2DUJA

Crystal structure of the complex formed between proteinase k and a synthetic peptide leu-leu-phe-asn-asp at 1.67 a resolution
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
279
structure length
279
Chain Sequence
AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTDILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the complex of proteinase K with a specific lactoferrin peptide Val-Leu-Leu-His at 1.93 A resolution
rcsb
molecule tags Hydrolase
molecule keywords Proteinase K
total genus 97
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2006-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 2dujA00
3PRKE 3UNXA 1TMGE 3DE7X 4HVLA 4OV6B 5JXHA 2ID8A 2X8JA 1OYOA 1DUIA 3WQBA 1GNVA 2ZWOA 3PTLA 1IAVA 4WOCA 2Z30A 3BGOS 3GCXA 1TM3E 3H42B 1GTG1 2E1PA 3SICE 2ZWPA 2XTJA 4B5LA 1NDQA 3LPDA 1GNSA 1PJ8A 3GCWA 3TI7A 5B1EA 1BE6A 4DZTA 5FBZA 1PTKA 1DBIA 1PFGA 1SUPA 3AJ8A 1SUDA 2Z56A 2QTWB 4KPGA 5AMXA 5ARDA 3F7MA 1Y3DE 4KG7A 5FFNA 1TO2E 2PMWB 2W2OA 3CO0S 4C3UA 2V8BA 1NDUA 2PWBA 1AV7A 3DE5X 3I34X 3I2YX 1PEKE 4HX2A 4LVOA 4CFYA 1SN7A 1OYVA 1YJCA 3DE0X 1T1IA 4AKTA 1Y3CE 2SICE 1GA4A 4J94A 1KDVA 4DWWA 1SCDA 4H6WA 2SECE 3QMPA 3OSZA 3DWEX 1SBHA 1SCJA 3VHQA 4BWGA 1YU6A 2XRMA 2PRKA 2DQKA 3DYBA 2PKCA 4LVNA 1C9MA 1OT5A 1T1EA 1Y3BE 2W2NA 3D9QX 3I37X 3LPCA 5AQEA 4NE9A 2PQ2A 3VV2A 1GTL1 1SBNE 3VV3A 1GCIA 1SPBS 5JXIA 3TI9A 4FONA 1AH2A 1KDZA 3L1KA 4H6VA 5K7SA 1Y4DE 1AQNA 3DVQX 3GT4A 5I9SA 1Q5PA 2IY9A 2PYZA 1TM7E 2WV7A 1WSDA 2Z2YA 1V5IA 3ZXXA 1SCBA 1WMEA 1WMDA 4JP8A 4AKSA 4H6XA 1Y3FE 1Y4AE 4NE7A 1CNMA 1SUBA 2B6NA 1TM1E 1NLUA 3DVRX 4OMCA 1KE1A 2ZRQA 1YJAA 3WIVA 1WMFA 1ST3A 1TO1E 1AU9A 2HD4A 1P7VA 1C9JA 1ST2A 1Y1KE 3D43A 3EIFA 3DE4X 4ZARA 1SCNE 1AVTA 1S02A 1Y48E 1ZVJA 2HPZA 1KDYA 3WHIA 1BE8A 1A2QA 1SVNA 3LPAA 3P5BA 1AF4A 5ARBA 3VTAA 1AK9A 3BX1A 3EE6A 4Z2AA 3DW3X 1TM4E 2DP4E 1SUEA 3CNQS 2Z57A 3VSBA 1Y33E 4RYDA 1BH6A 1C3LA 2WWTA 1VSBA 5AVKA 1Y34E 1TECE 2G4VA 2IXTA 3T41A 3SQOA 5B1DA 1XF1A 3TECE 2Z2XA 2X8JB 3Q40A 3DE3X 4K8RB 3DE1X 3A3OA 3BPSA 3F7OA 1LW6E 1MEEA 1SIUA 1YJBA 1T1GA 1HT3A 5CW1A 4WOBA 4YN3A 3VYVA 5JMOA 4ZOQI 1BFKA 1Y9ZA 4CFZA 1R0RE 1V6CA 1GA1A 3DDZX 1TM5E 1BJRE 5ARCA 1SUCA 1UBNA 1IC6A 1SUAA 1R64A 1SBIA 3A3PA 3DE2X 5AVJA 2DUJA 2ST1A 2Z58A 2GKOA 3A3NA 3AFGA 1SELA 4GI3A 3DE6X 2P4EA 1S2NA 2SNIE 3GT3A 1BFUA 4C3VA 1P8JA 5JXGA 4KB5A 3HJRA 4I0WB 3AJ9A 5FAXA 1GT91 1ZVKA 2ID4A 4M1ZA 4NMXB 1S01A 3LXUX 1SH7A 1SBTA 1SBCA 1KE2A 1SIOA 1EGQA 2WUWE 1SIBE 3I30X 3DVSX 3DW1X 1WVMA 1EA7A 1R6VA 5JXJA 3F49S 3QTLA 1JEAA 3ZXYA 1GA6A 5SICE 1MPTA 2WUVA 1C9NA 2SBTA 2TECE 4OMDA 4MZDA 1TK2A 1CSEE 1P7WA 2PWAA 1SCAA 2W2QA 4CG0A 2W2PA 3WIUA 4DJ5X 1GTJ1 3Q5GA 2W2MA 3QFHA 1THMA 2Z2ZA 3EDYA
chains in the Genus database with same CATH superfamily
4U6SA 4RVNA 4Q1FA 3HCAA 4G67A 1Y6FA 1XB2A 2DH5A 1BOOA 4O29A 5FP0A 4COOA 2QV0A 4Q1AA 1EDEA 1QG4A 3V97A 1RRCA 3H6GA 4R9VA 1FW8A 1G5FA 2D0DA 2ZWPA 1UT8A 4DC1A 1MQAA 2RKWA 4F9FA 3C39A 3HKBA 5LJIA 4Z54A 4ZKDA 2ZLBA 1W0JA 2PT6A 1X86B 1T0UA 1IXRC 1NW4A 2RH5A 3D4LA 4RZHA 1KEUA 3DLIA 2BFAA 2CLDX 4QRDA 1LB1B 1XQYA 1AGXA 1A7AA 1TL7C 1NF2A 3ABOB 3CKLA 4QTUB 1ZCZA 4OQNA 1J8YF 3AVOA 4DB2A 1NI5A 1JTVA 3C5HA 3PC8C 3ZZ0A 1SXJB 5J4HA 1BE0A 2I6SA 2YV5A 3I2HA 4J94A 3ZYCA 5CLFA 1QOZA 2WD9A 2EEZA 3P2JA 4TXHA 5CXXA 1K08A 1T10A 2BHSA 2Z43A 1UOEA 2XDYA 3DV0A 3OQVA 1I9CA 1RHJA 5H5JA 2PA0A 4RJKA 3RC2A 1IVNA 2BP7A 2C9MA 2C82A 2WU4A 2ZRCA 1LQ2A 2FLVA 3A9CA 3BA1A 4F72A 1O9BA 4ZICA 4L7QA 2NT4A 2CSUA 3RABA 2QTVB 4C3ZA 4JOSA 1CZHA 1U98A 2I99A 2NSDA 1BN7A 3DOFA 3FPCA 4HMPA 2IY9A 2RONA 4TTPA 2BYTA 4GM1A 1SCIA 2FV8A 3BXGA 2VT6A 3UT5B 3CUTA 4DMFA 4U7TB 3WYBA 4BTLA 1ZX1A 4XARA 3TSOA 2ZYTX 3DOCA 1QYRA 5BR4A 4PYJA 1F5SA 4G5FA 2RFLA 1L1FA 2H7XA 3PJGA 2NTEA 3KSMA 5E4FA 1EUCA 1PKXA 2EP8A 3W3ZB 3CB4A 3VPBA 3E1SA 3T4EA 2C9YA 2AD5A 5EY5B 4WA8A 3X1MA 2GF0A 3LCRA 5EZ6B 3SD7A 2GO7A 2CY0A 1UXIA 4GWGA 5CX1A 1RWWA 2WG0A 3CNQS 3JU3A 1EFLA 1OGIA 3WBFA 1TTPB 2QW8A 5BN4A 4DV0B 3RF7A 4CM7A 2NX2A 2XEDA 2JFQA 2Y0CA 1VP9A 4HGRA 4RMJA 5DIZA 2Z2XA 1MOZA 2BMJA 4WA7A 4AX8A 3OJEA 5AVYA 3BHMA 2O07A 4TZKA 5K0NA 3U62A 4C01A 5A1JA 1RWKA 1QGZA 1UODA 3H8JA 3WZ2A 3WVNA 1BFKA 1OFUX 3SOZA 4TYWA 4AI6A 1VHLA 3DDZX 3QVLA 4FW8A 3TQQA 4ZAFA 4KAFA 3L7MA 3UBMA 1VBNA 2HPHA 2CEKA 2OO7A 2CNLA 2XYQA 4Q4AB 4FE7A 2BI4A 4KX5A 2GD0A 5JY6A 4PLWA 5CIWA 1FX0A 1XZPA 2V7XA 3HJBA 3V2GA 1YB2A 1AIPA 3ZKWB 4A4DA 3LBHA 2R84A 2VJCA 1DCMA 1TO6A 2WABA 1ZESA 4FP9A 4P82A 1ZAYA 1QFXA 2H8KA 2WUWE 4NAHA 1XKTA 4KR9A 3SJ7A 1LDEA 2AMFA 4MUXA 1IZ9A 4QUJA 2ZVJA 2Q99A 4AUKA 1G9XA 4KBYA 4JJ7A 5DZSA 2Z5LA 4FTWA 4IYJA 4ZOEA 3LK6A 5IC6A 3WB2A 1MPTA 3WRYA 4C4RA 3CSSA 1PTJA 4ERXA 2GNPA 2J0QA 4HDQB 3MG9A 1WRBA 2W6ZA 3R23A 4OQXA 5K8VA 2GTHA 2ZI4A 1HKUA 4OATA 3RYIB 5LOVA 3O03A 1HFWA 1TU3A 1AUPA 3CLKA 3KDSE 3KOZA 4ND8B 4PHCA 4I8IA 4UHBA 5C4GB 1Z6TA 2PG3A 3TTTA 3EDYA 5DNCA 1G8PA 3D6VA 1ZA1A 3GLUA 3LU1A 2NXJA 3RVMA 2WJAA 3LFUA 4FT4A 5HIJA 1YI0A 2RGYA 3R8CA 4EKIA 5TGZA 5KJ6A 4EGQA 2XKAA 3W9UA 4Z9YA 3HB5X 2A0FA 2QKYA 3AKDA 3WB1A 3GROA 3JWIA 2CD7A 2A78A 2R8EA 4PYOA 2NU8B 