2DUJA

Crystal structure of the complex formed between proteinase k and a synthetic peptide leu-leu-phe-asn-asp at 1.67 a resolution
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
279
structure length
279
Chain Sequence
AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTDILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Proteinase K
publication title Crystal structure of the complex of proteinase K with a specific lactoferrin peptide Val-Leu-Leu-His at 1.93 A resolution
rcsb
total genus 97
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2006-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 2dujA00
2DQKA 4RYDA 1Y9ZA 2PMWB 3LXUX 1GA1A 4H6VA 1YJCA 1BE8A 5FAXA 3AJ8A 1TO2E 2ZWOA 3VV3A 1V6CA 1R6VA 4YN3A 1S2NA 1S01A 1P7VA 1Q5PA 5K7SA 1ST3A 5JXIA 1SN7A 1TECE 1SBIA 2Z2YA 1KE2A 1R0RE 2Z58A 3DE0X 1LW6E 1BH6A 2IY9A 1AF4A 2SECE 4H6XA 2Z2XA 4BWGA 2X8JB 1TM7E 4ZOQI 3DE2X 1SUAA 1TM3E 4KPGA 1WVMA 5AMXA 2PYZA 4KG7A 1PFGA 3DYBA 2XRMA 3UNXA 3PTLA 2V8BA 1GNVA 1BFKA 1V5IA 1AU9A 1JEAA 1SIUA 4OMCA 5SICE 2W2MA 3QMPA 1T1IA 3VHQA 1VSBA 1SUPA 4MZDA 4K8RB 5ARBA 3ZXXA 3QTLA 4WOBA 3EDYA 4LVOA 4C3UA 3BX1A 5FFNA 4B5LA 3SICE 1WMDA 3P5BA 1Y3CE 1WSDA 3VV2A 1KDZA 3ZXYA 3AFGA 2HPZA 1OYOA 2PKCA 3Q5GA 3VSBA 3HJRA 3DWEX 1SH7A 1SUBA 1GNSA 1SCAA 3EIFA 1C9JA 3WQBA 1ST2A 1ZVKA 4DWWA 1HT3A 1GT91 1IAVA 2WUVA 1OT5A 2DP4E 1SBHA 5FBZA 1DBIA 3DVQX 1GA6A 2X8JA 1GTJ1 1CSEE 1TK2A 1SUCA 4J94A 1S02A 4CG0A 3LPCA 1CNMA 2ZRQA 1WMFA 1GTL1 3BPSA 4HX2A 1Y4DE 1TM1E 1P8JA 1YJBA 1BE6A 4NE9A 3BGOS 4C3VA 1SBNE 1BJRE 2SNIE 2P4EA 3L1KA 3LPAA 1A2QA 4HVLA 1KDYA 3DE5X 2SBTA 2Z56A 1PTKA 2W2OA 1T1GA 4WOCA 3DVRX 3A3NA 2ID4A 3I2YX 3LPDA 3TI7A 3GT3A 2PWBA 1Y4AE 1C9MA 2Z30A 3VYVA 4DJ5X 4LVNA 1T1EA 1WMEA 5B1EA 4DZTA 5AQEA 1OYVA 3D9QX 4AKTA 2TECE 4OMDA 3CNQS 1PJ8A 3GCXA 2G4VA 3WIUA 5CW1A 1Y48E 3WIVA 1Y3FE 1SVNA 3DE1X 2ID8A 3I30X 1NLUA 2E1PA 1P7WA 2B6NA 1TMGE 5AVJA 2Z2ZA 1KE1A 2DUJA 1EGQA 2WV7A 1Y34E 1AV7A 3TI9A 3Q40A 4NMXB 4ZARA 1SCBA 5JMOA 5I9SA 2IXTA 2W2NA 2HD4A 1SUDA 1MPTA 4H6WA 3DDZX 4I0WB 1XF1A 2PQ2A 2WUWE 2XTJA 4FONA 3TECE 1NDUA 5AVKA 1SCDA 3D43A 3DW3X 1YJAA 3DW1X 3A3PA 3F7MA 3EE6A 3I37X 1SCNE 1GCIA 5JXJA 2W2QA 1TM4E 1MEEA 2W2PA 1SELA 1C3LA 3I34X 1R64A 1UBNA 1Y33E 1AVTA 1GTG1 1SPBS 3OSZA 3F49S 1AQNA 4KB5A 3VTAA 1NDQA 5ARCA 1SIBE 3DE7X 1SBTA 1Y1KE 1Y3BE 1PEKE 4M1ZA 3QFHA 1TO1E 3F7OA 5ARDA 1TM5E 1SCJA 1C9NA 2ZWPA 1SIOA 1THMA 1Y3DE 3PRKE 1SUEA 3DE4X 3DE3X 3WHIA 3T41A 5JXHA 4GI3A 4Z2AA 1AH2A 3AJ9A 1BFUA 1EA7A 4NE7A 4OV6B 2WWTA 3DE6X 1ZVJA 2Z57A 3H42B 3DVSX 2QTWB 3GT4A 3SQOA 1SBCA 2PWAA 2PRKA 2SICE 1IC6A 4JP8A 1GA4A 2GKOA 5JXGA 3A3OA 5B1DA 1DUIA 3CO0S 4CFZA 1AK9A 1KDVA 3GCWA 4AKSA 1YU6A 4CFYA 2ST1A
chains in the Genus database with same CATH superfamily
1QJ4A 2HF7A 1Z2PX 4V0LA 3PNYA 4N0PA 1ZCZA 1LEHA 3FNFA 4RYDA 4D74A 4PINA 2QN8A 3ZCPA 4KTTE 4PPFA 1CQZA 1T34A 3HJBA 2NZXA 3K0AA 4WZAA 4B74A 2PBFA 2FMIA 3U3ZA 3H5WA 4F85A 3C7KA 2ZYIA 5EE3A 3OICA 3S99A 1M0TA 3DD1A 2PXHA 1UWVA 3AJ8A 4NQZA 1U9IC 2L19A 1RI5A 4F96A 3AHEA 3CISA 1G21B 4K9KA 4R16A 2QRMA 3F47A 1EHCA 3EZ7A 4LCJA 3W2EA 5I3ZA 3MELA 4QTUB 3I1YA 4KFSA 1DQNA 4DV3B 3C3XA 5LZ9A 4I19A 5LA6A 3TRHA 8ADHA 1Z33A 5KYWA 5M34A 2A9VA 3R5SA 1WLSA 5AJYA 3G9TA 3NHAA 5F5XA 4GH5A 1EDDA 3WB1A 1A95A 2VJMB 1F51E 4AP9A 3TNLA 3IHTA 2VKQA 4LMAA 5BO5A 1E2QA 4RCZA 3D4LA 4PGFA 1X2BA 2OHIA 4J75A 4TM7A 4ZOLA 4M0CA 4RW0A 4RZIA 1R6XA 3CNHA 4RELA 1WZNA 1XCLA 4Z4HA 5CDSA 5AFSA 4KDEA 3CJQA 3QTTA 1UBSB 3DS8A 4X54A 4EYQA 4DCCA 4ARZB 4F06A 3S2UA 1R12A 3H0EA 5BP7A 3T9AA 2IYYA 2ZI6A 4JR0A 3PUWA 4IJWA 3PPYA 4N7RA 1OGIA 5CCXA 1Z4QA 5EJGA 1QFMA 4ZCQA 3WJ1A 2CDRA 3FPAA 2XD9A 3MD9A 4GVXA 5C0OE 4B43A 4BWGA 2X8JB 3KQKA 4WLEA 2F8SA 4XM2A 5AW9A 3D59A 4B7AA 4KREA 5LZ8A 2FSUA 4DW8A 2A57A 2EZ8A 2RFLA 3BQMB 3MJRA 3JQRA 5AK4A 1GNTA 1FUIA 1U9CA 3FGPA 3A4VA 3PC2A 3RKRA 3F6YA 1ZK0A 3HB4X 3ROXA 4DY6A 4TYNA 1AJEA 5EERA 2ECFA 3NANA 5EWMB 5KTSA 4LJ9A 4QBTA 2X6TA 3OM1A 3STXA 1DQPA 2YWRA 2Z5GA 2ZJ8A 2YHUA 1YSCA 4HO1X 5BMVA 4NI5A 5SICE 1QGZA 3N2KB 3M6XA 2A7QA 3Q12A 4YGYA 1N5MA 2A5DA 1YE5A 3FHJA 2L0XA 3KD2A 3NNNA 2C3UA 3EXHC 2G5CA 5FEUA 2OD7A 4JI6B 2XZPA 4GXQA 3OTOB 1WPGA 1CY2A 5JCJD 2E5LB 3CPHA 3N2GA 1IY0A 3BWXA 2O48X 3HB0A 1WIWA 4JEUA 4ER6A 1RFLA 1T25A 1X2EA 1NBME 2B4TO 3N76A 1M6EX 3TSAA 4CR8A 1R4MB 3MMXA 1QYIA 3CLHA 4YPVA 4EQZA 1MB9A 1M6YA 2OCKA 2VP3A 3KQVA 1YVDA 2ZIXB 2C5GA 4BKMA 3S40A 1X8JA 3OPMA 3SI7A 3PQ8A 1O4WA 3C85A 2XB6A 4MVJG 4AIRA 5T8KC 3O26A 1XMPA 2ZCVA 3RIYA 3NTRA 4AJHA 4LGCA 1B6RA 1UJCA 2FSHA 2JFHA 4XGNA 4ARIA 4YQEA 2R7NA 1DB3A 3IPCA 3RVDA 3AP1A 4E11A 5FBWB 2AJCA 1M6NA 1N0IA 1U31A 4R8KA 3U7JA 2KBFA 4IJVA 1LLCA 2DF8A 4UHJA 5FI1B 2BH2A 3PKJA 4DB4A 1WSDA 1YZTA 5IT9A 2UZ0A 3AHHA 3VHLB 2AXQA 3N0RA 2B7CA 3GRFA 1TGVA 3GJ3A 4V1CA 4AROA 1E94E 2CW5A 4KHPB 1LLFA 2J9XB 3E5RA 1DSSG 2ZS8A 4L76A 1WXHA 2C4VA 3WJ2A 2DLCX 4QRIA 4KRYA 1OYOA 1LJUA 1QF9A 1ZOOA 2B8NA 3AR8A 1HG0A 2Q3EA 3G6WA 2IEGA 1LTQA 2VF5X 3SBXA 4QGFA 3L04A 1M5TA 1YAJA 4HNAA 5K8CA 3FGOA 3CR7A 1VLHA 4YR9A 3KFLA 3C14C 4QGBA 5ILQA 2Q4DA 2P5SA 4QDUA 