1YZNA

Gppnhp-bound ypt1p gtpase
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
178
structure length
178
Chain Sequence
HGSLVPRGSEYDYLFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDGKTVKLQIWDTAGQERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYATSTVLKLLVGNKCDLKDKRVVEYDVAKEFADANKMPFLETSALDSTNVEDAFLTMARQIKES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords GTP-binding protein YPT1
publication title Structural basis of family-wide Rab GTPase recognition by rabenosyn-5.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 56
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2005-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1yznA01
4AIIA 1QBKC 1VG1A 3KKOA 4OI1A 1U9IA 2ODEA 1SVWA 2O5VA 2YZ2A 4TTQA 1RRPA 5KSOA 4JL6A 4C0BA 2DYKA 2RMKA 4FMCB 2DFTA 4OI0A 2GVDC 1YZLA 3GJ3A 1XMIA 1PV4A 1WBBA 2ZRAA 5C4MA 3LY5A 1XJQA 4JLNA 4HB3A 4KHZA 1SXJA 3O8CA 4IFEA 3Q72A 2HLDA 4JLMA 2B7CA 3QF4A 3T5DA 1MH1A 3H1TA 3N5CA 1XB2A 3SZRA 2G1JA 1W7AA 1QG2A 1R0ZA 2R44A 2JASA 2EYUA 1E79D 1OT3A 4I99A 1C1YA 1ZNXA 1AQYA 1Q20A 4O0MA 1KNQA 1XEXB 3VR2A 3AH8A 3KZ1E 4TMVA 4W5HA 3AVUA 4PPQA 3OIYA 4MGIR 3K53A 1GOTA 1CJTC 3FKSA 1R4AA 1A2KC 1SHKA 3JVUA 2OAQ1 1XX6A 3ZDQA 2JLRA 3ADBA 3FHTA 4EQ6B 2VHJA 2IWRA 2VLIA 1RJ9B 3KTAA 4JSTA 4EUNA 2H18A 2QA5A 2O0JA 3PXGA 2GTPA 1E96A 3SYLA 5CK5A 2ZE5A 3DOEA 5KNDA 4XD7A 3MLEA 2REXB 2JA1A 3EIEA 4MGKR 2BMFA 3TUJC 1F2TB 1ZUNB 3IIKA 2OCAA 1P9RA 3U4QA 4ERNA 4TN1A 5KTYA 1G1MA 4Q21A 3W5JA 1NNEA 2OXRA 1Z07A 4G0NA 3NVAA 3ZGXA 4JIMA 5HE9A 1VKJA 4RFSB 1N3BA 4TSFA 2E87A 3UXMA 3B1WA 1JXMA 4LOAA 2FFHA 3FYHA 1AN0A 1KYIA 1UF9A 1WP9A 5FI1B 2FN4A 1Z5ZA 1RPZA 4TYYA 4EJSA 1ZNWA 4CEIA 2XXAA 3KFVA 4IKEA 4C0AC 3M0EA 2O8EB 2REOA 4TT3A 5CDFE 2FFBA 5FPYA 1SULA 2IW3A 4KYUA 2VTKA 4PO8A 2QQ0A 3HWSA 1DVRA 2DHRA 1NMXA 5KDDA 4TWZA 1ZUHA 1HT2E 1IBRA 1G8HA 1ZM9A 3NTUA 1F2UB 2DY1A 1TNDA 4M1TA 1XD9A 2W00A 1OFTA 4GSYA 4K81B 5JWRA 3REFA 3GEEA 1CS4C 1QHNA 4CT5A 3IPXA 2EFHB 2BBSA 4MKHA 4RZUA 2D7DA 3K70B 1UKEA 1VG9B 3QKRB 2RKOA 4MA4A 4QBFA 2NQ2C 4BFZA 2XNDD 1OXXK 1YR8A 3A4NA 3K0AB 3NBFA 1KMHB 3VHXA 4B3FX 3QVVA 5H8WA 3EWAA 4M1MA 3SJBA 4P31A 5DGXA 4C7OB 5KO2A 2V7QD 1KO4A 3M1IA 4QOSA 1JAHA 1TU4A 4Q4AB 1DELA 4DT1A 1LTQA 2P6NA 4FN5A 2X1VA 4Z54A 4AURA 2C03A 2VP5A 4LUCA 3THOA 1OB5A 4RSGA 5CJPA 1SVKA 1GKIA 1XFAA 1G291 3BJIC 2A2ZA 2O8FA 3CRVA 2LWIA 2V54A 4OI4A 2QMEA 2ZRLA 3K0CC 4A36A 2CMKA 1DAKA 2EVWX 3B78A 5BWMA 2ERYA 4ILEA 4JBWA 2ATVA 2A30A 1G17A 1MO6A 1VCOA 2UVQA 1E9EA 1CF4A 4G3XA 3A1SA 4P4UA 1AJEA 3V00A 4BFXA 4HAWA 2IS6A 5BXQC 2HJVA 3E70C 4NL4H 4TL7A 5BYJA 4POAA 2NO9A 4A0FA 2G9NA 1E99A 4ARZB 4BEBA 4DXAA 1HQCA 2QL6A 3GFTA 5IHPA 4TLCA 1A4RA 1T0HB 4MRSA 2ZS8A 5E7MA 4QJ5A 3KKPA 1E2MA 2PZEA 4B2LA 4FWIB 4GRAA 3PIRA 2WVJA 4ZCMA 2C99A 2ZUDA 2CK3A 2JDID 2XOKA 4C0HA 3O8RA 1W36B 2XB2A 1YJ5A 4MYUA 2YNMA 4RZ3A 3BFKA 1BO6A 3QE0A 1K5GA 2ZTSA 3WBKA 3DKVA 1GL9B 4BLTA 1NBMD 4LJ8A 1DAGA 1XPRA 3GLGA 2P65A 3AVOA 3SYNA 3VTKA 1ZUIA 3AVWA 4HSEA 4G5GA 1JI0A 4XVRA 1KDRA 1LVGA 4Q7LA 1XTIA 4AK9A 1SGWA 3SI7A 1S0UA 4LPKA 5CB6A 4IEEA 4GPTA 1FUUA 4AYTA 2P5SA 1VECA 1S3GA 2IHYA 3B8HA 1NY5A 2ZRFA 3T1VA 2F7SA 4IVPA 5BQ5A 3AVVA 5FR1A 1E3MA 2YYZA 2WJVA 4TL8A 1Z83A 3WRXC 1R8QA 3VMFA 1RZ3A 4LBZA 4L16A 1XD8A 2H16A 2X2EA 3RYTC 1IXRC 4LHVA 1Q44A 1R0WA 2VP4A 1YR6A 4X8LA 2IYZA 4R2IA 4J0QA 1S1CA 4C0JA 1KI9A 1SVSA 4JLDA 1XEXA 5A0FA 3P4YA 5EXTA 3SNHA 2GEUA 1BS1A 1V5WA 2YWFA 1T91A 1HYQA 1DO0A 2J3EA 1HY3A 4IXNA 4DLRA 3VKGA 1W4RA 4IOLA 1I4DD 3L82B 2AFIE 4LX0A 1RRFA 1IY1A 4EPXA 2VL7A 1KSGA 4C30A 4EQ6A 1UBFA 2CVHA 1KHTA 1RJ9A 5EXXA 3EIQA 2A3RA 2IYRA 2R8RA 1HE1C 1P2VA 3H84A 4JSYA 2GJ9A 5LD2C 1DPFA 2WTUA 3CRW1 4GP6A 4WOPA 3B13B 1YQTA 1GITA 4JVNA 5LD2B 3IEUA 3MJRA 2Z0MA 4I1UA 1PLKA 5AUQA 5E7JA 4FMCF 3Q3JB 3WMFA 3V4RA 2Q3MA 4CEHB 1T8UA 3BFVA 1F5NA 5FPHA 1R5BA 4RFSA 4EPYA 3T15A 5F9FA 1G3MA 1Z6AA 3WHLA 1FL9A 1IXSB 3GJ5A 2WIBA 5JI2E 2PLFA 3E2IA 4ABYA 4JLBA 2F3TA 1P3JA 3NC0C 1ZD8A 3TVDA 1YVDA 3T34A 2IK8A 2DFNA 1AGPA 1N6LA 4MKIA 1Q22A 1KIMA 4JT2A 2OLJA 4O3MA 2ZVPX 4R98A 5CM8B 1G8FA 2O8EA 2GJ8A 1QG4A 1U8ZA 1RC8A 3QQ5A 2GA8A 3N70A 4QNMA 1KI7A 4Q1DA 4PPGA 3ZS8A 2RB4A 2FEMA 5J40A 2ZI6A 2ZS9A 4JYCA 1E6CA 2KI5A 2LCFA 2VP6A 4DLWA 3CF2A 2W6JA 2QY9A 1K6MA 1T3LA 3AGQA 1EX6A 4IDNA 1F2UA 2R65A 2F6RA 4LV6A 3T12A 1LY1A 3H86A 3WHKA 1Q21A 1R5NA 2ZI9A 3EWSA 1J8MF 3QXCA 4PSVA 3U3KA 1UJ2A 4ZI2A 5CYOA 5GVSA 2PJRA 1BIFA 2XTNA 1BMFD 2CL6X 4KITB 1DADA 1S1MA 1P2UA 1M2OB 4FINA 1ELOA 1FZQA 1GDDA 3CF6R 4KBGA 2O8DB 1T0JB 3VR5A 1HQYE 4JLKA 1DE0A 4QGFA 1W49A 2ZRDA 4Y0VA 5CDFA 2WJGA 1YRAA 4ZDJA 2D06A 4A8JA 2A5DA 4FCTA 3HJNA 4Q19A 3EPKA 2C04A 3CH5A 1JALA 4MRRA 3RS0A 1N5IA 4TZ6A 3IO3A 2CNWD 3L2OB 1OPXA 4MQBA 4MRPA 2A78A 1DO2A 4ASUD 1NG1A 5B64A 1G5RA 2QAGC 4WZ6A 2HJGA 2D62A 2CEAA 4NCIA 2FNAA 4R2HA 4NONA 4QHSA 1JEDA 1OLOA 4A82A 2V4ZA 4P33A 3PEVA 4DVGA 3C7KA 2BIFA 3ZZTA 1AZSC 2IYUA 3BFXA 3THYB 4F7WA 2ZETA 3EPLA 4URUR 1FNNA 4HAUA 5FH9A 1E4VA 4V0NA 1E9FA 2F1HA 4B6FA 1SZPA 4KCGA 3TR0A 4BLSA 2JIZA 4WA7A 4CEJB 2DCUA 4B2IA 4Q1AA 4A1FA 3OIUA 1KKLA 3GMTA 3T06B 1N0WA 