4TYWA

Dead-box helicase mss116 bound to ssrna and adp-bef
Total Genus 182
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
182
sequence length
508
structure length
508
Chain Sequence
SKLIHVPKEDNSKEVTLDSLLEEGVLDKEIHKAITRMEFPGLTPVQQKTIKPILSSEDHDVIARAKTGTGKTFAFLIPIFQHLINTKFDSQYMVKAVIVAPTRDLALQIEAEVKKIHDMNYGLKKYACVSLVGGTDFRAAMNKMNKLRPNIVIATPGRLIDVLEKYSNKFFRFVDYKVLDEADRLLEIGFRDDLETISGILNEKNSKSADNIKTLLFSATLDDKVQKLANNIMNKKECLFLDTVDKNEPEAHERIDQSVVISEKFANSIFAAVEHIKKQIKERDSNYKAIIFAPTVKFTSFLCSILKNEFKKDLPILEFHGKITQNKRTSLVKRFKKDESGILVCTDVGARGMDFPNVHEVLQIGVPSELANYIHRIGRTARSGKEGSSVLFICKDELPFVRELEDAKNIVIAKQEKYEPSEEIKSEVLEAVTEEPEDISDIVISLISSYRSCIKEYRFSERRILPEIASTYGVLLNDPQLKIPVSRRFLDKLGLSRSPIGKAMFEIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular insights into RNA and DNA helicase evolution from the determinants of specificity for a DEAD-box RNA helicase.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein/rna
molecule keywords ATP-dependent RNA helicase MSS116, mitochondrial
total genus 182
structure length 508
sequence length 508
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2014-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
A PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4tywA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4tywA02
2WTUA 2OG2A 4LV6A 1H65A 2I1QA 2OAP1 2VLIA 2SHKA 1KI8A 1P3JA 2XSZA 5FUYA 3ZS8A 5KOYA 1D2MA 2XZPA 2ZXUA 1JALA 2C98A 2ZJAA 1RYHA 4HAZA 1CS4C 1E1RA 1W5TA 4KI0A 5FL3A 2ZAOA 1BH2A 1H8ED 1FTNA 4ZV4A 1WMSA 2ZIAA 3HDTA 4YDHB 4F4JA 4BFXA 3GJ5A 1Q1QA 1UKZA 2W6IA 2RCNA 2CE7A 3CRMA 1ZMXA 4IDHA 2R6GA 3TAUA 1KI7A 4MRPA 4AC9A 5HPYB 5CJ2A 1VHTA 1ZNXA 3K8YA 1PVOA 1CR0A 1JQJC 1D2NA 2GZHA 2R6AA 1FW6A 2J5XA 4LGMA 1XXHB 3NDPA 1E2EA 4NYMQ 4ZI2A 4HZUA 2PX3A 1QHNA 1TU3A 3CNNA 4MKHA 2B6HA 2DY1A 1EGAA 3P26A 3LBNA 1W0JD 2CMKA 2VTKA 3MD0A 4HAVA 3VU9B 3B60A 1P2TA 5FOUA 1G1MA 5JS8A 3WMEA 3RRNA 3THXB 5SZIA 4DSOA 3O8CA 2IYUA 3I8XA 3REFA 1RC8A 1KDTA 1NI3A 4DJTA 4X8OA 2FU5C 2RAPA 2WWXA 2JLVA 2V55B 1CRQA 3AKDA 2A5GA 1E1QA 3FMIA 2B8TA 2GNOA 4RD6A 3JZMA 3TJZA 1CJKC 1Z3IX 4Q9KA 1G18A 4M1SA 5BXQC 1GNRA 4HLDA 6Q21A 4YLGA 2ZSFA 4LBVA 1N0WA 1JAHA 2IYTA 3SJZA 4ACBA 2IUSA 2F43A 5JRZA 1BOFA 1JXMA 3JZAA 3ADKA 4DB4A 4ZDJA 1RRPA 4DRZA 4UXHA 1YVDA 3KTAA 1CXZA 2BBTA 2O8CB 2I1VB 3FMOB 3BFKA 4GI7A 1X6VA 4C0AC 3PV0A 4Q4JA 3VMFA 2P6RA 4OI4A 1G6HA 4L9SA 3CH4B 1P9NA 3RC3A 1KK3A 1Q57A 4OHZA 3K0EA 4F7WA 2AXPA 2O5VA 4IRUB 1A2BA 2GZDA 3QSYA 4OI1A 2QPTA 3AQ4A 2PT7A 4C9BA 3BJIC 3AB3A 2J9RA 2OBMA 1CU1A 2C03A 2BMEA 3PEVA 2C9YA 4BGDA 2H7VA 3RNLA 3AH8A 3TGPA 2FOLA 2RKOA 3W90A 3LNCA 3AVTA 1YZTA 1MH1A 2ONJA 1OXVA 1J8MF 4OK3A 4FCWA 3F0TA 3G82C 1Q1EA 3MJHA 4B3DA 2G9NA 1N6KA 2MMCA 5JZVA 1DO2A 3KTAB 1EFHA 2DWQA 1UADA 4I1UA 3TIFA 2DFNA 1IBRA 3IIJA 2ZAMA 3DMDA 1Z0FA 1CLUA 2WKPA 1EWQA 1FMJA 2O0KA 3WYFA 1JEDA 1QG4A 1J8YF 1KO5A 1XEFA 5FR1A 2JEOA 4TL7A 1ZM4A 2J0QA 4QBGB 3VKHA 1JNYA 1IOZA 2AX4A 3UMRA 3FMFA 1V43A 3AVUA 3HU2A 3MGCA 2ZTSA 4HAUA 4XTCS 5P21A 2C04A 2DBYA 3I5XA 3PIRA 1F2UB 3AKEA 3W6NA 1XCPA 1VG1A 5GVSA 4M9ZA 2W58A 1XPUA 4L15A 1RJ9A 1G291 2QBYB 2QAGC 2ZRKA 3VTKA 2JLZA 3QBTA 3ZIAD 821PA 1XFAA 1TNDA 2QE7D 5J4HA 3T34A 4MKFA 5ELXA 4I4LA 1ZUHA 2KWIA 3N70A 2ZRHA 1RZ3A 1IY1A 1HH4A 1ZAKA 2F3TA 2OXRA 4UXIA 1NKTA 3FKQA 4RD0A 4S2EA 1VIAA 2BJWA 2QAGB 3EZ2A 3P32A 4TT3A 4A36A 1EX6A 2YKGA 3BIFA 3VNUA 3I73A 2TMKA 4IVPA 1UKEA 2JLRA 5CITA 4K8OA 2O8BA 4LJYA 1A82A 3K0SA 4RSGA 1N6LA 4JKIA 4C0JA 2NO9A 1P9WA 1IN5A 2ZVPX 4G01B 4LHXA 3H1TA 1DVRA 2JIZD 1G7CA 5CB8A 5F3WB 5FR2A 3E70C 4BLRA 3CPEA 3I3SR 5LDDC 2WSSA 3CRQA 2JGNA 1JBKA 4TL6A 5FOVA 3KJIA 1W4AA 1D8TA 2ZRMA 2O8EA 2HT6A 221PA 4BFSA 3GLFE 3K0AB 5KYKA 2JLXA 2G1KA 1II8A 1XEXA 3CW2A 2BV3A 2GXAA 4NZYA 1G7SA 2D2FA 2GESA 2ZJBA 1W47A 2QU8A 1R5BA 4JL6A 1XJQA 4KYUA 1FNNA 2XTNA 3LY5A 1XJ0A 2VSFA 3PUYA 4A0HA 3AVQA 1Z22A 2UVQA 4DB2A 3HYRA 4N0EA 5B57C 5DISB 2W83A 1E2NA 1Q3TA 2ZRGA 3DM5A 4P3YA 5F2EA 2OT3B 1DTSA 2QM8A 4JVMA 1YRBA 3C5HA 5E7MA 2BOVA 2P6UA 5FFMA 4KODA 1P4SA 3GMTA 2J41A 2FDCA 3RS2A 5L3VA 1QDEA 4H9GA 3M4YA 5DHAA 2FPMA 1UJ2A 2XEXA 4NONA 5TDHA 3AVPA 4IFEA 1Z8FA 4PHGA 2DCUA 1YR9A 4QM6A 4NCNA 1N3BA 2C9CA 2RGNA 1N6PA 5AJZA 4QJ5A 2BMDA 1E9AA 2FF7A 3TW4A 2ECKA 2P65A 1S2MA 3GLHA 3K09A 1KSJA 5L3QA 2JLWA 5H1YA 4TQAA 4B3XA 1DOAA 3QUSA 3A6PC 4TMZA 2QRNA 4B74A 2A9KA 1J2JA 3NVAA 1KYIA 2IWRA 1XB2A 2QT1A 2ZJ5A 3FHCB 2EYQA 3EXAA 2ZSAA 5EJEA 3THYB 1P62B 3GJ0A 4NYMR 5LB2A 2GAAA 1E9FA 4HATA 2OFXA 2WMNB 1SXJE 3NBXX 3BXZA 4RZ2A 2X77A 3D3QA 1IONA 1E69A 4FMDB 2OUKA 4US1R 3T1VA 3ZYCA 4TMWA 5DO9A 3FKSA 4QBFA 3IEVA 3KUCA 4JBXA 4M1MA 4DDUA 2JIZA 1UBCA 3KFXA 1G5RA 4EUNA 1V5WA 1G20E 2AR7A 4JLNA 1NRJB 3UATA 2WJYA 4E07A 2CHVA 2F9MA 4XD7D 2CHGA 1E9DA 2FPKA 4DUGA 4DLWA 3AF0A 2QZ4A 1WDTA 3C16C 2XX3A 1G9XA 1AA9A 2PX0A 4QBIA 3THOA 2R8RA 3GJ7A 3Q5EA 4LRWA 2A2ZA 4DCSA 2DFTA 2O8DB 2Z6VA 4IDOA 3RAPR 1T4GA 5JJLA 2BVNA 2GEDA 2H57A 2VBCA 3OIYA 2FFHA 1QG2A 1W44A 5D3QA 5FBQB 3DVLA 5CB6A 3HR7A 1OH8A 3R9XA 4C0QC 4ON9A 1JJ7A 1RW4A 1HV8A 4BECA 4OQFA 5D3MA 2R44A 2CE2X 2GVDC 5B58C 1UPTA 1BIFA 1TADA 4U5XA 4BRUA 5F9FA 3QPVA 1Q44A 4O3MA 2C5LA 2RB4A 2IYRA 1P61B 