2OCLA

Crystal structure of valacyclovir hydrolase s122a mutant
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
254
structure length
254
Chain Sequence
SVTSAKVAVNGVQLHYQQTGEGDHAVLLLPGMLGSGETDFGPQLKNLNKKLFTVVAWDPRGYGHSRPPDRDFPADFFERDAKDAVDLMKALKFKKVSLLGWADGGITALIAAAKYPSYIHKMVIWGANAYVTDEDSMIYEGIRDVSKWSERTRKPLEALYGYDYFARTCEKWVDGIRQFKHLPDGNICRHLLPRVQCPALIVHGEKDPLVPRFHADFIHKHVKGSRLHLMPEGKHNLHLRFADEFNKLAEDFLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis of prodrug activation by human valacyclovirase, an alpha-amino acid ester hydrolase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Valacyclovir hydrolase
total genus 92
structure length 254
sequence length 254
ec nomenclature ec 3.1.-.-:
pdb deposition date 2006-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2oclA00
3D7RA 4ROTA 1JJFA 1IZ8A 4OUKX 2HU5A 3H19A 1VZ2A 4QDZA 3BIXA 2FJ0A 1QLWA 1A8SA 1E8MA 4EY4A 3M83A 3WZMA 4Q1VA 3ICWA 4AB1A 3NWOA 4FLFA 4Q05A 1UZAA 1BEEA 5JZ9A 2ACEA 3CXUA 4QEKA 1LZLA 4IH9A 1L7RA 4UBIA 3AINA 4J03A 1GT6A 5K3AA 1R1DA 1C7IA 4HRYA 1MPXA 2GZRA 4X93A 1QTIA 3DD5A 4G8CA 1XZEA 2QJWA 1OCEA 5AKGA 4QLAA 5ALFA 3WWDA 3QMMA 1EDEA 1E5TA 3ED1A 1AUOA 4RE6A 4G4GA 2Y2UA 5C8VA 2OG1A 4H7EA 1YSCA 1TQHA 1U4NA 3EQ8A 2R11A 4BTLA 4C89A 3O95A 2XMZA 5CW2A 1GQSA 5CBKA 4B9AA 3RM3A 2PU5A 2JIDA 2XMGA 4L3WA 4QDTA 3CN7A 3QPDA 2OQIA 4MWTA 1EH5A 2C58A 3FSGD 1TAHA 3ZWQA 5K3FA 4CIBA 4LXHA 3DQZA 3DLTA 1P0PA 3A70A 4Y2UA 2YXPX 2WUGA 2WHRA 1UOOA 5ALNA 3H2JA 1XLWA 1ZJ5A 2DHDA 5AKIA 5LP1A 1MX1A 3WJ1A 3WL8A 4FOLA 3H1AA 1Y7IA 1ZGBA 1X2EA 2Z3ZA 1MNQA 3FYUB 4ZREA 3O4IA 1TRHA 4EY7A 5FKJA 4G4JA 1PJAA 1EA5A 1FSSA 3G0IA 3G0CA 3A2LA 1UFOA 2VJDA 3I2JA 2XUGA 3T4UA 1Y7HA 4ZI5A 2RONA 4KRXA 4Y2VA 4BVLA 2PX6A 3CCBA 1ZD2P 5HKAA 2H1IA 1BCSA 3ILSA 4RE5A 4DMKA 3SX4A 5I9IA 3PICA 3WA7A 4OYYA 3AFIA 3FBWA 2EDCA 1QTRA 3BDVA 4UHCA 4ARBA 3V1NA 4AN1A 2OPHA 3PFCA 4EY8A 1VA5A 5HFNA 1ZIXA 3VJLA 1QE3A 3GELA 5FP0A 1W6RA 2XLCA 3RLIA 4UHHA 3Q0TA 1J06A 3HJUA 2VTVA 5ALIA 5HK8A 1J2EA 5JZBA 2X5XA 4DMCA 4EY5A 1JJIA 4BTVA 2CUTA 2XUAA 3FYUC 4UHEA 2Z8XA 4U2CA 5AICA 3VXKA 4DNOA 1XZKA 3IURA 2C5GA 3JYHA 4X91A 4G9EA 4TVKA 2RGUA 3WMRA 3AUKA 4MQMA 5K5EA 2G4LA 3AZOA 4Y2RA 3R3ZA 2WJ6A 4B6GA 4UBNA 2XUFA 2QZPA 3NOXA 1CUAA 3WL7A 4Z49A 4RNCA 1T4MA 1XRMA 1THGA 5ALHA 3C6ZA 5K3EA 2XUDA 2GBFA 1BCRA 5JIBA 5AK3A 3OPMA 3O4GA 3LIIA 2BFNA 3IVMA 4BDTA 1QIGA 4BRSA 5AOBA 1DX4A 3DCNA 2QRUA 1QJ4A 2DQYA 2J3QA 2WTNA 5AH0A 5EHZA 1MAAA 3PFBA 1P0MA 4N8EA 2VF2A 1F0PA 1DQZA 2ZJFA 3KWJA 5DWDA 5AKKA 1LNSA 1R3DA 2HA4A 4EZIA 3UUEA 1LPPA 5ALMA 3ZLTA 2JGMA 5CXXA 2PL5A 3WK5A 1G4HA 2QR5A 3PI6A 4AZ3A 3DYVA 1SCIA 3OURA 1BN7A 1ODSA 4KAAA 2HFJA 1YCDA 4K5QA 3DYIA 4EUSA 3FLEA 3OG9A 2HRQA 5JD5A 3D2CA 4ITVA 1E89A 1JFRA 2GYVA 5T4EA 2WG2A 2QVBA 1UK9A 1MNAA 2RHWA 4O08A 2J4FA 4AO6A 4BB0A 5FLKA 3E0XA 4W1QA 5KBYA 5SYMA 4J0HA 4DYHA 2ZSHA 5LIPA 5ALKA 1CUZA 2ORYA 2FUKA 4KAFA 4C88A 5LLSA 1LPSA 2ROQA 4JYMA 2WU3A 3DKKA 6YASA 4K2AA 3VVLA 3GUUA 1VZ3A 5AKZA 2AXEA 3G9ZA 4CCYA 1CUEA 1IUNA 3WK4A 2XUKA 1B6GA 4X95A 1CUYA 4UHBA 1AZWA 5ALVA 4MWSA 1L7AA 2OCKA 2JGEA 4G5XA 3I2HA 2OCLA 4QLOA 2Y6VA 2WIKA 4K6KA 5T4BA 3C70A 4P93A 4JH0A 1XLUA 3OOSA 5K3FB 5AKEA 5EIAA 4M0EA 4AMYA 1AMNA 2Y2VA 3WKDA 5A71A 5AI8A 1WB6A 2EEPA 2WG0A 4G4IA 3FLAA 3HABA 4P92A 2Z5GA 2DQZA 2HA6A 4B0PA 7YASA 1I6WA 2ZYRA 4QA9A 2W22A 4E46A 5ALEA 2HA7A 3ESAA 1F0NA 1JKMA 2PSFA 4UBLA 1N5MA 4PSCA 3NUZA 4AZ0A 2WHPA 1EDBA 2JBWA 5AI5A 3V9AA 3O0DA 2B61A 4J0DA 3BXPA 4W63A 5CXUA 5EIHA 4H7FA 1O6FA 2XLBA 3V1KA 2PKYX 5YASA 1FFDA 2FX5A 3DJYA 4ZRDA 3STYA 1CUHA 3W9UA 3QMVA 4P9NA 3WK9A 1QFSA 1VE7A 4E14A 1ODCA 1R50A 2JGKA 4E11A 5DYTA 4QZVA 4J0KA 5HF9A 1QIKA 3IUQA 3H2GA 3WKAA 3DOIA 3KDAA 3X3HA 2AJCA 1ETHA 2GBGA 2JGLA 3D2BA 1EHYA 4QWWA 2Z3WA 3W06A 1RYYA 1ACLA 3PE6A 4XX1A 4HAIA 5ALSA 4FTWA 2VJBA 5HFAA 3EF3A 4LXGA 4MEBA 4L0CA 4IH1A 1NU8A 3IIIA 4TPKA 2XMBA 5JD4A 2V98A 5AM4A 1CUXA 5CH8A 4AO8A 1K6EA 2X8BA 3M81A 1EDDA 1THTA 4LYEA 5DNVA 3EIOA 4DSAA 3CCCA 3MGAA 5AKJA 5AK5A 4EY6A 3F67A 5DYWA 3S2ZA 3FVRA 1FFBA 1XZBA 2WFZA 3F97A 1H2XA 2OGSA 1SCQA 3N2ZB 1W76A 1XRLA 4JYPA 2PSHA 4UFOA 3K9BA 1X70A 2WKWA 2YH2A 5AM1A 3D3NA 3TGLA 3FNBA 2HA5A 1G5FA 1S8OA 1Q83A 3I6MA 4Y2JA 4G1FA 4FBLA 2DHEA 3C5VA 5DLPA 1H22A 1MTZA 1UXOA 2P8SA 1H2ZA 4LKOA 2G5TA 4FLMA 4BC0A 1YS1X 2DCMA 2J3DA 5H3HA 3HSSA 5EHXA 5AK4A 3I1IA 5K3BA 1VKHA 1LGYA 4C4YA 1XRPA 1BU8A 1XQXA 1T2NA 3C6XA 2XMQA 2VJAA 1UK7A 1USWA 5C8XA 1ZI9A 1EB8A 1MU0A 1W52X 1GKLA 1XRRA 3AZQA 1EXWA 5FPQA 5JAOA 5JAUA 3V48A 1XZCA 4WY5A 5AM5A 1CPYA 2ZYHA 3IB3A 3H1BA 4X6XA 4A16A 1WB4A 2JGJA 3SWWA 4UBJA 1DWOA 3WQHA 3O9MA 1UKAA 1VOTA 1DU4A 4BRZA 2BGNA 2WM2A 1ISPA 2QS9A 3D4LA 3QVMA 3KSRA 4LHEA 5JANA 2HDWA 3MVEA 1XZDA 5A2GA 2EDAA 4D9JA 5CURA 1XQWA 4WY8A 3R3YA 2H7YA 2ZSIA 5ALPA 5DJ5A 4HS9A 3R3UA 1IMJA 5CT5A 4BP8A 3B5EA 1QFMA 2V9ZA 5AKXA 3IUMA 5ALOA 3BDIA 3DS8A 4BAUA 3WI7A 5JADA 5K3CA 2V96A 3WK8A 1SFRA 1C4XA 5FOQA 1MO2A 1MN6A 2XB6A 3EQ9A 2GYWA 4CFSA 1ORWA 1WM1A 3D0KA 1EB9A 2HL6A 3FSGA 1FFEA 1TCCA 1DWPA 3QPAA 1GPNA 2XUHA 2QM0A 5T4HA 1N5RA 4ETWA 5LYYA 2VQ6A 4DTCA 3GA7A 2HIHA 5IH7A 