2OCLA

Crystal structure of valacyclovir hydrolase s122a mutant
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
254
structure length
254
Chain Sequence
SVTSAKVAVNGVQLHYQQTGEGDHAVLLLPGMLGSGETDFGPQLKNLNKKLFTVVAWDPRGYGHSRPPDRDFPADFFERDAKDAVDLMKALKFKKVSLLGWADGGITALIAAAKYPSYIHKMVIWGANAYVTDEDSMIYEGIRDVSKWSERTRKPLEALYGYDYFARTCEKWVDGIRQFKHLPDGNICRHLLPRVQCPALIVHGEKDPLVPRFHADFIHKHVKGSRLHLMPEGKHNLHLRFADEFNKLAEDFLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis of prodrug activation by human valacyclovirase, an alpha-amino acid ester hydrolase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Valacyclovir hydrolase
total genus 92
structure length 254
sequence length 254
ec nomenclature ec 3.1.-.-:
pdb deposition date 2006-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2oclA00
4BVKA 3W9UA 4ZREA 2R8BA 1XKTA 1ZI6A 4GDMA 4UFOA 4YPVA 3E1GA 1DX6A 2DQYA 3LP5A 3ZV7A 3K6KA 4CG1A 3PUHA 1BEZA 4KE6A 4J7AA 4BVJA 4KYVA 2XMQA 3RKSA 5IVIA 5ALSA 2O2HA 5EFZA 5A62A 4ARAA 1UFOA 1FFAA 1I6WA 2H1IA 3WJ1A 4F21A 1E8DA 4P9NA 4GBGA 3I2IA 3K2IA 5HF8A 4MEBA 2CUTA 3LLCA 3OOSA 4G9EA 4ROTA 5FV4A 5CH3A 2OXEA 3QMVA 1MJ5A 2PBLA 2OCIA 5E4YA 4UHHA 4MXDA 2OCKA 4BAUA 2HA6A 1G4HA 1JU4A 2HU5A 2ES4A 1QO9A 4H0CA 3WL8A 5CH8A 4X92A 3DOHA 3O95A 4FFVA 5J3JA 2AJBA 5K3FB 3P2MA 3T4UA 4Y2JA 5DWDA 4IH1A 5JD4A 4Q34A 1Y37A 2WU4A 4FNGA 4L3WA 5AI4A 3WQHA 2QM0A 2WJ3A 1ZD4A 1AURA 4PV7A 1CUUA 4NS4A 4X90A 1LPSA 1ISPA 2WHQA 4QDOA 5T4BA 1JKMA 3IDAA 2QMQA 3STUA 4G8DA 1IZ7A 1EINA 3V1MA 4OUKX 2Y6VA 4U2FA 1K4YA 1N5MA 4HXFB 3DDUA 5KWJA 1LZKA 1XZIA 4J0KA 5CT6A 4BBZA 4DLNA 3BIXA 1E89A 2O7VA 4LYEA 3WA6A 3LCRA 4HS9A 2GBIA 4LIPD 3D0KA 1AUOA 5A7GA 5LZ2A 3V9AA 3MUNA 5ALYA 4NMWA 2C5FA 1LPOA 2WLSA 4BTVA 2PPLA 3DQZA 3QVMA 4DTCA 1CQZA 3WZMA 1SCKA 1J06A 1IMJA 3R40A 4CI9A 2JGLA 1SFRA 5ALXA 2VT6A 3AZPA 1CUWA 1XZKA 3O9VA 3LIIA 4PSUA 3TEJA 2HU7A 1ORWA 1H2XA 4QZVA 1OILA 4C01A 1EHYA 5E4TA 5EIAA 4B84A 5DTIA 1EDEA 3VKFA 3I6MA 2XB6A 1JU3A 2V98A 3L1IA 4QNNA 1UOPA 1LPPA 2WFLA 5HF5A 5KBYA 4EB0A 3FCXA 2PX6A 2WHRA 4AXBA 1IZ8A 1YR2A 2V97A 2Z3ZA 3Q0TA 4AZ0A 5C8XA 4B9EA 1BCRA 2DR0A 4UFPA 1ZICA 1HDEA 1LPBB 4BDSA 1F0NA 3N2ZB 5LLSA 2Y2UA 3ZPXA 1SC9A 5FP0A 3R3VA 4EHBA 5DYWA 3L1JA 4AQDA 1C7IA 2WJ6A 3A2LA 2YH2A 4Y2QA 2XUHA 3S2ZA 1LLFA 3UUFA 2BCEA 5I8PA 1CUGA 4U2CA 3QBJA 2WHPB 3V1NA 5HQ3B 1MNAA 3KD2A 5ALOA 1FSSA 2OGTA 1SCQA 4I4CA 4PSCA 1W6RA 2OG1A 3G9XA 3FYTA 2PKYX 4YK7A 3BE8A 3ZLTA 1R9MA 1CUJA 1TCCA 1IUNA 1J07A 2XMDA 3MVEA 5LYYA 4C4XA 2GZSA 1XZFA 1L7AA 5ALLA 2DHEA 3KXPA 4F0JA 5JANA 3NGMA 2QJRA 5ALNA 4B6GA 2R11A 1D07A 3G02A 1HBJA 3OC0A 1PJAA 2BJHA 4PQEA 3WWCA 4WJLA 5ALMA 4B0PA 1QIKA 1RP1A 4G1FA 4W1QA 1QIJA 5AK6A 2DSNA 3CN7A 3IULA 5ALTA 4KE8A 4CIBA 3KSRA 5C8VA 2WTNA 1CUSA 2QS9A 3IUJA 1CPYA 1WCYA 3ILSA 2RHTA 1USWA 4W1RA 3WK7A 1BN6A 4XIIA 1VOTA 3LIPA 3ED1A 4C6HA 2ZSIA 5KWIA 1CUIA 3DKKA 1LZLA 2WIFA 5CW2A 4CCYA 3OM8A 3DCNA 3ESBA 4ZV7A 5LZ8A 2JGMA 1UT6A 4UPDA 4NZZA 4G5XA 4BCBA 1MX1A 2VTVA 4DMHA 5AI8A 3C6ZA 1G5FA 4OYYA 3V48A 1BU8A 2PVSA 3DYVA 4X93A 4H18A 1AZWA 3BXPA 3DNMA 3F9CA 2OAGA 4S0XA 4MEAA 3ANTA 3R3WA 2FUKA 5SYNA 1TK3A 3WIOA 2WUGA 4XVCA 3I6ZA 1P0PA 1W75A 6YASA 1VZ2A 3STWA 4MQMA 1Y7IA 4F5ZA 4Q3KA 4KAAA 5BV7A 3QPAA 3R41A 3EQ9A 3WLAA 1R9NA 3EIOA 2IX9A 3HJUA 1EB9A 5AM4A 4CCWA 2DFPA 3CXUA 2HRRA 2GYUA 4F60A 3B3QA 4RNCA 5AI6A 2CMFA 2HM7A 3JYHA 1CUCA 1BEEA 1ODTC 4V2IA 1UOQA 2XLCA 5DLPA 4EUSA 1H2WA 2WFMA 4RGYA 3AZOA 1CR6A 1MU0A 3DOIA 1RYYA 5ALIA 5AICA 5LZ5A 2CKMA 4FBMA 4QE3A 4CFSA 5AOBA 4WDRA 3QPDA 5K3FA 3H19A 4M0MA 4I19A 4X6XA 4QWWA 2I78A 2QXUA 1Y7HA 2H9YA 2VJCA 1EH5A 4W63A 4LHEA 5AKXA 1R3DA 1JJFA 5K3DA 3H2IA 3WKAA 3IA2A 4ITVA 1LPMA 4U2DA 4EY5A 1VZ3A 1QGED 3IUNA 2PSJA 3BJRA 5FXMA 3QYJA 4CG3A 1J2EA 1O6FA 4G9GA 1QZ3A 2WUDA 3C8HA 1DX4A 3FYUB 3C5WP 3DL7A 4U2GA 3G0DA 2JGIA 1GPKA 1MT3A 2I3DA 3CCBA 5HKBA 5FKJA 3SWWA 2C7BA 2VATA 1U8EA 4ZI5A 1E66A 1AQLA 2ZYIA 1TCAA 5BWBA 4IHAA 2HU8A 1EB8A 2LIPA 2XMSA 4WDQA 1GQSA 3HSSA 3KOOA 2XQFA 1FJ2A 5LIPA 2QOEA 1WPRA 1A7UA 1K8QA 3F96A 3VJKA 1DU4A 4E11A 2PSEA 1UWCA 4N8SA 4G4JA 5T4EA 4KRXA 4OSEA 4GW3A 5JIBA 1X2BA 5EGNA 4GECA 1ODCA 1EVEA 1K63A 4H7EA 4ZWNA 3A70A 3WWEA 1FFEA 4H35A 3I2KA 4FKBA 2WQZA 3B5EA 2BUAA 2QTBA 4UHDA 5HK9A 1ZIXA 4BZZA 3OURA 5AK4A 1ACLA 3STXA 3IUQA 4EY7A 2HA3A 2ECFA 2ACKA 4OU5A 4I3FA 4B81A 1WB4A 4DMCA 2WG0A 4X6UA 1LBTA 4QDZA 5HF6A 2Z5GA 2QVBA 2PSDA 2VAVA 5JZSA 3FOBA 1DWPA 5FLKA 4OYLA 2VJBA 3TJMA 5AKZA 1GPLA 3QPCA 4Q3LA 3VXKA 2ZYRA 2FX5A 3VJMA 3WWPA 4MQLA 1CUFA 1UK9A 1UKBA 5CT8A 4C88A 4C87A 5D6OA 4BP9A 2ZJ7A 2VT7A 3S8YA 2C4HA 1VXOA 2X8BA 2PM8A 4FBLA 4AO6A 1DQZA 4QA9A 1VJ5A 5IVDA 3UMJA 2HRQA 2HDWA 4M0FA 1N8SA 3G9TA 1QFMA 3FVTA 3KWFA 5AOCA 4G8BA 1UK7A 4E15A 4G4IA 3NOXA 2YYSA 5EHQA 2PU7A 2G4LA 3R3UA 4P93A 5AP9A 3FLEA 3G7NA 3W06A 5AM2A 2HL6A 4J0DA 3ICVA 1QTRA 1XRRA 5ALVA 1TCBA 4UBJA 4W1SA 1WB6A 3IVMA 5ALJA 3WWOA 2JF0A 5HFNA 3MGAA 2JEZA 1UKAA 3WZLA 4B7ZA 3SX4A 4B83A 4PNZA 4BP8A 1M33A 5LP1A 1GQRA 3O9MA 2ACEA 2QJWA 1YA8A 3PE6A 5AKIA 1EX9A 3WJ2A 3GBSA 4X7BA 1MN6A 2XUGA 1MX5A 2VJDA 3D3NA 2QT9A 3IBTA 2IIVA 4AN0A 3Q8WA 4MYDA 3PF8A 