A 4MGYR 2ZSEA 4PAOA 3U44B 1CRQA 4B35A 3WXMA 3THYA 2CK3D 4OJKA 1PLLA 3B78A 3IIMA 1ZP6A 1D9XA 3FPAA 2HT6A 4TLDA 4F93B 3U3OA 2QMEA 1E2GA 3BD9A 1GRQA 3B1VA 4US2R 4RCZA 3ZZUA 2ZS8A 1G3RA 1U0JA 2QT0A 2OUKA 4KI0A 1CR0A 2YC4C 3SFZA 3KDSE 1N6KA 4N0EA 4US1R 1NBMA 4DT1B 2F55A 3MD0A 1IJEA 1P9WA 3IILA 4NMMA 1U99A 2IK8A 3FB4A 3DEFA 1HUQA 3HWSA 4GSYA 1U81A 4HB2A 2BC9A 2ZE5A 4K46A 5L3QB 1GNPA 5G3ZA 3IIJA 4ARZB 1UBGA 1PJRA 2F9LA 2ODBA 1ZC4A 4RFVA 1E9AA 3ZD7A 1F6BA 1JECA 4Q47A 3KJHA 1OHHA 1Q21A 4LV6A 2O8FB 1FTSA 2ASEA 3KL4A 2ERXA 3C5CA 1FNNA 4IOLA 3B6EA 3F0TA 1UBEA 4DCSA 5FBVB 5F3WB 4GNKA 4JLMA 4ZCMA 3PV0A 3C4JA 4ZKEA 4P4SB 4LGMA 5CIQA 4KO8A 4XD7A 5DI3A 4MA4A 2YC2C 2XOKA 4TSFD 1OHHD 2XITA 3LH5A 3AV0B 1B0UA 2RGNC 4MUBA 1OF1A 1XMJA 4W5HA 4B74A 3M0EA 2P0EA 2QAJA 4B2LA 5CK5A 3AVPA 4BFTA 2PH1A 3FE2A 2A5DA 5LD2C 3KJGA 3MJRA 2ZJ8A 4JT4A 1Z28A 2Z5FA 4BLOA 1G1MA 3IDQA 3ZIAA 1AS3A 2GF0A 4HSEA 2RKOA 3G5UA 4TTPA 5C46F 4Q7MB 4EFMA 4OJQA 2D7DA 1TL7C 1R4AA 2IYSA 2ZPTX 4URUR 5EP1A 1NVUQ 4YDHB 4JLAA 1G64A 3VAAA 5FFMA 5JBQA 4UNPA 1G8FA 4M1WA 4MGZR 721PA 4XTCS 3QXCA 4D4KA 4C0AC 4QJ5A 2GKSA 4YONB 5UKDA 3QENA 1FMLA 3VHXA 3B85A 1YZLA 1GKIA 1II9A 2N42A 1ZCBA 3HPRA 4QG7A 2W6ID 4CRWB 4US0R 1CIPA 5K8IA
chains in the Genus database with same CATH superfamily
4PQFA 4IX1A 1XDDA 5JECA 3R76A 1T8WA 4IVQA 3CNLA 4WCFA 1G5HA 3KEMA 3M33A 5COAA 5I51A 1X7ZB 2NACA 3L43A 3T54A 4C3ZA 3GH1A 1Z74A 2HMYB 1YQQA 1UPCA 4RZ2A 4FSDA 2H4WA 2EG9A 1DJPA 2GN0A 5HQTA 3NDPA 4TLBA 3BWMA 1O6GA 1C0EA 5KNLA 2FN9A 1L5ZA 1LJLA 4IS2A 2GFIA 3IXQA 2OFOA 3ZU6A 3VPFA 1LK0A 7MHTA 3KUCA 1NU6A 1UZLA 2V4MA 2WYVA 5CLLA 3AI7A 3FVVA 2NVWA 3HN6A 3KQMA 4D3SA 3SR3A 4ZMRA 1VE9A 4S2EA 4QDZA 1AHNA 5AW4A 1U7OA 3MOSA 4BVHA 2WU0A 3B6ZA 4CE6A 2X5NA 3RSZA 1P74A 1E4VA 4OGKA 2HJHA 3WGVA 4E4YA 4OF4A 5EPOA 1U7DA 2P2DA 3GLVA 3HH8A 2CNKA 3RJ9A 1FMFA 1UQRA 4AKEA 5B3KA 4QVGA 4CEJB 4R5MA 4G0MA 1PO7A 4RVDA 5DN6D 2ZSIA 4M9SA 3ER9A 2AR0A 2OXFA 2R68A 4I5FA 4GW3A 3OBIA 4JOSA 4DBVO 2A9KA 5FBQB 3P19A 5L3QA 3RBVA 3GNQA 2C07A 5BMOA 4Y2YA 2W7TA 4BVEA 2BGGA 1UFVA 4PC6A 3DFKA 3UBTA 2NSDA 3CRRA 4KXVA 4D96A 2XDYA 1PN3A 4YHBA 1YVDA 2YW2A 4MITA 1E2UA 1IN6A 2DFPA 4JU8A 3EXEA 4GI7A 1T5LA 5AOCA 2E3JA 4IJQA 4OHWA 1HI9A 2O2EA 4J0KA 2V98A 1EAYA 4KE9A 5B4TA 5D5QA 3FPHA 3MSXA 4NLLA 4TL9A 4UZEA 5G0TA 3RVNA 5IEJA 2RJ3A 4M1SA 2BP7A 2FK8A 4ZOQI 4IFEA 1DV1A 2VRWA 