4Y1RB

Sav1875-cysteinesulfonic acid
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
169
structure length
168
Chain Sequence
KVAIILANEFEDIEYSSPKEALENAGFNTVVIGDTANSEVVGKHGEKVTVDVGIAEAKPEDYDALLIPGGFSPDHLRGDTEGRYGTFAKYFTKNDVPTFAIHGPQILIDTDDLKGRTLTAVLNVRKDLSNAGAHVVDESVVVDNNIVTSRVPDDLDDFNREIVKQLQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Uncharacterized protein SAV1875
publication title Structural and functional insight into the different oxidation states of SAV1875 from Staphylococcus aureus
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus mu50
total genus 58
structure length 168
sequence length 169
ec nomenclature
pdb deposition date 2015-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01965 DJ-1_PfpI DJ-1/PfpI family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4y1rB00
4Y1FA 1T0BA 2NV2B 5DFAA 3ZJ5A 1K9VF 3CYFA 3NONA 3NVAA 3VU3A 3L4EA 2H2WA 4Y1RB 5SY9A 1OY1A 3P9QA 4Y0NA 5JZMA 3TTYA 3EZGA 1C3OB 1JDBC 1PDWA 4WINA 3TTSA 3WFZA 2YWBA 4ENUA 1KWKA 2W7TA 4OQ4A 1P5FA 1BXRB 3NOVA 1A9XB 2VXOA 3EWNA 3R74A 4JQSA 4ZDIA 2FEXA 2LXNA 2R1VB 2RK4A 4B31A 4P35A 1I1QB 5K4AA 1SOAA 4GE0A 4LGYA 2ZUWA 1SY7A 2GHRA 3EFEA 3P9RA 4N12A 4P36A 2YWDA 4L8FA 4L8YA 1VCMA 3SF8A 3PQ8A 1J42A 1Q7RA 3FIJA 4LRUA 4P5PA 4UOQA 1KXJA 1IPHA 1UCFA 4K2HA 4N0MA 3SOZA 3ZR4B 4AUMA 4HCJA 4MNTA 4Y1RA 4Y1GA 1T3TA 3PQ6A 4AJ9A 1GPWB 1P80A 2AD5A 1R9GA 4I4NA 4ENQA 1Q2UA 4OIFA 5LIRA 1OX6A 2ABWA 1T36B 4RKWA 4WXYB 3NORA 2VPIA 3OT1B 3UMMA 4GUDA 1P81A 1GPMA 3PQ3A 3PQ5A 3RHTA 4AULA 2R1VA 3TTTA 1CE8B 1IZYA 1OX4B 3CZAA 4E5VA 3EJ6A 1GGEA 2VDJA 3D54D 3R76A 4AUNA 4B7AA 4ENPA 4ZGGA 1CF9A 1P7ZA 2OR3A 1M6VB 3F5DA 4XLLA 4GE3A 3UGJA 4P34A 3B3AA 5SYAA 3GRAA 4ENSA 5SY4A 3TTWA 1FY2A 4PXYA 3MIIA 4OGGA 1GGKA 2ZUUA 1S1MA 3L18A 4L7QA 4UZSA 4E08A 1KWGA 1O1YA 1IZZA 2YWCA 2ISSD 4OJYA 3ZJ4A 1QVZA 3OT1A 1PV2A 1GG9A 1PE0A 1CS0B 3CZ9A 1JVNA 1WL8A 2VRNA 3P9PA 1QVVA 1OX4A 4ENVA 3NOQA 3PQ2A 4BIMA 2WJZB 4UCFA 1ONSA 1G2IA 2R1TB 3UK7A 4ENRA 3TTVA 2AB0A 3L7NA 3CNEA 4ENWA 2YWJA 3TTUA 1OI4A 4R7GA 3SF8B 4ZDJA 3B38A 4QYXA 3CY6A 4I46A 1P7YA 3KKLA 4BTEA 2RK3A 3TTXA 1QVWA 3BWEA 4P2GA 1GGJA 1GGFA 1QWSA 2RK6A 1QF7A 2ZUVA 3ER6A 4RKYA 2ZUTA 3TQIA 4L95C 3M3PA 1I7SB 3PQ4A 4ZDKA 5SY6A 5E9AA 2V4UA 3EN0A 4MTCA 3FSEA 4L78A 1OX5A 3UOWA 4BFLA 3BHNA 3N7TA 2R1TA 1VCNA 4Y1EA 4QYTA 1U9CA 4ENTA 4D1YA 1I7QB 1C30B 4OGFA 1L9XA 1QDLB 1KA9H 2ZUSA 3F71A 3P9SA 1KEEB 4I2NA 1FYEA 3MGKA 4OFWA 4MGHA 3R75A 4UNIA 4ADSG 2A9VA 5JZOA 5BV2P 1GGHA 2GK3A 4AUEA 3NOOA 1VCOA 1PDVA 1N57A 3PQ7A 2NV0A 2IUFA 4S0ZA 3B36A 4B5KA 3UJNA 3L3BA 4L8WB 2R1UA 4B2YA 4B40A 2XF2A 2D7JA 2VKTA 4UOZA 1VHQA 5IP5A
chains in the Genus database with same CATH superfamily
1GTG1 2Z09A 4GOLD 1PGNA 3RQIA 1G3RA 2G17A 1JHMA 5DGTA 5ALPA 3B78A 4DLZA 1JDBB 1OY1A 3PE6A 4AU1A 4NXMB 4ESEA 3LPCA 3OQBA 3ZV5A 1GL9B 2EFEB 1NVXQ 5D3ZA 1A8IA 3RFCA 1QIFA 5EXSA 4N0PA 2OBLA 2A57A 2CMKA 1I5EA 3MRXA 4J4HA 1XCBA 1A69A 2NADA 4M0DA 3EAQA 4D3ZA 4EPWA 1QRUA 1YQUA 1Z9BA 1OFIA 1B0PA 2HYDA 3RC9A 3SOPA 5KWVA 4B7UA 4AYWA 1SM4A 4L8YA 1H93A 1SN7A 3H9QA 3PQ8A 2X9NA 1PTKA 3NDJA 5BSMA 2R1ZA 3IAFA 1L5KA 2YV5A 4HCJA 2HNBA 1LBIA 3FPCA 2HU2A 2OSVA 1Y8QA 2AD5A 2JLSA 3PDJA 4IIXA 1QOPB 4W99A 3UUFA 4DBZA 4DL9A 3A04A 4L9WA 2ABWA 1O95A 2EATA 2VLBA 5E8RA 4X8MA 3E05A 3EMVA 5KSZA 1CTQA 2LRHA 4MK4A 4WZBB 5J47A 1EWTA 1SXJA 4PN3A 1ZH0A 3KYDB 3DOUA 2QTCA 4PIMA 3CH5A 1UXKA 3BN3A 4MRVA 3B6JA 3I23A 4D9NA 2BLLA 4J2HA 1HM5A 4XD2A 4Z54A 5CBPA 5JAOA 1I33A 5CIQA 3RUFA 1LQ2A 5LOVA 1JJIA 3ABQB 5HIIA 3EZ6A 2CUZA 4KQMA 1V3QE 4PZ0A 3KE9A 1U0GA 5JCJA 2Z8XA 3GNTA 1PR1A 3N59A 1ULTA 3ET5A 1GNSA 1KFKB 1RU3A 2F1IA 3DLTA 4KAAA 4EHIA 3K05A 1KI2A 2ZLBA 5F12A 1E98A 1ZIYA 3JY6A 4WOBA 4RFSB 3DQQA 2J7KA 4WTOA 4DUYB 1PJ3A 3M82A 4Q4DA 1P2GA 3RRNA 2FWPA 4WY8A 4S24A 1XN4A 3D02A 2JLXA 1T0HB 2NZ8A 3D8SA 3VAYA 2J9FB 3IP8A 3A1TA 2H00A 2W6JA 4PICA 1I3MA 3D3KA 3RAPR 3E1SA 1IN6A 4EIWA 1OLSB 5F9HA 2OYSA 3LSYA 1M6VA 5IKOA 1H4TA 5DXFA 1WCXA 2GMWA 1G66A 4IVQA 1KK0A 3GDHA 2CSXA 2G07A 4NZOA 5BSUA 2Q6LA 2JAXA 1DKPA 4LJYA 3WWEA 4DSAA 1VMKA 1RLJA 2WHXA 3ADPA 1CY4A 4KX3A 4YH1A 3CRRA 5DPMA 4EX6A 1EP1B 5E6SA 3KJHA 2QBYB 1H8HD 1YO6A 4P33A 3LZCA 3OCCA 2PS9A 3HO8A 3NNDA 4TTSA 1I4TD 5K3FA 3SLGA 3UGKA 1TT5B 5J58A 5BWNA 1EVZA 1J8QA 2HF8A 3E15A 2ZRPA 4EFDA 1UOQA 4W8OA 1K6IA 1VECA 3PT9A 2OHFA 3ND6A 5ENZA 2ATIA 2IEDA 2XPCA 2DHCA 3FKSA 1QO9A 1QLJA 1T35A 3PNMA 3CF6R 2YUTA 1B0ZA 5K0ZA 1GVNB 1UK6A 4HDNB 2Z9BA 3V4OA 3CRMA 1VLJA 2ZETA 1WD5A 2KE5A 4ZZ3A 3HQ4O 2IBTA 1CP3A 1GQSA 2BELA 2VHCA 4HY3A 1CJSA 2EFHB 2N47A 4I14A 4IFBA 7MDHA 1Y7HA 4JOQA 1FJXA 4G1UC 4AS2A 2HU5A 3H87A 1JYFA 2VDRB 4JLSA 4MAFA 4EM6A 1NNI1 1GCUA 1MVNA 1S2OA 2BFBB 4IDHA 2ZJYA 1UKYA 1UP6A 4XWWA 1O87A 1YI8A 2PXAA 3EVGA 3I9FA 1PU2A 2PUAA 4NU0A 3ER9A 5CEEA 4QU8A 3WB9A 3WFZA 3TTSA 4HNTA 1HLGA 4BFZA 3IKMB 4WBSA 4V0LA 2Z95A 2EOAA 2ZR0A 4D99A 4EYKA 2ZXEA 3NH9A 4MR8A 3FGZA 3QVGA 1SOAA 2IGBA 5BN3A 3X1DA 3BDAA 3SC2A 4R3UC 1XI2A 2UVPB 5KJFA 1QQAA 1MVLA 1ZCFA 3GZ4A 4MYUA 4Y6OA 1XXHA 3VO9A 2PZBA 2QV7A 1G21E 1GTVA 2JCXA 2ATCA 2BRUC 3KTFA 4GR5A 3KQHA 5LZ9A 5D3MA 