1J07A 1EK1A 4H7DA 1TIBA 2HADA 1YASA 4UBOA 5HQ3B 4GBGA 2QUBA 3AIMA 3I6YA 3GZJA 1XQVA 1UK8A 4HXGA 3WZLA 4BDSA 4B9EA 5LZ7A 4NZZA 1HQDA 1CR6A 2QMQA 1E3QA 5DYYA 2H7XA 4GWLA 1BN6A 4Q3KA 1CUVA 5AKHA 5ALQA 4EA6A 5EHQA 3STUA 3AILA 4HXEB 4MYDA 1ZIYA 3HZOA 3D2AA 4GI1A 4ZWNA 1XKLA 1LPNA 2CEKA 1YS2X 3WYNA 5AIBA 1CV2A 5E4JA 1XLVA 1ZOIA 1F6WA 4CG3A 1MAHA 4FNMA 4W9RA 1K5PA 1KU0A 4DNFA 1JU4A 1ORVA 4KYVA 1TCAA 3D59A 5CT8A 4BE9A 4CIAA 5BV7A 4EHBA 1HL7A 4BCCA 4BZWA 4WFJA 2K2QB 4OB7A 3UUFA 1WCYA 3PF8A 2VAXA 1CEXA 1DX6A 1AKNA 1CUIA 2ZVDA 5ALYA 1EINA 4MXDA 3G0DA 1CRLA 1G66A 4GEGA 1UOPA 1XROA 4B83A 2XQKA 1XZGA 4H7IA 3C6YA 1WPRA 1ZD5A 4A23A 4LIPD 2RAUA 1UKBA 3STTA 5F4ZA 3LP5A 3WK7A 3W04A 2OQVA 1XZJA 1HKHA 3AJAA 3FWHA 3TJMA 2AJDA 2XUJA 2VSQA 2WUFA 2O7RA 5HF6A 4ZXFA 4HXFB 2BUAA 3LLCA 4X71A 2GBIA 3HI4A 3MUNA 2X76A 2CMFA 4K6HA 3IDAA 3R3XA 4L9AA 4UFPA 4MJ3A 5CMLA 3F96A 3I6ZA 4AO7A 3T52A 5E4YA 2OLEA 1CUJA 4B85A 1JU3A 3HEAA 2ACKA 4DGQA 3ESCA 4M0MA 4K6GA 5JAHA 4I4CA 2ES4A 3KD2A 4X00A 4DNQA 1D07A 4Y2PA 1XRQA 4GHWA 4GLBA 4JNCA 4BAZA 3WWOA 2WILA 5AOCA 5EI5A 5AI0A 3A6ZA 2AJLI 3WWCA 1HDEA 4FNGA 2HU7A 1WPXA 5LZ4A 1EVEA 5A6VA 5IKXA 1CUCA 1YB7A 4DM7A 4XIIA 2I3ZA 2AJ8A 3P2MA 5ALTA 3H2IA 2C4HA 3I2KA 3I2GA 2C5FA 1SC9A 4H77A 5LKAA 4B82A 3BF7A 2BAGA 5ALXA 5AO9A 1XZAA 2VEOA 4X94A 2WIDA 1CUUA 3R3WA 4GDMA 4ZGBA 1CFJA 4QNNA 2WHQA 5D3KA 1U2EA 4HZGA 4BVJA 5E4TA 1KU6A 2VJCA 5AJHA 2XQJA 3I1YA 5BWCA 2GYUA 4FLEA 5ALRA 4Q34A 5A7FA 5DTIA 1IVYA 4Y2QA 4PQEA 4OU4A 1GGVA 4UHDA 4CG1A 2HFKA 1YA8A 5AM0A 3HC7A 2BKLA 1GKKA 3YASA 3R0VA 3B3QA 3DL7A 2YYSA 1DT5A 4N5HX 1HBJA 2OGTA 4UBKA 1ODTC 3F9CA 4H7HA 3HACA 5JALA 5FXMA 3SK0A 1QGED 4DLNA 5JYCA 4BCBA 4B7ZA 1LPBB 2HHAA 4FHZA 1A88A 2QKYA 3UMJA 2B4KA 2G5PA 3QITA 1FFAA 5JATA 4G8BA 1X2BA 5SYNA 4KEAA 2PSJA 3QPCA 5ALGA 1AQLA 3WLAA 2HM7A 5KREA 4MEAA 3I2FA 3C6BA 1U65A 4UHFA 2RIPA 1XKTA 4BVKA 4JEIA 4X7BA 5FUMA 3R41A 3WYDA 1VA4A 5C7YA 4KE6A 2OGZA 1BE0A 1ZI6A 2CZQA 5LZ9A 1Q84A 5IVHA 1UWCA 1YR2A 2PBLA 2JF0A 3FVTA 3JWEA 2O2HA 2C0PA 4H7KA 4ZV9A 3F8SA 5D3ZA 4NS4A 2B9VA 2XT0A 3CN9A 4CG2A 3STXA 5BOVA 3OTQA 1CLEA 4BAGA 5DTJA 4OPMA 1CUFA 3PUHA 5JASA 2BGRA 1BEZA 1FFCA 5CT9A 3BF8A 3DDUA 1RP1A 3V1MA 1LZKA 1YAHA 4J0CA 4KRYA 2XMDA 1QIDA 3G9XA 3HRHA 2PU7A 1H2YA 1UKCA 2JEYA 3TEJA 5HCUA 1M33A 3BWXA 2XUIA 2E3JA 1XZHA 2HU8A 3QZUA 3ZLUA 4FBMA 2XMCA 2CJPA 2QT9A 4BCDA 4NVRA 3IA2A 4HVTA 4LYDA 4W1SA 4Y7DA 2XQIA 5KWIA 2DHCA 1R4ZA 5E2IA 1YA4A 4CCYB 2ZJ7A 4P08A 2H9YA 3O4HA 5IVDA 4XVCA 5ALDA 4WFKA 5EGNA 3GFFA 3HXKA 2IIVA 1VJ5A 1WHSA 1LBSA 1FJ2A 4U2GA 1W4LA 2ZYSA 4OD0A 1P0QA 2B20A 4L72A 4B84A 1GPLA 5CTAA 3ICVA 4HTAA 4UFNA 2R8BA 3F98A 4PNZA 4QDXA 2IITA 1W75A 2J4CA 4FWBA 1Q0ZA 4CCWA 1JMKC 3A2NA 3STVA 4H7JA 3K6KA 4UBMA 4DMFA 4Y9SA 3WKCA 1W1IA 4V2IA 1SOMA 2PSDA 3PF9A 3G9TA 2Y1KA 2BCEA 2H7CA 4C4XA 2QOEA 3H0CA 5ESRA 4U2BA 3FCYA 1BROA 1HLGA 3N0TA 5EIEA 4OB6A 2DR0A 4WCVA 3DEAA 4BATA 3KWFA 1LPAB 2QXUA 4ZV7A 1GPKA 4X85A 1LPMA 3ANSA 3C5WP 1BS9A 3PDCA 1VE6A 4OB8A 3IUJA 5HKBA 1ZJ4A 4BZZA 4Q3OA 1XFDA 3DL4A 4Y2SA 3ZLVA 3U1TA 5LKRA 5FRDA 2GBCA 3C8DA 4YPVA 4PSUA 3C43A 4X92A 4AMZA 1CUGA 2WU4A 3SC2A 2O2GA 3E4DA 2WLSA 3E1GA 2PVSA 2OXEA 1U8EA 1DWQA 2QUAA 2WSLA 4FDMA 3I28A 2JGFA 3L1IA 4QDUA 2WIJA 5JARA 4Y2XA 4IQ4A 1Q0RA 4QDOA 2PUHA 1BRTA 2VT7A 2I3DA 1QIEA 4WFIA 2AJBA 5C8ZA 1UOQA 4MQLA 2Z8ZA 4PW0A 1QOZA 5DNWA 3A2MA 1NX9A 2RI6A 3LCRA 3R40A 4W1PA 2XI4A 4IO0A 2OCIA 2D0DA 2ZYIA 5CH3A 1WB5A 1IZ7A 5ALLA 3JW8A 2O7VA 5A7GA 4BE4A 2VATA 4PO3X 5IVIA 5AOAA 4X6UA 4I3FA 3RKSA 2WJ4A 1QIFA 4UUQA 3G0GA 5JD6A 4TGLA 2XMSA 5AHXA 4EBBA 3G02A 4YX9A 3QMWA 2OCGA 4UPDA 4LXIA 4F0JA 3OM8A 2WFLB 2DSNA 4KAJA 4J0JA 4ARAA 2HRRA 3OC0A 5LZ2A 3R3VA 4CI9A 1ACJA 3K2IA 1O6GA 4F5ZA 4AQDA 3FOBA 1MX5A 5HF5A 1R9MA 3WIOA 1QONA 2CB9A 5AI4A 2BJHA 1J1IA 3AZPA 3ESBA 4KACA 1QIIA 2YASA 2HA3A 2Q0XA 4GW3A 5I7UA 4WDRA 5LZ5A 1XZMA 3IUNA 1EX9A 4A5SA 4AXBA 5HZGA 1R9NA 4S0XA 1EI9A 5A62A 4RPCA 2WIFA 5AI6A 5AM2A 5CRIA 3QM1A 3BJMA 5DNUA 4BP9A 4DNPA 5ALUA 3VJKA 5IVKA 2UZ0A 3HLKA 5AKYA 3W2TA 2WFLA 1QO7A 1KEZA 2ONCA 3ZI7A 5CT4A 3DKRA 1WHTA 4FKBA 2CKMA 3LS2A 2WFMA 1GXSA 1ZD3A 1VXOA 1CQWA 3VKFA 3Q8WA 4INZA 3WKBA 4FFWA 4BC1A 1G42A 3STWA 3VDXA 1ZD4A 1DTEA 3WWEA 1QIHA 3KXPA 4KR0A 3H2HA 1TK3A 1PV1A 2WG1A 4XJVA 4H0CA 1CUSA 1HPLA 5HQ3A 1QIJA 2JGIA 3WKEA 3DNMA 4B0OA 2XUQA 5AM3A 1QIMA 1EK2A 3FCXA 1UT6A 1CQZA 4C6HA 2DFPA 5ALJA 1IUOA 2RHTA 4X3CA 2XE4A 2QTBA 4N8DA 1RWQA 2ZJ6A 3BL8A 1DQYA 2I03A 2C7BA 1AGYA 4G9GA 3L1HA 3D5EA 4Y2TA 4MYSA 5JAPA 1XQYA 3EBLA 2I78A 1CIJA 1P0IA 4AX4A 3GROA 5EHNA 5AK6A 4WJLA 3MUOA 5CH5A 4PF1A 4GECA 2WHPB 3M82A 4BBZA 4X6YA 3ZPXA 4J0IA 3H04A 5ALZA 1EVQA 3M3DA 4GXNA 1L7QA 3S8YA 1YB6A 1VLQA 1H23A 2XUPA 1TKRA 1TCBA 5AP9A 1E8DA 4KE7A 2G63A 4OCZA 5HK9A 3WA6A 2D5LA 4I19A 4B81A 5JZSA 2NW6A 1QO9A 1OXMA 4B80A 4JUIA 3WJ2A 3FLBA 2ECFA 1A8QA 4X97A 1DT3A 1VXRA 3WL5A 1LBTA 4J3JA 4H18A 1N8SA 1JMYA 3RK4A 4YASA 1CVLA 5CT6A 5HF8A 4DMHA 3FAKA 3ANTA 2XQFA 3ZV7A 3BE8A 4N8SA 3VISA 1MJ5A 2WQZA 4M0FA 2Y6UA 4QWMA 3LIPA 3G9UA 1PFQA 2CBGA 4U2DA 5T4FA 4XWGA 4C4ZA 2PSEA 1F8UA 4F60A 3G8YA 5D6OA 4Y2YA 3B12A 4IHAA 4W1RA 