2OCLA

Crystal structure of valacyclovir hydrolase s122a mutant
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
254
structure length
254
Chain Sequence
SVTSAKVAVNGVQLHYQQTGEGDHAVLLLPGMLGSGETDFGPQLKNLNKKLFTVVAWDPRGYGHSRPPDRDFPADFFERDAKDAVDLMKALKFKKVSLLGWADGGITALIAAAKYPSYIHKMVIWGANAYVTDEDSMIYEGIRDVSKWSERTRKPLEALYGYDYFARTCEKWVDGIRQFKHLPDGNICRHLLPRVQCPALIVHGEKDPLVPRFHADFIHKHVKGSRLHLMPEGKHNLHLRFADEFNKLAEDFLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Valacyclovir hydrolase
publication title Molecular basis of prodrug activation by human valacyclovirase, an alpha-amino acid ester hydrolase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 92
structure length 254
sequence length 254
ec nomenclature ec 3.1.-.-:
pdb deposition date 2006-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2oclA00
4KYVA 4JYMA 1HLGA 1QO7A 3BXPA 2WUDA 5FRDA 4CCWA 3H0CA 4B0PA 2WIKA 3I2FA 4H7IA 1FFCA 3FLAA 3AIKA 1G42A 4TVKA 2ZJ6A 1FJ2A 4GECA 3IA2A 5K3AA 3IUQA 3S8YA 4IH9A 5JYCA 3B5EA 1GKLA 2XUHA 2HA0A 2WM2A 5LZ5A 1ZOIA 3HZOA 5ALPA 4UFNA 2XE4A 2XUKA 2PSHA 2E3JA 4BCBA 4YK7A 4QLOA 3D5EA 1CUGA 4X94A 4X7BA 2AXEA 3DL4A 3RM3A 4DMCA 3ESCA 1QIMA 3FYUA 3WA6A 1DX4A 4ZI5A 4UBKA 3ZLVA 2X76A 1TCCA 3LS2A 5HKAA 2VJCA 5FV4A 3O0DA 2Y6UA 2J3QA 3EQ9A 2XMBA 1EVEA 1QGED 1QIDA 4J03A 2XT0A 4QWWA 3FCXA 5C81A 5DNVA 4A5SA 4UHFA 4DMKA 1SOMA 4BTVA 2QUAA 3HLKA 5FDFA 3H04A 4PF1A 2HADA 5ALHA 2WIJA 2QMQA 5AHXA 5KBYA 1THGA 4G9EA 1B41A 4UBOA 2ZSHA 2PSFA 1JMYA 4DNQA 2QRUA 2HDWA 3WYNA 3PE6A 3EQ7A 2ZVDA 1IUOA 2HHAA 3W9BA 4Q34A 3A70A 3R3ZA 4UHEA 1GXSA 2CKMA 1BRTA 1Y7IA 1XRMA 1USWA 4H7FA 4S0XA 3V1KA 5ALKA 3U1TA 5KWIA 5EHNA 3GZJA 4UUQA 4Z49A 5C8XA 5A6VA 2P8SA 4KE7A 2WHPB 1HKHA 5A62A 2XMRA 1XZKA 4FKBA 4EHBA 1ODSA 4B80A 1XZLA 5T4EA 1QZ3A 1FFBA 1R88A 4BAZA 4H18A 5CT8A 1E5TA 1BEEA 1B6GA 1QTIA 3DDUA 4EB0A 1NX9A 1DWPA 1YA8A 4J3JA 3QH4A 4U2FA 4FTWA 5AJHA 2WJ3A 5AM0A 1ACLA 2OQVA 2JGEA 4EY7A 4BP8A 4IH4A 1DTEA 2AJ8A 1BCSA 4KE9A 2QT9A 4E15A 1UKAA 5AI6A 3AZQA 4B81A 3H1AA 1YAHA 4OB8A 2WUEA 4LIPD 5D6OA 3O95A 4Q82A 2YH2A 2J4FA 4J0HA 4BVLA 2GBGA 3R40A 5K3EA 1CUBA 3DKRA 2OGTA 3ESDA 4B83A 1BE0A 3STTA 2BUBA 3KWJA 1W4LA 3C43A 2J3DA 3OTQA 1TKRA 4BB0A 5LZ9A 1CUSA 3U0VA 4C01A 3O9MA 1P0MA 3AFIA 3O4JA 2GBFA 4DSAA 1RP1A 3M82A 1YSCA 4YX9A 3FLBA 2WFMA 3VISA 4Y2JA 1CPYA 1AMNA 2G63A 2ROQA 1HDEA 3CXUA 2DFPA 1XQWA 1VE6A 4CCYB 1H23A 3Q8WA 2VA9A 3ESBA 5HQ3A 1MX1A 1XRQA 3I2GA 4ITVA 3STVA 5DLPA 3WLAA 2PPLA 1ZD2P 1CIJA 4WY5A 1XZCA 1D07A 1N8SA 4G9GA 2DQYA 2JGMA 2XMZA 3HABA 4MXDA 5JAOA 3FVTA 5AOCA 3MGAA 3VXKA 3O9VA 2R11A 5IVIA 3BL8A 1QE3A 2ACKA 3WJ1A 4DTCA 3C70A 1IZ7A 2W6CX 4ETWA 1YA4A 5IVHA 4AO7A 3O4HA 3QMVA 4AX4A 2D5LA 5JANA 4AO6A 5CBKA 5JZBA 4Y2QA 3A2LA 1MNAA 1YB6A 3I28A 5A71A 4I4CA 4E46A 3BE8A 3H19A 1IZ8A 1UK6A 3LCRA 3OC0A 4JH0A 4KJXA 1ZD5A 3G8YA 5HF5A 2XQFA 4N5IX 4Y2XA 2XB6A 2ZYHA 1AKNA 1K4YA 3L1JA 1K6EA 4KAJA 3WL8A 1H2YA 3IUMA 2DCMA 3A2MA 4CI9A 5LLSA 2YYSA 5ESRA 3WWDA 4HRYA 2JGIA 3H18A 2VATA 4L3WA 3FOBA 4X85A 6YASA 1CUXA 4ARAA 1SC9A 1CUIA 1VJ5A 1QIEA 4QE3A 2BKLA 1NU6A 5AK3A 1GQRA 2OG1A 4DLNA 1K5PA 4HZGA 2CEKA 1CUYA 1S8OA 1VZ3A 4X6YA 3ED1A 4Y2UA 4Q3OA 1U4NA 3JW8A 2ZYRA 4UHBA 2BAGA 3D7RA 3BF7A 1E8NA 1EI9A 2AJDA 1T2NA 3ANTA 3I2IA 4B6GA 3WKBA 2CUTA 2RI6A 4DGQA 3F8SA 3NGMA 4Y2VA 2QTBA 3VJMA 1ISPA 4ZWNA 5CRIA 2Y6VA 5BWCA 3OPMA 4NZZA 5KREA 3IIIA 1JMKC 4X6XA 5K3CA 1EB9A 1ZGCA 1XKTA 1XQXA 2LIPA 5ALFA 4M0EA 3JWEA 1JJIA 2WIFA 2XUGA 4BYMA 4K2AA 5AKGA 4Y2PA 2HA3A 1MNQA 5EIHA 5LZ4A 4Q3LA 1WCYA 4DSZA 4AB1A 4M0FA 1GQSA 5EHZA 1XZJA 2EEPA 1AZWA 2C0QA 4XWGA 3KWFA 3DNMA 2VQ6A 1MT3A 2ZJFA 5AKJA 3NUZA 4J0CA 1Z68A 2QS9A 3C8HA 2Z8ZA 1JJBA 4PV7A 4DNOA 3G0GA 3QPDA 4KE8A 5I8PA 1TCAA 3H2HA 1XZFA 1LPBB 4HAIA 2GYUA 5SYNA 3ZWQA 4N8SA 3V48A 2XLCA 2OGZA 4BAUA 3ZLUA 5JZSA 1XQVA 1WOMA 5D3ZA 2HU7A 5DTJA 3H2IA 4EY5A 3A2NA 4X92A 2Q0XA 2QM0A 3B3QA 2BGRA 3G02A 1W75A 2EDCA 1I6WA 1LZLA 1PJAA 3FVRA 3DCNA 1CUEA 2WHRA 4X90A 3TEJA 1GT6A 4WDRA 3SX4A 3DYIA 4IQ4A 1YCDA 1UKBA 5CMLA 4QZVA 1CQWA 3G0DA 4AZ0A 1Q0RA 1P0QA 4ZRDA 4Y7DA 2JF0A 4F21A 5AM4A 1CQZA 1LBSA 4WJLA 4KAFA 3R0VA 2WG2A 4U2DA 5C8VA 3STYA 1BS9A 3IVMA 5D7BA 4U2BA 4HS9A 2GZSA 3QMMA 1RWQA 4HRXA 3RKSA 5EFZA 2JIDA 4B82A 5AH0A 4KAAA 2D0DA 1MX5A 5AM1A 4Y2SA 2EDAA 3DJYA 1VXRA 5ALDA 1X70A 1DQYA 1JT2A 2X8BA 4B84A 4RNCA 1W52X 2XQGA 5CH3A 3D2BA 2XUFA 4BC1A 5K5EA 5LIPA 5A7FA 1CR6A 2C5GA 3E1GA 1OILA 4B0OA 5HZGA 2B4KA 4J0DA 3S2ZA 3WK4A 1U65A 1F6WA 2CBGA 4E14A 3QZUA 1ZI8A 1CEXA 1E8DA 1ZIYA 4CG2A 3FSGA 2FJPA 1LPPA 4EY4A 3V1MA 3C6YA 5ALGA 1W1IA 4H7JA 5JADA 2AJLI 3GBSA 2BCEA 3H2KA 4RGYA 3X3HA 4L72A 4EZIA 1ZGBA 3G9UA 5SYMA 5EGNA 3GROA 1J07A 1YS2X 4UBNA 2XUIA 5JAUA 1GPLA 3WWOA 1MU0A 1EK1A 4BZWA 4UHCA 5CURA 1VLQA 4BVJA 3TRDA 3D4LA 2FX5A 5AI8A 1UK9A 4V2IA 2JGJA 4BBZA 5FXMA 1R9MA 3AUKA 1EVQA 1L7AA 4ZGBA 4DMFA 3K9BA 4AN0A 2HRRA 3IUJA 2PU7A 1MO2A 3F67A 1SCIA 3WJ2A 4WFJA 2XQKA 4C4ZA 5DJ5A 4C4YA 5KWJA 2XUPA 3HEAA 2H1IA 2RIPA 4ARBA 2QJRA 2CZQA 2OXEA 2W22A 1VA4A 3T4UA 1N5MA 5ALLA 2Z8XA 4CIBA 1EK2A 1IUPA 3WKDA 4MQMA 1EHYA 7YASA 1CFJA 4BZZA 2DSNA 5AKIA 3GUUA 2H9YA 1AQLA 