1R88A

The crystal structure of mycobacterium tuberculosis mpt51 (fbpc1)
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
267
structure length
267
Chain Sequence
AAPYENLMVPSPSMGRDIPVAFLAGGPHAVYLLDAFNAGPDVSNWVTAGNAMNTLAGKGISVVAPAGGAYSMYTNWEQDGSKQWDTFLSAELPDWLAANRGLAPGGHAAVGAAQGGYGAMALAAFHPDRFGFAGSMSGFLYPSNTTTNGAIAAGMQQFGGVDTNGMWGAPQLGRWKWHDPWVHASLLAQNNTRVWVWSPTNPGASDPAAMIGQAAEAMGNSRMFYNQYRSVGGHNGHFDFPASGDNGWGSWAPQLGAMSGDIVGAIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MPT51/MPB51 antigen
publication title The structure of Mycobacterium tuberculosis MPT51 (FbpC1) defines a new family of non-catalytic alpha/beta hydrolases.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Immune system
total genus 89
structure length 267
sequence length 267
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00756 Esterase Putative esterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1r88A00
2AXEA 2VT7A 5BV7A 1OILA 3I6ZA 1XKLA 5LYYA 3A70A 1KU0A 4H18A 1XQXA 5DYTA 3HSSA 4XJVA 2ECFA 3L1IA 4BATA 5CT6A 3OC0A 3IDAA 3D59A 5AKKA 4WFKA 1TIBA 4ITVA 1YSCA 1VKHA 5JYCA 3IUQA 1QIGA 3ZLUA 4ZXFA 3QPCA 2OXEA 1XZAA 3H19A 3IVMA 3AIKA 2I78A 1XZIA 5ALGA 4PW0A 4RE6A 1F6WA 2IX9A 1QO7A 2HA7A 2DQYA 2WUFA 2XLBA 2HA2A 2HU5A 5HK9A 1EA5A 3UUEA 1KEZA 5EHZA 3H1BA 4J0IA 4Y2RA 3EF3A 2WIKA 2JGLA 5A62A 1DWOA 2XUAA 3ESAA 3D5EA 5JZBA 5LKAA 2O7RA 1PJAA 4GWLA 3GBSA 1CUXA 1N1MA 1ODSA 4PSUA 1ZI9A 5E4TA 5HF9A 4WFJA 4GW3A 5JAUA 4H7KA 2JGKA 1R9NA 4AXBA 1VA4A 1IUNA 2QJRA 3E0XA 1CV2A 2WTNA 2CZQA 1B41A 2WJ4A 4C89A 5A71A 4Y2SA 1CUZA 1ISPA 3WK6A 2QR5A 1JMYA 5ALOA 4BCDA 3G02A 1L7QA 5C8ZA 1PFQA 4P93A 3FYUC 4BZZA 5DYYA 3SC2A 4BC1A 3O4IA 1BS9A 5ISMA 1OXMA 1AKNA 1UOOA 2XQFA 3PFBA 3D4LA 4BYMA 5HF6A 1SCQA 5AP9A 2FJ0A 5D6OA 5LP1A 1UFOA 2ZJ6A 5T4EA 4B0PA 2XUHA 5E2IA 4B6GA 1R88A 3KDAA 3R3XA 5ESRA 5DJ5A 4A16A 1J06A 2Y2UA 4AX4A 4J0KA 4LXGA 2PU5A 4S0XA 2CKMA 5CRIA 3DNMA 4H7HA 2IITA 1ZOIA 1WPRA 1S8OA 4KYVA 2Y6UA 2HRRA 4FKBA 4I19A 1QIJA 5EIAA 3WKEA 5KBYA 3P2MA 4DMHA 1Y7IA 1YR2A 2XI4A 4X94A 3D2BA 4UHHA 3M81A 2PSHA 2HRQA 2QMQA 4OU4A 1UOQA 2O2IA 1FFAA 3L1HA 3HLKA 3I1YA 4M0FA 5JD4A 4BCBA 4L9AA 4OCZA 5YASA 2XUQA 4JH0A 4EY6A 4KE9A 3AIOA 5K3BA 3O95A 4OYLA 4G4JA 1XZJA 3G9ZA 2B61A 3FCYA 1SCKA 2GZSA 4HS9A 4G1FA 3O9MA 4AO6A 3DOIA 2HDWA 2AJ8A 5LIPA 5HFNA 1HQDA 4QWMA 1EDBA 5JASA 4CIAA 2BUBA 3G9UA 3O4JA 3NWOA 1AC5A 1LBTA 4Q3LA 4C4YA 5JD5A 5EHNA 1MJ5A 3CN9A 4PSCA 3FAKA 2J3DA 2GBGA 4GXNA 1QTRA 4H35A 4X6XA 3BJMA 3ICVA 1EHYA 3G0DA 2VTVA 1QIDA 4P08A 4CCWA 1EK1A 1LLFA 1XZMA 1TK3A 5K3EA 1H2XA 1MX1A 2PKYX 5BWCA 2XQIA 3W04A 1E8MA 3PUIA 2J3QA 4UBIA 3BIXA 4OPMA 2BGRA 3EQ7A 4X85A 4FBLA 2R8BA 5CT5A 4C01A 3OG9A 3V1KA 4A23A 4G8BA 3AFIA 4B0OA 2VJAA 4DTCA 3RK4A 4KE8A 3IUNA 1CEXA 4BC0A 1UWCA 4G5XA 5I9IA 1WB6A 4X92A 3AINA 1XLWA 2JBWA 4J0DA 2WILA 3I2GA 1Z68A 4MQLA 5ALSA 4OSEA 3VJKA 2QXTA 1Q0ZA 4FWBA 3K2IA 1GKKA 3CN7A 5BWBA 4UHEA 5LKRA 3KWJA 5AHXA 3NUZA 3I1IA 4X7BA 1J07A 2XMZA 4QLAA 1TKRA 4U2EA 1GXSA 2JGIA 3GELA 3WWOA 1QIMA 5AK4A 3QVMA 4QDXA 5JD6A 3Q0TA 4LYEA 2X5XA 3C6ZA 1DTEA 1ZD4A 4N5IX 4MYDA 4KJXA 3RLIA 4LIPD 1WPXA 4B85A 1CUVA 1N5MA 4X6YA 5EI5A 3A2LA 1X2EA 3JYHA 1XQYA 5CT9A 4J7AA 4ZREA 1NU6A 1WB5A 4EY4A 1EDDA 1EINA 3ZLTA 4L3WA 2AJLI 3BJRA 1R9MA 1FFCA 1USWA 5JADA 2WHPB 1DQZA 4H7IA 2W22A 2GBFA 3ICWA 1CUWA 4QDTA 1RWQA 2PSDA 3I2IA 1BU8A 3FVRA 1H2ZA 5KREA 2OPHA 4C88A 3FWHA 1XZBA 4OB8A 4AZ3A 1ACLA 1AURA 5HFAA 5JANA 2HIHA 1ZICA 4UPDA 3JWEA 3H2JA 4G8CA 4UHCA 2WJ6A 1LZKA 1MX9A 4XVCA 1H22A 3IBTA 3WIOA 4ETWA 1ZJ4A 2JGJA 3M82A 4DM7A 1CUSA 1ZGBA 4KE7A 4UBLA 3DKKA 4WY8A 2VEOA 5AK6A 4L0CA 3QH4A 1ETHA 3ANSA 2QS9A 5EIEA 4MWTA 5AKJA 3VDXA 4M0EA 1JU3A 2BGNA 3F9CA 3HRHA 5AO9A 3OOSA 1K5PA 5AK3A 3WJ2A 3STVA 1YAJA 3QPAA 4HRXA 5AKZA 1G42A 2QJWA 4F5ZA 3LLCA 4KAJA 3KOOA 1ZGCA 3N2ZB 4Y7DA 3O9VA 1XZKA 2BUCA 3DYVA 1TCBA 3UUFA 3LIIA 1VZ3A 1CVLA 4U2CA 3TJMA 4OYYA 5HKAA 1N5RA 1NX9A 2HFJA 1H2WA 4QA9A 1G66A 1GPLA 2PL5A 3C5VA 3HZOA 1IZ8A 1W6RA 1W76A 4EZIA 1DX4A 4LHEA 1UKCA 4U2DA 1EB9A 4BBZA 1EH5A 5A7FA 2QOEA 4FLFA 1U8EA 3GUUA 4JYMA 2EEPA 1CFJA 4C87A 1EB8A 5IH7A 2JGMA 2RONA 4K2AA 2D0DA 5HCUA 1UK8A 3G7NA 1YA4A 2AJCA 1GPNA 2JEZA 3WWEA 5JIBA 2YH2A 1QLWA 4YPVA 3R40A 3OURA 1QIIA 5FPQA 2X8BA 2XLCA 4H77A 4KR0A 3WIBA 3WLAA 2B4KA 1LZLA 3H04A 4FLEA 2NW6A 4BVJA 3QMVA 5AOBA 5IVIA 1ZD3A 4HXGA 2V98A 3MVEA 4EY8A 3R3YA 3WL6A 3QMMA 2DFPA 3G0BA 2XUGA 4EUSA 1Q84A 3DJYA 3G0IA 3WA6A 1XZCA 5JZSA 3PE6A 4M0MA 5T4BA 4AZ0A 4LKOA 4W1RA 1K63A 1F0PA 2OGSA 4PV7A 3DOHA 5AKHA 1EK2A 3L1JA 2H7YA 1GKLA 2YYSA 3T52A 3WKBA 4XIIA 4BCCA 5LZ5A 5CMLA 4IH1A 1MAHA 5CH8A 6YASA 4ZV9A 5ALKA 3GZJA 1W1IA 4EY5A 1EVQA 1MO2A 1K6EA 3AIMA 1LNSA 1VE7A 2Z3WA 2DSNA 4PSDA 3WKDA 2HA3A 3WYDA 4MEBA 4C4XA 3LS2A 2JGFA 1PV1A 3D7RA 2QUBA 5EHXA 1XZGA 3FBWA 4PF1A 2Y1KA 3H2GA 1QOZA 2VATA 4G4GA 4BRZA 3HACA 1XRMA 3WKCA 4K6GA 4W1PA 4B83A 4GI1A 4HRYA 1ODTC 1QGED 4Y2PA 1E8DA 2VSQA 3A6ZA 3C8HA 4J03A 5I7UA 3HI4A 2R11A 2DR0A 3CXUA 4J0HA 3TRDA 2XMGA 2X76A 1LPPA 4FLMA 5D7BA 5AK5A 5HF8A 5BOVA 2XQKA 1XKTA 4KACA 2OCKA 4CFSA 3ZWQA 2HA5A 3F67A 3U1TA 5HQ3A 4MJ3A 1BEEA 2E3JA 5FDFA 