1R88A

The crystal structure of mycobacterium tuberculosis mpt51 (fbpc1)
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
267
structure length
267
Chain Sequence
AAPYENLMVPSPSMGRDIPVAFLAGGPHAVYLLDAFNAGPDVSNWVTAGNAMNTLAGKGISVVAPAGGAYSMYTNWEQDGSKQWDTFLSAELPDWLAANRGLAPGGHAAVGAAQGGYGAMALAAFHPDRFGFAGSMSGFLYPSNTTTNGAIAAGMQQFGGVDTNGMWGAPQLGRWKWHDPWVHASLLAQNNTRVWVWSPTNPGASDPAAMIGQAAEAMGNSRMFYNQYRSVGGHNGHFDFPASGDNGWGSWAPQLGAMSGDIVGAIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MPT51/MPB51 antigen
publication title The structure of Mycobacterium tuberculosis MPT51 (FbpC1) defines a new family of non-catalytic alpha/beta hydrolases.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Immune system
total genus 89
structure length 267
sequence length 267
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00756 Esterase Putative esterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1r88A00
1XZEA 2BGRA 1R3DA 1EDEA 3ZWQA 2DQZA 4JEIA 3ZI7A 2I3DA 1ORVA 3BXPA 3HC7A 3U0VA 1UK7A 2PX6A 4Q3OA 2DCMA 3V9AA 5CBKA 1EDDA 1CUBA 3WKAA 4X85A 1UFOA 1XFDA 4FFWA 1XQVA 3G9XA 1QIJA 1GPNA 1C7IA 3R3WA 5DYWA 2VSQA 1IUOA 3GA7A 4ZV9A 3G02A 2Z8XA 4BCDA 4X00A 1QIGA 1UK6A 4N8DA 3C5VA 1G4HA 5CTAA 1ZGBA 2WJ6A 2W22A 3BWXA 3I2GA 2WUDA 1USWA 2WJ4A 1AKNA 5K3AA 4UPDA 1HDEA 3WYNA 2VA9A 4UFNA 5HF6A 2EEPA 5AI0A 3I1IA 4KE8A 2AJCA 2ZYHA 2ZSHA 3Q0TA 1E89A 2JGIA 3M83A 5AOCA 3WWOA 2CZQA 4KE6A 1D07A 1BS9A 2WILA 5ALGA 2ZSIA 5ALZA 5IVKA 1WB5A 3DD5A 1WPXA 3F98A 1XRMA 1TIBA 3VXKA 2J3QA 1MX9A 4U2GA 3FSGD 1DWQA 1BN7A 5CH8A 4BVKA 2H9YA 3G7NA 4LHEA 1UZAA 1UK8A 2R11A 3IUMA 5E2IA 3H2KA 3I6YA 3AINA 3HXKA 5DNWA 4WFKA 3SK0A 3DKRA 4WDQA 3HSSA 1A88A 1YR2A 3QPAA 1TQHA 5ALKA 1WHSA 4L9AA 3I2FA 5EIHA 4G9GA 5JARA 3I6ZA 3QMVA 1QJ4A 2X8BA 4QZVA 2ZYSA 2DHEA 3KDAA 3BL8A 2P8SA 5EHZA 3N2ZB 1XZJA 4M0FA 4C4XA 1R50A 4RE6A 5AKXA 1E66A 4AB1A 4Y2PA 2OG1A 3U1TA 1K63A 3IUQA 4DLNA 2AJ8A 4WY5A 5ALPA 5CT6A 5T4FA 5AM5A 2JGJA 1W1IA 3IULA 1F0PA 3WL7A 5JIBA 4HVTA 5A62A 4BYMA 2WG2A 3QZUA 5FV4A 1CR6A 3PI6A 3UUEA 5IH7A 2I3ZA 2DHDA 1PV1A 1CUUA 3WJ1A 2XUOA 4EY7A 2O2HA 4X71A 4LKOA 5H3HA 2XQJA 5LYYA 4JUIA 1ZIXA 1ODSA 1XZHA 1MN6A 3EIOA 3STVA 1JFRA 1KEZA 3D5EA 2FJ0A 5DNUA 4XIIA 1XQYA 2I78A 3FAKA 1UK9A 4ITVA 1CLEA 4KAAA 3QH4A 3WJ2A 4CG1A 1QZ3A 3DEAA 5IVIA 2VATA 4EZIA 2YASA 2Y6VA 2ZJFA 4H7FA 2Y2UA 1IZ7A 2O2GA 4N5HX 1CUFA 1JMYA 1AX9A 3O95A 5CT8A 4OYLA 3IA2A 2BCEA 2HA5A 3DLTA 1IVYA 2PVSA 1CUHA 3O4HA 5AI8A 4XJVA 3C6ZA 3PFCA 5JYCA 4TGLA 3WKEA 4I19A 1CQZA 3FYTA 3F67A 1ZJ4A 2OPHA 1LPMA 1TCBA 5AOBA 4J0JA 3RK4A 1E8DA 1ZOIA 2Q0XA 5HF9A 4PNZA 1SC9A 5AOAA 4OSEA 5JAHA 1K4YA 1CUJA 3LIPA 4TVKA 4OD0A 2ONCA 5ALFA 1DTEA 1X70A 4N8SA 4UBLA 3WK5A 4H35A 1A8SA 2WIFA 4Q05A 2C0QA 5AICA 2Z5GA 3ESAA 2XUFA 5D6OA 1XZBA 1LPPA 4IH9A 5SYMA 4YX9A 4AQDA 4BVJA 4E11A 1SOMA 3KD2A 1FFAA 5DWDA 1MAHA 5E4JA 2JGKA 1PJAA 1GKKA 3WI7A 1UXOA 5T4HA 3O4JA 5A7HA 3ESBA 1JU3A 4QDXA 5HF8A 3R3ZA 2CJPA 3AJAA 3WWDA 3W06A 2DHCA 3OPMA 1Y7IA 2J4FA 2QJRA 1XZIA 3UUFA 2E3JA 3FOBA 4BZZA 3IVMA 5AKEA 1YS2X 2O2IA 3DKKA 4B9AA 4CCYB 5IKXA 5FKJA 5HKBA 4HXEB 2QRUA 4KJXA 3G0CA 3WWPA 4AZ0A 2JGFA 1KU0A 4CG2A 2VEOA 4GECA 3EBLA 4G8CA 3RKSA 4P92A 5JAOA 1UOPA 2ZYIA 2XUGA 1H2ZA 3CCBA 4QLOA 4X94A 1HBJA 1VE7A 1YCDA 3GBSA 1GPLA 2WFMA 1YSCA 5C8XA 2WTMA 5ESRA 1S8OA 3N0TA 2WQZA 3STUA 2V9ZA 1T2NA 1EK1A 3OTQA 1CUVA 5BWCA 3LLCA 3R0VA 5ALLA 5LZ5A 4AO7A 3CXUA 4OB8A 5ALYA 4PF1A 1W75A 2VT6A 1CPYA 4X92A 1CV2A 4C01A 1YB6A 1J06A 1U65A 2QTBA 2WIGA 3DQZA 1M33A 1SCIA 2H7XA 2RGUA 1BN6A 2DQYA 4G4JA 1GQSA 1YA8A 4OCZA 1MU0A 1SCKA 4W1SA 3SC2A 1YASA 4CIAA 3PFBA 1QO9A 4FNGA 1C4XA 3RM3A 2GBCA 1XZMA 1CFJA 2DFPA 1YB7A 5BOVA 2XUAA 1P0IA 4G9EA 5JALA 2IX9A 3KSRA 1CVLA 2O7VA 5ALIA 1XRPA 4DGQA 4X3CA 2WFLA 3DNMA 4HRXA 2WHPB 3WQHA 4GHWA 3W04A 4HZGA 4ZV7A 4DSZA 4I4CA 1TAHA 4PSDA 1QIDA 1XLUA 3DYVA 3SX4A 1J2EA 4H7HA 3H2IA 3FYUA 4OYYA 1BROA 3H04A 3VJMA 5T4BA 3AUKA 4FLEA 3VVMA 4QA9A 5JZ9A 4MXDA 1LPAB 5AM4A 1THGA 2BAGA 5ALNA 4X90A 1ACJA 3D2BA 1XRRA 5ALDA 3WK6A 4CIBA 2VJCA 4RPCA 4EBBA 4CFSA 4CI9A 4BP9A 3QM1A 4UBMA 4EA6A 5ALTA 1JKMA 2BUBA 5EI5A 5CH5A 1NU6A 1L7AA 3ICWA 4ROTA 1E8MA 4QLAA 5DLPA 1ZIYA 2B61A 2WU4A 4CG3A 5ALQA 2BJHA 1Q0ZA 2XMRA 1DWOA 4LIPD 2ZYRA 5AKJA 5HCUA 2PM8A 4C89A 3WL6A 4KACA 3ESDA 4M0MA 1FFBA 2QVBA 4FBMA 5AM3A 4BDTA 1YA4A 2WSLA 1CUZA 4E14A 1I6WA 3GZJA 5AKYA 2W6CX 2K2QB 5AIAA 1THTA 2VT7A 4EY4A 5I8PA 3DS8A 3OURA 2XQFA 4EUSA 1CUSA 4AXBA 4FLMA 4ZXFA 4KAFA 2R8BA 4OPMA 3H18A 4FWBA 5C8VA 5CT5A 4Y2XA 4B6GA 1Y7HA 4LYEA 2IIVA 4NMWA 5HK8A 4PW0A 1FFCA 1VZ2A 1L7QA 3D2AA 2HADA 4PQEA 4BRZA 2OAEA 2AJBA 2C5FA 1T4MA 1DINA 3L1IA 2JGMA 4ETWA 4BZWA 1XZCA 1XZAA 3ZPXA 5HF5A 4L3WA 4B80A 2HU8A 5LZ4A 3R41A 1QTIA 1AGYA 2HU7A 3O9VA 1B41A 2HA6A 3BJRA 1ZGCA 2D0DA 5K5EA 4DTCA 4WJLA 1AMNA 1XRQA 4X7BA 3IUNA 3D3NA 5AKLA 3WKCA 2G4LA 1X2EA 1TCCA 1MX5A 4JYMA 2GBIA 3ESCA 2QUBA 1VJ5A 1UT6A 1CUGA 2ACKA 2OGSA 5AI4A 1IZ8A 5DYYA 4INZA 4MEBA 4J0GA 1Q84A 4S0XA 1DT3A 2WFLB 4PV7A 1A8UA 1UKBA 2OCIA 3T4UA 3OC0A 1LBTA 1MNAA 4J0IA 1VZ3A 4FHZA 1EK2A 4UHEA 3PICA 3AZPA 4Y2VA 3FYUB 1E3QA 3BDVA 5AKZA 4PSUA 3PUIA 3HEAA 