4TYWA

Dead-box helicase mss116 bound to ssrna and adp-bef
Total Genus 182
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
182
sequence length
508
structure length
508
Chain Sequence
SKLIHVPKEDNSKEVTLDSLLEEGVLDKEIHKAITRMEFPGLTPVQQKTIKPILSSEDHDVIARAKTGTGKTFAFLIPIFQHLINTKFDSQYMVKAVIVAPTRDLALQIEAEVKKIHDMNYGLKKYACVSLVGGTDFRAAMNKMNKLRPNIVIATPGRLIDVLEKYSNKFFRFVDYKVLDEADRLLEIGFRDDLETISGILNEKNSKSADNIKTLLFSATLDDKVQKLANNIMNKKECLFLDTVDKNEPEAHERIDQSVVISEKFANSIFAAVEHIKKQIKERDSNYKAIIFAPTVKFTSFLCSILKNEFKKDLPILEFHGKITQNKRTSLVKRFKKDESGILVCTDVGARGMDFPNVHEVLQIGVPSELANYIHRIGRTARSGKEGSSVLFICKDELPFVRELEDAKNIVIAKQEKYEPSEEIKSEVLEAVTEEPEDISDIVISLISSYRSCIKEYRFSERRILPEIASTYGVLLNDPQLKIPVSRRFLDKLGLSRSPIGKAMFEIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rna binding protein/rna
molecule keywords ATP-dependent RNA helicase MSS116, mitochondrial
publication title Molecular insights into RNA and DNA helicase evolution from the determinants of specificity for a DEAD-box RNA helicase.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 182
structure length 508
sequence length 508
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2014-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
A PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4tywA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4tywA02
3TK1A 5DYIA 1M2OB 2R62A 3AKCA 5EP4A 4DKXA 1S9HA 4B6FA 5CB8A 5FL7A 3X1WA 1CJKC 3T1VA 4EUNA 3IUYA 3CRQA 1ODFA 3LBHA 1GNRA 2A78A 1ZUIA 2AXPA 3QOFA 1W2HA 2QMUA 1NN3A 3AF4A 4K46A 4JKIA 5H70A 4KYUA 4YDHB 4LJ6A 5CK5A 3WRYC 1RRGA 3LH5A 4G5SA 5J4LA 3IHWA 1QHSA 2HXYA 1U0HC 2ZRFA 2NQ2C 3QKTA 2REXB 4MA4A 1QHHA 4MYUA 5AJWA 5ELXA 4L16A 4ASUA 1EFRD 2IYUA 2ZE7A 4PANA 3VX4A 3MUFA 3ADDA 3KXIA 3RS3A 3AGQA 4M4SA 3TVTA 1NKSA 3TVDA 2GAOA 3TUJC 4II7A 1U0LA 3PUYA 4D0LB 2ZAOA 3ZIAD 2X19A 2DFKB 3A1VA 4Q21A 1P2SA 2YHSA 3FMIA 4Q19A 4BEBA 4OQFA 2IW3A 1LNZA 2W58A 3NHBA 2JJ1D 1BYIA 4LHWA 4M2LA 3GP8A 4JBXA 1UAAA 1OXSC 5BN5A 3BBPA 2P6NA 4IHQA 4TMTA 4MITA 3WYFA 1M7BA 2WOJA 2ZI6A 1KAOA 2D7DA 2ZI3A 2OILA 2LCFA 1G7RA 3AH8A 3K9LA 3IO3A 4HLCA 4JSYA 2QZ4A 4DEXA 1H8ED 3RRZA 1E1QA 3TAUA 1BYUA 4GPTA 3NTUA 1HA3A 4PPNA 5CM9C 3MAAC 3OHMA 3I61A 2QGZA 1W36C 1O3YA 1MO5A 1EFUA 3SI7A 4BFWA 4NYIQ 4HI0E 4LDJA 1YZUA 4I1UA 2G1JA 1WQ1R 3QPUA 2D4HA 4Q4LA 4M21A 2DFNA 4KCGA 1G7CA 1J99A 1OH5A 3J81k 3EPHA 5JCZA 5EUQB 2QMEA 3WHLA 4ERNA 3FB4A 4KVGA 2CMKA 3VKGA 1E9DA 4XH9B 1JPNA 2QPOA 2CE2X 5G41A 5IDVA 2V1UA 3P20A 1SVKA 2BIFA 4YONB 3UMRA 1OXXK 3CF6R 721PA 1JQLB 1Q57A 1IOZA 4D81A 4DSOA 3CPEA 1R7RA 3B85A 3HP1A 3QJYA 2VF8A 2W6IA 1G3IA 3K0FB 3N5CA 2IYLD 4PSKA 3L0PA 3VR2A 5E3HA 2CHVA 1J90A 4AKHA 1HTWA 2BEJA 4LSGA 2EFHB 4QGAA 1D9XA 3PUXA 1CR1A 2QE7D 1XEFA 2QQ0A 4DUGA 5L3RA 3UKDA 4FCTA 4CYMA 5HKKA 3C7KA 1N6KA 3P4YA 5P21A 1QG2A 2A7QA 4YMTA 1ZM3A 2ZJ8A 4GOKA 4UJ3A 5KHOC 5H8WA 3IKJA 3ZZTA 1L4UA 3REFA 5JI3E 1R6BX 2R6DA 1CTQA 4GFDA 4PHTA 3TRFA 1KSJA 3I8SA 3RS5A 2R2AA 1P9WA 4KSCA 2IUTA 5JLJA 2XZLA 2PLRA 3OFNA 1J7KA 1T0JB 1RW4A 2J5XA 2QL6A 4A0HA 2XEXA 3FMFA 2GWHA 3A4NA 3ASZA 2GVZC 1DPFA 2BHRA 2IX3A 3K0FA 2ORWA 3OEHD 1WRBA 2P3SA 2BBTA 5EE0A 2WKQA 4RD4A 1Q1QA 4HDQB 4IEEA 4BZQA 4QBIA 2EFGA 2CNWD 4L8GA 3NDBB 3EA0A 4FW9A 4QHYA 4NH0A 1UKYA 3WMFA 2JLVA 4JBWA 4B34A 1VIYA 3ADKA 2AWOA 2ZRAA 2AK2A 3SOPA 1XB2A 4F92B 3T5GA 1OXTA 5L3VA 2XX3A 3QG1A 3QXSA 2JLQA 5BN4A 4QJ5A 1Z5ZA 3TLXA 821PA 1TEVA 5B57C 3THYB 3WNCA 1P4SA 3BFKA 1NN0A 3W3AA 3I5XA 1E9SA 4UNSA 2EWVA 3RLFA 5K8TA 2Q9AA 2VHQA 2WSSA 1P9NA 4ESHA 4B2IA 3AM1A 4TQUS 3RC8A 3CX7A 1R8SA 2ZUCA 2V6JA 1M34E 4G01B 1WE2A 3I5YA 2TMKA 1A2KC 2IYQA 3U44B 4L5BA 4LGMA 5DN6D 8OHMA 2C2HA 221PA 1A4RA 2GETA 1AA9A 4DC9A 1T3LA 4PAQA 4FWTA 3MG9A 1JECA 4DZZA 2BMEA 2QQEA 2EQBA 1LS1A 4RZXA 2A5DA 1YR9A 2PCLA 1NP6A 4RD6A 2F1HA 4XTRA 2V55B 2DHRA 3EIQA 4Q4AB 4RCZA 3KZ1E 4MYCA 1FP7A 1GTVA 3KB2A 3M4YA 4V02A 3TQFA 4PC6A 4A2WA 4LV8B 1S9DA 1NG1A 1WDTA 2DR3A 2GESA 4LC0A 3THYA 4G5RA 2O8EB 2NPIA 3FDIA 2CEAA 1E9AA 2Q3HA 2WM9B 3GEIA 4Q5IA 3BE4A 3MJRA 1GDDA 2GF9A 1JXMA 1X6VA 1M74A 1XX6A 1FX0B 1G7SA 1K8RA 2RGNA 3PEWA 3CO5A 4TL8A 5JJKA 1RE0A 3GJ7A 2J9RA 3U44A 2NTYC 1ZD8A 4JLBA 4HDOB 3MD0A 1ZP6A 2ORVA 5AUNB 1E2MA 1N6HA 3BH7A 2W2VA 4Q01A 3R8FA 1EG7A 4Q4AA 1DOAA 4XD7A 2IS4A 3WP0A 2X2FA 4OL0A 1KI8A 5JS7A 1TQDA 1E2FA 3FGNA 3LLUA 4HAXA 2ZRNA 4BLTA 2HV8A 4LJ7A 1ZNWA 1PUIA 2C77A 4N3NA 3ETLA 3KQNA 2QRZA 3LRPA 4WOPA 1A5TA 4OI4A 3DL0A 4ARZB 1NI3A 4HB0A 4MRNA 3NVAA 3ZH9B 1S0UA 1KNQA 2X2EA 4PR0A 4C3ZA 3M1IA 4MQBA 1RIFA 1FX0A 1I4TD 2FH5B 4GZLA 5FPKA 2ZRDA 2XOKA 2WHXA 4MRVA 2AR7A 1L8QA 2FPLA 2VL7A 3KKMA 2CK3D 2IXEA 1VYTA 5KSOA 4WXRA 3X1XA 2W0MA 1OXVA 4QXAA 2QEQA 2X77A 4LBYA 1Q21A 1JAIA 1IN5A 4BLPA 5G3YA 1IONA 1TF2A 1W0KD 4MYHA 1IM2A 1VMAA 2YOGA 1E94E 4U00A 3T12A 2RGDA 1FMJA 2OT3B 4EPWA 1E1QD 2QORA 4IEIA 3R7WA 2CL7X 3UATA 2KI5A 2YJTD 3SU8A 3QQ5A 2VSXA 2YVUA 3BORA 1DAEA 4TMWA 2RB4A 4LOAA 2WJIA 1AM4D 3ZZUA 4JYBA 3SFVA 3O8BA 1F5NA 3PVSA 1P60A 3Q3JB 4ARZA 1YRAA 2RCNA 2J7KA 4LWZA 1OW3B 1Z2CA 4A9AA 4PZZA 2IHBA 4D82A 3UMFA 2QRNA 5EE1A 4MRRA 3GPLA 2MSEB 1WBBA 2VP0A 5JJLA 3SE0A 2BJWA 5HZKA 2OBLA 5TDHA 3KUCA 1XPRA 5CLLA 3FYHA 4D26A 5AJVB 2ZS8A 