2VAVA 2CEKA 1X70A 3QMWA 4P9NA 5IKXA 2QRUA 3ANTA 1JJBA 4EY7A 2XMDA 1QFMA 3H0CA 4MWSA 2WIFA 1ZI8A 4I3FA 4AN1A 4DNQA 2OG1A 3ZPXA 3AZPA 4DSAA 1WM1A 5ALYA 3B5EA 1Y37A 3AZQA 2Y6VA 1ZD2P 4YASA 1W4LA 4RNCA 5FRDA 3LCRA 4J0GA 1XFDA 5CH5A 3TGLA 1CIJA 1JMKC 2GBCA 4F21A 4LXIA 2YXPX 4XWGA 3H1AA 1QE3A 4HTAA 3DLTA 4DSZA 4K5QA 1A8SA 2ZYRA 2QM0A 4LXHA 1GT6A 5CW2A 1WB4A 2PUJA 1LGYA 5K5EA 4X71A 1AX9A 4TGLA 5HZGA 4W63A 3BWXA 5HF5A 5AICA 1IVYA 1VA5A 2J4CA 5LLSA 1SCIA 4UBNA 3I28A 3F97A 3ED1A 3R41A 1XRQA 3E4DA 4GEGA 4DMCA 2VT6A 3VVLA 3I2FA 2VJDA 3PDCA 1TAHA 1UK7A 5ALUA 5ALXA 4WFIA 2WG0A 4KAFA 2RIPA 1W75A 4BTLA 2XQJA 1XRLA 4CCYA 3MGAA 4H7EA 5ALDA 2G5TA 3FVTA 5LZ4A 5SYMA 5J3JA 1A7UA 3ZI7A 2PSJA 2RAUA 3O4HA 4ZWNA 3K9BA 4WDRA 1QIKA 4U2FA 4FFVA 4Y2VA 4E46A 5CXXA 3C6BA 1CUJA 4IH9A 5JARA 2OLEA 3BL8A 2RHWA 4X3CA 4FOLA 3Q8WA 4Q05A 3WK4A 5IVKA 2JEYA 4XX1A 1EI9A 1U65A 2J4FA 4GBGA 2GYWA 1IUOA 1JT2A 2XDWA 4QZVA 1M33A 2OQVA 3R3WA 1MNQA 1MTZA 4K6KA 4Y2YA 2HM7A 5SYNA 3WWPA 3RM3A 3A2NA 4KE6A 3DL4A 5DTJA 3WL5A 4WY5A 5AM1A 3N0TA 3BXPA 4IQ4A 1BEZA 2YASA 3W9BA 4OD0A 2DQZA 3H2KA 4NVRA 3QPDA 2BUAA 1BCRA 3B12A 4X97A 1THTA 3CCCA 4BAUA 1RP1A 2GBIA 2WLSA 2K2QB 1DQYA 1J2EA 1T2NA 4Y2QA 2GZRA 2DHDA 4OB7A 5ALWA 2XUOA 4F0JA 3ESCA 5K3FA 1T4MA 5T4HA 1MN6A 3H2IA 4PQEA 1C4XA 3AUKA 4N8DA 2GYVA 2PPLA 1CR6A 3HABA 3WL8A 3C87A 5ALQA 3K6KA 4N8SA 1XZHA 5AM2A 3V1NA 3STXA 2ZYSA 1CUCA 2PUHA 3I2HA 3R3ZA 4DNOA 4BE9A 2HU7A 1TCCA 2WJ3A 1THGA 2HU8A 4WDQA 4AO8A 3AZOA 4ZV7A 4UUQA 3KXPA 3V48A 1HDEA 1QIFA 4CG1A 2CUTA 4DMKA 3D0KA 2QKYA 3D2AA 4PO3X 3FYUA 4EBBA 4MEAA 5FP0A 4Y2UA 1VLQA 2FJPA 3STTA 5C81A 2XQGA 2WG1A 3VJLA 3V1LA 1Q83A 1Y7HA 1BRTA 1R1DA 3E1GA 3PFCA 4KRXA 4IO0A 3WJ1A 2XMQA 2WFLA 3WK8A 2ZJ7A 3NGMA 1BN6A 1ZJ5A 1WOMA 5FLKA 1LPSA 1DWQA 1XLUA 5HKBA 4AB1A 1UZAA 4EA6A 4Z49A 4N8EA 2BKLA 4JNCA 4B80A 1IMJA 2V97A 4AQDA 5FXMA 3RKSA 3GA7A 2LIPA 3WK5A 3EBLA 5KWIA 1FFEA 1H2YA 2WM2A 2ES4A 1P0MA 3ILSA 1ZI6A 3V1MA 2QVBA 3QZUA 3H17A 4P92A 1QFSA 1CUUA 1ACJA 4FMPA 2Z3ZA 3WWDA 4KRYA 2WFMA 5AM5A 1XLVA 5JALA 5A6VA 1JKMA 1VXRA 5FOQA 4TPKA 4OB6A 3T4UA 1CUAA 1UOPA 3WYNA 1AGYA 2ZSIA 4HVTA 3QITA 3STWA 1G5FA 4BDSA 4AN0A 2XUPA 2ROQA 1JJFA 1E3QA 1TRHA 5DNUA 1CQWA 4EB0A 2WKWA 2BFNA 4BRSA 5ALJA 4C6HA 1A8QA 1J1IA 2FX5A 2I3DA 4RE5A 2ONCA 5AKYA 4Q3OA 3WK7A 1F0NA 1FSSA 1F8UA 4DMFA 1QIEA 2WIJA 5AI0A 1W52X 3O4GA 3C6YA 5H3HA 4NZZA 4BVLA 5ALLA 1VJ5A 1FFDA 3C8DA 5ALHA 1SOMA 5CH3A 2H7CA 5AIBA 1A88A 1XROA 4CI9A 2CJPA 3HJUA 5CTAA 1E5TA 1YASA 5DNVA 1MAAA 1LBSA 3PF8A 1P0IA 5LZ7A 1OCEA 3HEAA 4ZRDA 3WL7A 1AUOA 2B9VA 1DT3A 4X91A 1TCAA 3D3NA 2O2HA 4CG3A 4V2IA 2GYUA 2PVSA 1XRPA 1LPMA 2OCLA 5AM3A 1IUPA 2O7VA 5AI6A 3WI7A 3EIOA 2DHCA 4QEKA 4HXEB 5DTIA 3FNBA 2DHEA 4DIUA 1GGVA 2JGEA 4UBKA 1HPLA 3M3DA 4X6UA 4UHFA 4U2BA 5ALFA 2EDCA 3B3QA 1C7JA 4B9AA 1CRLA 1GPKA 3WZMA 4L72A 4BAGA 2ACKA 2DCMA 1CPYA 4NS4A 5AI4A 4BP8A 1H23A 3E3AA 4G9GA 2XMRA 2VF2A 2P8SA 5JAOA 3W06A 4EHBA 3FLBA 2WHQA 3UMJA 1CUYA 1CUFA 4GLBA 5KWJA 2PU7A 3GFFA 4QDUA 3BF8A 4H7DA 4Y2XA 1YS1X 4IHAA 4BAZA 1HKHA 3H2HA 3WWCA 5IVDA 3OTQA 3RARA 4FFWA 4Q3KA 2WHRA 4FDMA 1QONA 2OCGA 5E4YA 1IZ7A 1E89A 4DYHA 4ARAA 3G0GA 1I6WA 1X2BA 4QE3A 4H0CA 2BCEA 5AKLA 1QO9A 2PSEA 4A5SA 1JU4A 1NU8A 4Y2JA 2PBLA 1CQZA 2UZ0A 2JF0A 1K8QA 2H9YA 3S8YA 5ALEA 5CURA 5JAPA 3FCXA 1FJ2A 4G8DA 3EQ9A 3LP5A 2XUFA 3U0VA 4FHZA 1FFBA 1SC9A 4BDTA 2OQIA 1VE6A 3DL7A 4NMWA 3W9UA 1A8UA 2WU4A 4BTVA 2CB9A 5K3CA 2V96A 3M83A 4ARBA 2XT0A 4ZGBA 4UFOA 3WK9A 5ALIA 4B82A 4JYPA 2C5FA 3H18A 5CT8A 5AKEA 3ZV7A 5F4ZA 4O08A 1Q0RA 3I6MA 1ZIXA 1BN7A 4GDMA 5ALPA 1BE0A 3WZLA 4FBMA 3BDIA 2H7XA 3X3HA 5AKGA 4UHDA 5I8PA 5ALZA 3BIWA 4Y9SA 2XMSA 3GROA 1GQRA 5AKIA 5CBKA 5EHQA 5FKJA 4FTWA 2EDAA 2HL6A 1DWPA 4KAAA 2OAGA 2G5PA 5AM4A 2VJBA 2PSFA 4OUKX 5AH0A 2ORYA 4KEAA 2H1IA 5AOAA 5A2GA 4PNZA 4I4CA 3VVMA 3KWFA 5D3ZA 2OCIA 2C7BA 5DWDA 3YASA 4QNNA 2W6CX 4UHBA 5AOCA 2Z8ZA 4ROTA 5C8VA 3WKAA 1P0QA 5LZ2A 3F98A 3WA7A 4GECA 3W2TA 2C0PA 3V9AA 2QTBA 1MU0A 3ESBA 2FUKA 2O2GA 1MNAA 5JZ9A 1UKAA 2WUEA 4DNFA 3C6XA 3F8SA 3BDVA 1SFRA 1ORWA 4X00A 4X93A 3QM1A 4W1QA 3W05A 4N5HX 3C45A 4INZA 3IUMA 1O6FA 3IURA 3PF9A 1UK9A 4W1SA 3SX4A 5LZ8A 4H7JA 3R3VA 4E15A 4IH4A 1QTIA 4DNPA 1UT6A 2WHPA 3STYA 5C8XA 4MQMA 2WIGA 2G63A 1CUGA 1MX5A 4U2GA 5A7GA 1XZDA 2C0QA 2WUGA 4Q1VA 1VXOA 2RGUA 3WQHA 1HL7A 2D5LA 1JJIA 1XZFA 3HYSA 4K6HA 1CUDA 3G8YA 4ZI5A 4QLOA 2XUIA 2C5GA 4DLNA 3DCNA 3I2KA 5ALRA 1P0PA 3SWWA 2Q0XA 4UBMA 1U4NA 1C7IA 3KSRA 4UFPA 5JATA 5AJHA 1EVEA 4YX9A 5AI9A 3FSGA 4X90A 3IIIA 4FNMA 1CUEA 4E11A 5K3DA 1LPOA 1LPNA 1L7RA 3DYIA 1ZD5A 1B6GA 1XRNA 1XQVA 5AIAA 1WHTA 3F96A 1YCDA 5HQ3B 4BZWA 1YS2X 4B7ZA 1E66A 3PUHA 4JEIA 4AMYA 5LZ9A 2OGZA 1JFRA 2HA4A 3DEAA 4B9EA 1EXWA 1CUHA 3HC7A 1GQSA 1BCSA 4CG2A 5ALVA 3A2MA 4JUIA 1XQWA 3IA2A 5EFZA 3IUJA 4BB0A 4AO7A 1KU6A 5T4FA 4MYSA 4QWWA 4AMZA 4LYDA 1UK6A 2HA0A 3MUOA 3ESDA 5HK8A 5C7YA 3AILA 2ACEA 2XUKA 5FPPA 2VQ6A 2WQZA 4TVKA 3ZLVA 5CXUA 3IB3A 3OPMA 1CUIA 5FUMA 1QZ3A 1XRRA 2XMCA 4UBJA 2OAEA 3STUA 5DLPA 5IVHA 3G9XA 4G9EA 1UKBA 2ZSHA 1N8SA 3R0VA 3WMRA 3JW8A 4UFNA 4CIBA 3S2ZA 5ALNA 4D9JA 2JIDA 2QXUA 4B84A 2ZYHA 2Z8XA 5AKXA 3SK0A 