4BX0A 4R31A 4DRXA 3WLTA 2C57A 1RRVA 3K1AA 2I67A 2DRIA 3LHDA 1SFRA 2G6TA 3L7BA 5FA5A 2LCFA 2QE6A 3U1TA 3OFKA 3HY4A 5BV2P 1R9MA 3F90A 4KLCA 1RWQA 3E05A 2HHHB 1PEKE 2O57A 4OG2A 3AKZA 3CZRA 5IKEA 1JLRA 4WH0A 4KMOA 1VGQA 2AS0A 1ZJYA 2RI1A 2VFAA 2CDBA 2DJIA 2WD7A 4KIJA 2BFCB 4H6WA 4QRIA 4U2KA 3D4IA 1T1RA 4MW7A 4Y6RA 3M5WA 2YH2A 2ETVA 3DL2A 2GZ2A 3GJZA 4HC4A 3V80A 2O3SA 3THYB 1PQPA 1T9AA 3G7NA 4PPQA 1V7CA 5CH5A 2HREA 2PVCA 1U3DA 2WF7A 4Q4AA 5AVOA 3EPJA 4HGQA 4LRWA 4MV3A 5J4KA 4GP7A 3X1YA 3WGZA 1CDZA 1QS0B 4UDOA 3ZE7A 1Q1BA 3WQQA 2X42A 2HF2A 1H8HA 5CJJA 5D51S 5AJYA 3A14A 1T3ZA 2QVXX 5HDBB 2OBBA 4K9SA 4X8OA 2BY4A 3G9TA 4OB6A 2X2EA 4PEVA 2FN9A 2P9QA 3FCEA 1TM1E 2FU5C 2J1LA 4LEIA 4KXFB 5H9WA 3LSYA 1GSAA 1HURA 2IYOA 2BFFB 5FBLB 5AVXA 3ZDBA 1ZG3A 1KWKA 3H9QA 3QHQA 4FFVA 4RKRA 5H7XA 2FQWA 2QTGA 1UJMA 2G3YA 4GM4A 4HH3C 3ZQJA 4P5EA 4EFMA 3TX6A 1MJGA 1RDFA 2BBSA 3FX2A 2HN9A 4E2XA 2I1LA 1YZKA 4REQA 1L4LA 3W8RA 4QBFA 1XZNA 2O7NA 3D6HA 3GMIA 3G5UA 5D6NA 5I7VA 3OBIA 3KB8A 4FGZA 4J7XA 4IDFA 1TCVA 3DP7A 1FYFA 1XBTA 3IAEA 1UZAA 4TWRA 3UA3A 3VR4H 2AQKA 2G67A 4C2BA 8ADHA 3IL2A 2HXGA 3DM5A 3GDGA 1LDGA 4IF4A 4P0PB 3ODPA 1D2RA 4P22A 4P6VF 1OU0A 4Y2GA 1U8CB 5ALIA 2YC4C 3RI3A 1QUEA 4BWFB 1M1NB 3PUKA 2NPOA 4MWSA 4MW5A 3FJ1A 3VM6A 1KTIA 4E09A 4YMHA 2QJFA 1DV2A 4BNLA 4HRAA 4WIAA 3CG0A 3SPXA 3X0DA 3C7DB 2JFFA 2JIMA 4FFOA 4QGHA 5IRCD 3RJZA 1UAAA 4PSUA 1Z4QA 2ZKLA 3MT9A 2KSQA 2OAEA 3PNYA 2OCAA 2DT5A 1GZSA 3NU1A 4MQEA 3ADCA 4R9NA 4AMGA 1D0VA 1JG6A 4GR5A 4N03A 3FFTA 4N3BA 4ZT5A 4IYRA 1ODJA 4ES6A 5H9VA 2KPOA 4MWOA 5CDHA 6REQA 1CR4A 1YB1A 4UUQA 1V8DA 2OEPA 3GU3A 4UVIA 2WOJA 2YBDA 5I3CA 1AUXA 5LZ5A 4BEBA 4ER7A 2J0UB 3QUAA 4RKWA 1F48A 5IKMA 3HXPA 4IFEA 1SZDA 2HMVA 1VG0B 4ZT6A 5BNZA 1B4DA 2RGDA 4IP0A 2WUGA 4GMXA 4NBNA 1DXHA 2KE5A 3EOBI 2JBAA 1HYQA 3MPOA 3CE6A 4QOHA 4R1NA 5KJEA 1E4EA 4Z0HO 3EVTA 3PCXA 4AO8A 5FOQA 3QG5A 1FQKA 4G09A 1N6PA 1XNQB 4GOOD 1V25A 3U7RA 1XA4A 4YIHA 1SXJD 5AI5A 1FUYB 3E35A 3PK0A 3CU5A 4K28A 2YMQA 3U0VA 821PA 4M87A 4HWKA 3TAUA 2IHBA 2XXJA 5KTNA 3CHYA 4TKUA 3JQ8A 4Q1EA 3W8NA 1NVVQ 5DLPA 1Q2XA 4OB7A 4B1FA 1M83A 3NNDA 3FETA 1OZ0A 3DCJA 4Q7LA 5F3DA 1XWFA 1Y4UA 2PO7A 3MJEA 2ZT7A 2XZTA 1YT5A 1JR3E 2PQ2A 5J5CA 1ULAA 2HDWA 4JB8A 3X1XA 4E14A 4ZK6A 3LC1O 4M49A 1RXSA 3ZKAA 1D2EA 1NF9A 1QE5A 1ZOLA 3QXHA 5FOWA 4S04A 5ENZA 4ETNA 4JT2A 3F7TA 3NBYC 1NN0A 1C4XA 2OXRA 2ECOA 4PANA 1KQNA 3I53A 4L6AA 4YCJA 1JJ7A 1P2VA 1KI4A 2BCEA 3G9QA 2I65A 2VHCA 3LIIA 3D3JA 4FYPA 4YR7A 1AU9A 3NHPA 2C7GA 3Q0TA 1MXHA 2B35A 4TRJA 4LBWA 1QC5A 5MN4A 1FZTA 1D9XA 2VQFB 4I46A 2PGXA 1SC6A 4G5HA 4D80A 3I01A 2R8XA 2AGVA 3QPVA 4DCTA 4CDMA 4ZHSA 2ZI5A 3RD5A 3WAGA 4RYLA 4Q9LA 3BMQB 3P32A 3H1BA 3C1TA 5JJIA 1DOZA 4MS3A 4YJ2F 3LLMA 4WZ6A 3F3YA 3OZAA 3OQ6A 3FCAA 2Q3HA 1MT0A 3TG2A 1JI0A 4TV9B 2ZCUA 2C58A 2ZAOA 3SR4A 3AVUA 1QH0A 2ZJ0A 3DZCA 2JA1A 1D09A 3T3OA 3K6SB 4BQPA 2FLKA 4JLVA 4NCKA 5ALMA 1MW9X 3B53X 3U5ZB 5B7NA 2CXTA 4BKUA 4NZPA 2JANA 3FNIA 3G0GA 4GI3A 4M8LA 4R0MA 2V74B 2QYOA 3KDAA 1C5KA 1PR0A 1SB9A 3HNPA 1Z8DA 2RBKA 1PV2A 4KXYA 1NDHA 3HBAA 1D0SA 3EGXB 3P7MA 4TLAA 1G6Q1 1RYFA 2I3BA 4YALA 4ZI7A 3R7AA 1M2JA 1OZAA 1MNQA 3L49A 2PLWA 4Z9XA 1Y5LA 2QMYA 4J43A 3O4GA 1CF4A 1JFRA 3UWSA 4F2DA 1JDZA 2R79A 3A06A 2H9AA 2YYAA 3N8HA 5ICMA 4L50A 2X0DA 2I6XA 4HEJA 1GAEO 1N8TA 1CR6A 3EXAA 1N7HA 4UPDA 2V0CA 1ZICA 3K9HA 1C7QA 4V2IA 2RKBA 5CVDA 3FRJA 1SQ6A 4ZV4A 1II0A 2W43A 1BDBA 1ORWA 2BGTA 3T1OA 3UICA 4AJLA 3WLSA 4AP5A 4DNFA 1T6NA 1A04A 2ONZA 3ODGA 3FDJA 2R97A 1NXTA 3ROEA 3UJ3X 3WSTA 3M4NA 4F46A 1R4AA 1XF9A 1B76A 1XVUA 2VXBA 5DGTA 2MIIA 1IY1A 1WCYA 4HAVA 2ATVA 1DZ3A 1RXCA 2ZT8A 2XTJA 4COKA 2XNDA 4N6NA 1FSGA 1JGTA 5EWLA 1PJ8A 1VKJA 1ZA2A 3PIDA 2UZ3A 3K9CA 4D8UA 4HX9A 3RIGA 4RVHA 4TKLA 4WZBE 1H2EA 1S2MA 1OIVA 3E58A 5AKLA 3GNSA 2ZJBA 2DM6A 3CNEA 3H1PA 3HJUA 4Z99A 4FHEA 1KDVA 3HWX1 1OLOA 3A1DA 3I42A 2WA2A 2XWSA 4KLZA 3L6DA 4EY6A 3ER8A 1ZH6A 4O4LA 4Y6LA 4TM7A 2QVBA 1E8DA 2ZWIA 3BQMB 4Q3OA 3V4FA 3I6ZA 3KQVA 1A5BB 2NO5A 2ZCJA 3WHPA 4Q9HA 2CC2A 2OV2A 1BVYF 3HV2A 1VSTA 2QR3A 3A0RB 4JC5A 3I52A 3ZWCA 2AMVA 3NGMA 5C5DA 1LTKA 1VLVA 4I5DA 4V38A 5JAUA 2A1TS 1KPIA 2WIDA 1EG7A 2N9UA 2I78A 4IQ0A 4G0OA 5IU6A 1VL6A 1YZ3A 4K6HA 3O94A 2XIQA 2GPSA 4RGQA 5FWXB 4RACA 4DF3A 3R41A 1G291 5HS4A 4MUJA 5FI1B 2CHQA 2KJQA 3HNOA 3CYFA 4EW2A 2A58A 4RO0A 2BWJA 3LF2A 1GTMA 1ISSA 4X6LA 3DPIA 4P93A 2X3YA 1TF2A 1M34E 1NVTA 4FYMA 4PO1A 5ILOA 1AE1A 1WXGA 4X41A 3EG9B 2D0PB 3KVNA 1XDSA 3JXEA 1ZLXA 4MI3A 1KJWA 4PSAA 3ZK8A 5B36A 1CEXA 1KI6B 2HSZA 4OBWA 1NQ5A 3AR9A 4LN1A 5AM3A 3DZFA 4P0QB 3PX7A 4HLUC 2G6BA 1QO0D 3TOZA 5I5EA 3I5XA 5I7SA 1XA3A 4X84A 1NYRA 4ER5A 4UHJA 5JMOA 1K8QA 3H7IA 1NONA 4ILKA 3IJPA 3FMFA 3EISA 4H1UA 4KNVA 4XUDA 3SF0A 4J16A 2F1RA 3IP8A 4MQUA 3T34A 1CCWA 3K4HA 1GUZA 3OE7D 1YR7A 1Z6PA 3N8NA 4EUSA 1A76A 1DZIA 1XMXA 2IZ5A 4P7KA 4X65B 2AL7A 3W3AH 5IVHA 1L5NA 4I9FA 4EO9A 1ZBDA 5AJZA 4YQEA 3TN7A 4Z6KA 2FJ0A 4NMLA 1RYYA 1ZIXA 3AJ9A 2WTUA 1UKVY 2V7QA 4P0TA 3THWA 2QP9X 4K3VA 2PTGA 2YZKA 1JKMA 3A6JA 4RK7A 5E9WA 4JI3B 3VJKA 1ZD5A 4MAFA 4CQMA 2FCRA 2RDMA 4EYOA 4Q7JB 4I14A 