2OCLA

Crystal structure of valacyclovir hydrolase s122a mutant
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
254
structure length
254
Chain Sequence
SVTSAKVAVNGVQLHYQQTGEGDHAVLLLPGMLGSGETDFGPQLKNLNKKLFTVVAWDPRGYGHSRPPDRDFPADFFERDAKDAVDLMKALKFKKVSLLGWADGGITALIAAAKYPSYIHKMVIWGANAYVTDEDSMIYEGIRDVSKWSERTRKPLEALYGYDYFARTCEKWVDGIRQFKHLPDGNICRHLLPRVQCPALIVHGEKDPLVPRFHADFIHKHVKGSRLHLMPEGKHNLHLRFADEFNKLAEDFLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Valacyclovir hydrolase
publication title Molecular basis of prodrug activation by human valacyclovirase, an alpha-amino acid ester hydrolase.
pubmed doi rcsb
source organism Homo sapiens
total genus 92
structure length 254
sequence length 254
ec nomenclature ec 3.1.-.-:
pdb deposition date 2006-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2oclA00
4QNNA 5CW2A 1EK1A 3DKKA 4OD0A 4H7HA 2WG0A 5T4BA 4UBIA 1UT6A 4Y2RA 3FLBA 2LIPA 2QMQA 1AKNA 1BEZA 4H18A 2RHWA 4AB1A 1IUPA 3O9VA 4H7DA 4ZREA 5ALNA 4BP9A 2JEYA 5AOBA 3VXKA 5AK6A 5AOAA 5CH3A 5BV7A 5HZGA 3W9UA 4NZZA 5A7HA 2HU7A 1C4XA 4J0KA 5ALIA 1UWCA 3Q0TA 5AIBA 3SK0A 1Q0ZA 3YASA 4MWTA 1ZGBA 4Q3LA 2VTVA 1BN7A 4G8CA 4ZXFA 1UK9A 4HVTA 1ODSA 4QDZA 1YAJA 2WUEA 3STWA 3IUQA 3D7RA 3IVMA 4Y2YA 1PJAA 2JBWA 2VEOA 1G66A 2HA6A 1DT3A 3STYA 4QZVA 1XZLA 3KWFA 5FP0A 5AKJA 2O2GA 2V96A 2XUFA 2RONA 5ALKA 1YB7A 3ZWQA 3H2KA 1OXMA 1NU8A 3PFCA 3R3ZA 4LYEA 1XRMA 5EFZA 3HACA 3KWJA 4L9AA 1H2YA 4HXFB 3V1KA 1QIDA 2PSDA 2Z3ZA 5JADA 3FYUB 4M0EA 5FLKA 4N8EA 4BTVA 2RHTA 3GUUA 1EB8A 3E0XA 1DWQA 3JYHA 3NGMA 3W04A 5HCUA 3ZV7A 4UFNA 1VLQA 4BRZA 2QS9A 4H7KA 3QM1A 2BGRA 5CT4A 3C6BA 1ODCA 3JWEA 2WJ3A 1JJFA 1JKMA 2ZJFA 4B9EA 2G5PA 2DQZA 1DINA 4OYYA 2OLEA 5HQ3A 4PSCA 5AOCA 4BDTA 3MGAA 1UFOA 3DS8A 4J3JA 2DR0A 4PSUA 4BVJA 3AILA 4W1PA 1KU6A 4EY7A 2CB9A 1UOOA 1MX1A 3BF8A 1XLVA 1YR2A 5FXMA 1G5FA 4Y2VA 4YASA 3G9XA 4UHFA 4OB6A 3MUNA 3STUA 1BRTA 2JGMA 3W05A 3FVTA 3HEAA 3NOXA 1SC9A 4PV7A 2ACKA 3PDCA 2K2QB 5LKAA 3A2LA 3E1GA 4N5HX 4EY4A 4DMCA 3FOBA 1XZBA 3F9CA 1VXRA 2BFNA 3WK5A 3R0VA 2H7CA 5AI5A 4RPCA 4O08A 1S8OA 5JAOA 4MXDA 4X7BA 5BOVA 3A2NA 3AUKA 2HL6A 3Q8WA 3CN7A 3V9AA 2QKYA 2XUHA 2BJHA 3M83A 2CZQA 3WA7A 3R3XA 2IIVA 2C7BA 5CRIA 1QFSA 2DHEA 3L1IA 3OTQA 2ORYA 1GT6A 5LP1A 3A70A 5HKAA 2ROQA 5AI9A 4FTWA 1ORVA 4H35A 3HSSA 2OPHA 1WPRA 2Z8XA 5T4HA 3RM3A 3C6XA 5AM5A 3QPAA 5CXXA 4N8DA 2QXTA 1DX6A 4GEGA 5LZ9A 1SFRA 2JGJA 2PUHA 3G9TA 2XLBA 4AO8A 3D5EA 1FFCA 4OB7A 6YASA 2RIPA 1YA8A 1X70A 4RNCA 3H19A 1TQHA 4X6UA 4Y2PA 1QIHA 4INZA 1QIMA 1LGYA 3AIMA 4Q3OA 4CG2A 1JT2A 4BB0A 5ALFA 3FYUA 2XMBA 1CUJA 4WY8A 4F60A 3TEJA 3V1LA 2PSFA 3E4DA 4FKBA 4BZZA 3DDUA 1C7JA 5JARA 1LPNA 5DYYA 4CFSA 1MAHA 5ISMA 1QIFA 5ALEA 1BCRA 4PSDA 4AMZA 1ZIYA 3U1TA 1Q84A 4IO0A 4MEBA 3D2CA 5JASA 5E4JA 1UK7A 1CUBA 3AZPA 2QJRA 2XQKA 1AQLA 3QMWA 5CH8A 1LPOA 5JIBA 4L0CA 5BWCA 1E66A 3O0DA 5EHNA 2V98A 3DD5A 3VJLA 5JZBA 2QJWA 3H2JA 3O4IA 4KAJA 1OILA 4KE9A 4LKOA 1N1MA 1L7QA 1CUFA 1QTRA 1W1IA 4HRXA 2VT7A 4HZGA 5AI4A 2ZJ7A 2DHDA 3I2HA 1YB6A 4K6KA 5AP9A 4DNFA 1M33A 1MJ5A 1BU8A 5HK9A 5A7FA 4MYDA 2XUOA 4Y2XA 2WU4A 2C0PA 3WQHA 4CI9A 4UBLA 5LKRA 3N2ZB 1U8EA 5IVHA 1EK2A 3BDIA 3R3UA 5IKXA 2OCGA 3PF9A 3ESDA 4X6YA 3I2IA 4NVRA 1ORWA 1QE3A 4G4GA 4BAZA 1CR6A 4UHCA 2HFJA 2XB6A 5SYMA 5IH7A 3IB3A 2VATA 3I1YA 5AM0A 2CMFA 4P9NA 2GBIA 2QR5A 4WDRA 2XQFA 1H2ZA 2C4HA 3CCBA 4DMKA 1T4MA 5A62A 4FNMA 4AXBA 2WLSA 5HKBA 2JGFA 3H0CA 4BYMA 3WK9A 2W22A 4RGYA 3HZOA 1ETHA 4A16A 3AINA 4KR0A 4WFJA 3QPCA 1ACJA 1EH5A 4RE6A 2XUJA 2AXEA 3E3AA 3KSRA 3V1NA 4Y2TA 2WG2A 1CIJA 1A8QA 1XKLA 4EY8A 3QYJA 1K5PA 2JEZA 2I03A 2Y6VA 5J3JA 2O7RA 4BAUA 1Y7HA 1YS2X 1XQVA 5KWJA 1WM1A 4IQ4A 1ZI8A 1HBJA 5ALRA 4H7IA 3BJRA 3HXKA 2O2IA 5AM3A 4G8BA 2HDWA 1HPLA 4NMWA 4W63A 1E8NA 3PUHA 4H77A 3PFBA 4ARBA 4YX9A 5AKEA 4Y7DA 3WWOA 4MYSA 2CJPA 2OAGA 1CUUA 1FFBA 3QH4A 4C4ZA 3BE8A 5CH5A 3IUJA 4FBLA 2BKLA 4K6HA 4Y2SA 1QO7A 4ZWNA 4EBBA 1XFDA 1QIJA 4G8DA 1VA4A 1QGED 4UHBA 5C8ZA 1THGA 4K6GA 4W9RA 2BCEA 1HLGA 4DNOA 1A88A 4H7FA 5EI5A 4AZ3A 3HJUA 4EA6A 1IMJA 3DKRA 2XUPA 5ALVA 3O95A 2DHCA 4B7ZA 1YASA 2EEPA 2UZ0A 5CT9A 3ICWA 4U2CA 1DQZA 5ALWA 1ZIXA 1VZ2A 3VJKA 4CIAA 2H7XA 2YYSA 1XRPA 3BWXA 4QA9A 4LIPD 1GXSA 1DTEA 1TCAA 5AI8A 2WILA 2PL5A 5EIEA 2XUGA 1WHSA 3WL8A 5ALUA 1E3QA 4FFVA 1FSSA 5IVKA 4QDXA 4QWMA 1IUOA 1GPNA 3QZUA 3WWCA 1TCBA 3F97A 4HXEB 3OM8A 4A5SA 3WWEA 4W1QA 3R3YA 5A7GA 3VVLA 4C88A 3WKDA 1QIGA 2Y2UA 4JH0A 1MX5A 5DWDA 2PBLA 1EDBA 5EHQA 5HF6A 4X91A 3WZLA 1PFQA 5LYYA 2QUBA 1CUYA 2ZVDA 2J3QA 3R3WA 4U2FA 1XZKA 1ZOIA 2YH2A 3PE6A 1DWPA 2W6CX 4PW0A 4E15A 4EY5A 2XUQA 2OCLA 3WL5A 2OQVA 4P08A 2WFLB 5LIPA 2XUAA 3MUOA 4A23A 1XZHA 4BE9A 1AURA 1CUHA 2AJDA 3WYNA 4C4XA 4D9JA 4LHEA 3KOOA 3WWDA 3AJAA 4OU5A 2C0QA 3PI6A 4QDOA 4EZIA 2OGZA 4LXIA 4BP8A 2WHPA 4LXGA 2BGNA 4BVKA 4AX4A 1BE0A 3IBTA 1P0IA 5LZ8A 5JD4A 2ZJ6A 1FFDA 1G4HA 3FSGA 4X85A 2WHRA 3F98A 3V1MA 5C7YA 2GZSA 1R3DA 3SWWA 1X2BA 5AH0A 3UMJA 2RGUA 3L1HA 4BE4A 3ICVA 4CCYB 5AHXA 4DLNA 3RKSA 4UFPA 2JIDA 4X94A 5I7UA 2H7YA 4PO3X 1SCKA 4IH9A 2VAXA 1A8UA 2PUJA 1JJIA 1I6WA 1XZGA 2GZRA 4Y2JA 5LZ4A 4AN1A 1EINA 1MT3A 