5IM4F 2VP4A 4RZ3A 4QOSA 2WUWE 4IOMA 2KS6A 5C32A 4O2RA 1A8SA 2MYTA 3MTEA 1Y5NA 4QVKA 4X1IA 2ANBA 4XKJA 1W0KD 4G5FA 1OAKA 2V1XA 3WLEA 3HBFA 4ZT3A 4QWWA 2X9GA 3F5SA 2JGFA 4RY9A 4LSWA 4RBNA 5F2OA 5B1DA 1CS4C 2V7QA 3C87A 5H9WA 4J1SA 4V2IA 5KMGB 1ZK2A 4EYKA 2YS7A 1HT3A 4LZOA 4AJOA 3O4GA 4R2LA 5E9AA 4BX3A 3PPXA 1BE8A 2C9DA 4EUFA 2AN1A 4EUKA 2WMDA 3GEEA 1M9NA 2Q3FA 1D8AA 2C4KA 5DOZA 4EYSA 4Y9RA 3FPJA 4MVJA 3R7BA 2OYCA 4RY8A 2XE6A 4U2GA 4H7EA 3TW8B 5KYYB 2DPXA 4C6SA 1YA4A 3F9RA 4KO1S 3Q98A 4YRGA 2GPYA 1E3QA 4RVGA 5BPHA 2PSDA 3E84A 4JBWA 3VR4H 3HBMA 1EUDA 3NOXA 2M6LA 4AZSA 2Y9PB 3D7MA 4C1NA 2HAEA 4PYJA 2OD7A 2R6JA 1WV0A 2FGKA 2HRQA 2JKYA 3A6JA 3AR6A 3HHEA 1W5FA 1PR9A 3PWKA 2F3PA 4URWR 2E1PA 4KUGA 1WULS 1J56A 1CJMA 2GKGA 1BZYA 3JD3A 3JVEA 1I3OA 1UBKS 4N6NA 3UAVA 2CV0A 4AN4A 3BXXA 5KX5F 1QIJA 1A4RA 3E2IA 4TWZA 2B4AA 1QFXA 3V46A 1XQ6A 1BKYA 1KOLA 3TIXB 1LBSA 1L5MA 4YP7A 5IF9A 2MSEB 3H0KA 3MZ0A 4C14A 1Q1BA 1MG0A 5ALUA 3NANA 4ER6A 2JLUA 1T1IA 3H17A 5B3LA 1GG5A 3SQWA 2V45A 5C5CA 3KKNA 3VOAA 2VHEA 4GRDA 1TAUA 2YRWA 5GM1A 4EWLA 1JGTA 4YIKA 4DDTA 4HXYA 2CNWA 2CXNA 2RHJA 3F90A 1L5OA 1N7GA 4IJ5A 2VP5A 3T3GA 3VYSB 3HP4A 2GUGA 1WZUA 1O94D 3ACBA 3I4FA 3FAZA 2I4TA 3UXYA 3SIRA 4CT5A 4EHLA 1KI4A 3CLRD 4GMFA 2J0QA 1ZA1A 2N3ZA 4V0RA 4L6CA 1SK9A 3FIUA 3DHNA 1QJCA 2YZ2A 5C7OO 4LF4B 1CJCA 2WYUA 4RZIA 1PNTA 4TYNA 4MUFA 5JALA 3SWWA 1UJMA 2ZSBA 1E96A 1DUVG 5AKZA 2HSGA 1A2OA 2QQ0A 3ELDA 3L8YA 4P3KA 5K5EA 5KJCA 5TQ0A 3OA2A 3QOXA 2M1ZA 3KIPA 1XMSA 5C1PA 1CHDA 3K2IA 4I4TF 5CLJA 5LBUA 2WMOB 1XTIA 4RH1A 1CQIA 1AK9A 3EXFB 4MIKA 1M2WA 2RI6A 4OI2A 1F2DA 3LX8A 4FX2A 5E6RA 4BJ1A 3P71T 3RDPA 4HLUC 3DWGA 2AQIA 3RBZA 5JXWA 3VRHA 4HHEA 2QN7A 1T3SA 1P7YA 2G1AA 1PAUA 5JS1A 1PBTA 2R5FA 5AQEA 1D07A 3W2FA 3Q0IA 4DR7B 1SY7A 2VCHA 4Z4HA 1ILEA 1SBNE 3NPAA 3ND7A 4LPKA 3AEQA 4XVQA 4ZREA 1F8XA 1M72A 4HNGA 2I3GA 1GGKA 4BZWA 4GP6A 1Q84A 2GEUA 3QVMA 1J0BA 4NC9A 3WWZA 4N5MA 1FFEA 4RQUA 5K0GA 1D09A 5FBWB 4DLAA 2YXPX 2WNIA 5ARBA 2FY8A 4OXYA 1OV6A 2P5TB 5LA6A 4RTRA 3SMVA 3ET5A 1LF0A 3R09A 1G20A 1C3VA 1JQBA 4AY3A 4O4HB 4JUAA 4XYMA 2V6FA 3M1YA 4HBGA 1P0QA 1PJQA 5FV7A 3EPLA 1QDLB 1G2QA 1O9BA 1YCDA 1T0JB 3WL8A 1NYTA 4D9KA 3BERA 1SCKA 3WLKX 1PG0A 5KOJA 4JU9A 4F3RA 1K4KA 1SCAA 3S8MA 1KNQA 2ERYA 4PSAA 2V54A 4FCTA 3TLCA 4BP1A 4NZNA 2GBLC 2HJGA 5CH8A 3LHKA 5FL3A 3ZCXA 4ZHQB 5JCJD 2FW1A 5EN4A 5IF3A 