2OCLA

Crystal structure of valacyclovir hydrolase s122a mutant
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
254
structure length
254
Chain Sequence
b'SVTSAKVAVNGVQLHYQQTGEGDHAVLLLPGMLGSGETDFGPQLKNLNKKLFTVVAWDPRGYGHSRPPDRDFPADFFERDAKDAVDLMKALKFKKVSLLGWADGGITALIAAAKYPSYIHKMVIWGANAYVTDEDSMIYEGIRDVSKWSERTRKPLEALYGYDYFARTCEKWVDGIRQFKHLPDGNICRHLLPRVQCPALIVHGEKDPLVPRFHADFIHKHVKGSRLHLMPEGKHNLHLRFADEFNKLAEDFLQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Valacyclovir hydrolase
publication title Molecular basis of prodrug activation by human valacyclovirase, an alpha-amino acid ester hydrolase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 92
structure length 254
sequence length 254
ec nomenclature ec 3.1.-.-:
pdb deposition date 2006-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2oclA00
1JI3A 1UK7A 4WY8A 5T4FA 1SC9A 3MGAA 4P08A 3EQ8A 3B12A 1ZIYA 4X90A 3HSSA 4UHCA 3D3NA 1J2EA 1UKBA 1XZKA 5AIAA 4WCVA 3DYVA 3W06A 3PE6A 1X2EA 4BB0A 5JD6A 2JGJA 1Z68A 4OPMA 1IZ8A 2X8BA 3I2JA 2JEZA 1CFJA 4UBJA 1E8MA 2DFPA 4Y2PA 3C87A 1ZIXA 4AN1A 4GECA 1YS2X 1LLFA 5EIHA 1QTIA 1YCDA 1ZJ4A 1G5FA 1CIJA 1VXRA 3OTQA 3WK8A 1Q84A 2RHWA 2ZYHA 3IUQA 1IMJA 2IX9A 5CH5A 1TKRA 5EGNA 5T4BA 1QIJA 3CN9A 4EA6A 4WFJA 4G8DA 1BCRA 5K3BA 2VJCA 2WUFA 2ROQA 4BRZA 4BE9A 1XQWA 1IUPA 5JAUA 1FFEA 2QJWA 1AMNA 5I9IA 2WUGA 4J0HA 1CUJA 1JU4A 2WTNA 2HDWA 3C43A 4AO8A 4B6GA 4C6HA 3A2MA 5DYTA 1JKMA 2ZSHA 1ZICA 1A8UA 2J3QA 1ORVA 1R50A 3DCNA 4BVKA 2GBFA 1YAHA 3RARA 4LHEA 4E11A 4M0MA 4X94A 3EBLA 4K2AA 4BAGA 4GXNA 4YPVA 2X76A 1TRHA 3V1LA 3DD5A 3D0KA 3BL8A 1QIHA 1W52X 2AJLI 2VATA 3CN7A 2EEPA 3LIPA 4PF1A 2QUAA 5HKAA 3O4HA 3PF8A 4PO3X 4QA9A 4I3FA 4A5SA 1BROA 2XB6A 1GQSA 1X70A 4N8SA 1AURA 2B9VA 2XMRA 5HKBA 4QWMA 1KEZA 1R88A 2WFZA 2ONCA 3VJMA 1Q0RA 4ARAA 5DNWA 2VAVA 2DSNA 5ISMA 5HF6A 3C45A 4DSZA 2XUHA 1QTRA 2HA0A 5HZGA 3WWOA 1W1IA 1LPBB 4QDOA 3WYNA 3B3QA 2ZVDA 4N8EA 1J06A 4Y2SA 1GKKA 1LGYA 1OXMA 2J4FA 3NWOA 4YX9A 3UMJA 4DM7A 1UZAA 5K3DA 1ISPA 2WU3A 3RLIA 1CUAA 4FWBA 4CG1A 4PSUA 1VKHA 2C0QA 1VZ3A 5JARA 3H19A 4MEBA 4HS9A 1ACJA 4K5QA 2VJBA 4G4GA 4H7KA 2OCIA 1UKCA 5JAOA 2FJPA 1UOQA 5FPPA 1QO7A 3DQZA 4AZ0A 5CBKA 1LPPA 1UOOA 5AM5A 2I3ZA 2C5FA 5ALJA 1XRPA 2H1IA 4P92A 1JMKC 4I4CA 4UFOA 2XQIA 5BWBA 3C6YA 2XUJA 1XFDA 5LZ8A 3T52A 1B6GA 4BTLA 3R3ZA 1HKHA 5AKGA 3WZLA 4CIBA 1JJFA 5AJHA 3BJMA 4K6HA 4W1QA 1JMYA 2LIPA 3IUMA 4CI9A 3G02A 3IURA 2PSJA 5ESRA 2PUJA 1CPYA 3TEJA 4MQLA 4J0CA 3BXPA 3AUKA 4E15A 4JUIA 1ZGCA 1NX9A 5BWCA 3FYUC 3WZMA 1HBJA 3VJKA 4BCBA 5IH7A 2XUGA 2BUAA 3F9CA 4GI1A 1VOTA 1I6WA 4Q34A 3AZOA 2WUEA 1EHYA 4Y2XA 3HC7A 3GROA 1P0PA 3BIWA 3WL8A 4Q82A 1FFDA 1GPLA 5SYNA 5AI6A 3SC2A 1JU3A 4UPDA 1F8UA 3H2JA 3V1MA 1MX9A 3X3HA 5AKKA 2WG1A 3W2TA 5C7YA 4EY4A 2WILA 4WDRA 4F21A 4NZZA 3DKRA 3ZLTA 3FLAA 2VT6A 3O9MA 1CRLA 1UOPA 5FDFA 1OILA 5KBYA 3PICA 3QMVA 1P0QA 2HA2A 4JYMA 1TCCA 1QE3A 2DHCA 4CCWA 4GLBA 4EBBA 3I28A 1U2EA 3FCXA 3VDXA 3H04A 5C8ZA 3SX4A 4L0CA 1QIKA 3HI4A 1J1IA 3ILSA 2Z3WA 2XUDA 1BEEA 4D9JA 3DDUA 4BDTA 4H7FA 2BGRA 4P9NA 5LZ5A 4B9AA 1W4LA 3FWHA 4EZIA 2V98A 4W9RA 4EY8A 3W05A 5J3JA 4FFWA 2ACKA 4DGQA 5IVKA 2OCKA 3I6YA 3WLAA 1UK6A 2WIDA 4U2FA 5AHXA 3C6ZA 4IQ4A 4J3JA 1EH5A 4AMYA 1EX9A 2HHAA 2H7CA 1CUEA 4BTVA 5YASA 2DCMA 3I2KA 3C6XA 5JALA 3YASA 4DMKA 4KAFA 1XRQA 5CXXA 1JJBA 2BFNA 4NVRA 5EHZA 4MYSA 1DT3A 5ALDA 4AO6A 1XZIA 4B83A 1IUOA 1XZJA 3FCYA 5AK5A 5ALHA 1VXOA 3STUA 1QO9A 3IULA 4ZXFA 3E0XA 3QITA 3ZLVA 4B84A 1EDEA 3HZOA 4AN0A 5LKAA 2QTBA 5CXUA 3WK5A 2QXUA 3WYDA 6YASA 1EB9A 4X95A 2J3DA 3STWA 3AIKA 3UUFA 5HFNA 3IVMA 3R41A 1CUWA 1O6GA 3V48A 3WL6A 2OGTA 4NMWA 2W22A 1CUCA 4Y2UA 3WKEA 1QIDA 1XRLA 2HFJA 5E4TA 1QFSA 1YB7A 4UBKA 3O4JA 2QKYA 1XZDA 5KWJA 3L1JA 5LYYA 2YH2A 1Y7IA 2XQGA 4Y7DA 2ECFA 4X6XA 2RAUA 4O08A 3A70A 4QNNA 4C01A 2OQIA 1YR2A 4FNGA 3TGLA 2OQVA 4ROTA 4AB1A 4KAAA 3C5VA 2G63A 2O2IA 3STXA 3WK7A 4Q05A 4ZREA 3O4GA 5DWDA 5AM4A 1RP1A 3Q8WA 3FSGA 5AK6A 2QUBA 1SFRA 4IHAA 3IUNA 2JGKA 3WKBA 4CCYA 4BC0A 1WCYA 1LPMA 3F96A 1U4NA 2FJ0A 4ZV9A 3QMMA 3DL4A 2PSFA 3F67A 4OD0A 1XZMA 4L72A 4KE6A 3EQ9A 2XDWA 4X93A 2WQZA 3WKDA 2OPHA 3K6KA 2Z8XA 1BN7A 5CT6A 5JAHA 1W75A 2GYUA 5C8XA 4DNPA 4U2CA 1TCAA 2O2HA 2XQFA 4J03A 1CUUA 3QVMA 2RIPA 5EI5A 1MU0A 4WY5A 2XMDA 3KWJA 2PM8A 3KWFA 4DMCA 4UFNA 1R3DA 1EB8A 2XQJA 5IVDA 3O9VA 2IITA 3RM3A 1TCBA 4J0JA 3STYA 2PL5A 4HVTA 3FBWA 2O2GA 2R8BA 3KD2A 1LZLA 2UZ0A 5A7GA 2JGLA 3KXPA 3Q0TA 3ZPXA 4FLFA 4BZWA 4KJXA 2RHTA 1RYYA 2XE4A 3WWDA 1VJ5A 3FAKA 5E2IA 2WG0A 1TAHA 1XZBA 4CG3A 1QONA 5CURA 1F6WA 4IO0A 1R9NA 4N8DA 3H0CA 1DWPA 2P8SA 5FLKA 4PSDA 1XROA 5ALOA 5HFAA 4BVJA 3H18A 1WB6A 3F97A 1IUNA 4FFVA 4J7AA 5EIEA 2XUQA 3R3UA 1J07A 2HFKA 3SWWA 3AINA 2RI6A 2DHEA 5ALZA 4DIUA 2W6CX 1ZGBA 4G5XA 3H2KA 2WIJA 1P0MA 1VZ2A 1CUDA 4Y2YA 4B0OA 4Y9SA 3HJUA 2ZJ6A 2RGUA 3BF8A 3R0VA 4E14A 5ALFA 3R3YA 4HXEB 5AM1A 4M0FA 5AO9A 1MX1A 3W9BA 5JD5A 5AICA 1CR6A 2CEKA 4AQDA 3ZLUA 2C7BA 4FLEA 2HIHA 2VAXA 2ZJFA 4PSCA 1XLUA 3AJAA 3H2IA 5HF8A 5JANA 3WI7A 2V96A 2C4HA 3IB3A 3GFFA 4FLMA 5K3CA 4EUSA 2HA5A 4DNFA 3I6ZA 1HQDA 1DINA 5F4ZA 4BRSA 3I2FA 3ESAA 