4Y1RB

Sav1875-cysteinesulfonic acid
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
169
structure length
168
Chain Sequence
KVAIILANEFEDIEYSSPKEALENAGFNTVVIGDTANSEVVGKHGEKVTVDVGIAEAKPEDYDALLIPGGFSPDHLRGDTEGRYGTFAKYFTKNDVPTFAIHGPQILIDTDDLKGRTLTAVLNVRKDLSNAGAHVVDESVVVDNNIVTSRVPDDLDDFNREIVKQLQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional insight into the different oxidation states of SAV1875 from Staphylococcus aureus
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus mu50
molecule tags Hydrolase
molecule keywords Uncharacterized protein SAV1875
total genus 58
structure length 168
sequence length 169
ec nomenclature
pdb deposition date 2015-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01965 DJ-1_PfpI DJ-1/PfpI family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4y1rB00
4UZSA 3UOWA 3ZJ5A 4AUEA 1KWGA 3B3AA 4ENTA 3UK7A 3TTTA 4ZDKA 1QVZA 4AUMA 3B38A 4I2NA 4Y1EA 1U9CA 3TQIA 2VRNA 4Y1RB 1OX4B 2VKTA 1KXJA 3P9SA 1FY2A 3BHNA 1R9GA 2VXOA 4L95C 1T36B 1UCFA 2RK6A 3D54D 4I46A 4N12A 4OIFA 3CZAA 4WINA 5JZOA 3SF8A 3L7NA 4HCJA 1T3TA 4N0MA 1T0BA 4BIMA 1GGFA 3L3BA 3PQ6A 4P34A 1I1QB 5SY4A 2A9VA 4P35A 3MIIA 2LXNA 1P81A 4B2YA 1GPMA 1VCNA 4L78A 2ISSD 2V4UA 4OGGA 1M6VB 2OR3A 3FSEA 3NVAA 2R1TB 1ONSA 4OJYA 4BTEA 3TTVA 2W7TA 4ENPA 1CE8B 4LGYA 2NV2B 3P9PA 4ENSA 1OX6A 1FYEA 4Y1GA 4MNTA 4L8YA 3F71A 3EFEA 3TTYA 1C30B 2ZUSA 3PQ5A 4ENRA 3UMMA 2D7JA 3EWNA 1C3OB 1CF9A 1IZZA 2YWDA 1L9XA 4Y0NA 3ER6A 4P36A 4L7QA 4OFWA 1JVNA 1P80A 1IPHA 4OQ4A 4UCFA 1J42A 3NONA 4XLLA 4Y1FA 4B40A 5SY9A 4P2GA 1I7SB 4D1YA 3F5DA 2VPIA 3WFZA 2AD5A 1QF7A 1GGKA 1IZYA 2XF2A 3PQ2A 4MGHA 4Y1RA 4E5VA 4R7GA 3UJNA 4I4NA 4E08A 1P7ZA 4L8FA 1JDBC 2WJZB 4RKWA 4ENUA 3L4EA 2ZUUA 3P9QA 1O1YA 1KEEB 1KA9H 1VHQA 3KKLA 1CS0B 3EZGA 1PE0A 3TTWA 4ENQA 2H2WA 3OT1B 5JZMA 1WL8A 4ZGGA 2GHRA 4K2HA 2ZUVA 4ENWA 4QYXA 3PQ8A 3SF8B 3EJ6A 5BV2P 1N57A 2R1VA 2VDJA 5DFAA 3R76A 4AJ9A 1OX4A 5SYAA 3TTXA 3SOZA 4B5KA 4AUNA 3PQ3A 4GE3A 1PV2A 1G2IA 4RKYA 3TTSA 3R74A 1PDWA 4ADSG 4QYTA 4LRUA 1PDVA 1Q2UA 1A9XB 1K9VF 3L18A 2ZUTA 1GG9A 3CZ9A 2YWCA 4ENVA 3UGJA 1BXRB 2R1VB 1P5FA 4PXYA 3R75A 2YWJA 3B36A 3BWEA 1GGEA 5K4AA 4MTCA 1VCOA 2RK3A 1SOAA 2YWBA 3N7TA 4BFLA 1OI4A 2NV0A 4ZDIA 1P7YA 3CNEA 2AB0A 1SY7A 3CYFA 3RHTA 2RK4A 3NOVA 3GRAA 2R1UA 1QVVA 3TTUA 4B31A 3CY6A 4P5PA 3EN0A 1GPWB 1QWSA 1OY1A 2ZUWA 3NORA 1VCMA 1OX5A 2R1TA 1QVWA 4UNIA 3NOQA 4S0ZA 4UOZA 3MGKA 4GE0A 1Q7RA 3NOOA 3PQ7A 4UOQA 1S1MA 3ZR4B 4L8WB 4JQSA 2FEXA 5LIRA 5E9AA 3ZJ4A 2ABWA 3FIJA 4ZDJA 1I7QB 1KWKA 5IP5A 3M3PA 4WXYB 4AULA 2GK3A 4B7AA 4OGFA 1QDLB 3PQ4A 4GUDA 3P9RA 1GGHA 5SY6A 2IUFA 3VU3A 1GGJA 3OT1A
chains in the Genus database with same CATH superfamily
2Q6IA 3V46A 2VDLB 5ALLA 5D3KA 2FPUA 1FUUA 3GH1A 4XZ3A 4ND1A 4I2NA 4G4SP 4CGZA 2W2KA 5LQDA 1E9DA 4GM4A 2J8ZA 4V0OA 2PH1A 3U5TA 3K05A 1WMFA 3JRXA 1H1TA 2HLDA 2A33A 1A4XA 2BBOA 1K6JA 2P6OA 2ATIA 2X4LA 4Z51A 5J3JA 2VRWA 1O08A 3O83A 1VG9B 4MV0A 2PKQO 4PXAA 4V2IA 1J56A 3B9PA 3LC2O 3DOOA 4R4JA 4URWR 4B83A 2VTBA 3OLYA 3NXKA 1N1DA 5JAPA 4WCFA 3VH3A 5BOSA 4MDEA 4XDHA 4B80A 5JQGF 5A05A 2CKDA 2Z3WA 4FQ8A 1G6HA 1N6LA 2PUGA 3OO1A 4L0MA 1GU0A 5DI3A 2HRZA 3O4IA 4Z8XA 2MSEB 1FNMA 3EAGA 4ZVNA 3NAQA 2DTDA 4DLWA 3FTDA 1Z88A 3UF0A 2OCBA 3NBUA 3PNKA 3MQFA 2G1JA 3CF4A 4NOLA 4R9SA 4UTNA 3WBJA 4OQMA 2XE4A 3P9YA 1PJ3A 2LIVA 3C87A 1BXZA 4BQPA 4KUEA 2OV2A 2I4LA 2F59A 3O6VA 4O33A 3MILA 4BLQA 4HS9A 5ITWA 1JEYA 1QE3A 5FBVB 2FXVA 2ODEA 2O8CB 4PS0A 3FNQA 4RY2A 2JPDA 2CHFA 3DFKA 5FHRA 3PP8A 1ENYA 3EUFA 4HTFB 4V3CA 3UG7A 1RZRD 1QH9A 1QF7A 2AT1A 3NAZA 1IBSA 1IBKB 3NX4A 4N9WA 1MLDA 3H83A 5CB0A 1SQ6A 4MI1A 1MP0A 4Q3EA 3L1JA 3A6PC 3PL5A 5EE3A 2BUAA 2QGNA 1NW8A 1GLVA 2H8GA 2AG0A 3FROA 1FBTA 3OUZA 2Q4OA 2H2WA 4FFVA 1D4FA 4H6WA 1IQ0A 4LN1A 5BR4A 1OR8A 1SCUA 2FDRA 2Y77A 4Q34A 5T67A 4C9BA 3PDIA 4B6GA 1QCYA 4AMBA 2N75A 2FPLA 4W1RA 3HKBA 4PPFA 1M2OB 3HNOA 4MIEA 3I3OA 4H1UA 3RHZA 2HU5A 2TS1A 3NEYA 3H5AA 3KLNA 2OQVA 5KTRA 3JWHA 2XNKA 1G1MA 1LWOA 1ZUD1 4KJZA 3CNHA 3X1XA 5A6SA 3FKSD 3ZVKA 1DJQA 3ETLA 1ZRNA 3ESCA 4KO4S 1H3FA 2WF8A 2GPBA 5IT5A 1TYAE 5GJVC 2DBYA 3LZDA 4YRZA 3U4QA 4Z0TA 2PCLA 1YONA 1KYTA 2MSCB 1WQ4A 3CA8A 3QF7A 1AXGA 4B6JA 1QHYA 1UFOA 5A4DA 1WXQA 1Z45A 1JILA 3EQ6A 3N7TA 1GUYA 4JBXA 4D81A 3QJGA 3QX3A 1A2BA 2CNWD 3L7JA 1OLUA 4NZPA 4REQA 1VPWA 2TYSB 1GCIA 3CT4A 4RABA 3RTAA 2CMKA 3CX6A 3LKDA 2VDQB 3C39A 5FLYA 4ZCPA 2CJXA 1R3DA 1B2RA 3C8UA 3CCBA 3M0EA 4FS8A 4S0ZA 4XSHA 5DK6A 2O8BA 1Q12A 5EMMA 1J00A 3V8NA 2C77A 2OAQ1 1L8XA 4DYHA 3SGLA 3QXHA 4TT3D 2JVIA 2H11A 1Z15A 2P9FA 2GK3A 4FUQA 3IKJA 4NU0A 1EQUA 4BATA 1UBGA 3F9RA 4RKEA 1KFKB 2ODBA 3OD1A 1IRXA 1G8JA 4G4JA 4BX3A 3EQ2A 1IFXA 3EIEA 2BY4A 1XZJA 1YK1A 3B3JA 2R87A 5AP9A 2XE7A 2F3TA 3VR2A 4IX1A 4DXAA 3CEMA 4U02A 1RE1A 3DWFA 1JNXX 4WL0A 4X62B 2WSLA 2B1GA 1CQIB 2CFSA 3AOEC 1SO8A 1D2EA 1OAAA 2BH2A 3BZWA 4L72A 1R4MB 1G2PA 3B8EA 4KGDA 4AZ0B 3B6KA 2ALJA 4Y2JA 5BSGA 2D5IA 3PI7A 1GGFA 3CLUD 4RAQA 4G5GA 1V5WA 2ADFA 2X4IA 1Z2OX 2O0HA 4NCHA 4EJSC 3DAPA 4GOND 3R6TA 1XVLA 3H7AA 1J21A 4PTLA 3LUFA 2IVZA 1E1YA 4DQXA 3T9BA 1YKFA 1FYWA 1VJTA 