1NY5A 1RFLA 4W9MC 4FMBB 2P67A 4B2PA 3ZD6A 1S8FA 1E2QA 3N2IA 4DEYA 4ILEA 3V9PA 1E96A 4DLXA 4OQXA 5E7MA 3UPUA 5JMTA 1KO1A 1T3HA 3PENA 1KKMA 1ZU4A 3W90A 3JZMA 3AKEA 1NVVQ 3JVUA 3O47A 2ZSEA 2PBRA 4EPVA 1P6XA 4IRUB 3SYLA 3U2QA 3KXKA 1FMLA 1PUJA 1CIPA 2JIZA 3ZS9A 4P31A 2QTFA 3G82C 2CL6X 1XF9A 4FD2A 1IBRA 3B1WA 4LYFA 2AKAB 4ZDJA 1F2UA 4BFUA 2QN6A 4C0QC 4C0SA 5FBVB 2EWWA 1W0JA 1IXZA 2AX4A 2BMFA 2A5FA 2IHYA 5LD2B 2GXQA 2IBMA 4HDCA 3EX7C 3HU1A 1COWD 1AGPA 1SVSA 3H84A 1E4YA 3U60B 3DO6A 1P2TA 4DWJA 3UIEA 4ACAA 3MGCA 2GXAA 1ZAKA 4ZDWA 1IN7A 5DIFA 4TMXA 1P5ZB 2ONJA 1MT0A 1KI7A 3VFDA 3T15A 3CX6A 3DPUA 2NGRA 2NIPA 2WKRA 1RZ3A 3W6PA 3JVVA 3ZS8A 1R2QA 2GJAA 2PZFA 4MRSA 4IDNA 1ESNA 4BFTA 2N1BA 4AG6A 4TLAA 2ZU6A 1FL9A 5FOVA 5F3WB 2IK8A 3CR8A 1NJFA 1XEWX 4XTCS 1NJGA 3IGFA 4XWOA 1ZUHA 1ANKA 3U7FB 4Q1BA 4M53A 2WSSD 4Q48A 2XSZA 1SKYB 5KDOA 5FI0B 3ASYA 2OLKA 4P4TA 4CZ2A 5F98A 3OIYA 1E0KA 1OIWA 3CLVA 5J4VA 3FMPB 2FE4A 3PEUA 1AK2A 3X1YA 2IL1A 1IY2A 2VP5A 1GRQA 4WXPA 1LF0A 2F1IA 4DSNA 4QM7A 3HR8A 4QHTA 3IDQA 5EP2A 5KO2A 2FEOA 4IJMA 2OFWA 3QKRB 2IYYA 4B3DA 4B75A 1NY6A 1ZVQA 3WBJA 1TF5A 2ZRJA 2XNDA 4GP6A 3W5IA 1IJFA 1S4QA 3ICQB 4GBMA 2WAYA 2VQSA 3C41J 1P75A 4GOXA 1RRPA 4HAZA 3EXAA 1LS6A 2P5SA 4XSHA 5FI1B 5HR5A 2EYQA 2CHGA 1W36B 4Q9LA 2XZPA 4RFSA 2ZI7A 4KHZA 2Q21A 1W5SA 1HV8A 2NO1A 4DVGA 4U5XA 2JJ2A 2WV9A 1UBEA 2MSDB 3AP1A 2GXUA 2Z5FA 3DKPA 4DT1B 3B5JA 5F9HA 1LF5A 1E79A 5C4GB 4BECA 1Z0KA 4LI0A 2F9LA 1Q22A 3QKRA 4BE7B 1NBMA 4GZMA 5FUYA 1ZYUA 2J0SA 3FKQA 5EUMA 5C4MA 1AKYA 4MKIA 3AQ4A 1PLLA 3AVOA 1ZD9A 3PV0A 3EZ9A 1XCGB 1H65A 2BMJA 2ZRIA 4AKEA 4OHYA 2AHOA 2XTMA 4PC2A 1N25A 1J70A 6Q21A 2WICA 4NONA 3U3OA 3LDAA 3TH5A 2ANBA 4W5WA 3L43A 3ICEA 1MH1A 5BYJA 1X1SA 3QI2A 4MDEA 1NVWQ 1G1MA 2XOKD 4E09A 4XJXA 2Q3MA 4LJ9A 2OCBA 3DOEA 3T1QA 1TUIA 1UEJA 3LX5A 4DSTA 1SVIA 3BXZA 3IQWA 2CVFA 1XPUA 2QROA 4MGIR 2FZLA 1MRNA 3BGWA 2CCGA 2MMGA 3QF4B 1ZINA 1E2PA 1U0JA 3I1FA 3V00A 1RYFA 3PUZA 3KXLA 5HCNA 3TMKA 4A6PA 4ACBA 1EWRA 2BKUA 2OFXA 4EFMA 2RGBA 1PZNA 4PSAA 1M7GA 2WWFA 2ZJYA 3P4XA 3SR0A 1HE1C 2KBFA 2WBLC 3QPVA 4EKDA 1Z22A 2FU5C 2IF2A 3IO5A 5JWHA 4G0NA 1UKVY 5J47A 3PFIA 4IDPA 1U8ZA 3VR5A 1AZTA 3SFZA 1JR3E 3A1UA 5ANRB 1XMJA 2V9PA 3OIWA 4WIAA 5EJEA 1U9IC 1E0JA 2CCJA 1G21E 3A8TA 3W6NA 4B3BA 4RKEA 5B2ZA 2JLZA 4Y0AA 2XGJA 1M8PA 4NCKA 3HYTA 3KL4A 3NEJA 2GNOA 4JJZA 5CK4A 3BD9A 2OFOA 2ZRPA 3CONA 3EARA 1JJVA 1E1RD 2PX3A 2NPFA 3A1SA 1XTKA 3SBDA 2BCGY 2J7PD 4BZPA 3VHXA 5FPYA 3H86A 1G8YA 2VPPA 4PPGA 3VMFA 4AURA 3W9YA 4WZBE 3U3KA 3A58B 1G17A 1GAJA 4WW0A 5D3QA 5DE3A 4HSEA 4Q18A 3FOZA 4ZCIA 4YLGA 4KODA 4O0MA 3GJ6A 1ZMXA 3Q72A 1GL9B 1DAGA 5FR2A 4NHOA 3CIOA 3EG5A 4CDGA 3C15C 3IPXA 2XNSA 4BRWA 2OG2A 3GMTA 4GRAA 4DCNA 2IYZA 5FTLA 1KHTA 1Q3TA 4JT2A 3Q8XB 4DLRA 1KDOA 2GRJA 2V54A 2YWHA 2KJQA 2XZOA 5AUQA 1E2EA 1XCMA 2B6HA 3B7GA 3BJIC 3M0EA 2AWNA 4YXWA 3BC1A 1Z83A 2AFIE 1GKIA 3IEUA 3KQKA 4LHYA 4PQYA 3KTAA 1R10A 3CRVA 4FWIB 4RD0A 5L3SB 2VP2A 3VNVA 1UFQA 4XSGA 4CEHA 1Z3IX 2YYZA 1GSIA 2GBLA 3OIVA 5JJIA 2MSCB 3DVLA 1HUQA 3C16C 3CWQA 3SHFA 1S96A 4P4SB 1CR4A 1XTJA 4B6EA 5GVSA 3H2YA 3CPJB 3QVUA 1X1RA 4ZKEA 1S1MA 2Z83A 1US8B 1G18A 3N2EA 421PA 1XXHA 2DWQA 4V03A 2ZITA 4C30A 3WMEA 3I3SR 5TARA 4TYYA 2ATVA 2J41A 2R6GA 3CUEF 2FV8A 1MO6A 1Z47A 3MMPA 5HE8A 1AJEA 4URXR 1OYYA 1E2HA 3EC1A 4NYJQ 2OXRA 3GLFA 1G20E 2BVNA 2EU8A 4JKYA 5IT5A 1SVWA 5L3SA 1NMYA 1BKDR 2VYFA 2G9NA 4KLZA 2X1VA 4HAWA 1GWNA 3TKLA 1KK2A 1VIAA 3R9WA 2VHJA 3ZVMA 3GLIB 2QG6A 2G1KA 3RANA 1KK3A 2CLDX 2C95A 3DMDA 1E9RA 3DMNA 4P4SA 1Z6TA 4D0GA 4A8JA 1OSNA 3WNBA 3AVTA 1GP2A 1N0UA 1AN0A 1US8A 4F93B 4ESVA 4OJKA 4HAUA 2IWHA 3B82A 1VYUA 4LYAA 4JS0A 4AYWA 1UKEA 1E2DA 1OE0A 1G7TA 2WWIA 4NYMR 4F4JA 3I62A 2XTZA 2VO1A 2ZVPX 2XITA 4MRPA 3AKYA 1OHHA 1ZNXA 5FOUA 4B3FX 4BZXA 3EIEA 1N6PA 1Q3HA 2ODEA 4KXFB 3RSOA 4EJSC 3DZ8A 1KI3A 4GT1A 1KJYA 2ZU0C 1UDXA 3AF0A 2RGCA 4HUQB 1GG2A 1NNEA 1RC8A 2QENA 3SC3A 3GLIA 4MGYR 3KKPA 3QXXA 2AD1A 2ZQ5A 3IIJA 5JS8A 2JJ2D 5EQTA 4FMCB 1IHUA 5LB2A 4GP7A 1YZLA 2Q0HA 4TT3A 1XU4A 3E70C 4AKGA 1E79D 3F3YA 2A3RA 4TSFA 3AVVA 1GFIA 1N0WA 1II0A 2J0QA 1PLKA 4TTPA 3OAAA 1CP2A 4XWAA 5IHPA 1QVAA 1XMSA 2CL0X 3LAWA 4Z1MD 1NBMD 2VP4A 2YZ2A 2PJRA 4NMMA 2R6FA 2ODNA 1KDPA 3VAAA 3LX8A 1GITA 2XB4A 3OIUA 3KDSE 1H8HD 2QY9A 4NCNA 4ZCMA 5B58C 4QBGB 4AI6A 2I3BA 5J4YA 2QMOA 2H1LA 3NBFA 1R5BA 2GZHA 1Q1EA 1CLUA 2CCKA 3AF3A 3CKLA 4LBVA 5IK2A 4B43A 3B1YA 5UKDA 4EPTA 5F2EA 1ZJ6A 2BDTA 2P6UA 3LBIA 5JEEA 4B33A 1IXSB 1FW6A 1P9RA 4BLQA 2D62A 3PG5A 2B21A 1UBFA 3QBTA 4GOJA 1F60A 5BXQC 3EA5A 1XPOA 1N5JA 3AVQA 3K70B 2GCNA 2ZJBA 3HWSA 3RVBA 3KUDA 3UWKA 1XDBA 1IN6A 5DYGA 1QF9A 3TAHA 2KE5A 3ZLJA 3VR6A 5H1YA 2R6AA 4NCHA 3MWJA 4M1TA 4OK6A 5EXSA 3HPQA 4A2QA 3FHOA 4LHVA 3LXRA 1W1WA 2AL7A 4AYTA 5EP3A 2NZ8A 1YRBA 1BS1A 2R9VA 2C96A 1NLFA 3TE6A 1X8LA 3GQBA 2A5YB 5CJ2A 4X8MA 4B44A 4JBYA 1KSHA 1L4YA 2C78A 1TMKA 2G88A 3K0SA 2HDNB 4M1SA 2BBSA 5BW8A 1P2VA 2QPAA 3LFUA 2VTKA 5E7IA 3RNLA 3IQXA 4URVR 1CR0A 1BO6A 2VHUA 5JRJA 4OI0A 1VCNA 3UG7A 4LJ8A 2FFAA 1TU4A 4GI7A 2ZJOA 4KAXA 1GRRA 1II9A 2FF7A 4RCYA 1CJVC 3SBEA 3LBNA 1U99A 3CNLA 1LW7A 2DY1A 2F43B 4JZKA 1PV4A 1DS6A 1YZQA 1HH4A 3BRWD 4AKIA 3B78A 1NSFA 2QBYB 