1R88A

The crystal structure of mycobacterium tuberculosis mpt51 (fbpc1)
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
267
structure length
267
Chain Sequence
AAPYENLMVPSPSMGRDIPVAFLAGGPHAVYLLDAFNAGPDVSNWVTAGNAMNTLAGKGISVVAPAGGAYSMYTNWEQDGSKQWDTFLSAELPDWLAANRGLAPGGHAAVGAAQGGYGAMALAAFHPDRFGFAGSMSGFLYPSNTTTNGAIAAGMQQFGGVDTNGMWGAPQLGRWKWHDPWVHASLLAQNNTRVWVWSPTNPGASDPAAMIGQAAEAMGNSRMFYNQYRSVGGHNGHFDFPASGDNGWGSWAPQLGAMSGDIVGAIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of Mycobacterium tuberculosis MPT51 (FbpC1) defines a new family of non-catalytic alpha/beta hydrolases.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Immune system
molecule keywords MPT51/MPB51 antigen
total genus 89
structure length 267
sequence length 267
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00756 Esterase Putative esterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1r88A00
4H7JA 4LHEA 3GROA 1AGYA 1Q0RA 5E4JA 2WG1A 3CN9A 3QVMA 5ALZA 1FSSA 5LZ7A 2BCEA 4FKBA 3T52A 3C70A 3UUFA 2I03A 2ONCA 3WWOA 3F98A 4KACA 2ZSIA 1THTA 4UBNA 4W9RA 1JU3A 3VVMA 1EB8A 3ESAA 2WIFA 1VA4A 3HI4A 3M82A 4NZZA 1RWQA 4EHBA 5C8XA 2BGRA 5ALSA 4KR0A 5ESRA 3O0DA 2H7CA 4N5IX 3VKFA 2CKMA 2QR5A 4ZREA 4HAIA 3RARA 3STXA 4QWWA 4W1RA 4C88A 2I3ZA 1GQSA 1N5RA 2PX6A 5FRDA 4KE8A 4KAAA 2PSJA 4PW0A 3QPCA 3C45A 4J0JA 4TPKA 4UHFA 5ALFA 1ZOIA 1CUXA 1HKHA 3QBJA 4OSEA 3FLAA 5AKLA 2QOEA 1W1IA 3W2TA 3TJMA 3GBSA 3W04A 2WIJA 5ALHA 4Y2RA 5LYYA 2XUHA 4BCDA 1AURA 2WG2A 4J0IA 4F5ZA 4QA9A 5AKXA 3DL4A 4J03A 5LZ4A 5AI4A 1EB9A 3H2HA 4O08A 3W06A 5CBKA 2XUQA 4LXGA 4OB7A 4WY8A 2XMZA 5EIEA 5AK6A 1TK3A 3QMWA 4MXDA 1ACJA 5K3FA 2AJLI 4FWBA 3WL6A 4QDTA 1C4XA 4DM7A 4PSCA 4B84A 4H35A 2Z3WA 4GBGA 4P92A 4FBLA 2XDWA 4UHHA 2C4HA 3GELA 3H2JA 4DMKA 4MWTA 5T4FA 5KWJA 4NS4A 1IVYA 3F96A 4IO0A 4MEBA 5JAPA 5JALA 3I2GA 1BN6A 4UBMA 4IQ4A 1DWQA 5AKIA 4CFSA 4H18A 4BB0A 1Y7IA 4H7EA 2X5XA 2Z5GA 2CZQA 3IUJA 2WSLA 4HZGA 1XKTA 5K3FB 2HA3A 4UBKA 3MUOA 1MJ5A 5AM0A 2XMBA 4KRXA 5DYYA 1CPYA 1FFAA 4GW3A 3WA7A 1O6FA 5SYNA 1P0PA 1ZD4A 2WU3A 1YAJA 3HRHA 5CURA 5FKJA 4UBJA 1XFDA 4QDUA 4BZZA 5AKJA 4PV7A 5JAUA 3P2MA 3E4DA 5H3HA 2XMSA 4ZV7A 3ILSA 2BFNA 4JUIA 1DX6A 2X76A 4Y2QA 2XQKA 3RM3A 2VJAA 3AJAA 3K2IA 2XMGA 4YK7A 2WHQA 5EFZA 2PSEA 5AIBA 2Z8XA 3HC7A 3JWEA 4AZ3A 3D2CA 2BKLA 2HU8A 5JARA 4ZI5A 4B9EA 3I2FA 3D5EA 1VLQA 2V96A 3QMMA 2AJ8A 1A8SA 2QM0A 5DNUA 1UZAA 3OC0A 3CN7A 2WUDA 3NUZA 5KREA 3O9MA 3RK4A 1W52X 1C7JA 2EDAA 3STVA 2WIDA 2VT7A 3HXKA 4FTWA 1Z68A 1J07A 1CV2A 5BWBA 5EIAA 1G66A 1K4YA 4W1QA 5D3ZA 1Q0ZA 3O9VA 2JF0A 4ZV9A 3G0DA 5AH0A 4E46A 1WPRA 1G42A 5FUMA 3H1BA 2PM8A 5ALIA 2HM7A 4DLNA 4DNPA 3KOOA 1OILA 3U0VA 5DNWA 4XJVA 4UFPA 1QFSA 5J3JA 3CXUA 4HXEB 5LZ5A 2AJCA 2WILA 1AKNA 2OG1A 4EY6A 4W63A 3H2IA 4WFIA 3D0KA 2GBIA 4L0CA 4UFNA 1S8OA 1BROA 3HEAA 4X7BA 1EVQA 4UUQA 3G9TA 2GBFA 2Z8ZA 3H2GA 1IUOA 5JZ9A 4J0DA 2VJBA 4K6HA 2JGMA 5CMLA 3N2ZB 4UPDA 3R3UA 3FBWA 1DT3A 5A71A 3Q8WA 4S0XA 3LS2A 1CUZA 1XLVA 3A6ZA 2PU5A 4GECA 1VOTA 3LCRA 1IUPA 4MYDA 1WB4A 1Q84A 2C5GA 5JATA 4BE9A 4OU5A 2WIGA 1W6RA 1CRLA 2C7BA 4FFVA 1JFRA 5ALVA 3I1IA 2OQIA 1LPBB 1AC5A 4FLMA 1QFMA 1HL7A 4HXGA 3B3QA 2XLCA 3DYVA 2QRUA 3G0GA 3WK6A 3M3DA 1XZEA 4XX1A 3WQHA 2H1IA 2RHTA 1XQYA 4W1PA 5ALOA 3WLAA 5T4HA 5I7UA 4AO7A 2OGTA 4PNZA 4OU4A 2C0PA 3C6YA 4BDSA 3M81A 4K5QA 5ALLA 4AN0A 3DNMA 5FXMA 4G1FA 4QDXA 2YH2A 4C01A 4HXFB 5CT9A 4H7HA 1UT6A 3I6YA 1WPXA 4EBBA 2XQFA 2DQYA 3QPDA 2VQ6A 4FBMA 3IDAA 1LPOA 1WB6A 4X90A 2XQIA 4EA6A 2BJHA 2PKYX 1EDEA 4U2FA 1QTIA 4B9AA 1VE7A 5JIBA 1MPXA 3D7RA 3BDVA 2XMQA 2HU7A 2H9YA 5K3BA 4J0CA 2WUGA 2QUAA 4QLOA 5DWDA 4FLFA 1GPKA 1E89A 5CT8A 5AHXA 4B82A 4N8DA 1UWCA 1UK9A 3B12A 2ORYA 5HCUA 1U8EA 3KSRA 1LPPA 1YCDA 3H1AA 3ZPXA 4ARAA 4AX4A 2OCGA 3QH4A 2Y6UA 3F97A 4UBLA 1CUWA 4JYPA 4LYEA 2QTBA 1ZJ5A 5AM1A 2E3JA 3DKKA 1ZIXA 4UHCA 1XZCA 2IX9A 2W22A 1SCKA 1ODCA 2CUTA 3WK9A 1R50A 3EBLA 1QIHA 4YPVA 1CVLA 3F67A 1ZGCA 2OLEA 5LZ8A 3WIBA 1TIBA 1H2WA 4F60A 3WWCA 3DEAA 4X00A 4AQDA 2K2QB 2XT0A 3KXPA 1XZDA 3AZPA 3VJLA 1A8QA 2VAXA 3DLTA 4ZRDA 1WB5A 2DHDA 1ODTC 4DNOA 3BXPA 5LKAA 4IH4A 3T4UA 3QZUA 4UHBA 3I2KA 4I19A 4G9GA 1VKHA 1IMJA 5ALKA 3UUEA 4L72A 1MX5A 4KAFA 3IUNA 1SC9A 2C58A 5CT6A 1L7RA 4DGQA 3IBTA 5C81A 2XUPA 2AXEA 3D4LA 2ZYRA 5CTAA 2JGEA 3W05A 5AM2A 1K5PA 5DTJA 5HF6A 3EQ9A 2DHCA 4C87A 4B0PA 1VA5A 1W4LA 3DQZA 2WJ4A 3IB3A 1DU4A 3SWWA 1LPAB 2EEPA 1YS1X 4NVRA 1CUEA 4HTAA 5EHNA 1E8DA 2CEKA 5ALYA 5CT4A 3WYNA 3HJUA 4KJXA 3FLEA 4RGYA 3G02A 5K3EA 1BE0A 5AI9A 1Y37A 2HL6A 5EHZA 1UK7A 4TGLA 1EK1A 2XE4A 3WWDA 1U2EA 3R3ZA 5HK8A 4OB6A 2WFMA 4G4GA 4BAZA 5AKKA 5AKZA 4BC0A 4Q3OA 4FLEA 5AKYA 1EXWA 3WA6A 3KDAA 5AI6A 2PSHA 2VTVA 5HF8A 1H2XA 4CIBA 2VT6A 3UMJA 2XUGA 1TCAA 1UKBA 1D07A 5K3DA 5FPPA 4UBOA 5AOAA 4IHAA 2QXTA 3DDUA 2FUKA 4PSDA 5D7BA 5LLSA 3QITA 3DL7A 3OPMA 1I6WA 4Y2YA 2VJDA 1ZI6A 1ZD3A 2WKWA 4HRYA 1AQLA 3FYUC 1ACLA 1YASA 4P08A 1BRTA 2J4CA 1QZ3A 1YS2X 1EA5A 4Q3KA 3NOXA 5CXXA 5KWIA 2Y1KA 1QIFA 1XRMA 3ESCA 4Y9SA 4MWSA 1J1IA 3X3HA 3BIXA 4OYYA 5JD5A 2Q0XA 2PU7A 5EIHA 2XQGA 2PUJA 4KAJA 1DTEA 2WJ6A 5IVDA 1AUOA 3BIWA 1LZLA 4XVCA 5JD4A 