2DUJA

Crystal structure of the complex formed between proteinase k and a synthetic peptide leu-leu-phe-asn-asp at 1.67 a resolution
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
279
structure length
279
Chain Sequence
AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTDILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proteinase K
publication title Crystal structure of the complex of proteinase K with a specific lactoferrin peptide Val-Leu-Leu-His at 1.93 A resolution
rcsb
molecule tags Hydrolase
total genus 97
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2006-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 2dujA00
1OYVA 1SBNE 1SH7A 3ZXXA 1HT3A 4RYDA 2W2NA 3EE6A 3QMPA 2WUWE 4DWWA 2W2QA 1R64A 3DE0X 1DUIA 1VSBA 1KE1A 1Y4AE 1YJCA 1TM4E 3DVSX 1GNVA 4C3UA 3H42B 1BH6A 4JP8A 3DDZX 3WIUA 3P5BA 1CSEE 3D43A 4ZOQI 1EA7A 1GTG1 4KB5A 1SCJA 3GT4A 1KDYA 3VYVA 1C9JA 2PWAA 2Z2XA 4OMCA 1TK2A 2XRMA 3SQOA 1TO1E 3LPAA 4OMDA 4AKSA 1TO2E 2Z2ZA 3VV3A 3TECE 1WSDA 1ZVKA 3DE6X 1SUBA 1SUPA 1R6VA 1ST3A 1Y34E 1SBTA 1NDQA 4C3VA 1P7VA 2ZRQA 4YN3A 2DP4E 4LVOA 1SBCA 2ST1A 2P4EA 3DWEX 1GTL1 2Z58A 2G4VA 5JXGA 4CFZA 1MPTA 1GTJ1 4NE7A 3BGOS 1ZVJA 1AF4A 1JEAA 1NLUA 2WUVA 2Z56A 3OSZA 3PRKE 1KDZA 4KPGA 3GCXA 1OYOA 3DE4X 5AQEA 4DJ5X 5CW1A 4M1ZA 1BFKA 3EIFA 1S02A 4HVLA 2Z30A 2PQ2A 3D9QX 4AKTA 4LVNA 2E1PA 1T1GA 1DBIA 1XF1A 1P8JA 1Y33E 4NE9A 4Z2AA 1PTKA 3WQBA 3F7OA 1CNMA 3F49S 4H6VA 1GA6A 1AV7A 1NDUA 1SN7A 1TM3E 2W2OA 1WVMA 2ID8A 1S01A 2ZWPA 3VSBA 1AQNA 4CFYA 1SIBE 2DUJA 1A2QA 3SICE 2W2PA 3DVRX 4H6XA 2IY9A 1YJAA 1C9NA 1SUEA 2SECE 4MZDA 4H6WA 1WMEA 1UBNA 1THMA 3TI7A 1GA4A 3I34X 1SVNA 2WWTA 5JXIA 3AFGA 1SCDA 3VV2A 1SCBA 1S2NA 2V8BA 3EDYA 1LW6E 4B5LA 4WOBA 3L1KA 1SIOA 3I30X 4BWGA 1TM1E 1GCIA 4K8RB 3AJ9A 3A3NA 1AH2A 3DE1X 4DZTA 3HJRA 5ARDA 1AU9A 1C3LA 2X8JB 3LPCA 1BFUA 2PKCA 1KE2A 1TECE 5JXJA 1PFGA 2ZWOA 1Y3DE 1EGQA 2PRKA 1BE6A 2GKOA 4OV6B 4I0WB 3I2YX 1WMFA 3QTLA 5AVJA 4HX2A 1MEEA 2SNIE 5AVKA 2ID4A 5ARBA 2Z2YA 5K7SA 2QTWB 2W2MA 3A3OA 5JXHA 3CNQS 2XTJA 1T1IA 3DE3X 3UNXA 4NMXB 5B1DA 2IXTA 2SBTA 3BPSA 1TMGE 2HD4A 2PMWB 5I9SA 1SELA 2B6NA 1SBIA 3DW1X 1YJBA 1BE8A 2TECE 1V6CA 2Z57A 3LPDA 3F7MA 4J94A 1SPBS 1Y3BE 1Y9ZA 3DE5X 1SCNE 3GCWA 1GT91 1SUDA 3GT3A 1PEKE 3BX1A 1GNSA 3ZXYA 3DW3X 4WOCA 1V5IA 1Y48E 1GA1A 1SCAA 1WMDA 3WIVA 1P7WA 1TM7E 1SUCA 3DE7X 2PWBA 3QFHA 2DQKA 3Q40A 4FONA 4KG7A 3T41A 1Y1KE 1OT5A 5SICE 1SUAA 3WHIA 4ZARA 3VTAA 1KDVA 3A3PA 5FFNA 1Y3CE 2X8JA 3VHQA 2PYZA 3CO0S 1SIUA 1Y4DE 1T1EA 5JMOA 3DYBA 3I37X 2HPZA 3DE2X 3DVQX 3LXUX 1PJ8A 5B1EA 1YU6A 1ST2A 3PTLA 2WV7A 4CG0A 1TM5E 5FAXA 1IC6A 1IAVA 3Q5GA 1C9MA 1Q5PA 1AVTA 1SBHA 5AMXA 1BJRE 1R0RE 3AJ8A 4GI3A 2SICE 1AK9A 5FBZA 1Y3FE 5ARCA 3TI9A
chains in the Genus database with same CATH superfamily
3CY6A 3OJCA 2QTLA 3QUTA 4L8WB 3DWFA 2GPYA 4U7HA 5G1OA 1OYVA 3GNSA 3HSSA 3PRHA 1WXGA 1ZOLA 2HRQA 4J1NA 3TTUA 1DLIA 2IOHA 4D9BA 3K70B 2QVCA 2CF6A 2OCDA 5JATA 4UC0A 2I3GA 4JLMA 1MT0A 3RABA 5AW2A 1ZEJA 3C3XA 1IU9A 2TS1A 2VAVA 4IVPA 4J1TC 1XVAA 3SE0A 1F6WA 4X3PA 2RD2A 1Q0PA 5TT1A 2EEPA 4XD2A 2G80A 1Q1ZA 2Z1DA 4BEBA 4F11A 4ZQGA 3NUQA 4G09A 3LFUA 1AQJA 3U4DA 1CTQA 3PJDA 3E5RA 1UBHS 1KYWA 3JAWA 1MJGA 3LO5A 5I51A 4J03A 2CNBA 1O95D 1CQXA 1JU3A 5FEUA 2VJQA 2BKUA 2YS6A 4JI2B 4JVLA 1E3WA 3Q7EA 1YZFA 3H1PA 3B7WA 3FXAA 4P31A 1DBQA 3VBEA 1ZSVA 1NYTA 3H17A 4ZO8A 1Z5PA 4EUFA 4MV1A 2VDOB 3WG9A 3ZKWA 4Z5XA 5C80A 4HMPA 1YZKA 3FMVA 3BE8A 3K1ZA 3O8BA 4GE3A 4LPKA 3P9CA 4Y9TA 3K94A 3PWKA 4D6YA 3W6PA 2P4HX 4B0OA 1EK6A 4EGJA 1AC5A 4XQEA 4ARBA 2WWYA 1UK7A 2Q0SA 3RH0A 3VX4A 3UBTA 5A6VA 5E9WA 4UJ3A 5E0KB 4TYWA 1FNMA 2B3TA 4KB5A 1JLMA 1LVUA 1OLUA 3E1SA 1E4OA 3WMRA 5ABPA 1UQTA 3KDSE 3DKRA 1DQZA 1YI8A 2BCEA 3LZDA 1JVSA 1YRAA 2HFJA 3WL7A 1NQUA 2NZ2A 1KAHA 2FH5B 1ZPDA 4PR3A 4GE0A 3L0SA 1N6OA 4ER0A 4JAVC 2J5BA 2XMQA 2M6LA 1JKXA 4ZCSA 1AHNA 2N75A 3B5JA 3H8SA 4HNSA 4QTUB 3TTSA 4NBUA 1R8XA 2C9BA 5BT8A 4PYOA 3DMRA 4WNAB 3PQ3A 2FEWB 3AWDA 1MGPA 4W7HA 3WWZA 1PS0A 5LP6B 1J2JA 3MB8A 1BIFA 1FYEA 3RK0A 5HF6A 1ONSA 1E18A 2P40A 4RHYA 1H1TA 3ICOA 4KNWA 3VSAA 3LDFA 1SVOA 1WCIA 3BE4A 3COJA 3FGZA 2IHTA 4C7OB 2ZXEA 3IQFA 3BDVA 5BVGB 4FBGA 5TMPA 4P98A 4K6CA 2DG2A 2CT8A 2K2WA 3ZJYA 2XYPA 3DKPA 4R01A 1I3KA 2JRLA 4N0MA 5F73A 1N92A 5JYCA 1OX6A 4EFLA 3O2QB 4G0ZA 1FX0B 3W8DA 1V3QE 3VSDA 3WWEA 1QCDA 1U9IC 2BM1A 2GJSA 2WTEA 4CUZA 4R2MA 4OA5A 1ZVKA 4DG5A 2G4CA 2ZIFA 2XUZA 3CVVA 3FSGA 2MINA 4CU5A 1CRWG 3FPBA 4ZDJA 5HRUA 4I55F 5E1OA 4BQFA 2CK3A 4K05A 2A86A 1B6RA 3P2JA 3BQMB 2HMAA 4D4IA 2D5LA 2GCEA 2YV3A 1YCHA 3AX6A 3OU6A 4QPNA 1NIPA 3M5DA 4YN3A 4RK4A 3SBOA 2H1SA 2PSDA 3NGXA 3PNPA 2Z1NA 4ASUA 4DW8A 2PYDA 1OVGA 4ND5A 4KFCA 1HDIA 1WM1A 2IFTA 4Q01A 2G6TA 2Z3VA 3KM0A 3ZDAA 2X2EA 4J49A 5TR9A 4HY3A 1XL0A 1KF0A 3QRWA 2Y99A 3TPFA 5CEEA 1YE5A 2R9VA 5MN5A 2VDPB 1IXKA 2GX6A 2P9CA 1MX1A 1WE2A 1PG2A 2CFCA 2CLEB 2GF0A 4Y7CA 2NU6B 5HK8A 4CMHA 1IEQA 4MH0R 3FR7A 4BASA 1VKOA 3T38A 4Z4EA 5BW6B 1SIWA 3NT5A 3PC7A 5B3AA 2GH1A 3AP2A 1Q3HA 1HLGA 1W48A 1QB7A 4KXUA 4GXNA 1JEAA 4LRWA 4WW0A 3C4VA 3UK0A 2MMGA 4H4DA 