2XMDA 1N5MA 1XZIA 4OSEA 2JGLA 3B5EA 5BWBA 1QIEA 1R9NA 3IIIA 2PKYX 5K3EA 3IDAA 5C8XA 3I1IA 4HAIA 1RYYA 5JATA 4F0JA 2WIDA 3P2MA 3WMRA 5HF5A 2DCMA 4KJXA 3FYUC 5JAUA 4HXGA 3WK6A 1W4LA 2BUAA 3C8DA 4E46A 4J0CA 3WL6A 3EIOA 1J07A 1LPMA 3WKCA 1QLWA 1E5TA 2I78A 5AKKA 1WPXA 3NUZA 3LIIA 4HS9A 2ACEA 3G8YA 4B85A 4AO6A 4ZI5A 2ZYHA 1VZ3A 3O4GA 1B6GA 3AIOA 4B84A 1CUVA 1XZEA 3LCRA 1QTIA 4OPMA 3FWHA 1SCIA 3WKEA 4N8SA 1JFRA 1TK3A 3DL7A 5K3BA 4FHZA 4DTCA 1EA5A 5CTAA 2JGKA 3G7NA 1XZDA 5DNVA 2WUFA 2WUGA 5K3CA 4M0MA 1FFAA 1GKLA 1XLWA 3LS2A 4GXNA 3WK8A 5ALDA 1JI3A 2PU5A 2QT9A 1ZGCA 3L1JA 1ZD4A 2VAVA 1R50A 3N0TA 5AK4A 1ODTC 3WKBA 2GBCA 3T4UA 1H22A 3HI4A 5D6OA 3FVRA 2I3DA 1AMNA 1AZWA 1J1IA 4BATA 5AKLA 3H2HA 3LLCA 5D3KA 4KAFA 2EDAA 3SX4A 1DQYA 1MN6A 4V2IA 3VVMA 2V97A 3WIBA 5JZSA 4U2BA 2GYWA 4DNPA 3VISA 3IUMA 4KE7A 3G02A 2OGTA 1N5RA 2B20A 4GBGA 5ALJA 4KE8A 3CXUA 5AM1A 3C45A 1PV1A 5JALA 2CBGA 3ZPXA 1BEEA 2I3ZA 5DTIA 2XQJA 1P0PA 1XRLA 5ALYA 4BTLA 2OQIA 3OC0A 4K2AA 4XWGA 2B61A 2CKMA 3I6ZA 5JD5A 4PQEA 2FJPA 4WDQA 1UZAA 1K8QA 2AJBA 4MQLA 1X2EA 1R1DA 3C87A 2HM7A 4WJLA 3O4HA 2VF2A 2HA3A 5KWIA 4ZV9A 3O9MA 2J4FA 1IZ8A 1FFEA 4IH1A 1TAHA 2HHAA 1SOMA 2HU5A 4DSAA 1UK6A 3EBLA 1H23A 5AKZA 3CN9A 1A7UA 2X5XA 3R41A 5C8VA 3DOHA 2Q0XA 3D2BA 3IURA 3VKFA 1HL7A 1JU4A 3K2IA 4G4IA 2QM0A 1AUOA 4UBMA 1P0QA 1UOQA 3C6YA 3I2JA 4DMHA 4OB8A 5AJHA 1ZD3A 2HADA 2CEKA 4BCCA 1R9MA 2Y2VA 4JEIA 1F6WA 2EDCA 3D2AA 2HA7A 2WTMA 3QMMA 4X71A 3OG9A 4AN0A 2G4LA 4ZGBA 4QLAA 2D0DA 1N8SA 3H1AA 4CG1A 3HC7A 1XZAA 4FNGA 5FKJA 5IVIA 1SCQA 3DQZA 3HYSA 1DX4A 2C5FA 4QEKA 4E14A 2G5TA 1LNSA 1UKAA 4EY6A 1UKCA 3C8HA 5DYTA 2GBFA 4X97A 1IUNA 3PICA 4H0CA 2HFKA 2XUKA 5AO9A 1MPXA 1CUXA 1D07A 4PNZA 3UUFA 3IULA 1CVLA 2P8SA 5JANA 4B80A 3DJYA 4MQMA 4G9GA 3QITA 5AI6A 4EB0A 2H9YA 3TGLA 1TKRA 2NW6A 1HDEA 3EQ7A 5A6VA 4UPDA 3RARA 4EHBA 1P0MA 4KRYA 1QIIA 2WU3A 4J0DA 2CUTA 4B6GA 3ESCA 4J0IA 2PPLA 4AQDA 3ILSA 5CMLA 3M3DA 1AX9A 4WCVA 2QXUA 4X6XA 2AJLI 2X8BA 4FLEA 4C89A 5JAHA 1QFMA 3G0BA 2RI6A 4ITVA 1LBSA 1Z68A 4L72A 5F4ZA 4W1RA 3GBSA 2WKWA 5EIHA 4UUQA 4H7EA 4JYPA 4B9AA 1XZCA 3STVA 5FOQA 1CQWA 2QOEA 2VT6A 4GLBA 3UUEA 4UFOA 1BN6A 4UBOA 3WL7A 5HK8A 2WQZA 1XZFA 1GQRA 1HKHA 1MX9A 2Z5GA 4X93A 3G0DA 3GA7A 3PUIA 3I2KA 4C01A 4F21A 3C70A 2AJ8A 4DMFA 4XX1A 4LYDA 2OXEA 3BF7A 4U2GA 4CIBA 1R4ZA 1QO9A 3C5VA 3LP5A 1GKKA 2XMSA 5A2GA 1F0NA 3FSGD 2HRRA 4J03A 1JJBA 3U0VA 1DU4A 2XMQA 3FCXA 3WJ1A 2ECFA 3I6MA 3BL8A 5HQ3B 3R3VA 5FRDA 2J3DA 4HTAA 1RWQA 4UBNA 1CRLA 2PSHA 4WFIA 4QE3A 1UKBA 4EUSA 2GYUA 3B3QA 4FLMA 3IUNA 5AM2A 2WIGA 1J2EA 3OPMA 1MTZA 5ALOA 1QOZA 3H18A 5I9IA 3NWOA 4ETWA 4G9EA 3ED1A 3KXPA 2YASA 2R11A 5YASA 5HFAA 3DYIA 2BUBA 3S8YA 4AMYA 2WIFA 5T4FA 3BDVA 4MEAA 3ESBA 2VJBA 2JF0A 1VE6A 4JUIA 1YSCA 5CT8A 5AIAA 5H3HA 3KDAA 5KBYA 2BUCA 5CT5A 2DQYA 2OCKA 3TRDA 3G0CA 4KE6A 2XMCA 1THTA 5LZ5A 5JD6A 3D59A 1KEZA 3H2GA 2ZYIA 5I8PA 1WB5A 4CCWA 4LXHA 5LZ2A 1VKHA 1U2EA 2XDWA 2WG1A 1EX9A 4QLOA 1CLEA 2PX6A 3C5WP 1WCYA 2WIKA 5AKHA 3VJMA 2WJ4A 1ZD5A 4FWBA 3CCCA 2Z3WA 4UBJA 4FDMA 2XQGA 1GZ7A 1E89A 4P92A 3WWPA 2WUDA 4E11A 3FAKA 4RE5A 3QBJA 3S2ZA 4C4YA 2O7VA 3AIKA 5ALGA 4FOLA 3C6ZA 5CXUA 3WYDA 1DT5A 2VQ6A 2HA5A 1EXWA 3R40A 5E4TA 1YA4A 3K9BA 2AJCA 1CUDA 3DYVA 3D4LA 2HA2A 2E3JA 2FJ0A 2QUAA 1XRQA 3A2MA 5DNWA 5JAPA 4GHWA 1DWOA 2ZSIA 2OGSA 3ESAA 4GI1A 5CBKA 3AFIA 3W2TA 5EHZA 2IX9A 5HFNA 2PU7A 3A6ZA 1ISPA 2XMZA 1XZJA 5FPPA 5ALQA 5DYWA 1FJ2A 3HABA 2VSQA 1LZKA 4BRSA 1RP1A 5LZ7A 4Y2QA 5D7BA 1XZMA 1EHYA 4ROTA 4QDUA 4DNQA 2WSLA 2R8BA 1MAAA 4KYVA 4B82A 1GGVA 3WK7A 1MNQA 4BVLA 2DFPA 3DNMA 5ALZA 5DLPA 5FV4A 1VXOA 1CFJA 1EVQA 3QPDA 4CG3A 4I19A 1VJ5A 1WB4A 2DSNA 1CPYA 3H2IA 1AC5A 5AICA 2ES4A 4BC1A 3B12A 4J0GA 5K3FB 5A71A 4J0JA 5ALLA 3STXA 2ONCA 1J06A 4OUKX 1GPLA 3GZJA 2FX5A 5IVDA 1HQDA 4Q1VA 5E2IA 4GW3A 4NS4A 5AKXA 1Y37A 5T4EA 5ALTA 4Z49A 3IA2A 3W06A 1B41A 4JNCA 5AM4A 2OCIA 4MWSA 2XMRA 1XQXA 3AZOA 4Q82A 2QVBA 2PVSA 1XLUA 2XQIA 3D3NA 5EGNA 3DEAA 5ALSA 3WIOA 3ANTA 3HRHA 1O6FA 4UHEA 2H1IA 1QIKA 3H04A 2O2HA 1H2XA 1XQYA 4W1SA 4X92A 3SC2A 3ZLVA 7YASA 1W75A 1F8UA 3I28A 4J7AA 5HF8A 2WHQA 1QZ3A 3GELA 4X90A 2B4KA 1KU0A 3QMVA 4S0XA 5SYNA 2WFLA 3BXPA 4FFWA 4OYLA 3G9UA 3I2FA 2BAGA 3OOSA 4TGLA 3BIWA 4ZV7A 4DGQA 5ESRA 5FDFA 3F8SA 2VJAA 3C43A 1CUSA 5DTJA 4X00A 2GYVA 2YXPX 2OAEA 3GFFA 3HLKA 1EVEA 2XMGA 2PSJA 5ALHA 3I2GA 3WKAA 2ZYSA 1UK8A 3F67A 1A8SA 1W52X 1CUEA 4GDMA 2HA4A 3MVEA 3ZI7A 2XT0A 2Y6UA 2C5GA 4I3FA 3GROA 1EDEA 4FMPA 4YK7A 4B83A 1XRRA 2G63A 3PF8A 5CT6A 4UBKA 4GWLA 1ZICA 4TVKA 4N5IX 5DJ5A 2QZPA 4CCYA 4BAGA 3X3HA 3WLAA 5EIAA 3BIXA 3FBWA 1EDDA 5D3ZA 3W9BA 1GQSA 2WIJA 4IHAA 3RK4A 4QDTA 1Q0RA 5HF9A 4ARAA 1BROA 1TIBA 4KAAA 4PF1A 4BC0A 5K5EA 1JU3A 3M82A 1TCCA 4XIIA 4X3CA 3BJMA 2QTBA 4BCBA 4XJVA 4JYMA 4Q3KA 3STTA 1E8DA 3RLIA 1LPPA 5AKGA 2ZYRA 1WHTA 1TRHA 3ANSA 2XUIA 3KD2A 3FYTA 2XUDA 1BCSA 1ZI6A 2B9VA 1C7IA 1BS9A 5AK3A 5K3DA 3AZQA 4UHHA 4BZWA 5ALPA 4DYHA 2JGEA 3ZLTA 1JMKC 1U65A 3FCYA 1IVYA 3K6KA 5LLSA 2PM8A 1E8MA 4Y2UA 5K3FA 2RAUA 4AO7A 3OURA 4Y9SA 5AK5A 1ZI9A 4C87A 4YPVA 3DCNA 4J0HA 4KRXA 5JZ9A 1USWA 1UXOA 5DNUA 5ALXA 2C58A 1CQZA 4QWWA 