4KWCA 4CM7A 3JTMA 5AW3A 4ZI7F 3C3AA 4LISA 4Y9TA 5MHTA 1S4MA 3MGGA 2GBCA 1BJTA 1GPYA 2XX3A 1N1DA 4EHKA 1S2DA 1DE0A 1ZH8A 3CPJB 4YAFA 5CM9C 3PT5A 2A14A 5B3JC 5CYGA 3U5TA 3AF0A 1RAEA 1XSEA 1NV8A 2R66A 4HWRA 4DADA 3CQ9A 3EMBA 3UC5A 4ZDKA 2IEAA 3B85A 4C6TA 1NOJA 4EW6A 5EPOA 5LD2B 2J48A 2K4MA 4DSAA 4LJLA 1DBIA 5EZYF 1R0LA 1RHMA 4CT4B 4D3SA 1GL7A 1QIJA 4AICA 3L8GA 3ZCVA 6ABPA 2DPHA 5IXYA 2WSLA 4U6SA 3BE5A 2P5YA 4YRJA 3F5FA 1JRLA 3C6ZA 2FP4B 3EGVA 1K4KA 4PIVA 2JHAA 3AY6A 3FIUA 3TSWA 1KYIA 5FLEX 3BCSA 3L8MA 4ZCRA 1YZYA 3UH1A 1M2OB 2PMFA 3G9UA 4DQLA 3NAMA 2P6RA 2J67A 3HGTA 1RKUA 2NU6B 4JKYA 3OEEA 4WNIA 4C08A 1OA1A 3GVXA 2YDYA 3WNQA 3SIPA 2YS6A 3ESRA 1C1HA 3G02A 1QE5A 1WEHA 4RESA 4ISBA 4WKNA 2WI8A 3R7AA 5F1PA 1KJNA 2JZCA 1YR2A 2Z9DA 4EWLA 1Z07A 3MLBA 3CE9A 4RORA 3RHFA 2QZSA 2AN3A 3TQCA 2YV3A 3CONA 1XQVA 1KY2A 3QLEA 2CBGA 1YJBA 4Y6SA 4Q7EA 4CIDA 1PJ2A 1UJMA 3COZA 4G1FA 4CIAA 3BGOS 1U1CA 3Q2OA 3I6BA 2GX6A 3F5MA 3HY3A 1Z56C 1LBQA 1D3AA 1D2MA 1R15A 2VK8A 2ZR8A 3OZUA 4HY3A 4RZ3A 4W1RA 5THXA 4NVRA 2Q3FA 3UHPA 3CIOA 2QTLA 2IPNA 2OZPA 3UMBA 1ZP6A 4IFTA 3GLGB 3ORRA 4AMGA 4HWOA 2P4EA 4MVJA 5ALWA 4KCGA 3CRZA 3TZEA 4X5OA 3T3HA 3VQTA 2JFBA 1I1HA 3L05A 4M53A 4JEIA 1GPAA 3IQEA 4GLJA 5D2CA 5L4NA 4UHCA 4C4PA 1Z28A 3WQHA 5FNVA 1Q7RA 2GXUA 3LP8A 5CAEA 3MTGA 3DQPA 2FK8A 5EMMA 2COUA 2NPIA 3FPGA 1XTUA 1QH0A 3EVAA 4H7JA 4YAIA 3COYA 4D82A 3KR2A 2CF5A 2P35A 4PZEA 3HH8A 3TJZA 3WMWA 4DGSA 4DWJA 3KQWA 3K31A 3IRVA 4RZXA 2VCEA 1CUWA 1SWVA 2ZRPA 1ISGA 4DMCA 3DLAA 2HO4A 5BWBA 2P9CA 5JDIC 1A88A 3LYLA 4JB0A 4A10A 4RJLA 1ZCAA 2Y8EA 1H93A 4EMUA 4YRLA 3S5JA 4LVNA 3LKZA 2BLNA 3QNUA 4Q93A 2XNSA 5FUYA 1PSDA 3QYJA 4W5HA 4FWTA 4HUTA 3CCCA 4G4GA 5FTLA 3A36A 3M1IA 3VR1A 4CG1A 4DA0A 1T9AA 4XD7D 2K2WA 1EFVA 2HBYA 3H6GA 1CLUA 3FLMA 5KTOA 4F21A 2W6CX 4A6EA 4CLRA 3QBJA 3SXUA 3S7TA 4RJKA 1XHEA 1MMFB 4LI0A 1BDBA 1KDRA 2QGFA 1ZCJA 1P8AA 1M2WA 3EC2A 3FNIA 4ZVTA 3S7ZA 3ZKWA 4XTCS 3VSDA 1A3CA 3K09C 4O3FA 4H0CA 1RXIA 1NM5C 2IUFA 3EZYA 3R3UA 1SVKA 1U3UA 2PUEA 2OYCA 1M6HA 2IGTA 5GY7A 1NJGA 3QOFA 4BMZA 5IAJA 1ESEA 1Y7IA 3BRSA 1FYXA 5A9TA 1CVLA 3QRWA 1PVDA 2B4YA 2BE9A 3BE4A 1Q3KA 4JC8A 4P4SA 4RXTA 1XZIA 4XVHA 5DW3A 1TTTA 1ESZA 2CKDA 3C4QA 2BI8A 4UCXA 4O4LA 3DUFA 2QM3A 4J4TA 3GBSA 2C29D 4PHGA 4XIFA 5DV9A 4K9PA 3T15A 2B1RA 3BBLA 4FGJA 2PZLA 4DIFA 5BQXA 2PTGA 1LPNA 4FZJA 3EWNA 1EBFA 3DZCA 3N8DA 4OQEA 4OXIA 1PR1A 1XPJA 1N1MA 2MJLA 4M0PA 2A1TR 3HCRA 4O63O 1I1NA 3DFZA 4DV0B 2DJ5A 2XDAA 5EP4A 3WO0A 3H6HA 1M5UA 3IC5A 3SS8A 2VLIA 1KI6A 2GWHA 2UVPB 4MWGA 3R76A 3WSTA 4EFLA 1KR5A 4OHWA 5FO0A 2A1TS 2VDWB 4GXTA 3GNSA 2ECOA 3W8DA 2D7CA 4L7QA 2EEPA 2FPWA 2V7UA 4E12A 2V7QD 3C45A 3NUQA 3R3WA 2JI6A 4YFVA 5C1IA 5L6MB 3TECE 1OD6A 4CG3A 4ZMRA 5B6JA 6CHYA 2WMOB 1BXKA 1SGWA 3HDVA 1YGPA 1LFAA 1FUYB 3K4QA 3QLUC 2VZ9A 4G0NA 4XYGA 5BN4B 3IP1A 2V58A 3E5HA 2I6SA 5KVQA 1HG1A 2AEMA 1RS0A 2GARA 4UVIA 3ZZMA 3S27A 1Z8HA 4L8FA 1DV2A 3C15C 5C37A 1Q2XA 3I76A 3PG5A 4WKPA 1CE8B 2C2WA 4MS3A 3T3IA 3DNFA 3ESYA 4PXYA 2IP4A 3L9WA 3GH1A 4UQPA 1X87A 4G23A 5KIAA 1NKSA 2NSYA 4WK0B 5FLKA 4PC1A 5BNZA 5GMOA 2P27A 5LPNA 4YT2A 1K5HA 4M1QA 3TZCA 3NB0A 2I1VB 4UXIA 2XRFA 4Z99A 1G5TA 2WT4A 3KKOA 3DTVA 3EH2A 3MCWA 1GPDG 4HF7A 1JT2A 1P74A 1TMKA 2J5BA 2RONA 3EXHB 3OPQA 4K87A 4KQKA 2ZE8A 4KZPA 4MQBA 4MRNA 4EECA 2JGIA 3T3OA 4ZV9A 3GP8A 3IPYA 1L5QA 1Y4UA 3K0KA 4I3FA 2PT5A 2WYUA 3GG2A 3GMSA 5HIAA 2CNNA 2YY6A 1Y37A 2ZJ1A 4U4AA 1JAXA 5JROA 1QBGA 3FFAA 1JR2A 4LIPD 3KJIA 3SDSA 4AJ4A 3PP8A 1TTPB 4LV5B 5IP5A 4KXNA 2IHKA 5CDFE 1QRAA 3DHNA 4RY2A 5GOTA 4JJIA 1YR3A 3B5JA 2IU0A 5ADUS 2IOQA 4FDTA 1TW2A 1QRDA 2PM8A 5EAIA 3OJLA 4QPCA 2GD0A 3WICA 4Q3AA 2B21A 4NU6A 2MINA 4KDFA 1WDMA 2C3PA 2X77A 3L8FA 4L6AA 2AFHA 4AZTA 2C3OA 1JWBB 4DV2B 3R5JA 4BX0A 1X7ZA 3GRPA 3BWYA 4IAOA 2ZIEA 1RPNA 4HP8A 3OIVA 4Z4EA 1IMJA 5HRAA 1SIBE 2OGZA 4HWGA 3JQFC 1V47A 1WTCA 2Q5CA 2ZJ7A 5IW8A 3OWHA 4EHDA 3V00A 3LM8A 2Z08A 3FUVA 3KUUA 4AI6A 1PR4A 3Q2IA 4IRXA 5B53A 3B9PA 2H5IA 2HCTA 3FYDA 4KXFB 3TNYA 4H0NA 4R41A 1S6YA 1HDIA 1T10A 2VJPA 4XIIA 3E9RA 1SVWA 3TZBA 1RZUA 3I58A 2O4CA 2EWVA 4X66B 2R60A 3GXOA 1MCZA 1CD5A 5LYJB 1KU0A 3T4PA 3ADBA 1JH9A 2WKSA 1QP4A 2XNCA 1IRXA 4BGIA 1XD8A 3NH6A 3F1KA 3L7DA 3VU1A 2ZWPA 3ZXUB 4AJ2A 3L92A 1WO8A 4Z7NB 3H4IA 2HSDA 2CB9A 4XDHA 3HLYA 1HDXA 4INOA 1L8AA 2JH9A 1YE8A 3IDQA 4U00A 2GCNA 1Z0AA 5IK2D 4P4NA 1RP7A 2R1TB 2YHIA 4WD3A 1IEXA 2F1JA 2F67A 5AVZA 2E89A 3ZBUA 1N3IA 3O5AA 1F2UB 4O4JF 3HCNA 3AC0A 3IHWA 4OA8A 1R1DA 4XFKA 1EFKA 3L6CA 3KJGA 2Q5LA 3KDSE 2RD2A 1ETUA 3UT6A 1F60A 2JBWA 3VU0A 4CN8A 1MUUA 3HO6A 1USVA 3L0DA 4JL6A 3SHVA 2CV1A 3R5FA 1V8ZA 4MOWA 2IX3A 4H7KA 3H42B 1FYFA 4R2LA 3U56A 2VZ0A 3HM9A 1K7FB 4R0VA 1Z2OX 2BBOA 1EXMA 2VH2A 3JQAD 4BLRA 3IYLW 2J4FA 1COZA 1W5EA 5DLEA 1Y9AA 2DFDA 1CJVC 3MCTA 3M5CA 5DN6D 3GPLA 3CVUA 2WVHA 2QOEA 2BFDB 2P7HA 1ZRNA 1SK9A 2C9BA 1UC8A 1DIRA 3KXIA 5CB4F 1XEXA 4PN3A 4NEGA 1UP4A 4NV0A 3GJ5A 1E2IA 4Q37A 4G0WA 3WBJA 3VNUA 2AXPA 4WZAE 4XX0B 3HUTA 4AJIA 4P0TA 4NZNA 3FMIA 1W5FA 4I4TB 4PNPA 5CEJA 3FM9A 1YWGO 5C8ZA 5L3QA 4F3TA 1RBYA 2FMHA 1PT7A 1ZITA 4YLEA 3UOWA 1KQOA 