2HADA 3PI6A 2XMCA 5ALWA 1WOMA 3ESAA 5C8ZA 2C58A 1XZHA 4CIAA 3AILA 2ROQA 3W05A 2XLBA 4W1PA 5SYMA 5JASA 2Y6UA 3X3HA 2CEKA 1XZJA 3FSGD 3L1HA 2XMRA 2WJ4A 5AK3A 4LXIA 4AN1A 5JATA 4K6GA 3GUUA 1QIEA 2BKLA 3G0CA 1CUEA 1U2EA 2J4FA 5H3HA 3WKEA 2D0DA 3ZI7A 1ZGBA 2DQZA 1CRLA 4BDTA 4FMPA 2WSLA 4JUIA 1U4NA 5JAHA 4FOLA 4OD0A 4M0EA 2XUAA 3G9UA 4B82A 2VEOA 4J03A 3QMMA 1HKHA 5AKLA 4LXHA 1T2NA 1ZOIA 4Y2TA 1VA5A 3IIIA 4QLOA 1E5TA 3JWEA 2ZJ6A 2RGUA 2VA9A 1ETHA 4AO8A 1F6WA 3AUKA 3E3AA 1TRHA 1U65A 2IITA 4RE6A 2PL5A 2WIJA 3UUEA 4KJXA 1ZD3A 1QJ4A 5IH7A 3G0BA 3V1KA 5IKXA 2WTMA 1AC5A 4OPMA 2O7RA 5DJ5A 2QUBA 2PSFA 1ZJ4A 1KEZA 4DNPA 1CVLA 1THTA 4EA6A 4DNOA 5JZBA 1YS2X 3VVLA 7YASA 1R50A 1XRNA 1YSCA 5ALDA 1DT5A 2CB9A 4K5QA 4WCVA 5IVHA 4HXEB 1OCEA 3D5EA 4BAGA 1AMNA 2BGRA 4UBKA 4A16A 3QZUA 5K3EA 2ZYSA 3ZLUA 1EVQA 3FLAA 5D3ZA 2Z8ZA 3O4IA 2OPHA 1NU8A 3BF8A 3RM3A 2WHPA 3C5VA 5LKRA 1FFDA 3D2CA 3BIWA 3WI7A 1XKLA 2PSHA 1GKKA 5ALEA 2XMBA 3DLTA 3EF3A 1W1IA 1LNSA 2HFJA 3EBLA 3AZQA 3EQ8A 5A71A 3A2NA 4UBNA 4AX4A 2HA2A 2XUKA 4J0JA 3O4JA 1JMKC 4GI1A 2O2IA 1VXRA 3G8YA 3STTA 3V1LA 2QZPA 3VDXA 2QUAA 5F4ZA 5T4HA 2OCGA 1CV2A 4L9AA 4OB8A 3AJAA 4UBIA 4Y2XA 1EDDA 1XQWA 4GXNA 3I2FA 3HXKA 4QEKA 2OLEA 3SK0A 4B85A 1QONA 4C4ZA 3ESCA 4CCYB 4KEAA 4IH9A 3DJYA 2XQKA 5ISMA 4KR0A 4TGLA 5AK5A 4BVLA 1QE3A 1BS9A 3I28A 3GELA 2OGSA 2RHWA 4QDTA 2Z3WA 3TRDA 5DNVA 1A88A 3IUMA 5CXXA 2WUFA 4YX9A 5CT5A 2K2QB 1QFSA 5D7BA 5AO9A 1Q84A 1LBSA 4C4YA 2HA5A 4FLFA 2J4CA 3C45A 1N5RA 4N5IX 3WL6A 4RE5A 4OCZA 3WYDA 3I1YA 3WK8A 3FBWA 4H7FA 5ALPA 4N8EA 3RLIA 1JI3A 2WKWA 3WK9A 2WG2A 2HIHA 2Z8XA 3I2HA 4GEGA 2HHAA 4GHWA 1XZAA 4D9JA 2WU3A 3K9BA 1EA5A 4ZXFA 5HFAA 2Q0XA 3H18A 3C70A 2GYWA 3AIOA 3R3YA 5CMLA 4KAFA 1YCDA 3M83A 4FNMA 1VE6A 4U2EA 3ZWQA 2UZ0A 5AM0A 4DMFA 4KACA 4DYHA 3STYA 5E2IA 2XUOA 2WM2A 3QH4A 1GT6A 4PSDA 2RAUA 1IUOA 5CBKA 4B0OA 5JALA 3JW8A 5HQ3A 3D2AA 3EQ7A 4J3JA 5T4FA 1WM1A 3R3XA 2HFKA 3AIKA 3U1TA 5EI5A 1XFDA 1BROA 2QRUA 3DS8A 3STVA 1JJIA 5CURA 1W76A 1XLWA 4O08A 3LS2A 5AJHA 3O4GA 2VJAA 4IO0A 3WKCA 1XROA 4DGQA 3PDCA 2DCMA 1G66A 1SCIA 3CCCA 1QIIA 4BB0A 2GZRA 2DHDA 4ZRDA 2ONCA 5ALFA 1MAHA 3N0TA 3FVRA 5AKHA 4Y2VA 1WHTA 4G4GA 3C6XA 4J0IA 1G42A 3WK5A 1R1DA 3FLBA 2FJ0A 4AB1A 1F0PA 1TKRA 4IQ4A 3I2JA 1XRPA 3WIBA 2VQ6A 4L72A 2JGEA 1DINA 3DKRA 3M81A 4HAIA 2AJDA 3MUOA 1XRQA 4MYSA 1IUPA 4JNCA 2CJPA 1X2EA 4UHBA 5CT4A 2J3QA 3F97A 2J3DA 1P0QA 3FYUA 5EHXA 3RK4A 4LYDA 5ALGA 3DYIA 5HKAA 1PV1A 3CN9A 1XQXA 2XUDA 4H7KA 2JIDA 4UBMA 4ZV9A 4HRXA 4H7HA 4ARBA 1CUHA 5AKEA 4Y7DA 3PICA 1R88A 4HXGA 1BCSA 5EIEA 1VE7A 4UFNA 5C81A 1EK2A 4Y2RA 1GGVA 2BUCA 4EY8A 3FNBA 3G9ZA 1Q0RA 3BL8A 2HA0A 5AKKA 5I9IA 4K2AA 1QIMA 1VA4A 1QO7A 1UXOA 4H77A 3AIMA 1QIDA 5ALKA 2PUJA 1P0MA 2WG1A 4GWLA 4BTLA 1LPNA 2JBWA 2JEYA 1ZD5A 1XZEA 3ICWA 2GBFA 5CRIA 2V9ZA 1XZLA 1QLWA 2W6CX 1CFJA 2ZJFA 5AKJA 1X70A 5AI5A 1LGYA 3C6YA 5JADA 4ETWA 3I1IA 4WY8A 3FCYA 5DNWA 1CEXA 4BCDA 3D2BA 4EZIA 2RONA 5ALZA 3D7RA 1CUVA 4AMZA 5LKAA 3W2TA 4P08A 1UZAA 4HVTA 3GA7A 4J0HA 4XWGA 4DIUA 1JT2A 4OB6A 5DYTA 1K5PA 2OAEA 1JJBA 1JFRA 3H1BA 4DM7A 5FRDA 3QM1A 5JAPA 1L7RA 1W4LA 3WL5A 1MNQA 3WK4A 4FHZA 4X97A 2B4KA 5AIAA 4UHEA 4YASA 1GKLA 1QIFA 1XZDA 1MAAA 5EIHA 4OB7A 5FPQA 3WWDA 1WHSA 3BF7A 1XZGA 3H0CA 4A5SA 1ACJA 1ZJ5A 3HZOA 4A23A 2C5GA 4WFIA 3SC2A 3AINA 3D4LA 4JYPA 1VLQA 1XRLA 3HRHA 1O6GA 3BDVA 1LPAB 4K6HA 2ZVDA 1DTEA 5JAUA 4WFKA 3DL4A 1MX9A 2WFZA 4KAJA 2XUPA 2VSQA 1EDBA 3WKBA 4N5HX 2XQIA 1CIJA 2H7CA 5LZ4A 4Q05A 2B61A 1QIGA 4G8CA 5EHNA 2JGFA 3A2MA 5D3KA 3F98A 3KWJA 1AKNA 1BRTA 3HEAA 5AOAA 2D5LA 5CXUA 1B6GA 4E46A 5AKYA 3T52A 2EDCA 3H2JA 1ZIYA 5AM1A 2AJ8A 3DD5A 2JGJA 4FWBA 1UK6A 2GBGA 1TQHA 2XT0A 2B9VA 2XUJA 2I3ZA 3G0IA 1ZD2P 1WPXA 3H17A 3R3ZA 4C89A 2E3JA 2PU5A 4PW0A 3F67A 3OPMA 1YAJA 2Y2VA 1A8UA 1OXMA 2WUEA 2GBCA 4Q82A 2ORYA 4UHFA 5EHZA 3QMWA 3GFFA 1DQYA 5JYCA 5A7HA 4X94A 5BWCA 4UBOA 5KREA 4EY4A 5JZ9A 4Q3OA 1HPLA 4X85A 1UOOA 1YB7A 2G5PA 1DT3A 4AZ3A 2XUQA 5YASA 3FWHA 1E8MA 5CTAA 1CLEA 4DNQA 5DTJA 1GPNA 3ESDA 4DMKA 1XQYA 4X95A 1N1MA 5FOQA 4U2BA 4J0CA 1YASA 1P0IA 2BFNA 3O0DA 4H7IA 5I7UA 3WA7A 1Q83A 1AGYA 2AXEA 5C7YA 1TIBA 4HRYA 4CG2A 4BCCA 3E0XA 3R0VA 4WFJA 1XLUA 4QDUA 4BATA 4WY5A 4HTAA 2ZSHA 2RIPA 2VF2A 3PFCA 2FJPA 3HLKA 5JAOA 3WKDA 2WIDA 1QOZA 3C6BA 4ZGBA 5LZ7A 2W22A 4DNFA 1PFQA 5JD5A 1Z68A 3C43A 1W52X 1XZBA 2XUFA 1L7QA 2QXTA 2QR5A 2OGZA 5AI0A 5HZGA 4BZWA 4QDXA 1CUAA 2WIGA 4MWTA 4H7DA 4DSZA 1CUYA 1YAHA 4Y2SA 4BYMA 1UK8A 2Y1KA 4X91A 3HI4A 1QTIA 5HF9A 1KU6A 1KU0A 1C7JA 1WB5A 3I6YA 1R4ZA 4QWMA 1GZ7A 3QITA 4IH4A 1DWOA 2XE4A 3F8SA 4H7JA 2I03A 3H1AA 1ZI9A 1CUZA 1K6EA 2ZYHA 3FAKA 3PUIA 4E14A 1F8UA 4J0GA 4UUQA 3PFBA 4KE9A 1AX9A 5A7FA 2HA4A 3FSGA 1EI9A 3BWXA 1H2ZA 3HACA 4DSAA 5A6VA 1E8NA 4Y2UA 3DEAA 1XZMA 1C4XA 3VISA 1ORVA 4BE4A 1UKCA 4KRYA 4X6YA 5ALUA 2H7YA 4LXGA 2WIKA 2H7XA 5AI9A 1SOMA 2XUIA 5K5EA 3HYSA 1CQWA 2RI6A 4QLAA 4XJVA 5AKGA 2OCLA 3D59A 3PF9A 3H2GA 1Q0ZA 1THGA 1JMYA 1FFBA 5JARA 1H23A 3NUZA 1H2YA 3GZJA 4X71A 5ALRA 4K6KA 4Y2YA 2XDWA 4BRZA 5A2GA 1ZI8A 1XRMA 5JD6A 1CUXA 2VAXA 1HQDA 3BJMA 3VVMA 1RWQA 2DHCA 2XQGA 2C0PA 4GLBA 3OTQA 4N8DA 