4Y1RB

Sav1875-cysteinesulfonic acid
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
169
structure length
168
Chain Sequence
KVAIILANEFEDIEYSSPKEALENAGFNTVVIGDTANSEVVGKHGEKVTVDVGIAEAKPEDYDALLIPGGFSPDHLRGDTEGRYGTFAKYFTKNDVPTFAIHGPQILIDTDDLKGRTLTAVLNVRKDLSNAGAHVVDESVVVDNNIVTSRVPDDLDDFNREIVKQLQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein SAV1875
publication title Structural and functional insight into the different oxidation states of SAV1875 from Staphylococcus aureus
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus mu50
molecule tags Hydrolase
total genus 58
structure length 168
sequence length 169
ec nomenclature
pdb deposition date 2015-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01965 DJ-1_PfpI DJ-1/PfpI family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4y1rB00
4UZSA 2W7TA 2XF2A 1OI4A 1T36B 1P81A 4I2NA 2GHRA 2NV2B 2R1UA 3OT1A 4L8YA 4P36A 3VU3A 3L7NA 4B2YA 3L3BA 1OX5A 4GE3A 2VRNA 4QYTA 4P5PA 2YWDA 1P7YA 3ZJ4A 1J42A 2NV0A 4E08A 1I7QB 4B7AA 4RKYA 4ENRA 1I1QB 1Q2UA 3M3PA 4L8WB 4Y1RB 5LIRA 1JDBC 1IZZA 1I7SB 3D54D 1OX4B 4OIFA 1PE0A 3NOQA 2VPIA 1K9VF 4MTCA 1N57A 3EFEA 1P7ZA 2AB0A 3F5DA 4P2GA 4WXYB 4ZDIA 4ZDJA 5BV2P 1GGKA 4ENPA 2VXOA 2R1TB 1QVVA 3TTVA 4BIMA 1OY1A 2H2WA 3PQ8A 3R76A 2LXNA 3CYFA 4N12A 4I4NA 1KA9H 3CZ9A 4QYXA 1VHQA 4HCJA 3TTWA 1QWSA 2ZUVA 2ZUWA 5SY9A 4PXYA 3BWEA 4L8FA 2ZUUA 3EZGA 5K4AA 1GPWB 1GGEA 2YWJA 4R7GA 4B31A 3MGKA 1PV2A 4Y1EA 3PQ3A 4WINA 4Y1RA 1KXJA 1VCNA 5DFAA 3UK7A 4AUEA 3B38A 1GPMA 3N7TA 5SYAA 2ZUTA 1OX4A 1BXRB 3B36A 3TTSA 2VKTA 3FSEA 3UGJA 2R1TA 4Y0NA 3BHNA 3P9QA 1L9XA 1CS0B 1KWGA 4RKWA 1OX6A 3EN0A 3ZJ5A 4OJYA 4ENSA 4LRUA 1FYEA 3ER6A 4ENVA 1FY2A 1C3OB 3R75A 1S1MA 3PQ6A 2AD5A 2OR3A 3TTTA 2D7JA 4UNIA 2ABWA 4E5VA 3KKLA 2VDJA 4ADSG 3UJNA 3CZAA 1GGJA 3NONA 3P9RA 4ENQA 1IPHA 2YWBA 3NVAA 4B5KA 4ENUA 1CE8B 1QVWA 4AUNA 4L78A 3P9PA 3NOOA 4GE0A 4OQ4A 3FIJA 4MGHA 4AUMA 5JZMA 5E9AA 1T0BA 4ZDKA 2R1VB 1O1YA 1VCOA 3SOZA 5JZOA 1QF7A 1WL8A 3B3AA 4JQSA 1UCFA 3ZR4B 3MIIA 4UCFA 5SY6A 3TTXA 1GG9A 3WFZA 1M6VB 1VCMA 2RK4A 2RK6A 4L7QA 1T3TA 3SF8B 2YWCA 3F71A 3NORA 4P34A 1U9CA 2V4UA 4UOZA 3PQ7A 4OGFA 4I46A 3PQ2A 1Q7RA 4K2HA 4GUDA 3P9SA 4MNTA 1R9GA 2FEXA 3CNEA 1SY7A 3L4EA 4Y1FA 2WJZB 5SY4A 3UOWA 1KWKA 2IUFA 4OGGA 1P5FA 3OT1B 1JVNA 2ISSD 3EWNA 3NOVA 4XLLA 3L18A 3TTYA 1QDLB 4AJ9A 4ENTA 1PDVA 2RK3A 3GRAA 3CY6A 4AULA 2R1VA 1GGHA 4BTEA 1GGFA 4Y1GA 1A9XB 4L95C 2GK3A 3TTUA 4ZGGA 1IZYA 1PDWA 4OFWA 4N0MA 4ENWA 4UOQA 3PQ4A 3UMMA 2ZUSA 3TQIA 2A9VA 1ONSA 5IP5A 4LGYA 1KEEB 3RHTA 3SF8A 4BFLA 3EJ6A 4S0ZA 1G2IA 1CF9A 1SOAA 4P35A 3R74A 1C30B 3PQ5A 4D1YA 4B40A 1QVZA 1P80A
chains in the Genus database with same CATH superfamily
1D4FA 1HK7A 1YNSA 1XVVA 2X4LA 3CEAA 3DDOA 4QQKA 2FXVA 2ASEA 3VR2A 4HDKA 3JQEA 4MIOA 4CDGA 3I0MA 5AM2A 5JD4A 1USVA 2WMNB 3NHAA 4JVOA 3PV0A 5BWMA 1E0DA 2Q45A 3BCRA 1LI5A 3CS3A 3K2IA 2RDMA 4G0MA 4MHSA 3KX2A 4ODIA 3SIPA 2DGDA 2HBYA 2ZYRA 3GVCA 4O3MA 3U17A 4YPOA 1ZESA 1ES9A 1V5EA 3FYCA 2XUKA 2J9GA 3KVRA 1AGRA 3SLRA 2DH6A 5ARDA 2HA0A 3AL0C 2EWVA 4CKBA 2H7CA 4RCZA 5HDBB 1I4DD 4YRDA 2NGRA 4I08A 3K0SA 1D4OA 3QXSA 3G1TA 3B6ZA 4JYAB 5LU9A 1BWRA 4OUDA 3AF0A 2GHIA 3L9WA 3PBKA 4JIGA 4M0PA 2YV2A 1E99A 3HRKA 4UCQA 5HTOA 2H0RA 2OBMA 2XPCA 5ENZA 4A5SA 3RU2A 1E2BA 1UBUS 3D6NB 1DTEA 3EQ2A 4NCHA 4QDXA 1VJRA 1F51E 1X92A 2XE6A 3RG2A 1GYRA 4MQEA 4JR2A 5AVUA 1ZOSA 3IKLA 1N32B 1KJYA 3M1LA 2D4HA 1RJ9A 3UANA 1Z26A 4WOPA 2VYCA 4LOIA 4RAQA 4YT2A 4L9WA 3JQGB 5ELLA 3D0RA 2YXEA 4Q7EA 3UW1A 5IKMA 1YB7A 2CCKA 5ADWA 4Z4IA 3MJ4A 1XT6A 3K71B 1KF0A 4XIGS 1L5HB 4HH3C 5CVDA 3V7NA 4C78A 3JWGA 3GRZA 1MORA 4D7AA 2ZXUA 2RH8A 4Y2PA 2OENG 1TXGA 2C2WA 2PRKA 1N2BA 3N8GA 4NBNA 3UUGA 3H6GA 1QRRA 2B25A 4BWYA 3F4BA 2GR9A 5LJIA 4EHBA 2E9SA 3BUSA 4I1YA 1U2SA 3ZLBA 4WD3A 4IEEA 4ER7A 4TWIA 1CZLA 3HDVA 3RH0A 3GEPA 2HA5A 1RYMA 5JU6A 1PT5A 2I4NA 3T34A 1P29A 1X1TA 5FNZA 5IW8A 4NYIQ 3AVWA 1TJNA 3CWZA 5ESRA 5FWXA 4KDRA 2GPWA 1LEHA 5FD8A 4FQ5A 1U2EA 1DCFA 2Y1GA 2ZJ5A 1CB0A 1DB3A 4PPNA 4JI0B 2P79A 2ZQYA 3IB6A 4RV5A 3SFZA 3LPLA 4H3VA 3PGKA 3QHAA 1H85A 4OLJA 2J0UA 3LX4A 2FE1A 3U49A 1TYCA 1RCFA 4QUHA 5JI3E 1AH2A 4L6AA 3E7WA 5T5QA 1F12A 4JT2A 4XB1A 3IXLA 2BE7A 3B1JA 2WVGA 4TTJA 4NDNE 4FOOA 5KNBA 3K8OE 1O2DA 2KMLA 2ZZMA 1SHKA 4Q4AB 5FBWB 3E1KA 1YJAA 3X2SA 2Y1LA 3IYLW 5EJ7A 4B76A 4ZAXA 4FJ0A 5DO9A 1VHWA 4PC3A 4FT4A 4XIFA 4YFYA 5C18A 1ZH2A 3GAAA 2WYOA 1BU8A 4E31A 3V4PB 1QGZA 2SKEA 1HZZC 1RKXA 3A2LA 3WL4A 4JP8A 1MO2A 4H77A 3GPDG 3PNVA 4HMQA 4QU5A 3SF8A 4BYMA 5J4YA 2PUAA 3RWOA 4Q3BA 5LZ5A 3KHTA 3AK4A 4BFUA 1UXIA 4RMNA 5TMPA 3L7OA 3ZWAA 1QMPA 4OX9B 5ED0A 3R6GA 4RSHA 3UGQA 1EG7A 1SELA 3HH8A 3Q9NA 4RTQA 3DQQA 2VH1A 4I3GA 2JNWA 1BWSA 4K9SA 2HV9A 3WO0A 3CEMA 1F2UB 1MC4A 1Z2CA 2HF9A 2I76A 1R8XA 2DY0A 2YICA 3D5EA 3NAZA 5L7YA 1AKVA 3ANMA 4X5OA 1JUDA 1T4CA 3LWZA 2BR5A 4C89A 4I3HA 3RTGA 4CQLA 4H3SA 2GPNA 1I1QB 2XMCA 3JR7A 1YONA 4XWWA 1NA5A 1JBQA 2NU6B 4IZHA 4KLNA 1O9HA 2QLMA 2A88A 2FR0A 3DP7A 4V0RA 1JLLA 4RTSA 3HBAA 1TX4B 1B93A 1PT8A 3W9BA 1GZSA 2JAUA 5K2MA 5DBOA 4G4JA 2PT7A 4ZJUA 2VRBA 2Z08A 1QQTA 5HCUA 2XMZA 