4RIEA 1QHEA 1W94A 2VA8A 2HJVA 3HHPA 3AEUA 1VMEA 3I12A 4D44A 3WWOA 4ICIA 4URVR 3LUHA 1L1RA 4Q1VA 2VDPB 1NN3A 4JC5A 4RK4A 4UQLA 4U5XA 3DVAB 2XQGA 3FPBA 4FMPA 5HUQA 5T4BA 4LX8A 4UBMA 1V5FA 1B8PA 3WWCA 1R5JA 1TAQA 5A6VA 1ISMA 3C5CA 2ZSBA 2W8BB 3JASA 1KRHA 2ZP1A 1CJCA 1FP7A 1RPTA 2RGYA 3G2MA 2APJA 4MJLA 4BVHA 3ZDFA 2EKLA 5A5FA 2Q3CA 3ANSA 4XX1A 2ZPTX 5FD8A 5JJKA 2OGSA 4HYYA 3S28A 3HGMA 1J24A 2P8SA 4CMEA 4RY8A 3PC3A 5B7QA 4ZREA 1NVXQ 4A92A 3HFGA 1OVMA 4P0PB 2V4MA 1KYZA 5FFFA 5J4KA 3WSVA 4FI3C 5A0TA 1RLUA 1XZKA 1DWQA 4EENA 1IEWA 3MJVA 1CZOA 1V6CA 1A8PA 1G8KA 2HSWA 2XB2A 3QUSA 4JS0A 3SHWA 2V6BA 5E3IA 5JW6A 2H1CA 3KJEA 4KXLA 2QLMA 4MW0A 1Q5PA 3L1JA 5HE9A 1T2DA 3HXOA 2HRDA 4BJHB 3K0EA 2BFOA 4R6XA 1OTYA 3B1ZA 2FN3A 5E9WA 4PGGA 4DLYA 1KZ6A 3P9QA 3H9JA 3VZDA 3W6UA 4HZUA 3CO5A 3TR6A 2RHWA 3COPA 3GJ4A 2ZSAA 3ZJ4A 1E1YA 1VC2A 1Y80A 2E37A 5KTMA 4O08A 1D5WA 3S4YA 1P0IA 2TMYA 1T2CA 2BZ0A 3K2QA 4LBZA 1TZKA 3DJYA 5IU6A 2Z2KA 4OB6A 2PQ6A 3IAHA 2ZYSA 3T5GA 3VYWA 3H3JA 2R751 1ZGHA 2OV6A 1AF4A 3IDAA 2YXNA 3ZPXA 5GJVC 1QO0A 4WJKB 3WMGA 5CITA 4NJMA 2AOTA 3ZZNA 3WAGA 2FZ4A 3KYJB 5EN4A 4INJA 3AEQA 3PGA1 3QI7A 3X43A 2O8FA 1M10A 5FOQA 4ZXFA 1RQRA 1RWPA 1IXSB 2HSEA 1J09A 3ONNA 5BPHA 2FWIA 4Q16A 3REGA 4E07A 3ZWWA 2F3TA 2AGVA 1GLNA 1SC3A 1YZUA 2AFRA 4DKXA 1KEZA 1RTTA 1V1RA 1XN1A 1QDUA 2O7SA 1CB0A 1H6BA 1N7IA 1W5BA 2OXEA 4OBBA 4DG9A 4K9SA 4N7MA 3GEDA 1N5LA 4O2BB 1U8XX 3D6UA 5JZ9A 2NUPA 3AYXB 3W8FA 1QP7A 2O2ZA 3WDMA 3TOCA 4OBWA 1DIHA 4E5YA 3IFSA 2NO6A 1FP2A 3BB4A 5AXDA 5LQDA 3THYB 3F4KA 4OHVA 2XMDA 3N7TA 1N6LA 1N2HA 3KP1A 3RB8A 4RPIA 1JP7A 1Z7YA 3ISJA 4M8KA 3G5TA 1VL6A 3LBHA 3LYUA 1KHHA 1QIEA 3GJYA 3NPAA 4RL6A 1Y5RA 3VR5A 3U4QB 3THWB 3O47A 4L3OA 1BNCA 1SC9A 1Q0RA 2C2OA 1JU4A 4KN9S 4P7BA 1IEQA 3LLMA 4HEHA 4CM9D 3CSSA 1C9EA 1YR7A 4PRZA 5CFZA 1XDGA 4UW9A 4E5VA 2H1RA 1Z2AA 4DRXA 1G3MA 1A4UA 2YVLA 4WINA 2PSJA 5HBGA 1WDWB 4OI0A 2FNAA 2O3SA 2XR1A 4YX9A 2JHFA 2H7YA 4MUNA 4N4AA 1EBUA 1G0NA 2IUYA 2M6SA 1E2NA 1U65A 2M98A 1JKFA 2W0SA 4ZT7A 2W2LA 5F98A 2W6JA 3LW8A 2PFGA 3GJZA 3HEAA 4KKXB 5A6SB 3EHEA 2OYRA 4JT8A 1I4WA 3UFXA 3ZU4A 1N2CE 3DAYA 2GBLA 3NQ41 4FFVA 1GG5A 1AKUA 3PHCA 3GG9A 4IIUA 4UAUA 3SIRA 3UTDA 3GN1A 3LC1O 5B30A 4M7RA 4MXDA 1HOXA 2IZ0A 4PYMA 2X0JA 2PKEA 3UMMA 2L82A 4KQ2A 3K4HA 2C2GA 4PQYA 4RNDB 5AI6A 4C01A 5KTTA 2G06A 2RHLA 2CMGA 1XAJA 1AQ6A 2F8LA 4HDMB 2CNWD 3FDXA 4DCOA 1NLMA 1YK0A 1RVV1 4IJMA 1VCHA 4FB5A 3KZXA 1KEVA 1VYTA 1GN8A 3NFRA 5T4FA 2NM0A 1QIHA 2JD0A 4WEOA 1YMVA 1P81A 4C0WA 5HZKA 1TCAA 2QBYB 4G4JA 2Z8XA 2WSMA 2XYRA 1VIVA 1YDGA 3LDUA 5DFAA 2JBHA 1WCYA 3SLRA 3UV7A 4F4UA 4PW0A 1MHPA 1ST2A 4M2LA 3RUPA 1KK2A 3HBNA 3M7IA 4GLBA 3GRYA 3G2OA 3ZDDA 2Z43A 7REQB 5F78A 4QO8A 3VNQA 3PXBA 4HUQB 4JNKA 4EBBA 1OT5A 1DLJA 2V98A 2XMBA 3F8TA 5B2ZA 4C2BA 1ND5A 4OQNA 2BOVA 2GESA 2OCDA 5CYPA 1PD1A 1J1IA 2ZR9A 2ZE5A 3NRJA 4MB2A 4AWAA 5IFLA 1XZCA 4F60A 4DBZA 2B1JA 3PITA 5ERXA 4YDSA 2ZDGA 2WKQA 2DSNA 4E5PA 3EAFA 2JAQA 1LBEA 3COSA 2EBFX 3U7QA 3FBTA 4ITUA 1XZPA 4K6GA 2JIDA 3KOXA 4N65A 2B30A 4JVMA 3PRHA 3Q3JB 1SEPA 4F1KA 4DUZB 1EZ1A 1UQTA 4MMXB 3AXSA 3KTAB 2Y1EA 1YBAA 1JFFB 2AMVA 3KR1A 1NG9A 1NONA 3QEKA 4JHXA 4RENA 1JKJB 1CIJA 2GO1A 3ET5A 4YJ2B 4QTXA 2QD1A 1IHPA 2ZJ4A 1VJTA 4FR0A 3JWPA 2ZK7A 2ISQA 3JXEA 4MEBA 3AR4A 2OXIA 1PLLA 4DEVA 1TK9A 3KPYA 1E7YA 1U63A 1S2MA 1TZJA 2NO1A 3W0LB 1NVEA 5AD1A 2DYKA 1RWQA 4JYBA 4YAWA 1JR3E 1POXA 2B1IA 2ZM5A 5DM0A 2NO4A 4D9NA 2AKYA 3L8DA 4GDMA 3WWPA 3ENNA 4JGGA 4UTOA 1AXEA 3VGJA 3C1UA 1GR0A 1YL6A 3AIIA 3MS2A 4QGGA 5I5GA 1JLSA 3DKKA 2C2YA 4JT4A 1FK8A 5AJZA 4KITB 1G5QA 5JOQA 3PJEA 2WIGA 3WK5A 4KFUA 5JSKA 1NJFA 3BHJA 1JFRA 2X86A 3HB5X 2XE7A 3DZIA 2XCQA 1DIGA 5FBQB 1DARA 4L9AA 3ZE0B 4RMGA 3V7NA 3D4NA 5TGZA 1UK6A 3BRWD 3L6EA 4IOMA 2Z56A 1UKVY 2W6ID 1RADA 3VO1A 2H31A 4CYMA 4EAQA 1DRJA 2P2LA 4H3HB 4HHEA 2WE7A 1G18A 2ALJA 2AWOA 4I9GA 3U3XA 4P0QB 3ANMA 1JDPA 1XDDA 3B52X 3DTNA 1J70A 2XQIA 3G0BA 2UYOA 4JGIA 4WQMA 3ZC3A 4D45A 1WB5A 3O3OB 2Q2VA 2PIAA 5HPYB 4M8LA 1SOAA 3GCZA 1L5SA 3DDSA 4R2WA 1GTVA 2P9GA 1KOGA 5JLAA 1OROA 1DIOB 1Y63A 2OB2A 3GLFB 3L2OB 1LSUA 4HD8A 2VRWA 3D3EA 4NZOA 4QC2A 4ZFNA 1G59A 1HBJA 1U8UA 4LJ4A 1XZJA 1TU3A 3PEWA 4NXNB 5CT8A 4FHZA 3TTTA 1FDOA 4LOLA 3QFFA 3GRUA 1I2AA 3P2YA 3OFVA 1LI7A 4G8JA 4WMLA 1QR2A 4I5DA 4TRJA 4UUOA 1JIQA 3R40A 3D9QX 3ROZA 2A0YA 1IUKA 1QLJA 4MSUA 2RH4A 2WWHA 1KAMA 3TSOA 1JDJA 1W5AA 1IQUA 1B00A 4EJSA 1HFEL 1Q1EA 3HWWA 4ZKDA 2BGWA 2D3TA 4HQFA 3M89A 4KEAA 4DYVA 1U0JA 1Y1SA 2QEQA 2WUDA 1DQZA 2PMDA 5K3FB 4EPYA 1F5SA 4MR9B 2BCEA 2IZ7A 1A76A 4PQEA 3VC7A 2PUAA 1PHPA 3VNVA 2IPXA 1X7DA 3MCAA 1QZ3A 4EY7A 4YDHB 4US2R 4MWZA 3VAAA 1XTJA 3L07A 3IQGX 3MTJA 2OHHA 1LGYA 3D8BA 1W0KD 1XCPA 1Y3IA 2FWMX 2IIPA 4A0SA 4IWYA 2PFSA 3N5KA 4QBFA 1A04A 1ONNA 5D8DA 4ZC8A 1JSZA 4DVGA 1I4OA 2H1VA 4GSKA 5JMOA 1PNVA 4K28A 2EBUA 4IINA 1T5DX 2WD8A 1QYDA 3IP3A 3LZ6A 4A23A 4X84A 1XZQA 2VS1A 1XV5A 1JEJA 4LHSA 2CMKA 1F06A 3PHLA 1XBTA 1T91A 2CLSA 3ER6A 3OSUA 4XR4A 5DTIA 1U0SY 1OLSA 2GAFA 4KL8S 2GDJA 2VEDA 2V59A 3E9QA 2PJRA 2EVWX 1KQNA 1RXEA 3IXQA 5FP0A 3KZ1E 2P0EA 3SIWA 3LUGA 3VR4D 3OF5A 