4CCYB 4Q34A 2V9ZA 1YB7A 1GZ7A 1G4HA 1RYYA 3VXKA 2Y2VA 1XZEA 3I6YA 2QZPA 3FYTA 4BP9A 4G4IA 1HLGA 1DU4A 3DD5A 1EDEA 1BROA 1LPBB 5CT4A 2I03A 3PI6A 5A7HA 4J3JA 7YASA 1ORVA 4YK7A 2QT9A 3IULA 4E14A 3DKRA 1HBJA 1MPXA 2C4HA 5AI8A 2VAXA 4W9RA 5E4JA 1XZLA 4FNGA 5DNWA 1YAHA 2BAGA 4H7FA 4C4ZA 2RI6A 1O6GA 4J0JA 3VJMA 3TEJA 1UXOA 2WG2A 1L7AA 4MXDA 3O0DA 1R50A 1LPAB 1D07A 1R4ZA 1WHSA 1K4YA 1YB6A 4F60A 1YA8A 2WUDA 2WFZA 3FSGD 2XUJA 3EQ8A 5ALTA 3FOBA 3D2CA 1AQLA 2BJHA 2PM8A 3DS8A 1R3DA 2VJCA 1QJ4A 2ZVDA 4QDOA 3HXKA 3R3UA 1DX6A 5FV4A 2OGTA 3QYJA 1TQHA 3FLAA 5K3FB 2CMFA 1JI3A 3VKFA 4RPCA 2WTMA 2ZJFA 5ALMA 2PX6A 4HZGA 3G9TA 1CLEA 1VZ2A 4X95A 3PICA 2RHTA 5JAHA 2I3ZA 2AJDA 3CCBA 1E8NA 5D3KA 3LIPA 2XB6A 4DGQA 2VA9A 1DINA 4HXFB 1ODCA 2XMBA 2G4LA 3QBJA 3OM8A 3NOXA 4B81A 5EIHA 4OU5A 1VOTA 1WCYA 3C70A 4BVKA 1EX9A 2ZYIA 2WIDA 3FYUB 4BE4A 3C43A 4WCVA 2HADA 5AM0A 2WSLA 3DQZA 3AJAA 5DYWA 2QUAA 1DT5A 2XUDA 3C5WP 1QIHA 1U2EA 2HFKA 3I2JA 5AI5A 4UBOA 2C58A 2WU3A 3BF7A 2CBGA 2AJBA 3KD2A 4GHWA 2IIVA 1AMNA 2WFLB 2XE4A 1AZWA 1CUBA 2B20A 4QDZA 1ZIYA 3G0CA 4WJLA 2HA6A 4HAIA 5K3AA 4J0CA 4Q82A 3VISA 4Y2TA 3DDUA 2HHAA 4RGYA 2Z5GA 3FLEA 1MT3A 5EGNA 3BE8A 3MUNA
chains in the Genus database with same CATH superfamily
2I0FA 3HKBB 3MJHA 4K0RA 3BHNA 4PNEA 1JH8A 1WXHA 2CDAA 1VC2A 2AXEA 3EGDA 4KCGA 4TYNA 2VT7A 3WLIA 2YWFA 1RLIA 1OILA 3KEGA 4TN5A 2D1QA 4R2KA 3UPUA 1FVFA 3L6BA 4NBUA 5AW5A 5LYYA 5DX0A 3PUKA 3I9KA 3V4VB 1H2FA 1I3KA 4TMYA 4B75A 2J85A 3E9YA 3IIEA 3LW8A 4G0ZA 4L0MA 5I7SA 4NOJA 1DNPA 4FMDF 3HSSA 4KHZA 4QYWA 2EZ8A 5CT6A 5B55A 3KPJA 2FPIA 1Z8FA 3KEOA 1U0SY 2YXBA 3D59A 1PBNA 3IDAA 3P4YA 4HGOA 4P1ZA 5AKKA 3TGWA 4KP7A 1VKHA 4BKOA 1A98A 3H42B 2ERYA 2R8EA 6Q21A 2FSIA 2P9TA 3CLVA 3PFIA 3TR5A 2IYUA 3ZZ0A 3F73A 2QWXA 1Z6QA 2ZAOA 3QLTA 4TTVA 1RXIA 2A5FA 2OBXA 3WTCA 2IUTA 3QXJA 1D1QA 5EJ8A 2CHEA 5ALGA 5ICSA 1DCMA 1O2DA 5AUOB 5J4KA 4QUGA 1MF7A 4OHXA 4G0UA 2FNAA 1MZPA 1QO7A 1MTOA 1ZU4A 2HA7A 2NQ2C 2WUFA 3P2YA 3PENA 3R3HA 5IAKA 1A5TA 3NHPA 3T1QA 3PWZA 5LNK6 3IEMA 4CEIB 4LSMA 1S5PA 3DEHA 1KEZA 2E6UX 1ID1A 2FN7A 5KVCA 1GU1A 1JG7A 2YWJA 3K0BA 3QE0A 4I2NA 4TZ0A 2AC2A 2WUVA 3W2GA 2I9PA 3RU2A 5C2JB 2IUFA 3NNSA 3EF3A 4V3BA 1RAGA 2JDID 4QRHA 1SGWA 2WIKA 3PQFA 3NG1A 4YVFA 5A62A 4OMUA 3R0XA 3DYBA 1NVFA 1VIDA 1WV0A 3KRTA 4PRZA 1AHPA 1HYHA 4OHBA 3UJ3X 3TPFA 5IZ4A 3T9EA 1Z6AA 2PWPA 1OLXB 3DGFC 3GBSA 3CEJA 3IQFA 3RT1A 2OCAA 4GSKA 4N3BA 2YMMA 2Z09A 4D4JA 1AUQA 1ODSA 3S2SA 1N5JA 5FEUA 2JBAA 1S8NA 4YUWA 1NTOA 3EEBA 4MDHA 2Q2NA 4AJ1A 1ENOA 2HJVA 4GQBA 2V8BA 4M8NE 2G6TA 5H9WA 5HZMA 3PRHA 1JDJA 4AXBA 4RFSB 2W2MA 2QJRA 2A14A 1P2FA 5HPYB 2NXJA 1FMCA 3CH4B 1X1CA 4D1YA 3I92A 3VPXA 2BFDA 2ZRCA 2R1UA 3R5SA 2X4LA 5J58A 3LO5A 3P9SA 4QAQA 3WYFA 3ET5A 1AKMA 3UG6A 4FD3A 1G3RA 4L9WA 2WJ4A 1B41A 4HO1X 5GAJA 1LKZA 2N0SA 4F9EA 1IU9A 4BZPA 2VNIA 3WK6A 2H4JA 4R40A 4XM2A 5JO9A 2AR9A 4C4AA 3E22B 3AFMA 3O82A 3T5MA 2WD9A 3HCNA 3OD1A 2Y77A 1YL5A 2H2IA 2CYBA 2VP6A 4NQZA 1EFVA 4CM7A 2F3RA 4JI0B 1P61B 2YIMA 1AMUA 4HWPA 4MH0R 3CWCA 2IGBA 4PIMA 4PY2A 4W5RA 2WC1A 3KVOA 3WYEA 4JXZA 4BC1A 3K4PA 2OFPA 1L7OA 3PGA1 4X1YA 4ZC1A 2V7XA 4Q9IA 5GINE 4MPDA 3DBRA 3HRIA 1JPNA 1V6CA 1Z38A 3JRXA 3ZWXA 4UMDA 3KYIB 1XD9A 4W9NA 1LTQA 1AKNA 1KSJA 1PJ8A 1TVKA 4ZV4A 3PFBA 3TLCA 1UZNA 5ICFA 1L6IA 3QEMA 1KYZA 5REQB 4BYMA 4DLAA 4US1R 3GRUA 2HB6A 1ZM4A 2E87A 4OG2A 1C1DB 4AUMA 1BX1A 5D6OA 4X24A 4RJIA 3UYLA 2ZJ6A 2W6IA 1E7YA 1SUSA 2Q9BA 2W4MA 3INYA 3IVCA 1R37A 1PG0A 4PG5A 5B1HA 4CIVA 4YUYA 1P9OA 4EJMA 1R0SA 4UU1A 1JEJA 4WZBB 4CF3A 4D5EA 1J2RA 1IH8A 1L8OA 3HR8A 4WIAA 1IJEA 2VTBB 4TV9A 3IEXA 3NH9A 1NDQA 4QUKA 4G26A 1P0CA 1RT9A 1UFRA 3I39X 1UEJA 4K6CA 1J06A 4IXWA 4H1HA 3IHTA 3SJAA 3WR5A 3IQZA 4LXGA 1EIWA 2PU5A 2QL5A 4RTJA 3ONWA 3SYTA 1UBFA 3QU4A 1GG8A 1JPVA 2P1ZA 4DDWA 1S01A 1FP6A 1WRBA 2BF7A 2GA8A 2PZAA 1T5IA 4HWRA 3QYFA 1DX9A 2IEYA 4XVRA 4ER5A 2O5VA 4ZA2A 1ZOIA 2NZJA 1VFNA 3HGQA 6AT1A 2J45A 3I01A 4LJ8A 4GKJB 4KFRA 4MUAA 2Q1WA 4OXQA 1PAUA 5F76A 1WUKS 4GE3A 1ZZEA 4ZVMA 4DRXA 2WHYA 3EVNA 1G8HA 3RAFC 2RHGB 4N3NA 1Z73A 2A1UA 3ABQB 1TZCA 4I19A 5EIAA 3TLJA 3E84A 3V00A 4J91A 1U3TA 4KQMA 4KSCA 3W2EA 3WKEA 4DMHA 5KBYA 5GONB 1GR1A 1X9GA 3CUTA 5CDUA 1ZW6A 3MTGA 1BMFD 3T7DA 1AO3A 5IJZA 5LUAA 4FJ1A 4RPKA 4EX7A 4ENPA 2WP8J 4DKXA 1DXHA 2XI4A 5DM1A 5IULC 3WIUA 2CDNA 1WB9A 1U0NA 3IJ5A 3DMPA 5KSZA 2ASEA 4GZ5A 3U44B 1I33A 4XASA 4G1BA 3GCGA 1ENZA 3PRJA 4MDYA 4OU4A 5JFOA 2R25B 3IA7A 4OGKA 5NULA 4KNVA 3R4CA 3CXRA 1IY2A 4I1IA 4M0FA 4JB0A 3P9XA 4BCBA 4L9AA 3KUXA 2I2DA 4GYYA 4OCZA 2BFMA 4WCDA 4AP5A 3COSA 3GFOA 2PGOA 1ZG3A 3CQ9A 1CT9A 5E9QA 4A8TA 1K86A 5D7NA 3N7TA 4QHYA 2IK8A 1E4EA 3GT0A 3ICOA 3TEMA 3KZNA 4QTUB 5CU7A 3WNBA 4Q4AB 4LC0A 2EKPA 5I4KA 1FU4A 4OHOA 1OB5A 5K3BA 5LB4A 1FBNA 1ZXLA 3GY0A 4OYLA 2F1RA 1GGEA 5KYXB 4U8HA 4FVTA 1RNLA 5B4TA 3G9ZA 4YRTA 1W93A 3SVZA 2EBFX 3KKMA 2Q3EA 3WIDA 3A1WA 2PKWA 2CZGA 1I5RA 3MTQA 4L5CA 3IE0A 1WUYA 4YGYA 4EI7A 3HUUA 4GQIA 2IU6A 1JFFB 2C4KA 4IIDA 3RBVA 4NENB 3RIMA 5FI1B 5JDIC 5FWAA 4ALNA 3B5IA 2B92A 2HHJA 3DVAA 4HJXA 4WK4B 3HM9A 2WWTA 2NZXA 3B53X 2VJMA 3CG4A 5A5GA 2VDVE 4E30A 2AJ8A 8ABPA 5HRCA 