5JPCA 5JCJD 2XCOA 1KMMA 2BEWB 1EAMA 1EH5A 1EWRA 4K6CA 3HNRA 2ENUA 3MJSA 1LQUA 2V4ZA 2J33A 3FAKA 4AL4A 1IEVA 1EBBA 1KEVA 4DCMA 5BSFA 5SYNA 1PF7E 5L40A 1LEHA 4CUJA 5AI9A 1SK9A 4GYYA 4U5QA 3P9ZA 4XE5A 1N2JA 2YVLA 3QZUA 4GR4A 4AF8A 4ZHQB 1NVKA 4MS3B 3VPGA 5G1OA 4OGWA 1KBZA 1PN3A 2RIRA 2NW6A 1SKMA 1D8AA 1NZDA 2ODPA 3Q9UA 4K6MA 4AICA 3U44B 3ZVKA 5IT0A 5DM0A 4CV3A 2B1QA 4JKIA 1UOPA 4DSUA 3ZNQA 1PFUA 4PCUA 3Q9LA 2C54A 2JG3A 2C5BA 4NVRA 5FI0B 4XEHA 4EPWA 1NJ5A 4J0QA 3WE7A 1GLGA 2NVUA 1AQ6A 4C3UA 1K7XB 3K31A 3BT7A 2PGOA 4FOLA 2MOKA 2OGWA 1U0LA 2X14A 1DGQA 2Q6TA 4EPRA 2NNLD 3D6JA 2OWDA 1MKYA 1NW6A 4RDHA 1JFFA 1PW7A 2VHYA 1ZU5A 3KJNA 2FMTA 4EFDA 2ERXA 3JWPA 1QYIA 3M5DA 4C2TA 3DZHA 3I9JA 4HR7A 4JI0B 5IJWA 3BAFA 2NP6A 2QJOA 4RDIA 2XBMA 5IFLA 8AT1A 4I81A 3TLZA 1CQJA 3R76A 4Z7JA 2FDCA 4YPVA 3OQNA 3FNGA 2W8ZA 3OECA 3QYAA 4LXQA 2I29A 5ALSA 5JD5A 3VX4A 3FR7A 1EE2A 2PNJA 1I0ZA 4R8MA 2OGZA 2PWYA 3F98A 5GZ1A 1N3BA 2XDQA 1E5VA 2XQVA 4KK3A 3QLUA 5D3MB 4OHMA 5DRTA 3T5CA 1GVHA 2WWVD 4B8WA 3ILXA 4J2HA 1GZUA 2AXNA 1EZZA 1FMCA 3OPNA 2O59A 1CP3A 4RKYA 2YCLA 2ADFA 4K7JA 3O9MA 3K4QA 4JL6A 5AYVA 4TS4A 3HO8A 5JS6A 3LP6A 1QG0A 5KSYA 2XUPA 1XKXA 1N0WA 3REQB 3VSBA 5CFPA 3TRDA 1LA2A 3FNBA 2ZSAA 1YA6A 3OZRA 5JD4A 4I5GA 5JLJA 1NVVR 4GX5A 1RJFA 1KSGA 2GSDA 3ZEIA 4PC7A 4EABA 4Q1DA 3V4VB 5JD3A 3AF6A 4NHOA 4E2ZA 5JAZA 4HRYA 3S99A 2VOJA 1PT7A 2NZ8A 5C8VA 3KJEA 2A94A 3O73A 5HJ5A 1H22A 4LQLA 4BO6A 3WY9A 3WJ7A 5FWYA 4S05A 3VVCA 4DAEA 1TYCA 5JNTA 5F1OA 1FX1A 2NSJA 3IJ5A 4FHZA 4CF7A 2NZXA 2IUFA 4QTXA 4XJSA 1S2NA 1RAAA 2QX8A 2JFXA 4NYIQ 4M9ZA 4CM9A 2OZLB 3W2TA 2IYUA 3CONA 2QVLA 5FPHA 1UEXC 1PD0A 1SXJC 2WILA 2WWXA 3T5GA 1VLZA 3K05A 3G0IA 1ECGA 1WBDA 4YAEA 5FLKA 3HC7A 5CB8A 1TNDA 4RNCA 3ACCA 5EJFA 4TV8A 2BLNA 1E9EA 2WHPB 4HLCA 4TVBA 2EJVA 3LUJA 4MUFA 2A4MA 4UMDA 5ALOA 4M9XA 4LISA 1EIWA 3JAWB 4RX1A 1Y8AA 2JAXA 2NU6A 3V33A 4D26A 3GLFA 4Q3LA 4ZQFA 2PU5A 3FOAA 4YP1A 3GCZA 5AOCA 4BN5A 2FR1A 1HTWA 3GLIA 2V1UA 1I3KA 4L51A 1PD1A 3TIIA 2ZE8A 1JUDA 1ORVA 3CH6A 3CRRA 2ZWOA 3FGOA 2M6KA 4UTOA 5KYKA 2VSOA 3L06A 2XCRB 4C4TA 1V1MB 1J0XO 5EA2A 1WXXA 2IDMA 3NIDB 4KR3A 1ZH2A 3ZY6A 5L6LB 3THOA 1UC4B 2FSVC 2N47A 3PNSA 3L6UA 2OOKA 2W2KB 1FDIA 1PEAA 4MQLA 1BE6A 4HJXA 4CKBB 4GX1A 3AJ8A 2D2XA 1GTRA 1X7ZA 4BKQA 2CMGA 4RLQA 3TS1A 2UXBB 1EFRD 3DHEA 4HTFA 2IPLA 1J25A 1JEYA 4RF4A 1BQ4A 5L4LA 2QZPA 3DE0X 3VR6A 3FRHA 1A9PA 2ZZNA 3CSDA 3IKVA 3REOA 2GI4A 5IXYA 3PXGA 4PVDA 2VHWA 3RFVA 4CCWA 2QEQA 1DFHA 1GM5A 2ZB2A 4JN6B 2YIVX 5THQA 5JPDA 3EPKA 4RIEA 5IPFA 1QO7A 1Z7YA 3JARA 3R0ZA 4ML3A 2QM3A 4TRNA 2RGWA 4AD8A 1EGMB 2XLCA 4GAEA 2GF9A 1CQWA 3SX0A 2FMUA 3FKSD 2QBYA 3G2OA 1E4OA 2ZR7A 1Z2DA 4LXHA 1IFXA 1XU9A 2IHKA 2ZQYA 1THTA 1WMDA 5DTEA 4LRYA 2J09A 4KR2A 1S9HA 1Q74A 2WZQA 2BFCA 1J00A 5EXDA 4JP5A 4BGEA 1KR2A 3EXIB 1YGYA 2CL7X 3HRKA 5BYKA 2ZSFA 1N6NA 1K66A 4KTVE 4M9QA 2Q4RA 1YRAA 1DG1G 5KNCD 4KI7A 4WY2A 3TQTA 5MFPA 1IPHA 1UJBA 2HTFA 2XA2A 3LJKA 4YCDA 2H54A 4QYIB 4YRMA 2D62A 1UBOS 2QAJA 4GQAA 1N2GA 1UMDA 5M04A 2YWEA 1N0VC 3VAAA 2CGEA 2VJQA 3IAHA 5IT9A 2ISQA 2WU3A 3II6X 3L8YA 3FWYA 5ENDA 6NULA 4AWAA 3TZQA 4ME6A 1IJKA 1TMKA 4K88A 2W2XA 5G02A 1Q16A 2ATXA 4F91B 2QU7A 4QOGA 2JIQA 2OCDA 1G20B 2PS1A 3GXOA 1BX0A 1U7ZA 2C7VA 4IPTA 4KFSA 4OGLA 5E6UA 2A7XA 2SCUA 3DDNA 1YZQA 1LCIA 5EUQB 4OLFA 2J9YB 4C4XA 4IM7A 3NHRA 1HF3A 2Q6IA 4IXMA 2DFPA 2AK2A 4N48A 4LJRA 5EHIA 4R2IA 4M9UA 2I4IA 2O54A 2IPNA 2GEFA 1P6QA 2B83A 1XRLA 3AGPA 2ATIA 5EIEA 4PGFA 2PSFA 1XRMA 4P7FA 4PFSA 1YQGA 3SZMA 4EPXA 1CQPA 4U7GA 3VR0A 4DCGA 2FQ1A 3GCGA 2BE7A 3AZQA 3PNOA 2B99A 3TD2A 5LUAA 4BQNA 2SCUB 2Z6VA 2OCXA 1GGNA 3PDJA 3U16A 2ECPA 2LCQA 4MI1A 3B5EA 4R2MA 4LVCA 2QBYB 1EXMA 1L5MA 1ODIA 4N0PA 4ARSA 5HZHA 3RYHB 2EKDA 3K2IA 2WICA 5FUYA 1AB6A 2W6ID 2G7ZA 1XLTA 4D44A 4Y2TA 2AJCA 4K1XA 1NQVA 1PW5A 3F5FA 5IMSA 1JQ3A 5E8JA 2GVZC 4D9HA 2ZIWB 5LZ7A 1BE1A 1VRCA 4K6FA 3H9JA 1P4AA 2I80A 1EXNA 3D2AA 3M3PA 2QUJA 3BWDD 3ZY2A 1LBSA 2OKCA 2CV1A 1FFXB 3PJEA 1EK1A 3LPDA 2W70A 2ZJFA 4AZSA 1KSFX 3FGZA 2DTXA 5CD1A 1KHTA 4S35A 1BYIA 2QL5A 1E7QA 2FPOA 4HTFB 2WUEA 3WL7A 4NYJQ 4Q4JA 2OL4A 1YF3A 4CKBA 1OKKD 3SK0A 5JRZA 3PHCA 1VJDA 1J20A 4MW0A 1U0SY 1VSUA 1W6RA 2D8AA 2FG5A 2OQIA 2PK3A 3KHKA 1QR6A 1BW9B 2VDLB 3KHUA 1CJMA 4JT9A 1JMKC 2QUKA 2VHQA 4FZVA 3VNBA 4B0PA 4BNDB 1YB7A 5DOZA 3VHQA 4F4IA 3HFGA 4FK8A 2AV6A 3PRJA 3N8IA 4LIPD 1VYUA 4KFTA 3CIFA 4I50B 1CR2A 1MJFA 1NN1A 2O8DA 2ASEA 1J5PA 3OQOA 3EZGA 3VV3A 3A1NA 1XRNA 3KBBA 4NJEB 4LY0A 3ZQ6A 3DVQX 2JLCA 4HAYA 5BWMA 3MS2A 3RTCA 3QW2A 3RUEA 3LX8A 3CUYA 1EWVA 4G26A 4YRPA 4YMUA 1SOVA 4JB3A 2B7LA 3O2JA 2H7YA 3GW8A 3ZZUA 1YJAA 1CFJA 3OU6A 3PR2B 4HFMA 1QIIA 3STYA 4NJMA 1IPEA 1CNFA 3F3SA 4AZ0B 2FE1A 2P68A 5DASA 3QXJA 1USWA 1HY3A 1IIRA 2XB4A 3CRMA 3KVVA 1G6HA 1AY0A 1WM1A 4GRDA 3RRYA 2C96A 3SI7A 1E18A 4LXXA 2O5RA 2BMWA 1IULA 2IDJA 1UQTA 5KDLA 5MN6A 1XEWX 4DV5B 1XPOA 1JYEA 3HKBB 2P4HX 2VDWB 2FSGA 3E4CA 1G8YA 1JKXA 2Z5GA 5FPQA 1G8SA 3EVFA 3RAPR 3LL7A 4N12A 2FFAA 4BX8A 1T3TA 1C9YA 1O97D 1VBFA 2ZTHA 2R00C 4CMIA 1B3RA 2Y1CA 2NTVA 1RQXA 2HC9A 5DLYA 2NU6B 1K8RA 2G0AA 1E2LA 1E3QA 4AJIA 