3RU2A 1K3UB 2WWRA 5HF9A 3WKEA 1QP7A 4EX6A 5IKMA 3KJZA 3VPGA 2EW1A 5JAQA 4JGBA 3SYNA 2ATXA 4I14A 3GZTB 3NRJA 3KU4A 4HB0A 2HSWA 4JL8A 4LJLA 2P4EA 4MHOA 3VOTA 1E3IA 1G1AA 1KKMA 2AOWA 3JQRA 4I81A 4WLUA 3AFIA 3OEYA 3A31A 5AHXA 4HGZA 2NQ8A 3AYZB 3C8UA 4NX2A 5G2OA 5JYBA 1PV1A 3U7GA 4ZHQF 4W5WA 4YRTA 3RRZA 4AP5A 1GFIA 1TKCA 1CJVC 4TKMA 3FH0A 1UZMA 2ZKLA 4FQ8A 4LDQA 1C3JA 1T91A 2O9JA 3GAAA 4KQEA 4M2LA 4QPPA 1KEWA 2HWKA 3AXTA 4RAOA 3RSQA 2F8MA 5CITA 4UEWA 2OMKA 4GZ6A 4II3A 1VHDA 2W2VA 3EEIA 4EKNB 4YAFA 1K3FA 2HCRA 5EIBD 2O05A 1PD1A 1ZPDA 5BWBA 3C24A 3HKDA 3F7NA 3E0QA 4L6IA 4RK1A 3SXJA 2V7TA 3UG6A 3B3JA 5DASA 5JDIC 2KWIA 2QTAA 3ADKA 3O8NA 5J63A 2ZDGA 3TDKA 2AEJA 1MB3A 2YMLA 1YS1X 2QTCA 2EWMA 2ZYSA 5DXAA 2WWFA 2OQVA 3ETNA 3UK0A 3WOVA 1D9ZA 1WUKS 4MQFB 4MYHA 1ICIA 4UBMA 1ICEA 1ODKA 2CNNA 2QLMA 1CUDA 3A9WA 3FR7A 4YAWA 3W9BA 4M7WA 1GTRA 2IV7A 2H1WA 1JWBB 4BKQA 1HLFA 2EERA 4DV4B 3IL2A 2WT9A 1BMTA 3K72B 4RQTA 3CPEA 2A78A 2FPRA 2A5YB 3PNQA 3H8JA 3K0CC 1TVKA 1JVNA 1GFZA 2OG1A 4OVKA 1QXSA 4L72A 2JLVA 3DMRA 5H82A 1ZRHA 4LBVA 4RMJA 5IC5A 3LUDA 1BKSB 1ADYA 3HDYA 2C9BA 2Q46A 4I1VA 4MV0A 4DR4B 4NENB 1YHNA 2W48A 2WNHA 3OC0A 4MWZA 2WI8A 1R15A 4QPDA 5CLIA 2DGDA 1A69A 1TLTA 1HYHA 1U02A 1EFPA 3GLKA 4P2GA 1V3UA 2HLNA 1YBHA 3R3XA 5KSOA 3WWEA 3JPYA 3AG5A 3EC1A 1PSDA 2MWMA 5E2IA 5TVGA 3FUXA 5AKLA 2HNAA 3OX3A 3M1AA 3UA3A 4EY6A 2GN1A 2IIBA 1NFRA 2AJTA 4ZZ0A 5JH7A 1DBRA 4YCBA 2ZJAA 1EI9A 3ADDA 4KGDA 4MDHA 3NTOA 4QDOA 5LP6C 4MEJA 3ZJTA 1CS0A 1CJTC 2BEKA 2FCAA 2B2CA 5BVHA 1X1TA 2L2QA 1MORA 3V00A 3GA7A 4HEJA 1KR5A 4HGRA 4HFJA 2QAGC 2WVJA 2H6EA 3H1PA 3BL5A 2PLFA 4Z7OB 2I91A 2BR3A 4HDAA 2A0KA 1IUOA 2JFUA 5CFOA 1C81A 3QPAA 3CT6A 1TYEB 3LGSA 1EIZA 2VDWA 4MPPA 3G17A 4EW1A 3UMCA 4EF6A 5CA1B 2DG2A 1SC4A 3SG0A 1VB5A 5DHSA 1VGRA 4NZYA 4M1QA 4QYTA 4JUFA 4RTLA 1NM5C 2I7TA 2C2MA 3E9RA 5L3ZA 3FWNA 4R7ZA 2GTPA 4QUDA 1J23A 2I7XA 3BL8A 2JI9A 3I3SR 3KYCB 1SBQA 2CFRA 3BSFA 3BTVA 4IXDA 4KXUA 3TVYA 1HT0A 3GUHA 5GVRA 4YRZA 3RADC 2IOYA 3ULKA 1XIVA 2P67A 4MMXB 2CZGA 4K6CA 3GLQA 1QMPA 3BGIA 4WA7A 3T3MB 3G0CA 3RV4A 2NSLA 2F2TA 2FLWA 4FDAA 1XKXA 4L76A 3OQMA 4RGBA 3T5BA 4EUHA 5KINB 4PAQA 1JEOA 3QJ5A 4Y2GA 3AZQA 3N70A 3SZRA 4CMCA 1JN0A 1TM4E 4YJHA 3IMGA 1K63A 3UTDA 3FYUA 2UYYA 1F20A 1TO2E 3I1JA 5JO9A 3AZOA 1V41E 1RI2A 4B09A 3VSCA 1RMYA 4RO0A 2VF7A 5DTMA 4MVCA 1UKVY 3GJ4A 1L4LA 3OZCA 3B3QA 1JKXA 