2CZQA 5E4JA 3C87A 3WK6A 4X00A 5K3CA 1T4MA 1HL7A 4PF1A 4Q1VA 3TGLA 1XLVA 4BC1A 5K3AA 2AJLI 4FDMA 1EK1A 2G5TA 3OG9A 4RPCA 1FFCA 3WYNA 4BC0A 4OU4A 2OQVA 1IVYA 2GYVA 1YA4A 4BE9A 5AH0A 5BOVA 3IB3A 5FUMA 4NVRA 1BE0A 5FDFA 5ALQA 4BAZA 4LKOA 4P92A 2V96A 5HK8A 3HC7A 3AFIA 3WMRA 5DNUA 5IVKA 4INZA 2YXPX 4FLMA 2NW6A 4TVKA 2WILA 1BN7A 5FPPA 4EBBA 3RARA 1ODSA 3M3DA 1XQVA 4AO7A 1NU6A 5CH5A 2WFLB 2BUBA 2BAGA 3NWOA 2CBGA 3H04A 1TAHA 2EEPA 1E3QA 2BGNA 4MJ3A 4AMYA 2X76A 3FYUC 3H2KA 3C8DA 3B12A 4JH0A 1EXWA 3ZLVA 4PO3X 4FTWA 4W9RA 4L0CA 1A8SA 4Y2PA 5LZ9A 2QKYA 5ALHA 1CUDA 2X5XA 4B80A 1B41A 1CUBA 4XX1A 4JYMA 3A6ZA 3M82A 4TPKA 1DWQA 5DYYA 4Y9SA 4MWSA 2YASA 4JEIA 2AJCA 2PUHA 3W04A 4UHCA 1S8OA 2HA7A 3VJLA 2XMGA 3E4DA 1NX9A 2XQJA 2EDAA 5ESRA 1QIHA 1MPXA 2O2GA 1YS1X 5AHXA 4B9AA 1A8QA 1MTZA 3W9BA 4EY6A 4X3CA 2B20A 2XMZA 1GXSA 3KDAA 3IURA 1HLGA 2OQIA 3WL7A 1XZCA 3GROA 1YB6A 2G63A 5AIBA 2JGKA 3ANSA 5HCUA 3HABA 3G0GA 4HZGA 2C0QA 3I2GA 1MO2A 1H22A 5K3BA 3O4HA 4BRSA 5CT9A 5AM5A 2P8SA 3U0VA 1ZGCA 3YASA 4UBLA 4FLEA 1J1IA 3BDIA 2XI4A 4Z49A 1VKHA 5AM3A 3H2HA 4FFWA 4KE7A
chains in the Genus database with same CATH superfamily
1AKEA 4JHLA 1N5JA 1PQYA 5CYFA 2KLBA 2FEOA 1SXGA 2ZYWX 4RPHA 4BJ1A 1PG0A 3AETA 1TOAA 2Q2QA 3S2SA 1JHMA 1REQA 3LHDA 2H92A 4JUCA 3CKMA 4UFOA 4C30A 2OENG 2C7PA 4FYXA 4X24A 2DQYA 4LRYA 4E4TA 4B31A 5A4KA 3ZV7A 4PWYA 4DPLA 4IOJA 4CG1A 1BEZA 3OMWA 5AJYA 4BO3A 4KYVA 2XMQA 4RTKA 2YWDA 3EGEA 2Y93A 1G8KA 3ROKA 2O2HA 3FNHA 2G1UA 3DBRB 4BO4A 3RRXA 3CXRA 4CT5A 2FPMA 5A62A 1GGNA 1AB5A 3AUUA 3DEIA 2FPSA 1Z73A 5AW5A 3C6MA 1V1RB 2I22A 1ULAA 2AFHB 2F43B 1JVNA 4WY2A 5DF1A 2COKA 4JHXA 3UCEA 2W2QA 4JGBA 3MCAA 3K2IA 1WTCA 2B78A 2J0UB 2R60A 1X0VA 1GLGA 2PBFA 4K3UA 4AI6A 1Q5PA 2AUTA 1ZNWA 3JQCA 1H2RS 1KERA 2HTFA 3PZRA 1N6RA 1UMCA 1V41E 2R6JA 1IQRA 3LLCA 4FEYA 4G9EA 3DV9A 3DVQX 3MBOA 4OIFA 2GO1A 5CH3A 5L45A 2Y05A 1JQJC 1IHUA 2PNJA 5EERA 3LHFA 4G0XA 3QK7A 4KXFB 2OXEA 4XQGA 2PZEA 3WIUA 2PBLA 4YQZA 4Q4DA 5I9BA 2OCIA 2OCBA 5F76A 3U2QA 4UHHA 2I7VA 4WXEA 5DRTA 3I4CA 1H9BA 3SI7A 1NJ8A 1G4HA 5BNIA 4GSKA 1V8ZA 4S0ZA 2ILTA 3VZBA 2YNMC 4Z4EA 3IKMB 4YMSA 2ASEA 2MR5A 2QPAA 5HRCA 2HJWA 2FWAA 3GEMA 1VCNA 3BA6A 3WL8A 2FDXA 4L6AA 5TS2A 1A9SA 3DBRA 4ZAVA 1QGUB 4YRPA 4XE5A 5I3CA 1S7CA 1UDWA 3FTQA 1ISGA 2YWBA 3EUWA 3O95A 1X42A 4MUYA 3SYNA 3WGGA 3MWKA 4GZ5A 3UHFA 3TR5A 3G82C 4XXHA 3PHCA 3EZ9A 4PFKA 4KN5A 5DVZA 1KDZA 2NXJA 5DWDA 4IGKA 3FMPB 4LJYA 4CN9A 2JLXA 1D1QA 1B4DA 3IPRA 4LY9A 4GG1A 3EJ6A 2WU4A 3RSQA 5E1OA 4Z0PA 3SE7A 4EGSA 3AT1A 5AI4A 4XASA 4ZKDA 1AURA 3BSYA 2X8LA 3RRMA 4HMOA 3N6XA 1H3FA 1CUUA 3AY0A 3BHJA 4UMEA 1KFJB 3GJYA 3KT6A 3NBZC 4AJJA 3B1WA 4CW7A 4NFSA 4AS3A 3P26A 1FCJA 2MJLA 2YZGA 1SPXA 1TVMA 4NNPA 1R5NA 1N7GA 1PIWA 1I3CA 3D6TB 3ILVA 4FUQA 1FNMA 1E3SA 3C5HA 1W4BA 4GOLD 2VBGA 4AY4A 5T4BA 2MYUA 4EG0A 2X2EA 3BMCB 1Q50A 1Y9DA 1Z7EA 2QMQA 2VC2B 4NU0A 5EG5A 1JG6A 4P7GA 5AMXA 3HNPA 2J6CA 1EDZA 3D9QX 2Q46A 3BJZA 3I04A 4DQ0A 4AJ4A 5E6RA 4IDAA 1CIVA 1XZIA 4J0KA 4MRSA 5CT6A 3L0IB 4CQJA 1UANA 1TJNA 3F4BA 4ZJUA 3LC7O 3O8DA 1VL0A 4WXRA 4MRNA 3SQXA 4DLNA 3SJBA 3TTVA 1C3OB 2GPAA 4A27A 2ONZA 5LYJF 1CETA 3EH2A 3QWFA 2IU6A 1NZDA 4TYQA 5EIWA 3BCHA 4EHDA 2NXEA 1TECE 4KVAA 4LW8A 1L4NA 1C3VA 4LYEA 3SEFA 4KRFA 1P1JA 3KJQA 3IVAA 1K75A 4HH0A 2Z08A 4HS9A 4NBRA 3O8QA 1IEXA 3IJPA 2E9SA 3FN4A 5FADA 3T7IA 1OGIA 3ZWMA 5EZYF 4J2OA 3AKYA 1PHPA 2X7HA 2UVQA 4BNFA 3CZ5A 5GINE 1RRCA 5FBRB 2AUNA 2OG2A 2Y1WA 3V9AA 1WUIS 2G0NA 2I3AA 2NUAA 2YRFA 2H2FA 1GLVA 2HSWA 3O1HB 4IEFB 3A6GA 4NMWA 4WQMA 3NAZA 4B3CA 1FL9A 2SECE 3UMSA 3KYBA 1A8PA 5KHLB 3SQDA 5TE9A 1XEWY 1ZBQA 2PPLA 3PDWA 3NG1A 1S1CA 4WNIA 4AUEA 3OP4A 1SCUA 4KPUB 4WWHA 1SHUX 3ESYA 1CQZA 2P5TB 4RULA 3WZMA 4W7SA 1SCKA 1J06A 2FMKA 3R0ZA 1IMJA 2WJHA 4KN6A 4BMCA 4DRZA 4EYQA 1WZ2A 1IN1A 3ZBUA 3OPYB 1Y9ZA 2EJVA 2ZJ1A 2C98A 2G77B 3DWFA 4MW9A 4RHTA 2PLAA 5TLSA 2D8AA 3CPEA 1ZGJA 4Y2HA 3DEYX 1ISSA 1SUDA 4FEAA 3T9BA 3JAMA 1MC1A 3BH7A 4KNWA 1EBUA 2COEA 4IF4A 4JR1A 4LTDA 4WN3A 4H08A 3ONVA 3RHFA 5ICMA 2IHJA 1CJUC 3LIIA 1VPTA 4Z1MA 3GA0A 2GFQA 2HU7A 4RK4A 4YROA 2VO1A 2O5EA 3I83A 1Z8NA 2QZJA 1M0WA 3R6LA 1G3QA 4BVFA 3C7KA 4XYEA 1DKPA 1U81A 2NUBA 1EHYA 4AROA 4XSVA 5E4TA 5KOYA 3T5CA 4K1XA 1EDEA 1M0SA 5IJ0B 4IXWA 1GPMA 2EG9A 2RHOA 2F64A 3JQBC 3QA3E 4Z2YA 1WS6A 1JU3A 3CVOA 3OZIA 3L1IA 4MWCA 1OT5A 4O2BB 2BKUA 4ZZ3A 4AQ7A 3RAFC 3SZOA 4G41A 2C20A 4QNNA 5DNYB 1UOPA 1X8KA 4Z0NA 2J0SA 3KAPA 3SNKA 4HV4A 1LPPA 1TT5B 1E2EA 1MGPA 1TC2A 1Z35A 3EASA 3M6LA 4EB0A 5KBYA 2PX6A 2WHRA 3DFUA 1C7QA 2WF7A 4WKGA 1IZ8A 4QUKA 5JJBA 1YR2A 2V97A 1HE3A 2H2GA 2QL5A 3FRHA 3GT4A 3GUHA 3HB0A 5FWDA 1BCRA 3ETJA 3V5NA 4ZI7B 5C8XA 1ZICA 1BOFA 2O23A 2PD4A 4HN9A 1U0GA 4G5QA 1JAZA 2OM2A 4JWKA 1LX6A 1KZGB 1V5FA 4FGWA 4LRWA 2JIOA 3PC3A 1T5IA 3N2ZB 5AK0A 2D2EA 4NQZA 1WP4A 2ATVA 3NHJA 4NEGA 2IQIA 5CJPA 1IYZA 1W59A 1QPGA 1KXJA 2JAHA 1GOTA 2QR3A 2ZSKA 3FCSB 4NJMB 1SHJA 1RQPA 3R3VA 1EZ4A 4BB9A 1GA6A 2O52A 1T9GS 3WSTA 3EZGA 4EIWA 3DOFA 2G25A 3OEED 1H42A 1QMPA 4ENQA 2F17A 4RHXA 4F96A 1PLJA 1PKEA 2R6CA 4ZO4A 4CM4B 1SOUA 2NO6A 4WNYA 2X8WA 3X1DA 4LC9A 3A2LA 1EESA 2JJ2A 