4AKEA 2OSBA 4ARZA 4Q02A 4QM7A 3QVUA 1G8YA 4Q9JA 4DRZA 4QBIA 1NKSA 5DH9A 2R6FA 3FVQA 4HUQA 4RY2A 5IT5A 1XJCA 2QORA 1GFIA 2E1RA 1YZUA 5FL7A 4YMWA 4JVMA 2YINC 2JJ1D 1CJVC 5EQTA 2P67A 3D3QA 2O8BB 1CTQA 5B58C 1KK0A 1R6BX 2VPPA 3T1OA 1E2NA 1Y3AA 3LNCA 1VIYA 1QF9A 2JLQA 4OBEA 3ADDA 3SYKA 1N0UA 2OEPA 4JLOA 2J7KA 2H8KA 4I4LA 4Q1CA 4DUGD 2WJJA 2WOOA 1GZSA 1UFQA 3L8ZA 4F4IA 1UDWA 4YMSA 3FHCB 3CNOA 4JL5A 1BOFA 1RVDA 1PLLA 2VP0A 2ZRGA 1AGRA 4PHTA 1N25A 1KGDA 2RGNA 1KOFA 4NCJA 1U0JA 4YC7A 4DC9A 1KKMA 1MR3F 2IUTA 2PT7A 3P1JA 4Q4HA 4TMZA 4A6XA 3K9GA 4RD1A 3BH7A 4IDQA 2F1IA 1I4TD 3ETLA 3THXA 1FMLA 4Q1FA 1AS2A 621PA 4CZ2A 2FPMA 1Z28A 3RVBA 3AV0B 1FUKA 2IYVA 4UKDA 2ZROA 2ZUCA 1PVOA 2XTMA 1Q12A 1KAGA 4X8OA 2J9RA 1LFDB 4DJTA 4XWKA 5DHFA 3R7WB 2GKSA 3BERA 2YKGA 3VR4A 2IS4A 3OFND 1G4UR 2ORIA 3IQWA 4BFTA 4NMMA 4URXR 5CLLA 2XSZA 4MH0R 3AB3A 3CH4B 1GVNB 1CXZA 1XXHE 5FTNA 3QF7A 2Q21A 4LGMA 2C2HA 1G3QA 3O47A 5EXSA 3LXRA 2JLUA 4IDOA 2JLVA 3TQFA 1OXUA 4NPHA 1FP6A 3I62A 1OIXA 1Q1BA 1FP7A 4B32A 2HV8A 5L8VA 3EC1A 5DN6A 4LYHA 1WBDA 1RRCA 5FBLB 2QU8A 1JQJC 4DCTA 4WZBE 4C9BA 1F60A 4GOJA 3DDCA 3OF5A 3PQCA 3QIAA 3W3ZB 3W9YA 1TMKA 4P4SA 3QOFA 1GP2A 1XTSA 1XD2B 1XPUA 1J70A 1IN4A 1YHNA 5KNCA 1JECA 1ZNYA 1U94A 1XXHB 2XNSA 4CT4B 3PEUA 4MYTA 1N5KA 3L0SA 1LB1B 2Q3HA 5DLQC 1NF3A 3CX6A 1A2BA 1Q3HA 2P3SA 4W9MC 2E9SA 1GG2A 3ADCA 4G1UC 5AUOB 1E2FA 1FX0B 1EFHA 1KK3A 1U99A 1D8TA 3KDSE 2KBFA 4OK3A 4A4DA 4PR0A 3FPAA 5FUXA 5GADl 3Q7QA 1NLFA 1ANKA 3K09C 5ELXA 1IXZA 2WWGA 4BEJA 1TQ4A 4QRHA 3IPYA 1OYYA 2GZDA 1W4AA 2FPLA 2Q6TA 1KI2A 4LI0A 4MKGA 5KSYA 1AZTA 2WICA 5C1BA 4B34A 1E2PA 1U98A 2P5TB 1E2IA 1Z22A 1XMSA 1CP2A 1N6KA 1Z6GA 2ZI4A 1GRQA 2C78A 4O2LA 2IT1A 2OBNA 1KDTA 2F43A 3P20A 2AXPA 4GOXA 4BFSA 1PZNA 2A7QA 1DAMA 1RYFA 3A1VA 3B1XA 1E1QA 4IXMA 1YZNA 4Q4LA 4D2IA 5G53C 2CL7X 4HZIA 3Q8XB 2QE7A 1YKSA 1AKEA 2CLCX 1SXJD 2WWHA 3K0EA 2CLDX 4EPRA 1JB1A 2HLDD 5DO9A 3RABA 2NZJA 5G3YA 2CJWA 1IN7A 5JSZA 2JLXA 3M6AA 1II8B 3OHMA 2BKUA 3TIFA 1II0A 1HV8A 4HEJA 4JVSB 3GPLA 3GQBA 1N6IA 1CJUC 5GJCA 2VIIA 5C2JB 4IJMA 1G20E 3THYA 3PUYA 1KI6B 3BK7A 4RCZA 3UATA 4Y0AA 1D9XA 2FDCA 3VNVA 2W6IA 4G01B 4EKDA 3FDIA 4DLTA 1Z0AA 3CNNA 3FKSD 1UAAA 1DARA 1D9ZA 4RVCA 3VR3A 2GDJA 4D81A 1E9RA 4QJ4A 3OAAA 3N2EA 1SVIA 2QEQA 2RAPA 2R62A 3FB4A 3A37A 1YU9A 3DPUA 4DLVA 421PA 4QKQA 1VYUA 1NP6A 3FE2A 3UMFA 4XTCS 5JRJA 1EX7A 1G7RA 4NYMR 4ZCLA 2F55A 3JVVA 2FA9A 4N3NA 3PUZA 4RD4A 4XD7D 3CBQA 2QGZA 5EJEA 3GLIA 3F3YA 2J5XA 3HU3A 3LLMA 4HB4A 4Q03A 5FI0B 3HPRA 4B6EA 1N6RA 1XDBA 3L0OA 4KYIB 3CRRA 4Q7JB 4UJ3A 2O8BA 5TVKA 3GLFE 3DMNA 1MO3A 4TSFD 2IS2A 2FZ4A 5C46F 3KL4A 3QBTA 5FOVA 4A0RA 5KPDA 5CLQA 3FWYA 2QPTA 2AHOA 4H9GA 3B60A 2RGDA 3BBPA 1E0SA 1XF9A 3BC1A 3NBZC 5J4HA 2AWOA 2V1UA 2J59A 1UKYA 1ZC3A 4NYMQ 4C0LA 3D8BA 5KUTA 4URZR 1A5TA 2R6DA 3B1ZA 2NO6A 4BFUA 5JLJA 5CITA 4Q4JA 3AP1A 2RH5A 4OKSA 2C77A 1IN5A 3THWA 1ODFA 3Q7PA 3SOPA 4BUJA 4EAQA 3RANA 3NKVA 1W4CA 1ONBA 4BFVA 3GLFB 1MABB 1QHXA 1Z0JA 1ZCBA 1QHSA 3ZYCA 4LYAA 2C95A 4AI6A 1P5ZB 2QRZA 2J0VA 5F9HA 4M8NE 1NJFA 2PBRA 4TMKA 5KSPA 4OQLA 2CE2X 4AG6A 5GJWC 3UK6A 1U0HC 4CRWB 1MV5A 4IDPA 3EG5A 5DISB 2ZXUA 4AYXA 1NI3A 1G7CA 2CDNA 3AUYA 2O8CB 4Z1MA 3R7WA 4B43A 2W83A 1OHHA 1SKYE 2PEZA 4XWOA 2I3BA 1Z08A 4ZIRB 2V1XA 2Z4SA 4PO1A 2BHRA 1XTKA 3I4LA 2OFWA 4DSTA 1ETUA 3CUEF 4NHOA 4EPVA 2ZE7A 4R7ZA 3EPJA 1R5OA 1KI4A 1OH6A 2ZJZA 5H68A 2NMVA 4GI7A 2DR3A 2HCJB 3F5FA 2P6RA 2IBMA 4L8GA 4TLAA 1EWRA 2JGNA 2MSDB 3KXLA 3NEYA 2WJIA 2D3WA 4PAOA 2J0SA 2A9KA 2RGEA 3R9XA 3B85A 2F3RA 1GAJA 2KE5A 3NIBA 3ZIAA 1WCV1 5E3HA 3IQXA 3QXXA 1KJWA 3ZLJA 2I4IA 3CO5A 1NBME 2YC4C 1M1YE 4M2LA 4HZUB 1XMVA 5J4VA 3U7FB 1MO5A 1SKYB 2BV3A 5HCIA 3AKYA 3JZMA 2FSIA 3ASYA 3VU9B 4XIGS 2OG2A 3Q9LA 1XD2A 2VH5R 3KUCA 1E0AA 1FTNA 3RC3A 5G41A 2GXQA 2RGGA 2PCLA 5HZHA 1GRNA 3N2IA 1CLUA 2VYFA 2J7PA 2OFOA 1FQJA 4GMDA 2FH5B 4HLUC 5KOYA 2ZU0C 4QHTA 2GCPA 4TMXA 1NN3A 5DI3A 5H70A 1OJLA 2MMCA 3CX7A 3KJGA 4Q9LA 1DAFA 2EFGA 3CW2A 1OV4A 2CK3D 2XOKD 2AWNA 5BN4A 2CHVA 1RE0A 1KI3A 2BCGY 1QDEA 1XEWY 2GBLA 1NVUQ 5CYPA 4D25A 2OZEA 1T5LA 4N1AA 1S9HA 1COWA 1XEWX 2PCJA 2PMKA 2HDNB 1G41A 1PJRA 2GRJA 5EXPA 3ZVLA 1X1RA 4LC1A 1WA5A 4GP7A 2OE2A 1VG0B 2ZRKA 5EE1A 2YWHA 3GLHE 4L15A 3EZ9A 3TUZC 1PLJA 1E2KA 3AM1A 4I81A 5JJKA 2B6HA 4QG7A 3TKLA 1E0JA 2MMGA 5LDDC 2ZSEA 3GFPA 3KJIA 4L9SA 3CX8A 2VP2A 3VQTA 1ZNZA 4JLPA 2HF9A 1EFTA 4MDFA 1L4UA 2GJKA 2IUUA 5K8TA 5DIFA 2YWEA 3EZFA 4ZDWA 1D6JA 2EU8A 4ZO4A 4FW9A 4JJKA 3GFOA 1EFUA 1JPNA 1QHHB 4XTRA 4GZMA 1II8A 1F6BA 2IEZA 4G5OA 3ICEA 5CM9C 4E03A 2REBA 1JR3A 2Z4RA 1E1RA 3FTQA 4M9SA 5LPNA 1KI6A 4CGZA 3GLHB 4D0LB 1ZD1A 1EWQA 4DKXA 3Q5EA 4V0ME 4C0QC 2G0TA 2W0SA 5HPYB 1RIFA 1Z0DA 5J4LA 4F93B 2VHCA 2IF0A 1AS0A 4KV9A 3X1DA 4NZYA 4Q9IA 3DHWC 4PTLA 2OILA 2QI9C 1L7VC 1G64A 2G3YA 1X8JA 4IHQA 2AXNA 3AF4A 1WDTA 5DE3A 3EZ2A 1SQ5A 4C0SA 2DWPA 2WSSA 3WNBA 2IWHA 2IXEA 4DEXA 1U8YA 4PHGA 2ZJ5A 2NZ8A 5TDHA 2LKCA 2QP4A 1G5PA 4A2PA 3E1SA 3GJ8A 1TU3A 3EXAA 3AKCA 3I61A 2Z5FA 3LX8A 1KSFX 3CB4A 1WB9A 3G0HA 1IY0A 2HYDA 2EW1A 2IEYA 2YVUA 3VX4A 1G21E 5GVRA 4X8MA 4LHZA 4U5XA 4YLGA 5FFMA 1M6NA 