1UMCA 2V54A 3OWHA 4XDZA 1GARA 1T1RA 1HO3A 2B36A 2RBEA 2ZSAA 4N12A 3W6OA 4ONEA 4YR9A 1EDOA 3EUWA 3O4HA 3X44A 1VKRA 2JJYA 2Q5LA 2QN9A 1JEDA 3QLEA 3L7KA 1Y1PA 1WQ1R 1AGNA 1LSSA 3QI7A 3NYWA 4JLKA 1C41A 1Q7GA 3LUCA 3DTTA 2YOGA 2OBFA 4LI0A 4Z86A 2GARA 1YUNA 4RQTA 5JSYA 3UUEA 4DJAA 2O8CA 3TOZA 2E4UA 1K7FB 4ND8B 1IHDA 5FYDA 4M9SA 1D5CA 1DJQA 3VBEA 2QBYA 1FDRA 4OD0A 1U94A 2F4NA 5BXYA 1AZLA 3EGDB 4A10A 2QJOA 5CB4A 2C3MA 4NLLA 3H5IA 3EISA 1XWFA 2GLUA 4C4SA 4D98A 3TUZC 1KKMA 2FG7C 4IOKA 2Z3WA 2ZYGA 3MTGA 4KDFA 2XMPA 2ZTVA 3EUEA 3IBFA 2OQRA 5HZMA 1MIOA 2Q0XA 2X4GA 2BBOA 1A8QA 3D8NA 4IDNA 4S1PA 2AQKA 3EMKA 2R5NA 1OFGA 4IINA 2FJUA 4WQMA 2SKCA 1EHIA 3COSA 3PI7A 4EYQA 1ZM2A 3D7LA 1WL8A 1BYIA 2C2MA 2FR8C 1UP6A 4GZ3A 3ADBA 2ZTMA 2Y67A 1M6VB 3OPYI 4NNPA 3LQKA 1SXGA 3GUVA 4WCFC 4DBLC 1WPRA 3NH6A 3WMRA 4CR6A 4CMEA 3A58B 4XJXA 3RBAA 1E2MA 3N2EA 4XWOA 2WTEA 1Z45A 3NPMA 4GR9A 1NUQA 4MICA 3HYSA 4EJ0A 1IM8A 2FEXA 3K30A 1T2AA 2ZSDA 4MRNA 2XLBA 1UZMA 1GTVA 1T1JA 2QGZA 4DA9A 3SVLA 1JFSA 1Q0QA 4OK5A 1Z82A 4W1RA 2DHEA 2J5QA 2FPPA 4YJ2F 4ZRDA 4ZV7A 1NVDA 1GCGA 3AF2A 4A8HA 4WZBE 3D1LA 5EP3A 1Z8HA 3FFXA 4IVRA 5AKHA 1JQDA 2G1UA 4OI0A 3TTUA 3WNVA 4N48A 4RMJA 1EA7A 1PWYE 2CL6X 4LZNA 1V96A 4S2EA 3WTCA 4A0RA 4BNTA 3AFMA 3GFBA 5A4IS 1BWPA 1RYEA 3IRUA 4PZYA 3ZQKA 4CL2A 5HM6A 2FZEA 1JG3A 1UBJS 1XX6A 5AUOB 4DKJA 4DAEA 1GAEO 4WUVA 4C2TA 5C1OA 2PJRA 2ZBFA 2OXIA 1XC7A 3VO2A 1VYUA 5H16A 4D42A 3E9CA 3AGQA 2CEAA 1XROA 1J0EA 3V80A 5CXUA 2R1UA 1VHJA 3A37A 2JJMA 1PUIA 3RLFA 3ZWOA 4FU0A 3BIOA 5EJFA 4EYEA 1O6FA 1RAAA 4RNDB 1DCTA 3FKSD 4EJSC 3LOPA 2H4JA 1EX7A 3ME5A 4JEHA 3SHTA 1B3RA 1OH8A 4K9QA 4PSAA 2O6LA 2JA2A 4WDQA 3OUZA 4N7JA 1SM4A 3I9FA 1EIWA 4ZCTA 1SC4A 2HIAA 4CTKA 4GFDA 5FUBA 1P18A 2PKEA 3CJTA 4HNGA 4N01A 1JE1A 5DT2A 3QF4B 2CZGA 2Q5FA 2QD4A 3RUFA 2ARKA 4TLLB 3TAXA 721PA 3B53X 5F1YA 2JGIA 3R76A 2ZRIA 4IFBA 5F3WB 3JATA 4KQKA 4RGYA 3JYQA 4Y3UA 3I3SR 4ZU3A 3T9FA 2Z1DA 1Z07A 3D8RA 4KQWA 1QWSA 3G7UA 3JR3A 2Y2UA 5E9WA 5AWFC 1P3DA 4X44A 1OLUA 1FSFA 3GROA 1T9AA 1NVFA 3E7FA 4FYVA 2GBPA 3MCTA 5T4BA 2RGEA 2J9XB 3AI3A 5ENDA 1ZCJA 5JDIC 1HR0B 2I4MA 3VH1A 1VE6A 4CMAA 2IZ5A 3OTWA 2COUA 5BVGA 1OAAA 2JIZA 3CR3C 1N2ZA 1MZVA 3I8SA 3FNBA 4AJOA 3MM4A 4TYQA 7REQA 1NF8A 5BSWA 4CG1A 1DX6A 4BJ3A 1B2RA 1YR6A 1GL9B 4UU7A 1LSJA 1H65A 4ENSA 1HEIA 3URKA 1CRQA 3WKDA 1UAYA 2KX7A 4HVCA 3GJZA 5K3CA 4XGIA 2Z57A 3PC4A 2FEPA 2M9MA 3PHGA 1XPUA 2OBBA 2XNDD 4X6LA 4IOLA 3P2IA 1B3BA 4D8TA 5JFTA 2DRIA 3ESCA 4QQRA 3FIJA 2DTDA 4G9EA 4MLPA 2DEUA 4MYSA 4X61A 1GRNA 2GILA 2R0QC 2B0CA 2GF0A 2ZIFA 2FP3A 1J4AA 3BMCB 5TPWB 1JHXA 3DMGA 3KTDA 3L0SA 1J9ZA 1OU4A 5AI9A 4MVJM 421PA 4GPBA 4ESOA 1MPXA 3BBLA 4WCFA 3FLEA 4W1SA 5DNDA 3A28A 2EKQA 2C3YA 5F1PA 3ZLVA 1HDOA 2P0YA 4PQYA 4PYJA 1QHGA 3B1XA 1MDFA 2MYTA 1HE5A 4N4AA 1CRPA 3SXPA 4HWGA 1G8YA 2WJWA 2YYYA 3O1LA 2EKLA 3SK0A 4B7ZA 5MN4A 2QHXA 4E30A 1EA5A 3IELA 1Z34A 3K20A 3AFNA 5AHRA 2JBAB 2MCFA 4E4TA 2PL9A 3NHMA 1OREA 2DP4E 4C05A 3HE3A 4OQZA 4D4IA 4J7CA 1NRIA 1E96A 3LCCA 4E94A 4XVQA 3V7YA 1MOZA 1BVRA 3G8BA 3RS8A 4FC7A 4WLEA 2LCFA 4LVNA 4S12A 4ZARA 1DOHA 3JQDA 4FM9A 4INAA 1W49A 4HGQA 4KZPA 4D81A 4RS4A 1U8TA 1QRTA 2KWIA 2UUAB 3TIFA 4REOA 2JAXA 1UXKA 1ZUD1 4BVEA 1LZKA 2CBGA 4LA4A 5BNWA 2RGUA 3WNBA 3C1AA 1A9ZA 2AFHB 2C54A 4LDPA 1I7PA 2XIJA 5TDHA 3OQJA 2C5HA 2EDCA 1AK9A 1M2GA 1QZ3A 2QYTA 1APBA 4PFQA 1NNLA 4DXHA 3FF1A 3AM3A 2V3WA 2WD7B 3HR4A 2BBTA 5JISA 2WLSA 2V1XA 4X20B 4PGFA 1ODTC 2QRHA 4M9RA 4PX9A 5EJAA 3Q3IA 3VU8A 4AJNA 3DOIA 1LGYA 3B20A 4UVEA 3AHJA 4B4KA 4DRXB 4E13A 4LOAA 5BWBA 4YRTA 2O8FA 2BZGA 2OG2A 4RTPA 4X1YA 2O0HA 4U9HS 2ZDHA 4CIXA 4OEHA 2OG1A 1A7UA 3VC2A 1XDDA 1P2TA 3DH0A 3RRJA 2FQXA 4WNIA 3TL6A 1O5OA 2XCTB 4JC5A 3VH3A 3F4LA 5BW5A 3BRSA 2D4AA 2ZB2A 4X95A 2YFYA 2HZBA 4DBZA 2IPNA 4HS4A 2F1JA 4C4AA 2DT8A 3OT5A 5FUQA 3KL4A 3F7OA 4HXGA 3CU5A 1KI1A 3FBGA 1LNZA 2BYTA 2JDIA 2A0YA 3C41J 3ABOB 4D9IA 1NTRA 3PU6A 1W30A 1Z0KA 5B1YA 4CIAA 5K9ZA 2W2LD 8AT1A 1TQ2A 4GWLA 4C4YA 5J2UA 2H18A 2GVDC 3AJ9A 4YAOA 3EX7C 3NTOA 1DAEA 3KJQA 1DLJA 2WYVA 1N3LA 2J46A 5E3IA 1JQBA 5LDDC 1F2DA 4LFCB 3BFPA 4GPEA 4IH9A 5EN4A 1WXHA 1YBMA 2UYGA 3T15A 1LV7A 3BGDA 4YJDA 2D00A 2P9GA 3FDJA 1VG9B 5DYWA 3T5GA 1UINA 3V1KA 2OGUA 2AI1A 3U3JA 1FNSA 2EP5A 3U26A 1KY5A 3CEHA 1ADGA 3DMTC 4EEKA 1IQUA 4XD2A 4LYHA 4BYGA 4MA5A 3CISA 5AM3A 5SZJA 1BJRE 3L1VA 4NE7A 3RHZA 1PS9A 4Y2YA 4DREA 1V5GA 1VIDA 1GRQA 4PCAA 3GP5A 3FNHA 2A3RA 3R77A 1YNOA 4JJAA 5ALVA 2JAWA 4AY6A 5CLFA 1XN1A 4RZ3A 4EO9A 1CFZA 1IOWA 1L7DA 3FUCA 3OC0A 3GJ7A 3F98A 1OYYA 1Q95A 2E48A 3H5RA 4Q3LA 4BEJA 4X3CA 3QPBA 4LJ5A 1NWHA 2O0JA 2VSXA 3HCWA 4LN1A 3WYAA 4GNKA 2V7XA 1JT2A 3ND7A 4HGNA 5CVCA 4NBRA 3T3HA 4GP7A 4DV0B 3DDHA 9LDTA 2IDZA 4NBKA 4QJ5A 5IZCC 4K05A 4OGGA 1ZN2A 1MB3A 3BM5A 1QHNA 2I66A 3F1LA 4IJ5A 4EPRA 4EOGA 1WD7A 3HUEA 3NO4A 3RIXA 4YMGA 3S55A 3NBYC 5BUQA 5JJ5A 2OHHA 3MWEB 4A6PA 5IT4A 3H0EA 5LXTB 2X4IA 3TOCA 2Q8NA 4E1BA 4NE9A 1NX6A 3EQ9A 2Y9MB 1JGTA 3ICPA 3WGNA 3IA7A 4ZZ1A 4BZWA 2ZRBA 1XTKA 2B35A 4BJ1A 1DQPA 2UYOA 3ACCA 4C01A 2Q4EA 2DG2A 4MJ3A 2RHTA 1UQRA 4P5EA 3VNRA 2W6OA 5E6SB 2WFAA 4G5RA 1B6RA 2P3LA 4PBTA 