3U26A 3B52X 1FPMA 4JJKA 2NP6A 1T9DA 1LLFA 3DWEX 1F3LA 3PNLA 3S2ZA 3ANXA 3UYLA 1E4OA 3EIUA 2FY8A 3A25A 4NF2A 2ZBFA 4PQRA 1CUGA 3A9RA 2W93A 3HBAA 1K6JA 2OLKA 3QBJA 4EEZA 5ALOA 5KYUB 3WOVA 3UB4A 1APBA 2X2OA 2BEWA 4GPBA 4I4CA 4RHEA 3PFKA 2GM4A 2OG1A 3JAWA 4D79A 2IXEA 1GTZA 3GP5A 1MDFA 3C74A 1S89A 3BE8A 4WVFA 4Y6SA 2VK1A 3R8XA 1OZ0A 2YHUA 4PZAA 2VHVA 3GRFA 5KHAA 5JFTA 2KMLA 3ITNA 4F3YA 3NORA 2H4HA 4L5AA 5LYYA 5B6JA 1OLXB 2WKQA 1NOKA 3IR7A 5TF0A 4ERXA 4D4KA 2ATCA 5PGMA 4YR7A 4OLHA 2J33A 2QRJA 4YNBA 1R12A 4CDNA 5JANA 4XM2A 3NGMA 1JR3E 4DMRA 4B6GA 4YUZA 1RKXA 3ETCA 1UT5A 3LQRA 5BSFA 3GRUA 5J63A 4BU1A 4RC9A 1CJBA 2ZI6A 1E59A 3LPDA 4GOJA 2Q1YA 4Q1CA 3QLEA 3V8NA 1XMJA 3IS3A 5FR1A 1NV9A 3OC0A 3VKWA 1YS6A 4LMPA 2BJHA 3T38A 4WJLA 3VPCA 2C2HA 5PNTA 2CF5A 4ZVMA 4KDFA 1PNQA 4UM8B 3PHGA 4F8YA 4A6PA 2ZWVA 4CZ2A 2ZTLA 2ZM5A 5I7VA 1BDIA 1ZGAA 3E3NA 1RP1A 4K05A 1AB6A 4P80A 3T1YB 1FZQA 1N0IA 2G4CA 2QMHA 3AF0A 4EJ0A 3PLAE 2E1RA 1V7QA 3R8FA 2GLUA 1IY1A 4ZI7F 4YDSA 2B8JA 4KE8A 3KSRA 4JXXA 1Z7BA 1SD2A 1QQAA 4EUFA 5CA1B 4NCAA 2GAOA 3FWKA 3K05A 1SULA 5F3DA 2VP9A 2Y0PA 3FNRA 5T7BA 3BZBA 2VH5R 2D0PB 4EJ6A 4IPTA 4J29A 3P9SA 4C43A 2LZ0A 2QRVB 2V4ZA 1K8ZB 3GVCA 3E61A 2XIJA 2QTMA 3GLKA 1NN0A 2VPQA 2NNWB 4WMLA 1TQ4A 4RTPA 5E8RA 3FCEA 2C4MA 2V7VA 3VKUA 1SCJA 4W1RA 2HQ1A 4IAOA 3BC1A 1SUEA 1UPCA 1YBAA 4XZ3A 1IOZA 3HYCA 4OO3A 3WK7A 3RC1A 4IJMA 5BRAA 2Z6AA 2YYZA 1Y98A 3OJWA 3JQFC 5GVRA 2WUWE 2R96A 4BV9A 2GZHA 4PS0A 4ER3A 3AW8A 3SC3A 1GCUA 3A1NA 4XIIA 3K6SA 3BWCA 1NBME 1WQ4A 4WGGA 3I32A 4MVJF 4DSOA 1DJPA 4RL6A 4YI3A 2I7DA 1DDOA 3HYRA 3PNQA 4RYDA 1I01A 3UAYA 3V7FA 3WRWA 4JYZA 4P7FA 4C0JA 4W5NA 1SBTA 5SICE 4YRBA 2UYCA 5DBFA 2R9VA 2BFAA 4AJ1A 1P29A 3CX7A 3GNSA 4JX8A 4BFZA 5FOWA 2J67A 5GWXA 4RK7A 3ETHA 4M1YA 3HKCA 4ZT5A 5FLYA 3ZY2A 2B3DA 4CCYA 1ONNA 1VIVA 2H1WA 4ALMA 5FL3A 5EJ5A 4X54A 1AUQA 2HUPA 3D4BA 1RI4A 4GZ6A 3VSBA 3PJRA 2G6TA 2JGMA 4R8MA 1AXGA 2XT6A 1ZGGA 3HCPA 3K8ZA 4UU7A 2CHGA 5DI9A 1QC5A 5JZOA 2G9ZA 2HNKA 1IM5A 1YKSA 4WACA 2IA5A 3GRVA 1RJGA 4AWXA 3I12A 2F7SA 1ULZA 1U9CA 3FUVA 4LRQA 4YAFA 4U7HA 2IK8A 3CGGA 2RAFA 4TTTS 5AHRA 4MP3A 3HCNA 1A7JA 4Z5XA 3JD2A 4EG3A 1U90A 1UWLA 2HI0A 1G6HA 3QW2A 5FWNA 2ZVJA 3ISJA 4XGQA 3V48A 1KYVA 1BU8A 1NOIA 3DYVA 3VNAA 4AP9A 4CMGA 2FWNA 5CDFE 3ASZA 2JCGA 2QVGA 2Z1MA 1F8YA 3IQWA 3OT4A 2CJWA 3DZFA 5E7MA 1ZGHA 3VTZA 4YDQA 1D6SA 2JAWA 1Q3HA 3C97A 4ISCA 2FK7A 2JK0A 5TMBA 1LDNA 3GJ4A 2N46A 3OPYI 4UXIA 1RABA 3FRIA 4CU2A 5G1OA 1Q11A 1KY2A 3AC0A 2GKOA 1J8DA 1M8GA 3HWSA 2AX4A 3RJ5A 4E22A 3Q98A 4R0NA 3U7HB 3GP8A 1P5FA 3T9CA 4AY6A 4XVCA 2B8NA 2P30A 5JCOA 4UM5A 3JD4A 1TMYA 1PO7A 4QKQA 4ZN6A 1P0PA 1U3FA 3K1TA 3TVDA 3ZGNA 1P39A 2AG0A 3QOYA 3WWYA 4GXRA 3O8BA 3ZX5A 2OBYA 1E2LA 1IWPB 4FYJA 3SDBA 3STWA 1ID1A 4I66A 4MQMA 2HX1A 2H6EA 4Q3KA 4Y6GB 5IC6A 3V80A 4J0EA 1SWWA 4KAAA 5BV7A 3QPAA 4TV8A 2IP4A 3PWKA 2BEJA 3H86A 1Y1LA 4IXMA 5A2QA 3MTAA 1EM6A 4DDHA 5KQSA 3SM3A 3UOGA 3WLAA 1Z7GA 1LVUA 2WAMA 3MFQA 4MW2A 4D99A 3Q8MA 5H82A 1G8HA 3OCCA 3W5UA 2IX9A 3DZHA 1AUXA 3HJUA 3WWZA 1Z4LA 1SO8A 5AM4A 3EULA 2QLTA 1G5RA 1ZD8A 2QRZA 4DIKA 2HRRA 2VP3A 2GYUA 3HADA 3H9UA 4ILEA 1EZ1A 1WUHS 4V2IA 1PZEA 1DIAA 1YVEI 2G5CA 4TMXA 5JSKA 4EUSA 1X80A 3P2YA 1GRCA 4C0BA 1Z6ZA 3CF0A 2PXXA 3EAQA 1RYEA 1II0A 1QDUA 3SXUB 4J76A 1KRHA 2HK7A 3KOZA 1T2UA 4R3NA 4C0HA 1E18A 1E4EA 4ARCA 4G85A 1RYYA 2G7ZA 3REFA 5B2EA 3PNOA 4JXZA 5ALIA 1G8SA 1YHZA 3EG5A 2G1PA 2OYCA 2FQ1A 3GU3A 4XQEA 1KSGA 1SXIA 4CFSA 4TV9A 4AG3A 1UEXC 1DCKA 1YL5A 3SAJA 4Z53A 1ZHOA 2Q27A 4L6CA 4I6GA 4AKEA 2H1FA 3U0BA 4RKYA 1XCOA 5A9RA 2Z98A 1NPYA 1G9TA 1LCIA 4H16A 3AHCA 1PKXA 2XYQA 4Z4GA 4KNYA 4O2AB 3A7DA 3JSXA 4EF4A 4ZMRA 1DAGA 1XR3A 3A4NA 1NM5C 4LTMA 4F9TA 1VKJA 3HKCB 3K5PA 1U3TA 3VC2A 4ZTZB 4YQEA 4FT2A 3FTCA 1K89A 3A1DA 1IDOA 2I78A 3OIWA 3T7CA 2I99A 5KWSA 3HVKA 4HBGA 5K3OA 1OWOA 1Y7HA 2D13A 3CWQA 1I3LA 1GYPA 1UDXA 1VGVA 1ZNYA 3FNFA 4TKVA 2YIJA 4M0DA 2VJCA 1EH5A 3LI2A 3IOBA 4G0OA 5CM2Z 2ZTHA 2FHSA 5ANRB 2XEXA 2RI0A 1DJNA 3KK0A 1JJFA 1N33B 3H2IA 3NEYA 1VJ0A 3E0QA 3FHLA 1DG9A 2IZZA 3QOWA 1ND5A 1LPMA 2J46A 4RZUA 1VZ3A 4U2DA 5LQMA 3UXEA 2Z3VA 1WA5A 1AD2A 2RHHA 4FN5A 1SKYB 1M2VA 1H1LB 5BURA 4D5GA 3QG1A 4M9XA 1Q6ZA 5FXMA 3ZZ1A 5HHTA 3Q5GA 3H8JA 3QYJA 2OZVA 2ZRDA 4LF7B 1J2EA 3FE2A 2H5JA 1V43A 1SVNA 2H8GA 3D6JA 1QG6A 3AVXA 1XN1A 1TYBE 4PLPA 1QZ3A 4KK4A 2DOKA 4KXWA 1FDVA 3DOOA 3RQSA 4AJNA 1DX4A 2FQXA 3D8TA 3ZV3A 5FNVF 5JS8A 2F67A 1JW9B 3PQEA 3BTOA 3MIIA 3TD6A 2W0SA 4V1CB 5AVZA 2J3KA 1U3CA 3VR2A 3CF4A 2JAUA 1RAHA 3VNSA 5LOVF 4UEWA 1GPKA 5DDIP 3RK0A 3QTLA 4AYWA 4NS1A 3D5QA 3RE1A 2EQ5A 4HEQA 2VATA 1F5NA 3NBAA 5FH9A 1H94A 4ZI5A 1WXFA 1E66A 2QLNA 2CYBA 2J09A 4NH0A 3ZIDA 3MQFA 4JOCA 2GTIA 2WW8A 3JQAD 1RXIA 1VG9B 2GTPA 4L76A 3UJBA 5BWBA 2E4XA 4EARA 2HT1A 3OE7A 3IQDB 4A1FA 4LFAB 1C80A 3KYCB 2Z2YA 2C5LA 4HLUA 2HU8A 3OLVA 4BE7B 1OFVA 1EB8A 1HZZC 1WPQA 4XIGS 1PQ4A 2GN4A 5EJEA 1FDIA 4WDQA 5JNWA 2JD2A 1X74A 3HSSA 4KPFC 4UU8A 2ZZNA 3KOOA 1FJ2A 4QFDA 4F5YA 2QOEA 1E7SA 1DRVA 1SKUA 3AY6A 1NW4A 3BX1A 1ADGA 2SKDA 2BGUA 1E6UA 1D2NA 2W58A 4MRPA 2BMEA 3PDIA 4EJFA 1JWBB 2R7AA 5BNFA 5CEJA 3GK3A 