1ZD3A 4KAFA 4CIXA 5FUVA 4JP2A 2GPSA 3VTFA 2FJ0A 3L7OA 3PRKE 4W63A 3WMWA 3CZMA 3U0VA 1L4YA 1YL5A 1VP9A 1P9LA 1U0RA 1W85B 3GLIE 1GTMA 2OFWA 1Z6AA 1EUDB 3A2NA 3LXMA 4E5KA 4ZJZA 2XZTA 2HOQA 2PLFA 3GCXA 2AFHB 1CIPA 3W9SA 4ZI2A 4PAOA 3CH7A 3FJOA 5DWVA 4DCJA 1GG5A 4HRXA 4KRFA 3PXGA 1KBOA 3DDNA 1OKKD 1RM4A 3NOXA 3PR2B 5KYUB 3KCNA 4ARSA 1DARA 2WT4A 1A9QA 3NXSA 2ISSD 4RJTA 4AJHA 3L1JA 5ITVA 3QWFA 2K7ZA 4NS1A 2E1PA 1Y9JA 1DBIA 1YZGA 3B2EA 3NEYA 5F51A 1XF9A 2QNBA 3T6KA 2GBIA 2D1TA 2G40A 3JYHA 2IEYA 4EM6A 1YS2X 1QUEA 4UBJA 4KVFA 5A0TA 1QO7A 1OWPA 4JJKA 4KIUA 1IWOA 1U4SA 4Y2SA 4YV2A 5A4KA 5IUNC 1B74A 1KDPA 2PCLA 3HVIA 1WKCA 3IE0A 1A9XB 2JKYA 3WQBA 1KORA 2BFNA 2P5YA 2A2ZA 2WJ4A 4ZT6A 3L7DA 1NSFA 3RU2A 4HFMA 1LDEA 5AUPB 1ZXXA 5GZ6A 2OBNA 3WA7A 4D8WA 3L6OO 5ITZB 2XUAA 1RVDA 2VNKA 4LJKA 3T7RA 2CNWA 2R00C 4IJUA 4RAQA 1ORVA 3I9NA 4X60A 5EUBA 4YJ2F 1YE8A 1V47A 5HIKA 1W49A 3O4RA 4KZPA 1SIBE 4EUEA 3OZGA 2C7RA 2CVOA 2J5RA 4HGQA 4YRSA 5LMZA 2XZDA 3FMPB 4PYMA 3QE0A 4WEQA 1IQUA 5GZ1A 5AVQA 3TTWA 3RTDA 3DMDA 9LDBA 1HEYA 4Z8YA 3S81A 1D1SA 5AIBA 5ETJA 3D4LA 1EAMA 4P35A 3NBQA 3TIIA 2WYUA 4D74A 4M88A 4TKZA 3KPJA 1PJ2A 4GGMX 3PQEA 5JS1A 3LRTA 1J9EA 2KB0A 1YQXA 2OK8A 2XUIA 2G5TA 4HDKA 3RJ9A 1J5PA 3KK0A 3LWBA 3UB4A 3WGKA 1YA6A 4LX0A 2Q9BA 1EHCA 1NLYA 1LTHR 3D7LA 1T0BA 3I9KA 5LLSA 2N0SA 2VCYA 1G2PA 1K8QA 2O57A 4D44A 2YFKA 5TVKA 3PQ4A 1T4CB 4EPRA 2JGFA 5FLKA 3PQ7A 5JDCC 3DV2A 2PM8A 1XYVA 4ID9A 5CYOA 3HYNA 4OHOA 5DGHA 1HXHA 3DLPX 3MS2A 4FSXA 1BKYA 1ECJA 4NNJA 4EH1A 3A06A 2CUTA 1TF2A 3RBXA 2YS7A 2ESRA 1MZPA 1GZ5A 1EVKA 3WMXA 2XB9A 3P2OA 3H7AA 4B2LA 2IHJA 5A7HA 4BJ6A 3L5KA 3BT7A 3FF1A 4UDXX 5T7BA 3CW2A 2B20A 1JHQA 4QC2A 4BKPA 4MV8A 4IDBA 2ZUFA 2IX9A 1GD1O 5CTAA 3DGEC 3O2NA 3N6RA 3OKFA 1XYYA 4II3A 4NIMA 1EFRA 4HB3A 4AJ1A 5K0BA 1PR1A 1VJ1A 3AKDA 4IJMA 2D06A 4UATA 1Y6GA 1ZGCA 4ACBA 3LPMA 2W6NA 1O95C 4YJKA 3UHOA 2X19A 1RM0A 4M49A 4J9UE 4ZP1A 2CKDA 2YRFA 4LRQA 1Y81A 2B92A 3OZEA 2CNLA 1BE6A 3NRCA 1FU4A 3ZWMA 2WUDA 3AZPA 4GI2A 1DKQA 1OX4A 2IIQA 5TGDA 5FA8A 4CTKA 1U4OA 2WA1A 3BXHA 3CYFA 2GK4A 2VDKB 3FIUA 3HCPA 2XYHA 4I0WB 2Q3MA 3A32A 3TLKA 1W4ZA 4EG1A 2ZROA 2CHQA 1T2VA 2VCEA 4HPWA 4ED9A 1PJLA 3BJRA 1NXSA 1NLFA 1E98A 2SNIE 5GJVC 2FSFA 2LRHA 4W5JA 1VFPA 3NFYA 1N5OX 1U1FA 3QXXA 3ND8A 3ETJA 5EHXA 2Q9UA 2OCKA 4TLAA 1V45E 2XGOA 3AG5A 3WYBA 2DQZA 3TOCA 1BD3A 2KYRA 3LHIA 5DW3A 2JLYA 4MUAA 1ZCJA 2NNLD 5HWSA 1XDSA 2GZ1A 5JXHA 1NNEA 1V4VA 4X1YA 1KEKA 4TTRA 2BV3A 4IOJA 2GN0A 1UDCA 2J5KA 1GQRA 3SS9X 3K0KA 3OKAA 1T1IA 1BVYF 1XTPA 3GP3A 1KPHA 4E08A 4WLNA 4Q7QA 1YKSA 1LF0A 1CULC 2B4TO 2COKA 4II2A 4LF9B 2FXIA 1P4SA 3SXUA 3NVKI 1UP6A 4UEWA 3FM9A 1UADA 1GPBA 4B3IA 1KFKB 1R0ZA 1IHUA 1JW9B 3H9JA 3HDTA 3AW9A 4PQGA 3RUEA 4AN4A 2RMKA 1SUWA 4WMLA 2GK3A 3TMKA 1KBZA 4D0RA 5GVSA 3N3AC 3W79A 3U60B 3A6EA 1YH3A 1WDWB 2J08A 2RGXA 2XMCA 2PUJA 1E9CA 1T2NA 4R5MA 1H0KA 5J2UA 3NHMA 4YT8A 2GCPA 4AJOA 1F2VA 4X1KB 4EJ0A 2J1LA 2P77A 4AYTA 3MLBA 4OGGA 4UVDA 3USCS 3MHPA 1BGXT 1A7JA 5A3JA 5JWOA 2IPMA 1JDBB 3EXHA 3B12A 5C8VA 3MWGA 4WI1A 3PKZA 5JPDA 1IIBA 5DBHX 5C35A 2E6KA 3REOA 4EIWA 4QNRA 2NO5A 2Q9CA 3Q8MA 5F9HA 3JATA 3OUZA 1U8UA 3P9QA 4MAFA 2C5SA 4QBKA 1PEDA 2RJ3A 2W8BA 3UMBA 3PGJA 4F5DA 1YR7A 3F6SA 4Q9IA 3U3ZA 4HAZA 4FC6A 2AMLA 3BAZA 4R2LA 4CLOA 4LXHA 2P9TA 4LQCA 4TXHA 1AKQA 2ZRMA 4F12A 5BMOA 4A2QA 2BFDB 2OFOA 1YFKA 1OFIA 4OEHA 1GNRA 4XYMA 3V1MA 4N0DA 1M1ZA 4GP7A 4R1SA 5IAAA 4HFNA 2XYGA 1CUZA 2NTJA 1WXDA 1PBNA 4ZIRA 3VZSA 5B7NA 4L0MA 4IYRA 3QPAA 1T3GA 1VE3A 2ZUTA 4LKRA 5K0SA 5K6AA 3ZD8A 4DPMA 5AW4A 2OZLA 3G0DA 2HI0A 3BIXA 3I3OA 3DW3X 3CLRC 3D2AA 3CVWA 2GNPA 4F6RA 4EG4A 1DQYA 3ZYZA 1F8FA 2Q41A 3S2GA 5A4AA 1Z0JA 4EB6A 4B48A 3FUVA 3GVPA 4IOMA 4IS2A 3SEAA 4XPIA 1M67A 1XZCA 3IB6A 2F3RA 4RNCA 4JB8A 5B1YA 3MGGA 2W90A 3DT8A 2XGMA 3ZHXA 5AVOA 2EIXA 1V1MB 1BHSA 1SWVA 2AN4A 1REQB 1VCMA 3ICCA 3IKMB 1WXXA 2AXPA 5B6JA 1OT5A 4RTNA 2C95A 2J07A 2JGDB 2WJWA 4E22A 2UYHA 3E03A 1JIUA 2JLUA 4PXYA 221PA 3FDZB 3V4LA 3A1CA 4A6XA 1PJTA 4KPEC 1NQXA 3K20A 4ZARA 3ZCUA 4ZFNA 3KSMA 1WZUA 4RY8A 5AVZA 1KIFA 5JCZA 3W5BA 3OESA 5FULA 4RJIA 1ULUA 2H7XA 1UP4A 5DPMA 2JCSA 2GCGA 3RW9A 3UH0A 5JNSA 3GFOA 4R1QA 1Q0LA 2GR9A 2HWWA 2DFPA 1FYFA 4GU5A 1XKQA 1LLFA 3UUEA 3MINB 4QJ5A 3SJZA 1K9VF 2RARA 2OP1A 4ZYVA 4IRMA 4H60A 2XTAA 3QHPA 1USVA 4GVPA 3T8YA 3U44B 1K5DA 5J5CA 3ZU4A 4MCAA 2O1EA 2LGJA 3ECCA 4WZ6A 2WU1A 7MDHA 2VP3A 4Q9HA 1ML4A 4ZOLA 1J0CA 5LSAA 4DQKA 4X3OA 1G5IA 3G13A 1TEHA 2HYDA 4BFYA 2JS7A 4CKWA 3GX1A 2HPZA 3FFTA 2XZPA 5FJIA 3N59A 1D2CA 4FI3F 2O2DA 4AZVA 4CBVA 4D82A 3L79A 4R1LA 1KZ7B 4PSDA 5A5GA 2CJYA 1EE9A 3RIGA 1P9WA 3KQQA 5DYIA 1NUPA 1QCZA 2RKWA 1FQKA 5T8KA 5JLAA 2PL3A 3ND6A 3SYRA 3UAVA 4DS3A 2WJ3A 4BGDA 5D8DA 1X19A 4DSOA 2YN0A 3AF2A 2EWVA 2XVXA 1I6LA 2G06A 3IDFA 2RHDA 3OFSA 3F7TA 4G81A 3IVGA 2VXCA 4JLSA 2PUVA 4XYGA 1DADA 2MYPA 3VC2A 4DNQA 3ZD7A 4MX8A 2Q1SA 5K1ZA 1E2PA 3BE6A 1NBIA 3D4BA 1AHHA 4R9UC 2HHAA 3TGWA 3IUMA 4UNSA 1CJUC 5BNTA 5KUTA 4W8HA 2R2GA 4MMZB 4PBRA 4EG7A 3D7RA 2DGDA 1DZ3A 3QVGA 3FYUC 4NDNE 5ECGC 1AGXA 3S27A 5A71A 4IV0A 4RHCA 1TT7A 4B2YA 1JDJA 1Y3FE 2P67A 