1ACJA 1UXOA 1WB4A 3EIOA 4OPMA 2GYWA 2O7RA 3DS8A 4FLEA 2C58A 2G5TA 3M3DA 2PX6A 2VJDA 1BN7A 1SCKA 2WFLB 3FNBA 2WHQA 4AN1A 2OCIA 1GPKA 4UFPA 4HXGA 4BCDA 2J4CA 4KEAA 1XLWA 4BRZA 1LPMA 4G8DA 4F5ZA 4QA9A 1J1IA 2QXTA 4HVTA 1YB7A 4RPCA 4ZV9A 2Y2VA 3PUHA 3HI4A 1WB5A 2BUAA 5DYTA 5AI4A 2HRQA 3D0KA 3WWCA 2HIHA 2RGUA 1LNSA 4WCVA 3LLCA 4G4JA 1UKCA 4OCZA 3I2KA 3WA7A 1HBJA 3HYSA 4LXIA 5DNWA 1VA5A 5BWBA 1XRRA 1K8QA 4I3FA 2WU3A 1YAJA 4UHDA 2ZYSA 3WWPA 1E89A 2Y2UA 2WJ6A 4MJ3A 5HFNA 1ORVA 4OU4A 3VVLA 4C87A 3F9CA 5HFAA 3OG9A 1EXWA 5AM3A 2HFKA 4L0CA 1A8UA 4B85A 3K2IA 2WHPA 4EBBA 3CCBA 4MEAA 3FAKA 1XQYA 2YXPX 5AI0A 3STWA 2XMCA 1TK3A 1X2BA 3WMRA 5ALRA 2JEYA 2FJ0A 3FCYA 1XROA 5CT6A 1Q84A 4G5XA 3HC7A 1DINA 1AC5A 4FLMA 3IDAA 1AURA 3I2HA 4BDSA 2HL6A 2BFNA 3N2ZB 2XUDA 1XZEA 3WL6A 1JU3A 1ZD3A 3B12A 5CTAA 4U2CA 5LZ8A 2ZJ7A 1UT6A 2X5XA 4BDTA 4QDXA 2WTMA 5DYWA 1QIKA 2WIGA 4FNGA 1ETHA 1UZAA 4C89A 2ZYIA 1CRLA 4J7AA 5J3JA 1LLFA 4EY8A 4UBJA 2O7VA 3MUNA 4MQLA 5AK4A 5AKHA 4CG3A 1EDEA 1TCBA 3DKKA 2PSDA 1A7UA 4B9AA 5K3DA 1QIFA 3R3YA 4TGLA 5ALUA 1JJFA 1XZGA 3SC2A 1QIGA 1TQHA 4WFKA 1Q0ZA 2Z5GA 3I1IA 4PW0A 5HCUA 5EIAA 4Y2YA 1EX9A 1X2EA 1WHSA 2HA6A 5A7HA 4FLFA 4OD0A 4M0MA 2I78A 5ALVA 1DX6A 1WB6A 2XMQA 2I03A 3AINA 4RE6A 5D3KA 5JAPA 1GPNA 3ZI7A 4UBIA 4CCYA 4BRSA 3D3NA 1C4XA 5E4JA 4Y2RA 3O4GA 2QJWA 4AXBA 3C6XA 1CUAA 5CW2A 3ICVA 3HRHA 2DHEA 4H7EA 5JASA 2Z3ZA 3WIBA 3M81A 4GDMA 5ISMA 4OB7A 1CUDA 5AI9A 2JBWA 3WZMA 2IIVA 1UOPA 1CUCA 4LYEA 2OGSA 3WL5A 2CJPA 2HA2A 3FWHA 4WDQA 1EDDA 5HK9A 4U2EA 4E11A 2PU5A 2WLSA 1LPOA 3HJUA 1THTA 2PUJA 4GEGA 5CT4A 3VVMA 3AIMA 1G66A 5ALOA 3CN9A 5EIEA 5JARA 4P08A 1KEZA 4H35A 4GI1A 3L1HA 3I6YA 3AIOA 3KDAA 4X97A 4Y2TA 1GZ7A 2VF2A 4PSDA 1GKKA 1MPXA 1A88A 3IB3A 3CN7A 3ZLTA 2PUHA 2WG1A 2C0PA 5I9IA 2VT6A 5K3FB 5FPPA 1Y37A 5FLKA 1ZIXA 4G4GA 5JZ9A 3UMJA 3WQHA 1XRPA 3IURA 3WYDA 3FLEA 3DL7A 3VDXA 2CB9A 1VZ2A 4OSEA 5AKYA 3O4IA 3R3UA 3RK4A 1HPLA 1WPXA 1CUUA 1R1DA 3WIOA 2PBLA 5JD6A 1H2WA 5YASA 4P93A 2QR5A 1H2ZA 1XLUA 3GA7A 2QKYA 4DNPA 3VJKA 1CUJA 2B20A 2VSQA 4TPKA 3H2GA 3MVEA 2CMFA 3QPCA 3E0XA 3G7NA 4CFSA 5FKJA 3ANSA 2ONCA 1U8EA 3BWXA 3W2TA 4W63A 2PKYX 3HSSA 2XMGA 3LP5A 5IKXA 3BJMA 3FSGD 1VKHA 3STXA 1XRLA 2RAUA 1A8SA 2QZPA 4OU5A 3BDIA 3PI6A 1JU4A 1ZJ5A 3QPAA 2AJBA 2XUOA 3BDVA 3WI7A 1Y7HA 3FYUB 1G5FA 2XMSA 2FUKA 3C8DA 4FWBA 3DOIA 4C6HA 3KOOA 2XQJA 1WM1A 1TRHA 3UUEA 2WFZA 4FHZA 5H3HA 4BC0A 4J0GA 1MN6A 1HQDA 3I6ZA 3QM1A 4FNMA 1VE7A 3I6MA 4Y9SA 2BUCA 2OQIA 1CUHA 3BIXA 1CLEA 3QMWA 4Q1VA 2ORYA 4X3CA 4QDZA 1FFEA 3KXPA 3W06A 3DOHA 2WUFA 2Z3WA 3M83A 4JUIA 1DT3A 3AZOA 3DEAA 3G0BA 4X95A 1CUFA 2ECFA 2HU8A 2H7YA 4QWMA 2JGKA 3WK6A 3F97A 4H0CA 4PQEA 3TJMA 3CCCA 5K3BA 4HXFB 4AMZA 5ALYA 4XJVA 4LXGA 2BJHA 4X91A 1IUNA 1QLWA 4KACA 3MUOA 1UWCA 5A2GA 4LYDA 2QUBA 5C7YA 3KD2A 1KU0A 3LIPA 3STUA 4W1PA 4PNZA 5JD4A 5IVKA 1QIIA 5LZ7A 5F4ZA 1R3DA 5AKLA 4ZREA 4DIUA 3GFFA 3EQ8A 1IMJA 1UK7A 3WK9A 2ES4A 3C6BA 3WL7A 5CH8A 5JIBA 2WJ4A 5FUMA 4JNCA 1QO9A 2YASA 1E66A 5AP9A 2DHCA 3GELA 5FP0A 2QXUA 3E4DA 3N0TA 3FYTA 2O2HA 1BN6A 4WY8A 5ALZA 5AK6A 2WG0A 5DNUA 3WZLA 3WK8A 4BCCA 4OYYA 5JAHA 4MWSA 2XQIA 5ALTA 5AOAA 1ZJ4A 2JGLA 4BP9A 4BVKA 4FBLA 3PFBA 4P9NA 5AO9A 1JI3A 1R9NA 5E2IA 1DT5A 5ALNA 5FOQA 1XZBA 3A6ZA 1ODCA 4XVCA 5JALA 5CXXA 3W05A 1R50A 5T4FA 3C45A 4H7DA 1XLVA 3C5WP 3QVMA 5CH5A 1F0NA 4YPVA 2XUQA 5HF6A 5E4YA 5C8ZA 1RYYA 5IVDA 4NVRA 1QIHA 4FOLA 3C6ZA 2PSEA 5BV7A 1QFSA 1L7QA 2GBCA 2XMDA 4LHEA 1CUVA 4P92A 3PF9A 3V1LA 3OM8A 4QEKA 1LBTA 5AOBA 2G5PA 1MAAA 3WKEA 1AX9A 1EA5A 2PSJA 1SFRA 2WSLA 4NS4A 4W1RA 4F0JA 3E3AA 1FFDA 1E3QA 2K2QB 1LPAB 2OLEA 1HL7A 1JFRA 5AIAA 4INZA 4N5HX 3WKAA 3OURA 4ROTA 3V1NA 1XZHA 2XUAA 4UBMA 2AJCA 5CXUA 2BGNA 2V96A 4IO0A 4CG1A 4GXNA 1C7IA 2QVBA 4EY6A 1DWOA 4QNNA 1EINA 3DYVA 4H77A 5ALQA 5ALWA 3BF8A 2VJAA 4H7HA 1O6FA 1TIBA 2HA7A 5I7UA 3QYJA 1J06A 1F8UA 5ALXA 2B9VA 1M33A 2HA5A 3R41A 2XI4A 3G0CA 1DWQA 5HQ3B 1ZI9A 3H2JA 1J2EA 3K6KA 3QBJA 2HM7A 3PDCA 4OYLA 1DQZA 1G4HA 4XIIA 3HXKA 5DYYA 1LGYA 4CIAA 1O6GA 3KSRA 1MTZA 1F0PA 1MJ5A 1LZKA 3AJAA 4W1QA 2DQZA 4EUSA 3G9ZA 1QOZA 1CUZA 1UFOA 2HA4A 3V9AA 1QFMA 2GZRA 1BU8A 2XLBA 3PF8A 4GLBA 5LKAA 3PFCA 1W6RA 2V9ZA 3I2JA 3H1BA 3RARA 4W1SA 1A8QA 2C4HA 4J0JA 4ZXFA 1U2EA 2PM8A 5AKXA 1IVYA 4IH1A 4LXHA 5AI5A 4EA6A 3FYUC 2WFLA 4PO3X 1GGVA 4DM7A 2H7XA 1QIJA 1WPRA 4Q05A 2I3ZA 1SCQA 4BE4A 4QDUA 3DQZA 1ZICA 1AUOA 5AM2A 3PUIA 2WTNA 5HKBA 4OB6A 4W9RA 1LPNA 2V97A 5T4BA 1VOTA 1OXMA 3F98A 1XZMA 3IUNA 2DHDA 4F60A 2WU4A 3VJLA 2JEZA 4N8EA 1ORWA 3SWWA 1BROA 5HF8A 2DR0A 1YASA 1H2XA 1LPSA 1Q83A 1NU8A 2HFJA 3D2AA 2O2GA 4WFIA 1OCEA 4C4XA 3ICWA 2WUGA 4FFWA 3W9UA 1XZDA 5E4TA 2WILA 4IHAA 5LP1A 5T4HA 5ALMA 3IBTA 1K63A 3PICA 2XUJA 4BTLA 1XFDA 2VAXA 4A23A 2RHWA 4FBMA 4X00A 1QTRA 2VTVA 5ALIA 1FSSA 2XDWA 3G9TA 2R8BA 1T4MA 2VJBA 4UFOA 5LYYA 4RE5A 4MEBA 5DTIA 4X6UA 1UOOA 5EHXA 4FMPA 3WKCA 5BOVA 5HK8A 3H17A 5AIBA 4JYPA 5ALSA 2IX9A 3G9XA 2RONA 4PSCA 1XZAA 5JATA 4KRXA 1N5RA 3ZV7A 4GW3A 1XKLA 5CT5A 2GBIA 4DYHA 4N8DA 1ZI6A 4MYDA 1AGYA 2H7CA 5LKRA 1TAHA 3C87A 1N1MA 1C7JA 1VXOA 2GYVA 3I1YA 1WHTA 1QONA 3ESAA 4BAGA 1ZD4A 4HTAA 3IULA 