3ZWQA 4OHRA 3T9AA 2XT9A 3EZYA 1LNSA 4DCMA 4KR6A 3P9IA 2O0MA 2OBFA 4NBNA 4WIAA 4YP0A 1K5HA 2HRCA 5D2CA 5DU2A 5KU7A 4JLSA 3R24A 2V4ZA 3ZWVA 1QHSA 4B6JA 3WDSA 4GUAA 4M6WA 1SHJA 1ZO8A 3LVRE 1E99A 2D06A 2FN4A 2UZAA 2ZIFA 3TL6A 1L7AA 3KQKA 1GTJ1 3AG6A 3A1DA 4WADA 4XJVA 4IH1A 3I62A 2XT6A 2AYYA 1PQPA 1E8MA 2JJ8A 4R1QA 4OLHA 1XLTC 2FHSA 2GCOB 3JQBA 1VL5A 3A1VA 5B1IA 2WTUA 3P9QA 4G86A 3DMFA 4CKEB 4B87A 3LUGA 3Q1KA 5AR1A 3O8OB 4BLQA 3CVVA 3G88A 4DYDA 2C5AA 1JBEA 3UM9A 1WDMA 4BP3A 3L8CA 1N9GA 4W1QA 1J7KA 4X7PA 3ONWA 5C9ZA 3BK2A 3FI9A 3LY5A 2HWWA 3O92A 3IKTA 4IIYA 2V0GA 2ZI7A 3EOAI 2B5VA 3WO0A 4PZYA 1MOSA 2BR4A 5KUTA 3ISVA 2FWMX 2JLSA 2ORIA 2R5WA 3LDHA 2XB9A 4Q5IA 1MAVA 2AMLA 3DLIA 4MWOA 3RYHB 4X7RA 4FEAA 2I54A 2P4UA 1PT8A 1RXWA 1PHPA 4FN5A 1WMDA 4HWTA 4MRVA 5LQDA 4R2XA 2BWJA 5AMXA 3MS7A 3I23A 3HXKA 1T29A 4H31A 3U19A 3A6ZA 1T5DX 3L1IA 3NQ41 1ENOA 1QHHA 2BSAA 3K0SA 3E5HA 3MJDA 4QQKA 4L4RA 2ISCA 3DVAB 4XWKA 5H5JA 1YFJA 3LBHA 1TTPB 2HV9A 4LVUA 5AI6A 2I4MA 3WK6A 4YI3A 1R37A 1BE6A 1UQUA 1U8CB 2GD1O 4OXIA 4KITB 3ZBTA 3W5DA 1JXOA 3HRKA 1WXGA 1Q1QA 5HJEA 2PX6A 5ELMA 3E3NA 4C7BA 3ZZ1A 1NV8A 3DBRB 3W9YA 1TTHA 4CKCA 2WVAA 2GZ1A 4UHDA 4C0JA 5LZ2A 4RXUA 1WLYA 1IBCA 2C00A 5CLQA 2OXCA 3GGCA 3ZWPA 1JA9A 3LRXA 4CPDA 4D9BA 4EGSA 2MMGA 1BE1A 1PK9A 5FWXB 4X44A 1PEKE 2YMMA 1ZD1A 4MX8A 1D5WA 4L78A 3ZX5A 2PKWA 1MAWA 5DHQA 4NYMQ 1T0BA 4LSZA 3GLIA 2LP4Y 3IIIA 3T4UA 3NNSA 4EGAA 5K6TA 1GEEA 1UDCA 5HZKA 3LS2A 1AQJA 3HLKA 1M67A 1E9RA 3KL2A 4YRRA 2JVIA 2OZEA 1O6CA 4J9UE 4NMWA 4MKHA 4QARA 1KY2A 5DHUA 4B85A 3ZWNA 2XZDA 3NG1A 5DMHA 4QASA 3D4OA 1U5AA 4WECA 4G9BA 1NBOA 3BSWA 4X3OA 3R4VA 5IJXA 4V1CI 1DE0A 4F9EA 2FX3A 1TB4A 2BEJA 4NP6A 1AHIA 2XT0A 4KXNA 3GLGB 1NLUA 3GF4A 1L5VA 5L3SA 3B1WA 3WNDA 2B1QA 4YT4A 2O2SA 2GPAA 2J5XA 1EK1A 2OWEA 4JLOA 4D26A 2A2ZA 3RSFA 4L3OA 2AF3C 3QQPA 2IGTA 1S5PA 2NU9A 3UC5A 4QHTA 1M6VB 2WK1A 4A3SA 2WICA 3A32A 4DY6A 1AO3A 5IJ9A 4XUEA 2QR2A 5AJYA 3MGAA 2RGCA 4JI4B 5FOUA 3TFWA 1PX2A 2YWJA 4OFXA 2Q9AA 4B7UA 1A4XA 4E0BA 3I6IA 3LCRA 2NZVG 5I45A 4J4TA 1GXSB 4HVTA 1NKVA 1DG1G 1NVBA 1P3DA 1X39A 2V6GA 3AKYA 3KQTA 4PEVA 4B17A 5B1YA 4R16A 1EJBA 4X24A 3OX2A 1NQWA 4M0LA 5I8WA 4K28A 1XXHB 5AI4A 3KK0A 4TVBA 1P9NA 2ZWPA 1T0UA 5C4MA 1KGDA 1ZG3A 5AK4A 4OP2A 1DBPA 2OAP1 2OOKA 2PUHA 3A06A 1T8UA 4WK2B 5AM2A 3CEHA 1Z4KA 1WU7A 1YRYE 5SYMA 1KOFA 2WDPA 1MPTA 4OYYA 4V0OA 