3G9UA 5AKXA 3FSGD 4KYVA 3ESBA 5LZ7A 5AKEA 4UBIA 1CUBA 2FX5A 2XMZA 4QWWA 3T4UA 4FBMA 4KACA 5AI9A 4EY5A 2XUPA 5D7BA 1CVLA 5AOBA 4H7DA 4OB8A 4OSEA 4C87A 1QIIA 1G4HA 2GBCA 3ESCA 2JGFA 4KRXA 5ALEA 2XMBA 4IH9A 4XWGA 5A6VA 5EIAA 2CJPA 3WQHA 4AXBA 1HLGA 5ALQA 2AJ8A 1CV2A 2CUTA 2HRQA 4CCYB 4QDUA 3I2IA 1A8SA 2FUKA 4QDXA 4U2GA 3WL7A 4W1RA 3H2GA 2GBIA 4XX1A 1CUFA 3WJ1A 1SCIA 2OAGA 1FJ2A 4WFIA 5FRDA 1U65A 1WPRA 3R3VA 3STVA 5AM3A 2VF2A 4AX4A 1XZAA 1H22A 3DS8A 3BE8A 3W04A 2CZQA 1DWOA 2AJDA 4LKOA 3QMWA 4LXGA 5AK3A 1AUOA 4MJ3A 4DTCA 2ORYA 3R3WA 4WJLA 3LS2A 5AKLA 4YASA 5AKJA 2WHPA 3PI6A 1S8OA 1TK3A 3ED1A 5CH3A 2WIGA 4CFSA 3I1IA 1YA4A 1B41A 2QM0A 4UBNA 4B9EA 2EDAA 4XVCA 3WJ2A 3JW8A 5A2GA 1LPNA 1QIEA 1CUVA 2HA7A 1CUXA 4H7EA 4Y2TA 3G0IA 4BVLA 4WFKA 5AOAA 3K2IA 4FTWA 1K63A 4P93A 1DU4A 4KEAA 4ZWNA 1QFMA 1GXSA 1ZI8A 5AKIA 2OGSA 4RE6A 4PW0A 3DL7A 1IZ7A 2WIKA 4FNMA 5A7HA 1QLWA 1MJ5A 1DQYA 2NW6A 3PUHA 4OUKX 3R40A 4MYDA 5AKHA 1ZD3A 2ZYIA 1MAAA 3OC0A 3D59A 2BUCA 5AI5A 2XLBA 1N5RA 5ALXA 2QS9A 2CKMA 4LYEA 1DWQA 1TIBA 1DX4A 2JEYA 5CT4A 1O6FA 5ALUA 4Y2JA 5AI4A 3G0GA 2JGIA 3L1HA 5FPQA 3M3DA 5ALGA 5AM0A 1C7IA 4G8CA 1GZ7A 1T4MA 4X6YA 4U2BA 4TVKA 5BV7A 4L9AA 4X85A 4GWLA 3HYSA 5EFZA 3A2NA 1XQYA 3ANSA 1ODSA 2OGZA 3A2LA 3RK4A 5LZ9A 3BWXA 4L3WA 1JFRA 3HEAA 1D07A 4UBMA 4EY6A 4Q3OA 4ZGBA 4RNCA 1UK9A 1HDEA 5T4HA 4BE4A 1XZLA 4JYPA 4F60A 3I1YA 4J0KA 2PSEA 3GELA 5EHQA 3H2HA 4OYYA 1EVQA 4J0DA 2DHDA 3G0DA 3QPCA 5FKJA 1E66A 3ZI7A 4HXFB 4GEGA 2JBWA 3KDAA 4OB6A 4EHBA 4BCCA 4CIAA 4BC1A 2VQ6A 5HQ3A 4W1SA 3G8YA 4KE7A 3C6BA 3WWCA 3GUUA 4GHWA 4ARBA 1UFOA 1EXWA 2ZSIA 3PDCA 5LP1A 3STTA 1E8NA 2D5LA 3D2CA 4J0GA 4U2DA 3DYIA 1ZJ5A 4I19A 4BCDA 1BRTA 2HU5A 2QT9A 4HTAA 1MNQA 4CG2A 4EY7A 2O7RA 1WB4A 4WDQA 3I2GA 4QLAA 2GBGA 2Y1KA 5DNVA 3IIIA 5HCUA 4Q1VA 1XKLA 5HK9A 2OLEA 3M82A 1Y37A 1H2XA 2Z5GA 3HABA 1ETHA 4FDMA 2GYVA 2Z8ZA 4H35A 3WK6A 4IH1A 2VJAA 1TQHA 4PQEA 5KWIA 3BDIA 3N2ZB 1ODCA 4HZGA 1CQWA 3ESDA 1H2WA 2O7VA 1XRNA 1XQVA 1LPSA 2XLCA 2JGEA 5JATA 1F0PA 2PX6A 3QH4A 2QMQA 2G5TA 2V9ZA 2WFMA 3G9TA 5FV4A 5JZBA 2I78A 3DLTA 4QDTA 3N0TA 2WG2A 3IBTA 5C8VA 2WHPB 5AKYA 5ALPA 3FYUA 4U2EA 1SCQA 1XZHA 2ZYRA 5JYCA 2PUHA 2PU7A 1IVYA 2CB9A 4UHEA 3U0VA 4HAIA 1K4YA 2ACEA 3IDAA 4JEIA 1UT6A 5JASA 4KE9A 4OCZA 4Y2QA 3L1IA 1MN6A 3OOSA 1UXOA 5ALVA 1AKNA 3QZUA 2HU8A 1K5PA 4NS4A 4QLOA 5K3FA 2WU4A 1XZGA 3H1BA 5CTAA 3LLCA 3UUEA 3VVLA 1BS9A 1YA8A 4MWTA 1Y7HA 2XUIA 3VVMA 2DQZA 3G0CA 3BF7A 1UWCA 2QR5A 2HM7A 3WA6A 4QZVA 1EK1A 2AJCA 1EI9A 4ETWA 3FOBA 1DX6A 3AFIA 3W9UA 1AC5A 1ZD2P 1E3QA 1XRMA 5FP0A 4DYHA 1Q0ZA 1N1MA 3MUNA 1G66A 2V97A 5DNUA 3O0DA 5FOQA 1NU6A 3ANTA 4H7HA 1FFCA 2QXTA 2BCEA 2PPLA 2PVSA 2XQKA 3CCCA 3FVRA 1CUHA 2HRRA 1MPXA 2XUOA 2XMGA 5C81A 3WMRA 1EDBA 1EINA 2WHQA 1DT5A 4LXHA 3BDVA 1R4ZA 4JNCA 1UKAA 4K6GA 3BJRA 1C4XA 4QEKA 1G42A 5AOCA 1SCKA 2ZYSA 4X71A 1XRRA 3G9ZA 5KREA 1UK8A 3GZJA 2I3DA 3NOXA 2AXEA 4AZ3A 1LZKA 5LIPA 3AIMA 5DYYA 5ALRA 5HK8A 2DR0A 2XMQA 4UBOA 4X97A 1ACLA 5K3EA 4DNOA 1SOMA 4MEAA 1YB6A 4GDMA 2PBLA 3QPDA 2IIVA 3U1TA 4DMHA 2VA9A 4C89A 3A6ZA 5HQ3B 3VKFA 3FYTA 2B20A 1H2ZA 2C0PA 3H17A 1HPLA 2QJRA 2WHRA 4BATA 1BN6A 5ALMA 4FMPA 4YK7A 3HACA 5IVHA 3PF9A 5E4YA 3F98A 4BAUA 4HXGA 3WA7A 1K6EA 1QZ3A 2VT7A 5CH8A 4X7BA 4DSAA 5A7FA 1N5MA 4Y2VA 1RWQA 2OXEA 4K6KA 3WWEA 2GZRA 3WIBA 4C4ZA 1LPAB 4X91A 1DQZA 5ALTA 4UBLA 2WFLB 3DKKA 1GPKA 3C5WP 5IKXA 5K3AA 4OU4A 1GPNA 2BUBA 1CUIA 2HA3A 1F0NA 4BP9A 1E89A 3WK9A 1WHTA 3AIOA 1ZD5A 5CT8A 4FHZA 2VTVA 5D6OA 2JF0A 5ALIA 4E46A 3RKSA 5EHXA 1EDDA 2BAGA 5JIBA 1PV1A 1PJAA 3WWPA 5AP9A 1CUZA 2ES4A 4EB0A 4ZV7A 2HA4A 2X5XA 2XT0A 4ZRDA 1XKTA 4KR0A 3HXKA 4AO7A 2JIDA 1WHSA 2C5GA 4A16A 1CLEA 3DNMA 1H23A 3FYUB 5ALWA 2CMFA 3K9BA 1M33A 1VLQA 2G5PA 3HRHA 3DOIA 4F5ZA 4H77A 3IUJA 4UFPA 5A62A 1XLWA 3AZPA 4F0JA 4MWSA 2YYSA 5JZSA 2Y6VA 3ICWA 1R9MA 1QJ4A 4B80A 1KU6A 5DLPA 4G4JA 1T2NA 3WKAA 5SYMA 1L7AA 4X92A 4Y2RA 4B82A 1OCEA 1MTZA 3D7RA 1EA5A 5K3FB 2XUAA 5LKRA 4DLNA 2WJ6A 5LLSA 5LZ4A 3D2BA 2WTMA 1CQZA 3DJYA 3F8SA 1CUGA 4KE8A 1XZCA 1L7QA 4AMZA 5ALLA 1GT6A 2VJDA 2WJ3A 5DJ5A 1K8QA 4PV7A 1ORWA 3IA2A 1GQRA 1ZI9A 3D4LA 3OPMA 4DMFA 2VSQA 3QYJA 1LPOA 3M83A 4H0CA 5T4EA 4TPKA 5HF9A 3R3XA 5JZ9A 2Y2VA 3QPAA 4FBLA 3LCRA 1CEXA 3S2ZA 2WSLA 2YASA 2EDCA 3M81A 5AI0A 1VA4A 3JYHA 3QBJA 2HU7A 2H7YA 3ZV7A 5CW2A 3PUIA 1BCSA 3AZQA 3V1NA 1A8QA 5D3KA 4B81A 1QIGA 2OCGA 2CBGA 2XMCA 1YASA 1AX9A 2K2QB 4GW3A 3BIXA 1XLVA 4UHHA 3I2HA 1YSCA 4RGYA 3E3AA 3O4IA 3V9AA 1FSSA 2I03A 2QVBA 2PSDA 1C7JA 2WLSA 5E4JA 2PKYX 2PU5A 2VEOA 3CCBA 2BGNA 4Q3KA 2XI4A 3B5EA 4KRYA 3D2AA 3FNBA 2GYWA 3D5EA 4QE3A 4MXDA 4N5HX 1USWA 1BU8A 3E4DA 2WIFA 1MO2A 5HF5A 4A23A 1YS1X 4MQMA 2B61A 5JAPA 1A88A 4H18A 1XZEA 3C70A 1FFAA 5H3HA 3TJMA 1WPXA 5DTIA 1HL7A 5CMLA 4TGLA 1QIFA 1ZD4A 2DQYA 4W63A 3EF3A 2YXPX 3PFCA 3LIIA 1WB5A 4S0XA 4W1PA 1U8EA 2BKLA 2Y2UA 3AILA 1E8DA 5I8PA 1CUSA 1W76A 1VA5A 4G1FA 4UHFA 1MAHA 4X00A 3G7NA 3S8YA 1LNSA 1BE0A 3WIOA 4JH0A 3QM1A 1AGYA 1AZWA 1R1DA 1EK2A 3C8DA 4XJVA 4C88A 3ZWQA 3TRDA 5AH0A 4KAJA 4G4IA 4ITVA 4XIIA 1EVEA 1JT2A 3KOOA 1GGVA 4Z49A 5JD4A 5BOVA 4BYMA 3PFBA 5AK4A 3O95A 2BJHA 1Q83A 