2XDWA 1T9BA 2BBSA 3SQNA 2KWIA 1E6UA 5KQPA 3BREA 2ZIVB 4FFDA 4GBJA 1VBMA 3C3PA 4UCXA 3IEMA 1NX9A 1R0ZA 1XN1A 4DRXB 2IU6A 1I7LA 4OXRA 3BJMA 4J1QA 5I5EA 4XE5A 3GFSA 1M73E 2B8JA 3TZQA 5EMLA 2AQ8A 4G36A 4P36A 1LTKA 3ER9A 1QBKC 1U8FO 2Q1WA 1BDBA 3NETA 4K28A 4MH0R 5T64A 3F6PA 5AUNB 3GIWA 1U0EA 3WAJA 4K3UA 1E0AA 1J20A 2ZB8A 4L0CA 4RK7A 3QU9A 2PKQP 4PS1A 3SAJA 4EENA 2Q7OE 3I61A 1HLGA 1FFHA 1Y80A 2H4WA 3H3JA 4PG5A 2I2XB 4WOKA 3ICVA 5ADUS 1EA7A 2ZRKA 4GI2A 2ZRGA 1GTZA 1IXYA 4GQBA 2Q4DA 5T4FA 1Z5OA 1KJ9A 3R7LA 2NXCA 2CWDA 3F6BX 1BHQ1 3GEEA 1VJ1A 5IF3A 1I94B 3LUKA 3TB6A 1C1HA 1QHHA 1W5AA 3A4LA 1PVDA 3GDWA 4R5MA 2FEOA 1ZJZA 1QBGA 1S8AA 4U8GA 3TW8B 1RM0A 4OHUA 1TK2A 2HFKA 5SYAA 3I58A 3LDGA 4BN0A 3LC7O 4LQCA 1CPYA 2OFXA 1G8SA 3M5PA 4RZ3A 3IR6A 3QPDA 4G86A 5AI4A 5J2TB 4EX6A 5LL6P 1G5IA 3QV2A 2V0CA 3C6QA 3CX3A 2BFCA 1S3FA 4GOKA 1NW7A 4EJSB 3QOXA 1OH5A 3WFIA 5C3MA 2VZLA 5COQA 4EB3A 4NABA 2ODPA 1XEFA 5FPYA 2XRMA 2GN6A 1CR4A 2ZSHA 4LIPD 5FPHA 4BO5A 1B6SA 3ZC3A 1QHEA 3MWDB 3ZW9A 4TV9A 2IF0A 4ZREA 3KFLA 1VMAA 3IUEA 3SQLA 1XF9A 2AKEA 3GCWA 4ZKDA 1F1BA 2P65A 2WINI 4NPHA 4MLCA 4EGFA 3T1QA 3EN0A 1KO7A 3AHFA 4OL0A 3NYQA 4MSUA 3RC1A 1JKJB 1ZNYA 4DREA 3RHSA 3GYBA 4KC0A 4XYBA 1LEHA 2J3QA 4GX2A 5CVDA 1WE2A 2AQIA 3UJDA 4Z53A 4OBEA 2J87A 3Q98A 1LV8A 2CDRA 1NBIA 3DZDA 3G23A 4FBLA 2A30A 3D3JA 4UAUA 4FMPA 2EFGA 4ZA2A 4LV6A 3AEUB 5IYZF 1P8JA 3WHKA 4NFLA 3RU3A 3UAGA 1HZZC 1OUMA 3HVIA 4RVOA 5HGJA 4EJFA 5EQFA 2RHLA 2QM3A 5JALA 1JMKC 3KEMA 5FI0B 4OPMA 2OBMA 1H6AA 1QZTA 1OZGA 5ADWA 5JS8A 3BSWA 2QP3A 3A2NA 3L1IA 4HXEB 4EUHA 5CB4A 3F6CA 3NKLA 2CXNA 2EP7A 4YCAA 4DV3B 1NJ2A 2FP4A 2IXEA 5AM5A 2PSJA 3IMFA 3BFPA 4ND2A 4XQGA 4RADA 4CI0B 2XXJA 2E9SA 3K1JA 3JPYA 4QOHA 3SEZA 1V1JA 5HJ2A 4AKEA 2OFOA 5HOEA 1S2OA 2PFSA 3HUEA 4YQEA 3OQPA 4WFIA 3D7SA 5I9IA 1M1YB 4M7RA 4EB8A 3N3BC 4UATA 4NEHB 4DY6A 2O0KA 1RXSA 2JVKA 2VH2A 3GLSA 5TF4A 4O08A 4MV6A 4ZC8A 4UEQA 4YRQA 2XUDA 3HCDA 1FTWA 2FMFA 4O0MA 3VNAA 2WOOA 3CH6A 3AJRA 1H69A 1OYOA 1Y5MA 1O87A 3OTIA 4MO2A 3W6UA 3AHCA 3PNVA 2BE7A 2QUJA 3O9VA 1BQ4A 4TLBA 4BDSA 1GGMA 2PRJA 4MQFA 4B79A 3AM1A 4LZNA 4WXPA 2VHZA 2AW5A 2GBCA 3HS3A 3H87A 5KQRA 3N0TA 1WLYA 2YMPA 1J9ZA 1R88A 1G5FA 4GPTA 4LDPA 3COJA 4TYWA 4HNHA 2F43A 2GM9A 4XLLA 4IDHA 2X1HA 1NUTA 5AHWA 3RSSA 5KTKA 1QAMA 3STWA 3IHLA 4OMUA 1XWFA 5FR2A 4F2PA 1YKSA 4WERA 1E1CA 5DX8A 1E2FA 1EBFA 2Q8QA 4DY4A 4PQGA 4O2BA 4IJMA 1W75A 2V03A 4N0PA 4UU0A 1JECA 3CIFA 1Y9ZA 1S9DA 1S8OA 3ZGLA 1L3CA 3AKEA 4DSAA 3GN1A 4QOGA 1UKCA 2X9QA 3P96A 3EZNA 1F8XA 3LQKA 2IHNA 5ARDA 5ULLA 1W5SA 1KC3A 2IIBA 1M0TA 1AN0A 1W4LA 1WPQA 2IHZA 3IOBA 4LXHA 4RZQA 5C8DA 4HRVA 1ZMOA 4K6MA 2O8BB 1NI4B 3N70A 3R74A 3RF7A 2GJ9A 3FF4A 4YCCA 5FWYB 1WIWA 4LRUA 4EW3A 1XP5A 4TVBA 2WNSA 1XJ0A 3KU4A 2P9HA 3ZV7A 1K8QA 1X7DA 5KKCA 2X0NA 4LZAA 5HF8A 1V5GA 2R2AA 3AVOA 4Y7CA 4FILA 4J4TA 4ZP1A 3VYUB 1YJ5A 1JHQA 2ECPA 3N2KB 5FL7D 2XZDA 3PBKA 4E4YA 3L0BA 1YI0A 5IH3A 1PAUA 2H1SA 3G2JA 2ZVJA 3M6XA 5P21A 2ZLBA 3RH0A 4CQMB 2GYYA 4EHLA 2FPMA 4IIUA 1CNMA 3V7WA 3FDXA 2DHDA 4JDUA 1B15A 2ZRLA 3TKYA 4BV3A 3QE0A 3OSZA 4N7BA 4TQUS 3WHPA 3K31A 3TIGA 3H9CA 4GICA 4GS5A 4MKXA 4YT8A 5E3IA 4L8WB 5KWEA 2FOXA 3U48A 3ZS9A 5LDGA 4D9HA 3D1LA 4O4HA 4HGOA 3X2FA 5IJAA 4TN5A 5FPPA 5JATA 1TADA 5J5AA 4IV0A 1VJ5A 3FLAA 2JHCA 3N8DA 2I2CA 1RTTA 4M0KA 3ZXSA 2CLCX 3QUBA 4Z7QB 1X1DA 4DWOA 1XTJA 4EA6A 5I7EA 1RMQA 1B4DA 1FXUA 3S81A 3FPSA 2ZXFA 3FW1A 4P83A 3NGXA 1F2VA 3HYRA 4GWKA 3TGPA 1NQAO 1P60A 2VJLA 3WK4A 5CDUA 4HTFA 1UC8A 5E1DA 1N3IA 2QUAA 3NIFB 1OGJA 1OI3A 4LZWA 3GJQA 3SK0A 2EX0A 5JMOA 4GOJA 4Z49A 3FSGA 2FN9A 3L41A 5B1HA 1F5SA 2IYYA 4C08A 2IEDA 3OETA 4MV8A 5L53A 4X91A 2X6RA 2ZSUA 1T0BA 2QV7A 4KGZA 2V55B 3VAYA 2VRCD 3PUIA 1CLEA 3AB8A 2B2XA 3Q8KA 3FLMA 1I4DD 3MIIA 4RSGA 3ROFA 3SICE 2X9VA 1VZ2A 3UJHA 1ZSVA 1T2DA 5DXAA 3RHFA 2FUKA 4FZ3A 2F8SA 1G41A 2PA0A 1A9ZA 4AJEA 5BOSB 1ZD2P 5CLGA 2FSUA 1LQTA 1R8QA 1NFRA 3RU7A 4XYLA 1MT3A 1NWHA 2WHYA 4BRUA 3ERCA 5CDTA 2QK4A 3MB8A 5FBLB 1DCKA 1GKKA 3T9CA 2C2HA 2RGNC 2OOKA 3AX6A 3K9NA 4CI9A 4D3FA 3F7OA 4B3BA 1V8ZA 3BD9A 1KI9A 3ZZMA 1JW9B 4FMDF 3MRSA 1HYGA 4F85A 5IKMA 4JP2A 5AK4A 2VAXA 5JO9A 4YRBA 1Z7BA 3MRXA 1N5OX 1XLVA 2GBLA 1W52X 4TVKA 3TEJA 3T1YB 3RE1A 1V3QE 3D1JA 5AKLA 2ZUUA 4GC5A 4OSOA 1R5OA 4MRRA 3W3AH 1U1DA 5IWCA 1IM5A 4E31A 4LY6A 4C30A 3OKAA 3BL6A 4JI5B 1QK3A 1RBZA 1GM5A 5FULA 1NUHA 2O6LA 5JS2A 4F4FA 4ZYZA 2C7RA 4M86A 2YRWA 1EP9A 2WEKA 1U81A 2FW7A 3GVIA 3SOZA 3HWRA 2W6MA 4LSWA 1BW9B 4AS2A 3KKEA 4P4NA 3KSZO 3V1KA 1Q0PA 4F3YA 1NGSA 3OEHA 1NYLA 4FYVA 2WU3A 4F6RB 5B1DA 5I01A 3UCFA 3GVXA 3LO5A 3GGSA 5CFPA 5C46F 4EJ0A 4IDEA 5K3AA 3OZEA 3G0GA 1TA9A 1BS1A 3FYUB 1TM1E 4CLOA 2J5KA 1NONA 4Q7LA 4V0ME 3OE4A 1GYRA 1J8QA 3OURA 4FYHA 4IL5A 2I6QA 3OCXA 5ITZB 4AWAA 4DIMA 3G7SA 2WZCA 3JWIA 2RK3A 4IVRA 1KMHA 5JMPA 1PR9A 4QOEA 2XGOA 2PWAA 1TIBA 2R5WA 4NFSA 4GR9A 3WICA 1QLJA 4C21A 1QWSA 2GPTA 5B57C 1E1KA 3MMNA 3MBIA 1YZLA 2PJDA 3G59A 1RRPA 5FWNA 1WXFA 4NQZA 3TLGA 2B4TO 4JOSA 5JZVA 1TIPA 1Z37A 3FSJX 4PVCA 2AKYA 4Q47A 5JAIA 1C7FA 2ATXA 4GOXA 4CIDA 1UBRS 5FR1A 2BGLA 4HDSA 4Q9IA 5AICA 4C7BA 1GLNA 2DVMA 5FA5A 1GZ3A 