1MNAA 2XMDA 3HSSA 4KE9A 1XLWA 4V2IA 4EB0A 5KBYA 3WYDA 4DMHA 2WHRA 3AZQA 2GBCA 1RP1A 4K6KA 5CH5A 4WFKA 4N5HX 1CUJA 3EIOA 4AB1A 3A70A 3HLKA 1X2BA 1E5TA 3I2IA 5K3AA 1MAHA 1MNQA 4X71A 1F8UA 3C6BA 5A7HA 3GA7A 5DNVA 4FHZA 4X6UA 4Z49A 1TCCA 2HA2A 5BWCA 1ORWA 3C43A 1LNSA 3PFCA 4GDMA 1QONA 1C7IA 3S2ZA 4J0KA 3WK4A 1Q83A 1UXOA 1P0IA 3FSGD 4WFJA 4CCYA 3HABA 5T4EA 5JAHA 3JYHA 5HZGA 5JYCA 5CH8A 4UFOA 1BEEA 1ETHA 4GHWA 2J3DA 3RKSA 1JKMA 1GZ7A 1WHSA 4BAGA 2PSFA 4UHDA 1XKLA 4DYHA 1KEZA 3C8HA 2O7VA 3PUHA 3WL8A 2I78A 4BRZA 5BV7A 4QLAA 3WKEA 3AILA 1EHYA 1WCYA 4FNMA 4MJ3A 3M83A 4CI9A 4U2DA 1DX4A 3O4GA 4M0MA 2XLBA 5LIPA 2Y2UA 1T4MA 1XRNA 3ESBA 3GZJA 1IUNA 3ZWQA 1LBTA 1O6GA 1IZ7A 1XROA 3DYIA 2EDCA 4X97A 4B81A 1K63A 2WHPB 1TCBA 3K9BA 2VAVA 3WL5A 4DMFA 4OYLA 2HRRA 1QIGA 4RPCA 5E2IA 2C0QA 2W6CX 3QM1A 5DLPA 4WJLA 4BCCA 1FFCA 3I28A 3VVLA 4PQEA 1NU6A 3IVMA 3C8DA 2XUAA 1DQYA 2VATA 3L1IA 2YXPX 1CFJA 3PFBA 1MT3A 3C5VA 1WOMA 1RYYA 5YASA 3DJYA 2PUHA 4J3JA 3WIOA 3V1MA 5FDFA 3YASA 3G0IA 3BWXA 2IIVA 4C89A 4KE6A 2CJPA 1QLWA 3SX4A 4HS9A 3FYUB 1PJAA 1FFBA 1EVEA 4Q05A 1UK6A 4A23A 2PSDA 1ISPA 2RGUA 4BVJA 5A7FA 2R8BA 2VA9A 5HQ3B 3PE6A 3DS8A 3PI6A 1VE6A 4MEAA 4G4IA 4BVKA 2LIPA 4CG2A 3E0XA 1DWOA 3FOBA 4C4ZA 3W9UA 4DIUA 1JJBA 1BCSA 4OCZA 3R3VA 4G9EA 4JYMA 2HFJA 4BAUA 3SK0A 3VJMA 1GPNA 4H7FA 1GGVA 2ES4A 5AOBA 1XZJA 5ALEA 3ESDA 3IUMA 3I2HA 2XB6A 1CUIA 4DNQA 1X70A 4Q1VA 5IKXA 1CUGA 1AZWA 3B5EA 1EDBA 4Y2VA 1XZLA 4DMCA 1QO7A 2HU5A 5AI0A 5JASA 5AM4A 2V98A 3CCCA 1MAAA 3FCXA 2OAGA 1UOOA 2GZSA 4B7ZA 4B80A 5JZBA 5LP1A 4ARBA 1CR6A 3G9ZA 2Z3ZA 1JU4A 4BVLA 1E8MA 4DTCA 5F4ZA 1QGED 2HA0A 3OG9A 1AMNA 1QIEA 1TRHA 4XWGA 2ZSHA 2O2GA 2D5LA 4FOLA 4E14A 5CRIA 4F21A 3F9CA 4E11A 1JJFA 5FP0A 4BTVA 1EH5A 1JJIA 3WL7A 3CCBA 1J06A 3BF8A 3R41A 3PDCA 4AN1A 4G8DA 1N1MA 2XUOA 5HKBA 2WFLA 4QNNA 2NW6A 1R9MA 4Y7DA 2HA4A 4J7AA 3FCYA 2G63A 2ZJFA 2WFLB 4AO6A 4BP9A 5A7GA 5E4TA 4BZWA 4C4YA 4I4CA 4F0JA 1GKLA 5D6OA 1EINA 2JBWA 5FLKA 1XQWA 2VEOA 1KU0A 2X8BA 2OCLA 3AUKA 1HLGA 3LP5A 3O4HA 2VJCA 2ZYSA 4EY8A 4H77A 5IVHA 5FPQA 4GEGA 4H7IA 1J2EA 4Q34A 2QKYA 5AP9A 3GFFA 1USWA 4P93A 1H2YA 2FJ0A 3W9BA 5LZ9A 3F8SA 5ALUA 1DINA 3WK5A 1BEZA 2ZVDA 5LKRA 3L1JA 3HACA 4FMPA 4ROTA 3KWFA 3ZI7A 3EF3A 4PF1A 4ZWNA 2QT9A 2V97A 2QUBA 3PF9A 1ZJ4A 2O7RA 1NX9A 3AINA 5K5EA 2O2HA 3DCNA 3WJ2A 3KD2A 4K2AA 1MU0A 2OCKA 2JGIA 2YASA 4P9NA 1CLEA 2FX5A 4U2EA 4KYVA 5K3CA 1EK2A 2XMRA 1CUFA 3RLIA 3WMRA 3FAKA 4XIIA 4X93A 1LGYA 1YAHA 1K6EA 1XRLA 5AO9A 1ZI8A 4IH1A 2JGLA 5HFNA 1MX1A 4PSUA 1F0NA 2XUDA 3PF8A 1N8SA 2JIDA 1JMYA 3IUQA 1XQXA 4Y2PA 1VZ2A 3STWA 2GYVA 5C7YA 3C6XA 3TGLA 3A2MA 2HA5A 4LXHA 5HQ3A 4X3CA 4H0CA 1IZ8A 3DD5A 2PPLA 5ALQA 4Y2UA 2HIHA 2OAEA 2WUEA 4AMZA 2IITA 3FYTA 3H18A 1L7AA 1JT2A 2RHWA 4GLBA 4U2BA 3FYUA 3MUNA 1ZICA 4LKOA 1F6WA 1VXRA 2WLSA 4J0GA 4OD0A 1M33A 3WK7A 5ALPA 1E8NA 5JD6A 1VXOA 1XZFA 5EHQA 4HRXA 5ALTA 3VXKA 3IIIA 4A16A 1XZHA 2QS9A 2ZYHA 4M0EA 3MGAA 4JEIA 1AX9A 2C5FA 5IH7A 2DR0A 2WTNA 3E3AA 3R0VA 4RE6A 3R40A 5I8PA 2H7XA 1CUVA 2OXEA 1PFQA 3STYA 2DFPA 4CG3A 4KRYA 3V1LA 5JANA 3U1TA 1NU8A 1XRRA 5AKHA 2XUIA 2WHPA 4BYMA 1QTRA 3H0CA 3WKDA 3FSGA 1QIMA 1CQZA 4D9JA 5DYTA 5HFAA 5C8VA 4ETWA 4M0FA 1TAHA 1HPLA 2QJRA 1LPSA 3E1GA 2QVBA 5AJHA 4RE5A 5A6VA 4L9AA 3QMVA 5AIAA 3R3WA 1YA4A 2VSQA 1CUDA 4NMWA 2JEZA 1R88A 4I3FA 3AFIA 1QIDA 1HDEA 1SCQA 2JGFA 1CUHA 1WM1A 2OGZA 5ISMA 3G9UA 3OTQA 2V9ZA 3IULA 1CUYA 3PUIA 1L7QA 1CUUA 2D0DA 2J3QA 3ZLUA 2DQZA 1P0MA 4BDTA 3PICA 3I6MA 1W76A 2GBGA 5AICA 1QOZA 4MQMA 4Q3LA 4CIAA 3STUA 3ED1A 5AK5A 3WWPA 4CCYB 2O2IA 2XI4A 2DCMA 1MTZA 2WG0A 1QIKA 2CB9A 1GPLA 1HQDA 1X2EA 5E4YA 3N0TA 4UHEA 3MVEA 1XZGA 2CMFA 2P8SA 4QDOA 3AZOA 4HVTA 2B9VA 2BUCA 4X94A 4JNCA 3EQ8A 1ZI9A 4WCVA 1VJ5A 3FLBA 4X91A 3BJRA 5AKEA 3ZLVA 4EY4A 4X6YA 4EZIA 5ALXA 5FOQA 2YYSA 4BC1A 4N8SA 5BOVA 5HKAA 1B6GA 1ORVA 4QE3A 1CQWA 3LIPA 5A62A 2Y2VA 5IVKA 1BS9A 2ZJ6A 1UFOA 4QWMA 2RAUA 1FFEA 2DHEA 4AMYA 4BE4A 1G4HA 1UKAA 3VDXA 4LIPD 2HADA 3NGMA 4TVKA 5JZSA 2H7YA 4MYSA 4PO3X 3S8YA 4X92A 2R11A 4H7KA 3I6ZA 1XZMA 5ALMA 1EDDA 5ALDA 2J4FA 4AZ0A 4QDZA 1UOPA 5ALJA 1EI9A 3ICVA 1Y7HA 3C5WP 2B20A 1MX9A 2JGKA 1DQZA 4FDMA 4G8BA 4BBZA 3C6ZA 1EX9A 2CBGA 5A2GA 1GKKA 4E15A 4EUSA 2AJBA 3AIOA 5DTIA 1CIJA 2HA6A 2WU4A 4DSAA 3AIMA 4K6GA 2GZRA 3O95A 5AM3A 2ACEA 1A88A 5EGNA 2WIKA 1UK8A 2XUFA 1XRQA 5CT5A 3AIKA 2GYWA 1E66A 1GXSA 4A5SA 5LZ2A 1YA8A 3L1HA 3OOSA 1R4ZA 5FV4A 4OPMA 2BAGA 1QE3A 1GT6A 5ALRA 3H19A 1BCRA 2WUFA 3WKCA 4RNCA 2G5TA 4CCWA 3BDIA 3BJMA 2QJWA 3D2AA 3C87A 4BP8A 1YSCA 2XQJA 1CUSA 3I1YA 3EQ7A 4WDQA 3A2NA 2UZ0A 1MN6A 1MO2A 2AJDA 1H23A 6YASA 4AXBA 4L3WA 2FJPA 4G8CA 5AK3A 5CW2A 4Y2TA 4AO8A 3I2JA 1TQHA 1CUCA 1ZGBA 4GXNA 1VZ3A 1PV1A 1XZKA 4WY5A 4DNFA 2WQZA 2GYUA 4KEAA 1LLFA 5ALNA 3G7NA 1H22A 1ODSA 2QZPA 3ANTA 1HBJA 1U65A 2WM2A 3OURA 3TEJA 4Q82A 1H2ZA 2ROQA 4ZXFA 1DT5A 3LIIA 2B4KA 1YB7A 4IH9A 7YASA 4U2CA 2Y6VA 1FFDA 5HF5A 4C4XA 4EY5A 3H2KA 1R3DA 3R3XA 4JH0A 1FJ2A 5ALGA 3IURA 1ZD2P 3QYJA 2BUBA 3NWOA 3V48A 3G0CA 4MQLA 1QO9A 1WHTA 1N5MA 5AI5A 4H7DA 5I9IA 2OPHA 1QIJA 4B0OA 1JI3A 1CEXA 3D3NA 3K6KA 2HFKA 4W1SA 1R9NA 4Y2JA 4UBIA 3IA2A 1QJ4A 4CG1A 