2ZYAA 1QE0A 2XR1A 5DISB 4TV8A 5EIHA 1P17A 2BKEA 2X3UA 2DETA 1PGJA 1YZLA 2ZRMA 3ZIAA 2J0SA 4HGQA 3EEYA 1WP4A 3M6LA 1GRNA 4M7WA 2W2QA 4OMUA 1PFKA 2IWHA 5CLJA 2HBZA 3ZHQA 3HXOA 1E4YA 4FEGA 4DILA 2WD7B 3DQPA 1PBNA 2BJVA 4TMZA 2MSDB 3L0ZA 3LY7A 2I0FA 1H4QA 1TK2A 1GXSB 2EYUA 4ID3A 4D4JA 2C3PA 4BY9E 3H97A 4ZZ2A 4AZ3B 4MR7A 5B64A 4NWIA 4CMEA 1H8ED 1P1FA 4GE3A 1KSFX 5DBIA 4R6WA 4P3NA 4ZGWA 2DHRA 2VZLA 4PQGA 5KU1A 3WFIA 2X2EA 4UHBA 3ZV6A 1OXBB 2V54A 4LAFA 2RIPA 1S5PA 2BI8A 2FFHA 2VHWA 3CNOA 1RMQA 1NDUA 2A9FA 1RR6A 2BSAA 4X3PA 4FOTA 2Q28A 4CQLB 1QYDA 1J06A 1TTPB 3ESDA 3I1YA 3OY2A 1OI7A 4WAUA 3L1JA 1U8YA 3P9YA 3NETA 3BTOA 2VPPA 2ZIAA 1NW7A 5JW6A 3L4BA 5B4VA 3KVOA 1XNJA 4D92A 3SHVA 2DHQA 3UKDA 1XTQA 3VJKA 3F7TA 4GOOD 5HPYB 2QD2A 1XPJA 5FX2A 4D0GA 5ALQA 1T9AA 1P44A 2C3UA 5K6TA 2NWQA 3UK6A 1ZGZA 3V8BA 4RTQA 1UM9A 5FLEX 3PUVA 4TXLA 4DV6B 2RGXA 5TGZA 3RODA 3QTBA 3V7NA 4D8VA 3CSUA 5E2AA 3SC3A 4OHRA 2ZYDA 3EODA 5KNBD 4P3OA 3EYAA 4FX5A 1MDFA 1P91A 4ZODA 5BMVF 2HPVA 5GV7A 3AUTA 1A77A 2WM8A 1NONA 4DIEA 1XAIA 2ZZNA 1M5TA 2Z30A 2VJDA 2OC4A 3COJA 4UZEA 4Y0AA 5EYPB 4HNSA 4D9GA 3KXDA 1XDWA 2PQ0A 4KCGA 4P3PA 4LE2A 3KEFA 3MC1A 1TYEB 3DBLA 3KELA 4PHGA 2NO4A 3O82A 1AHHA 1F38A 5BV2P 2CHGA 3HEBA 4B3FX 3I45A 3ZGVA 1XMQB 1BHJA 2I33A 3H1EA 3DKVA 1FRZA 4YQYA 1MB3A 2EP5A 4FJ2A 3D8UA 4U6SA 4XVUA 3PHHA 4G07A 1HOTA 2BISA 2PL3A 2ZB4A 1IXZA 3ROZA 1L5SA 1ISJA 4WZAA 3LY9A 3C5EA 1TGVA 4IWYA 4DPLA 4D4GA 1BD4A 1SC1A 3NONA 3PX2A 4Q3EA 3U7QB 2VCYA 2JNWA 4XOUA 1LC0A 1E79D 1UFVA 2OHVA 5TR9A 2OEPA 3Q8LA 1UIRA 3MTDA 1JH9A 4IVPA 1Z0FA 1ZYUA 2CLMB 3CVUA 3GZNA 1T9ZA 1VKNA 1MC8A 2X3FA 4QBHA 3A1EA 1Z4NA 2OWDA 1CR2A 4WFJA 3RTDA 1LF0A 4A16A 4UEWA 1KU0A 3BWDD 3A2NA 3AKCA 4R83A 1SPXA 1WDLA 2ISCA 3H0EA 4O6VA 4AYTA 4HLQB 4R2HA 1KJQA 1Z0DA 2QORA 3MINB 4MVJH 5DTIA 5C32A 2XQGA 2PX8A 2PUDA 2CVFA 2EEPA 4UOQA 2G71A 3SC6A 5TT0A 1ZI6A 4R01A 5HJ7A 3TW4A 2IU4A 3RGGA 5BMOA 3GPBA 3ZD8A 4MUXA 2MSLA 1YKGA 4RACA 1WCYA 4ZPXA 3ZE7A 1ZD8A 2ZZKA 4GG1A 4JBNA 1U3CA 3RJ5A 4GL2A 3UMMA 1VJRA 1U8AA 3EOZA 5HIJA 2CV1A 1IMJA 1Z6XA 3MWFA 4E3ZA 1OX4B 4ZD6A 3HM2A 3VPGA 4D9BA 4ZGGA 4F4UA 3G8YA 5AMXA 4AYXA 4G0UA 1AN0A 5AJXA 5M3BA 2G72A 4LZAA 5JARA 4TT3A 5FB3A 1KBQA 4M7RA 2HJWA 4O4HF 3R44A 4YUZA 3GJSA 1IUNA 4F11A 2WK1A 3B6EA 3RUIA 4XIJA 4B2PA 3A9RA 1VL6A 4N6GA 3I42A 4QL3A 2AW3A 3UHAA 3VR3D 3ZBTA 1HL7A 3K0KA 4TL6A 1E2DA 1JE1A 3R5SA 2E82A 3WISA 2QN6A 3R9XA 1EFHA 1IIRA 1V39A 3HDTA 2J9RA 3JYNA 3OECA 3PNBA 4OBEA 2V7QA 4JGBA 4OUKX 1MGPA 5IYZB 1C3OA 4J1QA 2HRDA 5EMNA 3NOQA 5T67A 3LDHA 5JBQA 1T8TA 2AR7A 2AFIA 2DWCA 1I2CA 1IH8A 2QXUA 3W9SA 4C08A 5ELLA 4DDVA 2R5WA 2FZCA 5LQDA 3QTLA 4NX2A 3ZWYA 1Y3FE 1DHRA 1RMYA 1ZONA 4PCLA 3SBEA 3N8KA 5H9WA 1YTLA 3R3ZA 4UUAA 3RWMB 3CZPA 4DBVO 1H2ZA 1NW5A 4IM7A 5H02A 1ENYA 4J1TC 4OREX 1PZNA 3AGPA 3IP6A 1L4FA 2ZE7A 1AT1A 4X8HA 3UMRA 3ESRA 4EPTA 1AKRA 3EGIA 1QKJA 2NXCA 2DUJA 5IC6A 4RELA 3TZBA 2XDQA 3OOSA 5EXXA 3TL2A 4R8LA 1UUFA 3VNSA 3JQEA 3UOWA 3GRRA 5I7UA 2X8LA 4BUZA 4NNPA 1XTKA 1U81A 1FTSA 3KEGA 3OMWA 4UU7A 3ROTA 1O6CA 2ATXA 3NWEA 2F8LA 2QR5A 3O1LA 4UMFA 3TWOA 4BO6A 3EIXA 5G3YA 1DDGA 1Z7BA 4PGFA 5ILQA 4Z7OB 1OWMA 2PGOA 5K20A 2H52A 4Z4QA 5NULA 4Y6PA 4YJ2B 1VL5A 1PJ4A 4IEEA 2PAAA 2G6TA 5BVHB 2D2VA 1OQAA 3U81A 2NV0A 5C8XA 5C5EA 4ERXA 1JJFA 4DDKA 3WNDA 4QDOA 4RETA 2MOKA 1C1HA 4YRAA 5C3MA 1WZNA 3UMJA 4D5EA 3QJGA 1JILA 4PU0A 1Q7GA 1MQ8B 1U5BB 4TV9B 5LQUA 1PJ2A 2FRDA 1WWKA 2GEVA 3NFRA 4I6EA 3NVAA 3IAS6 2QTVB 4Y8VA 2MMGA 3MCVA 1CZLA 1OROA 3FOAA 4EQ6B 5JLJA 1WUYA 2GFQA 4QGFA 3R9WA 2GASA 1E77A 1C0EA 2XVZA 3G0CA 3K5WA 4IV5A 4BO8A 3UWMA 5DJ5A 5DGIA 3W4KA 3NNNA 4X61A 2SKDA 3VSCA 1JEDA 3F6YA 2ZT8A 2IGTA 3RT7A 4BMNA 4BN5A 3BFVA 1W36B 1DXQA 1PK8A 1XJ5A 2OLJA 3FR8A 1YIDA 1ZEMA 2A88A 4GP6A 1NFRA 2FK7A 2WIFA 4LGVA 2DHEA 2DKOA 3R7SA 3U39A 4EA6A 1W0KD 4LHEA 1E1RD 5DHUA 1EK1A 5DVZA 4U7TB 1EU1A 1R9GA 1ZI9A 3TNJA 1F7UA 1HSZA 3QVKA 5LD2B 1HGXA 5F9MA 1BN6A 1SHUX 3GPLA 3U1VA 3GGSA 4WOKA 3T9CA 3AKEA 4NG5A 4OM7A 4I1RA 2TECE 4UEKA 1ULHA 4Z8XA 5C8YA 3MOIA 3IAUA 2YNMD 5J2TF 5CVCA 1EK2A 2ZYWX 1GD1O 2R4UA 1SUFA 4QFBA 4BJHB 1ADCA 2DGDA 2G80A 4WWHA 5E4YA 1HY3A 5C5DA 5L3ZA 4ARVA 5DASA 2JI6A 4QNMA 1TPZA 4UBJA 4BX3A 4D3XA 3DMRA 4EUHA 5F7OA 3L0YA 2RHRA 5FP0A 3KZVA 1CKEA 2B35A 5KYWA 1DKUA 4MOWA 2G06A 2VF5X 1NXTA 1XYVA 3G7SA 1LTHR 4HQ0A 3RARA 4M1EA 4DIMA 8MHTA 1I4OA 1QVZA 1T3SA 1PTJA 2VI5A 3GY0A 2ODNA 1DHTA 4MUEA 1BC5A 1WBBA 1PG2A 1EFCA 3RH0A 2HUNA 1XZCA 2QTRA 3AQ4A 4C3ZA 5K0CA 1R8JA 5G3ZA 4JP3A 4UDOA 4L3VA 1SVKA 2ZBFA 2HLPA 4CHGA 5JWHA 1DQSA 3EEFA 2B1QA 2QM8A 2NGRA 4IIBA 1XQWA 2C7PA 2MR6A 4NBLA 1N2HA 4QFDA 3K9BA 2X0EA 2WOOA 1L5OA 2QJWA 4JFRA 4ER6A 4KGXA 5EJ9A 4B3XA 3DL2A 2NVUB 1K89A 5FJJA 4E30A 2A0UA 3GMIA 2QG9A 4AKGA 3L0PA 1ULSA 3Q7SA 5KREA 2FUG1 3LK6A 3BB1A 3NI2A 5LZ4A 1CBUA 1V9LA 1Y6QA 3G49A 4DLXA 4EKYA 2ZIEA 2XUPA 4II3A 1EBUA 1RXWA 1G8JA 3B3GA 3GJ8A 1A4IA 3ESBA 1Q0UA 5FUBA 4UHKA 3IT3A 4EYQA 5LQKA 4YY3B 1XHEA 1RQXA 2WIDA 1I7QB 1O95C 3UWPA 1OGIA 2CW5A 2ZIXA 2XDWA 3NUZA 1XTVA 3F71A 2QLNA 5TMBA 3UNXA 4DV0B 1H66A 2Z2YA 3PXBA 4WNCA 1ZPDA 3PV0A 1IWOA 1SXJC 1T2VA 3GRZA 1LPOA 1XJ0A 