3DOHA 1LBTA 4BZZA 4DNQA 2GZSA 3GBSA 1VE6A 3G0BA 1DTEA 1AQLA 4OB7A 3FLEA 4OU5A 3MUOA 2B4KA 1XZFA 2ZJ7A 2Z3ZA 2RONA 5FXMA 1H2YA 5ALKA 4LXIA 4BBZA 4M0EA 4GBGA 5IVIA 2HA6A 2PSHA 3KSRA 1THGA 5CT5A 1VE7A 1FFBA 2WFLA 2HL6A 4UUQA 1GKLA 4B85A 4IH4A 5LZ2A 1P0IA 4HRYA 5CT9A 2WJ4A 1KU0A 1LBSA 3WL5A 2JGMA 2WKWA 5ALNA 1JJIA 3VXKA 4Q3LA 3SK0A 4B7ZA 3ICVA 4BAZA 5AM2A 1THTA 5DTJA 5ALSA 3V1KA 2QZPA 3HLKA 1ZI6A 1A7UA 2D0DA 1PFQA 5I7UA 4FOLA 2WM2A 2Y6UA 4ZI5A 4BDSA 2HADA 4BP8A 5ALYA 1XQXA 2QOEA 4X6UA 2J4CA 2H7XA 1L7RA 3WK4A 1QGED 4RE5A 3NUZA 4V2IA 3OG9A 3VJLA 4G9GA 4B0PA 3LP5A 3GA7A 3VISA 1E5TA 3FLBA 4G9EA 7YASA 5FUMA 1MNAA 2G4LA 4X3CA 2H9YA 5AI8A 2XUFA 5EHNA 3WKCA 3OM8A 2E3JA 4HRXA 2Q0XA 3CXUA 2WUDA 2OG1A 4UHDA 5DYWA 5A71A 4UHBA 4RPCA 5AIBA 4INZA 5JADA 3EQ7A 4H7JA 4J0IA 1YAJA 1WM1A 2R11A 1MT3A 2C58A 5AKZA 2QRUA 3DEAA 3C8HA 1NU8A 1QOZA 4PNZA 4G8BA 4N5IX 1ODTC 3E1GA 3FVTA 4FKBA 3MVEA 1QIMA 2OAEA 1WOMA 3P2MA 2XMSA 4LIPD 4OYLA 4C4XA 1CUYA 1ZOIA 3JWEA 5K5EA 5CRIA 3G9XA 1MX5A 3NGMA 5D3ZA 2XUKA 3I6MA 1N8SA 2AJBA 4LYDA 4C4YA 4H7IA 1X2BA 3EIOA 3H1AA 1W6RA 3OURA 1BEZA 4QDZA 2OCLA
chains in the Genus database with same CATH superfamily
4WY8A 2OAQ1 4KGXA 4B74A 4P33A 1KYTA 1CZRA 1RLOA 1QDUA 1ULHA 3TTSA 4F3RA 5JNLA 3C7KA 4MV1A 2CLOB 1G8SA 4FCTA 2H0QA 4U7HA 3U7QB 2OD7A 3QLEA 4YAKA 5KJ1A 4YCSA 4X90A 3DA8A 3DZIA 1U6KA 2FW6A 2IV3A 4GC5A 4ZZ2A 3DAPA 4EG7A 1NZFA 1HOXA 2E55A 4IX1A 2C7QA 3ZIDA 4WOBA 4NCKA 4I4NA 1HL3A 3EWAA 3OJEA 4LZZA 1XZKA 2CN1A 1WMAA 3MELA 1EFAA 4FNAA 1WCXA 2JKYA 1YD7A 1KGDA 1RHMA 4OJMX 3W06A 1KMHA 1N2CE 1IQ0A 3PE6A 3F49S 4FFRA 4MWOA 1X2EA 1OPRA 2ZU0C 3AP1A 3RAEC 4PBSA 1I2ZA 2CXQA 2DUWA 4LZWA 2IYOA 4BB0A 4DFDA 1V41E 1RZUA 2B6HA 3H2ZA 4WKBA 4OPMA 3OT5A 1FYEA 5A1TA 1ZC4A 2YYZA 3GQBB 3ZHZA 1PFGA 2JEZA 2OENG 2QNBA 3MJ4A 1RBMA 4FHFA 4OHCA 5FO0A 3RS2A 3UAZA 1TT5A 3USZA 4R9NA 3TKAA 1PJBA 1E8MA 1EX7A 2OBMA 2DFPA 1EFVB 4IIUA 5FLXA 3AM5A 2BYTA 3DAGA 3PI7A 3AGPA 3C87A 2DTDA 4J90A 2FR8C 4BLQA 2FQYA 1K7YA 2BCJQ 2B36A 4KMMA 1YS2X 2IP4A 1LLFA 3HXPA 3SJZA 4CM8A 4R2MA 2XECA 5T41A 3GH1A 2ZWAA 3AQIA 3C2QA 3W5IA 5FBVB 1YCDA 2W42A 1G5FA 4L8WB 3JQCA 4YROA 1MCZA 5JS2A 3OTQA 3WK8A 2YQZA 1N8NA 2YL2A 2VQSA 3QKSA 4PLTA 5HWSA 4NBLA 2E82A 2JFYA 3OCXA 5JFTA 4KCGA 4YUVA 1GZ6A 2IX9A 3E3NA 3Q9LA 1CRQA 2JLBA 4G0PA 4PWZA 5EE5B 5FPHA 3N9IA 3ZYCA 1TKRA 1DJPA 1P2SA 3RT9A 4LSGA 4N39A 3IT1A 3EIHA 1WLYA 4TS4A 4Q15A 2OD9A 5T4BA 3WC4A 4EA6A 5KU1A 4WFJA 2QTLA 5FOVA 4LAFA 5TS2A 1K0FA 5CNIA 1YQGA 2XVXA 3RYCB 2X0DA 2QRQA 1NW9B 2XMPA 2WUFA 2ZRPA 4RDIA 4HGPA 4Z54A 1EXVA 4KXFB 4DAOA 1SU7A 2EX0A 5JE8A 5EWLB 4GDFA 2C9BA 4J16A 2ROQA 4MV4A 1IBSA 4G2TA 1XQWA 5JI2E 2WSBA 1FFEA 3AL2A 2VHJA 3PEVA 4JJIA 1J0EA 1X7ZB 3O9ZA 1KFJB 4M99A 4A0RA 2QPOA 4F5EA 2NO9A 4J0HA 4LZPA 3DOOA 5B3JC 2HDWA 4KL8S 5KX5A 1EGVB 2ZYGA 3MSXA 1GUBA 3EPLA 4DJDC 1XZNA 4H3HB 4C6HA 3A2MA 2G09A 4DGSA 5LOVB 1FK8A 1S3GA 1U94A 2YV5A 2OK7A 1NVTA 1GNVA 1BE1A 4MPRA 4MV9A 1T9KA 3CVJA 4PNEA 1M1ZA 4L5BA 3OI7A 1P73A 2Q5EA 1Z5OA 3FHOA 1KYYA 3HYNA 4WERA 4JB8A 2QGZA 2QRLA 3H1PA 3FKQA 1G4AE 3CUSA 1OYVA 2G8NA 5ABPA 4R51A 4GRAA 5H16A 1D0VA 3ORYA 4XZ3A 2BISA 5IBPA 5AW3A 4BVKA 3NHZA 1NLZA 4GBED 2ZE7A 2NU8B 1R4MA 3PFGA 2ZSDA 1LBQA 1DOZA 3EVCA 3I42A 4HQOA 4LHEA 4MV0A 3PX2A 4AS1A 4OOFA 1D2CA 3E9EA 4PLVA 4YMLA 4BMYA 2IUFA 5GY7A 4NG4A 3F90A 1C4WA 5AVKA 1PR3A 4K9PA 3QELA 4YPVA 4JVSB 1W4CA 2OBBA 4WNYA 1JH8A 5FCDA 4MCIA 3RS0A 4LC0A 1OXSC 4O4JF 2IVZA 2XKJE 4HNGA 3TN7A 5KPJA 5DNYB 3DCIA 1M2GA 3GA5A 1MOQA 1TRHA 4RENA 2NXWA 3ZWYA 5IYZB 1GVHA 2P2SA 4BKOA 1PDVA 1J23A 3DTYA 4V02A 1TEVA 1QCYA 2R00A 4NFLA 3THXA 3DM9B 1MFZA 1Q1EA 2R8OA 4PF1A 1T43A 1KEUA 2QUAA 1N0UA 4JJZA 5FOUA 5CB4F 4KQWA 4YJDA 3BDAA 4MLZA 4WY2A 3CZAA 3D6FA 3PF8A 4LQDA 5BPHA 1QKKA 1QNLA 1TX4B 2PT6A 2J46A 4W5OA 4Z4EA 5FPKA 1KZ7B 3O3CA 4PAWA 4C0SA 5LIRA 4AUKA 1QXSA 1BROA 4IIHA 2WWYA 2WRZA 4TQUS 1WXEA 3N87A 3ND9A 4LBYA 4NYJR 3T7DA 3TFOA 2BT4A 3N39C 2B9VA 2HPZA 2RCYA 5HKBA 1GTRA 1R88A 1F2DA 3T5CA 3VJMA 1Q0RA 1Y4SA 2P6RA 4R9RA 3ZZ1A 4MV3A 4V0ME 3AQ4A 2TSYB 1L7VC 3HBJA 1JLHA 5DNWA 2DSNA 2Z8YM 4KI7A 2V0NA 3TNDA 3B3JA 4DSZA 5JWRA 3D4OA 1RJDA 3B6EA 2W70A 4P4TA 3EA0A 1XEXA 1BXGA 4B6FA 1GTVA 2FPGA 2WHXA 3NHWA 4L4UA 1WXWA 2HWYA 1JIJA 1O95A 2IL1A 1R18A 3DTTA 3LE8A 2QMYA 4EJSA 1C29B 2PX8A 5BUQA 2G76A 4G5YA 3KG2A 3WWOA 2AJTA 1Z5PA 2IS2A 2DWCA 3BMNA 1DARA 2ZAMA 2ZB4A 4FMCB 2D5CA 2Q1WA 1OMOA 4KTVE 4HPXB 2D2IA 4TL8A 4W82A 3ZNOA 1JXMA 1R9GA 4D0LB 1ADFA 2C4UA 3JPWA 1ZNXA 2JH3A 1TU4A 3FTCA 4ZN6A 1EVKA 4DLTA 5KQRA 3CURA 2DBVO 3ZJ5A 1NW8A 3RFXA 5DISB 2ZANA 4IOMA 1X7XA 2FOLA 2WUWE 5KOJB 3DVQX 3QVGB 4QGFA 3TNJA 2J4FA 5JD3A 4Q4JA 4F4CA 1W85A 3OUTA 5EKTA 4ZHSA 1NBEA 3H7IA 3DE3X 3L6BA 2ZBPA 5IDQA 3K16A 3R6TA 4NECA 1NUTA 2B21A 4YXWA 3ITKA 1SUBA 1T36A 3RHTA 1T2FA 5L3VA 2AZXA 2IS1A 4HLUC 3Q87B 2Z2JA 4JT9A 4LXXA 5DSXA 3RV4A 4CG1A 1PWZA 4EA8A 3ANMA 3KXLA 1L4HA 2C0QA 5HS4A 2J0EA 4KGDA 1R12A 2C59A 1VZ3A 1Z22A 3U3OA 4ABYA 4MJLA 5FBZA 1CNMA 2BFDA 1F20A 2IYUA 2D5BA 3LNCA 4KIWA 4ZOEA 5G4KB 1U02A 3AHIA 3PGVA 4K5QA 1MB9A 4RCYA 4ZI7B 4G4GA 2YWXA 4H7KA 2EFEB 2HB6A 1W9HA 1U8TA 1Z4NA 5LDGA 