1LZKA 4CCYA 2QS9A 1TCAA 3QVMA 3I2HA 1HKHA 4KEAA 5K3DA 3AZQA 1EXWA 4GW3A 4EB0A 3A6ZA 1QTRA 2XMSA 4BP8A 1DU4A 1XLWA 5I9IA 3G0IA 5A7GA 4PSCA 3B12A 1QFMA 4X6YA 4DNQA 4KRYA 5KBYA 2QZPA 2XQIA 5IVDA 1R9NA 4FDMA 5JZSA 5JD4A 5A2GA 1Y37A 4UBIA 4HS9A 5EFZA 3V48A 1XROA 2GZSA 5ALUA 2CKMA 1JJFA 3ZV7A 4K6KA 1F6WA 1BEZA 4GBGA 2CB9A 4Z49A 2V97A 4NS4A 1WCYA 3G8YA 1TKRA 5AKHA 2WUFA 5AM2A 3YASA 1EVQA 5CW2A 4J7AA 1LPNA 4BCBA 1UKAA 5LKRA 3F9CA 5EHQA 3GELA 4CCWA 5AM1A 1JT2A 5ALOA 3C8HA 4IH4A 2G63A 4MEAA 2YXPX 3STYA 3DL4A 1BE0A 5CURA 4XX1A 2GBFA 2ES4A 5J3JA 3R3XA 3WIOA 3FLEA 4XVCA 5K3CA 3VKFA 5LZ2A 5E4YA 4H7KA 4DNFA 3STXA 5K3BA 4BB0A 1LGYA 1XQXA 3AILA 1VE6A 5JD5A 4FKBA 5CXXA 5DJ5A 4BVLA 3STWA 3E4DA 4HXFB 4DNOA 1MAAA 2WFZA 1GT6A 5CMLA 1K6EA 1ODTC 3WWCA 2BKLA 5I7UA 4H7JA 1QIMA 5JAPA 2Y2VA 3WKBA 3WK7A 5AJHA 1QIFA 3HABA 1XZGA 3EQ9A 5ALHA 1XKLA 3M81A 2WHPA 4TPKA 1ISPA 1E8NA 4JH0A 2RHWA 1QIEA 2Z8ZA 2XUIA 3WK9A 4Y2UA 4OB6A 4W63A 3FWHA 4HTAA 1JU4A 2NW6A 3H1BA 2D5LA 5LP1A 5ALEA 1C7JA 2XMQA 3ZLVA 1EH5A 4WFJA 2GYWA 1DQYA 2WKWA 5FDFA 4BAUA 1F8UA 1ORWA 2FUKA 1HLGA 3O4GA 1H2YA 3I2JA 4A5SA 3G9ZA 5ALMA 2AJDA 1G42A 4ZREA 1EINA 3EQ7A 2PSHA 3DJYA 6YASA 3BF7A 4N5IX 3T52A 3S8YA 5IVHA 2GYUA 4DMKA 5ALSA 1H23A 2PSFA 1XKTA 1HL7A 4J0HA 5FPQA 2VJDA 1N1MA 4KYVA 2V98A 3DCNA 2XLBA 2JEZA 3KWJA 3LCRA 3C8DA 2VJAA 3WIBA 5SYNA 3EF3A 4GXNA 3V1KA 4RNCA 4OU4A 3HJUA 2Y6UA 4X6XA 3WK8A 2H7YA 3QPCA 4GI1A 5DTJA 4DIUA 1R4ZA 1CUAA 5C7YA 1WM1A 1AUOA 2CEKA 1LZLA 5HFAA 1IUNA 1G66A 1WOMA 1QOZA 4U2BA 4IH1A 4BE4A 5AK4A 3NOXA 1KU6A 4QE3A 5K3FA 1X2BA 3H0CA 3NUZA 4KRXA 2HIHA 3E1GA 4KAJA 1FJ2A 3DOIA 1EHYA 5AP9A 3W05A 1L7RA 4BE9A 3STTA 2ACEA 2G5TA 5EIAA 3EQ8A 3I2KA 4IHAA 3IUJA 2HU5A 2DR0A 1TRHA 4BCCA 5CT4A 2RHTA 2HA7A 3AIKA 2XUHA 1J07A 1O6FA 2IITA 4P08A 4L72A 1VLQA 3D2CA 1DT5A 3BE8A 1EX9A 4G1FA 2ZJ6A 2YYSA 3NGMA 2PKYX 3JWEA 2PSDA 3GROA 4J0CA 4GDMA 2B9VA 4B0OA 1AZWA 1YS1X 1GXSA 4YPVA 2WLSA 2XQGA 4DMFA 2FX5A 5T4EA 2C5GA 3WZMA 3G9TA 1EB9A 4EY6A 1MNQA 3CN9A 3ANSA 2HFKA 7YASA 4OU5A 2RONA 4B7ZA 1K5PA 3RLIA 2GZRA 1YAJA 2C0PA 3E0XA 1A8QA 5AIBA 4QEKA 2VTVA 2HA0A 2JBWA 2RI6A 3C43A 3FNBA 5FP0A 2JF0A 1GQRA 4W1QA 4BDSA 5ALWA 4J0DA 5FUMA 2VF2A 1WPRA 2HFJA 3ZLUA 4AO8A 1EI9A 4ZGBA 2BGNA 3G0GA 1FFDA 3DOHA 1CUXA 4UBNA 2GYVA 5LIPA 3FCXA 1P0MA 1WHTA 4HXGA 4UBKA 5HKAA 2C4HA 1HPLA 3C45A 2PL5A 3SWWA 4UHCA 4AMZA 5BWBA 2Z3WA 2OQIA 2PUJA 3H2GA 5DTIA 3TJMA 5JZBA 1UOQA 4HRYA 3F96A 2XDWA 3WL5A 4F5ZA 4MQMA 4W1PA 3KOOA 3R3VA 2X5XA 5FRDA 1QFSA 2XLCA 3FSGA 3K6KA 4BTVA 5CRIA 1QIHA 3TGLA 1VKHA 4C4ZA 1XQWA 3V1LA 1JI3A 1DX4A 3QMMA 1PFQA 1B6GA 4FOLA 1ZICA 5D3KA 2C7BA 3VVLA 4KR0A 4BC1A 4NVRA 3FVRA 5C81A 2WU3A 2XUQA 2QXTA 2BUAA 5D7BA 1FSSA 2PUHA 3WZLA 1QE3A 3QBJA 4P9NA 3VJLA 5YASA 3MGAA 2QXUA 2JEYA 2ORYA 3PDCA 5EHNA 3QMWA 1CUCA 4M0EA 1CQWA 5AI5A 1H2XA 3A2NA 2GBGA 2XMDA 3K9BA 2I03A 2H1IA 4Y7DA 2OCGA 3IDAA 4UBOA 3HI4A 5K3FB 4YK7A 4EY5A 3O9MA 2ZJ7A 1OXMA 1TK3A 2ZVDA 5LZ7A 4BRSA 4C4YA 2XUJA 5FOQA 5HQ3A 3P2MA 3H2JA 3WWEA 5JD6A 3FYUC 1N8SA 4GWLA 2HRRA 5FPPA 2UZ0A 1ZJ5A 1WB4A 4JNCA 4W1RA 4G4GA 2WUGA 2PSEA 2WUEA 2VAVA 2HDWA 3Q8WA 2PU7A 2J3DA 3G9UA 4MJ3A 3V1NA 3QITA 5AKIA 3BIXA 1CUEA 3D0KA 3HLKA 3M82A 5CH3A 4AX4A 4QWMA 3IIIA 2XUPA 4BTLA 1ZI8A 4AO6A 3RARA 3ED1A 2CUTA 4QWWA 2HM7A 4L0CA 4KE7A 2XMCA 3V1MA 1RWQA 2XMBA 3WKDA 4Y9SA 5FXMA 4UBJA 1IUPA 2C58A 4H7EA 4O08A 4QDTA 2J4CA 3MUOA 4C87A 4MYDA 1G5FA 4PO3X 4UFPA 4H7DA 2CMFA 5AM0A 1N5RA 2OAGA 4RE5A 2QJWA 1AURA 3UMJA 5ALJA 3C5WP 1VA4A 3TRDA 3G0DA 4FFVA 4AZ3A 5JAUA 4ZI5A 1QONA 2XMGA 1NX9A 3GUUA 5CXUA 2OCKA 1BU8A 4LXHA 4Y2RA 1O6GA 1U8EA 4BBZA 3R3UA 4V2IA 1XRNA 2QUAA 3FCYA 4I3FA 5HZGA 3A2LA 4LXGA 4ZWNA 2WIJA 4RGYA 1U4NA 1H2WA 4BATA 4WFIA 1E5TA 2WG0A 4G4IA 5AHXA 5A71A 1SCQA 5AH0A 2JGEA 4OB7A 1EA5A 1ZD3A 1CRLA 4J3JA 1GGVA 4MWSA 3C87A 1XRLA 5JATA 4FBLA 4DMHA 4B84A 4X6UA 5EGNA 3IURA 1MO2A 4B81A 4HAIA 1Z68A 5ALVA 2RAUA 3R40A 3LS2A 3GFFA 3HACA 3DYIA 3O4IA 1SFRA 2XE4A 1R88A 4BAGA 2OCLA 1ACLA 2XQKA 1LPBB 5BV7A 1UWCA 4W9RA 4G8BA 5KREA 5JASA 4BAZA 4K6HA 4ARAA 4AMYA 3MVEA 4F21A 1U2EA 2BUCA 4EHBA 5E4TA 2G5PA 4WDRA 1HQDA 3PF8A 1XLVA 4H18A 1W76A 4EY8A 3L1HA 3WMRA 3H1AA 4K5QA 4Q3LA 5HQ3B 1QO7A 2WHQA 4U2FA 4LYDA 2OLEA 4J0KA 3ZLTA 2PPLA 5AK5A 4QDZA 1R1DA 3WLAA 3FBWA 3R3YA 3WK4A 1MJ5A 3VJKA 1CUWA 3B3QA 1UOOA 3QPDA 5AO9A 2WHRA 3OOSA 3IB3A 2WJ3A 1MTZA 5DYTA 3LIIA 3H2HA 3BJMA 1OCEA 1EVEA 1W6RA 3C70A 4G8DA 5LZ8A 4F60A 3E3AA 4LXIA 2OGTA 3CN7A 3AZOA 1RYYA 1UKCA 2QMQA 5A7FA 2WIKA 4UHFA 5EHXA 5LLSA 1ZD2P 4B9EA 5C8ZA 2XI4A 1JJBA 1VXOA 2AXEA 1MPXA 4MWTA 3FLAA 3B5EA 4UHBA 1BCSA 1CEXA 2XMZA 3HZOA 2XUDA 1CUYA 4X95A 2Z3ZA 4UFOA 2EDAA 3BIWA 4Q82A 2HHAA 3VDXA 4FLFA 1QIKA 2CBGA 4J03A 2PU5A 3LP5A 3AIMA 4B0PA 3A2MA 3FVTA 2AJLI 4E46A 2VJBA 5HK9A 2HA3A 1NU8A 2EDCA 1YAHA 4ZRDA 4Y2YA 3I28A 1CUDA 1VXRA 4B85A 3KXPA 2RIPA 2WTNA 1K8QA 4U2EA 3C6YA 2OXEA 1GKLA 4U2DA 4Q3KA 1N5MA 4B83A 2JIDA 4DYHA 4C88A 2HRQA 2QKYA 2XT0A 2QT9A 2HA2A 2QM0A 1BRTA 1OILA 2FJPA 5AI9A 4XWGA 2WM2A 1ZI9A 3PF9A 4AN0A 3ILSA 3DL7A 3F97A 4H0CA 3PUHA 2YH2A 1VA5A 1W4LA 1IMJA 4F0JA 1AQLA 4Y2TA 3I2IA 4DM7A 2WG1A 3MUNA 3AIOA 1JMKC 5JADA 3OM8A 