1QB8A 3CLSD 3OH8A 2NU9B 1QQ6A 2W0SA 1RAAA 1UBJS 1WF3A 4X8MA 2PS1A 4MLPA 4F46A 2VSXA 3OOJA 3IOMA 5LYJB 2J0EA 4MRAA 4I1OA 3BFJA 4Q9HA 1R9NA 3WBJA 2QU8A 2YVLA 4ZVQA 1SUEA 4LXIA 3F47A 4Q24A 1YZUA 3W2HA 1PWHA 4Q1VA 4WASA 1X8XA 2EC5A 3DE2X 1ECBA 3LLSA 2Q8NA 4AJ4A 1BE0A 5ICEA 1NPDA 5JBIA 2RAPA 3RASA 1TFRA 1N2IA 5JVDB 3JQFC 3W4IA 3K6RA 1VPWA 2EQBA 3VSAA 1U8AA 3OUUA 3TZQA 3DG9A 3CNOA 2QL5A 1R1DA 1WUHS 3VAZA 3S8YA 1RAEA 2IPNA 3EGCA 2XX3A 3L6EA 1JAZA 3MIIA 4RK6A 2GPSA 3V9PA 3PUWA 4OUKX 1K8XB 1DZ3A 2Y05A 4H7PA 1WQ1R 1AGRA 2DZDA 1DC3A 4XCQA 1UZAA 1YKSA 4XEHA 4YROA 5BT8A 2EEZA 3PJFA 4KQXA 1IXYA 3W5SA 1VLZA 2XYGA 4GKVA 1YOVB 4MS3B 3E27A 1KVTA 3FTQA 1GU0A 4RV9A 4ARVA 3DLPX 4O63O 2JC3A 3P27A 5JDIA 3EA4A 2RK4A 3SC6A 2BFMA 3QVJA 3A9VA 1X9HA 4V0QA 5CH3A 3VTZA 4DIBA 2IW3A 3RUDA 4MVWA 1U04A 3OSZA 2QM0A 3K4HA 1NN0A 3WFIA 1CVIA 3NUQA 4LMAA 5IP5A 1I6WA 1VJ5A 2VTKA 3CLVA 1ZAYA 4HNRA 4LGCA 1JFVA 3CLUD 2H5EA 3OQIB 3UJ3X 3OTOB 1ND5A 1ZD5A 4H6PA 3RVRA 2ZXFA 2YZMA 3D0QA 3ONVA 4Z0PA 6Q21A 3MJEA 2GEDA 1SVMA 3CKKA 2WA1A 4JXJA 4EI9A 4JKOA 2C2XA 3KB1A 1R50A 1RRPA 1A27A 3M6UA 2PR2A 4BQPA 5FUXA 3VX3A 4RHYA 5BQPA 3DOEA 4BS9A 5DNUA 3H2GA 4BNHA 5H4HA 2IZZA 4JB2A 4WN3A 5F98A 3JAWB 3EOZA 3VV3A 3DKRA 3KSRA 2FG5A 2P3OA 3TM5A 1HK7A 3BMCA 4C4SA 5I8ZA 1XNJA 1LSUA 1OZGA 2O2CA 3L0ZA 1BXRB 2BKUA 2O0HA 4S05A 5CFLA 1TU0A 3DTNA 5AI8A 3TLEA 2OEPA 2VXCA 3PDIA 3V4PB 3VKGA 1N5MA 1OYWA 4N49A 2E7ZA 2VOJA 1T4GA 3ANYB 4IQGA 3V2HA 4HX5A 5BQOA 1Q1NA 1SUSA 4UHHA 3EY4A 3FWYA 5ERGB 4FMDB 2PNFA 1HDRA 1ZI6A 2YRFA 3PRHA 1TECE 4G9EA 3OOEA 4IV0A 3RI3A 1J2JA 1JKFA 1OX4A 2XTZA 4HAYA 4L08A 1QOQB 1A72A 5IK2D 3KHKA 4JX9A 1QVWA 1JQKA 1EVLA 1P2DA 1ST2A 2VSQA 4XJSA 1PF7E 5BUSA 4EJ2A 1G6OA 4LWQA 1QYVA 2D1QA 2ZB3A 4N0DA 1G5PA 2CVFA 2Q29A 1RYNA 3E9EA 1C4KA 1CZLA 4KXMA 4DOMA 1JG6A 2ID8A 5CDSA 4CIDA 1RZRA 5TPZD 3EMDA 4F5YA 2P40A 4UW9A 2HDHA 3FCXA 2C5GA 3GRKA 3QE0A 4RENA 4OQYA 2DSTA 4WNYA 4B7CA 2BGTA 3BXZA 2ZRJA 4HGPA 4D79A 1XVUA 2YJTD 2FDXA 3PXEA 1VIYA 4IX9A 3GJQA 3SYTA 1HDOA 1SCQA 2PFKA 2XPCA 1MGPA 1E9FA 3PE3A 5DVZA 1RQXA 4C4OA 3O9VA 3CIOA 4ENSA 1AQLA 5JWOA 2DPMA 3SEZA 2YVKA 3ZK7A 4KRFA 3CTMA 1J4AA 3H2JA 4DMKA 3KXDA 4AY6A 4YN3A 1ULSA 1X3SA 5BV0A 4MGHA 4YVFA 2C7BA 2ORVA 1NXWA 5CPFA 1YB5A 2QPTA 5BYKA 3C7CB 3TCKA 1WBDA 3RVPA 1CSEE 4WZBE 5TIIA 1N0VC 3RYIA 1GGVA 2OAGA 4HAOA 4GS5A 4WOKA 1Z47A 3EASA 3UJ8A 3OWXA 