1B23P 2R65A 1XWIA 2H18A 4ZO4A 2NO0A 1ZD9A 5CIWA 4TLCA 2ZRAA 1UDXA 4R9UC 1WB9A 3QG1A 4AYTA 4YXWA 2DPXA 2QT0A 1US8A 3NH6A 2Q3HA 4D0NA 1TF2A 1WA5A 1QHHA 3L2OB 3EZ6A 3W5IA 4CEJA 3X1DA 2F7SA 1K6MA 2BCGY 2EU8A 1W48A 3CIOA 2EVWX 4DIEA 3T1QA 3PEUA 3TH5A 2O8DA 1SVOA 2YJTD 3CR8A 3ZZ0A 2Z83A 3A1VA 1ETUA 3SFVA 2BBSA 3D7MA 3QQ5A 4DLXA 2JLUA 1N5KA 3PEYA 1EESA 2E87A 4XSGA 2BKUA 1E98A 5A5GA 2ZE5A 2NO7A 2V3CC 1W0KA 1XCMA 1HEIA 4CF7A 3U7FB 4BFYA 1KJWA 2FMXA 2WWFA 4Q47A 3DPUA 1Z6YA 2ZJYA 4MGYR 3NBYC 1VCMA 2Z4RA 1U9IA 4EJSA 3SHWA 2QSYA 1WBBA 3DZDA 1A2KC 2QM7A 3LVRE 3X1YA 3ADBA 1Z2CA 1KMHA 2QP9X 1WF3A 3U5ZB 3QY0A 2ZI9A 1XU4A 3CM0A 4WIAA 3ZGXA 3DKVA 2OCPA 4HB2A 3X1WA 2HYIC 3X1XA 3B85A 1TQ4A 4ZDIA 2GA8A 4UQOA 3CNLA 4LJ4A 1W36B 2JJ8A 3B1VA 2ODBA 3HU3A 4P4UA 2WSMA 1FZQA 3E2IA 3L0IB 1XPOA 2GBLA 4DT1A 3J81k 3MG9A 1T91A 1BMFD 1VG9B 3W34A 4TL9A 3DKPA 3ZQJA 5FOTA 1HURA 3PUVA 2WJIA 2IHBA 4MITA 2XZOA 4LJ6A 1RKBA 5KDOA 1GNQA 1BYUA 3SQWA 3VR2A 2O8BB 3CZQA 1KTVA 4TZ0A 3R20A 5H8WA 1ZVQA 2OBLA 1GSIA 1OXXK 1CR4A 4XIGS 1KMHB 2QROA 2RGCA 1XNJA 2XNDA 5JJKA 1Q3HA 2IEZA 4GSYA 4HLQB 1LS1A 1SKYE 4II7A 5JSZB 2MSEB 2ANCA 5BW8A 4A8JC 2LKCA 2ZRBA 4NKRA 4AG6A 1OV4A 2FGJA 2DB3A 4NHOA 4NYJR 4BEJA 5J4LA 2EFEB 4Q4AA 4QGAA 3GLGE 2JATA 4G1UC 4MYHA 2EFCB 1VCIA 1ZC3A 1F3OA 2KSQA 3UXMA 3VX3A 4AKHA 3CWZA 1OH7A 2QPAA 2HJGA 4ZCMA 1N0VC 5EE3A 2FFQA 3BK7A 2NO1A 4GL2A 4ZDKA 3NBFA 5JEDA 4DT1B 2B8WA 1LF0A 1GG2A 1SXJA 2V7QD 4JVSB 1MO4A 3GJ4A 2FN4A 3MFYA 2BKEA 4ACAA 3ZVRA 5C2JB 2ATVA 3U2QA 1H8EA 2PEYA 4C2TA 2HV8A 2WAXA 4CT5A 1M8PA 4GT1A 1LF5A 3K70C 1GDDA 4A1FA 5AUOB 4Q19A 2WJJA 2N42A 3CX6A 1BKDR 2WSSD 3LQRA 4AURA 3HPQA 2HJVA 2GEUA 1NSTA 3BORA 1P75A 4CEHB 4ARZB 5DE3A 421PA 3EA5A 5FUVA 5FBVB 2FX3A 3BFVA 4GP7A 1G4AE 4UJ5A 2DYKA 1GP2A 2QTHA 2VHUA 4WZAE 4IJMA 2BEJA 4A6PA 2UZ3A 4F38A 1AQUA 4QNRA 2FA9A 5KSOA 5EE9A 5CYPA 1LFDB 4MDFA 1B0UA 4Q1CA 3EZFA 4GMDA 2J45A 3WMGA 1DG3A 1GL7A 3BS4A 1DAEA 5CLQA 3BAFA 1U99A 2D3WA 1Z08A 3U6BA 4EKDA 2F1HA 4LPSA 2PMDA 4R2HA 1NLYA 1IM2A 2XJ4A 4HZUB 4LYFA 3VAAA 4DLSA 2BBWA 3SFZA 2HXYA 3EZ7A 1HQYE 1NMXA 3KZ1E 3IQXA 3VFDA 4F91B 1VPLA 2EQBA 3KB1A 4A2WA 1GITA 2NZJA 4MKIA 1QHIA 1VDZA 3IILA 1P5ZB 1A1VA 5SZJA 2XZLA 4JLOA 1PJRA 1E1RD 2IBMA 4LJ5A 4Q1FA 1S0UA 1YZNA 1UBFA 2AFHE 4F92B 2FZ4A 2V6IA 2YOGA 4V0NA 4Q9HA 5EP2A 4Q1AA 1CTQA 3RANA 4A0RA 3UK6A 4CT4B 1E9SA 2BM1A 1W46A 5JCPA 3LFUA 3N2EA 4B47A 4HAWA 4B2PA 2BMFA 1KZGB 1E2HA 1YZKA 4JZKA 3QKRB 4P0TA 2XOKA 4O0MA 1M7HA 2IWHA 3ZIAA 1JR3A 2QE7A 2ORVA 1E0SA 4C0BA 3WRYC 3GJ3A 3KX2A 4V0LA 1R0ZA 5FTMA 1DG1G 4DCUA 2QGNA 3K0FA 2GZAA 3U44B 5FPSA 1ZIOA 5D3MB 4W9MC 1IJFA 2JCSA 3KFVA 4BZQA 3LLMA 3MAAC 2BC9A 4BLQA 4R7ZA 5TARA 3HR8A 3SHFA 2Q3FA 1NVVQ 4G5GA 4KSCA 4Q4JB 3SEAA 3W3AA 3VR6A 5AJYA 3BFXA 5DHFA 4M9XA 5HE8A 3PEWA 2WIBA 3NH9A 2LCFA 1XMIA 4MYTA 1KY3A 3U6KA 4W5HA 5KSYA 3REGA 2RHDA 2QL6A 2WJHA 3QPUA 3FOZA 4C2UA 1KAOA 1W4CA 3T5DA 3R7WB 3PXGA 4FCVA 1KK2A 3DL0A 3UIEA 2IYQA 2GAOA 4UNNA 2HEIA 4KFRA 5JS7A 2C9OA 2WWGA 4TLEA 3BH0A 4DDVA 5JI2E 4ASUA 1HUQA 1AIPA 1XEWY 1KNXA 4GPTA 3SDZA 2PCJA 1PLKA 1U94A 3IQWA 3PUWA 4OL0A 4RJLA 1G19A 3WNDA 3U4QB 3AVXA 2MSDB 1VCNA 4HB4A 4NCIA 2P6NA 1UKVY 4RD1A 1AN0A 1RYFA 2ZUCA 3GPLA 4YXWD 4FWTA 3FYHA 3NEYA 2K5UA 2F55A 1NBMA 3AKYA 3DOFA 5AUQA 3EPHA 2H5EA 1ESNA 2GJ8A 3LAWA 3Q7PA 4BRWA 2GKSA 2QY9A 3AF1A 4LJ9A 1KJZA 2IL1A 1EWRA 1SXJC 1MT0A 3C15C 2F9LA 2XAUA 2WWWA 3UMSA 3QVUA 1UAAA 3KKPA 4A0GA 1ELOA 1DAMA 1DAIA 1ZNYA 1R0YA 1T9HA 1F2UA 1YZGA 4I1OA 2G0NA 4IEIA 1UBEA 3QVVA 2ZI3A 1W0KD 3GJ8A 4KAXA 3S1AB 2MMGA 2XOKD 1D2EA 4TT3D 1GL9B 2J1LA 3F8TA 4PPQA 3K09C 5DIFA 5EZ5A 1TX4B 2CCJA 3I92A 1KSHA 4OBEA 2IYWA 4DBLC 2GCNA 4QXAA 1OFUX 3QF4B 4A82A 3BB4A 4DIDA 1JB1A 1FX0B 3HWSA 1ZM3A 3LV8A 4P33A 1OE0A 3SJBA 4BUJA 4ABYA 1DAFA 4FI3C 2ZR7A 3WXMA 1DO0A 3W9YA 1M6NA 2VF7A 3K70D 2QBYA 2IA5A 1P2VA 4B33A 1G3IA 2YNMA 3DOEA 4BQSA 2RGAA 4ITRC 4LI0A 4LHYA 2J3EA 2VL7A 1L7VC 4WW0A 2RHMA 2BMJA 2ZI7A 3CWQA 4MKGA 2AD1A 4AK9A 3B8HA 2AXNA 4MYCA 3T1TA 4LV8B 2PLFA 1NVXQ 4QGHA 1W36C 4RFSB 2VP6A 1P72A 4PQRA 3LQQA 1BMFA 4FD2A 3O8DA 2GVZC 2V6JA 4IKEA 1LS6A 5FL7D 4E09A 4B6FA 2Q9BA 2ATXA 2FWRA 3R9WA 3Q9LA 2XGJA 3C4JA 4TMVA 5HCIA 2A30A 4I1SA 4Y0VA 1AK2A 4HLUA 5FOWA 1IN4A 3B6EA 2GCPA 3MJRA 1X1SA 2V9PA 4KU4A 1U0LA 2NOAA 3GLGA 3X1ZA 2QAJA 3QE0A 5TXGA 3QKSA 1KO7A 4FINA 3OEED 1G64A 2YWEA 1Z07A 2QNRA 3S1AA 4JBYA 1O87A 4OJKA 3HYTA 2QORA 4Q7KA 4Z8YA 2RH5A 3BGWA 3FFAA 4CEHA 1E2KA 2J7PD 3IUYA 3IBGA 1NLFA 1Q1ZA 1W36D 4URWR 5JWOA 2FG5A 1S8FA 1VTKA 2Z5FA 3CF6R 2HDNB 4P4SB 1FX0A 2IT1A 1IN8A 2PZGA 5C1BA 3SOPA 2X1VA 4M2LA 3ZZUA 1QBKC 3KQLA 2QSZA 2W0SA 3WHKA 5HZKA 4JYCA 1WCV1 2NZ8A 3T06B 3THWA 3RS4A 2PCLA 3EX7C 2W2VA 3CF0A 4OHWA 1A5TA 4AG5A 8OHMA 3WYAA 2QP4A 4A9AA 3OAAD 1EK0A 3U7GA 1IN7A 1PUIA 5FPHA 3PUXA 2FJUA 1ZM9A 1E2MA 2QGZA 2IXEA 2V1UA 4OHXA 3I1FA 1AJEA 2QQEA 4KYIB 2J59A 4PC2A 3AF2A 1T8TA 5E7IA 4PHHA 3HU1A 1N6IA 1XZQA 2F6RA 3P4XA 2CL0X 4JLJA 4PZZA 2O8FA 4MA4A 4AKEA 4X8HA 4CEIA 3AP1A 1Y3AA 1XTRA 1JXOA 4US0R 2QN6A 4QHSA 2WWYA 3Q72A 4TZ6A 121PA 1SVKA 1EFCA 1WRBA 2I3BA 5JHGB 4P4SA 4IHQA 1OYYA 1IN6A 2WOOA 3AV0B 2D62A 3KUDA 4WVFA 2VHTA 521PA 3IPYA 4Q7JB 3LXXA 2CVFA 4QHTA 1SULA 3CF2A 3ZH9B 