3C6BA 2QR5A 3KWFA 4P93A 4D9JA 2XB6A 4WY8A 5JANA 1GPKA 4Q34A 2Y1KA 1WB6A 5D3ZA 4C6HA 4MYSA 3VISA 3C6XA 5FLKA 3IBTA 3W9BA 1A7UA 1JJIA 2BFNA 4U2CA 1QIIA 1BEEA 3NWOA 4OUKX 4IO0A 2OQVA 4FNMA 1P0PA 5LZ9A 1XZDA 3WYDA 3D59A 5AI6A 4DSAA 2H7CA 3O0DA 4A23A 4QNNA 3ICVA 3JYHA 2OGZA 5AK6A 1J1IA 1LPSA 1AC5A 1F0NA 2HL6A 4ARBA 4YASA 1XZLA 2DSNA 2B20A 5A6VA 1ZD5A 4E15A 1ZD4A 5LKAA 1FFEA 4X91A 5ALRA 1MX1A 3DDUA 4NZZA 3W9UA 1W52X 1LNSA 1ZI6A 2ROQA 2VAXA 1XZFA 5AK3A 5F4ZA 4Q1VA 5K3EA 1H22A 2VQ6A 1VOTA 2HA4A 4K2AA 1GZ7A 2JGLA 3HYSA 1DQZA 4X93A 4N8EA 3WA7A 1QGED 1XZKA 5EIEA 5HFNA 1P0QA 2LIPA 1EDBA 2WIDA 3D7RA 2QOEA 4UHHA 3PE6A 4G5XA 4UHDA 1LBSA 3TEJA 4FTWA 4X97A 3JW8A 2PSJA 2B4KA 3BDIA 1R9MA 3W2TA 3BF8A 4Y2QA 4GLBA 4WCVA 3H19A 4KE9A 3A70A 1LLFA 5ISMA 1Q0RA 4FMPA 4H7IA 1LPOA 4BC0A 2X76A 1QLWA 1MT3A 1Q83A 5AKGA 4IQ4A 2O7RA 4Y2SA 3H17A 4JYPA 2PBLA 3OG9A 3AFIA 3WL8A 3F8SA 5DNVA 1ETHA 2ECFA 4QDOA 3HRHA 1CIJA 5ALXA 3S2ZA 3K2IA 3D4LA 3CCCA 1ODCA 4Y2JA 5AKKA 3ANTA 4H77A 4DMCA 4AN1A 4B82A 1EB8A 3L1JA 3G0BA 3QYJA 2XUKA 3I1YA 4DNPA 4GEGA 4A16A 3I6MA 4UUQA 1CUIA 3M3DA 1RP1A 1DX6A 5CT9A 3WA6A 4QDUA 1BCRA 1DWPA 2V96A 4MQLA 5KWIA 5KWJA 4K6GA 3FLBA 3X3HA
chains in the Genus database with same CATH superfamily
1UJMA 2A33A 1VRWA 1V1JA 4UCFA 4AKIA 3G3EA 2HCTA 1NJSA 3VC1A 2J9ZB 3ZWQA 4JEIA 1ECFA 3EBOA 1M34E 1P72A 1CZUA 2H4HA 2QRGA 2V7EA 2Y68A 3A6EA 3HDTA 3HC7A 1FDUA 2V6BA 4WI1A 3DEIA 5IXSA 4UJ3A 5JI2E 3U0VA 1DAKA 5IAKA 3CU5A 3M6IA 3PXDA 2WYVA 1FFXA 3V9AA 1XO1A 2ZWOA 2WWWA 1E1MA 1V8BA 1FVFA 1TQ6A 2E37A 3BGOS 3HKBB 3UCFA 4KMOA 2LW7A 1QTNA 2QUKA 3PQ3A 3OIDA 4TXNA 2VBCA 3NHPA 2UZIR 4UUOA 1YL7A 4FCWA 3T7TA 1LJLA 2IHTA 5T6BA 3GGDA 5BW5A 3FPJA 3RRFA 1OF1A 3WKAA 3LX6A 3RC8A 3E61A 1E60A 1PQWA 4I9HA 3UWKA 2G82A 1LV7A 4ZRNA 3KJIA 5EWLA 3VZBA 5JSUA 2AYZA 2G1AA 4DHWA 3HCAA 3RIMA 2WZQA 4I1YA 4M8KA 2F9FA 4CM9D 4ESOA 2AR0A 3O38A 4TYWA 1DGQA 5DNDA 1C7IA 2GVZC 2JI6A 2RHMA 3Q6MA 1GRQA 2YWRA 1IUOA 3IUEA 4ZV9A 2V7XA 4MW6A 1UK6A 3H7IA 4N8DA 1SQSA 3I1JA 2OCDA 1ZHOA 3LJKA 5HMLA 3ZWYA 3PUKA 4JJFA 5JCOC 2JLWA 3CLKA 3CMMA 3BWXA 3FKSA 1PJ8A 3I2GA 2GBLC 4DIBA 3JR3A 2HCBA 2X8WA 1MP0A 2J0UA 2HBQA 3VHXA 1U98A 4XM0A 5IDWA 2OYRA 2NOAA 2PFSA 4W7HA 1O96B 4UPDA 3GVIA 1HDEA 3A4LA 2PJDA 3HY4A 1R9JA 2QD5A 4RHYA 2EEPA 2F7SA 1QR6A 3RC2A 3BIJA 3U09A 4KE8A 3ICQB 3ENWA 1YRQA 2A4KA 4HGOA 2VUHB 2HJVA 2HNAA 3I39X 4GPD1 3I01A 3ZV5A 2AV6A 4EJSB 4MR7A 5HJ7A 3ZVNA 3M83A 3SQOA 1NF2A 2ATCA 3WWOA 2VPYA 2CZQA 3OM1A 4EENA 3I6BA 6CHYA 4NEQA 1UP4A 1AQIA 3M6LA 2I54A 2Q49A 5ALGA 1BOFA 1INLA 1H6DA 4J1NA 2Y1OA 4HZUA 5ALZA 4FB5A 2G9UA 3C7AA 3AH8A 4GQIA 5KYWB 2IF0A 1FX0A 3VR3A 4C4SA 1U04A 4KG7A 1V3QE 3HKDB 1BW9A 5BQPA 5CDHA 2GQ0A 2VLBA 3KQSA 4C0HA 1TIBA 2JAWA 1T2EA 5AUPB 2I6TA 3R9WA 2G1PA 5LXTB 3MD9A 5I8ZA 1RHKA 3FSGD 3W77A 4ZQHA 2YICA 3SQMA 3C24A 1XEWX 4F5EA 1TF2A 5HNKA 1W30A 1J0AA 1Q3TA 1UZAA 2B6HA 2AXNA 2HV8A 3LD9A 2H9IA 3PLNA 4GL4A 4YI5A 4IDFA 5E2IA 3GJQA 4AXXA 2JCGA 3G13A 4CLEA 4RHUA 4E5VA 1VYUA 1V8FA 1CS4C 1BKDR 3L7JA 1G3MA 1QQ7A 5DTQA 5JDIA 2RHHA 4M9ZA 4YJ2A 2ZE6A 3U80A 3SK0A 3RSQA 3HSSA 3RSCA 1SELA 5BWLA 3LLSA 5E4FA 1IM2A 1SO8A 4L0DA 4KITB 4FYJA 4R1TA 4RM3A 3FNHA 3UAOA 2V0GA 2QR2A 3O3OB 2BV3A 2PTHA 2VWHA 1C8VB 3AF3A 1SKYB 1UDXA 4L9AA 4A5OA 3RAFC 1KBQA 4CW7A 3RS9A 1RMQA 2HJ9A 2XZTA 3EUAA 3S7ZA 3V4SA 3K8QA 4G9GA 2FWRA 5JARA 1R5OA 1T5HX 1Z4IA 2C7VA 1GL3A 3UUWA 3ZW7A 2PX4A 3QMVA 1NR5A 2RGNA 1QPBA 3QFHA 2ZYSA 3CKKA 4NZYA 2LCIA 1ZMOA 2GUWA 3LAWA 4P7KA 4XQGA 3O83A 4BLPA 3F6CA 1DJQA 1ZUHA 1Y3CE 4R9SA 4RZSA 4GOKA 2VS1A 3MJSA 1E77A 3BG5A 1EM8B 2Q5QA 3G2MA 3OKAA 4IFEA 3C3JA 4ZT3A 1WMFA 5CVDA 3DMYA 3I58A 3HY6A 4DA0A 5JU6A 3RKRA 1RM5A 1Y9JA 4C4XA 3EXAA 1R50A 3RQIA 4UMVA 3W2EA 5SICE 4JJ7A 1ZAKA 1OIWA 1RC0A 4JLPA 1JLKA 2CWDA 1BD4A 2R3SA 2UXCB 1VMEA 4N5LA 1O08A 1SUWA 3D7KA 5BW4A 3U1TA 3FRHA 1NN1A 1K63A 1TYBE 3IUQA 4HXYA 3I45A 3AF0A 4ZVUA 3SOZA 3D4PA 3LKVA 1N2OA 4I4TB 4WY5A 5J4LA 5CT6A 5JS2A 5T4FA 3ETEA 2F43A 3QWAA 3GAZA 3HCWA 2C83A 3M89A 4G97A 4URXR 4JQCA 3M70A 3QHAA 2H63A 3MINB 2WYHA 4N7BA 2YCBA 3IULA 2H1SA 3BAFA 3UT5A 2C78A 1SBIA 2PGIA 2ZE5A 2ZCVA 3GGSA 3CNQS 3M4YA 1W9HA 1R0SA 3OIVA 4HVTA 5FTLA 5KTPA 1FQKA 1U7DA 4KRGA 4P38A 2XRMA 2FRVA 4XLZA 1CY7A 1COWD 4BYMA 3C5HA 1MEEA 5M04A 4MUAA 4MW2A 1CR6A 3OQMA 1FFYA 3CLHA 2EC5A 3C3YA 3GJYA 3TTTA 5IH7A 1SXJC 4R8VA 1A9XB 1IHPA 2W6ZA 1VLVA 2R1VA 2RH4A 1XYVA 1SJ9A 1V39A 2C1XA 2IY7A 3FB4A 4XUCA 1CUUA 3FWZA 3MJVA 4MUMA 5B7GA 1LI4A 1V5FA 1I1QB 4C06A 4YBZA 1B43A 4I81A 4WACA 1AHNA 1Y8QB 1ZN8A 2PGNA 2G5GX 4RHXA 4EB6B 4L4YA 4BPRA 5LNK6 3LZCA 1KOGA 1E5DA 3GHYA 1EUZA 2B4YA 1O97D 2C29D 5J4VA 5HX7A 3RC1A 3OZCA 4GPIB 4R5HA 1SZDA 5F3DA 2QW8A 2J3EA 2ZYWX 1PQYA 1LRLA 1ODSA 4MZDA 3TX6A 3ZGXA 3PL1A 3JY6A 4F7WA 2FFHA 1EDZA 2YNMA 3U44B 1JTVA 1QFJA 3SLKA 3Q72A 3KOWA 4MYHA 5FJJA 4DLLA 1K4KA 1IBKB 1V8ZA 2CLFB 1Z3CA 2O3QA 3AR5A 3DFZA 5JW6A 1LDBA 4R16A 2O7NA 1YK0A 1PHPA 2Z2JA 4M1YA 1J49A 4XTCS 4X8OA 1QU2A 1XQYA 3WFIA 3U3XA 5GJWC 3RUIA 3FAKA 3L8YA 1OIVA 3QXSA 5GONA 1CLEA 2QJFA 3KEGA 1E63A 3AUUA 1JS1X 3IBSA 1NVMB 1VL1A 1ZGJA 3DZIA 4CG1A 3K70C 5WRFA 1QZ3A 1QP4A 1ZK4A 5DULA 