3T3NA 3G23A 5BSKA 4C22A 2DLCX 4YLGA 2HK9A 1W5AA 4D9CA 3IPAA 2GVDC 4QUEA 4ZMSA 3KSDO 2OXTA 2IXGA 1NE2A 4IHJF 2YIMA 3RAJA 3RSFA 3BGDA 1UK8A 2ZBEA 4FHCA 4CIVA 4AJJA 3U4QB 2Q0SA 3LW8A 3N1UA 4EKGA 1FYEA 1HDZA 3N28A 3E03A 2DHCA 1Y6ZA 4QEDA 2B7CA 1W46A 1UANA 1WPQA 2Z8YM 1VKHA 5REQB 3IE2A 4PX5A 4FDLA 2D6FA 3OF2A 1KAHA 4N5MA 2WUFA 4G0NA 1NJ1A 4ZOAA 5BN3B 2JARA 2H1OA 1GZ5A 3BRWD 3JYOA 5KHAA 2GMWA 2PWAA 1QRRA 3FTNA 3DV2A 4IDNA 5SY6A 4JLUA 2HRZA 4WGGA 2J87A 2NXWA 2YVKA 1P9LA 3U26A 3LOQA 4LCJA 4S1TA 5ALKA 4ZVRA 3PIIA 3QX7A 2FPPA 1UPUA 1M6NA 2ADMA 3NWJA 1BGWA 1E0SA 1BCSA 3M6LA 2L19A 5BUCA 2M9MA 1XTQA 4ONEA 4Q3BA 1IQUA 3HKCB 5JH7B 1GR0A 4L8WB 2IUUA 2O05A 1QR2A 3ZI7A 1H1LA 1NXVA 1QHNA 2QT9A 2QGNA 3FHCB 3I1YA 4DABA 4QJ3A 4QOFA 1E4VA 1W35A 1HTTA 3RKUA 1N0UA 2B1IA 2HB6A 5LJLA 1JKJB 2BHTA 2H51A 2JLVA 1NMYA 1M33A 4EKEA 1JG1A 2WYHA 2FWAA 4HAXA 1E5TA 1KIFA 1II8A 1M8GA 1BFDA 2DUWA 1S6YA 2AZDA 3FUVA 3G1WA 3IUJA 4IFBA 4JJEA 3TSCA 4EF5A 4MMZB 2YY6A 3L0OA 4DMRA 2Z6AA 3ETEA 1E9CA 1U1DA 1WA5A 3L8MA 3N9IA 4LHSA 3UUFA 4ZYWA 4EB0A 4ZGGA 2XTNA 4R1QA 2ECQA 4E32A 4BRSA 1W2HA 3ZGVA 1L7NA 2HH9A 2JFZA 4EPTA 3QU5A 2RCNA 1L7DA 1RKUA 1G0NA 5KYGA 2J4CA 1SD5A 3O8OA 3ENWA 5JCXA 3E82A 2JI6A 3FHLA 3PX3A 3OKFA 3I72A 4AMYA 7GPBA 1AS2A 4K9QA 5B4UA 5B55A 1NRIA 1WOYA 3SXJA 3HB4X 4FZRA 4XFDA 2B5WA 2C7QA 4KQMA 1UBEA 5LYJF 5B1HA 1IYZA 2AEJA 2R2AA 5P21A 1WDLA 3TWOA 1KEZA 1J2YA 2IEIA 2TMKA 4EUHA 1T2AA 1JAXA 3FWKA 4YGXB 1T15A 5E4TA 5T64A 4UNQA 2HBYA 3EEIA 3ESZA 4D5GA 1ICEA 2RC6A 4NICA 4QHTA 4BO8A 4QNRA 3IUBA 3PXAA 4HK4A 1SCNE 1P9OA 1T43A 3TQFA 1TK9A 4L4XA 1G21E 1I4WA 1E2GA 1XUOA 1ZFNA 2JIBA 1Z4MA 3M5PA 3R3VA 3X1WA 4AB1A 1JJBA 1MABA 2BFPA 1XZ8A 1R4ZA 1DFGA 4N0EA 3B8HA 3Q5EA 3QQ5A 3KD3A 4S1OA 2UUBB 2YFQA 4B7ZA 1ISGA 3PTAA 2FGKA 1QK4A 2G80A 1DBRA 3MYYA 2GK7A 3LE8A 4AWXA 4M21A 3KS9A 4CKWA 2TSYB 5EGSA 3AXSA 4UM9B 3E9EA 2O8CB 2AFVA 3CW8X 3IHTA 2GHQA 1F14A 2OHFA 1Y9ZA 2CZGA 2I2WA 4JJ4A 4MB0A 4QBHA 1RI3A 5LM3A 3OIFA 3SY8A 2QUBA 2HA4A 5MGNA 1ENOA 3L77A 1W93A 4LRUA 3ANYB 3RTAA 3OURA 4NENA 2BEWA 4RXTA 2GBLC 3TNYA 2BFNA 2Q46A 2BCGY 3OOWA 3S2IA 1OH5A 1FSSA 2P9FA 4DDKA 3BCRA 5CDGA 1E3DA 2ETXA 3IRUA 4PSCA 5BQXA 5AW0A 1YTUA 1AV6A 4A3SA 2QN3A 1ZHOA 5U9CA 2IOFA 2BGKA 4PCAA 1LK5A 4RGBA 2WF5A 3GN1A 1N1EA 5BQPA 4EDHA 4TT3D 1FFYA 1LFDB 2C8JA 1GQ2A 3ZV4A 4Y6PA 3W9YA 3EQ7A 2TECE 5TMPA 3BYZA 3N8GA 4CCAA 1YNSA 2CVZA 3GAZA 3GFQA 4G24A 3V1LA 3WRXC 2BF4A 2IVZA 4NCIA 1H1DA 1DMSA 1ORRA 4NKRA 3RUIA 3MT0A 3HXOA 4U39A 1DB3A 4DUGD 2GPBA 1U90A 5D2CA 1DRJA 5LIRA 4UAVA 2DBVO 1FVXA 1JECA 2AJLI 5EE0A 4DR5B 2A0XA 1E8MA 4FDVA 4Z9BA 3WXBA 5BQFA 3TB4A 4H7HA 4J2TA 4IR7A 2VPXA 3Q3EA 3F74A 1J5XA 2EIHA 4XGQA 4G4GA 2C2ZA 3REGA 1U02A 4PWZA 5DGCA 4MCJA 1KI2A 5LXTF 5AOBA 3PX2A 4MYRA 4HI0E 3WP1B 5J23A 3CX6A 1TW3A 4R6XA 1P2FA 3A27A 1R0BA 2OM6A 2R7LA 2Z2IA 3PKIA 1MB0A 1GPAA 1KAQA 2DQYA 2WIFA 4OJTA 2AOXA 5F7JA 4EEXA 5LN1A 6AT1A 2Y9MB 3HVJA 4MGZR 3OOJA 4A82A 1DC3A 5JI3E 1MIOB 3IPYA 1NC1A 3RIHA 5EHGA 3RVLA 3B5IA 1TJ3A 2YQ5A 4ESVA 2JZOA 1M1XB 2VT7A 3VNQA 3I9NA 1YWGO 1Z6QA 1Y9AA 3R5JA 4GZ6A 3SIXA 1EINA 5B53A 2I4MA 4IUBS 4QKQA 3ICPA 3O83A 3B7PA 3BVPA 2P30A 2PMKA 3PE6A 3H2BA 4GYWA 4TMFA 4W1RA 3A6FA 4PBTA 5H4HA 3PDIB 3COSA 1W0KA 1AKEA 1I1NA 2OLJA 3RFCA 1AKVA 1H8EA 3HEBA 2QNRA 3R5KA 1VIVA 1YR6A 4KSYA 4OMCA 3CEAA 1CV2A 1M75A 4JOQA 2BRUA 2XW6A 3EZNA 3FNEA 4RMGA 1JIUA 2G5PA 2VH2A 3A3KA 2ZK7A 1CUFA 1PVDA 2ZJ4A 3KKPA 2WU8A 2C1ZA 3PCTA 1QVZA 1W4LA 4QPZA 3RSZA 4D45A 5ESDA 2UVPB 1JDTA 1N1MA 3D6NB 3NANA 1GYRA 4C6SA 2FFBA 1R66A 4JXKA 4QULA 3EXHB 4WI1A 1XK6A 1WF6A 1L1RA 5CJ2A 1DKRA 2GYYA 1VL5A 1PS8A 3EAQA 3F6YA 4K9RA 4A27A 4R71A 1P73A 4AYWA 4UNRA 5FPKA 5ICCA 3H2KA 4FMCB 2CB0A 2EBUA 4BMVA 3C6QA 4DA9A 5JYCA 4ZVMA 1CUVA 3PDHA 3QOWA 1TTHA 2VL7A 1X8JA 3GIWA 3IVXA 1MX5A 5GP1A 5IHPA 2WTMA 4HS9A 2IYAA 1JFLA 1NJ6A 1IXKA 5JS2A 1KI9A 3AERB 1CJUC 3O7WA 4M0KA 1YZFA 4YCBA 2ANCA 1Z0JA 3GGDA 5EUBA 2C3MA 3D8UA 1FIUA 3QPUA 2C84A 2HPVA 3PBKA 1P0MA 3QITA 1CUHA 2RD2A 2WSLA 2WT9A 1OHHD 3TLEA 1WUHS 1IM2A 2FA9A 1U0NA 1QCDA 1VE1A 1W5SA 1SIBE 3CUKA 3KWFA 5K6TA 1DEOA 3I30X 3IB6A 2GSWA 3IP1A 4D9GA 3U81A 3ZJVA 3AVTA 3P4YA 4RF2A 2Y1FA 3U19A 2WY2D 5F5LA 1QFJA 1DJPA 3WI7A 4E5KA 1BVRA 3RWBA 1G4HA 3QEBZ 2XOKD 3F97A 1WF3A 3PI7A 2Y9PB 1DL5A 3NVMB 1I24A 4YAOA 1MEJA 1SQSA 2Q3FA 3H4TA 5EKUA 4DMMA 4E94A 4FT2A 5DYTA 1AHHA 2Q6VA 5KQSA 3C8MA 4PLHA 3AR3A 3LD9A 3P96A 1XCJA 4GMGA 2I2BA 2VS1A 3UH1A 4DBLC 5CFLA 1EFAA 3FOEC 2C5FA 3D7RA 4EFLA 4BQOA 3QBVA 5KX5B 3JQAB 2HXYA 4JFRA 2IIQA 2ZPUA 4X94A 1YK1A 3G79A 5K0SA 3TF5A 1J2JA 1UKCA 1AKWA 2RK6A 3O0TA 1Y1TA 1IB0A 4R69A 4A8JC 1RAIA 4WZZA 5ILGA 3HJAA 1JAHA 1BCRB 3JR3A 4ZQCB 3L4SO 1EBFA 3TKYA 2O3RA 4KQCA 1IE3A 5DBOA 3EXHA 2IK8A 3I32A 4U3JA 3ZU2A 3ZVNA 4NOJA 3H2IA 3FOBA 3LPMA 2X3UA 1J39A 1L8XA 1JG4A 1ADCA 2V65A 3H4IA 5BQ3A 3NXSA 3AV0B 2EFCB 3Q3GE 2YVUA 5JSUA 1UP7A 2XD9A 2RI0A 4AKGA 2BIFA 4TTAA 5AD1A 3QVJA 1JF8A 4KC0A 2IPMA 5E6RB 5KTOA 2XT6A 4H59A 3UB2A 4PY2A 2QJWA 3HYLA 4FIDA 2GRAA 1BDMA 1PLLA 1E5DA 3A9RA 3FZQA 3D7MA 1MQ8B 3PDIA 6REQB 2QX4A 1WQ4A 2COKA 2O2GA 2OCBA 2I33A 1Y1PA 