1XA0A 4WEOA 4PLPA 1Z4LA 3PKZA 1KXZA 1QKIA 3MA0A 2LDXA 5EXXA 3TL2A 4HDNA 1ILEA 4LF9B 2ZIGA 1HQDA 2D7DA 3RADC 4QWMA 1ZGHA 1CZLA 3SN6A 4V1CB 4H3HB 2BUBA 3O4JA 1N0HA 3ZDXB 4Z1MD 2AMFA 4JBLA 4Q3LA 3EG9A 1FFGA 5JD5A 4G0NA 2Y1FA 1JHDA 2R9VA 1MJ5A 3UHOA 4JA0A 3IMCA 1W96A 1G8FA 3QV2A 3KOUA 4XPIB 2F43B 3GLFE 1PTKA 1XXHA 3S7ZA 1N36B 5IJ0B 4XDGA 5HDBB 4OIMA 2GBGA 5GY7A 3A58B 3DWGA 3FCSB 2PRZA 2ZQYA 1KAQA 4J43A 4IR7A 4A73A 3FI0A 2X3YA 2GJ4A 2QDXA 1HFEL 1MC1A 1ZZGA 5EMKA 5KDLA 5I7HA 5AMXA 2AN1A 3B6KA 4RETA 1Y9ZA 2QTFA 2ZAMA 5JVDB 1Y1LA 4LVCA 1A9OA 4L1KA 4KXVA 2A7QA 1QYVA 1PEDA 2VTVA 4IIVA 4IX9A 3A1CA 1FLDA 3EFBA 5CITA 4XQGA 1R4MA 2IS1A 5FR2A 4IMIB 2WTBA 3Q1KA 2BEWA 4N0PA 3O2NA 1I01A 1VKNA 2NO7A 2Q3BA 1X13A 4IKPA 4ARSA 3HBFA 1O95D 3UBMA 1TK3A 5K3EA 4QOSA 1VKOA 3FZYA 2R6ZA 2D3WA 3BICA 3MWKA 2DWQA 3KAJA 4P7JA 4ZVSA 4LRWA 5C5DA 3GFTA 4GUDA 4MV8A 2Z9DA 3KQTA 1PW7A 3RHZA 4ENUA 1IIRA 5JJ5A 3TJRA 1R0WA 3AJ9A 4L50A 2Y27A 1E1LA 4KPEC 1IULA 5FUWA 5BW8A 5JZMA 4L6IA 1TCVA 4DLPA 1XPUA 4DIFA 4CR8A 2BGRA 2R1ZA 4HDOB 2GASA 4X85A 3BKXA 1Y7LA 3TM5A 1U3GA 4U9HS 1OZFA 2QLFA 4P7BA 3QXHA 2H2AA 3OKCA 4C01A 4EL0A 2G4VA 2XCIA 2V7QA 1P5FA 2EATA 1F9EA 1WUIS 4OFWA 4B7CA 2HHHB 2HTEA 3FPEA 4MAAA 4C88A 4OI0A 4OQNA 3HVIA 2F59A 1YT5A 1RHRA 2QAJA 4MV0A 4DMMA 2FW1A 4ZKDA 2WOOA 5IMSA 3NANA 3CGGA 1M72A 1E58A 2IDKA 3TTWA 4RD2A 4BQFA 3SMVA 5L3SA 4QU0A 3RK4A 5KSWB 1JEYB 4KE8A 2IH5A 1CEXA 3LM8A 2IA5A 3DPSA 3BH0A 2H16A 4OLAA 2AHOA 3FUWA 4G5XA 1F4VA 3JALA 3QXXA 1WB6A 4X1OA 4X92A 2C96A 1EFLA 4FK8A 1WBDA 4RK6A 2OPBA 1NULA 4V0MA 3KQLA 1D1TA 1GLGA 2JCXA 2FW9A 3L46A 4IWXA 2P6PA 3VPBA 4YRZA 4TMTA 1KZYC 1XLWA 2JBWA 4OHFA 3WG9A 2WILA 3E9RA 2WIBA 4U7GA 4DCNA 4IDGA 3NTUA 4WACA 5EXDA 4U6SA 4ZYTA 1UDRA 1JILA 4S35A 4YT8A 1G59A 3DTVD 2ETVA 3TOZA 1K89A 1IDN1 4KXNA 2A78A 1SVMA 4F4IA 3K2IA 4JMLA 2E6KA 1GKKA 1RWMA 3FB4A 1DAMA 3CN7A 3D6NB 3HWSA 3HR4A 3PEVA 3QBTA 3PC4A 1NZJA 4FJ0A 4JC0A 4EY3A 4YCLA 1D4AA 1X7XA 1GPH1 2BHRA 2Z6AA 3N0WA 4X7BA 4Q47A 3ZD8A 4QLAA 4H0FA 4C04A 2AIRA 2DKOA 4R0MA 1GWNA 3BDAA 4U2EA 2AEFA 1V2HE 1NR7A 1R7RA 4C4OA 3ABOB 4TWBA 1RWOA 4GBJA 2JCYA 5HCIA 2M1ZA 4N6OA 1C4KA 1RFGE 2UYOA 3MWDB 3JD1A 3Q0TA 3PNKA 4IQFA 4LYEA 1A4RA 5L53A 1KMCA 1GPBA 1W30A 1HDIA 1C81A 5JECA 1Z17A 2BFFB 3H75A 3EPHA 1F12A 1W581 4INOA 4MYDA 1XN4A 4Q93A 4YP1A 1HM5A 1D1SA 3RLIA 1WPXA 3KL2A 4HX9A 1CR4A 3KSMA 1SHTX 5KWVA 3W5DA 2YHSA 4EGSA 2ATCA 4U9IS 3FTEA 4IVNA 3KKPA 4X6YA 4FJ2A 3VAZA 1N2EA 5I4CA 3OZSA 5EI5A 4C3ZA 2YXEA 1C4WA 3UIEA 2ID4A 5DGHA 3ICEA 4J7AA 5ENZA 5JPIA 4BLPA 3MGKA 3W5VA 2ECOA 1EDDA 3HEMA 2FPLA 4MLDA 1YTUA 3ZLTA 4ZCQA 1IC6A 3CIOA 4OQYA 1U9JA 2V3CC 1Q1BA 1QS0A 2Q07A 3OUZA 4M1MA 3SX2A 2X9NA 3H6GA 1Z4MA 2QTGA 3KVRA 1QF9A 2CWWA 3BJRA 4JENA 3SMQA 4I1VA 3MD0A 3W3AH 4C05A 4YV2A 3NCTA 4EFMA 3A4TA 1F7VA 3NT5A 5AD1A 4Y9RA 4EB3A 1FFCA 1PHPA 3T7KA 3O8CA 1IN8A 1XA4A 2HD4A 3FRIA 2WHPB 2OO3A 4OM7A 1T9KA 3FN4A 1EFTA 2NSHA 3A6JA 3BD9A 1QPBA 4PLYA 2CFRA 1YQEA 3UEOA 1EXVA 4EABA 1Y5IA 4X20A 3U13A 5K4HA 5IANA 2OBFA 3HG7A 1RAIA 1WXGA 1YB5A 3IEIA 4AZVA 5IN4A 1QZXA 2H4ZA 3Q3EA 2IPMA 4CMIA 2PSDA 3I2IA 4CRWB 1E9DA 2EBWA 3LZ6A 4GPIB 2YVAA 1H2ZA 1PNRA 4BMPB 2DE0X 1KY4A 3L6CA 2R44A 3FPFA 1DBPA 3PQ3A 3GFVA 1AURA 1QV9A 2AFHE 1ZMTA 2GFHA 1VDMA 3DZCA 2FSUA 4JKOA 3RTAA 3RVPA 2HPAA 3ZDCA 4DVJA 2W83A 4QOEA 1L1RA 1E4OA 2NU9A 2NXCA 3GCXA 5B37A 5EMNA 4OXIA 4UPDA 1JUDA 3BXXA 3JVEA 1K8XB 5I6DA 2PAFA 1DAPA 4KLZA 5IUJC 5T3YA 1ZH2A 3ESYA 5CA0F 3VU9A 5F98A 2OWDA 2XTJA 1SXHA 5DXJA 4F93B 4MKRA 2CMGA 5HS4A 4M9ZA 1QH8B 2ZBFA 4G8CA 4UHCA 1ZGAA 3UJDA 1M1YE 4RBNA 4DABA 4JVSB 3EVBA 4Y1RA 1ZM7A 1MGOA 2OK7A 5INTA 3BD8A 1T5TA 1XTBA 4XVCA 3C5EA 2X8JB 2F8SA 3IBTA 4C0KA 2DMRA 4ETNA 2I34A 2ZPAA 1ISSA 4PG8A 1SUIA 2JGJA 4CM8B 3HYRA 1NVXQ 1YL6A 1RWNA 3FWZA 2LD4A 4XX0B 4C5CA 4FDLA 4LF4B 3JAKA 1ABBA 2PZFA 1NW6A 2FRDC 5JSZB 3LA8A 3R1IA 3P9CA 2ZJZA 4JJ6A 4F3CA 4PEVA 1U3UA 2VEOA 1TEHA 3FY4A 1GTRA 4L0CA 3H16A 4JQCA 1KQFA 2P35A 1MHPA 5IMBA 1ETHA 1NR5A 3TW4A 1HQKA 3ZV3A 4D45A 4DLRA 2NLOA 5BY2A 1NVKA 2OHJA 3BIOA 1CDOA 1NUAA 3DE0X 3KJFA 1CY8A 3KOZA 1EBFA 1YKSA 3OOHA 3E9CA 4MI3A 3VDXA 2FSHA 3C8MA 3FG9A 4H1UA 4M0EA 2C1XA 3Q8LA 1L6RA 3FOZA 3F9CA 3GGGA 4RV4A 2B37A 4UDXX 1MXFA 5BV1A 4UU0A 2EFJA 1EQAA 3EISA 5BSEA 1AV6A 4H3VA 4PPGA 1T34A 1Z28A 5LXTA 2H5EA 4O3MA 2GGSA 1IB0A 1PGJA 1ZM9A 3MJ4A 5AK3A 3ETHA 4DXDA 1TZ2A 2OBBA 2A0FA 2BHSA 2JVJA 4GRDA 2ZVPX 5E1OA 4YP7A 1YAJA 1ARZA 1RYDA 3LBNA 1RE1A 2ZB3A 3CB2A 4HRXA 2NVUB 5AKZA 4KXFB 1G42A 2YHIB 5CIWA 4PX3A 1QAMA 4FR2A 4IG9A 3UJAA 5FTLA 4LOIA 5C52B 2Z5LA 2H1OA 2RHDA 2OFOA 4DWJA 4IHJA 2H1HA 3VO8A 2FFQA 3N2ZB 4XE5A 1U9IC 2EJBA 4P22A 5D8DA 1H2BA 1J25A 1FX0A 1D0VA 1T1GA 2Y67A 1A69A 3DYVA 2RMKA 5FOVA 3OI7A 1A5BB 1SC1A 1X38A 5ADUS 1KA9H 4ILEA 3S1AB 4D3SA 1EEXB 4GI3A 3E58A 1CVLA 1Z83A 4U2CA 3HA2A 3TJMA 4Y2GA 5KVQA 5FWXB 3GPDG 3I83A 3O2JA 5FOXA 2HFJA 1HT0A 1G66A 1JXOA 1ODKA 1Z3CA 3N59A 5J5AA 5HIAA 1E7RA 1ZRSA 3CLTC 3QUSA 3SYMA 1NLFA 5LD2B 1W6RA 3E1SA 3PDUA 4Y1FA 1DX4A 2DPMA 3B2QA 1UKCA 1NF9A 3FPAA 2NU6A 3HNPA 3O2SB 3V2UA 5A7FA 5B2FA 5J2TB 4AFNA 3I04M 1F9AA 1NVEA 2L17A 3EGIA 5EE1A 4EKEA 3UXYA 5E95A 