3U3JA 3KKMA 2REOA 3QKRA 1KOFA 2VP2A 1MRNA 3KJHA 4JVNA 4YMSA 4F4IA 1VYVA 2XB2A 4C7OA 2ASEA 1RRGA 1U0JA 2FSIA 2VP9A 3UG7A 4CIDA 4ZIRA 3LLUA 3OEHA 4B2IA 4XVRA 1E6CA 4ZKEA 4CGZA 2C78A 3K9NA 2ODNA 4RZUA 3EIEA 4TLBA 2G83A 1U8AA 3SN6A 4CRWB 4EPXA 2GF0A 2Q21A 4JBWA 1XTSA 5SZHB 4FN5A 2FGKA 2OHFA 2WKRA 2B92A 2IYVA 3WMFA 1R4AA 4KVGA 2W2TA 3V00A 5KDDA 1VIYA 2GJKA 1NJGA 1XXHA 4LC0A 1NG9A 3UPUA 1JECA 4JLAA 4BEBA 2WICA 2W0MA 1II0A 3RABA 4BFVA 3WP1B 1C4OA 3UG6A 1FL9A 2WPDD 3QEOA 2ODWA 4C30A 4D6PA 3ZZTA 1W1WA 3OF5A 1II9A 4Q1DA 1N25A 1G3RA 3SZRA 2YWHA 3B78A 4M1OA 5DSZA 2IW3A 3K53A 2HLDA 3T12A 3ASYA 2QI9C 1NVWQ 2ZITA 3UWOA 4IOLA 4B43A 4CEIB 4QFMA 4CVNA 1PUJA 1ZNZA 4D0LB 1UKYA 3SE0A 2GHIA 4N0DA 4Q4HB 3T5GA 4NPHA 3KXLA 1JI0A 3JVUA 3CH5A 3ONWA 1S9HA 3ASZA 3HPRA 4V0OA 3QENA 1KNQA 4PXAA 4URUR 1Q20A 1H8HD 2MSCB 4PHTA 5F9HA 2CLDX 2Q3MA 2AWNA 2IS2A 3IBYA 2NTYC 1DPFA 4MDEA 1N0UA 1T5IA 3O47A 1JR6A 1JPJA 3GFOA 4GBMA 1WP9A 2ZYUX 4RD3A 5FOXA 2ZPTX 5CJPA 2J46A 4Q01A 1OKKD 1ZIPA 3LW7A 3DO6A 4JLMA 2OFWA 1OHHA 3EWAA 3LDAA 4D0GA 3TR5A 3K9HA 3U60B 3ICEA 4EPVA 4B35A 2PJZA 2ZS9A 3OEEA 4NCJA 2ZSDA 3TUIC 2YC4C 1AS3A 3P20A 4DKXA 5HTKA 3EZ9A 1UEIA 5LBIA 4CW7A 1G3MA 1GAJA 2GTPA 3Q3JB 3ZVLA 2Q0HA 5JMTA 5GJBA 4DHEA 1E4YA 2VPPA 3PG5A 4TYWA 1ZC4A 1SQ5A 2Z0MA 5CK4A 3C8UA 2OLJA 2D7CA 2J0VA 1G17A 1DAGA 2VIIA 4P31A 1YU9A 621PA 5LD2C 3EPLA 5EP1A 1CJTC 4GRAA 4DSUA 5L3SA 4RFVA 2AHOA 2O8EB 4V0ME 3CX8A 4C0HA 2VSOA 5DN6A 1NN0A 1XD2B 3RLFA 1R6BX 4B3BA 4LHVA 4Q4HA 4JJZA 4YC7A 4DSTA 1T3LA 1DARA 3I61A 4URXR 1U90A 2YYZA 4PAQA 1Y63A 2ZRPA 3SR0A 1BS1A 4IXMA 2ZS7A 3RS0A 4C3ZA 3KQKA 4D4JA 1OH6A 1KSFX 2HLDD 4KBGA 1AS0A 3ND8A 1E0AA 3CO5A 4WBSA 1D9ZA 1U0HC 3H0KA 4TL8A 2QG6A 1ZU4A 1K5GA 1TF7A 1XRJA 5KUTA 4ILEA 1M7BA 1GL6A 4TMXA 4NTZA 2WWIA 2IYSA 3WP0A 3GLGB 3TAHA 3C41J 3CKLA 1J7KA 2VSXA 5CDFA 1G8GA 5E3HA 1EX7A 1N6NA 1SHZA 3IIKA 3THYA 1SZPA 2EW1A 2IXFA 3SYKA 1GRRA 4M9SA 1I4TD 1ZUNB 4QRHA 1W49A 5EP3A 2YVUA 3EARA 2NIPA 1G3UA 1Z0DA 1UF9A 1YZLA 3IPXA 1XD2A 1E94E 3AKCA 1KGDA 1TQ2A 4RZ3A 4GMXA 3ADCA 4IW3B 2JAQA 4C4PA 1KIMA 1DELA 1JPNA 3B5JA 4A8JA 3MWKA 2VQSA 2ZANA 3TW8B 1NMZA 2VH5R 1T5LA 4LHWA 1GTVA 4M0LA 2VP0A 3CZPA 4Q02A 3AGQA 4JSYA 5EE5B 3N2IA 2QAGA 4DCTA 1E2GA 3B13B 1S1MA 4DWJA 4BPBA 4DZZA 4BFWA 3B1WA 1AGPA 2BHRA 3THWB 5DI3A 1AQYA 3B9QA 3DMNA 1TUIA 4MH0R 4IXNA 3QJYA 4G5QA 4UJ3A 1W7AA 1E2DA 2ZRLA 2F1IA 4EPTA 2HYDA 3FDIA 1G8YA 4DDWA 1JEEA 2OESA 4BLOA 4IEEA 3Q85A 3B9PA 2WPDA 1DAKA 1T6NA 2YV5A 3KXKA 3QEJA 5FPKA 5DN6D 1CP2A 3BE4A 5DGXA 1NBMD 3K70B 3K0AA 3I32A 3D6TB 2NQ2C 1M2OB 1G5PA 1HQCA 2H17A 2OILA 3GQBA 4EPRA 1JR3D 2CCGA 4B71A 1J90A 2ZROA 3OAAA 3CB4A 1E9EA 1G16A 5TY0A 4YMUA 1I4LD 2GCOB 1N6OA 4EFMA 2YWFA 4YONB 1KZ7B 1MO5A 4KLNA 1E96A 4A2PA 2QRZA 3GCGA 1CRPA 2QA5A 4QOSA 1E2QA 1QHXA 4RKFA 3WYGA 3GLIA 2VEDA 4D4KA 5KO2A 4EQ6A 1Q22A 1Z0AA 1D9XA 2IK8A 2OV2A 5EXSA 1FUKA 2A5DA 1VYTA 4TTPA 5JEEA 1GOTA 1N2CE 5FI0B 4LOAA 5SZKB 3FHTA 3IHWA 3U44A 4O25A 3K9GA 4NMMA 1R5OA 1E9RA 1NMYA 5AUPB 1S4QA 1M7GA 1MO6A 3ZJYA 5HKKD 4AKIA 4Q9IA 4OK6A 1ZCBA 3GEEA 2IC5A 1IQPA 3NC0C 3EC2A 2WM9B 3CRW1 3TUJC 3DDCA 3OZXA 721PA 1VCOA 3QG5A 1ZNWA 4KFUA 2B7CA 3QXCA 3V4RA 1CJMA 1E79A 1D6JA 4PO9A 4G5OA 3NEJA 3NWJA 1X86B 3DZ8A 5EP4A 2IYLD 1TUEA 1PLJA 3R7WA 1F2TB 3UANA 1W4RA 1NVVR 2P5TB 3IEUA 5J4VA 1IJEA 5HKKA 4B76A 4NYIQ 1KKLA 3GLIB 4HSEA 1COWD 2FV8A 3TSWA 2RGEA 2ZU0C 4EQ6B 1U98A 2OEPA 4KCGA 4KHZA 4JKYA 4Q18A 4DC9A 3A1TA 1NN1A 1XEWX 1JJVA 4GZMA 1NBME 1E79D 4FMCF 4G3XA 4FMDF 5HE9A 3P4YA 2CL7X 1Z6XA 1HE8B 2D2EA 1HY3A 4YDSA 1GILA 1Z0IA 4LJ7A 1G7TA 3EAQA 4NL4H 4ZCIA 1JR3E 2ZRDA 4RKEA 4ERNA 2R6DA 4TTQA 4Q03A 5EQTA 5J40A 3RSLA 2ANBA 1Z28A 3OESA 2VP4A 1NP6A 4U02A 3WRXC 4ZKDA 2F3RA 1HT2E 2ZREA 2J7PA 2CVHA 3QOFA 3RS5A 1PLLA 2JJ1D 4LJ8A 4GOKA 1S96A 3H2YA 1CR2A 2ZRNA 5GVRA 3V4FA 1YHNA 2JJ2A 2X19A 4OK5A 1Z5ZA 1G8FA 1T3SA 1TQDA 3O8BA 4LSGA 2GWHA 4XWAA 1SVIA 4JL8A 3QXXA 3TBKA 3GLFA 2RGXA 3M0EA 4E03A 4LY6A 4ASUD 1TQ6A 4BWYA 4HEJA 2QMOA 1SVWA 2DFLA 4Q1BA 4UNSA 4DXAA 3N5CA 3BC1A 3TMKA 3ZD7A 4Z8XA 1OXUA 3MUFA 1L4UA 1W4BA 2QPOA 4Q4LA 4LJAA 5KNCA 2GJ9A 2EWVA 1X1RA 1TU4A 4LYAA 2E1RA 1SVLA 5GJWC 1G8PA 2H92A 1YR7A 2G88A 5B2ZA 3M1IA 3VQTA 1X8KA 3LA6A 1E0JA 2ZU6A 4POAA 5B64A 2J0SA 3A37A 1YJ5A 5A4JA 3EASA 5BN3A 1IHUA 1P2SA 3B7GA 1TTTA 4EPYA 4W5WA 4K46A 1KY2A 3VR3A 1F48A 4KFSA 4NYIR 2R6CA 3OHMA 1VG8A 5JFGA 1SXJB 5C4MA 1XDBA 2V4ZA 5JWHA 1G3QA 1RE0A 4A92A 4EIWA 1E9BA 1FOEB 4R98A 4OYHA 1T3HA 3RHFA 4PO8A 2HCJB 3EWSA 1LTQA 2QEQA 3IKJA 4L8GA 2Q9AA 3LX8A 4H1VA 2IF2A 1GVNB 1N5LA 1FP6A 3KXIA 4MRNA 3QKTA 4X8LA 2WVJA 5AUNB 2B7BA 1OIVA 1P60A 3B1YA 3LD9A 2V1XA 4HUQB 2CNWD 1OJLA 1CR1A 1XD9A 4PSKA 4AI6A 4G5SA 2YOFA 1E2LA 4IDNA 3SYLA 1AZSC 1SKQA 2ZI5A 2D4HA 3EIQA 4GOJA 4RD2A 1GZSA 4Q7MB 3ICQB 3KKNA 4P4TA 2GJSA 3LWNA 3WNCA 3AEZA 5LB4A 4TQUS 4PTLA 4KVAA 3PR1A 4TMTA 5G53C 1SVSA 5H68A 2KE5A 3RRYA 4CDGA 3PQCA 3A1UA 3AUXA 4PFSA 1ZD8A 1C1YA 2FSHA 1G6OA 2ZS8A 4OKSA 4M1WA 3L0OA 1KK0A 4TLDA 2OAQ1 1KO4A 1K5DA 4Y0AA 2ZJZA 2D7DA 4XVQA 1JAIA 2EFDB 1X3SA 2N1BA 2DHRA 2REXB 4MQBA 4M9QA 4MUBA 3G0HA 2YOHA 2AL7A 1F60A 4B75A 1L8QA 4JLVA 1KDPA 1M74A 3NG1A 1UDWA 2NG1A 1KAGA 2R62A 4KFTA 2GRJA 4LDJA 3AM1A 