4N6OA 1K8QA 3SXPA 1SOWA 1ZG3A 1E63A 1ETUA 1NVDA 3DT9A 4OP1A 5JAZA 1YE3A 4GMXA 4F8JA 3RRNA 4YP0A 4DCCA 1VG0B 1JG7A 3OEYA 1IAQA 3ZVMA 1G3MA 3ABQB 3I9V1 3G85A 1J25A 4O4IB 1ILWA 4LPSA 2JEOA 3IBFA 4OHOA 1NVXQ 4V0LA 5A4FS 1VL5A 2AEMA 5L6MB 2VZEA 4KRXA 5DRYA 2R8PA 3VUEA 2E0IA 3AEUB 5JIBA 1CYDA 2QN8A 4EITA 5IWAB 4DR3B 3UGKA 4LJ5A 5KKAA 4YMGA 5KOJB 1X7YB 5EGNA 4OQYA 5GMOA 4D0LB 1FLNA 3E9DA 5LL6P 1D6NA 1AGPA 1UBOS 2WR8A 1GFZA 3BDAA 1EVEA 2FEXA 3WGQA 5HKKD 1IE3A 4A36A 4FEEA 4H7EA 3HHEA 3A70A 4ZWNA 5JUWA 4DDMA 2XCOA 3DEKA 1U2ZA 2D54A 4IDPA 4NOJA 3VR6D 2FE4A 3B5EA 3H9JA 4KH0A 4EWLA 4ZHQB 8ATCA 4BP1A 1T4DA 2DX7A 2EWWA 2D1FA 3FCCA 4XFJA 3F3YA 3I1FA 3OURA 5LQCA 1R6XA 1PK7A 3TZEA 4K0KB 2WDPA 3L7IA 4RTJA 2R97A 3DFZA 2WNHA 4A0FA 4AT1A 2DVMA 1H2BA 1ACLA 1TT5A 2XWPA 4EKGA 3F4LA 3U3RA 2VA8A 9MHTA 2FQYA 4H1TA 2ACKA 4ZD6A 4OU5A 3TLJA 1UBMS 2NVUA 5G41A 2GEJA 4B81A 5B7NA 4D25A 1U3UA 1NLZA 1UJ5A 2CL0X 4QAJA 3VH4A 3LYLA 4X6UA 2B69A 2FRDA 2YXLA 3X1KA 5CCXA 2XVZA 1VKNA 1QXSA 2A67A 4NBTA 3KSDO 3IT2A 4YJGB 4GLJA 1Z47A 3D6UA 3PFGA 1X39A 2QVBA 4D8UA 4OOFA 4C4RA 4HGQA 4QJIA 1W2HA 2QUJA 2F8LA 2IE8A 1FU8A 2PWBA 3DVLA 1DX9A 4GOND 4JUFA 2OD2A 3EVBA 3S44A 2GBPA 2HHCA 3MHTA 1C9KA 1Z18A 2QTVB 5F1OA 3ZD7A 4PRZA 4WZBB 3FF4A 3VXKA 2ZYRA 2I54A 1I0IA 5IAKA 1KYTA 3L5KA 1VIDA 3VJMA 3W5BA 1D2AA 5BUQA 1JV2B 3Q11A 4D9CA 1UKBA 1IUKA 2O2CA 3H6HA 2ID8A 3HQ4O 5KCZA 1TUIA 1KZ1A 3ONNA 3C16C 4DLSA 3CMMA 3CB4A 4RY2A 3FI0A 2M1ZA 2GEUA 3MXTA 2JGNA 4FFLA 2GD1O 2I9PA 5BSEA 3ZJTA 2ZKLA 2C5EA 2OPBA 5L3SB 4IDDA 3E9NA 2C4HA 3NBYC 4H7PA 2JJYA 3NCTA 4RW0A 1NT4A 1LK5A 3N8HA 2ZJ8A 4KU4A 5ER6A 4XWWA 5IP5A 4CKEB 2H2IA 1PX0A 3UTCA 1IZZA 3HA7A 3IVXA 3OHPA 1JHYA 3C3YA 4PLCA 1NAIA 2XODA 5FI3A 1DQZA 2YHAA 5BQPA 3AH8A 1QDLB 3N0RA 4HVAA 1V4VA 1W36B 5HRUA 2HDWA 4IX1A 1D2GA 1QRSA 1IOWA 1U0SY 4IJKA 4IJ6A 2MYNA 5JSZB 1NXQA 2J5QA 3U4QB 3IEVA 4C21A 1HYEA 2OCDA 3BD6A 1Z5VA 3VI4B 3HBJA 3PVSA 4X7RA 5LOVB 4E15A 1YJ5A 4HOYA 4ZZ1A 2GK7A 4EKIA 1B42A 2VDNB 1U0JA 1DKOA 1R74A 3OOHA 2PU7A 2ATIA 3HY6A 4M1TA 5FNVB 1BFUA 4PO1A 2IYEA 3PWZA 2Q50A 3W06A 1YUMA 1MB4A 3BRCA 4ZYXA 3RFXA 3ETDA 5LJLA 2QI9C 1GUYA 3TLKA 3NHUA 4ARZA 4W5QA 1YFJA 3U40A 3PKZA 3CX8A 3C41J 3QLVC 5CIQA 3PWSA 3ZWNA 1QFJA 1JPNA 1ABFA 2E18A 4UBJA 2LVBA 4ZT6A 5CLGA 3SR0A 2P35A 1DIRA 2J5RA 4CMAA 3J7AC 2UXBB 4EENA 2BI4A 3MF4A 4JASB 3UK0A 5KVCA 3QA9A 1E64A 3BXHA 2YINC 5LNK6 3GZ4A 2AXNA 1Q1BA 3WLQA 5A3JA 3IPXA 1Z4IA 2A1UA 1K08A 1SIWA 3IOCA 1VPLA 4MA5A 4EHJA 4OGFA 2HWKA 3SX4A 1Q74A 3DDZX 3H4MA 1TIKA 4W7IA 3WGLA 4PNZA 4N7RA 3QUTA 4RADA 4WLFA 2YJZA 1PZXA 2O06A 1OLSB 4GC5A 3OA2A 2ALJA 4HPWA 4LDZA 4YAGA 5KOJA 1HFEL 1A4UA 3GRZA 4GXQA 1ZCAA 1ZQ1A 4BIIA 1PS9A 1UMDB 3O9MA 2ACEA 4R05A 3S2IA 2QJWA 5AKIA 4NFLA 3K9LA 4FIZA 2YY6A 2E55A 3I9MA 3CLUD 3K31A 3WJ2A 4BFSA 4QEZA 1A0OA 1T26A 1TU4A 3GBSA 4C0WA 2YQZA 4Z4IA 1TQ6A 2D3WA 1G20A 1MN6A 3OQ1A 4X7BA 1L8AA 3SP1A 3U39A 3WXBA 5GJBA 4BNDB 5LQRA 5KX5A 1M34E 2YQ5A 4PTZA 4Q3NA 3W5CA 4ZOAA 4R2KA 1W85A 2IIVA 4M8LA 4MI6A 4R7GA 4AN0A 4QC2A 3QFTA 1R2QA 1TFUA 2RAPA 3BE5A 1BKSB 1UDCA 5JJCA 5BVHA 5ITZA 5DTEA 1V3QE 2XXBA 2A0KA 2C58A 1QZUA 1YE5A 2HPVA 3CR7A 3N0XA 4G01B 4MRAA 3VR1A 2SBTA 1SM4A 2FKNA 4CIAA 1GVNB 4CIXA 5IKMA 1OX6A 2HIAA 2VRCD 3WLPA 2HLDD 2ROQA 3W05A 5JXJA 3FPAA 4ZVOA 3DH0A 5EIOA 3HKBB 1RM0A 4PN3A 1TLFA 3DNFA 1W29A 2VTKA 4G5OA 4IINA 4YAEA 5SYMA 4DZTA 5ESWA 4GMFA 2QAGC 1GAJA 3SBOA 2FKAA 4E5MA 1W0JD 1E9BA 3NNNA 1C1DA 5BV1A 1E2PA 3SJZA 1NE2A 3G8AA 4RTNA 4EBFA 2UXCB 2QTZA 3ABSB 1Z16A 3EY9A 4E5VA 2XMRA 2WJ4A 2ZAGA 4IR7A 4LXIA 3GPLA 4FW8A 1JFTA 1CLUA 2ZBDA 2Q5CA 4GLOA 1X92A 3QKRB 3G0CA 2FLWA 2ZT7A 4BO1A 5JAIA 1WV0A 1O97C 4BNNA 2AZ4A 1NI3A 2J1LA 2FDCA 2AUMA 2O8EB 1U04A 2J4FA 1R9GA 3DF7A 4LZJA 5H3HA 3H8VA 1M1UA 3RJTA 3RPEA 1LWOA 1QX3A 2D0DA 1OBHA 2P5YA 2CUZA 1FTNA 2RB4A 1UC8A 3A4YA 2DQZA 3IPLA 3O4VA 4TTVA 4BDTA 1G8GA 1JG3A 4OHUA 3K1ZA 2WSLA 5TPWA 1I3KA 5JAHA 4OQFA 5JISA 1HT2E 3OH8A 2R8YA 1WKVA 3DFIA 3OQHA 3PU6A 4G84A 4EHLA 1QH1A 1NHGA 4R0VA 3U49A 1K66A 1T2FA 4PONA 2CT8A 3G9UA 4G0UA 4I5FA 4WEQA 4FW9A 3LC2O 1WDLA 1FDUA 2K2WA 2WHYA 4Q7JB 3WMEA 3WLNA 2IYPA 5AQEA 1TXGA 1EX7A 3MYRA 1ZDMA 1ATZA 2P4HX 4IY1A 5AKLA 2GILA 1T2NA 2JFZA 2R7KA 1H1LA 3VSCA 4G1MB 3WX0A 5CVTA 4JI4B 3UAZA 1OFUX 1FJHA 4MYCA 4NP6A 1GZ4A 1ZSYA 3O4FA 1NVAA 3OZFA 5AUOB 5BMVF 1KFEB 2VJPA 2XWQA 1PR2A 4QLOA 3FPKA 3UK1A 4MGHA 5IKPA 1KC1A 2YWGA 2JI4A 4KLRA 5JAQA 1NLUA 3K72B 2VF7A 4B17A 1YBFA 1I32A 2H9AA 3LJKA 5EKSA 3ZIAA 4CL8A 1RLTA 4KYUA 2H3HA 3SBDA 3U48A 5JQGF 4D9EA 4MVJD 1MEJA 1EFPB 4H0NA 1A9OA 1EP2B 4UE6A 5EKDA 1IM2A 1M34B 1RP7A 2NSHA 3Q15C 2RH9B 3WLKX 4F85A 1U9JA 4KJXA 3USCS 3RLFA 3CH4B 5IH7A 3D1JA 4CQLA 1NFRA 3VHXB 1W36C 2MSCB 3VZDA 2PJZA 1CJSA 1A27A 3CTPA 3SC4A 4HNGA 2EX0A 5KEIA 5IYZB 3HG7A 1E2GA 1Y6ZA 2GESA 2ZSJA 3NT2A 4K8RB 4DEXA 1FTGA 2JFOA 3ML1A 3S2EA 2QF7A 5COBA 5FFMA 1D8AA 1K6MA 1XTUA 3O3OB 3ET4A 2AKEA 3TQIA 5JS2A 2P6NA 2X4DA 2YZMA 5AUQA 2BE7A 4JCCA 3H6GA 1N0WA 4LBZA 4NYJR 1XNJA 1UKZA 5FTNA 2MMGA 2O8DB 1FFGA 1ZJ4A 3HDTA 3LOQA 4QHSA 3R9IA 5F2KA 1XMVA 4DA6A 4E5YA 5KPDA 1UQRA 4WASA 3LGAA 1GU0A 4DNPA 4UDYX 3F5SA 4EA6A 