4R1QA 2K87A 1U2ZA 2EL7A 1L4YA 4B6QA 3HBFA 1FZTA 5BYJA 4PHHA 1OASA 2CKDA 1WXXA 4AYTA 4B75A 3SJ7A 1A95A 3F73A 1AA9A 4U7HA 2EW1A 1TK2A 2IYVA 2QVZX 5AJTA 3UY4A 2FPIB 4EW3A 4I5GA 4IIDA 1HDCA 4NWIA 4CM1A 1NW6A 1PFGA 2YZNA 3H84A 2ZUEA 4EMSA 3SEFA 5AJWA 4XSVA 5DKFA 3UWPA 2ZEJA 4PG6A 5JC8A 4N41A 3WLPA 4YN3A 4QPCA 1ZQ1A 2E4VA 5DCWA 4J0FA 5FTKA 1DRUA 2WHYA 1BJTA 1PE0A 1Q0RA 2X8JB 4J1QA 2E4ZA 1BOOA 4PHGA 1FFDA 3MLAA 2IUEA 1T2EA 2VUIB 2CVOA 1DG1G 3DJYA 3PUJA 2OCYC 4ZKDA 1Z17A 1XTTA 2PMDA 5IDWA 3B78A 1JR3A 4WOKA 3TW0A 3KEMA 4PYIA 2WFLA 4EHLA 1Z83A 1H3NA 2I4OA 5FF9A 2ZUUA 4RHEA 13PKA 1XLVA 1BVUA 4KXMA 3TSWA 5EJMA 1C3VA 4QBKA 4JXXA 1CUBA 5EP4A 1VGRA 4EJ6A 3FVWA 4BQOA 1TVCA 2JLXA 3WK9A 2XW6A 3U6KA 2VSNA 1ISJA 1DLIA 4BRWA 4EG7A 1H6AA 1TT5A 1OXSC 1UBKS 2A94A 3BA6A 3LXMA 3FHOA 4QTYA 3V4FA 5BMVA 2F1RA 1QHHA 1U5AA 3T35A 3QMVA 4L4SA 4IX1A 4HB3A 2WSYB 4PF1A 1P6XA 1V47A 4DCUA 2ZREA 2N1BA 4N5LA 3S2UA 3QU7A 1D1QA 3FY4A 4WNYA 3KXKA 5J5VA 4RULA 1ZD4A 2J8ZA 1ZK2A 5DCLA 5DRTA 3RK1A 4PN3A 1TEXA 2C29D 5EMKA 1I51A 1PBTA 1J23A 1W0JD 2WILA 3ADPA 3EFHA 3GVHA 1Y3IA 1TCAA 3H2ZA 5EPOA 1NKVA 2AJLI 1KMCA 2H8GA 4ZHQB 1E89A 2WJHA 3CGGA 2NUTB 3ZGXA 1EP1B 1GPLA 3IPRA 2CFTA 4EW2A 2KW5A 3AVOA 2ECPA 3B2NA 3IDFA 4IDQA 1SURA 2C83A 1AN0A 1DS6A 2XVYA 1I3LA 2C4VA 3U0BA 4I4TF 2ZTUA 16PKA 1SVNA 1Q74A 2Q28A 1KDYA 1SKYE 2J85A 5BV0A 1I01A 5E9AA 3N28A 3ZCTA 3RK4A 1MEOA 1HETA 1YS9A 4JUCA 1IHOA 4X1IB 4C7JA 4HX2A 5EZYB 2OV2A 4RIIA 3TTXA 4DY4A 1JXOA 2O4CA 2IRWA 3UC9A 2DQKA 3B5JA 3ROMA 4QHTA 3JWEA 2XMQA 1GFIA 3GARA 3IQGX 1T3TA 3HFSA 3FFTA 3O73A 4BMXA 4KO2S 1ZDMA 1J90A 1R6TA 2P8SA 5KNDD 2DPGA 4EKIA 5CDFA 5JMWA 3NB0A 4X91A 1HFWA 5DHTA 1N7IA 2QTBA 4TQGA 4HNAB 2OYCA 2H2FA 2M32A 1L4KA 5IZCA 4WASA 4UAJA 3TLGB 1SG0A 4R8VA 2R84A 3M5WA 3OE7D 4OXQA 3SOPA 4HSEA 1FP6A 1XZFA 2Z3ZA 5U9CA 1G9SA 1Q50A 4QREA 5IT5A 4OCZA 3OM9A 2Q4OA 3CVVA 1QG0A 4BASA 1R8SA 5GIOE 2UZ1B 2VK2A 3GH1A 2HF7A 1W35A 4FGWA 4PZ0A 3FLMA 5E2IA 1ZD9A 4AIRA 4AL4A 1XVLA 5HUQA 121PA 2HA3A 3BC1A 4RACA 1QIKA 2E4WA 2QI9F 3ROPA 3TL3A 5C46F 3JZAA 4P83A 5M2QA 3CT4A 3M6XA 2CKMA 4LQDA 4AJIA 3GWZA 3AI7A 4FFLA 5HIJA 3X1ZA 1CNMA 5DLPA 4DZRA 3L8ZA 2XKAA 4C08A 4CL8A 1H3EA 3R0JA 3NJRA 4JEUA 4A0GA 1R9NA 4ROSA 3ERCA 5FWNA 1JSRA 3R7BA 2JRCA 2IDKA 4TWJA 1CHNA 3UA3A 2N0SA 2Q1SA 4RD3A 3PGMA 3FX2A 3V32A 1KDPA 1IL0A 4PHFA 5C3MA 1KJQA 2J6CA 2ADOA 2XMDA 4Q16A 2O1SA 4F71A 4XQCA 3NT2A 5K6AC 1V4VA 3CLHA 3BMQB 3R7SA 3MAJA 3O7MA 1XZGA 2VXOA 3M4ZA 2SECE 3A4TA 4FYHA 4MP8A 4TMTA 4AWAA 4Q7KA 1NR1A 2O2DA 1K0UA 2X2EA 4R3UC 4TV9F 4B48A 4DTIA 1EUCA 1X9GA 2BY4A 1PJBA 3HDHA 3ITKA 4TGLA 2AOUB 2WTUA 3DVQX 4AZ0B 3J7AC 3FUXA 1Q44A 4LJ8A 3CNQS 2QUAA 2YHSA 2C4MA 5H68A 2QRVA 4WUTA 3SNKA 4K1LA 2FLVA 3S1AB 5CA0B 4UW9A 1NN5A 2ZE8A 1CIPA 5DTRA 1RJEA 1ZNQO 2IUUA 2C94A 2IHYA 3D8HA 3X1DA 3SM9A 4RM3A 5KQSA 1ZMRA 3BGIA 4XB6B 4AURA 2QLBA 2EYUA 2C3OA 3QZUA 1I30A 2A8YA 5ALSA 3U40A 5I9IA 3O2SB 3FMGA 4WAUA 5JTUA 1W6RA 1S4QA 5BURA 3P9YA 1RCUA 3P9QA 4JXJA 2E82A 1G66A 3FRJA 4GLJA 3VKWA 2ZI5A 2IWRA 4EZEA 1SXJD 3Q6NA 1RM3A 5BNIA 3WJ1A 1FX1A 1PAUA 1Z13A 2CVFA 3BJMA 3N6XA 1AKMA 4C30A 1VGQA 1JE0A 1CP3A 2RARA 4AN4A 1GCOA 2CNKA 2Q50A 4GRIA 4UBLA 4C0BA 3SVTA 3U7FB 1JHPA 1EFDN 1MPTA 2LZ0A 1U4SA 3NKFA 4JELA 3T9AA 3E0QA 2SCUA 3WXMA 2F8TA 3H1PA 4EQ6A 5AP9A 3C8MA 3WV5A 5CJJA 1UBFA 4F21A 1VCOA 2FWBA 3HPRA 4I8XA 5AJUA 2PQ0A 1DZ3A 3TIIA 4ZJZA 2OO5C 3LJKA 3F78A 1H22A 4MRMB 3SHVA 3LP5A 4URXR 1R64A 1PKEA 1P0FA 4PPYA 5BR7A 5KBYA 3ZHSA 4YUYA 2EBWA 1ZJ6A 1GNSA 1V8DA 1DWUA 2PWYA 3WLMA 2Q21A 2XE7A 3RYCA 1SULA 2OXRA 5GIPE 1W76A 3EVNA 2I3AA 5GAJA 1SY7A 1XTZA 5HRCA 1YTUA 1F4PA 2EHJA 3EC1A 4MR7A 5CMLA 3BL6A 4N8DA 5DXFA 2ZJ2A 1ACMA 1DO8A 2BFMA 4RTKA 1CUWA 1XDUA 5ISMA 2XQIA 4YIKA 1OYOA 4EKEA 3QKUA 2WWRA 2WICA 1IY9A 3EGCA 3BMNB 2I54A 4IY1A 5FWYA 1HQYE 4V0KA 4RUKA 5LQNA 2DLCX 4ZV9A 2NADA 2ZIUB 1R4NA 2A6PA 4I1IA 2QMQA 1IN5A 1N75A 1WSWA 1FRNA 2BZSA 2HADA 3CONA 3PT9A 4K28A 4RY9A 3CPHA 5DT9A 3KQMA 3WYEA 2V6FA 1U02A 3E48A 5ESDA 3EJ6A 3F3KA 4YMVA 1KK1A 3DGFC 3WLKX 1C30B 2X0RA 4H17A 3ABRB 3ZY4A 5B2ZA 3T7EA 1M1YA 1E2KA 2I4IA 4M0KA 4D6PA 2HPVA 4CV0A 4G0ZA 5J59A 4N7BA 1MABB 4KPYA 1UMBB 1RWVA 1Z4KA 2PKQO 4H7DA 4UU1A 2YHIB 5DZSA 1GRCA 1VHDA 3KOZA 5B36A 1ECCA 2ATVA 2XNDA 1W94A 3BF7A 3CC8A 3OCVA 4MR8B 5FBLB 4ESHA 1M2VB 4P0PB 1Q2UA 3OX3A 4B82A 3WADA 4H7HA 4KH0A 5FULA 4DG5A 2WMYA 3H5AA 5BSRA 5AK5A 5EXDA 4MS1B 3M7IA 3CPJB 4P2GA 1VMAA 1WZCA 3MD0A 4PIVA 5F9MA 3VI3B 4J8PA 1PGJA 1Z5UA 4R40A 2RHMA 4HAIA 4M0FA 4YAFA 5ILGA 4CLEA 1E32A 3I61A 4RY2A 3UF0A 2JEZA 2H4ZA 4NEQA 3LK6A 4DQUA 1CERA 1M7BA 3IQFA 5IKOA 4BLWA 2QIOA 3ZCQA 1RMYA 2NZJA 3F90A 3P19A 4OLBA 2DQ4A 4TT3D 2WTAA 2AJ8A 5KJCA 5F3DA 2JPDA 3IV6A 5KOJB 2X8WA 2XQJA 1XYYA 2X7HA 5EUBA 1OWMA 1C9KA 1CUXA 3LCVB 4CM6A 3WZLA 4O33A 1LDYA 1SCIA 1QB7A 4RCYA 1RFLA 1ZAKA 4OFZA 2A9RA 5CYGA 3CRW1 4MPTA 5IPFA 4R2IA 2ZRDA 4OG2A 1KTIA 4MQMA 1CY2A 2F6RA 3WK8A 3ZDDA 1E3EA 2NVBA 5L53A 5LFAA 1ADCA 3QU4A 2YTZA 3PSAA 3RTAA 2EVWX 1N5MA 2OUIA 4MV3A 1QYVA 1CJTC 1LDGA 3HFGA 4DIEA 1P7PA 3PZRA 4ARSA 4Z2YA 4MKHA 5E1OA 4WZ6A 4IIJA 1GLGA 2DBZA 1CE8B 2WHQA 2XZTA 3PJGA 4Q82A 