4FCTA 3LRPA 4JLPA 2W6JD 4NE2A 4L16A 5CYOA 5IK2A 3ECCA 3HJNA 3K0FB 3L82B 4HDQB 5DYGA 1ZINA 2GK7A 3FB4A 1ONBA 2P5SA 3TQCA 3TE6A 3EC1A 4MGIR 1Z83A 2ZRIA 1VG0B 5H70A 1XMJA 3IDQA 2KBFA 4Q66C 3CRRA 2JDID 4DEYA 4KXFB 1XP8A 5EUMA 4F4CA 2ZRFA 5AR1A 4Z51A 1QRAA 5JWRA 2GXQA 1AKEA 2FEMA 4QGFA 4LYHA 3C14C 1OKKA 1UBGA 1OFHA 2G77B 1DEKA 5CLLA 2WBLC 2JA1A 2J7KA 4XTRA 2BWJA 4M22A 5FUXA 2PT5A 1AGRA 3SQXA 4JYBA 1KJYA 1Q12A 3F3YA 2PL3A 5EUQB 4WXPA 3TUZC 1XZPA 4JL5A 2GK6A 4M1YA 2GXSA 2WWHA 4ARZA 5K8UA 5AWFC 1ESMA 1Z0KA 3SBEA 1TF5A 3AVVA 4XVUA 5C4GB 1WBDA 4PQYA 3A58B 3PCRB 4HLUC 2JJ2D 5FOSA 3NBZC 4M1KA 1W5SA 3CBQA 4IOJA 4BFTA 2G1JA 3UWKA 3B82A 4L9WA 2GBLC 4DCNA 4LUCA 2XXAA 3UMFA 2P3SA 4C7OB 1KI1A 3L0SA 4PAOA 2REBA 4M1TA 1NKSA 4OQMA 5L3RA 2PH1A 2CLSA 3NHBA 3I72A 4JSTA 1HYQA 5FTNA 1F2TA 4BLSA 1QF9A 2VO1A 1YR8A 1ZUIA 3L8YA 2HXSA 3VKWA 1N6HA 3P1JA 4PC3A 1WQ1R 1ZCAA 3I8SA 2VA8A 3G5UA 4B44A 1KI4A 4J0QA 2OCAA 1Z47A 1OIWA 3BB1A 4G5RA 1VYUA 1R5NA 4JMPA 2ZM5A 5DNYB 2LKDA 3OEHD 4EFLA 4BFZA 3A4LA 4PX9A 1SGWA 3ZQ6A 4TYNA 1ZYUA 2AKYA 1G8HA 4WZ6A 4K81B 3PJRA 1OLOA 4I81A 4LYJA 2ZRCA 3H86A 4OI2A 2C2HA 3QNUA 5C46F 4MGKR 3ZD6A 4DLTA 1G5TA 5AK0A 1ANKA 1FQKA 1Z6GA 3SBDA 2ZETA 1VHLA 3AGPA 1XTQA 3KQHA 4LPKA 3BB3A 2ZJ8A 4Z1MD 1GNPA 1R2QA 2R9VA 2R6FA 3L8ZA 2Q6TA 3CRVA 4PPFA 4V03A 3EPKA 1XD8A 2ZQ5A 3GLHE 1L4YA 2IHYA 4QGGA 3GLFB 2R2AA 2OXCA 3TQFA 4GDFA 2FNAA 5JCZA 4AYWA 2QQ0A 2Y8EA 3QXHA 1Z2AA 2IX3A 3V9PA 4GP6A 4MYUA 1E2PA 4XWOA 3Q7QA 1OIXA 3QKUA 5DYIA 2J0UB 4MRSA 4QM7A 1NJFA 2GJAA 1CKEA 1KI3A 2C99A 2FFAA 2IYYA 1U8YA 4DLYA 3PUZA 5FBLB 1OXSC 4KJZA 3B1ZA 1YZUA 3NHAA 4RFSA 1Z63A 2YC2C 3FHOA 4BASA 4M8NE 1NY6A 1OW3B 2YINC 2ZYWX 3P27A 3L43A 3VKGA 1H8HA 2L0XA 3VX4A 2OCBA 2VYFA 3GEIA 3T1OA 2KB0A 1ZU5A 2FEOA 3DM9B 2PBRA 3IO3A 2RGGA 3FKSD 2ZUBA 2DWOA 3RYTC 3GLHB 3EW9A 1PZNA 3H4MA 2RGBA 1MV5A 2AWOA 2DR3A 4Q48A 5HZHA 3RVBA 2OO7A 3W8RA 1KI2A 2A78A 1I4DD 1E3MA 4I1VA 4MUAA 3PVSA 4KO8A 1E2FA 3CR7A 1E4VA 2VF8A 2CL6X 5CIQA 1P9RA 1RRFA 3ZLJA 2VHQA 1OSNA 4HDOB 4IVQA 4UNPA 5KNBA 1A7JA 1XBTA 5L3SB 2OSBA 1OPXA 5DI9A 3O8RA 2IS1A 4DCVA 3WHLA 3EA0A 4NBSA 4BE7B 3B1XA 4N1AA 4D4MA 1OFIA 1R10A 4M4SA 5FBRB 5J4KA 3GD7A 2OE2A 2C96A 5JJIA 4HB3A 1GRNA 1TL7C 1E99A 5KNDA 5KTYA 2IS4A 2RMKA 1T0HB 2VP5A 4BZPA 3FWYA 4TTRA 1KO1A 5J47A 5CK5A 1KI6B 1R8SA 2G6BA 1FP7A 2OFOA 3NDBB 1I2MA 2C77A 4WAUA 1Q21A 1RIFA 3E5HA 5TB5A 1XJCA 4N3NA 1LVGA 3LX5A 3VR5A 2HF9A 2YHSA 2NPFA 3LW8A 4BLTA 1GKIA 3EG5A 4HUTA 4DLZA 2AN9A 1VKJA 3M6AA 3GEHA 3I5YA 5EXTA 5C18A 2PLRA 3CUEF 1IY0A 3MWJA 3U7EB 4TSFA 4KLZA 2XNSA 1F6BA 3ZS9A 4DLVA 4MRVA 3VR1A 5TVKA 4ZDWA 2OCYC 1X8LA 3L0PA 2FFBA 5M04A 1KI9A 5IF9A 1CJUC 3LO5A 1KSGA 3QPWA 5AJXA 2QUZA 1II8B 5G40A 1MR3F 3OIVA 1COWA 4V02A 1EFRD 1M34E 1UFQA 2PZEA 3TLXA 4PZYA 4E22A 4QKQA 4FW9A 2J87A 2GILA 2H16A 5FUWA 2CLCX 5LD2B 3QIAA 3RS7A 4RVCA 3CPJB 4BFUA 1ZM2A 1T8UA 2QMUA 4A6XA 4XSHA 1K8RA 2D06A 2I4IA 4JJKA 1AKYA 3FPAA 1MRSA 4PSAA 4CEJB 4AY2A 1U81A 4LK2A 3U3RA 1ZM7A 4ZIRB 3FFBA 2IUTA 3IO5A 2O8CA 2P67A 3KQUA 3A1SA 4D2IA 2C8VA 1EFUA 5JRJA 3R8CA 1E0KA 2RGDA 3C5CA 4B34A 1GRQA 3QKSB 1KDOA 1J70A 1WE2A 2JASA 2ZRJA 5IK2D 3A36A 2ZI6A 2Q9CA 5K8IA 2FZLA 4FMCB 2HF8A 4JS0A 1HT1E 3TNFA 3CNOA 2QTFA 4LCBA 4A0FA 5FL7A 4DLUA 4D80A 5AJWA 2B21A 2DFKB 1ODFA 5BQ5A 1LW7A 4KV9A 2PEZA 4PO1A 5L3QB 1CULC 3T61A 5AJVB 3TVTA 4C0LA 5BN5A 2FSGA 2PJRA 3GFTA 1FPMA 3WY9A 4ESHA 1EG7A 4B2LA 1MABA 1I2DA 1NN3A 5J4YA 1NY5A 4G0NA 2BIFA 4YQFA 1OB2A 1FQJA 3DEFA 3Q8XB 3QF7A 4XJXA 5CDFE 2CXXA 3WNBA 4E5UA 2EFHB 4OQXA 4ZCLA 2H1LA 4URYR 2XNDD 4AYXA 3SS8A 3Q5DA 4IDPA 4JVLA 2ZSBA 4P32A 1W2GA 3CX7A 4PC1A 2NGRA 1IXRC 4D82A 2A5FA 3QBVA 3OE7D 4X8MA 1UEJA 1E2IA 4W7SA 2YWGA 1WXQA 2PMKA 1KDRA 4NH0A 2C95A 3WBJA 2ZVQX 3BH6A 4AIIA 2O8FB 3FMPB 1N5JA 1E2JA 2G3YA 4CZ2A 5FI1B 2BDTA 1U8ZA 4HYYA 4JLKA 1Z29A 3KJGA 3TKLA 4S35A 3SU8A 4FMBB 4NYJQ 1SXJD 2V7QA 4UNRA 2ZSEA 3LXRA 3X2SA 1NL3A 4A15A 3MRSA 4PPNA 5CM8B 3AVYA 1YKSA 2JJ1A 1KMQA 1W0JA 1AS2A 4LHZA 1L2TA 2IXGA 5E7JA 4DEXA 2IF0A 5EZ6B 1KHTA 1QHHB 2E9SA 2VHJA 2W2XA 1FUUA 4OHYA 1U9IC 4EJSC 3FE2A 1DAHA 4EFNA 2UKDA 4OQLA 4D4LA 2GXUA 2LWIA 1DBSA 1XCGB 1HE1C 1P7CA 1OB5A 4DDTA 4Z54A 3AP2A 3MMPA 3ZDQA 1GM5A 1DADA 2CHQA 1YE8A 5E95A 5K8LA 4EAQA 1GKYA 1US8B 3W5JA 4AKGA 1RJ9B 3PITA 3SC3A 4CYMA 2H8KA 1P2UA 1CBUA 5TV2A 4B32A 4BZXA 1QZXA 4RZXA 2A5YB 3ZVNA 2EFGA 3RSOA 2W00A 1EXMA 1XX6A 2ZE7A 4BLPA 4PANA 4UKDA 3AVWA 1G4UR 1QVRA 1XMSA 3TSZA 1TEVA 4QJ4A 4URVR 2CDNA 1KKMA 2O52A 4ZI3A 1VMAA 3AP3A 2X8AA 1QVAA 5FTKA 1T0JB 2AK2A 4QBHA 5DLQC 3RDPA 4U00A 1NLZA 4M21A 3W8NA 4C0KA 4R71A 2W6JA 2HT1A 3EPJA 4QNMA 1LY1A 5KSPA 4LC1A 4Q21A 2ZR0A 2PZFA 3KL4A 4JLDA 1R7RA 1YZQA 2AD5A 2FH5B 2WZQA 1CIPA 1FMLA 4D26A 1N5IA 3AUYA 4B48A 1Q1BA 5B30A 1XPRA 2AK3A 2ZE8A 1QHGA 2HCBA 4EDHA 2X2FA 2WAYA 2WJGA 3RC8A 1Z6TA 1XEXB 2JDIA 2KJQA 1TEXA 1CEEA 3RRMA 3QI2A 2ORWA 4HZIA 4TYYA 3U61B 2EWWA 4A2QA 3R8FA 4MGZR 3SNHA 2O0HA 5GJCA 1GFIA 4HI0E 4PR0A 3UKDA 3PFIA 1A4RA 3CPHA 2CJWB 5BWMA 2GEVA 2IEYA 4UNQA 3U3KA 3ND9A 1F5NA 2CBZA 4TWZA 4D81A 1NG1A 3H84A 3MSXA 4U7DA 2CNWA 3RWOA 4QHYA 2WIAA 4DVGA 2WOJA 1S3GA 1XTIA 3GFPA 4FIDA 3I62A 2HUPA 2ZYVX 5EE1A 2RGNC 3KQNA 2IYXA 1R0WA 1VECA 5FBWB 