3KQQA 2YIJA 4BNIA 2ON6A 4PIVA 5KYGA 5F1YA 1PL6A 3DLIA 3N2LA 2NVBA 1BSVA 2BZSA 2PDAA 4XUEA 4D9FA 2WRZA 4WNCA 5IH7A 1RW4A 1JQBA 3QRWA 3ZWWA 3N3BC 4KZKA 4MRVA 2R4UA 4WN9B 5TX7A 2HT6A 1KDYA 5EXTA 4UPEA 2AJCA 2JEZA 2F1JA 2YWDA 2ID7A 2LTAA 2YDYA 3CLHA 3DBHB 4C0LA 3W5BA 1DAKA 1PG2A 3QKIA 2BFCB 1X9HA 4FGZA 4U3JB 4YPVA 1D2AA 2SKCA 5GIPE 3RLFA 1NBEA 1BOFA 1AQYA 4TSFA 3P96A 1RJEA 4REQB 4JEHA 1S3IA 3I4CA 1J8DA 2OZLA 5KYUA 3ISJA 3VO1A 3PQEA 3BSSA 1V16A 3AVQA 3B9PA 1EEHA 5ICCA 2HTFA 1QH0A 3QMVA 2E89A 3BQ9A 5IVIA 4MWOA 5J2UA 1COWD 1VJ1A 1L4UA 3FHCB 3DUFB 1T1SA 3CNNA 3HQ4O 5AXCA 2EIXA 5CPBA 5H16A 4DB4A 4RPHA 4QTXA 4Y2HA 1ECFA 2IYWA 7ABPA 2JEOA 1TKCA 3PPWA 3HVKA 1X8JA 5DFAA 4TLMB 3REQA 3CLRC 4FIZA 3WL6A 2VYQA 1KARA 3C7AA 3QLUC 4EUSA 1QUEA 1E7WA 4QU9A 4QSHA 3T3PB 1IPHA 4HDAA 4AY6A 4C0BA 4FHEA 1J21A 3OKPA 3WA6A 1BS1A 2J6IA 3UJ9A 5JZSA 5H4GA 3VA7A 5JNWA 1VCOA 3QGMA 4LKOA 4TUYB 5B4VA 1NATA 3RRBA 4DM3A 1L7VC 4C7XA 2Q9AA 4GWKA 5DM60 1JPUA 2QIOA 4XD7A 1OI2A 2OGSA 2VDWA 4N65A 3RYFA 4B3HA 3VO2A 3DOHA 1GYPA 2XX3A 3DTYA 5AKHA 4X8OA 5A04A 2AXQA 1FYDA 2H7YA 2LV8A 2W2OA 4Y1GA 2YYSA 4A27A 1EUDA 3AU9A 3CVJA 4JGIA 2WE7A 3WGHA 3BS4A 3QQPA 4WBNB 1WIWA 1E6WA 4ZTBA 5LZ5A 1LV7A 1UBJS 3A3NA 1MAHA 1CSEE 3GUVA 3OZEA 5CH8A 3NUGA 1ZD9A 3RREA 3SJ7A 3I23A 4ZV9A 1KI7A 3WLFA 2ESRA 2Q2WA 5KQSA 5ALKA 2AKAB 5IAAA 5KQMA 2ZSUA 2UAGA 4MTCA 4BMSA 1Q2XA 1EM8A 1E2PA 1O5TA 2P2YA 3G2QA 2NV0A 3INNA 4J94A 4UNPA 4YNBA 3RW9A 3SIRA 5DI3A 4GFDA 4LJ9A 4F4FA 2VJYA 4ZI7A 1K6EA 3RVKA 2NU8A 5AQ1A 1VE7A 3U26A 3ITEA 1F20A 4HRAA 3EDQA 3IIKA 4V0OA 1QH1B 3D6JA 2IHYA 4ZPXA 3BWDD 3KTDA 4E5PA 2ZGVA 2B5VA 4GS5A 4EA8A 1EGMB 2PY6A 3C41J 3WYDA 2AX4A 4KITB 3Q7IA 1G19A 4AKEA 4XDZA 3F71A 4MCIA 1U7OA 2JBHA 1CR2A 4OQMA 4C4XA 4D9CA 4DRYA 1O9BA 1EUCB 5IAOA 4R5MA 2QUBA 4OQFA 3EX7C 3LHSA 3HJTA 1XZGA 1N2BA 2D5IA 2XGMA 3MMPA 3L6RA 3K2EA 4ABTA 2PJRA 4LVNA 3ZHVA 4F86A 4LEIA 2VATA 3CZAA 4EVIA 4X1KB 2Q8QA 5C34B 1U9CA 4LRSB 1C9NA 1XEFA 3C1UA 4UQLA 4D46A 2SBTA 1I6KA 1TJYA 1WU8A 2VOJA 1M2FA 5EUQB 4DPLA 1T6YA 3R7DA 4R84A 2AFIA 1OLSB 1QGED 1C9YA 2J09A 1P72A 3B48A 4KH1A 1YVUA 2MYNA 3ND9A 2NV6A 1YMVA 4MICA 3VKWA 5I7UA 4PX2A 4TKVA 2DR0A 3ETNA 4XFDA 3VGJA 3TRDA 3ADOA 4CMHA 2XMGA 2OHVA 2XCLA 3AEKB 3KKKA 1KI6A 2AGVA 1XQ9A 3MSXA 2O1XA 4QU5A 3W0LB 2O7QA 1LH0A 3EXFA 2G8LA 4D4LA 4HFNA 5EINA 3O83A 2GS9A 3BMCA 1DAIA 1XKTA 5C4GB 4DQKA 3D4OA 1LBQA 5IC6A 4EPRA 1G4AE 4IQGA 1D1PA 2OCKA 2H29A 2V4UA 5H83A 5JI3E 3U1TA 4MJ3A 4Q1EA 1JS1X 1REQB 1QJCA 2J3JA 4DCSA 4I9FA 2VAVA 2QENA 3HYTA 4ZQCB 1AK9A 5H8WA 2Q5FA 3UWKA 1PU2A 4D74A 1JHYA 5IKXA 3PJFA 3C48A 4KQ2A 3FR7A 3ANTA 2WKQA 2YXDA 3P9QA 1PZFA 2W93A 1BDBA 1US8A 4HX2A 2PZJA 1DIAA 2VBCA 5C7LO 2CUNA 3RCBA 3CEHA 1NN3A 3WQQA 1P39A 2G28A 4K9NA 4MWSA 3B3GA 3SFZA 2A1TS 2JJ1A 2PS0A 2QRJA 3GJ0A 3U4DA 1XGKA 4JVLA 5GV8A 2JFYA 2HXSA 1M1NA 4PYIA 4YCAA 1W0JD 3WNZA 5LWHA 3ZOZA 3B5EA 4LC1A 1TU0A 2ZUTA 2L82A 4M7RA 2CXTA 4CR6A 2B21A 1DRWA 2XAAA 3CNHA 2OHHA 3CUSA 3TKLA 4B8YA 3TW6A 1AXEA 6GPBA 3I9V1 3QUCA 3R76A 2I6UA 2D5BA 1JMKC 2JK0A 1TA0A 3H0KA 4I5DA 1AQIA 4IDAA 1IBCA 1GOTA 5FORA 3HU2A 2ZDQA 4ZZ2A 2R7MA 4EP1A 1V8PA 5A3RA 3QPBA 1QE3A 2JFFA 4NMLA 2HHCA 2RGAA 3DLTA 3AG5A 3KK0A 3WJAA 2ZYRA 1U04A 5DBEX 4UAGA 4WINA 5KAPA 3JXEA 5TQ2A 4EX6A 4CEJB 3JPWA 1NJGA 1GT6A 2HXGA 3EZ6A 3R20A 4FFBA 5CW2A 2PUJA 1QLHA 2X2OA 3IOEA 1VJTA 5JU6A 3GJQA 5KYVA 5HZGA 3L8EA 3SEFA 3JYQA 1QYWA 3OIUA 5HF5A 2ZETA 2CC2A 4RA6A 3DM5A 4Q3NA 2XCTB 1J8FA 2AXNA 5LQCA 4CKYA 1MJGA 1U8AA 2C03A 1IM5A 1YQWA 4I4TB 1VHJA 1VA5A 1OX6A 4RD3A 4RDHA 1PFYA 2N9UA 2FZ5A 1Z4IA 2X5JO 2J4CA 4EHNA 1VSQA 2REQB 4ZT7A 1A97A 4UBNA 5CFMA 6REQB 1A9RA 3I28A 4JWTA 3ILYA 3F97A 4TTIA 3PCTA 1YS9A 1OROA 1PL7A 2QN3A 3R41A 4R83A 2I6XA 3KLOA 1AKEA 1XRQA 1QRSA 2JKYA 2AH5A 2P77A 3E4DA 4YXWD 2VT6A 2Q27A 2XRMA 3TBKA 2OQRA 2J48A 3ZNOA 3RGGA 3PDCA 2C0CA 4OO3A 4J90A 1DGQA 2C83A 2ZU6A 5ER6A 1XC7A 1JSRA 1XDDA 2QROA 2WG0A 5F7XA 2VF4X 4KAFA 1M2WA 4M1QA 4F11A 3SVTA 4NKRA 4KREA 2JFGA 3ZKAA 4G5HA 3ZHQA 3HLTA 4GPAA 1O8CA 2XQJA 2GKGA 2PUWA 2ZUBA 5SZKB 3EA4A 4B6PA 3JASA 4N6NA 1P31A 1CQPA 1P81A 3PZRA 3AFHA 5ALDA 1W19A 5FNVB 1K7YA 1YK0A 3Q9LA 1Y6RA 1J0CA 1SKAA 2HU2A 1A7UA 1GLNA 4S3MA 3ZCPA 5J3JA 2PSJA 2BGUA 3ESXA 2IUYA 2PMWB 4E09A 5KJFA 4P3XA 4RMJA 4WDRA 2PXHA 2FWRA 1QIKA 4E2FA 3CVXA 1WUJS 1EK6A 1YJAA 2CVFA 1U6KA 4FMDB 5CXXA 1DJQA 4A0FA 4PCUA 4HLUA 4S1WA 1W0KA 3QU9A 1CUJA 4NAHA 2XE7A 3E15A 3BH7A 3EMBA 3CYFA 4L28A 3UV3A 3FOWA 2B2NA 1VRCA 2BD0A 3DCIA 3FDZB 5B4UA 5JBNA 3ZVNA 2C2YA 3NBMA 1JSCA 2CDRA 1YBVA 2RHWA 4X3CA 2B7CA 3NASA 5LVAA 3MELA 3SNKA 2Q46A 4M83A 4Q05A 1NPYA 5K6AC 3E5HA 4CCSA 4HT3B 4HZIA 4XX1A 3RV4A 1EI9A 4HQOA 3OESA 2D2XA 3CR3C 1M34A 2GYWA 3K9WA 4NJEB 2HIMA 5TR9A 3CEAA 4KWTA 1VE9A 5ELLA 4G5YA 5KHAA 2XD4A 5K8UA 3ADPA 3CSSA 2XDWA 2X2FA 2Q4BA 1H3FA 1HLFA 4HWSA 1M33A 2NU7B 3Q2IA 1ZS9A 1CVRA 4A8JC 1MTZA 4C4RA 1UBRS 4K6KA 1A9ZA 3SHTA 3L8FA 2JLXA 4OOFA 2ZFUA 3G5LA 2V6FA 3HDHA 4CLXA 2FF5A 1WY5A 1SCAA 2ZXFA 3EXHB 2O8FA 3H05A 4G41A 4KE6A 3T7SA 1NVVQ 4QUBA 2RARA 4RGBA 1SQFA 3TB6A 3WL5A 2JG3A 1QMGA 4AZWA 1JE0A 2VQSA 2ZIXB 1CTQA 5IS2A 1CULC 3GLVA 2C1ZA 4IQ4A 