2HU8A 5EXDA 2NWQA 4C0JA 1HYEA 2R7KA 3L9WA 1HL7A 3IEPA 3LZ6A 3LLUA 1MEOA 3FDIA 2AYYA 3O21A 4F72A 6REQB 2XTMA 1QR2A 3E0XA 4L73A 3BSYA 2FPRA 3Q3EA 4UZSA 1Z8NA 1X7HA 3AEXA 4F3KA 1Q3KA 3VV2A 1QOPB 4RQAA 2P9ZA 2HMUA 4R8MA 1G6KA 3CEJA 1T3ZA 2FX5A 3JQDA 3MTQA 5L40A 3KVVA 4YP0A 1BRMA 4CIBA 2C2KA 4TL8A 5J59A 1MPTA 3TGWA 2JEYA 1WX1A 1K7CA 2RHJA 2BF4A 3AFOA 1DWUA 1F4LA 3BHNA 3HJTA 2X0FA 5IZ4A 3QI7A 1Y4AE 3KD2A 4NBNA 4NCBA 1A8QA 1K7FB 4I50B 4W99A 3PDCA 3DMRA 2GF2A 3I8OA 1KOFA 2WRZA 3IDFA 1IN7A 1JSLA 1JWLA 2GI4A 5HE8A 2NZ2A 5DIZA 5ELXA 2BJVA 2ZWOA 3SS8A 3P2OA 3RK0A 3JQAB 1IM2A 1DTSA 2P1ZA 4D6YA 3QA3E 4BFXA 1LRKA 2ADOA 2VCHA 5EJ7A 5FNVA 1DKUA 3DTVB 1JAZA 2WVAA 1RYZA 5FOSA 2IYSA 3D6AA 4HWRA 4P3KA 1WZCA 1HTTA 2XOKD 3D0QA 2RGBA 3JQGB 5MN4A 1ETUA 2POCA 1OFVA 3C6ZA 4MW9A 2FAXA 2ZB4A 2C5LA 4TMVA 5DNUA 9LDTA 2HMTA 3FYUA 4RVFA 4TTJA 3D8BA 4XW2A 4BV8A 4WDRA 3CE6A 3SC2B 5LNK1 1GJRA 1XFDA 1Z4OA 1IK6A 1JS1X 2GAOA 3RJZA 2WYWA 1PI3A 1O8BA 2PBFA 1GTSA 1EE1A 2RKOA 5DLPA 2OA0A 2VBIA 4YRFA 1PE0A 3Q9LA 1NAIA 3TBFA 2C98A 4JASB 4O4JF 4PFQA 1ZK2A 4C7MA 1E9SA 3GRUA 4KFRA 4C6TA 1WY5A 4ZHSA 2GVZC 3ZQUA 1U6KA 3ET5A 1UJ6A 3C98A 2HHJA 2IPXA 3IIEA 3WGJA 1ZU5A 1O0BA 4C4OA 1YR3A 4TKUB 4CQLA 2C94A 1RXIA 1YUNA 2NADA 2ZRNA 1L5NA 2ZOSA 4JUDX 1QIIA 3FYSA 1YT5A 1AT1A 2YHUA 1WBJB 2OHGA 3GPIA 4FYMA 3TLBA 4BNVA 1S2IA 5JTTA 3AVYA 3IP8A 3W5CA 3E5HA 1TJYA 3NC1C 4MB2A 1FB5A 4Q3DA 4K81B 4CU2A 5LWQA 1IUOA 1L1QA 2D06A 5K0ZA 2AN1A 2HLDD 4MCIA 1AHPA 1ZONA 1UEJA 2EQAA 2DETA 3K5IA 2IS1A 4MV4A 3NUZA 2HHAA 1ISPA 3BILA 3TRJA 2NV0A 3LNCA 1DELA 2RK4A 3G6KA 1I10A 1CHDA 1NT4A 3C3MA 2F3PA 2ZT8A 3ESXA 3LI2A 4CM8A 1C9KA 1K8ZB 4Y2YA 2CVOA 3P1JA 4MYHA 3SJAA 4Q82A 2JD2A 4P5EA 4XGRA 3VU9B 1EDOA 4RUKA 1XAHA 5EMKA 5CFNA 3NOQA 1EBBA 2XGSA 4FI3C 3P45A 1VGQA 3L79A 3N05A 4FI3F 4EPXA 3VMMA 2RI6A 1TU3A 4MRAA 3E7XA 4C03A 1TQDA 2D2XA 3DZHA 2G0TA 1KK3A 4L9WA 3AF1A 5DDIP 3FR7A 3AEKB 1VKRA 3LTNC 2ONZA 1UJ5A 4LZZA 2IHKA 4OUKX 1SIBE 2BISA 2PRIA 4OAOA 4RK1A 5DWQA 1JYEA 1N2ZA 5LP6C 4HT3B 1DPGA 1I80A 2DTEA 2JK0A 3RWBA 2X9GA 3P0RA 2R9VA 2PUEA 3PICA 4BO4A 4EA7A 4ZI7F 3FDZA 2P4QA 3RC2A 1XV5A 3ZWNA 2GR9A 2O8VA 4DVGA 1EIZA 2XR1A 1MT0A 4EBBA 5HKOA 4ZU6X 4ZO8A 1PR2A 1N5IA 3EDOA 5ALPA 1VLQA 3WYNA 4U2EA 3ZEIA 2AG8A 1C7IA 4TMXA 3ZHOA 5BMOA 1IY9A 4AYTA 2PUFA 3HBLA 2IDMA 2XSZA 2QRZA 2EF0A 1CVRA 4JDPA 1V8OA 2HSZA 3S8EA 4ZYLA 1QGYA 5EJ8A 4PRKA 3QPAA 5KJ1A 3TQFA 5DBEX 5IK2A 4CUKA 4PONA 4LMAA 2QTGA 4OREX 2MYPA 3Q7SA 1L5LA 2A0WA 3UGKA 3WZMA 3CCCA 1H94A 2GSDA 3OOJA 4KRFA 1KU0A 1JLLA 3OEYA 2BFBA 3L04A 4QGHA 5HIMA 3WBKA 1WCWA 1Z6TA 3FTNA 1E2LA 3L2OB 4H1VA 2X7HA 3M6UA 2O4UX 2QN2A 3AB7A 5L3QA 2I2FA 1U6IA 1IZZA 5J2UA 4KGXA 3MAGA 2V54A 4AP6A 2IBSA 4YWJA 4C07A 4RKQA 1KVQA 2P68A 5HGXA 3PZRA 4MUFA 2NQTA 2ZSEA 3QF4A 4W5JA 1RZVA 5IBPA 4TUYB 1E2IA 1HRDA 4TS3A 2XW6A 2H7VA 3CNOA 3TYXA 4JUFA 4IKEA 3PD1A 1TTPB 3TCNA 4S3MA 5KBYA 1R6UA 4PQEA 1CJSA 1PL6A 5F5NA 2GXUA 5KWIA 3BGIA 3EC1A 2QAJA 3L01A 4RVSA 1EP2B 3K0FB 2VUUA 3ULKA 1BJRE 3PGA1 5KMGA 2XT6A 3AETA 2HHLA 1ZMTA 4H3SA 5CXSA 2PGLA 2F9LA 4PAGA 1B6GA 1NZJA 3VU0A 3C6YA 5DGXA 1IONA 2CLSA 3IQFA 1I6KA 1X9GA 2GD6A 2Z5LA 2ODTX 4LJLA 4QBFA 2FFAA 3EJ6A 1VBNA 4IIDA 4PYOA 4GMXA 3LGSA 4QDXA 4B3SB 2XB9A 4HV4A 1P2TA 2E5LB 3O38A 1L8LA 3ANYB 1QH8A 1K8RA 1YXMA 1I6LA 2KLBA 1KZ6A 1W4RA 2HIAA 2EFCB 2YMLA 5KVCA 4EPWA 2VT2A 4MICA 1XMJA 3MTDA 3CPEA 3I4LA 2HO5A 4JX8A 3TR5A 1PDVA 1DBQA 1ZU4A 4PNHA 2A58A 2BYTA 3AIOA 1DMRA 4OFBA 5A5GA 4F06A 2Z2IA 3SJBA 1GR1A 4NE9A 3QMWA 4B7ZA 1NVWQ 2A0YA 1KI8A 4JT8A 2IXDA 4KMRA 2Q99A 2R2GA 2VQ6A 4QWWA 3UBTA 2A59A 3GBSA 1QP8A 2HSEA 1P0PA 4QGBA 4RHTA 3W77A 2XA2A 5FCDA 2ZI9A 5B58C 1WZIA 3BGOS 4HZGA 1A69A 2QZSA 1ELOA 4MKFA 4QJBA 3GNSA 3TE7A 4TT3A 2AR7A 4M53A 1B3RA 3EDMA 2VNAA 1JX6A 1BYIA 4MV5A 3RJ9A 3NV7A 1ZOLA 4ALJA 4BB5A 3NHKA 2A5GA 3A06A 3DFMA 5DBIA 1YU6A 4ZQBA 4AMGA 2VJOA 4H6XA 1FP4B 1TEHA 2BKLA 1CDZA 4LJAA 4RKFA 4FGZA 1K6MA 2HSWA 3OMLA 3WY9A 3ZCXA 1QORA 3WNVA 3ZCPA 4ND7A 1E4EA 2MSNA 4CV3A 4HAZA 1SK8A 3KWMA 4ZO6A 3L7YA 1SXJA 1DRUA 1OXMA 3NWOA 1WUHS 1Z63A 3LAWA 4TV8F 1UPXA 1DJMA 2JH9A 2HADA 3FH0A 3K9CA 1YVDA 1J23A 1J8MF 1D2CA 1BKSB 4KQWA 3SBOA 5EUCA 1UKVY 4F9TA 3OCUA 5FWYA 4J0CA 2KI5A 2Q5EA 4HH4A 5EFZA 3BXPA 4JIMA 3NDRA 4QTYA 4CL2A 3L0PA 2JAUA 4HUJA 5K0LA 1YE8A 1O2DA 2VHYA 4G81A 4MV3A 2YXEA 2XKKA 3ML1A 1IVYA 2YIVX 1F8FA 5A4IS 2P2CA 4AN0A 1SZPA 1XAGA 1BQEA 3IV9A 3VO2A 3RVMA 2UVPA 4MWSA 3L1KA 1DMSA 3AEUA 2BHSA 4RK5A 1IHUA 3ZV6A 1PZFA 5EESA 3N74A 1SZCA 1F20A 1G4HA 1XZPA 4JJ8A 1KZ1A 4NTZA 3C3KA 4OA8A 2WC1A 3PJFA 4PX2A 1I8TA 4XLTA 4JA2A 4J0QA 3WB0A 2JLXA 2OR3A 4UXJA 1SELA 2OMKA 1BDHA 2ZP1A 5JNRA 3FNFA 3T7EA 4DCCA 1N8SA 4N5LA 2NP7A 2OWDA 2G6TA 2B98A 3CCFA 5KEIA 5K8CA 1EUCA 1T2UA 2HU2A 1D0SA 1OKKD 3C3CA 4BKOA 5K20A 1U6JA 2V7WA 4YGXB 1TYZA 4KXNA 5H02A 4BVAA 1VE6A 5LLDA 1AZTA 2QYHA 2AOWA 5JMTA 2GESA 5TGTA 1QPBA 5GADl 4H3KB 1F7VA 3UPDA 1MTOA 4D1YA 4FMBB 3HZRA 1EXDA 3UJBA 1WCV1 3G9QA 4TLCA 1MOQA 2Z1NA 4H1HA 1PV4A 1YHNA 1DIGA 1XBTA 2J9RA 4F3CA 4YUAA 4NATA 3HGMA 2NVBA 3H0KA 3LWZA 4CCAA 5I7WA 7YASA 3T9DA 1S1CA 4NE7A 2WAOA 5F77A 3VH1A 4DDHA 4HNVA 1EUYA 