3DDCA 5IVIA 5JVDB 5TS3A 3MK31 4INPA 4WKCA 4KX5A 4PAMA 4DRYA 2JGDA 4EZIA 2F3UA 3KZMA 1HNZB 3QUCA 2IDMA 2Y2UA 5JY6A 3AF5A 1WPQA 3ILHA 2EJTA 2O2GA 3EIUA 4RX1A 4XVQA 1IPHA 3EPKA 4CT5A 1EWKA 4KUEA 5F12A 2AHOA 4ENPA 1BDBA 2C2HA 3FPEA 1JMYA 3PRYA 2W2PA 1JXMA 3O95A 1OZ0A 4IYJA 5CT8A 1X86B 3QUTA 5IH3A 4BJ1A 3OZFA 3E22A 1M83A 4DGSA 5A1JA 1YR9A 5EWLB 2YV4A 2WAXA 4URFA 4NE9A 1L7PA 3TLYA 3WP0A 3VZPA 1YU6A 5DM70 2VHWA 1CUHA 1Z7WA 6REQA 4FKMA 4OAPA 1IXZA 1GTG1 1V8DA 3EZGA 3IQZA 2JA2A 2VI5A 5AI8A 4CM3A 4M7OA 1DQPA 2G0AA 3U4QB 1GYRA 3O82A 2QV7A 3L4BC 1KIMA 1I5OA 2L19A 4HNUA 4Q9KA 4YO8A 1N92A 2AD5A 3AI1A 1N75A 1R8QA 2DPGA 1Z8FA 4PAOA 5LQDA 1JFLA 2VHZA 1ISHA 1OYVA 4Q47A 4OYHA 1DUVG 4C3UA 2I6SA 1L9KA 1P61B 1PT9A 1XL1A 3WIEA 3F67A 3KHTA 4GX2A 2AZXA 1BFDA 4ZCSA 3PK0A 1GQQA 1A95A 1GPH1 1TKAA 2H1WA 4KIFA 3VHXB 1R4MA 3MSXA 1LXCA 3BFKA 2PRIA 4J0JA 4CT4B 1O8CA 2GLTA 1FMFA 4H1UA 3PXXA 3A1CA 3KSMA 2ZCUA 3TTXA 3WNZA 4HMPA 3EWNA 3KDPA 4FS3A 1QQBA 1Z7YA 1U2DC 1N0HA 2CMKA 1PJRA 2Z8YM 3WMWA 4PNZA 1SC9A 2OECA 4C03A 1XDUA 2RJNA 4GWKA 2VXOA 5ENVA 1C3LA 1BC5A 4OSEA 2J6IA 3ETLA 5AW0A 1VYTA 3NV9A 1B6RA 1K4YA 2IUEA 2E4VA 3K1YA 4AS1A 3LIPA 4G4SP 4GICA 4NIMA 4II2A 2JJ2A 3I9MA 4DHEA 3UAYA 4GEKA 1N5LA 1T8PA 4W9MC 4BO9A 4P84A 5C1IA 5ALFA 1T9DA 1KQOA 3P9YA 4HYYA 2VBIA 4HZUB 3AR7A 4RPJA 4MUNA 1DBIA 3SBXA 1P9OA 2EAUA 1FX0B 3UMMA 3K70D 3G2QA 5CB8A 1A8SA 2NZ8A 1HT3A 1BW9B 3ZK9A 2PR2A 2FW8A 5AICA 2C0QA 5A03A 3A6PC 2Z5GA 1P2BA 4KR9A 3HG7A 3OM0A 1E2NA 2WF8A 4IH9A 3JWPA 3UHPA 5CITA 1DFIA 1F3LA 3QKIA 2DUMA 1QHGA 4ZC8A 4BVJA 3TOXA 3W5JA 1LFAA 3OQPA 5E3IA 4DIEA 4CCSA 2FN7A 4RQTA 1MAWA 1KNXA 2LPMA 4L08A 7AT1A 4G25A 1ZG3A 1WABA 1NYLA 4MV6A 4MGKR 3EVDA 1EGVB 3E7WA 3SYLA 2C4TA 5JJKA 2BMDA 1JEOA 1MAHA 2P78A 1OFHA 4WCFA 2I4RA 2MYUA 3DB1A 3HJCA 3IVXA 3KZNA 4Q37A 5KVSA 1NFRA 4WESA 4IJKA 1QGYA 3DGFC 5FD8A 5KSZA 4QJ4A 2BMEA 3FA2A 2HSJA 3MWEA 4S2UA 4XKJA 1PJ2A 1Q2UA 4WKOA 3CNNA 3PWKA 3QVUA 4C43A 5A7HA 3ZDRA 2Q50A 3IALA 3B7PA 3DXYA 4JJIA 1QP7A 1CK4A 4NZOA 2A0XA 4EVSA 2ORVA 3WWDA 3AJAA 1OSNA 1C2TA 3TD6A 3TOSA 4NONA 2DHCA 1Y7IA 1JF8A 3OA0A 3UUFA 2Q21A 2ZK7A 3V2IA 2JCVA 3TIXB 3FOBA 3A1WA 3ISVA 4DL9A 4KSYA 1E5XA 3W8EA 4EM6A 3SHOA 2EKLA 1M8KA 2D2IA 1TGYA 2PUCA 2IYSA 5TT0A 3OLYA 5TQJA 4FD2A 2P41A 1PWYE 4NR0A 1PFKA 1D1TA 1YS2X 3DKKA 2WAYA 5EVJA 2JLXA 2H1FA 1XHEA 4EKGA 5IKXA 2QTWB 4P86A 4HXEB 4U39A 5ER9A 1J0CA 2YN4A 3LZDA 3IAHA 1T34A 2IZ5A 5IRCD 3WWPA 2CVHA 2H92A 4FQ7A 4RGBA 4YRRA 4JKOA 2YV5A 1C3JA 4RCVA 4KVFA 3OQBA 3TIVA 2F43B 1F8FA 3BN3A 3VYUB 3NBMA 3EBLA 2YTZA 2MMCA 3O91A 2ZUDA 2X4IA 4JX9A 3UT5B 4P92A 2YJ3A 3PFNA 3QVWA 1TEXA 3I6IA 3KUUA 4LX0A 3C98A 3NHRA 1BHQ1 2C4MA 1N3YA 2XVAA 4RWEA 4WZBE 3UMVA 3VR0A 1B6SA 3JXEA 1KBOA 2HBYA 4GPTA 1TM2A 1E79D 2QPOA 3KQQA 5LA6F 2B0JA 2IUSA 2ZB7A 3C39A 4MV4A 4PGAA 1GZUA 3CCBA 3H7AA 4I1SA 4YJFA 5P8WA 3ADBA 5EIXA 3T3OA 5TS2A 1HBJA 1VE7A 5IK2D 1AXRA 1ZHHA 3CZMA 1YJCA 4LC9A 1KK2A 1YSCA 3TVDA 2C4KA 4KWHA 5DM60 1RAIA 4HKTA 2B30A 2A67A 2QMOA 5C8XA 3ZV4A 1SUAA 5B2EA 4RMIA 1S8OA 2NZXA 2PH1A 3EZXA 2AW3A 4GGPA 3SE0A 2NU8A 4UTRA 5HIMA 1FTNA 1TADA 1IEWA 5IU6A 4L4XA 2CLCX 2A9VA 2QRLA 2IGTA 3IQHX 5GGYA 2V9ZA 5IDYA 5TMBA 1R0ZA 4LBZA 1O94C 5JS6A 4OHYA 5EVCA 4I9NA 4U2KA 4BEVA 4CTNA 4Z5XA 4IVPA 5BWCA 4RZUA 3R0VA 5LP6C 1G8JA 3BRWD 4KK4A 1NOKA 4LAFA 4EHNA 3HYCA 3IAM6 4OMUA 3L9WA 5LBUA 4H4DA 4AO7A 5A2QA 2WIAA 3IQWA 2H2DA 3JQRA 1YRWA 4HAVA 4WOBA 1K89A 4OB8A 1O9GA 4WXEA 4BWVA 5F5NA 1PP4A 3HBJA 4PF1A 3SEZA 3TLXA 1H6AA 4N5DA 5DT9A 1PEAA 3NCHA 3TZBA 2F1KA 2YZNA 3WMGA 3HP7A 4RA6A 2BSAA 4BGDA 3J7TA 4LF7B 1HNWB 1O03A 1YB6A 1J06A 4WK2B 1U65A 3IX7A 4RHCA 3MIIA 1Y98A 3A1DA 3LX5A 3GG2A 3ZI0A 1OGIA 4C4PA 2VUUA 5GONB 2D1YA 2H2GA 3K9HA 2HMAA 3WNBA 1EFPA 4XW2A 2I76A 3P2IA 2TMGA 3A7EA 3L0CA 3U49A 1CP3A 4ZVNA 3K0SA 4X64B 3NTXA 1GAXA 3JSXA 4GP6A 2JGDB 2G6BA 3DT8A 4PC2A 5FWYA 4CMCA 5IULC 4Z4EA 4GT1A 2QE7D 3TB6A 1X0VA 3UWDA 3E9YA 4D8UA 4RJ2A 5C1OA 3DNPA 3HRIA 1JH9A 3AY6A 2O23A 4TV8F 3EEOA 1JE0A 3E22B 2QTFA 2E9SA 2H4JA 1HE2A 2HMWA 1C9NA 2LE0A 4TQ9A 1HYBA 1JJ7A 1SOVA 1GQSA 2P2SA 4W5HA 4RVHA 3SR0A 2HK6A 2E4WA 4W1SA 4CZ2A 6REQB 4X60A 2J48A 1HDCA 1YS4A 2JDID 3C48A 3N75A 3RM3A 2J32A 4CR6A 2ZJOA 3AU9A 1CFJA 2DFPA 1GU7A 2Z5FA 3EW9A 4RH0A 4YCNA 3WRVA 1G7SA 2WEKA 4CQLA 2FJUA 4HCJA 3ZR4B 4FIDA 4DPKA 5JALA 4N40A 4O02B 2IX9A 1QYWA 4IVNA 5CYGA 1RYNA 1EP1B 3LM8A 3D7LA 3TDNA 1H5QA 1UBRS 2AN1A 2VNSA 1DAPA 3PS9A 5TQVA 5JBNA 2I7VA 1HT1E 2KBFA 5EKUA 4RULA 1GVHA 4P8RA 2FR0A 3NHFA 4Q15A 2WQ6A 1XG5A 4B1FA 4KXFB 1KK3A 1NWCA 3LXMA 3CLTC 3OU2A 4WK0B 2OE2A 2DG2A 4XWKA 4QATA 4X3CA 4MV8A 2LCQA 2YMMA 2R6AA 4HRXA 3CM0A 2JAOA 2P65A 1NQUA 4NPHA 3QNMA 3FWNA 3FZYA 3WQHA 3W04A 1A9RA 1ENYA 5B4TA 4ZV7A 1W4RA 4I4CA 4MSUA 3ZHOA 3BVPA 1UBNA 3KKPA 2OFOA 4RACA 1OR8A 3EDQA 4K8RB 3ZZMA 3SX4A 2EFCB 3HR8A 2HDNB 5AXBA 2AOXA 4DLTA 2X5KO 3RVSA 1NHWA 4NKRA 3KFLA 3OEHA 1XMJA 3QOWA 3R0IA 3TSOA 3I52A 4C7KA 1BROA 1YFJA 3L7YA 2IRWA 1SBZA 1KQGA 1M34A 1H2HA 4OXKA 3K1ZA 3DCJA 5DLQC 1ZNWA 3NHJA 3W8DA 4PLGA 5CAEB 4FLEA 2C98A 5KX5A 1KDPA 1S0UA 1Z3IX 4LN1A 1Z6GA 3C7KA 4DAEA 1VL6A 2ZI4A 3NRCA 2R44A 1OZGA 3IP7A 5AM4A 2VK4A 