2HT1A 1QVRA 1Z8FA 5GJVC 5CM8B 2YINC 3GJXC 4RD2A 3QBVA 1KJZA 4DCSA 3R20A 1E6CA 2QA5A 1QHNA 5L3QB 4TL6A 2W83A 4HEJA 3PEVA 3UWOA 1TQ4A 4MUBA 4JLOA 3TSZA 1ZM9A 2WKPA 3MWYW 1WMSA 3G5UA 3P27A 4Q02A 2A30A 1EGAA 1JEEA 4NE2A 1IY1A 3DHWC 2JATA 3RWOA 4KBGA 3A4LA 4KITB 5KTYA 2Z6VA 4IXMA 4MKHA 2KWIA 1U2RA 4Q00A 5H68A 1NMZA 1Z0IA 1XJ0A 2JLXA 1G291 4JL5A 2J0VA 2ZSDA 1FQKA 1VG8A 1XP8A 4BQSA 3M6AA 2OCPA 2OAQ1 4PC7A 1TUEA 1Z6YA 4IFBA 4IKEA 1FPMA 2DYKA 2F43A 4LBZA 4Q03A 5CITA 1P61B 2QBYA 1OPXA 2ZJ2A 1VECA 1JJ7A 1WF3A 2Z4SA 4B76A 4OHWA 4GMXA 4WVFA 3PITA 5L3QA 1ZNZA 3PJRA 4C0JA 5C1BA 3K53A 2MMCA 5HTKA 2VEDA 1D8TA 1N2CE 4Q4JB 3A36A 2FSHA 5KPJA 2R6CA 5HZHA 3U3JA 4I4LA 4ABYA 1YZGA 1SHKA 3K09A 1Z0JA 1GIAA 2WJGA 2VHTA 1AS2A 1XD2B 2F3RA 2XJ9A 4LHXA 4BFSA 1JR3D 4EFNA 1EX7A 2EW1A 2DFLA 3E1SA 1N5IA 3RS2A 4L4UA 2C04A 4R7ZA 1AS3A 1D6JA 5GADl 1UM8A 1XTRA 1T4GA 4KJZA 1BMFA 2L0XA 3HYRA 1V5WA 2VHCA 3MWLA 1GUAA 1D2EA 1DBSA 3RRMA 4B35A 2H92A 4CEIB 1E0AA 3UG6A 3MWKA 1NSTA 3NBYC 1IN8A 1AGRA 2OBMA 1MR3F 4L9WA 1E2NA 2P0EA 2P6RA 3QEOA 1I4DD 3DZDA 3QE0A 4JLJA 4KYIB 5J4HA 4Q4JA 5FL7D 4RZ2A 4DLTA 5IRCD 1KSGA 4HLUA 1W4RA 3B1XA 4KI0A 3R8CA 4URZR 3U3RA 3C5HA 3LW8A 1U8AA 1AQUA 3HR7A 1XD2A 3FKSA 2HJVA 2ZRHA 2GZDA 3QY0A 1I4LD 1CU1A 2XTNA 3ZQJA 1N6NA 2JDIA 2WJYA 4PO9A 3GEHA 4PFSA 5IF9A 4TLBA 1OJLA 4C7OB 2W2TA 4PPFA 3NC1C 4KFUA 3TUZC 4DLVA 2GZAA 5KYKA 2XXAB 1SKQA 4F38A 2WZQA 3GJ8A 5FOSA 3PIRA 1N5LA 4IVRA 4JLVA 3NEYA 4ASUD 4IVQA 4BFVA 5K8LA 5JECA 4CEIA 2O8EA 3U5ZB 4TN1A 2FSGA 4ZIRB 2Q6TA 2QM8A 2HCJB 1U94A 4IOKA 3OAAD 2R44A 2WJHA 4KBFA 2ODBA 2BOVA 3TGPA 1B23P 3L8YA 4B3CA 2PMDA 2ZUDA 4DLUA 4YC7A 4TLDA 5CYPA 1ZM2A 1N6LA 3IEVA 1VTKA 1KK1A 2O8CB 3GJ3A 1TPZA 2OESA 2Q3FA 4BWYA 1JI0A 4D4LA 1SXJB 4V0KA 3QF7A 1R8QA 3SJCA 2XB2A 2ZSBA 2QSYA 4NDZA 5KNCA 2XXAA 2ECKA 2Q9BA 1FNMA 1G3MA 3AKDA 1DO2A 1KI9A 1U9IA 2IXFA 2P65A 3PQCA 4BFXA 2O8DB 1W5TA 2ZS7A 2ZROA 1DELA 1KO5A 1R0WA 3L0SA 5JHHB 4ZIRA 2IS1A 2RKOA 4LRWA 1AKEA 3EASA 5C18A 2G0TA 3CZPA 3L0OA 1G3QA 2GJ8A 1OIVA 2IF0A 3VU9B 1ZIPA 3QPWA 4OQLA 2O8CA 3AVUA 4QL3A 1U8YA 4DCTA 1J8MF 1SXJA 1FTNA 1G16A 1ZCBA 3SQXA 3WRXC 3HDTA 5K8UA 3HU3A 4V0OA 5KDDA 2WOOA 3EPLA 2CVHA 1XCPA 5J5CA 1R0XA 4XWKA 2W6ID 4W7SA 4UJ5A 2GEVA 2J0UB 2ZRLA 2YNMA 2QP9X 4G5QA 1KJWA 4B3XA 4N0DA 4GMDA 4C9BA 3FHTA 4E03A 1YQTA 3ZZ0A 5GJCA 2CJWB 2O8DA 1OKKA 2IUSA 2BCJQ 2YKGA 1A1VA 1TAGA 3GFPA 4O2RA 5FUVA 1ELOA 3T06B 3SS8A 4US0R 4HAYA 2OHFA 4DUGD 3QNUA 4I1VA 3AVPA 1S3GA 5HKKD 4OKSA 1G4AE 2SHKA 3QXJA 1OYWA 2V4ZA 1RPZA 3VU9A 3PEYA 4DB4A 4NKRA 2QM7A 1Z06A 3Q85A 2CLSA 4IVPA 4QNMA 3H1TA 5TY0A 2UZ3A 1MOZA 1XMIA 2GK7A 4UNPA 3BFVA 3EZ7A 3OFND 2IEZA 4X8OA 1OFHA 1W48A 4TYQA 3EWAA 3D31A 4CVNA 1E2KA 3EW9A 3W5JA 5SZKB 1XD9A 4M1MA 2DPXA 4BASA 3N70A 2JEOA 2BWJA 1NBME 1OF1A 2EFEB 4TYWA 1EFCA 1VCIA 4G3XA 5FH9A 3THOA 4TLCA 1VPLA 2FNAA 2CJWA 2NO9A 4Q1DA 1NG9A 1VDZA 3DM9B 3QIAA 2HLDA 2B8TA 4L15A 3H0KA 1GVNB 4K8OA 4EJSB 5A4JA 1C9KA 1GKYA 1YKSA 2I4IA 4N0EA 4MDFA 3CH4B 2ZJZA 5TV2A 3TIFA 5JBQA 5FTKA 1X3SA 2ZE6A 5JFGA 2FDCA 1XRJA 4NCIA 4XVRA 2ZEJA 4JVNA 1Z0AA 2RMKA 4OK5A 2IYSA 3T61A 4BEJA 3TNFA 2NOAA 4PZLA 1KO7A 3ZGXA 1KDTA 1OIXA 4OQMA 4A15A 5D3MB 1OB5A 2GTPA 2IS2A 2ZSFA 4B32A 2FPKA 2QT0A 1Q0UA 5FR1A 4HLDA 5J40A 4D25A 5KSZA 2HCBA 1YZKA 2B8WA 1M6NA 1PLJA 1G8GA 1HYQA 2YWGA 3I4LA 1DEKA 4E5UA 2WWWA 3QG5A 2FOLA 2IS6A 4EJSA 4P33A 5SZIA 3NHAA 2CLCX 2DWOA 1KYIA 1T9HA 3CNOA 2BM0A 5KDLA 4DB2A 5CLQA 5JRZA 2DCUA 1MABB 2KSQA 2REOA 1Z29A 4QG7A 1BMFD 2JA1A 4RJLA 1Q20A 3C14C 4IXNA 5HCIA 3W34A 3GFTA 2RGGA 3VQTA 2WAXA 1II8B 1LFDB 3GLGB 2OCYC 3SZRA 2ZR9A 4V0NA 1RVDA 1BIFA 5AUOB 3THWB 2V8OA 3OEEA 3GEEA 3K8YA 4P3YA 4QFMA 1W49A 1YE8A 5D3MA 2RH5A 3X1ZA 3AGPA 2O0KA 3AV0B 4B3GA 4OK3A 2IEYA 3GLHB 4F7WA 4YMVA 3KQLA 2B7CA 3L82B 5LB4A 3VR1A 4A0GA 2ZIAA 3REGA 2FN4A 4Q9KA 2Z0MA 4A6XA 3F8TA 3K0CC 4YMUA 3RHFA 4JVLA 2ERXA 3THXB 2PLFA 4HUTA 1W47A 1CBUA 3C4JA 3SJZA 3C5CA 2JDID 4XD7D 4Z8YA 4HAVA 5FFMA 4RKFA 2V1XA 3GJ5A 5SZJA 3W8RA 1MABA 2PCJA 1JBKA 5DH9A 4W5HA 4G5GA 5JWRA 1W44A 1II8A 3GLGA 2CE7A 1T91A 4TZ6A 5G3ZA 1NF3A 4OI1A 1I2MA 4ZDKA 2ZRCA 3THWA 1VCOA 3QXHA 4NYIR 1FOEB 3ZIAA 1FUUA 1WP9A 4JIMA 1CJTC 4JL6A 1CKEA 4JT4A 4OBEA 3GLHA 2QMHA 3R9IA 4DT1A 1A7JA 1DAKA 1OLOA 1EXMA 2JJ1A 5BQ5A 2Z43A 3LVQE 4AY2A 2WWHA 3E2IA 3MLEA 3K0AB 2AK3A 2WSMA 2FMXA 1DTSA 3THXA 5EXXA 5TB5A 1XXHE 3HJNA 5FTJA 4PQRA 2IA5A 2PX0A 1EESA 1YR7A 1H8EA 1KZ7B 3NH9A 3CPHA 5AUPB 1OT3A 1T8TA 3AUXA 3D8BA 4PSVA 2PL3A 1T8UA 4JLPA 3I8XA 1QG4A 4M1KA 3RSLA 5KOYA 5KPDA 3B1ZA 2O8FB 1UF9A 2YC4C 2ZRGA 4M9XA 5EE9A 2VBCA 3GLFE 3BS4A 4EIWA 2GJKA 4QM6A 4URWR 3F5FA 5JCPA 2BV3A 1E9EA 1F6BA 5FTNA 3FTQA 2JLWA 2ZI9A 2V3CC 2QTHA 5CJPA 3UANA 2ZJAA 1ESMA 1KKLA 1GOTA 3CB4A 4LHZA 4BFYA 4HB3A 3V4RA 1V43A 2OCAA 4UNRA 1EX6A 1SXJD 4QGHA 5C46F 3K0AA 1R5NA 2HJGA 3NXSA 3QF4A 4OHVA 4MGZR 4M0LA 4IOJA 4RVCA 5HE9A 1G5TA 1GILA 1YR6A 1J8YF 4D6PA 4O3MA 5FL3A 4DHEA 1D2MA 2W6JA 1NLYA 2BEKA 2HT6A 4PO1A 1KGDA 2YV5A 2O8FA 2H57A 1NMXA 4EQ6B 4M1OA 2DB3A 3BB3A 3Q9LA 2LKDA 3DKVA 4D4KA 1VYVA 1F48A 1Z6XA 2H7VA 5JZVA 4LJ5A 3LO5A 1ZRHA 4AIIA 4D4MA 1SGWA 3RRYA 4QBFA 2GJ9A 3CW2A 1KO4A 4OI2A 3U7HB 4ZPXA 3U6KA 3GLIE 2JIZD 3T35A 2QTVB 1OFIA 1KOFA 