4MUBA 2HT1A 3NDBB 3PEWA 3QI2A 1AA9A 1XPOA 3BB3A 1ZP6A 3G5UA 1YZQA 1OB2A 4PANA 4FMDB 1E2HA 3M4YA 4KO8A 4Q1BA 1NSFA 2BKEA 3NC1C 5E7IA 1OKKA 4RD0A 4V02A 3ZVNA 2D2FA 5JZVA 2WSMA 1TQDA 5LBIA 1GTVA 3DM5A 1VCMA 2BM1A 4NU0A 2CHGA 2AK3A 2PLRA 3OZXA 2W6JD 2W2XA 1MABA 3UKDA 2IF2A 3KXKA 3IEVA 1FW6A 1GNQA 4U02A 4ZKEA 1GL7A 1Z3IX 1ZIPA 2FF7A 4TQUS 3WY9A 2AKAB 4AKHA 1PUIA 1IM2A 5GJBA 2F1JA 2XNDA 3K0FB 4MDEA 2RGNC 3K70D 3AKEA 1IONA 1S3SA 4OHXA 1AQUA 3CF0A 3AGPA 3AQ4A 1Q1ZA 5FOSA 3MSXA 1MOZA 3CZPA 4NKRA 4WIAA 4DZZA 4OHVA 4AY2A 2QBYB 4EFMA 2D74A 1UBGA 2GCOB 3BOSA 3R20A 2FX3A 3U2QA 3SJZA 3IBGA 2R2AA 1W0KA 2ODNA 2OBMA 1CBUA 4GDFA 2W2VA 4B2PA 3GJ6A 2W2TA 4MUAA 2NPIA 2KB0A 3KKMA 3C15C 4V0OA 1ZCAA 2CCJA 4KVGA 2VQSA 2H92A 2ZU6A 1MKYA 1T3SA 2BCJQ 2EYQA 2IYSA 4BLRA 1FPMA 1J2JA 3RWOA 1EFRA 1QHIA 2JCSA 4BECA 4DLZA 2XZOA 1JJ7A 4ZV4A 2IS1A 1QVRA 4TQAA 1F2TA 2ZRJA 2WWWA 3DVLA 1T4GA 4OI2A 4URVR 3QKTA 5HTKA 1G3UA 2X8AA 1OFHA 2IYXA 1W1WA 2QPAA 4E22A 4XH9B 1N0VC 1Z2CA 2QM7A 2V6JA 3BAFA 2ZYTX 3RRZA 2WMNB 3AF3A 2BDTA 2JIZD 1T6NA 3PUWA 3NBYC 3VKHA 1IN6A 4C2UA 2FSFA 2FSHA 5FTKA 2PT5A 5AUPB 1DOAA 2I1QA 4B71A 1P9WA 1Z2AA 2VO1A 4BZQA 2ORVA 4YQFA 1GL6A 1GRRA 2FGKA 3VFDA 1SVOA 2B8WA 3HDTA 4HB0A 2R9VA 5CK4A 5EZ6B 1LS6A 1US8B 2ZE6A 4ITRC 5FL7D 3U7EB 5HCNA 2BVNA 1J7KA 2QGNA 3K9NA 3DM9B 4DCVA 4FMBB 1HT1E 1D2EA 1U90A 2BMJA 5JMTA 4NYIR 2VBCA 2QTHA 1H8HA 1E2LA 1P60A 4TYPA 2AX4A 521PA 3R8CA 4PC7A 1KI1A 2EQBA 2Z43A 1ZU5A 1Z0FA 4KBFA 2ASEA 4KVAA 3KB2A 2ZVQX 5AJXA 1E9CA 1YE8A 2DBYA 5G40A 4TYWA 3O8BA 1VHTA 4BPBA 3QKRA 1RRGA 2Z6VA 4II7A 1WQ1R 3K0AA 1KMHA 2UZIR 2CVFA 4YDHB 5EUMA 1UBEA 4F92B 2IXFA 4G5QA 1OW3B 821PA 3EW9A 4A2QA 2MSEB 3SEAA 3B1YA 4JS0A 2V6IA 3NHBA 1ZM3A 4DLYA 2IA5A 4C7OA 2WZQA 2JJ8A 3LRPA 3P26A 4NYIQ 3KXIA 3L8YA 4FD2A 2A5YB 2WJYA 4IFBA 2ZJ8A 3U61B 3W3AA 4D80A 1HEIA 1U81A 5DI9A 4ACBA 4Q4AA 2VA8A 5AWFC 1D5CA 5JHGB 1GKYA 5J4KA 3AVXA 4QM6A 2D2EA 1CRQA 2BWJA 2IYYA 3FFAA 1QHHA 2QAGB 3UPUA 4C0KA 1LF0A 4KFRA 1E2DA 4LC0A 5JWOA 2ZJ2A 5TB5A 2FFQA 3QKSB 2OAP1 2H57A 3IIJA 4RKFA 4PC3A 1AS3A 1NVXQ 3H2YA 4JJZA 1VDZA 3W90A 2FZLA 3V9PA 1XTRA 3K0CA 4DLXA 1NJGA 3GLHA 4OK5A 1JJVA 2BMEA 1R0YA 2O0HA 4QL3A 2N46A 3OE7A 3I5XA 3U7HB 4UXHA 1S96A 2ZJYA 1CIPA 3PG5A 1XNJA 2GEDA 1AM4D 2P2LA 3LLUA 5A4JA 2GXAA 3WMGA 1N5JA 3DEFA 3ZD7A 2XSZD 2QZ4A 3A1WA 1TQ6A 4DIDA 5TMPA 3U44B 3AVYA 3EIHA 3TE6A 4YXWA 4URYR 1WMSA 2C9YA 3I8SA 1FQKA 4O2RA 4E09A 2FGJA 4KFTA 4NCHA 1Y63A 3MWJA 2OCBA 1G3RA 1KSHA 2BBTA 2OXCA 1EK0A 4ACAA 2VHQA 1NSTA 1AK2A 4DB2A 2PL3A 4Q00A 4RD3A 1Z6TA 2KSQA 1W4BA 2IXGA 5DN6D 5BN5A 1P2SA 1XZPA 1OSNA 2R6CA 3DOFA 4BLPA 2VF7A 2BMDA 3HP1A 4V0MA 2RHMA 4M9XA 4LV5B 2QPOA 4A92A 3MGCA 5AR1A 3K9HA 3I8XA 5K8UA 1XMJA 2O0KA 5EE0A 4U00A 1JQLB 4JKYA 4LBVA 2P6UA 2OM2A 4MYCA 2NO0A 4HLCA 1R7RA 4TTPA 2AN9A 3GJ0A 4HYYA 3U6KA 2XAUA 3FMOB 2ZSFA 1JXOA 5HE8A 1SXJE 4G5RA 2PMDA 3LD9A 1K8RA 2QP9X 2ECKA 5EUQB 1OH8A 2SHKA 2J0UB 2GJAA 1AIPA 4BLOA 4B73A 1ZYUA 5F98A 4HB2A 4QGAA 1U9IC 3CPHA 2JEOA 1I4LD 1PUJA 1KK1A 3CONA 4R9UC 1KDPA 5EP1A 1KK2A 5FBVB 3BRWD 4CF7A 1HH4A 1WF3A 2JJ2A 1YZGA 1JPJA 2ZANA 3F0TA 4TYNA 4TLDA 4YONB 4DCSA 2RGAA 3A4LA 5BYKA 5DYGA 1SXJC 4R71A 3AVTA 5C18A 3BGWA 2BEKA 2IX3A 4OQNA 1E1QD 5CJ2A 1SXJB 1D2NA 1DEKA 2ZQ5A 2GXUA 3TW8B 5HR5A 1Q1EA 1E0KA 2QE7D 2N1BA 2C5LA 4HATA 3QF4B 4Q9KA 5FBWB 2V8OA 3E5HA 1GNPA 4AC9A 1IY2A 4OK6A 4KU4A 2LKDA 3HR8A 4PAQA 3ZVRA 4BZPA 4OJKA 4JVLA 4Z8YA 2GWHA 4XJXA 4BZXA 3LFUA 1P4SA 1N2CE 3OESA 2OCPA 2GK6A 3EAQA 4FMDF 2A5FA 4TL6A 3OEEA 5FOUA 3RAPR 2ODWA 3K1JA 5ANRB 3S1AB 3SBEA 2ZYWX 3TR5A 1XU4A 1EG7A 1KO8A 2WWYA 4CEHA 2F9MA 1A1VA 2W6ID 4V0LA 1MRSA 1TL7C 2AD5A 2J41A 1OYWA 3FHOA 3KTAB 2F1RA 4RD2A 5BN3A 1N6PA 3LVRE 3SR0A 1E9BA 2BBOA 1SVLA 3CNLA 2AK2A 2GF0A 1XCMA 3OAAD 4Q9HA 1NRJB 5L3VA 4UNNA 2HYIC 1P72A 2FJUA 1TUIA 1Z6XA 4LSGA 3VX3A 2ZAOA 4BWYA 1KDOA 3RS3A 4IRUB 2QN6A 3MD0A 5DSZA 2N42A 2GJSA 1KY2A 1NG9A 3TRFA 4DLUA 3RC8A 3W5IA 1FOEB 1US8A 2AFHE 2HT6A 1E4YA 2NO1A 4A2WA 3NXSA 4TMWA 5FOTA 1VG8A 3P4XA 1G19A 2OBLA 2P0EA 5GJVC 5HKKA 1NKTA 4EJSC 2VHTA 1RFLA 2ZITA 2UKDA 4LJ6A 5JCZA 1CKEA 2FU5C 1N6NA 1TQ2A 2K5UA 4PX9A 4EJSB 1A82A 1UPTA 3IILA 2ZM5A 4OQFA 2ERXA 3I3SR 4NCKA 4EDHA 2ATXA 3WYGA 1TF7A 2OESA 5AJVB 5FUVA 2ANBA 2CXXA 5E4FA 5LB2A 4F4CA 3IGFA 2O8DA 2GNOA 1LF5A 2GBLC 4RZXA 1GM5A 1W0JA 3P27A 3EC2A 3VAAA 3W6PA 1MO4A 1JEEA 2GEVA 5AK0A 2IYLD 2IL1A 1ZVQA 3SE0A 1GSIA 2ZIAA 3MWKA 3RHFA 3WRYC 1NY6A 3F8TA 1Z47A 1IJEA 1UEJA 2QMHA 121PA 2VRWA 3CIOA 5L3QB 4DB4A 5UKDA 4TYQA 1NN0A 3DZ8A 5DHAA 4AWXA 4TLBA 1H65A 3KB1A 4N0DA 1TX4B 2OV2A 2QAGA 3HYRA 2FWRA 2ZSAA 3AEZA 2YOHA 5IDVA 3TAHA 4L4UA 3KQLA 3IUYA 1L4YA 1RW4A 1NMYA 3B1VA 4HLDA 4Z1MD 1OHHD 3QUSA 2W0MA 2G0NA 3OEHA 4BGDA 5P21A 3FMPB 3L0PA 4DT1B 1P75A 3RSLA 3T61A 3SU8A 4IOMA 4CEJA 3AP3A 2ONJA 4EIWA 2PEYA 5J5CA 3FOZA 4D0NA 3RS2A 3U44A 5DNYB 4QXAA 4KFUA 1HA3A 4OQMA 3UWKA 1OFUX 2FFAA 3KKNA 3WYAA 3MCAA 1Z6YA 2ZRCA 3LXXA 4QBHA 4A15A 1ZJ6A 3U3OA 3TMKA 4RJLA 1OXVA 2EFEB 3ZIAD 3J81k 2FE4A 1DAEA 4HI0E 5FTMA 3CPEA 2JLWA 3GLGE 3QXJA 1GWNA 2ZUBA 3HU2A 4JLVA 4LV8B 2OCYC 4MRNA 4PAMA 3AP2A 1H8EA 1KMQA 