2I6GA 3VOSA 2NOAA 1M2KA 5C3MA 1CJCA 4LHVA 2FJPA 4UXHA 1WSDA 1RWNA 5B7NA 1RI2A 3LC7O 2AG1A 1QO7A 3DQZA 3LKZA 1Y1KE 1RZ3A 2HUNA 3TNLA 4QU5A 5FR2A 1P72A 2JHFA 4YRSA 4QATA 2Q29A 4YCDA 2CUZA 3R7WA 2RKOA 4FGWA 2VHEA 3IUYA 4QRHA 4D3FA 3PX7A 1LPPA 1W0KD 2HJWA 5NULA 2GZ1A 2ZXFA 4YRIA 2H6EA 4YHBA 5A2QA 2EWVA 3ZCPA 3N28A 4G01B 5TR9A 1HLFA 3UFXB 1KO8A 1BFKA 3NPMA 5KYNA 1RQGA 1WNTA 1HR0B 4C7MA 1OFTA 3OLVA 1A4UA 3GHYA 4BV8A 5IJ0B 4NCHA 5JQGA 1WSWA 3AY0A 4AG3A 4UDXX 1JMKC 2AOUB 1D4ZA 2A9KA 4UFOA 1TFRA 1PZNA 4N7BA 5DBGA 3L9WA 2H18A 4WK4B 2IV7A 1ESZA 1KNXA 2CDAA 1COZA 3C6YA 3MM4A 4P86A 3ONEA 4O2AA 4R7TA 4RW0A 1NVUQ 4WLVA 4YYEA 1HZJA 3OZ7A 5EL0A 5KQSA 4KV9A 3OPYA 5A5EA 4BTLA 5DVZA 5AKGA 2ZBUA 3AF5A 1EG2A 2RC5A 2ZAOA 2F9FA 1MRNA 2ZTUA 3QJ5A 2DXIA 1GU7A 1GV1A 3DVAB 4W1QA 5IBRA 1Z3IX 2LIPA 2EQAA 1VLMA 2ZBQA 3QU9A 2AFHB 4MWGA 4OFXA 3UWSA 3SYTA 2QI9C 4O63O 2O3JA 3GXOA 3V7YA 3MERA 3AEQA 3JYNA 2P41A 1IIRA 2PAFA 3PNMA 3Q3IA 4KQCA 3G02A 3L5OA 4A2WA 4TSRA 4RMHA 3DONA 1TUEA 1YUBA 5I3ZA 4QKQA 1KK3A 4OATA 2PUJA 5LQRA 1CPYA 3PUVA 4PC2A 4A6DA 5DM70 2DRIA 5F7OA 3AL0C 2XEDA 3A9SA 3CF2A 4GD3Q 1QVRA 2Q9AA 3AUKA 1BHSA 3H5TA 1ZNYA 3VI4B 2O19A 3LPAA 4D81A 5KYUB 3DXZA 4QBFA 3WZMA 4I14A 2VHTA 1HBJA 3VTFA 2I2AA 5CFQA 1M34A 5FIUA 2M1ZA 1IHDA 2IYXA 4KVFA 3JRWA 2ZRLA 4BCBA 1C9EA 3NTOA 2BUAA 3F9CA 1Z45A 5IT0A 4AS2A 4ZJZA 4WXRA 2FSFA 3EW9A 3AVWA 2OXRA 5B4UA 5BWNA 1NQAO 2C3MA 3I30X 1I6WA 2NU7A 2GNOA 2XF8A 3L1UA 4ZQCB 5A05A 4CKBB 5KC9A 1KKUA 1VIMA 3MMNA 3OTOB 3U1VA 1KI6A 3AVOA 4PPFA 1IK6A 3WL8A 3EDYA 4ZYWA 1FFDA 1ZCBA 2HUPA 3LBAA 5FJJA 5TF4A 3HVRA 2EIXA 4M7WA 1BCRB 1SVOA 3U49A 3V2UA 1IXRC 1Z4LA 5FTLA 3VR4A 2BFFB 2BZGA 3BC1A 2JS7A 4QYTA 1O2DA 1QPZA 2XTJA 4NOJA 2AXNA 1Y1RA 3V3KA 5GJCA 1LDMA 2Q5HA 3BE4A 3Q7IA 2DFKB 5HJ5A 3MCVA 2JHAA 3OM0A 1ZK4A 2GK4A 1JU3A 4IINA 4MK4A 3WHKA 2NN3C 1GQYA 3H4VA 1YV9A 2CSUA 1PD0A 1M7GA 4U0KA 1DXQA 3PQFA 1T0BA 5AVVA 2B1GA 3IP5A 4L8LA 3S55A 2P9FA 4MUEA 1Z4PX 1Q7CA 1USVA 2WG1A 3GRRA 5C7YA 4EY4A 5KNCA 1G18A 3A4LA 4NEGA 4CGZA 5BNTA 3WGZA 2W98A 3R6LA 4AL4A 4ATNA 1MVOA 3PUXA 4C5BA 5CDTA 1S1CA 3PDIA 5KBYA 3VKGA 3S6JA 3ROQA 1Y9DA 3LHDA 4IJUA 2X8LA 2D1FA 4CDRA 4ZV4A 1BWPA 3DW1X 4YT8A 5F9HA 2HA2A 4HUQB 1PNQA 1ZL0A 2FFQA 3BHNA 1N6RA 1TCCA 3MWKA 4GPD1 3BMCA 4GLOA 1QE3A 2DHCA 2GWHA 3KJXA 2C0CA 4TWJA 3SE7A 4GLBA 1UJ6A 4XX0B 5K8VA 4IZOA 4IR7A 4TYPA 3WRVA 1IAQA 4EBBA 2VN8A 4HMOA 5BVHA 4YAEA 3B9RA 1PT8A 4C1BA 2KLHA 3HB4X 3J81A 3LX4A 2ONZA 3UK0A 3FFTA 2BL4A 2W48A 3WGUA 2W4IA 4TUYA 4P8RA 2R1UA 4JR0A 5TARA 1KFBB 2GPAA 3SYMA 1Q11A 3H04A 1SD5A 2E4YA 3IAAA 3T5AA 3RC7A 3E9ZA 2GASA 4X8MA 4M46A 4UARA 2Z3WA 1UP6A 2IEGA 4PLYA 3T7TA 3DDUA 3EMKA 3OCJA 5CBPA 3KLNA 2ZJ3A 4Z2YA 4MV8A 3DPUA 1R5JA 1GGHA 2GHRA 3HZRA 4OAOA 3FNGA 3GDHA 3O8RA 1O95D 4JI5B 1SQ5A 3ZWWA 3FOZA 1WXQA 1IN5A 2VJMA 1KO1A 3JTMA 2DPMA 1KEEB 1ADYA 1NOKA 2ATEA 2EOAA 3FDJA 3G7SA 1AN9A 2P0AA 4JJ4A 1TO6A 3KR1A 5CB8A 4LBZA 1HC7A 1M1YB 2IF2A 3W05A 2DBRA 4ZZ1A 1F5NA 1HSZA 2REOA 2IYNA 2CLLB 4GKVA 4ENUA 3L0ZA 4HH3C 2R6FA 3ETGA 2X13A 2FWMX 3EUFA 3EXG2 5DX0A 1ISFA 1UK6A 3UK7A 3RIHA 1OT5A 3KZKA 3IT3A 1W1UA 1DXYA 4IXWA 3AUFA 1G5IA 3GUCA 4RHXA 5LDDC 2IXDA 3OSZA 5JMWA 1KP2A 3QOYA 3W5JA 3AKDA 4LE1A 2OMKA 1XVIA 4DDWA 2QYSA 5KC8A 1U7DA 2ZT7A 4YXWD 3PJGA 2OZLA 1EX9A 5CVEA 3FH0A 4AP6A 2IYYA 2H7CA 2NSLA 1O77A 4ZI3A 4UU7A 3AF4A 4PYKA 3K0FA 3N2YA 5HFJA 1F3OA 2MYTA 1TUGA 2W7TA 1LW7A 3WISA 2QZJA 4LZJA 3I2KA 3ZHQA 3RAPR 2PLRA 2CBXA 3MGBA 3YASA 2BE7A 1XPOA 3D64A 1E2PA 1LD3A 2PS0A 3AUTA 4DR2B 4UQLA 3S2IA 2GAFA 2Q1SA 5E95A 3WGYA 4Q1CA 1CU1A 1X86B 5FUVA 4JB2A 1TOAA 3B82A 4R2JA 5EHZA 3UAWA 4Z4HA 1TEHA 3DOFA 3HP4A 1XZIA 3N3AC 5KDLA 5LXTA 4FEYA 2EU8A 1HLPA 1ZCAA 3Q3JB 1D2NA 1DMRA 1PNVA 1IUOA 1XZJA 2ZYTX 4QHTA 5ALHA 3GLFB 2GUWA 2MU1A 1OD6A 2ZW9A 4TKUB 1NNUA 4U63A 4OFBA 5CDHA 7ABPA 3OZDA 4U4AA 4BLWA 3SDZA 1Y4ZA 2GN6A 2QAJA 3QK7A 2OV3A 4J29A 3FMGA 4KU4A 5C37A 4IAOA 4MWDA 5K8JB 2A78A 3I9LA 4B7CA 3A3NA 3TZKA 1E58A 2CE7A 2HJGA 4RD3A 5ICSA 3BSYA 1EDEA 1I0ZA 4I1SA 3VNSA 4AN0A 1OVGA 4R0NA 3TLEA 2DC1A 3ZKWA 5LKAA 3FNEA 3URKA 4YNBA 1U7XA 1E2FA 3B3FA 4O2LA 1L5RA 1N75A 5CEEA 4UE6A 1J22A 2QTBA 4OI4A 2IUUA 4MWEA 4BFXA 1SC4A 1NXXA 1PK7A 1Z2OX 5DOZA 1LJLA 3WYDA 3IDFA 4P6VF 4IWYA 4P7BA 1DRUA 1XP8A 4URFA 2C2OA 4X95A 2X4DA 1P74A 2H31A 2ZWMA 3MQFA 3RABA 3WGJA 4OJYA 2IS4A 2NO1A 5FHRA 5DN6D 1E0JA 3FDZA 3JWGA 3N7UA 3DE5X 3AIKA 4X60A 4HWSA 3UUFA 1R6DA 3DE0X 3BJEA 5E3HA 4HDCA 2O8EA 2QTHA 4NZ9A 1K8ZB 1O6GA 1R2QA 4IBOA 3V80A 3IEMA 4MQEA 2JKZA 3B2QA 3BEOA 2OK8A 2OGTA 3GLTA 1PR9A 3KPWA 3Q2KA 3TMAA 1BO6A 3AIIA 1I80A 3ZU3A 3SGLA 3UJ3X 3RYFA 1B0ZA 1CUCA 2FSVA 2VXBA 3BXXA 4PSKA 4HG2A 3AUYA 3HRKA 4LNUB 1V2HE 5DCLA 1RAIA 1YB7A 1DZ3A 4TX1A 5BT9A 5HP4A 1VYTA 2ZSKA 2VBGA 3GYGA 4NULA 2QKYA 4RPIA 4LMPA 1TADA 3GGGA 1UWVA 3PVCA 5H70A 3SCZA 3NHLA 4DHEA 3T4EA 5BV2P 2J33A 2YH2A 1FDUA 4YRCA 1Y7IA 1BVYF 1UC4B 4V03A 2ECFA 2F3SA 4KH0A 3ZE6A 1FXWF 1V9SA 2FPUA 2JFQA 3DBLA 1QZTA 4U8HA 4X6XA 3FUCA 4CM9A 4AI6A 4EUNA 4WT7A 4E22A 2H8GA 2QY6A 3SHOA 2DH6A 3LUBA 4JYZA 2C4WA 5CCEA 2WMDA 2CYBA 3SLGA 1YT5A 4FSXA 5AUOB 1AK9A 4NMMA 1YR2A 2ZWIA 