3DEFA 3SYKA 1KMHB 3C8UA 4Q9HA 4BUJA 3B9QA 1W0JD 4LZZA 2J87A 1E99A 3CWZA 2OLJA 3KFVA 3RRNA 4I99A 4EPYA 1QHYA 1A82A 2OSBA 5HPYB 3WYGA 1X8KA 2GKSA 2F3TA 2HUPA 4DIEA 4QBHA 1QDEA 3OEHA 3OF5A 2AFHE 2FA9A 2N42A 2GHIA 3BH6A 3FPAA 2X8AA 4UXHA 2C9YA 1KZGB 1AS0A 2OXCA 2FSFA 4EQ6A 2W00A 1QZXA 5GJWC 1XEWY 2OV2A 2J3EA 3WBKA 2OEPA 3WYAA 2VH5R 5L8VA 4AD8A 5E95A 4ZO4A 3KJHA 4IFEA 3NG1A 3NWJA 4QGFA 1W4BA 4CW7A 2PJZA 1KMHA 3ZDQA 1FTSA 2P2LA 4UXIA 2XSZD 3AF1A 4KU4A 2FFQA 1FZQA 3SJBA 1IN4A 1XMVA 2VSOA 3BERA 1R4AA 2XAUA 1GKUB 2VLIA 4PAOA 1S2MA 3ADBA 2ZE8A 1UKZA 3JZAA 2I1QA 3BB1A 3B9PA 3VKWA 3U7GA 1I2DA 5FBRB 3W6OA 1QHIA 4RSGA 3LXXA 1HQCA 3NH6A 2ERYA 5FUWA 2B7BA 4V0MA 2H17A 2PT5A 2XNDD 4DIDA 5KSYA 1CRPA 5AR1A 4JVMA 1QHHB 2WMOB 2GEDA 3CH5A 2O5VA 4WA7A 2WPDA 2ODWA 2O8BB 3MSXA 2FJUA 1QHGA 3IBGA 4M9QA 1IJEA 2E1RA 1XBTA 3DM5A 3ZQ6A 1E9CA 2YWFA 3B8HA 3NKVA 4R71A 3WP1B 3AUYA 4FCVA 5JWOA 2ZI4A 2J1LA 5FBQB 1DO0A 1G6OA 3RAPR 2OUKA 2D2FA 1UPTA 2YWEA 3RS4A 3ZD7A 2FFHA 1MO4A 3KB1A 2ZSAA 4NL4H 4B73A 4PHFA 1SVOA 1TF7A 3UMSA 4Y0VA 5KSPA 3CRRA 3EWSA 1UBCA 3TQCA 4YMSA 3V4FA 1U81A 3B13B 1O87A 2QAGC 3QEJA 4I1SA 2O52A 4GSYA 1NN1A 2G77B 5AK0A 4PZYA 2ZS9A 3VNUA 1E0SA 4ITRC 2O8BA 3CX8A 2AKYA 3QXCA 4NPHA 3WXMA 3VR3A 4PX9A 1L2TA 2LWIA 4BLRA 1CEEA 1W36D 4HUQA 3KQUA 1KK0A 4A0RA 4BFZA 4JSTA 3TW4A 4RFVA 3QUSA 4QNRA 3I72A 3NDPA 1TQ6A 2CK3A 4B71A 4CT4B 3DDCA 3OZXA 5G53C 5DISB 2OBNA 2AXNA 2EFCB 3PCRB 3CRW1 3I32A 4MYTA 1R0ZA 2F1JA 1W0KA 4ZI3A 4M9SA 3NC0C 4US2R 4DDVA 2CBZA 1G8PA 4PC1A 4U02A 1TL7C 1QRAA 1C4OA 2PZEA 1OH6A 4HYYA 4DLSA 3KJEA 4LPSA 4IDQA 1ETUA 1VG9B 3AVXA 1DAIA 1KI4A 5CDFA 5K8IA 5BN3A 3TW8B 2V6IA 1DARA 1DAFA 2JASA 3BWDD 2ZRMA 1XZQA 4CF7A 1KY3A 4TMKA 1XZPA 3EIHA 1XFAA 1KDRA 3NIBA 4LJAA 2RGAA 1MO3A 2ZXUA 1FQJA 4BGDA 1NVVR 5C2JB 1P62B 4OHXA 3CF0A 2JLUA 4R98A 4C0LA 1KTVA 3EAQA 4C0AC 2QAJA 1Y3AA 5DHAA 3HU2A 4M22A 1NN5A 3Q7QA 2QGNA 2KBEA 1SULA 5FPHA 1JPJA 1N3BA 1KSFX 2WWXA 2HYIC 4JYCA 2OO7A 4Q1EA 1Q1ZA 3EC2A 2ZTSA 2HXSA 3IHLA 3LLMA 4DJTA 2FGJA 2W6JD 4TQ9A 4US1R 1KMQA 4OJQA 1G6HA 1WXQA 1NRJB 2WVJA 3QSYA 2D06A 5A5GA 3O8RA 1LB1B 1ZC4A 3SJAA 5DI9A 4AWXA 1XJCA 4JLAA 4WAUA 3IILA 1X86B 3KJIA 4PTLA 4URUR 3SQWA 1L7VC 3A1WA 3Q5EA 2QI9C 1OH7A 2JGNA 3AEZA 1N6RA 4E07A 2F7SA 4YXWD 3ZVNA 2JJ8A 4R2IA 3AP2A 2C99A 4DCUA 2H5EA 1KI1A 4P4UA 1DVRA 3AF2A 3LV8A 1COWA 2IC5A 4MGKR 2ATXA 2ZVQX 1CF4A 4OQNA 2EYUA 4E22A 3AP3A 1HURA 1NL3A 1JQJC 1E9FA 3ZVLA 2ZYWX 1EWQA 1SQ5A 5FPTA 3IPYA 4PHHA 3RABA 1N6IA 4TMVA 4C0BA 5EE3A 3LQQA 1XD8A 4LYHA 2BKEA 2FSIA 4RD3A 1GL6A 5CIWA 3T5DA 1B0UA 1NIPA 2FZ4A 2WWGA 4C4PA 4DCVA 4S35A 1BOFA 5TVKA 4AYXA 1LV7A 1VCMA 5DNYB 2D2EA 2RGEA 1NVXQ 2A5JA 3D6TB 1CJUC 3FHCB 2VP9A 2GBLC 2PH1A 3T1TA 2W2XA 2J45A 2IUUA 4AC9A 1JXOA 2OAP1 3QVVA 2A2ZA 1YZTA 1ZCAA 4FCWA 1G19A 2QSZA 2VIIA 2EFDB 3RYTC 2YOFA 1GNQA 4DSUA 4JLNA 2WJVA 1IAQA 4HLQB 4Q1CA 1Q44A 2C8VA 4FXPA 4DDUA 3MFYA 4KFSA 3WHKA 1P7CA 2D7CA 2QNRA 4F91B 3SNHA 2AD5A 1XTQA 3EZFA 2IYTA 1SXJE 1GL7A 4CGZA 2Q9CA 3K0CA 3LW7A 4HB4A 4Q7KA 4O2LA 3S1AB 4H1VA 1IQPA 1OV4A 2XJ4A 2E87A 2IWRA 4XVUA 1U98A 2O0JA 3W3ZB 4A1FA 1OHHD 2ANCA 2GILA 2FX3A 1ZC3A 2BJVA 2ZETA 5CYOA 2WPDD 4TZ0A 1LTQA 3SDZA 4HZUB 4LV5B 2BBOA 3OE7A 1M1YE 1G5PA 3BB4A 1DAMA 1P73A 2OM2A 3QENA 2QP3A 3VHLB 5EE5B 3CNNA 4F4IA 1Z07A 1D2NA 1G9XA 4NTZA 1GM5A 4A8JC 1DAHA 2GCPA 3KKOA 1CRQA 4BLSA 1YU9A 3ND9A 4EPXA 3AVWA 2ZRKA 3TBKA 4TT3D 4Q7MB 5M04A 1G5RA 2QUZA 4TSFD 2A9KA 1GRNA 4AG5A 4DLZA 3FMOB 5JSZB 2EVWX 1Q12A 4NYMQ 2WMNB 3A1TA 4Q66C 3K0EA 4RZ3A 1W7AA 3S1AA 1Z0DA 2F1RA 1TTTA 4NCJA 4CT5A 2PEYA 1RKBA 1KNXA 1WB9A 4A92A 5JI2E 1R5OA 2CHQA 1J2JA 1XWIA 5SZHB 3R7WB 1HEIA 3K1JA 5KUTA 3IIMA 4M9ZA 3QKSB 4HZUA 3A4MA 4B48A 621PA 3QKUA 1W4AA 1VG1A 5IK2D 1K5DA 3RWMB 4TWZA 2GAAA 4C7OA 2WIAA 4I81A 3UXMA 2J46A 1P72A 4GL2A 2C9OA 2DBYA 3ONWA 4LV6A 4A4DA 1OB2A 1E2LA 3B6EA 1RRCA 4ZKDA 1TNDA 2W0SA 5KNDA 5FBLB 4CEJB 1RYHA 1SZPA 3U7EB 4A0FA 1KI2A 3U4QB 2GXSA 5JSZA 1Z2AA 1WBDA 2ZR7A 4R2HA 4QHSA 3GCGA 1CS4C 4Q9IA 3EPJA 2ZREA 2FGKA 2G83A 1W2GA 4WZ6A 5EZ6B 5JEDA 4PAMA 1OXUA 3CRMA 4NU0A 2G3YA 4G1UC 1LY1A 3G0HA 4DRZA 3QKSA 4JL8A 4Q4HB 2GEUA 4TQAA 2NO6A 1N6OA 4FIDA 4TYNA 3BOSA 5FOXA 1KIMA 4KO8A 1JNYA 1Q1BA 4GDFA 3OESA 1ONBA 4TTQA 3K9NA 1DG3A 4Z51A 2N46A 4J0QA 4LYJA 4CEJA 5TMPA 4X8LA 4N1AA 1E1RA 3K70D 1GNPA 3U4QA 1F2UB 1ZNYA 2OZEA 4ZI2A 5FUXA 2IT1A 3GJ4A 1CULC 2J7PA 2BMDA 1W4CA 4OHZA 1XTSA 2JLYA 1YHNA 2C03A 1SKYE 1U90A 3O8CA 2PT7A 1G64A 4URYR 4DLWA 2PMKA 1G8HA 2FEMA 1G4UR 3LD9A 2Z4RA 3KKNA 1TADA 4LJYA 2JCSA 1Z0FA 1Y63A 4V0LA 4Q4HA 3RS0A 3FFAA 4I1OA 1QHXA 5GVRA 5LDDC 3AB3A 3B60A 4RD1A 3T34A 2J0UA 2D3WA 4B47A 3HPRA 1NKTA 5LBIA 2VP6A 2GF0A 1ZD1A 3TR5A 4QGGA 5BYKA 1VHTA 3K70C 2UKDA 2RGXA 4NYJR 1Z6AA 5TXGA 3CBQA 4YMWA 4DDWA 3EPKA 1DG1G 3GLGE 4LC1A 2RHMA 4YDSA 1ZM7A 1JB1A 1TEXA 1DADA 2ZRBA 4EDHA 4UNNA 1XEXB 1CXZA 2KB0A 4EAQA 1G3RA 3BIFA 1WCV1 2VA8A 5J4KA 3GLHE 4MKGA 2ZM5A 5FPSA 3CM0A 4MKFA 4U7DA 3D7MA 4PO8A 2UZIR 4C0KA 2WTUA 1F2TB 2VSFA 3T1OA 2ZAMA 5KU1A 2GCOB 1HE8B 2ZUBA 5AJYA 5DLQC 4MUAA 1HT2E 2QAGB 3NBXX 4FI3C 4JMPA 4NBSA 3L8ZA 4D4JA 2V7QA 5DGXA 3GFOA 4KFRA 1G8FA 1UEIA 2VF7A 3WY9A 3KKQA 3VKHA 2J59A 1PJRA 3VTKA 4RFSB 1E2GA 3PUVA 