2PWBA 2EKDA 1WCV1 3KHUA 3LUDA 4DG5A 4KTTE 1KVSA 4J3FA 1NDHA 4AZVA 1DB3A 3R7AA 3E5RA 4O3MA 1USIA 3D2BA 4TLBA 2Z6QA 1V4VA 4PGGA 3I0NA 1XRRA 2ONYA 4HI0E 5AT1A 5ALDA 4IIVA 3OCVA 5HJEA 3NHZA 4RADA 2XSZA 4EBBA 5D85A 4C08A 1SHZA 3ODGA 4M0KA 4EO9A 1XGKA 1A2QA 2MJLA 1Z2DA 3QM1A 4WCFB 4Y30A 1AKRA 1QLHA 2V03A 1GQFA 1ZUWA 3LG2A 4I50A 3D3EA 3FWYA 3KG2A 4MW7A 5ALTA 1JKMA 2P0AA 4X3OA 4EJSC 2AI3A 2CHFA 2R1ZA 3N5CA 4X6LA 3WDMA 3G1WA 5EI5A 1KI2A 1RRPA 1PNTA 3MWEB 1NU6A 4KQWA 1L7AA 3ICWA 1A9ZA 2Z8YA 3LBAA 1E8MA 3TAHA 1ZUIA 3GH3A 4QLAA 2GA9A 4GPAA 1DBVO 4AJOA 3BMNB 3AP1A 4O4HF 3KNZA 5ALQA 4JWTA 1M54A 3U2QA 4B3JA 1Q0ZA 2XMRA 5HKLA 1QGUA 2QLLA 4HO1X 4MA0A 2B35A 3A9RA 1AK2A 3CLTD 1TJ3A 2O7SA 3EZ9A 2JFQA 5HCUA 4JX8A 4KFSA 1ATZA 2ILVA 4RK0A 1U2GA 4QUKA 4ZYTA 1VB3A 1UXIA 1Y9EA 4EG0A 3UJHA 2DMRA 1QH9A 2V7UA 3QXGA 2IV2X 4ZCIA 1YNSA 1Z26A 2ZATA 1XPUA 3SJAA 3WGKA 9LDTA 2Z9CA 3OP4A 4MV1A 4ADSG 2GCNA 4FBMA 2JARA 2JH8A 2GEDA 3EZFA 5FORA 2OV2A 3KE9A 4ZRMA 2B25A 3EDCA 3OF2A 1BEUB 5IJAA 3ANYB 1GTZA 1TQ2A 4PY2A 3S6JA 4QRHA 1E0JA 2ZYUX 3HQ4O 2YYZA 2YL2A 2M2IA 3QKSA 5ARCA 4ZMBA 4CUZA 5DHUA 3L79A 3CYFA 1I6WA 2WV7A 2YY5A 3QKRA 3GZJA 1LVGA 2O05A 5FNZA 4DDMA 4PSAA 5JHGB 1NLFA 1SCUA 1Y3IA 2C03A 5FJIA 2P91A 3DAHA 3TKAA 4B6QA 1EJ2A 1THTA 2D00A 4FHCA 1P4AA 1IZYA 1XCOA 2VT7A 2XYRA 3PQ6A 3OURA 1O9HA 3F6SA 3DA8A 4J4BA 3C97A 3BWEA 4I1RA 2Q3JA 2XQFA 4UQPA 4EUSA 3THXB 2WD8A 4FLMA 4ZYYA 4LQLA 1ULBA 1AKUA 1RYBA 3A0RB 3EG5A 5JJCA 3CPHA 4YMIA 1ZH8A 4LGVA 5IM4F 1TEVA 3WAKA 1UKZA 4IGEA 1H2EA 4FWBA 4ALJA 1KIAA 3AM5A 2OR3A 3PXAA 3OPQA 3PQ4A 1J56A 1G9SA 2GRAA 3IOCA 5CT5A 4Y2XA 2FSGA 1E1QD 4XB2A 1UH5A 2VO1A 4L0MA 3T3NA 4ZHQF 1WAMA 1Y7HA 4G5GA 4A82A 1U81A 3LU1A 4ENWA 3GUZA 1G59A 1NX6A 3I83A 2PJUA 3KOMA 1YDGA 4NCAA 2IXAA 3CISA 3D6TB 3L6UA 4PW0A 4DMMA 1ZD9A 3PJFA 4CR8A 4MS4A 1OWLA 2AZDA 1KDOA 1FYVA 1FBTA 2YIJA 3KQVA 4PO3X 3AUAA 1KI3A 3CKYA 3LDFA 1ESEA 2HDHA 2XE6A 1VIVA 2ZJBA 3DVAA 3KIPA 1S02A 3W7VA 1ZY2A 4N3NA 4RPLA 3PGVA 4PBSA 4CM1A 4YRFA 3T1TA 3V4RA 1DC6A 4LQDA 5T3YA 2CDCA 1UL1X 2GPSA 3L4EA 1CF2O 1ZOLA 2YBDA 5JUWA 5A5FA 1KJNA 4DRZA 5BQ3A 1PGPA 2FG5A 3HJTA 1Q3HA 1L5FA 4RA6B 4ETWA 4JXZA 2DJIA 1XZAA 3H9CA 3RS2A 2O2XA 1V7QA 3RS0A 3PHJA 4Y18A 1ECBA 5FL3A 4CIYA 4ZEMA 4G0WA 1I80A 2CW5A 1QF7A 3ZPXA 1NI4B 4DZZA 1KH2A 1M0WA 1EFPB 3TKLA 1RJ9A 3P1JA 2X8LA 2JI7A 4QQNA 3C7CB 4X54A 3T9DA 1LF5A 1N0IA 3ADOA 4R9UC 4IGKA 2B34A 2C84A 4B80A 5LZ4A 4LF4B 1UJ2A 1EUDA 1GR1A 1T0JB 4YLEA 5A0TA 4RVSA 4I4IA 5FWYB 5ELXA 1YF3A 1BOOA 4RFSA 5AK0A 3RUEA 2HLDD 4B4DA 2HU7A 3IP9A 1N2XA 4P7BA 1T36A 2XIQA 3IHTA 3T06B 2C04A 1YZVA 3BJRA 1M1UA 2OK7A 2QLFA 4PBRA 1B74A 1ARZA 4MVJI 1ZGCA 5BT8A 2D0DA 2C2YA 3DXZA 4JSRA 4MS1B 5DISB 3UJ6A 4WK4B 3W5HA 5A9RA 5K5EA 4DTCA 1WRBA 1FNCA 1Z8DA 1YQXA 1WUHS 3GCWA 4YT4A 2N46A 3OEED 3KQLA 2Q6KA 3MOGA 5DP2A 3GZ4A 1H5UA 4URZR 3WYNA 1Z5NA 1AMNA 1P9NA 2W11A 1HT0A 2C5HA 4J9VA 3IUNA 4ZCTA 1KS2A 2ZRHA 3QKTA 1M75A 1C0IA 3EA0A 1VMKA 5BN1A 1O3YA 2XOKA 4L5BA 1DUIA 1P18A 1UAYA 2OGSA 5CDSA 5DNYB 3WLLA 1XK7A 5AI4A 2OKGA 5AVJA 1IZ8A 2JAXA 1YRHA 4HWOA 4LSZA 3RSLA 3WBFA 3UM9A 4INZA 4MEBA 1I32A 5BN4A 1NZDA 1DS6A 1K0FA 1U7HA 2UAGA 3L43A 5M7EA 3MPOA 3RVKA 4RK1A 4LZZA 2A0KA 2PJZA 4PV7A 3G8BA 4JXKA 5DFAA 5FUXA 4LYJA 1HEYA 1ZA2A 4YMUA 1IXYA 3MGGA 4OJNA 2NT4A 3DDHA 5DBGA 4G0NA 4R9RA 5A4AA 5KUTA 3U48A 2AWOA 1ZK1A 5DBOA 3ZY6A 5C8YF 2Y0BA 3B36A 4L9RA 1EFVB 4EDHA 5BV1A 3PICA 3AZPA 1JEYA 1E3QA 1I4TD 1RLUA 1YO6A 2IXTA 5KHLB 2HPHA 1Y42X 3G7SA 5AKZA 3LY7A 1N2JA 4Q24A 1TB4A 2WWGA 4ZDIA 3WYBA 2J67A 3NRBA 2PRJA 1X1RA 4LBVA 5EJ2A 3AJ9A 2JAUA 2QS9A 3LRTA 3RYIA 4CCYA 1R8SA 3CEAA 3B53X 3BBLA 3EXFB 2FK7A 3PZBA 1MZVA 3QVMA 4CDRA 3THWA 1TZJA 1YB1A 1D5WA 1UQTA 1ZLYA 3HSKA 5K3DA 3T61A 1FSPA 1EP9A 1ODFA 2GPWA 3IERA 1DBWA 1HWYA 1LSOA 4IIJB 2IE8A 3PCRB 4GXQA 3BCUA 2NUTA 1LW7A 1M7GA 1V41E 3WNDA 5JC8A 2E4YA 2GTIA 3OT4A 2FDXA 5FWAA 1L5HA 3PGLA 3NT4A 1VFPA 3ZBUA 5I9IA 3T5BA 4PSCA 1DG3A 4R1SA 5JRZA 2VQEB 4K9KA 5BMVA 1DOZA 2FFRA 3B12A 3CFYA 2Z1NA 5KBYA 2QZPA 1H94A 5C9ZA 2XQIA 1E3MA 2ASVA 2QXYA 3ELYA 1G20E 1P9LA 1R9NA 1X87A 2ZJ3A 3E5HA 4I50B 4F12A 1ZNZA 3A9VA 5EZ5A 4HZIA 4DLNA 2A9RA 1FSZA 3LF2A 4ZC1A 5JR3A 3U3RA 3RVMA 5DIZA 5A2GA 1Y37A 3F4LA 4UBIA 5FWDA 1PR3A 3HFGA 3ADKA 2OFWA 2VRCD 1DTSA 3FZGA 5A4KA 5IN5A 1AZLA 3RIGA 5LOVF 4QNMA 1H05A 3PC6A 2PX8A 4E12A 4OQYA 1MG0A 2EYQA 1A77A 2GZSA 2QQ5A 5ALUA 2PS1A 3UPDA 3ZGYA 4XYLA 2OC9A 1DKQA 2QJTA 1IM5A 2EZ8A 3GZTB 2SNIE 2WP8J 1QRRA 3CUEF 3VOBA 3CVYA 3JATA 1ZKMA 3VU0A 3ZK8A 4DEYA 1RMTA 2V97A 1Y48E 1Q77A 2GZHA 3VU8A 3CS3A 3MD0A 2P90A 1APBA 5LQNA 4B32A 4BNWA 1G8AA 1WCYA 3A3YA 3DEKA 4JQSA 1DDIA 2B1JA 3RFTA 2X9GA 4ZU3A 1TKRA 3LPAA 5AM2A 2L82A 3YASA 2ONKA 4IF6A 1KJ9A 1TJYA 3KT8A 2JD1A 1KEKA 5CFNA 2AYYA 1CG6A 2HV9A 2SKCA 3B6IA 5I9BA 3IHWA 4J7AA 3V32A 5BV0A 5LYJF 5LKRA 3PJDA 2CDRA 1QAOA 5JDIC 2H1RA 2QLNA 2ZXFA 3U16A 4CCWA 5JPCA 4QBFA 3ZDFA 1JT2A 1TYCA 3FGNA 3GEBA 3QKSB 1H0KA 3OZTA 3QLUA 1NC1A 2HD4A 3L8MA 3GU3A 3IO5A 3KJQA 4HNRA 3QKRB 3FPBA 4IH4A 1K7EB 4DV0B 4MEAA 2YXPX 2OHFA 4JUCA 1KKUA 1Q0SA 3UXMA 1SCUB 2CLHB 3NKFA 3CF4A 3UAXA 3OCXA 2YVQA 2QQ0A 3KJHA 1A69A 1DJPA 