2G4LA 4UHHA 4G1FA 4O08A 4U2GA 2RHTA 2C7BA 2V98A 3TGLA 3VKFA 5CT9A 3LIIA 3FBWA 3DLTA 2OAGA 4AZ3A 3P2MA 2QOEA 4G8CA 1BCRA 3YASA 5HF9A 4X71A 5ALEA 2O2IA 3RLIA 4BE9A 2VAVA 4NMWA 4G4IA 4KRYA 4J0IA 4K6HA 1CVLA 4QDOA 2WIDA 4K5QA 1FFAA 1EB8A 1EH5A 3AILA 3ZPXA 1L7RA 3Q0TA 4DMHA 4KE6A 2OCLA 1XRNA 1BEZA 4OUKX 3SK0A 2VT7A 2ACEA 3NOXA 4QDTA 5AKEA 2NW6A 4FFVA 3F96A 1CV2A 4BATA 5AKKA 4J0KA 4GBGA 4DNFA 4H7KA 5IH7A 4AO8A 4LKOA 1JKMA 4FDMA 1P0IA 4YASA 3HACA 4XX1A 2PL5A 2I3DA 5AKZA 2B61A 3QITA 5ALJA 1UK8A 1H22A 3G0IA 1R4ZA 5DWDA 1EDBA 3BIWA 4G8BA 2PVSA 4L9AA 1P0PA 3BJRA 2C5FA 1DU4A 4AQDA 3C5VA 2VEOA 3EBLA 1UOQA 4MYSA 1XZIA 5A7GA 5LZ2A 4X93A 1KU6A 3AZPA 4Q3KA 1MX9A 4JEIA 3T52A 4K6KA 5FPQA 3EF3A 4K6GA 2JGFA 4KR0A 3ILSA 4B9EA 1E8MA 1PFQA 5EHQA 2OAEA 4UBLA 5AICA 1MAHA 5AK5A 1ODTC 3OOSA 3D59A 4MWTA 4PSUA 3NWOA 3D2CA 1W76A 4A16A 5JD5A 5AM5A 1CUWA 1YS1X 3JYHA 3UUFA 3L1IA 2HU5A 3WK7A 2OCKA 3R3WA 3WK5A 4HXEB 3R3XA 2UZ0A 3W04A 4C88A 4B7ZA 2Y1KA 4QLAA 4I19A 4GHWA 4UPDA 2IITA 3DD5A 2WKWA 5K3FA 2OCGA 4ZV7A 1YR2A 2OPHA 2ZSIA 1PV1A 2WQZA 3WWEA 4D9JA 4AMYA 1QJ4A 3R3VA 4GWLA 5EI5A
chains in the Genus database with same CATH superfamily
2QN6A 1J0AA 4YT2A 5A04A 2ZBQA 2DBVO 1T3HA 4UUNA 3ZVLA 2ZI9A 3WLLA 3E8XA 1X8LA 3HUDA 3FPHA 3MWLA 2WUDA 2ZB2A 4JJZA 5JO9A 5FWDA 4YDRA 5EUBA 1PG2A 1IE3A 2BKVA 2XRYA 4ZP1A 2BEJA 2D2IA 3I2FA 4H7IA 4HDSA 1FFCA 4M1ZA 1NYTA 2I80A 2I7TA 2IDJA 2Y68A 4PAQA 1F3LA 1GL9B 1R0RE 2A5GA 1F8YA 3OP1A 3UJ8A 5I4CA 3J81A 1ESNA 3EGWA 3EGXB 2HK6A 4X61A 1G64A 1P81A 5KTMA 3D3WB 1UWKA 4GECA 2ZWIA 3IA2A 4FXPA 4WI1A 5J2TF 1KZ7B 1WSWA 4HPJB 4RAOA 5AESA 4TZ6A 1R16A 2IU4A 3DZJA 5JYCA 5BSEA 3FROA 3C48A 3B5EA 3FMPB 3TPCA 4B2LA 1SXJC 3IAS1 4FFBB 4LRUA 2PR2A 4LF9B 4I0WB 1AKQA 3A4IA 3ROMA 1NVXQ 2YYAA 3BRWD 2VP0A 3K6RA 2FFJA 5ALPA 3X1WA 3LQRA 4EVIA 5K45A 1ULSA 3AEUB 1XF9A 2GM4A 4Z9FA 4NMHA 1YBFA 3ZCPA 2C8KA 5HIAA 4GKKB 2XUKA 4IUCS 2OYSA 2PSHA 3IQGX 3OHMA 1XE3A 4YK7A 1IJKA 3KB8A 2AWOA 3HR7A 4XIFA 3E9MA 1IVNA 4NJOA 1GILA 2ENUA 2VCHA 3QA9A 1J0BA 2AE2A 1CZLA 4B6PA 4KZPA 1RM4A 4BRUA 2CKDA 1WMSA 2Q0HA 2GN1A 3HYTA 4LDRA 4WK0B 3ESCA 2QRHA 1QANA 1U2GC 3P0IA 3FYUA 1YQEA 1E9RA 4YRGA 1MG5A 2VJPA 3JQEA 1YKFA 3DZBA 1B74A 1N9KA 2VDLB 3P5SA 2NPOA 4RTOA 2CT8A 1DBSA 1KFBB 4AW9A 5A02A 5I4BA 5DYIA 3LS2A 1OYYA 5I45A 5IDQA 4DV4B 4U5QA 3O8CA 1X7XB 4OHZA 4V3BA 1GGKA 1LJLA 1S5PA 1VDZA 2VJCA 3DMFA 1Y98A 3IOCA 3O0DA 2IV7A 4BFTA 1KI7A 2GJ9A 5DBOA 2OM6A 2I6FA 4EMTA 3TNYA 2Y6UA 2ZCJA 1HZJA 2AFIB 2GERA 4EATA 2XMBA 4EMBA 3TLCA 1E1KA 3AF0A 2B2NA 1QG2A 1T2EA 2ON6A 2V7EA 2X0JA 3PPXA 1XCMA 1QGED 2ZJ3A 5CEEA 1HDIA 1HM5A 5CFRA 2HSDA 1VB3A 1U04A 2ZIFA 2ZT8A 4DR4B 1OR8A 5P21A 3WLOA 3FCXA 1G7RA 5C81A 1RM5A 5DNVA 1SUPA 4KOEC 1DMSA 2OXRA 2XGGA 2WMYA 4A5SA 3MJHA 4J76A 3JYOA 4UHFA 4MDFA 5M3BA 4DIMA 2OHOA 3E3NA 4PLGA 3DD1A 3TD6A 1IHPA 4JLVA 4D9EA 4BQFA 3JASA 4ER6A 1V1JA 3EVFA 3OZVA 1H4QA 4ZOEA 5D2CA 1KYYA 3I8OA 5LD2B 1G2OA 4YO7A 5ALHA 2E82A 1XO1A 4LJLA 4LF7B 2BTQB 2MSLA 3FOZA 1WX1A 4NDAA 3WWYA 1OLUA 2QMQA 4HQNA 3PJFA 4BFXA 1RMTA 1D2GA 1GWNA 1FSGA 1DKQA 2FY8A 5FBKA 3WHKA 1OU4A 4C0KA 1AXRA 1ZUD1 3ZYCA 2QTAA 4AKIA 3OFKA 4HZUB 4YRBA 5AW5A 3DW3X 4G9EA 3DQPA 2WKSA 1B41A 2P3QA 3ZWPA 5IYZB 2HPVA 4DIKA 3VTZA 1KFKB 2PSFA 2R4QA 2YW9A 3CF4A 2IWHA 2G80A 2ZUVA 1P1FA 1LTQA 2HDWA 1G9SA 1Z2CA 2IYNA 4HNAB 1RC8A 3CLUD 3LECA 3OKAA 5JROA 3MMPA 1A77A 1H6CA 4J0QA 2JDIA 5FBWB 1VYUA 2X2EA 2JARA 5J5VA 5JWOA 5K3OA 2P0YA 3D0QA 3X1MA 1C3JA 1HWYA 5JTUA 2ZETA 4F5EA 4YV2A 4GS5A 3UVEA 2O3TA 3VH3A 4IO1A 2GAAA 3EVCA 5FUXA 4BO5A 4DCMA 1IUOA 2QK4A 5CLIA 2EJWA 4Q34A 3W9BA 3ZZ0A 4P0PB 1OW3B 2XZDA 1H3FA 3A70A 4IGAA 4PX2A 5JVDB 1Z0IA 4QJ4A 1GXSA 3V55A 2CKMA 4BQQA 2GVNA 4XUCA 1CQJB 3CSDA 1WP4A 5GIOE 3HRIA 3LWDA 1B0ZA 1EM6A 4GEKA 4L5JA 1XTTA 4Q4DA 4RS4A 1C3VA 2PKQP 3ME5A 3L8HA 3A31A 5FR2A 2ZTVA 1KI8A 4UVDA 3HO6A 4R1NA 4DR6B 2VCEA 1RKXA 3GBPA 3U1TA 4DCNA 4R7ZA 1N6LA 5BT9A 1U6KA 1JSXA 3OJ0A 3A4MA 2H31A 4YO8A 1W36B 4ZK6A 1VE9A 2GQ0A 3GZJA 3VO8A 4PTLA 1O97C 1UT8A 3NX4A 4UUQA 4Z49A 1ZNWA 2JANA 5C8XA 4JOBA 4QFBA 2AZ4A 1TK9A 3M4ZA 4V39A 5DGIA 2UZAA 1RC0A 3VO1A 1A4IA 2C2YA 2QYTA 1W0JA 1TEVA 4GMFA 2VHUA 4KE7A 1VJDA 1HKHA 1XDWA 5EESA 5TARA 4C0HA 4ATNA 5A62A 5ES4B 5K3SA 4P81A 4E94A 2W6QA 4YUWA 2VHQA 3GGDA 3ORFA 4PG5A 5CM8B 4QHSA 3SX0A 4B80A 3UJ6A 1XCJA 2QRGA 1XZLA 4ZRMA 2J08A 3Q3GE 3E53A 2NXJA 1T4BA 1R88A 3KVVA 5IM5A 1WMEA 1A5AB 1TO2E 3L8MA 3QG1A 1RKQA 3ZWBA 5BSVA 4CIVA 4FYWA 4J49A 1KH3A 1BEEA 1TC1A 3H9EO 1TUBB 4H4CA 1QTIA 4IJQA 1VGQA 3K1YA 4JEUA 4L22A 2RBEA 1PL7A 3DDUA 4OHKA 4QEDA 4KMRA 4UZSA 1UM9A 3X2EA 5JQGF 3FZYA 3NNSA 5TC4A 4EB0A 1UBGA 3PEYA 3PXUA 2CNKA 4EKNB 3MD9A 4WXYB 4UTRA 1AVTA 1JEEA 3OTWA 3SFTA 3UHJA 4F2GA 1HDRA 5CFQA 1H6AA 3U6KA 3NETA 3NBZC 1W4AA 2QY9A 4MV8A 4RJLA 3R5TA 2R6FA 1L4GA 1KK3A 1OT5A 3BMOB 4I55F 4S1OA 2XKBA 2L19A 3OIFA 2FSVC 3OZWA 1A9PA 3VX3A 1XDZA 2ODNA 3V2IA 1OH7A 1ZU4A 3JPWA 1XZ8A 3MMNA 2WJ3A 4X20A 2AQ8A 3CLRD 3LF1A 4HJRA 2H1WA 2YIVX 1SOUA 3DM9B 2RJOA 2BEUA 3GOHA 4F5DA 5K0LA 4OX9B 3L7BA 1XJQA 1P6XA 3MIZA 1LBQA 2GFHA 5K05A 1X0VA 3L8ZA 4E03A 4MS1A 3C5EA 4CQLB 4NRDA 1BCSA 1TPZA 