2F9MA 3A6PC 1Z63A 2UVQA 2Y8EA 2FG5A 2QPTA 1T6NA 1YVDA 1KO8A 1XEXA 2ZANA 1N0VC 1JEDA 4LBWA 1MRSA 2G6BA 1IXRC 3I73A 1ZM4A 4P32A 1VG0B 4FINA 3WMGA 3EZ2A 1T5IA 3ADCA 3SN6A 2P5TB 2IYWA 3IBYA 2IYXA 3ZVRA 4PC3A 4ZDIA 1F2TA 2BC9A 1P2UA 4KV9A 4IDHA 4BPBA 3K09C 2C98A 1ZU5A 5LPNA 2GCOA 1HT1E 3TUIC 4XVQA 2QAGA 5G40A 2ZYVX 2ZR0A 1EFHA 3MCAA 3CR7A 3FKSD 2IYRA 5AWFC 4TL7A 4C2UA 3TR0A 4JLMA 3OE7D 5AJXA 3X2SA 1JR6A 1E2JA 2B92A 3SEAA 2C5LA 4DDTA 1EFTA 2I1VB 4QJ4A 4B2LA 1HY3A 3BH0A 4Q9JA 3GD7A 1ZIOA 1D9ZA 1ZBDA 1A2BA 4O25A 1IY0A 4JJKA 2FFBA 1EFRA 4IOMA 4QKQA 3O8DA 1AIPA 5JHGB 4YQFA 4A36A 4QJ3A 1E4VA 1NVUQ 1QBKC 1XTIA 1RJ9B 2RGNC 3RS7A 1C1YA 3TSWA 2HF9A 1JALA 4JLKA 4HLUC 4M1YA 521PA 2REBA 4Z1MA 1SVMA 4CRWB 1WA5A 4TYPA 2NZJA 2PEZA 3KFXA 4LJ4A 4W5JA 4KFTA 1T5LA 1UJ2A 4M8NE 3VX3A 4D2IA 1ZUNB 3X1DA 3MJHA 4UXJA 2VRWA 4BRUA 1H8HA 4LX0A 4Z8XA 3L0IB 1CJMA 4UKDA 5A0FA 3TJZA 5GJBA 1KI6B 2LKCA 4FN5A 4IOLA 2D74A 2RAPA 2ZPTX 5DI3B 3ZJYA 1AZSC 4Q1FA 4EPRA 4ZCLA 1OFUX 4A2PA 1JAHA 4F4CA 1E69A 2CDNA 3PR1A 4JLDA 3FVQA 1KAGA 5FOWA 4H9GA 2AN9A 3E5HA 3MRSA 1CR2A 5EP1A 3FWYA 4MH0R 5AJZA 3R9XA 2ZI5A 4NZYA 4LUCA 3WNDA 2R65A 4QRHA 2H8KA 3KJGA 1RJ9A 1Z28A 4L9SA 1FNNA 3U61B 2DWPA 4XIGS 3D3QA 4X8HA 3L2OB 1VHLA 1W46A 1PVOA 3Q7PA 1E3MA 3LWNA 4AK9A 4Q47A 3U6BA 3P32A 2ORIA 2WWYA 1XJQA 1E9BA 2HF8A 2OE2A 3H4MA 2HEIA 3BFXA 1SHZA 4XOIA 4Q7LA 1NLZA 4K81B 3SYNA 1KI6A 3TSOA 4M1WA 2H16A 2ZYTX 1TU3A 2YOHA 1VKJA 4GNKA 4IDOA 4LPKA 4PPQA 4QOSA 3GJ0A 2HYDA 3P1JA 4FMDF 2NO0A 4R9UC 5DI3A 1FUKA 3IIKA 4BLOA 2IYVA 2ZYUX 4Z54A 2ASEA 1N5KA 1S3SA 1HQYE 121PA 2BBWA 3DOFA 4C2TA 5FOTA 4C0HA 4V0ME 5KNBA 3LA6A 3Q5DA 1OKKD 4H1UA 4POAA 2YC2C 2G0NA 1E2IA 2QE7A 1X8JA 3KTAB 3PUWA 1YJ5A 4ON9A 3B1VA 2NMVA 2DFTA 2K5UA 4CEHB 2GVDC 4QC2A 1XNJA 2WIBA 1BH2A 2JLRA 5DSZA 1R0YA 4HB2A 3K9GA 3F0TA 1FP6A 1K6MA 3VR4A 1SXJC 1MKYA 4PXAA 5EXTA 4JVSB 1Z08A 4TL9A 1YZNA 3K9HA 3FE2A 1KY2A 1AQYA 3RC3A 2F6RA 1XXHB 4G5OA 1UBGA 1TX4B 4DLYA 1T0HB 4FMCF 4TMZA 1S1CA 4NP6A 2F55A 4ZV4A 3UK6A 4KSBA 4Q1AA 4RY2A 1OFTA 3LNCA 1TQ2A 2C9CA 5B64A 2CNWA 3GLFB 2HLDD 2PZGA 3W8NA 3KQHA 2CXXA 2GDJA 2QU8A 4RZUA 4EFLA 4KLNA 1E32A 4B74A 1UADA 1K5GA 2ONKA 4IW3B 4P0TA 2GA8A 3FFBA 1MV5A 2QP4A 1RRFA 3A37A 2O0HA 2QT1A 1YR8A 5DO9A 1T3SA 2NO7A 3P26A 4A82A 1UDWA 5CB6A 1OH8A 5DHFA 1ZW6A 5E4FA 5FTMA 5F9FA 4A8JB 5BWMA 3ECCA 4CIDA 4LCBA 4WBSA 4TTRA 4UNQA 1P3JA 1E98A 2GJSA 2GK6A 4KVAA 4Q7JB 3AVYA 3CF2A 5EXPA 4PHGA 1NIJA 4UQOA 4LK2A 3NBZC 4TLEA 2E9SA 4DXAA 5DN6A 2ZE5A 4OYHA 2NG1A 3I92A 4S2EA 3LY5A 1G41A 2FWRA 2WJJA 2V7QD 1LVGA 2IXGA 3EZ6A 1JR3A 2BM1A 4LY6A 2ZJ5A 4WZAE 1FFHA 3KX2A 5CDFE 1SVLA 5EZ5A 3U3MA 2JLSA 3ZYCA 4PQFA 2JAQA 2A5GA 1DE0A 3B2EA 5FBWB 3RDPA 1EK0A 1F3OA 1M7HA 3SHWA 5B30A 3LVRE 4DBLC 5CIQA 3BAFA 5E7JA 4D0NA 3ND8A 3CZQA 4FMDB 3BK7A 4HATA 3LQRA 3PXGA 5LD2C 1Z6GA 2RHDA 1D5CA 2R8RA 1GZSA 4D80A 1G3UA 4HZIA 3OEED 2FPMA 2H18A
chains in the Genus database with same CATH superfamily
4XW2A 2HSZA 4HRXA 4MZXA 4Q24A 5DCUA 5DYIA 2NWQA 3RT1A 3TK1A 1M2OB 3G0CA 1EVLA 2Q3EA 1DKPA 3DZCA 1YK0A 1S9HA 3KKZA 3GJYA 4FI3F 4WZBA 5SICE 5CB8A 2CZQA 1ID1A 4YACA 1BRMA 3BWBA 4GVLA 4LTDA 3VZQA 3X1WA 2OORC 1QV6A 1QE3A 1VKNA 2X0JA 3N28A 3LBHA 1ODFA 1J1UA 2A78A 2Q7XA 2NSYA 3I9KA 1N7HA 1I51A 4ZVVA 3WGIA 2DJIA 1NN3A 7MDHA 5KREA 4JKIA 2I4OA 4KYUA 2JRLA 2HM7A 3AIOA 4EO7A 1XAJA 3A6ZA 4H4EA 2C4HA 5F3DA 5J4LA 3H2KA 4PPYA 3TSAA 2C5FA 5CA1A 1ISSA 4DLLA 1U0HC 4MA4A 1RYMA 1G20B 2NQ2C 4L16A 4Q37A 1EFRD 1P9OA 2ZE7A 3KPWA 4YS6A 1C7JA 1ZS9A 1EUCA 4X61A 2CC2A 3JCZA 4FC7A 3TUJC 4EG1A 3PUYA 3D7LA 4MJ3A 3BSFA 1C1DA 1CR6A 1ZH6A 3A1VA 3I04M 5DHTA 4OHCA 1X74A 5LA6B 4OQFA 2W58A 3GP8A 1HPLA 1UAAA 1BYIA 2ONZA 2YMQA 3JQQA 1Z5OA 3CR3C 4OHMA 5KOHB 3BBPA 4IHQA 2J5BA 1LBEA 4IUCS 1NRWA 4RELA 1FF9A 3D2CA 1M2VB 2WF5A 3S0JA 1UFKA 2MINB 2L18A 4L3VA 1TM1E 3LX6A 3HB5X 1NW6A 4DR7B 1OXBB 1VL0A 3FYUB 2ZI3A 1F38A 5FORA 1GAWA 3COSA 3FPGA 3K9LA 4HLCA 4YRTA 2DERA 5JE8A 2BR3A 3RRZA 3TAUA 1BYUA 3SIXA 4LW8A 5CM9C 4NV0A 4Z2YA 4TM7A 3WQSB 4BO3A 3L07A 1W36C 5B6PA 1Y42X 3W79A 1MO5A 1UXKA 4OMDA 5DMHA 3BD8A 4LDJA 4S0ZA 1QIDA 1UQTA 5BY2A 2TMGA 1YZUA 1HDXA 1PR0A 3QE9Y 4WECA 2G1JA 2ZYAA 1N92A 2I7VA 3H8JA 1K08A 3K15A 4WLEA 1WAMA 3T1NA 4EKGA 5JAQA 5B12A 2WUWE 2WNIA 3SEFA 2QMEA 5L53A 4Z7OB 3FB4A 3TL3A 1C7IA 3Q9SA 1DQRA 3F74A 3GRAA 4J0EA 5F78A 2CE2X 2PNJA 4JP5A 4R84A 1B76A 2X40A 3FTNA 4BX2A 2BIFA 1XLTA 2P9ZA 3FDXA 3JD4A 2WYOA 4YONB 1WDMA 3UOAB 3CF6R 3NUZA 3U13A 5IAOA 1HYGA 1IOZA 2C0PA 4D81A 3CPEA 2R1VA 3R5KA 3R77A 4GM0A 4UPVA 1U80A 2VF8A 3AR8A 4A10A 2IIQA 3KPUA 4Y6RA 2CNOA 3CUSA 3HL4A 5A1JA 2B5VA 2D54A 2IZ5A 5E3HA 3EDQA 3RAJA 4IRMA 4AKHA 2JHAA 1HTWA 3GF4A 5IDXA 5KTNA 1HYEA 3M6IA 4JKOA 4JJ6A 5BPHA 3RRJA 2RD2A 1PR9A 3DZBA 3FRJA 3QFTA 1FEZA 5LM3A 5LN1A 4N65A 2QQ0A 5E9JA 5L3RA 1M1NB 3C7KA 1W75A 4FILA 2BEWB 4MVJP 2QGFA 2JGIA 4ZYZA 4KO1S 5KHOC 1APBA 5H8WA 3DQZA 1DRJA 4ZQCB 4ALKA 3PPWA 3VR4D 1L4UA 3P2MA 1QGED 5EHQA 2QF7A 1R6BX 1H2EA 2YN2A 2LCQA 2CFOA 1KSJA 3I8SA 3LWDA 4PBTA 3WFZA 1JHQA 1P9WA 1V8ZA 2R11A 4PIPA 4KSCA 2AMLA 1Z2OX 3JD3A 1LC0A 3AR2A 3O1LA 1BGXT 2BFCA 5A5FA 1LQUA 3W05A 4OAPA 1SPBS 1B1AA 1RXYA 3FMFA 3A4NA 2JJYA 4HWKA 4PBSA 2RSLA 3DZGA 3OE1A 3QEAZ 