3QIVA 2FSPA 1ZWLA 5HILA 1A9RA 5E6SA 1UXOA 3V4ZA 1J2EA 1SIOA 3TI9A 2F4VB 1ULBA 2ZRHA 3PVZA 5BN1A 2PQMA 3SHTA 3CVYA 1T2AA 2PKWA 3OOSA 4WLEA 3EWIA 4ZVMA 4XIGS 2RGAA 1C0PA 2GPWA 1TMYA 2A3RA 1SZDA 1R8YA 1U02A 5GPBA 4X8LA 4O4IA 1IZ8A 2OO5C 1IJFA 3I62A 4B09A 1U3TA 3K2EA 3KOYA 2ACVA 4WK4B 3RE1A 2W2NA 4TKMA 1CQWA 5EUMA 2R4UA 5I3CA 1S2OA 3IR5A 1HOXA 3NAZA 3T7SA 2ZK7A 4XUCA 1I1HA 4WXEA 3MOIA 2HL6A 2BDTA 4QO8A 4MI9A 4A9AA 4Q82A 3RHTA 4IJQA 1XVLA 1CD5A 1VSBA 1SU4A 3QPBA 3SLRA 3AQ4A 5JMWA 1KC1A 3AESB 5K6AC 2QBYA 2IX3A 4RZ2A 1KARA 2C97A 4FFNA 3X2SA 4BCBA 1MF7A 4WZBB 3L0YA 4YJ3A 5DH9A 5F78A 3ZLVA 1ESEA 3O9ZA 5D5QA 3SYMA 1IPHA 2H31A 4IGEA 5BRJA 3W1EA 3AIIA 5AHKA 4YRTA 3H1TA 3MTDA 5IYZB 2IY8A 1GPKA 3GVIA 3H8JA 4R40A 1O2DA 1EFPA 5FWYA 2IZ6A 1V1JA 4EYEA 1EGHA 5D84A 3B7GA 2I99A 1E7MA 4Y1FA 2WJPA 2D00A 3TZ6A 1JEYA 1ZL2A 4MA4A 5AVTA 1PQUA 2GD1O 3RTAA 2IV3A 4QLOA 1W1IA 3PGA1 3ZDQA 2QGFA 4W5TA 1RYEA 4DV3B 1L5ZA 1VLMA 4K6MA 4ZC1A 2PZMA 4FQ7A 5KZMB 3CH5A 1Z5NA 3OM1A 1TTHA 1XNRB 3RAJA 2GVNA 2IYVA 4O02B 4DUPA 4XDZA 4D6XA 3OSUA 2PLWA 4F4FA 4LGVA 1QCYA 2FPPB 2REXB 3EMVA 3G5MA 4ZTBA 2C31A 1QV6A 5CM2Z 2J6BA 2E85A 4IFBA 5AQ1A 3AEZA 3THXB 4HNAA 6ABPA 3RK4A 4NMWA 4GKVA 1W75A 3U31A 5JH7A 4V0KA 1L4BA 1DG3A 2PZKA 3MMPA 4WFIA 1L2TA 1KAEA 2NO4A 5AJZA 3QEAZ 5I4BA 1DFIA 3K2BA 1JDSA 3FPFA 1T6YA 3E0XA 4FUQA 3DLCA 4L3OA 4QICA 3J80A 2NPIA 1K98A 5TMDA 3D4PA 3TECE 1NULA 1JWBB 1T3HA 2Z9DA 4NF2A 3O73A 5K8CA 5K2OA 4MDFA 3B9RA 1UJNA 1M34B 2YH2A 4QREA 5LBTA 1VA4A 1UQUA 1Y5IA 2IYYA 3FB1A 3PEEA 4PSKA 5TARA 2PMEA 1W30A 2A92A 2JAWA 2R3SA 3E9NA 3HO8A 4EF4A 5C9ZA 5T8KC 1B42A 2JCXA 5ES4B 3BXGA 3TZEA 2FWBA 1AKNA 1P7VA 2Y1DA 2YBEA 2IU4A 3K8ZA 4OAPA 2OM6A 2PQ0A 2REOA 1XALA 2C4HA 3A4YA 3JAKA 4ZQCB 2VPWA 5YASA 4CQLB 4D96A 4E46A 1E5QA 5K8JB 3DWEX 4LJ5A 3GROA 3PFIA 3IGFA 3EZYA 3AWIA 1L9XA 1JHMA 4JHXA 3EBPA 1NQ5A 1Z8FA 4FCWA 1G6HA 5EMLA 1LWNA 1ZH2A 3TB4A 4B7AA 4FZ3A 1JMYA 2FRXA 4X95A 5FUYA 3CJRA 3HHEA 3ENNA 4ND7A 4A10A 3IA7A 4MWGA 2FWAA 5FX2A 3TR0A 1CBUA 2QUHA 4FR5A 4MUYA 2V54A 3ZWAA 1OB5A 4O4JA 1YS7A 2DQ4A 3AO0B 4CIYA 3KZXA 3BGOS 5E1MA 3UCFA 4JL8A 4BB9A 3U4MA 2JDID 4YRJA 2HSGA 3TB6A 1ZVJA 3HSYA 4BO4A 5DISB 4C6HA 4IX9A 1NXPA 4TVBA 5TSDA 1ZEMA 4H35A 1NJGA 4EHJA 1P2BA 2Q2OA 1UBGA 2JEZA 4K1XA 4NZ9A 5E9JA 1V5GA 1Z5ZA 1NR7A 1IMJA 4I8IA 4G2TA 3RBVA 1ZX1A 2HF8A 3RO7A 1WV0A 3DTTA 3KKLA 2XZOA 3PCXA 3PQ5A 4G0QA 4ZU6X 3D2CA 4RHXA 1H8HD 1NY5A 1ZIOA 3JQ8A 1FYDA 1DKUA 1E5DA 1MABB 4B71A 3WAGA 1EESA 2X22A 4OUKX 1ZK3A 4GOKA 1US8B 4R6XA 1SC4A 1JF8A 5G0WA 1NVUQ 3LX6A 2YOGA 3QPDA 4UHCA 3V8BA 4TKUB 4BGVA 3VGPA 4H7PA 4TYMA 2PFGA 2ZE8A 2ZS9A 4F7WA 4RXUA 1HDCA 1DUSA 4LVNA 1RPTA 3T9DA 3WAJA 5AHRA 1Z5GA 1D6MA 3OHPA 4A15A 3D1JA 4ZU1X 2BGJA 4Y30A 4OHXA 2H06A 4TSRA 3RVKA 3GWZA 3K8OE 2C0QA 3PWSA 4G63A 1J0XO 2X0EA 1CLUA 4Q3DA 4DNPA 3LCUA 1E0KA 4HQ0A 1DWOA 3AOEA 5K09A 5IJ9B 1JHZA 1X7ZB 2DR3A 3P0RA 1SUFA 1PFKA 1U7TA 5T4EA 4YP9A 5HS4A 1GLNA 4HWSA 4LIPD 2FZCA 2GAAA 4BQEA 4BVFA 1Z4KA 3X1XA 1OROA 2PFSA 4LRYA 3UAWA 4XEHA 4Q4AA 1MIHA 2EJCA 2QTRA 4M0EA 4PYRA 4QJ3A 4UOEA 2V1UA 3JSAA 1B41A 3WK7A 4KPYA 9GPBA 2H65A 1RU3A 3TEJA 5C5CA 3OQHA 2GI4A 2FDCA 3HDHA 3DD5A 1DVRA 3IUQA 1M1XB 5CDFA 4GIBA 2L17A 1OZAA 1Q15A 1TMOA 1CY0A 4B6GA 5BV2P 4CFYA 4IDFA 4I4TA 3C6MA 2QR5A 1POWA 4H0FA 4XUDA 3WTBA 5AJXA 3PPXA 4JR1A 2QD4A 5KQLA 5CFPA 4W9MC 1QGOA 3FUUA 4AKGA 4L51A 1MX9A 1R6BX 4EI7A 2JIBA 3AR4A 3B38A 4YCCA 3EEBA 3WWPA 1G291 2AWOA 4LQ4A 4JVSB 4HDRA 1F6DA 4JKYA 4YRDA 3GGJA 1U1CA 2O2ZA 3LVFO 2XY4A 2QENA 1MW9X 3EDQA 1ZUWA 2Y76A 3LOQA 1ISSA 1HOTA 1EGMB 1L1RA 2GERA 2Z5LA 3AR3A 3P2MA 4MVJP 4RD4A 2YMQA 3FGNA 1FJ2A 3K3PA 5CFMA 4UCFA 3RRBA 1NJ6A 4KFUA 4PC7A 1S5PA 3RT9A 4QOHA 1UBNA 1THMA 2A5LA 1UODA 1G4UR 3GVCA 1MKYA 1Q84A 2HQOA 2X7HA 3I5MA 4PFQA 1CB0A 3MT9A 3ONWA 1V71A 4TSFA 3RUCA 4ENVA 5G2OA 5LKAA 2DWQA 1YB1A 2QR2A 1OFUA 4GNKA 4BO2A 5JZOA 3BL6A 3GYGA 2XWQA 1VPVA 2WPDA 2Y1XA 1MR3F 3YASA 2FQYA 2X4LA 3RS5A 1CZRA 3K2IA 2NAPA 2R6AA 2HZBA 5JALA 2G5GX 5LYYA 3A1WA 3WB9A 1M2FA 5EJMA 2GD2A 1H3NA 2F3PA 3EIWA 1GEGA 2GO1A 4HGYA 4E3WA 4X93A 5KQGA 1Z6XA 3U4QA 3R0IA 2P9EA 3BB1A 3VI3B 1LF5A 2GCOA 2QM0A 5IEBA 2RG7A 4IUCS 4E2ZA 3GNTA 5KMGA 3SQLA 3P32A 1G41A 5H80A 3ZD6A 1N5LA 2OO3A 3CVJA 1FSFA 2VF5X 3HUTA 3KTFA 1VGQA 1ZGAA 1RXYA 2WAOA 1AXEA 2HCRA 4JIGA 2WUEA 4HNHA 4IDNA 4I4CA 2OZEA 2XQKA 2VYQA 2QMQA 3KNZA 2NZVG 4UMDA 3MRTA 1NU6A 1XZGA 2FW0A 4U7TB 1VLLA 3IXQA 3VYTB 3S55A 4G5OA 3AU8A 1F2TA 4GICA 1GWNA 3IKVA 4ZT7A 3ZGOA 2BM8A 1VRWA 4GR5A 4AZ0A 3RSZA 3ZDFA 3KUKA 3WLMA 1FFCA 1KVQA 1ND5A 1JWLA 3ZZTA 5C1PA 1CU1A 5GJBA 1FUUA 4WV3A 1EGQA 2WIKA 1HKUA 2JLQA 3ZY5A 4P0PB 1T36A 3CRZA 3T52A 2VJNA 2ZYRA 5J5AA 4F1JA 2HLDD 3NWBA 5AK0A 5MDHA 3WNZA 3GXBA 2GGSA 2RJNA 1E3TA 2PKQP 1M9NA 4EPXA 1RWOA 2W70A 4B79A 3AR8A 5AESA 1G21B 2Q6TA 3PFGA 1N2IA 3TRKA 3QXSA 3IBCA 2P5TB 4N4AA 1Q7BA 2B35A 3JQQA 4D80A 4U2EA 3OU2A 1YZUA 3UKOA 1M3SA 2ID4A 4FYPA 4FQ8A 3CONA 1X9GA 4DIEA 2PUBA 1AKWA 3JQ6A 1AO3A 3SVZA 1CY6A 1TFUA 2Y0EA 1TC1A 4HRVA 1WF6A 2EKLA 5JISA 1GKLA 3Q3VA 1WMSA 4LZPA 1BDIA 4JP1A 3CB4A 4J0GA 4NSNA 3NUZA 3T1YB 3CN7A 4GPZA 1J2UA 