2G1KA 2ZI7A 5AJWA 4DCNA 3EPHA 3NWJA 3SFVA 3TW4A 2Q9BA 3A1TA 2PJZA 4H1VA 4I1VA 5BW8A 3TLXA 2J7PD 5FR2A 3EZ7A 4FIDA 1R10A 1TEVA 4TT3D 5JFGA 2VP9A 2J45A 3A4MA 4TTRA 4Z8XA 3ZZ0A 1VHLA 2ZSBA 4B48A 4F91B 3BS4A 4DDVA 3GEHA 3A8TA 1E69A 2J0UA 2WWFA 2Q9AA 2WWIA 3HU1A 4JT4A 1W46A 1KY3A 1CJMA 3QG5A 3GLGB 3PR1A 1SVMA 3WMEA 4M21A 5DYIA 5JS7A 2HUPA 5KNBA 2J0QA 1E2QA 1I2MA 2WPDA 3SHWA 4K46A 1DS6A 2RGBA 1COWD 3T5GA 4D4JA 1FNMA 3PUVA 2GZAA 3PENA 1UKVY 3W8NA 4CYMA 2OT3B 4B47A 4D6PA 3RS7A 1EFCA 4V03A 3CRQA 1G7SA 3AVPA 1HTWA 2A5JA 4WAUA 5FTJA 2ONKA 1VYVA 1E32A 2IC5A 1AKYA 2ANCA 1J99A 4WXPA 1E2JA 1X86B 2G6BA 3AKDA 4B35A 2XJ4A 4P32A 4QFMA 3U6BA 4JBXA 2GAAA 2HXYA 3LW8A 1LNZA 4FI3C 4GT1A 4NTZA 3U7GA 4JZKA 1JR3D 4NH0A 3GJXC 3S1AA 5JEDA 1M74A 2AKYA 1E1RD 3LW7A 3HR7A 3UIEA 5IF9A 3SHFA 3EA0A 1Z0KA 2ZI3A 1E2GA 3CPJB 3ZQ6A 1IJFA 4GZLA 4PQYA 1ZW6A 4LZZA 1TF5A 1Q0UA 2XITA 1G9XA 4W5JA 1M8PA 2B7BA 3RRNA 4XVQA 3TSOA 3H0KA 3QJYA 4YDSA 1G4AE 2J46A 2QM8A 3RLFA 3ZJYA 3LO5A 2VSXA 2C98A 1XXHA 4IVRA 3TAUA 3NDPA 3QXHA 4LJ9A 1TEXA 3IHWA 1ZM7A 4PZYA 3IBYA 1NN5A 5K8IA 3PCRB 1FX0A 3TVTA 4CDGA 2WSSD 1NVVR 4B75A 3BH0A 3C41J 4HAXA 1RYHA 3U3RA 4DWJA 4JYBA 3LA6A 4ZPXA 2B92A 5IK2A 5D3MB 3BB1A 4Q47A 3C5CA 1GIAA 2ZE8A 1KZ7B 1G8PA 4B3CA 3KQKA 4B44A 2ODBA 3L0IB 1XZQA 4E07A 2BC9A 1KO5A 3K09A 4C4PA 4KXFB 5TV2A 4BRUA 3EA5A 2FPKA 3LQQA 3ASZA 2EWVA 3UMRA 5TARA 4LCBA 1SHZA 5TXGA 4XSGA 2OHFA 3KKQA 4TZ0A 1ZD9A 2QMUA 3FKQA 2V3CC 4OHYA 1FMJA 4OJQA 1I2DA 3I1FA 1KJZA 1NVVQ 1OKKD 2BOVA 3PEYA 3L43A 4IVQA 4PXAA 4PQFA 3TH5A 4ZDKA 1E94E 3MWLA 4OYHA 4BFWA 4B3GA 4UXIA 3RRYA 2QUZA 3MG9A 3LQRA 4EFNA 1ZC4A 5JCPA 2WHXA 4KFSA 4UNQA 3X2SA 3K70C 4D26A 1S2MA 5L3QA 2DFLA 1W5SA 2V55B 1JR6A 3FFBA 1E79A 2HEIA 1J8YF 2ZRBA 2R6GA 2CBZA 5FBQB 1NN1A 1DAIA 2CCKA 3Q85A 2RHDA 4EFLA 4M1YA 4A8JC 5JS8A 3KQHA 1J90A 3KJEA 1T5IA 2L0XA 3KJHA 3CWQA 4PHHA 4W5WA 4A8JB 2GETA 1GKUB 3A1UA 1OH5A 3TK1A 3U60B 4ZI3A 4MKFA 4NYJR 4DIEA 2ZRMA 4P0TA 1ZMXA 4XOIA 5FUWA 4ZCIA 3I5YA 4D4MA 3UG7A 3WP0A 1W0KD 4PHFA 4W7SA 5SZJA 3X1WA 2YC2C 4IDHA 3W6NA 5L3SB 2B8TA 3LBHA 4NE2A 2IYWA 3ND9A 3SN6A 4ESVA 1L8QA 2PX0A 4LK2A 5JECA 1U8AA 4IOKA 4UNPA 3TQCA 4V0KA 2ZREA 1N6OA 2VSFA 1EFRD 4AD8A 4ZDIA 1ESMA 3CRMA 5LB4A 3TUIC 3BORA 4PPFA 1LS1A 4Q66C 2NG1A 1KNXA 1WRBA 4NBSA 3LH5A 4LJ4A 4NYJQ 3VR1A 1IAQA 3BWDD 4Q18A 2UZ3A 1IQPA 2R6AA 4UXJA 3MWYW 4JKIA 3P32A 1P61B 4AKIA 8OHMA 2CCGA 1VMAA 1ZM4A 2VF8A 3HPQA 3UMSA 3RNLA 2EFDB 2XB4A 2WKRA 1DTSA 3RDPA 2ZPTX 2H7VA 2ZR9A 1JNYA 3PUXA 4FCWA 3CWZA 5FPSA 4HUQB 3WP1B 1ZINA 4WZAE 3NBXX 4LHWA 5CIQA 1CR0A 3AUXA 3B9PA 3QY0A 1VCNA 1BYIA 1W36C 3NH6A 2ORWA 4EPTA 4MGZR 4M1OA 5KHOC 3ADKA 4WBSA 4KLNA 3ECCA 3C4JA 1M7HA 2KWIA 2QQEA 3GCGA 5FBRB 2H1LA 1YR7A 3GLFA 4I1OA 2QRNA 4MITA 1H8HD 2Z83A 3I92A 4TLEA 1IOZA 3EARA 1M7GA 2XTZA 2YOFA 3LX5A 2GHIA 4RZ2A 2QT1A 1Q57A 3SS8A 4ZKDA 5KU1A 1ZU4A 4URWR 3GP8A 1XRJA 1TPZA 1Z0IA 4DHEA 3A36A 2ZJOA 1G8GA 2AL7A 3D31A 1X8LA 1E9DA 5L3RA 3QPVA 3KUDA 5JHHB 2C9CA 2JATA 2YOGA 4HDOB 2YHSA 3W6OA 1MT0A 4US0R 5CIWA 1OIVA 2WKQA 2V7QA 2O8CA 2HCBA 2NO7A 4XWAA 4LJAA 5KDLA 3FGNA 4Q4HB 2YJTD 4ZIRA 4M53A 1OH7A 2HF8A 3THXB 3PFIA 4A0GA 1A7JA 4F38A 3C14C 3QXSA 4HAVA 1S4QA 1X8KA 1KZGB 1G5TA 4Q7MB 3C8UA 2VSOA 2F9LA 1VCIA 2JLZA 5M04A 4M0LA 5B2ZA 4KODA 4PZLA 2G83A 5B57C 2CE7A 5KDOA 4O25A 5JBQA 1WXQA 2JAQA 2WAXA 2ZRIA 1QHYA 4DSUA 2CLSA 1T9HA 4LRWA 4KI0A 4UJ5A 4PPNA 4US2R 4M4SA 1EESA 3KX2A 4QHYA 1BH2A 1R8SA 3ZVMA 4HZUA 3OIWA 1DG1G 3OE7D 4HLQB 4NCNA 4LHXA 4BFYA 4QBGB 3VU9A 1ESNA 2GCNA 1P2TA 1P9NA 5CB8A 1XCPA 1VYTA 2EFCB 3BXZA 5KPJA 3TSZA 1Z8FA 1KSJA 1O87A 3FMFA 4A6PA 4YXWD 4M9QA 3REGA 3ZS9A 2OO7A 3KFXA 3WXMA 4B3BA 4U7DA 3SQXA 1FTSA 4JBYA 1LV7A 3WBJA 2DB3A 5SZKB 2JDIA 4C2TA 1OIWA 4NP6A 2D7CA 2X77A 4HLUA 1NL3A 2FEOA 4PSAA 2FV8A 2HXSA 2Q3FA 1TAGA 1VTKA 1P7CA 1NBMA 4OL0A 1P62B 3CM0A 4P4SB 2H5EA 1BYUA 4PO9A 4RFVA 4TQ9A 5D3MA 1W36D 4LHYA 4FCVA 4LY6A 2C8VA 4LYFA 2QSYA 3TSWA 1U2RA 2GK7A 2QMOA 1XCGB 3PV0A 4GBMA 4DCUA 3KQNA 1M7BA 2IHBA 5EP2A 3QPUA 2RCNA 2WM9B 1X1SA 2WIAA 5TY0A 3QEOA 4H1UA 2WWXA 3G82C 4UQOA 1G6OA 4HDCA 3RWMB 3X1XA 3MFYA 3QSYA 1G6HA 3QENA 4AKGA 1IN8A 1YRBA 4PC6A 5K8LA 1HE8B 221PA 4Q48A 1N6HA 4NDZA 3RS5A 4P4TA 2OLKA 2ZS7A 1JAIA 4DSOA 2GZHA 3MUFA 3QKUA 4BE7B 5AUNB 3LDAA 1TTTA 1EXMA 2NGRA 4PC1A 3I73A 5F2EA 2ZSDA 4CVNA 2AD1A 2YV5A 3T1QA 2J87A 1R2QA 2JJ2D 2C96A 1XBTA 3BE4A 4Z51A 2F43B 5EZ5A 2PH1A 1S8FA 4DLSA 4C3ZA 2ZRNA 3I72A 1XWIA 2GVZC 2FOLA 3VR6A 3TGPA 1T8TA 4M1WA 1DG3A 3NG1A 1V43A 5AJZA 2WBLC 3UANA 4PZZA 1G7TA 4L9WA 4LJYA 2VEDA 3RS4A 3JZAA 4S2EA 3VNUA 5H1YA 1UEIA 4K8OA 1KO7A 4N0EA 3UWOA 1KJYA 2CJWB 4G5SA 1YR9A 5L3SA 3K8YA 5JSZB 4D4KA 1Z29A 3RSOA 4BQSA 1UKZA 3IDQA 3GLIE 3DO6A 3FMIA 2ZJAA 3IKJA 1N5LA 4HDQB 4OHWA 1MRNA 1GNRA 1ZM2A 3BB4A 5EE3A 4I1SA 4P3YA 4D4LA 4QJ3A 5E95A 3T1TA 2XEXA 3Q5DA 4TL9A 3X1YA 1TF2A 1D2MA 1YZTA 1CULC 3MJHA 3OEED 3K0SA 2PX3A 2Q0HA 2Y8EA 4FXPA 5JI3E 3D6TB 4L5BA 3R9IA 4D0GA 4M1KA 1E9AA 1S9DA 4PQRA 3AF0A 1FFHA 1RKBA 4OQXA 1NLZA 4AYWA 5J4YA 1NLYA 2ZR7A 1KI8A 4D82A 4KAXA 1XTJA 4LBWA 5D3QA 3WNDA 4Q7KA 2BJVA 1KTVA 2ZAMA 5A5GA 1QVAA 2WAYA 