1NI5A 3EVTA 4G24A 3GFVA 1U65A 5GGYA 4IPTA 1UBLS 2WKQA 2OPBA 4Y6LA 3TO5A 1M72A 4LSMA 4L5YA 4DGQA 2AZ4A 4QBIA 4D8TA 1CUGA 1QMPA 3NDBB 1TAHA 1YKFA 4FKMA 4FW9A 1DEOA 4QATA 3S3TA 3WMFA 3NXKA 3OX3A 3LECA 1G5IA 2VDOB 3SCZA 2AWOA 2FK8A 2QRHA 3DFFA 4QUHA 3SQNA 2BFOA 4H3SA 4NQZA 2JEZA 3W2IA 3V3KA 3DW3X 1DNPA 1JILA 2PH7A 2A59A 1VJCA 4LWQA 1H9CA 2G25A 2QUIA 5BN4A 1GVHA 3BSWA 4ZT6A 3SE7A 2E4ZA 3RPEA 3FWZA 3WNCA 1P4SA 3B2NA 3EXFB 4EKNB 4QD3A 5LVAA 3RLFA 2AUMA 2EWVA 4RWZA 1EHCA 3HCCA 3OY2A 2WSSA 4RNCA 5CLJA 2XB9A 3HKBB 2K2QB 3RC8A 3CX7A 3IUMA 5DW0A 4U39A 3A2KA 2X0FA 1WZCA 2Q1SA 5I4IA 1PZFA 2EDCA 1ZSYA 4D92A 5DN6D 5DEOA 4EATA 1G98A 1B3RA 5BXYA 1TLLA 1GPJA 221PA 1GUBA 5KC9A 3MG9A 1JECA 4XPIB 5LQKA 5BNIA 1WD5A 3EAFA 3RGGA 2E0IA 1GGVA 2XT6A 5HF6A 1FDWA 1VB5A 1YR9A 1L3BA 3PC2A 1NP6A 1NNI1 4L22A 4XTRA 1KFJB 3S44A 1OWPA 1L4NA 2DHRA 3EIQA 4MUKA 4Q4AB 3TPCA 3VGJA 1P0FA 3QWHA 4IFTA 1BJRE 1FP7A 2Z58A 3KB2A 1QK5A 3M4YA 3Q0EA 4HS9A 4N3GA 3PX7A 3PT5A 5KJFA 3IH5A 4LV8B 1NG1A 1UKBA 1E4EA 1U3DA 1R27A 2DR3A 2GESA 5KI6A 2NU9A 1LPOA 3ZWDA 3THYA 4GI2A 3LT4A 3F73A 1H1TA 4XFKA 2Q3HA 2NX2A 4PAWA 3BE4A 3K5WA 1UMBA 3MJRA 5AXAA 5B1IA 1D5WA 1EVYA 5CVJA 4ZOEA 3PPIA 1X6VA 4G1VA 3LHIA 4PX3A 1XX6A 1ZN9A 1G7SA 4ZALA 5DBFA 4REQA 3R7SA 4TL8A 5LWHA 2Q6OA 4EW2A 1SQFA 3CN9A 5GIPE 2PX2A 2VAXA 1KQ3A 1KP2A 3H0EA 3RTBA 2ZM5A 4X54A 2FEAA 4H7DA 3G13A 4BATA 9LDBA 1N6HA 2RI0A 4C3VA 2BFMA 1YD7A 4B7XA 1N2CB 2LW7A 3DLCA 3COJA 2JNWA 5AM0A 2NTNA 2BLLA 2R8EA 2DZDA 3ZHCA 2IS4A 2CSXA 4OL0A 2XUHA 1E2FA 2ID8A 5EAIA 1W1UA 2YW9A 3IAFA 3INYA 1MX3A 1RJEA 1ZG3A 3ETCA 3E48A 1VMIA 1QANA 1ZNWA 2WD8A 2PAFA 3WDKA 1EZ4A 2WU3A 4ER3A 2X4LA 1AMOA 2H5LA 3ETLA 4O59O 2G82A 1P2DA 3CG4A 3LRPA 1JHAA 3OCJA 4WOPA 1JDUA 3H42B 1A5ZA 4OI4A 3CVOA 1BCRB 3JU3A 5E1OA 3NVAA 4I7EA 1OBVA 1C0PA 1KNQA 1T2EA 5FWXA 4EO4A 4EA6A 4MQBA 2FH5B 1C5KA 1CPYA 1JG1A 1FX0A 3D9QX 4YPFA 4H17A 1NRXA 2XOKA 3NOQA 5DHSA 4LNUB 5IAAA 3MOSA 2PZJA 2FPLA 1QGAA 4WXRA 3MJDA 3CISA 2I3ZA 2P9JA 2VVTA 3IVCA 4OATA 5ALEA 5AOCA 3HJTA 1DKLA 2X77A 3ZWXA 3GD5A 2Q6KA 1IN5A 1Z39A 2VXBA 1MX9A 4WDQA 4C1BA 1N3LA 1ZJ5A 4JROA 4WEOA 2VXOA 5IJ0B 2ECOA 2J3DA 1VMAA 2YOGA 2WW8A 3MCZA 3WAJA 1MB9A 3Q7IA 1DZ3A 3TFWA 2RGDA 4DDHA 3TECE 1JWLA 3MINB 3DS8A 5C7IO 3HU5A 2YHBA 2Q07A 3DE2X 4IEIA 3VUFA 4CF3A 3RVRA 1JHVA 1KPGA 1YU6A 2QVCA 3SU8A 2VSXA 3WBBA 1TC1A 5J3JA 1OI3A 2FQ1A 4JP1A 2RB4A 1GTRA 1AM4D 1JLHA 3ZZUA 4U3JB 5BORA 1F5NA 3GJTA 4I55F 3Q3JB 4QASA 1YRAA 1I3MA 1OWNA 2AEMA 1AKTA 1NT2A 2RCNA 3PFBA 1AB5A 2OWDA 3BEOA 1SD2A 4H7HA 3PL5A 4J3JA 4OB7A 2HNBA 1KAQA 4YJHB 1FXSA 1UANA 2HQOA 3CMMA 3SBOA 4JI8B 2GLXA 1Q84A 3C5EA 2IHBA 3JATB 2CVQA 3ZLBA 4D82A 3IX7A 4GUDA 1GNLA 2VQ6A 5IKOA 2AG5A 3GPLA 3FA2A 4WINA 1A71A 3F5SA 2WWVD 5T6BA 2VP0A 3O9ZA 1CEQA 2J3HA 2IZ1A 5HJEA 2O6HA 3IXMA 3ITKA 4L8YA 5HZKA 1UIRA 1CYDA 2J9YB 3O75A 1XPRA 3N2NA 2ZS8A 1RABA 1RFLA 4LXHA 5F76A 1JIQA 1FYWA 1KPIA 4BJ3A 4BKQA 4V0RA 3PRHA 1UBHS 4JP2A 4HNTA 1BFDA 1CHDA 2VLBA 4UEJA 4BMNA 4DEYA 3G1UA 1TM2A 4ILEA 4YJFB 1E96A 1DKUA 5K45A 1KO1A 1Y3IA 4HADA 4XR4A 4D02A 5AVZA 3FI9A 2F64A 1ZU4A 1YR2A 4NS1A 1LBTA 4ZRNA 4UE6A 4MQMA 3X1JA 3GGJA 1NVVQ 4HGPA 4EB6A 5BRAA 2PKEA 4KLAA 4YJDA 2C4UA 4IRUB 3K31A 2YIDA 2LIVA 1CIPA 3ZS9A 3LJKA 1YB1A 3ORSA 5EFZA 1F1BA 2EZTA 3K73O 2VQDA 3FHJA 4MV6A 4MYRA 1L7XA 2K87A 4Z7JA 2QN6A 3CJTA 3P9XA 1W0JA 2BMFA 2IHYA 4DYDA 2W11A 4EW6A 3R5FA 1LEHA 2B4YA 3HU1A 1AGPA 2VWPA 2WFLB 4RYDA 1ZQ1A 1JR2A 4JUIA 1XZCA 2GD2A 4ACAA 5LR6A 2GXAA 4ZDWA 1IN7A 1RZVA 2EQAA 4TMXA 3V4ZA 4YRFA 4FYIA 3PCXA 1WY5A 1KI7A 1QJCA 1TZBA 5ICSA 2NU8B 4HNHA 3T15A 3ORFA 3CX6A 4DR3B 2XUPA 1RZ3A 4NSNA 3GFQA 2W71A 3ZS8A 1ZICA 5B1DA 2WKWA 2IX9A 4RESA 1I32A 1K06A 3GRFA 1ORVA 2F1KA 2AJLI 3OMLA 2N1BA 1OCEA 3WQRA 5JXIA 4AG6A 3OKCA 1YC2A 4TLAA 2QMQA 1ZXLA 2EW8A 5AVRA 4BQRA 2VT6A 1FL9A 1IQUA 2PZAA 1WOMA 2XKAA 2Y1KA 4ZQFA 2XWBF 3I6YA 2BSXA 3IGFA 4O4JF 3SQDA 4KR3A 1ZUHA 4K9KA 3RU2A 3OD1A 2WSSD 1AGXA 3AI2A 5BT8A 4GX5A 4P4TA 5DOVA 4A23A 5J4VA 2EKQA 1CUCA 3T3MB 2FE4A 4EY5A 1IY2A 2VDNB 4HUJA 3RG8A 3FW1A 3IAS6 3TFQA 1IFXA 3P2JA 3U1VA 4QM7A 4O4LF 4OAOA 1MVLA 4ZC8A 5KO2A 2CHUA 4WZZA 2O5EA 2CKDA 4RQTA 1M2NA 1P1KA 1MOQA 1VP3A 1A50B 2XNDA 2ZRJA 2Q3BA 4GP6A 4HYTA 3AR4A 1F7VA 4ZAYA 3W5IA 5JJBA 4EEZA 2Q7DA 3CEHA 5E8JA 3UJAA 3WIBA 5AKIA 3OEWA 3BHIA 4GOXA 2C8KA 3MBOA 2C3OA 4HAZA 5D5QA 4XSHA 2D1TA 4JYAB 4BVHA 3E0QA 1X1CA 3FWKA 1GSHA 1CQIA 5COQA 3BYZA 3ZDYB 1RAIA 2XDYA 3HFJA 2QTBA 2H29A 2XB8A 4L7VA 4RGQA 5LBUA 5LCXA 4E1BA 4G0MA 3O91A 4UQPA 5T3UA 1CY4A 1WQ4A 1RWXA 4TKVB 4U5XA 3VH3A 2JJ2A 3ICWA 4CTJA 3AP1A 3LHDA 5KYWB 4HGNA 3DKPA 4DT1B 3B5JA 1X15A 1LF5A 3ITDA 4ZT2A 1BXRB 2DUMA 1DIOB 1DC8A 1JIVA 3R3YA 4WOBA 4YVFA 3TDMA 2P5YA 3NIGB 3TDKA 3U56A 2O7RA 1G9TA 4MVJH 1E4OA 4E31A 9ABPA 3NU1A 4JYZA 3ZDBA 1W5FA 4I2VA 4GZMA 1RADA 3SMVA 1MDFA 2INGX 3FKQA 5EUMA 5C4MA 2ZIZA 1I7DA 1EXDA 2MSNA 5HGXA 2QY6A 1AKYA 3AQ4A 1JKJB 4LKOA 3NEAA 1ZD9A 3GPIA 3PV0A 2FN3A 4B82A 3H5TA 4P3OA 3RODA 3NLLA 2BMJA 2BFDB 4AKEA 2AHOA 1T13A 4KEAA 1N25A 1J70A 2X8JA 4PC2A 4ZOLF 3L46A 4TX1A 1KU0A 5EJFA 1LKZA 1KGSA 4KW7A 4AP6A 3TH5A 3JYOA 4YQEA 1E3QA 1SOVA 3NGMA 3EMVA 4PSDA 3HA3A 4ZI7F 1W88A 1CZHA 5BVHB 4MDEA 1EMDA 1NVWQ 