4RCZA 4KITB 2NPIA 4PZLA 4YMTA 4DLRA 2W6ID 3LH5A 1KI6A 2AFIE 2OZEA 5CM9C 2WV9A 2G0TA 2CEAA 3MWYW 2Z43A 4RCYA 1GUAA 5DI3B 1IY2A 5J5CA 2D74A 3VHLB 1R8QA 3RWMB 1IXZA 3QXJA 4HB0A 4WZBE 5EXXA 2Z4SA 2BBOA 1AZTA 4OJQA 4KBFA 3K0CC 1OT3A 2BEKA 4FWIB 3ADDA 1X8JA 2XITA 1MO3A 1RVDA 3OIWA 1OHHD 3K9LA 5GJVC 4XD7A 2F1RA 1XF9A 2WJVA 3W3ZB 2ODEA 3SI7A 1NVUQ 3BBPA 1Z06A 5UKDA 3AVOA 4TMKA 4IOMA 1FTSA 4TYPA 3T35A 1ZJ6A 4JT4A 5JLJA 4GOXA 3C7KA 1PV4A 1ZW6A 4OI0A 1E32A 3IGFA 5F98A 4IFBA 2V54A 3MLEA 4B3FX 4GNKA 3SJCA 4AWXA 5JI3E 3BRWD 4NCKA 2OM2A 1U2RA 1Z6AA 2A5JA 2GCOA 1OH5A 4Q9LA 1R0XA 1SHKA 1O3YA 2BCJQ 3VU9A 3IIMA 3KB2A 1MKYA 2CCKA 4IOKA 2ZJ2A 2P0EA 4PC6A 4LV5B 4QC2A 5BYJA 2QTVB 2CK3A 3VHXA 1OYWA 4Z1MA 4IVRA 4HAXA 1OFTA 3NKVA 4LBYA 3F5FA 4R2IA 3HP1A 1EFRA 2V8OA 2VHCA 5KSZA 3B2EA 3A4MA 3U4QA 1RRCA 3QXSA 4PAMA 3KJEA 3U3MA 4QL3A 3RS3A 2N46A 3CONA 5G3YA 4RY2A 1YQTA 4A4DA 4F93B 1G41A 4KSBA 2UZIR 2WMOB 3SYNA 4XH9B 3KKOA 1RPZA 3K1JA 2ERYA 3LVQE 5HCNA 3BOSA 1NSFA 3TRFA 1E9CA 5GADl 5FH9A 2F43B 3A1WA 1MOZA 3ETLA 4A8JB 4NDZA 4L5BA 2DWPA 2CK3D 1AM4D 2F1JA 2NO6A 3BWDD 2XB4A 4XOIA 5FPTA 4DUGD 5JECA 4Q00A 1MABB 1ZBDA 1IAQA 2FPLA 1LV7A 1GWNA 2AKAB 5JHHB 3GJXC 2P2LA 4Q1EA 1CF4A 4PC7A 4US2R 4TQ9A 5L8VA 4HAYA 3TVDA 1ZD1A 1KK1A 3EIHA 4Q9JA 1SKYB 2XTMA 5TMPA 3BD9A 2XXAB 2ZE6A 5IRCD 1J99A 1OXTA 2GDJA 4RD4A 5DH9A 1FNMA 2BJVA 2KBEA 4LZZA 4PHFA 4B3GA 4W5JA 2NMVA 4D25A 1OF1A 3VNVA 4TLAA 3A8TA 2ZYTX 3KDSE 3PENA 4UXJA 4V0KA 1UM8A 1FFHA 4O2LA 5LPNA 1SVMA 1CJVC 3KKQA 1BO6A 4MRRA 2QMEA 3NIBA 5FTJA 2OLKA 2GF9A 2X2EA 2ZI4A 3W6PA 2XTZA 3D31A 5ANRB 3W6OA 3U7HB 1NF3A 2GETA 3VR4A 4EPWA 4ESVA 3OE7A 2YZ2A 2BM0A 4O2RA 5IHPA 1XTJA 3MWLA 1IXSB 5E4FA 4V0MA 2EYUA 4PPGA 4H1UA 4L4UA 4EJSB 3GJ6A 1LB1B 2VRWA 3NC1C 4JLBA 4PSVA 2ERXA 3K0CA 4Q5IA 2ZEJA 5KDLA 3NXSA 3LBHA 4QG7A 3TSOA 1DE0A 4WOPA 2QENA 2XSZD 1NN5A 5EE0A 4PQFA 2QP3A 1GIAA 1HA3A 4GZLA 3NTUA 1TAGA 2ORIA 1S3SA 3MCAA 4QJ3A 2XJ9A 4LX0A 1M1YE 1W2HA 1ZP6A 4TSFD 4LWZA 5G41A 4URZR 2IS6A 2WKQA 4WA7A 2QMHA 4WXRA 1HTWA 2ZR9A 1XTKA 4ZPXA 3R9IA 1XXHE 2A7QA 1NIJA 3GP8A 1RFLA 4XWKA 2JLQA 1S1CA 4OQNA 4YMVA 5A0FA 1KO8A 2IYZA 4JT2A 4OHVA 3FTQA 3IHLA 4NP6A 1D5CA 4NU0A 3E1SA 1NNEA 4YMWA 3ZVMA 2JLYA 3CLVA 4DSNA 1TMKA 2KI5A 2JLSA 1G21E 2OBNA 3OFNA 4GFDA 4NCHA 4B3CA 3GLIE 3RRZA 3OIUA 5G3ZA 5JBQA 4Q4AB 3LBIA 5FTLA 1YR6A 2IUUA 4JIMA 1QHYA 1ZRHA 3SJAA 4Q7LA 4B6EA 3T15A 1DS6A 2WHXA 3A4NA 2FSFA 3FVQA 2J0UA 1XMVA 3BERA 1G7RA 3TK1A 5KU1A 5IT5A 5JSZA 3QF4A 1GKUB 2CJWA 3D8BA 3AF3A 4LBZA 5KHOC 3FGNA 1YRAA 4TN1A 4HUQA 4HLCA 1E1QD 1C9KA 1S9DA 4I99A 5KPJA 2A3RA 1Q0UA 4C0SA 1EFTA 3OFND 4FXPA 5HR5A 1JQLB 5K8TA 4AD8A 1Z0JA 5IDVA 4IDQA 4HDCA 3THXA 5BYKA 3I4LA 1P73A 1NIPA 2ZJOA 2FE4A 3JVVA 1BYIA 4B73A 5BN4A 5FPYA 5KPDA 3AF4A 4M53A 2ZUDA 1P6XA 3BH7A 1N6RA 3TR0A 5EXPA 1QHSA 3WBKA 3DHWC 3U3OA 2O0JA 4TYQA 2ONKA 1TPZA 4LBWA 1LNZA
chains in the Genus database with same CATH superfamily
2WYVA 3Q2KA 4P3OA 2WJZB 3TEJA 3V1YA 4EM6A 2LPMA 2OG2A 3CINA 1H65A 2SHKA 1KI8A 1R37A 2WF5A 3B12A 1KJQA 2VAMA 3V6MA 3WGUA 4D3SA 3PNPA 4PN3A 3ZV4A 3KLPX 1YRWA 2ZJAA 3KU4A 2CXOA 4Q37A 5I9SA 3TD9A 1E1RA 3E81A 5CXSA 1BH2A 1H8ED 2P79A 1AF7A 1WMSA 5KHAA 2VTVA 3GJ5A 1UKZA 4I1YA 5B4TA 5LZ5A 1B4DA 3OJLA 4H77A 3ZJTA 1PNTA 2MR6A 3RC9A 4IDHA 1WSAA 4MRPA 2WP8J 3MTAA 4WLOA 1VHTA 1AHIA 3K8YA 5SY4A 1F9AA 1PVOA 1OUMA 4F9TA 5KTNA 2XMSA 1HZZA 1YCHA 1CR0A 3CH7A 2QX8A 3AL0C 3S81A 5JAQA 2A7XA 5CMLA 3VR0A 3KLMX 3V1UA 3Q0TA 3NDPA 4DUPA 1Z13A 1JQEA 2PX3A 3L1VA 4YHBA 4ENSA 1QHNA 3CNNA 5C81A 4IX9A 3ES9A 3LBNA 1UKCA 4OP1A 3AV3A 4RKRA 4OXYA 4JP1A 1IWPB 1E3IA 1UJ6A 4HD8A 1A3CA 1TE2A 5JOQA 3GW8A 1EM8B 4TV9B 1MQ8B 2DPMA 4KAFA 4MMXB 4DSOA 2VAXA 1V8ZA 4R4JA 1Y48E 1Q2XA 1OGJA 5TQ0A 2PX2A 1BMTA 3NORA 2FU5C 1FS4A 5F77A 3TRJA 2HN9A 4BKRA 3C85A 4WXEA 1K9VF 5ITWA 1CVRA 2XD9A 3AKDA 3EDQA 1E1QA 1NYQA 2B8TA 2Z1MA 4QARA 4RD6A 4ZOLB 3QQPA 4I9NA 3TJZA 4F3NA 1CJKC 4IICA 1DXOA 4HFJA 5MN4A 3IAEA 3BXOA 1R5JA 4YLGA 1ENPA 2W37A 4ESVA 4J7CA 4JY7A 3K1AA 1VPVA 4KLRA 2PPLA 3R5HA 2EOAA 1EP9A 1BOFA 1JXMA 3F4LA 5I8ZA 2HIGA 3ADKA 3JYPA 5SYNA 4ZDJA 5CAEB 5CFOA 5I6DA 2HAEA 3KTAA 3FVRA 4FFVA 1RMTA 2I1VB 3IAM6 1ZITA 1ZJJA 2R4UA 3S7TA 1ZK3A 3N8IA 3BFKA 3EXFA 2PWBA 4B84A 4N48A 3L06A 3PV0A 4Q4JA 4DEVA 4TLMB 3MAJA 4DLAA 3V2UA 4HYTA 2PX5A 1KK3A 1SOUA 3GAMA 4O4HB 3S2IA 1Z2DA 3FCCA 3HDGA 1BGWA 5BW5A 2G5GX 1JIKA 2O5VA 2X42A 3NV9A 4FD3A 4MR8B 1YSCA 2GZDA 2QPTA 5A5DA 4C9BA 2PT7A 3BJIC 3RKUA 2J9RA 2JVIA 2O2JA 2OBMA 3H9UA 4GVXA 2HBZA 3AEUA 1YOVB 2R5WA 3F6CA 2Y05A 4WECA 4R1MA 4EKYA 4GGMX 3FRJA 1B1AA 1Z2NX 1WUTA 4X7PA 1AUPA 2QRLA 2GUGA 3MT8A 1JKFA 1YB4A 3RRFA 2Z8YA 1O94A 4QGSA 2WLTA 4ZAXA 3AVTA 1YDEA 3QHQA 1UK8A 4CIDA 4OK3A 4LQDA 2WD8A 3F0TA 5J63A 1WU7A 1L5WA 2XLBA 3WYBA 1YZFA 4P22A 4W6ZA 3KZCA 4XYLA 1IK6A 5E2BA 5K51A 1SHJA 3SIRA 5IANA 5JZVA 3SIPA 1DO2A 4YUWA 1F5SA 4EW3A 4X24A 4RXUA 2AF4C 3DMDA 2JFHA 4QFBA 1Z0FA 2O19A 2IXAA 3C1UA 1JEQA 4R7GA 5IT4A 1CY8A 1JFLA 5DCYA 4EEZA 1ID8A 2YWBA 4X9XA 4TL7A 3SS9X 3GFQA 2R5NA 5LLSA 1IATA 7ADHA 1NZDA 1RAIA 4WKGA 3VKHA 4PIVA 5E8JA 4YI3A 1QYDA 1J0EA 1O1YA 2QRVA 2Y1CA 1A7UA 3F6SA 3HU5A 3PPVA 4YRPA 1CQZA 3QLVA 1FS5A 5E6RB 2PWZA 3FUTA 3H2GA 5IF3A 