3L0PA 1PAUA 3AKZA 2HYIC 3ML1A 2WF5A 2JLZA 3KSBC 4GSYA 3K09A 1F6BA 2FKAA 2VPIA 3P20A 5AI6A 1AKRA 1E3IA 3LTEA 3A6JA 4FQ5A 1ZVJA 1V8PA 3UCEA 1M5UA 4IIGA 3RWMB 2V0CA 1RNLA 5C4IA 3ZDAA 3P9RA 4KX3A 4B81A 4Y30A 1BRMA 3WRYA 4ENTA 3HM2A 4AICA 4P7KA 2AOWA 5DYNA 1Y1SA 2NGRA 3IFSA 4OB8A 2KBFA 2P2DA 1ECBA 2B9EA 4WEOA 2VH2A 5AW3A 2H11A 2QL9A 4XYMA 3UKJA 4NMLA 4JHLA 1AE1A 5D6OA 2LBPA 4NYJR 2WKQA 3IP5A 4X8LA 4IS3A 5B36A 8OHMA 1VPWA 1MV8A 2DTEA 2GBGA 4P6VF 3EPRA 4TKZA 3TVDA 2R1VA 4F4FA 4ZYWA 4YJDA 3U6BA 1XTQA 3QOYA 2TYSB 1CUBA 3DONA 3A3NA 3RE1A 4BP1A 4WT7A 4HH3C 4Z2AA 4RDHA 1IB6A 1VMEA 5CAEA 4R5HA 3CUSA 1FY2A 3PC6A 4IKPA 4LI0A 4KXFB 1Z36A 1J99A 2HREA 1WZNA 5B1EA 1FP2A 1PNOA 3C43A 1QP7A 1H5UA 1RWBA 1T5TA 1UQRA 2AYZA 4JUBA 4ZCTA 3H75A 3VPSA 3MJCA 2B8JA 1CUSA 2QAGA 4KUGA 1RHKA 2C82A 5EZSA 2QTMA 1XD2A 2YMMA 4I6JA 4MDYA 5COBA 5E0OA 1DL5A 3N3AC 3DTTA 1P0MA 3HR4A 5DI3B 3TOSA 2QJFA 3KZVA 1MXHA 1Z8NA 2IZ5A 3GFPA 1I10A 3R5FA 4GAEA 4N5MA 1YSCA 4ZI7F 4MI6A 5F1PA 2ARKA 2P62A 3IQDB 4P7JA 4JAVC 2QGZA 2ACVA 3ZY5A 4TVSA 1QGUA 5JJ5A 4LXTA 4FHFA 1YD7A 3DV0B 1V6CA 4G5QA 3VPHA 4B7XA 3G2PA 4AG5A 4YIHA 2O2JA 5I6DA 2J87A 1NTOA 1WNFA 3M4NA 2BLNA 4DV6B 1CPYA 3COSA 4RZ3A 1LK7A 3TH5A 4C14A 2NU8B 1AMNA 3Q5GA 3CF0A 2XGOA 3IXMA 3W1WA 1H94A 4RHEA 2O3UA 1Z0AA 5FORA 5TLSA 1R5NA 2ROQA 3AVYA 3KBOA 2WB4A 1PNTA 1HDEA 3CXUA 4AZWA 2AMLA 2R62A 1V5IA 1M8FA 2V59A 4II3A 4X54A 4Y18A 4WLUA 3RVBA 3EZLA 1ZX1A 3VTAA 5F76A 3VVBA 4CCYB 4CLHA 1VLHA 4EPTA 2CNNA 3H5RA 2VA9A 2P67A 2OC4A 1YS4A 1D6JA 3T5MA 2P2YA 1TOAA 4C0WA 1IXSB 2AVDA 2HH9A 4OMFG 2J9FB 2POCA 4EYKA 2NACA 4O4JF 3FDXA 3Q6MA 5GJBA 3UK0A 4JQOA 2FPWA 1ABEA 1KJYA 3IDSA 1A8PA 3LWBA 3ZDQA 5IC4A 5HUQA 5LOVB 2XRZA 1JAXA 2Y4OA 4KYTA 4NE9A 3G6WA 2PPLA 3KT0A 1ZMXA 3D43A 3DHYA 3BB4A 2EP8A 4UCXA 4N7JA 3T9DA 2DFNA 3D1VA 3DBRB 1L8AA 1N8SA 3IKVA 1A5TA 2B7CA 4K9DA 4YAOA 4NDZA 4DV3B 3OIYA 3DJFA 4ER0A 1RAGA 3WDMA 4BO7A 2HPHA 5CBPB 5FBVB 2D6FA 3VPGA 1J22A 4LTNA 3R5XA 2CE2X 2XMZA 5IZCC 4MXDA 1PJZA 5JAOA 4I6GA 2ZBRA 2GD6A 3EVTA 2AA3A 2W43A 1JDNA 3AP3A 5T64A 4RZQA 3LC2O 1N2GA 3QLTA 4QG3A 4KITB 4YJFA 4O2AB 3ROQA 4ML3A 2C2GA 3O9VA 1OOEA 4F5WA 4AT1A 4H6XA 1DDGA 1WQ4A 2ZBPA 3L8GA 4YCSA 3GO4A 5FLXA 1PK7A 1FQKA 5DF1A 3SJ7A 2ACKA 3WJ1A 1ACMA 4N0PA 4U0KA 1FYEA 3UK7A 1OXUA 1U2DC 1G20E 4J9VA 5B6IA 3K70B 1RKVA 2AIRA 5H7XA 4K81B 1RJ9B 1YA4A 2JRCA 1L5HB 2AN4A 3NBUA 3NT4A 1SKQA 1KC1A 2FSGA 3O4HA 1I4TD 2QR3A 3QMVA 4MHSA 5EP1A 2O0JA 1H42A 5FLEX 4KH0A 1T0UA 2D5LA 4FFLA 4G24A 4M76B 4Q3NA 4TL6A 4TS1A 3WTBA 1AQJA 4MYHA 2OD9A 3K9WA 4MK4A 2AOTA 3ET4A 2FX2A 4Y2QA 3A2LA 4YWHA 5ECGC 2G0TA 4DYDA 3HKBA 5FI5A 5MN4A 1Y8RA 3KUXA 4XDZA 1MNAA 1Z4OA 1V8BA 1VSTA 2ZKLA 3I28A 1KO1A 5A71A 3S28A 4RSMA 1M2EA 2WF9A 3WLSA 2EBFX 1HE3A 2FP3A 2J0UA 3PNBA 3LCRA 3RQIA 4YCNA 2VTBA 3L6EA 2ZRCA 2CDAA 3A9VA 2H0AA 2I2DA 2PKQO 3HWSA 1XMSA 4JH0A 4N3BA 2CL0X 3PLAE 2BD0A 2JCSA 3URMA 5DLQC 4AX8A 1E9VA 2OSVA 1ZD5A 5FYQA 3GEDA 2IQ5A 1RHMA 3QX7A 3FNHA 4N5IX 3VYVA 4Y2XA 1O96B 1UXKA 5A0TA 1UAGA 4PO8A 4D8XA 3UJPA 1LEHA 2XB6A 1XTIA 3V34A 1NBEA 4PZAA 5IM4F 1INLA 1T3SA 3L1JA 4KAJA 2GPSA 2NVUB 1BA2A 3A2MA 4M83A 5B4UA 1C1XA 2INGX 4QULA 3TMKA 4YJ2A 4PRLA 3WA7A 2IYLD 3L77A 1TVKA 4KFTA 3JQCA 4CL8A 1VYVA 5FH9A 4OQQA 3HFSA 4RXMA 4L3WA 1FNDA 3W5BA 4MKGA 3O73A 1OH6A 4HQLA 2I1LA 1Q1AA 4QICA 3U31A 2J0VA 4BVFA 1UZUA 5MFZA 2O8DB 4N39A 4WUVA 2ZIAA 4V03A 4ARAA 4C0SA 3HUEA 1JHOA 4ITUA 1FFSA 2Y1FA 4YCAA 3VR4H 2HGSA 1KJJA 4PCUA 4UEKA 4YLGA 2QV7A 2ZWAA 1Y4ZA 1QQAA 2HTEA 1RE1A 3A9TA 1U8YA 1NU6A 5G1OA 4BO4A 3HL4A 4RIFA 5AK3A 2OG1A 4MA0A 1X1CA 1NUAA 3B2QA 1FYWA 3O94A 4HZGA 2NVBA 1CUYA 5KAPA 2F3SA 3IYLW 1VZ3A 5AHOA 1RYBA 1KSHA 2DFLA 5LA6B 2D2FA 3I05A 1TX4B 3K53A 4X6YA 3E8SA 3ED1A 4I4TA 4LDJA 4MVJD 1T1JA 2O8BB 3NEAA 4Q01A 3FDFA 4D4IA 1JDJA 1KBQA 1M1YE 3WLNA 2RJNA 3THXA 2SCUB 1X3SA 2BAGA 2PXAA 3OAAD 3B1VA 3D7RA 1LS6A 2RB5A 4M9QA 2B5VA 1L5QA 3N0RA 5HQJA 5IDVA 3SAJA 1OB5A 2Z6AA 1Q1QA 4XWTA 1T9HA 1EI9A 2Q3DA 4D44A 2PGXA 1KS9A 1B0UA 1M83A 1T2NA 1MVLA 1FFXA 1IN7A 2JAXA 2W2XA 3I2IA 4RVDA 1CQIB 4K03A 1IK6A 2IIBA 4B6GA 2JCVA 3BZUA 1YVPA 4CVNA 5JC1A 4XLTA 5A5FA 1SOAA 1BW9A 1HURA 2ZT7A 3X1KA 3MC1A 1ZINA 1V43A 3ZI0A 5BW5A 4OATA 4U5XA 3NP9A 4QEZA 3G5TA 4LZNA 4BOYA 4DGQA 5ILQA 2NZJA 3F8SA 2I34A 4UAJA 2GARA 4RTSA 2X4LA 1P44A 3CLHA 5CRIA 1U99A 4ZWNA 3SBXA 1BGXT 4D79A 4BO2A 2EATA 4E5YA 2P4HX 2DR2A 3ACCA 1GVNB 1BJKA 1YR6A 5BNTA 1NF2A 2IEIA 4IEIA 5TB5A 2BFEB 5MF6A 1T6YA 1HDCA 1P0CA 2W4MA 3IIIA 2PX3A 2O7SA 1JMKC 2C1ZA 4X6XA 3S1LA 4MWCA 3UT5A 1KP2A 1ZMTA 2CFOA 4BUZA 2E6KA 1XKTA 3EPLA 1XQXA 2KSQA 3MFYA 3I6IA 5DSTA 1VHJA 3GLTA 3JWEA 4HG2A 2LDXA 2P78A 3ZIDA 4TV8A 5JNTA 5JXIA 2X9LA 3MAAC 5F1OA 4BYMA 4ZYXA 3GLGA 5E0KB 2DKNA 3EIWA 4I50A 5EIHA 5I9SA 1BXRB 5CG2A 4PSAA 1OC2A 1STOA 1MFZA 1HLDA 2RG7A 3SG0A 4JD5A 3B6JA 1B2RA 5EHZA 1SG6A 2O52A 2YNMD 2H29A 4WD3A 5L7TA 1XZJA 5FOVA 3ZU5A 2O1WA 1N1EA 4ND2A 1AZWA 2SECE 4ZQHA 3PS9A 2P40A 2ZQYA 4OM8A 1U0LA 1K5DA 2VQ6A 1FNCA 3IE0A 1MT3A 3NVDA 2V1UA 4UUAA 4ILEA 1G3UA 3EGEA 1FDVA 4YTEA 4TROA 4DJDC 2Q1UA 1CKEA 5DB4A 5AKJA 1YTUA 4NOJA 1I1QB 1GAWA 2BDUA 1UDCA 2FJUA 5HFJA 5KYUB 