2XOKD 2FY8A 4J16A 4XJXA 1Y1KE 1TKAA 2VJKA 1UEJA 3K71B 4BYMA 3CW9A 2ZB8A 1SVIA 3BXZA 4NBKA 4HTAA 1XPUA 1MMFB 4MGIR 5E4JA 1MRNA 3PE4A 3NBUA 2GRAA 3F1LA 3O8QB 2HD4A 4L5JA 3VZDA 1Y1PA 3ZC3A 1C14A 2P91A 5AVYA 1N9GB 2BKUA 3C3MA 4I4TB 1Y5LA 5EUCA 5LJLA 1H9BA 2PN1A 2ZJYA 4ZMBA 5CXQA 2AJBA 3QPVA 2CZCA 4PRZA 3E3OA 3U5TA 1XV5A 4E2ZA 2W6PA 1G2PA 4NZOA 4FR2A 1N2JA 1AF4A 3OQPA 4BNXA 2D4AA 3PFIA 2AZXA 3MWDA 4NBLA 3SFZA 3A1UA 2VH1A 4P98A 1XZKA 5LOVA 2R84A 1RQGA 1VE5A 1FFXA 2AMFA 2PWPA 2J3QA 1Z2DA 4ZVKA 4ALJA 3A8TA 3BX1A 3W6NA 3HUUA 4DY4A 1E1CB 4RKEA 3HJHA 4ND8A 4RFLA 5JVDB 4ZJYA 1IRXA 3RRFA 3CW8X 5HIIA 3KL4A 2GNOA 1MBZA 2ZRPA 2OP0A 1NVBA 3R3HA 2B4TO 3IAAA 4W1QA 1JFTA 5C35A 3B6JA 4GZ5A 2NAFA 4XDHA 3A1SA 3JSAA 1XTKA 3R4VA 4YUZA 3SBDA 3N8GA 2J7PD 3LOUA 3MC1A 1XHEA 1GZVA 3VHXA 2QJOA 4UVDA 1VLMA 4RY8A 5FUMA 2KS6A 4RIIA 1VIVA 5I9TA 1A9PA 4M76B 1KQFA 3U3KA 1QIIA 3A58B 1BD4A 3LCVB 5DE3A 3KQSA 5LUAA 4RVDA 4TN5A 1M6VB 9LDTA 4NJMA 3STHA 1XALA 5FR2A 1Z5UA 4BGUA 1OZ0A 3AW8A 5JOQA 1KS9A 2DRIA 3H8VA 2HRRA 1IC6A 2OD9A 3HKEB 3IOCA 3BKWA 4MVJM 1KHTA 5CX1B 3JTMA 3PC3A 1K2WA 4AY4A 3OH8A 4DLRA 2GRJA 4O4LA 5JV5A 2XZOA 5AUQA 1E2EA 1UP7A 1XCMA 3B7GA 5K3CA 4LF6B 1XQYA 2O50A 1UBRS 3O8LA 5CEEA 1SCUA 3L01A 2P11A 3HB0A 4YXWA 5IX8A 4X66B 5JFTA 2R7LA 1UMCA 2AFIE 3IEUA 4XPZA 4PQYA 4YALA 1BDBA 3CUTA 4KLRA 4XQEA 3JR3A 2C5SA 1GTJ1 4HAIA 4OFXA 3BWXA 4PNHA 1OLXB 2PRJA 5JJIA 3D8RA 2ODAA 3NAGA 4E4YA 1GA6A 1UMDA 3H2BA 3JALB 4YCLA 4MMYB 5A5VA 3CWQA 5MGNA 2WUFA 3UJBA 4ZYYA 5A4FS 1USKA 4MJXA 5AK5A 4Q15A 4BCDA 1K2VN 4DLKA 4D9JA 3N59A 2O54A 3CHYA 1S1MA 3T5TA 1E7MA 2NVOA 1G18A 3N2EA 2CMGA 421PA 3ZW9A 2YYSA 4OIMA 3KYDA 1XXHA 3MS4A 3VU8A 5GZ1A 3ER9A 1KRXA 1RLIA 5CVVA 3ROXA 1ZI6A 1ENOA 2AZDA 7MHTA 1QC5B 3R5SA 4TYYA 1PR1A 4QYTA 2J41A 2R6GA 1LGYA 4X93A 1IHDA 3PK0A 5ALPA 3I2FA 3O3CA 4JN6B 1JJAA 4GKBA 1MU0A 3KWLA 1AJEA 4G07A 4LXIA 1HG0A 1IH8A 3UOGA 2XECA 1WEKA 2G7ZA 2IPLA 2YVLA 1AUPA 2N75A 3IP1A 3PHIA 1G20E 2X0DA 1DQSA 1KERA 3EQ7A 3O4RA 5HIJA 1N2HA 1OX6A 1SVWA 3TJRA 1BE1A 3W6UA 2VYFA 3JQAA 2G9NA 1NUPA 2IOYA 1FYVA 2OY0A 2X1VA 3M82A 4RHTA 3VC7A 2HF7A 1VE1A 2WZDA 1E18A 4K9DA 2VHJA 3NTQA 3T0GA 3GLIB 2QRVA 2OCXA 2G1KA 1KK3A 4B6PA 1RM4A 2C95A 3ABIA 1I13A 2QHXA 4P86A 4RSRA 3SDBA 3ZCVA 1XNHA 1A8PA 1NVDA 4ZOLA 4CMCA 3TZQA 4ZFNA 1I01A 4NH4A 5JAZA 1GUZA 2BFBB 1WDLA 2JBAA 4B9AA 4LI3X 4E3WA 1A5BB 1AN0A 4RADA 1UJ5A 3AEKB 2WUDA 3NUQA 3D1LA 4NU5A 3VVCA 2PS9A 4P7KA 4DIKA 5E6RB 5IDWA 3SK0A 4WLFA 1VYUA 4CM4A 2Y1LA 1KZHA 2YASA 3AG5A 3G8BA 4LYAA 1B8PA 1FFBA 4RQBA 1E2DA 1ICEA 1OE0A 1DPGA 1OI4A 2WWIA 3IEKA 3L9WA 4NYMR 3WGZA 5AW4A 2LDBA 2VO1A 2F1OA 1P0PA 1PJAA 1I3NA 1OILA 2XITA 2Z1DA 5CNKA 1ZNXA 1LDBA 1SC3A 4EJSC 1Q3HA 4PX2A 1S89A 4NWIA 4Y3UA 4C4AA 2JFUA 4LZOA 1XN4A 1CDEA 1X87A 5E1BA 1KJYA 1M6WA 2XIQA 4RM2A 5DMXA 2PVSA 1IB0A 4F3RA 1NNEA 3DBLB 2QENA 1ZA2A 2RHGB 5CW2A 4E4RA 1RC8A 5JS8A 2XQJA 1V16B 2ZQ5A 2G08A 2OMEA 3AV3A 3FZNA 3NTLA 5LDHA 2JJ2D 1USVA 3E8SA 1IHUA 3RBAA 5LB2A 4DCGA 2WIFA 3F2VA 4GP7A 1YZLA 4FGSA 2IY8A 2A3RA 1Z34A 2TMYA 1JLRA 5BMOA 1T26A 3U4MA 4TTPA 3OAAA 1CP2A 4RCVA 4XWAA 1O57A 4YRDA 1RMTA 3ZXXA 4F85A 2Y2UA 3OCCA 2AVDA 4DQKA 5JU6A 2PJRA 2R6FA 4CQMB 2WV7A 2Z2KA 3IRUA 4LA4A 2M1XA 4Y1EA 2O3QA 1NW5A 1L4LA 1L8XA 5DNAA 2XB4A 3GAFA 4MO9A 1GU7A 4E94A 5KTRA 4BNMA 1N2IA 1PT7A 2BI8A 2VNJA 4QBGB 5EA2A 2ZCVA 1N34B 3PFGA 4FZVA 3VM6A 1SZJG 2FZGA 5LZ5A 3ORHA 3CKLA 1CWUA 5F3RA 3TRHA 5IM5A 1GGMA 1ONPA 3N2GB 3HKDB 4KN6A 1DDGA 4EYEA 4F56A 2P6UA 5G02A 1NXOA 3KOUA 4DNXA 1LK7A 3AHIA 3R3SA 4MQ6A 5KOJA 1P9RA 3A11A 4N39A 2F00A 2JI6A 2H52A 5ALJA 5JAIA 1CNEA 3SD7A 2I3AA 3P0JA 3QBTA 1I1HA 2JLBA 3GLKA 1BX3A 3V1LA 2NZWA 2ZJBA 5LNK1 3RVBA 3KETA 4WLVA 3RD5A 1NAHA 3EWIA 3KUDA 5CGZA 4MJLA 1IN6A 2X1LA 4O2BA 1UCFA 2NU6B 4EYOA 5DYGA 1YS1X 1G8KA 4IBOA 4TXHA 1XLUA 2QUAA 3WLHA 4MR8A 5H1YA 2R6AA 1ZGCA 1C41A 2C7BA 3LPCA 3PQ6A 3V8PA 4YECA 1CUJA 1R5JA 2J3LA 5EIBC 5BN1A 5ITZB 3RAFC 1EINA 4ZJUA 3WWPA 2DTEA 1B8VA 2GCIA 5ADUS 1W8IA 4JYPA 5ECWA 3ZY6A 1WKBA 1NLFA 5CJ2A 1B3BA 1O95C 1Y34E 4JBYA 4FTWA 1U7TA 2G88A 4M0EA 3K0SA 4NV3A 2HDNB 2WTXA 3G7SA 3L02A 1T9AA 1KP9A 1RLUA 2VTKA 3KUXA 1BO6A 5F7JA 2UDPA 5AM4A 4OI0A 2QW8A 2VK8A 3QVMA 3UG7A 3NRCA 1ZFNA 4J0HA 4G8JA 1PUXA 4LRXA 5FV7A 4AUEA 5DK6A 3JAWA 3VSDA 3I2HA 1TU4A 5K01A 1V47A 3LF2A 2HI0A 4ZAWA 5L7TA 1YC5A 3WKBA 2BMAA 1LW7A 1XRLA 4JZKA 5C8YF 1UJ6A 4J07A 5D00A 3GWZA 4BBJA 3TW0A 1NSFA 2QBYB 4KVZA 1QVRA 5GJVC 3EOZA 4YO8A 2WAOA 3GJXC 1RQXA 4PBRA 4PLHA 3HDHA 4TUYB 3VC3A 1NQUA 3M70A 3QOXA 1VBMA 4HEJA 4B9EA 1GT6A 1K1EA 3I8OA 4LZPA 3UWOA 1YDFA 3BHJA 5B55A 2B30A 3F7TA 2WKPA 1WMSA 3AFHA 4Q02A 3I37X 4U7JA 2HQSA 5CCDA 3EUEA 5CD9A 5IH7A 2KYRA 5ALRA 4K9NA 4NE2A 4QEZA 3SG0A 2JATA 5KTYA 4KXUA 1UPCA 3FMGA 4IXMA 4PE5B 2NZYA 2IIVA 4Z49A 4Q00A 3HHEA 4DNFA 2G17A 1XJ0A 1GXSA 2KQUA 4IIVA 4WK0B 1KVUA 2C1XA 2G04A 3A9TA 3AHCA 4HDSB 5AVSA 2QQGA 3VI4B 2VT2A 1YXMA 4CLXA 1TUEA 1Z6YA 3LZ6A 4QECA 1T4BA 2EZ9A 1VE3A 3BXHA 3U39A 3N0RA 1G42A 5JH7B 2C5EA 2DH5A 2PKXA 4Q03A 4QGSA 2H0AA 4KAAA 3ANSA 1LX6A 1QLJA 1C4WA 2IP4A 3MTJA 3ZW8A 5C8VA 4B76A 3KOOA 3OJLA 4DNQA 2O1SA 3DGEC 1FFWA 2JCYA 5L3QA 4MW2A 4WLNA 5FNVF 1DAPA 1JQDA 4BL5A 3K53A 5KYXA 3KG2A 5B3LA 