3HU2A 4EG5A 3E5MA 4HAUA 5CEJA 1Y81A 2C04A 2DBYA 5B1DA 3TX6A 4DKJA 4HS4A 4UVGA 3IERA 3I5XA 5ENVA 5JH7F 1F2UB 1JU3A 5DNUA 2B6NA 1XCPA 1B43A 2MJLA 4JUDX 4M9ZA 2NU7B 2W58A 1N7IA 1IVNA 1RJ9A 1JPVA 2NZXA 2F8TA 5KYVA 1YJBA 1H42A 1QHEA 1W1UA 1PGNA 3FZGA 2H0AA 4JHLA 4G4SP 2QE6A 2NUPA 2XRYA 1U0FA 4W5TA 5FF9A 1E8MA 3ZIAD 1Y5IA 4R9NA 1SIWA 4IIGA 3SEQA 3ZOKA 1RZUA 4D9KA 3D8UA 4U1RA 2KWIA 2FY8A 1RZ3A 5HFJA 2V45A 3AM3A 3PUKA 1M33A 3MRXA 3R3UA 2QRJA 2O6HA 1EE1A 4PYNA 2CZQA 1RM0A 4I66A 4IX1A 4WCFA 4ZEWA 3FKQA 3TRHA 1OY1A 1GLNA 4D9BA 4RD0A 5A7GA 1JIJA 2XCTB 1TLLA 1RFGE 2GARA 1POWA 5A5VA 3WZMA 3ABOB 4OBXA 3P32A 1W29A 2HLPA 4FZ5A 1VJ0A 3VNUA 3EOZA 2OB1A 4XB2A 1JBEA 5E6SB 2OCIA 2D2VA 2GO1A 2JLRA 2ZIGA 4K8OA 2NUAB 4LJYA 2O8BA 1A82A 1GZDA 4ZAZA 4P86A 5GY7A 3OWHA 2FB9A 3TZLA 3K0SA 1QYXA 2RE8A 4R6XA 5LA6B 4RSGA 2GHRA 4JKIA 1RLTA 2EWMA 3ZHOA 2Z95A 3BIOA 4GI5A 1P9WA 1ZX1A 1V7PC 5BNZA 1DVRA 1CQJB 3JQEA 2FFRA 3PXAA 3T5AA 1SCKA 1GKKA 4KQ2A 4BLRA 3O5AA 3U3ZA 2IBTA 1WB6A 5LYJB 2QMQA 2WSSA 3CG0A 3CRQA 4HYEA 3R6WA 2JGNA 3VSEA 2R7KA 3GOHA 3BIXA 3KJIA 2CC2A 3GNLA 8MHTA 4UU8A 4HNAB 2O8EA 2YY6A 1PIWA 5KYKA 1E1YA 2YMPA 3CW2A 3ZY2A 4UHKA 4G9BA 2ADMA 3HYCA 4KGDA 1G7SA 4URHA 1DRKA 2D2FA 2JI4A 1W47A 2ZJBA 3L8FA 5DYTA 5E9JA 5LU9A 1FJHA 1RPTA 4JL6A 4MUXA 2M6SA 1T1RA 4FKMA 4KYUA 4OKNA 5EIHA 2VSFA 3DL2A 4A0HA 4WJZA 3RTBA 3WSTA 1T43A 1Z22A 2V4MA 2M9MA 3OLCX 1CUUA 3EF0A 2UVQA 1MHPA 1K68A 3ZLTA 4EYEA 3MN1A 3AUTA 4M0DA 4MQMA 4OMCA 5B57C 2FN7A 2RHOA 3JQRA 2W83A 3N8KA 1YS2X 1E2NA 1Q3TA 2BM8A 2FI1A 2QUAA 4P3YA 4JI8B 2PFGA 3DE1X 5FP0A 2W8ZA 5TRTA 2OGTA 1FF9A 3QTLA 2XBLA 3C5HA 1IOLA 3V34A 4EX6A 2VK1A 3DBRB 3AFOA 4GC9A 1P4SA 1L6IA 2J41A 2IV2X 3RFTA 4EW2A 4Z7OB 1R4NA 1T5TA 5L3VA 3OFSA 1SXIA 3MFQA 2IVZA 3ZDRA 5JDIC 1UJ2A 1I7SB 3VO8A 4PONA 2WJPA 2Z9DA 4KTVE 5HIAA 4IVNA 4PHGA 3M33A 4D4HA 2DSNA 3K5WA 1SNYA 1SXQA 4AWAA 1NPTO 2IH2A 1N9ZA 2GZ1A 4KXMA 1Y89A 2RGNA 4DY4A 4HAOA 1RI1A 3BRCA 3TW4A 1DKQA 2CFTA 2EAUA 4YRIA 2P65A 3K09A 5ALHA 5H1YA 4C1NA 2Z57A 3MILA 5B6PA 2PN1A 4BU1A 4RDIA 1Z35A 1KYIA 1WJGA 2X5XA 3RYHB 1GY8A 1ULTA 3I0ZA 2VUHB 3TL6A 1M76A 1ZK4A 2ZSAA 3QJGA 5NLLA 3WIOA 4M37A 4AMYA 3GJ0A 1ZOPA 2JJMA 1C9NA 2Q5FA 4M0MA 2FMIA 3DYIA 4JOSA 4PAGA 5FB3A 3TM4A 4E12A 4YRGA 4ZYXA 2WMNB 1SXJE 3FGPA 3NONA 4QT4A 5DJ5A 2Y4OA 3BXZA 1ND5A 5KJEA 4YRKA 8GPBA 3ROFA 4LIPD 3HYNA 2OUKA 3WRXA 2HQRA 3T1VA 4X1IA 3IA2A 3OY7A 2Y66A 4RTOA 1ULHA 1EEHA 3FKSA 5A4MS 3C3CA 2FLVA 4NNJA 4X63A 4JBXA 3V4OA 4B4VA 2ZJ1A 4DDUA 4R41A 2JIZA 3R23A 4CCWA 4RVGA 1UBCA 3L4JA 1GGNA 2BGKA 1V5WA 3LECA 3S7ZA 2O05A 4B7UA 3HQ4O 2PR2A 5BQXA 2F9MA 4XD7D 1V7CA 2CHGA 3ZH2A 2FPKA 4C7XA 4DLWA 1DPGA 2I0FA 3AF0A 3RBAA 3V4ZA 5I7EA 5IYZB 2XX3A 4K28A 4NQRA 2V0GA 1AA9A 1EDZA 3PJEA 1Z26A 3Q11A 4WRRA 4MPJA 2DFTA 4O2BF 3QKWA 4IDOA 4MUIA 3GEGA 3FHLA 3KK0A 4DNPA 4KIWA 3AHDA 4IDEA 4IV8A 2GEDA 2H57A 2WRZA 3OIYA 1FVHA 4PLWA 1QUEA 5CP8A 1I5EA 1M72A 4AZ3B 4FM9A 1KRWA 3DVLA 3HR7A 2IHUA 3R9XA 3HCBA 4C0QC 3FYUA 3N53A 1MOSA 2OFPA 3LUAA 4Q3NA 1MNAA 4AN1A 1U8UA 1WULS 2LRHA 1DOHA 4GBGA 1P4JA 4O4IF 3W78A 3N2LA 3ZKWA 1RPJA 3ZG6A 5B58C 5LN1A 2DT5A 3SSMA 2RB4A 4RPJA 5C1OA 4E5KA 2VPWA 1IHXA 3KVYA 4EB0A 1SCQA 1B23P 4CWAA 4ZO4A 2NO0A 3TBFA 4XVCA 5CIWA 3BJZA 1HLPA 3GFRA 2Z09A 4B3JA 3CCFA 3D4OA 3QG1A 4EYQA 4YH1A 3QXGA 2ZVDA 2QT0A 3NH6A 4IDCA 4D0NA 1NW7A 1TF2A 1WA5A 2XQIA 1R6UA 2PL5A 3AIMA 4K3UA 3BMOA 3L2OB 4DMRA 5ITSA 1XU9A 3LDFA 2VT6A 1CQWA 3DD5A 4F1WA 3OIDA 4ZI7A 2G7MC 2H07A 2O2SA 4N7MA 1XQ1A 3FNIA 4MHOA 1WLSA 4FEEA 3X1DA 1K6MA 5JRDS 2LBPA 1TEZA 3IV9A 3FTCA 4H4DA 2ZSHA 3TH5A 3CR8A 1RZRD 1ETUA 3SFVA 2BBSA 3ROEA 3B8EA 1EESA 2VFAA 4LJSA 2VQ6A 2BKUA 3P96A 2HTFA 4EHBA 1ZAYA 4GPAA 4C3VA 1IOWA 3JQ9C 4RA9A 4HH3C 2O7SA 3RTCA 4CLOA 3LPCA 3N8NA 5TS2A 2NO7A 5AP9A 1R6XA 1W0KA 1XCMA 4JOQA 3ZR4B 4EP1A 3U7FB 4YVFA 3PDWA 3EXIB 5FWXB 5AXCA 4BFLA 4F6RB 1VE3A 3D2LA 3N86A 3OT1B 1Z6YA 3FTEA 1GQSA 4MGYR 4PG4A 5LLDA 3E4DA 3PLNA 2ZWAA 3WLLA 1QIJA 4PYMA 1WBBA 2H51A 2O3UA 3QVOA 4TRMA 2XYGA 4PCAA 1LI5A 3QHAA 3ADBA 3L1KA 1FYVA 1KMHA 1I3OA 4KNWA 3NTRA 4I6EA 4G65A 3RTDA 5A3QA 2Q8PA 3QLJA 3EEQA 1E1CA 2IOYA 2Q4TA 3CM0A 3OEWA 4L4RA 4WIAA 3CVYA 2ODQA 5IBRA 5J59A 1J20A 3FPLA 4HB2A 4BB9A 2EG5A 1LPBB 2A59A 2OR3A 4O4JB 3KAPA 4BKPA 2HYIC 4KGZA 3X1XA 2FSVA 4CR8A 4FOLA 5D8DA 4OGLA 2X41A 3TPCA 1Q7BA 2AJDA 1W94A 4MVXA 4NZNA 4M1QA 4OGGA 4UQOA 3ZE8A 1E6MA 4LJ4A 2ZT8A 4EB8A 1B74A 1MC5A 2JJ8A 2W11A 1OD6A 2VK4A 3FDXA 3FR8A 3JTEA 4UCXA 4JI0B 4P4UA 3LJKA 2WSMA 4LQCA 4PICA 2Q3LA 3KTDA 5I7RA 3F4KA 3E2IA 4GPIB 3WA6A 1JHUA 1MTZA 1RQ2A 2E49A 3FCUB 3I42A 3UQYS 3LG2A 4DT1A 3J81k 3GYGA 3MG9A 1UDRA 1T91A 4OA8A 1NVEA 4D79A 1VG9B 1W85B 2VDPB 4TL9A 4XEHA 1U1CA 4ENVA 4WN9A 2IHVA 2BF7A 5JSYA 3VBEA 2IHBA 4MITA 1KOJA 2AI3A 1Z25A 5CTAA 3HEAA 3SQWA 1NX6A 1JMVA 2HSEA 3CZQA 1KTVA 2DTDA 4BTEA 2IZZA 4K9LA 1E5TA 1RD4A 2JAWA 4AP5A 2A1UA 3ESYA 3JPWA 3RIEA 1OXXK 4IAOA 4XIGS 2VK2A 4JUCA 4XVHA 3PI6A 2RGCA 5JXJA 5FFNA 4KPEC 1Q3HA 4EK9A 1LS1A 2WUVA 5EYPB 2CLMB 3OSZA 3HADA 3FZYA 5IM5A 5FLXA 5BW8A 1K8ZB 1TQHA 2ZRBA 5LMCA 4LK3A 2C1EA 4XGKA 1OV4A 1OXMA 2CVPA 4NYJR 5BR1A 4J1NA 4QGAA 2B0JA 3DA8A 4WBXC 1FUEA 4G1UC 4PYOA 4RQBA 5KINB 3VX3A 1O95C 1PN3A 1XYYA 