2ACKA 3WI7A 4ITVA 4C6HA 5DJ5A 1E3QA 2OCIA 5AKGA 4X85A 1CUAA 3DOIA 5HF9A 2PBLA 3G9XA 1A7UA 3OM8A 3FNBA 4BTLA 3G8YA 5JADA 5JAOA 1LPNA 5AI8A 1XLUA 3STTA 5D3KA 1DWPA 1CUBA 1YB6A 3VJKA 1SFRA 3D59A 3V1KA 4YASA 1W75A 3H04A 2XMCA 1ZIYA 4BATA 2ZJ7A 5T4BA 2OQVA 2ECFA 2QMQA 1JMKC 2XUKA 1OCEA 2QXUA 4X6XA 4BRSA 5CXUA 4FFWA 5IVIA 2B61A 2XUJA 1XZBA 3Q0TA 4QZVA 5HK9A 1BN7A 1U4NA 3WWEA 5AK4A 1R1DA 1QIIA 1XQVA 2HA7A 3QPAA 3O4JA 1XZAA 2RIPA 3BF7A 1YR2A 3WZMA 2G5PA 1T2NA 4N8EA 4Y2SA 1XZIA 3V9AA 1XRPA 2WFZA 4G5XA 3HYSA 3R3YA 5DYWA 1G5FA 3ANSA 3TRDA 4ZGBA 1THGA 2RONA 3ZV7A 4Y2XA 3DKRA 2HRQA 3KWJA 4LXIA 3LLCA 5ALWA 1GQRA 1B41A 1OXMA 4G4JA 1P0QA 4QEKA 2WTMA 2OGSA 3WZLA 4GI1A 5SYMA 3V1NA 2JGJA 1A8UA 1SOMA 4GWLA 1K8QA 3HZOA 2RI6A 3SC2A 4INZA 4FNGA 3WJ1A 4B85A 1BU8A 2G4LA 2HHAA 1F0PA 3G0BA 2HDWA 3VISA 5C8ZA 3D2BA 2ZYIA 4LYDA 1KU6A 3FVRA 4X95A 2PVSA 5AM5A 1ZD5A 3A2LA 4B6GA 1SCIA 3WKBA 2PL5A 4U2GA 3O4IA 4B83A 4BCBA 3FVTA 1LBSA 3BL8A 3H17A 4OUKX 1UKCA 4OB8A 3ZLTA 2JEYA 3WK8A 1LPMA 3JW8A 5EI5A 2BGNA 4YX9A 4KE7A 4WDRA 4EY7A 2WJ3A 3DOHA 3BE8A 3GUUA 2I3DA 5CH3A 5AOCA 2BUAA 3FWHA 5EHXA 2DSNA 4DSZA 2VF2A 3ICWA 1LZKA 3WKAA 1UOQA 1TKRA 4J0HA
chains in the Genus database with same CATH superfamily
4FYIA 4JJIA 1Y6GA 4RJ2A 4RQBA 2DR3A 4EW2A 4OGLA 5FAKA 1S7GA 4DIBA 5EIWA 2IYFA 4LF6B 4QYTA 1NXWA 3GPBA 1PKEA 3AL3A 3T3MB 2JIRA 3EF1A 4EJ6A 3ZJTA 3M6FA 2YWJA 3FZQA 4KDEA 3D3QA 4MUMA 1E1RA 3ETEA 3PXEA 1CRPA 3DG9A 2WBLC 5LZ7A 2H2GA 1YONA 1I10A 3OU7A 1U28A 4B73A 4YXWD 3VNUA 3ZGVA 4JY7A 4WBNA 1QP7A 3WWOA 4B2PA 1V25A 5A5FA 3SDBA 1WS6A 1ORRA 1ZX1A 2F3TA 4KACA 2ZSIA 5DIZA 1WXGA 4PANA 1JU3A 5CEFA 1ZBQA 3V7YA 4ND8A 2JIBA 3LOUA 4B4OA 4DJFC 1VA4A 1AQIA 3R7AA 5KKNB 5C8XA 4Q4DA 3EGEA 4EF6A 1D4ZA 4UKDA 4IIBA 3WHPA 4ZAGA 5ESRA 5EJ9A 3GLGE 2L19A 3HB5X 1ADGA 1EM8A 2X5JO 3FSJX 1RXEA 4N5IX 3JVVA 5K20A 1E3SA 2GPYA 4TWZA 2NVUA 2B7CA 1JH8A 2CLSA 1R6BX 4XZ3A 3QFSA 4W1RA 3JQAD 4JUDX 4JYAB 2GCPA 3T99A 3W79A 1Q1QA 2GXUA 5IZCA 1CG6A 1Q7BA 1XDUA 2ZROA 1U7ZA 4XR9A 2XNKA 3HADA 3UAOA 1Q1BA 3C41J 1KH3A 4Y9TA 4RADA 2WF7A 2HNKA 2WMOB 1G3UA 3CX3A 5CDGA 2PSJA 1T8SA 2AZ4A 2GPNA 1YJAA 3SKYA 5DULA 2R6R1 4R8KA 4TPKA 5ALFA 4TV8B 4AZ3B 1FLNA 5IANA 1JX6A 3R3HA 1YZTA 1BHO1 5ESWA 1IN8A 1N6KA 1PL8A 2A59A 2HQOA 1AQYA 4IF6A 4O2BB 3DULA 4OSPA 1JHMA 5BOSA 1S2GA 1UXGA 4JSRA 3HJFA 1E9DA 2GDJA 3D6VA 4NOMA 5B1DA 1RC1A 3HKCA 1B8PA 2BTQA 5B37A 2A1UA 3TJMA 2P7HA 1KQ3A 5ALHA 2PD6A 4JVLA 1GUDA 2IS4A 4RTMA 4EDFA 2WINI 1NLUA 3R6GA 1AURA 2WG2A 3HXPA 4XUDA 1L1RA 1XF1A 3WGTA 2AL7A 5F7XA 3IP1A 5AKXA 3DL4A 5L3VA 4WZAB 1I9CA 1R66A 5EERA 3WL4A 4C06A 5JCZA 1JLRA 4YQZA 1SUIA 3PNVA 2VUSA 3I0NA 4MV6A 2YZ2A 4YRJA 2WWVD 3VPSA 4IV0A 1FUKA 1U2QA 3S2EA 1Z28A 4NOJA 1N0UA 1NVXQ 5H81A 1FA9A 1P2SA 1U2DA 3MJDA 3TEFA 1HNZB 1CB0A 1TK9A 1AZTA 1OT3A 1VJ1A 2DECA 1M2GA 2PUTA 3EZLA 4BASA 4AKGA 4BFLA 3O8CA 3H2HA 2BZ0A 3I30X 5BUZA 2ZUEA 2H5JA 1IY8A 2PR2A 3T7JA 2IZZA 2X9VA 2FFHA 2OM2A 2XUQA 1MRZA 2YWBA 3AW8A 3IQHX 1DEAA 1ODKA 2YWFA 4QASA 2OO5A 4WY8A 4DCMA 5I7EA 3K15A 1GUAA 2DPYA 1TK3A 2W37A 3SHTA 1FDOA 3T9AA 1ACJA 1QOPB 3U4CA 1V9LA 4MI1A 1G38A 5JZOA 4GU5A 1CDZA 3U3ZA 3A25A 1X80B 1DEKA 4L8YA 4QDTA 4DCSA 5B7PA 1KERA 5J59A 3M7IA 4XKJA 4AECA 5AJWA 5IAEA 1X13A 5J23A 2ZWVA 1C7RA 1JA1A 3A31A 3CPHA 4PSCA 4EA8A 5L3SB 4H35A 3SX2A 1RKBA 1NP6A 1E1KA 1RCFA 2P78A 4S1WA 4QDKA 4Y0AA 5DN6A 4NHOA 1J39A 4UHHA 4DR2B 3ND5A 1PT5A 1Z12A 2B8NA 1U3UA 3G2JA 3L93A 3OPYB 2QP3A 4MRVA 4Q4LA 4B8ZA 3ICQB 3H4VA 4M3NA 3NYQA 3JR7A 5K8LA 5BR8B 4DV2B 4NS4A 2GPWA 3FWZA 1H8HA 5DZSA 3HA3A 3OEHA 1B2LA 4IO0A 4EMUA 1XMJA 4MDEA 3R74A 1M10A 3WLMA 5ES3A 2AOWA 2IPNA 4QPCA 4HNUA 2GN9A 3BX1A 5IWCA 1OB5A 1L5SA 2IYOA 1N1EA 4IQ4A 2XNHA 3IBYA 2WQ7A 3VNBA 3HSKA 4DQKA 4LBZA 5L7TA 2GZ1A 2JDID 1EYZA 4R1MA 2GPAA 2QNIA 4MB6A 2X5XA 4YLEA 5EKUA 3C97A 3ASVA 2Z5GA 3MF4A 4U3JA 3P19A 5BW6B 2Q5CA 4JUAA 1H6DA 1DSSG 1BMFA 1FRVA 1J1ZA 2Q3HA 1D3AA 3DGEC 3NIGB 2IHNA 3MUOA 1RI5A 1EFHA 1MBZA 3EN0A 4DYDA 2GM4A 3OQNA 2N9UA 1TVEA 1VRWA 1C14A 3IXLA 5BW8A 2RKWA 3HS3A 1DWUA 3DV9A 3ESQA 3LZCA 3EVAA 1FLDA 4JP2A 2ZJAA 5IJ0B 5KDDA 1FE8A 2D62A 4GO1A 2IBSA 1RBYA 3FMFA 3IELA 1M2EA 1FS4A 5CFNA 1F6BA 2OA0A 3O73A 3GZNA 2PN1A 2D6FA 4QPJC 1I1HA 1WXXA 2H1LA 2HBYA 3HJGA 3HMQA 4MUBA 4MHSA 1IQPA 4U7GA 4XQ9A 4NCKA 2G0NA 5HRAA 2OMKA 2OBFA 4UBJA 3RUFA 1XFDA 3IPXA 4H1WA 4DXAA 1XMQB 1FDTA 4O8CA 2QYSA 3LT4A 3DB2A 3TTYA 5H3HA 5GIOE 1J9ZA 2PIAA 2XMSA 4WZAA 1YBAA 4GZ3A 5ICCA 3D0RA 3QWIA 1ZGZA 5AWFC 1L8AA 3NANA 5B7NA 4UXHA 4LE0A 2BMEA 3U4IA 3FY4A 4A8JA 3CRNA 4RANA 2G1PA 1PJCA 1J33A 2XF2A 1VE1A 2XQKA 1A5ZA 3JWJA 4FFMA 1CJUC 3AX6A 4FQ8A 5BRNA 2QL7A 4Q3DA 1T5IA 1QDUA 2I6XA 4CCAA 4CTNA 3M6UA 3LHKA 5GAJA 2WF5A 3FSEA 3IP3A 3QVOA 3AP1A 3ZQJA 4EYGA 5JCXA 1H2HA 4JJFA 2RKBA 3WRWA 2I8AA 2IFTA 4RSGA 4TV8A 2BY4A 1WCIA 1BG6A 1GU1A 4YMTA 2VQ3A 4O3FA 3D7MA 1OYVA 2AX3A 2GRAA 4HB3A 4ZI5A 3I2FA 2CVHA 3ZWBA 4J0EA 3BK1A 4Z86A 1L5YA 1L4NA 1VLQA 2W8BB 3CWZA 3MNFA 4C5BA 4YUWA 2CT8A 4F3TA 3W78A 1L1FA 1XPRA 2VHXA 4ZCRA 2FN4A 3B6IA 1TL7C 4PG6A 2DF8A 4RVSA 3PFKA 2YJ5A 2GHTA 2XT9A 1II9A 4GGPA 1UZAA 3UENA 1Y4DE 1KORA 2WUDA 4Q66C 5A3JA 