2DHCA 1MOPA 5LXTB 1D4AA 2GRJA 1A8SA 3B1WA 1QNLA 4ITVA 3NBQA 1CUSA 5JSZB 2HPVA 3M5WA 4B3RB 2IP4A 3MZ0A 1UODA 1ILWA 2GXQA 2QTVA 3O1LA 3QP9A 3WJ1A 3LUJA 2OCPA 3ZW8A 1P1CA 2ZIXA 4G63A 5JASA 3BRQA 1WABA 3TZEA 2CUTA 3QENA 3KBOA 3LQ1A 1M0SA 4LFAB 3RYTC 1T2NA 2OYRA 1NVDA 4RCVA 5KSOA 4V24A 2HHCA 4F2HA 4F3TA 1AGPA 1RZ3A 4NV3A 4N8DA 5JSZA 4RPCA 2G8NA 2XZLA 2OD2A 5B3KA 2CYBA 3E22A 2HNBA 4LXIA 2DFPA 4LTNA 1L7OA 4NU6A 3T3HA 3TRDA 1W2HA 3PJRA 1KH1A 1AB5A 3HHPA 5IDVA 3P0EA 3O2QB 5AJWA 1HH4A 4CDGA 3AEZA 2YHAA 3A6LA 4A0HA 3GCGA 1QVWA 1EVJA 2OHHA 4H16A 1PYOA 2JI8A 1TVCA 5A62A 2JI6A 1NPYA 3IBYA 4I55A 3FFXA 4EUSA 5A06A 1NWCA 3V8PA 3EGXB 1P9OA 3NYIA 1KY5A 2AJCA 2H4JA 2ID8A 2REQA 1I7QB 2PZAA 4OK5A 2XPCA 3WYFA 2BFMA 1LC0A 3BWBA 4AZ0A 1PP4A 1FVFA 2SCUB 3K9WA 3ABSB 8GPBA 1X80B 5EKDA 2VL7A 1Q0HA 3HXQA 1SHKA 4COKA 2WJYA 2J5XA 3U3JA 5H82A 3WGZA 1OTHA 5LQUA 3HM2A 2R8PA 2IHJA 2VTVA 1KO4A 4QM6A 4YP6A 5F2NA 4CLXA 1Q50A 2X2FA 1LPAB 3HZHA 5IJXA 4EG1A 4EY5A 1G38A 1SHJA 2AG1A 3TBHA 2WWHA 2W0MA 3MJHA 3PZBA 2TECE 3WA7A 2W90A 3CWZA 1P1FA 2H5LA 3CE9A 3F78A 3FOCA 3JW8A 3OHSX 2UVPB 5ES4B 2ZETA 3C16C 1WUYA 3G1UA 1Z25A 4XEUA 1KI3A 1VJRA 3SQDA 2Y0CA 1NQOA 2DWUA 2EBWA 3I42A 3IKTA 1A9OA 1V4VA 2JGEA 2Q3HA 4A10A 2GCOA 4D4IA 2ZRJA 3FHOA 1RJGA 3EMBA 3U4MA 2AVNA 2JLCA 3MFQA 2COEA 2JIZA 3K8OE 2Y1CA 2GH1A 4JOQA 3OJFA 4EGSA 2P4EA 2I4IA 2GZRA 4X24A 3M4YA 4U2KA 3F2IA 3OU2A 3GD5A 4P53A 3R41A 1ADCA 1WD7A 3R8XA 4XX0B 1ZRMA 2YJTD 5M34A 3MXTA 4KLNA 3TTXA 3IAAA 1QYRA 2V7PA 3I1YA 1FNSA 3OJLA 5EIXA 1TZMA 3PE6A 2BD0A 1QIDA 4DM3A 3IV6A 5IC5A 4B2IA 3O7WA 2A5YB 1YZFA 3SDBA 4G5XA 3BXOA 4Y6RA 1AK1A 3WGTA 3BXFA 1JEAA 3E9NA 5FOTA 3UJNA 4QG3A 1V7ZA 3L5KA 1ZBDA 3KPJA 1HLDA 4DCSA 2IQIA 3NATA 1EYZA 2X2EA 3B2NA 1RAAA 5CA0B 1HLPA 1EM8A 4I9UA 4JZYA 4MUGA 3O8RA 3QE4A 3WL3A 2RARA 1OMOA 2Z2YA 3FBWA 1JHMA 3RSQA 4CLHA 3WKEA 4NIMA 4M55A 2B4YA 2I8AA 2IPNA 2K2WA 4RTKA 2ORYA 4MVJP 1TF7A 1R0RE 3Q72A 4Q3OA 1ND5A 4F5EA 4X6XA 5A5EA 4AO7A 1MOZA 3D8SA 2FSIA 2XXBA 3LBAA 1MR3F 1RWMA 3CRNA 3PR3A 4QHYA 3DDWA 3AINA 4ZVTA 1NVVR 3G5LA 4C7XA 2A78A 1VMKA 4QDKA 4ZZ3A 2NVWA 1L4NA 3IFSA 1L7BA 2IEIA 3AC0A 1YSCA 3LQ4A 1J24A 3U4HA 2OAGA 4K05A 3GGJA 3FSGD 3K4QA 1ZUHA 3LCVB 3SD7A 2FPIB 1ZCAA 3L6UA 1Z2AA 1AVTA 4ZK2A 2RH9B 4LOHA 4HN9A 4AECA 3G5TA 3DWGA 1G3UA 1ZMRA 4JHXA 1SU7A 1YR8A 3NOVA 4LNAA 5EXEA 5KMGB 2OLKA 4Z0PA 1LSOA 3SQOA 4IEFB 4KVZA 4ZVKA 4PNPA 5AXBA 2IU3A 3L4JA 3F1LA 3RADC 1MN6A 1P3DA 1N3LA 2NYRA 1E3TA 3ESAA 3ZWCA 3OQ6A 3M4NA 4KNVA 2WU0A 1KZGB 1DP4A 4YUVA 1OHHA 2HF2A 4P4UA 3KSDO 4EUEA 1JFTA 2FSSA 2ZRDA 1NSFA 3LA6A 4GBGA 3TJZA 4LDZA 5AUOB 1DKOA 1A3CA 1UBTS 2DT5A 2QL6A 1ZQ1A 2XMZA 2EX4A 2PWBA 3QK7A 1SKUA 3SZOA 4POAA 3SSOA 1NV9A 4LJ9A 2D7CA 2ZITA 4Y2RA 5DE3A 3UC9A 2ZYUX 3ZIAA 3FKSA 2VF7A 2WSYB 3GT4A 3UCEA 1K8XB 1SXGA 1Y3BE 4L5IA 4KNYA 2HXGA 4R9RA 1CUGA 1ESCA 2H2IA 4DNQA 3QKSB 5FA8A 4UZFA 3C97A 3VSAA 3P9KA 2R44A 3W78A 1P0CA 5DTQA 5DTIA 3L0ZA 3PEYA 4JT4A 3KD3A 3RKSA 3TLZA 1FYFA 4LYDA 5H80A 4C4ZA 4D80A 1VOTA 4V0LA 5FAKA 3F74A 3HVUA 5KU7A 4QEDA 1HBJA 1E1QA 3U1BA 1NR1A 1SCUB 1SEPA 3PFKA 4PCVA 3R5TA 4K1LA 4YJDA 2JFWA 2GERA 1QQ7A 2P9QA 1WXIA 4N0MA 1TDJA 3AFGA 3LVQE 1SD5A 3OFND 1PFWA 4DV0B 2FWJA 2JASA 1QK5A 5EMNA 4D44A 4ZU3A 4IUYA 1LVHA 1RVV1 2P5TB 2X0KA 2YOHA 3F7NA 4K3VA 3FFAA 3VZSA 5HS4A 2O8CA 2JKVA 3DYVA 4U4AA 1JEYB 3AIIA 4JSYA 1JV2B 4KO1S 1CUDA 1TYCA 1MJGA 1NSTA 1HNZB 3SMVA 3T3MB 4ZEVA 1E5LA 3X1MA 3SG0A 1BEZA 5T3YA 4K1XA 3EQ7A 4LXXA 4QFBA 3JYPA 3TSYA 1TGYA 2XUJA 1NULA 2RONA 3IIJA 2FOLA 4RIEA 5GV7A 5HTKA 3I53A 5HOQA 1RW4A 3ONDA 4B34A 3U56A 1GL9B 3DDNA 1FBNA 2H31A 3QX9A 3V6LA 4EI9A 2I6FA 3Q8XB 1G7RA 2FFQA 3WRWA 5EEGA 1CUVA 1SJ9A 3OCVA 3OH8A 4J7UA 4JC8A 4GQAA 3DXYA 2NU6B 1U2GC 2R86A 4RVNA 2FR0A 3FUVA 4N01A 1Y7HA 3I01M 1GRRA 3LHSA 2KSQA 5F12A 1F51E 2WF6A 4Q5IA 4BMNA 3RROA 1NG9A 3QFCA 4JBIA 4JJFA 4AN4A 4F7DA 2NQ8A 2YS7A 2ZS9A 3ORRA 4OYRA 1EXVA 3BB1A 5FUVA 4FCVA 4JI1B 3CWCA 4YDQA 5DM1A 1BGXT 4UMEA 2QN1A 3PHJA 1GGNA 2HC9A 4JVMA 3VU8A 1Q57A 3JCZA 5HBGA 4QG7A 1GFIA 3FSRA 5EVCA 3DG9A 2ZBFA 3L06A 2CCKA 2PXCA 1S96A 4ZFNA 2V7XA 4RULA 1EGAA 2D0IA 1A9SA 2PZKA 1BEUB 2HRBA 2O23A 3L7KA 4MS3A 3QELB 4FCCA 5K3BA 4D4MA 1N5DA 2ZE5A 1K06A 5CCEA 2OCXA 4F1WA 4EPVA 4BHTA 2AC7A 2XCLA 4UU1A 2DQYA 3ANNA 2IEZA 3HCAA 3QX7A 2PSDA 2JCBA 4JGIA 5C1DA 3NMUF 5ALOA 3SNHA 1P0QA 3PGMA 3GEPA 5IYZB 4HS4A 4FHFA 3WYAA 1LKZA 3WG9A 2HF8A 1QFXA 3IAM1 3F47A 4G9EA 2QNBA 2BFPA 1FP1D 2HCRA 3N2YA 1CZHA 3PHCA 2JLSA 3QLEA 4OSPA 3UYKA 3B1XA 2ZXUA 1CRQA 1FXSA 3IH5A 1TMOA 4D4GA 1PQYA 5EG5A 3NTLA 2VQSA 4C4RA 2H4ZA 1ZH0A 1W85A 3GJ7A 3BFXA 3L8DA 3P32A 3KJQA 4OD0A 4INZA 4QPJC 5EZQA 3OPQA 1PLKA 1SOVA 3D6HA 3WS7A 3RRFA 3IR7A 4HVTA 3RAGA 1PK9A 2BGNA 2ZQ5A 4ZVLA 3OPMA 3BEOA 1HGXA 1CIVA 1JU4A 2M32A 2PX6A 3C7KA 3BJRA 3MG9A 4BVGA 1B6TA 2I1WA 2YKGA 4BJ3A 1MIOB 1LBQA 4P2BA 5HQ3B 1WWKA 4PCUA 4WKGA 2C1XA 3ZHRA 4MKIA 3A4IA 1W94A 2ZTMA 1RKUA 3FCCA 2Y68A 3R3JA 2XA9A 4BGUA 1K27A 1G3QA 1GRVA 2BDUA 3HJAA 4QARA 4DDVA 2IH2A 3CZQA 4H0CA 2GCEA 3RNLA 1HYQA 1PVOA 2HOQA 3SFVA 3KLMX 4XI9A 4DS3A 3CX4A 1OWLA 4WA7A 1D2RA 4WGFA 1GZSA 2X0IA 3R09A 3TRIA 1Q0TA 3OPYB 