2ZRFA 1PVOA 3D8RA 3AL0C 4BYGA 5IJ9A 3ICQB 5EKXA 1RBZA 2Z8ZA 4PV7A 2HIAA 1VB5A 3QPDA 4JUDX 4ZEXA 2E5FA 4EI7A 3BWBA 1F5NA 1ZM4A 2HYDA 4N3CA 5GGYA 1E2NA 2CXXA 2CXSA 2JGDA 3H2HA 3JWGA 2QENA 1QPBA 4INPA 4HAIA 4Z4CA 5DM1A 3BBPA 3ZCRA 4BWFB 4JCCA 1N78A 3L92A 4RZSA 1DLIA 3PU6A 4AG6A 3I9NA 3QLVC 3KK0A 3TPZA 2J1LA 1GSHA 4Z9AA 1A9SA 2YOHA 3ABSB 3LL7A 1DFIA 4J1SA 4US1R 3ZWQA 1JQKA 1T36A 2W2NA 4IW3B 3V48A 4U7GA 1CRQA 3D6NB 2Y76A 3ZLUA 3VOTA 5JZSA 4RD4A 3L0CA 3PQDA 4HNRA 1N9GA 3DL0A 1XQVA 2RB4A 5D3ZA 4DARA 3U7QA 1GQYA 3D1LA 4CDNA 2ZRPA 4J16A 1DOHA 4N1AA 5KX5B 3P0RA 2WVAA 1YZKA 2XY4A 3KB1A 4EI9A 3G8AA 4G23A 3A2NA 2ZW9A 1CF4A 4RKWA 3KTDA 3RYHA 2QM0A 4QNMA 3V42A 1X42A 2D3WA 4LXYA 2FZEA 2O23A 2XPCA 3G02A 1W75A 1GVHA 3HVKA 4Z0PA 3SZOA 4DDKA 3F9RA 4OHBA 1DI0A 4GP7A 3NHAA 4B3IA 4KLZA 2ZRQA 2XODA 1SXGA 3CZQA 1AS3A 4WK6A 3KNZA 1HDXA 3VC2A 2WHRA 5L45A 3HTXA 4FN5A 4X00A 1D2CA 4MW6A 3G89A 3LBNA 3QVXA 3SYKA 5FD8A 2UKDA 2XAUA 1YU6A 5A4DA 2PZEA 3NXKA 3SX4A 3DYIA 4LYHA 3QELB 1NF9A 4FKMA 4HAYA 3WMFA 2GETA 3G0DA 3ZDZB 2DUWA 4LMAA 4BNNA 1PR6A 4AZ0A 1SXJE 5JS1A 2Z58A 1GA6A 3K4PA 4TQUS 1OI3A 3T9CA 4OG2A 1Q0RA 2B8TA 1W88A 1HDZA 2G67A 2R00A 4O2RA 4EYEA 3U4DA 3P9YA 1EGQA 2EW1A 4RZ2A 4JHXA 3UWPA 2GCOA 1UMBB 2EERA 2QW8A 3PYLA 1ILWA 4IHQA 5F51A 4WJLA 2WJVA 3IO5A 4OL9A 5A4IS 2ZRDA 4ZJPA 4S12A 4EA8A 3H5OA 3H7IA 1NR5A 1UMDA 3AM5A 3R0VA 5DBHX 1HUQA 2WG2A 4U2DA 1JQDA 5KNDA 1OYOA 1YJBA 3IVMA 1KZ4A 1PK8A 2QW0X 2PMDA 5JG7A 5D7BA 4CTJA 4CLRA 4HS9A 4YT5A 4NULA 2RGGA 5FR1A 5FL3A 2A35A 4XIGS 1BS1A 3VR3D 4NARA 2AC7A 3RU7A 4EITA 4RPLA 2BZ1A 3PC2A 2JIDA 3QFRA 4FK8A 3AW9A 4M54A 5EE1A 5I9MA 5BV8A 4KN5A 2D0DA 5IAEA 3NNNA 3JARA 1MX5A 3KHKA 3QWAA 3R6LA 5AM1A 3TLZA 4EQ6B 5A5VA 4OGLA 4KLRA 4P4SB 3RVQA 3S8EA 2WNHA 1VXRA 3FYSA 1Z2OX 2D2VA 1H1LA 4E32A 3ANLA 5EJ9A 2AMYA 1RWMA 3PDJA 2WWHA 1VFNA 4GGPA 4S35A 3A4TA 3P94A 1W8DA 3B6EA 1RWWA 1JT2A 3E9YA 3EN0A 3ONDA 4N6GA 2I1WA 2X8BA 4ARVA 5J4HA 1LJUA 3SFVA 2FRDC 1N57A 3BSWA 3HY3A 4P82A 5B3KA 1W52X 4MMXB 1X0XA 5E1OA 2I8AA 2VNAA 1K0UA 1T0HB 2YZMA 2ZPUA 5KVAA 1CLUA 2RHGB 1WULS 3F6PA 2Q5JA 2XUFA 5C3MA 2G9RA 4NLLA 2PNJA 1Y5LA 1CRZA 2Y27A 3LH5A 5JAQA 2A5DA 2VOJA 1RKBA 1K6JA 5BR1A 5LIPA 4RIEA 2BCJQ 4MX8A 4X5OA 2I3AA 2Z2JA 1CR6A 1M0TA 5E6RA 4CM1A 4XPZA 2C5GA 1LC3A 4KO4S 2IHJA 5TXGA 1H6DA 3VMMA 4CMIB 2QVZX 3UMYA 1T1SA 2XAAA 2OBFA 3V7YA 5CLFA 3S2ZA 5HUJA 1U65A 2J32A 1F6WA 2CBGA 1HXHA 1L5FA 4MKRA 3TFQA 3QZUA 2OBXA 1E7YA 1DJQA 4NECA 1DDOA 4ENWA 3IT2A 2OV4A 3FSGA 4QGHA 1EDZA 1UBHS 1Q0HA 2QUJA 2FJPA 5C1DA 1LPPA 3MWJA 3CKMA 1BDHA 1IHDA 1NXOA 1VSQA 3OJOA 2HCJB 4L8GA 4P32A 1C5KA 1W49A 3OSZA 2E5WA 3BZBA 2BCEA 5CYFA 1PLLA 1M8KA 3PGVA 1FSZA 2WD9A 3LHSA 3ZCVA 3GP8A 2AOXA 4GOLD 4CODB 1Y1PA 4ZQCB 2R7LA 3HBNA 4GPBA 1ZGBA 5DRTA 3CUEF 3PWKA 2GTPA 4B4VA 1E3EA 3BK1A 4K46A 3WLPA 4JVMA 5C5CA 4XB2A 4FB4A 2EARA 3GLQA 1D5WA 3LA6A 4XQEA 1GUYA 3GZ4A 3PXDA 1KARA 5F52A 2OVFA 5HZHA 1UAAA 2CK3D 2XYQA 1UPXA 2GBLA 4OA5A 3WWOA 6PFKA 5JAUA 4CU2A 4DF3A 3DE4X 1WJGA 4JYBA 4ZVSA 4CNBA 5E1MA 4RH0A 3KT3A 4BVEA 4BZWA 3ZW8A 4DLXA 5JZMA 2QD3A 3HCEA 2FZCA 4Z1OA 3GFSA 3BFJA 2G17A 1N2HA 3JQ8A 1ZP6A 3D4LA 1Z2EA 3NIBA 2FX5A 1MZVA 1LSSA 3WGIA 3U7FB 4HCJA 4ISCA 5AI8A 1D4AA 4GQIA 3PJDA 3WP1B 4CLOB 4ND8A 1PGJA 4LOIA 1JQJC 4CMEA 5ABPA 1H3NA 4AJLA 3DVLA 1IM2A 1K6MA 1KE2A 4C4PA 3W2EA 2KYRA 2CMHA 1L7AA 3FM9A 3JYQA 3OOYA 5GINE 5TF0A 5LP6A 4TRMA 5T7BA 4AN0A 3HQ4O 1H4TA 4Y1RB 4C3UA 2FW1A 9ATCA 5KNCH 2ZZNA 2RHDA 2I29A 1AKYA 1ZK1A 2DT8A 2MSDB 3F67A 3F5MA 3TW8A 3R9WA 4HGNA 3BJEA 1AN0A 3LXUX 4IV8A 1JDTA 5FJIA 4BVGA 1M1UA 3O0TA 1OLXA 4F3RA 2GCEA 4LCEA 4D1YA 2C98A 4QSMA 4RKQA 4BWYA 1YDHA 4JX8A 4KTVE 5AJZA 3O2JA 4Q4LA 1D8TA 3GNTA 4A6EA 1Z29A 2WF7A 4WKPA 4FYHA 1P73A 4GRAA 4BIMA 2EKDA 3QSYA 5DFAA 2DLNA 2QJRA 4S2UA 2CHFA 5ITWA 1GKYA 1VA4A 5CPBA 5LQSA 2I7DA 3DZIA 1NHWA 4EF5A 2O8CA 1G8GA 1NVVQ 3BVPA 1LH0A 3R7AA 2VJMA 1QRSA 4XUGB 5AOVA 1SBHA 3IJEB 1VG1A 2DWPA 1CFJA 4CTMA 2DSNA 3K20A 5AKIA 4DUGD 3ZY3A 3W8EA 1B1CA 5LR6A 3JQ9C 4MV6A 1E58A 4OFWA 4E5PA 1PGNA 2G1AA 4E70A 5LPNA 4G0VA 3LCVB 2GYWA 3HBLA 1Z7BA 1ZFNA 3FNFA 1T8UA 3RD5A 2HIGA 2C58A 3I9KA 3M6XA 1GCGA 2G5TA 4TN1A 5CHEA 3TLGA 2XWPA 2PX6A 5EG5A 2YUIA 3V4SA 3L1KA 1QK5A 3EDMA 4L4ZA 1BN7A 2C1EA 3F1LA 2RGDA 3KR1A 4ASUA 4S3MA 4RW0A 2YIDA 3FCOA 2OXFA 3WLTA 3A9UA 2Q8PA 2Q6TA 4D96A 1M1YB 4HNGA 1TQDA 1SNYA 4HXGA 4JGIA 1EAMA 1P72A 1GA1A 1RFLA 2EV9A 4B09A 2PWZA 4D3XA 3JQGB 1LPMA 3X43A 4F5ZA 4DL9A 3RUCA 4GDFA 2ZJBA 3RRYA 4B6RA 1TQ6A 4RPCA 3W90A 2HLDA 2FEPA 3DLAA 4ZV9A 4B2YA 3RFUA 1CRWG 1L5YA 3PUHA 2X4IA 1XYYA 3WFIA 3HI4A 3NVAA 1Z34A 1CERA 3R8CA 4HAXA 4EG8A 2D00A 5AI4A 2HRQA 4N5LA 3S2FA 3I5YA 16PKA 3PUYA 3X1YA 4GUAA 1NKVA 3RT7A 3OIGA 3ZDRA 3AJ8A 1TZCA 4P0TA 3F90A 2LKDA 3LLCA 3ZZUA 2VQEB 1NRXA 4M9CA 2Z83A 4QL3A 5AQ1A 1G5IA 3MGKA 5DNWA 1MAVA 1VA5A 4B32A 3KKEA 4U00A 2FGJA 5BWBA 5IBCA 1APBA 5KNLA 1XRRA 3AJ9A 3GLHA 3M6UA 1KMNA 2A3RA 1WW8A 3H5NA 4HGRA 4I3FA 1XK6A 2WU3A 4L15A 3IVXA 2Q3EA 5JHHB 2R44A 1A9QA 2PKXA 4NYIQ 4GPTA 5EXTA 5SZJA 5GAJA 3ZCTA 2IS6A 4AIIA 3ITEA 1DEKA 3LX6A 3LFHA 4CQNA 4S1PA 1V71A 2Q4OA 1QBGA 2M9MA 5BNFA 2ZYSA 1UDRA 