5F2NA 3FRIA 4CIWA 4P6VF 2RB5A 1LC0A 1FTQA 1VMAA 3L0CA 5ULLA 1H85A 1HLFA 3CLRD 5H5JA 4NHOA 4EH1A 3RJZA 4RV4A 3KKNA 2YW2A 5REQA 3NVKI 4FS8A 3UK7A 2ZT8A 3WKEA 1OFVA 1V8OA 1Z6AA 1ZL2A 3GQBA 3Q11A 5EEGA 5FA6A 3J7AC 3K30A 4C5CA 1ULTA 2H9YA 3AR2A 1VYVA 3O4RA 2QSYA 3R3HA 2J32A 2EZUA 4ZT5A 5ECYA 3T5BA 4F46A 2OBFA 3DBLB 2Q4TA 4L3WA 1CJMA 1P9RA 1QANA 3AF3A 1S1MA 4GSLA 4K6OA 4TLLB 2V55B 2DHQA 2B1QA 3ND8A 4MHTA 1B16A 3AX6A 3EDOA 4OGWA 5CTAA 2OXTA 1T6XA 2WF9A 4QPDA 1MV8A 3EHDA 4G86A 1DC7A 4LY0A 5BSTA 3RYIB 4N7JA 2Q5HA 5DHFA 4C1NA 4OIMA 1R5BA 4CI0B 1ZD1A 4JQZA 2JIPA 4Y0AA 5B57C 5K09A 1IU9A 4TT8A 1II8B 5BVGA 1RRPA 4HAXA 4DMGA 4F4FA 1JHRA 1P19A 1TM4E 3W6PA 4HT3B 3PV0A 1M76A 4MPJA 3ZWXA 4GGMX 1MU0A 1C3LA 3T7CA 4WIAA 1UODA 1EK6A 2PRIA 1FTSA 1HY3A 1MF7A 3EGXA 1IXRC 2IIBA 3GCDA 4IRUB 5EGNA 3A4MA 4JI3B 3FIJA 5CFLA 4R1TA 1XKXA 3AYZB 3O3NB 3EMVA 4F1JA 3W8RA 5L9AA 3GAMA 3PKIA 5AKLA 3UWSA 3ZHUA 4N9WA 2IVZA 3PHHA 2PH3A 5AKZA 3M1YA 4E2ZA 4RTQA 1ECLA 4J2TA 2O3UA 4BZPA 3E05A 1AUXA 1QFYA 4FXPA 4MVJF 4C6SA 4EZBA 4F2WA 1CUFA 3HVJA 2H92A 3GWGA 2OHFA 3EUWA 3OOJA 4NIMA 3ZDYB 3BXFA 1IB0A 3THOA 5AYVA 1XEAA 2OSVA 3T8YA 3I1IA 4K7JA 4X00A 3OEYA 1Y8CA 2Q50A 5FNVF 4FEGA 3DOOA 2Z8YA 3I9V1 3IB3A 4JASB 3FYUC 5JYCA 4NDNE 1GQFA 1DU4A 1DJPA 1N2CB 1UOOA 2VUIB 1VA4A 4Q47A 1FMLA 1SNYA 3OTIA 5ARCA 3CINA 2ZJAA 5TQVA 3IO5A 1OUMA 1PYGA 4YUWA 4GZMA 2FZLA 3FCSB 1SD5A 2FWJA 1PT6A 4PYKA 5HJ2A 3W2FA 4MW5A 1WWKA 3LPNA 3Q7PA 3WV5A 3DOJA 5DU2A 5LN1A 3MMSA 4AJJA 3MS4A 4YK7A 4KAJA 1SY7A 1ZPDA 2DT8A 3BREA 5C32A 5JPIA 4OAOA 3V97A 3U16A 2EKDA 1FYVA 2F7SA 2G9UA 2QRNA 3JD3A 4G1EB 1NP3A 2FLVA 1CF4A 1R4NA 1ZMTA 3ISVA 4V0SA 4LKOA 1TA0A 3T9CA 2W5UA 4HNHA 4Y6PA 5ALOA 2VAVA 1I94B 1G4AE 3KSZO 4OHRA 4MKXA 3FHCB 1Q1BA 3QPBA 1T5TA 1J7KA 2UU9B 5DNEA 2PZMA 2H08A 3ZEAA 3K0FA 5LU8A 1KI8A 2GFHA 1XNRB 1IOWA 1UJ5A 3BQNB 2ZAMA 1D0IA 4DAOA 2VPQA 4ETNA 4AVYA 1T15A 2QTBA 1W29A 4HG2A 4IMRA 1R9NA 3VPAA 4MUYA 4B3CA 3MJSA 5KX5F 1TUIA 2CV2A 3LY5A 1GKUB 1GAXA 3QW4B 1JKMA 1LZLA 3ZZUA 4UKDA 2AVDA 3R5TA 1RAIA 2F3SA 2JFOA 1RHQA 2VK2A 2ZTHA 3GFQA 2I5PO 3OZCA 4PYIA 2GYYA 4IOJA 3BIFA 4WY2A 5FULA 3VDMA 3W7VA 2PL9A 4G9GA 4UHDA 3ZK7A 3KAJA 1Z2CA 3SQOA 3WIBA 2IPLA 2NUTA 4NX2A 2J7PA 1DMSA 1O95C 2QAJA 1P9NA 1IPFA 5IZ4A 1BS1A 3EXIA 2XBMA 2RAFA 4RCYA 4IOLA 5IHXA 2ZB3A 4EA7A 4CKZA 4HGQA 1YRHA 2BEUA 2GLXA 4D80A 1YQWA 4JLPA 2QU8A 1FNCA 3SQLA 5JSZA 4RLFA 3N0WA 4NTZA 2CXTA 2CSUA 3AUAA 4Y3UA 3CZ4A 1SMKA 3DMHA 4YRSA 1KR2A 4EMSA 4HDSA 4R2KA 1RJFA 3SEAA 4MUIA 3ZJYA 2G1KA 3GEMA 2EFYA 3LT4A 3WZMA 1Q17A 1RRFA 4J0EA 1WBJB 5DCYA 2BMWA 3IQXA 4CE6A 1TYEB 3M34A 1TAHA 3JQBA 3LF2A 4TQUS 3HKEA 3C3JA 4TLAA 2O2YA 1Q14A 3JQDA 1Z06A 3LTEA 3NOXA 5E1DA 3U3KA 2OECA 4TWIA 3KXDA 4U7HA 4URXR 1YU6A 4C4TA 2ST1A 3ZQJA 5JRDS 3IUPA 1KO7A 2I6TA 3AERB 1EXDA 5CA0A 1NXSA 2FPKA 1HT0A 4YREA 1SC1A 1U2SA 2IE8A 2SCUB 1NJ2A 1LDMA 2PO7A 3E9EA 3OQPA 3EG9B 3PL5A 4RPHA 5L4LA 3LXUX 4WZ6A 1V11A 3RUFA 1GA1A 1AQUA 1UJ2A 1XVAA 1P5FA 4NAHA 4QQNA 2ODPA 3LVQE 4LZJA 3MJHA 4RK0A 3BWMA 3IBYA 5I4KA 1U8CB 3DO8A 2BFBA 3EH1A 4HWSA 1HWYA 2VI5A 4Q9JA 2Z1DA 2AB0A 3Q1LA 4UXJA 4BU1A 1VKHA 1AGRA 3DMNA 3ZW9A 1RM0A 1EXNA 1VPVA 4JUCA 4G5YA 2XMPA 1DKMA 3VVBA 4PZAA 5K8IA 2AA3A 3OE5A 3ZKWB 3HR8A 3RGGA 1PAUA 3A9UA 1CY6A 3RFXA 2OCPA 1FFWA 1VIDA 3MIIA 4KACA 4G56A 4M98A 1IRIA 4EUKA 1KJWA 3QBVA 1XQWA 2A9RA 2II6A 4HPJB 1BGXT 4LY3A 1TFRA 1TECE 2VDNB 1GYRA 4BKUA 5I8WA 2BI7A 2ZUWA 1M7BA 1ONBA 4U9IS 3TZHA 1R0SA 4BMOB 3OC6A 5A7GA 3HFSA 3EIQA 5HQ3B 2EX1A 2BHTA 2DPLA 2BW0A 4YIHA 1ZNZA 3A9CA 3ABRB 2O0JA 3PNSA 3AR5A 5KDOA 4Y2QA 5K9ZA 1COWA 3GK3A 3T0GA 2Y1WA 2FFBA 4NYMQ 2G1PA 2V9CA 4E1VA 3U3RA 2J33A 3F4LA 4WZBA 1C8LA 2A59A 4D9BA 1ODFA 1KFKB 1VRVA 5FL7A 1E2PA 3FCYA 3MGCA 4AF7A 1AO0A 2YJGA 3MPUA 1NMSA 2C20A 3HXKA 5H4GA 4BJ6A 4P36A 5FJJA 1KAOA 2XMGA 2J0UA 3KL4A 3LQQA 4YMUA 2R6GA 2X6RA 4P34A 2O2JA 3LC2O 4HH1A 3BSYA 1PEAA 4PVCA 5ELXA 2J3LA 1V35A 2RJNA 1GPUA 1RXYA 2ATCA 3LL4A 2DETA 4DRYA 2VRNA 3DDHA 3VO9A 2R1VA 1JG1A 1VSUA 4EHAA 2HYIC 1XRQA 1YUBA 1KXZA 3D8NA 3QWBA 5JS6A 4OMCA 1EMDA 4IIJA 3E1GA 5K3EA 3WAKA 3JWHA 1ETHA 1T1IA 2Y76A 1XZFA 4FOTA 3X1WA 3X2FA 2XADA 1G20A 3DKPA 3MILA 1J5XA 1XXHB 2ZW9A 2WW8A 3IAS1 3U3OA 1XZEA 5ILGA 2CY0A 1T2NA 1VRWA 1V2HE 3SC6A 2JGKA 1DQSA 4DN6A 2IY7A 3TX6A 5IWAB 1XYGA 2CL0X 3D7SA 3JQ6A 2QG9A 3CT4A 2K2QB 3M9LA 1XGKA 4CNQA 3P2EA 4ZVKA 4B3IA 4Q9HA 4DTIA 1AZLA 2QTTA 1PNQA 3A0UA 3KZKA 1KFJB 4RDIA 3WK4A 1O96A 2GEUA 3GLKA 5F9MA 3TEFA 3TJMA 1FSPA 5IX8A 3BMQB 1T36B 1N4AA 2YY7A 4L1KA 3PHGA 1JI0A 1FS6A 2ZB2A 5H7XA 4AU1A 2G28A 4COOA 4HB3A 4F9TA 3TXYA 2IYRA 3LVRE 1YU9A 2WWRA 4OB8A 5KSWB 4LDAA 4QJBA 2V4ZA 3CZQA 3KEOA 3SD7A 4I14A 5GJWC 4C7BA 2C99A 2Q29A 5E1OA 3OD5A 1JX6A 3HKBA 2HF2A 2ZIUB 3LRPA 4CT0A 5BSGA 4B0PA 4GXRA 1SG6A 1MNQA 1LPMA 1T1RA 1A8UA 2GI4A 2GZDA 2E5WA 2HUNA 2FOIA 1IATA 2PAFA 1T8PA 2R6R1 2ZPAA 3DT6A 2PZBA 3L0SA 4G0MA 3L01A 4DC9A 4CL2A 4W1PA 1MT0A 5JS1A 4MIEA 2W71A 3R77A 4N0MA 9GPBA 5JLJA 3HTXA 5CW2A 2WHPA 4NF2A 4X3PA 4O2AB 1CERA 2GDZA 1YCDA 3MK31 2P3OA 4WLVA 5F21A 1SH7A 3VPBA 5HM8A 5TQ0A 2PMBA 3GJ8A 1KBZA 3V3KA 4C4ZA 4ER3A 