5FP0A 1GITA 5AYVA 3LWBA 5BSMA 1L3CA 5DWDA 2IYOA 2O8BA 1T13A 4F4JA 4RJIA 4CBVA 4G2TA 1KI8A 5JLAA 4JV5B 2NX2A 2INGX 1ZCFA 4E15A 4UBIA 3VVBA 5IXJA 4MTLA 1PLKA 4QZVA 1ZM7A 5JANA 3A3OA 3NIDB 1Q12A 5SICE 1Z2NX 3RC2A 4Q4JB 5T64A 3E9NA 4GM1A 4CTOA 2V45A 2HQ1A 2Y4NA 4PG8A 3EHDA 5I7SA 1EXMA 3Q88A 3AVTA 3PFKA 4KRXA 2NQ2C 5DHRA 3VA7A 1B76A 3TQCA 2D1QA 2FW0A 3T94A 2HK9A 4RETA 3A9SA 4DLTA 1GAWA 1XD8A 9LDBA 5HRUA 1ZSNA 1TZCA 3OI7A 4DR1B 2QVXX 1GVNB 5IEJA 2HY7A 4YT5A 2FZKA 3DBVO 3I5XA 1LNSA 1NQUA 4Y98A 4FYMA 5DXAA 5B6IA 1Q1NA 2W2LA 3IKMB 3LX6A 2AEJA 1RRMA 4KPUA 1NASA 1GU1A 3KYCA 4YK7A 5HKAA 3R4VA 4RZSA 4HFJA 5H3LA 1K7CA 3MB5A 5EPEA 3GP8A 4P7GA 5ALPA 2C8KA 4LXTA 1AZTA 4BNUA 1VE1A 4GXQA 3DJFA 3KO8A 4PO1A 1E2LA 4UAGA 1Q20A 5IJ0A 2IUTA 2VUSA 1KQOA 3HUFA 1CUFA 4Q4DA 1E3WA 2IYSA 3BQNB 2C2XA 2NUPB 3DZGA 3GWGA 4Z9BA 3VR4A 4ED9A 2CDRA 5GZ3A 2YDYA 2AS0A 5E9JA 2DTXA 3DEKA 3QEJA 3PNMA 2JVKA 4MUMA 4JP3A 5AVVA 1AUOA 1JIXA 2HB6A 3PNLA 4IJMA 2G07A 1KETA 3E2IA 4LRTB 2YDXA 1BW9B 1F06A 3UJ3X 4BO7A 5K8IA 2H07A 5AW7A 1DCKA 3CG4A 3L7IA 2J45A 1W36B 1CEEA 1UM9A 2AXPA 4F3CA 5ITZB 3MWYW 3MS2A 4JZYA 4FYYA 5BN3A 1EXDA 4GI2A 2Q2VA 4BIMA 2FPMA 5JBIA 4AQ7A 2CUNA 3C8ZA 1OZAA 1O87A 2WKWA 4J75A 1N1DA 1CR0A 1RLJA 1ZRNA 4V1CA 4N6OA 2Q3JA 1QFMA 1R6XA 2F3SA 5D86A 3DL2A 1MJGM 2PLAA 2FWIA 3I6MA 4ARIA 5K4AA 4I36A 1N3IA 3L84A 4IQ8A 4KITB 1EUDA 1YS1X 4MUBA 3NGLA 1U3DA 4XYEA 2FY8A 1N77A 4MCJA 2HFKA 4B3DA 1NZDA 5T8KC 3TG2A 1S0UA 5SYAA 2UXBB 4RF2A 2POCA 1Y6ZA 4NCIA 4UBOA 1E2UA 3I9V6 3RYIA 2IEBA 4HNSA 2D1RA 5G3ZA 4FLFA 2ZVPX 4PC1A 3NDPA 4JYBA 4QVKA 4HS9A 2HL6A 2R79A 5JMPA 4CHGA 1QYXA 5AOAA 1ZOLA 2ONCA 3OZUA 3A0UA 1SHUX 4GU5A 2DHCA 5IVIA 3S70A 2Z1MA 1G8PA 3MHTA 1Z4OA 4R2KA 2AD5A 4OMCA 1V1MA 1TM7E 4XGRA 4JROA 4W9RA 5H81A 4BO4A 2J07A 3C4JA 1K75A 1VRVA 3ZY2A 3N2NA 5L3SA 4AWXA 2NU9B 2VQ6A 2VPXA 4B5KA 3CR7A 3QBJA 2H5IA 2W6IA 3BZUA 3VJMA 2BELA 1Z2EA 4HQ0A 4KKXB 1ZIYA 1DDOA 4Q1VA 3WMFA 1YGPA 4C0LA 4RQBA 3F0TA 3FROA 5REQB 3STHA 3CPSA 3ZR4B 1CBUA 3D8UA 1ZD2P 3TDMA 2YRWA 1JKMA 3PX3A 1XZDA 4LTDA 4TXHA 4ER6A 1E7SA 3W04A 1HC7A 4C43A 1FUKA 2OPHA 4M0UA 1Z0FA 1XVAA 1EM8A 4LC9A 2BFEB 1Z6TA 3K8QA 4XD7A 2NT3A 5B1IA 1GPNA 4CFYA 1U8ZA 3PEVA 4UQPA 3PQEA 3CE9A 1ODFA 5IRCD 4RD0A 4P0TA 2V97A 1BXGB 3GFPA 2PKQP 5FTNA 3UVEA 3WP0A 1QGUA 1PR9A 4FD2A 3QOFA 4LQLA 4D44A 4GBJA 1G63A 1E1QA 1PR4A 2BLNA 2GYYA 2HCRA 3PC6A 2G9ZA 4MYRA 3G2PA 3KPJA 2R8PA 1C2YA 1VGVA 5IHPA 2P3SA 2XUGA 4O25A 1XKTA 2D5LA 5EUMA 3ZWPA 2AK2A 4HBGA 3PQ4A 2BISA 1U0EA 3E9QA 2FCRA 4XWKA 4Q6BA 1W48A 1UXJA 3OOWA 4BNGA 4LYAA 4J0DA 3WLAA 3LT0A 5T57A 4JDPA 1UXGA 3TRJA 1YVEI 4D57A 4UJ3A 2YY6A 1PG5A 3GMIA 5LB2A 1C3XA 1IEVA 1H66A 3LUPA 3LHFA 2XUIA 4JWKA 1W4LA 2Y0DA 2J48A 2XGOA 4QE3A 1EK5A 4XIJA 2FZGA 5F5NA 4TKLA 4Y9DA 3GLHA 4U02A 1V43A 3HG7A 2A7QA 4WKCA 3RS2A 2DJ5A 3DPUA 3HN2A 3QK7A 3IEIA 4K9LA 4Z54A 1KR5A 3O0TA 3DTVA 2LCQA 4QSHA 5KTKA 1DIHA 1IZZA 1O7JA 2C7PA 4LYFA 2SNIE 4X7RA 5EFZA 2H06A 1E6EA 4C20A 2ECOA 3VTAA 4YJHB 2BKUA 2K5UA 2VPPA 4GXRA 4BBZA 2CL5A 4RY8A 1T91A 2VEOA 1QPBA 1N6OA 5D1NA 3U09A 2ID4A 3EXHC 1XJ5A 3SP1A 3LWDA 4XGKA 1J49A 3L1JA 3PUWA 3UK0A 3LUHA 3MJRA 3BN3A 1L7VC 5CLGA 5CVJA 1M1XB 4DUGA 1H1LA 3KT3A 2JJ1A 2BTQA 4WI1A 5JRDS 3BILA 5DNEA 3RCBA 3DT6A 821PA 2QTNA 1ZO8A 3VX4A 2B8EA 4CE6A 2BVNA 4YNBA 5CB4F 1THGA 4K6KA 4C7VA 1OA1A 1YB1A 2ZM5A 1OZHA 3H6KA 1AE1A 3EGIA 4ZC8A 1U0NA 1CUYA 1LPSA 2C95A 2F3TA 1OYVA 3G2QA 1M10A 4RK4A 1DHRA 5BPHA 3II6X 4ZOLA 3ZCPA 3OF2A 5C4MA 3CH7A 3C3MA 3L40A 4XFKA 3I8OA 2P41A 3QE0A 4NDZA 1O0BA 3DV0B 3GAMA 4KK4A 4CLHA 1PX2A 1DINA 2J7PD 4J0GA 5DN9A 3U56A 2FPLA 1VJTA 3FRIA 1T1GA 2JLCA 2W93A 4UM9B 4G1EB 3A3YA 2GLXA 2I8CA 2AOXA 3G2HA 4DJJA 4OAPA 3I12A 2CLLB 3FXAA 4MKRA 1QSGA 1ZUIA 2VWHA 4LHZA 4RF4A 3TXXA 4KRGA 3WK5A 1SQGA 1IXZA 1GUZA 5BR1A 1X7XB 1NYRA 1Y42X 4EB6B 5JY1A 1ZG3A 3G5MA 4I1PA 4ZAFA 1LJLA 1L5QA 2O8DB 1NU8A 2W11A 2F3UA 4ZDKA 1ZVVA 1KRXA 1ZK1A 2J67A 2VXYA 3A4NA 3CZMA 3RWBA 2BGGA 3KELA 2G83A 5B4TA 2FWRA 1DBQA 4LX0A 4PANA 4QTXA 3TX2A 3EWAA 1ZEJA 2Z0MA 1CZKA 4DHEA 1U7WA 2QRJA 2NVUB 2WU1A 3WYDA 4ZVVA 1PL7A 3ISVA 2V6IA 1N5LA 4RJ2A 3IDOA 3EAGA 2E7ZA 2GAOA 4UXJA 4H4DA 1XJ0A 1ZEMA 1ZVKA 2ZOSA 3E1SA 1U4NA 2HCFA 2X77A 1R9GA 3HSYA 1G4AE 3KYIB 1LRLA 1NE7A 2QRZA 3W5HA 4DV6B 2GVNA 4KFTA 1WF6A 1UANA 3N8HA 3WLHA 5IDXA 1AZSC 3QE4A 1GL3A 2NU7A 3N2IA 2FEOA 2VYFA 2G5CA 2Z8XA 2F1IA 2H1HA 3OTQA 4LI3X 4YI5A 3GLFA 3DZHA 5EWMB 1A9XB 1FRZA 2QYSA 4WXPA 5DV9A 2H1IA 5DASA 5ALOA 4ALLA 3GJ6A 4JB8A 1AXRA 3E15A 4O2LA 1V5FA 4AQDA 5A5GA 3NTLA 4ND5A 2J0QA 2VPZA 2NTYC 3U3OA 2NMVA 1Q3HA 1A50B 1Q7EA 2ZIZA 3L8MA 4KEAA 2G17A 4PYQA 4BKOA 4MXDA 1UKZA 3B6EA 4PO8A 2Z5LA 4D9GA 4BLOA 5L8VA 4F12A 1HQDA 2C9DA 5EKTA 3VMMA 1XZ8A 4FIDA 2DFDA 2A9OA 4NYJQ 3WGIA 1U11A 1KJNA 2X5JO 2GETA 4MRRA 1AO0A 3HU1A 2FSSA 3TLEA 2G76A 1J09A 2HDNB 1VZ2A 1OTXA 4ZVKA 3HL4A 4QFDA 1F6WA 2IPOA 4DCVA 1CDOA 2DTEA 2BHSA 1ZH4A 2R4TA 3ZWCA 3WWOA 1SC9A 3VOAA 3KP1A 1E6LA 1G7RA 5ICCA 1VJ5A 1TRKA 2EWMA 2NM0A 4U3JA 4YDHB 4IEIA 5E6UA 2VL7A 1D2RA 1DGQA 4HT3B 1JALA 3L7JA 3OEED 3OHSX 3OZDA 3CBGA 5BVHB 2M1ZA 3Q8KA 2REQA 3MINB 3EXHA 2WPDD 5DDIP 2B69A 3NIWA 