1VA5A 1GPKA 2Z8ZA 4OCZA 1LBTA 5CURA 5K3AA 1OCEA 1YAHA 3JW8A 3T52A 1LPBB 1QJ4A 4P93A 1LPAB 4BBZA 1MU0A 1ZJ4A 4BDSA 4X95A 2VA9A 4WFKA 1H2WA 1JMYA 4GECA 1G42A 4KEAA 1CEXA 4BCDA 1R88A 5EHXA 3M81A 1CUGA 2QRUA 5AI0A 1YCDA 1YS1X 4TPKA 3V48A 3WI7A 4C6HA 2WFZA 1LLFA 1EI9A 3QVMA 3WZMA 1IZ7A 4OU4A 3D0KA 4M0FA 2XLCA 2WFMA 1K6EA 4UHDA 2HRQA 3TJMA 1LZLA 2OG1A 3FLEA 3FLAA 3I6YA 2FUKA 4HRYA 4KACA 2WTNA 1MO2A 2XE4A 3FNBA 4U2DA 1UOPA 3F96A 3DL4A 1XRNA 1XROA 1CV2A 1W6RA 1NX9A 3EF3A 4U2EA 1AGYA 4I4CA 1CUWA 4FLFA 2WHPB 4Q05A 1LPSA 1U4NA 2WM2A 2HA0A 2D5LA 1EB9A 1CUIA 1Q83A 3G0IA 5KREA 3DOIA 1QONA 4DIUA 4L3WA 1VE7A 4B0OA 2GBGA 3G0GA 5AKIA 2VJDA 4H7JA 5AKYA 2WJ6A 4DSZA 5FUMA 4G5XA 3LIPA 1L7RA 1K63A 4Q34A 4XVCA 2JGIA 1T2NA 4G4JA 4IH4A 3G9ZA 4MJ3A 1WB6A 2V9ZA 1CUZA 1W76A 3WJ2A 1K4YA 2VJCA 3ZLUA 5FPQA 1L7AA 2J4CA 4B0PA 3H17A 2Y1KA 1CUCA 1O6GA 5E4YA 3EQ8A 2IITA 3DLTA 5ALMA 5C81A 1Y7IA 1CUAA 4ZRDA 2PSEA 1NU6A 1VOTA 4DM7A 2XI4A 4K5QA 2X76A 1XQWA 4WY5A 1ZD2P 1XKTA 1F0PA 3H1BA 1ZJ5A 3EQ9A 1MNAA 2HIHA 2HU8A 1WOMA 3WA6A 3WK4A 4FBMA 3O4JA 4F5ZA 2ZSHA 4G1FA 3VDXA 4AZ0A 5JYCA 4B81A 1ACLA
chains in the Genus database with same CATH superfamily
3AR6A 3EHDA 3DG9A 2F1JA 3DXFA 3RTGA 4FMCF 5E2AA 3N6VA 2H3HA 2HBQA 2D1TA 2HMSA 1E64A 3LFUA 3R6LA 4OD0A 4D3DA 4EEXA 1IEWA 3O1LA 4DV1B 4EFDA 1YTUA 4H7HA 4MIKA 5T4BA 4E21A 3U4GA 1K2VN 5GIOE 1D4ZA 3INGA 1UBMS 4LBWA 5B1EA 4D1YA 1BH2A 3KTDA 3DKIA 3FDZB 1YQQA 3P1JA 3GJQA 4Y2RA 3K0AB 3S1AB 3TOCA 2C77A 2ZRGA 2GEDA 4O33A 2CVHA 2O23A 4HBGA 4Z8XA 2ZITA 1UP4A 2B2XA 2XGMA 1DXHA 2NO1A 3QXXA 2RHWA 1IXYA 4AB1A 1IUPA 5FOTA 2NNWB 4BP1A 4Q7MB 4JI5B 3IEKA 4YYEA 1P62B 2GSWA 3IOEA 1NPYA 1OXUA 3NHUA 3AI2A 5AOBA 4DZZA 3JQ7A 5IBCA 1E3DA 5CXSA 4JXZA 1NMSA 2PZKA 2NUBA 2Z4SA 3BMCA 4IFIA 5C4IA 5BV7A 5HZGA 4IZ6A 3LX4A 3PQ5A 4L9WA 2JH8A 4TUYA 4G23A 4MLCA 4BO8A 4DTIA 2EERA 1L7PA 3HPRA 5A7HA 4R2XA 4TMKA 3ZY3A 3WLJA 1E4EB 2WEKA 1O4WA 5ALIA 5M2QA 1UWCA 2G76A 1V8ZA 5BMVB 1TYDE 4Y9UA 2BI8A 4KX5A 3QF4B 2NPFA 1RD4A 4MWTA 4C06A 1U9ZA 4WOPA 3GJ4A 3C2QA 3OM0A 4ZQEA 4URVR 1J9GA 3HFRA 3KPUA 3CONA 5AOVA 1L1QA 2QSJA 3COSA 3IP3A 1TK2A 3LYHA 3O31A 3OECA 4RK7A 4CKBA 2Z6UA 4ZXFA 1UK9A 1JW9B 4UREA 4HVTA 1P29A 1FCJA 2G07A 3FTDA 2FEWB 3UXYA 3DM9B 4OO3A 3GYBA 5DHSA 3WDMA 1JQAA 1G9SA 1NW9B 2V7XA 4Y2YA 1PJAA 2ZBRA 3CPJB 1ECGA 3X1YA 1NDHA 1TQ2A 3HK2A 1RRFA 2PUVA 2HA6A 4P4TA 2ZXUA 4JI2B 2Q6TA 3G2NA 3O82A 2A0KA 1R8SA 2J0UB 3CVJA 1OA0A 3MAGA 4JC0A 1I4WA 2X3YA 3JYLA 3FY4A 1VRCA 3NBKA 4GPIB 1MQ9A 1VLLA 4PHHA 5EUQB 2VZEA 1J21A 3IVXA 3WQSB 5JS7A 4R1UA 5BR7A 3C7CB 2O2GA 2XUFA 1AK1A 1P73A 5ALKA 4EYSA 4RTQA 5DBEX 3M6LA 4TKVA 1YB7A 1FQOA 4JP8A 5LDDC 1RRGA 2FZVA 4YMIA 4BP3A 1OY1A 9GPBA 2JK0A 1DL5A 3UH0A 1GM5A 4Q1DA 3P52A 3HEBA 2XBMA 1E5DA 3AF6A 4ID3A 3TLBA 5IJ0B 3JPYA 4KQKA 3O8RA 1SC6A 2C5BA 2G71A 2GF9A 3B2EA 5K05A 4HXFB 4FMDF 4GI3A 3MGGA 2F59A 4KXVA 3SSOA 1V96A 3LCUA 3WRYC 2E4VA 3OMXA 5JADA 3FYUB 1MB2A 4M8LA 2ET6A 3NM4A 2BHRA 3GA0A 3L4BA 3Q5GA 2IELA 4RWZA 4X8HA 4BTVA 3F1KA 2BL4A 2CV1A 1XPJA 2VRNA 3OE7D 4ER6A 4ZEVA 2E1RA 1RYMA 2CSUA 3VQTA 1AKWA 1JZSA 2HLPA 3U4QB 1U28A 4Q7LA 2XYPA 5E7JA 2B6NA 4IW3B 1YNSA 1IPEA 2C5LA 2Y0EA 3CTPA 2XQVA 4U8GA 5HCUA 3JVVA 5FUBA 2J3IA 2JJ1A 5B5SA 5CT4A 1LNQA 3P97A 3C6BA 4RESA 1IYZA 2J3HA 3WGZA 2AR9A 2C57A 4NMLA 2NG1A 1R4NA 4UUBA 1RLOA 1UFQA 1YKFA 3Q7SA 4WXMA 3LUGA 3VYWA 4W5TA 3CRQA 1KI1A 1BCRB 1OIXA 1JKMA 4WV3A 3LAWA 5F7ZA 1RMTA 4P3PA 4WE3A 5A6SA 1U7WA 3CY6A 3SBXA 3BGSA 4FFLA 4LC9A 1QWSA 4INOA 1YU9A 3FMOB 2H4XA 3OTWA 2SICE 1QH8B 1ZUHA 3DOJA 2FWIA 4Q3NA 5JNTA 4ME6A 2J6IA 4BDTA 2AW3A 2AG0A 4LGCA 3AHFA 2QMOA 4X41A 4MKGA 3MERA 4HTFA 5FFMA 2FPWA 1N33B 2A0UA 3KJEA 2AI3A 4ENWA 4YR9A 1P8AA 3U7GA 3QXSA 5DNCA 4YDQA 2W98A 3GB9A 1E1QD 4RKRA 1H65A 3IPXA 4D97A 2E4XA 1I14A 3SOPA 2UDPA 5JAMA 5M5BA 1KZ4A 5EHIA 3BTOA 4KWIA 1GGNA 1T1EA 3CJRA 3QUAA 5FOWA 1DKMA 2CB9A 2JGDB 3X1KA 4ZCMA 4QGSA 3AEYA 3IO3A 3NBFA 3RVBA 4I1IA 5BW4A 4BMOB 3GJSA 4YRZA 1GLVA 2BELA 4D56A 4G5OA 2M9MA 5EZYF 1QC5A 4UHFA 4OB6A 3E7FA 3MUNA 4JHLA 4KQ1A 4I1PA 4UKDA 3W9YA 4C5AA 1UBTS 3HLYA 1BRTA 2EV9A 2GRAA 4G65A 3W05A 4R0MA 2GK6A 3EH1A 4HB3A 4B3SB 1ZKMA 3Q1KA 1D2MA 1KQPA 3TKLA 3RF6A 2PJRA 4L0DA 3EDOA 1X0XA 1SUFA 1FJHA 1U2DC 3TEFA 3MJ4A 1AZLA 1G5TA 2BTQA 1BIFA 1T4BA 4BNUA 3OQ1A 3TZKA 2W2OA 4HSGA 1RJ9A 2C5HA 2R7KA 5CNMA 1OIWA 1MT0A 1A27A 2HKIA 4OF4A 3EEQA 4PV7A 4HYEA 5B2ZA 2FPOA 1FU4A 1QCYA 2QJTA 5EWJB 4CLRB 4EJSC 1DIOB 2ACKA 5BPFA 4BJ5A 1BWRA 2K2QB 5LKAA 2RB4A 1DC3A 2VHXA 1T9ZA 3PKJA 5TB5A 3E1GA 2PZLA 5DYNA 1IWBB 4Z1MA 1IN5A 3TI9A 4CM4B 1LA2A 4ZOLA 3RIMA 1OTXA 4XDHA 4PHGA 5BWLA 2F1HA 4YLEA 5BSFA 4YP0A 1T2DA 1FYWA 2Q3EA 3P5BA 4EY4A 1ABBA 4I5IA 4X7PA 5JCJA 3VI4B 4JVLA 2QENA 5A04A 3R3SA 2EG9A 3F9CA 3ZWNA 4JBNA 2FF5A 4BX9A 2I4OA 3PDUA 5TPZD 1KPGA 4F2PA 1DHTA 3LUAA 2MT9A 3CLKA 3NTQA 4CEHB 3DOUA 4FIZA 5AI5A 4FW8A 1LLQA 3MJCA 2W2NA 3CCFA 2A6PA 2F3SA 3SZ3A 3T7IA 2P0YA 3DZIA 4KLCA 4QELA 4QTTB 4O08A 3FUXA 1XZQA 1A4UA 4LDQA 3KBOA 2GGSA 1R27A 2W2LD 2WNHA 5FOSA 4ED9A 4EPXA 2ODTX 4XVRA 1AQJA 4MQEA 1OFIA 2CVOA 2PH1A 4IFBA 3A7EA 1UFKA 2WE7A 4L3VA 1TO2E 4MW1A 4X7BA 4DC0A 