2PS0A 4XFDA 4O1IA 1FTGA 1I2BA 4Q9AA 2Y3IA 4AU1A 1MA0A 3ROPA 4NXMB 1OE0A 2IITA 4OXYA 3BZBA 4K03A 4EY8A 3O8OB 5KHOC 5EJFA 2Z09A 1AUPA 3RIEA 6ADHA 3W04A 4PSDA 3DONA 3GVHA 4JCCA 4MIYA 3W6ZA 1RXCA 1WKVA 1W4BA 1IPHA 2PUWA 3MB5A 4GMKA 1IOZA 2Z30A 4G84A 4Y2GA 4X6YA 5KIAA 3K30A 4JH0A 3SYNA 4BEVA 3ZWYA 1A77A 1ORTA 1RQ7A 1WLSA 1KSHA 4KXVA 5KQLA 1SQSA 2PE5A 4MPPA 4GI1A 1T6YA 4TMYA 5ITZA 4DE5A 3CKKA 1DOAA 2FUG6 4RF3A 1F7UA 5DM4A 2D8MA 5CH8A 4R71A 4JWTA 4QICA 2N47A 5KYWA 1CRLA 1PKXA 4RGVA 1M2EA 1SA0B 3C8ZA 2X22A 1WHSB 1D8TA 2QJTA 5E3JA 3V42A 2NT3A 4MP8A 1AGXA 3DCYA 5DB4A 5CCDA 4Y9DA 3RS2A 1G59A 3CN9A 1F8GA 2WHPB 2Y4OA 4P93A 5IRCD 2P3SA 2WYIA 1XTPA 2W6ZA 1NKTA 3W8EA 1QKKA 2AFHE 3T0GA 3L8EA 1OZFA 1GZ4A 4BKQA 4CIXA 1NJGA 1PYDA 2AIRA 3DLTA 2PS1A 3FZEA 1NMEA 3DR3A 3DV0A 3NWPA 3PQ3A 4IDCA 1TMGE 1NNI1 3H75A 3W9SA 3Q4GA 5KOJA 3VR4D 1AXEA 3VPHA 4A92A 1O0SA 1A9XB 3FNHA 2QVGA 1V7PC 3L18A 4G1FA 4PZCA 5GP1A 5H3CA 5JMWA 1VPDA 3SMQA 4D3ZA 1XVAA 4EELA 3WKAA 5G41A 4MA5A 2A1TS 1TGVA 2FZCA 4AW9A 2NO0A 3PUVA 5JNUA 3OEHD 4GUAA 5LP6F 4G85A 2C2YA 3KYJB 4HZUA 3UUFA 2ZZKA 3CWQA 3W1EA 1UWCA 1QE5A 1G2QA 3UK2A 1QGOA 1R00A 3HR7A 4MRMB 1IUKA 1XHFA 5TARA 3EX7C 3G2QA 3DULA 3P5BA 1PWHA 4TT8A 5BUZA 2UVDA 5K3OA 1DXOA 1XVUA 4IJWA 2NU8A 5HYVA 2QUHA 3H19A 4CKCA 3COPA 3K0AA 1XDZA 4FW8A 3H2IA 4ZVSA 4AZWA 3DHNA 2FMHA 2WTNA 2F1OA 3OM1A 4R40A 1PU2A 5K05A 2WG1A 3JQ6A 1ZSNA 4NAVA 5CA1F 2FWAA 1G3RA 5DHSA 4IXDA 1AKQA 5AM0A 1TLFA 1GQQA 3AWIA 4F5DA 1CY4A 3BXXA 4XDZA 2I5PO 4NFHA 3L49A 4F5ZA 5CTJA 2YUIA 3D8HA 3GB9A 4IXTA 4U2GA 1GZVA 2A57A 5AVQA 5MGBA 3NAGA 2XRYA 1PJCA 2IXAA 3ROTA 1AO0A 4RMJA 2C31A 4RXUA 1TTQB 2XB6A 2QX7A 4CTKA 1R9GA 2D8AA 4M8SA 1N2XA 5JRJA 1XPUA 1I01A 4LE0A 4J90A 2ZYIA 3N5KA 1FFDA 3U3RA 4GP7A 4WW0A 1RQNA 3K92A 2IPMA 1GPDG 1QYVA 4PGGA 4P3XA 5A9TA 4ECAA 1G4UR 3PQ6A 3ZJYA 4X64B 1DIRA 1XWIA 1O97D 2AWNA 1KOJA 5HW0A 1V8BA 3B2EA 3FPGA 3K1ZA 1NW5A 3ANXA 4H27A 2X0DA 5BRJA 5D86A 3S99A 1CY6A 4ENQA 3NTOA 4F12A 1U9IC 2BFDB 5CDYA 2DERA 4DSNA 1H9CA 3NYRA 1Z0ZA 1ML4A 2CBZA 4B3CA 4JJ7A 1JIXA 1KPIA 3DXXA 2QT0A 3AMVA 1R1DA 1NQWA 3EGEA 3RTGA 2QRKA 4ZJZA 1O97C 3QG1A 5DM70 1REQA 3Q1KA 1YE3A 1ZK0A 4WLFA 2XA1A 1FRVA 1W4AA 3F98A 4LKOA 4U2FA 4DA8A 1ZOPA 2BR4A 3IBTA 4D41A 4EY3A 4P2GA 2QJRA 3GAFA 1G63A 4D5EA 5CNJA 2D1YA 3E9ZA 3QGMA 4IVPA 4BAUA 2WIGA 5EERA 4ZAXA 2PUCA 2ZYHA 1W4ZA 1KQGA 1C1DB 2O8FA 1ZD1A 5I9MA 3PTZA 2FW1A 2FYTA 1BCSA 1L5SA 3VH2A 2ZKLA 3FDFA 4CUZA 1NDHA 2GUWA 2ZIAA 3PFWO 1TAHA 5LB2A 5I3CA 3WMRA 4G01B 2PTGA 5IARA 1JIUA 5ENZA 2JAPA 3EXHA 3BIJA 3D2BA 2F4VB 1YS6A 2XUFA 4B87A 3HU2A 2C2XA 2ZG6A 3U7QB 4RPLA 4G8JA 1S4MA 4XOUA 3UKOA 4BECA 2PGAA 1VG0B 1MG0A 1QM5A 2BFFB 4JT2A 4DNPA 4ZEXA 5CB4B 3LHDA 5EHNA 5LP6A 2YW9A 4ER6A 2FWBA 4ENVA 5CEFA 3HGTA 3M7IA 1P2SA 4EB0A 4JLOA 2FUEA 2H7CA 2ZS8A 3WIDA 2G67A 1EJBA 3QVTA 1CVLA 1U04A 2OBYA 1V26A 3ZGYA 5J2TF 3LU1A 2YV3A 3FNRA 1IN5A 1R6AA 2YMMA 3F67A 4NRDA 4RNDB 1L9KA 3TTUA 3VZCA 1SIUA 3KYCB 2ZRQA 3CR8A 4D74A 3VZPA 4EG0A 2PT9A 4NOKA 3SR0A 3DD1A 1HOTA 3UANA 4ED9A 4M1ZA 2PX5A 4JMPA 4M8LA 4HNRA 4UDOA 3RS4A 4DJEC 4UTRA 3G2HA 3WKBA 4HWOA 4I1OA 4B75A 1BVHA 4QYIA 4PZUA 3TE6A 4W5NA 5CIYA 1XP8A 3B3GA 2SCUA 5TMBA 5I4KA 3ZDDA 3EYAA 3QUSA 4EKYA 3AQIA 1LH0A 3DPIA 2JL1A 2GDJA 4MGIR 3SC3A 1SNYA 3ABOB 3ESRA 1XPOA 2W6OA 3PHIA 2BDTA 3ZHUA 2VQFB 1IDN1 1M1XB 4Q93A 4NU8X 4CTNA 4F9FA 3OZIA 4QD3A 3I5MA 4KHPB 4PO1A 4ZTBA 2XADA 1C9NA 1ZN8A 2NNWB 1Z29A 1BVUA 1EVLA 2PZEA 4NF2A 3SX0A 3ZHCA 4KSCA 2VP2A 3P0HA 4Y1EA 3ED1A 4H0FA 5E2BA 1TF5A 3IOCA 4I5EA 4IGFA 1MB9A 4IKPA 3PQFA 4C0AC 4C29A 1YBAA 3R9WA 3TW8A 1B42A 3BCHA 4OIFA 3ASYA 4YO8A 1PR3A 4F56A 2FEWB 2GCNA 4QBGB 1PFGA 4ZANA 1UBCA 4EDFA 5FWXB 1IN8A 5EKSA 3AVUA 2O5CA 1IIBA 1FTYA 3GLIA 3SIWA 3DDOA 1KBZA 4LHYA 1DCTA 16PKA 3QX8A 1L5WA 1WNTA 2IHUA 1X94A 3AHHA 1ZLXA 4C05A 2EAUA 4C6HA 1YQTA 4MEJA 3L6OO 2UAGA 4BYMA 4AX8A 1EGHA 1B8OA 2R6R1 2ZI3A 4ZCTA 4X3OA 4RZIA 1W76A 3QIVA 3MM4A 3HRIA 4UQLA 1TA4A 1NSYA 4L8YA 1K98A 2SHKA 2QTVB 2OP0A 2V3WA 3DMFA 3FRIA 4CZ2A 4BXOB 3EJWA 1XL1A 1T4CA 1VJGA 1XJCA 5DBGA 4R2JA 4EQZA 3GLIB 3LT5A 1L4FA 2ZB2A 4B3MB 4L6CA 2XVZA 1FFBA 1KE2A 3GLFA 4ILKA 3SJZA 2CZQA 2RHRA 1DX9A 2REXB 3HCFA 2ZT6A 5BT9A 1CIJA 4JP5A 2X1LA 1F60A 4I9FA 3SHTA 3EXIB 2OD7A 2EC5A 5GPBA 4RJTA 4NBSA 4DCJA 3EXHC 2E4AA 3TUIC 1Z7GA 3CVXA 3V2UA 3UUWA 1Z4JA 4OQEA 3N2EA 4AMUA 2G9RA 4K6HA 2FG5A 4X7PA 4YJHB 3G85A 1EA5A 3UK1A 2IXBA 3ESBA 3VXKA 3WWPA 1VE1A 2V3VA 3OT1B 4NONA 4RLSA 3ZBPA 1DAGA 1PN3A 3ZWKA 4DA4A 3LY8A 5DM0A 4G4GA 5KOYA 2R1VA 1GKUB 2PZGA 4FOOA 3V6MA 1A5SB 1UOOA 1Y81A 2QQEA 4M98A 5EWJB 1JHYA 5FNZA 2IL1A 4CT5A 2PIDA 5L3SA 1DLIA 2IUUA 1HG1A 3MFYA 3I73A 1JKFA 4U8HA 3S68A 2NUPB 2W70A 3QE9Y 3BXHA 3KC2A 3HCPA 2E85A 5DYYA 4Z2YA 3UQZA 2YR0A 1F0YA 2P75A 5BV1A 4J16C 3L8FA 2A3RA 3MC1A 4MROA 1KBQA 3I6BA 1JKMA 3MWLA 3WNDA 2Y67A 1UBUS 4H7DA 1DDIA 1IG3A 2GEUA 3AXSA 1SHTX 3G1WA 4K40A 3P8ZA 1UZNA 5K8LA 4GX5A 4JMLA 4XVRA 3RYIA 4JYAB 3V3KA 2W6NA 3K4PA 5BPHA 2YDXA 3OJWA 5FYQA 1J8VA 1I2CA 2WKPA 3I2HA 3BB3A 1J1IA 1XUOA 4FR5A 4B3HA 5KKAA 1QQ6A 1Z18A 2IXTA 2HYDA 1PNOA 2P62A 4RYDA 4XD7D 1AQNA 3I9JA 3JPWA 3QKUA 3UHAA 