2I22A 2PSSA 3IR5A 4DCTA 1OTXA 1T91A 3AV3A 3QK7A 1OV4A 4LA4A 3GMIA 3WNQA 1DP4A 3FZGA 2NAPA 3B53X 3O4RA 4KIGA 1WZCA 4M1TA 3D4PA 1E89A 3EZ7A 4Q1EA 3AR6A 3TVYA 3WYFA 5JAZA 3PL5A 2CCGA 4JQYA 1B4DA 3D8SA 1EYZA 2FN4A 3O31A 4ER7A 1J56A 2C03A 1ORVA 4OU4A 3VVLA 1TDJA 2BR3A 3RJ9A 2JJQA 3W3ZB 3IDQA 2OBMA 5HFAA 1GG2A 3IGFA 2BBSA 3KKKA 2BSQA 2JI7A 3D7LA 3WGNA 3N2YA 3CVJA 4QXQA 1JF8A 1KMHA 1PR2A 1SN7A 2CUZA 2FE4A 1GFSA 3HB7A 5GJVC 1A8UA 1F2UB 2L18A 3PX2A 5T57A 4B3JA 4B85A 5KTRA 3K2IA 3OIWA 2XVZA 3A2KA 1THMA 3M6LA 1Y63A 2QVYX 3B3GA 3JD3A 5SZHB 2P5SA 3GRZA 4EBBA 1SUDA 2R1UA 5TT0A 3DV2A 3B2EA 1XQYA 1T2FA 4D82A 1JR3A 1TTQB 1U7WA 1YMVA 2WOJA 3LLUA 3TBKA 2QA5A 3SYRA 4Z7OB 3IEMA 4Y7CA 1C4WA 1GLGA 2XMCA 4HAZA 1YE5A 3WB2A 3OZIA 4D80A 4YMTA 5A9SA 1RABA 5ALRA 3GYGA 3U17A 4ZI3A 3EVBA 2ZS8A 3CRRA 1GTL1 2FFAA 4A0HA 1HE4A 4LJYA 2HDNB 1KZ9A 4CR6A 1FW6A 1RQGA 3GA5A 4B3TB 2IDMA 5ERYA 2QBYA 1CQPA 1DBIA 3JSAA 4HDMB 3PFHA 4S1NA 5CT6A 5KYXA 3DLPX 3VH2A 3OCYA 2XT6A 2JI8A 3CLSD 4R6WA 1SU7A 4FLMA 4JJ7A 4TWAA 3H0KA 2BKUA 3HDTA 3NTXA 2Q3LA 1JG1A 1VRWA 2A9OA 3BQMB 3EC2A 1C1DB 2AWNA 3CURA 3QTLA 5H82A 4C0JA 4CM4A 5CDYA 2QU7A 1DAPA 1XZEA 2Q2QA 5G4KA 3WDLA 2XZLA 3K05A 1ZD3A 2E0IA 3FMVA 5KWVA 4QPJC 4DCJA 2ERYA 5FOXA 1NMQA 4PM4A 4KPUA 1QQBA 5KJ6A 2P9FA 3EXHB 4FUQA 2NPFA 5EZYF 1LJ8A 1ML3A 1UT6A 1KGDA 1W2HA 3W4JA 1FK8A 1CR0A 4J9UE 4XASA 4MARA 3T7AA 1FNBA 2OCYC 2YXEA 4BDTA 2YS6A 4BLQA 1AA6A 4QOIA 2VRCD 1PSZA 4J43A 1WHTB 4D8TA 3PCRB 2O8NA 2JD1A 2WOOA 1MUUA 2OWEA 4PPGA 4P0QB 3UFXA 1QC5B 1UMCA 1U7OA 2IYQA 1ETHA 2D5AA 3PSAA 5CA1B 1K06A 2QQ0A 3T8YA 1KAEA 2FQ1A 2YHUA 3LDUA 1YRYE 1SXJB 2X5KO 2GEJA 5DX8A 1CRLA 4XLLA 3ZWYA 4I4LA 3REGA 3KVYA 3UY4A 3OFJA 4IDFA 2ZRLA 4JS0A 1XNQB 2FPUA 1DPGA 4P5DA 2X0FA 2V7QA 3SIPA 2CSXA 2ZSFA 1WXIA 4MQLA 1O89A 2VUUA 3HU2A 4FVTA 4MW7A 4WVFA 4AZ3B 4TV9A 1XN1A 5DP2A 1W0KA 5AKHA 1ZHHA 5AXBA 3TZ6A 3OE5A 2E4WA 3FI9A 3G2QA 2P6PA 3GRRA 4EB6A 3FFBA 1PDOA 1TCBA 4EHDA 2AJTA 3DT6A 4BEBA 4B2IA 5KINB 4RBNA 5IBRA 2J5KA 1CXZA 1A7UA 3VNBA 2FA9A 5PGMA 1B6RA 1V1RB 3WX0A 3RC8A 2VLIA 2R96A 3T1OA 3TUJC 4UQOA 1RZUA 3NPAA 1J1ZA 4A6PA 3BJZA 2NU6B 1TYAE 1HH4A 2H4WA 1TM2A 3OQIB 1QIGA 3KLPX 1JZSA 2I3GA 3QI7A 3A06A 1PQ4A 1UC8A 1P7VA 1U6JA 1U9IA 1MF7A 2PXCA 1C0KA 2Z5GA 3MRSA 4JKYA 4U8GA 4PW0A 4UMEA 3SICE 2M6LA 2O50A 3LAWA 4DWOA 1KVRA 4RORA 3T94A 3TBFA 5CX1B 4OOFA 1N2CA 1KK2A 3FUVA 3OSUA 4NHEA 3O1HB 4JQSA 3ZQUA 1ETUA 5DN6D 5BSHA 4JZYA 3SMVA 2XE7A 4W9NA 1VYHA 3W2FA 5A7HA 3HNRA 4AC9A 2B1JA 4ZIRA 3LTNC 4UHJA 5E1DA 3QY0A 4ZAYA 2J5QA 1DJNA 2FGKA 4CHTA 2VYVA 5AHWA 3G13A 4Q5IA 5ALVA 3RSQA 5FHQA 1ZYUA 4CCAA 2G1PA 4YAEA 2F1KA 1I0ZA 5BO5A 1HNXB 4YUZA 2Q5OA 5MHTA 1DXYA 4ZT4A 2FPGB 4QOHA 5L3ZA 5LYJB 1QRDA 3CCFA 3NHKA 5I51A 5JH7B 1IOWA 2GXAA 4QUDA 1QU2A 1QX3A 4RE6A 3UQYS 5D3KA 1J8VA 5KSYA 2F1OA 4NWIA 5JAPA 2IU6A 3HEMA 3S2GA 5EJ5A 1WW3A 1CE8B 2CLHB 4FNAA 1U7XA 1EQUA 1D03A 3ZGZA 3CKLA 3EEBA 4YR9A 2CVZA 1SY7A 4UBIA 4N0QA 2P65A 3VR5D 5I5GA 2OM2A 3GR6A 5KWSA 1F17A 1LX6A 1EMDA 5G1PA 3RVLA 2FF5A 3OX4A 4BKRA 4YAFA 5E4JA 3S6JA 1H69A 3LFTA 4C2TA 5JFTA 3KAKA 4KOAA 5GWXA 3ICVA 5L6LB 2DHEA 3I0NA 3U1BA 3WIBA 4PNHA 3ZDCA 3BMNA 4CKCA 4Q1AA 3WWZA 3NDBB 1N8KA 3KVRA 3PHHA 4OB7A 5GV8A 3ND8A 2ZU0C 4YXFA 3RS0A 4AXXA 2ZZMA 3F4BA 5INTA 1CUDA 2WQ6A 5IAGA 5L3SB 3PHLA 2WJHA 1P9OA 1XNHA 5H3LA 5IT0A 2A9JA 4ZMBA 3N74A 3QE9Y 4WBNA 3IQZA 4FYMA 3NKVA 3WHPA 2C5LA 2IHVA 1NQOA 4HEQA 3KDSE 3TLBA 1U3FA 3NBYC 3WZMA 1I7QB 4XEHA 1UT5A 5BSMA 1YHZA 3RTAA 5BSFA 4KR7A 1XELA 3TLJA 1C8BA 1CUCA 4LYEA 5E9JA 1EXVA 2OGUA 1L4NA 3Q3JB 1N1GA 4HX5A 4MPTA 4NY1A 3CLKA 2OG2A 4UXJA 3L93A 5ECYA 4IEFB 3FWHA 2XB2A 2FU5C 2QD2A 3IQXA 4KMSA 1EJ6A 3LUBA 4N12A 1YT5A 1NW7A 2I76A 1Q1ZA 3PC3A 2JVIA 5AJYA 1H0SA 1EDDA 5GJCA 1KDRA 4PYKA 4R3WA 3S1AA 4QD3A 1XSEA 3EMBA 3JQRA 1JBQA 4CL3A 4XWKA 2WLSA 2JD0A 4LRWA 2IGTA 3EE6A 3WO1A 3ZJ4A 3ITDA 4GEGA 1L6IA 1ZCBA 5IW8A 4WCFC 1MIHA 2ASEA 1G66A 2NV2B 4H1HA 4CI0B 4MI1A 1FJXA 2OCAA 1ESCA 5EIWA 1X1QA 2ZBDA 3MT0A 5EIEA 2PH5A 4F04A 3G88A 4GI7A 5JCOA 1WLSA 1L1RA 2WJJA 4M0UA 3G68A 5EP4A 5FUYA 1KEZA 4H35A 1HTWA 4WNAA 2BFBA 3UK2A 1CBUA 2A94A 4REMA 3I6YA 3CKYA 3AX6A 2DQ4A 4ARSA 4EDHA 2CYAA 4OXQA 5JBQA 2ZVJA 1LCIA 1D2NA 3K2EA 3IB3A 5BSRA 1G8MA 3IHLA 3T41A 1P8AA 4WLEA 1D9ZA 1ZUIA 4M88A 1D0VA 4RA6B 1B42A 1X9IA 1W94A 2GN0A 3RSZA 4EOGA 5I9IA 2VT6A 3AKEA 3B82A 5B37A 5EWJB 4UM9D 4YQEA 2XZOA 1Q19A 4MLCA 1UWLA 1KY2A 1R6UA 1SU4A 2PT5A 4AL4A 3WGMA 1XRPA 3CIOA 1E2QA 3C7CB 4E13A 1ZMRA 1KQNA 4TL9A 5JWHA 1HR0B 1Z45A 1PUXA 5I01A 2MHCA 2Q5CA 3EZ6A 3ICEA 1ADFA 5HMMA 1RYZA 2VYCA 3DL7A 2PZ8A 2W83A 4MZXA 5G0WA 3VDXA 5CDSA 2FMUA 1RQ2A 5BWMA 1NW6A 1CJUC 1FQJA 2ZIUB 4MAAA 3AYXB 1AZLA 5AKYA 5DCLA 5FQNA 4E5VA 3VPCA 4ZZ1A 4H1TA 3WIOA 2FN7A 1FVHA 1U7UA 1JS1X 2CD7A 2GUWA 3UG7A 1NUSA 4AP6A 5JD6A 4MR9A 1V8FA 4TYWA 1TA0A 2BZ0A 4YRFA 2FG7C 5YASA 2QPLA 3L7LA 3HXTA 3IHKA 1QXSA 2HPZA 2FI1A 1B8UA 3ZE7A 4QGGA 3N0XA 2F2TA 1VG9B 2JAWA 2KMLA 3I32A 3CUVA 3ND9A 4FJ0A 5E6UA 3G8DA 4G1BA 4FYYA 4TPKA 4Z3DA 5T5QA 3VJKA 1NXSA 4ZU3A 4F84A 5B5SA 5M7EA 1UBFA 4MR7B 3ZDYB 3AB3A 1DMRA 3QPCA 5DBIA 2EEZA 3G7NA 4KGXA 4ZN6A 3GJSA 