3GLIB 2ZRHA 4KSCA 4DEYA 3TJZA 1CU1A 4FWTA 3W8RA 4CIDA 5EE9A 1IHUA 1X3SA 1YZKA 2JLSA 1P6XA 2YWGA 2ZRPA 4LJ5A 4MYHA 1R0XA 3DKPA 4WVFA 1CR2A 4OHZA 3CR8A 3ND8A 2BM0A 3B82A 4PSKA 3BD9A 1CR4A 3NHAA 3W34A 5HZKA 3PJRA 4B3DA 2A5GA 5SZIA 1KAOA 3MMPA 5HKKD 3PITA 2G77B 3A58B 721PA 1ZBDA 3IO5A 4KLZA 1B23P 1BMFA 2Q9CA 2WKPA 3K9LA 4XSHA 3TNFA 5JWHA 3VHLB 1XTQA 3H4MA 2O52A 2XGJA 2IYQA 2XX3A 4Q4JB 4YMTA 4IW3B 3K0FA 3THWB 3LVQE 1CEEA 3CR7A 2B21A 1CJKC 1OFIA 3A6PC 1W5TA 5IRCD 1B0UA 3R8FA 2IYTA 3NEJA 1W0JD 4LJ7A 2QBYA 4HUTA 4HAYA 2GCOA 2QP3A 3SJAA 2CNWA 4DDTA 2H17A 1U0LA 4ASUA 2BEJA 4DBLC 1EGAA 2WOJA 1NMZA 5FL3A 3NH9A 4AG5A 2ZEJA 3QNUA 4BASA 1II9A 3V4FA 2X19A 3AF2A 3OIVA 3LV8A 1QHGA 4YMUA 1W47A 1JBKA 4DDUA 2QTFA 4Q5IA 3GD7A 2EWWA 3D7MA 3EX7C 3EASA 4LPSA 1G3IA 3OEHD 4DSNA 2VHUA 2AR7A 5SZHB 3GEIA 1P73A 3ZH9B 2ZYUX 1Q3TA 3B5JA 3GJ7A 1NIJA 1SKQA 2GESA 3I32A 1TUEA 2FG5A 2PZGA 1W48A 1K5DA 1F48A 3LAWA 1UDXA 3U4QB 2ZR0A 1OF1A 4B74A 1OXSC 2JJ1A 5G3ZA 4RKEA 4LWZA 1E98A 3MRSA 4M22A 4WXRA 2GXSA 1DBSA 1G18A 3SFZA 2JLYA 3U3MA 3CLVA 4IOJA 3TBKA 3RRMA 4LBYA 2NTYC 3DMDA 4M9ZA 4A9AA 3WNCA 3DZDA 2QSZA 3PVSA 4DUGA 3T35A 4TMTA 4CEIB 1H8ED 1HURA 4XVUA 5FOXA 2XXAB 4BLQA 5KSZA 2FMXA 1Q1QA 4RCYA 1CR1A 2NIPA 3CKLA 2J1LA 3O8DA 4M1SA 4B3XA 4QGGA 1XEFA 4Q1EA 4US1R 5JJIA 1XJ0A 5DI3B 3UG6A 1ZIOA 5EP4A 2WV9A 1NVWQ 1BKDR 3IHLA 2OFXA 3CZQA 4UNSA 4HAZA 1L2TA 1XP8A 2MSCB 1O3YA 3QBVA 4KSBA 3ZQJA 3SJCA 3LBIA 1UBCA 4LDJA 3BH6A 6Q21A 2GF9A 4B76A 4X8HA 4QGHA 3AF1A 4Q01A 4CW7A 1JR3E 1VPLA 4GL2A 2DPXA 2TMKA 2NPFA 3U5ZB 2D4HA 2WPDD 5FTLA 3X1ZA 4JL8A 4JMPA 2DWQA 3QEJA 5C4GB 4S35A 3EZ6A 3QKSA 1TADA 2CL0X 2NOAA 3C16C 3IIMA 2CHQA 1ZAKA 2KBEA 2GILA 3C5HA 5KYKA 4LYJA 2RGXA 3OFNA 1GILA 4PFSA 1GUAA 1E9SA 4GMXA 2BJWA 1F3OA 1OXTA 5AJYA 3ZZUA 4E5UA 3B9QA 2WJHA 2QROA 4YMVA 2QTVB 2FSGA 3QPWA 3U3JA 1ZRHA 4EPWA 1NIPA 3ICQB 2XZPA 1UM8A 3B2EA 3MAAC 1G16A 2O8FB 3QG1A 5JRZA 2QENA 2WMOB 4RD6A 5JJLA 1T3HA 4IEIA 5EP3A 5FUYA 1KO1A 4QC2A 4GNKA 3SC3A 2X2FA 2W58A 1Z63A 1VIAA 1X6VA 2DFKB 3ONWA 4JLJA 5JEEA 1E2EA 4GOKA 4A0HA 4B33A 2C9OA 1CRPA 2G88A 1W2HA 2QNRA 4MGYR 3AVQA 1UADA 3LWNA 1M34E 1WE2A 2QAJA 3HYTA 5F3WB 1DAHA 1C4OA 2QG6A 2I1VB 4ESHA 2ZI5A 1HUQA 3SBDA 3B7GA 4BRWA 1W44A 1Z06A 1C9KA 3DL0A 5B30A 2XZLA 4QNRA 4JLAA 2KJQA 3SDZA 2GAOA 4UNRA 5J47A 3SQWA 2XJ9A 4F4JA 5FPKA 1W2GA 5FPTA 1LW7A 3ZD6A 3WYFA 4ON9A 2OUKA 2ZJBA 1OE0A 4MRVA 3LBNA 3BIFA 2PZFA 3B6EA 4PC2A 1QRAA 4KJZA 1QZXA 2QT0A 4WW0A 5FOWA 3VKWA 2BBWA 2RGCA 2IUSA 2DWOA 2ZYVX 3GJ4A 2V9PA 4DDWA 5EE5B 5IK2D 4GFDA 3KQUA 3R9WA
chains in the Genus database with same CATH superfamily
2PUFA 4IV5A 4OI1A 4E13A 2VTBB 3HCBA 1SVWA 3DL4A 5F5LA 2F90A 1WB6A 3O2JA 3O38A 4KPGA 1XHEA 1DINA 2WLTA 2GVDC 2XUHA 3ZVKA 4TOIA 4XGIA 3GJ3A 3NWBA 3RPEA 1LI7A 4DWOA 4EGAA 3FYTA 3PLAE 3C1UA 2JFYA 1AO3A 3UAVA 1WUJS 3AUSA 4ZZIA 4YAFA 1YUNA 2M6RA 2Z08A 3ZDYB 3IOCA 3O8CA 1G8KA 4RIIA 3NYQA 1W1UA 3TW8A 4DARA 5JJ5A 1R15A 5LMCA 4PBTA 2B7CA 2D8MA 4R9RA 3O95A 4O2AF 1MH1A 4XDZA 5COQA 1PT8A 2ZYSA 2EZ4A 3D6VA 3JQPA 3E84A 2PKWA 4G89A 3TOXA 1FJ2A 4RK4A 4WT7A 3LHFA 2R44A 4KQFA 3VI3B 3LIPA 5E0KB 3SG0A 3PX7A 4P38A 3ZU2A 1AK1A 1TM2A 1UJBA 1XEXB 2QVZX 5MN4A 1IIBA 3KZ1E 2XF8A 3I28A 2BH2A 1UM9A 4BMCA 2EIHA 4F3YA 2QT9A 3JVIA 5AT1A 3QPBA 4HRAA 1P44A 4O4IA 3SYRA 1W35A 1XX6A 4YT8A 2JLRA 4R1PA 5F1KA 3WIEA 3ZR4B 1PIWA 2FB9A 4BTLA 3ADBA 1P80A 1T2FA 1IG3A 1SELA 3K1YA 2IWRA 1FFSA 3T9AA 2H18A 2QA5A 3ZWOA 1K89A 3DL7A 1H2RS 3PXGA 1E96A 1P2BA 3EGCA 2BR4A 5ICCA 2FW1A 4RHYA 5IZCC 1CUCA 2LBPA 4XD7A 3ITNA 3MLEA 1H22A 1Q95A 1GPMA 2ZWVA 3EIEA 3DYVA 4X94A 4H7EA 2FW8A 1Z7EA 3EVTA 2JZOA 2OCAA 1IPEA 3JYLA 8GPBA 2PWBA 1PNRA 4YDRA 3DTNA 1Z07A 2J4CA 3ZWKA 1GADO 2WSBA 3NVAA 4D8YA 2VUSA 4DIKA 3FNGA 2JIBA 3M81A 3P19A 4IHAA 1OFVA 2E87A 1CRLA 3S27A 5JDIA 1JWLA 4UUQA 4QUDA 2OV6A 1JQKA 4TXJA 1KEVA 4FNMA 4H3SA 3DDWA 2R7MA 1AN0A 4A3SA 5ADVA 1RYDA 1KYIA 4BTEA 1FUIA 3RV4A 3G59A 1WP9A 4UHBA 2FN4A 1G8JA 2JFPA 3GEPA 5FI1B 3VYUB 1O95A 1EIWA 4TYYA 2PU5A 1CZOA 1M5TA 1OYOA 4N5LA 5IBRA 3WKAA 3W4JA 3QH4A 1GR0A 4IKEA 2RBGA 3ITDA 4C0AC 4DQXA 4GF5A 1RCFA 5BRJA 2O05A 3K9QO 3RUCA 3ZDRA 1SB9A 2ZB8A 4RY8A 5F21A 3IX7A 1SULA 4KYUA 2Q8NA 1W34A 4GGMX 4O2BB 3CZMA 4BOYA 3QVOA 1T0BA 3AR9A 2QQ0A 1GN9A 4C7KA 4DIBA 4F9EA 1DKOA 3BCRA 3PRHA 4JT8A 4TWZA 2CMFA 1COZA 5EHQA 1HT2E 3WX0A 4NMLA 2NQTA 1P19A 2DR0A 2C61A 4M1TA 2QZ9A 3NHZA 1JEYA 5BQPA 1OFTA 1TXGA 3KG2A 4XLZA 5IXSA 3OLWA 1R4NB 4OJYA 3REFA 2QTBA 1CS4C 1V3UA 3LNTA 3OFKA 1JDBB 5IHXA 2D7DA 2DUNA 4PLZA 5C1IA 1ND6A 2Z2YA 2NZWA 4TKUB 2NQ2C 5ALMA 1OXXK 1X0VA 3DLPX 3K0AB 3KJNA 3VHXA 4BIIA 4AY3A 3SJBA 4BMYA 1T1IA 2NO4A 4AZVA 3C4QA 1XU9A 4EG6A 1AKNA 1F9AA 5TIIA 3TTXA 1NT2A 3T3NA 1W85A 4LRUA 2A5LA 3HHPA 1N1EA 1JAHA 4ZFNA 4ZHQB 1MPTA 2NU7A 1WG8A 4UZFA 4AWAA 3RJ5A 1PVDA 2YJ6A 2R47A 1LTQA 4FN5A 4P34A 2X1VA 4WLOA 3TS1A 3X0DA 4IQ8A 1Y1QA 4BMSA 1JDVA 5JADA 3EVCA 4LUCA 3C3XA 3R5FA 1RQPA 4MB0A 4RSGA 1BD3A 5H5JA 3CVWA 1VL1A 3U13A 3MTIA 2WSLA 4G63A 3BL8A 2EARA 1BHSA 1EWVA 1L4FA 3EZNA 3PLRA 4OI4A 1Z4QA 2QMEA 2ZRLA 3K0CC 3OPNA 2ZPUA 1GKLA 4IILA 5K6RA 1Z9BA 1RHUA 4ILEA 