3MT7A 5H8WA 1GYRA 2WP0A 2J85A 2AEEA 3MJFA 5LQNA 1LSJA 1VJTA 1V71A 1C7JA 3PPIA 1NXVA 3PT9A 1QGUA 1NONA 3E5MA 4EB6B 3H99A 5EJ2A 2EDAA 1EM8B 4NESA 2AN9A 3DMHA 1NBMA 3NNNA 3PFNA 2QEQA 4P7BA 3BCHA 3Q1KA 1NJGA 2O6LA 2VT7A 2WIDA 3HXKA 2GJ4A 4C0AC 4OQDA 2G1KA 4K9KA 4XM2A 4BNXA 2G72A 4R2JA 1M66A 1LVGA 1NURA 2QPTA 3AUTA 4D57A 2VXYA 1CV2A 1IH8A 3IPAA 4MH0R 1GRVA 1KK2A 3DW1X 3THYB 2Q45A 4MAAA 2Z2XA 4W1QA 2RGEA 3OWOA 1NW7A 2YOHA 2ZYVX 1Q0ZA 4FMCF 4O0LA 3GLUA 3MXOA 2ZRCA 2FLKA 3N1UA 4BO6A 5KVSA 2H0AA 1F4PA 2JIOA 2OOKA 3KUXA 1OA1A 2QE7A 4RIHA 5AH0A 3A9VA 4GPIB 1NBOA 1U8FO 4TXNA 3CO5A 2R6ZA 1C1YA 3LRTA 3NHJA 4F11A 3FPAA 1Z0JA 2FUG1 2NZYA 3H1BA 1NMSA 1YS6A 1RW4A 1XJCA 2FWJA 2HM7A 4H0FA 4HN4B 1M9NA 3QVTA 1VYHA 3ZDXB 2BGJA 4MKZA 3V7WA 3LZ6A 3K1YA 1QK4A 3JQCA 1UC5B 2EJCA 2FMXA 2GLUA 4A3SA 1UODA 5FHRA 1K8YB 1OILA 2NZVG 2OSVA 3AUFA 1CIPA 5L40A 4EUEA 3DZGA 1IJFA 5DXFA 4U7DA 1W9MA 5LZ5A 3EWAA 3EVDA 3OX1A 1DXYA 1E7QA 3LP8A 1I1NA 2G7MC 1AKNA 3K9LA 1O95D 3ES9A 3O92A 4RF3A 3W77A 3SF8B 2HHJA 4Z7JA 1EQAA 1H0RA 3E3LA 4W63A 1T1JA 2PQ2A 3PI7A 4OL9A 3HKDA 3R0JA 5FLEX 3D0KA 3Q5GA 3V97A 4D6XA 1S8OA 3OJXA 1HI9A 3QUTA 2J6BA 5DNEA 3P9ZA 3HGQA 4X7PA 1RRFA 1TO1E 3EQZA 2FDRA 1E9FA 4UHJA 4RD2A 1F4VA 1K4MA 1SKQA 2QDKA 1IJEA 4HGQA 4HLNA 1O94C 2WKRA 4J0DA 1XEWX 5BSRA 4RKRA 3I45A 2EG9A 4TWRA 4QO8A 3HFSA 3PPYA 4IZ6A 4K6HA 4ZOCA 5KO2A 3U3DA 2JGMA 1LI5A 4CU2A 1J5EB 1NPTO 1BQEA 3GJ8A 4LXQA 2P4HX 3L7IA 5B4TA 2CFSA 1HQCA 1B8NA 2IP4A 4HCJA 4CMAA 3Q0EA 4BQNA 1MZPA 4C6SA 2HT6A 2E49A 2FF7A 3LCVB 5EPEA 1P4AA 5DHQA 4EHKA 1FMTA 3Q8WA 3AEUA 4R84A 1EX7A 1U9CA 2H7VA 3GRAA 3LS2A 5JAIA 1OWNA 3K0KA 3VSDA 4AICA 2BSAA 2AW3A 2ZYGA 4R8VA 3V8VA 1D7OA 1E1CB 1M7HA 2I65A 3A6ZA 2DMRA 3K5IA 1ZN9A 4DS3A 1LI7A 5KQMA 4HO1X 4JC5A 3E5NA 4BN5A 2CVPA 5T57A 1KJZA 2AR0A 5HZKA 1PZGA 2ST1A 4ZOAA 2Z58A 1VOTA 3QQPA 4MCHA 1TIPA 5EJ7A 3BG5A 1U9YA 4DV3B 1E18A 2P30A 3C39A 1QCCA 2E48A 2VCYA 3KB1A 4YJ3A 5CB4A 1PK9A 1SIUA 3PGKA 3O6VA 4HP8A 3K9GA 4IG9A 4OU5A 5HMMA 3U39A 2M6LA 3HSYA 4PLGA 1NDHA 2EXXA 3GUZA 1YR3A 1DLJA 1UDBA 2WNSA 5LMUB 5AT1A 5JXWA 5IHXA 1UIRA 2OQIA 2Q3JA 1CU1A 1LPBB 1ABEA 3L6UA 4AYXA 4CKEB 5LQCA 2OZEA 4NYIR 4ZT5A 3ETNA 1PFKA 1X77A 1FB5A 5AVVA 1C30B 2PMDA 4BWVA 4DLZA 2ORVA 4QOFA 4LY0A 5CGQB 2XZDA 3QX8A 5JSZA 4MUEA 2QRUA 3G0GA 1OTHA 1P45A 1XZEA 2BRUA 1N5KA 2IWRA 2EHDA 2C8LA 3SC2B 1OZHA 4GR4A 4WZBE 5BSEA 3RUHA 4RVUA 3WQHA 1KWKA 2QTNA 4QBHA 1UFVA 5H4HA 4ZZ2A 1XVIA 1JSCA 4KW7A 1NQXA 2BCJQ 4HLQB 4C0QC 5BNZA 4MX8A 2I1QA 1UAAA 1W88A 1NZDA 4YPOA 2QUZA 2QYHA 1MX3A 3B1KA 2CW5A 5FUVA 3WGOA 5JJBA 5T4HA 3E82A 2PGNA 5HWSA 3N6VA 2OGTA 5G3ZA 1ANKA 4PNZA 2PFKA 4ASUA 4D41A 1Z0FA 4P53A 4RKYA 1BHJA 2C0PA 2NUTB 4PNEA 2H0RA 2M1ZA 4QGGA 4YJ2B 1JG7A 2ZR9A 1EP2B 3DLCA 2B8JA 3KD3A 5HZMA 1PU2A 3N87A 2O3TA 1RWOA 2IE8A 4LDJA 3L9WA 4Y1FA 3HNOA 4IWNA 1D6JA 3AR2A 5C5CA 3LC1O 4IXTA 1H2AS 4AN0A 1CJSA 4QGHA 5BNTA 3U7HB 4KO8A 1M2HA 2QRLA 4DKXA 5BQOA 1LWOA 4BKQA 3DV0A 2CN1A 1I2MA 2YH2A 3IAS1 3VA7A 6Q21A 3EYAA 4HXFB 3QY9A 1WPXA 4HSEA 5AHKA 4YAWA 3AFNA 1NFQA 1DG3A 1G21A 2Z2KA 3EG9A 3GG9A 1A9TA 3MYYA 4A16A 3T5AA 2DQYA 1OX5A 1PGNA 2BI7A 4HPXB 1ZLYA 4DT1B 1MB3A 3VAAA 1KEKA 2Q3DA 3R6TA 5JISA 1I7LA 1Z5UA 2C5EA 3HUFA 4NZNA 1XCBA 2X2EA 3TLGB 1SZCA 1EAYA 4K9PA 4MVJH 2FZEA 4IOJA 3IMKA 5A9TA 1ECLA 1ICEA 5DT9A 5HW0A 1QDLB 5HPYB 4HDQB 3TQOA 4E4RA 2W2PA 4RVDA 1JG1A 3MS7A 1Y8QA 2IV7A 2GVNA 2IYSA 3NT4A 2Y1OA 1N5JA 4G56A 1MPXA 1RSZA 3FPGA 3HDTA 1A7JA 4YMUA 2SHKA 1RWMA 1OWOA 1WD7A 2P2SA 3LM8A 4J0CA 5TQ0A 3QPWA 3EXFA 4WZBB 2JH3A 4QLOA 2O7QA 3GFQA 3LHDA 5DWDA 3OI7A 1V7CA 2B3TA 2Z9DA 4WFQA 4F3KA 4UVGA 1ZVQA 3N53A 4H6PA 4XB6B 3UJCA 4B82A 4OMFG 2E0IA 3CC8A 2HN9A 2W2LA 3FIUA 4DDUA 1DG9A 1UWCA 3PFIA 3TW0A 1CC1S 5DBGA 3OUTA 1JL3A 1UEXC 2R7MA 2HW8A 3AP3A 2VJOA 3LX6A 1U8EA 5BT8A 3KTAB 4QT0A 3UK2A 4Z5XA 2ZITA 3D0QA 4M6WA 2W42A 3HBFA 1N8TA 2BM1A 1C29B 4EFKA 5E6RA 2YNMA 4HH0A 1C8KA 4FGUA 2B8TA 1P9OA 3KSRA 2GMWA 2BWJA 4HEQA 4JI1B 3TX2A 3AF1A 3D3WB 1L8OA 2WY2D 5FO1A 3UG6A 1HQYE 3U2QA 4NBLA 1R0BA 1YCDA 2GN6A 2RGAA 1Q7GA 4Y1EA 5L7WA 2PWZA 3CR8A 3F97A 3Q11A 4GMFA 5KKCA 1RLMA 4MQEA 1I14A 3FM9A 4XXHA 4H2DA 2JJ1A 1LNQA 4LYEA 3E3OA 3A1WA 1I4LD 4MYHA 1DDOA 1X7XA 4OM8A 2J32A 2JANA 1IEQA 4URHA 1YDMA 2VNSA 1ZJ5A 2V4UA 3KM0A 1XI2A 4F4CA 4U00A 3G23A 5K6AC 2CNDA 1XE3A 1YI1A 3UJNA 5LN1A 4AULA 2XSZD 2AB0A 3DKKA 4JJAA 4JQSA 2HJWA 2ZRMA 2DKOA 1GP2A 1P9LA 1UJCA 1DBPA 3NM6B 3X2SA 3KYIB 1ZLXA 1H9BA 3BGSA 5LB4A 2HK6A 4A8HA 1LUAA 3SNHA 1UKVY 1A1SA 2A3RA 4ZKEA 2W22A 4ZJYA 2O5VA 2AN3A 5A6SA 1Z9BA 2RHLA 2CUTA 3EA0A 1R50A 3WK9A 2Z56A 3R24A 3MA0A 4QGAA 1TUBB 2FRDC 1DKMA 2NT3A 3QE0A 4R2KA 5FFMA 5LZ8A 1WHTB 3O03A 1JZTA 1Z8DA 1JXOA 3BHMA 1OZ0A 3GCGA 5CK4A 4PAMA 1C1DA 1P7YA 2X0RA 2Q1XA 1T3GA 1H8HD 1TIBA 1H2WA 4JLAA 2Z04A 1QQ6A 1U90A 4Q1AA 4GPZA 5E8RA 1Z2CA 3RR2A 3Q5EA 3UJ8A 4KX5A 4D99A 5BVGA 1X1QA 1HDOA 1UFQA 4QRDA 2CJWB 3UVEA 1I2DA 1N2OA 3LO8A 2F3SA 1PO7A 3R8CA 1K66A 4DRYA 1CP2A 4WHMA 4CL8A 2ID7A 5G4KA 2PX3A 3NGLA 3EVTA 4QUKA 3TTWA 2DHDA 4RIFA 2HAEA 5EXTA 3TTVA 3BEDA 3NWJA 4QG7A 4AF6A 4AK9A 2BEVB 4Z1MA 5FBVB 3PJDA 1K92A 1GAJA 4ISBA 1U3WA 1EFCA 3PS9A 1JIJA 