1UK6A 2PUJA 5KWJA 2QXTA 3I2IA 4J7AA 3RARA 2XQGA 4KE8A 4FFVA 2XMRA 2O2IA 5ALWA 2FJPA 1JT2A 3H18A 2PM8A 4DIUA 4OSEA 1IUPA 1GZ7A 4F21A 5FV4A 2XDWA 1K63A 1DINA 3VVMA 1SCKA 4C87A 2OAGA 3EQ7A 4X90A 2WTMA 3G7NA 5LZ8A 4BYMA 5J3JA 1XZIA 3H17A 4E15A 1CUWA 1WOMA 1MX9A 3C8HA 1ZGCA 1ZICA 3TRDA 4KE9A 5BWBA 2LIPA 3IBTA 4Q82A 4NMWA 1YAJA 1XRNA 1XZFA 2GZSA 2QJRA 5AIAA 4RGYA 4U2EA 4N5IX 3QBJA 4H35A 2WUEA 1CUBA 3O4JA 1A8UA 2WIGA 3GBSA 4OU5A 3C45A 3E3AA 4OYLA 5ISMA 4HRXA 5A7HA 3L1JA 1A7UA 1OILA 3W9BA 1GQRA 4PSDA 3ESDA 4IH4A 2BUBA 3O9VA 3V1LA 1H2WA 1B41A 3FYTA 4EB0A 3HYSA 4G8DA 5FDFA 5C81A 1LLFA 3DOHA 4DSZA 2WUDA 1R88A 5K3DA 5EFZA 3VJMA 4C01A 2BUCA 3WL6A 1QZ3A 2VT6A 5D7BA 4U2FA 1CUDA 1N1MA 2PPLA 2HA0A 2OAEA 3IULA 1AC5A 2HA2A 1E66A 1JJBA 2C0QA 3NGMA 3WWPA 1NU6A 4Q3LA 5I8PA 2VAVA 1K8QA 4AN0A 3FYUA 3C87A 1JI3A 3H2KA 1XZLA 3WK6A 2WJ3A 3QH4A 4J0GA 3PUIA 3U0VA 3AIOA 3BJRA 1C7JA 4YK7A 2XUOA 1E8NA 2V97A 2W6CX 3BIWA 5FPPA 4FMPA 2VA9A 3G0BA 1Z68A 3W05A 1LPOA 4QE3A 1Y37A 4KJXA 3WIBA 2JEZA 4PV7A 1ZI8A 3QYJA 2IX9A 5AKLA 3KOOA 5AI9A 1AX9A 1K4YA 4WDQA 1MT3A 1AURA 3AIKA
chains in the Genus database with same CATH superfamily
1JDBC 3A6EA 4ROTA 3K0CA 3QLEA 5DF1A 5DHUA 3HM9A 5K4AA 4TS4A 4MKZA 2BFDA 4IUCS 4JLPA 3WTBA 2WD7A 2XKBA 1WD7A 2AXQA 2IEBA 4DUYB 4QDZA 3OT1A 4BN4A 4ZFNA 2OLKA 1K7SN 5H82A 3EEYA 1PJ4A 3D1JA 3KEFA 2ZI7A 3RS2A 2WMYA 2GLXA 1N7IA 2QTGA 3UK0A 2W6MA 5GVRA 5FOUA 3UT6A 4XWKA 2PZMA 4N7MA 4ASUA 4BO5A 3BFJA 4XH9B 2CLEB 3O7MA 2Q9AA 3IRUA 1WW8A 2BHRA 3U09A 3KYCB 4HCJA 2WABA 2X3UA 5D8DA 3ICWA 3OQPA 3NWOA 1UBFA 2RBGA 4J2OA 1OLUA 3DBVO 2ZTHA 2G8NA 3EXFB 3IP8A 3RFUA 1SVMA 2C4TA 4FR2A 5IZCA 4LNUA 3N2EA 5JEEA 3O4FA 3SIPA 1XELA 3ZWDA 3EVBA 3F74A 3PNPA 4QEKA 4YDRA 1THMA 3ZE1B 3AINA 4ZANA 1KE2A 1QH8B 3ZVNA 3IPYA 3S29A 5ERYA 3CINA 2AG8A 3MT0A 2O7SA 3L02A 1R1DA 2R84A 3PYMA 1PR6A 4R5HA 3R76A 4CL3A 1MPXA 4RSMA 2WV7A 2OESA 4LRYA 2WIAA 4XGQA 1K5GA 2VWPA 2O1XA 3TRJA 2JIZA 5JFOA 1J0XO 1ZITA 3CEMA 3W90A 5A1JA 3D0OA 1QTIA 3P2EA 2AZ4A 2HWWA 2Y77A 4PLHA 3EG5A 2IC5A 4NENA 2AR7A 3UJ8A 2JAQA 1T9KA 2QJWA 1FS5A 1U02A 4KTVE 4RGQA 2P6PA 2R6FA 2WVHA 3PDJA 1IZYA 3NIFB 2JGDB 4NYMQ 1LB1B 4QLAA 1L3IA 5ALFA 1CDEA 4ANFA 2DVMA 2ZJ8A 4AS1A 4ALLA 3EHEA 4HPJB 2C8VA 4G4GA 3E7XA 4AJHA 5C37A 3JR7A 2UZAA 1XE3A 4YRQA 2OG1A 4LJRA 3UMBA 1KEPA 1OAKA 3CW2A 2ID9A 2PT6A 4Z9AA 4IZIA 5B3AA 1DIAA 3DDSA 1YVDA 4LOLA 3T5GA 3TSAA 1QRAA 2E7ZA 2FWIA 2JC3A 2XMZA 5ITWA 3S5UA 5KKCA 3WBFA 2GEDA 2W8ZA 3O47A 5CBKA 5MGBA 4LJ8A 2A9PA 3RF7A 4EHAA 1GZ5A 3AOGA 3RM3A 3LCJA 1OZGA 2QUZA 1G8MA 3OEEA 3UJ7A 5F9FA 3DZHA 2H31A 2IYNA 3NW9A 5KYWA 1O9GA 4YT5A 5CITA 3U44A 4IINA 2YZ7A 1CE8B 3H11A 1YS7A 1SZCA 1SWVA 4J16C 1EH5A 4Y6OA 1XHLA 3KTOA 3UWOA 1OLXA 1NF9A 1U6JA 1NR7A 2JVIA 2VCEA 5ITZB 4RADA 1TQ6A 3SZMA 1FMCA 2QZJA 1GTRA 2VA8A 4X24A 4JVSB 4ZCSA 2RD2A 1H2FA 1T2AA 2HDNB 4HWOA 2VH1A 1P0PA 4LXHA 4RACA 4AT1A 3A70A 4CG0A 4CEHB 3FVVA 3GQBA 3M6VA 1F2VA 5FF9A 1NF3A 3LC2O 3H5IA 3QIVA 4EPRA 3GEPA 4EHHA 2BE7A 1WNFA 2R66A 3NFYA 3AVPA 4FCWA 1JN0A 1X7YB 1W49A 4JLUA 4RDHA 1XLWA 1ISRA 3EDMA 1JVNA 5DBGA 1AKMA 1JEQB 2OD2A 3RVMA 2DHDA 4CMEC 3BIJA 1T6YA 1BXZA 2PYZA 1JQDA 1M8GA 1H9BA 3P9IA 4E08A 5LP1A 4PAQA 2G0AA 1BJKA 4NBNA 3WJ1A 1NP6A 2PUBA 1K8XB 1RQNA 4FIZA 1O77A 4R2XA 3X44A 2NX2A 4UMFA 1QFXA 2UVPA 3GUYA 3R74A 1F0KA 4ZVTA 4MSUA 1J33A 1ECJA 3KXDA 4IL5A 3WL8A 1Q7RA 1FRZA 4WXMA 3FLMA 1RRPA 2NYVA 1QC5B 3QV1A 1Y7IA 3A9CA 3W8EA 1BW9A 4CMBA 3OCXA 3CLTD 3HBLA 4X1YA 1X2EA 4XDYA 1EP2B 3W7VA 5HUHA 3UPTA 1YK1A 4MJ7A 1EBFA 5IS2A 4BO4A 4Z2YA 1NDUA 2C5HA 1G8YA 2W2VA 3UB3A 4EKIA 1DUSA 5EWLA 3RSHA 4R1NA 3W7AA 3G0CA 2ZE6A 3DMDA 3R23A 3TQOA 4ERXA 1RXYA 2RK3A 3ROXA 4K1LA 1P8JA 2AMLA 2PX6A 3ML1A 5IBPA 5I9BA 2AVNA 2V6JA 4QYIA 3OETA 5ES4B 1A50B 5HKAA 4CDMA 4HZUB 3OKCA 5HE8A 1I1OA 2EX1A 5JDCC 3ZKWB 3I1FA 1A71A 1BCSA 4JQZA 1G20E 5FWAA 5I9IA 2ZUTA 1YDWA 3EIWA 3L0CA 3GRZA 1R3UA 1KO1A 3PICA 3PQ7A 4E33A 1QK4A 5CHYA 3V42A 4HEA6 5K3SA 3CUSA 4YRLA 4E4YA 3WV4A 1MXHA 4EWLA 4CXMA 3ASYA 5LD2B 5I8WA 2PN1A 1VDZA 1Y6QA 2JL1A 4LK3A 1Z4NA 2ZBRA 2ZYAA 5BYJA 1G8FA 2O20A 4PRLA 5JE8A 2EDCA 1ZH4A 3K4QA 3SLGA 5DT2A 4AF7A 3MRXA 4UHCA 4XGRA 1CVRA 4E5UA 1OU0A 1EWVA 1GVNB 2JIBA 3HZRA 1F38A 3UKOA 3PUKA 3PFCA 5IF3A 2JB9A 4QQRA 4F6CA 3O9ZA 1XUOA 1Y9ZA 2F9FA 2WWRA 2KMLA 2HV9A 4GT1A 1L7EA 2DUUA 1L5RA 4YT4A 1ZIXA 2BRUA 3FSRA 4PAWA 3UY4A 3FHTA 1A76A 5CB0A 5HMLA 5FP0A 1W6RA 4WT7A 2DTDA 1WMEA 4C29A 2QZSA 4KRFA 3G3EA 3BSFA 3COPA 1J06A 2D5CA 2OXIA 3RVBA 1KYTA 4JXXA 4B2YA 1Y8QB 3HR4A 3EQ6A 1MX3A 4Z3DA 5ALIA 4Q3EA 5CPFA 3K0AB 4K81B 1YZFA 4RCZA 1PT9A 4DLAA 2Z2ZA 3WGIA 5EMMA 1JJIA 3I76A 2QY9A 5A03A 2A4KA 4E1AA 4FDAA 5EOVA 2A9FA 2AUTA 1BMFD 3M6UA 4RHYA 2CUTA 3LPMA 5BNTA 2ZIGA 1RMYA 1S7CA 3CBQA 3GNQA 4MVJI 3I0NA 5FTJA 1CTQA 3TL6A 3M4YA 4QEDA 3C16C 3IURA 3D1VA 3L1VA 2FW6A 3OCCA 4I46A 3RABA 4ML3A 4Q1EA 1IG0A 4A6XA 1NUTA 1PZFA 1U7PA 3KDSE 4RLQA 2OV4A 4TVKA 4DSTA 4R2WA 2XNSA 1BWQA 3CJTA 1NF2A 3OX4A 4D44A 4YGYA 1P6XA 4CTNA 1VP9A 1U2GC 4O4LA 2GFHA 1IHOA 1Z2PX 2QRPA 2YIJA 1XA3A 1J90A 2XVMA 4EKYA 3T7TA 2G4LA 1KY4A 2EF0A 4XD7A 4Y2RA 3OFSA 3ZHCA 4UTXA 1E7RA 4HUQA 