2QTFA 2O8CB 3ROFA 3PQ5A 2Y0DA 5CB4F 2CHVA 3V3KA 3MUFA 1B6TA 1W8DA 3VVLA 3RIEA 4CM3A 4JJFA 5BO5A 4PC2A 2A30A 1VLMA 5JY1A 2YQ4A 3RVPA 2B98A 3PIIA 1YSCA 3I5XA 1VBNA 3I39X 1VBKA 3MWJA 5ALDA 4K5QA 5E0OA 4M53A 1YMUA 3UICA 2CXPA 3D5EA 4KTVE 2GEDA 2M2IA 4C4OA 1I36A 3GHYA 3TM4A 1RQGA 1OU0A 4NAUA 1L5SA 4M0LA 4JLNA 4NZPA 1WKCA 1N2BA 2Q2NA 1T5OA 3CU5A 4Q6BA 4BASA 1XALA 2PV0A 3GNLA 2FSHA 4GPZA 5K3EA 3H1PA 2Y1GA 2JLZA 1SXJA 2V5VA 3GJQA 3Q3GE 1GYRA 5BSUA 2WAOA 3WNVA 3AR7A 3U6KA 4YQFA 4MULA 3GJRA 4M76B 3UHOA 4AY2A 3O4IA 4RVCA 3Q6NA 3DPUA 1KAOA 2HZ7A 4BV3A 4QGSA 3RM3A 3A31A 3S1SA 3SZLA 1K9SA 2PR7A 4KFSA 4Z9AA 1FFDA 3D2CA 3BIWA 4QECA 4I4NA 4EPWA 5L53A 3LKZA 1JDSA 5TR9A 3IEUA 2VTBB 3UAXA 2BYTA 4C9BA 3WP0A 5LUBA 4DCSA 1S3IA 1OW3B 4FGUA 3UHJA 5A4IS 2XMBA 2HMUA 2VDMB 4OBBA 4UEKA 1IY9A 2GK6A 3KSUA 1KI9A 4LHWA 3QSYA 2IXDA 1J00A 2HFJA 5H1YA 3TGLA 2GWRA 3EQ8A 1YQGA 3N7UA 4YXFA 4LJRA 2WP8J 4AX4A 1E5DA 2F3SA 4UNIA 4DCMA 1YRQA 1ZM4A 2FF5A 4HDOB 2OL4A 4NABA 4UTXA 4RENA 2QQ5A 4BBAA 1JMKC 2O2IA 3E05A 2QZPA 4O8CA 2X4GA 2BSQA 3EWSA 1I51A 4EO7A 1ZUD1 1WW2A 4ZO6A 3H99A 5T4HA 1S3GA 3ODGA 2I55A 3E7FA 3AI1A 3TI9A 1E94E 1OIXA 3AJAA 4UBIA 3TLZA 1MUUA 2L19A 2BEUA 3HM2A 3I5UA 3GQVA 5SV2A 3K0SA 1N7HA 3BB3A 4LC0A 5KJCA 1A50B 3I2FA 4IRXA 3UG6A 2VPIA 1H8ED 3GVPA 5ABPA 4DDTA 2N3ZA 1ZZEA 4Z0HO 1NX6A 2JBAB 3PGLA 1H9AA 1ST3A 3JWIA 2B8WA 4YJ2A 4RZHA 2CMHA 2XNKA 1UP7A 2SCUA 3NOVA 4KR0A 4US1R 2BBTA 2H4YA 3C8MA 4ITRC 4BVLA 1QV7A 2ZAOA 3EAGA 1U1EA 4HX5A 2R1VA 3B3AA 1C14A 4TSRA 3RYIA 4DLBA 3OX3A 2CLDX 4UUOA 2OE2A 2QD4A 4EJSB 1AM4D 1PGJA 2CFTA 2E4VA 2JFPA 1JXMA 2X4LA 3GELA 4FONA 3SLKA 4QDTA 3ZQUA 4BMOB 1TZCA 1A88A 4FDVA 1W93A 3KXLA 3II6X 1SC1A 3TLBA 1NXVA 4W4TA 3PHIA 2I1WA 2PZLA 4QBHA 5JDIC 2LCQA 1DAMA 2CXQA 1YMVA 4IV0A 5D7BA 5KNBD 3H75A 5AO9A 3G1TA 1LBSA 1Y7TA 2DECA 2O2SA 4QOFA 4X8HA 4PAOA 5HX7A 2AOTB 4IRUB 1GNSA 1Z5WA 1FBNA 3C45A 5L3SA 2BEVA 5FPYA 2DT5A 4DV3B 3I6IA 3RYHB 3LX4A 1F2TB 2CF6A 4ZOBA 5LCXA 4P7KA 3WYDA 1BH2A 4HWOA 2QE6A 3E9EA 3RIHA 4FMBB 3K0BA 4PC3A 1L7NA 1TJPB 1L5KA 4CG0A 1IN4A 1IJEA 1WKBA 5ALPA 3L40A 3K9CA 1X1RA 1T4GA 1GG2A 2WD7A 4Q18A 2XOXA 2R44A 1RXUA 4TQ9A 5A6SB 4OAQA 4X3PA 2RBKA 5CFRA 1J56A 1TCUA 3GLTA 3CLUC 2CVOA 3GGDA 1JI3A 3FMGA 3WK9A 4NATA 4DA0A 2HIHA 2QYSA 2WP0A 2WJWA 5BQFA 1ENYA 3HU5A 1EG2A 4ZQEA 4GHWA 1XZAA 4G0QA 4Y2GA 1ABEA 2WU3A 2FK8A 1CERA 2KHZA 2P9ZA 5DZSA 3UGTA 3VBEA 1ZJWA 1KL7A 1J8VA 1YS7A 1NOJA 1YFKA 1RM4A 1EA5A 3ZW8A 3IE0A 1O5TA 2CL6X 2OXTA 3ILHA 4ZXFA 3SYKA 1UBRS 1C3LA 2Q0XA 1PQWA 4CLXA 4DKXA 4ENTA 1SA0B 2I3GA 2DPGA 1BHJA 1X7XB 3AIOA 1ZD1A 1YMQA 2FE1A 3KEQA 4NZOA 1CJKC 1J0BA 2Q5IA 2XD4A 4Q02A 2PKQO 2EXXA 3L4KA 5CXSA 2NU9A 3TD2A 3UWDA 1YCDA 2FN9A 5IM4A 2IPNA 4KL8S 3WLMA 3ANNA 5IVPA 4MKHA 1F1JA 4BNVA 3UKOA 4A2WA 3WBKA 4IG4A 1F8FA 4IMPA 5G1PA 4UW9A 4MR9B 2H0QA 2PO7A 1MXHA 1WLYA 3PQ8A 3K2EA 2BM1A 1EK6A 1U2GA 1GT6A 4QPNA 4BXOA 4PSDA 4QAQA 4D2IA 1RFGE 1JAIA 2AMYA 1MOPA 2HF9A 4OREX 1FTWA 4JQCA 4MUNA 4OK5A 1CNMA 4ZQCB 2V6JA 3RSGA 3AHHA 3CVXA 3LA8A 4NEQA 1F2UB 1IEWA 4B0OA 5JNRA 2GB4A 3JW8A 5FHRA 3TNLA 3ON5A 5ECYA 5JALA 1KZYC 2DBQA 4Q9DA 3WWEA 3DMYA 3QSGA 4J3JA 5T4FA 3OWXA 5CVJA 3G2QA 5C9ZA 5H9VA 2CFIA 1GILA 2IUFA 4L4SA 2H4JA 4RVGA 1TZ2A 3COYA 4WAUA 1YR9A 4N3NA 1PSDA 3EVDA 3SBEA 3PPVA 1PI3A 3V34A 3HPQA 3AIKA 2J9YB 1EJ6A 5EI5A 1NAHA 3RU2A 3EZ2A 1U7ZA 3O75A 1DAIA 4QU9A 1N8NA 1H2HA 3BGDA 4HO1X 4K9QA 2CK3D 3AG6A 4O08A 3AHIA 1JECA 3LS2A 3LMKA 5FWYA 1E4YA 5AJHA 3O4GA 4TUYA 2QE7A 3LGSA 3PEWA 2Z8YA 3BK1A 3MCWA 3Q6MA 2P1DA 4DGQA 3D1LA 4RD0A 3PDCA 1MW9X 2DCMA 2H3EA 4R7ZA 3KUUA 1SCIA 4RLQA 1FX0B 4BB0A 3BFKA 4LE2A 4Q3EA 1A77A 5GGXA 4DV5B 1QTQA 1ZMXA 4YRLA 4E51A 1PUJA 3OLXA 5KC9A 3N0TA 3FVRA 3MD9A 5AKHA 4DA8A 3QNMA 4NOLA 2EKZA 3C6XA 1G42A 1OI2A 1WMEA 3GGSA 3IP8A 4LG1A 2PL1A 2ZQZA 3A9CA 3FLBA 3IYLW 2FJ0A 4AKHA 1PSWA 4H4CA 1KMHA 1F0PA 3UJNA 2VP2A 3OCWA 4L4YA 4RDHA 3R7NA 1S2NA 4V1CI 2P27A 4DB2A 1HDZA 3AEKB 5CDTA 2AI3A 2BHTA 1NBWB 3X0DA 3UV3A 4EPXA 5GIPE 2X0EA 1XRPA 3BH0A 1UMCB 3I8OA 5EP1A 1A95A 1CZUA 1Z0JA 1RD4A 1XZQA 3EGVA 3OD1A 1T3GA 5FPTA 1PYDA 1T1EA 4WKBA 5DXJA 1QE5A 4C5BA 5E7QA 2LGJA 4NLLA 1YS4A 4NONA 2CVFA 5E2AA 2UYYA 1XCPA 2XDQB 4CM9D 1KMNA 4W9NC 2O19A 4GR5A 1ZN9A 5BW6B 4JNCA 2WSIA 2FWRA 3A6LA 3VVCA 3B13B 5JBNA 3HMKA 4IXNA 4IHJB 1UZUA 2C8KA 1XIVA 4LZWA 3RYFA 1X13A 2HBRA 3KD3A 5D84A 3R9WA 3HXOA 1P0QA 3AR9A 1DV1A 1LQ2A 2GBLC 2BM8A 1ZEMA 3FFTA 2AF4C 2ERCA 1Y9JA 4UASA 5TB5A 1HYQA 4RKQA 2JLWA 2KS6A 4NAHA 1CFZA 5IJ9B 2BZ0A 3AV0B 3FYUA 1JILA 4EYSA 5BRJA 1RTTA 1ZM9A 2JA1A 4LYDA 4MI1A 4R9RA 3DYIA 3DO8A 1KR5A 3W6NA 1V25A 4BMYA 2XUDA 2NO9A 1JDPA 3N2NA 1IZ0A 5MFPA 3AHFA 1NUTA 4RXTA 3UXHA 4IOLA 1ZH6A 2IUYA 4AY5A 4XM0A 4ZV9A 2VAMA 2ZB4A 4PFJA 4ZMSA 3TOXA 3ZE0B 5E1BA 1RLMA 2LDXA 2DM6A 4GYWA 2I4MA 3WDMA 3PE4A 1CUHA 3PNBA 5DHFA 3FSRA 5J2UF 1GV1A 1OZFA 2BFDB 2AFVA 1XMXA 2F6RA 2WMOB 1E6LA 1R88A 2FZCA 2AF3C 1IAVA 2HD4A 3N59A 3PICA 3RSSA 5B5SA 4II2A 3RWBA 1I9GA 1KBQA 2EFYA 1DC7A 3QJYA 3RRFA 1C2YA 4MS1A 3GGOA 3ZDBA 4UNPA 1G6OA 3KC2A 2REQA 1D9ZA 5DO9A 5EA2A 3NMUF 2VHXA 2P78A 1XPUA 5C81A 4U3JB 1GGVA 4Y2RA 1V48A 1RPAA 1DE0A 