2CXNA 5CG2A 2XVYA 4LRUA 4GD3Q 6Q21A 4BO3A 5EXPA 8GPBA 3O3MB 1FLAA 4QJ4A 1LK5A 3U7QA 1XQ9A 3CN7A 4ZP1A 3WRXA 1EUCB 3ONEA 3ZV4A 5B57C 221PA 1O8CA 1GPH1 2CGEA 1EA7A 2QKYA 2ZVQX 4PQRA 3ZZNA 1QG2A 4PAOA 3M83A 2CJYA 3GJTA 3P9CA 4H6XA 1G9XA 5JMTA 1CNFA 1XCBA 2BVNA 4J6FA 4LYJA 5HM8A 1GL9B 1QFSA 1J9ZA 2DHEA 1I1OA 2RBEA 3IPAA 3OTQA 1BSVA 1GT6A 5LP1A 3EGWA 1RWWA 2LDBA 2OAP1 2I65A 3K9QO 4FS3A 3VO1A 3VR1A 3NUGA 2ROQA 3VU9B 1NHWA 2IHYA 4EMTA 2YICA 3BCRA 3PPIA 3HFSA 3HCPA 3P4UA 2WA1A 4U6SA 3ZDCA 3AHDA 1DWUA 2DSTA 4LNAA 2OPHA 1Q17A 1JPJA 4C30A 5KNDA 3V8EA 1JHVA 3ZEAA 1WPRA 5JY6A 1OI2A 1OLSB 1NNSA 2FPIB 2OGUA 2Z8XA 3IESA 3M1IA 3QOFA 4M89A 4RLSA 4RF3A 5FPTA 4ZEWA 4R8KA 1A2QA 1XG5A 5AM5A 3J81A 3TNJA 1QDUA 2GPBA 4DADA 3PBKA 2Z43A 3FNQA 1DX6A 4Q4JB 4DGSA 5LD2B 1WMFA 2QM8A 3WB1A 5EE0A 4ASUA 4BQOA 5LZ9A 1ECJA 2JGJA 3AI7A 1ZUWA 2W0MA 2Y93A 3VSBA 3O3CA 2GJAA 4P7BA 4RY0A 1YMVA 1FFCA 2AHOA 4RADA 2CC2A 4AG6A 3S40A 1A98A 1ONOA 1UEIA 3AR2A 1D5CA 5AW3A 1YA8A 2B1IA 1IM2A 3QVJA 3H19A 1NIJA 4X20B 1EFCA 4WN3A 3VDQA 1X7YB 4G6ZA 3AM5A 3NIGB 2OB2A 5TMPA 3A04A 4C4SA 1GVNB 2JGNA 3D1JA 1LGYA 4G0YA 4GBED 4UHJA 4Y30A 4CG2A 1LRKA 5J5AA 4L15A 1P7ZA 4QTXA 5KKCA 5ALFA 1U2RA 4ZICA 2FP4A 3TCKA 5H81A 4ER7A 1VHLA 3DDNA 1Z0DA 2ESRA 1JEYA 1DG9A 5CPBA 4EO4A 5IYZA 3RYFA 4MR8A 5CDTA 2AV6A 1Z6PA 3TEJA 4X63A 3NW9A 3V1LA 1WVIA 3COYA 3KXDA 1XCMA 3BERA 3DD1A 4NBWA 3TZEA 3UMVA 5FV7A 2JB9A 4WBNB 2QROA 4E5DA 1US8A 1WRBA 3EIXA 2E48A 3ZZMA 3HJCA 4FKBA 3GW8A 1Y4DE 4BZZA 5JQWA 4UVGA 1SCAA 4OGKA 2PT5A 4E5SA 3ZXIA 2ZREA 3KXLA 5TPWA 2ZR8A 5EEHA 1TAQA 3ZD7A 4HK4A 1L8AA 3SF8A 2AHRA 2A86A 3SYKA 5KSZA 1B14A 3DC2A 1Y6FA 4BBPA 3RU3A 4QUIA 3OLQA 3F6RA 3H65A 5TR9A 4D2IA 3E4CA 4A2QA 3U4HA 5KMGA 2IP1A 5T41A 3IQHX 4NU8X 4U7JA 5IPFA 1B16A 3HWRA 1V3TA 3GCZA 1V7ZA 4DYDA 2QM7A 1H2HA 4OATA 1PV4A 1F4PA 1Q84A 2FUG1 1V1RB 4IJ5A 3RTDA 4MEBA 4MRAA 3SQNA 4E88A 5IEJA 2E82A 1C14A 5JASA 1WZNA 3A7DA 3ZDBA 1ATZA 1MRNA 2B6HA 2XTNA 1KZ9A 1U0LA 2XVAA 3AJ8A 1PCXA 3AZPA 3C1OA 5B36A 1NGSA 1IQRA 1YFLA 3EQ2A 3AGQA 5ECWA 1J8DA 4K9DA 5CH8A 2VP3A 1LPOA 3CZQA 3VR4D 2H16A 2V8OA 4AECA 5CCEA 1JRLA 4GO1A 4TRJA 1Q15A 4YV2A 1O57A 3AV0B 1YQGA 4LGYA 4WXEA 2ODWA 1E66A 5IM5A 4CHTA 4XUDA 5EHNA 1EP9A 2RGNA 1Q0LA 4IOKA 2WM3A 3GVXA 1F0YA 2QG9A 3M8KA 2NVWA 5JO0A 2FR0A 5H4HA 1TKCA 2MSCB 3W2EA 5JZBA 1J99A 3TDKA 5JSYA 3VPHA 3Q6IA 4BS9A 5L3SB 2ID4A 2XWQA 1ZOSA 1UPBA 3CHYA 3TQSA 2IODA 4H31A 4PZPA 1EVLA 4NCIA 1YCFA 3A9CA 4QXPA 1M34A 2AXPA 2IFTA 1BD4A 4RD1A 1L7QA 1E3SA 3ADOA 5CA1B 3BCSA 2AA3A 1W1IA 4HRXA 2VNSA 2DCUA 1DKNA 5FA5A 5KKNB 3H5TA 3FKSD 5HIMA 3UKOA 2UYYA 1GU0A 2R6GA 2VTKA 4BLWA 1SUCA 3I2HA 4PWZA 1GAQA 1E3JA 1GARA 5JBIA 1X3LA 1P9NA 4ND5A 3TGWA 3NGLA 4DNFA 3IEPA 1HEIA 1KEUA 2AKYA 3EGOA 2XCTB 2HIMA 4EG6A 2RGGA 2NACA 4J1NA 5A7FA 5C3MA 3FDFA 4JBGA 1FMTA 4BJ6A 2BSQA 3FIJA 5BO5A 4F38A 2C0PA 2R6CA 3L84A 2AMYA 4M87A 1UUFA 1USUA 2JCSA 5CFLA 1F7VA 1QH1B 4F06A 4EB6A 2BF7A 1Z4JA 3WQHA 3GEGA 1SM4A 1E20A 5LKRA 4K88A 4ZEOA 4XDZA 1YR3A 1U0NA 2HD4A 2LRHA 3DB1A 3I0NA 3VX4A 1U8EA 1X1AA 5K20A 2PGOA 1TA0A 2HAEA 3GT3A 4X5OA 1EK2A 1JTEA 3BDIA 3ORSA 1QRUA 3B1VA 4Z9XA 4EKDA 1M8JA 5EE5B 1SGWA 1QHHA 3BJIC 5CNJA 5CD1A 2Q9AA 5ITVA 3PF9A 1I10A 1ZCFA 5JHHB 3FHTA 4B32A 3ESDA 4H6WA 2POCA 1V3QE 4DB4A 4Y1FA 4H7PA 2E6KA 5JEDA 1O5TA 1P9LA 2G72A 4X3OA 4MZXA 1GTMA 1CF2O 3CGGA 4YAUA 3BE4A 3EVFA 3KWLA 4EFMA 4KO1S 1DJOA 2F9LA 2JATA 2PH5A 4BAZA 5IXSA 3MWKA 2C2GA 1KY2A 4UHCA 1DC5A 1DDGA 5HBRA 3I04M 5HMLA 3U7JA 4EW6A 3NJRA 4ILEA 1N2SA 4NENB 4ESEA 4RJKA 2YCBA 3I1YA 2CL7X 3FNGA 1RPJA 4LMAA 2WWWA 3R5FA 4KIJA 5FNVF 1ID8A 4ZGWA 3TIGA 3LX5A 4OJYA 3RT1A 2WJGA 3H13A 4MVJF 2ZP1A 2WT4A 2XQFA 1EE9A 1KH3A 1C1HA 2BW0A 3E48A 3WLQA 2BC9A 1H2ZA 2PUAA 2G6BA 1XI2A 4KFTA 2C4HA 5GJWC 3ZU6A 5BSWA 3FZYA 4D9NA 4Q4LA 1TVEA 3U7FB 4E5YA 4AXBA 3OTHA 3RUFA 4B74A 2JGFA 5C35A 4BYMA 3PVSA 1Y42X 2JJYA 5P21A 3ANLA 2YY6A 3LDUA 3DEHA 5DHFA 1E18A 3R7DA 5DGIA 1SKUA 4MB0A 2H48A 3DZJA 2O1WA 1UC4B 5IAKA 3E3LA 1M6VB 5EEGA 3N86A 2IEYA 1KOGA 1BQ3A 3HCFA 1XXHA 1UBUS 2IF2A 3LPMA 3PKZA 4IX1A 1MJGM 3LHSA 1TM1E 4KPGA 2BKEA 1I32A 4N39A 5C9ZA 4G0NA 2DY1A 1ECBA 1W2HA 3NRJA 4CQMD 3K20A 2ECPA 4B2PA 3AHCA 1KWGA 3QW4B 3I72A 3NT5A 1EG2A 4J3FA 3PFWO 3AUXA 3U6BA 1VIDA 1C0LA 4MVYA 3B6IA 3VPBA 1UDRA 4RE6A 1D1PA 4KDFA 2NT4A 4B2LA 2QAGB 1PVOA 2CEAA 3K8QA 3PWKA 3TF5A 3PEWA 1X1CA 2QQFA 4Y2TA 3MCWA 4XGNA 1C3OB 3EHEA 2VUUA 2WG2A 1CIJA 2IZ6A 1E1NA 5FTNA 3UJAA 5CCBA 2FU5C 3QYJA 2OFFA 4QVGA 4R71A 1M8GA 1YIAA 1SAYA 1YBHA 3WLIA 4E70A 2BBOA 4JQYA 4L6IA 4XGKA 5IAEA 1DXOA 4IUYA 1DAPA 2HW8A 4G24A 4JLPA 2EHJA 3QX3A 4HH3C 4UVDA 2OZLA 1HMPA 1RKXA 5FHQA 2G7ZA 1IJFA 1Y7HA 1YS2X 2XAUA 2ONZA 3KOMA 3QFHA 5CGQB 3PNBA 4LNHA 4QEDA 4B3FX 2I55A 4IQ4A 1U94A 1ZI8A 4J1TA 1JMVA 3A37A 4QYWA 4NE9A 4E30A 3ENVA 4IGAA 1U0OC 1JA9A 1MIOB 2CLCX 4K87A 3LCMA 4D3SA 4G8BA 1R0YA 3PU6A 1KI6B 4BVFA 4ENUA 3IPLA 1A04A 1VPDA 4NMWA 4RFLA 4G84A 1B6SA 1NW5A 4L9SA 1DCMA 2GUWA 5J4LA 3WMEA 1L2TA 1DKPA 1JXOA 1QKKA 3T94A 1GSIA 2RG7A 4DRXA 4FGKA 1FNBA 5CYOA 1U04A 1ZM3A 5CG1A 5KEIA 3AFGA 4ARBA 4MKFA 2IEIA 2Y9MB 2ON6A 4IZHA 2WV9A 2PXHA 2TECE 4MS3B 