5AVYA 1ZC3A 4UBNA 5A0VA 2YNMC 1SXJD 5CUQA 3G0OA 1GTL1 1NZJA 3ETNA 3NEYA 3EARA 4JXKA 5E38A 3M0EA 1TPZA 2IS6A 1YMUA 1KXJA 1C9DB 5KVCA 3N74A 3FTEA 2GWRA 1T4MA 1THGA 3DZ8A 3MEQA 1FQOA 3QG5A 5DE3A 2GEBA 2BFAA 4Y1FA 4KGXA 3HWSA 2OKCA 4MPJA 4G5GA 3WAKA 2BGTA 3TW8A 3OPMA 3B6JA 3PNBA 1KOLA 2CXRA 2ZWOA 2X42A 2BFNA 3I4FA 4QPZA 3S2EA 3IVMA 5KO2A 2WOOA 2GHQA 3EY4A 4X1IB 1HE5A 3GUHA 5BOSB 1QH8A 1R74A 5HDBB 1TA0A 3WNQA 3SC2B 3W3AH 2R2AA 2VBGA 4BPRA 2DLNA 2O48X 5DGHA 4GC5A 5JRZA 5DPMA 5CX4A 3A3KA 4C30A 4HNAB 1XIVA 3KBOA 4IDPA 4OHRA 5JSKA 3SY8A 4EA7A 3PFBA 3SS7X 2ZE8A 2XE8A 4ZQEA 1DCMA 4EH1A 3JR3A 1V45E 1Z4IA 4N8EA 3N8NA 1AT1A 2QMUA 1DQZA 4GQAA 4LDNA 4WN9B 2O8DA 5DWDA 5B3JC 3ZX4A 3UA3A 1LTKA 3HUTA 5AKKA 3UICA 5FOWA 2X7XA 1LNSA 1R3DA 4MYTA 4TXNA 2HB6A 1WTCA 3DLAA 3C4QA 3S5JA 4BVGA 2J32A 1S9HA 1U7ZA 4DR7B 4B4DA 1Z6XA 1J4AA 4MIEA 2QTFA 3RE1A 5ALMA 3VPGA 1BAPA 2F3PA 2W6PA 3ZLTA 2PL5A 1LJ8A 1NFFA 1Z88A 4QPNA 2ZIAA 3SM9A 4GMHA 3S3TA 1H0SA 1BOOA 2PH1A 3QG1A 4YECA 1FZQA 3CW8X 2QR5A 3VV2A 3C6KA 4AUEA 3GEBA 1H8EA 1SIWA 3TUIC 4OQLA 4Z51A 1TIPA 2ZBUA 2WTBA 1ZUNA 2OHGA 3WGYA 4EGCB 2W6ID 3C1TA 1TGYA 2OSBA 2XHEA 1D0VA 1FX0A 4KXQA 2IODA 1SCIA 3U9LA 4NHEA 2B25A 5IK2A 2CT8A 2EFJA 3FYCA 3QW4B 4NQRA 1JALA 5I6DA 1YCDA 3K9GA 5ES3A 3UTCA 3QLVC 4A5OA 5JISA 1A1VA 1POWA 3MBKA 4QO7A 2Z5VA 3W8DA 3WDLA 4KBYA 1R0BA 2HRQA 5AVVA 1IHYA 1PT7A 3FNEA 1OZAA 3D2CA 4ZHSA 5CDSA 7MDHA 4KN5A 1R4AA 1PCXA 1KOJA 1ITZA 2PV7A 2JBAB 1WD5A 3EGVA 5CFRA 3HEBA 2W37A 7MHTA 1RVDA 3ZDEA 4BQQA 3ABSB 1ZQ1A 4LOKA 3KUXA 5T4EA 3U81A 1RC1A 2QVBA 4A6EA 4I9GA 1WUIS 3L7LA 1XPOA 2QN2A 4LWZA 2ZVQX 3TZCA 4COOA 3N6XA 1ZUHA 4MULA 2AV6A 2OWEA 3L4SO 1NLMA 3IR7A 2OR3A 2GF9A 1EU1A 2A8YA 5ENZA 5KBYA 1WSAA 1PD0A 2DCUA 2H63A 2I3GA 2C4KA 2OXCA 3CH4B 3EWNA 3FVWA 4G5OA 2ZKIA 3OA0A 4NABA 4BLOA 4KREA 1LDYA 2YYAA 3FZGA 3O8QB 4DYHA 1FCJA 1FTYA 1ZONA 1NLUA 2R8OA 3NBAA 3AHFA 2ORYA 4BVBA 2FUKA 1Z3CA 4WTOA 5I8ZA 2BW0A 5E95A 4C88A 5JHGB 3CLTC 1F8XA 2CUZA 2EZ9A 3A0UA 3GWGA 3F9IA 3KL4A 3OZBA 5AJVB 3U7FB 4QDJA 4ZI7A 4OQFA 1D9ZA 3AFHA 1Z5ZA 1TM3E 1J9EA 4JYMA 4PR0A 3VSCA 5T67A 4CLOA 4IHJF 2WU3A 4DCGA 3DWIA 2C4VA 4EG4A 2B99A 3DKKA 3I32A 4GX1A 1OFIA 1FXWF 5KYTA 1U8AA 3DWGA 4TUYA 3REFA 1P9OA 5B64A 1ZOLA 4UVIA 4II3A 2JJQA 2UZ4A 4MCAA 4QXMA 3OLVA 3ETJA 1HT0A 2XWSA 3HA5A 1Y8CA 4TTTS 2AXEA 5KNBA 4RA6B 1C7QA 4R0MA 2MHCA 3GRCA 6ADHA 1CUEA 3JYLA 4RMHA 4WLUA 2XUKA 4J7XA 2HK6A 1H5QA 2AC7A 3D9QX 4I6JA 5LUAA 1I4LD 3FRIA 3HSYA 3QHQA 1SBCA 3SS9X 1RXWA 1O1YA 2WSSD 2Y27A 1ULHA 5THXA 1OAAA 2FH5B 1KZ6A 2H48A 1CUYA 4UHBA 1AZWA 3E6AA 2AOXA 2AH5A 2VXBA 2VRWA 3F6BX 2OCKA 3R4VA 4KKXB 3CH7A 4NATA 5EZYB 3OF2A 5GQSA 1L7MA 2GEVA 2OCLA 1VPWA 2Y6VA 4QLOA 3FPEA 3U3RA 2GZ2A 4BEBA 2YJGA 3WVNA 4X63A 1SPXA 3QJGA 3I62A 4MUEA 1HOTA 1V9CA 3TTYA 1KK1A 1OT5A 2R5NA 3FTQA 1VRCA 3W5JA 4BP1A 1QWSA 1XLUA 2TMDA 3H5TA 3Q4GA 4TWZA 3UAGA 2BI8A 4PLZA 3S1LA 4A0HA 1D2MA 5CVUA 1BX0A 3AXTA 4I14A 3LA6A 4PGHA 1KKMA 3RSSA 4D0RA 4G5HA 4WXEA 2OQ2A 4PYQA 5CDFA 4JYAB 4BS9A 2R6ZA 1QVZA 4F8YA 1R00A 2RGEA 3MJSA 4YJKA 1AMNA 2PXHA 2RMKA 5A4JA 3W4IA 1Y80A 1G2IA 1D7OA 5A71A 5EYPB 3IAHA 5CB4F 4EECA 2E21A 3RIHA 1G8GA 3LD9A 4XYLA 5JYEA 3EVNA 3ND7A 3TLBA 2X2FA 3ASZA 2ZUVA 4G4IA 4MGZR 4C4AA 3ADKA 3OE7D 2BIFA 3B53X 4P92A 1GKIA 1S89A 2VJLA 3NNSA 3P20A 1HMYA 3N0VA 4RKEA 4E6EA 3RANA 4E03A 5KOIA 5EVCA 1NDQA 1TD1A 3TB4A 2CLLB 1WCWA 5HUJA 4DHEA 3NHWA 1JDSA 5EIXA 2HA7A 3WX0A 3ESAA 1JKMA 2YIDA 3W79A 2CLCX 1B00A 1Q92A 2HF9A 4UBLA 1HLDA 5C8YA 1EGAA 3D4BA 3IMKA 1MVLA 3L6CA 2J48A 1TCVA 3SC6A 3REOA 3VO1A 3D31A 2JVKA 4FDUA 3GXOA 3CO0S 3PRYA 4M49A 5EEHA 4BZPA 3CT6A 3GCXA 4RAQA 1BD4A 3NUZA 4I4IA 3IKLA 5DGXA 4FJ2A 2IXEA 4JJGA 2W58A 3BGVA 2H2AA 4OHPA 4YUWA 2G67A 2QRQA 3ORSA 3B1FA 5KNDD 1EDBA 3DV9A 1E5DA 1A82A 1JPVA 1A9TA 1PN3A 2Y1CA 3J81A 3V9AA 5EE5B 1AOXA 3IVGA 3VDNB 2YICA 2IDZA 1HM5A 3NUQA 4YS6A 1OVMA 5TY0A 1PW7A 2QAGC 5BQOA 4JEHA 4RSRA 3C14C 4HKTA 3PHIA 4EPVA 4H7FA 2Z6VA 1O6FA 3TSZA 2YCBA 1TTQB 5BXYA 1HY3A 1S7GA 1VLMA 3CR3C 1FFDA 1SXJC 3GLUA 1ZRNA 1C0EA 3DUFB 3ESXA 2FX5A 3E27A 3ROQA 4V0MA 6Q21A 1E4VA 3WK9A 1E1LA 4MARA 3WFIA 3PC6A 4HAXA 3MW8A 3A6GA 3QE4A 1VE7A 5FPYA 3PXEA 1ODCA 1TYCA 3ZHXA 3I9MA 2FWAA 3QVTA 4DR3B 1Y9JA 4BV2A 1URPA 3OJLA 4CKCB 4J0KA 4G5RA 5F2NA 3AM4A 4YAUA 4OMUA 1WXEA 3TVYA 5BMVF 1UMKA 3H2GA 5SZHB 3NC1C 4F3CA 3WKAA 1DUVG 5THKA 5TS2A 1KDYA 2JFGA 3X3HA 4YQFA 5DEIA 3R5FA 1ETHA 1T10A 3N2LA 2QAGB 3L41A 4W9NA 5DN9A 5B1IA 4E2FA 1A04A 3D7KA 3G5MA 3LZ6A 3GIDA 2I76A 3QK7A 2B7BA 4EITA 4YO8A 2GSDA 5KKAA 5FIUA 3W06A 4LXTA 2I7DA 2BFFB 3NOQA 1XYGA 3VR5A 5ECWA 3HJBA 1ULTA 3GRYA 3PE6A 2IOYA 4XX1A 4AWBA 5HG0A 5IABA 3UWDA 5JNWA 4FTWA 4G2TA 1YZTA 2DKOA 1E99A 2KBFA 3RJ9A 3GJ4A 3GPLA 2PD4A 2WMOB 3VPBA 1R12A 3FDJA 5IBCA 1WR8A 3NLLA 2G9RA 2O3QA 1QO0A 2BCJQ 1YQGA 2GN0A 3QWFA 4L0CA 4MEBA 4IH1A 1V4NA 2AR0A 4KVZA 3RU7A 2JCXA 3SYMA 3IIIA 1YGPA 2J9RA 3EIQA 1RDFA 3A32A 4TPKA 3SYNA 3TTVA 4MICA 2FR8C 4BMPB 2XMBA 3OIWA 4WUTA 1ABEA 1VHJA 3NHFA 1W5EA 3BGSA 4G5FA 5AM4A 1G7RA 2Y67A 3BA6A 1CUXA 3L0ZA 1YH3A 2P78A 5CH8A 1ZBQA 4AO8A 4JI2B 2JEOA 3KHSA 1RQXA 4Q4DA 3QJYA 4GPAA 1GKYA 