2I7XA 2WINI 1P45A 2OUKA 3T3MB 5BN3B 3ODPA 2W58A 4NMXB 3JQ9C 1J5PA 4AU1A 1CJCA 1V2GA 4I6GA 4OD0A 4C20A 1VJRA 2AFHB 4IMJB 4LBZA 1K0FA 4ZVLA 4R31A 3P52A 5GZ1A 4OP3A 1J20A 3H2KA 4GOXA 4GX0A 1M67A 2EVWX 3CH7A 4LZLA 5C32A 1OE0A 4MOWA 1XTZA 2B83A 3HY4A 1Q0LA 5EJ5A 3R77A 1I9CA 1E3WB 1XDBA 1SVWA 2PWYA 1MDBA 1WMFA 2BUAA 5DYGA 4C5AA 3BA1A 4MQUA 3QJ5A 2F1HA 3TVDA 4NK5A 4H6WA 1FQWA 2DWPA 1LK5A 1M1YB 3PWSA 4UUAA 4MHOA 4Q00A 5FYDA 1FLAA 3P9NA 3HN2A 2VLIA 3ASYA 3KSZO 2YHBA 1X8LA 2WLSA 2BKAA 3PRYA 1C30B 4ZODA 5CPFA 2V74B 4F91B 4OX9Y 3RSOA 4B7UA 2NXNA 1UXKA 1Z34A 2O54A 1KY5A 1T2NA 2GZRA 2DHDA 4RV5A 3TYXA 2Z2KA 1PS0A 3GT7A 3OJFA 4NFSA 3SZLA 3PJDA 4OB7A 4NU0A 5A0VA 5KX5A 4WESB 4OA5A 2R96A 2P2SA 1T6ZA 4DR1B 5T4HA 1L5QA 4DQUA 2APJA 1N5OX 1PX0A 4G1UC 3ZW8A 4EMBA 3H2IA 4HSGA 1MO6A 1BW9A 4P4GA 3QWFA 4HFRA 3SC2B 4N8DA 4MHTA 4MMYB 1YFZA 4OUDB 4NOKA 3NHYA 2Q0HA 2Q7DA 1XB2A 1E9RA 3WL8A 4QXQA 5I9BA 5ALQA 5IK2D 2WB4A 2HYDA 4RQTA 2Z95A 3RJ9A 3ZW7A 2RHCA 3EF0A 4Q3AA 1BWQA 2A0KA 5E8JA 4DIEA 5B58C 5LLTA 5B30A 2V0CA 4YRKA 1WMEA 1ML4A 2P9QA 4WA8A 4HH0A 1M75A 2ZYSA 4FGJA 2FW6A 4FSHA 1UIRA 4B87A 1CUCA 3H11B 3I2HA 4FU0A 2JAWA 3EGOA 3PVCA 2VSNA 5F1KA 5H4HA 4FINA 1FDIA 4HDKB 2RHOA 2YY5A 1TCCA 3G8BA 3NH6A 1RBMA 4EI2A 4UCXA 3NXKA 4ZP1A 2WDPA 3HFSA 4F04A 2G9NA 5ILOA 1QU3A 1LC3A 1PNVA 5DASA 1G21B 2HLPA 1P0FA 4AP9A 1ZHHA 4EO7A 3H9CA 2FE4A 3H8SA 4FZ5A 4CFZA 5AFSA 5EWJA 2QVLA 1XTSA 2JLSA 4MJLA 1R6BX 3CT4A 1P62B 1HSZA 1V1MA 3NNNA 3V48A 4LZAA 1VBMA 1NNSA 2PS1A 2P41A 1W8IA 2EXXA 4FUQA 5BOSA 2PUBA 2OV1A 4FYHA 1OKKA 4CG1A 4D92A 2VWPA 1D2GA 1R0YA 3G2JA 3HHPA 1Y3IA 3H5LA 2OG2A 4OSOA 3QKWA 3RVOA 3LXXA 2OXIA 2QQ5A 2ZBVA 3SF8B 4PG6A 4ZHQF 3KTAB 4S1TA 1U2PA 1Y6QA 5FP0A 4PHFA 3DE3X 1GRQA 4KXQA 1G291 2WJGA 2FJPA 1CS4C 5C81A 1ISRA 3UM9A 5JPCA 4WVLA 1RJFA 4WHMA 3WQSB 2DULA 3DDZX 3M4ZA 4I1UA 1GTMA 1Y7HA 521PA 3VSCA 4M0DA 3GWGA 2FETA 4JBHA 1KI2A 2O0JA 2GCEA 2DPHA 4BZXA 2X23A 4K9RA 1H1TA 4NDZA 3JZDA 2WD7A 3M70A 3CSUA 4OK6A 2CNBA 4LFAB 4YUVA 2GEKA 1FA9A 3C3CA 5IH3A 2EOAA 3GGSA 2JNWA 4WW0A 4MRMB 1SJ9A 1Y1TA 2C5AA 3WJ1A 3ZNNA 5BPHA 2C29D 1FDVA 2ZROA 2H06A 3OD5A 1NONA 3CTPA 3TX2A 3VAYA 1OT5A 4Z6KA 3QVJA 1ZJ5A 5FLKA 1N2IA 3IP1A 3DDOA 1DWQA 3W5CA 4JC5A 3GLGE 4B43A 3F6RA 5EXSA 3FCAA 4F56A 1TU3A 1FMTA 3GQVA 3PHIA 4L4XA 1KDZA 3RWOA 1JFTA 1UZAA 3JWIA 1DADA 4HCJA 5BN5A 2UYQA 1OIVA 3QOWA 5G3YA 3BIFA 3FWYA 1T36A 2AR7A 4B80A 5CYPA 2FF7A 3QOXA 1JQJC 1VL6A 1VYUA 1UMDB 2VDPB 1TQ4A 3IPYA 3Q6IA 2C2GA 3Q15C 4K8RB 5ESDA 4YRPA 3TRIA 3M1YA 4YLYA 2FPUA 4RHTA 4FP9A 4D7AA 1ZSNA 3HL0A 4NQRA 1TVEA 1KDTA 1AB6A 3JYOA 4DCJA 3HKBA 2YWEA 4P4NA 3SHVA 5I7RA 1KS2A 3P9YA 4RA9B 1T13A 3ETJA 5ILQA 4EHAA 3VR6H 4LJ6A 3PFFA 7MDHA 2ODWA 1LU9A 2C5BA 5B7PA 1ZBQA 3EG5A 2QVBA 5FBLB 1V3QE 2Y71A 3WL3A 2B7LA 3H4IA 3H17A 4P92A 3IDZA 4DTIA 4B3RB 1CUUA 1ACJA 1KEVA 1SUAA 4WK2B 1P4RA 1SC6A 3L7LA 3UA3A 3T3IA 4O0LA 2CVPA 4HMPA 2UDPA 1LCIA 2WKRA 4H3KB 1AGXA 2GPSA 1S89A 1W5SA 4F3RA 4DLBA 5UKDA 2FP3A 1PX2A 1SQGA 3SFTA 3W3AD 1P4HA 2KJQA 2EP7A 5A6VA 1KDPA 2JH8A 5HE8A 3TVTA 3JQGB 1ORTA 1R5OA 2XYPA 3NI2A 4MQFB 3VKGA 4TPKA 1O95C 1EVYA 1C7FA 5LUBA 3ZCRA 4IGKA 5WRFA 2IZ7A 2A9OA 3OHSX 4B44A 4YRJA 1D2MA 2CL0X 3KT8A 1JKJB 1R6UA 2EF0A 3QUQA 3DO8A 4KGVA 5DYNA 1ZD1A 1P1RA 1RFLA 3E7DA 4HVTA 1MGPA 3WGMA 4CEIA 4I66A 4X1IB 3TCKA 5I45A 1BC5A 1HE4A 4ZCIA 2E5LB 2JJYA 4FQ5A 4KKVA 1G5FA 1L5RA 3KU1A 4LYFA 3S81A 4GGPA 3G1UA 5JCOC 3D7KA 5KNDD 1O96B 5DE3A 4Y6QA 1V5IA 2XNCA 2XUPA 1JAIA 5DKFA 2G5GX 1QR2A 1RR6A 1JR3E 1ESCA 5F7ZA 1BDHA 3FMPB 4ER0A 3FOAA 3QHAA 4KVGA 3LBYA 3AFGA 1N57A 3GJTA 1GZDA 1UH5A 3OY2A 2PCJA 3X0DA 2P6UA 2O0KA 5ALJA 4C0SA 4CODB 4C6HA 1OLXA 1AKQA 3IB6A 3RC7A 4WE3A 4F4JA 3VPSA 1M10A 4JYZA 1N2HA 2FX5A 3ELYA 1ZMRA 3L79A 4INJA 3FCUB 1SQSA 4JGBA 3ZUGA 4BNFA 3FHOA 1X8KA 2F1KA 3HNRA 4RE5A 2WIAA 5H5JA 3MGBA 4ZZIA 3I0NA 4EATA 3R5HA 3VUFA 1IBMB 3LNCA 4ISBA 1EP1B 4A8PA 4EPWA 1FSSA 1XX6A 1Y4UA 3BTVA 4ZQFA 4DUGD 3A1TA 2OZVA 1B8NA 1RWXA 1QIEA 2QN6A 1GFWA 4M9QA 3R7AA 3RD5A 4DXHA 2XBMA 2BDTA 2BSAA 3BRWD 5HSGA 4KHPB 4DB2A 1W29A 4LY9A 2OSVA 1KJWA 4FE7A 2QM7A 2OECA 5K0EA 4CUJA 3LUJA 5JXGA 4ALJA 1DUSA 5ALLA 1VJ5A 2IOFA 1FFDA 3MEQA 2PZKA 5C51B 2P2LA 1E0SA 3D3EA 4KSBA 5CH3A 3B7WA 3FPKA 1OMOA 3IILA 1KOJA 1A88A 2OVFA 2GTIA 3A9TA 5TIIA 3NYWA 5ABPA 1GADO 5CTAA 3OE1A 4J7CA 3RTEA 3J7AC 3WMXA 1GNVA 1PR0A 3E22A 1MRNA 1KO5A 3M49A 3ONDA 4I08A 4OLJA 4QTZA 4RKEA 3Q4GA 4I6JA 4WRRA 5DNVA 5FA8A 5K0SA 1MEEA 1OD6A 3LPDA 1ZWLA 5IM4F 2PCLA 2JGRA 3JQDA 1QQTA 3PF8A 4JN6B 3U80A 1P0IA 3RC8A 1OFHA 3F7TA 4AAYA 4PCLA 3R7WB 3QSYA 2JIBA 3L0BA 2J30A 1SHLA 1OCEA 1QHGA 1WDLA 2ODNA 2Q50A 3CEPB 3HEAA 4LGMA 1UOEA 2FSGA 2B1RA 3WL7A 4EEZA 3UTCA 3HRKA 4H15A 4ILKA 2PH3A 3DSRA 1DT3A 5I5EA 2ZTHA 2IWRA 1TCAA 3D3NA 3L7BA 1J0DA 2FFHA 2FW7A 2P75A 2GYUA 2W7TA 4L8WB 4V38A 3T1HB 3HUDA 5ILGA 3PJRA 3OM1A 2PVSA 2WA1A 1TJNA 1LPMA 3HMKA 5REQA 3VKUA 5AM3A 4EJSB 1KK3A 4MKHA 1I2CA 1C1DA 4BQQA 1TUBB 1JVNA 5T8KC 1UEIA 3PD0A 4J1NA 2I8LA 7GPBA 5A4DA 2DHCA 1NRIA 3PC8A 4DJJA 1F8FA 2I7DA 1K2WA 2J33A 4WZBA 4ZT4A 2OVBA 4QEKA 1MENA 4RTKA 1GA1A 3OX2A 3GD5A 4KPUB 2VTBA 1HA3A 1WF3A 2EU8A 3TZKA 3AF5A 