3HGMA 1SUAA 3QZUA 1A9XB 2WHEA 4GVXA 1PFVA 1VKHA 3AXSA 5KU1A 3NDJA 1PR9A 2WYUA 2P9JA 3H5IA 3KQSA 3RJ5A 4K9OA 1Y9JA 1DIAA 2BE7A 4KB5A 4L72A 3G0HA 2H9IA 2B0JA 3IUNA 5C8YA 1A9ZA 5LU9A 4PG7A 3K4HA 5DO9A 1QH8A 1QR2A 1UEJA 1N7IA 3DT6A 5CFOA 3W0LB 1BJKA 3AIIA 2H4HA 3HDYA 2C58A 5CT6A 1RFLA 5JPDA 3OZ7A 1QUEA 1Q7RA 5GINE 4Y7CA 2AXEA 2D5IA 2II6A 3AI3A 4KO4S 1NUAA 4MS3B 5DBEX 3HLTA 2ZP1A 2I0FA 2ZE7A 2AG6A 3V8BA 3QW2A 3DMNA 1M7BA 2ZB2A 4Q15A 1YHNA 4ZYXA 5BN3B 1VDMA 3QKSA 1AXEA 2VS1A 3CZ5A 2OCYC 4F7WA 5DTJA 5SZJA 4DY6A 5JYEA 5KYYA 4URZR 2DHCA 3RRZA 4W5RA 1QWSA 1IY2A 4YA6A 4TKUB 3THWA 3UT6A 1I4DD 5A9SA 2YRFA 1WWKA 2OE2A 3MOSA 3RUPA 1KDRA 3P9IA 3KWMA 5EMKA 1W0KD 4U63A 4R9SA 3A10A 4PBTA 2WJ4A 3SWWA 1DU4A 4DAOA 1LPAB 3MCUA 2R87A 2C04A 4DIKA 2RHMA 1UQUA 1M3SA 2POCA 3V2UA 4AZTA 1P1BA 3GL9A 3KT6A 5M5BA 3PCTA 4G63A 4GAEA 5EE9A 5JOQA 1CUEA 2A7QA 3OLXA 3OQJA 4ALLA 1GLGA 2HU2A 2OP1A 1V43A 3DQPA 2O4CA 1EJ0A 4K6MA 3HO6A 5ALYA 4EFLA 2OL4A 4D81A 3P9PA 3N8NA 1DJQA 3KKMA 5AJVB 3TTTA 1YFLA 1N0IA 1C1XA 3ZJ4A 4OX9B 1ZA1A 3FLEA 1PEAA 2E4WA 3G02A 5BV2P 3LUAA 5IJ0A 3PGJA 3HWSA 6CHYA 4ARCA 3GLVA 4FSHA 3R9IA 5CA1A 1G41A 1ZNQO 4C4TA 3TJZA 5E95A 5FOSA 5EHZA 2R4TA 3LZDA 1YGYA 4H3SA 1U2EA 2JGRA 2VH5R 3R3ZA 4IHJF 5HK8A 2AXQA 2EF1A 3EZ6A 1T4GA 3ENZA 4G4GA 4B4DA 3KB2A 2ZYAA 2EZTA 5AKZA 1ZK2A 1N3LA 1VCHA 4XDZA 1H93A 1YJQA 2VHJA 3LYUA 4XX0B 3GNTA 2X1VA 1W93A 4WINA 4WWHA 3NRBA 3U7JA 1QKJA 1SD1A 2ZRJA 5EZYA 5IAGA 3RFCA 3RHSA 3NAQA 2YYYA 2NIPA 4LZJA 1D1QA 3JQEA 121PA 4WGGA 4PYRA 3CQ9A 1G8AA 3E9EA 3SMVA 5SZIA 4NMXB 2HO5A 4C29A 4G5YA 4ODIA 3SOPA 1I0IA 2BEJA 2PT9A 3R7FA 3SFZA 1QQAA 1K8RA 4A8PA 3RC8A 1XAIA 3U3XA 1UBSB 3KLOA 4CIBA 1IQUA 3NEYA 3OESA 2YRXA 1YVUA 3EJWA 1D07A 1ULSA 3DMPA 1GIAA 3KKKA 4UBOA 2OBXA 2FOIA 3RS2A 3BVPA 3BFXA 3JSAA 3NG1A 5F1KA 1FTGA 4I8DA 4X45A 3DE5X 5IDWA 2WD8A 3ANMA 2VKQA 3DL7A 4TYPA 1FXUA 1H2BA 1HNXB 4ZCLA 3ML1A 3FTDA 2VDQB 4HDMB 1RXUA 5GTDA 1L5MA 3IAM6 4JI3B 1DNPA 3OU2A 5C31A 1FFSA 5JWOA 2JAUA 2JLAA 3RE1A 3TXXA 4ZJUA 1EBFA 1M8JA 1KKLA 1P6UA 3EBPA 9ABPA 1E9AA 1P75A 1DHTA 4HB0A 1BRTA 2J4CA 1CS0A 2HLPA 1PDOA 3KUKA 2SCUA 3RT7A 1VHQA 4ATNA 1EA5A 4I55B 1BVYF 3K70B 3S0JA 3NOXA 4N0EA 5DOZA 1SBTA 4E09A 4FFBA 3FMVA 1NE2A 4L5JA 2IF0A 5C53B 4A0RA 2C42A 4B74A 5AHWA 4DR3B 4BQFA 3FDIA 4NENA 4YP9A 4KLZA 1QIFA 3ESCA 3OZBA 5LBTA 4EWLA 1X8LA 2O3QA 3I3SR 4J1SA 2X2FA 3RYFB 2AOXA 1J1IA 3BSWA 4KIJA 4DA0A 3RTDA 1NN3A 5GGXA 4V0OA 1YZQA 2HSWA 2IELA 1E6UA 2Q0XA 2VPZA 4UAVA 4CM7A 1P7WA 1TC1A 3IAEA 4R7ZA 2XBUA 3OZAA 3U13A 4B71A 3WL3A 5IDQA 4UU7A 3IR6A 3GJ0A 2PNJA 1AKTA 3SPXA 3COZA 3VGJA 4RQAA 1F8XA 1L4HA 2MMGA 1NNI1 4MWGA 3WRVA 2XTMA 2ODWA 2Q8NA 4LZLA 3ZV3A 3CGWA 1AUOA 3NIFB 1GGFA 1O6BA 3BIWA 2OCDA 5TSDA 5ICEA 2QRJA 4QPZA 1MNAA 1GA1A 2PVCA 3INTA 1B0AA 5ITVA 4L6IA 4Q9NA 2P4EA 1XBTA 2BEKA 1QYDA 4KE9A 5EUCA 3SC4A 4ZDJA 5D3QA 4EB0A 3HHEA 2F1JA 1NUPA 4ZQGA 4IMRA 2QN3A 4DMHA 3R0QA 4U0JA 4B4WA 1YKFA 2WHRA 3A6EA 4A03A 1X92A 4YCMA 2GBCA 1AUPA 2AYZA 3MT9A 4FONA 2Q9BA 3DC7A 3DVSX 4OHBA 2ZUCA 3TH5A 2J48A 4NXMB 1Z7EA 4TSKA 5EWLB 3CNOA 4JLVA 4OUDB 1TEXA 2FSSA 3GBVA 1S7CA 5CH5A 2BM8A 3BHJA 2CLLB 2EW2A 5B57C 4OLBA 5E2BA 4MJ7A 1KDYA 5L3QA 2W5UA 1CUJA 5AUOB 3J81A 2XCRB 1T36A 1X86B 4CN8A 3L0SA 5KHLB 1FW8A 4XGKA 3EDYA 1J9GA 3I23A 4P3OA 5I7AA 4KQ2A 2QNBA 4YR7A 2JIMA 1V95A 4KNYA 1IJBA 2ABWA 3A4YA 1AN0A 3HLKA 2DFKB 1VHTA 3MUEA 2B1JA 1X2BA 4ZCQA 3I3OA 3HPQA 3H8SA 3I2IA 3EUWA 3MZ0A 1KAMA 2G9RA 5UKDA 1KJ8A 4ANFA 1KZ9A 1TZJA 2J0UB 4G5QA 3WLKX 3MQFA 2WWIA 4P7FA 5A7HA 5FA5A 2AIRA 5DNVA 4J4HA 5KX5A 3L46A 4Z49A 3KKLA 4W6ZA 1FIUA 3UMMA 1NY6A 2A86A 3ROPA 1DJOA 4LPSA 4BE7B 1I7NA 1N9ZA 4XGRA 1W29A 2H63A 3G7SA 1W48A 2P0EA 3CEAA 5CB8A 4J1NA 5CVTA 5IF9A 4PSKA 4II2A 2RHJA 1M8GA 3OZXA 1QONA 1PTJA 3HMKA 3CLKA 2PZLA 4UEWA 1CF9A 4J0KA 2WIBA 3IMFA 5EIBD 3SJZA 4C6TB 1T5HX 1TQ4A 2QN8A 1UMDB 2W2MA 1UXOA 3O7WA 1XEAA 3IQZA 2JASA 3EDCA 3FSGD 3QOFA 4WFJA 4WK4B 3HABA 1G3QA 2Z9BA 2V3VA 4X20B 2M9MA 5HZGA 4MYCA 3QEMA 5FWXB 2QR3A 1JQ3A 5CNKA 2EFJA 5DEIA 5KVCA 4P7GA 1MP0A 4IMJB 5ESXA 1BEEA 2M2IA 3N6RA 4N3GA 3LF1A 3I01M 3TX6A 4C4OA 2J3DA 5P8WA 3U48A 1I7QB 2B2CA 2FWMX 3R5SA 5JAMA 2QRVA 1KP3A 2XX3A 4PYJA 4S1NA 1BS1A 4B32A 1U4SA 1RJGA 4GEKA 4MIKA 2PSFA 1EGAA 2AC2A 4TLLB 3SEFA 5AW4A 1ISHA 3M8KA 5DB4A 2BMDA 5EG5A 3TAXA 3PR2B 3ICPA 3BXFA 3RBAA 4CTMA 5FNVF 1XN1A 3REQB 4ZK2A 5JZMA 1ZK1A 2C7QA 5WRFA 1T2AA 4L16A 4O63O 4ESEA 3WL8A 1HO3A 1H8ED 4PN3A 2AOUB 1WQ3A 3IA7A 2ZDQA 4HX5A 4KDRA 3MINA 1WUJS 1WKBA 4NNJA 2QX6A 4MR7B 4RHTA 4YP5A 4BQEA 3T3NA 4QLAA 3AILA 1N0HA 1L4MA 2H3HA 2NO9A 4IRXA 4TMWA 2BT4A 1O0BA 4JOCA 1J5PA 1N5DA 1KS9A 3VNAA 3GGJA 3UATA 2VP0A 2JS7A 3PC7A 4OQNA 1Z38A 1Y6ZA 3GLSA 3M83A 1SELA 4LPKA 1D03A 1ZCJA 4BNUA 3KKNA 4U2DA 3KXKA 2F90A 4IFTA 1XP8A 1PE0A 2B94A 3UZUA 3ZHQA 4K9LA 4GDFA 3P2YA 4KPFC 3UTCA 2JKZA 1YZKA 3O4GA 4JBYA 5A5DA 1AVTA 2ZT7A 5LIPA 3T5CA 1JQJC 3ZW7A 1GZSA 4C2AA 4CR6A 1SVNA 2JBHA 2DB3A 3FUVA 3OIWA 1XJQA 1RYEA 5E6UB 5AW0A 2J3LA 2PT7A 3FDJA 1IAVA 3UTDA 1GQQA 1XTJA 1IB6A 1SCJA 3PNKA 4IKOA 3W4KA 5FI1B 5K8JB 1ZJ6A 1Y63A 3EHEA 3GGOA 3GLFE 3CLUC 3WIEA 2C4KA 3C6QA 1Q3KA 4CMCA 3TMKA 