4EUSA 1B73A 1ZI8A 1XFAA 2BIFA 2BR5A 1ODKA 2RMKA 2I0FA 2YTZA 3P0FA 3QYAA 1XD9A 1YS9A 4CM5A 4CKBA 2RGWA 1KZHA 2IELA 5AUQA 3KEQA 3UIEA 1XEWY 3FYUB 1QRTA 1L4EA 2HADA 5F1KA 1Z0JA 4LXXA 5DWVA 1H1LA 4EB6A 4S1NA 1PWEA 4H7PA 1BROA 2LE0A 3ETHA 3WLLA 2O1XA 5DLPA 2G36A 4HDKA 3QWIA 1GM5A 1C30B 1MOQA 2ZTSA 4HDRA 2NSLA 4OLAA 4HVCA 2FU5C 2D1YA 2XRYA 3AB3A 3R0QA 4DIBA 1KYYA 3OMXA 1RFGE 4J2OA 4DQDA 2ZYTX 1Y6QA 5JAUA 5KYNA 3K16A 1SKYB 3I42A 1CUUA 1SD1A 4K6CA 4LWPA 3LVBA 5K4HA 1LJLA 1SBYA 3PXXA 4IJQA 4WJLA 5ICEA 4X7RA 1XU4A 3FLEA 1N3YA 1V3TA 1N6OA 1E4EB 5TQ2B 2CEAA 2POCA 4ZI3A 5IKOA 1MAVA 4WNAA 1OT3A 3B1FA 5B1IA 4I5FA 2VDRB 4H4CA 2QGNA 2OQIA 3FA2A 3FWPA 4Q1DA 4RQAA 4MV4A 5IN5A 3R7BA 1PEDA 3U4CA 2X0IA 1VJCA 1ZQ9A 3MRVA 3C0KA 4B81A 2AOVA 3H5IA 4PONA 2HY7A 1RLOA 2C59A 2QGZA 1DP4A 2B83A 3G68A 2FSPA 5BWCA 1M2VB 2A0UA 3EGDA 1SCUB 4FUQA 2IZOA 1WF6A 4EF4A 3EEYA 4NOMA 3AINA 4I1PA 4OLJA 4NSNA 2ZKLA 4RD6A 3TJRA 2YYSA 1JHDA 2C9MA 1E59A 4D81A 2JGRA 1KO4A 1VBKA 2DMRA 5GV8A 3T1NA 3KOUA 1F12A 4M0UA 4XWAA 5F77A 4JQSA 4DJTA 3TXAA 4P3YA 3ENQA 5JASA 4CTOA 2UYHA 3K1AA 3NAGA 3UJAA 3FFTA 3D7NA 4CNBA 2I2FA 2NZ8A 4P3PA 2RHCA 4W4TA 2E7ZA 2AOUA 5CLQA 3WVNA 4EPWA 4YCLA 3I6YA 1HSOA 4RTRA 1SXHA 3D5QA 4IMJB 1JFSA 3B7GA 1WMBA 3LIPA 4HB4A 1PTKA 1E0SA 4WHMA 1JWAB 4KUEA 1Q15A 4ECAA 2FTKE 1LXCA 3U31A 2QPTA 3HUEA 4BQSA 1MQ9A 2C98A 3UQZA 3D02A 4DEXA 1UL1X 3T7AA 1T1GA 1RHKA 1T9BA 1YQ9A 3V8RA 4E2YA 1QKIA 4LOIA 3DOFA 5IEJA 2GOYA 3UUEA 3TI7A 4DRZA 1X80B 4AS2A 2PWBA 2PUHA 5JFGA 5B37A 5CVDA 2I78A 3O8QB 5EE1A 4ZAYA 3TH5A 4AJ1A 1V0JA 4A0HA 4BV9A 1YVRA 2JIZA 4PR0A 1ZDMA 1TEZA 2HPHA 1CEQA 4OHOA 4A8HA 1PNTA 2NVOA 3MAGA 1N5IA 2HL6A 1BXGA 2FEPA 3QXXA 2IU4A 4XSVA 4YP7A 4KQGA 3I72A 1E2LA 2JC3A 3STWA 1QAMA 3A1EA 2BV3A 1X70A 2IEIA 1H6DA 1BO6A 3RANA 3OEED 4D02A 4KVFA 4M83A 2G08A 2Q27A 2V45A 2ZSDA 2WFMA 3U4HA 3E27A 4OI4A 3O1IC 1GPNA 2P68A 4YWJA 2GD1O 2ROQA 4JK3A 3H1EA 1BDIA 3KVNA 4IIXA 1GRCA 2IU6A 2M1ZA 1MXFA 1SXJA 3WOVA 3RU2A 4D9EA 2PGDA 3SM9A 4YMWA 5AUOB 4KI0A 2C0PA 2F59A 2RGNA 1YS7A 4PLYA 1UDBA 1KQFA 3HBJA 2ONCA 2YIMA 1OXSC 4GI7A 2O54A 2JFWA 5EE0A 4AO7A 2KHZA 3B1YA 3F6CA 5LKRA 4L8WB 4EO4A 1XJCA 1L2TA 3HYNA 5J9FA 1M2FA 1SCKA 3INGA 3I64A 4JGBA 1VCIA 2XUHA 2WZBA 1H2XA 4PSDA 2FPUA 1SXGA 2DFNA 4ENSA 5JPDA 3L1VA 2PK3A 2BFFA 1UK8A 3D1LA 2AK2A 4MVJD 4G1BA 1MC1A 1LDBA 5G1NA 3IIMA 4C0SA 3FSGA 4HQ6A 4N3GA 2P3SA 1GO2A 2FRDA 2FWBA 2X2OA 2QM7A 5AVTA 3AM3A 1RWXA 4Z4QA 3Q3HA 1TUGA 4MRAA 3WLAA 3B6MA 1P3Y1 1RLJA 2H7VA 4G0XA 2UZ1A 4Q4HA 2Z5VA 4HAOA 1J2TA 1UWCA 1NQWA 3MLEA 5E6SB 3T3NA 2XNKA 1A4RA 4AUNA 3ABIA 5CURA 4DANA 2FQXA 1ZGGA 5EIFA 3UAWA 5EZ5A 5KJ1A 5HM6A 1BDJA 3C3KA 4EW3A 3WGKA 1PK9A 5JCZA 4TQGA 3T9FA 5C5IA 4D46A 4I8IA 3WYEA 1AIPA 1C3OB 4OQLA 4L85A 2X42A 2ZSIA 4V0RA 2HKIA 3NBUA 4NMWA 1ADBA 1UXIA 3HVHA 3QVOA 3SR0A 5JFTA 5EIBD 3GJSA 3WGHA 4Q15A 5K6TA 4P38A 4KN8A 2YUTA 1F4PA 3H1GA 1QXSA 4IVNA 2EZ4A 4ZTBA 5DI3A 4BVGA 2WK1A 1HE1C 3ABQB 3UKDA 1GSAA 3DMDA 3TVYA 5BQFA 2IZ5A 4RS3A 1JZTA 2MHCA 1N4DA 1J23A 2PANA 3ZEIA 5HKOA 2HTEA 1C50A 1PBTA 3IHLA 5HG0A 1FJHA 4L6IA 2BKLA 3LWBA 5ALHA 4X0EA 3KYIB 4CQLA 5DGIA 2Z6QA 2NP6A 3VVCA 1JIIA 3EFOB 1AHIA 3KV3O 4RF5A 3IS3A 2C94A 1JSCA 3LU1A 2DM6A 2X9LA 3C5WP 1Z29A 2Q07A 4HQNA 2C9DA 2ZI4A 1KVQA 3RTEA 4E4TA 3H97A 1W6UA 1X1EA 4RPCA 4YUVA 2B2XA 1VSVA 2WF8A 4H7FA 2GN1A 1EE2A 4J0FA 2HCRA 3BOSA 2ATXA 2PZJA 2WSBA 3RF6A 2JB9A 1A2KC 2CJPA 1IM2A 5JH7A 2ETVA 3OLYA 5EWLA 4RA6A 2EQAA 3AU8A 4N0QA 4CKCB 3EDCA 3UJ9A 1KZYC 1IB6A 3BD8A 4L0MA 3HBFA 3H4VA 2RH9B 5J59A 2CZCA 2WPNA 3I5YA 4D4MA 1JDTA 1Z0IA 2A0XA 5KZMB 3TBFA 1J8DA 5HCUA 1NI3A 4WOPA 4BDTA 5JNVA 3ZIAA 3QF4A 5C1PA 1NQXA 4A16A 4ZEOA 5BN3A 2J5KA 1T9GS 3OPNA 1SBZA 3OVMA 4NXMB 3K1YA 1S8AA 2FOXA 3NIDB 2UZ4A 3RFTA 3DE7X 3OJWA 5JD5A 3SMVA 2OP1A 1Y89A 2OTCA 1NBIA 4KYVA 1YFKA 2O07A 1W4LA 2NZYA 4Q4LA 4U2BA 1U4OA 3WGNA 3ZBPA 4LJ8A 5H3CA 2ZJBA 1OAOC 2YN2A 5FO1A 1X1SA 4YP9A 1PJTA 2Y05A 2OAP1 4TS1A 4Y1GA 3M4JA 1DAPA 1H5UA 5EEHA 4CMAA 4RQTA 2CFIA 4KWHA 2ACWA 1C0IA 3SJ7A 1ZISA 5F7ZA 5T6BA 4EJFA 4Z8YA 4BBPA 1E4YA 1RKQA 5LNK1 2WNHA 3RRNA 4I50F 4W63A 4B09A 1I14A 1KH1A 1CR4A 1OXTA 2VYQA 3N74A 1THMA 1OTHA 5AIBA 1ZVVA 1P9LA 3NWBA 3M8KA 5DNWA 2VR1A 1SUEA 2PLAA 4CMIB 1PHRA 4OCZA 3TOVA 5IJ0A 1NNI1 3QKSB 4LWZA 3KLPX 5CIWA 3N75A 1VMKA 1GEEA 2CVOA 3DOCA 3Q7TA 3DTVD 4MCAA 2J59A 1JEQA 5GV7A 5BRNA 3S44A 3SDBA 3BAZA 3VC3A 3DPUA 2C5FA 1Q21A 4PX5A 4MUFA 4PN7A 1CJBA 3OCYA 3EEOA 2ZITA 4MH0R 2WHQA 4IWXA 1MEOA 1S2GA 2VSFA 1Z4MA 3D7RA 2CDAA 4HDQB 1YNSA 3FOWA 2ZPUA 3GLTA 1JIKA 2Y6VA 3LE8A 3QUCA 4GI5A 5HOEA 3ICOA 4IF4A 3WRVA 5K05A 3AKYA 2QX6A 1PIWA 4C4RA 2QVZX 3O4VA 4OB7A 3EGOA 1GXSB 1E3DA 2VQFB 1RMTA 3TPZA 3GU3A 2ZSJA 1QFXA 1A50B 1YB4A 3FX2A 3LQKA 4TLBA 5CVEA 5AWFC 1IC6A 3TCXB 4E51A 2VP0A 4DIEA 2BEWA 3X2SA 3OZSA 5BSWA 4ZGGA 2D13A 2JCXA 3AH8A 1E9CA 1O77A 1WHTA 4YHHB 3HNPA 3GNTA 2HQRA 3WLRA 4I6GA 2NV6A 4F38A 1Q7BA 1GV1A 2NADA 4TWRA 4MVWA 4LZNA 1XOIA 3GAZA 4CR6A 5HIKA 1NOKA 1ZUWA 1ZMOA 2AOWA 3N05A 1NIPA 4MRRA 3SPXA 5KB3A 2AE1A 2P9JA 5KYUA 2Y71A 4O5AA 4COKA 1J22A 1M54A 1GQ2A 1ISFA 2NVUA 1AUVA 2OCYC 2WJ4A 1YKSA 