3QXHA 4HH0A 1S8NA 3Q0IA 1JDUA 3W05A 5LKAA 1EIWA 1GKLA 2IW3A 2PUTA 1DB3A 1E2HA 3NJ4A 2F67A 2J1LA 2Q6OA 4XR4A 5KOHB 5CXUA 1SUBA 4M8NE 4DDTA 1EI9A 3S5UA 5A4DA 1CQJA 5MFPA 2PWAA 3PXAA 1WXDA 3WX0A 2QR3A 1SIOA 1HBJA 3G59A 3WL5A 1RTTA 5CYFA 1N0WA 3REGA 1A2KC 1H1LA 2I6XA 1A5BB 3VTAA 1LS1A 1Q0SA 2Y1GA 3BBPA 1N8KA 3JQPA 1QHEA 3LQFA 9MHTA 4YQZA 4D26A 1G9XA 2HRCA 1TMGE 1DSSG 2P9FA 2C78A 3NH6A 4OATA 5HKKA 3GAZA 2ID9A 3QEOA 3FUCA 3F2VA 4GXRA 3V7YA 4YRSA 3KOZA 2QENA 1G8KA 1OIXA 2ZJZA 1VBNA 1VQ1A 3BL8A 1QLHA 1KJ8A 1U65A 1E9FA 2FSSA 4X6LA 3W5DA 2DH5A 1U0LA 1M6HA 1NXOA 3WLKX 5HOEA 3ZGLA 2A0YA 3CZ5A 4IILA 3BIWA 1JNYA 2O1XA 2V97A 2HIMA 1F48A 4ISBA 2I99A 1S4QA 1WXGA 2RKWA 1ND5A 3JQAA 5E1OA 5T64A 5J1SB 4FGKA 4B79A 1K7FB 1FFSA 1MIOA 3AVQA 3UWDA 4NABA 4GMKA 2DB3A 2FPXA 4MV4A 2FPRA 4GD3Q 3T5DA 5GONA 1DNPA 1N6HA 2YUIA 2EX0A 4ENPA 3DTYA 4KU4A 3HGQA 4TVSA 1ML3A 5IULC 3QH4A 5I48A 4ND8A 2PX4A 4MA5A 2OFWA 3HEAA 5C52B 4MUYA 4TUYF 4EGJA 3UXHA 1D8TA 2FN3A 2UUPA 2IYVA 3KOUA 1BDMA 2DM6A 2PSHA 3DE6X 2R8OA 3UA3A 4ZJYA 3Q2OA 2OFXA 3W9BA 5CITA 4CKZA 4X92A 4TYMA 2QQEA 2RHLA 4N47A 1EG7A 3M1YA 1ISSA 2GXQA 3PJGA 4ZQCB 5IABA 1XTTA 4DVJA 3MJ4A 1Y6GA 3QY9A 2C82A 4Q1EA 3H42B 4RQUA 1UK7A 1E1YA 3I4CA 2CXPA 1H0SA 2AB0A 2NO0A 4WXMA 2YHUA 1X77A 4Z51A 2C3MA 5G0WA 4XD7D 4QYXA 1I0IA 5JCPA 4IDAA 4C4YA 2P9JA 4YT8A 2N3ZA 1OA1A 4PC7A 1IFXA 1RXIA 4JJIA 3HEMA 4IDOA 3MMXA 4WX2B 5DH9A 5HXAA 3IUPA 1FQOA 1NXXA 4G5QA 3R0QA 2NSJA 2B5WA 9LDBA 4C6TA 2QNBA 2WJ6A 1HMYA 3TYXA 2SECE 3AESA 4L9AA 4IXTA 2H6EA 1GTJ1 3TN7A 3ZK9A 5F21A 4ZAGA 3INNA 3I9V6 4FKMA 5BYJA 4C03A 3DT6A 4TWJA 4J91A 3UQYS 3AF6A 3V55A 1GCGA 4QXQA 4XKJA 3R9IA 2QRNA 3FXAA 3LV8A 3TAHA 2R48A 4EG6A 2Q2VA 3RRJA 2X4IA 4EYGA 4OOFA 2R44A 4YMGA 4CMEC 3L8ZA 3S1SA 2JANA 2CXUA 5E2BA 1IHUA 5AM1A 4CLRA 1ZA1A 4HMQA 4N5LA 3ZCTA 1F2DA 1QIKA 1GPLA 1KFJB 3GGPA 4XTRA 2N42A 1K5HA 5JZ9A 3KIPA 1BYUA 3OHMA 1B1CA 3LY8A 4YGYA 1TLFA 1J2EA 3BSFA 4H7JA 1Y3AA 3RTEA 1HKUA 5A5DA 1K6MA 3I9OA 2QDKA 3GP8A 1YE8A 3I5UA 3U37A 1C81A 1CUZA 2ZYSA 2BEJA 1XAHA 2DRIA 2ET6A 1F12A 2WMOB 2YFQA 2YVQA 1MAVA 2YL2A 3C3KA 3CKLA 3OJEA 4MUNA 4RXMA 4WKGA 4EVQA 4UE3S 2AX3A 2QX4A 1RYBA 4QJ5A 1JBQA 1E3WA 1GITA 1J9GA 4FVTA 2Q62A 3DSRA 3EFEA 3PUXA 2C95A 4WESB 3HJAA 4KGVA 4UNPA 3RQSA 4MI6A 4OJMX 4ZRDA 2ZEJA 1QV9A 3WGMA 2GXAA 4EI2A 2C9MA 1XZQA 4CIDA 1WCIB 5J5AA 2CLFB 3LDUA 5F4ZA 1KPGA 3CUEF 3TQOA 2XMQA 3HHEA 4KQ2A 4PLCA 3TX2A 2CHQA 2RHHA 4PFSA 1AGXA 2F62A 5LQRA 4DHWA 1K98A 3PB3A 3P96A 2ORED 3DBIA 4YI5A 1BDHA 4C4XA 2CCJA 3PC7A 4R0VA 5JNVA 4UAJA 2WU0A 4AF8A 1ZP6A 4JP8A 4BNMA 2W2MA 3ED1A 1FDWA 2JIBA 1KK2A 2WDPA 3I4LA 3D0QA 3MTGA 2ZZMA 4TXMA 2JVIA 5FBVB 4MULA 2IH5A 1TQ2A 2HSGA 1NBIA 1SZCA 4XLLA 3K70C 3ZH9B 4IH9A 1E1CA 1FFXB 3T5GA 1ZWLA 5DXJA 3IIKA 4CODB 2WHPA 4X5OA 2H4YA 1T8PA 2QW0X 5KPDA 3B2EA 4LMAA 3ONVA 2Z1DA 3I9KA 3O7WA 1SBZA 1TE2A 2OM2A 1B8VA 1PV2A 4K6MA 3CZCA 1UODA 2ATVA 4FC7A 3SQWA 4XJVA 4J90A 1PVOA 2VTEA 5CT9A 3ORQA 4LZLA 4QPZA 3WVNA 4X3CA 1MC4A 4U00A 2J3IA 2J33A 5K45A 2H57A 4A2WA 2R66A 4PG6A 1IQUA 1Q3TA 4LJ7A 5ALVA 2RE8A 3V2UA 2IUUA 1YRYE 4XVRA 5CFOA 6PFKA 4MV7A 2X9LA 2XRFA 4BX0A 1WE2A 2GEBA 3RSZA 4JVLA 1XU7A 6NULA 2RC6A 4HN2A 3O26A 5AVXA 4YXWA 1FQWA 3KVNA 2GN4A 2TMYA 1YDHA 3ELBA 1DTWA 4XDZA 2DOKA 1C7JA 1RBMA 2J46A 2R1TA 4UBOA 5EZYA 2WMNB 2NP7A 2VXYA 4HHEA 4GI1A 1FDVA 2C5BA 4YT2A 3I09A 5CFQA 1CDEA 4UU1A 2VF4X 3F9IA 3UFXA 5AJWA 1H5QA 1MDBA 1NI5A 1DI0A 1ZH2A 4HAWA 2ONJA 1S96A 4GC9A 4LRSB 1VJDA 1ZMRA 3NHYA 3HSYA 1VI6A 5TSDA 1H2FA 3V4SA 2FSVA 3R7NA 1ADFA 3UPDA 4DLLA 2R60A 2W2LA 3IJRA 3IRVA 3N87A 1VLVA 3W5JA 1UBGA 1KSGA 2XMZA 3T3MB 3V4PB 2BHTA 1SRRA 3JAKA 3OPNA 3WSWA 3PC4A 1KDPA 5M7EA 1QJ4A 3FF1A 1M8JA 1X1TA 2CLKB 1P4GA 2EBUA 2H1VA 4Q34A 5JMOA 2AX4A 1S8AA 3DS8A 1OU0A 2D1YA 1NSTA 2X8JB 2W7TA 2XUIA 3DBOB 5JHHB 1C9DB 3CG0A 4CKYA 4KFCA 4ZAVA 3C3AA 5DXAA 1XKTA 2J9XB 1WHSA 4W1RA 1FX0B 3AFIA 4D6PA 1TFUA 2E2WA 2DTXA 3BA1A 2I2WA 1EBBA 4L6CA 1I01A 4CQNA 1LJ8A 4P4SB 2WZCA 3U4GA 2RH5A 5TC4A 4YV1A 4RMHA 5THQA 2ASVA 2CHEA 1SKAA 4LXYA 3ROFA 4XCXA 1Q2UA 3AIOA 4G86A 2ZU0C 4I50B 5C46F 721PA 4CL3A 4HXEB 3RCBA 1Z7YA 4KRFA 3TI7A 5DB4A 1HH4A 1MMFB 2TMKA 1XEXA 5BSHA 3GLGA 2NO5A 4CMAA 1C1XA 1DBPA 1LFAA 2BOVA 3U7HB 2JFGA 4E5VA 2Q4DA 2H4WA 3PF8A 3FYUB 3IMGA 2FR8A 2OR3A 2QUIA 5HOQA 1I5RA 1POWA 3HCCA 4QFMA 3O8NA 1U7XA 4KACA 3DFZA 3GVIA 2Q29A 3K1ZA 1CY6A 3RANA 1FDTA 3G2OA 1XVTA 1FUUA 1C9NA 3OE7A 5JH7F 4Z9AA 1G5QA 5BN4A 4PSVA 2P5TB 3NVDA 2WI8A 5KCMA 4BFYA 4H77A 3OKFA 3W90A 3K70D 4US1R 1ZESA 2G5TA 5JECA 2WYOA 2W0SA 3OPXA 2FRDC 3DOJA 2PGJA 2ACWA 3R3UA 3VVBA 1VB3A 2IUTA 3NBKA 4J0DA 4DMUB 1GPUA 1OF1A 3HMKA 5EN4A 3E7PA 1OAAA 1PX2A 3VU0A 1B2LA 4B7CA 3DVAB 4KPUB 1QTQA 2V6FA 1RXEA 3D0KA 4IMJB 5JYDA 3MUOA 3VGJA 1QNLA 2O52A 5ERYA 3WLIA 3CRZA 4JASB 3PEFA 3A70A 3RADC 1RAAA 1HE2A 2P5UA 3T54A 1YZVA 3QUAA 2Z8YA 1BDJA 1W4ZA 1WA5A 3EZ7A 5TE9A 1SO8A 3FAKA 3V1NA 3D0OA 2CF6A 1DRUA 4UPDA 4GMDA 4GVLA 1SNYA 1WMAA 5DYWA 1ATIA 3QLTA 2OMKA 3WL8A 2P30A 2B3DA 3CRVA 1GHTA 1PN3A 2BMVA 3AHDA 3E0QA 2Q0XA 4O08A 5DNEA 1IUKA 3THWA 1R4MB 5LQCA 3GGCA 1NSFA 3AW9A 5JZOA 2GCIA 1MZPA 2HXSA 4GWKA 3ORFA 