5AKEA 3WWOA 3GCGA 2YMLA 4MYSA 2PX2A 4ZARA 1XAGA 2H1CA 3LWBA 4EVIA 2NZ8A 4P6VF 2E85A 3OOWA 4PBSA 5HPYB 1CUUA 1U8UA 1XEWX 5DNAA 2Q6LA 3PGJA 3RD5A 2I6GA 4G26A 5JJBA 4YAGA 2NYAA 1FFBA 3NHMA 1WBBA 5CH5A 1JIUA 3COVA 4UULA 1I2BA 4PHTA 4JDUA 1G5HA 1BWPA 2QP3A 3GRPA 5IFLA 2BKLA 4QYSA 4ZMRA 1O58A 2OZPA 4H1TA 4UTXA 4JLOA 4L8GA 4ZWNA 5I7AA 4EBBA 3A4YA 1Q0PA 1R0SA 4G8DA 1E0JA 1Y4AE 4TUYF 4Y1RA 3CRW1 5FPSA 1DO8A 4C43A 5JI3E 1TKAA 2HCJB 3NWBA 1GFZA 1SCJA 2VDLB 3OLVA 4H3SA 2VTDA 4FGJA 3TLAA 1XAIA 5B4UA 4XQCA 4IFEA 4K6GA 5FUYA 1S2GA 1XAHA 2PKCA 2GM5A 3HGMA 4PG4A 2BCEA 1RAIA 2JFQA 3OH8A 5EL0A 4DNOA 7ABPA 2GLXA 4H7FA 1V8FA 1MF7A 1ZSNA 2WD7A 3HJUA 5EI5A 2CL0X 3HCCA 4LJ7A 2KJQA 5MFPA 1NWCA 2FSVC 2IL1A 2KX7A 2R8RA 1N3IA 2VLIA 3BSWA 4INPA 1IMJA 1R16A 2CF5A 4ZU6X 3WB2A 1LDEA 4NL4H 2BFFB 5LP6C 2D0PB 2W8BB 2XUPA 3IT1A 3LNCA 3R4CA 5HMMA 1UDXA 2QV0A 4EP1A 2FUG6 2XWPA 3GVPA 5K0CA 3HNPA 2QTVB 1RJEA 5IUNC 3G8DA 2FR1A 5FD8A 4IEEA 3UMRA 4LV8B 4IHJA 2R8XA 1VBFA 2Y0CA 2IIPA 3VA7A 4TV8F 3LOQA 3T06B 3ADCA 5ALWA 4AAYA 3PVCA 4MRMB 1BJKA 4N9WA 4WLFA 4KO8A 4GI5A 3VJKA 4CIAA 5LWQA 3P2OA 2D2VA 4RV5A 4GUDA 4WECA 4B33A 2QD2A 3GPBA 3QA9A 3PJGA 2P3OA 1ECCA 2YRXA 1J1UA 2ZB3A 2QE6A 3GIDA 2WILA 4QT0A 2EOAA 2YJTD 2AL7A 3N8IA 2BEJA 1WHSA 1ISSA 3T1VA 3WL8A 4E03A 4RZUA 1P0CA 1D3AA 1E3QA 4FFVA 4LZJA 4RKFA 2O2CA 1UH5A 1HYEA 4YJ3A 3O2NA 1FSSA 1YKGA 1XHEA 1YRQA 3EPPA 4KXXA 4QWMA 4RZHA 5C7OO 1GPNA 2NTNA 3IPYA 2FPRA 3QZUA 3WWCA 1VJGA 2ADOA 2QLBA 4QPJC 3AJEA 4P22A 2QSUA 3AP1A 3Q2OA 4ALJA 3O7MA 4H2DA 1UBJS 2XNDA 1VDMA 2NU7A 1FU7A 4O1HA 4XPIB 4D80A 1WPGA 3AM3A 3TAUA 2JI6A 4MVXA 3KV3O 4Q19A 2V0NA 4MV6A 4KXMA 5CVEA 3DHWC 2BD0A 3WGGA 1IB6A 2O2ZA 3ZVRA 2NSJA 4O4HA 2Y2UA 1EFPB 4FIDA 4RK4A 1MX5A 2XA9A 4F7WA 5KTRA 3BJZA 2N47A 1GZ6A 4XD2A 2L0XA 4TKLA 3W5IA 2Q4BA 1DC7A 3KFXA 3L05A 5JCJD 2CJWB 1EDBA 1T1SA 4D6YA 4B7UA 5CNKA 3WZLA 4I1RA 1PFQA 1PQPA 2GZAA 2JZCA 2DQ4A 1SVUA 1T2VA 2A35A 3L3BA 3LW8A 2DZDA 2QUBA 3TDMA 1N6OA 2UZAA 1BW9A 4TVKA 2OC9A 3M9XA 4F6RA 3ZW9A 3TVYA 5EZ6B 3ISVA 1BFKA 3R3WA 4MQ6A 4U2FA 4L2IA 4UNQA 4DM4A 4RTRA 3QYFA 3QNMA 3PE6A 1R4MA 3PQFA 3VZCA 1NT4A 3Q9UA 1IBLB 3K0FA 5F2OA 3R8XA 3RVMA 2XA1A 1P7WA 2DBYA 1P61B 2H9AA 3P27A 1ZL0A 3EQZA 3P9XA 1N57A 3OZVA 4IICA 2HCRA 1N6RA 4UNSA 4MVJG 4O3FA 4UEWA 4GKVA 5FL7D 3WBKA 1XV5A 2DFKB 4QJIA 3L7IA 4AIRA 1AQIA 4XYMA 3RVKA 3LXMA 5H3LA 4CV2A 2X3UA 1PTJA 1WUKS 2AFIA 3PA8A 4AICA 1O97C 3FHJA 3K5WA 4ND4A 1QAMA 2JIBA 3EODA 1WXWA 2YL2A 4P8RA 4AU1A 4YMVA 1AURA 4XWWA 1G4UR 2ZQZA 2ZSUA 4RSGA 4YAIA 4LF6B 1BS1A 3FUUA 3PKIA 2XY4A 2FPGB 3DMRA 3EY4A 1WCWA 4D9JA 2ZPUA 1WJGA 1RQGA 3ZNOA 3IOMA 2OKGA 3WWDA 5L8VA 3RC7A 5IT0A 2Q46A 1G59A 1L4BA 1XOIA 4OU5A 4NZOA 3ZWAA 3SNHA 1KMIY 3U49A 3MQ2A 2HJSA 4NBVA 2BGNA 4LN1A 5J40A 3QFRA 3FVWA 3U3KA 2B8NA 1BE0A 2OECA 2YMQA 2QYHA 5EYPA 5JD4A 5TGZA 3EXHB 1FFDA 2PZ8A 3SS7X 2WNSA 5IP5A 3KCQA 1I7QB 1FB5A 3PWTA 4DFDA 2GF0A 2IZ0A 5EVJA 2ZRHA 2YUIA 4DQ0A 4B3RB 3ZY6A 1XPRA 4Q3DA 1Z33A 4RVUA 3FDXA 2HSGA 1GR1A 1Y9DA 4ZZ1A 4RHXA 3RJ5A 1TUBB 2EX4A 2DPLA 4MV4A 3ZIAD 3OZBA 4BO6A 4LBYA 4OSPA 1RWKA 1QUEA 1P8JA 1R3DA 1TDJA 1P91A 1NQTA 2I3BA 4HWOA 3HWX1 5AH0A 1RZRD 1BXKA 2QNBA 4HEJA 4MKHA 3NDBB 3RI3A 4FMBB 1EYZA 2C9OA 1QQTA 2LKDA 4QFMA 5AHXA 4F2HA 4DLNA 3RKSA 1NZJA 3OF3A 5E9QA 1Y5IA 4YCNA 1UZMA 4R2JA 1O9BA 3OT1A 3BOSA 4ZOLF 4EJSB 4UFPA 2N1MA 1AKTA 2QAIA 1LWOA 4CKYA 2DAPA 2P79A 3KJNA 5I7UA 4QM7A 4IOMA 2FPSA 4JI4B 4C22A 5AVOA 1MC5A 2PWZA 2BPOA 5E6SB 5E3IA 3LYLA 4YACA 3ZWPA 4F72A 2Y0DA 2W2VA 2HXYA 2A33A 1N1GA 1KDOA 2C4NA 2VYCA 1QX3A 1F0KA 2HRZA 1JR6A 5K4GA 1JJIA 1P1FA 2Q27A 1I6WA 4IIVA 1J5XA 1NMQA 3D6JA 1U1GA 2MCFA 3WIUA 4I5EA 4CNQA 3D6HA 5LZ4A 1FUUA 5CBPB 1FVXA 1QAOA 2WTXA 1EINA 1QFXA 3DBHA 4FDUA 3BK2A 4IZIA 2F67A 3JQ8B 3OJEA 4PYOA 3PJRA 1XZIA 2JGLA 4YRGA 3B5EA 1Y98A 1SXIA 5BWBA 5HIAA 2XTZA 4WZAA 3IIIA 1KMMA 1I3NA 2HJVA 4HNRA 5K3EA 4E4TA 2WRZA 4PN7A 3IIEA 4R5MA 2RCNA 3A36A 2ZIXB 4DDVA 4CMKA 4RJIA 5ES4B 4UJ3A 5JATA 4MW2A 4F0JA 3COJA 1ESEA 1BXRA 4XXHA 1RS0A 2WIDA 2B21A 3P2MA 7ADHA 3A1FA 4RBNA 3TQOA 2MR6A 4PR3A 4ZAVA 3UJPA 5FFFA 1ZNXA 4K3VA 3T5DA 3TRFA 4B6OA 4L8WB 1OB5A 1M0WA 3MPOA 3HU5A 5F77A 4MS4A 1MR3F 1DUVG 5BN4A 3C8DA 1GTSA 3EIHA 4RKWA 1HDYA 4JQZA 4YAJA 2UXCB 2Z2JA 3WKCA 2ECKA 3EIFA 4IFTA 2NP7A 2BYTA 2I78A 4ZRNA 3SQWA 3NBMA 2P9TA 2VXBA 2GAAA 1XRSB 1JDUA 1NVMB 3BIFA 2I54A 4PVDA 1KYVA 5CK5A 3ZKAA 1SHLA 2ZETA 1MLDA 2HLNA 2ZYHA 3EMDA 1CNEA 3HDHA 2CZGA 4M1MA 3SJ7A 2O2YA 2V55B 3TIFA 3AIOA 5LA6A 2GXQA 1CUVA 3BKXA 3WC4A 4PZAA 2P6UA 4RDHA 4V3BA 4QJBA 3MXTA 4RK0A 2O8EB 3IUEA 1A9PA 4GQIA 1L7BA 4QFDA 2XNKA 4Q9JA 1Z15A 3FDZA 1JFRA 3DL7A 4N8SA 4CPDA 3S1AA 4HJXA 3UNXA 3EARA 1E0SA 4KQJA 4L0MA 3NRBA 3HO6A 1UP7A 2IRWA 4BX2A 2H1RA 1M6EX 1EA5A 2X1HA 3SXPA 3NHZA 4MA4A 3KHSA 1NAHA 4CTJA 2WUGA 4LMPA 1PR4A 1SVLA 4MTCA 1Z8FA 1GRCA 3BBPA 1IONA 1WAMA 4EUHA 4DDUA 4KDCA 1M5UA 4NYJQ 1GFIA 2F1RA 4YWJA 3RS0A 1EFAA 5LXTB 1IXRC 1BGXT 1VSBA 2ZRIA 3MF4A 3PXBA 4YXFA 1BVYF 4MUAA 1Q7EA 1E4EA 1W8IA 3DEFA 4CQLB 5IYZF 3RSGA 4ZKDA 5JCOC 2PUBA 4AYXA 3OCUA 5BMVA 3CRVA 3D8SA 2C2YA 1V0JA 2A1UB 4HDRB 2C9CA 3SFZA 2YJNA 2ZCUA 3QF4A 1K7YA 