4FHGA 1TGYA 2YHAA 4ZT3A 2R5WA 3ZQKA 5JO9A 4EG4A 3KQUA 1TEXA 1TLLA 4QODA 3ZXXA 2HSGA 4RJIA 5JSHA 3AW9A 4F7DA 2A9VA 5A6VA 2OK8A 4U7HA 3M1AA 4AKSA 3PFKA 2FRXA 3FIUA 3RC7A 2PR7A 4KRYA 4EMSA 4Z7OB 2UU9B 1BA3A 1E92A 1RTKA 4Y1RB 3OPYA 1FTWA 2X7JA 2BI7A 2R8OA 4XM1A 1L5FA 3LUCA 2QYHA 4II3A 3T3MB 1T5LA 3H5IA 1K1EA 1K6JA 1SM4A 2O48X 3GJRA 3JQ9A 5C3MA 3WKEA 1DAGA 4BVAA 2FWIA 4IY1A 1FVHA 4JLMA 2HYDA 4D0GA 1WXEA 3NEJA 1RYZA 2WWTA 4FE3A 5ELLA 3UPDA 5A0VA 1QCZA 2YV2A 4AECA 5JY1A 4UW9A 3R3HA 3ECCA 1ZC3A 3A3OA 3MNFA 1A96A 4BNHA 3V55A 2FMXA 3MVEA 4UCXA 4WOBA 5C7LO 3FPEA 5KYXA 4FJ1A 1PGJA 4XPIA 1UWVA 4R3NA 1G8FA 4DUZB 5A4AA 2ZPAA 4P4SA 4E5UA 5BWLA 1W0CA 1OC4A 3K8QA 4QXAA 2X4DA 2EX0A 4GECA 3G2MA 3A1TA 3FROA 2GAOA 4G4JA 4G0WA 2AR9A 4YV7A 2Q5JA 1C9DB 1S7CA 3K2QA 5DNVA 5D00A 3TCNA 1N4AA 3FE2A 4JL5A 1B43A 4MDFA 4ZQIA 3EMDA 1TD1A 2C61A 3FOWA 1DT5A 3T3GA 4BATA 1KS9A 2JFOA 3A28A 4HRVA 2YHIB 4QGBA 1RLOA 1NTRA 3BSWA 4NK5A 2E3JA 2F59A 3U4DA 1U99A 3DVSX 3SHWA 3JR7A 3ZHRA 3KKOA 1G0OA 1L3CA 1RE1A 1JNYA 3NPMA 4BKRA 2FZWA 1RLUA 1YCFA 4AMUA 4BX2A 3FPBA 3U61B 1NQTA 3DBIA 2DHDA 4Q02A 2NO1A 1GN9A 4AY3A 1F8GA 2ZANA 3AOGA 1K2WA 1S2OA 2WHQA 3L0IB 4AJ4A 2O1EA 4KNWA 1UFQA 2KI5A 1RQ2A 2I62A 3Q6IA 2QVYX 5JHGB 3ZR4B 3EAFA 4BNWA 1KS2A 1OPXA 1UAGA 2XDWA 2BRUC 3TW0A 1Z2PX 4K81B 4BMXA 1ZGCA 1E2HA 2VLIA 4FX5A 3NAGA 3F6CA 3OO1A 1QP8A 2BJHA 2EFEB 2PKXA 4GYJA 3UWKA 3DCNA 3OZVA 5T4FA 3IEVA 4J0DA 5LP6B 5KOHB 3HLYA 4C7OA 2R1TA 4X20B 2AT1A 4Y6GB 4B75A 5FD8A 2OCIA 2P9HA 1ZMOA 2X0FA 1X1EA 2OC9A 3T0FA 3I9KA 4DWVA 1VIYA 3KV1A 4AXXA 5CH8A 4O4LF 4ARZB 3O2NA 2XEXA 2ZVQX 2P7IA 1CDEA 5ECGC 4JJAA 5H81A 1DEHA 2CXRA 3F71A 3UCEA 4HH4A 4GOLD 3DD5A 3DR3A 4M0EA 2ZIVB 4F7WA 4KSCA 2D1TA 2R44A 3FW1A 1D2HA 1OFGA 1QV7A 3UJHA 2FQQA 1ONPA 3I76A 4W6ZA 2WTEA 1XZHA 3E7WA 2BSQA 3FVQA 4GNRA 2PDAA 4C6TA 2ACVA 1B0UA 2BAGA 2PWPA 4XGIA 5JXIA 1LK0A 1GKIA 4LZPA 1SXPA 1Q7GA 1YZGA 1U8UA 3ZI0A 3BL8A 3O8OB 3QPBA 3QPAA 4L8GA 3HABA 3UYKA 1W2WB 4WJKB 2PFSA 2ZRFA 2FMIA 4RKEA 2GPAA 2CLKB 4DV4B 2O8EA 2AEMA 1G20E 4WKPA 3O8QA 1CD5A 1ML4A 2VPQA 4LQDA 4KKVA 4MYTA 5HPYB 3AR4A 3V8EA 1J0AA 4P32A 1EZ1A 4CM5A 3A25A 1Z88A 3ROZA 2XGJA 2NLOA 3FXAA 3WAKA 3I2FA 3Q7EA 4QJ5A 2BHLA 5SZHB 3GP3A 1ECFA 1HL7A 2RB5A 3DZDA 3EHEA 3LPAA 1Z0FA 1JZSA 2NUTB 1UJNA 1VJ5A 3L5OA 3T7JA 3NVKI 1NPYA 4LHWA 3ZKWA 2PVSA 1N5DA 3ZXUB 4G01B 1GKKA 1YOVA 3UAGA 3UPTA 2WFMA 3C45A 2IXAA 1UFKA 2QNIA 3Q40A 5CVVA 5AK4A 3SYMA 3TMAA 3NHLA 2R8BA 1MJ5A 3E53A 3RTEA 2C3UA 3I9V6 3WDMA 3EDOA 2EL9A 5TT1A 3E5HA 3J80A 2AX3A 4LWOA 1VC2A 2I7TA 4Y1EA 2QMOA 3Q4GA 1ODCA 2D1FA 5TX7A 1Y7HA 1ZH0A 2PD3A 3IERA 2AVNA 4L02A 5CVEA 1QH9A 5PGMA 1Q1ZA 2XGSA 3P19A 4YP0A 4Y3UA 1OI2A 1SHZA 3TOXA 1N9GA 5AUNB 1W8DA 3ZJTA 5JEEA 2Q3DA 2SNIE 3I6QA 2ZGVA 3HBMA 3K72B 1LJ8A 3NHSA 4PSVA 4RZSA 3UT0A 1YFLA 1PNTA 1UADA 2HM7A 2Q3BA 2QX6A 3R7LA 2EIXA 1N6OA 2REQA 4BLVA 5LZ2A 3PT9A 2PBFA 1JIQA 5JNRA 1CUUA 5EGNA 1ZU4A 1PNRA 2XYPA 5DN6D 3OJXA 1EHIA 1JT2A 2FNAA 2FSHA 1BU5A 2B94A 2OAP1 1JIIA 2OKGA 5DBGA 4OD0A 1UMBB 2QX7A 3HN2A 3H17A 3RK4A 3QFFA 4JJIA 4ZZ3A 3RARA 4GKKB 3VBEA 2EW8A 5CFRA 1G64A 4JYBA 4OXKA 2I5PO 3K94A 5I6DA 3C1AA 4HN9A 1WZCA 1ZXXA 2P1DA 4O0LA 1GHTA 7AT1A 5DTJA 3KZXA 3AL2A 5DMXA 4PSKA 1QZTA 1T24A 3PUVA 5AW8A 1DOHA 4IMIB 4B3CA 1WABA 1BS2A 4H7JA 3W5HA 4JQSA 3VYUB 4AXBA 4YUAA 5KNCA 4EA6A 4XCXA 3IHLA 3QKIA 4LGYA 2I22A 3HEAA 2WM2A 1HZZC 1OWNA 2WJWA 1TVEA 3CKYA 5LP6A 2FMHA 1K6EA 2C88A 2J7PD 2YXPX 3VOBA 2W2LD 5A4KA 3GLHA 5L7TA 2EXXA 3HZRA 2IY7A 1EIZA 4YLYA 3HI4A 3N2ZB 3FD8A 1AM4D 1N2SA 3GFGA 3IMCA 3LVRE 3OM0A 5BN5A 4NDNE 4F1KA 2RHRA 3MEQA 4GM0A 4IILA 1NF8A 4ITUA 4MV1A 2Q2WA 3NB0A 3MBOA 5EEHA 2PUAA 2EBHX 4YI3A 2R62A 1E96A 3L8CA 5DDIP 4M54A 4IDGA 2JGEA 1A9QA 4QJBA 3H5RA 4OJNA 2J3IA 3GA0A 1MVLA 4G1UC 4RD4A 4BVJA 5D01A 1Z5GA 2HRCA 5FTLA 2OSBA 3SSOA 2JCBA 3OEHD 1X8XA 5JG7A 4XW2A 4RF5A 3IUSA 4CM3A 4CKEB 3EZ7A 3IAAA 4YONB 3JAMA 1ACLA 3DBLB 2HMAA 4PPFA 4X6UA 3COJA 2IS2A 3FYCA 3R1IA 1VHJA 2IYPA 3TQOA 2R751 1RFGE 3D3EA 3VR6D 1O6CA 3R24A 2XYVA 5TLSA 4KAJA 2WMOB 1GUBA 3RANA 4A26A 3KK0A 4REMA 1JZQA 3T15A 3TI9A 3ZZTA 2ZITA 3V1UA 1TYBE 1H6AA 5DI3A 1GQQA 2OLKA 3H0KA 5DU2A 5AJXA 2Z2JA 3FFWA 2W2KA 5L3SB 1V7PC 2NXCA 2O8VA 4EA7A 4KGDA 1G2IA 2VJMA 2ZAGA 4ZVOA 5LDHA 4PZZA 3IUMA 3N8DA 4HXFB 3DVRX 1GOTA 1DIHA 4ISCA 1TO1E 1V16B 3F2VA 3EIFA 1PJBA 3L7LA 4QG7A 3K71B 1M0EA 4C1BA 1R0XA 4F8YA 1KDYA 1ZGZA 4JHLA 3KQOA 1THGA 3L92A 1SVNA 1HSZA 1ZEMA 1Z29A 3A6DA 2A5JA 2GB4A 2XMRA 1J0BA 3BRQA 4MMYB 1RJEA 3BX1A 3KB2A 4XPIB 5T41A 4Z2AA 5JCJA 2I6UA 4D92A 1DRKA 1Y4SA 5CCBA 3CLHA 1QGUB 4QL3A 4UD2A 3GL9A 3TL6A 4YPFA 4PAMA 3VNVA 2AUMA 2CJPA 1JTEA 5DX1A 5KYWA 3L79A 5I4CA 1QB8A 4IDHA 3ASYA 2ZYDA 1Z12A 4LNHA 4PIMA 3SLGA 4CFZA 3QTTA 4EH1A 1CB0A 4QELA 3FUWA 5HG0A 3RH0A 5HS6A 4QATA 1IUOA 2ZE5A 1N2CE 4BEWA 2EG9A 2WSSA 2A59A 3MT7A 1LI7A 3P27A 1Z4NA 4S0ZA 2NZWA 1BMFA 3IJEB 5HTOA 1GL6A 1QBKC 1BNCA 4O02B 1ZVKA 4FNAA 4YO8A 3FYSA 4PXSA 4JVSB 1GXSB 5MDHA 1NPTO 2Y1DA 3W2GA 2V6GA 4LK3A 2A6PA 4J3FA 4UU1A 5AM1A 3RF6A 2O2EA 1NJ8A 1T6XA 4D4LA 1CC1S 2GK3A 2ZJYA 1Z4IA 1K9SA 1M76A 4J0GA 3ZE1B 2BTEA 2IDKA 