4MWTA 5CFPA 1JX6A 4FK8A 3ABSB 2XCUA 2WWHA 2SCUA 4EITA 1K9SA 1WE2A 3IJEB 3NTVA 2ADMA 3NWBA 4E46A 4H7DA 5IXYA 4CQLA 4R4JA 4B4VA 1ZUNB 3TM4A 4I6JA 1L3CA 3D8SA 1ZUHA 1UJCA 4H4CA 4UATA 4N12A 2IXGA 5KNDH 2GILA 2ZVQX 4LYDA 3S3TA 3TN7A 2Q5CA 4OPMA 3C74A 3QEJA 3B3FA 3R5TA 4U02A 5H02A 2P6UA 1EB8A 3ZDBA 1SUIA 5BYBA 4DUPA 3DE6X 4N47A 4FZJA 3O2NA 3BMOB 1JDBB 2FEAA 4IDAA 3RTGA 1XAHA 2C4MA 3NUZA 4AY2A 1L8OA 2CLKB 4WDQA 3VR3D 5CXXA 3UMGA 1SQ6A 1UK7A 4LRWA 2Y6VA 3F6CA 4UNRA 1UM8A 2PBRA 2IW1A 3TTTA 3AVTA 4YRIA 1Q14A 2IY7A 1QG4A 1Z5PA 3EZFA 3ER8A 1XJWA 1TZBA 3LLMA 4FGJA 5IN4A 3SZ3A 3T7KA 3W2GA 3GP8A 1UCFA 2WUGA 1OI4A 4D4GA 1W0JA 1CY6A 2D2XA 3ABOB 3T7TA 2Q3JA 1JLKA 1UODA 1XWFA 2WSBA 1FU7A 2FB9A 4PAWA 4YRNA 1PZGA 5EZYA 1M74A 4IIDA 1SCJA 3TYXA 3K0AB 5EXXA 1GKYA 4YV7A 4YV2A 2DT5A 4HXGA 2OC4A 5DN6A 4YMGA 1SZJG 4GM4A 1LW6E 2Q41A 4GKAA 5HCNA 1RWOA 2Q9BA 3FOZA 4OLFA 1FJGB 3LF1A 1CQIB 2J3LA 2WVHA 4ZEXA 2XCIA 2L19A 3QX9A 5I3ZA 1RFGE 1VJRA 1VRCA 1GPWB 1LJUA 3G5TA 3ZNOA 4N40A 3EG9A 1XI2A 1NNI1 3KVVA 3EQZA 4A8JC 4NK5A 1BCRB 5K6RA 1TZCA 3OFSA 3GP5A 3BHMA 4HDSA 3THYB 1CLEA 3B9RA 3ZXUB 3OFKA 2I1LA 5HILA 3CCBA 3HJUA 4O4JB 4RGVA 5KYTA 3LPNA 5L8VA 1FRQA 1KK3A 5AVQA 4LFCB 4KFCA 1PR5A 3D8TA 4FOPA 2QX7A 3ZQUA 1AQYA 1FC0A 2AZTA 2RH4A 7GPBA 1V5GA 3R0VA 1P7VA 2FE4A 3TBFA 1VJGA 2B20A 2VDLB 3HCFA 3CLUC 4YMVA 2QTLA 3ZUGA 3MCUA 3WIOA 1JDSA 2HW8A 3AWDA 4MSUA 3F98A 3N2ZB 4D45A 3E05A 4GBED 2F1HA 4F60A 2V6BA 4ZMSA 3THWB 4B3SB 3X43A 4O2BA 4A2CA 3BCUA 3D4NA 4JVLA 5A9RA 2EFGA 5JSZB 2HX1A 2DQ4A 3C15C 5EHZA 2IZ5A 1NHGA 2PPLA 3COYA 1H6CA 3NIWA 4R6WA 1WY7A 3NWOA 1RVDA 2PUGA 1QHGA 3HLTA 1YH3A 5DF1A 5CYGA 1XJ5A 4FWBA 2O0LA 5KNDD 3GPBA 2WWWA 1DFGA 3AESB 3C7DB 3GRZA 2RHLA 4R31A 1Z5GA 2YXDA 3OPYA 1B2RA 3EPJA 3CKYA 2OV4A 4LGYA 5DM70 4C4YA 3R8FA 4PC1A 1Z38A 5IVKA 3EEYA 2FDRA 2BOVA 1UEXC 1NOIA 1ZA2A 2F3RA 1G20B 1MFZA 2X19A 3BHNA 4XWTA 2BM8A 4OHPA 4Q39A 4LFBB 5KKNB 1W25A 1G5TA 4U3JA 1ZM4A 1A8PA 3C6YA 3PUYA 2GBGA 4PTYA 2EKPA 4I6GA 3KOZA 1T6ZA 3C8HA 4O4IF 1EUDB 5CDFE 4E6EA 2ID7A 2JK0A 4DLUA 3U80A 1Z2NX 2AUMA 1IUPA 3NALA 4NAVA 2YYYA 3R9XB 3GVHA 4NE2A 3OX4A 2OV2A 3OJXA 1WD7A 1X7GA 4AYXA 5T4EA 4IJ6A 4PS0A 4CIVA 1UC4B 3JYOA 1IWOA 3IT2A 4B4WA 3LUJA 1KDOA 2BGNA 1PGPA 4REMA 5GZ6A 3NTXA 4BDSA 3VU9B 1SUCA 2YOFA 3TB6A 1JIQA 3KOYA 4UVDA 5K03A 2CLMB 3S70A 5L51A 2JASA 3QPCA 2H7CA 1FFDA 4TV9A 1PSZA 2B4RO 1JYEA 