3QA3E 4KXQA 4Y9TA 3ZJ4A 2UZ3A 5JNTA 5AJWA 1U9CA 4OO3A 4BV9A 2EFHB 1M0WA 5A3QA 1QF6A 1OTXA 4UREA 4YAWA 3UMRA 2CFRA 3B1VA 4EI8A 3VR4D 1R0XA 2JFGA 4PQFA 2O2IA 2ZRIA 1RWXA 5CDYA 4B3TB 5JVDF 1OYWA 1NFQA 1VCOA 4B09A 2GO1A 1JDSA 3O4GA 5J4YA 4NU5A 4X54A 4LS3A 4M55A 2HSWA 1VSTA 3LLUA 4B87A 3JAMA 4M89A 5EVJA 2WR8A 2EGHA 3BM5A 3ODPA 3Q8WA 3I9V1 5K6AC 1L4LA 1M7BA 2JFFA 2QBYA 4BVAA 2OYSA 3QW4B 3UKDA 1J2UA 3MTDA 1X80A 1YR6A 4GI5A 4IMPA 4KXNA 3IUNA 4M1ZA 3VPHA 3WKBA 4HV4A 4Q7MB 2XYQA 3ERCA 3DD1A 1IC6A 2O5CA 1E2KA 1TKBA 3OX4A 1WCYA 5JSQA 5KNCD 2ODTX 1LPMA 1G19A 2XWSA 3H8WA 4YCNA 1MH9A 1U4NA 2FJ0A 3EFOB 4KTTE 5F1OA 4YPFA 1DVRA 3CRRA 3QMMA 4ZV9A 3D4IA 3OOYA 3DL4A 3SHQA 2AN3A 1B6SA 3GFQA 3JQBC 3KDPA 2VHVA 4KWCA 4TZKA 4CIYA 5JXGA 3F67A 5LMNB 5DNAA 3CZ4A 2VPXA 1LQ2A 5J1TB 2JIZD 1DHTA 3E27A 2YWDA 4O4IF 4MVXA 4ZOLA 3S7ZA 3P2IA 4FYPA 1O9GA 4K9MA 4RKYA 3ZGLA 1XV5A 4ACAA 2FMHA 2I4RA 2JFHA 2XGSA 3DZHA 3ZCVA 1T9GR 4EKNB 4HDQB 3ZDDA 3EQ9A 1SOAA 2CCKA 3MSCA 5A3RA 5JNVA 3KB1A 3O21A 2WQZA 1ZHFA 3NC1C 5AD1A 2AC2A 3K6KA 4UD6A 1YGPA 4GVPA 1NC1A 3C1TA 1OXVA 4ZT5A 3SC2B 4FYIA 4F93B 4GL2A 1ODFA 5LBTA 1KK0A 5C8XA 3D6HA 1QWSA 1R6BX 4U2CA 3ROFA 1ISRA 3X2EA 1H1TA 2HD4A 3DKPA 1Z4KA 3FUTA 1TCAA 2XQFA 4DVGA 4R9VA 1N5JA 2VUHB 5EP2A 1MQAA 3N2LA 3QVMA 5B2ZA 4JLNA 1I3OA 3A1FA 1F38A 5FQOA 3RSOA 4L95C 4AJ1A 2VKQA 1JEOA 2W0MA 1OOEA 5CJPA 3LUGA 4DCUA 3N6VA 4DA8A 4HZUA 2HRDA 2YJ6A 1PQ4A 3D8HA 1RVDA 5E2AA 3ZE1B 1OI7A 1ABEA 2B83A 5MN6A 1A9XA 5IAOA 3KAQA 1DIBA 1IOZA 3CJTA 1CQIB 3DMPA 7MDHA 1ZAKA 4XYBA 3NDRA 1CIVA 3UM9A 3KWFA 4E2ZA 1W2HA 1P1FA 1XMIA 4I6JA 4UFNA 3LPLA 2I29A 3EBPA 1EB8A 2X0NA 1ZC3A 3H4IA 5FF9A 5IVDA 5E6RB 3G1TA 3OH8A 1KI2A 3ASZA 1N7IA 4C6RA 1OA0A 4NDNE 4TTJA 1FP4A 4IFTA 3STYA 4HVTA 4EYQA 2OP0A 3AF1A 1TU3A 3ADDA 2G0TA 3X1MA 3I6QA 4UTXA 3OCCA 2PYZA 4XH9B 3ACDA 1P9WA 1XU7A 1E6KA 3SC4A 3GVPA 3T1YB 1AE1A 3Q9SA 5EN4A 1VHWA 3ZK8A 5E6UB 1U3WA 4HMQA 2VG8A 3PWTA 4RLFA 1RW4A 3ZPXA 3KAKA 3OICA 2I4MA 1N2BA 4HGOA 1RYYA 4L76A 4REMA 2QUKA 1X14A 1XE3A 3EDOA 3HCRA 5JXIA 1JEQA 3LZ6A 2R1TA 1GT91 1VJ5A 2G83A 3INGA 1GQFA 2Q4TA 1JSZA 3CVOA 3CLRC 3P32A 3WLHA 3T1TA 3L0OA 2FN7A 5A03A 4RGVA 3P4YA 1C0KA 2EC5A 2IOQA 4X65B 5BWOA 1Q3HA 2Q5JA 4FI3C 2VKTA 4ZQBA 1J0DA 1NV9A 3HY4A 3R8FA 1VBNA 1UOEA 2EARA 3ROTA 4RH1A 1CR1A 3KTFA 1NDUA 3UMVA 2P8SA 2HPVA 4R4JA 2ZBVA 1XROA 2EERA 5ALOA 2CNLA 3UJ6A 3KIPA 3VPBA 4E21A 5JMOA 1E92A 3KSZO 2WWXA 1XTSA 2WTEA 3NT5A 2W90A 4AW9A 2VRNA 3LBFA 3RBZA 1CZHA 3F97A 3UC9A 3BSWA 4J1NA 1IUNA 2ZS8A 4UTZA 2HMUA 3IPXA 3FRHA 3O8LA 3AI3A 1VGRA 2QT0A 4FFBA 5THXA 5AVXA 1Z0FA 4XM2A 2IBMA 3AINA 2RI6A 1Q7EA 2KLBA 4Z7OB 2W6CX 2QE6A 2G28A 4OKSA 2XNKA 2JAOA 2GAJA 3LGAA 1RKUA 5P21A 3I61A 3E2PA 1I24A 1EVZA 5A3SA 2QR3A 4YVFA 1MV8A 2Z30A 1H3EA 3VGJA 1GGKA 2FXVA 4QG7A 1CUDA 1FLDA 1ZONA 1PW7A 2Y1CA 4JITA 3RS8A 2BGWA 3HJUA 3ILYA 4WBXC 1VGVA 4AJEA 2GHQA 5A3VA 1S2LA 6REQB 1TM2A 5FTJA 1QANA 4OGGA 1BYUA 5AM1A 3F9IA 5AO9A 2O0HA 3OMLA 4QTXA 4TWRA 3O8OB 2YNMC 1VM6A 3ZGZA 4QEZA 1G9TA 3E9DA 1SD1A 4OF4A 3UK2A 4MW4A 3TG8A 4BQEA 5JD5A 1Y6FA 4JUFA 2R0QC 4E4YA 2FWRA 3R20A 4LK3A 4CF4A 3LLSA 1GVNB 5I4IA 1I8TA 4NZNA 4I0WB 5TMDA 3MPUA 1XEWY 2C7BA 4ZQFA 5WRFA 3OZFA 2IH4A 2JC3A 1K68A 3K2EA 1DCTA 2VAXA 2ZJFA 2BGIA 4PSCA 1KJIA 4BVFA 2V3CC 5IMSA 3TR0A 3TTXA 1Z6GA 3E9RA 4H4DA 4D5GA 1U2TA 1K5DA 4MVWA 4NV1A 4RPLA 3WI7A 4BNNA 4TL6A 3G49A 3THYA 5BSFA 2D59A 2E49A 3FZQA 3S3TA 4EA7A 4R7GA 4FLMA 2Q6VA 4QASA 1U80A 3BH7A 1KVUA 3Q0EA 3HMKA 3I6ZA 2HCJB 3TECE 1HQDA 4F2GA 2IT1A 4MJXA 3OLZA 2IXTA 2FJUA 2XNDA 4JFAA 5CVTA 2YJNA 4DA6A 3U4QB 1VJDA 3I0ZA 1RHUA 1P9NA 3ESAA 1CJMA 1HTBA 3G9UA 2VDQB 2I67A 4HDRB 4HQLA 5FBRB 4Q16A 4TZTA 1L5GB 1EM8A 3NDJA 3ZJYA 1H8ED 4MZXA 5LQUA 3R6WA 4KN9S 1PJSA 2P35A 4LOLA 3ESBA 2WSSA 4HSEA 5AKEA 4UBIA 4R8LA 5F98A 3TLGA 4A7PA 2XMZA 4QWWA 1P61B 2PEYA 3ASUA 3IYLW 4YLEA 1T35A 3I04M 2WJJA 2XB2A 1RE0A 4KQ1A 3SQOA 1Q19A 5F9FA 2ZUFA 1UP7A 1RXYA 2AEJA 1VKNA 3M3HA 1J0XO 1NXPA 4H1HA 4EY5A 2XUPA 4D9GA 1HDZA 3H8VA 1M1NA 3ZD6A 5JCZA 3IXLA 5ENVA 1KJQA 2O2JA 1LDEA 4GAEA 3CVVA 5AOBA 3TRKA 1J33A 2C2WA 2O2DA 2ORED 5FO1A 1FP1D 1QIIA 5LA6F 3DZFA 4WI1A 1YRYE 2H92A 3AI2A 4CKWA 1XPUA 3VHXB 1HXHA 4P81A 2FDRA 2WD7B 4KRXA 1JDJA 1JVNA 1TZMA 3K8YA 5ALEA 1JZSA 2XMBA 1TRKA 4JP8A 3NTQA 3RSFA 1Z9BA 5GAJA 3C16C 4PLCA 2BEWB 5LP6B 2B92A 2IODA 2WHYA 1IM5A 3CNBA 5HCNA 4ALNA 1T3LA 2YVQA 2EKDA 4MYUA 3N1UA 5JISA 4ENTA 4BMVA 2AKAB 6CHYA 2JAPA 1DV1A 2OCBA 3DWEX 4Q0MA 1RXVA 4CCYB 2HRQA 3KNZA 3PR1A 4IV0A 5ECGC 1OB2A 4RFSA 4BNDA 1E3SA 3P94A 1A5ZA 2BZ0A 3A8TA 5D6NA 2CV1A 1WF3A 1ZVMA 3S2UA 3WL7A 4W1RA 2Y76A 2XE8A 2HMTA 3DMRA 1SKUA 2XIJA 3TBHA 4ZAXA 1ZVKA 4PC7A 2LP4Y 3PU6A 3QPBA 3PXUA 3PXGA 2NADA 1SCIA 1NOIA 1TMKA 1HT1E 3ESXA 2O6LA 1NSTA 1YKFA 3NYQA 4UHKA 3UJ7A 1WMEA 4OG2A 5L7WA 2C9ZA 5F21A 5C5EA 3PXXA 1ZBDA 3LK7A 2DSTA 5B57C 4F4DA 3OZXA 4L22A 4AROA 2F3TA 2P5UA 2P6PA 2FCAA 4I1OA 4PZEA 3UJPA 1LUAA 1L8LA 3DTVA 4E3ZA 4AMVA 4G0NA 1SUDA 3BE8A 4ZQHA 1FNDA 2QTVB 1V45E 2IZZA 1TJ3A 1P7YA 4BKMA 1GN8A 1S8AA 2XKKA 1XCOA 4J91A 1PFYA 1IHPA 2AG8A 3T9FA 4H59A 1FQJA 4M2LA 5TPZA 3RUEA 5EUBA 2WYOA 3U6KA 5JXWA 1AUOA 