2DHEA 4LECA 2OO7A 4RZQA 4XQEA 2O8EB 2GN2A 1SUPA 5I9NA 3THXB 3M3DA 2JKVA 1DZIA 1RC8A 3AERB 3CZ4A 1OLOA 3MCAA 3R5FA 4IGFA 5LQJA 5ICMA 4ZAZA 3FHTA 5FI5A 2WFAA 1FRZA 4XD2A 5TS3A 3LO8A 1NUUA 2F3PA 1U6IA 2VT3A 5HTKA 3S99A 1AG9A 4B4VA 4GP6A 3HCWA 4UUBA 3WZMA 3P97A 4TKUB 4BXOB 4N9WA 3DEFA 1XRSB 4DR5B 1N2XA 3KQMA 2PANA 5GOZA 1FF9A 4GR4A 1V7QA 1EKXA 5GONA 2YCBA 1H23A 4PO1A 1HH4A 1NVUQ 1U8TA 3O8OB 1JNYA 2DG2A 5EJ2A 1XTKA 1HC7A 1PFVA 5HOQA 3IUYA 4CF5A 1LNZA 2VXCA 4RMGA 2ZJ0A 5L4LA 3U44A 2OCYC 3TTVA 5LMCA 1M76A 5C8YF 5BRNA 3LYLA 1LJUA 2RGBA 4D4MA 1JECA 1UBKS 2YMPA 1D0SA 1TYCA 3FLBA 3G0OA 4CCAA 4EHBA 5AWFC 3KSUA 3ZU3A 2BRUC 1L7XA 5KWJA 1PL0A 2PU7A 1CX9B 3QFRA 5EJAA 4L2IB 2YWBA 3BF8A 5KJ1A 3FDFA 3VOSA 3I5XA 1QO0D 3H2HA 3WWCA 3N7UA 3BWYA 3H2BA 3OPXA 4JP1A 3H5IA 4JU9A 4RMNA 3B78A 3TW8B 1U4OA 3O93A 3ORHA 3H8JA 3W2FA 5A3SA 5KYXA 1QONA 1WXEA 4RDCA 3HDJA 1IZ7A 4YAEA 3HVUA 1C3LA 5C46F 1BGVA 1IXYA 1GTJ1 3ZDBA 3G0HA 2VPIA 3ABIA 2O8BB 5E3HA 1X2BA 1YDGA 4QM6A 2EV9A 4JFRA 2ZCVA 1XMJA 2R1VB 2H7VA 2W2LA 3MC1A 5ER9A 5F2OA 4NENA 3GUHA 1V5GA 1VHTA 1K68A 5EXPA 1NYQA 3DMDA 2UZ0A 3T95A 4LI0A 1HFKA 4Q6BA 1DTSA 5BXQC 4V0RA 1ZNWA 3KUDA 1CEYA 1AKTA 2A59A 2ZZMA 1U7UA 3R9XB 4GI7A 2V03A 1DAGA 2GK6A 1HZJA 3FJOA 5CURA 3C24A 2NOAA 4NZPA 4J6FA 1K0UA 3TDNA 2R47A 5JAPA 2HMWA 1H6CA 2OKGA 2J3HA 5CA0B 5DYIA 3MJSA 8LDHA 1OPXA 3LQ4A 4XGQA 3WHKA 4V1CA 3G5TA 3EQ9A 3LP5A 3RK0A 2GNOA 3SLRA 2DECA 2W4QA 3U0VA 1TVMA 1FFBA 1JIQA 1LBHA 3NAQA 4KKXB 2J32A 4K9KA 5ECYA 5TE9A 2PZ8A 3EK2A 3AXSA 3I6IA 3ICPA 1OAKA 4JJEA 3O4RA 1VBNA 1GUAA 2OQIA 2GM9A 2QZSA 1ZUD1 2HJHA 2FOLA 4JSYA 4XPIA 2F43A 3VC7A 2ENWA 4YMUA 5IJ0A 1IBRA 5I9TA 4IXTA 4FYXA 3DTNA 3ZCXA 1ZN7A 3K73O 4AF7A 1A8UA 4UTPA 4TMKA 5LR6A 3CNOA 1B6RA 1JZSA 4BTVA 2CB9A 5ERXA 1QQBA 4LYAA 1H69A 2ZRKA 1J22A 3UOWA 2VLBA 2CYAA 2JA1A 3LC0A 4ARBA 2J07A 3LLVA 3ZQUA 5EVJA 4ZHSA 5A06A 5JVDA 2HOQA 3NWEA 1ND5A 1FXWF 3DFIA 1GQYA 4UFOA 5IRCD 4CM5A 3AX6A 3BWMA 1QANA 4JYPA 3LCMA 4DILA 5CT8A 3ZV7A 4B5KA 2VQFB 4I2VA 2WPDD 4JJ8A 4MVJI 1BWPA 3N8KA 3OLXA 3URKA 3SEZA 2P62A 3LF1A 1PR2A 3ISTA 1KVRA 5EJ7A 3NKFA 5A1TA 3DO6A 3IIJA 3MJRA 2C8KA 2I76A 1MIOB 2ZU0C 2R65A 3Q9UA 3GLIB 1RYFA 1Q0RA 1RAFA 1ZJZA 2ZRGA 3IOBA 1BN7A 1RVDA 3RFXA 3EW9A 3OMLA 1Y7TA 2RBKA 2TMKA 2NAPA 3DBOB 1X7ZA 3HZRA 3PPIA 4FBMA 4WZ6A 4D8XA 5KMGA 2X42A 1OWPA 1EUQA 2CDBA 3SDBA 3SS9X 4QO8A 5FHQA 4UHJA 5TF4A 1H8EA 4M99A 3PS9A 3MFQA 4W5HA 3IT2A 1BJKA 4R1NA 4R6WA 3DDSA 4UHDA 1E59A 2XJ4A 2ID9A 3D0RA 1Y9JA 2XAUA 3KPWA 5DSTA 1ZM2A 3N76A 1T2FA 4B4DA 2GMWA 2ZWOA 1XL1A 3QLVA 1FRVA 1GSAA 2JFPA 1XCBA 4ZO4A 3TE6A 1WD7A 1RYHA 2Q6OA 4ZK2A 4EDHA 3BZWA 3MYYA 4B47A 1HG0A 3KUKA 2Q28A 1R00A 3CJRA 4IXMA 5CDFE 5IC4A 4MDEA 1IK4A 4AT1A 5HIKA 2WJWA 2EDAA 2Q1XA 1JEYA 4OFBA 1JAYA 1GCUA 3VX3A 3W5UA 1PBTA 2HL6A 3IO5A 4BNGA 1IWBB 1KP2A 3DL2A 5FNZA 5G1NA 4D3XA 2DAPA 4MVJM 1WXFA 4MGZR 2VJBA 3OY7A 5AM4A 1FNNA 4LNAA 4BWFB 4EEKA 5BQFA 2AZDA 2W6PA 4WUTA 2HSEA 2YZ2A 4AJEA 3SKVA 5I48A 3TNJA 3WLJA 5B2EA 3DKIA 1KAGA 3EGEA 2HIGA 1GCAA 1NSTA 3JZMA 3NKVA 3K72B 5U4XA 1JBKA 4TWZA 3L7IA 5A2GA 3ADDA 3WLTA 4CQJA 3BQMB 4CMGA 2B4AA 3VVMA 3C14C 1EVKA 1DELA 1SVUA 2A84A 2CL6X 1DV2A 1FW8A 1JR4A 4JBGA 5KCZA 2DPYA 1IPEA 1LWNA 4UHBA 2P4EA 3D8HA 1CCWA 1U3DA 4MUNA 2X1VA 1AB5A 3EZNA 3EVCA 3FRJA 3LKBA 3NTQA 1CY2A 2ZJAA 3VR1A 3KPVA 1TJPB 5DTQA 3UCFA 3WKAA 1Y5RA 3N07A 1MOPA 1QC5B 4GLLA 5F2NA 4GMDA 1E9VA 1M74A 4IJKA 1WLYA 2XDQB 1KJQA 3WLMA 1KVTA 2JCGA 3W2TA 1TO1E 2C0PA 3V9AA 4LDQA 4ZOLF 1CY0A 2C3OA 3U9TA 1PKXA 4P35A 3T9AA 2DHRA 2O2GA 3O47A 3PEWA 4JLUA 1TEZA 1PJZA 4C7OB 4K3UA 2COUA 5JZ9A 2CUZA 2H2DA 4G4SP 4KIJA 3TN7A 2RH8A 3CBGA 2FQWA 3HDQA 1JHAA 3KG2A 1Z2AA 4R98A 3C6KA 2ZJ5A 3AY0A 3S8EA 3OCVA 4B34A 2CB0A 2FWBA 2ZZKA 2OUIA 1GSOA 3F8SA 2BEUB 9LDTA 1JJAA 3MWLA 4E2YA 4YS6A 2HF7A 4RM3A 1C0KA 1X3LA 4YRSA 5A5EA 3THWB 1TC1A 2AZMA 3RIHA 5KNBD 4RKYA 3AVXA 3O38A 3Q88A 4H4DA 2X2EA 2BR5A 3HXLA 4X00A 2GH1A 4ASUD 1N9KA 4W1QA 3H2YA 2ASVA 1R6VA 1V39A 1JQAA 3K4HA 2P67A 3KHTA 2FZEA 5FA5A 3VR5D 2DEUA 3MJVA 1O6FA 3B8EA 1S4QA 2CL7X 3FGOA 2VSXA 1UK9A 5BNWA 2HUNA 4GYWA 1P5JA 4W1SA 4Q37A 1DQNA 3SX4A 4UTNA 3QFFA 3MAAC 2HV9A 2MMCA 3R3VA 1J2YA 1FL9A 1TYZA 3LQFA 3MINB 3I9FA 4E4YA 1YC2A 3NIGB 4FUTA 4Q39A 4D41A 3L8ZA 4O4HF 5FWNA 2JFUA 1E0AA 1QGAA 1SD1A 1XWIA 1FP1D 2GTHA 4XTRA 3WFJA 4FWTA 5DHRA 2WHPA 4IY1A 4KX3A 3TZ6A 4KFTA 4FI3F 4GWGA 4K9MA 2EL7A 1E69A 1HWYA 4U2GA 5DW3A 1OTYA 2ZLBA 1XZDA 3MWYW 1GPJA 1TJ5A 2BPOA 2XE6A 4MVJG 3F2IA 2I2FA 5DXFA 2CJWB 3PXBA 2YMQA 4FIDA 1EFKA 4D9MA 1NUTA 1EM6A 4CLRB 5KWEA 4S05A 3HYSA 1NPTO 2G07A 2HXYA 2HLNA 2DPLA 4LX0A 1BFDA 1T25A 1ZCZA 1L4GA 4QLOA 1EXNA 4A1OA 2WWFA 3OQIB 4DLNA 2ATEA 1X7GA 2O0HA 4FHCA 1QHHB 1K6XA 3WSWA 2VK1A 2ZUDA 4IGIA 4YP5A 2G1UA 5ALRA 4QGFA 4PICA 1KO1A 3ZWYA 3H5AA 1KRWA 1QH8A 1X7WB 1XTRA 4WXYB 5A05A 1DDGA 5HVNA 1U4NA 3WGIA 1C7IA 4X8LA 3RU3A 1FFYA 1QORA 3KSRA 2X8JA 3HZHA 2QL6A 1ZUHA 3NONA 4R2JA 4BX9A 4UFPA 5BSVA 1EVEA 1D8TA 1SQ5A 5EP1A 5IXYA 1W73A 3C3EA 1JXAA 2GN9A 4R41A 4IZIA 5CLGA 3OCJA 3IIIA 4XX0A 1TYDE 2FPGB 4MV3A 3MOSA 3LJKA 1NN5A 4AIIA 3VDNB 1E2IA 4V0QA 5IEBA 5K3DA 4ZKEA 3UNXA 3U1BA 2HZ7A 