2KS6A 3G9XA 1L7XA 2LCFA 4DVGA 4EEXA 3M8KA 5JS2A 5HRUA 1PHRA 3MCTA 2PX2A 4S0ZA 5FUMA 4FE3A 2KB0A 1XVAA 4W8GA 3AY7A 4QTYA 3AVWA 1QBKC 1P2BA 3DFUA 4KMOA 4IIGA 1XDBA 2A9PA 1S9HA 1F8XA 4Q7KA 4BFTA 3OP4A 3B1FA 1CYDA 1MW9X 2C83A 3RTGA 3TOVA 4TTAA 3JYQA 3D5EA 4DLYA 4GR4A 1KZ6A 3OMXA 2IE0A 4O1HA 5KIAA 1PP4A 1UPBA 4FOLA 1IEVA 3ZWPA 1HUQA 1DQNA 2ZPUA 2MMCA 2UDPA 4I99A 4DTCA 1XMSA 3L1UA 1JRLA 1PTJC 2H4XA 3LAWA 1A9PA 3AFOA 3NHPA 3HVJA 4Q9NA 5E6UB 4ZKEA 3LT1A 1TTTA 1XIVA 2C77A 3WGUA 1XYGA 2XUQA 3IUSA 4P35A 4DYDA 4HXYA 3AB3A 4HAXA 4L27A 1JH8A 3ELYA 2XB8A 4R3NA 2Q1XA 4P2BA 2WNHA 1C2YA 3ZHTA 4LNUB 1M74A 2EZUA 3I5YA 2VHEA 1G7CA 2GTIA 3VR2A 2QS9A 3E9CA 1J8MF 2ZI3A 3V00A 3N2IA 1ZOPA 4YMUA 4AJLA 1W85A 3OQIB 4F2WA 3IAXA 2GVDC 4C2UA 1FYVA 1WQ3A 2JGDA 2IELA 2PA0A 2HQSA 4GH5A 4M8LA 3SJUA 3EXHA 2GN0A 5JXIA 4ERNA 1HFKA 3QKUA 4CV1A 4ZJPA 1TUBA 3NAZA 4O02B 4QLAA 1S8FA 2OZEA 2QYHA 4UPEA 1XLTC 4GEGA 1JG7A 3FDZB 3RAFC 3KSBC 3QPUA 2OD2A 4I4LA 1Z25A 3AFGA 1TM7E 4QUDA 1TNDA 5GGYA 4UBKA 1I1NA 1XLVA 1L4UA 2GM5A 2YHIA 3IXLA 4ZCIA 5CYPA 1HYEA 4G36A 1JQAA 2GAOA 3NHJA 4AAYA 2PY6A 1I24A 2IKSA 1S9DA 3SU8A 4YPFA 5JCOA 4WK6A 3GJ0A 1DRWA 2FMKA 1KFCB 5D7NA 4CDRA 3DHEA 1CCWA 3SYLA 2HMSA 3A11A 5IDVA 5GVSA 4FINA 3FJOA 4LZJA 4BLVA 5E95A 1GZHB 3NYWA 4ZV9A 4CG0A 4LUCA 4MWDA 4H7EA 3A6HA 4BVAA 1BH6A 3AF5A 1U4SA 1NW8A 1G7TA 1O0SA 1ORHA 1XJWA 2HREA 3I34X 4U9UA 1RHQA 4R7GA 4QUAA 2YJ3A 3ZDXB 1N9GA 4DWWA 3W3AD 4D0SA 1EVKA 3EVEA 1Q0ZA 5JLAA 1NN5A 3RSSA 4EZEA 5AKLA 4Q6BA 2RONA 4RFVA 2XMCA 2W2NA 1NVGA 2PUFA 3ROPA 1UOPA 4JMPA 4L95C 4XM1A 3LP5A 1TC1A 2BKXA 5TPZD 5DULA 3A10A 1PEDA 4RWZA 2PCJA 4A03A 4HQFA 4INJA 3KSMA 2OM6A 4A27A 2IF0A 4L78A 3IE2A 4IIEA 3RUPA 3KT8A 4UD2A 1ID8A 1VZ2A 1A8SA 5CLFA 1EVYA 2Q5EA 3MNFA 3MSCA 3FFTA 2FWRA 1P7CA 1UH5A 2VP5A 5AQEA 1YR9A 3DEYX 4U4AA 1XEAA 4LNHA 3R75A 5E8JA 2ZSEA 1PR0A 1N8NA 5EJEA 5EKDA 4JJ8A 4X64B 1NULA 3H2ZA 3BK7A 1EMDA 4O4IA 5I3ZA 4MW6A 1U7DA 1Y3HA 4OPMA 4XH9B 4BZPA 3TPZA 3I5AA 3LXRA 1TVEA 4G0ZA 4WRRA 5HEKA 3WQBA 2GNOA 4MQFA 5A7FA 1S3SA 1KZ9A 3ND7A 1ZJ5A 1I32A 2PFKA 3T94A 5ETJA 5FEUA 2ROQA 4Y7DA 1KY3A 4TMTA 3W4JA 2XYPA 3H2IA 1I94B 2HBYA 1E7QA 1OBOA 4CIAA 1UAAA 4FGWA 3TF5A 3FA2A 3KOMA 2HQBA 2RH4A 3A4YA 4XFJA 4B8ZA 5GZ1A 2DXIA 3GHYA 4KQWA 4MS3B 4BS9A 4RV4A 3A1DA 3AEKB 2AF3C 3ELUA 2B98A 2XA1A 2BKUA 3EVFA 4JC4A 1WMEA 3HLKA 2QHXA 2WY2D 6LDHA 4DHEA 4I3FA 3VV2A 2C2OA 4O4LB 4KOAA 2XE6A 4I4TA 2Y1DA 3UPTA 2Y0DA 3WLJA 3OJXA 1ZC4A 2BP7B 1K6JA 1YBMA 2EW1A 2ZJ6A 3IJEB 2M98A 1FUEA 3VC1A 1BGVA 1VE9A 3N6XA 3O38A 4PNHA 5HA5A 5HWSA 1RYEA 4KO3S 3BIFA 3O1HB 2C5AA 3TM4A 4FQ5A 1N75A 2GZRA 4K6OA 2CJFA 3QU4A 3RVKA 5BWLA 5H1YA 4OXKA 4QVGA 4M9XA 5HZKA 1QMPA 4BLWA 4CKBB 1SC6A 1M2NA 1G63A 4JR1A 1N0UA 1U0SY 4FZVA 3ANNA 5J2UF 1J2TA 1VC2A 3DOOA 3AETB 1LDNA 2Z2ZA 5CDUA 3QU5A 1DCMA 3MT7A 1XRMA 4C0SA 1V5IA 1Y4SA 2PGIA 5AM0A 5L4NA 3NEJA 4EYEA 3UUGA 3ZU6A 5DKFA 2F1KA 1Y3DE 1YS9A 3HNRA 3DF9A 4GLFA 2DBYA 2RHJA 2RJOA 3EJWA 3IUEA 3CIOA 3BH6A 2I8AA 3FHLA 3FB1A 1MN6A 4XM2A 1HXHA 2W2KB 3O6VA 2J4CA 3O8OA 1V6AA 2CMHA 3GFFA 4AO8A 2W58A 4CL8A 1M2FA 4HB0A 2CLEB 2H1SA 3C6XA 4LPSA 5TS3A 3MJDA 1AKWA 3U3KA 5CCBA 3NPMA 4KRYA 4GHWA 1S8OA 4UDYX 2AQIA 4DABA 1TT7A 4GWLA 5LP6C 1KJJA 1V9SA 3ZS9A 1U11A 4LZNA 3B48A 4Q1VA 4FXOA 4BTVA 3GRCA 1QHGA 3T7DA 3GIDA 3RF6A 1DLJA 1E6UA 2IU6A 2RJNA 1VHDA 2BZ1A 3KYIB 1YRAA 2CUNA 2X5OA 4XX1A 4LFAB 4Q4LA 2HX1A 2HU7A 1SB8A 4IHJF 4MRMA 1JQBA 1WSDA 5BOSA 3F0TA 1W29A 2QG6A 5HRAA 1EX1A 1MX3A 1SVWA 1IM8A 2ZYTX 3VPCA 3IAS1 4M55A 2WM3A 3DLBA 1GAEO 2YDXA 2Q5OA 4NHOA 5J9FA 1OXKB 2ZS7A 1EXWA 2C57A 4I1VA 4F3YA 5KZMB 3H0CA 3TRDA 3JALA 4MW9A 1E5VA 1EYZA 2Q9UA 2RGWA 2Y66A 5JXGA 2Q7OE 2OBXA 1FXWA 1H3FA 4RAOA 1UKBA 1J0DA 2XUJA 2DKNA 3AEQA 4I9NA 2XCRB 1XRSB 2IYZA 1CB7A 1V8ZA 3X0DA 3GV0A 1K4KA 3VOSA 5AW8A 2D7DA 2Y0CA 1K75A 1PG5A 1UPUA 3SR0A 4M9CA 1MJNA 4ZOCA 1CUDA 2EFJA 2GJ8A 2IHBA 2NSDA 1Z0IA 3UCFA 3MXOA 5HQ3B 3E3MA 5GTDA 4QJ4A 5HR5A 1G64A 3SX4A 1YE5A 1BHQ1 1X9IA 4GT1A 5EE9A 5B3KA 2D59A 1NW4A 4G1FA 1ODTC 4U5XA 3C3JA 2BI4A 5EMJA 1T9DA 1NGSA 2BSXA 4L0DA 5DRTA 5EP1A 4ZEXA 2PU7A 5H0IA 1UQTA 2ZRDA 1PBTA 3M0EA 1Z63A 1E7MA 2QTHA 3DDHA 2QJOA 3QPDA 4BX2A 5IHPA 3C39A 3AYZB 1RJ9B 2G28A 4BNZA 7ABPA 3T9EA 1RQNA 4P6VF 3CNNA 1UMDB 2BFEA 3QF4A 2WF6A 3TO5A 3FTQA 3ZU2A 4BC0A 5JPDA 4O2LA 2ZULA 5DTQA 1JR3A 2C5LA 1VSVA 2C04A 2JJYA 3ZHBA 1UXJA 2ZJ1A 4GYWA 1XV5A 4WSOA 4PF1A 3WYNA 3NX4A 3AINA 4YDRA 2ZWPA 4ENQA 1OOEA 3SVTA 2ECFA 2F3SA 3CE6A 3F6BX 3IAM6 4PRYA 4RTJA 2G9VA 3QW2A 5FPSA 1WP9A 3E70C 1VIYA 4ZCQA 5LLSA 2FFAA 1EJ6A 1KK1A 2O06A 3UH0A 4ZVOA 1XF1A 1TUGA 5IC4A 1X74A 3VBEA 3A2KA 4WCFC 3IT0A 1T8YA 2REQB 4PLFA 1V16B 4Y3UA 2FN7A 1G5PA 1JA0A 2FFJA 2C1EA 4K7JA 3O84A 4FI3C 5LYJF 1H85A 2SKEA 4K9RA 1HQCA 5F7XA 2PGLA 3EC1A 3DOCA 5FRDA 1W49A 2I6UA 1VTKA 2YMLA 4J0JA 3IDQA 4JIGA 4UEQA 3O4HA 5FORA 1W4LA 4JJ7A 2D5LA 3GN1A 5ISMA 5KKNB 2JHPA 3KE8A 2JZNA 3HJCA 3WICA 1S1MA 1XJQA 1FQKA 3GCGA 3N2GA 3MQFA 4RVUA 1F8GA 2FSVC 4IIVA 5EUBA 1Q1ZA 2G4VA 3A9UA 3JPYA 4YDSA 3HNPA 3WL4A 5CM9C 3P9PA 1QVVA 2VKQA 2IYAA 3PQ2A 1MKYA 2HNKA 1WY5A 2PX0A 3I3OA 2GFIA 1JDVA 3DDOA 2HMVA 3HSKA 4KP7A 