3D5QA 2XODA 3PQ8A 3SR4A 2QAGC 2HWXA 1TVCA 2OBLA 2YN0A 2ZUBA 3IDOA 4KMMA 1N3IA 3GVHA 4OAQA 4X97A 3AETA 2PRZA 2E82A 2QD2A 1ZH6A 3JQGB 3L5OA 1YRLA 3RT1A 1K63A 1YK1A 4HEA6 4B81A 1ML3A 1O08A 4R01A 2KQUA 2CHFA 3L79A 4NE9A 5BMVF 3ZJUA 3K9CA 2DERA 1MV8A 5IM4A 5ADHA 1DX9A 5J2TF 2IW3A 4Z0TA 1V6CA 5LIRA 1QB8A 5BUCA 4H1VA 2DUMA 2VPWA 4IXDA 2FMTA 1QIGA 3Q40A 1AGRA 2POQX 3WGKA 2WWFA 5FDFA 1KR5A 4HKTA 3AF6A 2AZDA 3RKRA 3RAEC 4DA9A 5FF9A 4BCCA 3DC2A 3I28A 1R6VA 2R8ZA 3KHKA 1XD2A 3O5AA 4JT4A 2BZGA 2PPVA 4AIIA 3HV2A 4KR2A 3VVLA 4PQEA 2BYTA 1DXOA 1QHIA 4MDFA 4MS4A 2D2EA 3IVMA 4NE7A 3GFPA 1T0PA 4JDPA 2DFTA 3UXYA 5C32A 5KMGB 3E7PA 1KAGA 3DW3X 4PQRA 1CFJA 3G6KA 2QW8A 1KMHB 4ZVSA 1MT3A 3SHFA 1UJNA 3I53A 5M34A 4X24A 3N59A 3C5VA 1WOMA 1Z4NA 1RYYA 3TCNA 5KJFA 1GUYA 3GJ3A 3RV3A 3CJRA 1QH9A 1V3QE 2CNNA 1LDMA 1E1RD 2GRUA 3T7RA 3GJ4A 3G0IA 5B1IA 2ATIA 4CUZA 2YWXA 2IIVA 4L75A 4KPUA 4P3YA 2JZOA 1BNCA 2KW5A 2EJUA 2D5AA 1OFGA 1VPEA 4QHYA 2ZS8A 2NU8A 2CJPA 3BSFA 4O2AA 1QLWA 5CPFA 3TOSA 1ZRNA 3VZQA 4C5AA 1IOLA 3UMBA 1X1CA 5B64A 4TTAA 5JBIA 1FYDA 1PJAA 2Q4TA 2N75A 3BK2A 4H16A 1CK4A 1T1RA 2CLMB 1E6CA 2BF4A 3CB4A 1FFBA 4NJMA 1P62B 1YZUA 3H9JA 2AHRA 3JRXA 3SU8A 4D9IA 4HQFA 2QRZA 3D4PA 4XD7A 2OO7A 3W6OA 1WTCA 2ZWPA 3BGIA 3OZRA 4LCJA 3ZCPA 2FCRA 3P52A 2PSDA 1ISPA 4J8PA 4LOIA 4NJEA 2I67A 2Y0DA 3RC9A 2VA8A 2A14A 4BRWA 4GKKB 1ZH0A 1H1LA 2R8BA 2VA9A 2J46A 5DXJA 3TE6A 3P4YA 2WF6A 5DI3A 4ZYYA 4RK7A 3DS8A 5C9ZA 3ITNA 1ZIDA 1RHQA 2QLFA 4RMGA 5LNK6 2V0CA 3JTMA 5BRAA 4JV5B 3DV2A 1TM2A 4MEAA 3LC2O 5KUTA 1EHIA 2P8JA 1NBIA 5K3SA 1UBNA 5EJIA 4IUDS 3N7UA 3VR6A 4C4ZA 4C7XA 3T3OA 4KITB 4IDPA 2H17A 1JJBA 2F48A 3LYAA 1Y8AA 4AJEA 1EAMA 1Q44A 5AVUA 3IHLA 1IXRC 4OCZA 2B0CA 4QUDA 2DPXA 1N36B 1TJ3A 1XP5A 1GNLA 2ZI6A 3WLLA 4US2R 4JYMA 4WOPA 1Q5PA 1TUEA 5EKTA 2HFJA 1IUKA 5CM9C 3E1SA 3TLXA 4DA7A 3BMQB 4EAAA 4MWCA 4N47A 3QRWA 1TTPB 3SK0A 5CFQA 2CHGA 4H7FA 3ZCVA 4DC1A 4C04A 3KSBC 1SQ6A 3W34A 2ES4A 3CRRA 5ALEA 2W4MA 1LK0A 5EKSA 3TG8A 2BHRA 2VNIA 2ENUA 3NHAA 3HCFA 4WIAA 4R6XA 1CUIA 3RODA 2Q9CA 3KZCA 4BVGA 4ZA2A 1QBGA 1PJ4A 5EYPA 5HM8A 2CE7A 1PJ3A 4JUBA 3KBBA 2QUHA 5JEDA 3WFZA 2J59A 3CUSA 1RAHA 4WKNA 4Q1VA 5G1OA 4V0LA 1PK7A 3OZUA 3FZEA 3RIGA 1Z6ZA 2BIFA 1NOKA 2VUIB 3L5KA 1MVOA 3RVNA 4CDMA 2VIIA 4PZ0A 3BRQA 4PIMA 1H2RS 4HS4A 4L4ZA 1QO7A 1PW7A 2JFWA 2BEUA 2B98A 5TLSA 2JAHA 4BMOB 5AK0A 1MQ9A 2RBEA 1TU3A 4ZOLA 2V98A 3LPLA 2VRCA 3K94A 4Y9DA 4E5YA 1W8DA 1JEYA 1ZXBA 4I5IA 4L4SA 3K2QA 1LJUA 4B7ZA 1AKMA 1AO0A 2SKCA 2BVNA 2W8ZA 3DEJA 2E5WA 1QPZA 1YRYE 3MWLA 2OFXA 3DP7A 5B4UA 5LP1A 1S6YA 3H9UA 3LCJA 4UQPA 1BMFD 2LR0A 2DTEA 5BURA 1CR6A 3G9ZA 3QJ5A 4O5OA 2QENA 1JU4A 3ZLJA 4KWIA 4HFRA 4DTCA 1ZOPA 2CL6X 5JU6A 4WN3A 2IDZA 5K05A 3H8VA 1RBMA 4B7UA 4F97A 2NP7A 1JHAA 1G3RA 3DDWA 1UWVA 2EGUA 2J3IA 3IALA 3TLYA 3VR3D 2JJQA 1NBME 3WLNA 4AJ9A 4UJ5A 4EFDA 4FOLA 3K9QO 1VM6A 4OK5A 4F21A 3IOBA 1TKAA 3AT1A 4NFYA 3VH4A 1VBKA 4E11A 1OGYA 1WO8A 5FP0A 4GL4A 1YFJA 4XGIA 4DLRA 4ENWA 3ADDA 4DN6A 1JJIA 2ASEA 1CETA 2FXVA 4RD4A 2I4IA 1TECE 2IU4A 3BF8A 3EARA 4G0PA 2QI9F 2IS1A 1I5RA 1BDBA 1XJ0A 4YJFA 2H1FA 5EOVA 1NGSA 5LQKA 2WJAA 5FEUA 2WRZA 1DG1G 3NBMA 5LQMA 4I1UA 1F48A 4RVFA 4QYMA 2VXCA 1SR8A 4KLCA 1P60A 5FOVA 5H3CA 4CT4B 1Z0SA 2YJZA 2ZIZA 4EL5A 4AZWA 3IQWA 4BEWA 1R9MA 2NUBA 1EKXA 2HA4A 4Y7DA 3R0IA 4D0SA 3FCYA 4Q16A 4I2VA 2W43A 2E21A 3FN4A 2ZJFA 5CIYA 1EE1A 3PRHA 4RABA 2WFLB 1QKKA 4MRRA 3CEJA 2IUUA 3VZDA 1U8XX 1KOFA 3ER8A 2X6TA 3T9DA 4W9NC 2CC2A 4TLCA 5A7GA 1B3RA 1COWA 2JDIA 4N7RA 4OHCA 1T25A 1E2EA 1UPUA 2A94A 4I4CA 4MVJM 3OIDA 3KR9A 4YJFB 4UVEA 5DBHX 2SNIE 4MUJA 3RYIB 3Q87B 1WX1A 4JB8A 3VMFA 5AR1A 5EQTA 4AU1A 3ITDA 5NLLA 1ND6A 5KOYA 4YWJA 4WZAE 1IWPB 1YBMA 2EFEB 3UHFA 3BKWA 1ZITA 5ENVA 5DLQC 3HN2A 3REFA 2AKEA 3V2GA 1UADA 2OCLA 2PRSA 3QPVA 3JD3A 1X94A 1HLGA 4BO4A 5AVWA 3EXEB 1Z2PX 2AHOA 3FR7A 2VJCA 3DKIA 4KQ1A 1HUQA 1CZLA 2DBRA 2ZYSA 4LHVA 4EY8A 5KPDA 2CK3A 4B3RB 4KI7A 1AV6A 4MVWA 4FR2A 1C41A 4MVJE 2YDYA 2GLTA 3JX9A 2IH4A 5HQJA 4X5OA 3A1DA 1GTSA 4R31A 4DUZB 3RUAA 4NECA 5AP9A 2PUGA 1J8YF 1XCOA 1GFSA 5FHQA 1MEOA 4JEHA 1H2YA 5F5NA 2VRWA 3W9BA 1F9AA 4KYIB 5LZ9A 5HILA 5BYJA 4B6FA 4EI8A 2GLXA 1JJVA 3H8WA 1UKEA 2C7VA 1XDBA 4ZO8A 1QLJA 2PLFA 4K6FA 1WP9A 3DP9A 4ZOLB 2WK1A 2FMFA 5FOXA 2VCEA 4IJ5A 3HACA 1Y4AE 3AKDA 3PKJA 4XA8A 4IVRA 2NO0A 2H1SA 3TOXA 5CNJA 4D8WA 4BGUA 2VPQA 3PNYA 5B58C 1Z4IA 4PF1A 1M1UA 1A2OA 4WVFA 2V97A 2QMHA 2QUBA 2FB9A 4GLFA 1ZJ4A 2DM6A 1N6IA 2I1WA 1SK8A 2XV1A 3UMGA 3AINA 1JVNA 2GJKA 3O4VA 3EQ6A 3WJ2A 1MXFA 3KD2A 2NZXA 4D02A 3WTCA 4CLRA 4LOJA 2C9BA 1CB7A 2AEFA 4KTVE 1XMOB 1E2QA 2E37A 2PO7A 4PGAA 4LV6A 5DBFA 2OXIA 3PIRA 5EZQA 1CLEA 2CNWA 2IPMA 1SMKA 3PVZA 3T7CA 1M1NB 1L5KA 2HJVA 3UGQA 1ATIA 5IF3A 3EDOA 2Z08A 3F4LA 2PTGA 4MV1A 1M0SA 5K3CA 1IIBA 4GI7A 2QQEA 3BQ9A 1J23A 1MD9A 3CE6A 3T4XA 3FAKA 4XIIA 3E1KA 4R81A 1XNRB 2IXFA 1KA9H 2W00A 3H5AA 4EPXA 3QVVA 5EIXA 5HTOA 1MORA 5JRDS 2K5UA 3S2IA 3RH0A 4A2QA 1J0DA 2ETVA 4C3VA 1R8JA 2WW8A 5KWEA 3T7DA 3FTFA 1ZD8A 2EBFX 2VFAA 3NKVA 1E2BA 2R9VA 2VPPA 3EGCA 4YS6A 2COKA 3F8TA 1ZL0A 4L4YA 1ZCFA 4HQNA 1Z22A 3D6TB 4QSMA 1YIOA 5DNCA 3BIFA 1SULA 