4FD3A 1KYTA 1D2NA 3HP4A 4MV7A 2WY2D 1R9MA 1JFRA 3NDJA 4ZQHA 5SY9A 3S29A 3LA6A 1NLZA 4KE9A 1IVSA 4CI9A 5TGDA 3N70A 4NCKA 2IBMA 2DBRA 1QOQB 2ZSKA 2DR3A 4QYIA 4RF3A 1JKJB 3H9GA 4U7DA 1TA9A 4IDGA 3EAQA 3VYUB 2ZRNA 4YT4A 2QVLA 4F5YA 1JHUA 1JJVA 3Q87B 4WKPA 1CD5A 1L7RA 1MOQA 2MINB 4HXEB 1HL3A 2PD6A 4AZTA 3T1QA 2N1MA 2WPNA 1KPGA 5IMBA 4Q9JA 5B7PA 4N1AA 3UGJA 2G71A 3T9CA 2ACEA 1VC2A 1P2UA 1EQAA 3DBHA 1JLMA 1QG4A 1ZK4A 1G21E 3BXXA 3IV9A 2Q1UA 3L8HA 4QFCA 4YRRA 1NBEA 2JAPA 1KQ3A 3T6KA 4C2UA 2UU9B 1OT5A 2A5GA 2O0LA 4KC0A 4BBPA 2J3HA 2ZUDA 1QMGA 2ZSFA 2A5DA 3E9EA 1RZUA 4WXEA 5CX4A 4B6OA 2JG3A 4AKHA 2XKBA 2ON6A 3A05A 2FSUA 3GNQA 4FKZA 1QCZA 4IHAA 3AJAA 2LD4A 2KJQA 4B3HA 5ETJA 3M5DA 3REQA 3IOCA 3OJFA 3WSVA 5L4NA 5C5EA 2BKVA 2GWHA 1Y8ZA 1HOTA 3OU2A 4ZYWA 1Q15A 1IK6A 3H3FA 3NT4A 3NP7A 3BZBA 3OU6A 4RA9A 4JXZA 1L6RA 3FTDA 2BFFA 1JHDA 3THSA 3TM4A 4TLAA 3C5WP 4YJGA 3QIAA 4IWYA 4PSUA 2YIVX 1SU8A 2Q3LA 3BHIA 1YI8A 4N9QA 3ZZNA 4YJ2B 1JDVA 1ORHA 2I29A 4BO9A 3M2TA 4M3NA 3KV3O 4Z7NB 1UC4B 4WIAA 1RWNA 4FFSA 3ESQA 1L7BA 2I7TA 3M3DA 5LB4A 3RSQA 1IAVA 4F4IA 4PRKA 2FRVA 1A1SA 1P1HA 2F8SA 3AJDA 1NNSA 4KWTA 2J0EA 4TT3A 1KFBB 1RLOA 2IQIA 3GDHA 2OORC 4QNMA 5KNBH 2G9VA 4ZGGA 1CTQA 3L07A 3GLGE 1EWVA 2RHCA 3LI2A 3W79A 5FPTA 1YV9A 1WUTA 2LDBA 3QG5A 1U1EA 1XDBA 4YMIA 3TQRA 1RAEA 3UKDA 2RMKA 3ZHVA 3KJNA 1H5QA 2I4LA 1KYYA 4M54A 5FPHA 3ETJA 1XCLA 5A6SA 2GKSA 3QVMA 4RVSA 2V58A 3PGXA 1QFJA 3I04A 4LEIA 2XF2A 4IXWA 3SR3A 3R9XB 1VSBA 2FX5A 5C5DA 4FE7A 2AOTA 1KGSA 4M4SA 3KKQA 4V0QA 3VU3A 3VNUA 4MEBA 4DR2B 2KQUA 4QXRA 1RXWA 1ZS9A 3EIFA 3DZBA 5AI5A 2FVYA 3MOGA 4JBYA 4GOXA 4WY5A 1ZI8A 3AY3A 3KAPA 4D99A 4DJDC 5IKPA 1OFUA 1YJQA 1D0VA 3PDUA 4YV0A 3ZGOA 1ZJZA 4CCSA 1PF7E 2ACVA 1P19A 1ZL2A 2GZDA 3GGPA 1MA3A 2ZUBA 2NUAB 3F2VA 3DAHA 2WJAA 4QVIA 2R87A 3UH1A 1XHFA 2G4VA 5J2UF 5KIAA 3T3DA 1ISIA 4NCXA 1DKLA 2G04A 3B1VA 4QYXA 1WF3A 1PW7A 1W2WB 1X38A 5DIZA 4ME6A 4AICA 3D2LA 4B6FA 4UFOA 4ZJYA 1A7AA 3ILXA 5FPQA 2Q46A 1Y1QA 2P9ZA 3C3KA 4GQBA 3N9IA 4EY6A 2XQVA 2WU3A 3QLUC 2WT9A 2BEKA 3TL2A 4KACA 5IK2D 1U7TA 5IABA 4Y9SA 1O96B 5BQXA 1W5TA 2REBA 3Q5EA 2RG1A 4KU4A 5KAPA 1I6KA 2VLIA 1QHFA 3EDRA 4FFVA 3OPQA 4H6WA 3NEPX 1VLZA 3KHUA 2XCSB 1EFHA 3JARB 3PPIA 4JLDA 4NARA 3V7UA 4YUXA 1P4RA 1UKAA 4MOWA 1OBOA 1X7GA 2R7MA 3SJBA 3OQNA 4JIMA 1KO8A 1QFYA 1Y8QA 4WE3A 1E77A 3PNOA 1C5KA 2O8EB 5L3VA 3HVJA 5DOVA 4QLBA 4DQVA 221PA 1MQ9A 4MPDA 5AVWA 2HLDD 4IVPA 1J70A 2ZS7A 1L5NA 2CNWD 1IPHA 3EXG1 1KVUA 4IDPA 1J8VA 1HNXB 1JFLA 2X5KO 1Z7YA 3I6BA 1TOAA 2FFAA 4EG1A 4X93A 5A02A 4DM7A 4I6GA 2CFCA 2VT2A 4MGHA 5C7YA 4URZR 5LC1A 3ROXA 4J49A 4YGXB 4DMFA 4N3NA 2F7SA 1MAHA 4H7JA 3A11A 1W0KA 3DAOA 4JQSA 3BWYA 4GNRA 4ARZB 3L6RA 4LVCA 3MRTA 2WM9B 1FK8A 1DARA 3HFRA 4WECA 2BFCA 1NQXA 1YKGA 1PNQA 2Z3VA 1KJ9A 1WO8A 5EY5B 4DANA 3B6IA 3NORA 1Y3BE 3FUTA 4MWDA 2DSNA 3BGVA 2VDWB 1E5VA 3ANXA 3MERA 4BX3A 1C9MA 3C3CA 3D3JA 3RW9A 3ZWDA 3O82A 4CZ2A 3ZV4A 1K5HA 4NU6A 1P9RA 3H9EO 4YWJA 4FOPA 3V3KA 3N8IA 2PNJA 4DCSA 3EXG2 3A7EA 4INPA 4OL9A 2YUIA 1DRVA 3ZEAA 1ZW1A 5ABPA 4J43A 2GGSA 2MSKA 2R1VA 3ETDA 2CGEA 4D8UA 1FVXA 2RC5A 1WXQA 1HL7A 1ODKA 4D4KA 3V4ZA 1XEFA 3KUCA 1ELOA 3DA8A 4KV9A 2JIBA 3L8CA 4DLUA 3LYAA 4PX2A 2FPXA 1AGPA 3PHBE 4R9VA 2XRZA 3ESAA 4E4RA 4TS3A 3C8DA 1KEEB 3DNMA 3H9BA 2Q3CA 3QFHA 2LVBA 3M9XA 3R3JA 3IRVA 3TLCA 2O8DA 2DFPA 2QR2A 3FHCB 4OM8A 3SSOA 3IP8A 3R5XA 4A3SA 5IH7A 2WI8A 3ETCA 4AU1A 3WQBA 2BFPA 3RABA 2PBZA 4B71A 2OV3A 4NXMB 1AU9A 1X7HA 2PLRA 4IR7A 2VPQA 2CJWA 2DUJA 1OFHA 1LVUA 4C0XA 4U2GA 3O26A 2IDJA 2AWNA 2ODTX 4ZYTA 4HDQB 2WZBA 2A4MA 3DKPA 1GG5A 1FS4A 4QGHA 3ZWBA 3LNTA 4ZGWA 3WYGA 2C2BA 1Y6GA 1KRWA 1BX1A 3PKJA 2WOOA 4Q66C 4R68A 1V6AA 5IUKC 2WLTA 1P1KA 2IS4A 1T6YA 2P2ZA 3G0GA 1V45E 4TYYA 3FAKA 1EDEA 4L3VA 3CX7A 4RK1A 4REQA 3FUVA 4JJ7A 5HE9A 4ZK6A 2XXAA 1CXZA 5BMVF 1H8EA 3EEQA 1P0CA 4XWGA 2GJKA 4YR7A 1W5SA 4QBIA 4CUZA 3JQAB 5CD1A 4MV9A 4DR4B 2GEFA 2D7DA 3FDZA 1GLVA 1FFEA 1ZU5A 4OQDA 4BAUA 3ZJUA 3PLNA 1E3LA 4IIUA 2AI3A 4AS2A 4A8TA 1XEXB 5ERXA 4YRPA 2VDOB 5JVDF 2Q07A 1ONOA 2WKPA 2WZDA 1WP9A 4KO8A 3QLUA 2Q9UA 4NKRA 4DMLA 1FTWA 2OE2A 1UOPA 2O4UX 3C1TA 3ITEA 3HO1A 2GASA 2PCLA 2WRZA 3ESXA 2WQ7A 1P6UA 4TXJA 3ZKWA 1U7OA 3N7UA 1QK4A 5B1HA 3K8YA 2OP0A 3LPCA 3IE2A 3FSEA 1YQTA 2VWPA 3PC2A 3NGMA 4EHAA 4DB4A 4Z8YA 3OT4A 3KLBA 3NEAA 3I5AA 4PR3A 5JVDA 3UXYA 3M6VA 5IVPA 1CC1S 2BFDB 4W9MC 3QKRB 4Q1BA 3FOEC 1T34A 4FX5A 4HLNA 4CT5A 4F3NA 1DCMA 2OO3A 1P0QA 1C0IA 3GCDA 3LCMA 2G36A 4FTWA 1NV9A 3OEHD 4KAFA 2H1FA 3D3WB 1USGA 4TV8A 5H02A 2I9KA 4GQAA 5ALQA 5TSDA 5JH7A 1U80A 4I4IA 2PRYA 4JP5A 6ADHA 3AI1A 3R0QA 4P08A 2PDAA 2P40A 3LUFA 1E1NA 1UEIA 1NURA 2YJ5A 4RTJA 1RXEA 2BI8A 1L5MA 3ZK8A 3E35A 2FF7A 1Z5GA 3HRHA 5A3VA 2BDEA 4KIGA 5CDUA 1EXVA 2BUCA 1C1XB 1K3TA 2NO5A 2XXBA 3ZHCA 1V3UA 4UVDA 3G0HA 3L7CA 3MMZA 1ECPA 1QFSA 3R6TA 4PICA 1P2BA 2JLRA 4GKBA 2D54A 1JYFA 1TA4A 3O8QA 3GPIA 1TAHA 1B8OA 2UZ3A 1KWKA 1MX1A 1TU0A 5E7JA 2ZBGA 2VT7A 2WAOA 3MZ0A 4D43A 2P2YA 4CCAA 2DSTA 5JJCA 1WB9A 4D3SA 1JS1X 5IUNC 3UJCA 3FFBA 1WP4A 1YQEA 3OO1A 4KYUA 2LBPA 3ESBA 4POAA 4COKA 2GPJA 4LSGA 2X15A 5DWVA 5GZ6A 4KQHA 3IMGA 4AD8A 