4NP6A 5EVCA 4BB0A 4Q3EA 5FBVB 1QIIA 5HKAA 2G6TA 3WE7A 4QUHA 3KJHA 2FRXA 2JGDB 5ITVA 2FWRA 2YW9A 3ELDA 5E3JA 1AY0A 2LCIA 3BHNA 1WAMA 2Y27A 4DXAA 1SUWA 5JRJA 3N2NA 3WLHA 4DZZA 1MJFA 3O8OA 3UKOA 1R0XA 1PZFA 3I8OA 2WJ6A 5CDUA 2VAPA 3KALA 3T06B 1EAMA 4UC0A 4NZMA 3K4PA 2FOLA 4YT5A 3TFOA 5I7WA 1J4AA 2N0SA 4GYWA 3AI1A 4PC6A 1E6EA 3CN7A 1D09A 3K92A 3RARA 2NAFA 6ADHA 3KKPA 3PGMA 1XE3A 2ZRDA 1GQRA 2VWQA 1EUDA 1P1FA 2GBGA 4FYPA 3H9QA 4HK4A 1JEYB 3JSAA 3FTQA 4FGWA 4TKUA 1JAYA 4R3WA 4MQEA 3G5AA 4FILA 4WZBE 5F1OA 2AKEA 5DYTA 5ESDA 4NCKA 1D6SA 1QONA 1AK2A 4YJFA 4ME6A 2IGBA 3CJTA 4PLHA 3RU3A 1WPQA 3SJUA 2I4NA 2AI1A 1SBIA 1QC5A 1ZCFA 2CUNA 2QI9F 3F7NA 4FINA 4HPWA 3ILXA 1Y1PA 4WECA 5ENDA 4J3FA 3R74A 4FYIA 3CEJA 5GVSA 3WGMA 4RIHA 3D1JA 1QHHA 3IT1A 1VM6A 3NV7A 4HXGA 1RPZA 1Z4JA 3KUDA 4RBNA 2E6UX 1CIVA 3B9BA 1JPUA 4GPBA 3CGGA 1RIFA 3KXPA 4DLXA 4LGVA 1GL6A 2FV8A 3PBKA 3CGWA 1Q0SA 4TMKA 2ZCJA 1ZUNB 3NWEA 5FPHA 2SECE 5HFNA 3VBCA 2FKNA 1DG1G 1JXMA 2CNBA 1G20E 5BR8B 3NETA 5EZYB 2I66A 3ES9A 5IFKA 2BRUA 1NXTA 2PJZA 4R7ZA 5EXPA 4BLUA 2PQMA 1PZMA 2W00A 2YOFA 2BGJA 5HJEA 1YR6A 1H5QA 3VR6H 2C3YA 2G40A 1U02A 4MJXA 3EIHA 1IHDA 1O7JA 2R6AA 3AOEA 1TM3E 4QAJA 1Z4NA 2FF7A 3I2GA 5H70A 4HCJA 3TMKA 3VYUB 1Y1TA 3ON5A 4RDXA 1WPRA 1NI4A 1DNPA 3Q2KA 4N76A 4M38A 1YK1A 2FN9A 5JAPA 4D5GA 4C03A 3ZGOA 4ENUA 1JEAA 2YMPA 1APBA 2GETA 3D5TA 3AFHA 1PQPA 5EJ9A 2P40A 2YJ3A 3OBBA 5L4SA 3OTQA 3JQEA 3KQSA 1SVSA 3TRKA 3MT8A 3P8ZA 5AUPB 1Y8QA 2C4TA 2GCGA 1KSJA 1L5KA 4HFMA 2OMKA 1JV2B 1WMSA 1BMTA 1J39A 1YB7A 2VQ3A 3BL8A 2NACA 1NNLA 2XCOA 2LXNA 3DYVA 1KWGA 3AF1A 2I6QA 3QTLA 3VH4A 1KK3A 2UZIR 4FDUA 1VB5A 3RTAA 3MW8A 1ZN9A 3DTTA 3C7CB 3OPYB 3QJYA 2R1ZA 4OQFA 3W5SA 1QDEA 4F6RB 5A5EA 4ZD6A 2NQ8A 1U2DC 2P90A 3T3PB 1ZL0A 4BN5A 5J43A 4R84A 1ZIYA 2DFLA 3WL8A 2D4HA 5KJEA 1EZZA 2WAAA 2P7IA 4DZRA 2ZAYA 1L5ZA 2YR0A 2GGSA 4MA5A 3M3DA 3WLIA 4BO5A 4Z6KA 4CDNA 3QPCA 5ADWA 2XNJA 3OO0A 3FZEA 4PNZA 3THSA 4D2IA 2BTOA 4R2XA 4WN9B 3TLJA 1JMVA 1XF9A 4ENWA 4OJYA 2I33A 3T99A 5IVHA 1MBZA 4BMXA 3Q5DA 2XQFA 3G79A 4HNQA 1CUVA 2IXFA 3JQ7B 2QUZA 4BQQA 1KDZA 4ROSA 2LBPA 1U0BB 1QO0D 3KS9A 2DR0A 4AAYA 4E0BA 3A2KA 1Q0PA 4MVYA 5DP2A 3UJ7A 2A5YB 4QGAA 1X7GA 3HYCA 1ZW6A 2WD7B 3CVYA 1XMOB 3HZZA 3OQBA 1JKXA 2GCPA 1WNFA 3VSBA 3TL6A 2F64A 2XWSA 1CRLA 4Q7QA 2C7QA 1DEKA 3NU1A 4EB3A 2WTUA 2YIJA 3SC2A 1S8NA 3OIDA 1LLUA 1M6WA 2AF3C 1QIMA 1BXRA 3AEZA 1DAEA 4QEDA 1P0CA 2H17A 3B60A 4ZODA 2H0QA 4XVUA 4OUDA 2LZ0A 4IJ5A 5GONA 1KK1A 2JD2A 4HLUC 4OMUA 3QU2A 4G5OA 1VBNA 4D6YA 4URZR 5L95A 4OOEA 3FR7A 1EHIA 3RIXA 5JE8A 3RE1A 1WL8A 2FXIA 5C7OO 5B7GA 4JJGA 5AK5A 4L15A 3HSSA 3UT5A 1P1JA 3NV9A 1XT6A 2DFVA 2HWYA 4NV3A 1T3ZA 3VR5D 1K2WA 2Y9MB 4J94A 1BMQA 4NCNA 2YIVX 3C7AA 2V6IA 3N3BC 3T9BA 3T7SA 1AKVA 4EPTA 2R47A 3O4JA 4BQRA 1FUEA 4HXYA 2IXAA 4HX9A 1WMFA 1XTPA 2HQBA 4ND7A 3K9BA 4B5KA 4KR6A 4N5HX 5EI5A 4E30A 2A94A 3VTFA 2O8DA 2EDAA 4Q6WA 3N0XA 4S3MA 3IUNA 4D9HA 1FXWA 3H65A 3UXEA 1DT5A 5P8WA 3CLKA 4HNTA 4LNUA 4XVQA 3UO8B 4S2EA 1KPIA 2ONKA 2YRFA 3ASYA 2VJBA 5FUXA 4ENPA 1AMNA 5GIOE 1WCXA 2ZWAA 4IQ8A 4WKBA 3KFVA 4MUJA 1KMCA 1FFEA 4FGLA 4PIPA 3SWWA 2W2LD 3AW9A 2JDIA 1XJ5A 4IZOA 1PYDA 4IICA 4NE9A 2Q5JA 4BNDB 4PBRA 1L7DA 4JB8A 5AI8A 5SYMA 4PU0A 1EM8A 2YWBA 2NNWB 4BZZA 4QQKA 2Y77A 3LQ4A 2A86A 1J5PA 2Q6OA 4M8IA 1UKAA 3KXKA 1ISRA 4DR2B 1QHXA 4Z1OA 4RZSA 2A0FA 2VDQB 4I8XA 1JR6A 4FBLA 4ZVPA 4EI8A 4ABYA 2GM4A 3H86A 2YZ7A 4MR7A 4BP3A 3REQA 3DE5X 2HZBA 5IVPA 3UBTA 2IV2X 4KX3A 4UAGA 1MO4A 3QKRB 3TSZA 5LL6P 1C2YA 3PICA 3R23A 4FWBA 5KOIA 4F9GA 2FMXA 1PGPA 4GBMA 1KS2A 2NU9B 2DH6A 2UUPA 3D3WB 2P6NA 5BNFA 5T4EA 521PA 2G8LA 1GADO 1OLUA 3GNLA 4F4CA 4A1OA 1Z68A 4WWHA 3IIKA 2H51A 5GZ3A 4KMRA 2F3QA 3O8LA 4QX6A 1UBLS 4P7FA 3SEFA 1LDGA 4KMMA 4F3CA 3PUJA 3ZS9A 1VJ1A 3TW8A 3AUTA 3VYVA 1FFDA 1YBVA 4NK5A 2F55A 4KMSA 4ZQGA 4EZIA 3EPKA 3EQ7A 3W9BA 2PGNA 1YACA 1KQGA 2BHNA 3H1AA 1D0VA 3W6ZA 1FTYA 5IG2A 3VAZA 5JD4A 3KO8A 3WR5A 2WIKA 4BO2A 3WP1B 3IMGA 3MZ0A 4CVNA 2WAYA 1K5GA 2BBSA 2P9BA 1OZ0A 4RF4A 4LQCA 2CXOA 4L2IB 4D7AA 3LO8A 1Y5MA 3QVXA 5IH7A 3HPRA 1L5VA 1S3SA 1UDXA 2I62A 3FUTA 4MV6A 2RHOA 4U2FA 3L8HA 2ACKA 5CW1A 1CF2O 3FFWA 4L75A 5FOWA 4EA9A 1M83A 3K5WA 3V7WA 3V4PB 3D1VA 2AFIB 2WTNA 3D0OA 3NH9A 2CJYA 2HJWA 1FVXA 4BVJA 4QXAA 1IQ0A 4BIMA 5AJUA 4TGLA 3NHZA 3FHOA 2VPZA 1JDNA 2QAGA 1LBHA 2JHGA 2RDMA 3O9VA 4Y2RA 4X1IA 1U28C 2HWKA 5TEVA 2CDNA 3WYAA 2AZXA 2Q5QA 2Q21A 3ETLA 3PGXA 2HDHA 3TR5A 1KI2A 1DMRA 1KRWA 1IXKA 4G5RA 1V45E 2V96A 4NMXB 1W52X 3FCUB 1OOEA 5BQ5A 4ZA2A 1F9EA 3GA7A 2WDPA 4E4YA 4JVOA 1E89A 2MR6A 2TMGA 4PLVA 1RYFA 4RKYA 1RWKA 1XJ0A 2WUFA 3Q9NA 3WO1A 5JAHA 1U8EA 1A5TA 4Y18A 4XRRA 3L1IA 5EMLA 3ZW7A 2VSQA 3KPUA 4KAFA 4CI9A 1JQ5A 4M1TA 3PNVA 2GTPA 4D9KA 2PQ2A 5E7JA 3JD4A 3HVIA 4CF3A 4RVHA 1EX1A 2XTJA 3VSEA 4W8GA 3N2ZB 3SVZA 3I9FA 1IJFA 2GJSA 5BV2P 4W5NA 1G16A 4U39A 3O90A 1E0KA 1G5PA 4O4JB 3HJCA 4OK5A 4U9UA 3SX4A 1BVRA 3ME5A 3UMJA 4Z0HO 4EJMA 3O8RA 1MD9A 4F5EA 1VJDA 1JDSA 2Q1UA 3ETJA 4M1YA 4YRIA 3ISTA 3OJFA 4PCAA 1RKBA 1OZGA 3BIWA 2BP7B 3KPWA 1YZLA 2MMGA 3CNBA 5THQA 3JR3A 3SJCA 3OE1A 3BGIA 3ZDCA 3FNQA 