1QYWA 3BCUA 4Y6SA 3AOEC 5EXXA 1KDRA 3O84A 4WERA 5FTJA 1V25A 2BISA 2E4ZA 2XQIA 5KJ1A 4QUHA 4E1BA 4Y6QA 4U9UA 1Z29A 1Z38A 2GRUA 3G88A 4NRDA 5EHQA 4X00A 3CZPA 5LUAA 4D26A 5ALSA 5BNZA 3GUZA 5MGBA 5JI2E 5KIAA 4NBSA 1W29A 5EHIA 4RFLA 3PIDA 2IS1A 5ESWA 1CJVC 4XQ0A 1P2SA 4AN1A 1ZISA 2I6FA 4Z53A 2GZSA 1RTKA 5GINE 1J5EB 3AF1A 2GZ2A 2WZQA 1DJMA 2AN5A 1SBIA 3OO0A 4RD6A 1PR4A 3OG9A 3AFIA 1D9XA 1T9BA 1P1BA 3EC2A 1OFTA 4PHTA 1R5NA 1P31A 2P27A 3K8QA 4MP3A 3GJZA 1C1HA 2TECE 5ILQA 3T4PA 3H2ZA 4ZZ3A 2DVMA 4PLFA 3CMCO 3KQMA 2WLSA 2XOKD 5FHQA 1YIAA 3GDGA 3C3PA 1Y3BE 1VLZA 3L41A 1AS2A 1PTJA 1DQNA 3CZ5A 3PYXA 1UC9A 2IF0A 4HZUA 4GX2A 5THKA 3A6PC 1P4JA 3JAWB 2VNIA 1MVOA 1P72A 1SCNE 1LBTA 2H8KA 1E3WB 1DWPA 3H18A 1NXWA 3QQ5A 3R6DA 4WUTA 1JT2A 5D01A 2TMGA 1YSCA 3RSHA 5KSWB 2JI6A 2HPAA 4ARCA 2WF6A 1ZMBA 4NU6A 4Q9LA 3JVIA 2X0NA 4URXR 3ZKWB 3JZIA 2JGAA 3NEJA 3UJHA 5KKCA 4KODA 2G5CA 4CMAA 1S4MA 1TB4A 1CY7A 3WSVA 4CVNA 4Q3OA 2NSHA 1Y48E 3GJ3A 3W6UA 1LLQA 4BO3A 1H42A 1ECBA 2WHYA 4FLEA 4L57A 4U7DA 3WLJA 1E3LA 1TYZA 4HBGA 1YKGA 1OLUB 3LO8A 3RLIA 3A0UA 1L6RA 2GJ4A 2HU7A 1JJ7A 4J2OA 4PZUA 4Q1DA 4RBNA 5HIMA 4GKAA 3ENQA 1N2CE 3A04A 4MV6A 4UVHA 5DT9A 3UC5A 2BLNA 4E2FA 4CG3A 1Y63A 2X5JO 2FPGA 2PZAA 2DX7A 1DIBA 3WGNA 2HLNA 2J0VA 1SEVA 4GI7A 1LC0A 2QVZX 1QQ6A 3WGZA 3WY9A 5FFNA 5HPYB 4AKEA 3HFRA 1Y3CE 3L8YA 3KX2A 4AKIA 2FOLA 4JI3B 1V3VA 4QVGA 1KIAA 4Z7NB 1QKIA 1YI1A 2EGHA 5E0OA 4XWOA 4M4SA 1WCIB 1UFVA 4KWEA 3NWOA 4HG2A 1HMYA 1XXHE 2G76A 3AM4A 4OXKA 4WKBA 5DRTA 3Q87B 5HF5A 2MTBA 4YO8A 4V39A 4B6FA 4WFKA 2FR0A 3EBLA 3K0CA 2EG5A 4BCDA 4I9FA 3TG8A 3TSAA 2J45A 3S8YA 1QK5A 1KI6A 2ZIUB 5CA1A 2EXXA 4X62B 3S2YA 4DEXA 1DPGA 4F1KA 3L6EA 4IUYA 4FFRA 5EKDA 1EUZA 3HABA 3UJBA 1EFHA 5KYGA 2D0IA 2FSIA 2XUJA 2MINB 2ZULA 1XDWA 5DHFA 3ZQ6A 1EIZA 2J32A 4BKOA 5JZSA 3ORQA 4MDEA 1YQWA 2CMDA 5H7XA 4B31A 3LBIA 4ZTUB 1HG0A 2YXNA 5B1EA 3ELYA 1OBHA 1IK4A 1W4AA 2WVJA 2X42A 4JYMA 4KQEA 4LVCA 1JFVA 3RARA 4DV0B 1IBRA 4AY5A 4ZGGA 2ZUCA 2HJSA 4UHJA 5CLHA 4BNHA 5BW5A 1WETA 1PUJA 1J9GA 1TF5A 2YMMA 4EPYA 1OBVA 4N82A 4OJYA 4HS9A 3U80A 2ILTA 2CDNA 4JJZA 3PQ6A 1IC6A 1XU4A 1TEZA 2EKPA 4FPXA 4PN3A 4BEWA 4JEMA 4PC1A 4R3UC 5C5EA 2FFBA 2I4LA 3ZIUA 1A4IA 5GJWC 4DDHA 2O8EA 3C7AA 4PPFA 4XQCA 4QODA 5KOYA 4MUBA 1L5WA 2IUUA 4HDNA 2QRKA 2DBYA 4LE0A 4CKBA 1CB7A 3K9BA 3FOWA 4K9LA 1P6UA 1OI4A 3C2QA 3D54D 3VOSA 3NOOA 1X15A 2W22A 1DKOA 3DOIA 4QQFA 3E0QA 2P11A 3DLAA 4DQLA 1EK0A 4BX2A 3K0HA 4MTLA 2VK2A 2XTZA 3TZLA 2AFIE 1CUHA 1FXWF 3EN0A 1M6NA 2OHGA 3GARA 1FMFA 1TJNA 1PV4A 2GJ9A 2XXJA 4AC9A 5LP1A 1MH9A 2OOSA 4O63O 5LU8A 1FLVA 4GPEA 1OYWA 2P2YA 4RYDA 3E8SA 3X1MA 1PTJC 4YPVA 4GMXA 1M5RA 1HSOA 1AKYA 1F8GA 5FUMA 2DFVA 1MENA 3UG6A 5EEHA 3GUYA 3OMWA 4DJEC 2CCJA 1YD7A 3ENZA 4JYZA 1ML3A 3WHKA 5FCDA 3VR2D 2P6RA 4E5PA 5FWXA 2GNAA 4D9MA 4MPDA 2YY7A 3HXMA 1YJCA 4GSYA 4E14A 5H0IA 2TRSB 1T8PA 2XBLA 4M9CA 2QP3A 3W2GA 4EHAA 1JG6A 3AC0A 1FYVA 3LV8A 4WGFA 3SGLA 1LK7A 3UB3A 5JAMA 3U56A 1Y7TA 4ARUA 4RPGA 3ZW7A 3NCTA 1N7JA 1EP1B 2C83A 1ZC4A 4KUGA 3T3HA 3DDZX 1RM5A 3INNA 1T0JB 2HEGA 1S2LA 3OPYI 3M70A 3WIUA 5BY2A 2QAIA 1JG1A 5DF1A 5FBLB 4P34A 2OAGA 3KQHA 3OZ7A 4DMKA 3H13A 3HY6A 3BXOA 1E3MA 1C8VB 3WYAA 1XMXA 1FNDA 3FG9A 3IBFA 1M83A 4KPUA 1V9CA 4WSOA 2CMGA 4E15A 5FOUA 1RE1A 4BO5A 3C8HA 3LOPA 4NEGA 4RV5A 4AWAA 3I9LA 1L8AA 4R0MA 4HCJA 4YR7A 1HYBA 4BQIA 2HFKA 3ODPA 4OMCA 3F6YA 5HKOA 5LDHA 3H16A 2XRMA 1WW3A 1O8CA 1E9FA 2IYQA 1V0JA 3DAGA 4KXMA 4BE4A 3O9MA 4UXIA 2UZAA 3RU3A 3VSEA 4BFWA 4TMVA 2WU3A 5BV1A 4DCMA 1MRZA 1YA4A 3TPZA 4TS1A 3AVOA 3A1TA 3KE8A 4BZPA 1GPUA 3FHJA 3OWXA 5J23A 4DR2B 3F1LA 4DR7B 2YJ6A 3F90A 3B36A 1CUGA 1E2QA 4TRJA 2BLLA 4OQXA 4YNBA 3RJTA 2ZRNA 3RASA 3RR2A 4KUEA 2OQ2A 1UDRA 5EFOA 2QZPA 3QPWA 4HDKB 1UH5A 1DJQA 1ZY2A 4UM9D 5FPKA 3Q9UA 4LV8B 5F7JA 2SCUA 5HGJA 2VA9A 5I7WA 2ZANA 2GASA 4AI6A 2I7XA 3T99A 4KWHA 5E1BA 1NOJA 3EUWA 4MV3A 4QGGA 1KU0A 2W5UA 2X3YA 3BGDA 1P5RA 3FSJX 4JMLA 2DBZA 4YEDA 3P20A 3T15A 4CMCA 1V37A 3AF5A 4EX6A 1Y89A 4RCZA 4YLGA 3ZGNA 3RAFC 2QTNA 3LL7A 1O0BA 1COWD 3F74A 3ZHYA 5JC1A 4ITRC 1U63A 3BFXA 1ZDMA 2OV2A 2VQ3A 1HYHA 2O8VA 4ZVQA 1DDOA 3R8XA 5ENZA 1LV8A 3RVQA 3A9CA 3LT5A 2DETA 1RMYA 3DZHA 3V1TC 4D3YA 2ZBRA 2QX7A 2CUZA 1F14A 3M7IA 1P7CA 1QF9A 5FRDA 3KKPA 4FUTA 2I7CA 4BJHB 1J1UA 1T5OA 2C82A 2K6GA 2G67A 2PMCA 3KOOA 5BV0A 1VPWA 1U7WA 4QQKA 1X1DA 2EW8A 3DDSA 3GAMA 3QLTA 3ZV3A 1Z3IX 2O4CA 1NT2A 4E6PA 3E05A 4F56A 5L45A 3PB3A 1TYEB 3WRYA 2DY1A 3QLJA 2QTMA 5LIPA 2VR1A 4BRWA 5CNMA 3VJMA 3F6BX 1YS6A 3OM0A 3TD2A 4FNMA 3ADBA 1R12A 2Q28A 2QRPA 2XE7A 4S2EA 1AF4A 1OX4B 4P4UA 4EHIA 1NLUA 1PEAA 1R00A 2NYUA 2QJFA 3FTCA 2EGUA 4JOCA 3THOA 1XIVA 3ZWDA 2OHOA 4D9NA 4G0YA 1EDOA 3Q0EA 1P5HA 1XCJA 5EWJA 3VM6A 2ZQ5A 3U1TA 2ZSDA 2UUCB 3Q0IA 5DIFA 3BFVA 4FYIA 2PGLA 2IQ5A 1IM5A 1WCWA 4XWWA 3KHKA 2B4YA 2IYPA 1Q20A 1PG0A 2VDJA 4NZNA 4G1BA 4NU8X 4C78A 3KSBC 1FP6A 3DWIA 3FHTA 2FU5C 5TNXA 3TRFA 4CCAA 5FTNA 1PLKA 4DABA 1CQZA 2COEA 3ER8A 4X1YB 3L84A 2CEAA 2Q6OA 1K7CA 1H22A 5B4TA 1E7RA 1IDN1 4LW8A 4UHKA 3ADOA 1YF3A 4OQYA 4LSZA 2VI5A 4LXXA 3WSTA 1EUYA 2GARA 4ZCRA 2FKAA 3TINA 2NSLA 4FX5A 