3A0UA 1T36B 1G2OA 2FQYA 3OJFA 3WB1A 4UTPA 1MO6A 5G0WA 5IF3A 3JY6A 1N32B 1B6GA 3NGLA 1UMDA 1K8ZB 2Q49A 1ICIA 2NT3A 4J6EA 1U7ZA 1YGPA 5EIAA 4P4UA 1DV1A 2DZDA 2KHZA 2DPLA 3HKBB 1ECFA 3AFGA 3PNKA 2VR1A 4FMPA 4MUFA 1B4DA 3E70C 4WD3A 4MPRA 5BXQC 3QVXA 6REQA 1VBFA 1TD9A 1N1MA 2P0YA 2PAFA 3LUDA 4P2BA 1Q0HA 4A0FA 2P9HA 1M33A 2L17A 3MA0A 4N76A 1HQCA 3KVRA 4FE7A 3F3MA 3RIGA 1VL2A 3FZYA 1D07A 1BG6A 1X7GA 1T0HB 1X14A 2ZS8A 3E27A 3HE3A 2EZUA 2X8WA 3O4IA 1E3QA 3QGMA 4QJ5A 3ZW9A 5L45A 2O5EA 2YQZA 4FWIB 1YJBA 3RVSA 5TF0A 1F38A 1XC7A 2JIMA 3TM5A 5K8JB 4ZCMA 1PGJA 4FC7A 5GZ6A 2JDID 1C9NA 4RA6A 3O8RA 4OHMA 4UM9D 1TOAA 2NUPA 4JBIA 5EIHA 5IAGA 3G3EA 5EAIA 3V2IA 1RAIA 3BFKA 4JJ7A 3TPFA 3FJ1A 1K5GA 2ZTSA 3INYA 2JJMA 4JT9A 4EQZA 4I5IA 4RHUA 4TS9A 2WE7A 3ZKAA 1DAGA 1XPRA 5DT2A 3GLGA 1MLDA 1WY5A 2QL9A 3VTKA 3AVWA 3UM9A 3LGAA 5DYNA 2AG1A 4LRQA 1AG9A 1JI0A 1KEEB 1WOYA 3EDYA 1KDRA 3PHCA 3SXUB 1XTIA 1HX7A 1A69A 3DE4X 3SZGA 2QX4A 3SI7A 1FIUA 4RFLA 1ZK3A 1ZIYA 2CN1A 4LPKA 1KVTA 4MJLA 1MC8A 1FUUA 5ESXA 4EY4A 4U6SA 1Q7BA 2HK9A 3PLNA 4YCDA 3KM0A 4WCDA 1VECA 2IHYA 4AJKA 3S2GA 2ZRFA 3M5DA 4IVPA 5JRDS 3RARA 1RYYA 1P5FA 4RMNA 4R0MA 3TX2A 5FR1A 3AVVA 4ZOLA 4BL5A 1O94D 1Z83A 5EIFA 3VH4A 3WRXC 4DM7A 1R8QA 1QFYA 1VIVA 2CNKA 2FP4B 1RZ3A 4QVGA 3V8VA 1MAHA 2ADOA 5IMBA 4A8PA 4ZZ3A 3DO5A 3OZWA 1XWFA 4FYXA 4INOA 1O96B 2X2EA 5FO0A 1DC5A 4JOCA 3WYCA 4MYRA 4CN9A 2OWDA 3A31A 3KR2A 2IYZA 4HNVA 4CIYA 1T25A 4KXNA 3F5QA 5A4IS 5J23A 1WTAA 4KPUB 4BP3A 4JMLA 1KI9A 4ROSA 3N1UA 4JLDA 1H66A 1XEXA 2ON6A 5A0FA 5EXTA 4IHJA 1P0FA 3DE2X 3UOWA 4W5NA 4YPFA 3NNSA 3VR6D 2YWFA 4EYSA 3DEYX 4ZP1A 3CHYA 4IXNA 2W8BB 4B82A 3ITKA 1VE6A 4TX1A 2AFIE 4EPXA 1QGDA 3R24A 2R25B 1SCQA 1UT8A 2V0CA 3COYA 4ZVPA 5THXA 1UBFA 2AJTA 1U11A 2A3RA 3H5VA 1PAUA 1QORA 1YULA 4HQLA 4JSYA 4URFA 5I47A 5LD2C 1DPFA 4C6TB 3QLVA 3ZDCA 3BZUA 1K3UB 3B13B 1G9SA 1KR2A 4H3KB 4WOPA 1WKVA 1ULHA 3R9KA 2Z0MA 4I1UA 2XQVA 3FUUA 1ENZA 4COOA 4DMRA 4GE0A 3TGWA 3DTYA 1IBCA 2A0KA 1NZJA 3QPCA 4K9LA 3OECA 1ECBA 5FPQA 1G4HA 1T8UA 1SC6A 1ZISA 3BFVA 3WR5A 1F5NA 3LQ2A 5G0SA 5D8DA 4UHDA 5BMVA 4AJHA 1JV2B 1VPEA 3BWYA 1XZNA 1Z6AA 3WHLA 2QYHA 1FL9A 5BN3B 2C4HA 4DR4B 4OXNA 1NW5A 4FFMA 4ABYA 3AUJB 4JLBA 1P3JA 4DOMA 5ALNA 1YB1A 1XRPA 3RRXA 3T34A 2IK8A 2QVGA 4YREA 5CDHA 2DFNA 1AGPA 1N6LA 4MKIA 4MS1A 5KTTA 1KIMA 4JT2A 4KWEA 2H1OA 3RUEA 4BB6A 1C7IA 4F3NA 4O3MA 3P9IA 4R98A 4PZPA 3QWIA 4NBVA 3SK0A 1U8ZA 2PK3A 5HQTA 4KI7A 2GA8A 3OZEA 4QNMA 4JU8A 1ZOOA 1ORRA 3ZE9A 4O2BA 1D09A 2FEMA 3FNBA 4HX2A 2VOJA 3SSOA 4ARVA 2Y76A 3O74A 2R79A 2KI5A 3CUSA 3PDUA 4IXWA 4PTZA 5ALPA 4DLWA 5JZBA 3ZGOA 1Y1RA 3CF2A 1SCUB 2DM6A 4W8HA 1X8XA 3DBVO 4BLWA 2QY9A 2VCYA 3QLUC 2PVPA 1I6MA 2GN4A 3T5CA 4IDNA 5JZMA 2O2CA 4UVHA 1QPZA 4Y2SA 3WJ7A 2YR0A 5LOVF 3N59A 1R5NA 3EWSA 4R01A 4ZI2A 1Z4MA 1P4HA 1R4NA 5CYOA 1LEHA 4S1VA 2XTNA 1BMFD 1G8SA 3IJ5A 3ODGA 3DVAA 1M2OB 4FINA 4R7GA 1VA4A 1FZQA 1ELOA 4GM1A 5BSMA 1NASA 3K70B 4KBGA 2NP6A 1FTYA 2MWMA 1JKMA 3WGTA 2O8DB 3GJTA 4TKUA 1Y8RB 1HQYE 3G8CA 1SCBA 4JLKA 2OQRA 3B1KA 3S44A 2I99A 1O0BA 1W5BA 4AS1A 1YRAA 4HWGA 1PQYA 2D06A 5BSTA 3WK7A 5FJJA 4A8JA 1THGA 3QBEA 1DUVG 4H7KA 3GPBA 3HJNA 2XVMA 4JI3B 2GRUA 4Q19A 2XWQA 1JALA 1GTMA 3RS0A 1Y3BE 4BAUA 4XWYA 3K71B 4ASUD 1NG1A 3ORSA 1LSUA 3AY3A 4DE5A 1KVUA 3C5WP 2JFWA 2D62A 3LBYA 4AECA 4HSGA 4D4IA 4NONA 2FFRA 4OSOA 2Q1WA 4OOFA 4QHSA 1QRDA 2VAMA 2X8LA 3G5AA 1OLOA 3JWHA 3L7JA 8MHTA 5K05A 1VHJA 2PGLA 3JD4A 3K5HA 4GEKA 3TOVA 5KC8A 3C7KA 2PA0A 1E3EA 1AZSC 1SNYA 2OMEA 3ZZTA 4RHTA 2XE8A 1U9YA 1T36A 1WDLA 1WVMA 4V0SA 4F9GA 4PYQA 3A25A 4HAUA 4YFYA 1E4VA 4FCCA 1U3FA 1LD3A 1VPDA 2J3LA 1DJQA 2OMKA 1DDGA 3DWFA 3NHSA 4JXJA 4UDNA 2H31A 4KE9A 5HF9A 4AMZA 4BO6A 5ARBA 4CEJB 2HBRA 3HKBA 2WKSA 2Q1YA 4UHEA 1AQJA 4EY3A 4DCJA 3OIUA 1KKLA 3UKOA 5ALYA 4AKEA 5ELLA 4DW8A 5JNTA 3QVUA 2C9MA 3OPYI 1V45E 1NKSA 1V1MB 2A6PA 3LL7A 3HXPA 4KIWA 2JKYA 1DFIA 1KRHA 5HM6A 1H6BA 1GFIA 3WGQA 4HPJB 4B4OA 4X3CA 2ZWIA 4H1TA 1B74A 5FL7A 3RTAA 3KKKA 2FEPA 4HGOA 2O2IA 4PW0A 2DHQA 3DBIA 5CRIA 2EFJA 4WN3A 2VPPA 3TCNA 1DI0A 3T1OA 1M0SA 3G2JA 1DHTA 3EGVA 1F7UA 3SQLA 4EZEA 2QN8A 1EP9A 4MDHA 3AI1A 1KH3A 3CEPB 4ISBA 1MVLA 3UTCA 1VPVA 4IJUA 4OAQA 1E3WB 3V5NA 5HMMA 4PQGA 2I4OA 1F12A 2X15A 2ZB7A 1LVHA 3BXOA 1XHLA 2H8KA 2XQKA 3LUAA 3SKVA 3DLBA 2WJJA 3L5OA 3P2EA 4F1KA 1DLJA 2D8AA 3FHCB 5TQ0B 4JL5A 3SHVA 4E5DA 3DEKA 1RVDA 4AB1A 4CI0B 3HQ4O 1MQSA 1NQXA 2HFJA 2JGKA 2VJNA 4DC1A 2CUTA 4XYBA 4CL2A 4OH1A 1IZZA 1KOFA 1P31A 4LZLA 1OGIA 3SAJA 4HQFA 1BX1A 2JIRA 4TMZA 3FJYA 5H80A 1QHFA 2F3QA 4EMUA 4RD1A 4GYYA 3BH7A 4EB0A 5HJ7A 1AKWA 4XX0B 5AQEA 3ETLA 3THXA 1FMLA 3OBIA 1O96A 4OXQA 3D59A 2FPMA 4DGSA 1Z28A 3KEQA 2WFLA 5CR9A 4DL9A 1XR3A 3G8BA 2YX1A 5AO9A 5HF5A 3TTWA 2JL1A 1SJ9A 2EJCA 5KQGA 4N7MA 1JEAA 2A94A 4D80A 4AN4A 5KCZA 1Q12A 1PVOA 2Q6LA 2WYWA 3GPCA 4AL4A 1LFDB 3G13A 4DJTA 2YXEA 5JY6A 3R7WB 1GCGA 2MIIA 4JSRA 1XRSB 3S5UA 2NXCA 3HEAA 3TOZA 4UQLA 3WAGA 3H13A 4BNYA 2R7NA 4NMMA 5JDCC 3CURA 2V6FA 2QTTA 3EVBA 4QDUA 3RWBA 5EWLB 2MYUA 3B6IA 3C6QA 1HLFA 2Z95A 4WQMA 3P2YA 1FFWA 1IDOA 1TM4E 1O58A 1M6VB 1LDYA 1XXHE 3RSQA 4TWJA 