2E4UA 4KN5A 2IEZA 1JMYA 2TS1A 3IUQA 2XB4A 1N9KA 5KQSA 3LPDA 4Y2PA 2NXJA 1VZ2A 3UK1A 2GBLA 2YOFA 3TGLA 3PFHA 2H1RA 1UDRA 2YYAA 5JNWA 5KC9A 4MI6A 2CXNA 3AU8A 3PXDA 4LXHA 5DCLA 5D8DA 1FX0B 2P5UA 3Q9SA 3QFHA 4O4IF 4RXUA 3NIDB 4Q1BA 1OAOA 1VG1A 4FGWA 4NCAA 4DF3A 1GKYA 5JJ5A 5I6DA 2PPLA 4Q01A 3UAZA 5ALQA 2LD4A 2F62A 3ILXA 2OAEA 4J1TC 4ADSG 1WW3A 3ZXUB 3V00A 3I8OA 1R15A 5HR5A 2EZ8A 2DRIA 3V34A 2I2XB 4GLBA 1QG6A 3GOQA 3P1JA 4U2BA 1B4DA 2P62A 3AHGA 1WCV1 3UGKA 3FYUA 1PV4A 1T5OA 4IDGA 4LKOA 2NQ2C 3VV3A 2FQ1A 4NABA 4X60A 3BFPA 5DTEA 3CIFA 4O4HB 3SN6A 3UT5A 5U9CA 3KQTA 3R2JA 1N9GA 4UASA 4P4SA 3HR4A 2AE2A 2O5EA 1DFGA 4I4TF 4QFCA 3WK7A 4UCWA 1IHDA 1KTVA 1SJ9A 2VDPB 4HR7A 5EJGA 3UC5A 1VXOA 3OCXA 1X8KA 1YC5A 3AGPA 4K6CA 4Q4AB 4R9NA 1NF8A 1J5XA 1YI8A 5LFAA 1RWNA 1Q2UA 3GT7A 3LT0A 4OKIA 5ECDA 4AVYA 3EAFA 3LBIA 4WLNA 4XWTA 4UTRA 2C7RA 1KI4A 1PLLA 1XZHA 1RC0A 1TA4A 2BV3A 2DHQA 3K96A 2GN8A 1FNMA 4B6QA 3MGAA 4HWOA 3RVPA 3M3PA 2ZSUA 3V32A 2JLQA 1IPHA 4CV0A 4EDHA 1HFJA 3R0VA 1EJBA 3ELUA 3ZKWA 4QXQA 4CNQA 1ODJA 1NT4A 1NF3A 2I2CA 4KFCA 3O2SB 1VG0B 3D6MA 1K8ZB 3HU1A 3BH0A 1PFQA 1Y98A 5F21A 1K98A 4YUVA 3U62A 3ZXYA 2HJGA 3FUXA 4XGQA 1Z37A 2FUCA 2C1EA 4M22A 3M34A 3V1LA 5JANA 5LXTA 2WAXA 1SB8A 1K7SN 1J0AA 2PT6A 5EA2A 1U0RA 3QV2A 2VUHB 4BYMA 3JAWB 2HSJA 3WKDA 3JQGA 1A9SA 3AETB 2BGLA 1HT1E 1U0SY 2V45A 3NR2A 3A05A 4PRLA 4DABA 4DIMA 5C5EA 3ANXA 4ZQEA 1CQZA 2PUWA 2ZSFA 1TYZA 4YMIA 2OB1A 2YTZA 5CXSA 1YU9A 1E77A 3T15A 2ZJ1A 2GK3A 3NEAA 1XVLA 3BS4A 1PS9A 2OXTA 3NUGA 5AD1A 3GH3A 4IJQA 1G19A 1TAHA 4FHCA 4R2LA 1GQ2A 1L9KA 1P8AA 2R7KA 1M2OA 2BHSA 2IIPA 1X7YB 1RPAA 2R1ZA 1E60A 3H5RA 3OCJA 1J22A 2XCIA 2XTNA 2XBMA 5EAIA 3NRCA 3OD5A 4L9AA 1NBWB 2OV2A 2A1TS 4P4GA 1S9HA 4ZEWA 5COQA 1P2GA 1RZUA 3R3WA 2VSQA 1Z25A 4DUGA 3MAJA 2ZBEA 3QTTA 2Y1EA 1NG1A 3FWNA 4WEQA 1U31A 3RYHA 1U7XA 2OWEA 1MKYA 4C4RA 4KXFB 1RM0A 2O2SA 2OBNA 1XXHB 1DBVO 2OGZA 1OI4A 1XXLA 2I6TA 3ECCA 4QVGA 4EJSC 1YUNA 3OOWA 1USGA 3OQPA 3P9QA 5KKAA 1F2TA 1OQAA 3IDZA 4N18A 4RJIA 3G9UA 3NAZA 1NC3A 3OTQA 5H9VA 4BNHA 2BSQA 1SIWA 2VBGA 3MINB 2V9ZA 2Q3MA 1KZ4A 4JHLA 3HVKA 4W5WA 1RYZA 3PUIA 2V6JA 1L7QA 4MA5A 4MWBA 3DXZA 1UWLA 3T4EA 2DOKA 4JI2B 1U7DA 4AJIA 3CLRD 3OTHA 3ZLUA 1EDOA 3EIXA 4LZWA 1IOWA 3SYRA 3PYXA 3BB1A 3MLAA 1X7WA 3FSRA 2Y8EA 3CJTA 3LGSA 5HDBB 4EPRA 1PUJA 3KS9A 3Q0IA 3U3RA 2JZNA 5IYZF 4ZJPA 1S3FA 2OGWA 2VDJA 3DXFA 2CK3D 5C7OO 1TYBE 2MOKA 4JB0A 5JR3A 4QJ4A 3U17A 3RBZA 1I2ZA 3P2OA 4AF7A 2ET6A 4Y30A 1ZMOA 4RTLA 3PZBA 2H16A 1Z16A 2WDZA 1B6RA 3DO6A 3GAAA 4YALA 4F56A 3LXMA 1XNHA 1ADYA 5SY6A 4GPD1 5A04A 2P67A 1SKMA 4GIBA 4D7AA 3RRYA 4YV2A 4Q3LA 3LQ1A 1XFAA 3E9RA 1Y5LA 3ED1A 3MGBA 4S12A 3WWPA 2LDXA 2HHLA 4KXXA 1K6JA 1LJLA 1AUQA 4PRYA 1KF0A 2OCXA 3AQIA 3UXEA 3DBVO 2J9XB 1EVYA 2TYSB 3CNQS 3GFRA 4H3VA 4ZXPA 3TO5A 4AG3A 3B3JA 5AW5A 1QIKA 3KU4A 5E3HA 1U0EA 1DC4A 2ZBVA 3KQQA 3SKVA 2P77A 2GUGA 4LVUA 4MGYR 5AVZA 5I5EA 3OAAA 5E4YA 4D4MA 4RY8A 2XH8A 3NONA 3FVWA 3PSHA 1QHEA 1E79A 2JLSA 1HZJA 3IIKA 3MK31 1P74A 5KX5B 5TXGA 2XGJA 4P3KA 2B9VA 2BUCA 4Z4HA 4W5TA 3WP1B 1CZRA 4G1VA 1OAKA 3VC3A 4BS9A 3AHFA 1E2MA 3ZKAA 1FXWF 1WZNA 4D42A 4LOKA 4S1PA 5IFLA 3EQ8A 1AY0A 5L53A 2WJYA 3GRYA 4KGDA 4G81A 4V1CB 1WQ4A 1ZI9A 1ZM7A 5FD8A 1TDJA 3T7TA 3G68A 1VJ5A 3JATA 2RHCA 4X91A 2EL7A 3KUUA 3MB8A 4DJDC 5C18A 4XD2A 1DVRA 2CVQA 3HU3A 2AA3A 3VX4A 2R79A 2HT1A 1KMMA 3RLFA 2YYSA 2GTHA 2QX8A 2R85A 2VJLA 1WABA 4HAWA 4AY2A 2OCAA 3D7KA 5CLQA 1Q50A 5KYKA 3JZIA 1N92A 1HEYA 1PL0A 1ZNZA 3JD1A 1XCLA 5D5HA 4JN6B 3AHEA 2BF7A 2FHPA 3O8OA 4Q21A 1ORVA 4QUAA 3LV8A 1V8DA 4CG0A 1ZHFA 4CTJA 4ND5A 5A62A 3BE4A 1T3TA 3N2YA 2OHVA 4UNSA 5K0ZA 1R8XA 1E20A 3T41A 5M29A 1WDMA 3SQNA 2AFVA 1BEUB 1XD8A 3IO5A 5HM6A 3R8XA 1NR1A 2VHUA 4NPCA 1AQJA 3MTIA 1FYXA 3GIWA 1MIHA 3QSGA 3HNPA 4TM7A 5GZ1A 4YP7A 1FFEA 4LNUA 4O4LB 4ABTA 1V7QA 3AM3A 1Z7YA 2FPMA 3G2LA 4RY9A 3PFFA 5K6RA 4YEDA 2WNHA 4GSYA 3L05A 5BWLA 3TQQA 4H1UA 4BO5A 3RRNA 4BNDB 4BBPA 1TTQB 1G4HA 1I6KA 4WNIA 1EWTA 1UKAA 4UMDA 4QGSA 1AMNA 3U5ZB 3CR7A 3TQSA 4Q19A 3W8FA 2HADA 4HQOA 5FUBA 1SY7A 1TU4A 2HY7A 1X7ZB 4L02A 2NO6A 1MJGM 4YMHA 5EHIA 1NPDA 4PO3X 4S1VA 1KY3A 4QOJA 2E18A 4NENB 4JB3A 3SM3A 3HTXA 2BFCA 3DPSA 4X92A 4RTOA 1Y7LA 3HVIA 2DETA 2O20A 4FFBB 4ONEA 2CXTA 1FVFA 2HOQA 3JWGA 1RRVA 4QTXA 5ALMA 4B79A 4B43A 4ZYVA 4LRTB 4TRNA 1XCJA 3VDMA 4PR3A 1EDDA 3AJEA 2J4FA 1IWBB 3UWPA 1S2MA 3EOAI 3KSDO 3JWPA 1X3SA 4QDZA 1UOPA 2IEBA 2AFIA 3NOOA 1N6LA 4EZEA 2L2QA 3ICVA 2OZLA 1K7XB 2RAFA 4NU0A 2JGKA 5E1OA 2J3EA 4E5SA 5JQGA 1ZRHA 2WSSD 4MUFA 1DMRA 1I5EA 1SXJC 4ITUA 2DWUA 4HDMA 1NJ6A 2D2FA 3ZNPA 1KZ7B 3PC3A 3TQHA 3RV4A 1ESEA 3HCWA 2ZULA 3WB9A 2XT6A 3PJRA 1TZKA 2G70A 4DLSA 4TKVA 1J2RA 4EHDA 5FWAA 1YMQA 3GLHA 3BZBA 2JJ8A 4EM6A 2AJBA 4QQNA 2GTIA 3DHNA 1CIJA 3RABA 2WU4A 1BKYA 1AH2A 1S5PA 2OV4A 3ZQKA 2GZRA 1VRCA 3O95A 5AM3A 2G07A 1MDFA 3NDPA 1MENA 4M55A 4RV5A 1RQ2A 3K72B 3KCNA 1XA3A 4BV2A 2JIPA 1QXSA 4XDYA 1ZONA 1VCMA 2NPFA 1XRQA 4WK0B 1H5NA 1DBSA 1RLJA 3GYBA 1C8VB 3NTUA 4J91A 4K8RB 3WMEA 4BO9A 3AIKA 5HMLA 5F23A 1E66A 1HDXA 4Z8XA 5G1NA 4EBFA 4A5SA 1VJ0A 5LZ2A 1O54A 4JT9A 1BJRE 2NTVA 5CDHA 3OBBA 2BAGA 3C3XA 3GNQA 