1ZC4A 3L5OA 4ZVSA 5HDBB 4BVGA 4BBJA 1GNLA 4IQFA 1OGJA 1UM9B 4A8JB 5B3JC 1JWLA 3PB3A 4EB6A 4LF4B 2FA9A 3EYWA 4JI2B 3AM5A 3TSYA 3IIEA 2EHDA 2QA5A 3GD5A 1P0FA 3MWYW 5AKKA 4KW7A 2R4UA 1XDUA 1EWTA 3DPSA 3KJXA 3TIGA 2V9CA 3VZSA 3F6PA 1IPEA 5L3ZA 3UENA 1CRPA 3OQVA 1UXOA 2CEAA 2NZUG 1CCWA 5FTMA 3PQCA 4IDFA 3BMCA 5TS3A 1QIDA 2V7BA 4PAWA 3IAEA 1G2PA 1P0MA 2AMLA 2UUPA 3WGTA 4QNMA 4BTLA 3H9GA 2R0QC 2WE7A 2NYAA 2D1TA 1RBQA 4MUMA 4AAYA 4OQQA 3SNHA 1NW5A 3LDAA 3EIEA 4M0KA 3EFBA 3S2GA 1WJGA 2PLFA 3Q3IA 3JYOA 1KY4A 2ZU6A 2KI5A 3ICWA 5DLDA 5CRIA 2FEPA 1SQ5A 3TK1A 2RGCA 2IEZA 3ESRA 2V7WA 4YDRA 3W1VA 2UZAA 2ZJFA 2EVWX 3RTDA 1KJWA 5MF6A 1CDEA 1IFXA 2JLSA 4EI8A 4HDKB 1I3MA 3DBLB 1X1EA 4ZVPA 4DLLA 5K8UA 1OXUA 5F9MA 4ETWA 3D6NB 2ZAYA 4E5DA 1NMZA 2AOUA 2PKQP 3TQRA 2JATA 1DAKA 4L8WB 2NSLA 2HDNB 3L07A 1P60A 1XWIA 1YRBA 4R68A 1M6YA 5F33A 5K8LA 4WNAB 4ETMA 2R68A 1N1DA 2G9RA 2Z43A 3DZCA 4AMZA 4TV8B 4N0PA 1YJBA 2VT2A 3HSYA 4OHMA 4YVFA 3VR5H 3DUFB 5KNBH 4DSTA 1P4JA 4JLAA 1FXWA 3SX2A 3SIRA 1JIIA 1CZRA 2EFDB 3TR6A 1U63A 3RWMB 1WB9A 5A9SB 2FPXA 5EINA 1YOVA 4GLLA 4E3WA 4MP6A 1TZBA 3FMOB 5I7WA 3T3NA 3U4HA 4J0HA 3I9JA 4XWGA 5HQJA 1QP7A 4F6CA 4KQ1A 1U3WA 1QO0A 1JT2A 3BSSA 1O6BA 1NRIA 1V7ZA 2HXYA 3T0IA 3LHIA 4BVAA 4IKPA 2P0EA 1N78A 1FLVA 3GVIA 4FMDB 5EQFA 1FDSA 2AN3A 3D7MA 1XAGA 4W8HA 1D1SA 2IYTA 3VOTA 1YNSA 3BGOS 1LUAA 4KUEA 3E15A 3O2QB 4WOCA 2DMRA 1XO1A 2CL5A 1KZ6A 4DM7A 2ERYA 4OMUA 1CJMA 3G5UA 2F43A 4EUKA 4CFZA 6GPBA 5DXAA 2M6LA 1QV9A 1QHHB 4UTVA 6AT1A 3C8ZA 1L7RA 4WZ6A 1LJLA 4D3SA 2B7LA 5F2OA 1MNQA 2V3VA 5C37A 5P21A 2C8JA 1L0BA 1GZSA 2PZMA 2ZVQX 1XP8A 2DRIA 3B3FA 5KYVA 1WBBA 1C4KA 4RGVA 4RIEA 1QC5B 1GPH1 5FWYB 4URXR 4HI0E 1U3GA 3I5MA 3IMKA 2CB0A 2BBWA 1QIFA 1VCHA 1RZ3A 2WEKA 1DFGA 2Z09A 1Z5UA 3V32A 4BQPA 1M2HA 2HNBA 1D5WA 1GUAA 2XNJA 3H9CA 3HCOA 1Z37A 4ONEA 1UH5A 3EOZA 1M73E 3EVAA 2GNPA 5FWXA 5FPSA 3ERCA 1WHSA 1GGFA 3BF7A 4JB2A 1C30A 1E6CA 1MFPA 3JRWA 4OJKA 4A5SA 3HK2A 5CB4B 2IPLA 3W7BA 3VPBA 2QN7A 5KTPA 1E1DA 2Y67A 4DUPA 5IAEA 3ZHVA 4GP6A 2ISQA 3D4LA 3P20A 1GZ6A 1IN5A 1R6UA 5TMEA 3AP2A 2QBYB 4HZUB 2R751 3AEQA 1ML4A 1AE1A 3NGLA 4JQOA 1XDZA 3SF8A 3U9LA 2WC1A 4JJ7A 3CPSA 3TZHA 1L4YA 2IHUA 1X7HA 1I7LA 2LV8A 3OQIB 4B5KA 4G1EB 1N3LA 2ZITA 4TL7A 3WGIA 4ARSA 2VXYA 2F8SA 2O2JA 2B5WA 1KQPA 2ODPA 2FSSA 3KV1A 3FR7A 4LY0A 3O31A 3JU3A 1VJ1A 2JPDA 5CLLA 3UQYS 1GTRA 4L50A 1Y82A 3EBPA 3RNLA 4M86A 5HGXA 2XUPA 2VSQA 1NURA 2BFOA 1V7PC 3F6CA 4NJEA 3WQRA 2X5OA 4QBGB 1NHWA 1OFTA 1VSQA 3SOZA 3TLAA 1LDYA 4MVYA 1XTKA 3VNVA 2DJIA 1BE1A 4UCWA 4R1QA 2H7CA 3HSKA 4TL6A 4O33A 3OKFA 3PNSA 1XC7A 2YX1A 3CT4A 2GGSA 1S3SA 4R1MA 4ZKEA 4GWGA 3J7TA 1J0DA 2JHFA 1L3BA 4CMJA 2X58A 3FUXA 3R6TA 1NQAO 2ZYTX 2J31A 4CTKA 2G9NA 4KV9A 1W0KA 4LJLA 3KWLA 1U31A 3C3CA 3DB2A 3OTGA 2H65A 1G0OA 3HLYA 6CHYA 3R24A 3GJ6A 3HEAA 4PG4A 5JV5A 5K03A 1W94A 1A5AB 5LQSA 2D5LA 4ALKA 4S1OA 4I81A 4AP5A 4IV5A 1NW8A 3CF2A 3UMBA 4DLWA 3RS5A 1B6GA 5CCBA 2FPPB 4ODIA 1JXOA 3D8BA 3I62A 1Z74A 1TPYA 2GCOB 2WAAA 5FFFA 2BEVB 1UL1X 1W1WA 3UNXA 3T52A 2G09A 1WDMA 2L82A 4HEA1 4NCHA 3UIEA 3QXJA 4U63A 4WK4B 5AM1A 2DBZA 1KOFA 1FQKA 3DDWA 4GGPA 4I36A 1JA0A 2JGJA 1I1OA 2FGKA 3DM5A 1KJJA 2I8LA 3COWA 5MDHA 2X3UA 2XT0A 4AWAA 2B9VA 1KQOA 2BMDA 4XSGA 2Q3LA 3DT8A 4TOIA 4UCQA 4YA6A 2GEBA 3RREA 3BQ9A 4JL6A 3NFRA 1YNOA 3ONFA 2Z2IA 3H17A 5U4XA 4HH1A 2JJ2D 3IPAA 5DCYA 1FYVA 2OXCA 3R3ZA 4BQRA 5C5CA 3A14A 4N5MA 3A9SA 1LFAA 2Q6IA 3SKVA 3SU8A 3ZCQA 3RVMA 3WGHA 3SLGA 4F5WA 1II9A 4H6PA 1MO3A 1Y8RB 4P3NA 2GBCA 3BIJA 3HU2A 4J49A 5GZ6A 2ORYA 4UHFA 3ZV6A 5IT9A 1A04A 2H2DA 2APJA 1CHDA 1F9AA 3GFFA 4OGKA 1BU5A 3TBHA 5FWXB 4ZAGA 2J7PD 1CDOA 3OMLA 4X94A 5A7HA 3IOYA 1RI3A 4OBEA 5K45A 2YS6A 5DK4A 4NXNB 4UBOA 3UANA 4CM4A 3AW9A 3GWZA 4Q3OA 3ZDXB 3VHLB 4FFPA 4TMFA 1VJDA 4X85A 3JR7A 1YB7A 3TM5A 4UD6A 3EZFA 3FSJX 2OC9A 4C7XA 2IFTA 3AUTA 5DSTA 5K8VA 4CLEA 3HVIA 1A4XA 1FP4B 4AZ3A 5H16A 5CTAA 1PT6A 2XZOA 5JBIA 1CLEA 4MCIA 3AI2A 1GYQA 1P8JA 2J45A 4YJ3A 3O21A 2AMFA 2FJUA 3AYXB 4P81A 4TT3A 2QQEA 2ZXFA 5DNDA 4GM0A 2F1RA 2HK8A 3GFSA 1N1MA 1AHHA 2VHCA 3QE0A 3ECAA 3EEFA 1OLUB 2X14A 4U2BA 1SUPA 2XTNA 4M9UA 5FHQA 1AN0A 1XYVA 5T3UA 3ROMA 1H0HA 3U5ZB 3IBSA 1SU6A 3EODA 2XE8A 1P0IA 1TTHA 2BFNA 3VAYA 4F06A 3GUVA 3ZBPA 4H4DA 1A69A 3L6RA 3I05A 3ZDZB 3EZYA 3RS4A 4PIMA 1MX3A 2FZLA 2IQ5A 3LVFO 4QLBA 1J24A 1Q83A 3M3HA 4JK3A 1N6NA 4K40A 5KCMA 3T34A 1YOVB 2YJ4A 5C7YA 4NXMB 2UKDA 2Z2XA 2UUCB 2CW5A 1NJFA 4HRYA 3AMVA 1X1CA 1S2OA 4BCCA 3U7GA 1JZQA 2G06A 4HLQB 1V95A 4IMJB 4QDUA 4BMSA 3AF3A 2HXGA 4MS3A 4R1SA 4B4UA 5B7GA 3NHZA 4ZT2A 5C18A 5CK5A 2KSQA 3LLUA 2ZSHA 4MPTA 5B58C 9GPBA 3SHOA 3EEYA 2OWDA 3GZTB 3PPXA 4CKCB 4YB8A 3PFCA 3VU9A 2VPPA 3OUTA 4XDYA 5JAOA 2IS6A 3A9WA 1W19A 2JIZD 3RVRA 2W7TA 2O8BB 3ILXA 3T8YA 4DNFA 1PFQA 4KPUA 5CUQA 2CXTA 2ZANA 1PHRA 3R5HA 1W52X 2HRZA 1K98A 1RLUA 1PJSA 2OV4A 2QV7A 3KIPA 4FSXA 1E2FA 1Q2XA 2QLMA 2XR1A 3LP8A 4A7PA 4CMIA 3KQNA 1EUYA 1E6KA 2QR5A 4QXPA 1MH1A 2RC6A 3BFVA 2EYQA 4CHGA 1H0RA 1RHUA 1YQWA 1FFWA 3BD9A 4KQCA 3SMVA 2H1SA 3BCRA 1N9ZA 1OREA 1J4AA 1DQPA 1DXOA 2R48A 3OAAD 4H7DA 3NH9A 2B4QA 2ORVA 2I6FA 2HRDA 1YAHA 