4LDRA 4DC0A 4UOZA 1U90A 3THXB 1WW2A 2V7EA 1O5IA 3CNQS 1Q0PA 3CXRA 3DOEA 3HWX1 2Z6AA 2R68A 4DIBA 1T6BY 2PFKA 3LLUA 3L0PA 4GGMX 4YJ3B 2ZIFA 5FJIA 3TLCA 2D1FA 1F2TB 3ZN2A 1GCIA 1OJ7A 4B3BA 5MN5A 3SDSA 2M6RA 4LQCA 3MGAA 3GJQA 4UQPA 5AKJA 5H80A 1NASA 1YZQA 2HO5A 3U80A 3V4OA 1YUBA 2DBZA 2FPWA 4DCUA 2VH2A 1I24A 2HLHA 3FVRA 4S1PA 3S2ZA 3SPXA 1Y7PA 3W5CA 1HORA 4GPBA 2VHXA 1TB4A 3CNEA 1CHDA 4R9VA 1BWRA 2QL5A 2C2GA 5NLLA 1W76A 1XD9A 4ZVQA 3EY9A 4TXHA 3E9YA 5E6UB 3WG9A 1S2NA 3MRTA 1MJGA 4JYPA 3AVYA 2HBZA 5L3SB 3NDJA 1VSQA 4B3DA 3VTAA 4GXTA 4G1UC 3VC3A 3JQ7B 1QVAA 5EWJA 3UPUA 1E3WB 1YL5A 1Q91A 2GVNA 4UDYX 5D5HA 2NVUB 1KMCA 1NMXA 4PYKA 3P9NA 5FTWA 3WLFA 4CETA 4OQYA 5M5BA 2GFIA 2HA5A 3QU2A 1QYXA 5JOQA 4FSHA 3CISA 3OX1A 4MQFA 4HJXA 1Q83A 5DMXA 1YQ9A 4DLYA 1W88A 3UKDA 3R3HA 5K8UA 4MCHA 3QE0A 5KWVA 2YHIB 4HAOA 5J63A 3IKMB 1ZR4A 3LF1A 2UYQA 4JBGA 2IH5A 3A1NA 1FTGA 3RJ5A 2JAXA 1A7KA 1FDSA 1ZWLA 3C3WA 2R8XA 2VYND 1NXXA 3I73A 1PIWA 3AO0B 3IUPA 5DGTA 2FUNB 5DLPA 4CLRB 1DAEA 1PAUA 2QRVB 3GR6A 3IJPA 3DPUA 1UXOA 1XEAA 3CLSC 1MQ8B 3IP6A 5EINA 4Z7NB 1H2ZA 3GZNA 4I1OA 2RHRA 4NOMA 3G9QA 3IVXA 3DG9A 3H1TA 2HJHA 4FLMA 4RJIA 4F5DA 2A35A 1C8LA 1N2JA 2Q2OA 2XA9A 3WMFA 2DCMA 3A9VA 1GUZA 2VOEA 4M7WA 2FU5C 2UXBB 1UPXA 1YBFA 3HSSA 4NU5A 2FZEA 1FE8A 1YE3A 4OATA 1R8XA 2WRZA 3MWDB 3I1IA 3HJGA 4E30A 1QGUA 1VKHA 1O8CA 1FDOA 2E1RA 1L5YA 3FFTA 4IDFA 5HS4A 2FV8A 2QE7A 1XRPA 4GBMA 4A73A 4YR9A 1T2NA 2DPXA 2Y9MB 5BSEA 3ITKA 3C6XA 5BRNA 2Q3FA 3FD8A 2VWQA 3CSUA 2XMQA 3C0KA 4YRAA 1USWA 4OMFG 5C8XA 1E3EA 4FFOA 1EB8A 1G6OA 2J0EA 2Z8YA 2FTKE 3DXZA 5B55A 2ZSFA 4DREA 1T8RA 3WGMA 5IN4A 4OP2A 2W48A 1T9ZA 1WV0A 2B1RA 2FMFA 1N1DA 2H51A 1H6DA 3KAKA 3KD3A 2QSYA 2VPIA 3QEAZ 4NMMA 3M9XA 1B1CA 2GAAA 4BLQA 2QSZA 2GXQA 4K8OA 4GOMD 3FHCB 3I3OA 1M2VB 4A16A 4D92A 5KTMA 2AN1A 3QKSB 4DN6A 3HGMA 2YN0A 1ZUD1 2GPNA 5IT4A 1GVHA 2FEPA 4L5JA 4CODB 1W2WB 3PNYA 1JLRA 2ZYDA 4KQFA 1GQOA 4BB9A 5DP1A 1V16A 4XX0B 4N3NA 2WT9A 1UKAA 1VOTA 4PGAA 2HZBA 1CDZA 2WM8A 4M7PA 4BRZA 2VDQB 2WM2A 1SXJA 3BK2A 1BXRA 1Q44A 4P54A 5LC1A 3ZYCA 2ZIXB 4L4XA 1A9OA 4N4AA 2XVYA 3V3TA 2R7LA 3ENZA 1JQKA 5LQNA 4DCPA 4QPPA 2E89A 1BHO1 3IHKA 4LOHA 4XYEA 1PHPA 3GJ7A 1TQ4A 3RVPA 4G07A 1YRQA 3PQ8A 4ROSA 1OFUA 3OTOB 3H99A 2W6OA 1A2KC 2EDAA 1LWNA 1P5HA 3CKLA 5F2KA 4XB2A 3RIGA 3ZIDA 4EVRA 2QTMA 4OAPA 3EZ7A 2Z6QA 4IM7A 1CWUA 2FWMX 4PLGA 2IYRA 3RGGA 1DAFA 5CURA 4ZEVA 4DLTA 3CLSD 4Y1RA 1M34B 3HDHA 1MXFA 2B6HA 1QYRA 3N76A 3L6UA 4MPRA 4EFMA 2RH8A 4HD8A 4QM6A 3DE5X 2Q99A 5ALPA 4TLLB 4NFSA 3THXA 2ZBPA 5ECDA 4JQSA 2NU7B 3MWLA 1IMJA 3UF0A 1T4CB 5FWXB 1XP8A 3NBZC 4DA8A 1DKMA 1LDMA 2OUKA 2WZCA 5A9TA 5KNCD 3B5EA 4K28A 1RWPA 2L42A 2XW6A 3H87A 1Q1GA 5REQB 1XRSB 5C4IA 5AKXA 4DUGD 5C35A 4L0QA 3MAAC 3PKZA 5ALOA 5I7FA 1GZ4A 3ADOA 3BCUA 1FYXA 3DS8A 5G2OA 2CVQA 3SEQA 3FKQA 4OL0A 1LI5A 3D6AA 1WDWB 5FO1A 2KLHA 3AC0A 3WK8A 1U8TA 4FUQA 4YCSA 1SFRA 3D8RA 3CPHA 2VNHA 1C4XA 1OXVA 1JGTA 3AERB 3K0FA 4BJ3A 5IJWA 5K6AA 4Z4FA 2QJOA 4MVJF 1MO2A 1QKJA 2VYQA 3I42A 3FDXA 5EHGA 1Z0AA 1V2HE 1L8QA 3UJPA 3KVNA 3LFHA 1MN6A 4Y1EA 2XB6A 1K8RA 2GYWA 4B3GA 1Y1TA 5EJ5A 4D5GA 1GA1A 2BFCB 1IBRA 1PR2A 3T95A 4F2HA 9GPBA 1E59A 1DRJA 4J8PA 2CNDA 3HBMA 3DFIA 2FY8A 5DHSA 5EQFA 4BWGA 2WP0A 5JQWA 4C05A 1HURA 1D4OA 3BULA 1VFNA 4TROA 1JAHA 5DK6A 4Z4HA 2F00A 2J31A 3FSGA 1T25A 1Z4QA 3WGJA 2JGDA 4FMCF 2X0IA 4MV1A 2QVCA 2MMGA 5JCXA 2UYOA 3VPXA 1XDDA 1TCCA 4M21A 3K16A 1KS9A 2QN3A 5CLIA 1VIYA 4KR3A 2ONKA 1JR3E 3L0DA 3LY8A 4E5NA 2C5BA 1Y1KE 5I51A 2X9QA 3TZ6A 2PKCA 3IE1A 4AZSA 1K97A 3UWPA 3AR5A 1ZN7A 3TQRA 4HDQB 5G1OA 3TRFA 3FG9A 4R81A 3D6JA 1UJCA 4BJ1A 1ZCFA 2QRVA 4Y67A 5D51S 1INLA 1CZLA 1D1QA 4JI6B 3TRIA 3EMBA 4XX0A 3QNUA 2AT1A 3O73A 5IH7A 5C32A 1HT1E 1PEKE 5CK5A 4XFJA 1AGRA 3HGQA 5DNDA 2NPFA 3DMRA 3EPJA 1JHAA 2NO4A 3OHPA 4OO3A 1QDEA 2C2HA 2C54A 4YFYA 4CLXA 1KYYA 4U7JA 3AXSA 1XQVA 1DKOA 1UK8A 3C6QA 3T54A 3F4LA 1GTSA 4KJZA 3OEYA 4DJEC 2ZVJA 5GTDA 2OOSA 1WF3A 4HS4A 2EJVA 5JVDA 2GSWA 5FNVF 2WSSA 3AVOA 5DYYA 4O8ZA 4E5KA 4YXWD 5KYGA 3ABIA 2R7MA 4P2GA 1T1RA 2NXNA 4MKRA 1L5GB 1GGJA 5P21A 2C42A 1C14A 2IELA 1RYHA 1NVUQ 2YXNA 4LJ5A 5ALQA 1L5KA 3CLUD 3DLHA 3AILA 5JDIA 1MORA 3IEXA 4IIJF 5FOXA 3U4DA 4GL4A 4LV6A 3LUAA 4P81A 4NBRA 5AUPB 121PA 4A9AA 3T7SA 4YJFA 1T24A 1GV1A 1VSVA 1T2EA 4M0CA 1YL6A 4QODA 5JWRA 3L8MA 1QV9A 1B1AA 4KQMA 1J2UA 1TUEA 3PQ4A 5BR7A 4KH1A 4NECA 1I0ZA 3EYAA 4MVJM 3A1WA 3RUDA 5IWCA 1YS2X 3U4QA 4QYMA 1YNOA 3BC1A 5AIBA 4U0JA 2W2LD 1MR3F 2BM9A 2B5OA 4WMLA 4R1PA 1ZOIA 2B8EA 1OGYA 3M6MD 3ZNQA 2ISQA 2GZAA 4IV5A 3V8RA 1KHTA 5IUKC 4XFKA 3M7IA 3T1OA 1RJEA 1SKAA 2AG5A 1DRVA 1T8SA 1W34A 4CQMA 1QE5A 2WTUA 3LCMA 5CDHA 1NF8A 4D6YA 4X1IA 2HOQA 2RGCA 1RFGE 1Z35A 1N2CE 5BW6B 2E5LB 3D59A 1FW6A 1FSPA 5JZ9A 1L4HA 4BE9A 1M2HA 1U7XA 5KSZA 1J1ZA 2HRCA 3KZXA 4C7OB 1T35A 2PUGA 3PIRA 1ZK2A 2BDUA 1HZJA 1P9NA 2GPTA 1E0DA 4EGJA 1VG8A 3IV9A 3NJ4A 1B0PA 3FPBA 4BCCA 5HTOA 1Q21A 3RIMA 4UEKA 1RQ2A 4M54A 1OKKD 4OB7A 5IAJA 3LYLA 3D8TA 1WCYA 3T4PA 4MS1A 1LQUA 4ZOCA 1MPTA 3QEOA 4BFZA 1HX7A 2FDXA 4IIXA 4C0SA 4DV0B 3W77A 2YV1A 1VCOA 3MLAA 3NHRA 4RIHA 3RV4A 2PUTA 1BXGB 2GZDA 5JMTA 