1ZMXA 1E1DA 1QCDA 1W25A 1LPOA 1W9HA 3CRVA 4CMAA 1PV4A 3W5AA 3NEJA 1ZD5A 4RYDA 5AESA 1XRNA 5J5CA 2XF8A 3WRYA 4KDEA 1NOKA 5GTDA 3EA0A 4PYNA 2A5YB 1E5VA 1XRJA 5KNLA 4FOOA 1Z4QA 4N41A 2I1VB 3H4TA 3PUHA 4JEIA 2ZRLA 1JL3A 2QJTA 1XWFA 1OXKB 4WOJA 1T9GS 2SKDA 1V7CA 2E7ZA 1X77A 3EIXA 3NT4A 3PYLA 3W2IA 1WQ4A 1X94A 2FLVA 1ULZA 4AUKA 2E4YA 2PMBA 4QPDA 1IK6A 5DSXA 2JLRA 1EXWA 1B0ZA 1G5PA 4Z8YA 3CPSA 5ALVA 5CB0A 2PYIA 3A2MA 5DM2A 3JQAD 4CE6A 3IA2A 1I13A 3ZJ4A 4EG0A 4EUNA 2NVUA 2O2CA 3HB5X 5DCYA 5IT0A 1O77A 1GNSA 2Q5CA 5BSWA 2XNKA 1XP8A 2BKVA 2BP7B 2CHQA 1HDCA 4J9VA 4I4LA 4AO7A 1JV2B 4Y0VA 2QRLA 4RD1A 1KOLA 2D62A 5IYZF 1TMGE 4F8YA 1I94B 3VKHA 3IQDB 1HEYA 1YB4A 2R60A 3S1AA 4UEOA 5FWXA 2QTAA 1GKIA 4JLOA 2JPDA 2HR1A 1YZFA 4P34A 4AMZA 4B4UA 2V6GA 4I7EA 4W7SA 3KM0A 4ZQGA 1MPTA 3HYNA 5C7YA 2B1QA 3GDGA 3E7WA 3FMIA 2IDJA 3JYPA 2YUIA 3LBIA 4BFUA 3EHDA 3G2MA 1UMBB 2Y1DA 1SA0B 3ML1A 1Q1QA 3WGKA 4DY4A 5CXUA 3BEOA 3D0QA 5FO0A 1J90A 3K71B 4GOND 1LFAA 1XLTA 1HEIA 1TD9A 4LRUA 4YECA 1BG6A 3OPYI 5J2TA 1QZ3A 4RPJA 3OBBA 1G17A 1YU9A 3ETCA 5BSHA 2DR2A 4MCHA 2Y0EA 2VUSA 4RF3A 1NI5A 1VJCA 4PZPA 2KLHA 4FDTA 4O5AA 4XR9A 5DLPA 3ENKA 3OJOA 5A9TA 3I37X 4Q6WA 2ZM5A 5IVHA 4OF4A 4UNSA 5KJEA 4DLSA 1EZ1A 2Q3HA 3WRXA 1M7BA 1IN6A 4PFJA 1J1UA 1I4LD 3GDWA 1WPGA 1OHHA 1ZWKA 4WN9A 4F6RB 1U5CA 3BB3A 3VZQA 3PC3A 4QBKA 3T5AA 2JLCA 3DBHA 1NY6A 3CFYA 3U40A 1OBHA 4KWEA 4HGZA 4K6MA 4F9FA 4KRFA 1GNLA 4QHTA 1V5EA 3WLHA 3K0SA 2RJNA 4ALIA 4P4TA 4REQA 5M29A 2W6JD 5HMLA 4JI5B 2V55B 5TQJA 4I1SA 2PS3A 3WC4A 2ZYHA 1K3TA 2C94A 2RGDA 1JA1A 1TC2A 2Z8XA 3DFFA 3W8DA 1PJRA 5DEIA 3PB3A 2ZZNA 1XCGB 3FTFA 1Y8QB 1RYYA 2H92A 4JQSA 2FOIA 1MJFA 1JI0A 3VXKA 2PXCA 3ZHCA 2Y2VA 3A1SA 1GGNA 1XZEA 3DUFA 4P36A 1C8KA 2QZPA 4X7MA 4FONA 1NHGA 3NOOA 2ZUVA 1HDZA 1E6UA 4CM1A 3R5XA 4HPWA 4ARCA 3K32A 3CX3A 1G3MA 4JJ4A 4MB2A 3LVQE 3JQ8B 3P9PA 5AVKA 4FHGA 3I01M 1Y89A 4WZAE 4RZHA 4JS0A 2CXNA 4R3NA 4E88A 1NQ5A 4E1AA 3T3OA 2ZYUX 1M8FA 2QK4A 1X92A 2ZEJA 2G06A 5A7HA 3RTDA 4N39A 4B6SA 1O94A 2EWMA 2XTNA 3DEKA 4GPBA 2W2KB 4TUYA 3T8YA 1LI4A 4J3JA 2TRSB 7YASA 2BJVA 4JR1A 2XCSB 4QDJA 4RVSA 1ORVA 1YGYA 1K98A 5L7TA 4Z3KA 4ISCA 1PJTA 1A7AA 2YJTD 4JLSA 2J46A 2QT9A 3IULA 4YK7A 3KXLA 2I2WA 4FOPA 4QT0A 4OH1A 1HTBA 1E63A 4LI3X 3SSAA 2CL5A 3WMWA 3GUYA 2GN8A 3PXCX 1HBJA 1MPXA 2UYHA 3DLBA 4QVGA 3HPRA 1RQLA 4MVWA 3IRUA 1RQ7A 1BD3A 3HCFA 2QTWB 4BFVA 4LF6B 1T8YA 3Q6NA 4WBNA 3IERA 3FW1A 2HLDA 4DUPA 4GOMD 1E79D 1R5JA 2I22A 2J7KA 3GARA 8OHMA 5CFPA 3EGXB 1XVUA 3A4YA 5I4BA 3HO1A 2WNSA 3KKQA 1L7MA 4RCZA 1BS2A 2H08A 1YAHA 3QXGA 3GK3A 3R8CA 4TTPA 2ZSEA 4BX8A 4LE0A 3ZGOA 4AJJA 4C4ZA 3ANNA 5SY9A 4YDQA 2E5WA 3VR6D 1TECE 1MB4A 3O7MA 2P7HA 4D56A 5A5DA 2PVPA 4M1SA 5AHRA 2PBRA 2PA3A 2I7TA 2LP4Y 2Y3IA 3KCNA 5C7IO 1L7AA 3JYLA 4X61A 4ZCSA 4MXDA 4NABA 1QH1A 1R50A 2H5IA 1PGOA 3B36A 3B6MA 3KLBA 5JUWA 1G3IA 3GJRA 1MG5A 1LPAB 4DIMA 2WJZB 1D07A 1UANA 2HJ9A 3OOJA 2AQIA 4KBGA 4URZR 5F2KA 3VU3A 3EPKA 4MPPA 2QL9A 1EUCA 4EGAA 4F60A 3DE2X 4FYPA 5G4LA 1N2GA 1KJIA 2XUJA 2EJCA 2P11A 3FMOB 4LYJA 4KDFA 4JLDA 1PD0A 4Q21A 1Q7CA 2AE2A 4X1KA 2WJYA 1FSZA 2H1RA 4EG8A 3D2CA 1RBYA 4UE2A 1NT4A 1J1ZA 1JSXA 4IUDS 3OFND 5BP7A 5JNLA 1SR8A 1DG9A 2UXBB 2PM8A 3HA7A 1HYQA 1RACA 2FHSA 3BX1A 3EUWA 1R3DA 5FTMA 4ONEA 2ZVDA 5JWOA 2NZ2A 4HPJB 2BEKA 2HDHA 3HXKA 5FOSA 1EFUA 2QGNA 1PZXA 5FV4A 1OLSA 3U09A 1UZLA 3HB4X 3AY6A 3O7WA 4TYMA 5JCZA 2DQKA 1XNQB 1G98A 3IJRA 4LDPA 1S2DA 3FLAA 2GD2A 5K3FB 1O5IA 3CZPA 3K53A 3IBFA 5FA6A 3FYHA 3LTEA 3U60B 3USES 2JJ2A 2G7ZA 5DRTA 3AEKA 3OEHA 4IRUB 1NNLA 1PJ2A 1UJNA 3DAHA 3RUDA 4QT4A 3L7KA 1Q22A 3W7VA 1TA4A 1IOLA 1XAHA 4UNNA 3UICA 4E12A 1RWBA 4RF5A 3W2HA 3K70D 5FBKA 2JZOA 2X6QA 4X95A 5B7QA 1G2PA 2E85A 3MMNA 1MVLA 3GP5A 3TQRA 5MFPA 3ACBA 4MARA 1SQ6A 1WXXA 1M9NA 4N3AA 5LQSA 1MOQA 1REQA 1E8NA 3MTJA 3NHJA 4PVDA 4RXTA 3DM9B 4FMCF 3T6KA 4GP7A 3WBBA 5GVSA 2O07A 2O3UA 4DAOA 3ZW9A 1O58A 1X0XA 2RKOA 5DX8A 5FPSA 1LJ8A 3KETA 1NUSA 1WP9A 2R5FA 3F6SA 3C4JA 4NS1A 1W1UA 1QDUA 2PGXA 1C7RA 3H5RA 5COAA 4HXFB 2OBMA 3JYNA 2D7JA 2GAJA 3W8EA 4DBVO 1MOZA 3PGJA 4HH1A 1YJ8A 1KTIA 2R4TA 4WGGA 3DMTC 3EPJA 1SCBA 2VKQA 2XMBA 4PONA 1JEEA 3DE7X 4LMAA 2ODPA 3QBJA 2ZJOA 3OM8A 2LNDA 4HR7A 4O8ZA 4QBHA 3T5PA 4PSKA 4B81A 1FQJA 1JQKA 3I0ZA 3QIVA 4XGIA 1N1DA 1O9HA 2BE9A 4P4LA 1BVYF 3IP7A 3K20A 1DO8A 2AWOA 1DC5A 3ITNA 2QQEA 1VOTA 4NG5A 5G4KA 3PHBE 3NHZA 2FEKA 2W71A 2XZLA 3AKDA 4HHEA 3OM0A 1T1JA 2ZYIA 1GXSB 1BU5A 1L4YA 2O23A 3JD3A 4BNKA 2IP4A 2AQHA 4XOUA 4MWGA 1XCJA 5JCXA 4H4CA 2A1TR 2OEPA 4WKOA 3H86A 4CUKA 4ZI2A 2Z58A 1GCGA 4IJUA 5G02A 4WCVA 2XRFA 3PDHA 5C31A 3A6GA 2FFAA 2E48A 1C0PA 3DQZA 4FYMA 4XUDA 4ZHQB 3AVTA 1SCNE 3AJAA 5DYWA 2HQOA 2XUDA 3U37A 3SG0A 1L1QA 2IZ6A 1JR2A 3ZWDA 3AHFA 4CMBA 3OSZA 9GPBA 4M0KA 4LZNA 1X7HA 4CEJA 1EWRA 1A95A 2Z8YM 4H31A 2HFKA 3FUXA 3S2FA 2FZ4A 3GN1A 3CS3A 3RG2A 4FGUA 1VMEA 3F7NA 1K7CA 4KMRA 4W5TA 3NBZC 2F1IA 3MMZA 3PU6A 1GRNA 1GILA 2CBGA 2AJBA 4GHWA 3A6DA 3J80A 2IIVA 1P29A 4X66B 2VPXA 1FUEA 2VVTA 4I4TA 3AMVA 2W9XA 4RY8A 3TVYA 2XOEA 1YVDA 4E2ZA 1AZWA 1CUBA 3G68A 4BKMA 4BLQA 4YQYA 5CEFA 2REQA 2VRWA 6REQA 1O6BA 3DAPA 3G0CA 1HT3A 4I5IA 4KR3A