4U2CA 4LYDA 1VJTA 3MT0A 2JLBA 2IS4A 4DUPA 3R77A 2D1FA 1K4MA 3C8DA 2AA3A 4U63A 1N34B 4JR2A 2Z2JA 2AUNA 1CJVC 3KQLA 4QOSA 5F3DA 3G7UA 5IDWA 2IBSA 4JXKA 3DEHA 1J70A 2E0IA 1EM6A 4MVJE 1XK6A 5A1TA 2O8NA 3NM5A 5K6RA 3VHLB 2ZGVA 3MBIA 4KYVA 5IM4F 1T2DA 1GNQA 2C0QA 4L5AA 4LW8A 1J23A 5HX7A 1M34B 3QJYA 3QWFA 2I5PO 2VPZA 3M81A 4R5MA 4FFRA 4XUCA 4EPYA 4QATA 3K8YA 4ZT3A 4DM7A 1X1RA 4F96A 2ZSAA 1I6LA 4WN9B 3OLCX 1LUAA 3ZHOA 3I62A 4FXPA 1GZSA 5ECYA 5HE9A 3WB1A 4PLHA 4B3HA 3RYHB 2PQ2A 1O4VA 2OCIA 3PD0A 2YJTD 3WAGA 1KK3A 1JEEA 4YDHB 5HGJA 5H59A 1KETA 4RLQA 3L3BA 1J6UA 4ZEWA 2FR8C 2YHSA 1WEHA 3N0VA 4I3HA 2WSSA 2ZG6A 3U16A 2P65A 4PQFA 3ZKWB 3EE6A 3BJZA 2OGSA 1M75A 4G0WA 1M1YE 4FZRA 2O5EA 3K73O 5KVCA 5CT5A 5A0VA 3QW4B 5T4FA 2C9BA 1IJBA 1C30A 1CJKC 1SVSA 1XB2A 4ZOBA 2SCUA 1AS0A 2GA9A 2C97A 2YIMA 1KWKA 1L7VC 3DAFA 3X44A 2GK4A 1KAEA 1CZNA 1O94A 4S35A 5B3JA 1EVLA 5EC8A 1WMSA 1YA8A 3FMFA 5IAEA 4BWGA 3G0GA 4N76A 1MPXA 1RWQA 1R1DA 2WILA 2R6ZA 3LU1A 3PHJA 5CCDA 2NU8B 1LGYA 4ZZIA 4FLMA 1U7OA 1TIBA 1SHKA 4PLZA 4XQGA 3CCCA 1N3BA 4LWZA 4K2HA 4BMCA 1QOZA 4DBLC 3GLRA 3S1AA 4BBPA 2V74B 4QLOA 1J21A 4R9RA 2VTVA 1QG6A 3WLEA 4GX1A 4MP6A 1BU8A 3D1VA 4RPGA 3W8EA 4U02A 4CNBA 1ZCJA 4DDUA 3I83A 4YRDA 3FZNA 1RXCA 4TKUA 1SC9A 2CFCA 1KQPA 4FFNA 4GUDA 4PX9A 2VIIA 4PSKA 5CB4B 4IIJB 3WDKA 4RGVA 3CINA 3ZI7A 1O08A 2QX9A 2B9VA 2Y99A 4ROTA 4RS4A 3RPEA 3A8TA 3WJAA 1KS9A 2H4FA 2F55A 1X8XA 2OXFA 4WEQA 4X9XA 2QZ9A 1ECGA 3JASA 5CJJA 3UJ3X 421PA 3ETJA 4ARZA 1S2GA 3HA5A 4IMRA 6GPBA 3U0BA 4GPTA 2A9RA 4BUJA 1QTNA 1JSCA 1FDUA 1X42A 2DCMA 1K7SN 4FYMA 4GI3A 5AHOA 4B4DA 1BH2A 1WXIA 3R23A 4TUYB 2DQZA 4ER3A 2ORVA 4G8DA 1ZWKA 1QH8A 1AG9A 2QLMA 4DT1B 1A7JA 3IR7A 3ZWWA 1JEOA 2DFVA 5CNKA 3C7KA 3JVDA 5H80A 3NP9A 4H3HB 3SFZA 4A0QA 5BSKA 2PH7A 4EGSA 4ZHQF 2MSWA 2IEYA 1CEYA 4BFXA 2WRZA 3BRCA 1YB6A 3DDNA 1M1UA 3EVZA 3QFHA 5C34B 2Q3EA 2IX9A 2ZI7A 1KC3A 2J6CA 3MUEA 3LMKA 4NZMA 4KITB 4NENA 1YZ3A 1OHHD 1BFUA 4X1IB 3I9V1 4FUQA 4G4JA 1QKIA 2QMQA 2O5CA 3E0XA 3DL7A 4LRXA 3KDAA 4LYEA 4MQBA 2AN3A 1ZICA 3DVQX 3OKPA 4FW9A 5AI8A 3MT9A 4OQNA 1ADYA 3T7TA 1JJAA 1L4MA 1BEEA 1EFRD 1Q7CA 5JUWA 1ECJA 1QWSA 3HS3A 1U0RA 2FPSA 3MWEA 1Q0RA 1XFAA 2B4AA 4Q7MB 3HKEB 3A6ZA 2NN3C 1EP9A 3DTNA 4FHEA 2XWSA 4Z3OA 3SKVA 3NBFA 3R0JA 4ZTUB 1DBWA 2ZRBA 2FZGA 4G09A 1KY5A 4WK0B 2WQ6A 3GCZA 1B3BA 2QGZA 1D6MA 1ZVMA 2XUKA 2CT8A 5ALMA 4DY4A 4RH0A 4CQMA 4UREA 3WBJA 4IY1A 1E69A 4Q4AB 4AZTA 4AXBA 3U4MA 4MB0A 3PXGA 2FPGA 3TJRA 4BL5A 3WLQA 5EJ5A 2GK6A 4PYOA 3WS7A 3B1YA 1LPMA 2QNIA 4ETMA 5A2GA 4TZ6A 1MIHA 4HDSB 3RNOA 2ID4A 3UUWA 3N8IA 3EIWA 4R68A 2XF2A 3AJEA 3TW8B 4OX9B 1Z3IX 4JMLA 2HC9A 1FTQA 4A26A 2VWPA 4BB5A 4EP1A 4X62B 3ZG6A 4ZV4A 4W5WA 4BO2A 3SZ3A 5MN4A 1OYVA 3RB8A 1WTAA 2X19A 4LBZA 4XEUA 4FYYA 4UM9D 2IS2A 2Q2QA 4B3IA 1JDZA 2RGEA 1ODFA 1RAHA 2QD3A 3VNUA 4XQ9A 2VF7A 2O2IA 3DZDA 4BFCA 4DJAA 1D2EA 3ZWQA 3VR1A 3NRJA 5F23A 3GRPA 1PT9A 2VRCD 4B31A 3L02A 4MH0R 3WHPA 2CNNA 2W2XA 5EE0A 5BXYA 3HXQA 4ZK2A 5D3KA 4J7UA 3TDKA 5DT2A 3MJHA 5IUJC 1Z74A 2G40A 2YN2A 3EZ9A 5G1PA 5HUHA 5JBIA 1CHNA 5CUQA 1EVJA 1N8SA 1WKCA 5JG7A 1M1NA 4MWOA 4UVDA 1C1DB 2XT9A 5IASA 1FBTA 3A25A 4ND3A 4C7KA 1ZJZA 4D02A 5KYKA 5SZJA 1A9OA 1CSEE 1SQSA 1F6DA 1QYVA 3IQZA 4BP3A 3OO0A 2Q5FA 1L0BA 3ZJVA 1T4CA 5DSTA 3WDSA 1YJ8A 3GX1A 5D5HA 2HRZA 5KMGB 3BGWA 3DLHA 2XZPA 1RHRA 5E3JA 4AKEA 4EI7A 2PGXA 2G83A 1MNQA 2V03A 4QEZA 2WZQA 1KQ3A 1SCAA 2WHYA 4REMA 5EG5A 2QMHA 2RHDA 4P0TA 1DIHA 1LW6E 5HK8A 3B1JA 1OB2A 4YRNA 3P9IA 5LCXA 1HQYE 1LLUA 1T36A 1XTIA 4FSXA 4L3OA 1SUCA 4JXJA 4TSFA 3KKKA 4K3VA 3JSXA 4H3KB 2BMJA 1DKMA 5F2KA 1FYFA 4M9SA 2AZXA 1OXUA 2PHZA 4HZGA 1OBVA 3ZNNA 3NYQA 1NYTA 4WOCA 2FUNB 3OLWA 3DAYA 4CLDA 4R9SA 1DT5A 3GJZA 4H7DA 4IGKA 1V43A 4PFQA 5M34A 3AHIA 3BMOB 4MEJA 4O4JB 1TM5E 5DHAA 1WXWA 1BFDA 1E9DA 3EMBA 3B8EA 3BILA 4LXUA 5F3RA 1R4NB 3K2IA 3WFJA 1BMFA 1G8HA 2A58A 4IJVA 3TR5A 5A3JA 2WFZA 5FAKA 1P6QA 2BFAA 4MINA 2QQ0A 3GT4A 1K8YB 1RQ7A 3COZA 1XD2A 3KLOA 3GO4A 5C18A 3UMBA 4IKEA 3WBFA 4J0IA 5FYQA 2AYYA 1G21B 1R9NA 1ZOLA 2CD7A 3IMFA 4OMFG 4D44A 2P7HA 2XUFA 3RFTA 3FNFA 5ULLA 3KB6A 1QH9A 1M83A 3D3JA 2Q5QA 5DIZA 5BURA 1D1TA 4PGHA 4PO1A 3QPCA 3I0NA 4RNDB 4YP9A 2VATA 1FUYB 1Z88A 4IIDA 3R5KA 4MPDA 1X1QA 4YAUA 4HAZA 4QT0A 4OHKA 4DV1B 1EDDA 3SFVA 4ZVVA 4Z7NB 4UASA 3TCNA 4BYMA 1PQYA 4XJTA 1EDZA 1G4AE 3FY4A 2G9QA 3CLRC 3FSGA 3IQEA 5AVWA 1CJMA 2QQ5A 5A4IS 3PLNA 3KC2A 2Q0SA 2GWHA 3ETHA 1RKVA 5CDSA 2QN2A 4QUEA 1O03A 1JHQA 1WMDA 3Q10A 5AUQA 5LUBA 3V3TA 4ALMA 5A5FA 5C51B 1KAMA 4IVRA 5LB4A 3ZXSA 1MH1A 4D9MA 5KJ6A 3PNSA 3QYAA 4B3JA 3PPXA 4DC0A 1GKIA 3NOVA 4M89A 4JVSB 2J5XA 3PYXA 4K9NA 5B58C 3OPYA 2QV0A 2VJNA 3F8TA 4WLEA 3RBVA 4MZDA 3FWNA 1ANKA 3AYXB 2B8TA 5KDLA 5EJMA 2BFDA 3QKSA 3TFQA 1FU4A 4KN8A 3FROA 3Q2KA 3F49S 4DLRA 5JCZA 5KOJA 4E13A 1GGNA 1XLWA 3QG1A 4R2IA 4AFNA 1Q57A 1TI7A 2QJTA 3PGXA 3PHBE 3HV0A 4AT1A 3ND5A 4X1YB 5KQMA 5MGNA 3WNZA 3O8CA 3AHGA 1MNAA 2B99A 4KXYA 4OP3A 4BFUA 3I8XA 3BQMB 4FQ7A 1BA3A 1T34A 5LP6F 1PJCA 5INTA 3X1KA 3D3EA 1Z6ZA 3KWLA 4WT7A 3NWJA 3MGGA 3WYEA 4MI9A 3K9QO 3NBMA 4A2CA 1C50A 1GN9A 1UFKA 3TSWA 1H5UA 1E6LA 4ENWA 4B46A 4ZVPA 