5EXDA 3SXUB 4RMIA 4CIDA 1NA5A 1Y1TA 3VC1A 3EF1A 4C4RA 1OC4A 1CS4C 4UU1A 1RQ2A 4CL3A 5DYWA 3R5SA 1SQ6A 1YT5A 4I1PA 2AMVA 1V1RA 3K5WA 3HR8A 1CDDA 3NI2A 3HLTA 1T2DA 5J2UB 2DECA 2J7PD 4H6VA 1GGHA 4BX9A 4ESHA 4MLZA 2BD0A 1O9GA 5DGIA 2ZRPA 2G25A 4IDEA 4U6QA 3HI6A 3VISA 1U1GA 2PUTA 1XRQA 3ZHSA 3PNLA 5KNDA 3J7AC 2X14A 4E03A 1PSDA 3ZHZA 1J23A 1FC0A 4KLCA 2I7TA 4RMNA 3R7AA 4BLVA 4BMVA 2PT5A 4GW3A 1CVLA 4LY3A 5B6PA 3HP7A 1KERA 1P1IA 5JWRA 5JSUA 4EJ6A 1VP3A 2H3EA 3C43A 3JATB 2X7XA 2XB6A 4G0NA 4I99A 3MD9A 3WSWA 4RF4A 3SICE 2A0UA 3CSUA 1XLTA 2P4UA 2WY2D 4ZAZA 1JI0A 2Z08A 3O47A 4DYVA 4TMZA 2M1XA 1RMTA 4CLOB 4IBOA 5EJFA 1TW3A 3NDJA 5F5NA 4ZTZB 3FHCB 4EG3A 1NJSA 4OPMA 2F1IA 3MJDA 1C9NA 3QBVA 1QIHA 1V96A 5TC4A 1I30A 2VNJA 1XA0A 3X1YA 2II6A 2SKDA 1QTIA 2ZBFA 3GGGA 3HGQA 2VEOA 1E79A 3ON5A 2RBKA 3L4JA 2K5UA 1FMJA 2QQFA 2YFQA 2KSQA 3L6BA 5TMEA 3VKFA 1LBEA 1IB6A 4Z9BA 4ER7A 1KC3A 2WYWA 1NBOA 1CEYA 1T9HA 1U2TA 1UJ5A 1W19A 3QKUA 2JFGA 2OZLB 3OPVA 4J29A 4RVDA 1Y8RA 4L76A 4W5RA 4IDDA 3E9EA 3DMPA 2YIMA 3R23A 2WWTA 4C22A 5JNRA 3A28A 1UF9A 4B80A 2YINC 4Q5IA 2WJHA 1H4TA 2EX0A 3DM5A 3P0FA 4WL0A 3AFGA 1YFJA 1U0SY 2DFNA 3BCSA 3EQ2A 3VV2A 4ZVVA 4NV3A 4EB6B 4M0KA 4ZYLA 1CS0A 2H5EA 4K9MA 3EDYA 3WMGA 5KNBA 4PIVA 2NU7A 4XPIB 5JS7A 5K3FA 2Q4EA 1ZMTA 1OFUX 2R8EA 4HWOA 5K3DA 2N42A 4WA8A 2HA7A 1G5TA 3JWJA 4M0LA 2O9JA 3PXBA 1E9AA 2W6PA 1T0PA 4LY9A 5A02A 1XJ0A 5EQTA 1WXWA 1H4SA 3W6ZA 4WECA 1N2BA 3I5YA 3E1GA 1DXOA 1HYEA 4LOIA 4BFZA 1LV7A 1GDHA 2FSHA 2ZITA 3QXJA 1O0CA 5BSKA 3VC3A 5L7TA 1AU9A 2FI1A 3LY7A 4LJYA 2XSZD 1DG9A 2WT8A 4GM0A 3C6ZA 1DQRA 1OIVA 2CXHA 3IP6A 4G1FA 4CCYA 2HXYA 1FNBA 5C8YF 4PC3A 4XUGB 1IY2A 4L78A 2OLKA 3KZOA 1DPFA 5EJ2A 5SYAA 5C7YA 5CDHA 4NR0A 1UPTA 1QFZA 1HQDA 2HMSA 2PRKA 1JQDA 3EEIA 3EFOA 4ZYXA 1MQ9A 2QLMA 1KWGA 3C1AA 2YOHA 3QBTA 1FXSA 1RNLA 1GUFA 1Y4ZA 4G5YA 1CR6A 4K46A 4P08A 2A4MA 4ZOLB 5K3SA 2G9RA 3UHJA 3WBKA 5AVJA 1ZLXA 4OTZA 3CUVA 2FN3A 1ZJZA 4QTTB 4CKWB 4CN9A 1FCJA 4W1QA 3DFMA 2VPIA 2O59A 1L5RA 1ZIXA 5ISMA 1UBLS 2EX4A 3FZGA 1WZCA 2O2XA 1C50A 3I9MA 1RRMA 4PYLA 3FFAA 3U4HA 3RAEC 4KK4A 4F6LA 3A3YA 1LKZA 1WU7A 2EW1A 1UMCA 3A3OA 1KETA 2CHEA 4KIGA 3CNQS 4NU0A 1JJIA 4TX1A 5IBPA 4ZVOA 5CB0A 5CBPB 1VI6A 3R0XA 3QHAA 3D6VA 3R24A 4ZEXA 4B4DA 4MICA 3DC2A 3I5AA 4LVUA 2DLDA 1N5MA 1UPXA 4YVFA 3WLIA 2HU2A 2C9ZA 5JE8A 4GMGA 3CN9A 2C9MA 1K63A 2HGSA 4URVR 5IHPA 3AIKA 5C32A 1TQDA 1RLTA 1MC1A 3QVGB 5B1DA 1U65A 4I2NA 3HRHA 4NEQA 4XWTA 3S0JA 1HBJA 3KOZA 1NVMB 3R44A 4FNOA 2VWQA 1WDLA 2VEDA 3MJTA 4PZLA 2GUGA 2B99A 3GJQA 3BD8A 4KE9A 1ICEA 4Q6WA 2RGGA 2V7BA 1QRDA 1GKUB 4MVWA 4LHXA 2Z5VA 1MOQA 5E6SB 1E5TA 3TQSA 4JR2A 4B17A 1JFSA 1TKRA 3N58A 4UUOA 3MAJA 1C1DA 3PIRA 2Z2IA 2C96A 4YC7A 3S28A 1ZXBA 3F5DA 4FT4A 5CVUA 2WIFA 4AZTA 2QS9A 3B1XA 3KJEA 4CZ2A 4FILA 4IH4A 2IDMA 4O4IB 4UMVA 3WKDA 3IKLA 2R8RA 1TU4A 2IHZA 4HYQA 3F7MA 4YCBA 2QD2A 3PPVA 1TCUA 2FX3A 1C30A 4TRRA 4BLWA 4DKXA 4EJSB 2BSQA 3H19A 3GMSA 2XWSA 4G01B 3HWRA 5ED4A 2J85A 4GLJA 1O6FA 3A6GA 1TW2A 3ELUA 3OZUA 2VDWA 2BH2A 1PS9A 5COBA 1GUBA 3BZBA 3PYLA 5KHOC 1G4AE 1FVFA 1WP9A 2HMVA 4AIRA 2QBYB 4FW9A 5DTIA 1SUDA 3E61A 2GTHA 4B4VA 1IZZA 4Z9XA 3F1KA 3LQYA 3FCCA 1Z4PX 3QMVA 3HJUA 4YJ3B 5L3RA 5CVJA 4KTVE 1L0BA 2OD7A 1QF7A 3ZXYA 1EWQA 1Z8DA 5J4LA 4DIMA 3N5KA 3V46A 4UD2A 4DHEA 4L75A 1QTRA 2G9QA 1GADO 1V5FA 2R7AA 4JEIA 4EZIA 4ZCTA 4DILA 2J4DA 4KMOA 3VZPA 3ZK9A 1E2KA 4PPNA 1EFPB 5CH5A 4KH1A 1FDWA 4OU4A 1U2GA 1KXZA 1NUHA 2SKEA 4Q9JA 5KTOA 4YJ3F 3OFKA 2HC9A 1DV2A 1TYBE 1JEYB 4YP5A 4YJHA 2XE8A 4Q18A 3SBEA 1L9KA 2QMZA 2QAGC 1YHZA 3KVVA 2ZB7A 4RGYA 1E94E 2HPHA 1A50B 2VNHA 2BELA 3HZZA 1SZPA 3L8ZA 5CM8B 2XUHA 4ZJUA 2Y0PA 1OH8A 3TAHA 1CETA 5IDWA 4EEZA 2PN1A 3D6TB 3B6EA 4AIIA 4C7VA 2H4ZA 2Y0DA 3ZHTA 1EGVB 5JU6A 1B26A 4OQLA 1AQIA 5ALGA 3OZVA 4PSVA 3MPUA 5HW0A 1E3EA 2XCLA 3X1JA 1T4BA 3NYRA 2WF5A 1EBFA 2ONZA 4CJXA 2WC1A 1U6JA 2PYZA 4V38A 4F5EA 5BSMA 2W6CX 2YASA 4HNAB 3NGMA 2RDMA 1V2GA 4D9FA 3C3BA 4L4UA 5JH7B 4I9UA 1DLJA 3PPYA 4QNNA 3NJ4A 1LPPA 3TBHA 3KQNA 1E9EA 1YNOA 2QT9A 5ITWA 4UBMA 3E70C 1FY2A 1T8UA 4N7RA 5BUSA 2UZ0A 2UVPA 5B3KA 4GKJB 3GCZA 4N6GA 3KLOA 4FGLA 3ZV5A 3MTJA 4XX0A 2XKJE 4EB3A 3IE1A 2BGLA 3OTQA 4I5FA 1F20A 1VB3A 4HQFA 1UR5A 1VB5A 3HUEA 3N7UA 4FVTA 5HQTA 1M2KA 1EUQA 1QV9A 4QPDA 2GFIA 4DWJA 1TZ2A 4C0AC 2HSWA 4F4UA 3JAKB 3LQQA 3NT4A 4ZO7A 1KR5A 1Y7PA 2RB5A 3SI7A 3WQQA 2QMOA 3H9CA 4CL8A 1NVVR 2NV0A 1IAVA 4L7QA 4MQEA 4YBZA 1M6EX 3JZMA 1D5CA 1V8OA 3DULA 3C6KA 3H2YA 4OFBA 1Q5PA 4QSMA 2GXAA 5DYTA 5CDYA 2ZBQA 3BSWA 3IT2A 5AOVA 4BQPA 2PTGA 2WBLC 4WK0B 3ZK7A 1O9HA 3KL4A 1R0RE 2ZB8A 4WY8A 1V7PC 2NTVA 4Q37A 5JRDS 3ST7A 5IAKA 3V7YA 3NU1A 2EU8A 4O4JB 3BXZA 4UUBA 4BMZA 3CS3A 4KQHA 3UJ7A 5IWAB 2SICE 4QKQA 3IJ5A 2ZR0A 2YIJA 3E5MA 3O74A 1AX9A 1OWLA 2BEUA 4PZDA 4U7FA 3LLMA 2XDQB 3A70A 3EA5A 3PA8A 2HXGA 5E2BA 1SBNE 5AK4A 4C0XA 4EHDA 1U98A 3A11A 1ZM3A 2G70A 2YV2A 3D8UA 3P9YA 3R3HA 4O4JF 4YMTA 3A31A 2ZYAA 3JQ8B 2AXNA 1R6UA 3O75A 1XZDA 2OGUA 4J0QA 1QX3A 1DRUA 4MQ6A 2RCYA 1V4NA 1GNLA 3VR3D 1TT5A 2QWXA 3EIHA 3O1HB 7REQA 5EQFA 2MYTA 2Q3CA 1GZSA 2R65A 4JGIA 3BKXA 3DS8A 1LI5A 4GMKA 