4PAQA 3WKBA 3SR0A 2WJPA 3NHAA 4DHEA 3Q87B 1H22A 1D2GA 3N7AA 5D6OA 1D6NA 3TD9A 5EQTA 3FMIA 3HA2A 4EKEA 1Z73A 3S44A 2BZGA 3A05A 3PB3A 2G0TA 4V39A 4II3A 1AZWA 1J1IA 1DEXA 3H5NA 3PXEA 4FE3A 2O07A 5B1DA 5MN5A 1L5SA 1SO8A 1U5BB 4M7RA 4V02A 2XUZA 3H6GA 1P2SA 4DY6A 2IU4A 3CF0A 1RWXA 5D3KA 4B6JA 2WWVD 2JEOA 2J0UA 1RI4A 3DO5A 5TGDA 1UQRA 2W6JA 3TOXA 3UXMA 2WJJA 4YI3A 3VR6A 3AKEA 3RAEC 2O3UA 1JSLA 1MN6A 3PTZA 1EXNA 4NNOA 4OLJA 1E5QA 4TLAA 1PT5A 2VRBA 4Q0MA 1UMCB 3R44A 1AKMA 2RB5A 5LMZA 4HNGA 4U2BA 2GYWA 2BSXA 3H1EA 3N8HA 1IC6A 4MLPA 3GIWA 2EGHA 1T4CA 1N7JA 3C7DB 5JQGB 5KZMB 2PFSA 2PKQP 1JAZA 4OJNA 1EESA 1E9EA 3EDCA 3Q41A 4QG7A 4NH0A 5FFNA 3N59A 2EZ4A 1E0DA 1XK7A 2C7GA 4MROA 3ZH9B 2OWEA 4EPVA 1W25A 1IJBA 2B4YA 4ZT2A 3W8EA 3ZY2A 1P2DA 2HCFA 5ALJA 5C8YF 1NVXQ 1VHWA 3C45A 2R1VB 2IYSA 2O4UX 4BU0A 2G9ZA 1M74A 1VRVA 3P2JA 4HWTA 5IAJA 2C59A 4JI3B 1RNLA 4MUFA 1QK5A 3MUEA 1LBHA 3QG5A 4RC9A 4TMXA 4D44A 3TD2A 1KBZA 1FU8A 4PQYA 5ALYA 4HNUA 3U4QA 4L8VA 3EULA 2Y77A 4GZ3A 3JVUA 1W5TA 2PLRA 2BSAA 5G53C 4XWGA 5IJWA 3SDZA 2E18A 3OUUA 3L9XA 3SICE 4JYBA 2VDKB 1ZCJA 1BVRA 4DM3A 2NTYC 4GOLD 4WESB 4D79A 1NRJB 1GO2A 1PDWA 4PZEA 3IL2A 2VBGA 4Y0AA 4NOLA 3WYAA 4RU1A 1GL6A 1EPUA 3D0OA 1IVNA 4UE6A 4BKQA 1F9AA 2FJPA 1MVNA 5EWLB 3ICPA 4RVFA 1YL6A 2RHHA 4C76A 2OMKA 4N40A 5DX8A 4J0QA 2V6MA 3IAS1 1FUKA 3JU3A 3RYIB 3K2EA 3NYQA 5JE8A 3OKFA 4NXMB 2QQGA 4C7VA 4QYIB 1KDYA 2PGXA 4O6VA 1X2EA 3GLGE 1RYBA 1E0AA 1QH8A 2CCGA 1TE2A 1ISFA 3KT0A 2WQ6A 1QCDA 4ZTBA 1LRLA 5G2OA 5GOTA 3UGQA 4KVAA 4DB2A 4BB9A 1U4OA 2FN7A 1RPTA 1Q0TA 2J4FA 5K4AA 5I6DA 2JCBA 3EG5A 1ONPA 4Z2YA 1IZ8A 1ZMXA 3KQYA 2PEZA 2VCEA 1BDHA 2P6OA 2HU5A 3QNUA 2FPPB 4KXUA 1I13A 3O73A 3MLBA 1UJBA 4CCSA 4PZ0A 4YO7A 1SOWA 2AC4A 1TEZA 1TM4E 4LKRA 4LSZA 6AT1A 4OHUA 2NSLA 1S4QA 1A7UA 1HE8B 1USIA 1H0HA 1LK7A 2I71A 2JGDA 2V7TA 1YO6A 2YS7A 3EA0A 1NOIA 3VHLB 3R7LA 4FPXA 4PIVA 2H1SA 5BY2A 5LVAA 3EZ6A 1V6SA 3E0QA 5MFZA 1OH6A 3B3JA 2DPYA 3KKNA 3QOWA 1MOPA 2XV1A 2GD6A 1XMIA 2JGAA 4G4IA 9MHTA 2C2MA 1PWZA 1AUOA 1M34E 3G5TA 1O4VA 4Q24A 1GA4A 3IERA 2EKPA 1E79D 1Y3BE 3H3XA 3HU2A 1H3FA 1Y7PA 3PNKA 4DMHA 4OB8A 4IIBA 1KPIA 1C9DB 1T2FA 1EFVB 2RGBA 3MWYW 4MHOA 2CEKA 4D8YA 5CB4B 4BCCA 3IFSA 1VDZA 4JEIA 1GDDA 2J4DA 4D4HA 1LVHA 2IQ5A 2EDCA 4UD6A 5DI3B 1IHXA 4PHCA 4YALA 4NXNB 1VSQA 5EWJA 5HCIA 2RIRA 1TMGE 4Q9IA 4X71A 1SOAA 4YTEA 3IVRA 1LDNA 4NU6A 5FTWA 3RK1A 2IC5A 1GTG1 3LVFO 2HMVA 3RRYA 3ZDYB 4DA8A 1RR6A 3U44B 4CM4A 1STOA 3AR9A 1RU3A 4XCQA 2R8YA 4URYR 1BDMA 1N5LA 5A05A 4RHTA 3OTGA 2MHCA 3VHQA 5BN3B 1JNYA 4RJLA 2TSYB 3OX3A 4E94A 2P90A 4KDRA 4YP9A 2D0DA 4OFXA 3VJRA 1P1BA 3WL4A 4Q47A 5GV8A 2XPCA 3WLKX 1I30A 4UUAA 1KR2A 4U1RA 4MTLA 3A1EA 4BNMA 1FW6A 4CEHA 3UJ8A 1U5AA 3AK4A 4CM6A 5JTTA 3BH6A 4DLWA 4EUEA 4ENVA 1PG5A 2D1RA 2GN8A 1CCWA 2ZULA 3FCCA 4PXAA 2VQEB 4MDEA 1A5ZA 4KN8A 4RFVA 3RW9A 2I1WA 4UCFA 5EKUA 1AH2A 4Q93A 4U7PB 3IDFA 5KAPA 4QU9A 5C5IA 5HVNA 2X4DA 4MS1B 3T1HB 5REQB 2IEBA 1BMDA 4D43A 2G5TA 3KJFA 5HHTA 4FWTA 1JE1A 3RBVA 5B4TA 1HH4A 3VO9A 3K70D 2ZSEA 5DYTA 3Q98A 3ROMA 3WSVA 2IU6A 4HYTA 1Z47A 2B25A 4D45A 1GD1O 1XJ5A 2I8AA 4H0CA 1EUCA 1CD5A 2OORC 4IDFA 3CZ9A 5D5PA 5TQVA 2AZXA 3KZVA 4B40A 5IM4A 3C1AA 2D7CA 3ZOZA 3COWA 2JGRA 5EC8A 3TXYA 3G49A 5DBFA 1KZGB 3NOOA 5D3MB 1MPXA 2Q2QA 1U8CB 4NCXA 4GBMA 1T1IA 4HDAA 4UVIA 2BZ0A 3D3QA 3IULA 1KO8A 3AERB 3FB4A 3VU9A 1YUMA 4MQMA 3RREA 3SCZA 4G9GA 1U8TA 3KQWA 5AI6A 3VGPA 7REQB 2A57A 2VDJA 1TKRA 2X1LA 2DWUA 1OLSA 2WAYA 4FN5A 2FPIA 4EECA 2P7IA 1XVUA 1K88A 2IH4A 3BXGA 1CZOA 2RI0A 4HADA 4L02A 4M9QA 2GPSA 4WFQA 3LKBA 3I5YA 3WGVA 4KTTE 5A6VA 5K51A 1LJLA 1W87A 3RARA 2IS1A 3EC1A 4Q4JA 4XSHA 2F8TA 1E94E 3I3OA 3L0CA 4LV5B 4YJKA 2VT3A 4V2UA 3GLKA 3MD0A 1SJ9A 2QLFA 1PT7A 4OQXA 1X7DA 4ALLA 3BWCA 2YBEA 3C85A 5A4JA 1XUOA 4DIEA 1XSEA 3VTKA 4B6GA 4TMFA 1ZCAA 4BTEA 2PPLA 4AQDA 2JLRA 2E5FA 4X20A 3GRCA 1X7YA 3IILA 1YDHA 5ENVA 4D99A 1RKUA 3T5GA 1IQUA 1I2ZA 3PC6A 2BN4A 2J41A 1A9TA 3QOYA 4H08A 4X6XA 3ZWDA 4D8TA 4BPBA 2P2SA 1QFMA 4QRIA 2JD1A 2GEVA 1BU5A 1LBSA 2QA5A 3KK0A 4HL6A 1NBHA 1D0VA 2IQIA 3M9LA 1FP7A 2D5CA 4L72A 5AR1A 3RROA 3HB9A 1SA0B 2WKWA 3RF7A 4UUQA 4JL8A 5THQA 1JAXA 3F3KA 5AHWA 1XDWA 1MDBA 3ANMA 3WSTA 2QI9C 4YQFA 4IIYA 3BL5A 2DPHA 1CQWA 2GRJA 4BB6A 4DT1A 1NZDA 2VT6A 1YMQA 3Q72A 2D0OB 1PG0A 3LA8A 4GLBA 4NJMB 4EG7A 4G81A 3ND5A 4IXWA 1BN6A 1LVGA 5L7YA 2HOQA 2VHZA 3F3MA 3VPSA 3FDIA 4F5WA 1P5FA 4UBOA 3WL7A 4C29A 2WPNA 5HK8A 2WQZA 4OAPA 1GCAA 4YDRA 5EJEA 3E9ZA 1UMBB 4G09A 4D5EA 4R2WA 1K8YB 1XFAA 4KLRA 4IHJF 1HDZA 4C01A 3MTQA 4F21A 4RZIA 4DLXA 3WJAA 1WDLA 4YCLA 3OPXA 1DO2A 4DC9A 3NOQA 4U2GA 4XCXA 2PBFA 1Y9EA 3UV3A 1IATA 3ZDZB 1C9YA 1QVVA 2XE7A 2JNWA 3MGKA 5HQJA 2HNAA 3E8SA 4HBZA 5TLSA 4UNIA 1SB9A 5G0UA 5CCDA 5KAMA 1IEVA 1EIWA 3IR7A 3C5VA 3PNOA 4URZR 1ULTA 2QX6A 2V7GA 1GKKA 4H1HA 1XTJA 1SXHA 1ARZA 2QN8A 2FUCA 3C48A 5K3SA 2ICAA 5HYVA 1O95C 4HFJA 1VKOA 1GY8A 5EIFA 4GPD1 3KZXA 1X7ZB 4UD2A 3UAOA 1X13A 4ETIA 4URFA 4YJ3F 3HVUA 3V32A 1VSTA 6ADHA 1LCIA 3HZZA 1C8LA 2XMQA 3FCXA 3R6GA 2ECFA 2B35A 2XTJA 3GUZA 4UU0A 3BL8A 1N5KA 4TSRA 1P2FA 3DKPA 1PQYA 2XD4A 1ZUNB 1IK4A 1DCFA 3CLTD 4H59A 