4F46A 3GI1A 4LWQA 3EWIA 2YXDA 1EAYA 3BFKA 4BO5A 2W2VA 1TKRA 4G5GA 2ECKA 4KPFC 2V5AA 2XYRA 3RAJA 3V97A 2G0NA 1R6AA 1IJEA 2PWZA 4MWSA 3WNVA 1QFMA 2N9UA 5DYNA 3FTEA 5FNZA 2I03A 4NOMA 2AXNA 3ICWA 3UG6A 1A50B 5KKAA 1QQ5A 1CEXA 4LE1A 4YRTA 1EB9A 3M5CA 1SKBA 3UYLA 4KVAA 3WMEA 3TAXA 4B7ZA 2EGUA 2PANA 3ADOA 3F8SA 1V25A 4YBZA 1FOEB 4B84A 4FS8A 2JHCA 4NQZA 3NW9A 1J1ZA 3D6MA 4M8IA 2KYRA 5I6DA 1GADO 2Z4SA 2OCLA 4Q3NA 1G5RA 2QRUA 2C4NA 3PPIA 4WCVA 2R9VA 4WUVA 2VBIA 3PUJA 3N58A 5AICA 3RYFB 3R7DA 4HMOA 1E2LA 1CUGA 3QWBA 1KAHA 4EO7A 1LH0A 2FSUA 4Q3AA 3MWGA 3HZZA 1B3RA 4OYLA 2PYDA 3OQJA 5KNCA 3MJSA 1VHTA 3Q41A 1II0A 3QVUA 2XSZA 1UMBB 3Q5GA 4ANFA 4WERA 1GGFA 3LUDA 4EJSA 2FG7C 4DRXB 3AR5A 4XSGA 3UJBA 2AE1A 1JIQA 1KYTA 3LY5A 2IXFA 3G88A 3WI7A 4BCBA 2W6NA 4HV4A 1D4AA 2X7HA 2X8BA 4OCZA 3NHAA 1OYYA 2PAFA 1H9BA 3R24A 3R6GA 4AF6A 3GLIE 1PX0A 3I1JA 4AUKA 2E87A 3L0OA 5ALZA 3E48A 4ZT6A 3BL6A 3CGGA 3FVVA 2GCPA 4I9UA 2NYAA 1GDHA 2VFAA 3K2BA 1D4FA 5AHKA 3JXEA 2AG5A 1DWUA 4RM2A 2WJWA 1PUJA 1KA9H 3GL9A 4MMZB 4RHCA 6YASA 3MGKA 1MJ5A 2JLYA 2VHZA 2YDYA 1SBYA 4JD5A 1S2MA 2EJBA 4AX8A 5JFGA 2HMTA 4HNGA 3SM3A 2ODBA 2YFYA 3CEMA 2FGKA 2D62A 1J0BA 1X8KA 4F3CA 1FTGA 1U1IA 2H06A 2RHCA 1R5OA 1F8FA 4L75A 3M4NA 2LIVA 1XZAA 2YMQA 2I29A 3LQYA 4D7AA 2MJLA 2IEBA 1UMCA 3S2ZA 2J5RA 3KBBA 2WAMA 3VTKA 3GC6A 3EWSA 1Z33A 5FNVB 2FFBA 3HVRA 5BNZA 4ZOLF 3L7DA 5AW5A 3ZWAA 3CW8X 2PYZA 3JTMA 3I2IA 3A4MA 5BYBA 4L4XA 2R8XA 1JAXA 2FWBA 1F4VA 1L8QA 4HZIA 4N5HX 1R5NA 4XUEA 4C0KA 4C4ZA 4W9NC 4QKQA 5M29A 1NBME 2ADMA 2RGBA 3CBGA 3E7WA 3TPCA 2XCQA 1FYXA 4F6LA 1SG6A 1WXFA 3BCHA 1GYPA 3PXDA 4O0MA 2BBTA 3EXG2 4GMXA 4QGAA 4R54A 1MB2A 3WB2A 1TK9A 4NSNA 1XTZA 2H8KA 1NUSA 1T6XA 2VRBA 4QGBA 1DAGA 2QUKA 2QX6A 5FOTA 1CXZA 3A6FA 3MYRA 3ZQ4A 4AUMA 2B0CA 1F17A 3BJMA 3KPYA 4JLBA 2AKEA 3NR2A 3FBWA 1YQ9A 4YJFA 4JAVC 1JSXA 4F5EA 2K4MA 1YI1A 1A0OA 3GFBA 3GD5A 5EUMA 2PLAA 1BE8A 4CHTA 1NLFA 3JWHA 3T6KA 2PX6A 4WMLA 5JV5A 3PX7A 5J4LA 4HPXB 4WGFA 3N3BC 1K88A 2Q7DA 2HSJA 2HDHA 2W8BB 2F59A 4NG4A 5SYNA 2CD9A 1V11B 4KQ9A 3PUYA 3ZN2A 2WM2A 4NDZA 3RJ9A 3TLMA 4GS5A 1XF9A 2BFCB 4LTNA 1KIAA 5G1NA 1UIMA 2QE7A 3UV7A 1DFGA 3BDVA 3PPYA 5DM1A 3KU4A 3VYTB 4EUKA 5BWOA 5TT1A 4NV0A 3CVWA 3IHKA 5ICEA 3HJTA 1XRJA 4AF7A 2XCIA 3ESZA 1R9MA 3U3MA 4NL4H 2GUWA 5EWLB 1A95A 3NO4A 1UMKA 2VJAA 1QQ7A 5JNRA 5A6SA 1R6TA 1MP0A 1TVCA 4GOND 1SXJE 2J8ZA 4NFHA 3U2QA 1JLMA 1TL7C 4FR5A 2QRQA 4IDQA 4MCIA 4UHEA 4XCQA 4WNAB 2V59A 1ACLA 1IXRC 3W8RA 1P2UA 1ST2A 1VKRA 1OIVA 4KV7A 3TTVA 1EHYA 3U60B 2B4RO 2VTKA 3H4TA 3ZIUA 1N6IA 5B1EA 3BDIA 4G89A 2FLWA 4RHYA 3HWRA 1T0IA 1RAFA 3C7AA 4MUKA 4P83A 5B3JC 5CNJA 4Z4FA 2NTVA 4X93A 1GPH1 1ZGAA 1P62B 4CN8A 4RKYA 1NQOA 1BVRA 4GSLA 3UXEA 3CKMA 4E94A 3BB4A 1NJGA 1D2NA 1QRTA 2O8DA 2BGJA 3IDOA 5BY2A 3T9AA 4MTLA 4M8KA 3THXA 1JDNA 2JAHA 4O2AF 1D5WA 2B83A 3HCNA 1FEZA 4B3BA 4KDCA 1II8A 2CDCA 4IVNA 5LBUA 3ILSA 4JLUA 1TYAE 1UEJA 1W94A 4MPRA 1FP2A 3H65A 3B3QA 1YIOA 4OMCA 1QG4A 3TLBA 1UWKA 4CETA 1PF7E 2C2YA 3BSYA 3JZIA 2WIGA 3SE0A 4RANA 1O6FA 1XP5A 2WJJA 2P2DA 3QFRA 3R41A 1PLKA 4IJMA 2WF7A 4RVFA 2C31A 4UCXA 3TG8A 4X65B 4I4IA 2HQOA 3KJQA 3EGWA 3F7MA 4WJKB 4LXIA 1JEJA 4D5GA 5LVAA 3QVMA 2VUHB 4OQEA 4NC9A 2EV9A 5HF5A 4MITA 4NJMA 4KAFA 3A0RB 4H6XA 5D7BA 5EA2A 5JOQA 4KREA 4YP6A 3D0RA 2IYNA 5JJBA 2HF7A 3D6NB 3LL4A 1VMAA 2J6IA 1YOVB 4L4YA 4MARA 4RF2A 3II6X 1E0AA 3AR2A 4GF5A 3R40A 2PYIA 4M53A 3ES9A 4W7SA 3TQHA 3PU6A 3DR3A 5BV1A 3VU1A 2WJYA 1DT3A 5LSAA 5A4KA 3CNLA 1PW7A 2ISQA 3LS2A 4GXQA 1Z6TA 1M8KA 1EM8A 1PZFA 2IDJA 3NC1C 3HBLA 3KOXA 2GRAA 5FFNA 4JUAA 2GFHA 4YJGB 2OCAA 1FRFS 1QPGA 3FPFA 4TYPA 1JHUA 4MNTA 4C05A 3BFXA 3PQ6A 4OAQA 2HA5A 2MDTA 3HWWA 3EAGA 2PWPA 2R8BA 1GL6A 2Q2OA 5TPWA 5KX5F 2YZ2A 4AQYB 2GARA 1K8XB 2FAXA 1KP2A 4KV9A 1IQRA 1T3LA 3W2GA 2YYZA 1CLEA 3SYNA 4HDCA 4MYTA 4EHKA 1BVHA 1I9GA 1PWEA 2YXPX 1E6EA 2ZRKA 3SQNA 3TQTA 5JC8A 3BIJA 3NMUF 3RTBA 1US8A 5I9NA 2NUPB 1ZRSA 4YMIA 3M2TA 1U8XX 1XXHE 1UBKS 3B5IA 3OJWA 4I8DA 4L8GA 1Y7LA 4LSZA 4XWTA 4YXFA 3EUFA 4NBUA 3VDQA 4UZSA 2QNRA 3LI2A 4GZ3A 1KPIA 2AH5A 2ZKLA 3OCJA 3A6PC 1J0CA 2GEKA 4GZ5A 4IUCS 3TB6A 1C7ZA 4FYPA 4JN6B 3C74A 1DBIA 4YYZA 1L6IA 2C03A 3PKIA 2P9EA 1T25A 4IGFA 2BL4A 3MJTA 3WLAA 2WF5A 1QNFA 1R7RA 3DHYA 5E6RA 2D2IA 5TXGA 1P4JA 4BFWA 2XXBA 1VE6A 2H59A 3LW7A 1CIVA 3U5ZB 2IVZA 3FZEA 2PNFA 2Y05A 5JSKA 4ZYTA 3KJXA 4FHZA 4OQXA 1YMUA 3BRWD 3QHQA 1KMCA 3IXQA 4XGIA 4N9WA 3B38A 3AP1A 2XUOA 3B6IA 5ILOA 4LJRA 2IOFA 3AW8A 1JJ7A 2PGDA 4JQYA 4BLPA 4C20A 2WFAA 2GA8A 3IOYA 5JZVA 1NE2A 4EYOA 4KE6A 2WYUA 1HFWA 3AL3A 3E3OA 1MRSA 1ZL2A 1NYLA 1B6RA 3KTDA 3M5DA 3N2EA 4D3FA 2AFVA 3SHQA 5KHOC 2HF9A 5KVQA 4DR4B 2NSYA 2AJLI 3R9KA 2Y6UA 2DPMA 4G5SA 4KRXA 5JJ5A 3UT6A 4QYTA 1NW3A 1Q16A 4CMBA 3OP1A 2IPNA 5JRJA 3ICCA 3BHMA 2OQIA 5BW6B 1VYVA 3OEEA 1N2EA 3LX4A 4L85A 1LTKA 1UP4A 3T7AA 5BOVA 5BR8B 3GCDA 1U6IA 1Z8HA 1B1AA 3TCXB 3ODPA 2JW5A 3FCXA 4B6OA 1YUMA 2WJGA 3RSHA 1YS4A 3RSOA 1QQBA 4K1LA 3ENZA 3H4IA 3K1JA 4Q9AA 4XVCA 2I76A 2V5VA 3GA0A 3KYCB 3M6IA 4RZHA 2F8MA 4U3JA 7MHTA 2V55B 3F96A 3L93A 2X58A 3IAM1 1B74A 4I55B 3OPVA 3U4CA 1RP7A 2ZBPA 5JADA 2VP4A 2YWFA 5HKAA 