1TIKA 5L8VA 1TVEA 5JWHA 2VT3A 1PJZA 3WJ2A 1MA0A 4IF4A 4WY5A 4LYAA 1ECGA 4JCOA 1GYQA 3F71A 1F6BA 3Q5EA 1DUIA 3TQHA 3UA3A 2HK6A 4IRUB 4BPRA 4WKPA 4ZZIA 4S1NA 5K05A 3ZWXA 4DWVA 1Q1NA 3S2FA 1KP9A 2IHYA 4TTAA 3V2HA 3A58B 5K51A 4D56A 4LY6A 5BORA 2OYRA 5ICEA 1JKFA 1G5QA 3AEYA 4JFRA 3GHHA 1GTVA 2P7HA 2VHZA 3DL7A 1VL2A 2RGNA 3A6JA 4IS3A 5T6MA 3U6BA 4RGVA 3I2HA 2IDZA 5FP0A 4Q16A 3EZ9A 5FOQA 3SC4A 4V0NA 4DSUA 3QZUA 2ZTSA 3HYRA 4Q4AB 4RMGA 1RXIA 4ZQIA 4P86A 1OI3A 2NNWB 3C7CB 4L5IA 1L8QA 1FP1D 1I2DA 4UFNA 1MV8A 4YXWD 5MHTA 1XV5A 2OO7A 1W5BA 4FOTA 4I08A 4RTMA 1HNWB 5AXAA 4YV0A 4WNCA 2FZKA 1BMQA 3JD2A 4XLTA 3ABOB 4Q3LA 2CGEA 2DY0A 4UEKA 3U4GA 9LDTA 4URFA 2HA4A 1FFBA 1GG9A 2B34A 2B5OA 2FW8A 1HLDA 3N2NA 3OUTA 4I4TB 5AD1A 1A95A 5F9MA 1IHXA 3EK2A 5I4CA 2W6ZA 4GOMD 3KT3A 4OSPA 3KQYA 4R1UA 1AUVA 3V8RA 1RWXA 4JB3A 1HPLA 2J5QA 3WS7A 3NHUA 1JFRA 5B7QA 1N1EA 2HA0A 2PANA 4GLFA 4HDRB 4HH0A 4I4IA 5G4KA 5BUZA 5CXQA 2XKKA 4LCEA 3MBOA 4WADA 1TO1E 1Z0ZA 2QT0A 2EBFX 5FYDA 2IV7A 1PO7A 4GPIB 3IBGA 3MWJA 1AMOA 1SOWA 2JBWA 3CX4A 3VJKA 3QF4A 4YMUA 3WYGA 2B94A 2DWUA 2E4UA 2H3HA 4ABTA 2YXDA 2J3MA 2HCTA 4PX9A 3SX2A 3FPJA 2OEPA 2J33A 2WHPA 2C98A 2G36A 2LIVA 2ZOSA 3FKJA 4FLMA 4JUAA 2HA5A 2FN7A 4YQEA 4DR6B 3L4BA 4HGRA 2PX6A 3I72A 1Y9EA 3V1NA 1WTCA 1NNI1 2AHOA 1VKHA 2ZT6A 4OB6A 2CHGA 2GKGA 2KI5A 3G2LA 4FD2A 3DMFA 1RIIA 4LDZA 4DLYA 2VTKA 1X7DA 3IMFA 4NKRA 1OI7A 1JAZA 1E62A 3IOEA 4YMIA 1SBTA 2GCOB 2TYSB 2XEDA 2ZQYA 4DOMA 2EFCB 4IIYA 4C3VA 1JAIA 4TTTS 1J9ZA 2WG1A 4GI5A 1RIFA 3L40A 2ZTMA 2O3QA 1IVSA 4M0DA 3ZVNA 4R51A 1K68A 2PUEA 5GY7A 3SR4A 3EVAA 3NVMB 2G4VA 2QNRA 3M82A 1T3TA 5F33A 4AZ0B 3HB5X 4C6SA 3MTIA 3N2YA 2I55A 4EITA 3EZFA 5C7LO 5A3QA 1Y5NA 4TGLA 4BN4A 1FFYA 1QYRA 1NJ8A 1PR3A 2B37A 1FFAA 2Y92A 3KWJA 3MTQA 1NYLA 5T3YA 1T36B 3GLVA 2Z8YM 3H65A 2YJNA 1L5VA 2JF0A 2OG1A 1NP6A 5KREA 3OM8A 2AC7A 3VVMA 1DEOA 3UTDA 1QOPB 4K26A 5FKJA 3L02A 2QE7A 2JPDA 4EA6A 5AVVA 1KMQA 2CUNA 2OV4A 3WZ2A 1J8VA 1BEEA 2HK9A 3M5CA 3Q15C 4OQPA 3JSXA 2MMCA 3GQBA 3OLYA 1JG3A 4F6CA 3CC8A 3IHWA 4Z4FA 5LCXA 3SVTA 3TD6A 4MXDA 3FZNA 8LDHA 2ZYUX 5CFNA 2CFSA 4OK6A 2HLHA 3IMCA 1S02A 4E1VA 2Z30A 2HHCA 2WSMA 3D9QX 1JHRA 1IFXA 1C2YA 3ESQA 5FIUA 1EEHA 3RSCA 5IT4A 3BTOA 5H9VA 5ALQA 1DKMA 1FTQA 4UZFA 4JBGA 1I36A 1LI7A 3CPSA 4TYYA 2AFRA 2RGNC 1NATA 2GKSA 4DLUA 2FQ1A 3AETA 2C9YA 4N9WA 5WRFA 4FGSA 4HT3B 1J99A 1TC2A 3RGGA 3QI2A 3V7UA 4TM8A 5EZYF 4WY2A 3FRJA 2JGNA 2JLZA 1HEIA 1Q7TA 2CXUA 5GIOE 2OWDA 3E27A 3MJSA 1VBKA 3D81A 4FKBA 4NZPA 3W5HA 3H8VA 3QVTA 4C21A 5JCXA 2ZCJA 1V9SA 1MAVA 1AV6A 4I5IA 4ZEVA 3UEOA 3G82C 3PD1A 4LMPA 1DAIA 2EX1A 2XVZA 2FZ5A 4YASA 1YIDA 5AI4A 5FJJA 5IXYA 1RM3A 4FDUA 4EY3A 3FNQA 4O5OA 4PBSA 3TIFA 2DFDA 1VCHA 3B78A 2GFQA 3NETA 4IJVA 4N3BA 4UE6A 5K4AA 1ISGA 3TLAA 1ZOPA 3V80A 4YAKA 1J0DA 3HVJA 4OXQA 4JU9A 1QPGA 1NBWB 5HM6A 4QU9A 1X8JA 1V8DA 4ZZ1A 2IWHA 2MSEB 4OHBA 1F5SA 3FFBA 4D4HA 4PF1A 1UAYA 3C3CA 4URZR 1DTSA 4P0TA 4AJEA 4M89A 4HZUB 3O8OA 4Y2TA 4DLZA 1NVWQ 5JLJA 5K45A 4I6GA 4RVNA 5FLXA 2IU3A 1BGWA 2GJKA 3GUCA 5EPEA 2I5PO 5KJFA 5KDDA 2UXCB 4H6WA 5G02A 1BX3A 3CB2A 4KGVA 2GM4A 2B78A 5DYYA 4E33A 3FTPA 2VQDA 1L5YA 4GFDA 4HOYA 3FPSA 3NIWA 1BD4A 1GA4A 5JY1A 1TL7C 3EDMA 2P3SA 3NT2A 3VR1A 5CXUA 4M2LA 2RHCA 4Y2PA 4XLZA 1LDGA 2I4RA 3CFYA 2QSJA 3ETNA 5IBQA 4CI0B 5BOSA 4PCLA 5DT2A 2H1WA 4AZSA 1L4MA 1OAOA 2QTAA 4ZVUA 3BGIA 5KNLA 3SC2A 1WPQA 4ZO6A 2WI8A 1X9HA 2H1RA 1NI4A 1J7JA 5IT9A 3G0HA 3EHDA 3PCRB 2AZXA 1X1TA 4HAYA 2VKTA 4GX5A 4ZHQA 3W05A 1I0ZA 3L0OA 4EY6A 5CK5A 1Y1SA 4KWTA 5HA5A 1K7FB 1EFLA 3KKQA 3V1UA 3ZIDA 4ILEA 1P3Y1 5JW6A 1OWNA 3PHHA 3WMEA 2FZWA 2ZJBA 4B4WA 1V8PA 2DLNA 2ZRLA 2FPGB 3EXIA 1TA9A 4KO8A 5FI1B 2V74B 4RIHA 1MG0A 4CDRA 4DUGA 4YCLA 4JQYA 5J1SB 1N2JA 2VDLB 3BB4A 1EFVA 3T35A 2HWYA 1BE0A 3EA0A 3L7NA 3L7KA 4LE1A 2FQQA 1H2AS 1MPXA 2Q2WA 4GF5A 5JXWA 3AGPA 3SQDA 1A76A 4Y8VA 3WYNA 3NNSA 2O3SA 4W4TA 3VOBA 3OE4A 3Q7IA 1UT5A 2X6RA 1XJWA 4MYHA 1M10A 4ALIA 3I61A 1FRQA 4F4CA 1OZ0A 2H4YA 2NAFA 2X9VA 1I0LA 1BAPA 2GXUA 3CTMA 3B1JA 1PFGA 4EAQA 2JHAA 4IZ6A 1O5OA 1QG4A 2J9RA 3IRVA 4K28A 3ROTA 1VM6A 2J6IA 1X7WA 1YB6A 4RDHA 4G9GA 1LPNA 2RI1A 4DCGA 4NDAA 3SVLA 4XIIA 4Z9YA 3OZXA 1KI6B 1MORA 5CA1B 1VL5A 2BCJQ 3INGA 3G23A 5E3JA 1K27A 1M2OB 4JBLA 1XZJA 4UREA 4OCZA 5FWYB 4CMIB 1A82A 2P41A 3NTRA 4BLPA 1LTKA 4EKNB 2VK4A 5LVAA 1GUDA 3K7EA 2BEVA 3OAAA 5KSZA 1DXQA 1T13A 4DDKA 3P96A 2ALJA 3OQOA 4OKSA 3NONA 5CA1F 1A4UA 1NNUA 3IDOA 3BIFA 3N8KA 3H3FA 3ZCTA 4YRBA 4M0FA 1J07A 1PD0A 1KY2A 4IEFB 4QJBA 1D1QA 4R1NA 3TD9A 4HDCA 4J4TA 4WJZA 1K7XB 4CIVA 5GTDA 1Z6PA 2M6KA 3ICVA 3A2MA 3QVWA 2O8EB 2F67A 1Q0RA 4XGQA 5HMLA 3G17A 5T41A 2B4QA 2VTVA 3PXDA 4HDNB 5AVRA 5HK9A 3IVMA 4CKBB 1F51E 1QYIA 2WM8A 3IMKA 4A7PA 3OBBA 4C7XA 3BPSA 3HXLA 4ZXFA 5HR5A 1NX9A 4UDOA 1OCEA 4M7OA 1V5WA 2J41A 3GT7A 3IO5A 2IYWA 3NM5A 3MCZA 1ZN7A 1E7YA 2WHXA 2P0EA 3K5PA 4OQDA 5ALKA 3U9LA 3KIPA 3ZJ4A 1CUIA 1QFMA 3ADDA 1NUQA 2QLTA 2FUG1 4BFUA 3PL1A 4MUHA 4WLOA 5TGTA 4IHJF 4QU5A 2HRDA 4A8HA 4UOZA 3EVTA 3EEFA 3OCUA 2Q7DA 1JYEA 3MTAA 4PWZA 3LGXA 4BDSA 1YJBA 3P9KA 1KFBB 4ZCPA 1PJSA 2VXOA 2Y77A 3PJFA 3QVSA 