4XUDA 2HRCA 3H42B 3LPAA 5FUMA 1ILEA 5ITSA 3TK1A 2LV8A 4IP0A 1ZO8A 1ATIA 3FM9A 2DMRA 5FI5A 3SVZA 4R0MA 5IABA 1S2MA 5KYNA 3V8QA 1WB9A 3JVIA 5TQ2B 1LLQA 2I03A 3KVRA 4KQKA 3S2GA 5A4FS 1XTVA 3EULA 4MW6A 1HFEL 3E35A 5IUNC 1U0LA 1O4VA 1K2VN 3UWDA 4WBSA 2AXQA 2WFMA 3R6GA 5J4VA 2C04A 3MJVA 1O77A 4OI4A 3AV0B 2V7GA 1TT5A 5B36A 4AUMA 3AKDA 1OVMA 3HCOA 3HCNA 2QYOA 4Y9UA 1S01A 1X7GA 1PJAA 2DBZA 1OT5A 1DO8A 2XYRA 3R3WA 4KRXA 3BOSA 4M1EA 3E2IA 1TPYA 1H42A 4KG7A 5CM2Z 5K0TA 3ORSA 2H85A 1C7RA 3PVZA 3K5PA 3ZV4A 5JZOA 2QRVA 4H08A 4Q4HB 4QPZA 1SKQA 3EPJA 1Q84A 2C7VA 3UMFA 2X4GA 2Q4RA 3EIOA 1JEOA 3BHIA 1CB0A 1G1AA 3N5CA 4R0VA 4J3NA 1AG9A 1SBQA 1T5LA 1TO1E 1UOPA 3T1OA 4DQKA 1R37A 4WXRA 4O2RA 4AJ2A 3SYRA 1U4SA 1C1XA 4L76A 2A0FA 3AI2A 2Y05A 4DR2B 2I3BA 1ZNZA 3P9PA 2XWPA 2WKSA 2QZ9A 1ZGAA 4RYLA 3QVXA 4H77A 4BV9A 2L69A 8ABPA 2QNRA 4M8IA 2OE2A 1ZCFA 5JC1A 3JXEA 2VHJA 1CFJA 3HABA 1KO1A 2VRBA 2OGUA 1JG7A 1H1DA 1OIVA 1C50A 1Z83A 4HRYA 1TC2A 2J4DA 5AIAA 4AWXA 5A0VA 3IO5A 1H1LA 1L7XA 3CZPA 4I0WB 4XWWA 1MEJA 3B5IA 5JYBA 2E89A 5JBIA 1N32B 1E7QA 2PYDA 2B99A 3H6KA 4URYR 1XLWA 4KX5A 3FTPA 3KBBA 3R7SA 2WDPA 4C3ZA 1A4UA 1KIMA 1KSJA 5ERYA 3VKGA 3NBFA 4FU0A 4X66B 3NUGA 4UE2A 4WWHA 5CU7A 2JNWA 4AS1A 2JIZD 3I04M 2LRHA 3KB6A 5EMJA 4QEZA 1AMOA 2BR5A 3KAKA 3I04A 4LJ6A 1DIHA 4JLBA 5ALEA 1BX1A 3B70A 1G20A 2YCLA 4XRGA 4RC9A 3JQFC 1P5ZB 3CVOA 3IVMA 3CZ5A 1B6RA 1MB0A 4JSRA 4N6OA 1UJNA 3IDOA 3SYTA 2OZKA 4UHBA 3VPAA 1F9EA 1JLLB 1GTVA 1KARA 1M6WA 4BX9A 4CYMA 1JHAA 2JFHA 1SG6A 1TUGA 2C2ZA 2AWOA 1TCVA 5A6SB 1RPJA 1NF9A 2HBYA 1UMDA 4XLZA 4YV7A 1XG5A 4C0XA 1ULTA 1C4XA 1Y7LA 1RDFA 2N1BA 3ANLA 4LMRA 1R4NA 4V02A 4YI3A 4M1OA 4X3PA 1XQ9A 4RD2A 1XTSA 2ATEA 4CHGA 4NCNA 2XBMA 4JHLA 2HDWA 4N9QA 3SXJA 3ZKWA 1RSZA 4EFNA 1AQJA 1ZR2A 1XCLA 1E62A 3K1YA 2I1LA 3AUAA 4JV5B 3B13B 4CR8A 2C83A 2CYAA 3BWYA 3DOFA 4YECA 1FFGA 4EGJA 4CIVA 1B8UA 2ZJ7A 3R44A 2XYGA 3IA7A 4G0WA 1II0A 1T4BA 3PUHA 1MC1A 4D9BA 3AHIA 3I52A 3PC2A 3TLMA 2BP7A 2R84A 3DDHA 1ACLA 1CNFA 1RCFA 4FINA 4KAAA 3K9FC 3FOFC 5HF6A 2OZEA 4HC4A 4Q6WA 4CTMA 1OXKB 1N2CA 3OF3A 4UMVA 4YRIA 2Q2OA 4YP9A 3SHQA 1Q15A 4ZDJA 2VJCA 4L9AA 1THTA 4HDMA 3KQSA 3M4JA 2LKCA 1O89A 4C1NA 1I32A 3RVSA 4A82A 6LDHA 5HRAA 5KX5A 2HI0A 3ADOA 4BGDA 4XGIA 3HY3A 2YICA 2JLQA 3EGDA 1RHKA 1L7MA 4O8ZA 4N5IX 3UXEA 1ZC3A 4B6SA 5KYWB 3GUUA 1KEKA 4P80A 5EKXA 2DY1A 4CF5A 3CNLA 3U44A 3WRXC 4LYGA 4WFQA 2JZNA 2N1MA 4J2HA 4QUDA 5A4KA 5L6MB 3AEQA 5HHTA 4C6RA 3E7DA 2C3OA 2N9UA 5EZYA 2JI9A 3ZY3A 4WZBE 2BI7A 1SFRA 3ENNA 2CHGA 1HDOA 4HHEA 5JJIA 5FF9A 1GG8A 4OJNA 2WJ3A 1HDGO 3RSZA 3P52A 1JIVA 3MMSA 4JFAA 4MOWA 4P34A 4UJ3A 4GWLA 5CYOA 3I9V6 1Y1QA 5KKNB 1EHYA 4M8KA 4RTLA 5HQTA 2C78A 4OB7A 4C22A 1JDNA 3CLSC 3T5BA 4DEYA 1XIVA 3FSEA 3LXRA 4IH9A 4JN6B 1BYUA 1OA0A 3L4BA 3C7DB 3N87A 3IR5A 5IAEA 2O7RA 3UT0A 5CYFA 5K0NA 2CNOA 3VDNB 4C2BA 2ZI5A 3MYRA 3I64A 4WMLA 5ALTA 2C82A 4F9EA 3GPLA 1QGED 5KCMA 2FHPA 4DUGD 1OXXK 4MEBA 2EGUA 2ZXEA 4EYGA 2BV3A 4TTTS 3RRBA 4IMRA 4I4TB 4BE9A 2IZ0A 1NUPA 3ZE7A 2QM7A 4QATA 3HPRA 5JSFA 3WJ7A 3DW3X 3W8FA 4ZVRA 3A0RB 2I6TA 3NHUA 1Z7WA 4R83A 2WOJA 4ZOLB 4D0SA 3DMTC 1L5KA 1JPNA 1KJQA 2KBEA 4X71A 1E3WA 1ZOOA 4XYGA 4HXYA 4TYYA 2IYZA 5HJEA 3OOEA 4MV1A 5LXTF 1YRLA 1JXOA 4GAEA 3SF0A 4DV2B 3MAJA 2DFVA 1J0AA 1MKYA 1YIAA 2H9AA 3L6CA 4IYRA 4I9NA 3QBJA 5ER9A 2CY0A 1YMUA 4HGNA 3OWOA 3WB9A 2R11A 1BD3A 1X38A 4J94A 4FFBB 4G0VA 4RLFA 1A2QA 4CF3A 1Q1EA 5TXGA 1XAJA 1O6GA 3AHJA 3NTRA 4WPGA 5D5QA 1AGRA 3I2GA 5SYNA 4MVJI 3HI4A 3TW4A 4RD1A 4YJ2A 1NQ5A 1OBCA 4E2ZA 4OGLA 3CUWA 5FTJA 1UQRA 2XB8A 2XWJI 3A6JA 3STUA 1D2MA 1TKRA 3B6EA 4YMIA 5IU6A 2BW0A 1NI3A 4O4IB 3LM8A 5DLDA 1VBKA 3W1VA 4RX1A 4EM6A 1SXQA 2P4UA 3S1AA 4UBNA 4FHDA 2A9FA 2OO5A 1MXHA 1Y4DE 4TZ6A 3VSDA 4S1NA 4CR6A 1Y6RA 4HH1A 5G3ZA 1FRNA 2CJYA 1CT9A 4HPXB 4WZ6A 1QRSA 3V8EA 1P2DA 1WUJS 5K8TA 1JDPA 3WMFA 4Q01A 3KR0A 2AKAB 1UT6A 4Q7QA 1CF4A 2WWRA 2XUQA 1X1RA 3PE3A 5KX5F 3H18A 5EYPA 3SEFA 2K2QB 2PG3A 3UCXA 2FEXA 1QC5B 1GRCA 4UQPA 5LIRA 3QVKA 4XVUA 4CQMA 4AKIA 1RS0A 4GM0A 4G07A 1WO8A 4Q24A 1U0RA 3QPCA 2W4QA 1TVKA 3BDIA 4MR7A 1C3EA 1A7UA 3QPBA 2HXSA 4XQ0A 3OT5A 1X86B 2OQ2A 4KQGA 3UHFA 2P6UA 4CKZA 4KTVE 4D5GA 4C87A 3ADKA 2G3YA 1TQ8A 2VF2A 3O3NB 2D1FA 3DOUA 3NIDB 5DNCA 2AFVA 2X1VA 2ZIFA 1P8AA 2EP5A 2Z0MA 3V00A 1GG2A 1V16B 3R5HA 4HZIA 1M10A 4S1VA 4QT4A 3T5AA 1O9HA 3HU1A 3Q7PA 3I28A 4FFMA 3GGGA 4G6ZA 4J0FA 5CX4A 5F52A 4OCZA 1IAVA 2WT9A 3BWVA 1LLFA 1BG6A 2OGZA 3D6NB 2QVYX 5BQFA 4BWFB 2PUAA 3OCZA 3WADA 1ZDMA 4WBNB 2G72A 4ZO4A 2EW2A 1DCMA 3E2PA 3EEQA 3X44A 5A3RA 5IASA 4IDOA 2Y0DA 1NYTA 2W6JD 4G0PA 4HVLA 4PQYA 3W7BA 3JQ7A 4XARA 1M75A 3BJZA 1C0IA 3U9LA 2GA9A 3C45A 5DTJA 3E1KA 4D96A 3TB4A 4BX2A 5CVVA 2PH3A 2D59A 1M7BA 1KERA 1JYFA 1Y6ZA 2G40A 3CJRA 1FJ2A 1NUQA 1DIOB 3KTOA 4A15A 2C9DA 1FS6A 2QQ0A 4KBGA 1Y3HA 1OREA 3O7MA 3PS9A 3BWMA 3HG7A 3V9PA 1Y42X 4B7XA 2ZVQX 1G7CA 2ZVPX 2YWRA 3VKVA 1OGIA 3RJTA 3SOPA 4QHSA 3TIXB 3ICPA 1XC7A 4IIHA 3ZKAA 3BICA 4E3WA 4S04A 2X41A 3TBKA 5IH7A 3IP1A 1NNSA 3V48A 3HJCA 4J9VA 5KC9A 2J0UA 3ISJA 2YQ5A 3KOYA 3AY0A 1ECCA 4OMCA 3LK7A 5B6IA 3A7DA 4PAMA 5CK5A 5GTDA 1R0WA 3JQRA 1SKYB 