5J3JA 1Y81A 4X41A 1EFUA 3AVUA 1OH7A 3FKSD 1XN4A 5B12A 3ETCA 4PG6A 3PKZA 2BJVA 2RGNC 1N7IA 1MR3F 1GKYA 5E4YA 3A37A 1M76A 1M8FA 1W0CA 5FQNA 2CFIA 1PK9A 2Q3FA 4BO6A 1T25A 1QPZA 4BNZA 1SVIA 3RVPA 1D1PA 1SM4A 3IP1A 4N41A 3FR8A 1XQXA 3FY4A 1VE6A 1XQ1A 2GEVA 2QA5A 1K8ZB 2GAOA 3KLOA 1A7JA 3MWYW 4OK5A 4L07A 4FDAA 4K88A 5CNJA 4RZ3A 4OHRA 1PYGA 2NLOA 1RRCA 3R3HA 5C32A 3KK0A 4XLLA 5CXXA 3QVOA 3ZGOA 2F2TA 1NW8A 4BVLA 4DNOA 1TIPA 5DYIA 3A8TA 3WO1A 2EU8A 3MBKA 3MGBA 4HUQA 1GT6A 3OH8A 5CMLA 2QX9A 5J63A 2X5JO 1FRZA 2ABWA 2IZ0A 2KE5A 2H2IA 1NIPA 1K6EA 3EMBA 3PCXA 3WWCA 4BX8A 3WDKA 1O0CA 1GSOA 5EXTA 1C50A 2B8JA 4NU5A 4BN4A 2DZDA 3GLSA 1BKSB 1ICEA 1P81A 1QIMA 5D01A 1TCVA 1K75A 4I3GA 3DVAB 5KINB 3KTDA 1LLCA 3VR3D 1RFLA 3A10A 3M49A 4FFSA 2B4AA 2FEPA 4F7DA 4D9BA 1WLSA 4ZQBA 1W5FA 3IVCA 3HABA 3O84A 4HP8A 2EXXA 4ZAZA 5P21A 5B30A 3GP8A 1J0BA 2IIBA 2A59A 3CF6R 1I2DA 1ZO8A 3B1WA 1Q0QA 4HH3C 5F1YA 1ATIA 3S1LA 1PD0A 1NQWA 4MYUA 4GGMX 3ZHXA 1F7VA 3EQ9A 1FYDA 1LSJA 2AKAB 3PHBE 3LUPA 3UJ9A 1G98A 3ECCA 3IXMA 2JI4A 1Y34E 3H84A 5IXYA 2HXYA 2I7TA 3G5MA 2Z8ZA 3ID6C 4KC0A 3WK9A 3LNCA 4JSTA 3JQGB 3VSDA 2YUTA 5FF9A 3U56A 4HTAA 3TUIC 1ZOSA 5G02A 4BO4A 1EUDB 2CD7A 1I7PA 1SK8A 1RXEA 5B1DA 2RMKA 3CWZA 3LBNA 4RFSB 3F5QA 3ROXA 3IDQA 3ZWMA 4E70A 1UBLS 3ZLVA 3CJTA 4KN5A 1YV9A 1HRKA 4Y6OA 5HUJA 3NR2A 2ZM5A 4RSMA 2FPOA 1ISSA 1NRXA 1OU0A 1T36B 2O7QA 4WA7A 1OFTA 4HWKA 4X1KA 4LCBA 1DQYA 4R84A 4WZBA 4EKDA 1PJLA 1N6PA 5FA5A 1F8UA 5BUSA 4C3OB 1NKVA 3AUJB 1LSUA 4IHJF 1KGDA 1E9DA 4MRMB 5EZYA 3GRKA 4IJUA 1O95D 1HLGA 1OYYA 3AERB 4N82A 2YNMC 1IK6A 1N0WA 2Y1WA 5E38A 1L1FA 4CFZA 4CLRA 1KMQA 1MB3A 5EQTA 4ND8A 1ZSVA 5ALMA 4KGZA 5EE1A 2H1LA 2VAPA 5JEEA 1J8YF 2D7DA 5L3VA 1NM5A 2R96A 2ZRBA 1NR1A 2I6GA 4M38A 3IT1A 2L18A 4FKZA 2H54A 2NN3C 1EINA 3DEHA 3IEUA 4PPNA 1G8YA 3I64A 2PS3A 4HAXA 1URPA 3GJ6A 3SJCA 3S81A 2PXCA 3H1TA 3E0QA 4WRRA 1ZISA 3BF7A 3I9V1 1SZPA 4B6SA 3S28A 4R8LA 5BN4B 1PX0A 2GNOA 5C1DA 3OTHA 1E2LA 5CU7A 3AVOA 4I8XA 2HHHB 4F3CA 1L5QA 1RLTA 3U4DA 4RVGA 3LC0A 3A1NA 4J0HA 2VJDA 2C31A 1YZNA 2NZVG 4LV6A 4WLUA 1NN5A 4AAYA 5GMOA 5AW6A 1J2TA 1FU8A 2GKSA 2JEZA 2XLBA 4YP7A 1IY1A 3B1VA 4S1TA 4BV9A 1U3TA 4B3HA 2I2WA 3LCRA 2VJAA 4HDCA 1VLJA 2I33A 5SYNA 2YXLA 1FEZA 3E7XA 2YXEA 3EFHA 3EF3A 3FUCA 4LV5B 1GZSA 4U63A 4XR4A 2POQX 4Y2GA 3ZUPA 4DCPA 4EI9A 4BV8A 3FE2A 3V1KA 1BMTA 1NW4A 4LEIA 4RESA 2JLUA 1NNEA 2XTNA 4LJKA 4JIGA 5JCXA 3NDPA 5F7XA 2HNKA 3HJUA 3D8TA 1CDEA 2YOGA 2Z30A 5L40A 3GJXC 3RYIB 1ZR4A 4KR3A 5AVVA 3ILVA 5DTJA 4GI1A 5IMSA 1G8FA 2IS4A 1UDAA 5KVQA 2VBGA 1I8TA 1M3SA 3B8HA 1GUAA 1KFCB 2J46A 1WM1A 2R85A 1TA0A 4AT1A 2EGGA 3MT8A 1L5WA 4C07A 3TX2A 3RSHA 1UC9A 2MR6A 1FUKA 1JXAA 1KTVA 1UFRA 3OOWA 5CGQB 1RCUA 1WOMA 1QOZA 2NXJA 3NATA 5F1PA 2FVYA 1CBUA 2ATXA 1L5HB 3RFCA 3KL2A 4LYAA 2J0EA 4XFJA 2FFJA 3JTMA 3K9GA 1EUYA 4OJYA 1IBCA 2UYOA 3GQBB 4JLMA 4QE3A 4AG6A 1COZA 2WKRA 1F1BA 5HDQA 5BOSB 3FUTA 2R62A 3ORFA 3PKIA 4J6FA 5IASA 5KYYA 2VJPA 4WOJA 1WCIA 3W6ZA 1HE8B 4KRXA 3V3KA 3GUVA 1X1SA 1QP8A 3E1GA 4GO1A 1BGXT 4KAJA 1KFEB 2PIAA 3QOFA 3W05A 4MI3A 3U31A 2UYCA 2FOLA 4AJJA 4WCDA 4GMFA 3AK4A 3WZ2A 4S3MA 2FLKA 1Y9DA 4E1VA 3STTA 2RGDA 1ETUA 2G5TA 5K0ZA 1WP9A 1XK6A 1AGRA 2V3VA 2PYZA 2XTZA 3JALA 3K5WA 4FYPA 2F8LA 2I4OA 1RRKA 2O3UA 1V0JA 4I4NA 4YP5A 3JATB 3EQ8A 1TM4E 4B3CA 2O4CA 2OBYA 3RC7A 3W3AD 5IAOA 5SZJA 2ZR9A 4LECA 1TZ2A 2OOKA 2QY6A 2RHTA 4QOIA 5IYZA 2YYAA 5EL0A 1QQTA 4PG7A 4LW8A 1Z37A 4XARA 4CMAA 1YGYA 4Q21A 1O6FA 3A05A 3IJPA 3VFDA 2RH9B 3A6GA 1YB4A 1ZUNB 2ZWIA 4CHGA 3HUEA 4L72A 4AJHA 2NAPA 5IDXA 1M6YA 2AA3A 5COBA 1N0UA 1ECPA 4EGCB 1DT5A 2Q1XA 4HGPA 2AMLA 1HZZA 3BE8A 5REQA 1KAGA 2D5CA 4G1FA 4WCFC 4BPBA 2NUPB 5A3RA 5DASA 2YYSA 4EUFA 1R27A 4K0KB 4M83A 2ACVA 5EKDA 1NA5A 2XW6A 4IF4A 1HOXA 1JSRA 2AZTA 5DTMA 4HNAA 2QR3A 3RU9A 3JWEA 4JKYA 2WYUA 4LHXA 4IJMA 1IEVA 5FCDA 4WUTA 3CCFA 3MG9A 4IMRA 1U0HC 3UMFA 5CYOA 3UFBA 2P9ZA 4E51A 2CBXA 3R24A 4TLCA 5F3WB 1B0AA 2XYQA 1VP9A 2Y9MB 4B0OA 1AZWA 1RCTE 2YDYA 4LGYA 2O07A 4YPVA 1KQPA 3W3AH 4AQ7A 4EP1A 2J9XB 3ZD7A 3CZPA 1EK6A 1UMCA 3CX4A 2ONZA 1G0OA 2AKYA 4FSHA 3TZHA 1CC1S 1K8XB 4NAUA 4TLEA 4M89A 3ER9A 1U8YA 1SCJA 1V16A 2Z43A 4O4LF 3UXYA 4PE5B 2VUIB 3VQTA 1NYQA 1E2KA 1MOSA 2PKQO 2JFGA 2FPGA 4R98A 1N3BA 3G9TA 3SYNA 4DG8A 4EHIA 1ZHFA 4EEKA 2ASEA 2Q4TA 2O2JA 3EVGA 4H3HB 1P2VA 3DYBA 3U9SA 4MW9A 2GX6A 4UTVA 3G79A 1GUBA 4Z8YA 4ZOBA 5EJ5A 2RONA 1Y3BE 2EOAA 2XA9A 3K09A 1TM3E 4L9SA 4B7ZA 4Z3KA 2IYLD 4GLLA 3MBIA 1QQ5A 1JHMA 2JJ2D 3R6TA 1KSFX 4PVDA 1JBKA 2ZB2A 3X1DA 1BJTA 4OFWA 2QTTA 1P1RA 3AKDA 3CE6A 1Z2AA 2YN2A 1KRHA 4ZOCA 2BBTA 3ZX4A 1X1AA 2PQMA 4DV6B 1IZZA 4RIIA 1G7TA 3C43A 5AW8A 1S4MA 4HDNA 2XNJA 3H5AA 4QBIA 1UEJA 3TK1A 3QWHA 2VPQA 3OJWA 4XA8A 4DTIA 5DN6A 4DVGA 4GYJA 3HH8A 4KWTA 4YUVA 1KYXA 5T67A 2B37A 3M4JA 5K0JA 4J0DA 3KQNA 1QYRA 5FUMA 2OHGA 4UD2A 4GDFA 3RWBA 2B5OA 1JZTA 2WHEA 4BTEA 1YRAA 5H68A 4LFCB 2I7CA 4FQ5A 4PRZA 1SA0A 1EI9A 2AD1A 4DZRA 2XNCA 2BGNA 5HCNA 4R0NA 3ZKAA 2ZR7A 3G0GA 1U0JA 1OFGA 3DOHA 2FSIA 2VL7A 1XHLA 4MIYA 2GYVA 4UBNA 5LIPA 2R7LA 3E84A 1PZFA 1WHTA 3PC2A 4HXGA 3F73A 2HJSA 3TJZA 1Q19A 1BGWA 1KYYA 2IHJA 5I4BA 4D0RA 1BQ4A 