4G2NA 4MJ3A 2FMXA 3JAKA 3W4KA 3C0KA 4F72A 3UWKA 3NEPX 2H2AA 3TOZA 4J3NA 3DEJA 7ADHA 1KPIA 1ZZGA 1P1HA 2FEPA 1TVEA 2JPDA 4N7JA 3HXMA 4DEXA 1NUHA 4Q4DA 1BOFA 2WHPA 3FWNA 4OBBA 4KO1S 4BJHB 5BSHA 1XPRA 3L84A 1PE0A 4KBYA 1DDGA 3I12A 4KREA 3PGKA 5D00A 1JDTA 2JCYA 1VMIA 1NRJB 2JANA 5FR1A 4F5DA 4LXTA 1AHIA 2XGMA 1ANKA 3JR7A 1YA4A 5LU8A 2LD4A 4D8XA 2P9TA 4ZVKA 3L6UA 1UFQA 3N2GA 4WINA 2C31A 3D7SA 4PG7A 1TVMA 4UBNA 4QQKA 1Q77A 2PH1A 5KVQA 3U7IA 2EDAA 3HB5X 3WJ2A 5ICEA 4HS4A 3DMNA 3V2IA 4HWKA 1LPNA 1H65A 2XB9A 2GMWA 1Q92A 1CUVA 2HA7A 4XWOA 1NMXA 2F17A 4JEHA 4P0TA 3TXYA 5CB0A 2P9YA 4R2WA 4Y2TA 1IB6A 1E1MA 1OVMA 3EXFA 4S24A 5CLHA 4YQZA 1JQ5A 3LCMA 1R3UA 4I9FA 4Y2GA 5AOAA 2GK6A 3N53A 1BMFA 1QGAA 2APJA 5CP8A 3UHFA 3WIDA 1SXJE 3K2IA 1N5LA 1Y6GA 1CEEA 4H31A 3CF0A 4XPIB 4ZWNA 4MUXA 1NNI1 2GLTA 2HLPA 4RK5A 4Z0HO 5CFNA 5HQJA 2ISCA 2NTYC 4DDMA 2YRFA 3LP8A 3MWEA 3DLIA 4JC5A 3WY9A 1YS9A 2IYRA 3FOAA 1G6KA 3IDQA 1WPGA 3SZ3A 3VU0A 1E18A 1UMDB 1LF5A 3B1XA 5DK6A 2B0JA 1MKYA 5E9AA 2Q1TA 2W6PA 1IZ7A 2C4MA 3ZX5A 3KOZA 2OKCA 4FNMA 1E2DA 2Y77A 4MS3A 4U7WA 5JJLA 4ASUA 4NCNA 3CRNA 1M67A 3FM9A 4MW6A 5ELXA 3GPCA 4MHSA 1OPXA 4CTNA 2N9UA 1WTAA 1GPH1 4U9UA 3PUHA 2OLKA 4CEJB 5AK0A 5LM3A 2RGNC 4PBRA 1H6DA 2RD2A 3HDJA 2PUAA 4ZKEA 3I4FA 5AKHA 2QVZX 5J4KA 3W3AH 3TSCA 2Q1YA 2VSXA 3RVSA 2JGNA 1TLLA 5B55A 2G9VA 1W25A 1W29A 4LQ4A 1JSLA 1KJ9A 1MAAA 2P69A 5EJGA 3OC0A 1TB4A 4B2IA 4RWEA 1RRGA 3FVQA 3HJGA 4RTMA 2BONA 2EW1A 2O05A 1Q1BA 3EJWA 2X5NA 1N5RA 4KN8A 1TI7A 3N5KA 2V7XA 1I10A 4F91B 1FL9A 5J2TB 4RZXA 4S1PA 1E0AA 3VSCA 2IP1A 4Q01A 3VYUB 3ILVA 4BO7A 2D7CA 4F38A 3IO5A 2FY8A 4H0NA 1DG9A 4P7FA 4RY9A 5HUHA 3P27A 4LRYA 2CMKA 5DEIA 5ALUA 3FGOA 5FTKA 1G3MA 1GYPA 3G0GA 3ISVA 2B8WA 3BHIA 2JGIA 2ZXUA 3LAWA 4JU8A 5DHAA 1RJ9B 3P0RA 3AOGA 3HB1A 4JQOA 4B3XA 5ALGA 5IAAA 2B7CA 3AVUA 5B3AA 4R7ZA 2GNAA 1C3VA 3ZJTA 1T4MA 4XUEA 5JEDA 1IE3A 3W2HA 1HYQA 4WXEA 4OL9A 1GQOA 2JH9A 1FUIA 4O0MA 2NZYA 2XYHA 3T6KA 1GA4A 1M6VB 5FBLB 4ZJUA 5FULA 3ZIAD 4ONEA 4ZHQA 1RRKA 2VUUA 3VO9A 1LLQA 1X92A 2KQUA 1XQYA 2IGBA 2R84A 2XKAA 4ENSA 4KR3A 3CKLA 1RJEA 4LSZA 1EJ2A 5SZHB 3ZVKA 1ODSA 1SA0A 2WSSD 4RBNA 4YALA 2F4VB 1Y1LA 1FDWA 3ZDFA 2GGSA 4DLAA 5BRAA 2I7TA 1Z37A 4K0KB 4R01A 4W5JA 4X9XA 5IJAA 5K2MA 5BY2A 4IIYA 4E5SA 2CK3A 1DBIA 1ADCA 3OETA 1NR5A 2KYRA 3DC7A 4I4TB 3FCAA 4M87A 1BIFA 1V1RB 2AL7A 2V9PA 2QROA 4YUWA 3MIIA 1NVAA 3QENA 4EJ6A 4EDFA 5FQNA 4PCUA 1R5OA 4PIMA 3KU4A 1FFWA 1SKQA 2O3UA 4GG1A 3I1YA 1GYRA 5D1HA 1VKJA 3E8XA 4CDNA 1HX7A 2G9ZA 3R0XA 5JDCA 4WZZA 1A2KC 1JH9A 3KALA 2D62A 4J0DA 3SKVA 1BQ4A 1NA5A 3AI7A 1VSQA 1ZSYA 3LBNA 4OQPA 4ZXPA 4X62B 4RS3A 4I55F 2R6R1 5EIFA 2BGLA 3HCWA 3HSKA 1DBQA 1C4KA 4GEGA 5A5GA 1CHNA 1PFKA 1VFPA 3KDAA 4DV0B 5EE1A 3OUZA 1Z17A 4B4VA 3E23A 4N0QA 4E03A 4CIAA 3WLKX 4KK3A 3Q8LA 2Q8QA 3FFXA 5NLLA 4G1BA 4XSHA 2OCAA 1KS9A 1NJ1A 4JA2A 2ZSUA 2FETA 3PCTA 5EZSA 2WSYB 5L6LB 1I1OA 3SMQA 3DWIA 2E48A 4EQZA 3R9XA 1N2EA 4KE7A 4R0VA 1XAHA 2RGYA 2RHBA 4WOCA 4URYR 4WZAB 1SIOA 1R0LA 3IXMA 4QIHA 5EWJB 5TC4A 3G5TA 1SXGA 5KJFA 1XZQA 1UFOA 4F96A 2VSFA 4OLFA 4ID3A 3ASVA 2CVHA 3M33A 3D2CA 5DASA 5L3ZA 1UBEA 2L19A 2LZ0A 4MEJA 3MWJA 3DYIA 5IH3A 4EJ2A 5JRZA 5K8LA 4I19A 2CVZA 4X45A 3UMFA 2Q2QA 3I53A 2ZYUX 2Y1OA 4QO7A 4MHTA 1WY5A 4LVNA 4RJKA 5TRTA 4BVBA 2O48X 4CG2A 1YL7A 4S1TA 5EVCA 4EY7A 4QPNA 4WDQA 2GB4A 2II6A 4L5JA 4Q1FA 2VS1A 4BFYA 1TEZA 3FTFA 1QCZA 5A9SB 3WO0A 1DCFA 4QOJA 2Y05A 5ITVA 3BK2A 4XIFA 1ZU4A 5IUNC 4JVMA 2A8YA 3Q7PA 4B8WA 4UOEA 5J2UF 1J5EB 1XKLA 1JDPA 3K6JA 3LDFA 2A0WA 4WCDA 4LDRA 3PPWA 3PK0A 3QWAA 3FX2A 5AJYA 1QH9A 1QRSA 2XJ4A 1TVKA 5HVNA 3HABA 1UWLA 3OP4A 4FDMA 5KYYB 2PKQP 2FEKA 1ZDMA 4H35A 1ZM3A 2G6BA 3SBOA 3CLVA 3P0IA 4B34A 1TYBE 2FZ5A 2FZ4A 1G55A 2AW5A 1RDFA 3LMKA 3NIWA 3FIJA 4PAQA 4POAA 4UATA 1B43A 1ECBA 3IMCA 2H3HA 4J16C 1N9KA 1T8UA 3FN4A 3F6RA 1OFUA 1ZVQA 1FA9A 1OFUX 3N75A 2NZXA 3W34A 3LY9A 3QBTA 5JNRA 3H9JA 1AKUA 4K03A 4CLRB 2GCOA 3N2ZB 3ROEA 3L7IA 3GD5A 3GX1A 4K2HA 4IIBA 3SEQA 1CQWA 3DP9A 2YS6A 1W73A 2SCUB 1XQVA 3MW8A 4U7TB 1ML4A 5DMXA 1MJNA 2CXPA 4LOAA 4D4KA 4AQ7A 4JYCA 2XLCA 1I51A 2E37A 3OKAA 3VAAA 1IJFA 4FOSA 2B4RO 4P4LA 5CFRA 2QMQA 2G5TA 3MG9A 2QSJA 2R79A 2V9ZA 1NKSA 3BD6A 3G9TA 5JEEA 2IHKA 1GEEA 3BRCA 3EZNA 1Q2XA 3BB4A 2PX5A 4WX2B 4XQCA 4OK5A 4CL8A 3MRVA 2K6GA 1ULTA 1ZH4A 3IBTA 3ZHBA 5IEJA 3F71A 1DX9A 1ZM4A 3O82A 2X6RA 2ZZNA 1JEYA 4E7OA 1SCQA 3MTGA 2W2LA 4OI2A 4OJKA 4H1UA 4X5OA 1IVYA 4OHOA 3KZXA 1G9XA 4TMZA 3LPDA 4UHEA 2ZOSA 3U0VA 2NXNA 1Q1AA 3C3MA 5JASA 3RIGA 3H83A 2VF5X 4ASUD 3FGPA 3CPJB 3FPAA 3HO8A 2J0SA 3IE1A 3L4JA 5KKCA 1P5HA 2P6UA 3BREA 1TMGE 2G80A 4LE2A 5DHQA 5SY6A 4JLAA 4K9OA 2P9JA 3I62A 1Z4MA 1KYXA 3L43A 2QN8A 3B1WA 2BFCA 4AJPA 2A5FA 1R6AA 5T6BA 2R00C 2YZKA 1COWA 4IVNA 3I37X 4GVXA 5LR6A 3RPEA 3C7DB 3V4LA 1D09A 2X7XA 3K6RA 5B37A 2F90A 5LUBA 3LLVA 3H1BA 1H1LA 1WV0A 2VUIB 1P4GA 2N1MA 2QN2A 2QRJA 3KSBC 2YOFA 4MGIR 3UUEA 2OBXA 3E05A 2G72A 4MZDA 5JPIA 4OH1A 4CKCB 4TXJA 3UW1A 4TROA 3ZQJA 3BCRA 1JRLA 1ID8A 4ZO4A 5C8YA 3NI2A 4R1PA 1XJ0A 2X3FA 1Z2EA 1ZGGA 4UHJA 1Q0PA 2HSEA 3HN6A 2XUIA 2W2XA 2OLJA 4JA0A 4RQTA 4KLRA 4X44A 3HP1A 5B53A 