3EXFA 1SJ9A 2C4MA 4FOPA 5IAJA 4IRXA 2GLTA 3IP5A 4RCYA 3I42A 2Y0BA 4XVQA 3IEXA 4CLRA 1JQ5A 3KJGA 2VWPA 3FPGA 1LNSA 5IK2A 1WSBA 2C2KA 2FLKA 3R3WA 4Q4LA 4S12A 5FOWA 3BRWA 3W1VA 2ZSBA 2OT3B 2XF8A 4I1RA 1PVDA 3WL6A 2GN9A 3HV2A 1G1AA 3GRKA 5FWXB 1TAHA 2XIJA 2F43A 1DOZA 2OHHA 1EHYA 2X9NA 3GEPA 5AHOA 5IULC 1DIOB 1A8SA 1JQ3A 3GBSA 3WJAA 2PSHA 3QA9A 1SD5A 1U6KA 3CV3A 3AUSA 2IA5A 4EVIA 1KO8A 1PEKE 1C0LA 1VL1A 2XV1A 4KVGA 4Z51A 4DC0A 2QYHA 3V4PB 4C4OA 3AUUA 2GZMA 3DWGA 4XFJA 2GBGA 3GP5A 3QGMA 3N75A 2QUJA 1P1CA 4ZAYA 2W93A 4BUZA 4R71A 1YGYA 3ESBA 1ELOA 2HUPA 2WOJA 4LGCA 4BO7A 4R1OA 5HSGA 2RAPA 3HJAA 2R79A 3DBLA 2IHKA 5HNKA 3WXMA 2TMKA 3IRUA 3WL4A 2Q50A 1RFGE 1KR2A 1Z73A 1CQPA 1ONNA 2CL6X 3FCAA 4QQNA 4BAZA 1U0BB 1U80A 5IT5A 1MG5A 4KPUB 3GH1A 5JO0A 1PK7A 1KFEB 1NKVA 1Y7IA 4R9SA 3AVQA 2B8WA 4XM2A 3VO1A 3DZDA 3HLKA 1ZNZA 1MNQA 3QIAA 4J0DA 5JZMA 5E2AA 4EENA 2Q4BA 1JKIA 2BMDA 3ORHA 2C5BA 2EGGA 1U31A 3KYIB 2XRZA 3H0KA 4RPIA 3H5IA 1KYQA 5DULA 3UF0A 1GO2A 2ZZMA 1R0YA 2XB4A 3AEQA 2VPZA 5EQJB 5BMVA 5BYAA 4JI7B 2AEJA 4B3TB 2ZZKA 1D2HA 1ZK4A 3HVHA 5JEDA 4ZO9A 5BSRA 2GYVA 2VDRB 2BIFA 2MT9A 1ZUNA 3BWBA 3ISJA 4K8OA 3B13B 4XI9A 2VOJA 3GLHE 1XNHA 3AZQA 4QYTA 421PA 1UKCA 4G3XA 5LNK1 4Z4HA 2CJWA 1AA6A 1RHUA 2ZAGA 5JCPA 1Q0SA 4QPZA 3ZTWA 5E7IA 4GKKB 1NVVQ 2I1LA 1DMRA 1UZLA 1WLYA 3Q2KA 2F4NA 2IPNA 2RGYA 2ZT7A 1YRYE 4G9EA 3S2IA 4TT3D 3HBAA 1J8QA 1PR2A 1LRJA 4FFBA 4JL6A 1H0SA 3HL0A 4XWGA 4BL5A 1G3RA 3VZCA 2PVPA 3RC2A 2SCUB 4LSMA 4Z0HO 2J30A 1JG4A 3IAAA 2QTCA 2XGJA 1JEEA 1R4NA 3JWGA 3BRQA 3O8DA 5HFJA 3IUPA 3LW7A 1O77A 1C7QA 1NUSA 3WIBA 1Q19A 1HGXA 5FBRB 4DCPA 2XE6A 4B40A 1JEOA 1GRNA 3T9AA 1ZGHA 4K9DA 1YU6A 1E60A 2XCUA 1E0SA 1ST2A 1U7UA 1DT3A 2QX4A 1A4XA 4WA7A 4H17A 4BC1A 1OH6A 2B36A 5ELLA 4LWOA 3PTLA 4MW7A 4NFHA 5DXAA 4CG0A 1YR3A 5HJ7A 2AR0A 4H7DA 3IH5A 4C88A 1N6IA 1CEEA 1O4VA 1RZRD 1B8VA 1VG8A 4HD8A 1C9MA 2WKRA 1Z6QA 4TQGA 3T7TA 1IHYA 3M9XA 3TCNA 3O82A 2JIRA 1LSUA 821PA 4FMCF 4R68A 1JR3A 1I33A 1P18A 4GDMA 4BX3A 2YZKA 2V7PA 2FE1A 5E9AA 2JRCA 3W2FA 1AURA 3O91A 4KQJA 2ZJ4A 3C7KA 1J0EA 1ONPA 2MJLA 4GOJA 3T61A 5IZCC 4WZAE 5SZHB 2B7LA 1QQBA 3STWA 4F85A 2PKRA 2W2VA 4Q7MB 3KYJB 4AO8A 4KXWA 3KEGA 3WLHA 1YVDA 2A0KA 4NPAA 1PR5A 2ZRCA 2XQJA 3BH7A 1JHUA 4B32A 4C5BA 5LNK6 3TKLA 4KDCA 5ERGB 4UBIA 3OX2A 4AO6A 3TVTA 1U8YA 5EWJB 2AZTA 4TV9A 5IW8A 1ARZA 3IULA 4FE7A 5DM60 4ICIA 3NM6B 1W5EA 3ZK8A 2NXNA 4Q4DA 1J0BA 4UNQA 4DBVO 4HGNA 2C1ZA 3R20A 5ENDA 2VF2A 2CLSA 3EYWA 3C97A 1AY0A 4OIMA 1PL0A 3BXEA 4LDPA 1B43A 1U0JA 2D0PB 1LW7A 4B76A 5DP1A 4XSVA 2RSLA 2P79A 5IASA 1L1EA 4A8JA 2ZZNA 3HXOA 3ZUGA 1BCRA 5FXMA 3S40A 2R1UA 2X86A 2WABA 2C99A 5DBFA 4AY4A 3L1UA 1SVUA 3F2IA 5T6BA 2DT8A 1Z2PX 2BSXA 3IBSA 3RSFA 2IITA 2JGKA 3I58A 4NBWA 4MVJE 3M1AA 2QXYA 2JZOA 3ABQB 3HWSA 3N3BC 3ZJTA 2HBYA 2I6GA 3ES9A 5TQ2A 3OJFA 1KRWA 3R6GA 4K9RA 1V1RB 3IAM1 2QRLA 1JDVA 4DMCA 1ID8A 2ETXA 4MYTA 1UC8A 5IF9A 4P53A 3PPIA 4YAGA 3EFHA 2CNOA 5LDDC 3L7CA 4TZ0A 4YAOA 3K0SA 1G3QA 1KHTA 1M7GA 3OEED 3Q3IA 3LYLA 1USGA 1NT4A 4Q21A 4UM9B 1D9ZA 4X6UA 2Z0MA 5LXTF 4XZ3A 4FWTA 4Q1CA 1ULSA 1G17A 1X86B 1YC5A 5AOAA 5JVDA 1GAJA 4EVQA 3BFJA 2Q8NA 1KHHA 5DOZA 2A5YB 4M54A 3L4SO 1JR4A 4KR2A 1KYIA 3Q3CA 2DERA 2DOKA 2E4XA 2QXTA 5HQJA 1F9AA 3Q1LA 1FSPA 4HB0A 3QYJA 4K40A 2WD7A 2HQRA 3CUYA 2Q4DA 1ADFA 2XAAA 3LUPA 5DSXA 5FL7A 5DNWA 2C5AA 2GM9A 2ZAOA 5I8PA 3RVSA 1MVLA 3BJIC 4I5EA 4UTXA 3EPRA 3EMKA 4X1OA 2DTDA 4X91A 4D0SA 3SP1A 4HRYA 2YVAA 1RAEA 1Y7HA 2ZE6A 2IIPA 2FN9A 3B20A 3HN7A 4HSEA 4MCHA 3EPLA 1H2ZA 3NDRA 3FSRA 5KX5A 1G7CA 2QX9A 2NYRA 3QWIA 1JNXX 4FXOA 4GT1A 1A8QA 3LS2A 4IVQA 4OHVA 3QG1A 3W8RA 1Y8RB 2GB4A 2X0RA 5FPQA 5GGXA 1PX2A 3FF4A 2H54A 1U90A 1XHEA 4WAUA 4A6EA 4M6WA 1FUEA 3Q7QA 4YACA 4YP0A 5CCDA 1U28C 3D6FA 3QF7A 4M9SA 4YT4A 3VO2A 4FCTA 1CS0B 1ULTA 3F8SA 2ZJ5A 1NG1A 4HAUA 3U7GA 2FPLA 2NU7B 5F7OA 1E2FA 2QYOA 5K3FB 4D9IA 3OUUA 3UJNA 1YA8A 1MTZA 1CR1A 2NXCA 2O3UA 5CYPA 1XMPA 2ICAA 1ABEA 3Q6IA 3E9CA 3LUDA 3IAM6 3QWAA 3QU4A 1O6GA 3MS7A 1XP8A 4WVLA 1NUTA 5AIAA 4ENRA 1XA3A 1X7HA 2PO7A 2A14A 2H08A 4J0JA 4R7ZA 5ECYA 4ZT4A 4RULA 3L4KA 1OB2A 2QW0X 4P3PA 3L92A 2QROA 3ZE9A 3HVKA 5LQMA 1T9DA 2DT5A 3L77A 1CWUA 3MC1A 4DSZA 3CW8X 1JIQA 3A9VA 5C1BA 2AF4C 1Q1EA 1SMKA 2BZ0A 1LVHA 4CCYB 3KLBA 3C14C 2EATA 3EZGA 1QP8A 3IT0A 3M6AA 4JR0A 3F78A 4ZC8A 4GGOA 1VCIA 1GTJ1 1GUAA 2CF5A 4N8SA 2QL9A 3EFOB 5U1PA 3FPCA 2XR1A 2R8XA 4K88A 4LJ4A 2C2XA 1SC6A 4ZGBA 3AJDA 2JH9A 4R0VA 3RROA 5KNBH 2ZS7A 4X6XA 5KDOA 4OMFG 3O8RA 5CNKA 3UJ9A 1GAWA 2JFQA 4MLPA 1FJGB 2FZGA 4ML3A 3SM9A 4TWJA 2RGCA 4QOEA 4BB5A 1BC5A 4DJTA 4MWSA 3ZVMA 1LWOA 2GBLC 2F1HA 3I01A 1NM5C 3NBMA 4FGWA 2Y6VA 4DLRA 1E20A 2BONA 1CYEA 4DJDC 2EWWA 5EY5B 5BQFA 4PZYA 3EIQA 3SYLA 1UMCB 4KXYA 1EXMA 2PUHA 2GN6A 2NUBA 3GFVA 4HAOA 1G64A 5DNVA 1EB9A 5H02A 3WHPA 1Q0TA 4KE7A 5TB5A 5TJHA 1VIDA 4N5HX 2Q4OA 4HMQA 5JJIA 2EOAA 3KQPA 3P5SA 3QFCA 3RS9A 3NDIA 4HQKA 1ZI9A 5DMHA 1T9GR 1OPXA 3VU8A 1DRKA 1UINA 3T4EA 3SZLA 4Z9FA 5EAIA 4PXAA 4UCQA 5B4VA 3GEEA 7YASA 2Q8PA 3VI4B 3LU1A 1QVZA 2AI2A 4E31A 4CNQA 2H2IA 3COPA 4J0KA 1SD1A 4NE9A 3ASYA 3AHCA 5ALXA 1PEYA 3JPYA 