3EQ6A 3EEBA 3ZGVA 1PT6A 1N2CE 2FPRA 3CEAA 4GGOA 4RHXA 2WTEA 3GL9A 2ZTLA 3LSTA 3U3JA 4I4LA 5ALSA 3SICE 3GYGA 3K1TA 1A2QA 1Z0JA 1V1MB 6NULA 2F3RA 1ZIYA 3QQPA 4Z9XA 2ERCA 5A6SB 4AJ4A 5CLFA 3UPTA 4JI2B 1GQRA 2EJBA 3OMWA 1XZJA 2DFLA 3IR6A 5F5LA 4DIFA 4M54A 4TS3A 3RS2A 3VJLA 1DSSG 4UD2A 4WVLA 4L4UA 4ZPJA 4X63A 3E5NA 1D6JA 4BYGA 2Y27A 4YUYA 3Q3VA 4JI3B 4TV9F 5D5HA 2FPGA 4K9OA 5ENZA 3MWLA 4R83A 4RJIA 3RHZA 3WV5A 1GAQA 4BNFA 2H92A 5AMXA 3E9YA 1N2XA 5EG5A 2H1FA 1SWVA 2VDKB 4IMRA 4XIYA 1IN8A 1AGRA 1AT1A 2ZJ0A 1AG9A 4L9WA 4MI1A 1ZRNA 2EOAA 5CCXA 4JLJA 1ZSVA 1QAMA 1GDHA 3LT0A 2VRBA 4TS9A 5HFAA 4OM8A 1P7ZA 4Q4JA 5FL7D 4RZ2A 4DLTA 2XLBA 4YMIA 4XQGA 1W4RA 4EK9A 1WVIA 3BJEA 4PAGA 4CNBA 4FHFA 3WTCA 1BHQ1 1Y8AA 3BFPA 1MQ9A 4QUGA 1AQUA 5TMDA 1SXPA 2ZRHA 2AQKA 2GKOA 3NHZA 4OQ4A 3TLEA 5A3RA 1UEXC 4E2WA 1E0DA 4ADSG 4YRNA 3R74A 3ZQJA 5DV9A 2XMRA 2HSJA 3G5LA 4HZGA 4DM3A 4RBNA 1Y3FE 4PFSA 2A9QA 1HLGA 2IKQA 4PEVA 4PPFA 1C9EA 3A25A 2GZAA 1V7ZA 2Z8YM 4IR7A 3G2HA 4F38A 3GJ8A 1EUDA 3CLTC 2O3RA 4QLBA 3MAJA 3NEYA 2JFXA 3H4TA 3QVKA 4IVQA 1JEJA 4BFVA 1QTIA 4XR9A 3NBKA 4G09A 1WHSA 2WG2A 1UL1X 3KR2A 4CEIA 5EHGA 2R4TA 4H7PA 2QM8A 1ZKMA 5T4HA 2ZIVB 2V0CA 3NIDB 2HCJB 2G8LA 5DCLA 3OAAD 2R44A 4BN4A 4E15A 2WK1A 5JCJA 5I48A 2POQX 3TGPA 1N36B 4D46A 5JAMA 2LUOA 3B52X 1C9MA 1H0KA 3N05A 3PZRA 3GFRA 5LZ8A 4J0DA 2EL9A 1QAOA 1YCHA 3BK2A 4YC7A 5CYPA 2V7GA 3UYKA 2R8OA 4ZHQF 3B8EA 2OESA 3K1AB 4YCAA 1JI0A 2PAAA 4XQCA 4BWYA 1RWPA 1SXJB 1C8LA 4D4LA 2BH2A 3AY3A 1C1XA 4MAMA 1DCMA 3QF7A 5CH5A 5C8YA 2PRYA 2AMYA 1V8PA 2DQSA 1YIOA 2W43A 1VE7A 1I7LA 4XD2A 3FJ1A 4RDXA 1KF0A 1G8AA 5ADWA 3EUAA 5EHZA 2G1PA 3CXRA 3IVRA 3SZGA 3I34X 4EG5A 1SAYA 5D1HA 2XXAA 1SB8A 3T7EA 5K3OA 1R4MA 1PFWA 3AKDA 3HWRA 2Y9PB 1UBMS 2Q6VA 1PFQA 2Q6IA 2ZYIA 3Q3IA 4G56A 1GQOA 1I8TA 4BFXA 1B1CA 1W5TA 2GYYA 2ZROA 1DELA 1R0WA 3K30A 3G0DA 2IVZA 3W5HA 2IS1A 1U04A 3H18A 3K92A 3EASA 3EMKA 2JCVA 1CF2O 3EQ2A 4PS1A 3C3YA 3CUWA 3G68A 3BE8A 1LVHA 4LVNA 2YFQA 4RPIA 4XYMA 4OQLA 1Z33A 1JNXX 2Z2XA 5TSDA 1U8YA 4TYMA 1M2KA 4MROA 3SIPA 5K2OA 3W8DA 2F59A 4E5PA 1BAPA 5LQDA 2Q0SA 4OSOA 3AERB 3EY9A 3NDIA 1YB4A 2WJZB 5L7YA 1EQUA 4XWWA 2CVHA 4ZOBA 3EXG2 2GEVA 4UJ5A 3LUAA 1PQWA 4B79A 2QP9X 3ODGA 3H2HA 2BSQA 3ISJA 3A1FA 1AA6A 4G86A 1V1RB 2C2OA 4RY0A 5IS2A 2EATA 1PVVA 4JH0A 4GMDA 2YV2A 1RZRD 2O7QA 1MC4A 3AESA 1OKKA 2IUSA 2BCJQ 2FW1A 4NEGA 1DUSA 2F8MA 4O2RA 1ELOA 1RJDA 1F0YA 2PWAA 3T06B 2QZSA 2OYCA 3UFBA 3L4KA 4C22A 5I7RA 1RWKA 4I1VA 4DMGA 1S3GA 1DRVA 1S2IA 4OKSA 1L1RA 4TROA 5HKKD 5FI5A 2VJMA 4CXMA 3DXYA 5ISMA 1M5UA 1P0IA 1D04A 4LNHA 2BKVA 2XA1A 1DU4A 2GAIA 1EVKA 3BIOA 4IP0A 3Q85A 3EVNA 4LECA 2XHZA 4QYIB 3TX2A 4BVLA 3T3OA 3NM5A 4H18A 3AL2A 2IFTA 1TTQB 3B1FA 2Q2NA 3H1TA 4IVPA 3W2HA 5FX2A 5HQTA 4R3NA 3EOBI 5EWJB 3BFVA 3D8HA 4FEAA 3V8VA 4EHJA 4RKWA 4B3MB 4TV9A 2LDXA 3I58A 2X7HA 3ESYA 3R6DA 2CBGA 2GPYA 5FBKA 2A0WA 4EF6A 4RA6A 1E2KA 4ZVMA 3W5JA 2QVBA 2H65A 4OB6A 1O0CA 3WIDA 1SUBA 2DPXA 2VFAA 1X14A 2YIMA 2JI9A 3EBOA 3GFGA 3GRPA 1HG1A 4QOIA 2BWJA 1OF1A 4RV9A 4TYWA 5TR9A 3UO8B 2X8WA 2XT0A 3UAGA 5K0EA 1QQBA 5AQEA 2FNAA 2CJWA 2H11A 2NO9A 4HC4A 3LTEA 2IPNA 2Q99A 2QW1A 2I34A 3H0KA 1A8QA 1E3JA 4LQ4A 3MB5A 3MNFA 3HCNA 4O1IA 4PZ0A 3CN7A 1ECJA 1LSOA 2ZJZA 3CH4B 5FWYA 5KWIA 4DE5A 1I2AA 1X3SA 2HMAA 2YJNA 2ZE6A 3PXCX 1XRJA 3IAXA 3WIOA 5IKPA 5AVJA 5JFGA 5SY4A 2QMZA 3TCNA 5JZ9A 1V11A 3FSGA 4XARA 3UCXA 1UDCA 5BRNA 3W3AD 1VHQA 2NOAA 2ZBUA 1E7QA 1EE1A 1KYZA 4PYKA 3JQRA 2P2ZA 2VUUA 1T4DA 3DDUA 2GCEA 3NPMA 2OHGA 3CT6A 4ZAVA 3ZNOA 1OB5A 3R3UA 1I36A 5HUJA 2IS2A 2BL4A 1AH2A 4P81A 4LNAA 1Q0UA 3HLYA 1EB8A 5FR1A 3UMYA 4HLDA 3OSZA 2QWXA 1T3GA 4PN7A 3QFCA 5DBGA 3SY8A 1YZKA 3AY7A 2ZBGA 2CUZA 4OQDA 1G8GA 1HYQA 1N5DA 1RACA 1VMDA 1YQEA 2H5JA 2Z09A 3HVHA 3N86A 3QPBA 1DEKA 2BSAA 4CM8A 4E5UA 3SHVA 2WWWA 3O6VA 3WOVA 2JFBA 2Y1OA 3CVWA 4EJSA 1UM9A 4P33A 3DB2A 4UM9D 1REQB 4TKMA 3Q6NA 2CLCX 2H6EA 2JCGA 3NTRA 1F12A 2DWOA 4RULA 1LPSA 3CNOA 2BDEA 3I6MA 5CLQA 3TLKA 3UICA 2P3QA 2PMCA 2RHRA 3I05A 2HU7A 3WRYA 1SBNE 2XDAA 1Z29A 5HQ3A 1JEYB 1QZ3A 2JA1A 2B5WA 2HF2A 4RJLA 1IWPB 3RHSA 4YPOA 4FGWA 1Z4QA 2RGGA 1DFIA 1JFRA 4MEBA 3VQTA 4L4RA 1FYDA 1D1PA 1FTGA 3UW1A 4C43A 4YT4A 1K89A 2Z9CA 3UJDA 3AEUB 3QYJA 5AUOB 2IBTA 4HP8A 1BWRA 3F9IA 2AUNA 4NG4A 3GEEA 1TZJA 4P3YA 4EJMA 3F2IA 2NXEA 1QH8B 3X1ZA 4DQ0A 4OK3A 2BGWA 2AT1A 2IEYA 3GLHB 4F7WA 1TFUA 1T2FA 4O4IB 4R7TA 4UTRA 3VR1A 4A0GA 4GW3A 3Q8WA 2Z0MA 3DCJA 4FT4A 2GCGA 3ISVA 5JANA 1O1YA 4W1SA 3GAZA 4W9RA 3ZBUA 1QHEA 2VWQA 3THXB 1X1TA 2FWNA 2XCLA 3GH1A 3ZWNA 4EECA 4Z8YA 1NAIA 4YAUA 3HBLA 4HAVA 4I50F 4RKFA 5FFMA 1Z8DA 2OXIA 4FYVA 1BE6A 1CY6A 3F3MA 3TGWA 4UMFA 4ECEA 1IXYA 2PCJA 5JD6A 2AC4A 4E21A 4G5GA 1W44A 4O4HF 1II8A 1CRWG 1UK6A 3EG9A 2DU8A 4OI1A 4GOLD 2XMGA 1M9NA 1NVGA 2RAFA 2ZRCA 3BK1A 4A0SA 4ZDKA 5IUNC 1VCOA 2D7JA 2EFJA 3OZCA 1FOEB 3SEQA 5AH0A 5KNDH 1UBSB 3ICOA 5JCJD 2IY9A 4BU1A 4JIMA 1O0SA 1S7GA 2VNAA 3REQB 3RLIA 1STOA 3M6MD 2QMHA 3E84A 1KEPA 1DAKA 1EXMA 4QPPA 5JDIC 2W2KA 1MJ5A 2G80A 3EVGA 4IJQA 4DPKA 4AY2A 2WWHA 1FS4A 3E2IA 1Q77A 3HCBA 1ISPA 2AK3A 2WSMA 1PJQA 1DTSA 2VWHA 3L8FA 4AO6A 1JQ5A 3SZUA 5E1DA 4C4ZA 2X7JA 2WYWA 4BGEA 4DHWA 1IUPA 2JJMA 2PX0A 1JG4A 1O94D 3DVAA