2C7GA 1EINA 1G19A 3T7RA 4R31A 3N86A 4HRAA 1CRLA 2JAOA 5LMNB 1TMOA 1XROA 3OCWA 3VVCA 4JR2A 1YK0A 4H0NA 4AG5A 3KPUA 5TARA 2IQIA 2XGSA 3SLKA 5KJEA 4JR0A 4HJRA 1J24A 5C51B 1MTOA 4AKGA 3UHAA 4RVDA 2HTFA 2PQ6A 3AHIA 2RAUA 1X87A 2VAMA 1GRRA 4M89A 1SKUA 4ZTBA 4C1BA 1SOWA 4DV7B 4MB2A 4QYXA 1VL1A 5BN5B 3BBLA 2H2HA 5TGTA 3OJOA 1NQOA 1RAAA 3U7RA 4C9BA 5FUYA 2O1WA 2PZAA 1R27A 4MLZA 4Y2GA 3ETHA 2NLOA 3KEQA 4EPTA 3K70B 1WF6A 5K51A 2C88A 2FPUA 4QJ3A 1LD3A 2XF2A 2C4MA 3BTOA 2H4JA 3PITA 3O0TA 1EDZA 3KYJB 4MR9A 3E2PA 2YRXA 1LQTA 2X4GA 1GL9B 3OVMA 4X71A 3UUGA 5LWHA 3NP7A 2GBIA 2CXSA 4QGBA 4XGIA 5GONB 1LC0A 2JH8A 2X76A 3ANLA 4LQLA 2EJCA 4NARA 3NTUA 4DADA 2LBPA 1V4VA 1O54A 2Q6VA 2I7VA 2OY0A 1NW5A 1A9QA 4FYXA 3UPDA 2B30A 4HDNB 1GKUB 3RQIA 1MO3A 5TNXA 3GC6A 3TQQA 2Y99A 2A88A 3ZS9A 1X7GA 1N9GA 1QZUA 1JP7A 2PBFA 1AKWA 4O4HF 5E4YA 3DJFA 5ITVA 1CJVC 3S2FA 4JLMA 2BR4A 2FSUA 3FFAA 4CLHA 3IAXA 1CF2O 3A6JA 3IE2A 4ZMSA 4TYWA 2X9GA 2HEGA 2KE5A 4F6RB 1P81A 4FZVA 4GVLA 4LS3A 4TT3A 4Z1MD 3UC9A 2OL4A 3OJFA 4L75A 4CMKA 3MBIA 4KI7A 4R2KA 3EPPA 5GM2A 3IQEA 3GGDA 4BLUA 1CB0A 2J07A 4HDRB 1HT2E 1JVSA 1RZVA 1KJJA 1ZSNA 3ORYA 3IELA 4Q6BA 2GN4A 5ITZA 3HKBA 1A4RA 2ES4A 3IOMA 3KD2A 3NBXX 4ID9A 4X00A 1W96A 4MO9A 1IZZA 1HE8B 4LCJA 2WJGA 1XRQA 1IJFA 2E4WA 3RAPR 3C4VA 4EA8A 2X8AA 2XGOA 3K3PA 4KXFB 2PRKA 1XN4A 5ENVA 5TIIA 3SX0A 1M2GA 1NQVA 2HK8A 3GUCA 1WP9A 5FBRB 4TKLA 3W2IA 3GT0A 1PJTA 4FEAA 1AKUA 4PCAA 4YV1A 2NGRA 3U7EB 1Y42X 3QP9A 4F9GA 1PVDA 3D6FA 4MTLA 1UC5B 2ZBDA 4NRDA 3OSZA 4MLDA 5E7QA 4OK5A 1AB6A 2FRDA 4MQEA 1NRXA 1T36A 1HYEA 1K3FA 1HDEA 1M3SA 2HU7A 2V4ZA 3B89A 1EVEA 1T5LA 3W5BA 3A26A 4COKA 1WZNA 3MMSA 3WO0A 2ATIA 1GGKA 1KC3A 4OQZA 3P2MA 4G5YA 4CM4B 1DMRA 1D3AA 2I1LA 3HCPA 5ECYA 3F5DA 4IXDA 5FV7A 1NLYA 5LCXA 1DJLA 1EYZA 4UXHA 4IG9A 2WJJA 1UDCA 1XAGA 3MMZA 1JNYA 3SD7A 4A0SA 2GPAA 2AF3C 2BAGA 2QD2A 1LBHA 2V7QD 1LSOA 3E23A 4D46A 5AO9A 3MZ0A 5KMGA 2GRUA 4GDMA 3ONWA 3I23A 3UTDA 1PRYA 4CCAA 3DAHA 3MHTA 3H7IA 4MJXA 4KUGA 2NOAA 2XTJA 1Q1NA 4BNVA 4OV6B 5IKEA 2EFCB 3C3KA 3R5KA 5JDCA 1XA0A 2CGEA 3LSYA 4CLOB 2WNSA 1VP3A 1FDTA 2IZ7A 3N2NA 3K4HA 1IPFA 4QUJA 1AV6A 3LCVB 1KU6A 3B36A 4JVOA 3WDKA 2Q6OA 2QE7D 3KIPA 4H1VA 4TKMA 5ALRA 1IN6A 1LVHA 3SKVA 4OLBA 3DE1X 3HFJA 1ZHHA 2NU6B 4IQ8A 2WWTA 3NOOA 4WQMA 5D3QA 4WL0A 2YHSA 5D7NA 3T7DA 1EE2A 1N6HA 5B7NA 1OREA 2REOA 3GGPA 1M0EA 3ZU3A 4HLQB 1FP1D 4MHTA 1Z0UA 1Y5NA 3LT5A 4PEVA 3ZD8A 5IFKA 3WAGA 2XXAA 1DEOA 5LP6C 1TM2A 4HDNA 2HREA 4OHOA 4AKHA 1OBVA 1GDTA 4NDNE 3T1HB 2HFKA 1SIBE 3DPSA 2R7NA 2RBEA 1MBZA 3BCSA 2H2DA 3AKEA 2G7MC 4LI3X 2O8CA 1MB9A 4JU8A 2BFDB 3M6IA 3WTCA 5JSYA 2YKGA 5LDGA 3ZJTA 5AM0A 2PGLA 5JH7A 3YASA 1GKKA 1B6RA 2ERCA 1ODKA 2FPXA 2XOKA 3GNSA 3R0VA 2CE2X 3PT9A 4ZT5A 5LR6A 1OFTA 1P17A 4XGKA 2EERA 1OLOA 1WDMA 1QANA 1U8CB 4XJXA 3GLGE 3PQFA 5DP2A 2OBMA 2YYSA 3LHFA 1DT5A 1NW6A 5CYGA 1UP6A 3LBHA 3B60A 4PBRA 1PQUA 1HBJA 4NSNA 3EUAA 2PKRA 1ODTC 4UBKA 2P4SA 4ENWA 3AG6A 3DF7A 3HACA 2VL7A 1A5TA 5JALA 1MGOA 1U6IA 4AMVA 3KYIB 5FWYA 3SK0A 4J29A 2GN1A 1TLTA 2I6XA 2XUZA 3OWHA 4HFJA 4OQXA 4Q4LA 1J0AA 4Z9FA 1IJEA 1SZJG 2XCUA 5K2MA 3IUSA 3JARB 1RBMA 1RAGA 1V11A 1DXOA 1K2WA 2HHAA 3NFRA 3O90A 4CN8A 1KGSA 4A0FA 2Y1WA 2WMNB 3D6VA 2Q2VA 1RWVA 3ACCA 3BREA 3G1UA 4J16A 1A88A 5CJPA 3SEAA 2H9IA 1K8ZB 4KQEA 2VNAA 4KX3A 2J46A 2YXLA 4O2BF 1E1RD 4WCDA 1X2BA 4LNUB 1Z6TA 3ILVA 2ERYA 4G4SP 2PSJA 3SVZA 4RIEA 3VTKA 3QPCA 2BTOA 4KV9A 1R4NA 2ZP1A 4V0LA 1W88B 1KQNA 2Y4NA 4XGNA 3H5WA 3QY9A 3WLAA 3ZGNA 5J2TB 2HF7A 3SZUA 3TXAA 3USCS 2ZJAA 1O87A 2QN1A 3ELYA 1JFLA 4AK9A 1BFDA 4FMBB 4HYEA 4TN5A 3V46A 2RIPA 3EPLA 1KQFA 4BVKA 1PK7A 4FFDA 4NE2A 4D9IA 1PJRA 1RLOA 2HWXA 2WAYA 3BWMA 3P0FA 4QTZA 4MVJE 4TRNA 2VK4A 3OQVA 5DOZA 1D8AA 4BGEA 5JXGA 1GNRA 4B76A 1V3TA 3I9NA 2X58A 3DQPA 3KUDA 4ZT6A 1UPTA 2D59A 2ID8A 2I4MA 2UAGA 4Y6SA 3WAJA 2FW0A 1PHRA 2BFOA 1H69A 2GGSA 2X4DA 1V2GA 4UDNA 5SY6A 2OGUA 3RHFA 2A7QA 3GZTB 4MRVA 5CIQA 2CZQA 3T9AA 4E2XA 2OMEA 1TJ3A 5LZ9A 2QVGA 1K6IA 2FZ4A 3GG2A 1Z0SA 3MLEA 4CKCA 2V7UA 4TL6A 3VBEA 1BW9B 2F1RA 1ZRMA 3HHPA 4YTEA 3ZQKA 1UFRA 4FGWA 3DDOA 1HXHA 3PXCX 1P2BA 1V8PA 5EFOA 1SEVA 2JLQA 5BT8A 4F9EA 3JWEA 1KDPA 2GTHA 1E1QA 5CAEB 1ISJA 1RLUA 4DM3A 2R1VA 2QN8A 5TEVA 3FYSA 3F8SA 5D3ZA 4NS4A 3NHZA 5SICE 4I1UA 1E1RA 4N5LA 2XT0A 5JPIA 3FMGA 2GD6A 1V96A 2P79A 2W4MA 4O33A 5KNLA 2X40A 4JVMA 1EFRA 3HV0A 1FUUA 4R7ZA 4WVFA 1TADA 2P68A 3HB0A 2QRKA 4S1OA 3W2GA 1JKJA 4HDKB 4OPMA 3DB1A 1YJQA 3QF4A 3PUHA 3ZDYB 4JY7A 2NTVA 4CMAA 4CL8A 4DPKA 2ZWIA 4IDNA 4DLZA 4I55B 1V7CA 4FC7A 1RQGA 1I2MA 3CEAA 4FM9A 3WLKX 2P5UA 5AVKA 4OOFA 5JQGB 1PK9A 2YVLA 3Q9SA 3D6HA 1BEZA 4DA9A 1FFCA 5CT9A 1VKZA 2ZTMA 4II2A 2PUCA 1U1FA 3V4LA 1K8YB 5MN4A 3K9HA 1LZKA 1OX5A 4GYWA 3C97A 3GJXC 5IAEA 4AF6A 3NTQA 3MT9A 3G9XA 3VQTA 5JUWA 2QZZA 2JEYA 2ZXUA 2D4HA 3BHJA 2H3EA 1ZBDA 1OYOA 2WF7A 3WGQA 3WYCA 8OHMA 1ADBA 2YWGA 3GCWA 4GRIA 5EE3A 1Y3CE 4O63O 1UM9B 3BWXA 3JSAA 3QKIA 4IDDA 1Z2DA 4R2JA 3PP8A 1ECFA 4P5DA 4BRWA 1B8PA 2JDID 5B7GA 5KINB 3VYVA 2BL4A 2RG1A 4X65B 2UYCA 4R8LA 4YHBA 5H59A 4ZYZA 4GM4A 4JDPA 3T5TA 3VHXA 4BNDB 2VBCA 4DANA 4MGYR 4C5AA 2B78A 3GDGA 