3O4GA 4XWYA 1C9JA 5CLIA 3GJ3A 3LG2A 3IT1A 4PE5B 1W75A 2I2BA 3R0ZA 3ZS8A 5EXEA 4R1MA 2VTBB 1W47A 2CGEA 3HXKA 3RS3A 4Z0NA 2YV4A 2GPYA 4E5DA 3ORHA 1KVUA 4IGIA 5I5GA 3A9WA 2E4VA 2V7EA 2D1QA 1GL3A 3CN9A 3ZWVA 1JF8A 3GUCA 2P8SA 4FILA 4K6HA 3SOZA 2FPPA 3UGQA 4MI3A 2YV1A 1VI5A 2EKPA 4G4GA 3QU7A 1HFEL 2Q1SA 3KALA 2IXEA 3F6EX 4MQEB 2PMEA 2FF5A 4HEA6 3DMPA 4MR9A 3EXIB 1CPYA 1SUWA 1AGPA 3CZQA 3LVBA 1KDTA 3K0CA 3KR0A 4JNKA 1RSZA 3TIFA 4C88A 1QPZA 3CB4A 2FSGA 3BPSA 2V5UA 1AA6A 3PGJA 1JIIA 4GPEA 2GYYA 2OKCA 2WR8A 3OKCA 3PUZA 3ZGNA 1SQFA 2DF8A 1GR1A 1QPBA 4I1PA 2A59A 1QH1A 4UBNA 3UGJA 1ZFNA 3UM9A 2XZDA 1WMFA 4HGPA 1ZJ4A 4F4FA 5KTMA 2PJRA 2VRWA 2DQSA 4TL7A 5C2JB 4RULA 1KHTA 4YCLA 4PFKA 4FBGA 4AB1A 4GU5A 4CGYA 3KWJA 4BVJA 1P1CA 4HDOB 4PNEA 1LW7A 3F6CA 2GVNA 4IDEA 4Z9YA 4LQCA 3GFGA 3ON5A 2XMBA 5DDIP 3X2SA 3IP7A 3OFVA 2JIZA 3CZ9A 3LW8A 5U4QA 4CDMA 5ALFA 4EA9A 3C5CA 3DTVA 3REQA 3AZOA 4CDGA 1G18A 2F3UA 4P92A 3UATA 4ABYA 3U3DA 4KVZA 2PH1A 1X9GA 2A8YA 2GBLC 1TXGA 4K86A 4IOMA 2BM1A 2GEDA 2R2GA 2X0NA 5DK4A 5U4XA 2WWVD 3MOGA 3TNDA 3W7VA 3FOEC 2Y1LA 2YJ4A 1JLLA 1T2NA 3QITA 2EFCB 4I46A 4EWLA 1UBUS 3FOWA 1SCUB 5ERXA 1E4OA 3EW7A 3GLVA 1LLDA 1NBWB 3M1LA 3OCYA 4ZVNA 4DSZA 5HQTA 2FQXA 2FYTA 2E6KA 2IC5A 5DM4A 1DAFA 2B82A 2OVFA 3L79A 3EASA 2RB4A 1RHUA 4QYIB 4YCNA 3VHXB 3HVKA 3HJNA 1PNQA 3QXCA 3PIDA 1HL3A 3DOIA 3FG9A 3GLHA 3K4HA 3PWZA 1RWMA 4YACA 3TLCA 3ZDFA 5H16A 3PCXA 4U5QA 1IG3A 4PS1A 3C3CA 1SC4A 1VKHA 2MR5A 2HEGA 1YRQA 2AFIE 1NMQA 2GF9A 2O54A 1UJNA 3DE7X 3T95A 1QF9A 5TS2A 1Q7TA 2YV2A 3KJZA 4RZXA 4DPMA 4A0FA 3QOFA 4EMSA 5CA0B 4XA8A 4P4UA 2AOTB 5EJIA 1MX1A 2N46A 3BTSA 3DAOA 3MIZA 4LMBA 2WA2A 4CV2A 2FJUA 4OUDB 2UZ3A 3USZA 5DNDA 1RYFA 2BYTA 3GJXC 3VH4A 3HO1A 2XYVA 1E3TA 2CNOA 3PENA 4QM6A 4NDNE 1QK5A 3CJTA 1PWXA 2BKAA 3N0RA 3GGGA 2VNKA 2ZUCA 4P5EA 2HZBA 3OZEA 3OZFA 4RVSA 4EH1A 1SURA 5BR7A 3VDNB 1ZK2A 3K6KA 1JDTA 5DHSA 4D8YA 5KBYA 3QE0A 1P77A 3IHTA 5FULA 4MDEA 4DV3B 2J3JA 5BW5A 3KQSA 3CEJA 5JIBA 3RF7A 1AUXA 1CYEA 5CA1A 3HDQA 1XZPA 3KG2A 4LJAA 5AOVA 2WVAA 1BXRB 1AHPA 2G6BA 2NAFA 4AMVA 1IBKB 4CBVA 2C9DA 1I1QB 1UDBA 4IMIB 3T0IA 2PD4A 5AW6A 2NLOA 5B1SA 3IHLA 4DRZA 1QAOA 2YWDA 2OOKA 3ZQ6A 2C9CA 1X1DA 2ACKA 2C2BA 4D9IA 1T1SA 1THGA 2O1SA 1O57A 2H17A 5C4IA 5GMOA 4B6PA 4X63A 4FDTA 1UT6A 3HZHA 1XPRA 4H6PA 4UTPA 1TZBA 4OI1A 5DCUA 4Y9RA 3A7EA 2FP4B 3FM9A 3P9NA 3WMRA 1J20A 3LTEA 2NU7A 3RHTA 4F38A 2ZXFA 1EJ0A 1SUDA 4I66A 3NIFB 3N2KA 4HDRA 4MA0A 1YJAA 3PI6A 5JROA 3ZTYA 2QP9X 2W48A 2QE6A 4H17A 1QRAA 5LQSA 5F7ZA 1CNEA 2PS1A 3HTXA 1ZH8A 1W6UA 1EGHA 1V2HE 1DC3A 5F51A 1QGED 221PA 7REQB 1T5HX 3I6YA 3AQIA 3V5NA 1W5AA 1SZJG 3K30A 1TW2A 1TJNA 4JQCA 5ITZB 1YU9A 5JY6A 1AUPA 1XL0A 4JP5A 4YROA 5AD1A 1NXWA 4UUMA 2QUAA 2Y4NA 3NOXA 3VKHA 4ZRNA 3KXPA 2Y1EA 4PEVA 1YDWA 7AT1A 3C1AA 5L45A 3NKVA 3QEMB 4R2WA 2B8WA 1R27A 1GAWA 2WAAA 3L7CA 3VU9A 4B73A 4EI8A 1VL1A 3R3HA 3W1WA 2J09A 4MCHA 5C0OE 2PJDA 3KLPX 2I78A 4GSKA 4HL6A 4EA8A 2H9IA 3P2IA 2CJXA 1LSSA 4RQBA 4ZQHA 1JKJA 3V6MA 1JA1A 2DLNA 4MAMA 3HDJA 1C3EA 4XWGA 3D43A 2CVHA 3UJHA 1K3TA 1WNFA 4UE6A 3M3PA 3UXYA 2V0GA 2G1AA 1XZKA 2Z9DA 4FC6A 2TMGA 4GX5A 3IV7A 4OD0A 5B2FA 4PYIA 1SCJA 1YZFA 2ZT7A 5AT1A 3ERCA 5AVVA 2H5IA 2HO5A 3K6SB 3F5SA 2FWIA 3MAAC 2VEOA 1BWSA 2XEXA 3VM6A 1JW9B 5LA6F 1R12A 1YR2A 3SDZA 2HJSA 3NTLA 3RSQA 1I2MA 3A05A 2XF8A 2UYYA 4C0BA 3D6TB 2J30A 1KI6A 3STXA 1E5XA 2DWOA 1EGAA 4YONB 2Q3HA 1O5OA 2PBLA 3T7IA 3ZWOA 4XOIA 3R3VA 2HL6A 2QTGA 2K87A 4L8WB 4IRXA 4O25A 3RLFA 1EH5A 3OJFA 4DMGA 4LDZA 3ZY3A 1RIFA 4BKPA 2Q4TA 4DLTA 4Z4EA 4DA8A 1SEPA 4KMRA 2BEVA 3T1OA 3RVBA 4BJ6A 4YPVA 3NV7A 1AZLA 4LQLA 5F1OA 3T8YA 3P2YA 2CLDX 1A1SA 1UDRA 2Z08A 2I3BA 2J0QA 1BX0A 3ACCA 4EJFA 2AGVA 1M73E 1ZU5A 1NF8A 3FZQA 4HAVA 3RVRA 1JDBC 1YQQA 3P27A 2XLBA 2WTNA 2PO5A 4FGLA 4LCEA 5AM5A 1OXTA 5PGMA 2E4XA 4ZDIA 2WU8A 4UBLA 4EB8A 4G84A 3VYRB 5AM3A 4UVEA 2VT6A 3EA5A 5B7PA 1SY7A 3ONWA 2JRLA 4L08A 1FDRA 3PHLA 2PXHA 1GUDA 1XMJA 1VRCA 3LH5A 2J4DA 4W4TA 5CT4A 1QUEA 2KHZA 3P2MA 3VSEA 1CUHA 4W5QA 1DIOB 5IM4A 1TKAA 4QFCA 2XYHA 2EDAA 2C42A 2JI7A 4RZ3A 3SQOA 1T8UA 3ZHSA 4Z5XA 5ADVA 1C9KA 1PJAA 2Q5IA 4R8MA 2RAVA 2G9RA 4W7HA 1K2VN 2BTQA 1RYHA 3QI7A 5GM1A 2Q0QA 3MTEA 1WHTB 3RVLA 3ZHRA 1DFIA 2QN8A 2QZZA 4B3SB 1BA2A 1WBJB 1EA5A 1WMBA 4WNYA 2H1RA 3EH2A 4Z9XA 5ECGC 2WKWA 4E1VA 2PV7A 4OXXA 3I4FA 1B0UA 1APBA 1Z4LA 3I01M 4ZRMA 3KQWA 2JJ2D 4EVSA 1WCV1 2WKPA 3DZIA 2CB0A 3BMXA 3PWTA 1VIVA 3U9LA 1X7YB 5H82A 1NMYA 1N5MA 1Y34E 2BEWB 4BMXA 2GPWA 3TQQA 3H9CA 2ZJ7A 2ZRNA 1GTZA 4PRZA 1D6SA 4KWCA 1F9EA 5FL7A 2ZE6A 4CCYA 3CO0S 1EFTA 1PD1A 1VOTA 5GJWC 3N8HA 2ZDGA 3K9NA 4WLVA 3P2KA 4BZQA 5DHPA 5TY0A 3CJRA 1NR5A 2QTWB 1YH3A 3SS7X 1PV1A 4B43A 5IARA 1GUZA 2D1TA 4FD2A 1RJFA 1VIMA 2I8LA 3ER8A 4CDNA 4M7PA 4URWR 1EDBA 2PH5A 1IUPA 4RA9B 2OBMA 4CYMA 1YBAA 1KFEB 1PD0A 1NKTA 3M3DA 4JR0A 1YQDA 1W4BA 1C0KA 2RKBA 4E5SA 1B6TA 3DWEX 1STOA 4W63A 4D9EA 1UJBA 4KRGA 1ZINA 2XNJA 3I6MA 4QGGA 4S1TA 4AMGA 1LPSA 2R8YA 4FEAA 5BPHA 1R0ZA 5KYNA 4GICA 5J59A 1VG9B 4EKDA 5A9SB 3B89A 3O8QB 2XUGA 4GMGA 4Z49A 4BQSA 2PKEA 2G36A 4Z7QB 5K8LA 3H13A 2Q4OA 1EPUA 1EVQA 4DIBA 4CTJA 1IRIA 3D2LA 