2WYOA 5TY0A 3V46A 1WG8A 3OT1B 2B21A 2E21A 1M7HA 3HCDA 1BMQA 1W4CA 1OJLA 2A5DA 2ZBPA 3PSAA 3C48A 4NDZA 5KVVA 3ZWPA 2CUTA 3K9LA 5HIAA 4DHWA 4MYCA 5CLGA 1M8PA 1ZR2A 1P77A 2AHOA 2KS6A 4X1IB 3UYLA 4MDHA 5A3JA 1YFKA 1NIJA 3U4HA 3RS3A 3SJBA 3LDAA 5CG2A 1ZPDA 5JDIA 5HF9A 1F1JA 3KPJA 1NUQA 1NVMB 3OBBA 5EZYB 3KOYA 3BGOS 4CLRB 3ZWVA 3V4PB 4DILA 4EB8A 4YT2A 4GC5A 3WTCA 2WB4A 4NZOA 4C0WA 1KARA 4P92A 4R0NA 1X70A 2WI8A 5EP3A 5C80A 4ZYLA 4URXR 1VCNA 4M0FA 1T8SA 5ES4B 2F3TA 4QG3A 3IE0A 4YP5A 2QRQA 2B4TO 4RLHA 1WTCA 5M7EA 3N05A 2IEAA 2C07A 1D1TA 4MKGA 5EP2A 5EC8A 1AKUA 3I05A 2WHYA 4ZQEA 2ZS7A 2BT4A 4DB4A 2ODTX 1JEDA 1OWOA 3LUDA 1GADO 1GR1A 2FF5A 1Z36A 5GONF 2GCNA 3WO1A 1CDDA 2BUCA 3F9IA 4F1WA 5A4FS 1QRDA 1RKQA 2W90A 2I7DA 4G5OA 1CZKA 4TOIA 5CHEA 4QEKA 4MRRA 4B79A 2LPMA 2G88A 3ZY5A 1I7NA 1Z06A 3I9OA 1FXSA 2FW0A 2IYNA 3EC7A 3MPUA 1J6UA 4CR7A 2HA7A 1R6UA 1S8OA 4QUDA 2VXOA 3I73A 5EJ8A 2PX6A 1WMFA 3AUTA 1P7VA 2OO5A 1QIFA 2XVZA 2Z83A 3IQFA 2R47A 2CFRA 3CRZA 3PYXA 4JUIA 4C2AA 4F45A 1E66A 1R0YA 4A23A 4TL7A 1ZD9A 1HE1C 4IFTA 5BW5A 4XASA 2Y99A 2FX5A 3RJMA 4RXUA 4BBJA 621PA 2ZTVA 4P81A 3BFVA 4RAOA 1B74A 2P27A 3IUPA 3TW8A 4B7AA 2GT1A 2EJUA 4YUXA 4UEQA 4KXQA 3PFWO 4DQLA 3D02A 1U11A 3LG2A 3DFFA 4A7PA 3WB9A 5FYQA 4YMVA 2P2YA 1G5PA 3NT5A 4L0CA 3LCJA 2ZFUA 2FN7A 5I7EA 1Y5RA 5L3QB 4KFRA 3QJYA 1Z3CA 3F5DA 5TS2A 3VSAA 2JF0A 4IGAA 3CR8A 3OPVA 5GGYA 1W4RA 1MUUA 1FTNA 3VPSA 4CMCA 1YR3A 4CKZA 4FFNA 5IM4F 4IGFA 2MMGA 3Q7PA 5KCZA 1YQTA 2B92A 2A5LA 1RJGA 2XV1A 4TTJA 3HB9A 5KYYA 2XQIA 3I5MA 4FC6A 5KSWB 4HDMA 1YQ9A 2DLNA 4W63A 1P1JA 4NU0A 4N41A 3QWIA 3L7YA 4NBVA 2XWJI 3CLSD 2ZI3A 3CT4A 3DWFA 1Z07A 4LXIA 4BV9A 2DFDA 3VHXB 1K75A 2QENA 5DTMA 1KI8A 3SG0A 3UK0A 5ALPA 1L8OA 3DL7A 2W9XA 3P9QA 2W2QA 1U2ZA 4P31A 1FFEA 3IHWA 4Z1MA 4BE9A 4EARA 3DFKA 1DFIA 1EPUA 1XT6A 1T3HA 3R3ZA 1E32A 4NDAA 4XYMA 5B58T 5L9AA 1JIVA 5FAKA 4ZVKA 5F2KA 3H0EA 1NA5A 1XTPA 1BMTA 4PPNA 4IHAA 9MHTA 1D04A 2GKSA 4UBMA 3U7QB 4BLUA 4MV5A 4KWIA 3E6AA 3PQ5A 1WJGA 4DDHA 1LLUA 2XE4A 1OHHA 3BWEA 3GLVA 3WOHA 1D5CA 1O9GA 2Z9BA 3FA2A 4JCCA 4GQIA 4KKXB 1FYWA 3WBBA 3K70C 3KQKA 3JVEA 4ESHA 5ECDA 2A5FA 2CW5A 4KUHA 1P2GA 5FNVA 3VHRA 3WNBA 3PC8A 4RORA 3IDSA 1ZN2A 2XYRA 1P1HA 1OA0A 1MRZA 1DSSG 2X86A 2ZI7A 1AD2A 1ZL0A 3HP4A 1ZJZA 3BICA 3V32A 4DLZA 2QP3A 2AMJA 3SQMA 1D7OA 5E6SB 1YI1A 4KQXA 2JCVA 4OFWA 2CNWA 4BQRA 4ZIRB 4D9KA 4DTIA 2GRUA 1IWBB 3T9BA 2WV9A 3RUDA 4OHKA 3DYIA 2LKDA 1U5BB 3BGIA 1Q21A 3IULA 1R6BX 3V3KA 1PK8A 1DP4A 1PJSA 2H11A 2FSIA 4EY8A 5B7PA 1J5EB 3ZHTA 5DX8A 1G8JA 3DC2A 4YRFA 1LQTA 1VE6A 4YAUA 3K73O 2JCGA 4WXHA 1C9KA 2E4UA 1Z17A 1IOZA 1K7CA 2FEAA 2PL1A 2QYSA 2YWRA 4HBZA 3TOVA 2JHCA 4OHVA 3FJYA 3ORRA 4P34A 2P9EA 3W05A 4CN8A 1KNQA 1O94A 2FPLA 4FLEA 1ZHFA 2DVMA 2HPZA 3MUOA 5E7QA 5BOVA 3UHOA 3RO7A 4AY6A 1JPJA 3F5MA 2ZATA 4LDJA 1H65A 4L74A 4YNBA 3WFIA 3Q3IA 5E2IA 1FVOA 1AMNA 1E1MA 1JPNA 2A9FA 2JAUA 1VMKA 4O3MA 5CNJA 2OCKA 4B7XA 3QKSA 4B4WA 4TQ9A 2DECA 2PCJA 1O8BA 4HZGA 3GMTA 2F3SA 1R7RA 1G8HA 3FLBA 4ON9A 2IY8A 3X3HA 4C9BA 3WLAA 3IDOA 1FLVA 2MR5A 1FRFS 3MQ2A 4Y98A 1O95D 5FNZA 4ZEXA 4DWOA 3BSYA 3DQPA 3R5SA 1PR9A 3ZN2A 3GN2A 2VYVD 1ATZA 4RTKA 3DXFA 1KJIA 3D6TB 3EGXA 4XLTA 2ISSD 4ZDKA 5KJ1A 3V1MA 1MD9A 2W00A 1RAFA 3HUUA 1QK3A 3KPVA 4ID3A 3L43A 3OZSA 4JITA 5HYVA 1VL2A 4LQCA 4NMMA 3KR9A 2BCJQ 1GT91 2H4YA 4KPUB 5FQNA 2YN2A 3B6KA 1SBTA 2R7MA 2C78A 1F8FA 3EULA 4BQQA 5HSGA 2E7ZA 1J7JA 3OI7A 3ROFA 2VR1A 3WGHA 1LDNA 3B1JA 4YB8A 4QOJA 2VO1A 3E0QA 1N33B 4QTTB 2PKQO 3Q8WA 5AKYA 1GU1A 3SLKA 3KQYA 5T57A 1D1SA 2YXDA 2WUVA 3GMSA 3FCSB 1VHDA 3LMKA 3NVAA 3R0VA 4BGUA 5LIPA 1M1YE 3THWB 2DBRA 4PNZA 4QXOA 4M0DA 4QJ4A 2ZE6A 1T1JA 3A6PC 2YHSA 3N2YA 3T0GA 2J85A 3GDOA 4Z86A 5C7IO 3PGVA 4UTVA 9GPBA 1EE1A 4R0VA 1G3IA 2RH8A 4YA6A 1NUAA 3N39C 2BGRA 3L8EA 2YIJA 2ID8A 3B1VA 4JL8A 2VUTA 3KJFA 1OYOA 1J22A 3GEMA 3LCMA 2HA6A 4Q47A 3VNSA 2CFIA 4AO6A 10MHA 4G1BA 3GZTB 4ZMRA 5JUWA 3H42B 4C0JA 1JSCA 1Z2OX 2WSMA 2HMWA 4ALMA 4F2PA 2CJFA 1FP4A 1N2OA 4QBGB 1RHMA 1A5AB 3HB7A 2XSZD 5FI3A 4B85A 2ZRPA 3T1TA 3ND7A 2OHVA 5BMOA 1RR6A 1TQDA 5PNTA 4OSEA 2Q6OA 1PZMA 3ROPA 4IJMA 5LXTB 1HL3A 4EYKA 5ENVA 5CBPA 1NM5A 3AP1A 4TSFA 3WP0A 2GCIA 4DXAA 4S1NA 5LD2B 2K7FA 2LTAA 1ZCBA 4IIDA 3NXKA 4ZPJA 2C5EA 1QGUA 3DMDA 2GM4A 2CLOB 1LC3A 1PNQA 3CZCA 5E95A 3ZCRA 1MG0A 1US8B 4KQKA 4MUKA 4RJLA 1DDGA 1SBHA 3VU3A 5D86A 4B35A 5JR3A 4G4SP 2A1TR 4LJKA 5DW3A 4FU0A 2AYYA 1G4UR 2DULA 1YE5A 3COPA 3EQ6A 1I6KA 1GRCA 4FYIA 3BIXA 1NJFA 4PTYA 5CB0A 4QQFA 4OVKA 2VYQA 2IX3A 1Q91A 3G5TA 5TPWA 3OJOA 4KMMA 4G5YA 2DY1A 1CB7A 1B00A 3VTFA 3LHIA 4CIDA 5FX2A 1JQLB 1UXGA 2H63A 3PLNA 2YHBA 3ELBA 4IHKA 2VJPA 1P0IA 4XJVA 1KDOA 4GU5A 2B37A 3ESRA 4N7MA 4EJSC 1U3GA 2KBEA 3ME5A 3AQIA 3F73A 1ARZA 1UZUA 1G3MA 5AW7A 1G21B 2IU4A 5BRNA 3UATA 2PJRA 1IK4A 4MCHA 3B1KA 1T25A 2ZTMA 3N7TA 3NHAA 4MP6A 1F4LA 3FSEA 4ZI7F 3IA2A 3R20A 2X8WA 2IEDA 4IDOA 5C1DA 2J0SA 3WL6A 3TSWA 1BXRB 2UZ1A 2ZB3A 3NOVA 2LR0A 1WNFA 1BXKA 1OSNA 1I7LA 2Y68A 3CW2A 1OJ7A 3OCUA 4PYKA 3WG9A 2BFWA 1U8FO 1G4AE 3LECA 1E0DA 4MMXB 5J40A 3HYTA 4ZRDA 1GD1O 1UFRA 3L8DA 5L7YA 421PA 1I80A 4IIHA 