4KNWA 3SWWA 1L5ZA 3CLVA 5BWBA 2REQA 2H4XA 2Z3WA 4J1SA 5DTIA 4F2PA 5K3EA 4X1KB 4WZBB 1JQEA 5AJZA 3RFUA 2Q1YA 4FJ1A 5EJIA 5FUQA 3QPVA 4E31A 5EZYB 3GPBA 4A3SA 3U39A 1NSYA 3Q3EA 5IUNC 2WSYB 5LM3A 1U8TA 5EJAA 4AUEA 1OX4A 1TJNA 4M87A 4YIKA 1A3CA 4AX8A 2FN3A 4ND8B 4DJ5X 3HP1A 4YLGA 2CT8A 3I0ZA 3PDIB 4A8TA 1ZMTA 5JRDS 2WU8A 5CRIA 2PZGA 2HSWA 1XLTC 3DEJA 2OEPA 3R6DA 2DBRA 3G6WA 1V96A 5GJBA 1RACA 3L1VA 4L8LA 3CLRC 4WKPA 1IJEA 1KP3A 4KQXA 4QC2A 3AFMA 4MPJA 4QM7A 3V1LA 3VNSA 2Q5EA 1ZEJA 2JLYA 4PYQA 1QF6A 2Q5JA 7MDHA 2F9MA 2B1IA 2QZ9A 3ZBQA 1DX4A 1N3LA 3K8ZA 2UUPA 4F5DA 4N18A 4AY2A 4TXHA 5HKKA 4D8VA 3DM9B 3H3JA 1YCGA 2DKFA 3MQ4A 2ZIVB 3TSZA 4RF2A 2EGHA 3BORA 4KR0A 5GGXA 3HVRA 3PQ7A 1M2JA 2ZSUA 3EN0A 4CNQA 1VHTA 1XZ8A 5GINE 1I7NA 1BVYF 2XUQA 3NI2A 3RABA 1GUFA 2BUAA 2GJKA 5JAMA 4I6JA 3J80A 2EF1A 1F60A 2ZSAA 1UC5B 1THMA 2PUHA 2VG8A 4JFAA 4QOHA 3PT5A 3WZLA 1RJDA 5G0WA 3DBHB 1OZFA 3IT3A 3VJLA 2NO0A 4R1NA 5BSFA 2EEZA 3LGSA 2ID8A 4YB8A 5FO1A 4Y1GA 1J0XO 3LNTA 4UASA 3MGAA 5B4VA 2QXUA 1W4AA 5C4MA 2ORYA 4IEFB 3CEPB 4H1HA 1CUCA 1ESNA 4MKZA 2E5FA 4M0EA 4LRSB 1G18A 1XMPA 1Z18A 5AI5A 3QX3A 2NV0A 4F8EA 4YAGA 2XRFA 1KORA 3I9KA 4WGFA 4GKVA 4ES6A 3M1IA 2GBGA 1N6IA 4OEHA 5BVGA 4Q1EA 2I55A 3DVRX 1U7WA 5KTOA 2BFDB 5CNMA 4RKEA 1FP4A 5L6MB 3P0RA 1TRKA 2ID7A 4DYVA 3CXRA 3GRAA 5LQSA 4B6FA 2NP7A 3HI4A 1V1RA 5KPJA 1KXZA 3ZZ0A 4D3YA 2X15A 2WV9A 3WVNA 4WHMA 1KAOA 2DPHA 3M5DA 3O9MA 5EYPA 3DSRA 5I5GA 1S7CA 2RH5A 2QD4A 2ZJ7A 1ACMA 2ZVDA 1ADJA 1NF8A 3O1HB 4TSKA 3HB1A 1KY3A 1GG9A 4OGWA 3E15A 4MOWA 1ZL2A 3DOEA 4V0RA 3VZSA 2OUIA 3H99A 1SVNA 4G0OA 3L4JA 4CEIB 2OFXA 2VN8A 1Z0FA 1F4PA 1EUCA 2Q62A 3EIHA 1PV4A 4GWLA 3JALB 2W2QA 1P2FA 3CLRD 1KPHA 3D43A 3K5IA 1ZJ5A 3OLVA 3PE3A 3VPAA 1ICIA 4YXWA 1A8PA 1MBZA 3A9WA 3F47A 5ILOA 1XN1A 1JTEA 1E7SA 2EFEB 2ATEA 3HE3A 2EP8A 3NJ8A 4GX0A 4TWJA 3NBZC 3UJ7A 3WS7A 3L6BA 4MCIA 1EX6A 4D8YA 1JILA 2BEJA 1DCFA 3UEOA 1WUIS 1TUBB 1WTCA 3OAAA 4KH0A 1AGNA 5IYZB 2VAVA 1EGAA 3WLOA 2HR1A 3HJFA 4BZQA 1Z73A 1V45E 3Q8WA 2D2XA 3BTSA 1W19A 1OI7A 3FYDA 3O93A 4BB5A 1VJRA 1X7XA 2XGOA 4OTZA 5IG2A 4INJA 4LY3A 2B4TO 3GN1A 3ZVKA 2O2DA 4BNIA 3N9IA 4KWIA 3G9UA 2H18A 3W6PA 3PWSA 1ZCAA 1LTQA 5REQB 1WXXA 1Y8RA 2OV6A 4KH1A 5AKIA 4EHKA 3R0JA 1MV5A 1SY7A 2R7AA 4RO0A 3OFKA 4XDGA 4Z4QA 1FOEB 2IXFA 4DMRA 1DBPA 2J9RA 2RHDA 4LJ9A 3I1FA 4BUCA 1H9AA 1YMUA 1CVIA 1PDWA 4JYBA 5CH3A 5SV2A 4A4DA 4QWMA 1W36B 3Q5DA 1SU8A 2XUPA 4E30A 1WV1A 3LUGA 4U1RA 4MCHA 6PFKA 5BSEA 5FBWB 3O3MB 4J16A 4D56A 5K0EA 4HRVA 2BZ1A 3AX6A 1UMCB 1L8XA 5DSZA 2EBWA 4ZGWA 2ZVPX 3JD3A 3COPA 3HPQA 3KELA 4QARA 3JWIA 3V1MA 1B73A 1DFGA 2PL9A 1U2GC 2EV9A 3BOSA 3L7AA 4IL5A 1G20A 1XVLA 3KD3A 2G1UA 1IXSB 2OQRA 3ICCA 4P4LA 2E55A 3DO5A 3H65A 1OFUA 2BE7A 2Q5CA 1I33A 4MUEA 4R1UA 3SLRA 2WWYA 1ZLXA 3HL4A 3MUOA 2FMXA 1IZ0A 1JECA 3LT5A 4MYDA 4L27A 4OXRA 3T3IA 1YXMA 4AJEA 2WHXA 5A0FA 4DABA 3DE6X 4Q48A 1PJCA 2YFYA 3OEHD 5MDHA 1VSQA 5AM0A 1N5RA 4RE5A 4L5CA 1QE0A 4BE7B 4PO1A 2OV3A 4L5AA 2YRXA 2Z3VA 5ALJA 1YUNA 1I30A 3WYCA 4CV3A 5LIRA 1EGMB 1ZC4A 4BNFA 3LGXA 3G0DA 3KR9A 4FFVA 3ZH9B 1GN9A 2NPOA 2P79A 3TLEA 4AZ3A 2J5QA 4FFNA 2I2FA 1V48A 3SZGA 4EQ6A 2A1UA 4EVRA 1R00A 5C0OE 2R68A 5E3HA 4F9TA 1QONA 2IF2A 4XWOA 1OA1A 2WUVA 4C7JA 2XMGA 3EGXA 1NULA 1BH2A 5CXUA 5JQGF 2R8XA 4WBXC 1VMAA 2OORA 1SA0B 1Z0JA 2D1SA 2P75A 4C20A 2C0CA 2MYTA 1U8EA 3UHAA 2XSZD 1DNPA 1QV9A 1QO0D 1WHTB 1XRNA 4W7SA 1XMSA 3ZZUA 3F74A 4Z0TA 4MITA 3KTFA 2AK3A 4CXMA 2PKEA 3ENNA 5HQTA 1IN7A 2JJ1A 3CSSA 3K2EA 1Y63A 2E49A 2GILA 2Q29A 4EFDA 3DDSA 3BHMA 4RGYA 5MGNA 2O8DA 4QUBA 3SIWA 2DAPA 2HLHA 4QTYA 1H69A 4G0UA 2PRYA 4L75A 1M72A 1QHNA 2MYNA 3HA3A 5HM6A 2FUEA 3AWIA 4G24A 4NQZA 2OAP1 4UE6A 4F84A 4HADA 2WG0A 5AHXA 1W8IA 2GJ9A 1VPDA 2IVZA 1OX4B 5G0SA 4N7RA 2JGEA 4NFSA 3RS5A 4IDQA 1CRLA 4X7RA 1C29B 1Z88A 3RQSA 2RGBA 1AKWA 5FL7A 5JATA 3PXCX 3IFSA 4GL2A 1J6UA 4N5MA 5LDGA 1O54A 2PS9A 3QE2A 2ZRNA 2PA3A 1P1CA 5KNBA 3VDNB 3E81A 3N87A 4P98A 4R8SA 4B81A 2A35A 1Y6QA 2XODA 4YJGA 1G7RA 3AFNA 3ZIDA 4L5YA 4MV3A 4REOA 4ZOEA 4KYIB 4Q7JB 2EARA 2RAUA 5FLXA 1N2IA 2IYAA 1NPDA 4M1SA 1Z83A 4R2HA 3L6RA 5ERXA 1WCXA 3QEKA 3HACA 3BUSA 3BC1A 3K9LA 2VXYA 2NZUG 1JHDA 1XDDA 4M9QA 3V33A 2P4QA 3KKEA 2C5BA 2YJ5A 5BUCA 4AY6A 2CGEA 4B4KA 3EUWA 2ZIXA 2QN2A 2ZS8A 1R88A 1S3SA 4BAGA 2A5LA 4WNIA 4AZWA 4TWZA 5JJ5A 3UK1A 3NBUA 5IWCA 2IODA 5H82A 2R6HA 2J8ZA 2QQEA 3KCNA 3OX4A 5I51A 2O2SA 2YYYA 1ISRA 2A7XA 3G7UA 4TRJA 1X7ZA 4IIFA 5IDQA 5CNKA 1LPBB 1PRYA 3L6DA 3GOHA 4IINA 2J6BA 4PS1A 5GV8A 4QUHA 1BXZA 1AT1A 2A3RA 4EPXA 1PVDA 5JASA 1E9FA 3FIUA 3I9OA 3QUAA 4K6HA 1ZDMA 1Q20A 4CTOA 3Q6NA 4HEHA 1SURA 3O03A 2IZZA 2O8CA 4UXHA 2VJMA 3MVEA 1RDFA 2K7ZA 3PVZA 5SY6A 2QZZA 3N53A 3NHKA 4U8HA 1CY2A 3QMPA 1H2FA 4YRZA 2X3UA 2BUCA 1UBOS 3KM0A 4JQOA 3DMFA 3PR2B 4RYDA 3SEAA 4C78A 1L3IA 2G5PA 3L7CA 1IOZA 4WDRA 5CB0A 1UM9B 2TMDA 4Y6PA 1V1RB 4LC1A 4O8CA 5I4CA 1C7ZA 1AMUA 1FLDA 1RXYA 4H18A 3VH1A 4EY8A 4L3VA 3KZOA 4NU8X 5DHRA 2ZUUA 3L1HA 1O9BA 1TX4B 5EYPB 4JUFA 2VIIA 3MJTA 1Z2CA 2J30A 3H1AA 3L77A 4PLFA 5B1SA 1B00A 3NX4A 2BHLA 2UZAA 4KIGA 4R40A 5T8KC 2QLBA 2QRNA 4OMCA 1L5GB 1OAOA 2BELA 5E9JA 4KJZA 1GCUA 