1ND6A 1TO6A 3R3VA 3GQBB 4G63A 3DMGA 3GDOA 4XKJA 4EVRA 2BM9A 3IQXA 3NVMB 3NC1C 4WOJA 1JIIA 1KVTA 3K5PA 2XTMA 3KYBA 3LW7A 4MWGA 3JAKA 3VHXB 3DFFA 1NFFA 2R1ZA 3EZGA 4O4HF 1LH0A 1NVWQ 4JY7A 4XYLA 1ZK2A 3D0RA 4FEAA 5L3SA 1FPQA 3BFPA 5AQEA 5FR1A 3TSZA 3U3RA 2W0SA 1M67A 4PAWA 4QYMA 5HW0A 5KJEA 3PJFA 2NAPA 2CD9A 1TQDA 3Q6NA 5EZ5A 5C3UA 2CXRA 1GAEO 4YAOA 2ZJOA 1GPJA 1FS5A 3B3QA 4JP2A 5CA1A 3W3AA 4GLOA 5ER9A 3QPVA 2FLKA 3F7NA 1WY5A 3W5UA 4JVMA 1RHQA 4Y6QA 3VNBA 2IYRA 4D25A 1VE9A 4NTZA 1T2UA 2HGSA 1Y8QB 1E77A 2CYCA 3ZVKA 1TCUA 1ZVJA 3F1LA 3KR1A 3B6KA 1E9RA 1EBUA 4B6FA 2YKGA 1VG8A 3K3PA 4ETWA 1QOQB 3L7BA 4R3UC 1NOJA 1JA0A 2XWBF 3AB3A 3TQHA 4AWAA 2EWMA 2PAFA 1FSZA 4R01A 3LBAA 4KUGA 5JD3A 5DTEA 1MABA 3PA6A 4DIMA 3EZ7A 2JI8A 4G86A 4LX0A 3VX3A 4BO9A 1BA2A 4ODIA 4JENA 1L5WA 4TLMB 2QSYA 4X1OA 3WS7A 1RP7A 4IXTA 2YIDA 3DYIA 5CM8B 4EHKA 1U99A 4J16C 3S8YA 3OUZA 4IF4A 3D8RA 1QH1A 3DV9A 4HQ0A 1TEHA 2R84A 3IVGA 4GRIA 5D00A 4I4TB 4R6XA 4ZDKA 4DLUA 1JG4A 1ZN7A 1UBLS 3CRMA 4U0JA 1GQOA 2C92A 2VJOA 3R6WA 2VJBA 2G82A 1Q0HA 1VE6A 1K7CA 3E9QA 3BAFA 3HV0A 3KDAA 4O0LA 5KBYA 5BR8B 2QK4A 5CT5A 1I0ZA 1NMXA 4W5HA 5DBIA 3DEJA 4PQGA 4LVUA 1UPFA 2B4QA 2HBYA 3WISA 3ID6C 4CIDA 2OCKA 2L69A 1IEXA 3TRDA 4CUKA 2IE8A 1SCDA 3PC8A 4UCQA 1AZTA 3HA7A 1M7GA 4H1UA 3ITDA 1GUBA 5LZ5A 5JD6A 4M7WA 3O4VA 4P32A 1KEZA 3MCTA 1MAUA 2E7ZA 3INRA 1LW6E 2YOHA 2OUIA 5B6JA 4PYJA 5I8PA 1VLZA 5GZ6A 3ITNA 3RGWS 3V7NA 1MC4A 1T3ZA 2PMBA 4CUJA 1VKHA 1K4MA 4N54A 1ZN2A 1CETA 3JCZA 4MR7B 2FJUA 3BHIA 2UAGA 4NENA 4ZT5A 5AVKA 1TEVA 1TU0A 3GEEA 4UEOA 4B3IA 2X7HA 4KXLA 3U2QA 4X65B 3AHJA 4TS3A 4GMKA 3VJMA 1OYVA 2JDID 2WJ4A 3B60A 2AFHB 2R25B 3A8TA 3DO6A 5FORA 3JASB 1OZHA 1IBMB 2Q1SA 3EF1A 4A1OA 1F60A 2ZRFA 4HH1A 1WNFA 3L0YA 3ETDA 1NUHA 4HB4A 3TZCA 1A5AB 2Z0MA 5D87A 2NXEA 4DIKA 4FFPA 3IE0A 3WWPA 4PLVA 3IB6A 3O8QB 4HHEA 2C1ZA 3OEWA 1L5MA 1SRRA 3BGOS 5GQSA 5T3YA 1WU7A 1SXJB 1M6VA 4HEA6 4B3XA 1PO7A 1A72A 4ECEA 3HJAA 4OQEA 1Z2PX 3NWPA 5JCXA 1J8MF 1ATIA 2Y1EA 4PAMA 2ZSFA 1JEQB 3RVLA 1XDUA 4C4YA 2C8JA 4MUGA 1YQXA 3HYNA 4JCCA 3AIKA 5HUQA 5ALGA 2RKOA 1V16B 1PJ4A 2ZWMA 3C6ZA 3KTOA 5KINB 4MQ5A 1U2GA 3GFBA 2CF6A 1D6MA 4HGPA 1TMOA 1HNNA 5CXUA 3WFZA 1DRJA 2QAGA 4CKEB 2NPIA 2Q3BA 1L7XA 4LTDA 2F8MA 3TNFA 2VDUE 4F3RA 4LXUA 3HBLA 5HILA 5LJIA 4FM9A 2ZJ1A 1LDGA 2OCYC 2YHUA 3N8GA 4MARA 5DGDA 3FCOA 5D84A 5EHQA 3WIVA 4I14A 4QOFA 2J6CA 3I9LA 3DDHA 3OLZA 3PQEA 2ZBDA 2Q7OE 3VR2A 1CUDA 2JI9A 1PR0A 1FLVA 3GEDA 3WNCA 3ZDEA 5JRDS 3IE1A 4O0MA 1R15A 1LS6A 1PJBA 2E3JA 1FX0A 5I45A 5E95A 2GTHA 3BM5A 4PCLA 3B1WA 4B3BA 1EGHA 4AUNA 2V9CA 1GIAA 2QUAA 1XRQA 2JKVA 2BFEA 2X58A 3A2MA 5I7WA 2OV8A 4EFKA 3I9OA 2OXCA 4ZYUA 1UBNA 1Y8ZA 1MIOA 3P9RA 3W2TA 2PVPA 5EHZA 4RIHA 4NBRA 5DNEA 5IVKA 3K9NA 4FQ5A 2YV1A 4UMVA 2Z6QA 2NZ2A 2YQZA 3H9EO 5KCZA 3UMYA 3A6ZA 5F9HA 1KI6A 1VJRA 3TK1A 3TQFA 3O8DA 1PX0A 4PTLA 5JDIC 3T3DA 2Q45A 1D8AA 1SVSA 3KVVA 2VZ9A 5LA6F 5GVSA 3WGNA 3K9LA 5K0GA 1M2GA 5AVJA 1FJ2A 3OQMA 1U90A 3MWLA 5KHLB 1YHYA 1KZ7B 3HABA 4UMDA 4FFOA 1HYQA 3EUAA 3LT4A 4MS3A 2QX8A 3EC2A 1DP4A 3REQB 4GL4A 5HS6A 4B35A 1MP0A 4MV0A 2V3CC 1ZK4A 4RH3A 1RP1A 2XOEA 4TRRA 5LZ7A 5D7BA 4XOUA 5E6RB 2CJXA 4KQ9A 4MPJA 2CLFB 1HL3A 2LZ0A 3OSUA 4BMDA 1R6BX 1Z0FA 1EHYA 5CW1A 1R0BA 1R74A 2W83A 1RKVA 3UICA 5CLGA 1Y0BA 4CQJA 3OQNA 1Y6JA 1HYBA 2HV9A 2O1EA 4ZYLA 1TFUA 3H5IA 4G8JA 2WSLA 1W5SA 1NI5A 5D6NA 1C3XA 2CSXA 1L5LA 4B82A 2JAXA 2R1UA 4OTZA 5FI0B 4Z54A 2ID9A 3T5AA 2AOTA 4BQIA 3NBYC 1EJ6A 4Q9HA 3EGVA 1Z7BA 2KPOA 3O3NB 2JBAB 3HWWA 4R1MA 3TDNA 1WQ1R 5BMVF 3K2QA 3N5CA 5EAIA 4ZCTA 1VIAA 3IAUA 4BVEA 3B8HA 4DMGA 4F6CA 1C3LA 3C0KA 4B76A 3LT2A 3C41J 5FV4A 3PT5A 1NY5A 3OQPA 1IBRA 1SZPA 4MB2A 1G291 3UHPA 3ZIUA 3M9WA 4U0KA 2HK9A 4BNFA 4BB5A 1FFYA 2PZFA 4YJ2B 3O74A 4DY4A 1NDQA 2TMKA 1YK0A 2BFFA 4CG3A 5C46F 4OKSA 3EVBA 1WP4A 1FUEA 4YLGA 4PC7A 3WSWA 1HLPA 2QTVA 3LYUA 2LP4Y 1W0KA 4J4HA 1SN7A 4C0WA 3A06A 2RHBA 4ZVPA 2ES4A 2GPJA 3LPAA 3C6QA 1KSJA 5D51S 1G64A 1JAHA 1OGYA 4J0GA 3VI3B 1RYNA 4DWWA 3ZZUA 1XTBA 4MRMA 4TTJA 1LXCA 2Y0PA 5CVDA 2V7WA 2BM1A 4YUVA 2HJWA 1LJ8A 1TX4B 2QORA 1PZEA 2WTEA 5K0NA 1YRWA 3OE4A 2H51A 3GZJA 3GHHA 4MUXA 1T6YA 1TI7A 2JCXA 1HQDA 3OCYA 2UYQA 3LWDA 2XZTA 4PFJA 2M1XA 4WW0A 4NS4A 1QG6A 5E2IA 1ZLXA 1ADCA 3TH5A 2OD9A 4I8XA 3ESZA 2A3NA 3U4DA 3JQGA 2KW5A 5AKXA 2I1QA 5T4EA 5ALTA 3W5HA 1YT5A 1Q50A 2WF5A 1VYHA 4ZQHA 2CVZA 4RW0A 1PR9A 4D0NA 2C3OA 2V6IA 3ZR4B 4N0EA 5H16A 1PL6A 3W06A 4FCTA 5CB8A 1EKXA 4G5SA 2VJQA 4AQYB 4Y0VA 4YB8A 4PZCA 2MMGA 4XPIA 4E22A 1O96B 4Q82A 3ZYCA 5KQMA 4IVNA 1JLKA 3ND7A 1SVNA 2QRHA 4UXHA 4ML3A 5EGNA 1E1CB 1E5XA 1QGUA 1Y1SA 2I4TA 3D3NA 3PWZA 1E2LA 3AKDA 4RYLA 3RCBA 4FDTA 2G8NA 2VVTA 2QLTA 3CM0A 3WIOA 2JCVA 3DP9A 1SHUX 1FTQA 3H5OA 4I2NA 4C20A 2WIBA 4DKJA 3H04A 3Q9SA 1EFRD 1KKUA 3M5WA 4O3MA 3F0TA 1H2XA 2CJWA 2G77B 2N9UA 4HCJA 4YI5A 3EPKA 4C7OA 1PGJA 2A59A 2W2QA 5DHTA 8MHTA 2AN4A 3AETB 1N7GA 3CBGA 3ECAA 3KJXA 4MEJA 1FNDA 1HC7A 1Q19A 3ONVA 4FT2A 4KR2A 1CJSA 4I2VA 3RUDA 4CF5A 2J9GA 4LHZA 1EAYA 3SYRA 1V8PA 2E2WA 4ZZIA 2H1WA 4NWIA 3KSAC 5JNLA 2V03A 2XITA 5HF8A 3JQRA 4LSMA 5DEIA 1FFSA 1WNTA 4R51A 4DRZA 1NQWA 1EM6A 