1AGXA 2MYPA 3PYLA 1H6CA 2VUSA 4I4IA 4NCHA 5AVYA 2IH4A 1J90A 2MSLA 5HW0A 3CZPA 1SCDA 5ECWA 1DXOA 4GMHA 1PR6A 3CT6A 1XU9A 5DEIA 3D54D 3EE6A 3A9WA 1RC1A 2OORA 2P6PA 4ZYUA 4M36A 4BLVA 1QZTA 5E9AA 3SSOA 4R2MA 1L4LA 5JVDA 2BSXA 2E4XA 1PWYE 1QE0A 3PLRA 3WQQA 1BVUA 5EZSA 4JCCA 5A3RA 5CB4B 3LMKA 1UQUA 4DIUA 3FMFA 1IHOA 4WASA 1QVZA 2RHBA 5SYNA 1AHNA 1W88A 1OZAA 1MEEA 3GYGA 1ZJ4A 1DVRA 4N40A 1EPUA 1W49A 2EX4A 4JX8A 1ZMXA 3U7EB 2V9PA 2ZS9A 3ETEA 1LF5A 2Q5IA 3I34X 5TPWB 4Q39A 3L4BA 3ETNA 3BDAA 5ALLA 4G81A 2HX1A 3MJEA 4JI2B 4ZQHA 3RNLA 3UUGA 4K8OA 4E2WA 1M34B 3WKDA 3B70A 3U4DA 3ZWOA 1E3LA 3ENWA 5EMHA 5CB6A 5HYVA 4I08A 2CBXA 1Z4PX 3FPEA 4NJEA 3DC7A 3F8SA 1K7SN 2VPYA 3PPXA 1X1BA 1R00A 2EEZA 2QMYA 1UJNA 1AQNA 3FVQA 4HDCA 1XIVA 1ZCBA 1IVNA 1KRXA 1RWNA 3VR5H 1A82A 2WFZA 4JJFA 1DX4A 2UXBB 1MX1A 2POQX 1IZZA 1DUVG 4KB5A 5SZIA 1D0SA 1Z37A 1USUA 1Y6ZA 4WVFA 1WKBA 1GZDA 4RU1A 3GNQA 1MAWA 4W1SA 3DBRA 3HKDB 5FWDA 3D8SA 1QLHA 1HGXA 2YV5A 4XYEA 2PT7A 1XTQA 3AVQA 3ADOA 3AONB 4X93A 3VXKA 4YAJA 2QVYX 3PHJA 5H82A 2VP2A 5C4MA 1K86A 1Y3BE 2OUKA 5JARA 3MWDA 1K97A 4DABA 4R81A 1U8YA 4DC1A 4Z53A 1EUYA 2X7JA 3DWFA 3CNNA 1H94A 3OU2A 4IXTA 3OJXA 3U7RA 5DXAA 1MVLA 1BH2A 4OJQA 1PJZA 2J09A 1H4VB 4RD4A 2C82A 2O05A 1A9XA 3FOCA 2V0NA 2J0VA 3I0MA 3PRKE 1CUGA 4J76A 4NG4A 3QVGA 1RWOA 1UAAA 5EYPA 3HCWA 3N07A 1M8JA 3NGXA 4HTAA 2X5OA 5FWXB 3AQIA 3TQSA 2XT6A 5KYXA 1MX9A 2Z2JA 3AFNA 3PIRA 3A9SA 3GI1A 5EIAA 5KMGB 5KCZA 5EFZA 2NU8B 4RA9B 2WU8A 4MVCA 1BG6A 1K92A 4NPHA 3CH4B 1AH2A 2ZBGA 1ADGA 4XPZA 3UW1A 4CU2A 4UTPA 4NOLA 1SKBA 1U2EA 4Y2SA 2OHOA 1BVHA 1Q91A 3DMTA 2CHUA 1E7QA 1MOSA 1GG2A 4MKZA 1TUBA 4GD3Q 4P53A 4ZANA 4M21A 2JHCA 1IHUA 1TO6A 3GV0A 3IVCA 1ESMA 2JZNA 2Q3LA 3PU6A 1NLZA 2O2XA 4MB6A 4GPIB 1F4LA 4ND6A 1R9GA 4A0QA 1GGMA 2HRBA 4ZVSA 3FMOB 4YBZA 3GVHA 1T8SA 1VGRA 1NI5A 3D6AA 2VHEA 3E9YA 3H2IA 2VNJA 4QELA 3PF8A 2NQ2C 1FFHA 4J7UA 2EJBA 4F56A 2Q0SA 3E7PA 3QOXA 1F20A 2IEDA 4P31A 4IH4A 2CMFA 2ZYUX 4GE0A 4NMLA 3D3KA 3E0QA 1JTVA 3BSSA 1E5LA 7MHTA 1DIBA 1HE4A 1QSGA 4O2RA 4RX1A 1MJ5A 3SYTA 4OQXA 4NNPA 3G2KA 4QXOA 4C0JA 1SC6A 4XUDA 2H2DA 4YTEA 4Z9FA 4YR7A 2V7XA 4MMZB 5GP1A 2GRJA 3AJDA 3TXXA 3H3XA 4OAQA 4EPVA 5ALYA 3LXXA 1ISIA 1Q74A 1A72A 2IXTA 2N1MA 2DQKA 3CLUC 3IALA 3DBHA 1N1EA 3A0RB 3KEFA 3QJGA 4M6WB 4W82A 3PWTA 3T7JA 3LCMA 1Y9ZA 4TVBA 2W70A 2QPAA 1YE3A 3L7NA 1MPXA 3GFRA 5SYAA 2V3CC 4WLFA 2WTXA 4PHTA 1V43A 3WKCA 4F4HA 1Q95A 2OK8A 4RIFA 4S24A 1QGDA 4BYMA 1XLVA 4JB2A 3PR3A 4IDPA 4Y2UA 4D99A 5BWLA 3AVXA 4UDYX 3BH6A 4Y1RA 5B36A 5C52B 5EKSA 1VG0B 2Z0MA 3KOWA 4HWKA 1UFVA 2ZRCA 4ZO9A 3FNHA 1ULSA 3FMGA 1CUSA 2EIHA 1PK8A 1R0YA 4B3XA 4US0R 1T0IA 4RVGA 4J0QA 2YMLA 5D7BA 5G4KA 1EB8A 3CNOA 4BV2A 5LMNB 4CMHA 4JR2A 2IYXA 3G2LA 4OA5A 1G2IA 4QUEA 5KWVA 4LN1A 4MW9A 3FYSA 3JS5A 4WL0A 2J7PD 2DPYA 2E4AA 3CRVA 1D4ZA 3L1HA 1YQDA 2QY9A 4KX5A 1L1FA 5H9VA 2JLVA 3EFEA 4C2UA 1VG8A 4IXMA 4BFZA 3PQ4A 5AKXA 3GFVA 5JSFA 4KN5A 3NKLA 1WY5A 4PLPA 5J47A 1SXPA 5LP6A 1V1MB 4HN4B 3LUBA 4P82A 5D7NA 3RUEA 1X7XA 3W6OA 3B3JA 4LDRA 1GFIA 4NYIR 4H1VA 5C51B 2VH5R 3UCFA 3JVVA 2EATA 3A06A 4MR8A 3SVLA 2CK3A 2ZJ2A 3LKBA 4TYQA 4MQ4A 2VPXA 1NW3A 2BTQB 1EE1A 2E3JA 4TS3A 3ZHRA 4C3OB 1P2SA 4TMVA 2WD9A 1Y6FA 4KGVA 1QRRA 2YQ4A 2LD4A 1P4AA 1Y7HA 2Y1OA 4HGPA 4ALNA 3DE2X 4B84A 1AUPA 1GSOA 1YOVB 3LCUA 4AJLA 4Y9RA 5FRDA 2IQIA 1P73A 1AKYA 4PG7A 4BJ1A 1V39A 3R7FA 1PFGA 1L7NA 5FHQA 4HV4A 1K6XA 1USWA 4MPPA 5DE3A 1H2HA 3ZKAA 2HGZA 2V8BA 4IEIA 1FYEA 3E3NA 4BQIA 2ILVA 4JT9A 1M2NA 2BFAA 3FDFA 3O31A 3TOXA 2JLXA 4ER5A 2JKVA 1C7JA 1EX6A 1ZVMA 1P1RA 2QDKA 5IAKA 3VUEA 4NENA 2C8LA 5H02A 3I39X 1QLWA 5A5GA 2BYTA 2IP1A 1XTKA 2BM9A 3RBXA 5ABPA 5CFOA 5JJIA 1DXYA 5C5EA 2OBNA 5A4KA 2QZJA 2CXHA 4JB3A 1DUSA 4E7OA 3SHTA 4QBGB 3OQ1A 1CDDA 1BX3A 1W93A 3GFSA 1OI7A 3I2KA 5A06A 5E8JA 4WOBA 2WMDA 1E69A 1AGYA 1I0ZA 2QP4A 4NZZA 1T4CB 2O8BA 3LX5A 3W9UA 3BX1A 3MPOA 1SHLA 2PUJA 1JVNA 1Y9EA 4EJ6A 3B6IA 3HU1A 2QUJA 1M1XB 4Z51A 4JBWA 3FOFC 5AO9A 4RTLA 1DBQA 1OX5A 1KMNA 1CJKC 4EI7A 5JBIA 1GP2A 3N58A 2YJ6A 3OA2A 1T0PA 2IYFA 3U4AA 4TV9A 4FWIB 5A5VA 2RHMA 4P4GA 1NJ6A 3PUYA 5FUQA 3HQ4O 2C2XA 4D9IA 5EQDA 1BW9A 4PC3A 1LPPA 1WUTA 3FPLA 4IV0A 4W8HA 4DT1A 2I7TA 3U7GA 4F3RA 5BORA 3J7TA 2Y0EA 1SKQA 1OFHA 1ZH0A 4BOYA 3UKJA 4JV5B 2GCIA 4ZT6A 1H2YA 3T1QA 4PAOA 2BEKA 3BE6A 4OG2A 3ML1A 4YT4A 2R5WA 3AFGA 3LFTA 2DQ4A 1EAYA 3URMA 5AVSA 2F48A 1B93A 4WCFC 4BNGA 2B69A 5FL7D 4UTVA 1U2GC 4XB6B 2YNMA 3SQDA 4LW8A 1XMJA 3RLFA 1X9IA 1QQ7A 3OUTA 4I46A 1HEIA 2J0EA 1SUBA 1QKJA 1NMZA 5KYGA 2Q4OA 1GZ4A 5BOSA 4NHEA 1WP4A 5KOHB 1R4AA 2FDCA 2HA6A 4QNRA 3AUYA 1DZ3A 1OCEA 4YB8A 2AC4A 3H5VA 3D3NA 1GTMA 2AD5A 2Z04A 3W5UA 3W5AA 1ZVKA 3E3MA 1IY1A 1HT3A 1M8PA 1K89A 1NQ5A 2CVPA 2WF6A 2CN1A 3BMOA 3LQYA 3N2EA 4GU5A 4N3BA 1K75A 1ECGA 4HB2A 4AF8A 1NW7A 1U2PA 1P2FA 1PZNA 4IDEA 2ZRBA 1YR9A 2PTHA 3QE3A 3SBEA 4B46A 5BV8A 4ZDIA 5B58C 5C8YB 3BJIC 1RYMA 3G17A 3A6ZA 3I2FA 4X1YA 3SOPA 4MP6A 5HUJA 1FFBA 3A1VA 4PC2A 6PFKA 1T8YA 2GASA 1P5ZB 2PMCA 3IUMA 1U8AA 2B92A 3K8OE 4MGKR 3QPUA 1FP1D 1XALA 3O93A 4RY9A 4DIKA 2BGLA 1DOHA 1TFUA 3W5HA 4M60A 1SQ5A 1VPTA 2WG1A 