2PY6A 5DBIA 2X9NA 3FTPA 3IP7A 4QBTA 2WJIA 5KOYA 4J2OA 2X40A 1D6NA 2OQVA 3QVKA 4ZQEA 3ZV7A 1PWHA 2PGLA 4N0QA 1SQFA 5TQ2B 5ITVA 2EX1A 2Y1KA 1VPTA 3K6KA 4NBLA 1XYVA 3EMDA 5CIWA 1ND6A 1QVZA 3D2AA 1DBSA 3G13A 3GAZA 4N47A 1C9JA 4WMLA 4P36A 3IAXA 3HVUA 4KLCA 2WABA 1WOMA 3EZ6A 4OHPA 3FHJA 4BMOB 2G28A 2IHBA 1V11A 4G85A 3AWDA 4DLNA 2VTKA 4W4TA 6LDHA 4EMTA 3CSUA 3AF4A 3AVXA 3AUUA 4RHUA 3N2KB 1NONA 2G80A 3AUKA 1JDBC 3O2NA 3R0IA 5G0SA 3ZE1B 4CETA 3JTMA 1UF9A 5JR3A 4B6GA 5AUNB 4JR0A 1H0SA 3GAFA 3GFTA 5EHIA 3L8YA 2WV9A 4J0JA 3JSAA 1W85A 2VHJA 2WIGA 2W9XA 5G0TA 3E5HA 1U98A 4CKYA 3FJOA 4EA6A 3S2IA 2IU6A 2ZYHA 3ZI0A 1KO4A 1NMXA 2H65A 3KQTA 4R7ZA 2KE5A 1OAKA 1GV1A 1KFEB 3H4IA 4KPGA 1VHQA 3IOBA 1T8PA 3IXMA 4JP1A 2OGZA 4JK3A 1EE9A 3OOYA 4R01A 3RADC 3TRDA 2WAMA 4DPMA 1O6BA 2I6SA 1YCGA 2YQ5A 4NQZA 5I9TA 3M34A 5J58A 3KSAC 3V4SA 3IPYA 1OTHA 3STWA 1N2CE 1MO3A 1XZEA 5DFAA 1ORRA 1J0XO 2VJCA 1GG2A 4RWEA 3N2GA 3L0OA 3LMKA 1WCXA 2OCBA 4Z9YA 1CZHA 4N76A 2I65A 1Q7BA 3PWTA 4GS5A 4CKEB 3QEKA 4G8DA 1E9SA 3LBIA 4AX4A 3MWJA 3DHNA 1QPZA 5JOQA 1K8QA 1WHSA 2V7GA 4H08A 5LKAA 4YP9A 5CG2A 4LTMA 1N0VC 1OB5A 4UHDA 1G8FA 2CLEB 5L3RA 3TSYA 3U4HA 1X7WA 2CNOA 4UNIA 2GCNA 3G0BA 3OM1A 1YCDA 3FR7A 4I4TB 5F78A 1Z15A 3ZWXA 1K5PA 2HYDA 3CLSD 3EY9A 4RZIA 1YC5A 2PL1A 3K6SA 1KDZA 3U4QB 3C97A 4K6GA 1ZN9A 4MUJA 1E1YA 3VHLB 4ZO4A 4ZVRA 3V4OA 3CZRA 5LL6P 2QGFA 1TGYA 5FLEX 4H7KA 4N39A 3SICE 1C8VB 1PR1A 4JASB 4F5EA 1L7AA 2WZQA 4D56A 1OTYA 3EGVA 2C31A 1D04A 2FRDA 2J3DA 3IQHX 4KQFA 2PXXA 5JCXA 3F71A 1J56A 4FR0A 4IGKA 3CCCA 1FBTA 2ZJOA 1WR8A 3LBNA 3OEEA 4UXIA 3UWDA 1FUIA 2W2OA 2B1RA 2WP0A 3NHBA 3IEMA 1AKNA 3QNUA 2RK3A 3LC1O 2Z83A 1LS1A 4IWNA 3SE7A 3BERA 5B58C 1PGNA 2NYUA 3R40A 3RUAA 1PV1A 1Z4IA 3MWFA 4N5DA 1E3QA 3PKIA 4IV0A 4M6WB 3AU8A 2XSZD 3HCBA 3R8CA 1KSFX 1ZIPA 1U3CA 1KI3A 3PUHA 1IATA 1M2WA 3AY7A 2I6QA 1NXTA 2ZYSA 4I9FA 2ZT6A 4U7GA 4H59A 3ZQ4A 4PZPA 4HDNA 5LQDA 1IRIA 3EPKA 1FXUA 2X9LA 1ULUA 1Y7TA 2UVPA 1FNBA 2VF2A 3I2JA 3VZBA 4NF2A 4CRWB 2WU4A 3JVDA 1HYEA 1W88A 2X58A 4AUMA 4YACA 5F9HA 3IHKA 5AUQA 1PUXA 6Q21A 1OF1A 3L3BA 1FNDA 4ZO7A 3R9KA 4DN6A 4NRDA 1O94C 4GOJA 4ARCA 2GCEA 1N1GA 5TQ0A 3TLXA 4BP9A 2H31A 3LUAA 1NAIA 2PVPA 1C4OA 3JQFA 2R8EA 1X1QA 4EFLA 2AMLA 1DBVO 3OJEA 4RE6A 3EZYA 3DWFA 3ZUGA 1A3CA 3UH0A 4KWIA 4B3MB 3K73O 1W75A 3B52X 4IZ6A 1EX9A 5EJ9A 3C4QA 5KNLA 1K9VF 3QVJA 1E2DA 2IZ0A 4TV9B 3E5MA 2Q3EA 3FCOA 5DCUA 5FUXA 3IUMA 2QLJA 1RKVA 4OJTA 2XRYA 3TB4A 2JLYA 2GZRA 3NTVA 1HX7A 3NOXA 5I47A 4G24A 2AN9A 4EECA 2CXHA 2YVAA 2X6TA 3AYZB 2O2EA 4G5GA 2YUTA 4LOHA 4PHTA 4TX1A 3SPXA 2J0VA 2WINI 3H6HA 3Q98A 3QLVC 4LXUA 2QN2A 3RSZA 2H8KA 4N8EA 4GP6A 4QG7A 1ZGGA 5B6PA 5HJ2A 4EHNA 1JG1A 3O3CA 1JQ5A 1F8GA 2JD1A 3KOOA 2P2NA 3V6LA 4H0CA 3B38A 2IHNA 1VTKA 3IE1A 4TOIA 1X7ZA 2O8VA 4OQNA 4IIJF 3AEZA 1ZYUA 2F67A 4K88A 4QPPA 2W8BB 3TRKA 2ATXA 3TYXA 2CXTA 1FLVA 4OXXA 1DQZA 3K9CA 4JVNA 3WZ2A 4B3JA 1NXVA 5LQSA 2VDPB 3N0TA 3WK4A 1W4CA 1SOMA 1DIOB 1J6UA 3HVHA 4P9NA 5J4HA 2WBLC 4BLTA 1ACLA 1DWPA 3CLRD 4LHSA 1NBIA 2FAXA 1BKDR 3PC8C 2QTCA 3QA3E 3HU2A 5TMDA 1PS0A 2NYAA 5BUSA 5L45A 3B13B 4XCXA 4PSDA 5A9TA 3WIUA 4GIBA 5IDVA 3AY0A 2IYAA 3K96A 4AJKA 4NPAA 1DTWB 4RMHA 2Z4RA 1WUIS 3FA2A 2ZROA 4O4LA 3BE6A 4XWYA 1YVPA 2C4WA 3K0AB 2CHEA 2JFBA 1TVKB 4C0JA 2BWJA 1FTGA 5F73A 3S8MA 3UMJA 3QJGA 3D6JA 1A5TA 4MCHA 2A7XA 3HB5X 5HW0A 2L19A 4UTVA 3ICWA 2WF8A 4FGZA 4LHEA 5C7OO 3KYDA 4RFSA 1NBAA 1OKKA 3SNHA 2GPYA 5JPCA 1A27A 2XDYA 3I39X 3MTEA 4LHYA 4YC7A 5DI9A 3WLEA 3EWSA 1Y4AE 3X1YA 3ZGZA 3FOFC 5L9AA 1TMOA 3QPDA 4WXRA 2VRWA 1JIUA 3RC8A 2XUPA 1ISSA 4LJLA 2CHVA 2EATA 2FSVC 1IJBA 3SQMA 1SBTA 3AB7A 5DW3A 4GRDA 3UB2A 8MHTA 3OE5A 1ZBDA 4CIWA 1BFKA 4IICA 3NATA 3WDKA 2A58A 2C07A 2RGNC 4YHHB 1WXGA 3PD1A 3I83A 1XRMA 3HJGA 4IF4A 1G21B 2R00C 3M33A 3B9RA 2Q62A 2UV8A 3R74A 2W2MA 4EJ2A 1CJSA 2RSLA 1KEKA 1RDFA 4I1RA 1HSOA 3RTEA 3EJWA 1W0CA 4DCJA 1K89A 1NLMA 3K8ZA 3TMAA 5DIFA 5DN6A 3NVKI 2PUCA 3CH5A 3GCZA 3PA8A 4M0CA 4M7RA 5EKSA 3O03A 5EWJB 5HGXA 1WETA 3SZLA 4PYKA 5GP1A 2FZWA 3M70A 1LBEA 1KC3A 1SMKA 3FFAA 2ZRCA 4AF8A 4GMKA 4MWOA 2BFNA 4IUDS 5BRJA 4DUYB 1JIJA 3CX3A 2GBLA 5DSTA 1OX4B 1VLLA 1QDUA 2EFEB 2JB9A 3C6ZA 3JY6A 3TX6A 4EGCB 5L6LB 1UOOA 2ID8A 5IN4A 1RWQA 3G2LA 1LBIA 4CF7A 4GSKA 1ENOA 3IALA 3W6ZA 3A4VA 1SEVA 1MCZA 1QG6A 2Q5EA 2VF7A 3BAFA 3CYFA 4LWZA 4UQOA 1EDZA 4JLAA 4WFJA 2QTGA 1ZZGA 3C85A 3NRBA 1Y1KE 3IAFA 4KAAA 3DXZA 4R1NA 5THXA 3REGA 3IIJA 3TNYA 3HB0A 3O3NB 4US0R 4KREA 3S3TA 3KSMA 3U3KA 5ECYA 3L77A 2IPLA 2R6FA 2PT6A 2VS1A 1EFVB 1P1BA 1L4BA 3GLSA 5EESA 1B8UA 3GLIA 3BFVA 1J1IA 1TGVA 1TB4A 2ZBDA 3KSZO 3R3SA 4J4TA 1VZ3A 3BMOB 4DRYA 2A33A 1R4MB 2FOXA 3IQIX 4P98A 3LQ1A 1SZPA 1CVRA 1BA3A 2RJ3A 3E22B 1XJCA 1F2TB 3EZ2A 3FJ1A 4J3JA 4MAFA 4NMXB 4W8GA 5K0NA 1M9NA 3JZIA 3VC7A 5JCJD 2JH3A 2J6BA 4MYCA 1AB5A 2W6JA 5LLDA 1LTHR 3KWLA 3L0PA 2YC4C 3CF4G 4ZD6A 2PZGA 5F35A 5E4YA 2G25A 3IIEA 3ER8A 3UIEA 3K2BA 1IU9A 1SBIA 5HF5A 3RHSA 1A9TA 5B3JC 2JFFA 1TO6A 2PU7A 2WVAA 3HB7A 5DK4A 5HMLA 1A71A 1J06A 2NO9A 4D4LA 3I1YA 2BONA 5HZHA 2VP2A 1VLQA 2XEDA 2AYXA 3IAEA 3OWOA 3GLUA 1E0KA 1Z75A 2YVLA 5D3MB 2RE8A 5IM4A 4MVJG 