5AUQA 1IBKB 4GR9A 2EV9A 3UAWA 5GADl 5JEDA 4TT8A 3GZJA 2H5EA 3HR8A 3KFLA 1QG6A 5TNXA 1VPVA 4E3WA 1NY5A 3L6BA 4YFVA 1L4FA 4CG2A 3GLQA 3DE6X 2DG2A 1DXQA 3WHLA 3QMMA 9ABPA 5JXGA 4YAWA 4ZYZA 3MJVA 2JBHA 1KZGB 1QHHA 3R3SA 1SCUA 4AIRA 3MWGA 1J70A 4YCMA 1J99A 1OX6A 2CJWB 2YNMD 3NZEA 2H1WA 1ETHA 2ZDGA 2D5CA 2ZBQA 3UH0A 4ZYXA 3TNDA 3WGIA 1PR5A 2P9JA 3DVAA 4DEXA 5LZ4A 4CGZA 3FNFA 5UKDA 2AR0A 3O84A 3OJ0A 4HFRA 3STHA 1F9EA 1WDTA 3LUKA 1U9JA 4HDRB 3NW9A 2DHRA 4MKXA 2OUKA 2P1ZA 4INOA 5JANA 5BV8A 1J21A 1WEHA 2QRKA 1LJUA 3MM4A 2YHUA 3VI4B 4MUGA 2H00A 2CXXA 4EVRA 2LXNA 2R6HA 1XTKA 4AMVA 3STUA 4NCAA 3C43A 3RODA 5JS7A 3SGLA 1KZ9A 1TGVA 4YAGA 1TQ6A 1P2TA 3ID6C 1BKSB 1OX4A 1P9NA 1KA9H 1UJ2A 4AZ3A 4TMTA 2TMYA 3KVOA 3K9NA 3TXAA 4RA9B 4BGVA 4DNQA 4DV7B 3RAGA 1FP1D 3Q7SA 1CPYA 1ECJA 2CXPA 5EQDA 3ITEA 1WCXA 1TX4B 3L4JA 1R5JA 4GMFA 3RC9A 3B3GA 4Z0PA 4LE0A 4WY5A 3C98A 1XNRB 5EVJA 4XB2A 2C4WA 1LZKA 5BV0A 4IDBA 4FEEA 2DY0A 3UBTA 4IRXA 1O1YA 1E2QA 5AJWA 1XEXA 1IY2A 2PMBA 4W9NA 1ZRNA 1JQAA 3LFTA 5DW0A 1MVNA 3NWBA 3VPXA 1OH8A 3HCCA 1Q0ZA 2JIPA 1T36B 4ARCA 4DR6B 3PKZA 3UENA 1QM5A 1CRQA 2OE2A 2VZ8A 4BS9A 4DIOA 5LDDC 4W9RA 3I64A 4A1OA 2X41A 1T9ZA 3V7YA 4KGVA 2SHKA 4GXRA 4KO3S 3DL0A 4LHYA 3SX2A 5J63A 5KTMA 1IY9A 1M2VB 2JVJA 2XR1A 1QLHA 4FONA 4IZ6A 4R3WA 4S24A 4WCFA 3ZDFA 4YT4A 5HA5A 4DRYA 3DLHA 5BSRA 2VDMB 4B46A 1VMIA 3ZEAA 1QP4A 5DYWA 2FUG1 3CG4A 4EO4A 1L9XA 2VSQA 1FDTA 3GJ5A 5GV8A 1KOFA 2AJBA 4LCEA 1KKMA 3TUJC 5EZYA 3WMWA 2Y93A 2O6LA 5IW8A 1PGNA 3J7AC 2IHJA 3JQ6A 5HQJA 4EF4A 1NBAA 1WUJS 1G20A 2MSLA 3RNLA 2ZUSA 3OO0A 1E1RA 3AEXA 4L0QA 4PE5B 3EFBA 1NVBA 3DZ8A 4G8CA 2D59A 3EE6A 4MS4A 3IQGX 3RT7A 3ZNOA 2OHGA 1Y6QA 3AUFA 4MDEA 5JATA 2P69A 3PYLA 4OQZA 1XZIA 2WHRA 3TEFA 4H1WA 3AVQA 2C2GA 3R9IA 1ESCA 1GDDA 3M5CA 4Q5IA 1NSTA 2ILTA 4HGZA 3HA3A 2CUKA 4EJFA 2C00A 5ARCA 1OILA 3W5BA 1ZRSA 4ED9A 3B7WA 3L1JA 1TPZA 2EKQA 5KUTA 1BN6A 1KU6A 1NIPA 1T36A 1CJKC 3D54D 1WP9A 2YQ4A 3P5SA 4OP3A 3BB3A 4ROSA 3QSYA 3CVWA 1M6YA 2ID4A 2PUJA 1U8AA 1XEXB 4KODA 3LX6A 2C2HA 3QP9A 1LNZA 1M73E 3LX4A 2O6HA 2AKEA 1MCZA 3WZLA 2JGDA 1H9CA 4PU0A 1IEQA 4HH0A 1I30A 2GPJA 2XQJA 1O0BA 3QE3A 3QWAA 1E9BA 2RHGB 1JJIA 4ZPXA 3QLTA 1PR3A 1CZUA 2D1SA 5FUVA 3W9BA 3K0SA 2R5FA 1H2HA 3CQ9A 4X8HA 1I8TA 2YUTA 3VO1A 4B4UA 4D8XA 3WYAA 2PGAA 2QMUA 3E3NA 4LOLA 4EJSA 5CG1A 4LWQA 3HYSA 5ER9A 4OM8A 4OMFG 4TZ0A 1GILA 16PKA 4QZVA 2IP2A 2UUCB 3U31A 1YRHA 1A4XA 4ESOA 2GAAA 5IH7A 2XODA 1EVEA 2EFGA 5BUQA 3BQNB 3PE4A 2R1VA 4E07A 1CHNA 4NK4A 4ZD6A 1BW9A 2QUHA 5H8WA 4M1MA 1PJ3A 3NAQA 2DQSA 1XCOA 1SCQA 5JQGA 3AB3A 4NOKA 1KP3A 4DMLA 2RK4A 1CULC 1ESMA 4OQLA 3G1TA 2X2FA 2PL9A 1MV5A 2W58A 4EOGA 4KLRA 4C21A 1K7EB 3S2GA 4L27A 4BLTA 2C98A 4JQOA 1JKIA 1ULHA 3A1EA 1SCUB 3W79A 1P4GA 3RBXA 1FFXA 2ZVPX 1KK3A 4ZCIA 5ED4A 4EJSB 3K0AB 4BFVA 2IL1A 3HUDA 4BTEA 4JXXA 1ZM4A 3LDUA 2AZMA 1GNTA 1JU3A 3G2IA 3MF4A 1F8YA 1WZEA 2DQKA 3LQRA 4FBMA 4HFNA 3RSCA 1N6HA 4Y18A 2GJAA 2XVMA 4YYZA 4WOPA 3SQWA 2VBGA 1RJDA 3AY0A 4HN2A 3LQKA 4FB4A 4KXNA 6CHYA 1L5QA 4XTCS 1GQYA 3AWDA 2P3SA 2PYZA 2GNOA 3Q8XB 3C5VA 4JNCA 4L9WA 3UHAA 3H9CA 4DEVA 1SCBA 2EARA 4CJXA 5JADA 5EE1A 1ODLA 4LHXA 3OCWA 2UZ1B 3D8HA 1CYDA 5DCYA 1C81A 4EGSA 5JNLA 3TUIC 3EXG1 2FKNA 4F56A 3R0JA 1LBHA 1W2GA 2R9VA 1GRVA 2GH1A 5JSZB 1JW9B 4C3OB 2H2WA 5C35A 5DLDA 4FMDF 5DNEA 3VUFA 1T4MA 4QU5A 4R5HA 4FS8A 4RFSB 2GD1O 4Y2PA 4TV8F 3VPFA 5KYTA 4F6RB 4QVIA 3A4YA 5E6UB 1ENYA 3URKA 1J1ZA 4ZOBA 3V4SA 4KNYA 3DE1X 1LX7A 4P54A 2KYRA 4L22A 4CKXA 1BSVA 4TLEA 3SS7X 5IBPA 4BV8A 3AUUA 4NBKA 2J3HA 1ODTC 4QYSA 1M2OB 1MO6A 3LVBA 3QI7A 5D3MA 2HIHA 4GI2A 1F0PA 4OAOA 5LA6A 2JGMA 4IEFB 1PI3A 2EC5A 1P5HA 2ICAA 3DE2X 3JZMA 4NV1A 1HFKA 2VWGA 4QDZA 2JVKA 2ZBFA 1RMYA 4BO2A 5T5QA 3P9PA 3G9XA 1QHEA 1RWVA 2NYVA 1HT0A 2QRJA 3QUQA 3EN0A 3LZCA 1T3GA 4WTOA 4ACBA 2XVAA 3RUFA 1WXFA 3QX9A 1T34A 2IWRA 3SFTA 5EIOA 3VU0A 3ZX4A 1RI4A 3GUCA 4B4KA 4JMPA 1H05A 3BRCA 3OIVA 4JELA 5TXGA 1K4KA 2DAPA 2R66A 2AFIE 5CNKA 4LDPA 4AT1A 4UTPA 5B6JA 1Y8ZA 5EIFA 2FDXA 1YJXA 1N77A 4I1IA 4N5IX 3EZ6A 4ALJA 2Q3JA 5GVRA 2VP9A 1QQ7A 2IHUA 2VUHB 3KJZA 3NUGA 3P20A 4N0QA 4Z9AA 5I47A 1OKKA 2QLMA 1HA3A 1J8QA 1QFYA 2J6HA 1WXDA 3GK3A 4I6JA 2EVWX 4EYEA 5KNDH 3GRAA 3W5IA 4IICA 4GXNA 2BGNA 2E48A 2AXPA 3GPCA 2VA9A 3FTCA 4QVGA 5A4JA 3TVTA 2YDYA 1UJ5A 1LBTA 3FYHA 4CMEA 1TEZA 4U0JA 3HJGA 3H19A 3EXEA 3FVTA 1C7IA 2FJPA 4UUPA 2V5AA 2RHMA 4OQ4A 3VTZA 1YK0A 1IN6A 1F3OA 3R8XA 1ZUD1 3MTBA 2A57A 3NV9A 5FL3A 3TZKA 3IGFA 3VI3B 3ZGLA 2IZ6A 4RV9A 1J2UA 1NVWQ 2BD0A 4BMYA 3DC7A 1H5UA 5CIYA 2HBRA 2PPVA 4XSGA 5IZ4A 1M2FA 2FXVA 2QJTA 1V35A 3QVKA 2P4QA 4UHDA 3R7BA 5JIBA 1DRVA 2ZUVA 2JGRA 3AI7A 5KINB 2XE6A 3RUAA 3LIPA 5JAMA 5A3VA 2QQ5A 2UAGA 3VXKA 4PX3A 1XQ6A 3LGSA 2FFJA 3DO5A 1DCFA 4HAWA 4EA8A 3OQIA 2GFIA 1NI4B 3MTQA 3IAXA 2G1PA 3IBTA 3A37A 4BV2A 4RELA 2L18A 2CVPA 5DK4A 3KBOA 2BISA 2CMKA 2YTZA 3GZ4A 4ZXFA 5SY9A 1RNLA 2HA0A 2GXAA 4K6GA 3OEEA 1WULS 2OHHA 4FD3A 1A27A 1QTNA 1Y6JA 4BFXA 3Q9NA 4EFNA 4ZTUB 4WDRA 2W5UA 3SAJA 1AGNA 1A7UA 1WU7A 4MPPA 1E3MA 1DRWA 1E64A 3B9BA 1WV0A 1JU4A 4NE7A 2VNAA 3AUXA 1N8KA 1NLUA 2OP1A 1QLJA 3DMTA 