1WSDA 3ZTWA 5JRDS 3RAGA 4AVYA 3HRIA 4B31A 4C07A 2OENG 1VKRA 1M2VB 3BWBA 3IQDB 2OXTA 3VDRA 3QU9A 3L8DA 2P0YA 3UHAA 3PDIB 3HO6A 4ZVLA 4X1IB 2P30A 4XGQA 3PFIA 1DUSA 1GNQA 2D7JA 2H54A 5GONF 3UB4A 1XBTA 3A8TA 4E4TA 1WCWA 1EFAA 2X15A 2VWHA 3CCCA 2J67A 1XC7A 1CR4A 3EGXB 5CIYA 3PSHA 3TZKA 3FUUA 1ODJA 1NLZA 1WXDA 1BGXT 2O8BA 4JS0A 4JEMA 2EZUA 1QLHA 3EYWA 2UKDA 1BH6A 1GDDA 3U3ZA 3DMGA 3QW4B 4KN9S 2XWJI 5K3CA 2GN6A 2HCBA 3GR6A 3VC1A 1YZNA 1AMOA 3LTEA 5ES4B 1SCIA 2VPWA 2QVCA 1U0OC 5FORA 3CH4B 2I7CA 3OM8A 4QDTA 4EGCB 5JHGB 1HKHA 3UWSA 1FLAA 2PXAA 2OA0A 3C4VA 1KAQA 4MP3A 3PQ5A 4DKJA 1QZXA 4I4IA 5EHQA 1LK5A 1URPA 2VUUA 4PLPA 2FJUA 2G4CA 3G9XA 5DSZA 5DTQA 1UK9A 1JT2A 2BHRA 1MRZA 3IPYA 4H0FA 4DDKA 4ZODA 3P5SA 2WPDA 1H2BA 4G3XA 2NIPA 4NL4H 3B7PA 4BRSA 4DRYA 2ADOA 5KTMA 3D59A 2FLKA 1A7AA 4NF2A 4F85A 2I8CA 2HLPA 1X1RA 1I2AA 1NATA 3LF2A 3FRHA 5FPSA 4B2PA 2XB6A 4J16A 4HT3B 4O2LA 2RH5A 2I3AA 4RA6A 3EGVA 5E7QA 1YA6A 4HAUA 1KO4A 4ZJPA 1IBSA 3BKWA 4KR2A 1NJ5A 2F64A 2IS4A 2JCYA 3GB9A 3HS3A 3HKEA 1DCTA 3BMCB 1R4MA 2J4DA 4FBLA 3RT7A 1NI5A 2V9PA 3R7LA 3RVSA 4WBSA 1MP0A 2YASA 4YMSA 3MGGA 3CNBA 3GLGE 3R6LA 4DLSA 2ZRAA 1XRMA 4DQXA 3HXMA 4E21A 5HMLA 2E1RA 4XI9A 2GM9A 1V39A 1VOTA 2NZWA 4HD8A 2QJWA 2X2EA 2X5KO 3IDFA 4L02A 3DW1X 4MW4A 1IJFA 1A71A 2J5RA 1IHXA 3L49A 1AB6A 4JP2A 1T9BA 1M8FA 3VU3A 4R5HA 3ZXXA 1QU2A 1L4GA 2QVLA 1HZZC 1PT9A 3I9FA 2VAMA 4NMLA 2EJCA 1BXRA 1K92A 4ND8A 1B43A 1IYZA 4Q3CA 3MFYA 1I5RA 2UVPB 5L45A 3DTVB 4PQRA 4WPGA 1T9KA 2WOOA 3F1KA 3Q9SA 4RJKA 4YAKA 5C7IO 1E77A 3P0FA 1E9DA 5CX1A 2HV8A 2A9QA 4NJMA 1LV8A 3GEIA 1XLTA 1SUBA 1RHRA 3IPXA 3PNOA 1WVGA 1HFEL 4E2FA 3G6WA 5LPNA 2FWRA 2OYRA 1RTKA 3S68A 1MU0A 3TDMA 3U4HA 4BMXA 5FULA 4HQ6A 2BI7A 4ZEVA 5CX1B 3HUDA 2OCLA 2VH1A 1CQXA 1E6CA 4K9LA 1R0WA 2PZFA 1KC1A 3NS7A 3NYIA 1U9IC 4RIIA 4F2HA 1F8FA 4BNMA 4C2UA 3HUUA 3SNKA 4E5YA 1SHZA 2AOXA 5B36A 1L6RA 1FFXB 2W2TA 4R2JA 2WKRA 4ND8B 5IJ9B 3INTA 2CFCA 3ETCA 2EU8A 2Y1EA 2NPFA 2C4HA 3CPJB 5ILOA 1NA5A 4EBBA 2HSZA 2VT3A 1KDZA 2XKBA 1COWD 5T67A 2ZIWB 4D8VA 3PFBA 1GZ4A 1R5NA 2P65A 1MB0A 3DO5A 3G7UA 1UBTS 3GCGA 5EIAA 3ZW7A 3RUHA 2V0NA 3NMUF 4DJFC 2FYTA 2QJTA 1JYSA 2XMCA 3FIJA 3MJHA 1K6MA 3B3AA 3IEUA 3RFCA 1G3MA 3RUAA 1V1MB 2UYGA 1V5WA 3MWYW 2WIJA 4FOOA 5L3QB 4TQ9A 4RHCA 1JHVA 3W6NA 3U7IA 3CLSC 1C9MA 3WB0A 4X00A 2OHFA 1X8JA 2YIMA 1DPFA 4YPOA 4HL6A 2X22A 3ODPA 1M5TA 