3FKQA 3DVRX 3I28A 4OP1A 4WXMA 1DBPA 1WCWA 1P2DA 1K5GA 4P4NA 5JSUA 5D00A 3HEBA 3IESA 4AF6A 4AZ3B 1P9NA 1Y7IA 2GHQA 1NBMA 2X0NA 2B20A 3CJRA 4I50F 4GVXA 5K03A 4RVGA 1GNVA 1J7KA 2WYWA 3BZWA 2QX7A 3U0VA 1TD1A 2P4SA 3SHWA 1MXHA 2QNBA 3DZ8A 4ZODA 1Y9DA 3BOSA 1VE9A 2GN2A 2H7XA 4HDKB 3TB6A 3PGVA 5GY7A 1BCSA 3AL3A 3G23A 3OECA 2QJTA 1Z4JA 1QPGA 2IYNA 4JWTA 1WU8A 3U16A 4L3WA 2BCGY 4CLDA 1SHZA 3GJYA 1ITZA 4LF6B 1BDJA 1YE8A 5GWXA 5IBCA 2FSVA 2NVWA 3C7DB 4DNQA 4HVLA 4E09A 1Y1SA 4W5NA 1OIWA 4H7IA 4R3WA 1JXAA 4H3KB 4CKBB 2OOSA 1SCDA 1IONA 2O2ZA 3A6JA 1N0UA 2RHWA 4BFVA 1N3YA 1YHNA 1LQTA 2QP3A 5AK6A 3TJRA 4DARA 4CMGA 3X2EA 3DBRA 4OUDB 4B6EA 2ACKA 3PK0A 3TD6A 4FOLA 1XGKA 1HEYA 4L6CA 2QSYA 2GN1A 1D7AA 2P9CA 3O4VA 4O4IF 1QK3A 2WDZA 2FP4A 3QX8A 4RHYA 4GRAA 3RS9A 3TO5A 3PTLA 2PO5A 3LDAA 4GEKA 3BRQA 1PVVA 3K53A 3USES 3AVPA 3FPJA 3OY7A 1RJ9B 3NAQA 4E08A 4GX1A 1KAHA 4UM5A 2CMHA 3FPGA 4PO9A 2BGUA 2BHTA 3QW2A 2IODA 3DPSA 5EEGA 4Z4QA 1TKBA 4JLUA 4IMIB 3T4EA 3MS4A 4TRRA 5B30A 1ZJWA 3EBLA 4WXYB 1GKUB 4ZN6A 2YZ7A 4LCEA 4UHHA 1NVAA 4DR6B 2RBGA 1SUEA 1T4BA 3GYGA 3QTBA 2XV1A 3FDXA 4ZOLF 5IJXA 5IVHA 4ACBA 1I3NA 2ASVA 1M5TA 4NYMQ 4C1BA 1OWOA 3W1EA 3FB4A 4A26A 3G2MA 1FDUA 4PNZA 1GUDA 1U1FA 4RPGA 3U1BA 4DV2B 4DV3B 2DHQA 2I7VA 4L8FA 1RC1A 5KHLB 1YRYE 4IYJA 4Y6RA 5D2CA 5KMGB 3DV2A 4TL8A 5CJPA 3RUCA 3GGJA 4D4HA 4ZOEA 5JSFA 1WX1A 1FDSA 3D4PA 2I87A 2JGJA 2MIIA 3IA2A 3P94A 4IDDA 5FHRA 3T06B 3UMCA 5FWXB 1FJGB 3D1VA 2A9FA 1BHJA 3DL4A 1GQRA 4B17A 2R68A 3LUDA 4RZHA 4UMEA 3SS7X 1PJ3A 2J0UB 4ITVA 4PSKA 1SC1A 2GCPA 3TE7A 1IVYA 4MQ5A 1L6IA 5CEEA 3TTTA 5HZGA 4JI2B 3OPYA 4XFJA 4HQ6A 1V3VA 5B3JA 5DP2A 2B8WA 2QP4A 1Q17A 2VDRB 3A3NA 4JLSA 3RVRA 2EDAA 2UXCB 3AONB 1KP9A 2FFHA 3QHPA 1W36D 1MB0A 3BIJA 5EXTA 3C3PA 4R6XA 4G0NA 4TQAA 1BQ3A 4DZTA 3K1YA 5DHFA 3PXGA 3DDZX 3NC0C 4BQFA 3I73A 3GEMA 4AG5A 2PEZA 1E5TA 1DQNA 2H6EA 2PZMA 3ZNPA 1HZJA 1ZJ4A 3SDSA 2DFTA 3IBSA 4R0NA 4DNPA 4BNIA 4K7JA 4MUIA 3SF8B 3QU5A 4M0EA 3ZWNA 5M34A 3EF0A 3VSEA 3FAZA 2FH5B 3PQ7A 4DSUA 2XHEA 1D8AA 3TUIC 1AZWA 2PKYX 1XKLA 1HRKA 1FNMA 4L3OA 1A9QA 4YP7A 3QVGA 4Z4GA 1QYWA 4DMGA 5AW6A 2Y2VA 5JNWA 2ZQZA 4RTMA 5BO5A 4CM8B 2DU8A 3GRAA 1HEUA 3IQWA 4C9BA 2IU4A 1HMPA 3GJ0A 4C88A 1REQA 3HHPA 1E6MA 1SR8A 4CQLB 2YY5A 3A6EA 3DP9A 3QYFA 4YCDA 5KWIA 1TF5A 2PX5A 1HTBA 3FG9A 4KN8A 1MFPA 5FL7D 4FMCF 4ABTA 4IOMA 1Y6JA 1P9OA 3V7WA 1UC8A 5K7SA 1BVHA 1JLLB 1UWCA 1W87A 3WQSB 1JHMA 4TUYA 5HKKD 4BGUA 4PQRA 4BGVA 4KOEC 2DKFA 2P6UA 4IJUA 1V48A 1LPAB 3DLAA 2Q3FA 2JFUA 2D1TA 3TZEA 2W7TA 2I91A 2XYPA 3ELBA 3FWNA 2ZYTX 4OHMA 1JH9A 2W48A 3JXEA 2X6QA 2XIQA 1HA3A 2IY7A 4Q9HA 4S35A 2A30A 2PZLA 4DVGA 2C9OA 5KTNA 4LFBB 4YRLA 1UFVA 1LH0A 4JI3B 3ZKAA 1JZSA 4A0QA 3NUGA 4NH4A 3TQTA 4MW1A 5EKXA 1JIKA 2B8NA 3O4RA 3PXCX 1P0IA 1XDWA 5DVZA 3VR4H 2O8CB 1K7SN 2W90A 3N53A 3IR7A 1DRKA 1NAHA 4MSUA 5B5SA 3L49A 2XI4A 4DG8A 4CJXA 2OCKA 1JMYA 1ZFNA 1C9EA 3A32A 4ZOBA 2DWOA 3Q3HA 1M2HA 2QBYB 4P22A 1RBYA 1C80A 2XQFA 3MFYA 2H2WA 1E1RD 4DIFA 3QEMB 3EEBA 3OAAA 5LP1A 1P0PA 1SVSA 5CB4B 4WOJA 4FKMA 1GY8A 1YOVA 1Z0ZA 2ZUVA 4UBKA 3TR0A 3OD5A 1KYVA 3INGA 4HI0E 5K0JA 1U1DA 2QLTA 3SQDA 2CJYA 1E2EA 1L8QA 1N25A 1F7UA 1MIOB 1VPVA 3HY3A 2PRJA 4BZXA 1EAMA 4HGPA 3WJ2A 1OYWA 4F91B 4ZO9A 3VZRA 1BGWA 3FPCA 5FT9A 4XX0A 1E4YA 1Q0TA 3Q0IA 2I2FA 5FR2A 1SC3A 2CXUA 1A72A 2NZYA 3AO0B 2X6RA 3BWXA 5CLHA 3UPDA 4F93B 3BB1A 4W5OA 3B9QA 4EB3A 2QDKA 4J1NA 3TCXB 5HKOA 4XYBA 1R6BX 3WRWA 2X8BA 1S2MA 1EE2A 1Z7WA 3MJVA 3QXGA 5JECA 1NU6A 1TUBB 4IW3B 1JHRA 1RYBA 2BL4A 4GYKA 4XIYA 4ZOCA 2JGMA 4MGKR 3EC7A 1JJFA 1HKUA 3N7AA 1EFCA 3NWPA 4YI3A 1NQWA 2PQ2A 1M34E 4KIFA 4QKQA 5C7LO 3NVAA 4WFQA 3CEPB 3BXOA 5E9QA 2FPPB 2C8LA 1CZOA 4RIFA 3COJA 3DM5A 3U7HB 3EVZA 4TRNA 1ZN8A 4KQJA 3MWKA 1UBLS 3AEKA 1JHOA 4ZDWA 1T43A 3MG9A 3FWPA 3R75A 3W7BA 4ES6A 1JBEA 4DM4A 1M54A 2EQBA 2QROA 4X6UA 4A2WA 2PGXA 2PZEA 1Z35A 1IWOA 1GG9A 5ALMA 2C7OA 1QYDA 4EPWA 2X23A 3WFZA 2ZRJA 1X70A 4AN1A 3ND5A 5J43A 3H9JA 4RHCA 4ZVLA 3RIEA 2HXGA 5ENVA 2R6AA 1YZKA 2GJ8A 1YZGA 5G3YA 1FB5A 1DQSA 1V7CA 3ETEA 3QJ5A 2UUBB 4M7WA 1EWQA 1F48A 4YIHA 4MUXA 4BJ6A 3LBFA 2WUWE 4QXQA 4XW2A 5HBGA 3W5DA 5DULA 4KXUA 5FR1A 1GA6A 1I4EB 1N2CB 3U60B 1KJJA 1ZZEA 2JH9A 2J4CA 3BFKA 4Q1CA 2O57A 3H0KA 1EVLA 4FZVA 4FYIA 4YASA 2NUBA 1FTNA 2JLBA 2JI6A 2B1GA 2N9UA 4UHFA 5K6RA 5LUBA 1Q3TA 2WTNA 1J8DA 3LRTA 1T0PA 4HX5A 2FOIA 3T52A 4CKXA 5CUQA 1AX9A 2G8LA 3QLTA 3P96A 2IW3A 4UM9D 3GCXA 5D1HA 3ORFA 2QYOA 5BQ3A 1FQKA 3QYJA 4B83A 1I9GA 2JIDA 2E37A 4M36A 2R7LA 3MLEA 4RJKA 4UM7A 4YRJA 4Y9RA 3JATB 4L07A 1G3UA 2HJVA 3UV3A 1E2FA 1LJ8A 1OXXK 1SKAA 3OQIA 4II7A 2WAAA 2M6LA 3I72A 4FPXA 5CH3A 4CUJA 2H4FA 1KQGA 1QP0A 1MEEA 4X71A 3SYNA 2DQYA 4WT7A 5ELXA 1OLUB 1L5OA 3HZOA 1G3MA 4QBHA 4MS4B 4P4LA 1PFYA 1BU5A 1CY7A 3LKVA 5A71A 4DILA 1LWOA 3GB9A 4IWXA 4O2BA 2REOA 2H9IA 3I6YA 5BVGB 3ZLTA 2H7YA 3WLRA 3I32A 2R6JA 1I2BA 3MUNA 3L0DA 4CPDA 4YRBA 7REQB 1E5QA 1NKSA 1PJAA 1V4BA 3TNFA 2R6CA 3CHYA 3FCYA 2YCLA 2Z8YM 1TFUA 4DQDA 3AY6A 4HO1X 3UTCA 1AGYA 3EODA 3GG2A 4BVBA 1KEWA 2Z2XA 3RT9A 4BE7B 3R4CA 1HY3A 1I3KA 2RJOA 3B7GA 4A1FA 1WW3A 5I01A 1JSCA 1DC7A 1GUAA 3EULA 1GGEA 