1UFVA 3QBEA 8ABPA 2ISCA 3OCZA 1W5FA 2C94A 5FKJA 3BMCA 1QKJA 1RD4A 1U8EA 2YFYA 3QV2A 4MUXA 3CZMA 2Q2WA 3D8UA 3E84A 5JSZA 3ZXYA 1U2RA 1M1NB 2D62A 3W2TA 5JZBA 4JL8A 3NJ8A 1KO4A 1I51A 4MRNA 2H3EA 2PKYX 2W48A 3HSSA 3PWSA 4NEHB 4QHYA 4JVLA 4N54A 2RFLA 4TYQA 4XB6B 5I7HA 5IKXA 4G67A 4YMWA 1V4BA 2J7PD 4GYKA 5DHUA 1NR1A 2A9PA 4YREA 4I5DA 1FDTA 2D1QA 4M22A 5JCXA 4KQ1A 3K0BA 1VBMA 4RTNA 5EXPA 2HJGA 4H17A 4NG4A 2J9YB 2VXCA 3FJOA 1D2EA 3M70A 4KK3A 3R20A 1FUIA 2ILVA 3H5TA 3WI7A 4YH1A 1Y7HA 4UULA 2R86A 4FC7A 4R0NA 3FPSA 2XMSA 5FTKA 4BUJA 4V1CI 4FWBA 2PKWA 1POXA 2X5NA 2ZRHA 1W1UA 3DOIA 4LHYA 4X1YA 3LT1A 2PLFA 3KPUA 4TMFA 4BNVA 4C6HA 2O8FA 4HNVA 4CF7A 4CUJA 3LGAA 4JNKA 2F4NA 1P5FA 3UUEA 2WFZA 3PFFA 3DDCA 1JPNA 3PYMA 5TT1A 1N2BA 1E1NA 1C7RA 1YUMA 1VBKA 2J9ZB 1KMIY 2BFAA 4YJGA 3COPA 3I6ZA 3C1UA 2WWVD 3OCUA 5L3QB 5CFOA 1V5FA 3MW8A 1REQB 1Y4UA 3FPBA 3M6WA 1ZQ1A 2F1HA 3V3TA 5KCZA 3I6MA 4Y9SA 2NLOA 1VL6A 2FSHA 3LUAA 1I36A 4NE7A 4Q3CA 4E1AA 5EE9A 4OQYA 1NE7A 3E2MA 1U7HA 2CLMB 5JQWA 4Q1VA 1LDBA 1MO4A 1YIOA 3AYZB 3CGGA 3NAMA 4WKBA 1F7UA 3NI2A 4G0PA 3GT3A 1E5LA 4UPEA 3W6PA 3AF6A 3UXHA 3J80A 3H8JA 1Z62A 4YAIA 4LGMA 2Z3WA 4DANA 1ZD1A 3H9UA 3REFA 5K9ZA 2QT0A 5M34A 1EG2A 1Y3DE 2WJIA 2IXGA 5EHIA 3G0BA 1NONA 2VT3A 3F0TA 5COQA 2Y67A 4XGQA 3U3OA 2P9CA 4URFA 4J0EA 3PNQA 1D09A 1JR4A 3Q0IA 5CYPA 3TCNA 3DOFA 1TUEA 4CR7A 4RH1A 2C54A 1FUEA 4JJEA 1KJQA 1UZMA 1YRQA 3F97A 4G25A 4X65B 4PQEA 5G40A 2ATXA 2YWRA 1EFRA 3DZDA 2C5EA 4KAXA 4HXFB 3FMOB 1XP5A 1G21A 2IHYA 4XD2A 1DRWA 1GAQA 4YB8A 4Q7EA 4E09A 5FBLB 5DSXA 3ESZA 2FPRA 4F6LA 4DCGA 3DP7A 3LY8A 3PK0A 2C4NA 3QJYA 4LY3A 5F1YA 4OQNA 1KSFX 5GY7A 2HMVA 3ROKA 3UV7A 4L0MA 1BO6A 4E6PA 4U7WA 1IY1A 1SVLA 1XDBA 1Z33A 2CVHA 3I5MA 1PL8A 3K8ZA 3MUOA 4MUEA 2QUBA 3RABA 3C3EA 4WZ6A 2JIQA 3V4FA 1KU0A 4PXYA 3Q2OA 5C7YA 2IUEA 3EGOA 1KXJA 3LIPA 1KMMA 4KGZA 3MTJA 1KJ9A 4V1CA 1YI1A 5JSQA 4KYIB 1HKUA 4IIBA 5BN5B 5MGNA 3IKTA 2QP4A 4OJYA 5CHYA 1CDEA 4QTZA 4HK4A 1NFFA 1X38A 1JV2B 2CN1A 2H5IA 4HDRA 4KGVA 5MN6A 3N7AA 1NNUA 2A78A 2J3EA 2R6AA 3KHSA 2WV9A 4CL0A 1VKRA 3GJTA 2QDXA 3CTPA 3TNFA 3WL7A 4YLYA 3O7MA 3F5SA 1GITA 3AF2A 3LGSA 4YRLA 4OM7A 5FUMA 4PN3A 4EGFA 4JNCA 3WGJA 4GC9A 4MPDA 2DWUA 1Z5OA 1VMAA 3FJ1A 1OBOA 2JJ8A 4MV9A 1GU1A 2REQA 3OE7D 4IQGA 4PTZA 5AP9A 4J4HA 5G0UA 3RCBA 3ZLBA 5GADl 1JTFA 5EIXA 2OHVA 1WY5A 2KWIA 3V8RA 4MYUA 3WV5A 3OUTA 4M2LA 2IP4A 3OQBA 1Z37A 2HB6A 2VF7A 3K4HA 3DAHA 3TOXA 3VBCA 2CVPA 5CB4A 3L05A 2LR0A 2GXQA 4UMDA 4KP7A 2NT3A 1K66A 3EZGA 3E6AA 2B5WA 3GIWA 4CMHA 2P2SA 1TD1A 1JJ7A 3KEGA 3GAFA 4MHOA 1PS0A 3WK8A 4MDEA 4BCCA 3QFCA 3GAZA 3QKIA 4OYYA 3GU3A 3ZTTA 3ETHA 3WO0A 3MINB 1AS2A 1I7SB 3BMQB 3R77A 3KKMA 1H66A 2VBGA 4FDVA 3T15A 3TS1A 4BFZA 2NUPB 2RGXA 5K8LA 4INAA 3PFBA 2ANCA 4ZI2A 1XYGA 2P69A 3V4OA 4FGKA 1JI3A 2YQ4A 3C0KA 2DBYA 4X62B 5TGTA 2X8LA 4Y9RA 2NTEA 3TTWA 5FOQA 3GUCA 4MCJA 3VU1A 3IPRA 1BDBA 1J8MF 2O6LA 3DE6X 2O9JA 4HS4A 3U3XA 4B34A 3HBAA 4NBKA 1B1AA 3SF8B 1XI2A 2J46A 1PNQA 4WZAB 2PYIA 4Q18A 2B3DA 1T1RA 4BMNA 1EX6A 2BEWA 3G5LA 3O1LA 1O0SA 1KPGA 4JJGA 3EXEB 4TWIA 3VH4A 4MGKR 4MOWA 3D3JA 2JHFA 3HS3A 3PDWA 1TPYA 5IYZF 1HEIA 2WYUA 1R50A 5KKAA 1QHNA 3TTUA 4H7DA 4RULA 4KW7A 4D3SA 2CXNA 4D9GA 1M2VA 2IYWA 5KTYA 2AGVA 2II6A 2PKCA 1XPJA 3CNNA 3FDZA 2P35A 3B5JA 3LF2A 2WIBA 4OBXA 4MVJM 4BS9A 1ZH2A 3OHSX 5I3ZA 1GUBA 5CH5A 3C3YA 1E2GA 3WAGA 1DAEA 3MWDB 3OPQA 1XU4A 2E18A 3GZNB 3I9V1 4M49A 3K0FB 4KXXA 2H16A 1PJ2A 3UM9A 4DVGA 5EJ4A 4MRPA 5GZ3A 2FQYA 1OTHA 3F6SA 3BULA 1N9ZA 1V2GA 3LW7A 3V4RA 4NVRA 3ROTA 3T7EA 4TXLA 4ZOLB 3U5ZB 1T2DA 1XAHA 5JVDF 2YRFA 4EI8A 1G5QA 3AFNA 2XH8A 4KI0A 5KTNA 1EFVA 2GBCA 2W8ZA 2WV7A 2KHZA 5KC9A 3FB4A 3CLVA 2DYKA 4IZOA 3GJ0A 4A7PA 5B58C 4F2HA 5DO9A 2Z4SA 5HKKD 1VTKA 4KI7A 1GFZA 4HYQA 1OFUA 1CZKA 4MH0R 4D8YA 4K6OA 3N75A 5GOZA 1OXXK 3ZD8A 2X1HA 4XRGA 3WKEA 3NBXX 2ZTUA 4IUBS 3BRWA 3W7BA 5F7OA 1DKPA 5L51A 4HLDA 4A92A 1HEYA 4D2IA 3CR7A 2MTBA 1L7VC 4MMZB 1CQXA 1T6BY 3KFXA 3AM4A 2LGJA 1NLZA 3RTCA 4BU1A 5BN4A 2P9GA 5JAIA 1C81A 5C7IO 2AX3A 1YFKA 3E3AA 1LUAA 1HT1E 4Z86A 4F4UA 2IIQA 2K2QB 2VIIA 1MEEA 4MO2A 1LPAB 2OLEA 1U1GA 2WF6A 4JU9A 4F1KA 2JJMA 1TC2A 3A3YA 1NXPA 3HU1A 4F12A 2W6ID 1JFRA 5AUPB 4EG1A 1E2EA 4RVUA 4G07A 4BNZA 1DV1A 1T0JB 4KVAA 3SMQA 5G2OA 3C3MA 4C29A 4Q7KA 2FLWA 3IELA 1DKOA 1R0KA 4KN9S 3ZGYA 5L4SA 1SKYE 5FEMA 2C4WA 3HU3A 4UBMA 5CXUA 1JNYA 3DVAA 3TB6A 3TZBA 1Z73A 5K4HA 3WNCA 1B2LA 5KQGA 4J1TA 3C85A 3PQ4A 5HGJA 4WFQA 4EY6A 1AU9A 1SB8A 5EERA 3VZPA 2PS9A 1PG5A 3UAVA 1LXCA 2VYND 4WMLA 4ZAZA 3O75A 4BB9A 3PNSA 4QXPA 1MT0A 2WD7A 2BP7A 3FPCA 4NBSA 3VR6D 4B3GA 3DMTA 5TEWA 3ZX4A 2COEA 3V6MA 1OBHA 2PLRA 1J9GA 4IY1A 3BF8A 1UBMS 4IILA 1CYEA 3MA0A 5I7UA 1RQRA 1IC6A 1Z7GA 4C05A 2J3IA 4PC2A 5JPDA 4TMKA 3TTXA 4ENPA 1F8UA 4MPJA 3MGBA 1W2GA 3SJAA 4MAMA 2K2WA 1JDSA 5ARCA 1JLLA 4P3NA 3GXOA 3DNPA 1U3DA 2BM0A 2YWCA 5DHFA 4AULA 1T9CA 2YV5A 3G0CA 1P9WA 3HY6A 3PA6A 4G2NA 5CK4A 4ZVRA 4D43A 1EG7A 1E4YA 3GCXA 3ZH9B 1ICIA 2C5BA 1J2EA 3QBJA 2BFCB 2PAFA 3IJRA 3OTGA 3I5AA 3QPVA 2PRSA 4L95C 4OYLA 3FNIA 4QTTB 2FFQA 2HLHA 1BXGB 2VDUE 2X40A 2JI4A 3CEJA 3OWHA 4I5GA 3L7KA 3WMEA 2PH3A 1RAEA 