4JL5A 3UM9A 1NV8A 1C3OA 2NPFA 3W2IA 3W9YA 3CZ4A 3LD9A 1W0JD 2CF6A 1E96A 2A84A 1Q77A 3H2YA 2FW8A 2QTAA 3TJRA 1LBTA 1FQKA 2CJWA 3QKTA 1IBCA 3A1TA 3KYBA 4UAGA 4PIMA 3ITKA 4EGQA 3ZNQA 5ALNA 3AY3A 5TT1A 1TK3A 4WESA 4LRWA 3UJ9A 4B3DA 1SBZA 3RUFA 1DJOA 4UTXA 1A9QA 1CTQA 3E3NA 3KFXA 2DR0A 3UW3A 4KWEA 4YAGA 3JQAD 4I5FA 4AJOA 3K9LA 4M49A 2RG1A 3FPFA 1U3VA 1J0CA 4MKHA 4NBTA 4TSFD 1O6BA 2WFZA 2A0KA 2FEPA 2YXNA 3CS3A 4HLCA 3ZE9A 1XRPA 1KORA 3DZ8A 3QU2A 3IVRA 4DZTA 2Q6KA 5LJLA 3NANA 4TWJA 2OECA 1M3SA 2AFIE 2WUFA 3O8BA 1B93A 2J6HA 4EG4A 5BSRA 3UT5B 2FKNA 3M4ZA 3UIEA 2I7CA 3WO0A 2WP0A 3CZRA 4GPZA 4LHSA 2ZUEA 3BXGA 1A95A 5KNBD 5E0OA 3N2GB 2O5RA 2O3TA 3QEOA 5F3DA 4ZT5A 5CAEB 4M0FA 5FX2A 3PU6A 4CM4B 3S5UA 1GCAA 2BI8A 2I7DA 2O7QA 1XEXA 3IMGA 2ZKIA 2AW3A 4KIUA 4Q4AA 4GI7A 2YHIA 5DGHA 2F48A 2WU8A 3P2KA 2QGZA 1G0OA 4FYPA 3TR0A 2Q7XA 3OPYI 4NU5A 4N5DA 1T5BA 3A26A 5B4VA 1FSGA 4PHCA 4HWSA 2HIGA 1PNTA 2AJTA 3QE2A 2FEAA 4MGKR 3WNBA 4CG3A 4E12A 4OMDA 1FW6A 5ALDA 1NAHA 1RXYA 3GQVA 4IHQA 1KFBB 1VKZA 3GXOA 3OJXA 3JD1A 3A31A 4U6SA 2QVZX 2AZDA 2XITA 1J0DA 2YBEA 1DOZA 5DK4A 2BPOA 1ZR4A 3DMNA 1E1RD 2CDAA 4KN9S 5EIWA 2TMYA 3FVTA 4Q1DA 1EFKA 3W4IA 4O4LA 1LVUA 5EWMB 1OTYA 1Z3CA 5HVNA 3G0CA 2Y66A 3ZBUA 4AY4A 3RYFB 1OXBB 1JDJA 4BFUA 3EF1A 4JODA 4UAJA 4PX3A 5I8ZA 1VJDA 4A6XA 5B55A 2PN1A 1G21E 5EXTA 2R5FA 1IMOA 4QU5A 4IVNA 1E63A 1RHUA 1ZC4A 2VDPB 1CE8B 1UK6A 1L7AA 5BW5A 4WVLA 1VKNA 4KQ9A 4X1IA 1YGPA 4OXQA 5EMHA 3B1KA 4P0QB 2GD2A 1CQPA 4OU4A 4W1PA 4EL5A 3IB6A 2PMWB 4X44A 3GLFE 1VECA 3D31A 1ZW1A 1V45E 1IEWA 2IYVA 2J3HA 3G8DA 3N2IA 1YMQA 3O4HA 1TB4A 4OFWA 2VJAA 4TWBA 3VMFA 2ZQZA 3DHEA 2WSMA 2HLHA 2WSSD 3LC1O 2V5AA 2OC9A 1MAVA 1XCPA 1VRVA 4UARA 3VJMA 1AKUA 2QSYA 1F14A 3NDBB 3G2LA 1WUTA 3EEIA 1E1QD 3CRVA 3JARA 4FFSA 4RA9B 2XMGA 2N0SA 2YCBA 2A5DA 1MOSA 2FWIA 1K6IA 1QTRA 4K6GA 1QSGA 3IIMA 2Y1FA 4ZAFA 4EMTA 1XCJA 5LZ5A 5B1SA 3B20A 4WNIA 4MVJH 2O8DB 5G0VA 4CW7A 3K70B 1P77A 1OX4A 1M34E 1M1NB 1ONNA 2REQB 2I7XA 4UNRA 2XX3A 1IUPA 3QXSA 3ED5A 4OA5A 3KQOA 3T41A 3JD0A 4EUKA 2QE7A 4CM3A 5IFLA 3UEOA 4DMGA 1T8PA 1U5BB 3LCMA 4EKGA 3OQMA 4IDAA 2EIHA 1I3NA 2FI1A 1WSDA 1U31A 2I0FA 2ZRAA 3QKIA 1M2HA 4R8LA 3ZTTA 3PKIA 4F45A 3VR4H 3O75A 2F9FA 3NGMA 1IB6A 3AIMA 1I5EA 3H13A 4OXXA 2G0AA 2B61A 2L42A 3H2GA 4E03A 3FB1A 9GPBA 2C7BA 1Y4ZA 2CNBA 2OGWA 3HRHA 1P4GA 4A8JB 2NU7B 2VBCA 3KSMA 3BJIC 3O90A 1NY5A 1PR5A 3OVMA 4XWOA 1E9VA 2CLFB 4P5PA 4QBTA 2ZRBA 5ABPA 5DNVA 3KHTA 3PVSA 4BLTA 2ZYGA 4A8PA 5H9WA 3T5DA 1ZKMA 1M6EX 4PXSA 4Z2AA 3F4LA 4Q4AB 3KPWA 1E66A 4DMRA 1DKPA 2BMAA 1E3MA 3OQVA 1PV1A 3AKYA 1M7GA 1E1LA 3R3XA 4EEKA 2JARA 4PYKA 1U2ZA 3LPNA 2AJDA 5CGZA 3RC3A 4PBRA 3ZUGA 1LU9A 1P6UA 2F2TA 1QZUA 3B52X 5LXTA 2ADMA 2QRHA 3MPOA 3RUPA 2HMWA 4DR5B 3VDXA 1DO0A 2OCGA 3A4MA 2WKRA 3DVAB 1S2DA 1ID8A 4QYMA 4DIFA 2R7LA 1R8YA 3FJOA 2P0AA 1U1GA 3O93A 1EEHA 1XGKA 1EVZA 4I99A 1XPJA 2WHRA 5FUYA 4KGVA 4CGYA 3IGFA 4PFSA 3T35A 1VHLA 3AG5A 1F0NA 1N0VC 2RHBA 4CL0A 1Q74A 4A0QA 5T57A 4BMPB 2P35A 2Q4TA 1TUBA 1LBHA 1VE9A 5DXJA 1NXQA 1SOWA 4I36A 3TDMA 4A2PA 3IUMA 3PXAA 4YJ2B 2C9OA 2IDKA 1X1EA 5SY4A 1DFHA 1AKRA 4OKNA 1MC4A 5B5SA 3IAS6 4RNCA 3DVQX 3OU7A 4ZQGA 2QP4A 2G9NA 3DVLA 4BNFA 4MRPA 4I4TF 1PG5A 2PRYA 5EIBC 2OBXA 2AI2A 1P9RA 1XRLA 2QF7A 1L5RA 4U9HS 3IYLW 3TTVA 4ENPA 2VS1A 4L0DA 1P7CA 4YUZA 1XAIA 1RI5A 1EKXA 5EQJB 3ECAA 2G36A 3VZQA 5CCBA 4P4LA 1C3OB 3PXEA 2ZZNA 1CCWA 1C9EA 4XUGB 1DINA 3A27A 2DPGA 5BN5B 1O4WA 2GWRA 4MI9A 4NCXA 4EPTA 5KNCH 2YDYA 1U2GA 2IVFA 3R9XA 1DPFA 3NHLA 1CUFA 4IIYA 1P45A 4ACAA 2WUGA 4HAUA 2REOA 1SU6A 3M33A 4O4HF 2YVLA 4TKVA 3ZZNA 4OXIA 3HWSA 2K6GA 3A3OA 2Z43A 3MD9A 1SUSA 4MWGA 1FXWF 1T9DA 2PR2A 4M36A 4BJ1A 3WYDA 4S1OA 4BCBA 1KEEB 4EF4A 5JZMA 1RAHA 3DM9B 2C2OA 4LW8A 4WZBA 5GGYA 2PX8A 3QQ5A 4PG8A 2B2NA 3KZXA 4DUGA 2WD7A 1V3TA 1URPA 3UJ6A 2FR1A 2AI1A 5ELMA 3H9UA 2DUJA 3ZHTA 1G0NA 1CY0A 1Q17A 4L3VA 4P0PB 5J4LA 3DLHA 1U63A 1S8FA 4P7FA 4ZPXA 5JOQA 1NR5A 2P3OA 1C8BA 3F6YA 1XA0A 5K2OA 5G4LA 1IB0A 3DT8A 3PVCA 4RVUA 4ZQCB 4FVTA 4PEVA 1PUIA 1CQWA 1PD0A 4WBNA 1Q1BA 1EZ4A 1U2EA 1AM4D 1H4VB 5K6AA 2UZ3A 5E4JA 2C92A 2OENG 3ZH9B 2CWWA 3SBDA 3D2LA 3JVUA 4LISA 1P5FA 5KOHB 3VYVA 2JCYA 3HDJA 4IIJF 4LX8A 3AI7A 1MMFB 4EG3A 3GLQA 2A9RA 2GF9A 1IM8A 1YDHA 4KR2A 2JK1A 4FGSA 4OIMA 1XNHA 3R3HA 2XSZD 2GPNA 1UFVA 1ZUNB 4E32A 1G5HA 4UU8A 1FDWA 5HWSA 3HVRA 5G1NA 3VKWA 1EB8A 5J4KA 4L5YA 1NM5A 1LRLA 2GVNA 2FPOA 3QRWA 3VAAA 4GYWA 5BWBA 1EGVB 5EJIA 1JIQA 1JWBB 4ZAWA 2ABWA 5K3EA 3BGWA 1NW9B 5IP5A 3TI9A 3SDSA 5IJ0A 1HE4A 1H8EA 2PGDA 4PYJA 1QMPA 1BE8A 4PLYA 2L0XA 5I7AA 1LJUA 5HKBA 3W4JA 1I6WA 1NIPA 4D0RA 1NJSA 3GGCA 1XDWA 1YCHA 1Y5RA 1YRWA 3AESA 2V5VA 2AF4C 2O57A 2PLNA 4KQIA 5KNDA 1QAQA 2Z2XA 4MR8B 4DPKA 1BD4A 1KO8A 3K35A 1J8YF 1XMIA 1JJAA 3HP7A 1T0HB 3JZDA 3QMVA 3RIMA 4CL3A 1I51A 1OI7A 3MLEA 3THWA 4GECA 4FEEA 4UHHA 3R5KA 3DLCA 2XD9A 3IIIA 1XVVA 5JECA 4DLSA 3AJ9A 3ND9A 1W1WA 3NGLA 3S1AB 3AGQA 1I2ZA 5CT5A 1WZUA 3ICEA 5AM1A 4GIBA 5C37A 4MUXA 2RHTA 4XD2A 5JBNA 4WLEA 4GNKA 4R0NA 5LQCA 2WJGA 1L5HA 1W1UA 2HSJA 1EK1A 3QLUC 1FRZA 3CF6R 4JELA 3SS7X 2X0EA 2QX4A 3VHXA 3O8DA 3D8RA 3G3EA 1M76A 1L8AA 3M6WA 