2ZBFA 1GT6A 1VBFA 3S1LA 2BELA 4PGGA 1BCRA 3E53A 4G0ZA 3ZDBA 1P7PA 2AQKA 5FIUA 1KDVA 3TL3A 3KBOA 4KFTA 4CT0A 3FVQA 2V74B 4GKAA 4LI3X 3KLMX 2VP5A 3IRVA 4HMQA 3BDIA 4QRHA 4CCWA 1L7VC 1H3FA 1G20A 1NDUA 3KJXA 3QVKA 1H65A 4XUGB 1U5AA 3KXDA 2QJWA 3D2AA 2CWDA 3KVOA 4F1KA 1YSCA 1CUSA 4Y1RB 4YJDA 3IB6A 4L5CA 1D9ZA 2OV6A 3T1HB 3A4TA 1G8SA 5FBLB 4R0NA 2UZ0A 4QBFA 3OA2A 4FJ0A 2WT4A 1XCGB 1LDEA 3BXOA 4BMZA 5KVAA 3X44A 1MO2A 4LTNA 1QFJA 1GFZA 3PX7A 2ACVA 1QDEA 1S2NA 2DBZA 5MHTA 1NNSA 3OEEA 4FN4A 3MFYA 1JDNA 3CKMA 4FEEA 2RGXA 1L6RA 3Q1LA 4E32A 1JBQA 1NVMB 3LUFA 2EJWA 4DY4A 5AK3A 1WUKS 4TTSA 1E2HA 3ZDZB 5CYGA 5KSZA 2ZQ5A 1GAWA 2QT0A 1FNSA 2OLKA 4PCVA 4Y2TA 1CUCA 2FQXA 4Q47A 1FCJA 2G1AA 3RWMB 3SVTA 2BI4A 5SY9A 1ZOSA 3SJUA 3NT5A 2PXCA 1XZKA 3R8FA 4BNZA 2KBEA 1P81A 2E4ZA 2FZGA 2WM3A 5BYAA 4MYRA 3RVQA 2WQZA 5D7NA 5BN3A 1EE2A 3BPSA 1LLFA 5ALNA 1Y3DE 3C1AA 1OYYA 4MS3A 2DBYA 5DH9A 5KCMA 1ODSA 3ANTA 3DE3X 3G85A 1PWZA 4HG2A 3WNQA 1HBJA 4BQQA 2O59A 3O3OB 2XY4A 4IQGA 4M1QA 5ERXA 1N5OX 3QVGA 4G2NA 1QF7A 3A0UA 3KE8A 1QHXA 2GFHA 4UD6A 1XK6A 2Q28A 3HL4A 5L6MB 2F4VB 3AFMA 1RACA 4QKQA 2J0VA 5C8YB 4NYIQ 2CWWA 1LS1A 5BQ3A 3WYCA 4PGFA 4ENVA 3LY7A 2BBSA 5EQJB 3COWA 4KWTA 2F1RA 1HTTA 2XKKA 5ITWA 2IHTA 3DDZX 1YB7A 1A9XA 2O8BA 5JW6A 2R8YA 3IVAA 3EFEA 1FTNA 7YASA 2VAWA 5BWNA 1AKQA 4FILA 1RTKA 4K9SA 1FFDA 4XVHA 1JYEA 3DHYA 3BZWA 4WKGA 5HF5A 1OV4A 3MT8A 2Y1FA 3ZY2A 4FKMA 3L0YA 2RK3A 5E1DA 4E2FA 3GXOA 1HDCA 4EY5A 3H2KA 2ZI3A 4GM1A 1QGZA 1PYOA 1PTKA 4I1RA 3V42A 1O6CA 3R3XA 2GD0A 2NSDA 4ARUA 4CPDA 1AMUA 1TM7E 2PX0A 4R16A 1MO4A 2WF8A 4N4AA 2XZLA 1UIMA 1EFTA 3JYPA 2PMEA 4DPMA 2C03A 5CG1A 2HCTA 2FPWA 4QYSA 3QYJA 4O1IA 2BUBA 5CVEA 5D1HA 4EZBA 1CEYA 4MTCA 3F6YA 1EFPA 4MW6A 1C1DB 3O1HB 3I6BA 1QO9A 3V46A 3E9YA 1KPIA 1P1JA 4JU9A 4LS3A 4PLPA 3TAUA 3V7UA 3MMSA 4EW6A 2P9YA 2EFYA 3QENA 4H7DA 4ZDIA 5BMVA 1OU4A 5DEOA 3G8AA 3U3OA 3MD0A 4MWOA 2P9FA 1CEXA 3L49A 1G18A 3PD0A 1NI4B 2I1LA 3DMTA 3K8ZA 3GBPA 4LISA 4Y2JA 2XWBF 6REQA 2GO7A 1TM5E 1R8SA 1SC4A 2QM7A 2VUUA 1XQ6A 1BE1A 1JT9A 3KUCA 3PTZA 5CLFA 2R5WA 3PLRA 4H08A 2O2JA 2Q4RA 4Z4CA 1M73E 3GEMA 1C0LA 4Q03A 3MGGA 4II7A 1AHIA 1RM3A 1KXZA 2ORIA 4I9NA 3UYLA 1THZA 2Y92A 2AZTA 2OCIA 2UUPA 4OJKA 3FTEA 3COPA 4FE7A 1Y5NA 4QNMA 1ZINA 1CUAA 5P21A 3NBXX 3WL6A 4FHDA 4B75A 1C4OA 2J67A 4IHQA 5IT4A 2ON6A 1WVMA 3I01A 2VDKB 1Y33E 1YR1A 2MINA 4NFSA 3L0ZA 1W36C 4YRNA 3OEWA 4IOMA 3K0AB 2I6QA 5JADA 1R0ZA 4BTLA 2IE0A 5TGTA 4CF5A 4UUMA 1WU8A 5JAOA 2I66A 2NUAB 1OMOA 3IQEA 4QRIA 3TRIA 5AI8A 4HUQA 5E6RB 4M0UA 3STTA 5B6JA 4B46A 1Z36A 1JIQA 2YBEA 1QFYA 3DM9B 2ECQA 3T7SA 4DDHA 3ZS9A 1A4XA 4PZCA 3KTAA 1G2OA 3JVIA 4NY1A 4OKSA 4R8RA 5IABA 4BPBA 3VJKA 2YVKA 2EJBA 3NBQA 1PR4A 5C8DA 5IULC 3ZD7A 1KYQA 4LYFA 5HZHA 3P71T 3PC6A 3WNBA 2VLBA 4BATA 1V0JA 2XCQA 2B1RA 4HH1A 4X0EA 3GG2A 3GZ4A 4TTRA 4BTEA 2OQVA 2ECFA 4JXZA 1VPLA 3R5TA 4PIVA 5LP6B 2WSSA 4IGKA 5TQ0B 4QU8A 1CY8A 1SPBS 3PQCA 4M53A 1ZK3A 4C43A 4A2WA 1E9SA 3EWNA 1NUHA 2QXUA 4TTJA 4ZARA 3TR6A 4KQIA 3TVTA 3ZWAA 2XXAB 2IQ5A 4OIMA 1T8UA 3COYA 5DGHA 1NL3A 4IXWA 5DYIA 4D3SA 4EJSB 4M9CA 1U7PA 1Y3FE 1Z39A 3ZG6A 4DG9A 1RYFA 1MABA 3IAUA 5EE0A 3K9FC 1G7SA 1QK5A 2WMDA 3WWEA 2PJDA 3M3HA 4P3XA 2I29A 3EZ2A 3UIEA 3GLTA 5EJ5A 1SCUB 1G7RA 3IPRA 5JMTA 4ZALA 2V7XA 4JI0B 2OLJA 2XD9A 4DT1A 2FZWA 1JALA 4BN0A 4M88A 3KOWA 1RQGA 2TMGA 3R9WA 1M2JA 1RXSA 1VJGA 1YR2A 1U2SA 3DHWC 3I73A 3RU2A 2JHPA 2F43A 3BQNB 5CDFA 1QGAA 1YC2A 4N8EA 2CF6A 3GZTB 5SYAA 2AR7A 3KKEA 4Q9LA 4Y2SA 4EOGA 3MILA 3V9AA 5JQWA 4M7PA 1XRPA 2UZAA 1NP7A 1A27A 2WFZA 3O83A 4LX8A 4OXQA 5JDIC 3DV0B 2P4UA 4GXQA 1FYFA 1R4NB 2XKBA 3X1DA 1G8KA 2Q1TA 4Y6OA 4IS2A 4JJGA 2WJWA 2VNKA 3HJHA 4DJJA 4ZGBA 3ZV7A 1DO8A 3DKRA 3B48A 3G5MA 3GARA 4Y2XA 3RG2A 3TZKA 1N33B 1RMQA 2NADA 1GUZA 1T0BA 1RU3A 3KFLA 3I8XA 4JOSA 2MU1A 1ABBA 1I4WA 4FGJA 1PN3A 5FPKA 2RHRA 4P5EA 1B41A 1OXMA 5LQDA 4BFVA 4G9BA 5A2QA 2DR2A 3L4KA 4RYDA 3KALA 3O31A 4G4JA 4MV3A 4D3DA 2X6QA 2WTMA 2P11A 2OGSA 4DUPA 3O38A 1EXDA 4EG6A 3VHQA 4ZCSA 1JAXA 1Z63A 3GAZA 1K75A 1LW6E 4TOIA 3RSQA 1FDVA 1QX4A 3WMXA 5G40A 3MMXA 2ALJA 1SOMA 1YUBA 1X1BA 1YR6A 3E5RA 3FGPA 2Q6IA 1BXRA 1KMIY 2ZETA 4Q4HB 4RHFA 4GWLA 1SRQA 4GOJA 1YTUA 2RI6A 1WEKA 4J9UE 5DK4A 3SSAA 1GTL1 3ETGA 1NHGA 1SEVA 1VIVA 4PSVA 1RE0A 4R3UC 1EUCB 3EE6A 5CCDA 2XADA 3G8CA 1KQGA 3E3NA 3CUYA 1TT5B 1ZS9A 4DLPA 3NPAA 4JJEA 3UC9A 1MOSA 3DZFA 4ML3A 1SC6A 3BSSA 3E6AA 1BU8A 3KVRA 3FWPA 2M6SA 4IVNA 3OOJA 4G36A 1F0PA 5KNCD 1SOAA 3G0BA 1J2UA 2G0TA 3G3EA 1PJRA 3PSAA 3VO9A 5I7OA 5C8ZA 3Q10A 2RHBA 4FXOA 3ROQA 2GR9A 4YT8A 1KU6A 4PFJA 4Z51A 4X95A 1GEGA 2NO5A 1ZD5A 1YRBA 5BVHA 1RVV1 3A2LA 4V1CI 5CCBA 3WKBA 2JD0A 5IAKA 1TZBA 5K0NA 4RK5A 4DRZA 4E51A 4FYMA 3IIMA 1UCFA 4JP5A 5KC8A 5ER6A 4AMUA 4B83A 4EG7A 2YOGA 3FVTA 1LBSA 4XVRA 2IZ6A 4R40A 4B4VA 4JWKA 1DMSA 1JHXA 4KHPB 4UUBA 4B84A 4W5NA 2VJPA 3G2QA 4DLAA 1UKCA 3QYFA 4TYNA 2JEYA 3WK8A 2DJIA 2GEKA 1K7FB 2FP4A 1YZFA 3QOYA 3G2NA 3A1CA 2BGNA 2QGZA 2UXBB 2IPLA 1X19A 4GP6A 2PWPA 2X0EA 3PXUA 1G9SA 1C7EA 4MWZA 1L5ZA 1AXGA 3KOZA 4NZOA 4IDAA 5HCIA 4IRMA 1SU8A 4NR0A 3LUDA 5F3DA 3EXHA 3GUUA 4MGHA 1GVHA 1QR6A 3ORYA 2O2XA 3AKEA