1WB5A 4LZWA 2VDVE 1LC3A 1D3AA 4UTNA 4ZCLA 5HCNA 4CKCA 3TQRA 3BQ9A 2QIOA 2X41A 1N32B 2E48A 4JVMA 4RTKA 3U4IA 1C1DB 1NMEA 3G1WA 1OX5A 4PO1A 2XODA 3EGIA 1CUVA 2R48A 2W2OA 1E1MA 2CYAA 4BJ3A 1S01A 4HAWA 1SXQA 4UDYX 3T5AA 2HCFA 4LYJA 2ZWPA 1GHTA 4UULA 5KOJA 2DU8A 1LS6A 5KJCA 1C30B 4P4NA 1NAIA 3LYHA 1KAGA 3IOBA 2RGRA 1QANA 3M6XA 4V3CA 3T5TA 1NRJB 3AUKA 4K6FA 5IJAA 4BJ5A 4B83A 2W2TA 2VDWB 4J0IA 2NUAA 2R47A 1QIIA 2OC9A 3S99A 4PLPA 3UY4A 3GBVA 4OH1A 4BBPA 5A4DA 3CEMA 2IHVA 2CJPA 1F3LA 2XXBA 4HN4B 4JYPA 3DBOB 2J3EA 3D3QA 2RBGA 2VP6A 4JUDX 4MPRA 2FPWA 4TUYA 4DSTA 3GFFA 5LWHA 2ZTUA 3PFWO 2Q6IA 2OXRA 4JODA 2BJVA 1FTWA 1V8BA 2G8LA 2IZ5A 4CCSA 3ZX4A 5IMBA 4QHTA 1A1SA 3VYWA 3T1OA 2HJWA 4WKOA 2QRGA 5TPZA 4RTLA 2M2IA 2W4QA 4IUBS 3PGMA 1EJ6A 3VR5D 2GZRA 5KB3A 4F9FA 1JLKA 3T3DA 3MOGA 4N7MA 3UAXA 3PX3A 2F1RA 5HHTA 1T1JA 1C7ZA 3AJEA 3BDIA 4DIBA 2AJ8A 3I04A 4OI1A 4MQUA 1DI0A 1N9KA 5JQGF 1F38A 2YJ3A 1R2QA 2ZETA 4QOJA 5BYBA 4RPLA 1XK7A 2CFTA 3H5WA 4R9VA 3VPXA 4E7OA 2AEMA 1KH3A 1L7NA 4MYCA 1NV9A 3N8GA 5KBYA 4YJHB 1DDGA 4AJKA 2NT4A 3GGSA 3KBBA 3MIZA 3TOVA 4GBMA 3ZXUB 5BV8A 3OT5A 4QVKA 3X2FA 4OA8A 2V5VA 1OYYA 1S89A 3M6LA 2G9NA 1UP7A 4M7WA 4EEKA 1KIMA 4E5VA 1VSVA 1O4WA 2H4HA 2ZPUA 1DEKA 1JHDA 4BPBA 1F7UA 2ZUEA 2WK1A 2VF8A 4ZI7A 1USKA 2YY5A 3P9SA 4BMCA 3DF9A 4PC2A 2HLPA 4L9RA 3C3MA 4ZJYA 1RRGA 2PD6A 2LUOA 3DO5A 1FMLA 2K87A 3HGTA 2PKCA 5HDBB 5A03A 4R81A 1MJFA 2FR1A 5LOVF 5A06A 3IEPA 4MUFA 1KMNA 1TECE 1XNJA 2JAQA 5IJZA 5JXJA 4IM7A 5IWCA 1SKQA 4TTQA 2AHRA 3M4ZA 3HJNA 4AZ3A 1R88A 1L7BA 1DCKA 1S4QA 4PW0A 4IGIA 3AI2A 1RPNA 4QJIA 4YROA 1CZKA 1SZJG 3QG5A 4REOA 1NLMA 3ILYA 2JHCA 4OV6B 2F8TA 2C3YA 5IJ0A 1IHOA 1WUKS 4LZOA 3A4VA 2YJZA 3CZAA 3HPQA 1U11A 2UVPB 8ADHA 2C8VA 4V24A 4NQZA 4MPPA 2OB2A 5CX1A 3MWKA 4QSHA 3ZWOA 2CXNA 4HS4A 4EJSA 1YMVA 5F52A 4MYSA 2QM3A 1P80A 4UNIA 2LXNA 4XX0B 1MEEA 3PC3A 4A6PA 1KQPA 2PBZA 2RKBA 1U8ZA 2W0SA 3L43A 1Z28A 1UKAA 1CCWA 3CRRA 3UYLA 2ECOA 3DKKA 3V6MA 1ZMXA 2F48A 3H4MA 1PVOA 2L18A 1HTTA 1K6IA 1KO7A 3HA5A 3E35A 3OCVA 2Q8QA 4V0SA 5G1PA 4BNYA 4C06A 1P0MA 2FPKA 4Q48A 1OHHD 4MQEB 3UH1A 4P3KA 2ZSJA 3EYAA 2FFRA 4HFRA 4PS1A 5DTMA 2JG3A 3ZVRA 1KRHA 2D5BA 2FXVA 2PNJA 2NIPA 4MKIA 2W37A 3GLFA 4JSTA 1PZMA 4HLUC 1JHYA 4NMXB 1ZMOA 2R5NA 1R0BA 4WDQA 3U3KA 2I65A 1Y4SA 5K3CA 3JYQA 4C2BA 3W5CA 7GPBA 1QG2A 1XVIA 2JFZA 2VUTA 4OHPA 4IVRA 4OI2A 3IV6A 1SKAA 1G20A 2VUIB 1R6TA 5K0TA 4MVJF 1IXRC 1QAOA 1JDZA 2BEUB 1HE5A 3RIEA 3L82B 3RT7A 3KJNA 4CLXA 3QXGA 4CIWA 4OBXA 4I1SA 4K7JA 2QL7A 1N9ZA 1TU0A 4P7KA 2RC5A 2O3RA 4G85A 1E8NA 4NJEA 1YUBA 1CUFA 5G0VA 4RF5A 3W2IA 2WQ7A 1KK0A 2ES4A 3JQAD 3UXMA 1BO6A 2ID7A 3RRJA 4OGKA 2VHQA 3IQGX 1E77A 1RCUA 4N8EA 1SR8A 4ZQFA 4D5GA 2A3NA 2XMGA 4MO2A 3NBYC 1YJ5A 1TT5B 4OHCA 1K0UA 4F3TA 3MJFA 1XMJA 2XBUA 3QLUC 3TVYA 4BDTA 7REQB 3W77A 4IQ8A 3ZLJA 1ESDA 1Y3HA 2X2FA 4HWKA 4BKRA 2DUWA 3ZX5A 5JCJD 3GAAA 4R98A 4RHFA 1MJNA 1XMIA 1M6HA 5AW9A 3VDQA 2H5JA 3DE5X 2FEKA 2WKQA 4KGDA 3S7TA 1ZZGA 4TVSA 2VL7A 4OXRA 4U63A 4M1WA 2FA9A 2IC5A 3GGPA 4NOJA 1G0NA 5DBIA 4ZRNA 5HKLA 1QIJA 1PQWA 5F35A 4KNYA 3AY6A 4FNGA 3FMOB 4A27A 1KI7A 4DR4B 4QDJA 4QARA 1G8SA 4HNQA 3GRFA 4GBJA 1K89A 5DYGA 3S7ZA 3CR7A 2YXLA 1XZEA 4GP6A 4LJ6A 5CB8A 5KTYA 2ZRFA 4Q3KA 1C9KA 5EINA 4HPXB 4B74A 5FNVA 3FI9A 2IZZA 3RYIA 2YWEA 4O33A 4XH9B 5JDIA 3E7WA 1TKAA 1ZUD1 5AI5A 3GCDA 3IVCA 3RHSA 2HRCA 1TM7E 1SUCA 4JJEA 3TOZA 2CNDA 3MS4A 3O8NA 2JNWA 2DFTA 3BL5A 5JD4A 3VR6D 3R3JA 1LPOA 2WHEA 4GLLA 3OKPA 1LS1A 4FONA 4CLDA 2PS0A 3KALA 3VH2A 1WBJB 4I1YA 4Y9DA 4XDHA 3UGKA 3W5VA 2WVAA 5CLJA 1NG9A 1JDPA 4EKDA 3G9QA 1S2MA 4MO9A 1ZN2A 3VTAA 4EY7A 3WLQA 1QV7A 2AQIA 4QUDA 3WFIA 3EW9A 1YFLA 2EZ9A 1IBSA 3GEMA 5ERXA 1EVZA 1HQYE 5G4KB 1Z63A 4XGRA 1GFIA 2VYFA 2HNAA 3FE2A 1EVYA 4OLFA 2K7FA 3LUHA 1LX7A 3CEJA 2G9UA 3LKDA 2CXTA 1N77A 4XRRA 4C0QC 4ZOCA 5EMJA 5BT9A 4K86A 1GNPA 4M3NA 3WGJA 1QQTA 3QF4B 4NS4A 4B6QA 2VP2A 1QE5A 3LE8A 2D1YA 2QV7A 3ZW9A 1DC6A 4NBVA 2GO7A 3ONFA 2ORVA 3CPEA 3E3LA 2WHPB 2EKDA 3N0WA 3OM9A 3PHLA 1JLSA 1AS0A 1L7QA 3MXOA 4JL5A 4WCVA 3JQFA 5AW1A 3M4NA 4KK3A 4D43A 4YGYA 2R2AA 3HR7A 2JCBA 1P6QA 1QIGA 1M1YE 4LTMA 5ENVA 5K3AA 1RHQA 1ODFA 4F2HA 4QEZA 4BUJA 1WOMA 1WS6A 5BO5A 1ORHA 2C1XA 3AV0B 2VG8A 1KK3A 3GNQA 1YBMA 4CI9A 1Z12A 4DRXA 3DBVO 2WU8A 1QOZA 2VHXA 2B21A 3BD6A 3JQBC 1QGYA 2E4VA 1H5UA 4J2HA 5CNJA 1H3EA 4FYWA 2X4IA 4UFPA 1QZ3A 2JD1A 2QTFA 1Q7CA 3GLUA 3OP1A 1RYHA 3AEUA 4UUQA 4DR5B 1F17A 4FZJA 4Y9RA 1H2XA 1N5RA 1E99A 1ZINA 2F7SA 4BWVA 2HU5A 4Z3KA 2XUFA 1R9NA 1GU1A 2QTGA 2VP5A 4UTRA 3STYA 5AKYA 1IN7A 4KN5A 2X9GA 4JI5B 4HVAA 5JRZA 4LY0A 3OZDA 1YRHA 3KXKA 1J8FA 2FR8A 4IFIA 2D7DA 4LHSA 2ZIXA 4E3ZA 2JJ2A 1QDEA 1OLSA 5DHRA 3VR4D 3OQNA 1K6XA 4JASB 4X44A 5F7XA 3MM4A 2HBZA 2ZEJA 1CF9A 5F4BA 3R75A 1C7FA 1XMVA 2FUCA 2PLNA 3W1WA 4RK5A 1NRXA 1AK9A 4JLOA 5EE1A 1NZJA 4V0QA 5BV7A 2R7NA 4X65B 3QUAA 3CUKA 4AWBA 3ZR4B 1R0SA 1ZQ9A 3TLEA 3WL3A 5E1DA 3QUCA 3NIGB 1QK4A 3ELWA 1MB9A 1HDEA 3GN2A 4IGKA 3TPCA 3ESYA 3QLVA 3MT0A 1LSSA 4N3GA 2GVZC 4OG2A 4G4GA 3UT6A 1F06A 4R2XA 5TMBA 3OIGA 5ULLA 3SS8A 1JH9A 1QPZA 3SD7A 1S7CA 5INTA 3GQBB 3T5CA 1DB3A 1ABBA 2W