3RVBA 1EESA 2ZPUA 1UQRA 5TVKA 3L6EA 3PC3A 4MVCA 1E5QA 1WETA 3DBHA 4LTNA 4PRYA 2QR5A 4OAPA 4P83A 1AUPA 3WBBA 1PTJA 2W8BA 4K6CA 1R15A 1Y4AE 2AJCA 2O8CB 3FOBA 3PCXA 1OJ7A 3ZWNA 1BXKA 2OUKA 1LSSA 3Q2IA 2PFGA 3AFIA 2BMDA 1PP4A 1AC5A 2E0IA 3UYLA 1ZPDA 4CQLB 1XDGA 1A72A 2RHGB 2VDPB 2WJVA 2ASVA 2VH2A 3I2YX 5TQVA 1E1LA 1WXXA 4FGSA 4K3VA 4FNOA 3QXSA 2FLWA 2C2HA 3B6ZA 5K0EA 2XCIA 4CT0A 3GP3A 4TRRA 4F8JA 3S1SA 2ENUA 1W2WB 3ANTA 9LDTA 1EWKA 2XT9A 1V95A 3BRQA 4XRRA 3VTKA 2F43B 3K6SA 3TLKA 1FFCA 3ITDA 4NZPA 2BTQA 3CB4A 3HUEA 4YUYA 2QXTA 3EG9B 1IXKA 1MA0A 2CK3D 3QXXA 4GXTA 1TUBA 3CCCA 2BP7A 3RD5A 3RQIA 3WLRA 1CUHA 3TCXB 1DCMA 3O94A 2XMGA 2PFSA 2IPXA 1G5RA 1EDBA 3GAAA 4BO2A 1EINA 4GMXA 1VHJA 4DANA 2WHQA 1DT5A 1ZS9A 4CEHA 3QIVA 4Q47A 5JFGA 2X9LA 4ETMA 3DHNA 3QWFA 4YY3B 2P11A 1WS6A 2YYYA 1P62B 3WWZA 4ZZIA 3EXIB 1PL0A 4BNKA 4WTOA 1KERA 2AF4C 4QQFA 3DR5A 2IDKA 4GNKA 1YCFA 4F45A 4LK2A 1B42A 1YF3A 2NZ8A 4PEVA 2OXIA 2XZPA 2YJ3A 4M98A 3DXXA 5E3IA 3C7CB 2IHVA 3FB1A 2Y1GA 2ZYSA 3EGDB 3LYLA 4FU0A 4BGIA 4HN2A 5LUAA 4ZGGA 2IYSA 1EZZA 4XWAA 1ZMRA 1UK8A 3ZQ4A 1UEJA 2JD1A 5DM2A 2ZQYA 4CFZA 3QYFA 4YAIA 4CM6A 4CTMA 4N3BA 1ELOA 3S2GA 4GPEA 5DX1A 3WJ7A 5I6DA 3N8KA 4B35A 5CITA 4BU0A 4DY4A 1OU4A 2JHCA 1RBQA 4DCVA 3NOXA 4RQBA 5D3MB 1ISIA 4E5DA 3U5TA 5L3SB 3GP8A 1ADGA 4RTNA 2ZYDA 4AZ3A 3ENZA 1TPZA 4ON9A 5DI3A 4MQ5A 1Q22A 2GT1A 3M6VA 4ND7A 2VDMB 3AIMA 4ZTUB 4WA7A 1Z08A 4WZBB 5F2OA 1A1SA 1T9GS 3MRSA 4ARUA 4C07A 4E6EA 1N6IA 3PRYA 2Z08A 4PZ9A 5K6RA 2ODNA 3A3KA 1PI3A 3V32A 4MKRA 1RT9A 3SPXA 2D3TA 4X97A 1CY6A 3TEJA 3THRA 4J7UA 1EX1A 1SY7A 5K3EA 4DNOA 3OOHA 1P1RA 1H2RS 1UMKA 1ZIPA 4R68A 2VNAA 4DLPA 1BDBA 4D6XA 3H5NA 1HEYA 3UANA 2B1IA 3U1TA 4C4OA 1AS3A 3OD5A 1BAPA 2MSDB 4DA9A 1XBTA 4NMHA 3VKFA 5FL7A 2B20A 2Q62A 2C0PA 3H17A 1J8VA 2OG2A 1U3CA 2QJRA 2WZQA 4J6EA 3VX4A 4G0VA 2QW1A 4C7BA 1BN6A 3CUYA 1Y8CA 2VF4X 3PKIA 4LHWA 1IHYA 1MDFA 2JCVA 3PGXA 3JZAA 2VAPA 3KOWA 5E4YA 4YRKA 4N54A 1G2OA 1K89A 2QMOA 1PJTA 3EPPA 3EZYA 5FI3A 3WOVA 1H2AS 4HXGA 4WOPA 1KQOA 1ZJYA 5KS2A 3CE6A 3N0XA 1DRVA 4WD3A 2YZ2A 3OZRA 1N5DA 2IYZA 1D7OA 2VT7A 4JLDA 1XF1A 3DULA 5K0LA 4DRZA 5B12A 3PFKA 3KQNA 3DT6A 1MENA 3GEBA 5EUQB 4R2IA 1E4EA 1G8MA 5JOQA 4G1VA 1NVBA 1R74A 1SVUA 1YQEA 4O4LB 1N6NA 3KL2A 2UVPA 4A03A 1E9SA 4XVHA 5DYGA 2AFVA 2W4QA 2KB0A 4FFMA 4PQRA 2OUIA 4JDUA 5ALTA 3RHSA 3SNHA 1G38A 2CMDA 2O1SA 3L4EA 5L45A 2RHOA 3CX8A 4DUGA 1EP9A 2MSWA 2RH4A 1T1EA 5KYKA 2ZUDA 2GCIA 4FYVA 2JIOA 4FCWA 4QGGA 3ROMA 2HF8A 2BRUA 2D0OB 1KOLA 1CUIA 1CNFA 1F0NA 3DFKA 2AR0A 3VZDA 1JGTA 4GR4A 8LDHA 3ENVA 1ZD5A 4L15A 4CLOB 4D0GA 2OOSA 2AOTB 1POXA 1EFRA 2W2LD 5FAXA 3I5XA 2YY6A 3I9NA 4NXMB 1FP2A 3T0FA 2VPZA 1N0HA 2QM8A 2EYQA 2VDVE 3ESQA 4B7AA 5GJBA 3QFHA 1R37A 4XKJA 4Q4LA 2KBFA 4UM5A 2NACA 5EHXA 3BT7A 1JBQA 3P4UA 4BGEA 1BGWA 1MC1A 3GRPA 4D46A 1SVSA 4ZOCA 5CDGA 1WJGA 1PJAA 1WZUA 2NQ2C 1HE8B 2XVZA 1DTWA 2WPDA 5CPBA 4ZOBA 5I3CA 1CUZA 1PT7A 2FPKA 2F1HA 2VP2A 2ES4A 3KQWA 3NBXX 4TKLA 4W7IA 4ZV7A 4DDKA 3FMVA 4JMPA 4ITUA 4JIMA 3AR9A 3CT4A 2E1RA 1LBIA 4IKOA 1FP6A 5ERYA 1X9HA 2H9IA 4ZRDA 4ECEA 1OH6A 3IHLA 1EE2A 1XKTA 1SG0A 1MZVA 3HXKA 3K9QO 4NBUA 4MQFA 2VSNA 4MWBA 3DYBA 2DCUA 4QXPA 4LYAA 5FWXA 1OLXB 4H3KB 5J5AA 1SWWA 4AG6A 4C0AC 3CNOA 4JOSA 3PDWA 4FCVA 4IQ0A 5A5VA 1YQQA 2J0UA 3V7WA 3V4RA 1TAUA 2J1LA 1FS5A 3KKPA 2FQQA 2B4QA 3G5UA 1P33A 1UDAA 1QTNA 1Y5LA 4XWYA 3INRA 1M3SA 1SUCA 1MJGM 3VPXA 3PHBE 5A62A 4M8IA 3HTXA 1V11A 3ICWA 2WJIA 5FI0B 4DA7A 1R9MA 3BWBA 4XM1A 4Z2AA 3EZLA 4Q21A 3BFJA 4YJGB 2FMIA 2NX2A 5B64A 1T2NA 1KYIA 4D9KA 2GPTA 1B76A 1S2IA 1E2UA 3ND8A 1L7AA 1RAEA 1OZHA 2FX2A 4FT2A 5BRJA 2GZMA 2FXIA 1E1KA 1OCEA 1YU6A 4KXUA 1MTZA 1ZW1A 2VBIA 3AC0A 4P0QB 1EA5A 1MAVA 3PNLA 3OPQA 3EGOA 4MGHA 4DL9A 1AS2A 1XXHE 4OQQA 3R9IA 4PVDA 4CEIA 3URMA 3R09A 4XCVA 1OSNA 2E87A 1DG3A 1ULAA 2J3MA 2XJ9A 3RS4A 2H54A 2HHCA 1KAHA 3D0QA 4O0LA 1RPAA 2QVLA 3RKUA 1JQDA 4LMBA 4Q4AB 2CVOA 5LZ4A 1MPTA 3O0TA 2WTMA 4C1NA 2NVBA 4V1CB 4QVKA 5ITZA 5AMXA 1CRZA 1MR3F 1SCUB 4PO1A 4JY7A 1D2AA 4AJIA 4CNBA 3NHKA 3EE6A 3QEBZ 3BKWA 4RIIA 3AVYA 1CUGA 4KO2S 5JVDB 2O8FB 3GLHB 4BFSA 1QHHA 1QQ7A 1RYFA 4GM0A 3MCWA 4JS0A 2OC9A 1QBGA 2GA8A 5EPEA 4DQUA 2DUUA 1S9HA 2YY5A 5PGMA 3UWOA 1L7QA 4KLNA 4S04A 3HP7A 1ZITA 1G7SA 1Y4DE 4Q3CA 2NT3A 5BR8B 1D7AA 1YMVA 3DMHA 4ZT2A 3DBOB 2Q3BA 3Q8MA 5IKEA 3SVLA 3T9AA 1V8ZA 3L1VA 3KVNA 3WLOA 3OX1A 4NJMA 1JFSA 1XB2A 1GKUB 1GSAA 2B98A 2IHJA 4PV7A 2P1DA 3BYZA 4WAUA 1XLTC 4A9AA 1GQRA 4D9FA 4EHJA 1TYEB 3E3OA 2I7CA 3D4LA 1C0EA 2A4MA 3W8FA 4D97A 1RHKA 1T9HA 1GM5A 3G8BA 3PJRA 5IX8A 2Q28A 1ZRSA 2D7JA 3FXAA 4LI3X 2HIMA 1S3FA 5T4EA 4UMDA 2QQ5A 2OO3A 2RGXA 3NPAA 1GGNA 4D8YA 5HF9A 4NH0A 3BFVA 2I7XA 4DLZA 3R3XA 4RETA 2VTDA 5G41A 2Y0DA 4EELA 3P96A 4IKPA 3VMMA 4RK4A 5JQGF 4KVAA 2Y2VA 1RXWA 1RBYA 3HG7A 4GZLA 4LJ7A 4LF9B 1NF3A 1EFDN 3M4JA 4PINA 3ZNNA 5LJLA 4RTLA 3FPHA 2R1VA 2WSLA 4JL8A 1MGOA 1YZVA 4OXYA 2MR5A 4O2AF 2O4UX 3OHMA 4TRMA 3U7RA 2Q6LA 1GG2A 4BO8A 3Q2OA 4OXRA 2JZOA 4C04A 3VX3A 3FAZA 4JLKA 3DBRA 2QEQA 2FDCA 1GPDG 3Q85A 2OA0A 4PFQA 1NI5A 2BEKA 4JGGA 1F2VA 2AN1A 2VNJA 1FE8A 4CU2A 3R7NA 5LQDA 2YVAA 4MKHA 4MQ6A 2BDUA 