1T8RA 4YQFA 1JFTA 2VTEA 1AGNA 4XIIA 3UT0A 1EK0A 1LGYA 3NFYA 3OWOA 2BFPA 3L9WA 2G70A 3VO2A 1GGHA 2HQRA 1AB6A 3EGCA 2QYOA 4W1QA 4A82A 1KY3A 1ATIA 4LY9A 5JNSA 2CL7X 1U3VA 3GJQA 2OXIA 2FFHA 3V9PA 3PTZA 2JAQA 2OHXA 2AD5A 1CUZA 2GM3A 2N47A 1YB1A 4ZANA 1VPVA 2QG9A 4TTAA 4BLSA 4AYWA 3TR6A 4V0LA 2YVKA 2XDAA 3ST7A 2SNIE 4BVHA 3QWHA 1QFMA 4MUGA 3NXSA 3UHAA 3WIVA 2GN6A 4RL6A 4BQPA 4BHTA 4DJFC 1QRRA 1VC2A 4PQRA 4BQEA 1ISMA 1I2AA 4UW9A 3PF8A 3NMUF 4HI0E 4C3VA 4MDHA 2NUTB 3I2JA 1EQAA 3Q7IA 1RMQA 4U4AA 2R0QC 4QUKA 3HB5X 1FP4B 3U4HA 4KXYA 1A8QA 3DFUA 4LQCA 2NVOA 5FLYA 1BVYF 1G8FA 2IP1A 2C4HA 5F2KA 4F96A 1LD3A 3RK1A 2PVCA 4AJ4A 1KAOA 2HSJA 2IBTA 2PM8A 5DV9A 1MTOA 3RRFA 1VCOA 4M7PA 2YZNA 1ZY2A 4YDHB 1PYGA 4ZEMA 3DEHA 2GK4A 3OLWA 2QYSA 5FFMA 3L06A 1BX0A 2DM6A 5U9CA 2DT5A 3CPEA 2VNJA 4PO3X 1T8PA 3CSUA 3M33A 2QLBA 4AUEA 4R2XA 5CJJA 4EQZA 5AW7A 1GFIA 1Q20A 1GU7A 1K68A 5EOVA 3KETA 2H7XA 1QIJA 4W4TA 1JAIA 1WPRA 3DBHA 4CDMA 8ADHA 1DTWA 4RTMA 2I3ZA 4AS2A 3TMAA 3DTVD 3IBGA 2FCRA 5DHTA 3KKZA 3T1NA 5HA5A 4BU0A 3RUHA 4U9IS 3L02A 3A7DA 3M5CA 2I33A 4DDTA 5A1JA 1MC1A 2RCYA 3NHWA 2UYQA 4ISBA 4IDAA 3KE9A 2Q2NA 4JL5A 3PUIA 2QZJA 1XDUA 3F78A 3EMVA 3NKLA 4OB6A 3T7SA 3WY9A 4B3MB 1M76A 1CG6A 2C9BA 3DXXA 3NT2A 4NEQA 4BMPB 4KQMA 4ENRA 4QHTA 4DCSA 1JIXA 1OXMA 5BURA 3BWCA 1FRVA 3QEMA 1O5TA 1V11B 2DHDA 2GI4A 1UJMA 1MXFA 3MN1A 3LLMA 3RT9A 4JGBA 3VJLA 1XWIA 2QROA 4L9WA 4RTKA 3EZXA 1YH3A 5I9LA 5LOVF 4PHTA 2CUNA 4N8EA 4R9SA 3UNXA 4F9EA 4UNSA 5KNCA 2BRUC 4M9XA 2WNSA 2Y0BA 3HHEA 4M87A 4MUYA 2ONJA 4WUTA 1P75A 2DR0A 3JV7A 3OPXA 4WZZA 2WAMA 4C30A 1H2XA 3OZXA 4R71A 1XV5A 4QUIA 3TLXA 2FPSA 4JSYA 5K6RA 1Q83A 2QPAA 2VWPA 4QBKA 2VYFA 1GN8A 1V4NA 4M7OA 5KTPA 1CY8A 2W2MA 3RVRA 3D5TA 3SGLA 1G4UR 1QG6A 1SA0A 2XTAA 4J2HA 2P27A 3TLKA 3ZNPA 2IZOA 1JA0A 3D6AA 3H6KA 1UBLS 2PG3A 3DE1X 1TAGA 3KR2A 4R7GA 1C41A 3T4PA 2XBUA 4C78A 4E5DA 4EG0A 5IMSA 3ZWNA 4E88A 2GD1O 1C7QA 4O2AF 3IALA 2V55B 3RVSA 5HIIA 3ZWWA 3C8ZA 2E7ZA 1QJCA 3QVLA 5EJFA 1Q3KA 13PKA 4AJIA 5LP1A 5ALMA 3CTMA 4NQRA 2P5TB 2QEQA 4FFSA 221PA 2YHSA 3HJTA 4LE0A 4ONEA 2VDPB 2VAXA 3MCWA 1AGPA 1IWPB 3CF4G 4YUVA 3BFVA 1FPQA 4CUZA 6AT1A 1QK3A 5ER9A 1U5BA 2EFGA 2RHWA 1PL6A 2VAWA 4PHFA 4U63A 5KOHA 5ALIA 3HG7A 3LPLA 5BYAA 4L28A 4EGJA 1D2MA 1PJSA 4ZK2A 2AN1A 1Z75A 3AUAA 4MVYA 1T4MA 1WU8A 3QY9A 4EEXA 4NPAA 1BJRE 1IULA 3OQVA 4LJ7A 4MEBA 4ZO9A 1Z4QA 1QR6A 2Z5VA 2ZBFA 2R8EA 5FPYA 1US8A 8GPBA 3QW2A 4Q4HA 1XTRA 1DIRA 1QH8B 4D41A 4KYUA 4AP5A 4CQMB 4N3AA 2DWOA 4GI3A 4P3PA 1TMGE 2RH4A 3KU1A 4NYMR 4B6FA 3HP7A 1ZXBA 4ODIA 4FGJA 3SZUA 1GCIA 2C61A 1KSGA 3DTNA 4MVWA 2AQIA 1XZAA 1SVUA 1PDVA 1I4DD 2BZGA 2C2MA 3L7MA 5D3MA 1ZVQA 5DGTA 3UAWA 1U2QA 2C42A 2PX2A 2XBLA 3G3EA 3PDIB 4TYMA 2IZ7A 3EY9A 5BUSA 3RSOA 4COKA 4D6PA 2P3LA 5C53B 2H7VA 1G8AA 2BDEA 1E6LA 1W85B 1YJ8A 2Q2OA 4GW3A 1XKLA 3GNQA 3LD9A 3I53A 2CHVA 3DFMA 3F5FA 4Z51A 2ZGVA 5KYWA 3KTOA 1DARA 3T34A 3IBCA 4QTUB 2NG1A 4M8NE 5IFLA 3ZHQA 1AXGA 3FPLA 1C7JA 3NEYA 3LNCA 5F21A 4YRAA 2EZ8A 5JRZA 5C8YA 1WKBA 3FE2A 4KWCA 4QYXA 4RTPA 2GYVA 3LY9A 3V1UA 1FFWA 1UODA 1Z56C 2HI0A 2BGLA 3ESAA 3FWYA 3SKYA 2QD1A 3IULA 4I99A 3QE2A 5C1PA 2ZAMA 2ZAIA 2QP3A 5LXTB 3TAUA 2AW5A 1MC5A 2C2KA 3IPAA 2XWQA 4FD3A 4HH0A 4G1FA 3RAJA 1A9RA 3JZIA 5J1TB 2G25A 3GL9A 4JJKA 4MRRA 4O08A 1WBDA 1OT3A 2RHTA 4EHAA 2C7BA 2F59A 2V98A 3DE3X 1OI2A 1RSZA 4F1JA 2FWIA 1GAJA 1H5NA 1MH1A 1WV0A 1I4EB 3AXSA 3LIIA 4TX1A 1B8NA 1GPDG 3W5JA 1RAHA 2PFSA 3ZOKA 1XTZA 3I62A 1JAYA 1HL3A 2NSYA 3BJIC 4G8CA 1OASA 4BMZA 3WB1A 1BCRA 2Z9BA 4GPD1 4N6OA 4DT1A 2A33A 1QKIA 1GYRA 2AHOA 2PIDA 5LA6F 4CMAA 3ZDEA 2VJYA 1NPTO 1RWOA 1AQUA 3RUAA 3EXAA 2O2IA 3DL2A 1AH2A 1BU5A 4NMWA 4IDOA 1VI2A 1OV6A 3KVNA 3PEUA 4KRYA 1FU4A 1QWOA 1FYDA 1TT5A 2QN7A 3HKCB 4K6HA 5TS3A 1NL3A 2IPNA 4N40A 2JFHA 3ITKA 4G37A 1P60A 4K5QA 4RIGA 5IEJA 5KOYA 2CBZA 2A57A 3M9LA 3S2YA 4LK2A 1S0UA 1K9SA 1Q0LA 3KPWA 1QO0A 1EH5A 1V16A 3PD7A 3R9KA 3V4LA 1XZPA 1EA7A 4Z8XA 1W34A 2HIMA 3Q0TA 4IKEA 4MJLA 3UA3A 3ZPXA 3BIFA 2IY9A 2FW8A 1M6VB 4DMHA 4S05A 2VTDA 2BSAA 1MB0A 3TZEA 4ENSA 2I65A 4M3NA 1AO0A 2OCLA 1CY6A 1MGPA 3KX2A 3ODPA 1H05A 1XRNA 2FB9A 3ENWA 3S99A 5KI6A 3K9GA 4XCVA 4OUKX 5L4LA 1YBHA 3S81A 4QUAA 4NP6A 1HYQA 5HOQA 1ZW1A 1AXEA 2VT7A 4L74A 4Q1DA 5CLGA 3TOCA 2ACEA 1M72A 1UP4A 2CXQA 1UFRA 3NOXA 3CYFA 1P33A 1VIAA 2X14A 3NHSA 3QOXA 1OX5A 2NSLA 4FFVA 4KVGA 1XD9A 4UTNA 3TRJA 3M6IA 3ED5A 4BATA 1PJLA 4GBGA 2PQ6A 2C57A 5IH7A 2ST1A 2I4NA 4FDMA 2G0AA 3GJ5A 3EBPA 1P0IA 2OWDA 1MZPA 4BBPA 2V6IA 1J2YA 2FEOA 3HCOA 2FDXA 3JQ7B 3NEJA 5BUCA 5CYOA 4O4IA 4OLFA 3QP9A 1UZNA 3BAFA 1FUKA 5FOUA 5CCXA 4MIOA 1UK8A 2N42A 3PENA 4JJAA 1H22A 2OP0A 1N6NA 3BXXA 3G0IA 3K5PA 3OX3A 5P8WA 1I5EA 3EIXA 3UAZA 2GA8A 5JBIA 4C2UA 3HUFA 3VH1A 3MLBA 6REQB 1UMKA 2XYPA 2FP4A 2A9RA 4UCWA 5FNZA 4L4SA 2ZB7A 3RJ5A 4X0EA 2I9PA 4JP8A 2I1VB 4QPNA 2NTJA 1N92A 1SKYB 1C29B 3GD5A 4OQLA 1XHEA 1SVMA 1UOQA 2A5YB 3EBLA 4WASA 121PA 1PQPA 1YQXA 2W2PA 4O25A 4PHCA 3UJCA 3WBKA 3ZZMA 5CB0A 3QE0A 4XB1A 1I3OA 1TK2A 2AVNA 1M8JA 2NO1A 2F43A 4G36A 2AKAB 4RMIA 3HDGA 3AZPA 2FRVA 4O0LA 5FV7A 5DH9A 3IE2A 3UPDA 3NYWA 1TM4E 5HS4A 2D06A 5FPQA 3I09A