2C7PA 3FD8A 1PT8A 1PT9A 1NQXA 1Z63A 4X90A 5EOVA 3QMVA 2FG5A 1DDIA 2AYZA 5FWDA 1G8MA 1M8FA 2PXXA 2V5UA 4R1NA 5SYNA 2MYUA 3NTRA 2REQB 3QOXA 4FFWA 2PD4A 2XDQB 3LI2A 3G9UA 4JD5A 4BLPA 3GO4A 4L57A 1Y3FE 3KHTA 4TGLA 5I9SA 5J1SB 3CVYA 3V7YA 3IPRA 4A0SA 5SV2A 4DGQA 3MTIA 1YJBA 4N7RA 5ESRA 5FDFA 4QUHA 5GADl 2FPGA 5T8KC 3ETNA 3DPUA 3ZGZA 2PXAA 2YRFA 2ST1A 2RGXA 1TM3E 1NQUA 5IG2A 1AHNA 1XA3A 2GYVA 2OAEA 2R8EA 2GJ9A 3BD8A 3IOCA 1VL1A 5A3VA 3X1DA 5KYUB 1E9SA 4JROA 1V6AA 1X87A 2A5LA 4BYGA 1Y5MA 1NUSA 2B8EA 1P1RA 4UTPA 2DG2A 2FNAA 1XCOA 3GI1A 1NMZA 1Q1ZA 4KCGA 2HLDD 4ZVOA 3PX2A 1ICEA 5D8DA 4OQYA 3BN3A 4DCPA 3DEZA 3ETEA 4QODA 2BHNA 5K01A 2PZMA 5EWMB 3EUEA 5AW1A 4HF7A 4YK7A 1GPWB 1Z36A 1TUBA 1SCBA 2CL5A 1F12A 2QG6A 2XKAA 3W4IA 5AVRA 4RS4A 1N9ZA 1VLHA 3NUQA 3SFTA 4D3XA 4O1IA 4UBKA 1H5NA 1JFVA 3GQVA 3UWMA 1YR1A 3N0XA 2YWGA 2G08A 1SK9A 3G1WA 3QGMA 4N5IX 1M6YA 2QUIA 3DVLA 1ZX1A 2VAMA 4O8CA 4BAGA 4P33A 3X3HA 2TRSB 3H8JA 1JU9A 2GD0A 3E18A 3VNAA 4RTSA 5TE9A 3Q15C 5FH9A 5DHAA 2GD2A 1ZM7A 4JBWA 1V43A 4EJSA 1O3YA 1EDDA 4DJEC 4EFNA 2O57A 2LR0A 1TYBE 1JKFA 1PJZA 5ADWA 3JR7A 2VDVE 5E6SA 2MU1A 4NPHA 5EMKA 2RJNA 5LWHA 2GEUA 4FZRA 2ZTHA 4LMRA 3O94A 4LA4A 3PYMA 3RJMA 3ICOA 3F7MA 1SU6A 3QIVA 3SIXA 4AJ2A 1WMAA 3IXLA 4DUGA 2AF3C 2X9VA 2ZBQA 3CMCO 4PF1A 5EKXA 5K0JA 5KQGA 5K5EA 3OPNA 3M82A 5CBPA 2W4IA 1KVQA 4F3YA 1E0KA 4X3CA 2NMVA 3W8DA 1DC4A 2FSHA 2OQ2A 3K73O 4JB0A 4WNAB 2B1QA 4QPZA 3AL3A 1Y9ZA 3KTFA 4H0FA 5ADVA 3DAHA 2XNSA 3JQ8A 3VR5A 4DMUB 2P5TB 1HQKA 1JV2B 4S0ZA 3T5TA 2ZLBA 2EFDB 4L5CA 1LX7A 2XH8A 3RG2A 1E8DA 3VTZA 1QH9A 1WX1A 1LPPA 2QYOA 3K1TA 1EX7A 3CUTA 3CUWA 4OQ4A 3KDSE 2VKTA 2ZIXA 2IS4A 3FWNA 5GZ3A 1JTFA 2C03A 3KD2A 1XX6A 5IM4F 1SQSA 4ZQIA 1OJLA 2H6EA 2SCUB 2YIMA 4GBJA 5DI9A 1Z75A 3QXCA 4PBTA 4Q9LA 5KIAA 3AHEA 7GPBA 4BX3A 4DDWA 4EO9A 3L7YA 2I2BA 1XD9A 1P9RA 4OQPA 1AF7A 2X2OA 1BS9A 2AQIA 3IEMA 5ALPA 2FHPA 4AXXA 4DDHA 4UPEA 3AL2A 1AGXA 4JB2A 2FI1A 3P71T 2HMTA 4CN9A 1TFRA 2WZCA 4BV9A 3UAGA 4JELA 1XZPA 1JSRA 3L8CA 4K1XA 3KSBC 1NPTO 2FETA 3ZXSA 3IR5A 2Y4OA 3PGKA 5LLSA 5KTKA 1WXQA 1G5PA 3QTBA 1WV1A 2EJUA 3MBIA 1E8MA 1N7IA 4WKCA 1UAAA 2DETA 2KYRA 1H8HD 3TFOA 4DA4A 2O8EA 4XASA 4YMGA 4LUCA 4B7CA 1F4LA 3DBRB 3UC9A 1PNQA 2IHNA 1GUYA 4KRXA 1IOZA 2Z8YM 3DR5A 3PUWA 1H6DA 2WM9B 3WV4A 2CB0A 4B3TB 1QK4A 3A1TA 4MIOA 4K9QA 1UINA 2ZK7A 1L4FA 1GXSB 1QQ7A 3HL0A 1UJ6A 5BQ3A 5DNUA 2C58A 3K72B 5FA8A 4JX8A 1CY8A 1E1MA 1Q3TA 4GR5A 4KOAA 4P5PA 5EMHA 2FWBA 2A88A 1VA5A 2XSZD 4JUDX 4K40A 4KSBA 1NJSA 2CLOB 1A9RA 1C9EA 1YL5A 3BH0A 1LBTA 1ZUIA 1E3EA 1GSOA 3HY6A 3KU1A 4LY0A 4P80A 3RTBA 5I7HA 4DPLA 4G0QA 1YAHA 2DUWA 3MYYA 4FSDA 4CQLA 4BGEA 4OIMA 5AVVA 1P0FA 2IPXA 1KJJA 2A1UA 1LPAB 1OHHD 5GZ1A 1LDMA 4BBZA 2M2IA 1SBYA 4D7AA 3JQBC 2CXTA 3TIXB 3SMVA 5JZMA 5CM2Z 3C3DA 3CVVA 4F3TA 1FFWA 2WJIA 4I50B 1PW7A 3KPJA 3TG8A 1F7UA 4MQUA 3CR7A 3MTEA 2O0JA 4QL3A 3U6KA 2JJ8A 3G8BA 2QVXX 4KQFA 1T3GA 1ADFA 4KEAA 1HE1C 4KHZA 4RVCA 4DCNA 1K8XB 3KFLA 4KDEA 1KFEB 4FWIB 1KZ1A 1W9HA 3PNVA 5SZIA 4AMUA 1U5BA 3IEXA 4K9SA 1QP8A 2VIIA 4K6MA 3SZGA 4QOGA 3DEIA 1NFQA 4BWGA 5L7TA 3QPUA 3DE3X 4N3CA 4AS1A 4IAOA 1F1BA 3H5WA 4RL4A 1AGRA 1EI9A 3UOAB 4O8ZA 3IUBA 3M49A 4OU4A 2DH5A 2HGZA 2VBIA 3SE7A 6NULA 1S5PA 5BSKA 3H75A 4ROSA 1Y4ZA 1UMCA 1K6EA 2VXCA 5DM2A 3VFDA 4G89A 4L50A 2EVWX 4KIWA 1Q91A 1AO0A 3ZQ6A 4YN3A 5JQGA 4BLTA 3UK0A 1DQSA 2F1OA 4G0OA 3VYRB 2DB3A 4YMTA 2W6MA 2Q5JA 4ITVA 4RY2A 4HRYA 3IELA 2WTNA 3NBZC 3SJZA 2XE4A 2W43A 3N6RA 1U7XA 3BC1A 3FNBA 4MV1A 4E4YA 3U3XA 2OE2A 3R5TA 3NHJA 1N5OX 4AQ7A 1COWD 3IQDB 1VL2A 3OLYA 3W1EA 3FW1A 2R1VA 3SC3A 1GZDA 1T9HA 4I1VA 3UAYA 1W6RA 2AVNA 2YW9A 2PUDA 3SIWA 4F45A 2IW3A 5LNK6 2J59A 1NX9A 5K8CA 3GRFA 3RFCA 4FLFA 1OLUB 3HEMA 3ORYA 4H4EA 4E51A 4MKZA 4YRIA 2HF9A 2C9BA 3DDOA 4JC5A 5I9TA 3BHMA 4YUZA 1U4NA 1FMLA 3HDQA 1FYVA 3M33A 5CA1F 3WFIA 1AB6A 1NWHA 2B8TA 1DIAA 2NADA 2RGCA 4YRPA 3W4JA 1CW2B 2FRXA 2IKQA 3JD4A 1ST3A 2VSOA 3AXTA 1EB9A 3EGIA 1U3VA 4OLHA 4QIHA 4PFKA 3DOIA 4JLDA 5F2KA 1C9NA 1HORA 1KI2A 1QONA 1RRVA 3KZ1E 1UPXA 3HH8A 3KQSA 4M38A 4A6XA 8OHMA 2VHUA 5FTLA 3GRZA 4RVDA 4HQRA 1V71A 4BFYA 3L6OO 3UAVA 4RMIA 4UCXA 5KUTA 1C1XB 4IIFA 4DSOA 2WJ6A 1E2MA 3M2PA 4RS3A 3FTCA 2NUAB 1K1EA 5B7QA 3N0VA 2AZMA 5FUMA 4G5XA 3HZRA 4ICIA 2FEAA 4ESHA 2I6SA 2YYYA 3FFXA 1GNSA 2GBLA 1L7RA 4MIYA 2NXWA 4XWAA 1XT6A 5JS6A 2UZ4A 3NI2A 1Z16A 3KL2A 3BGWA 2A5YB 4Q34A 3B52X 2PWBA 3CRZA 4HGOA 2LW7A 2R3SA 5LMNB 3G9ZA 3HJTA 5TQ2B 5SYAA 4EA8A 4CI0B 4AULA 1NC1A 1F17A 2A67A 4MMXB 4RD0A 4F9GA 2FPPA 5FO1A 1P6UA 4O2LA 3OETA 4C0QC 2R8ZA 1L7AA 4LY6A 3TNLA 2J4CA 1JVNA 1PU2A 4R2IA 1CUCA 2F43B 1Y1LA 3OHMA 4DDMA 3BE5A 4QD3A 5E4YA 1XEXB 1IZYA 4R81A 5B7PA 1KRXA 1HQCA 3K96A 2IITA 4R2LA 4ZCIA 4MV5A 1E2KA 4DKXA 2CFOA 5H0IA 2GZ1A 3NNSA 4E3WA 1M1XB 4XLZA 2AX4A 4EHNA 1DQRA 4S05A 2QB5A 5BUQA 5DW0A 4URXR 3EVZA 1ESZA 5F3WB 3HTXA 2OENG 3PHBE 4ZRDA 1P60A 1TEXA 2GO1A 3CNBA 1TJ3A 2VNIA 5L6MB 3PRHA 1AS0A 1EFVA 2MYPA 2YWFA 2XI4A 4FDLA 4DM7A 5CB4A 1FX1A 4AWBA 4YO8A 2OHIA 3KO8A 5IKMA 1E2NA 3TB6A 4AZWA 4EKGA 2I99A 4HWGA 4F4UA 2O8VA 3KUKA 4C21A 4ZZ3A 3VKHA 3AQ4A 1ZJ5A 3EQ9A 2PR7A 2BMVA 2O8DB 3JVDA