3QLVA 4QUJA 3H5NA 3R5FA 1IWBB 4M1EA 4NV1A 1S01A 2Q4BA 4MRMA 3GDOA 5C8YA 5C4MA 4S1TA 4Z6KA 1C4WA 3VBCA 4S3MA 1XTZA 2DJ5A 1QTIA 1ULHA 4LWQA 2NG1A 3MGKA 1EFPA 1U7PA 3N7AA 2B94A 3B9QA 3GV0A 4EVQA 3CLRD 1ZRNA 2E89A 2QRMA 4NMXB 2WOOA 5GV7A 1FRZA 3I6YA 3IKVA 3UMVA 4GL2A 3UJ9A 2DP4E 3RAJA 2YV2A 3QITA 4WJZA 4CM5A 1TJ5A 4NQRA 4HEA6 3FFAA 1G9SA 4TS1A 3RD5A 4H7JA 3R76A 2RBEA 3MELA 4UOZA 4CUKA 3N07A 1U0TA 3UOAB 4HK4A 3TCNA 5CDHA 1CS0A 1VMDA 1I10A 4LV8B 3FNQA 4KREA 3NNDA 4RQBA 3CKYA 2F4NA 5J58A 3S8EA 2NSJA 2GETA 3AR4A 3ZKWB 2XGJA 4DDKA 5FUYA 5JPIA 3NKLA 3DAGA 2GZDA 3I8SA 4FGLA 4ZOLB 3VPSA 3DFMA 2HB6A 4J0GA 3OZBA 1T9ZA 1W4CA 3FD8A 3Q2OA 4FDUA 4DVJA 2HH9A 3MEQA 3QX9A 4ZK6A 4ES6A 1TEHA 3NS7A 3OQPA 4YECA 4W5TA 3ZZ0A 3D4NA 1ULBA 2PRIA 3RC7A 4F4UA 4DDVA 3FSGA 4ID9A 5LA6A 5C8YF 3H87A 4GPTA 2XYGA 1QVVA 3F71A 5SY4A 1H2ZA 4CLOA 3L2OB 2NU8A 4ACAA 5A6VA 1U5BA 3TL3A 3E35A 4PNHA 4K9NA 2XA9A 3NEJA 4KH1A 3W2IA 3OU7A 1WP9A 4EELA 1DTWB 1N2OA 1OX4A 1CRZA 1D1TA 2IHTA 3GFQA 1N6HA 2V9PA 1A7AA 2D62A 4RUKA 3ZHRA 2IDJA 3VKHA 1YO6A 4GX1A 3GLHE 1MKYA 4KRYA 5ALUA 2H7YA 4Q19A 4RKFA 4KPEC 1VKZA 3OZEA 1T10A 2X4IA 2IKQA 5AHKA 4DQKA 1SXQA 3ZNOA 4AICA 2XUIA 2RHGB 5AVYA 3H1GA 4XIJA 2PUAA 3DXZA 5G40A 1NNSA 3C3XA 1AKRA 4P4SA 1CQWA 2A9PA 2RI6A 4CEIB 2HCBA 4TRRA 5AKGA 4O0MA 3HKBA 3CVUA 2OO5C 3K0CC 5J40A 2JRCA 3D59A 3PF9A 3RVKA 2CCKA 3H2GA 3KZXA 2YUIA 2QAIA 5AWFC 2ZUFA 1GN8A 2BH2A 1JMYA 2JCXA 5JARA 3LXXA 1ESZA 1H23A 4JX9A 1KK1A 3NUZA 2ZWIA 1H2YA 4HNAB 3KB1A 3IDQA 4A91A 5K0BA 5A0TA 3GZJA 5ALRA 3K15A 4K6KA 3DP7A 3JYNA 4OLFA 4DZZA 3P9IA 4L3OA 1XRMA 5JD6A 2E85A 2O1EA 3PRYA 1G2IA 2GRAA 1IOLA 2DQKA 2EQAA 5AVSA 5JHGB 3QU4A 2E5LB 2M9MA 4XUGB 1S4QA 3DNPA 5I48A 3U56A 3GP3A 2J9FA 4J16A 3BA1A 2P3OA 1G8FA 4Y3UA 1CQIA 1RWQA 2XAUA 2XQGA 3PUYA 3HA3A 2C0PA 2RG7A 3RYTC 3WZ2A 4C5AA 2H0AA 4GLBA 3V4RA 2NAPA 1WXGA 4N8DA 3RT9A 1SBQA 1NN1A 4JXJA 4G56A 5K99A 1UMDA 5FBQB 2IP2A 2E4ZA 4XI9A 1JUDA 1ADBA 4AECA 2WBLC 1VSTA 1EKXA 2GJAA 3ORSA 4EKNB 5CCEA 3HI6A 3UT6A 1AVTA 3VSAA 1O94D 4MMXB 4ZODA 3W8EA 2V6GA 4BJHB 5IN4A 1FUEA 3T5PA 2IEBA 1XLVA 4BLSA 2IUUA 2BZSA 1ODKA 2AJLI 2GZMA 1YQDA 1EK1A 2XWJI 2G5TA 3FYCA 4IP0A 3B89A 1FFCA 4ZDJA 4MW1A 3PKJA 2GERA 2QB5A 3WYNA 2AR0A 3W9YA 1IZ9A 2WOJA 4OU4A 1JFSA 4D9BA 3TJZA 3PI7A 4OFWA 3OIUA 1V39A 1N8TA 2Q07A 3IMEA 3M49A 2NO5A 3IGFA 4PLYA 3TFQA 1O95A 4RVFA 2EKLA 1P61B 4TXLA 4AMBA 1XPOA 1XDSA 1AXRA 2NU7A 5JO9A 1RQ2A 1I6MA 3LWZA 4EX6A 1YA4A 2JGDB 3MM4A 2R6DA 4NHEA 4XVHA 4RK1A 1HEYA 1RKVA 4NICA 1N3IA 1XMOB 1TZKA 1GZ3A 1VCMA 2ZIFA 3IB3A 4ZVNA 1ZCFA 1GO2A 4HSEA 1U1DA 5ENVA 4EQ6A 1Z0KA 3N2GB 5EJ7A 3MB5A 1BE0A 2YOFA 4J4TA 3F6YA 1RWKA 2WSSA 3GLHB 3L18A 4ZPXA 5F9HA 5BVGA 2HGSA 2Z56A 3IFSA 4GIBA 4NFHA 1PL0A 1TM4E 1SG9A 5ALQA 4A9AA 4CPDA 1BS2A 4TTSA 2YVQA 2V7PA 2ZBPA 1GL3A 3AR2A 1KVSA 3NM5A 4HPJB 1JN0A 4RVUA 4P92A 5CYGA 4YHHB 1E2UA 2VQ3A 3I9NA 3LLMA 4DWJA 1KBOA 5CW1A 4U2KA 3HC7A 3CUVA 4L5JA 4HLNA 4M38A 4PZPA 1Q91A 4N0MA 5T8KC 5K7SA 1JFFB 5HJ7A 2ABWA 4WVLA 2WJGA 2WZQA 3K09A 1O2DA 1DLJA 4QXOA 2OYRA 3TSOA 5L4SA 5FBKA 5P8WA 3ROEA 3MN1A 1JSCA 3LX5A 4K28A 1BDJA 4AQYB 2CGEA 1MXFA 2W98A 5B6IA 1CBUA 1JHVA 4MK4A 2BMVA 4OHZA 5LQNA 4QTXA 3GLRA 1XVAA 4F1WA 2IXTA 4BNYA 5GY7A 3SEAA 1ODSA 1Z5OA 1CY0A 4MDYA 3Q87B 3OSUA 4HH3C 3M3DA 4HF7A 1XQVA 3ECSA 2E49A 5DTRA 3D02A 1MV8A 2FVXA 2BGIA 2EGUA 3BXXA 3GFVA 1EMDA 4LY6A 3UH0A 4LJ9A 1T0HB 2P62A 1IJBA 3N74A 3NWOA 3QV1A 1LK0A 4P3PA 5E0KB 4HJXA 4URWR 3H65A 2P9YA 3GCDA 1TNDA 2XCSB 2IE0A 1NMEA 2AWNA 1GKYA 5IJZA 3ZHSA 4EG7A 1RWOA 5EPUA 4E7PA 4R7TA 2BGNA 2QRHA 3K4QA 2POQX 3IEXA 3WVNA 1FP2A 1K1EA 1Q15A 2V6MA 2VSFA 2ZJ5A 3M5WA 1O9GA 4FTWA 3UXYA 3UB3A 5JQWA 1Z0SA 3WLEA 3BMOB 3OZDA 3HVJA 3BQMB 5KVAA 3FKSD 4PC6A 4RANA 3S5UA 1Z2NX 3BPSA 1C1XB 1Z07A 1JKFA 2QAGA 3A8TA 3FZEA 3PPWA 4HAYA 2X5XA 2PS9A 4I1OA 1B41A 4LXXA 4B80A 4ECAA 4XX1A 4E07A 4AKTA 2X0KA 3M82A 1DWQA 3CNHA 3HO6A 5K4AA 2G83A 1HRKA 5KAMA 4A82A 2M1XA 1GGMA 4L74A 2TRSB 2Z6UA 3GFOA 4MROA 4YUXA 4MWSA 3FDZA 2BEUB 4EGCB 2PRKA 1N2CA 1SIBE 1WW3A 2PMEA 2CC2A 1SOVA 2PUHA 1D2CA 3TOZA 3AVVA 5CD1A 3V46A 3JQ6A 1UBFA 2PZGA 2HA7A 4UNNA 3AU8A 3FW1A 1JQAA 5FAKA 5LD2C 5MFZA 4L9RA 1G291 1EFRA 2LCIA 2QJTA 2CDAA 5BUZA 5FPKA 3B20A 3JVIA 3I9V6 4O6VA 3DXXA 3F6BX 1A1SA 2WWGA 1GZ5A 1MPXA 1UODA 1X7YA 1YS1X 1YZQA 2QRPA 1G21A 4II3A 2H59A 1LC0A 1L5YA 3IAS6 5D5QA 1FC0A 2JJ1A 5AHXA 1RLIA 4U4AA 4RZSA 3WLFA 4IJWA 2JD1A 1KF0A 3GUZA 1C8BA 3BQNB 4QOIA 2WWYA 2FCAA 4HQ6A 2NV6A 1RJ9B 4MUAA 4Q5IA 1A8QA 3KPUA 4WUVA 1UC9A 1QV6A 3TNDA 5HUJA 2HJVA 1ZXLA 3AI7A 3HFGA 3PGKA 1Q17A 3EVEA 2YHIB 4MHOA 3S29A 1Z45A 3NZEA 5C35A 3PHBE 4D0SA 4OLAA 4RQTA 1PRYA 2FSGA 3ECCA 2J9FB 3A1UA 4MOWA 1P1FA 3KKQA 4LYGA 2JHCA 8MHTA 4AJLA 5AVUA 5REQA 3EG9B 3G7SA 4BO7A 4JI8B 5B36A 3ANSA 4G2TA 2IC5A 2ZLBA 3HABA 4R0MA 5TMPA 5TPZD 3M9WA 1Z3IX 3EUFA 3PDIB 1QZTA 2C04A 2GCNA 2Z5VA 2DKNA 4HZGA 2ZUVA 5KMGA 4M83A 5AVVA 2PZ8A 1TZMA 4KFCA 1S2GA 2C4WA 1ECPA 4HWTA 5EL0A 1ZNQO 5H8WA 4FFOA 4YY3B 1JT9A 4RHFA 4CLRA 2LKDA 3M9LA 2WKSA 1W5AA 4BRSA 4ZYUA 1YQTA 4LXQA 4LA4A 5CG1A 3DJFA 5AM5A 4PINA 3BMQB 3TN7A 3UMGA 3ZYCA 2OOKA 1GZUA 2HZBA 2W6PA 5FUVA