2ISSD 2RKBA 1SRQA 3HRHA 2OBBA 3L8ZA 5JDCC 3VJRA 4PYOA 3G82C 3TFWA 1INLA 2WE8A 2XMQA 2ZRQA 2P2YA 5IJ9A 2ORED 2CYAA 4N3NA 1DV1A 1P80A 1UF9A 2XGMA 1QOZA 4HC4A 5HILA 3RKUA 3AF5A 3E7WA 1W47A 1IFXA 3DR3A 3AY7A 5MN6A 2V7GA 5LQJA 1J33A 3A1FA 4HH4A 1O89A 1TM1E 3GZJA 1LV8A 1UDWA 1UM9A 4Q12A 4WXRA 4PRYA 2JASA 1ZIOA 3DNMA 3QELA 1YZFA 3LUAA 3OZRA 1NYRA 1U6KA 3HJAA 1DCFA 1NDHA 3DCIA 4QU8A 3ZE9A 1XROA 4E4RA 2FN4A 5JAMA 3U6KA 2VLBA 4GOOD 2EJVA 5F5NA 4I81A 1BHQ1 4E22A 1FX1A 4W5WA 2UUOA 3ILYA 3MOSA 5H3HA 2OD9A 4C30A 1TMOA 3JW8A 2A1UA 5IYZA 5JEDA 2QENA 3ZD6A 1GGEA 4MUBA 4QEKA 5CXXA 4YXWA 1AN0A 1NMQA 4Y6RA 4ZYXA 3MQ2A 2MSCB 2CLOB 3QV1A 4XLZA 1V25A 3STTA 1CX9B 2A84A 3LPAA 2Q6VA 3OF3A 1TC1A 3UBMA 3FVVA 1PFYA 2I80A 5LDDC 4JJKA 3DL2A 1Z0DA 1RNLA 1K08A 4GHWA 2GK3A 4KQIA 4UREA 1SXQA 3R0XA 2HHCA 4ETMA 3KSUA 5TLSA 4B83A 2ZYDA 3LWNA 4I7EA 2QTMA 2WHXA 4W5RA 4TTRA 2QMUA 2ZYVX 3BJRA 1YKFA 5E6RA 5I8ZA 3PDIB 5IZCC 1BD3A 5JG7A 4CEIA 4KAAA 3HY6A 3F0TA 5TXGA 4QJ3A 3UPTA 2VOEA 2Z30A 3JATB 1HR0B 2IT1A 2BKAA 1TZ2A 3ECSA 4GRDA 4TYYA 1G3QA 4KQEA 4A82A 3U44B 1CUIA 2FE4A 1NP7A 2NXWA 5DNVA 1YI1A 1UKEA 2DT5A 4KGDA 5KQPA 3YASA 1IDOA 1LW7A 4TTQA 1GPLA 3ICEA 4I1YA 3TTUA 4Y9UA 3L02A 4L16A 1CZRA 1P2GA 2Q6IA 3R3SA 2GF0A 4EHIA 1N6HA 1V1JA 6LDHA 5EWJA 3Q7RA 1JSXA 3LUJA 2PBLA 4EELA 4WNYA 3RS4A 2GXQA 2QV0A 1ATZA 3KVVA 4FSDA 4GI1A 2EARA 2AVNA 1C9KA 2TYSB 4KJXA 1C5KA 3H8WA 4BZXA 1PJ8A 2F1IA 1E3WA 2B37A 4WT7A 3W5IA 1WZUA 4W9RA 4B4KA 1BS2A 1YB6A 4QODA 4TKLA 3NM6B 4UD6A 1X7WA 2BZSA 1P2VA 4UNIA 5FNVB 4IX9A 1OZFA 1FUKA 3DP9A 3KAQA 3WIVA 3I9LA 2IBMA 4I4LA 3WLQA 4GP6A 1QPGA 4QM7A 4NU5A 3QIAA 1VYUA 1YQUA 2XWPA 5AM5A 4LXIA 3G5MA 4NRDA 4LYEA 2IEBA 3MJ4A 3SIXA 5LU9A 2GJ9A 1HKHA 3CX7A 3I2JA 3VPSA 4G1MB 3MC1A 1MJNA 2B9EA 3OIFA 3HXQA 4M88A 1Z5WA 3PF9A 3F2IA 2VF8A 2P77A 2QJTA 1R8QA 3A9VA 2VAWA 4UEWA 4G5SA 4D4IA 1AV7A 3ER9A 4YP0A 3FSJX 4X45A 4XA8A 2QRLA 5FB3A 3IB6A 3OMLA 3FB1A 4X8MA 1HFJA 2VDUE 3IDFA 4IIDA 1WZIA 2ODEA 1FX0B 3ZJVA 5B55A 1W36D 3NJ8A 3ZQ4A 2O5EA 4AS1A 1V6AA 3EQ6A 2I55A 2NVWA 2VAMA 1CWUA 1JG7A 3ZTTA 2H4YA 3T3DA 3FDZB 2I91A 2XVZA 2ZBPA 3PQEA 3LWZA 3TWOA 4R1UA 1OTXA 4J29A 2C83A 5T41A 1HX7A 3DV2A 3QYPA 1F8XA 5KX5B 3R20A 2AW3A 4GI2A 4JJAA 1UBGA 1MB0A 1O6FA 1W5SA 2VHUA 1J8QA 3BCRA 4KIJA 2B1GA 4C0XA 2VJNA 1EXWA 2Z09A 1QIDA 3D31A 3V7YA 1EG7A 1KZGB 5D3QA 3U39A 4GKKB 1Y5NA 4B33A 1F2TA 1SA0B 2IUSA 2DLNA 2OT3B 1OBFO 2PVCA 3DMFA 3DZ8A 4RJJA 4RVUA 2A4MA 3WMRA 4D79A 2RGDA 2HCBA 3VOTA 1RPAA 4YJHB 4MV0A 1D2CA 4I66A 2YQ5A 1H0RA 1EUCB 2ATEA 4ND8A 4C0LA 1G60A 4GM0A 1IQRA 1ZA2A 3HRIA 2QQ5A 1Z45A 3EK2A 3I0ZA 3JALA 4OQDA 3V8PA 4YRMA 1FYDA 5BNWA 1E7SA 1RAGA 2QZ9A 1SXJD 3KOZA 3H4MA 3N6XA 5BRAA 1S2LA 3HLTA 3TAHA 3NX4A 8MHTA 3LKVA 5EFOA 5L3SB 3FGNA 1Z0KA 2VVTA 3VRHA 1KGDA 4G85A 3NEYA 3E3OA 4G0VA 1KAHA 3EYWA 4IFBA 2ZXEA 1CK4A 1KI6B 3A7EA 3FUUA 4L27A 4MS1B 4MWSA 1RJ9A 3PEEA 1LNSA 4N1AA 4Q1FA 5KJFA 1H3NA 2PZFA 2PE5A 2EOAA 4O4IF 5FTNA 3UG6A 4BFVA 4ZT3A 3FTNA 3QU7A 5K0LA 2WTBA 1MJGM 1PJQA 2HIGA 2JLRA 2M6KA 1S96A 2WJJA 4X64B 3QVTA 3PQ7A 4LI3X 3WLSA 4KK4A 1H65A 1K8YB 3C43A 4CM6A 1I7SB 3FSGD 4JY7A 2HNKA 2A67A 3HGQA 4LYAA 4BX3A 1N25A 4GOMD 3LC0A 4R3UC 4BBAA 4DLSA 2I71A 1OASA 4B6SA 5CJPA 1GQSA 1VFNA 4O0LA 3QFSA 3WFIA 1FW6A 4OP2A 2XCIA 1V4VA 1NFFA 2FQQA 1YASA 3DA8A 3LL7A 1L4HA 1CFJA 5EQTA 5K03A 3H18A 3CUVA 4KE7A 3NS7A 4B3MB 4FW9A 8GPBA 3P71T 1JMKC 1ECCA 1UC5B 4ENVA 4JC4A 4Q4JB 3DTVB 1T3GA 4MTLA 5GADl 3B2EA 4DMMA 3HFJA 2H06A 4KYTA 4WCFB 1TDJA 3LT2A 1Q22A 5LZ2A 4FGSA 1TO1E 3EIXA 5DYNA 2Y2VA 1ZICA 1LB1B 4JLOA 1AZWA 1WQ4A 2GN0A 1FF9A 1QYVA 2XSZA 3EUAA 4AG3A 1QIGA 1WXXA 5JSHA 1FJXA 3QG5A 1SG9A 2FSGA 4Q48A 4GL4A 4MVJI 1UT8A 1Y3DE 1GYQA 1XZMA 4RZ2A 4WESB 1OU4A 1FP4A 1I2ZA 1B6TA 3GIDA 1O0BA 4G4SO 4U2DA 3GROA 5ED4A 2HHJA 5C5CA 2J7KA 1HC7A 4DQUA 3DHEA 3O95A 3ZDAA 4C43A 1EK1A 1YZKA 4H77A 3TQRA 3IV9A 1DPFA 3O1HB 2EAUA 1GTRA 2H1FA 1WU8A 1OLXB 1HA3A 2ZVPX 5DTQA 5T3UA 1PV1A 2A35A 2QRQA 4A3SA 1KIAA 2WYOA 3DKIA 3IOEA 3NDRA 2WWTA 4C78A 1RZVA 2X0KA 7AT1A 1PS9A 3NM4A 3O73A 9LDBA 1PGJA 4MRMB 5AVXA 2I03A 2QTWB 1KJJA 2B7BA 2F1HA 3K94A 3LDAA 4MW7A 1PLJA 1LLDA 2GAIA 2W90A 3IULA 4G3XA 4QL3A 3UB4A 4BVLA 1P6UA 5IBCA 3WX0A 3DLPX 4CQNA 3V9AA 3BFPA 1A27A 3L6RA 5DHUA 4QOJA 5CK5A 3PUVA 4HR7A 1SR8A 3KSBC 3KB8A 1CKEA 2DZDA 2IRWA 3HE3A 3QXJA 1JLLB 1RTKA 1UKBA 1GGKA 2H4ZA 4J1SA 4M55A 1I33A 5A9RA 2GXAA 3ZJUA 5LB4A 3NLLA 4LDPA 1K6JA 2FFQA 4M87A 4F92B 2OCAA 4JQCA 3CX4A 3MYYA 1GGFA 5F3DA 1QOPB 3KDPA 3CW8X 3ZIAD 4QREA 1KMQA 2EQBA 4A2CA 2OG1A 3C6BA 5CLLA 1QU2A 1UIRA 1D4FA 4PLCA 3M6VA 2IVFA 2WTEA 1QRUA 2VDLB 4DTCA 1JEOA 2GERA 1CULC 1D8AA 3R8CA 2PH1A 1OBOA 3TMYA 4EHLA 3MOIA 1DWOA 1M2KA 1OJLA 3KYDB 2H9IA 4L50A 5D6NA 1E3IA 1L4MA 1RYBA 4O8ZA 1RYEA 2ZBRA 5CDGA 5CLFA 3Q8LA 1USIA 2D1RA 3T9DA 2OLEA 1R50A 4QJ4A 4QDZA 3RT9A 4PS0A 4HDNB 4PIMA 1DPGA 4ODIA 4L0CA 1UEIA 4FFWA 5EP3A 2FHSA 1OBHA 2XOKA 4ZVVA 2WAMA 2ZJFA 5HHTA 1YFZA 3HWRA 1HNZB 1UPFA 2WA2A 4K9LA 3SJZA 4JD5A 5BT9A 3L6DA 3LHSA 1N9GA 4J0CA 3VYSB 4X3CA 1D2RA 4LMPA 3PVCA 3TLAA 4AZ3A 5B6PA 3PC6A 1BE8A 1MKYA 3IQZA 3UAZA 4Z4GA 2PH5A 1U3WA 2PG3A