4ZOLF 3PYMA 4R5HA 4GD3Q 5SICE 2GWRA 5JD4A 2QPAA 1GSHA 4BAZA 1F14A 5ILQA 5A6VA 2NO1A 1JAYA 4KG7A 1PDVA 4BVEA 2WV7A 3NBFA 1CFJA 4CFYA 2ZXFA 3ZVRA 5M7EA 2FN4A 3ADPA 2BKEA 4PX3A 4OU4A 3PD7A 2G72A 3IE2A 4FI3F 2EARA 4GXRA 5D87A 5LNK6 3SWWA 2HV8A 3H2SA 4AX8A 2WAXA 4NE9A 3BL6A 4XYGA 4YRJA 4C07A 2C5GA 2HHLA 4ZVQA 4YMHA 4HN9A 2JVJA 1P9LA 1CWUA 1U5BB 3CX6A 4FXOA 5D3ZA 3M3HA 3LQRA 3ZWAA 2LDXA 5HK8A 1P7VA 4CEHB 4EEXA 4EY4A 3I6YA 3LP5A 4ARZB 4OL9A 5DE3A 3FOEC 3ZJVA 5FBVB 1KY5A 3BFVA 4GP7A 1G4AE 2B4AA 3KU1A 1Z5WA 2I6SA 2RGYA 3AUFA 1TVCA 3LCUA 4I9HA 4UJ5A 3ZXXA 1CUVA 1U2DC 2QTHA 2BEJA 3N7TA 3PFKA 4J03A 2UZ3A 4QNRA 2FA9A 3GRYA 1YIAA 5EE9A 4GKBA 4OUKX 1LFDB 2H63A 3GHYA 3K9QO 2JIPA 4Q1CA 3L93A 3JALB 4BO3A 4N65A 3UBTA 3WA7A 4GXTA 4QWWA 3DBIA 4YXFA 2X0NA 1JF8A 5H59A 4O8CA 4BL5A 3EW7A 4QUKA 2WHYA 4IFTA 4P7BA 4P54A 4DM3A 2F1HA 4LPSA 2EKLA 1Q19A 2OOSA 2YN0A 1QWSA 2PMDA 3NDJA 4TKUB 5TPZD 3SHQA 3STTA 1CE8B 1RR6A 4Y2VA 1IM2A 2XJ4A 3TZCA 2BBWA 2GMWA 4QUDA 1X1CA 1O95A 4JBLA 5I5EA 4DR6B 3NI2A 3L4KA 4MLPA 1HQYE 1NMXA 3JQGB 5JQGA 2VHXA 1SCDA 4COOA 2BSQA 1TI7A 4F91B 1P3Y1 3A1CA 1X7ZA 3EVEA 1FFGA 1OVMA 1QHIA 1VDZA 4U5QA 2Q4EA 4RV4A 1ZHOA 3HXOA 1PJRA 4M83A 4EATA 2H54A 1RI2A 1G8AA 1UPFA 1WPGA 3KZNA 5HZGA 3REQB 2GT1A 3WQRA 4DXDA 1U5AA 1T2DA 2WEKA 4YFYA 1KYTA 1O4WA 4N8DA 2FZ4A 2YOGA 2P9FA 2QYOA 5FYDA 1UOPA 1RYMA 5EJIA 3ZU4A 4A0RA 1NQ5A 3M34A 4JJ8A 4RESA 3UK6A 7ABPA 3L4BC 1FFWA 1W46A 4RSMA 3CNHA 3S2ZA 4B2PA 5BOSB 1MJGM 1T1SA 4UHJA 1OBOA 2O2ZA 1TVEA 1YZKA 5EZYB 4P0TA 3O0TA 1M7HA 1ZEJA 1QMPA 4I46A 3OQNA 1WZ2A 2VJNA 2VJPA 3GJ3A 3WDKA 3L46A 4MRAA 4PFQA 1RQGA 3ZDEA 1LC0A 4E3WA 1O89A 2EBFX 2GZAA 3U44B 5FPSA 1VHWA 3G9UA 5D3MB 4W9MC 1IJFA 4R1UA 3KFVA 3U4IA 4BZQA 5E9AA 5CX1B 5TARA 3FN4A 3HR8A 2GF2A 1NVVQ 2Q3FA 2QJRA 3PLRA 2AEEA 1IMJA 3W3AA 2GM9A 4ZJZA 1FXUA 2Q46A 1R8YA 2DLDA 2PLAA 3MHTA 2Y76A 2V6FA 3RG8A 3UJHA 5K5EA 1VPWA 1MG0A 4LMBA 2LCFA 2Q7DA 1Z7WA 3KZMA 4PNHA 5LCXA 4LZNA 1KY3A 4KMOA 5EEGA 4UAJA 2EJTA 3OIGA 5EKSA 5TT1A 3REGA 3UXEA 4RSRA 4EABA 4EA7A 5LWQA 1W4CA 2X5KO 3GJZA 3HM2A 4N5MA 3VKVA 4FCVA 3DOOA 2WD7B 2XUZA 3MS4A 4P2GA 3ENKA 2JBAA 5DM2A 4BQOA 4CM8B 3M49A 3S2SA 5BNFA 7REQA 5JI2E 3TW6A 4JOBA 4MWEA 3OKFA 2ZSJA 4GPTA 1D0SA 5CA1A 3MGAA 4NJEB 2VF5X 2EP8A 1FRNA 1PS0A 2YH2A 5JYDA 2P4UA 2POQX 3WNDA 3U4QB 2O7NA 2P2SA 2P3LA 2MSDB 4J76A 4PU0A 4RD1A 5TVGA 1TUBB 3V2IA 2XWJI 3DTVA 4BVLA 5IAKA 4H7DA 4Q3AA 4AZVA 4YXWD 3TLYA 2PS0A 5IP5A 3PFBA 2TSYB 2XA2A 3LUJA 1SQ0A 4DDKA 3CJRA 4GX1A 4YJFB 3GLFE 1CQIB 2PR7A 1FLVA 3FYHA 4MV9A 1S2DA 1ACLA 5AUQA 1C1DA 3GT0A 3Q7PA 1A5ZA 1U3WA 4Y6PA 2GKSA 1MB0A 3K35A 4O2AF 1OWLA 2IL1A 1XMXA 1SXJC 3KR0A 3MF4A 1MT0A 3OKCA 4N47A 1PWYE 3KSRA 2Q3EA 4ITUA 4TZTA 5BXQC 2WWWA 4B17A 3OA0A 5JTUA 4BLVA 1B6SA 1BE8A 3STHA 5TLSA 4AKTA 5U9CA 1UAAA 1A9OA 2YY5A 1I6KA 5HDBB 2HOQA 1DAMA 1L1FA 1DAIA 1ZNYA 3K94A 1BWQA 1YZGA 1GHTA 3C24A 3L04A 2WK1A 4I1OA 3KQSA 4P5DA 1G1AA 5JUWA 3QVVA 2H9YA 4RE6A 3GJ8A 1UAYA 1I3MA 1VPTA 4BB5A 1TYDE 3QA9A 1KOGA 1D2EA 1PGOA 4G8JA 5HUHA 2FVXA 3IOMA 3PKIA 4UMFA 2BTQB 4YRBA 3K09C 2CCJA 4OBEA 2I76A 2FW1A 1UXHA 2WTNA 3OJOA 3NTVA 3W0LB 3CTPA 4DBLC 1V8BA 1SBYA 2FW6A 4GZ5A 1YRQA 3TINA 4ND6A 2LP4Y 3NKFA 3Q8KA 3KJFA 1ZSNA 1KJ8A 3LCVB 4YTEA 4F06A 4J4TA 2G67A 4BV9A 1Y8QA 4P7KA 3DZCA 4BUJA 1ADJA 3ODPA 3PUJA 3KPVA 3VOAA 2D1YA 4P0PB 3FPHA 4PCUA 4MB2A 3WXMA 4DSZA 4LTDA 1M6NA 2QBYA 2H8GA 4DMMA 1G3IA 4BQSA 1R6TA 2B2CA 1DXYA 1Q3KA 1MAUA 1F0KA 1XRLA 2VL7A 4ITRC 1U8FO 2R7NA 3TEMA 1XO1A 2R87A 1Z5GA 2JGLA 2AN3A 3FNRA 3G2PA 4MYCA 4NZ9A 2AOUA 1M67A 4P3XA 3T1TA 1V0JA 1BH6A 1RMYA 4QGHA 4TKZA 4F6CA 3ETEA 4RFSB 3FUCA 4QOHA 4JI7B 2VP6A 2AW3A 1R0BA 2OHHA 2GVZC 2V6JA 4TRNA 3MGBA 4IKEA 5FL7D 3T7TA 4B6FA 4KO2S 4E09A 2Q9BA 2FWRA 3CLUC 1RQLA 2XGJA 5EC8A 4TMVA 5HCIA 2A30A 4CDRA 1YVUA 3Q3EA 4MQ6A 3ZK7A 1AK2A 2ODAA 3QMMA 2DZDA 4C01A 1U2PA 2PO5A 1TLFA 3EC7A 4HXYA 3B3JA 1X1TA 4JX8A 2B4TO 4K7JA 1CG6A 2Y3IA 3H1AA 4WBNB 1OBFO 2G9ZA 1ZVVA 2B9VA 3DV0A 2QAJA 3PHJA 5CW1A 3HKEB 4NMLA 4FINA 1YJXA 2JGDB 3OEED 2N1MA 2H4ZA 2NO5A 2PVSA 3M6IA 1JQ3A 3EVBA 2QORA 4I36A 1U9YA 3RASA 1GFSA 2G82A 2WTAA 5IS2A 3TX2A 1SUBA 1X19A 3WRWA 4DJDC 3VYTB 3IUYA 3K05A 3IBGA 1Q1ZA 4Z86A 3IE0A 4K6OA 3HWX1 4PINA 4DG8A 1EB8A 2H2GA 5JWOA 4R2JA 4NF2A 4ZP1A 3CVOA 2C4MA 2QN2A 3CF6R 4N0QA 5C3MA 4I2NA 4PZUA 1H4TA 1NFQA 3BL5A 1B76A 4U7TB 4CMAA 1D03A 2VNKA 5C8YA 4CL0A 1PNOA 4O8ZA 1PL8A 2Q62A 2X1VA 2EBWA 3I45A 3ZZUA 3KQLA 1ST2A 3EIFA 1LJLA 4JI3B 1N2EA 3HXTA 1TA9A 2UZ4A 5I4CA 2FQXA 1SBZA 1UBKS 1UJMA 2X0DA 4JJ4A 4TXHA 2QAIA 1DP4A 2O7VA 1WUKS 3KEGA 2PCLA 3HJRA 3O8QA 2W2VA 4BNGA 3EX7C 2GTIA 4D8UA 2C3PA 3RH0A 4MMYB 3WYAA 1GYQA 1Q0TA 5HS4A 1EK0A 3L7YA 1IN7A 3G0IA 4ZANA 5FPHA 4MUNA 1A72A 2FJUA 4L8LA 1UDBA 4QEZA 1RI4A 4IHJA 4RHYA 3RRXA 3RT1A 1I94B 1A4IA 3IAHA 2O59A 4JYMA 1R74A 3AHEA 3P71T 1W2WB 2ZIXB 4KYIB 3TLAA 3UJ9A 3MS7A 1D4AA 1QLWA 1PNVA 4OPMA 4DA4A 3K15A 2DPLA 4KQFA 4PRYA 2GJ4A 2X1HA 2P2ZA 1E3LA 3ONNA 2I34A 4HNRA 5ELLA 4AKEA 2VP3A 1I6LA 1Y3AA 1YL7A 1JXOA 4US0R 1P2GA 1JHOA 2QN6A 2YHIA 1KFCB 4IHJF 4PVCA 1SVKA 1SKBA 3FD8A 4P4SA 1UFRA 1SOAA 4IHQA 5COBA 2JIOA 4AMUA 4BKQA 3JQAD 5LQJA 4WVFA 2VHTA 4Q7JB 4BHTA 2HZBA 5IG2A 5C7IO 2XWPA 2CVFA 