3HRIA 2C2XA 1CDDA 3WMWA 3UT0A 2CJPA 4MW4A 1QQ6A 3JYPA 5FFFA 3LZDA 3RRMA 3SI7A 1GN8A 1IB6A 1SVKA 4C07A 1Y8RA 5EJGA 3DOCA 3RYTC 1IAVA 3ZCPA 4W1SA 5DM4A 4J3NA 2XB9A 2XQIA 3CX7A 3MTQA 1XNQB 1RADA 5LM3A 3UXMA 1Z12A 3N07A 1XJQA 2N0SA 5HEKA 1V5FA 2D2FA 2BY4A 4U3JA 4EF5A 1YA4A 1KNXA 4MP8A 5CEFA 4EZBA 3GJ0A 4LYGA 3MCAA 3O38A 4P08A 4N0PA 2C82A 1NMEA 1RPJA 2MINA 3G2MA 4HPWA 4KBFA 2H1WA 4MWCA 2XNCA 5G1PA 4EW1A 4XVCA 4FXPA 3ZUPA 2VN8A 2IEGA 4Z7OB 2PRSA 3BAZA 3BE4A 5EJEA 4N0DA 3RVJA 2CXQA 1R15A 1I3KA 4DILA 2OSVA 3W3AA 1GGHA 4H3KB 3VOSA 4D99A 4G41A 1FJ2A 2W4QA 3CNBA 1T6NA 2EBWA 1EQAA 3FROA 4U2GA 3R8CA 5HX7A 2W2QA 1W4LA 2CXHA 2G9QA 2ZYSA 1U8XX 4CBVA 2B20A 4GYKA 4CEIB 2W70A 5AHKA 5FX2A 1GPLA 4R7TA 4N54A 1E6UA 7REQB 3OJCA 1RAEA 3IAFA 2Y0DA 3H9CA 1KOFA 3G5TA 3OOHA 1G17A 3O8NA 1Z7WA 4JBLA 1L5WA 1E3WA 4JI1B 2J4CA 3H42B 3PFIA 5K6AC 3EUFA 3B6KA 4F11A 1E3IA 3AI2A 4LWOA 3ZH2A 5J2UA 1MABA 5KCMA 1CSEE 3V8EA 3HR7A 3KHKA 3LYHA 3P94A 1PDVA 3G6WA 1IM8A 5GV7A 4DUPA 4IO1A 1U99A 3TTWA 2Q1XA 4LJ7A 1TVMA 1SUWA 4XSGA 4E70A 2CNOA 1RPTA 4LF6B 1FQJA 4C21A 4DZZA 3ZQUA 1E92A 5BURA 4JWKA 4V2IA 3RIYA 2IS4A 1ZHFA 2JFQA 2RE8A 2YW2A 5DCYA 2BCEA 3WFJA 3VVBA 5FQOA 2WWFA 2XDQA 2QOEA 4CM5A 4RULA 5DNAA 5ESRA 3U40A 3WRVA 3GJZA 3PPVA 1HLGA 1F6BA 1N0VC 2HDOA 2R4TA 1E1NA 3S8MA 2ID4A 5AVWA 1FA9A 2O3JA 2Q3BA 2ILVA 1ZJZA 1PT5A 2EJBA 3ZOZA 1MABB 3MD9A 2H57A 3N1UA 2VF4X 3B1JA 4RQBA 4BATA 3NXKA 5A3SA 1U2QA 1TO6A 3F49S 1TI7A 3T3NA 2PWZA 4ZV7A 3BIOA 4BWVA 3M4XA 3RS8A 3AWDA 3MFQA 4LF8B 1D0IA 2B2XA 3D8UA 1GPKA 2DR3A 4JHXA 4MVJP 3F6CA 2GVZC 4B4OA 4UVDA 5J5VA 2YJTD 3ANSA 1GG9A 2I2FA 2XTMA 1BS9A 1X7WB 2XTAA 4UTNA 3AUYA 3BL6A 4EJFA 4B5LA 4XJSA 2P1RA 2NU6A 4Z7JA 2WKRA 4NNOA 2IL1A 3H4VA 3GYGA 3A1TA 4L6CA 2PGOA 3LPAA 1RBZA 4QGGA 4L9RA 4FW9A 3DCIA 5IM4A 5K9ZA 2LCIA 4ETIA 4WOBA 5B30A 2ESRA 3M8KA 1P2FA 4BQPA 1LV8A 1UADA 5ECGC 1GU0A 1XFDA 4FOPA 2F43B 1QMPA 2IUFA 5JCZA 3U1TA 3AHHA 5FRDA 2C59A 3L6BA 1RBQA 5EZSA 5ARBA 1O08A 3P0IA 4L73A 5FAXA 2W71A 4Z8XA 4KOAA 3C43A 1T9HA 2Q21A 2JI4A 3TXXA 4PZLA 4EB6A 5CX1A 2CF5A 1VPTA 5DW0A 1RXSA 3F90A 5E0KB 1ZVVA 1KJZA 4JIMA 1OVGA 1R5NA 2OGWA 3O8DA 3ONVA 4ISBA 4MCIA 4YP1A 4BFVA 4QTXA 2OXEA 1M2KA 1YACA 2C95A 2QUAA 3VPAA 4FOSA 4KIGA 5EC8A 4ZOQI 3IRVA 7GPBA 3JSXA 4OI0A 3L1IA 4PWYA 1JTFA 1X1RA 2WIJA 5TPZA 3EUEA 4R68A 2ZAMA 4IQ4A 3VX3A 2JIRA 2AW3A 4J76A 5ICSA 2O50A 2VT7A 2C83A 4L6IA 4MCJA 1QIEA 2R0QC 8MHTA 3LWNA 1XMXA 4LSWA 4QU9A 1UDBA 2HYIC 5C8ZA 3E61A 5KJCA 2GCOA 1O3YA 3ZD7A 2R1ZA 5DNWA 2AG1A 2O6LA 1VYUA 1AK9A 2GKSA 3W6NA 5KREA 5KQMA 4ND8B 1ATZA 2BFEB 4TSKA 4TV8A 4EW6A 1ECBA 4TV9F 4Q19A 1SQ6A 2RKOA 3U4AA 3AVWA 2Y1XA 2ECOA 1OZFA 2ZYIA 4RW0A 4URWR 4YVFA 2Q41A 1OX4A 2Q5CA 5T6MA 3G8CA 2CHEA 1XZPA 4PZ0A 2NXWA 1X1CA 1TFRA 4LBYA 5FFNA 3WL4A 1FS4A 3OWOA 4BE4A 2UZ1B 5CFLA 3CH6A 4PO3X 3W7BA 1U63A 3L7DA 4NFHA 3VR0A 1TMKA 1GZ3A 1ZMBA 1TK9A 4F9TA 3BTVA 3RS3A 5BRJA 4EVIA 3FOEC 3SCZA 3AFGA 1KZYC 2FWPA 5KOYA 3MSCA 2F67A 3QW2A 2F59A 2ZI9A 3LMKA 3G0GA 2AZDA 4E7PA 3KUKA 1SK8A 2XMSA 4TGLA 3SF8B 4M8NE 4DCTA 3U3XA 5EY5B 5JCJA 1Z7BA 3D7LA 1O97D 3CVOA 3KTDA 2NWQA 4MHSA 4RXTA 2CDBA 4TVOA 5DGCA 1B23P 4TX1A 4JZYA 3BMQA 1TQ2A 3SQXA 4BLRA 3ND8A 1XTBA 3G2NA 3QVJA 4FOTA 3BIFA 1DL5A 2YWBA 5E6SB 4K26A 1IBMB 2R1VB 2R44A 3V1TC 1OWNA 1ZGGA 3R1IA 5B1EA 3HYRA 3DZKA 4EUEA 4H6XA 3KQOA 4HSEA 5BSGA 2GZHA 1H8HD 3R5XA 4IVNA 4LTDA 4J94A 5CW1A 3GJSA 3OM8A 3HYLA 2WFLB 3DZCA 1I8TA 5HRUA 3ECSA 4W5QA 1KF0A 2OO5C 2OXFA 4KAJA 5G0VA 4ZEXA 4MR9B 2QN7A 4NBTA 1NPTO 3J81k 3FTNA 1T29A 3LYAA 1HQKA 2FQ1A 3AR9A 3PDIA 4G84A 4L4ZA 4KPUB 5ENDA 3L4KA 1VHDA 4OX9Y 4B7AA 3R3VA 4JN6B 4EJ0A 3CSDA 3HXLA 4ESOA 1G98A 3S27A 3GJ6A 5G4KB 2QEQA 3K2IA 4C0HA 4DR5B 1O6GA 2X14A 1OX6A 3J7AC 1OAOC 4ZP1A 2C2WA 2ZM6B 1L5OA 1D2AA 3LHSA 3FOBA 1JG1A 1MX5A 1Z0DA 4IOMA 1C29B 1E6WA 4WNAB 1DLIA 3Q7TA 3UIEA 4D74A 1U9CA 4BNWA 1HDGO 1HSZA 3S1SA 3JVIA 1G0OA 4E94A 3TK1A 1T0UA 421PA 2CB9A 2I5PO 4FN4A 2B8WA 3C15C 1ID1A 1H0RA 4L16A 4B3SB 1NSFA 1OSNA 2C97A 1PNOA 3ESBA 3QOFA 1FFHA 1BDMA 5L4SA 3KJQA 3WDSA 4H1UA 2Q0XA 4C0QC 1FVHA 2EBUA 5JPDA 1QFZA 5L45A 3OPYI 4WZBA 3NWPA 5U4XA 2GA8A 1X77A 2RCNA 2BBTA 2XMPA 2VDRB 5I7UA 4KWHA 5JO0A 1SBNE 1FJGB 3AEUB 1C3JA 3IUNA 1KO4A 1PDOA 4HB3A 3GUVA 1Q50A 4LXQA 4WINA 1K1EA 3G2JA 4KHPB 1JWBB 3GAAA 4LDAA 4X3PA 1NXSA 4EGFA 2O8DB 3TMKA 4GGPA 5JH7F 3UJDA 4ENQA 1NW7A 2VWGA 1ZP6A 4HLNA 4IQGA 3SHTA 2K6GA 1H2HA 4S0XA 2PL3A 4L0MA 2B4TO 3MHPA 4PXYA 2HD4A 1TU3A 1RAHA 2J8ZA 1JQAA 4HNGA 2DTEA 4I5DA 2Q27A 3I5UA 1DDIA 4ZQHA 3TRKA 4OMCA 4KFUA 4XM1A 4NZPA 4M4SA 2HPZA 1XU7A 1R6AA 2GN8A 1G60A 4EO9A 5LQUA 1JAZA 3H2SA 5AI6A 4Y1GA 4WKOA 2A5GA 4HAUA 4EAAA 2AKYA 2NZJA 3TSWA 3WWZA 5I7VA 2YFQA 2WM3A 1RWBA 1PKEA 2QMEA 4OGGA 4CQMB 2X5KO 2RC6A 5DNUA 4NDAA 1FUYB 4RD4A 2REQA 2PFSA 3H9BA 2IW3A 3GY0A 1Z6QA 2O0MA 3VJKA 4BLTA 4YMGA 5JC1A 3L6EA 2UZ0A 3HLKA 1SRRA 1N1GA 1WPQA 3GP5A 5FL3A 2NUTA 4INJA 4LY9A 5FR1A 4DCMA 2LGJA 5EXEA 3DKRA 4PTZA 3I9JA 3TKYA 4I3HA 4AZVA 3RS0A 2G1PA 1D2GA 1T9DA 1T43A 2ILTA 1I7LA 2WFMA 1GXSA 3A6HA 4JLWA 3GGSA 1N92A 1YFKA 3MCUA 4MH0R 1QOPB 3M6WA 3ZGVA 2Y0BA 5CD9A 2JI7A 1W1UA 4G9BA 2OZEA 