3IBFA 3QUSA 5H3HA 4LHVA 5B2FA 2CV2A 3H9BA 2WE7A 3AL3A 1E6UA 1I4DD 3FLEA 4YEDA 4KYIB 1C1HA 1G98A 3A1WA 1EVQA 1QANA 2L0XA 1ZNWA 4PSDA 1E98A 1HLDA 4D4JA 3GG2A 4BC1A 5JNWA 1IHXA 4AZWA 1X1DA 4X7RA 1J33A 4EB3A 1KJ8A 4HB2A 1KJJA 4YX9A 1Q57A 1X92A 3L6EA 1FFWA 4WKNA 2F64A 2QU8A 5DB4A 1GVNB 1KK1A 1CIVA 1QTIA 1L5VA 3DNFA 3H11B 4KBGA 4L9RA 4P3PA 4LF4B 3MRVA 5IDYA 4EL5A 4M1YA 4QDOA 2JFWA 5HIMA 4B6OA 1U63A 2QROA 1R8JA 1R4NA 2RBGA 4X95A 1G59A 3ZDZB 1ZUNB 1WAMA 4C0QC 2Z6UA 3EVCA 1NU6A 4MEBA 1KYWA 3ND5A 4PGAA 3WQBA 2P1RA 4HV4A 1UIRA 3AL0C 5G3YA 1PK9A 3GJ3A 4PYQA 1TYZA 4A6EA 1P1BA 2QQGA 4JP1A 5ES3A 5TMDA 5A5DA 5ESRA 3PJFA 5KYUA 5TPWB 4A6PA 4PLYA 1V11A 3CISA 4E03A 2ZUUA 1YB6A 3QUBA 4IJUA 2NUAB 3BWCA 1Y98A 3R0QA 3E8SA 2E4ZA 4MVYA 3UIEA 5K0EA 1WCIA 4DLUA 1DBQA 3AINA 4RV5A 5GZ3A 1LPSA 4XDZA 4ENSA 1FJ2A 1LS1A 3PFFA 3H11A 4L4RA 5E38A 1Z2CA 1U0JA 5C9ZA 3RASA 1FNSA 1FUKA 2I2FA 4FWIB 4JSYA 1D2CA 2PMFA 3CZ4A 4OB8A 1Z08A 1LDYA 3DHVA 4OV6B 2JKYA 3OLZA 2HO4A 3HDHA 2OV6A 3PA8A 4CNBA 4G9GA 3PD7A 4HAIA 1PVOA 2YJ6A 4LMPA 4LDZA 5LQUA 3FSGA 3WK8A 1FTSA 5LYYA 1I10A 2GTPA 2NWQA 4I5IA 3TI7A 4MINA 2H52A 4H2DA 2AE1A 3KAQA 1QX3A 2Q7OE 2ORIA 3OM9A 3L82B 1U1FA 5J47A 5LKRA 4F3YA 5BSWA 1EUDB 4QTYA 2V3VA 2YWJA 4E33A 4DSTA 1E58A 1VJRA 4YRBA 3KUDA 3EPHA 3E5NA 3VR1A 1JKFA 2AG0A 2E4YA 3HGTA 3OU7A 3OUUA 5KYVA 1YOBA 1R27A 4MO2A 3SYLA 4FGKA 5FKJA 5KHOC 2AF3C 2X4LA 2W11A 4L8YA 1N4DA 2GN2A 1E2PA 2J3LA 3N0XA 1W5TA 2BKEA 1T1EA 4MV7A 4EG6A 4BEVA 1ZK0A 1Q17A 3K7EA 1NI4A 2P4SA 1DUSA 1P3JA 2BKAA 2F1OA 2CJXA 1D6NA 2UYYA 2WYIA 3KOUA 3DXYA 3GJ7A 3W2FA 5AVWA 4C0HA 1KU0A 3B20A 2ZYUX 2B4RO 3BK1A 3IT1A 3MTAA 4KPUA 3D0RA 1M34A 2YFHA 3OAAA 1PJAA 1DLIA 1NL3A 5JXHA 4OMUA 3M34A 4KWEA 4YMLA 2XCQA 5CURA 1OGYA 2ADOA 4IIJA 5HRCA 5KJCA 2IGBA 2X6TA 1P74A 2AQIA 3OSUA 1IM5A 4PLGA 4WKCA 3NASA 5I9TA 5L7WA 3TJZA 4EP1A 2O23A 2K5UA 4KIUA 5IMBA 4AF7A 4IMJB 1DAIA 4IV5A 2RI6A 3VTKA 4AWBA 2GM5A 2J08A 3NH6A 5DHSA 2VJLA 3ONVA 4KE7A 3ROGA 4LRQA 1G6KA 2GXQA 5EESA 1T8UA 4Z4CA 2V6JA 4GLLA 5KNBD 5EN4A 1CR1A 5DSXA 3BPSA 4I4NA 4Y2XA 4YECA 4D9FA 3A36A 3FPGA 2HF7A 2IPXA 1II8B 2X0RA 3KXKA 3RROA 1O7JA 4MNTA 3KVRA 4IVPA 1QJCA 3QG1A 1LZLA 2BGLA 3EA0A 1S5PA 4NX2A 4Y9DA 1YRQA 3CKMA 4QUKA 1U3FA 2XB8A 4D8TA 2PEYA 3LCCA 1S1CA 1YQEA 3M1IA 2IU3A 3PEFA 4JDPA 1WY7A 3QH4A 1RM5A 1XKLA 2VPWA 4MCIA 3TTSA 1LDBA 1QONA 1RQLA 5ALYA 2C4MA 1JFSA 2O1WA 3L0SA 1WUIS 4W5QA 3PQFA 1ZYUA 4LYFA 2QUIA 3VZBA 5TQ0B 3IOEA 3CCBA 5BMVA 3LPLA 4WERA 4GBED 2P8JA 1XQ9A 3PFGA 2V96A 1ZINA 4HCJA 2NO4A 3WLLA 2HJVA 2CNWD 4Y9RA 3RVSA 2NZVG 4WCDA 4KPEC 3A8TA 2NUAA 1NVFA 4FEGA 1SCAA 4PXYA 3TSZA 1LBEA 3RVJA 2BMDA 4BY9E 2SKEA 3GP8A 2DTEA 4J3NA 1E6LA 2HRRA 4RL6A 1A4RA 3EIEA 3GJ4A 2JNWA 1OAOA 1EFCA 1XZLA 3C8DA 3UAZA 1RCUA 3LRPA 3FPJA 2FWNA 3MCVA 4ISBA 2Y0BA 1W88B 3DZBA 2IZ7A 1M6HA 2X8LA 3DMHA 2H0RA 4W5TA 2XUOA 3ZHSA 1RXUA 2YKGA 1M5TA 1M7BA 2R7NA 3EGDB 3JQQA 4FYKA 3K4PA 4BHTA 5A7HA 1U4NA 4WINA 4YRKA 1USVA 3AHCA 1U6JA 1FUIA 1V5EA 1F7VA 2C1EA 4YCCA 1FJXA 2E37A 3DF7A 4HQ0A 4JBWA 1V2GA 1XRPA 2JZCA 5FLYA 3BE8A 1ZNQO 2WFAA 2GASA 3GGGA 2OGSA 1PG2A 3MJTA 4K1LA 4QGGA 3TLJA 5FV4A 1JQ5A 3OZCA 4HUJA 5AM2A 4CL2A 1HKHA 3EMKA 3W06A 4FI3F 2UXCB 1N78A 4UTRA 4NYMR 2F9FA 4LJ5A 4W5OA 3N2NA 1PQYA 1Q0QA 3OP4A 4NFSA 5BNIA 1FBNA 3NC4A 3HA5A 5C81A 1E4YA 5F5XA 1GL7A 1Y3BE 2QTRA 4TTIA 4H7PA 2A67A 2H18A 3O3MB 3M8KA 3OTWA 4CF3A 1I4TD 2ZBUA 1Y1RA 2W22A 1LH0A 1BWQA 3D2LA 1JH9A 2FZKA 4TZTA 3BREA 4PLVA 4OLJA 3CNLA 3IPCA 5CDUA 3NG1A 5I9SA 5KYYB 2FH5B 1RI5A 4LTNA 1ZD4A 2C42A 3TZBA 3R6TA 3KZ1E 4IF6A 3FYUA 4UFOA 4ZO4A 2J5XA 4R1SA 5EIBD 1SK8A 4FJ0A 4CU5A 4JXJA 4R2LA 1Q12A 2EERA 2WJZB 3I1IA 4QDUA 2OXEA 3L4BA 3QE0A 1GPDG 1ESZA 1ZVJA 3AF4A 4L95C 2H3EA 3HDJA 5AW1A 4QAQA 3TW8B 4AQ7A 2XQFA 1LV8A 3LUFA 4KQWA 3VR3D 2ABWA 2FLWA 3KELA 3OQIB 2JLUA 2IKQA 5KTPA 4NFYA 4G63A 1LXCA 2JAWA 3TKLA 1MRSA 4O2BB 1SXQA 3LT2A 5KNBA 5GWXA 2VCHA 2OVBA 1Y34E 1ABFA 3L46A 1U7UA 4JUAA 2WQZA 4OP1A 4PFKA 5AW5A 4EHFA 1T9GS 5EJ9A 1MEOA 2X8JB 4TXMA 2VHUA 2ZZKA 2X0NA 3R6LA 6ADHA 2C3OA 3ETDA 5JYDA 1SIUA 5EE3A 2QDXA 3N7AA 1X42A 2DGDA 1BEEA 1GJRA 4FNGA 2OQ2A 4A0RA 3D8TA 3OZDA 1RXYA 5AJVB 4BVBA 4RK5A 1G3UA 3DZJA 3HRHA 4OXYA 2VHEA 3I09A 5BP7A 3O82A 2JLWA 1QZUA 4NF2A 3QE2A 2CV0A 1MAWA 3LH5A 4PYMA 3LA8A 1DVRA 2GPYA 4BNUA 1ID1A 2QDKA 3G5AA 3IDFA 5TVGA 4G5QA 1YGPA 4J0IA 5JJKA 3JD4A 3KLMX 3N6XA 1VBKA 3OPYI 1S01A 4L2IB 4PLTA 2ODAA 4R2WA 4URHA 2ZT6A 4I66A 2FSFA 4ARIA 1V9CA 1FB5A 5EHQA 3IXLA 1U3TA 5G0TA 1KK2A 3ZDCA 1P7YA 3DL4A 1GPLA 5K8JB 5DK6A 1E3WA 2OLEA 3AEYA 2HLPA 2WD7B 3SNHA 4WBNF 3H5WA 3M9XA 4BGDA 5ED0A 4E30A 1P7CA 4KE8A 2UXDB 2ZRLA 5HFAA 4DUYB 1YKGA 3O8CA 4ZJPA 5AW9A 5I7UA 1AKMA 2QUAA 3K0FA 3OCXA 1SKAA 4HNAA 3C6MA 2HMTA 5CK4A 5HJEA 3NBZC 1E3LA 1EU1A 1LPBB 3O8RA 2J9RA 1GARA 3HZHA 4OJMX 4KBFA 1Z0DA 3WNVA 1HEUA 2YR0A 4FYWA 4MS4B 2DU8A 1XLVA 2X0KA 3L0BA 2JAPA 2P67A 3KE9A 1TEHA 2H4WA 2O4UX 4MZXA 2H1FA 4RW0A 5ECYA 4F8JA 3ZCPA 3ZV6A 3GCWA 4ZOLA 5HJ2A 2JBWA 3BTVA 3LWBA 1PDWA 3N2EA 4FCWA 2QTWB 2ID7A 3TDNA 4OJQA 3DZIA 4Y2HA 2HCJB 1O5TA 4NLLA 5ALDA 2V8BA 3ZV7A 3ZDQA 4Q93A 1AV7A 4E13A 2R86A