1TEHA 2GOYA 4MUEA 4QHTA 3ABQB 1R66A 2GN1A 4RDHA 3VYWA 3ZV6A 4M0PA 1ULBA 2NV2B 3OICA 5LXTF 4C7OA 1XRSB 2BAGA 4MO2A 1XYGA 5A3VA 2LTAA 2FSIA 5AK6A 4QZVA 5C8YF 1CEQA 1C9MA 4NU6A 3OEHA 2NADA 1FNSA 3W9SA 1E6CA 5IUKC 2D0DA 4B0PA 4AXBA 4WFQA 4O2BB 5CBKA 2A86A 2C78A 3MJTA 2V03A 3RK4A 4JOCA 2V8BA 2WD9A 3EIEA 4ND8B 4BGVA 3R2JA 6AT1A 3JQAA 4EPXA 2ZCVA 1ZMOA 2JH9A 4H08A 2PX4A 5SZHB 1ECBA 3H5LA 4R3UC 2BYTA 2XA1A 3SXPA 3HGMA 2ODTX 2WWTA 1NNI1 2EL7A 3VV3A 1NJ2A 1UXKA 3EZYA 3IP1A 1HDGO 2OCDA 5KX5A 1YUMA 4U2DA 1W4LA 3UHOA 2H1FA 1L1RA 1VIYA 2ID7A 2ID4A 4N5HX 5TMEA 1G2QA 2H2AA 2XF8A 3UPUA 3ZWNA 2AX3A 3INGA 4BEBA 2WICA 1MC8A 2I4TA 2YZGA 1II0A 1V1JA 4GWLA 3RABA 4DMHA 2FRDA 3UG6A 3OZAA 1ILEA 1UCFA 2PUHA 3N74A 2WUWE 3R3WA 4D8VA 4K05A 3TCKA 1N25A 1A8SA 1G3RA 3FDJA 4TKMA 4YJHA 4BX3A 1UMCB 3FRIA 4AFNA 3C3JA 3EOBI 5IMSA 5PNTA 4EG7A 3CT6A 4B43A 3UWOA 2WKWA 4DTIA 4CVNA 1UQUA 4LRUA 1FCJA 1YE3A 4HGPA 4C6HA 5IHXA 3SE0A 3SX2A 1E5XA 1WHTB 2GEFA 2QLFA 3E6AA 1NU6A 1FFBA 1PJQA 2DT8A 3QVXA 4DMCA 1JIXA 1KH3A 1UMBB 2BEUB 4Y8VA 5EKXA 1VB5A 4ZVOA 4PXAA 3LUKA 1Q20A 1H8HD 5GONF 4EY5A 5F9HA 2CLDX 2IS2A 2AWNA 4AJ4A 1V3TA 4FYWA 4WFIA 1PP4A 1UBOS 3JZIA 10MHA 2Y68A 1N0UA 3BQMB 3O47A 2C58A 3I3OA 4DCCA 1JU4A 4KDFA 2AMVA 2G9VA 4PW0A 3RFXA 2Z6UA 3KHTA 3QZUA 5FOXA 3R6GA 4QOEA 2J46A 1YA6A 1L8XA 1ZIPA 4Y2SA 3R41A 1CUHA 3I2GA 4QYMA 3TR5A 4RAQA 1YC5A 3ICEA 4B35A 3OEEA 5TQVA 1XDDA 4P5EA 2C0PA 3DLIA 4MUFA 1GAWA 1QAQA 1VB3A 3EZ9A 4CG3A 3Q12A 1ZUD1 5K3FA 2FG7C 4CW7A 2HHJA 2XUGA 1ZOOA 3DT6A 4WX2B 2JZNA 2GTPA 3ZVLA 4Z9YA 1TUGA 3QLUC 1XNHA 4Q0MA 4DHEA 5HF8A 1C0PA 1W8IA 1GZ5A 3PG5A 4AWBA 2EDAA 5BW6B 4KXWA 4C2BA 5ISMA 4FOOA 4TYWA 4C4XA 5CK4A 3IP3A 3RGGA 3VU0A 1G17A 3ROQA 2VIIA 1AMUA 2V4UA 3QOWA 1OA0A 4N6OA 621PA 4MNTA 3OVMA 3AERB 5AVVA 2DAPA 2EF1A 5K03A 5BMVA 4Y7CA 1ICIA 3P9XA 2Q1WA 3CX8A 4C0HA 3PD0A 1NN0A 4IUYA 2FW8A 4B3BA 1Y82A 3SQMA 2Q3CA 3EFOA 4FYMA 1GU1A 4Q4HA 3KIPA 2I2AA 3PWKA 4JJZA 5LP6A 4DSTA 1BRTA 2WUEA 3C0KA 1SG6A 4BQFA 3I61A 4B4WA 2BY4A 2E82A 3GIDA 3ZY6A 5CH3A 1TLTA 4DGQA 2ZRPA 4RLQA 1QRDA 2FPSA 5CXXA 5THKA 3SR0A 4CM4B 4ZYUA 1ECGA 2NNWB 5FTWA 3W7VA 3ZHRA 1OH6A 2OV4A 1OC4A 1AS0A 4KNYA 3CO5A 4MS3B 4G67A 3AY7A 4LGYA 1D9ZA 3EN0A 8LDHA 4TL8A 2QG6A 1ZU4A 2QXYA 2WZBA 3EVTA 3IVMA 4X1KA 3L1IA 1XRJA 3T3IA 3WNZA 5KUTA 1YQQA 4NTZA 4KOEC 5EUCA 3WP0A 3GLGB 4ZRMA 3CKLA 5EHNA 1J7KA 2VSXA 1UWVA 7YASA 1E7MA 2E4WA 4M3NA 1QK4A 1G8GA 1Z7BA 2ECQA 1JAXA 1QOQB 2DWCA 2RCYA 5KVCA 4EJ6A 2EW1A 1I4TD 3GEPA 4OHOA 2D1QA 5A1JA 5A7FA 4O5AA 5EP3A 1Z5PA 2IV3A 4JQSA 2H2DA 4CL8A 2Y0BA 2Y0EA 3E84A 1VE9A 3FWKA 4MS1B 4U2GA 4GMXA 3ADCA 2QXUA 4RK0A 3JYNA 2OGUA 1BXGA 3DVRX 3JD4A 1ID1A 2ZKLA 3LCRA 4LHWA 3AI1A 4YP5A 4HRVA 3KOZA 5CT9A 5B7NA 2D2IA 4M0LA 3CZPA 4A7PA 3O4GA 4JSYA 4LNHA 3N2IA 4NBUA 1UBRS 4BPBA 4UU7A 1ZUWA 3UAVA 4BFWA 4NRDA 3JVEA 4WL0A 5TQ2B 3JXEA 5LOVA 3BXXA 2ZLBA 3V5NA 3DMNA 4NDAA 3HP4A 2DKOA 5JMWA 4EBBA 1G9TA 3VOTA 3MPUA 3IDAA 3GCZA 1YDMA 4A8TA 2UZ1A 1E2DA 4BZZA 4HNTA 1XSEA 2XB9A 1G8YA 4GYJA 4BLOA 1AK1A 1JN0A 5K0LA 3W5BA 2REQA 3B9PA 2WPDA 4HNQA 5EHQA 4QJIA 1M1XB 2ZVJA 4D8XA 3ZHTA 1T6NA 5LP1A 2VHWA 2YV5A 3BK1A 5EIWA 5FPKA 4DVJA 5DN6D 3TKAA 1ONOA 3BKXA 5CLGA 1NF8A 3JAWA 4REOA 2HLHA 4QO8A 2AUMA 2H7XA 3BREA 1U3TA 3C3BA 2DFVA 2C88A 1M2OB 4LXXA 4YR7A 1JHMA 4REQB 2OILA 2UV8A 3GQBA 1AKWA 3B3GA 3OZSA 2ISSD 3K32A 1IJBA 1KVUA 1G16A 1JA0A 1EI9A 5HX7A 2WG2A 1YI1A 4FZJA 1JT9A 3I4CA 4XI9A 2CLIB 2L17A 4TXJA 2YWFA 2ZCJA 3VH3A 2EP7A 2YMQA 4KLNA 5ALQA 4QECA 3GCGA 2IP2A 3IT1A 3RKRA 1C8VB 1CRPA 4ZCPA 2QA5A 3L7OA 3K6SA 1SQGA 1E2QA 3MT9A 1HL7A 2HRCA 3O4FA 4RKFA 1OAOA 4XJVA 5H80A 2I2XB 4XIFA 3RBZA 4BMCA 3QVSA 2A58A 1SD1A 4M8SA 3TL3A 5KO2A 5JTTA 5ED4A 5ALVA 5B7GA 5JD5A 3WGLA 1P39A 1I24A 4X7BA 5IC5A 1FU8A 4EA8A 1FUKA 1Q7GA 1ZESA 4L02A 1BDMA 3BQNB 6REQB 4RVUA 2CD7A 3FHTA 3IHWA 3WGIA 4O25A 3K9GA 2QUJA 2YVAA 3DAFA 5AUPB 1VKRA 3N7AA 1H3EA 3F49S 4ZHQF 1M7GA 2RI0A 2NPOA 1M0SA 4Q3EA 4Q9IA 4OK6A 2V6GA 1QH0A 3N87A 2IC5A 4A23A 1IQPA 1PTJC 1ZGBA 2FEXA 3SAJA 1M0EA 1XKQA 3K5HA 721PA 2VJMA 1T9DA 3FCAA 3OZXA 4R31A 2WIKA 3ZJUA 1NW4A 2FWJA 3CNEA 1R9MA 4X60A 2MU1A 4KFUA 3WLJA 3HFJA 4HR7A 3T4XA 1E79A 1ADYA 2YV1A 4PO9A 5ER9A 5CA0B 1CDZA 4H18A 1HNWB 1PZXA 3UF0A 4ZVVA 3R7WA 2HFJA 2YZ7A 1F2TB 4RQAA 3T7RA 2P40A 1QE5A 5IDXA 4BIIA 5FNVA 3HFRA 1IOVA 2BHLA 1KEEA 5CHYA 3QEMB 3ICOA 3HKDA 3M6MD 4R69A 3LP6A 1IJEA 1TAQA 4EVRA 3ZUGA 2AEMA 3C3EA 4HY3A 4HSEA 3OZRA 2RGEA 2ZU0C 2COKA 2C7GA 4C6SA 2GKGA 4EQ6B 3SYRA 4DC9A 1D1TA 5JBIA 3LGXA 2O3QA 3MMNA 3PEFA 1XEWX 2UAGA 2O07A 3M6UA 5FPQA 1HI9A 5BT9A 4FMDF 1CF9A 3IX7A 2A1TR 2FMUA 2HA3A 2CL7X 3P4YA 4I8IA 4J16C 3RF7A 1HE8B 2W9XA 3UJDA 1SUSA 1Z0IA 1CC1S 2DVMA 1GZHB 4NL4H 4ZU6X 3RADC 3QEBZ 1EHCA 1PFQA 5T3UA 1CQPA 2YICA 5DM4A 2R7LA 1CUYA 1E3JA 1UJ4A 2C4WA 3MWEA 3R5FA 5ENDA 2F3RA 1ZXXA 3W1EA 1X94A 3LKVA 1MENA 2ZREA 3QOFA 1VE6A 4PZCA 1N4AA 1PLLA 4BTLA 5BNIA 2AYZA 5CB0A 4B3RB 3GPDG 2OV8A 4LKRA 4D7AA 5HUJA 3DE6X 1TECE 2WZDA 3OMXA 4PZEA 1IU9A 1Y1KE 1KAEA 1V2HE 2GBCA 3FLMA 4RL4A 4Y1RB 5F52A 4O1HA 1YHNA 5GVRA 4ZHQB 4JI1B 2AA3A 2I87A 3JQ8B 4OK5A 3EXHA 1WCIA 3M5WA 3TLGB 4DJ5X 3L7MA 3KQWA 4C4OA 3TBKA 4BS9A 2RGXA 1M3SA 3COVA 5DGTA 5IN4A 3NTLA 4ZQF