2G3YA 4N7BA 2WR8A 4BO3A 4R8RA 5DYIA 3OZGA 5AHOA 4ZAWA 4ZICA 3F0TA 2R6DA 3SHFA 1CQWA 3JQAA 4KMRA 2BR5A 4JP2A 4CEJA 2D1RA 2O8EB 1NXVA 1IUKA 2IP4A 4BC1A 4BFWA 4OSOA 3STWA 1Y6RA 1AUXA 1I7QB 4IJKA 1DI0A 1HT3A 2IYZA 3TDMA 1TJ4A 1H94A 4LW8A 5ER6A 5E3HA 4FILA 3WWEA 4PONA 4DTIA 1QIHA 1W35A 3KXPA 4Z6KA 2EKLA 1OLXB 2WWWA 2VJNA 3CX4A 1XN1A 3S28A 5L6LB 4NTZA 1IONA 1GPAA 1UZNA 5HQ3A 2NZVG 1HLFA 1EM8B 2QG6A 4WLNA 2GKOA 2XUQA 3K1AA 1TGVA 1PE0A 3E70C 4B6FA 2EFEB 4HFNA 4C4TA 3H5VA 2Q8NA 4GUAA 4BB5A 2W4IA 5BSTA 1EK2A 1L5SA 2B37A 1PQPA 3FDZA 4UXJA 4BX8A 1U3FA 1V0JA 3E8MA 8AT1A 3TW4A 1XT6A 3D81A 4URUR 3EE6A 3ISTA 2C77A 4GICA 5ALJA 5IFLA 3SZOA 1J25A 2RHTA 1V8FA 1NMZA 3CZCA 4X3CA 2XE4A 3AB3A 4JMPA 1N75A 4OSPA 1TYDE 1RWQA 1QQ5A 3EBOA 3PFWO 4KGZA 2PLWA 3I8XA 1CJTC 4CGZA 4D8YA 4DKXA 1KJNA 4DV3B 1AGYA 4G0YA 3SHVA 1T5DX 2BFWA 3KLMX 3ORFA 4N6NA 1PP4A 2PX2A 4LEIA 3KJEA 2HLDA 2YINC 3GJTA 3R5SA 5ADVA 4LRXA 2KSQA 4I50A 1CD5A 4OBXA 3IQGX 4FKZA 4UMDA 2OZVA 1XQYA 4LZLA 3U7HB 1N25A 1QRRA 4IDAA 4CMEA 3E22B 3U26A 1UBNA 3AVXA 1PJSA 5EIBD 3KR9A 3SZRA 4AX4A 1LRLA 3CRQA 5FBWB 4TQGA 5EHNA 4YO7A 1KYVA 4EVQA 3MUOA 1P1JA 4QOHA 3A11A 4RQUA 5BSHA 4PF1A 1DBRA 4H60A 4ILKA 3DO5A 4JJKA 1DAHA 1KJYA 3L5OA 2JFXA 3NTVA 2WHPB 1V48A 4Q4JB 4RF5A 4GKBA 3G2IA 3K0KA 3K30A 3NRBA 2ATEA 3JTMA 3H9JA 3PYXA 2CBZA 5DW3A 3O2SB 2I2DA 1XCGB 1ODJA 4GXNA 4BU0A 1E7WA 3LX5A 1FYFA 3AETA 3UMMA 3S8YA 1Q7EA 1MRZA 1F12A 4M1OA 3T3IA 3RB8A 2F3RA 1GZUA 1YB6A 2C1ZA 2OUIA 4JS0A 1R66A 4MR7A 3WICA 3KT6A 4IQFA 5IPFA 5JSQA 1R4MA 1H23A 2XUPA 3EH1A 1S2GA 4D8UA 3A1SA 3ES9A 1QAMA 3MINB 1M76A 1X1SA 1O95D 2A57A 3CBGA 4K9MA 1MJNA 4KE7A 1SU6A 4OREX 1P1BA 2ZGVA 3JQGB 4MTCA 4OM7A 1HWYA 4TZ0A 3OA2A 3WYAA 3TBHA 1R8YA 3PQ5A 2NW6A 4LVCA 1QO9A 1OXMA 1JSZA 2AJTA 3DEHA 4L8YA 5CYFA 2QQ0A 3BE5A 3CQ9A 4FHGA 4B6QA 2IOFK 3BMXA 1JA9A 2D7JA 3H6GA 2W42A 5LXTA 4IKEA 4JV5B 3GT4A 2V4MA 3LHDA 2Q1TA 2ECFA 4D98A 1KYXA 2WE7A 4DGSA 1TJPB 1N2XA 4U9HS 4N47A 1XF9A 1VXRA 1WMBA 4MRMB 4NI5A 1LBTA 2IU4A 1NYRA 2W9XA 1KIAA 1VSUA 2AWNA 4OXYA 4QUGA 1E4OA 3CM0A 4LF9B 2C1EA 5HILA 2GAFA 3JASA 3F71A 5A4MS 4YJGB 1JMYA 3UJNA 4K6FA 4CKWB 4MZDA 2QROA 2WYHA 4XYBA 3HN6A 2LWIA 4YASA 4HVLA 4TM7A 3PX3A 4XYMA 1EWKA 1KFJB 1Y7TA 1PJBA 3I39X 3O8LA 2AUNA 4GE3A 4N39A 1U8ZA 1HTBA 1HQCA 4LGVA 1O57A 4PVDA 4B1FA 3AKCA 1VTKA 4TZKA 4ZYTA 2F1OA 2ZULA 3TNJA 3CEHA 4O4HA 4MIKA 3LK6A 2V1UA 1Z0IA 3HP1A 4KPGA 2WQZA 2FZLA 3U1VA 3TNYA 5K8VA 3FPAA 3OLCX 2BFBB 1HYGA 4WACA 4Z4CA 4ND3A 7AT1A 5DI3A 5EQDA 4GBJA 3EIXA 2J08A 1VL2A 3G0HA 3EZYA 5GPBA 4XM2A 2XOXA 2JZCA 3A9RA 1Q0SA 4GOJA 2BSAA 3OOJA 3G8YA 1UANA 3Q3IA 5H68A 3VR6D 1XWFA 2K7FA 3B12A 4MW6A 3WLLA 4F3NA 1CRPA 4OA8A 2AWOA 2PUJA 3AOEC 1FFXA 2QXTA 3I2IA 3RARA 2VJQA 4BX9A 1DJNA 2QAGA 1E6KA 5EWMB 3OZRA 2H2WA 3DEYX 2YJ5A 1C30A 2FR0A 3TRHA 2O2IA 4QAQA 2FJPA 1E0AA 1JT2A 1SHZA 4MWBA 2ZRAA 3OQOA 4OSEA 1I2AA 2Z43A 1P1KA 1Y8RB 2HSDA 1A9XB 1WCXA 2IXTA 2Q1UA 4FP9A 1COWA 4H4EA 4JCOA 2HSJA 4UM8B 4OI4A 1B26A 2NZUG 3CNHA 1XD8A 1JSCA 3M4JA 4OQMA 3SQMA 2PBZA 2WUWE 2LUOA 5CIYA 3CURA 3IBFA 3KELA 3V4VB 4YIHA 5MGNA 1RACA 1X15A 3GIWA 4YY3B 3H97A 1B0AA 2HWKA 2YFYA 3IDFA 1ZINA 2QJTA 1ECGA 1P9LA 1U8FO 2WTMA 3FMOB 3HDGA 3G7NA 4X90A 2DB3A 1K3TA 1EQUA 1LVGA 2QLTA 1XZIA 3H17A 4EGAA 1U7TA 2V65A 1PFUA 1CQIA 4RBNA 4YLYA 4RF3A 1ORDA 3II6X 1ELOA 4IIHA 4M9RA 3WE7A 3L7AA 1AK1A 1ZICA 3QKSA 1BFUA 4BN0A 2FW7A 3EZFA 4IJ5A 4JUAA 1TZKA 2VC2B 1PTJC 2EKPA 2ZLBA 1P5RA 2FE4A 1ETUA 1IHUA 1SCJA 2DWPA 3PD0A 2IHNA 2I9PA 1O9BA 2I6GA 3OIDA 5IYZA 5D3MA 4EFDA 3B7PA 1O58A 1YAJA 2XXJA 2Y0EA 2YNMA 3ZWBA 1FYEA 2GBPA 4A26A 2XZLA 5AIAA 2GR9A 4QFDA 2WZBA 4D9EA 1FUEA 3QBJA 4H35A 2IBSA 5L3SA 4LBZA 5GIPE 2FA9A 2A5JA 2HQBA 2WUEA 3O4JA 5CA1B 1E6CA 1RWWA 2IIQA 1PZHA 4IDHA 1QHHB 1NNEA 2WIGA 3EVAA 5FBHA 4HZIA 4PFQA 1DKLA 4OYHA 4LJ6A 5TPWA 2PX3A 2QM8A 3DEFA 3KQWA 3C45A 1DJMA 1P31A 4OYLA 3SF0A 4JHLA 5BO5A 5KOJB 5ISMA 3AB8A 3AP3A 1YKFA 4G89A 4HRXA 3SSOA 2EC5A 4RVCA 3DMYA 4GC9A 3A1FA 1Q5PA 1VLJA 4JT4A 5A7HA 3T7JA 1SA0A 5JTTA 1TEXA 1GQRA 1MOPA 2MMCA 3S4YA 4CWAA 1QQ7A 4YRMA 4C78A 3ESDA 4G0QA 1S8AA 1T9CA 2F90A 5KMGB 3V1LA 1E9BA 4B17A 5A04A 5FEUA 1X7XA 4MROA 3UFXA 2Y68A 3K1YA 4ENTA 3MTEA 5FOSA 3KKMA 1ZVMA 3ENVA 2MCFA 4AJ4A 4F91B 3G13A 4CLRA 1LLFA 5HIAA 2F17A 1T2DA 4EKGA 4MUFA 3U16A 1R88A 2VSXA 3H4IA 3QWHA 1HKUA 1NWCA 4I4NA 3RGWS 3G59A 4DBLC 1UXIA 4HH1A 3VJMA 5CJJA 4EJ6A 4C01A 1Z6GA 1IG3A 3BRSA 3NV9A 2BUCA 6CHYA 5JVDF 4KR2A 3IQDB 5GOTA 4FFRA 3KYCA 5E7MA 4PTLA 1P8AA 1BJRE 1F51E 1XQ1A 4MQFB 5FUQA 3X2EA 2G7ZA 1CUDA 4UEJA 3ZY3A 2PLNA 2PPLA 5IUJC 3MAGA 2XZDA 4K03A 4C08A 4OJTA 2Z4SA 1LEHA 4PGMA 2ZPAA 1O96A 2DKNA 1JHMA 2MOKA 3IR5A 3IFSA 3WIUA 4LSMA 1NN3A 3CG0A 4DZRA 1RI2A 2DU8A 3B20A 4NOJA 1AO0A 1RLMA 2WD7B 1R10A 3RFXA 3WLSA 4G4SO 1XVTA 2EJUA 5E9QA 3TR5A 4C1NA 1N2IA 2D2IA 1E63A 1JJBA 5JSHA 2IU3A 3B82A 2BOVA 1RYDA 2ZUSA 3FGZA 4MQ5A 5JBIA 5IXJA 1UKEA 2DJIA 1KMHA 2PZEA 3FYUA 4X0EA 3C87A 3K94A 5JROA 2I4LA 1NVBA 2GD0A 2FUG6 3H2KA 3INRA 3LT4A 4JUFA 4P7JA 4W8OA 5EZ6B 5ICGA 5KTPA 1TCUA 2QM7A 3FM9A 3P4UA 1XZLA 2NUPA 2PEZA 4AJIA 4M53A 1KJIA 4J43A 4R40A 2PRYA 4PX5A 3SQLA 3VU9A