4KNYA 2GBPA 5C37A 3SKYA 3K2QA 2JAQA 2RGYA 3C0KA 4LYDA 4UNQA 1PZHA 1VG0B 3T9BA 3X1MA 4YUXA 5A4IS 2OILA 2D6FA 3KRTA 1IK4A 3OEYA 5HZHA 2FX2A 2PPLA 2YZKA 5K7SA 5G1NA 1NZJA 1NLYA 4QDZA 4WXMA 4BEJA 3NHAA 3RUCA 4M8SA 4PQGA 2AFIE 4OP1A 3R3YA 4HHEA 2ACWA 1YMVA 5DLYA 1UWLA 3WDSA 4BBJA 5BV8A 8ATCA 2JKVA 1FVXA 2CFRA 2AOWA 5IXJA 5JLAA 1ANKA 1SUSA 4F4JA 4YJ3F 1UOOA 1FTGA 1AUPA 2NPIA 2WW8A 3CZAA 3GWGA 3QPDA 3S2YA 1O0BA 1AUVA 2BTOA 5AO9A 1NMSA 4PNHA 4TKMA 3GD5A 5ICEA 1RI3A 4W5NA 1EDOA 1MX3A 3PEWA 3QVGA 4FOOA 4RF3A 1Y8RB 2G72A 3TZEA 2FEMA 3K1AA 1JPNA 3BWMA 3INTA 3LIIA 2RBGA 4LJ5A 1Y1QA 2A3NA 4JI4B 1LBHA 2N75A 2RGXA 3H1GA 1EVEA 4K03A 3RUAA 4MR8B 4E5NA 5LFAA 3R8XA 2F8TA 4I2VA 4G8DA 3RLFA 3ZDQA 2XCTB 1PT7A 1Z07A 1GPJA 2XBUA 3E3AA 2XTJA 4K6FA 4ODIA 4ONEA 1C9EA 2OGTA 2Q4OA 3ZWCA 2NO7A 2XOKD 4GMHA 1ZGZA 4ANFA 1SVLA 2FPKA 3EC2A 2HXGA 2PKWA 3HL0A 4FW9A 3OQHA 2BE9A 5KQRA 5LLSA 3FSRA 3RBAA 2RC5A 3IEXA 1RAFA 3AEUA 4JP5A 3VYTB 1T26A 5C8ZA 1FXWF 1FS4A 1DQRA 4FW8A 1U9ZA 3K32A 4WE3A 3BPSA 4BHTA 4X20B 2E4AA 2XA1A 3HDHA 1G20B 1MPXA 3L7MA 3NM6B 3Q5GA 3Q9UA 3T7SA 1WXDA 3A2KA 1T8TA 4X5OA 3WV5A 1QRDA 2RHBA 1BCSA 1BD3A 5TVGA 3ABQB 2H5EA 2IYPA 1K8RA 3B2QA 3ITNA 5DN9A 2XMZA 1FDSA 1OT5A 3B6KA 3GX1A 3AFHA 1EM6A 1XKQA 1WLYA 3G2KA 3PU6A 5HILA 2RI1A 1BNCA 1WXGA 3NTUA 4X1IB 1LJUA 1JWAB 1CUYA 4E22A 1TZBA 3NYIA 3QLUC 4MAMA 1KBZA 4JP8A 5B7NA 1CQPA 3FCSB 3DP9A 1WY5A 1DEAA 5G40A 4AZ3B 1OV6A 1ZXBA 4FLFA 5LQMA 1JPVA 2BFOA 4EQ6B 1LQUA 2A1UB 4G1VA 3ZWAA 1HORA 4PINA 3D4OA 5KDLA 2WA1A 2ZLBA 4PPQA 3FLMA 3R7SA 3BGDA 4L50A 1K3TA 4Q1FA 2WDZA 4KYUA 1IY2A 5H16A 1YJ5A 5KHOC 1M8JA 2FUG6 1JP7A 1B42A 3GO4A 4P31A 3RWMB 1S4QA 2NSHA 2GD2A 2QJOA 1RIIA 1OWNA 3CNLA 5K99A 3GRRA 1PR2A 3PFIA 1M6HA 1QHIA 4H08A 4E46A 5HK9A 4MW1A 3TW8B 4LYHA 3NETA 2HA3A 4BMSA 1G6Q1 3Q7EA 3OPVA 4A0SA 2AVDA 2GAAA 2GCOA 3EXG2 3JQ8B 2QRHA 3HEBA 4EJ0A 2FVXA 5DNAA 5FT9A 4N48A 2JIRA 4HDRA 3EZNA 3I28A 3TQCA 4O1MA 1VXRA 2D0IA 3K2BA 2ATVA 2W9XA 3A4TA 1AS2A 3MT7A 4LCJA 4I46A 5ESDA 1M10A 2WTNA 2APJA 4QGFA 4Z9YA 3WISA 5KJFA 4W6ZA 1RXUA 5BR8B 3TXYA 4XIFA 4G5QA 1NTOA 3FFTA 3PENA 4JP3A 1JVSA 4O4JA 1JJVA 5DWVA 2JFYA 1JDSA 2I2XB 2SKEA 2CWWA 3BA6A 1T8WA 1ZONA 2OXEA 2Y0CA 4LMPA 2QTGA 4NF2A 5AHKA 5BSVA 4A0QA 3PP8A 4TUYF 2G76A 4JOCA 2O5CA 4V02A 1GPBA 4Q3KA 1N5MA 2P9GA 2V6IA 3D3KA 3P96A 3M8KA 4RK4A 5K3SA 2YY7A 4DCJA 4QRIA 4GUDA 1Z25A 2VXBA 1LC3A 3OOJA 3F1LA 3RC9A 1K3UB 1T8UA 1TK2A 2JIDA 1UMKA 2YWHA 2QNIA 4KQMA 3E9NA 4HB3A 4DYHA 2O4UX 1XOIA 4LZPA 4ARUA 3MOSA 2XD4A 4W5RA 3I04M 2C2XA 2P6OA 3CLSC 3AXSA 2JBAA 3RRYA 1AOXA 1EQ2A 4CUJA 1U11A 2QIOA 4YJGB 2QTRA 3FBGA 2JCYA 2OZEA 2ZB8A 1BRTA 3B3AA 4FOTA 5KYXA 1PEYA 2OAQ1 4KOAA 1RXVA 1SKAA 5FFFA 1I14A 4OBWA 4K40A 1BDMA 3PV0A 1T9HA 4B46A 4CGYA 4YCCA 3VKWA 1OLXA 2ZCJA 3QVKA 3QPWA 4MDFA 1W4ZA 4S1NA 4XWGA 2W2OA 2ZIXB 1L8QA 3P2JA 3KALA 2CL6X 3DBVO 2H5JA 2FP4B 3EODA 2AEFA 1EJ6A 3L07A 3IR6A 1Z38A 4PXAA 4AROA 4ZANA 5JXJA 2WWFA 1SB8A 1OWOA 1W4LA 4GRAA 2EFJA 2GAFA 5F33A 3L41A 3UB2A 4C05A 2QMHA 4M0LA 1WP4A 3VR6A 5LQAA 3LTEA 1GA4A 1X7ZB 4GI3A 4II3A 4Y2TA 2PUWA 1NUPA 2IIPA 3I2IA 3L6EA 3OPYI 4R2LA 3MUNA 4DM7A 2JBHA 3EVZA 3RJMA 1IY8A 3P52A 1OT3A 4KWCA 5KS2A 1AQNA 1FTSA 2GEFA 1IQPA 2XCSB 5LA6A 4B7XA 1NM5C 5JADA 3WMFA 5JSFA 5FI0B 2OBMA 2YUIA 4LVCA 4EEXA 4GYYA 2GJ4A 4P93A 1YZHA 1T13A 4MPTA 4RVUA 4MUBA 2O8CB 4R2MA 3KSUA 2VJMB 1AUXA 2LGJA 4YRJA 3RIYA 1T8SA 3CO5A 4Q34A 4A36A 1WB6A 5MHTA 4F4HA 1GGNA 3IPYA 4C22A 1JEQA 2PGJA 4L8YA 1PG0A 3VISA 4M6WB 1U2QA 4PYJA 3O74A 4JEUA 1K68A 4M46A 3DONA 4J3NA 2SECE 1TUEA 3IBTA 4B3SB 3M5PA 2YHBA 1Z4OA 4DBZA 4ZEXA 1A7UA 1WMAA 5IZ4A 3K3PA 4U2CA 4OGLA 1CZNA 5EJGA 3IAS1 2VRNA 4RDCA 5DXAA 1ADBA 3FIJA 3GFVA 4OUKX 1NVEA 3KZXA 3RIHA 3EA4A 5LZ9A 3C3BA 3ONEA 2TYSB 1FL9A 1KZYC 2NSJA 4TS9A 5DXJA 5JE8A 3QNWA 1U1CA 3CONA 5AI6A 1IFXA 1Y7PA 1O5IA 2H7CA 4GXTA 2PGLA 3VTFA 4BO3A 4Z2AA 3OZUA 4J8PA 1UBJS 1KI8A 3CLSD 2I91A 4NBTA 4ZVVA 2IGBA 2BEWA 2UZ4A 2OGZA 5KTKA 5TDHA 3FKQA 3TN7A 1C3EA 3O90A 3SYMA 1MXFA 3CGWA 4BLUA 1AC5A 1VKJA 4HWPA 4Z0HO 2Y76A 3TRIA 1B8PA 3EXG1 5K4HA 2AG5A 2FZLA 2HL6A 1HH4A 2FRDA 1YHZA 2IPLA 3OO1A 3TZLA 3L8ZA 1R4NA 2GZMA 4OYRA 1ZD5A 3WBJA 3U7RA 4E15A 5I7HA 1CZLA 1RYEA 1ZD4A 4UU7A 2HMUA 3Q7SA 1BWPA 3DMNA 1N7JA 2D06A 1SQ5A 2NIPA 2O06A 4J4TA 1NW9B 1V9SA 1A2KC 1FMLA 4RD3A 3WSWA 4Y6QA 2O0MA 2RDMA 5GY7A 2C88A 3FPFA 4B6RA 4OJKA 2Y27A 1JG3A 4G67A 2RIRA 3LGAA 1W52X 4D0SA 1YNOA 4BRUA 4TV8A 1UOEA 4AS3A 2CUKA 2CC2A 2P3SA 3ZY5A 4DJTA 4E5YA 5AK3A 3K1AB 4P7JA 4BNKA 2E4ZA 5DT2A 3N7TA 2HA4A 4P54A 1T6BY 4C4RA 2HJRA 2DLCX 2JGLA 2BF4A 2OCAA 5TY0A 3SQDA 2PFKA 3HYSA 4ZAFA 4EHAA 3ER8A 1HEUA 1VJCA 2NXEA 1QC5A 1IONA 4AJIA 2QPAA 1RPTA 3LA8A 4N8EA 3T0IA 4JU9A 1I7DA 2ZUBA 1H0SA 1PJSA 1RHRA 4GPEA 1YA6A 2Q3HA 1XU4A 3LT4A 3NW9A 3ROPA 2BKEA 4MUFA 4NPCA 4P33A 5IDVA 4FDLA 1H1LA 2WIDA 1UMBB 4QRDA 5DYGA 1TW3A 3L0SA 4RMHA 3T1HB 3HN2A 3AEUB 3EGOA 1SWVA 3Q15C 5FUWA 2P7IA 4F3KA 2Z56A 2HSZA 1HGXA 4ESHA 1YDEA 1LDGA 5PNTA 2CJWB 2A94A 5E6SB 4ROSA 4UCXA 4DCSA 4X97A 5LQJA 3OUZA 2B4KA 2BL4A 4CV2A 3ML1A 1AUQA 5JPIA 5K6TA 1XTSA 3OHPA 3MFYA 1ZW1A 1MMFB 3BF8A 4MQ4A 1MQ9A 3RHSA 3QFSA 4Y0AA 1PN3A