4QECA 4GT1A 3CKYA 3SJUA 2VZ8A 4H4EA 1T9DA 3DFFA 1L4MA 3KHKA 3PUIA 5K01A 2EHJA 1IJKA 4CZ2A 3VI3B 2C8VA 3PZRA 2YV2A 1N2JA 4OQEA 1Z47A 4ZEWA 4GYKA 5E1MA 5FL7D 4DDTA 2E4UA 2G07A 2H08A 3VH2A 3RAJA 2ID7A 2NUAA 1J0AA 3P8ZA 3EY9A 3UK1A 4GBJA 5I7FA 2WWHA 4HNRA 5AVZA 4XIJA 4YGYA 2PGLA 3RUAA 4CGYA 7REQB 3A1CA 4FW9A 5FADA 4EPXA 4EW6A 2ZSBA 2J6HA 3H86A 1SM4A 4BLPA 1UM9A 1XD9A 1Z4JA 1EPUA 2FEXA 4H6VA 4UHHA 3S70A 4B2LA 5C46F 8GPBA 5I45A 4KXXA 4RSGA 4OXXA 2VQEB 1P9RA 1T0UA 2D1RA 2DWQA 2GM9A 2QN6A 1DAIA 1G5TA 3DXYA 2FSVC 2NQTA 3E3AA 4RHTA 3OF2A 5FHQA 4MVJA 1O97D 1YB5A 1D9XA 3LUKA 4A8JC 4ECAA 2I03A 1DLIA 4MUFA 5EMHA 1Z0UA 1C7JA 3KXIA 2DLCX 4CJXA 4WV3A 3OT1A 5E4JA 4MW7A 3IAFA 1UJBA 4RJIA 4M83A 3ZBTA 4QG3A 1WKBA 2Q3CA 5A0VA 2PU5A 1QHSA 1ZAYA 3CCBA 3T38A 3KQOA 4JI7B 3WP1B 1IBLB 1F4VA 2ZI7A 1KI7A 2JRLA 3R9KA 1MXHA 4CDMA 5IN4A 2PE5A 3B5EA 3G5MA 3GRYA 5K0NA 2VQ3A 3W2IA 2AIRA 1NF9A 2W6OA 1L7DA 4IXNA 3AUSA 1JFTA 1II8A 3M6UA 3TAXA 2E6UX 1REQA 3MS4A 1DNPA 3ND5A 4K9KA 1Y1TA 3LC2O 4ZYUA 4EJFA 5A4FS 1XWFA 4FYJA 5AVQA 2MHCA 4QTZA 1HYBA 1KJYA 2WIFA 3FR8A 3QWIA 4G0XA 4A23A 1YS1X 2AUMA 1J1ZA 1CW2B 1KYVA 2EW8A 3JPYA 3EEBA 4IIJB 4G4SO 5C4GB 4MQMA 4EG8A 4FPXA 1AXRA 1EFRD 5T67A 4R3UC 4EUKA 3DZJA 1QUEA 1WABA 5IJ9A 2H51A 1A88A 3EZ9A 1WZ2A 4ZCTA 4JLJA 1CY7A 1XZEA 3OZIA 2CT8A 3HL0A 1GPWB 1ECJA 4QHSA 2P5TB 3BCHA 1MO3A 3TJMA 4DJFC 5BR1A 3JQ8A 1PO7A 2WPDD 1HL7A 1X39A 4TGLA 4C14A 4D56A 3VR2A 1QH1A 4IFBA 4I50A 3I4LA 5FT9A 3U17A 1BA3A 3KQUA 5AXAA 2CY0A 3TR6A 5FTMA 5C4IA 3HYTA 4XARA 4JOCA 1R8QA 1YBAA 5SICE 1T5BA 5IM5A 3W7BA 2XTNA 3AONB 3AP3A 1K6JA 3REQB 5TPWB 3JZMA 4E30A 2H4ZA 4YQFA 1CRWG 1KWKA 3ONVA 4KIFA 4B4KA 5ADWA 1YGYA 1WB5A 2AZMA 4FDVA 1U8EA 1RACA 2BKLA 1E3WA 3MJSA 2FN3A 1HDXA 1Z82A 3TS1A 1U9JA 3KPUA 2Y4NA 2O8NA 3HBFA 5GONA 3L93A 2ACWA 2VNHA 3PPXA 1ZSNA 3W8NA 2FMFA 1K6XA 1U31A 1U2PA 1W76A 1I3MA 4UDNA 3MQ4A 2BFAA 1MAHA 2WU0A 2X86A 3G7NA 1LNSA 2W6QA 3IQHX 4YRGA 1C30B 3NATA 2VR1A 4LF4B 1FRVA 1BE0A 3VDRA 3WIOA 1H1DA 4KGZA 4OAQA 4UCXA 3BERA 5AUNB 1VPWA 2RAFA 1EUCB 1C50A 2NVWA 3IKJA 4ARCA 2HI0A 3D02A 1AGYA 1AZWA 4BEBA 1R1DA 3I8XA 3T3PB 4YP9A 1I0IA 4C88A 3RJZA 1CB7A 1RQPA 1L2TA 2DF8A 3D6UA 3OFVA 4NATA 4AUMA 4D4IA 5A6SA 3SHFA 3H11B 3H4MA 1SUSA 5FA6A 1JXQA 9ATCA 4JC8A 1IG3A 3IFSA 1KI1A 3OJ0A 4LJ5A 3KOOA 5E1BA 1XCMA 4XGQA 2PFKA 4GX5A 4ZQGA 3PIDA 4A4DA 1FUKA 4ZVUA 2ATCA 1CF9A 4BYMA 4XCQA 4OQXA 1G8GA 2VZ9A 1AN0A 2F9LA 3IR6A 5CVVA 3TI9A 1KIAA 5AHRA 1KDPA 1WHSB 4ZQIA 1RCFA 3RV3A 1U2SA 4M37A 2XITA 2FMKA 3OWHA 1AGRA 1U9YA 4N0MA 3BCSA 2JL1A 1DOHA 2IPMA 3P9PA 4Y6LA 4HTFB 5T3UA 2EGUA 3DOHA 1LBTA 4CV1A 2NO7A 3HWSA 1KJZA 1VBKA 4PHCA 3GBSA 1QRRA 1YB1A 5GZ1A 3LT4A 3PPIA 1R10A 1RLIA 3AESA 3QU4A 3FLEA 2NYUA 2OHJA 3JQ9C 3HYCA 5DIFA 1CG6A 3LSTA 1AY0A 1EFTA 4JB0A 1L4YA 2IUEA 4N49A 3A31A 2BBWA 4RKRA 3MHTA 2XXBA 3TW8B 4BXOB 4B4UA 1Z8NA 1YUMA 2P9ZA 3A25A 2HJ9A 4M9QA 1QQAA 2K4MA 2BM0A 1I3NA 4LXIA 1AMOA 3I0NA 2QD4A 4M0EA 4MI3A 1HNZB 1F2TA 1VPVA 3JD0A 4GBGA 2LCQA 3A4VA 1BQEA 3F8WA 2JIPA 3KSRA 3MMXA 3OZSA 1I6MA 4RAQA 1E6WA 3VC3A 3VR6H 2O7SA 2PMDA 4MLCA 4AYXA 1FFBA 1PFVA 4V2UA 2YINC 3VC2A 1O0CA 5HZKA 2WFLA 1DKUA 1T4GA 3D2LA 2ARKA 1EGAA 1AKEA 1XRSB 3M6MD 1I4LD 3GDOA 1YXMA 3Q3GE 4UJ3A 5G0SA 4B85A 5LZ2A 2GFQA 1I6LA 3DAHA 4FMDF 4RY8A 1DEAA 4RZQA 4UE3S 4F56A 5CD1A 2FSIA 4BN0A 2RH8A 4M8SA 4N6GA 1D6NA 1RP7A 4BZPA 2ZT6A 4JJFA 2YHUA 3SZOA 1FIUA 1FYXA 5KNLA 3LGXA 3BD9A 3FMPB 4EJ0A 4ZDIA 3R7SA 2YTZA 5A0TA 2G8LA 2WKWA 3U6BA 1SRQA 4H15A 1H4VB 4A36A 4GPIB 4GBMA 3MGCA 1FLVA 1O5IA 2QJOA 4HWTA 1NZJA 4QULA 1E6CA 2DVMA 3ICVA 3CVYA 4BAZA 1EWRA 4UC0A 2B9EA 2DU8A 3AR3A 2G70A 3IJPA 3EOBI 5DTJA 5EA2A 1EBUA 5EJ2A 1W35A 1NE7A 3UJ9A 3W2EA 5HRAA 4N4AA 1MVNA 3V1KA 1M5TA 3AEUA 4V24A 4JVNA 5CVJA 1V16B 5HE9A 3QOFA 3T7KA 4WKCA 2YIDA 2QF7A 1D1TA 1A7UA 2RG7A 5GGYA 2BV3A 2HBRA 1C3XA 4BO9A 5AJTA 4TTTS 3WB1A 4W5HA 3TGWA 5ITSA 2WM2A 3T5DA 1TJYA 1MVLA 2PHZA 3B6KA 2HADA 2ZVJA 4MQ4A 2JJMA 3U7EB 3C1UA 1ZUNB 5AW1A 1HDOA 2VO1A 4EUFA 4IJ5A 3IOYA 4X6UA 1KDOA 1UCFA 3FUVA 3PC7A 3X1YA 2J4CA 3D3JA 2F1KA 5EQJB 1SKYE 1YIAA 2CJFA 4KBGA 1HMYA 1QGED 4RE5A 4WJZA 3UH1A 3NUZA 2FEAA 4QTTB 1I1NA 4ZU6X 5IK2A 1PJZA 3OG9A 1RQRA 2XCQA 4AJNA 4A73A 4A0SA 4YMUA 1SBYA 5JHHB 5L4SA 2XCRB 3MTBA 1DO8A 3GA7A 5A4MS 3VR1A 5KIAA 1OZAA 4V0SA 3VISA 1S2DA 4Z0NA 3FNQA 4RDCA 1E5TA 2HIGA 3FLBA 5G02A 3M7IA 3ZC3A 4QFMA 7YASA 4L4ZA 3OZEA 4R83A 1QSGA 1WMSA 2G4LA 2NPIA 2P2CA 4JWKA 5EYPA 3LUJA 4X3CA 2VYNA 4C9BA 5C7LO 1NN5A 5AI8A 2DAPA 3IOCA 3KQYA 2XUFA 3LHKA 3QHQA 3HVIA 2B3TA 4AJOA 1NXQA 3EXAA 3ZWKA 1FW6A 2FEMA 2GHIA 4YRFA 5C1OA 3HKBB 4GRIA 2Q0XA 3KV3O 1IDOA 3CXUA 1IZZA 3ELDA 4ND8A 4ML3A 2EF0A 2WUDA 3IQIX 5IULC 4QGBA 4D45A 5D51S 3ELUA 2R5NA 3UB3A 1DB3A 1CK4A 2RB5A 1MMFB 3IVGA 4L27A 4RPCA 4MUGA 1JJAA 2C7GA 4INZA 3V8NA 2BKXA 2ZSJA 3KXKA 3PQ3A 4NSNA 1X7YB 2WWWA 2WYUA 1OC2A 1SOVA 2GXSA 5GJVC 1LDNA 4EF4A 2AFRA 4L2IB 4KN6A 3VM6A 2R48A 2Q0HA 2UYGA 4N5LA 2QK4A 5DYIA 1XTIA 1VG8A 2HQ1A 1E1RA 4ZOLF 2NMVA 4DA0A 1PLLA 1TYAE 1XAJA 5CG1A 3KJQA 3JR3A 1E5XA 5TVGA 5FBHA 2R11A 2JARA 1MT3A 1T15A 1Y8QA 1UBTS 3KJFA 3OQVA 4U7FA 5AKZA 3E53A 2QRUA 3TYXA