2JCVA 3H8VA 3JAMA 5IFLA 1UH5A 2P67A 4WINA 3DEIA 4D4GA 3ZHBA 3U4IA 5IYZA 4KGVA 4C3ZA 2QRMA 5EIHA 1IFXA 1ZCBA 4OHZA 5MFPA 2IYXA 4HAUA 1BFUA 3FWYA 4EG3A 4NH0A 3UN1A 5AESA 1N2HA 3IDZA 1I10A 3VM6A 3C6XA 4EFDA 4FBMA 2P3QA 2RFLA 1FPMA 1JX6A 2OTCA 3MT8A 1C4XA 1I2AA 1G3QA 4FI3C 2DR0A 4TL7A 4WCFB 1U8CB 2MU1A 1GSIA 4TYNA 3BMXA 2CXNA 2AWOA 1EUYA 5CB8A 2D1YA 2HSZA 3SCZA 1SVMA 5AR1A 1XMJA 3M6IA 1NVGA 2EKZA 1OFTA 2VDUE 3D4NA 2ZI9A 1QB8A 1ZXXA 3QFTA 3GLKA 3P0HA 4H6PA 4O63O 5ESXA 3OM8A 4A0FA 1PJZA 4WZAE 2DKNA 1ISGA 1JR6A 1DTSA 3T0IA 5K20A 2TMDA 4S0XA 1E2JA 1GPJA 1D7OA 4LZJA 3ZYZA 1VKHA 2GD0A 2IHZA 1JJBA 2ZE7A 1LUAA 2BGNA 3NC1C 2XNSA 2D6FA 1FA9A 1W8DA 2AN1A 2VF8A 4Q48A 1SXQA 1CVLA 4BWVA 3GEHA 2XYVA 1T5IA 3CUTA 3TBHA 2ZSUA 4F5ZA 3CZ4A 3FYDA 2EJVA 1Z6GA 2IU3A 2VHEA 1QKKA 4LC1A 3AVYA 2OPBA 1E9EA 3M1YA 4MQFA 1K2VN 2JATA 3B2EA 4HLDA 3FWHA 3MJFA 4M1TA 1QLHA 2XA2A 2P75A 3K2EA 1TZMA 4K6HA 1N2SA 3DEZA 4ZRMA 2QT9A 1KK0A 1KMHA 3VDXA 1P33A 2EFJA 3IPXA 2XJ4A 4MPPA 3SSAA 2ZTHA 3UJ7A 3BHJA 1Z88A 5AHXA 1W4AA 1WG8A 4BTEA 1FCJA 3OY2A 5KSPA 1ZH6A 4RDXA 1DZIA 3WHPA 4XM0A 2D3WA 2CUTA 4JT4A 4C7OA 1C1HA 4LY0A 4MWSA 3OBIA 4FNAA 4OHCA 5K3FA 2CLFB 5E95A 1L4NA 1V8OA 1FFGA 3BRWD 3HV0A 2HLPA 1NFFA 4H35A 3R8XA 4BNDA 3Q8XB 4Z4EA 2O8FB 2C98A 1XB2A 1WMAA 2LKCA 2ZB4A 3DO8A 2DBYA 3K9WA 4KVAA 4X1YB 3HDTA 1M2OA 3L6DA 4CCYB 1CS4C 5KWVA 1T4GA 2FMKA 3C3EA 2CE2X 2F2TA 3GLVA 5BN5A 2QPOA 3BIWA 2EIHA 1M66A 4L5AA 4EL5A 5IS2A 4GKJB 3JALA 4TMKA 4TTAA 5IWCA 3C48A 1R5OA 3DDNA 4IJWA 2F9LA 2XADA 2ZS9A 3ODGA 3P52A 2E5WA 3N39C 4HF7A 3D6VA 2P6NA 4WSOA 1DWOA 4GGMX 1W29A 3A1UA 5LQMA 1YF3A 3EFEA 2EKPA 3I2HA 2VTDA 2EL9A 3HKDA 4IM7A 4M86A 3ZGYA 3EEIA 3K0BA 5ES3A 1Z36A 4FR2A 3B5EA 5K2OA 4KSCA 4XQGA 2E0IA 2VAWA 1BC5A 2OUKA 2VI5A 2AZTA 2QTVB 5C7IO 1F7VA 2PT5A 4DQLA 1M33A 2CBZA 3AT1A 3GZNA 1ABEA 1GT91 2P4EA 5HJEA 1GQYA 1XIVA 4B3XA 1J25A 1G5QA 1E6CA 1QH1A 1XTQA 2JKZA 2BGIA 3QPVA 4BTLA 4PLTA 1PDOA 3B6MA 2DERA 3SBXA 4D4JA 2I4TA 1TUEA 2GZAA 2VRCD 5DI3A 1EFKA 2JA1A 3O83A 1TAQA 1YFKA 4HLCA 4TV8F 2CK3D 4KHZA 1OBVA 3OOSA 4YCMA 5JT1A 3OM0A 2B98A 2OV1A 3EIEA 4OO3A 5JH7F 2A1IA 5MF6A 2R65A 1MG0A 1NUSA 2JGFA 3A6LA 4BN4A 4AKGA 3WRYA 4UATA 1CPYA 1BJKA 3DL7A 5CVVA 3GG9A 1ANKA 4HDMA 3AKZA 1B15A 5BR8B 3VH2A 3LFUA 5JFOA 1NGSA 2ZULA 2BP7A 4HRAA 2OSVA 4RK0A 4RCVA 4B6SA 5KEIA 2P6OA 2GXAA 5CDSA 1V1JA 4MHTA 3EF3A 3ONEA 2YJNA 5DYNA 2GFQA 4Y2VA 1XQVA 2XGMA 3IQZA 1NZJA 3N86A 4NFLA 4Z49A 5JALA 4JYZA 4NOMA 1CB7A 4PLYA 1EK1A 3UNXA 5EXSA 2KSQA 2OECA 2X42A 1LY1A 1QCYA 3ADOA 5K3DA 3WWZA 5B55A 5BSKA 5JNTA 2PKWA 1VPLA 2BJVA 4EKDA 3NYQA 2QW1A 4XGNA 4EDHA 4QPZA 2BE9A 1OBCA 1WE2A 1RXUA 3EYAA 1THZA 2I03A 3JW8A 5FI5A 3UAGA 4E5UA 5CA1A 4C0HA 1DEOA 3OLYA 2OYRA 4BXOA 4OFXA 4KTTE 1NXSA 1QGAA 2VSOA 2MSLA 4DEYA 3QKTA 3RPEA 4DSZA 5JWRA 3KAQA 1TEVA 2G9UA 5JSHA 3IKTA 3W2EA 3F6PA 4GUDA 2O5EA 2O1WA 1CY8A 3ONNA 2WEKA 5FFNA 5K8JB 2Y1WA 2RBKA 1P4GA 2BMJA 4J3FA 3I9MA 4G5FA 3NWOA 1E62A 1SN7A 4BJHB 4NEHB 4WL0A 4K9RA 1QUFA 3CKYA 4D9CA 3JWPA 2Q3BA 3EFOA 4GC9A 1Z4LA 1ECJA 4OSOA 1AXEA 1E1DA 3HJUA 2Q1TA 3PTZA 4YV7A 3UK1A 5C8XA 2OAGA 2AXEA 4MIKA 1V71A 2VUTA 2CXOA 3EZFA 3HKEA 1T2CA 5AXBA 3RM3A 3WL8A 1GPKA 2IOFK 2PTGA 3W5BA 2GXUA 3HEMA 4CI0B 3HJNA 2DFLA 4YO8A 4OB7A 4MUGA 5IAKA 3W1VA 3DLBA 2CVZA 1SUFA 4ZIRA 2PMEA 2E6UX 4XAQA 4OQYA 3JZMA 3OLXA 4P8RA 3KHSA 4BMPB 1Y9EA 4G5QA 2WFLB 1Z47A 2YFKA 2OL4A 2EX4A 4AB1A 4TL9A 4QGSA 2C5BA 4U6SA 5G0VA 2QA5A 2AZXA 5KJ1A 4XLTA 1NSTA 1MP0A 5A5DA 2NNLD 2C2KA 4MQUA 4OXRA 4E2FA 4UBMA 4DA8A 2GSWA 1SVWA 5DM2A 1TT5B 5BMVB 3BSFA 2VHWA 4FMBB 2OLKA 4WGGA 3HSKA 1AN9A 1TZKA 4LECA 1ABFA 1QHHB 1HSZA 3DMHA 3O4IA 3V2HA 4Q00A 3SFVA 1WY7A 3GW8A 4R1SA 1J9GA 1RWKA 1IBSA 4HYTA 3KQKA 2ZU6A 4ZVUA 4JX8A 3EF1A 3LT5A 3FNFA 4GL2A 2GEBA 3RT7A 1N1MA 3ANTA 5J2TA 1L7PA 4H15A 5DTJA 3UJPA 5LM3A 5JVDB 4X90A 4KQ6A 2CD9A 5EEHA 1SXJE 4B8WA 3FPKA 3T1HB 1SNYA 3WLTA 2OHJA 5K3EA 1SOWA 5I5GA 2ODAA 4M89A 3JAWA 2HQSA 4FN5A 3GPCA 2C77A 2QDXA 4V0SA 4F3YA 2ESRA 1PD0A 1GZVA 5F7XA 4ZMRA 3NVMB 3AM4A 1F9AA 3A1CA 2Z30A 1N6PA 3D6HA 4GXTA 1GG8A 3NIBA 3GJ4A 5DLEA 3QOYA 4AF7A 3AFHA 2IEIA 2QE7A 3T7TA 1F8YA 1W73A 3FBTA 5D6OA 1KWGA 2VXCA 3K70D 4UEKA 1GU0A 3C6YA 2I1QA 1MC8A 4P4TA 1S1MA 3LH5A 1C7QA 4QBFA 4RQAA 1VIVA 5E3JA 2FYTA 3SC2A 4J7UA 1P44A 4CLXA 1VL6A 2C57A 3COZA 1FC0A 3QSGA 4CF5A 2BCEA 3H5TA 1N6HA 3VVLA 2JGDA 1P3JA 4IIBA 4ALNA 4ENUA 5FOTA 2Y0PA 3ZNNA 1XRPA 3M6UA 3SOZA 4E5KA 4CMCA 2OM6A 1M1UA 3HWRA 1TTHA 4ANFA 1RC0A 1S3SA 1EE1A 1V2GA 3CMCO 3W9YA 2JHGA 1TADA 2HMWA 5G4LA 1OMOA 1AKWA 1B8VA 3LDUA 4IDEA 2NPIA 3PWSA 4TKUA 3ZHZA 4E2YA 5BV8A 2IH5A 2JARA 2R8YA 4BPBA 3MBIA 3PXDA 4LE0A 3COYA 4PFJA 4PTYA 4D9HA 2YNMD 2CDCA 1ZHHA 4V02A 1YZTA 4N3CA 3UOWA 5CBPA 3PEFA 3LDHA 5K4GA 1WQ4A 5EZQA 3RG8A 1P4HA 3TJZA 3LX8A 1YRQA 1E1LA 4M8SA 5D3QA 2VHUA 2RB4A 4XUCA 1CQWA 4O2AA 1QV6A 3TWOA 1SPBS 1XJWA 3DYBA 3VR5A 2HMUA 4LWOA 1SQSA 2R6DA 1T0UA 1MMFB 3EQ7A 4J29A 4KLZA 2BSXA 2VQ3A 1TPYA 4H1TA 1JH8A 1GN8A 1O3YA 3PJFA 3OLWA 2HXYA 5AW8A 2ZCVA 3D4IA 2QG6A 3O8NA 3C15C 4GPZA 4HWKA 1NPYA 2CLOB 4FNGA 1Q22A 3ZCUA 1JZTA 2V1UA 2VHTA 4EATA 1BNCA 3D3EA 2ZBRA 4XR9A 3I9NA