4YUWA 4TM8A 3R7AA 2C8JA 1RBMA 1OYWA 1YB1A 2ARKA 4KK3A 2DQZA 2J30A 3IA2A 3VZBA 4B6RA 1CRWG 3HKBB 5AXAA 3CO0S 3I9KA 2V7QD 3X0DA 3MHTA 1NU6A 3ABIA 1M8PA 3UPUA 2JAXA 2OHOA 1WU7A 2C9BA 5AQEA 2OXTA 3VSCA 5J4HA 1LUAA 1F4VA 4R2IA 3DDUA 4FDLA 1TO6A 3KWJA 4HDNB 3DE0X 3T7SA 3VR4A 1GIAA 3N0XA 1I7SB 3ZY6A 1R74A 5J9FA 3EF0A 2MYUA 3CF0A 4AJKA 2HT1A 2CXOA 1CUWA 3QNUA 5JISA 1R4AA 2VNSA 3H9BA 3GFTA 5AVXA 2ZI4A 5EWLB 5E6SB 4A2CA 1SCKA 1XRSB 3SBEA 1P7ZA 1GSAA 1Q83A 4OQYA 1EZZA 2FW0A 2QLJA 1L4LA 2JFVA 4N49A 4WXMA 1VHQA 4V1CB 1ND6A 3SSAA 4MMZB 4NNOA 5FFMA 5I7HA 3NRJA 3L8YA 3VO1A 4HDKA 3A1DA 2WAXA 5IVKA 1WDTA 2G9VA 5CVUA 4E07A 4AJ9A 4BPBA 2JHFA 2E5WA 3HTXA 2J31A 3I6YA 3NG1A 5AFSA 3ILVA 1ZN2A 2HJSA 3VR5H 1W88A 2B4QA 3A6GA 3GUVA 4FLEA 2WABA 2G5TA 1YR6A 4RORA 5L3ZA 2PXAA 4D6PA 1EUDA 4RD0A 1GUBA 5MF6A 4MWDA 5CYPA 1H2RS 1DADA 1XA4A 2UKDA 4NOJA 5BN3A 5I7UA 2OAEA 2Q9AA 4I1UA 2IELA 4IJQA 1LFAA 1NE7A 2QYTA 4YMVA 4TTSA 3K8YA 3U61B 1EIWA 2VCYA 1EWVA 1UBNA 2FSVC 2PRZA 5ALQA 1P31A 4RV5A 4XQ9A 5H3LA 5ADHA 2BF7A 4EB6B 3Q5GA 4K9MA 2XQFA 1C4KA 1ZOIA 2HWXA 4CMAA 1IHOA 3AG6A 3KP1A 1SB8A 4MARA 1QQTA 5TPWB 1AKYA 1BKDR 4B31A 4B5KA 1G98A 1K8YB 1UMBA 2AEJA 3T7AA 1A82A 2ZJ2A 1VZ3A 1ZG3A 2NP6A 4PLZA 2JIDA 1HDZA 1L7QA 1KL7A 3FA2A 1UT5A 1GPH1 3K0KA 2XY4A 5EN4A 1ZNXA 1HDCA 4H6PA 5C8YA 1UQUA 1BX3A 2D2EA 4CQMD 2XIQA 2UUBB 4F4JA 3CBQA 3R0XA 3FVQA 1QGZA 1YB4A 1XNJA 4DPLA 1UDXA 4IS2A 5ALJA 2ODWA 3C5EA 3V97A 2N46A 3ST7A 3JALA 1JP7A 5C31A 3URKA 1DEAA 1KO5A 1W6UA 2H6EA 3FCEA 4HDRB 3TI7A 3UK6A 5DHRA 3BSSA 1KZHA 1N2SA 2IYLD 3F6RA 3PSHA 3GHHA 4QOSA 5BXQC 4JLNA 2VKTA 5G4KA 2HCJB 3D4PA 3G5MA 2XTAA 1XYVA 4AMZA 4RVDA 5JY6A 5IT0A 1UCFA 3RU9A 1S3IA 2IOYA 1UANA 2PVSA 1SCJA 2OESA 5EIOA 5J5VA 3RYHB 5KAPA 1R64A 2X19A 3E03A 1IZ8A 3R0JA 4L4UA 2A7QA 2VNJA 3U16A 4OG2A 1CU1A 1TECE 2C5FA 3PNOA 4WOPA 4UDXX 4X7MA 3BMOB 4QNRA 2WA1A 2ZBUA 1D1QA 1X7XB 2ID7A 3KE8A 4ZZ2A 3DFUA 3VHXB 2AN9A 3GZNB 5CH5A 3ONVA 4EECA 1G20B 5A4JA 1W49A 1Y4UA 4DT1B 2GJ4A 3DT9A 1LFDB 1M34A 4LOLA 1H2EA 3GOHA 3RD5A 2YWDA 1BKYA 2NW6A 4PRYA 2Q3LA 4RMGA 4YAWA 2Y6UA 3C48A 3UMVA 5ERXA 1GQOA 3G9XA 5C2JB 4X7RA 1O7JA 1KJJA 2D7DA 1X3SA 3BTVA 3LT4A 4BNZA 1UBHS 5ALRA 1U3DA 3CUUA 4JJIA 1XXLA 2D2VA 2GTIA 4Q1FA 4ZRDA 4UXIA 1NF3A 1JXAA 2NYUA 2R8BA 2ZJFA 4LTMA 5EPEA 1SVUA 2BONA 3DPSA 3EUAA 3ZYZA 1ZGHA 3SP1A 4D4JA 4KITB 4PYIA 4J0KA 2CMFA 4HSGA 4K2HA 3E3LA 3NS7A 1ZCBA 1SU8A 5F76A 3PQ8A 4B74A 4EY7A 3TOXA 5JWOA 3D02A 4GLFA 3DUFB 3H05A 4NBLA 4XSVA 4YLEA 2PH5A 3NJRA 4DTIA 3VUEA 3NI2A 2WWFA 4DWJA 5CVTA 2F4NA 2UXBB 1M54A 3VM6A 4K46A 4Q7MB 3L77A 3VISA 4ZYWA 3W6PA 4YR9A 3T1NA 4D6XA 4TV9F 4TMKA 4IIFA 1QUEA 3DOIA 3D3WA 1XR3A 2WIBA 2BKXA 2BHRA 3ETNA 1JNYA 2ICAA 2P67A 1P0FA 3THXA 1UINA 4UEKA 1HSZA 5LCXA 2BEVA 3KQKA 2EFJA 2RKBA 5SZHB 1GGEA 3LVBA 1DC7A 5CW2A 3U4DA 5B7PA 1FX1A 4P5DA 2Q5CA 3ZK7A 4N48A 1Y1SA 3G8YA 1XKXA 2VDNB 2WUEA 2V8OA 1F48A 1B14A 1Q7BA 1FDTA 3AY7A 3DP7A 3EXG2 3JAKB 3KELA 2EDCA 3P9XA 4GGMX 5CT8A 3X43A 4PO9A 4J07A 3T7JA 4QHTA 2IY7A 4IWXA 1UXJA 2C2MA 4L57A 4Q0MA 5F64A 2DFNA 4EYEA 1JZSA 3AM5A 4J2OA 4ZKEA 3GNLA 2Q27A 3VGPA 2MCFA 2HZBA 1IBRA 1VP9A 3CLRD 5J5CA 1A8HA 1HPLA 3PFIA 2ZRHA 3C3EA 3GCXA 4DIKA 3U4GA 4DWVA 4X00A 2VDWA 2Q1YA 1KEEA 2PAFA 2JBAB 1HT1E 3E84A 3H8VA 5L9AA 4KPEC 2I4RA 5FLXA 4HR7A 2X15A 2ZCVA 1CYDA 4CRWB 3GEIA 3I2IA 1ISGA 2IPOA 3N0VA 1RLOA 2ZSFA 4UM9B 3OFSA 4BS9A 3HU3A 5EIAA 5SYMA 1QXSA 2J41A 4C0WA 2BTEA 3H9EO 3DS8A 1JTFA 4TLLB 5HZHA 3KCNA 5DNDA 1I5OA 1N2EA 1NL3A 2BHNA 2EKQA 4JYPA 3OLWA 4PE5B 3ANTA 5K0SA 1PRYA 1U2RA 3GW8A 3AL2A 4RIFA 4WNAB 4NS4A 4K5QA 2PYZA 3OM9A 4BRWA 4BQSA 3U80A 2Z1MA 5SICE 1IWOA 4UMFA 4A4DA 2VATA 3WNZA 1HKHA 2O3JA 2EOAA 3TOCA 2WFLB 1AMUA 3E6AA 2SKDA 4QBKA 1FIUA 2OCDA 1SAYA 2PUVA 2V4ZA 2R00A 3AERB 4MULA 5T4HA 2R1TB 4G0ZA 1OT3A 1PD1A 1ODLA 5F7JA 1TIKA 3AUTA 3QITA 4BLWA 5AIBA 2BZGA 4RS4A 1M2NA 4XWKA 2GAFA 1PSWA 4M22A 3D0RA 3P5SA 1KJNA 1I7PA 4X54A 2EARA 2X5KO 4GVXA 2QTWB 4OHPA 4GMDA 3I9FA 4LWPA 4FWTA 3PGVA 2A0UA 3G02A 1H65A 1NN5A 4IW3B 5A2QA 4RQBA 4KKVA 3HSSA 4WOBA 2WVJA 2WTMA 5HFJA 4HXFB 4AKHA 1D2NA 3PCRB 1OI2A 1FQJA 4BEBA 4DLBA 3NFRA 4FB4A 2ODNA 1QONA 3DVAA 1PL8A 2P0EA 5JHGB 4KRYA 5JJBA 2GETA 4IY1A 2RDMA 5E0KB 4PYLA 3T0IA 4GT1A 1LJLA 4OLJA 2VHQA 1GPJA 2OC4A 4I1SA 4C0BA 4ZYTA 1P2UA 2BZ0A 2IYEA 4IVQA 3BIOA 2XMPA 2Q3FA 1SVSA 5TIIA 4QYXA 5JSUA 1U2DC 1HURA 3EXFB 1GNRA 1QYCA 3PJDA 5TVKA 5BV2P 2X42A 2I3AA 1F12A 2OHJA 4O4HB 4UE3S 3UMGA 1P9LA 2JAWA 4COOA 5AJUA 5TQ0B 3LT2A 2NQ2C 4CKWA 5IANA 3NM5A 2XZTA 3A25A 4JEUA 2JGLA 5KI6A 1I3KA 2M1XA 2O3UA 4KB5A 2G82A 4NICA 4TKZA 3BMQA 2SICE 1Z4KA 4S12A 1K9VF 4I14A 4YRPA 3LP5A 4BFTA 1NBWB 1ZGGA 1VL8A 2QJWA 3QHPA 4UQOA 2POQX 3ZGZA 1JR6A 2QLFA 3IAXA 2A88A 5LMNB 7ADHA 2E4WA 1EK0A 1XHEA 5GY7A 4DR3B 1MCZA 1GRNA 2QT1A 1BWSA 1W9HA 4MTCA 5HZGA 3WGMA 3CNEA 1M83A 2YXDA 3DVRX 5CNIA 4UNNA 5A02A 5CIWA 3OJOA 2DSTA 3FPJA 2KBFA 1OYYA 4FWIB 3UB4A 4YJ3A 4E2XA 3ACDA 2PO7A 3WMEA 1TO2E 2ZYTX 3UV6A 1V1MA 2IQ5A 1YL5A 2DQSA 3HY6A 3VSEA 4ZJUA 3MD0A 1NI4A 4Z9XA 1OQAA 4ZICA 1J22A 3RUIA 5I8WA 1WMAA 1Q1GA 1AXRA 3VGJA 1HL3A 3G82C 4URVR 2FZ5A 3M6LA 3QBEA 1MO3A 2IX3A