1G3QA 5SYMA 1OH7A 2JF0A 3TQQA 1HL7A 4BUZA 1XI2A 4FFWA 3EVNA 2QD1A 5TPWB 1PJSA 1U6KA 1AHIA 1XZLA 2C59A 2Y0BA 3DKIA 4RENA 1LJUA 4LX8A 4NXMB 3MOSA 4J43A 1R4MB 2F1KA 2NU9A 2R48A 3ZXXA 1U0SY 5E38A 2HV8A 3L04A 5A06A 1A72A 5L8VA 3OPVA 4QBTA 5JCJD 1WBDA 1JYEA 5FBLB 1PVVA 2QUIA 4OP1A 4K9NA 4ZAWA 2C9ZA 1E63A 4WZBE 2X42A 4IJ6A 4C9BA 4DCTA 1CYEA 1XN1A 3DDCA 3QIAA 3P0HA 4IINA 2MDTA 1XD2B 1XPUA 1A76A 1Z25A 3D4BA 4LN1A 4W6ZA 5F7ZA 4ND1A 4I8IA 2IPAB 2B3TA 3M1YA 4R3WA 3AZOA 1CRZA 4YY3B 3L8FA 1GTL1 4FFSA 4N6GA 3PEUA 4E1AA 2NAPA 3HFSA 4ZOEA 2OG1A 1N5KA 4P0PB 1DKUA 3ML1A 4DIUA 1Q3HA 4W9MC 3ADCA 1YAJA 1JG3A 1E2FA 1FX0B 1EFHA 1U99A 4O1MA 1SA0B 2H2FA 2PRYA 4PR0A 1ZRNA 4UU7A 2IH4A 3FPAA 1J8QA 4DBVO 2RHOA 5GADl 3R5TA 3PL1A 5BNIA 1NLFA 2OBYA 3FWKA 1BJKA 5ELXA 1NUTA 1M5UA 2BUBA 1OYYA 2WJWA 1V11A 1W4AA 2OM6A 1KI2A 1LRLA 4FYKA 3TKYA 3WOHA 3F6RA 3CJQA 4MKGA 5LP6F 5C1BA 2C7OA 2BHTA 4BCDA 1NTOA 1E2PA 1Y89A 2Z6QA 3R6LA 4W7HA 2V97A 3HJBA 5A3VA 4AMYA 4M0UA 3M5CA 4CFZA 4O2LA 2IT1A 2F43A 5ALTA 2A7QA 3A1VA 4Q4LA 3TEJA 4D2IA 5HIMA 5G53C 4I5FA 4BYGA 2HBYA 5DCYA 2GBPA 2GZ2A 3LRXA 2QE7A 2XWPA 3Q8XB 4TZKA 1M0TA 1ZK4A 4CKXA 1AKEA 3E3NA 1SXJD 2B4TO 3K8ZA 4J0EA 5L7YA 2W4QA 3DMTA 4M38A 3OCJA 2P11A 3MINB 3N2YA 5M34A 2WSIA 1JB1A 3G9TA 5DCWA 3RC2A 1V4NA 4DZRA 5G3YA 4MI1A 6ADHA 1EFPA 1FFDA 3ZDEA 1YBHA 1OWOA 3V8MA 3R0VA 3DBLB 3SC4A 3TIFA 1II0A 1Z35A 1U0EA 2R5FA 4QUIA 3BXPA 4FNOA 2QX7A 4TKMA 1N6IA 3FPEA 5KS2A 1IWBB 5C2JB 5J2TA 4IJMA 5JAMA 5LU9A 1MDFA 3G6WA 3VR2D 3QJGA 4FEEA 2FDCA 2Q27A 3TPZA 2W6IA 2H4XA 2PZKA 3FDIA 3KL2A 4KMOA 4PNPA 4X5OA 4RVCA 5HRUA 1QHEA 2X5XA 1E9RA 1T3GA 4WNYA 3SNKA 4BU0A 3CLTD 2RAPA 1XLWA 5BWOA 2R62A 5KTKA 2OGSA 4O2AA 3RK0A 3MCWA 3DPUA 1VLVA 2HQOA 5JAHA 4KH1A 2SECE 2ZFUA 1UPBA 3FE2A 5JRJA 2PUHA 3N2NA 3ORQA 5D1HA 2PRIA 2A59A 4NYMR 2F55A 2IW1A 1PL7A 2C3OA 3QVSA 4JC5A 4RD4A 2I22A 4XYMA 5JOQA 1V5EA 3C87A 5D84A 4DQKA 4Z4EA 1IJKA 2BISA 3V8QA 2D1QA 3CEMA 3LLMA 4HB4A 3HPRA 3JRXA 5T4BA 1G20B 1N6RA 2CKMA 3QEKA 4XIJA 4Q7JB 3O4RA 1LBEA 5K0LA 5EKSA 2VK2A 3A9UA 1SBNE 3PI7A 5TVKA 5EG5A 3GLFE 1MO3A 3KT8A 3IKVA 1WNFA 3X3HA 2PKQO 2F8TA 3QBTA 5FOVA 4Y1RB 4A0RA 2OFFA 3B2NA 4DV4B 4Z7QB 4RJJA 1L3CA 3TNLA 4D02A 1E0SA 1E3WA 1R50A 4JR2A 3BC1A 3HKEB 3SSAA 2GZ3A 3PNVA 3DDOA 1UKYA 3TIVA 1J4AA 1ZC3A 3ANMA 4WACA 3VZRA 1KJIA 4FHEA 1UAYA 2DOKA 4BFUA 2EERA 2I9PA 4PRZA 3NAMA 5JLJA 4NCBA 5CITA 4Q4JA 3WIUA 2E49A 3SLGA 2QN1A 3IBTA 3G9UA 4EF4A 5HJ5A 4QOHA 5LMUB 1T8SA 2PX8A 1GUZA 1U2DC 1XTZA 3FNRA 1HR0B 2YV4A 4BUJA 3QA9A 4CV0A 5C8YA 3BN3A 4DUYB 1PV1A 4Z99A 4BFVA 5ED4A 4HVAA 2F4VB 4MO2A 4QTUB 4EY6A 4E0BA 5CLJA 3UW3A 4I3FA 3EXG1 4XX0A 2E4XA 4LF9B 4QRIA 4G84A 1QIJA 4LYAA 1B8PA 4G4JA 1FDUA 1L1EA 1P5ZB 1SQFA 1XU7A 2J0VA 3BGIA 4LMRA 4Y6LA 5GQSA 4DGQA 4KN6A 5F9HA 1AHNA 3DP9A 1GV1A 1YMVA 2Q07A 3G49A 2QLBA 4NBRA 4TWBA 4XB1A 5DX0A 4CRWB 4L4SA 4IDPA 1L1RA 2FUKA 2QR2A 3EG5A 4YRMA 1SIBE 4NNPA 3D1VA 1PDWA 2CDNA 3KEOA 3REOA 1WZNA 3W9BA 3R7WA 1JPVA 5AKYA 1QP4A 3NTRA 4BCBA 4DA8A 4BO0A 2RH8A 2I3BA 3LKZA 4L75A 2EIXA 1BD4A 1A7UA 4UVIA 3VVLA 3WL4A 5KOHA 1ETUA 3CUEF 3ZE7A 4NHOA 2J85A 1ML4A 9ATCA 4NVRA 4MP3A 4IIFA 1DKQA 3I01M 3MS2A 2ZJZA 5H68A 2XE4A 3HY6A 4IQGA 3BHJA 3HA5A 1RXUA 3FNEA 3GC6A 1GZ7A 1PI3A 1U0OC 3L93A 5GY7A 4AUNA 2OCXA 2QV0A 5DNCA 2MSDB 3NEYA 5KOJB 4K86A 5B3LA 1QQBA 2D3WA 4PAOA 2RCYA 4ADSG 1QJCA 2A9KA 4QA9A 3R9XA 3B85A 2F3RA 2J3JA 1EWYA 5IEBA 2QG4A 4QLOA 2VATA 4DJDC 3HB5X 1M1YE 2Q4EA 3JVDA 1GXSB 1OOEA 4RF4A 1C7EA 4EKEA 1GG5A 1OVGA 2YN4A 4K3VA 1MO5A 5P8WA 5J4VA 1QIIA 5GIOE 5HCIA 2DBRA 3AKYA 4NH4A 3HXOA 4BX0A 3ASYA 3EXIA 1O8BA 3P0RA 4V0RA 1NJ1A 2QYSA 4L3OA 5EHGA 1XD2A 3R5HA 2ZZMA 2UXBB 3PTZA 1ZVVA 2QUKA 5AKGA 4ZZ2A 2AN5A 1RFGE 4NK4A 5D01A 1QSGA 1AMNA 3UMJA 2JIDA 5HZHA 1AKMA 2WNHA 3N2IA 2VYFA 4WGFA 4GMDA 1QWSA 2EJUA 1HLGA 2GCPA 3DUWA 2Q45A 3IDOA 3NPMA 3R0XA 4CLHA 5B7QA 4WV3A 5DI3A 5KWJA 1YWGO 1XF1A 3OD1A 1SA0A 3CX7A 4K8RB 1A9TA 3PI6A 1QCYA 4MVJP 1KI3A 4JYAB 3QVGB 3WQHA 3QY9A 2YNMD 3V34A 1IXKA 3W7BA 4P4NA 3DHVA 5F5XA 5SY9A 4JUCA 5CU7A 2AI2A 2C7BA 2HA7A 3E15A 3AFHA 4H6PA 1D2CA 4NAVA 5JSHA 1PFWA 4X64B 1VE9A 2HDNB 1G41A 2DFPA 1E61A 4DG8A 3FY4A 3V8RA 4QU5A 1EA5A 1M8KA 1T6ZA 3O8OA 3QTTA 3DZFA 4XARA 1YU6A 4CCAA 5EE1A 1TYDE 1VG0B 3RRBA 1ZRSA 2Z04A 2YMLA 3FCYA 5HUJA 4D57A 5DJ5A 5GAJA 2YW9A 1NF8A 5JJKA 4QG7A 2PBLA 1Y8AA 3R7FA 2LV8A 1CT9A 2ACWA 2JHFA 3KYCB 5E2AA 3CX8A 1J1IA 5BYAA 1I5RA 1ZNZA 2JAUA 3EDOA 4OU5A 2RG1A 2X41A 3LOQA 1FLDA 1KEZA 4TWAA 5J63A 4DDHA 2YQ4A 3QU9A 1YIAA 3RUIA 3B1JA 2YWEA 3A04A 3EZFA 1M1ZA 3WZLA 3GFOA 8LDHA 1FS5A 4XTRA 3GJZA 4GZMA 4GI2A 3DBLA 4UNIA 1F6BA 4J2OA 4N6NA 4G5OA 4Y6SA 3EJWA 5CYGA 5CM9C 4G85A 1P6UA 1UBJS 5IPFA 1XOIA 3GVPA 4XGQA 3X1KA 5KIAA 1SHTX 5JARA 1E1RA 3IKLA 2CVOA 1XVLA 3FTQA 3MRXA 4L8WB 1J42A 4KK4A 4OQZA 4NARA 5E7QA 5AQ1A 5FCDA 4QTZA 1V1JA 1SM4A 1MRZA 5FA6A 1SO8A 1HYEA 3L4SO 4BN5A 3A05A 3DA8A 1EWQA 3M6VA 4DKXA 4GGOA 4WKBA 3Q5EA 4AUEA 3QX8A 3G88A 4DA7A 2R4UA 4GVLA 5AVSA 1RIFA 1Z0DA 2PWZA 1X9GA 4HGZA 5AK6A 4F93B 3EXEB 2R86A 1AS0A 3G85A 4KV9A 3BJRA 3KQTA 1H0KA 4NZYA 5SICE 1DXHA 1XVUA 4Q1VA 1NVAA 3LU1A 2CHEA 