3SAJA 5K3FA 1ISMA 5L53A 1GPYA 2IRWA 1AV7A 4KDFA 3ZQJA 1RYBA 3RO7A 1QQBA 2O2GA 3V1MA 5HRAA 1Q0LA 1KEEA 2QIOA 4BE4A 1O8BA 2E4WA 3RFUA 4JLJA 1QANA 2UZ3A 4XGKA 1T1RA 3D5QA 4JDPA 2F8SA 1M1NA 1YZKA 4Y9TA 3VUEA 2I99A 3B52X 4MV7A 3PQ2A 1D6NA 1CUFA 1SD1A 2DKNA 2C7PA 1K2WA 4S1VA 1OU0A 3GJ3A 2AHOA 4K3VA 1M2KA 2QN1A 4F84A 1TMGE 1IWBB 1ZOLA 3LLVA 5AW5A 4QYSA 3OICA 2OXIA 2CVPA 2UZ4A 2VG8A 3A70A 4GIBA 2WIKA 3HYRA 5BRAA 1NJGA 2VJDA 1DQYA 3QKIA 3FOCA 1DCMA 1EGHA 3EF3A 4INAA 4YUAA 4GDMA 2RHRA 3FCYA 2WT8A 1QQAA 2HPHA 2RGUA 2RHWA 2A4MA 3RROA 4YJ3F 3ETLA 3G02A 2WC1A 2OB2A 1Z22A 2DFLA 1EX7A 1O58A 2C20A 5AVXA 2H29A 3MAJA 1EGMB 1FMTA 3L82B 3PC8C 4M99A 4WKOA 5B37A 2PUFA 1ADFA 3F9IA 1Q1ZA 4HFRA 3K6JA 2R7KA 3BSYA 4KZKA 3LYAA 4EW3A 4I50F 4UUOA 2AN9A 3LP6A 4FLEA 3SX4A 5BXYA 3HG7A 3T5AA 4LRSB 3WZMA 3ORFA 2DFNA 2JFQA 4D9NA 3WK9A 1EVJA 3QYPA 3WWYA 4TV8B 4ZOCA 4I99A 3VNVA 3DXZA 4E31A 5KVVA 2DOKA 2XSZA 3HKBB 4GBGA 4TYPA 4MWDA 4BNZA 1KBQA 5FWYB 2XUJA 3IE0A 1DQRA 5KTRA 1HE2A 5EXTA 3L0SA 1NUUA 1U7UA 2R60A 2WAMA 5DO9A 5BMVF 3AVQA 4Q15A 3KOXA 2VSOA 5K3SA 2VS1A 1XCBA 4QO8A 5F5NA 3VPAA 3TUZC 5CLFA 2M98A 1NR5A 1PR1A 1WABA 1A82A 1H8HD 2ZRIA 3ITNA 5B3AA 5G4LA 2ZRMA 1Z4LA 5C4IA 4EI7A 1YR9A 1MC4A 1HQCA 2VSFA 1I7PA 1YRQA 5A2GA 3LGXA 3NDBB 3O4HA 5AI9A 4MW0A 2AGVA 3N6XA 2I2BA 2VP3A 3OLWA 2G4LA 4KBFA 2FEPA 4WNCA 2E0IA 1B6TA 4NNPA 5DV9A 1I24A 1MX9A 3CINA 1KBZA 4OHZA 1FVHA 1PFQA 1JI3A 1W0KA 4R84A 5JSKA 1K6XA 1Y8QB 1GQ2A 3EFHA 1D2HA 5D00A 3JALB 1JE1A 3LK6A 5CIWA 2QN6A 3RQSA 2VHCA 3PVCA 3QNMA 4OTZA 1RWBA 3E61A 1WR8A 1YRWA 5KOIA 1VIMA 4P4SA 3NAGA 2ZJ0A 3RNOA 5FOTA 1OFTA 4JZYA 5TMEA 1OAAA 1LLFA 4HH1A 1XTSA 4IYJA 4KUEA 4AM8A 3L8GA 1SHKA 3V4FA 4E4RA 1PNQA 2BM0A 2I7VA 2WV9A 2ZJ6A 3ENZA 4P1ZA 5AW0A 3GMDA 1EEHA 1U0FA 2YWCA 3OZTA 4C0SA 2RJOA 4AN1A 3H5OA 1R12A 5HFJA 4CM3A 2CNBA 1DIGA 3R20A 1XZEA 3P4YA 1GP2A 1R3DA 3DFZA 3RS5A 3EZ9A 3B20A 1X7HA 1Y80A 4B3CA 2XWBF 4Y0NA 1IOWA 2PBZA 1Z6QA 4GYJA 1YI1A 3W34A 4BMYA 2JPDA 3NLLA 5IN5A 3OLXA 2BRUC 5E6UA 3G0HA 1FZTA 4YRDA 2H7YA 4ZHSA 2J0UB 1PP4A 3OCXA 1JXAA 3LT1A 3DEHA 3Q87B 2WHPB 3W3AA 2WFZA 3LUKA 4FYJA 2BHLA 1NUSA 1YKFA 2FPIA 1TD9A 4FWIB 4WOCA 1CERA 3SYKA 3OVMA 5KVSA 2ZUFA 3KKZA 3ISTA 4O3MA 4OAPA 4J7AA 2XGSA 4EGJA 2R8RA 2HWYA 4XAQA 4U39A 4ZWNA 4JYPA 3H3XA 1W49A 2W98A 2Q6LA 4R3NA 5DM2A 2QZPA 5ER9A 1Z4MA 3ACCA 1UC5B 3IBYA 1NULA 4YRSA 2LCQA 1WOMA 4NEN