4QREA 3WWZA 4BOYA 4KGZA 5DHTA 4LF4B 5LBTA 3KTOA 1VIDA 1RPNA 3B2NA 3AP3A 3KAKA 3QFFA 4DCTA 3CLTD 1PEAA 4LJ4A 2P4SA 3RTCA 3URKA 1M6NA 2FUCA 3OIUA 1M2EA 4AX4A 3IP9A 2O19A 1CDZA 2R1UA 3ICVA 1QRRA 2C54A 1OPXA 3QFTA 2VNIA 1DQPA 4PX3A 1UEXC 1H5NA 2JGMA 3SYMA 1WSAA 4BFSA 1EJBA 3CYFA 4EY7A 4PRKA 3IEPA 3KFVA 1BXGA 2VDWB 3JR7A 1TJ4A 4MRAA 5DNUA 5K8IA 2LPMA 4F56A 4O1IA 5IH7A 2DTEA 2X76A 4PBTA 1MA0A 3RR2A 3UICA 2HSDA 4UUQA 4FCTA 5IANA 3A3PA 3FUTA 3KYJB 3W0LB 1TO2E 5GJBA 2RHBA 1W73A 5BSWA 4DXDA 1NZFA 4D43A 2OO5C 4F06A 5TJHA 3A6LA 3L07A 2H2FA 2IUEA 2V6GA 2I71A 3VOAA 4FIDA 4UTXA 1V1MB 3PDIA 2C2ZA 4IDNA 5F35A 4Q4HB 4DLPA 5EOVA 4D8WA 1N2BA 2XY4A 1EA7A 3H8SA 3M6FA 2C2MA 1CY2A 1ZKMA 2AI1A 2F90A 1V26A 2REBA 1HYQA 4KO8A 1T5SA 2COKA 1EXVA 4URFA 4E5PA 5E3IA 3WIBA 3SPXA 1U3GA 2WP8J 3DEIA 4W7IA 5KNCH 2R1VA 1AKNA 5HZMA 5LMZA 1EKXA 1GRQA 2IKQA 1DKNA 2G5CA 4GZ6A 2GN2A 2I6FA 3G17A 5JDCA 1C7QA 1JFSA 1G60A 4F21A 2EHJA 4WXHA 5JSUA 3GRAA 3HXLA 4GVPA 4ZREA 3WYDA 1GRCA 2F1OA 4N3NA 4AMZA 5BNWA 4X95A 1L4YA 3VJLA 4RY8A 3S28A 2C92A 2W6IA 3KQOA 3EGDA 4DFDA 2PBZA 3NHSA 4J94A 4GPD1 2NVOA 2WFLA 1RWVA 2I34A 1U0HC 2PPVA 2O0MA 4IOLA 2P79A 3GH3A 3JQ8A 2GKSA 2IL1A 3OOEA 4R2MA 5NLLA 3G89A 4W1PA 4YRFA 1ESNA 2GAJA 3ETCA 4IXNA 1MB9A 3ULKA 3RHFA 1NU8A 4C1NA 1JDSA 4U2GA 3GVXA 4D6XA 3K71B 1U2TA 1S3IA 1DQYA 5F5NA 1QK4A 4WESA 2QLBA 1F0NA 2VAMA 1FMCA 1Q20A 1VL0A 1HNXB 8AT1A 4DGSA 5JVDB 4HSGA 2HLDD 1O97C 4BB9A 3E7XA 3Q6MA 5FADA 1DARA 1UT8A 3T3OA 2L19A 3Q1KA 1JAZA 3HLYA 2IHKA 1ZCBA 2DQ4A 1L7AA 1OA0A 4IRUB 5EPEA 1IATA 1R2QA 3KLNA 2Q21A 1WZIA 5K03A 3LFTA 1RTKA 4LKOA 3N7TA 1NFQA 1ZC3A 4HQNA 4YJ3B 4DA0A 1KMQA 4W5NA 2AZ4A 4J3FA 2XDAA 4BQQA 4ZI7A 3P9KA 4X7RA 3K0CC 4TWIA 4M6WB 4MLDA 3S2YA 3D3WB 3T4UA 4BEVA 2YX1A 4DIDA 3S40A 3CF2A 1PLJA 1G0OA 4B3RB 3H6GA 5F5LA 5L95A 1OKKA 1R6BX 1I13A 1S1CA 4Q9LA 1RD4A 1PR4A 2WWWA 4PYJA 2YTZA 1G291 2RDMA 2GAAA 5ALYA 2G1PA 5KB3A 5J4YA 3NDPA 2VG8A 3PTZA 5IP5A 3TBKA 5I7RA 4LCBA 1T0JB 2YBEA 3VO8A 4AY2A 3QK7A 1HZZA 3R8CA 5EHQA 1ZUD1 5FWAA 2VYQA 2QRVB 2QYOA 2WA1A 3OM9A 3PBKA 4K28A 2NUAB 3DMFA 4BVGA 3TX6A 2PZLA 2EXXA 2V45A 4OHUA 3W3ZB 3EXFA 4OQ4A 2PEZA 2ZBUA 3EF3A 3ENNA 3EWNA 2GZSA 1GCAA 1DXYA 5HKLA 2LXNA 4NJEB 2LCIA 1XT6A 2CLCX 1HEUA 3M3HA 1VLMA 3PD7A 4XXHA 1NOKA 4EMUA 1U2PA 3DDCA 1BJKA 2X0RA 3HYNA 2DY0A 4NV3A 3P71T 1K4YA 4RJ2A 2JLWA 2G3YA 2FRXA 4P1ZA 1SHZA 3DM5A 3G2JA 4Y1GA 2AF4C 3CWCA 1INLA 4BKMA 2EQBA 2FLVA 4XYBA 3U56A 5LKRA 2VT3A 4N7JA 3S1LA 3GN2A 1EQ2A 3X2FA 3OZBA 2RBKA 5EIEA 4KWHA 2ZB2A 4R9VA 1I2ZA 1LNZA 4OYYA 5HKKD 3LX6A 1ORTA 2Q8PA 4RA6A 8ADHA 1F1JA 1Z2NX 3DPIA 3O2QB 3P8ZA 4CKCB 2CFSA 3JATA 1B15A 4JLVA 4DNFA 1HYBA 2PTHA 2PBRA 3GP5A 3JWJA 5KYGA 2OG2A 1SUIA 2ZIWB 3B51X 4QTTB 4Z0PA 1YDMA 1ZR4A 4Q02A 4UNQA 1RADA 1C14A 2GZAA 2O14A 2XB6A 1UFRA 2A30A 4LWPA 5B3AA 2JFUA 1U7UA 4NFSA 2Q3CA 3JQ9C 4FK8A 1X7WB 2D7CA 1ZN9A 5FI5A 1ZVQA 5LXTF 1G3UA 1REQB 2E9SA 4ZWNA 3PCTA 2O8EA 3NXSA 4N65A 5JNUA 3GLGE 3LHSA 2F9MA 5IT4A 3DBRA 4TMFA 1U8ZA 1JXQA 3CF4A 1U1DA 4MROA 3FUVA 4Q9IA 3D6JA 2I54A 3EVTA 5F5XA 2PKQP 3F1KA 3LNTA 4NTZA 1W0JA 1G3IA 3NU1A 1G2IA 3CNQS 4LA4A 4GYJA 5BR1A 1GPJA 1MG0A 1PS8A 2VN8A 5GPBA 1XZDA 4A8JB 1SC3A 5AM2A 3HB1A 4OQDA 4F7WA 4CG3A 2FKNA 2JIRA 1J97A 3W6NA 3N53A 4P7GA 3WYBA 3TQIA 5CBKA 5CDYA 4PY2A 3HR4A 3AG5A 3IIJA 1JLHA 2EW2A 1IDN1 4WFKA 4AL4A 5CYOA 3NKFA 2HB6A 2F4VB 4FB4A 3JWIA 4FJ1A 1V9CA 5KWIA 1OX5A 1T3HA 3L6UA 1VFPA 1PFYA 4EF5A 2V3CC 4E11A 2W0MA 3MWLA 4M21A 2OHGA 3I52A 3LCVB 4O8CA 4WVLA 4CEIB 1Y3CE 4CFYA 1O97D 4K81B 1R6DA 4MVJM 1L7RA 2OFPA 3OZVA 3TXYA 4MV3A 3ML1A 4BVBA 1HMPA 1PL7A 4DBLE 1U3WA 1P8JA 2XMPA 2V7VA 3WGQA 4IQ0A 2Z43A 2HSWA 1PDVA 3UENA 4AXXA 3E4DA 3A4LA 2YWRA 3E4CA 5IVHA 3ROGA 4HVLA 3GT0A 1E89A 1GIAA 3L41A 3CIFA 4EKNB 3ZXXA 2CEAA 2VC2B 2VDOB 4O2BF 4E09A 1X1AA 3WRYA 2C3YA 4ZYWA 3A32A 2UYOA 2P6UA 1KEUA 1E1KA 4U2DA 3G2HA 4Y0NA 2RCNA 3ADBA 4S1WA 4OAOA 4Y18A 3IEUA 3HY6A 5C8VA 2BM0A 4KC0A 3WGHA 3IO3A 3KQMA 3IX7A 4JUCA 4KI0A 4W6QA 2CJWB 4QXRA 3MN1A 2GZ1A 2YIVX 1S3GA 4BATA 1P7VA 1MABA 1XTJA 2X6QA 3DMYA 3ENKA 4ZCLA 5HTOA 4XTCS 3ZI0A 2QD1A 3RC2A 4XLTA 2HHCA 2V6BA 2B21A 3KHTA 4DM3A 3IQXA 1MQSA 3QBTA 5L3SB 4KVFA 3AF1A 5EI5A 2XXAA 1UPAA 2GM3A 4JL6A 1HO3A 1J7KA 3QU9A 4EHDA 3HU2A 5CURA 4RDCA 4BP1A 5MF6A 1C5KA 2Z2KA 4W1QA 2EF1A 5KX5B 1EFUA 1YHNA 1ZJJA 3GD7A 2G76A 3G9QA 4HR7A 4XYLA 4GDFA 4HQKA 5C7OO 1MUUA 2JJ1A 2FU5C 2PV0A 3H1FA 5IFKA 4PYNA 3DV0A 1KDYA 4KODA 5AIBA 4IQ8A 5FUWA 1NP3A 4QBFA 3AR6A 2D2EA 5B2ZA 4G0QA 1MRNA 4UATA 1O5IA 1QV6A 2FOLA 2F3QA 4NCXA 4WKPA 5CR9A 3LK7A 5C1DA 3D6AA 1RWXA 4GR9A 2BJWA 3WGYA 5K0TA 4NY1A 1E2UA 5HF6A 2HA7A 3KZOA 2FY8A 4E6EA 5J4KA 5EPOA 4PAWA 4E2XA 4MV9A 4RDHA 1IY0A 1JIJA 4A5OA 4DRYA 4G8JA 1RJWA 4R1QA 5AVZA 2VA8A 5AQ1A 1UZLA 2NAPA 3OLYA 5IKPA 3WNQA 4B6SA 1P73A 1ZDMA 4J7CA 4BMSA 4EB3A 4CM8B 3TXAA 1J24A 1CR0A 1DC8A 2R5NA 3ZEAA 2R97A 1KH2A 2BMEA 4MW5A 4K5QA 1WW2A 1Y48E 5FA8A 4Q4JB 2WABA 2IP1A 5JWOA 2HYIC 4UHCA 3VSDA 3AERA 4QGHA 1FFAA 3ABOB 3M1IA 4QHTA 4PFJA 4XIYA 1OLUA 3WWPA 1Y9AA 1ZK1A 2GEJA 3H2SA 4RVDA 2FW8A 4MCAA 2NZJA 1N5JA 3FYTA 3I0MA 2L2QA 2O2CA 4LDPA 5B1YA 4OY3A 3C7TA 4JVNA