1O5OA 4RPGA 1J5EB 5T3UA 2Z3ZA 1W19A 3OQBA 1JIIA 3M5WA 1X8JA 1P1BA 3IESA 3S2ZA 2A1UB 1G5FA 2DWPA 1L4EA 1WQ4A 3AO0B 4LKRA 4N5NA 4H7JA 1G20A 1LKZA 2X8JB 4IQ0A 3ESBA 4LOIA 4NOKA 4PHGA 5TDHA 4C20A 4EHKA 4F38A 4YRNA 3E1SA 3GJ8A 1F0YA 2MCFA 2GCIA 3LX8A 5EESA 3ZC3A 1I7LA 4OM8A 3LDUA 4OQYA 4PNHA 2QMZA 1IY0A 4UARA 4Y1RA 4W1QA 1DJPA 2IEYA 1KOJA 3OO0A 4LMBA 4U63A 1G21E 5E6UB 3TLJA 3T1HB 2WTBA 3WGNA 2R1UA 4XDYA 4X6XA 4JUBA 1ORTA 3NTQA 1YOVB 1MVOA 2ECOA 4HN9A 4LSZA 3WLHA 5K9ZA 1XPOA 4L28A 3G5UA 1YZQA 1WB4A 1SWWA 1K7YA 2B25A 3GUYA 5GONB 3VAZA 4DQ0A 2EZ9A 2ZSJA 4IS3A 2QOEA 2J3QA 2WUVA 4DCGA 4RMIA 3UK1A 1UC8A 3NC1C 1EE9A 4FLFA 4PRYA 5JBQA 1I14A 5GOZA 4KQHA 1OAOA 5LBIA 2BM1A 5EJGA 3I4FA 2CHGA 2AK3A 1GGMA 2QIPA 2EKLA 2W2XA 5KWVA 3UKDA 2E85A 5IFKA 1UDBA 3WBFA 1FW6A 4OXXA 2EGUA 4U02A 5EJ4A 5DNUA 4OHKA 4TQUS 3WY9A 4BKUA 1K3FA 5A1TA 4OFWA 1YRYE 2P1DA 1PUIA 4AKHA 4MYSA 1IM2A 4RPKA 5F1YA 4R8KA 4C43A 1DOZA 2F1JA 3SYTA 3HA3A 1TLFA 3K70D 3AKEA 1IONA 1S3SA 4ER7A 5C1PA 1WULS 1N36B 4WKOA 3AGPA 3VR5D 1Q1ZA 1L0BA 2NM0A 1K7XB 3MSXA 4IGKA 4ZREA 3WDKA 4EFDA 1NUUA 1MVNA 3RKUA 3GFSA 3PSHA 3LRTA 4E2ZA 2FPIB 1W0KA 4B3TB 4MINA 1CBUA 1K4MA 1RHRA 3DBRA 4MWOA 4RS4A 3LYLA 2IHZA 3EIUA 2NPIA 1FRZA 3JWGA 1TM3E 1THTA 2CCJA 4KVGA 1VJDA 2H92A 2VQSA 2ZU6A 4HQKA 5CT6A 3B6JA 4JA0A 2HB6A 2IYSA 2V8BA 2ZIVB 4YK7A 2B8NA 1FPMA 3M6IA 1J2JA 3ZDFA 4EA7A 1EFRA 4JQSA 4F11A 4ZV4A 4KC0A 3FCXA 3F6EX 2GPTA 4PX5A 5K3OA 5KOJA 1J5XA 3KXPA 4KRXA 5E4JA 3EE6A 3DVLA 1LLQA 1KVSA 3H2ZA 4CBVA 1G3UA 2AZTA 2FZ5A 3ZKWA 5A3SA 2HMAA 2IYXA 3WG9A 1T15A 1W1WA 2VJDA 4GLFA 1B1AA 4E22A 4V39A 4XH9B 5JH7B 5C8DA 1Z2CA 1DBVO 3RRZA 1JA1A 2EBFX 2WMNB 3CCFA 2IVFA 1YJAA 3AF3A 2QQGA 2AN1A 3WNVA 1Y4AE 1C7JA 1JZQA 3NBYC 3ONEA 2ZG6A 3VKHA 1IN6A 4DPMA 2O2XA 4HWOA 3HM9A 3PK0A 2HRRA 1UXJA 2RI0A 4BZQA 1EFAA 1DJOA 1E0AA 1JVSA 1PKXA 3VFDA 4I3GA 2ASVA 2FHPA 1LS6A 5IJXA 1R00A 1V0JA 1US8B 5E2IA 2DJIA 4FJ1A 3U7EB 5HCNA 3WNQA 9MHTA 1J7KA 1QZ3A 1NQAO 5DDIP 1Y5RA 2QGNA 3RK4A 5L9AA 4EBFA 4FMBB 4PLGA 4ACBA 1CETA 2RAUA 3T3HA 4NYIR 4P22A 1YVPA 3AIIA 4S1PA 2HHCA 2PS9A 1RWBA 2UDPA 4TYPA 4ZK2A 2AX4A 521PA 3KNZA 4HP8A 3U09A 3STTA 4E5MA 3T9FA 1ZU5A 2ASEA 4QOFA 4MIKA 3WLSA 1RXYA 4YHHB 4BMOB 3RHTA 4JLSA 5G40A 4AVYA 4BO2A 5CBKA 5K0JA 4TYWA 4KIJA 5KMGA 5D51S 3AR5A 4BPBA 5KNLA 4IWYA 2NYVA 3JX9A 1RRGA 3EJ6A 3LUGA 3E2PA 1WQ1R 1C3LA 2WTEA 3B20A 3GIWA 1KMHA 4II7A 2CVFA 4L08A 2AR0A 4YDHB 1IZYA 1V7ZA 3BMCB 2XIJA 4IKPA 2MSEB 5FXMA 3B1YA 3SEAA 1GDHA 3QBJA 1ZM3A 3U0BA 3LRPA 2RJOA 4W1PA 4FD2A 5JMPA 3RRFA 1TVCA 2WJYA 2C92A 1Z3CA 2GPWA 3U61B 2EX4A 1HEIA 4AICA 3CCBA 3ELBA 3FNFA 1GKYA 2IVZA 4AZ3B 4DNQA 4F2WA 4LF7B 1CY2A 2I2BA 2B4KA 3DLCA 2IYYA 3B5IA 4PS0A 5CYFA 3RJZA 4EVQA 3RYCB 2QAGB 3WIVA 1YB2A 2TYSB 2JS7A 1LF0A 4BATA 3ZV3A 2UUOA 2ZJ2A 3KZOA 1IUOA 2YMQA 2FFQA 2Z2ZA 5EPUA 3A28A 1WNTA 1PT5A 1P7WA 1ULZA 3JQ9A 1SWVA 3FWPA 4JJZA 1FS4A 3K1AA 5CNIA 2WVAA 2DF8A 2O7RA 1NJGA 1OBFO 2RGYA 3U7QB 4CFYA 1ISSA 1M2KA 3LPAA 4Q3CA 3T3MB 1PWXA 2BMEA 3UHAA 4IO0A 4B87A 1S96A 3OZTA 2G09A 1GGKA 1CIPA 2K7ZA 1TW2A 1XNJA 2GEDA 4G4SP 1FFXB 5DM2A 1QU2A 1QP7A 1SBYA 3DEFA 3ZD7A 4DJEC 2QZ4A 3EXEA 2TRSB 1A8UA 4E3WA 1QH8A 4AULA 3U44B 1XDUA 5IJ0B 4ZVLA 1QVVA 2AF3C 5L3ZA 1KYYA 3RT7A 3FCOA 3UJNA 1WIWA 4HAOA 4KFTA 2FW0A 2GO7A 4IHKA 2B1GA 2NTEA 3OIGA 1Z6PA 1UK7A 3D7LA 5BQOA 1EINA 1FS6A 4LECA 1JAXA 1G3RA 1KSHA 1YUMA 3OQHA 4C7MA 3B3JA 4ML3A 4AG3A 5MHTA 1SRQA 3HWX1 4RIHA 1U8UA 2VHQA 3ZDAA 1AK2A 4DB2A 4RD3A 3RADC 3N58A 1W4BA 4PV7A 5BN5A 1BU8A 2NUBA 4YLEA 1PDVA 2FAXA 2PJUA 4E2WA 1ZH0A 2V7GA 1K1EA 3VO2A 4WY2A 3CLSC 5C5EA 4L5IA 4PSDA 3K5PA 4V0MA 5K8CA 3NHKA 4M9XA 1P39A 3PT9A 1QU3A 2ENWA 3MGCA 3N07A 1QPBA 1SPXA 1ID1A 2H9AA 2I8CA 4I9UA 4Z86A 1EDDA 3JXEA 3M6FA 1LNQA 2BE7A 2O0KA 1NM5A 2C4UA 4K28A 5BSKA 4LF4B 3WE7A 4MYCA 2P6PA 1R7RA 3IEKA 2MSNA 3IUJA 2Z8YA 1TRKA 2YASA 4G1MB 5BRNA 3U6KA 2D4AA 8ADHA 4L7VA 1JXOA 3IPLA 4R2MA 3RFXA 5ES4B 1SBCA 3LD9A 5HSGA 4KUGA 5F4BA 2QP9X 2ECKA 2FR1A 2XUOA 3KLPX 1QM5A 1NW4A 1HETA 3D0OA 4BLOA 1DEAA 1G9TA 4YRBA 4HB2A 4QGAA 5CH5A 1LPMA 5H3LA 3TQIA 3UCXA 4ZEMA 2X6RA 3EFBA 3SZLA 1KDPA 1DIHA 3BRWD 1DWOA 4M88A 5D86A 5IVDA 4CF7A 5A0TA 4BTVA 4B85A 1JPJA 4DTIA 4WBNB 3AI3A 2HPVA 3EPRA 4TLDA 1XWWA 4G0MA 1U7DA 4EB3A 4DCSA 3A4LA 1DAOA 5BYKA 4MKXA 1OQAA 4R71A 3AVTA 3BGWA 4FWBA 3Q40A 2BEKA 2HA3A 3UMYA 2IE8A 1SXJB 2PZAA 2NZXA 3L4BA 2Q2NA 1IQRA 1YH3A 4WMLA 1UKBA 2GXUA 3AF5A 1SKAA 2FPIA 4YXFA 1SC1A 3CKMA 3P4UA 4HATA 2QU7A 4MHOA 3M9LA 5FBWB 3UXEA 4R9NA 1I10A 1GNPA 3IP6A 3L6OO 1Y81A 4RH1A 5E1OA 3MPUA 2IGTA 5ERXA 3ZVRA 3QWFA 4X92A 4B6PA 5DWQA 4HNTA 2B0CA 2GWHA 4XJXA 4TGLA 2YL2A 2HDHA 3I64A 4JOSA 1N2CE 3MJ4A 2OCPA 2Z9DA 3DHNA 3OESA 4FMDF 10MHA 2O3QA 4J2HA 1Z5OA 3TG2A 4U7TB 3B89A 5FV4A 2WWYA 4FFRA 3L7AA 4NEHB 4X3OA 1VXRA 2C2MA 2QX6A 5JH7A 1MRSA 1TL7C 1ZGGA 4GOLD 2VLBA 2M1ZA 2J41A 4P8RA 3RVOA 2VPWA 4UATA 2W22A 1ZD3A 3VR3D 3RU9A 1N6PA 4MPDA 2DWCA 5BURA 1SVLA 1SG0A 3UT5A 4HOYA 3M3PA 5L3VA 1W4LA 5K0FA 1P72A 1HE4A 1WZIA 2FJUA 3BDVA 1NURA 3DQZA 3HKDA 2I2AA 1BE1A 1WMFA 1QQAA 5JTTA 1VJ0A 3F97A 3R6DA 4BWYA 3IAHA 1WABA 4EITA 3RS3A 5D7BA