1YZNA

Gppnhp-bound ypt1p gtpase
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
178
structure length
178
Chain Sequence
HGSLVPRGSEYDYLFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDGKTVKLQIWDTAGQERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYATSTVLKLLVGNKCDLKDKRVVEYDVAKEFADANKMPFLETSALDSTNVEDAFLTMARQIKES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of family-wide Rab GTPase recognition by rabenosyn-5.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
molecule keywords GTP-binding protein YPT1
total genus 56
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2005-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1yznA01
4OJKA 2F43A 3H86A 3KKOA 3LW7A 4M8NE 1II9A 4WBSA 2OBNA 5TXGA 3L0OA 2FGKA 4B6EA 4B32A 1AS0A 2W2XA 1IN6A 2WJVA 1IXZA 1Q57A 4LCBA 1UDWA 3WMEA 3ZLJA 3EA0A 3VKGA 1VIYA 4KFSA 3UWOA 3B5JA 2OSBA 1NMYA 1E2QA 2C2HA 3O8BA 1LVGA 1NKTA 4PO8A 3CRRA 4DEYA 1C9KA 1IN7A 1N5KA 2FSIA 4X8HA 2VP4A 3THYA 1E6CA 5DHFA 3HYTA 2BM0A 3QPUA 4I81A 4RD0A 3I1FA 3UIEA 4ZDKA 1E94E 4LHYA 1YZTA 3GFOA 3B9QA 2O5VA 3QENA 1ZNWA 4NHOA 2ZYVX 3IBYA 4TTRA 5CDFE 1VCOA 2ZRDA 2CCGA 2ZS7A 3AP1A 2F43B 1KK2A 3SOPA 2IF0A 4NONA 4AYTA 5DNYB 2A5DA 1T8UA 2YKGA 1BS1A 3PIRA 1GL9B 3LX5A 4KO8A 5SZKB 4C4PA 2XZPA 4CDGA 1FQJA 2NO6A 2VHJA 5TB5A 4C0BA 2IT1A 2GXUA 2IYVA 2A5GA 2O8EB 3NEJA 1G3RA 2H8KA 3IIMA 2EW1A 1COWA 1W2GA 1CLUA 3KUCA 2J5XA 1N25A 5JLJA 1Z08A 1SXJE 2BBTA 1TL7C 2C99A 1XD2A 5EE3A 4B3BA 5AJZA 4JBYA 5FL3A 4AYXA 4B3GA 2ODNA 1K5DA 5FTKA 2F1HA 5BWMA 4RD1A 3CWZA 3QF4B 2DWPA 5J40A 2QBYA 3GLGB 3B13B 1IY0A 2WM9B 1BYUA 1KK1A 2J0SA 3LH5A 3UMRA 2AD1A 2AKYA 1E1QA 5TMPA 1Z5ZA 2ZS9A 4IOKA 3HJNA 4EPWA 4DSOA 4QFMA 1IM2A 2WMOB 4R71A 1DAKA 1P3JA 2ZUBA 3U2QA 1OIXA 5BW8A 1SKYE 1MRSA 3GEHA 1L7VC 3WP0A 5DH9A 3U7FB 4LJ6A 2V6IA 1XD9A 2RGAA 2Q0HA 4M9SA 5G53C 4BFWA 2Q9BA 1R5BA 3SHWA 3BH0A 2V55B 1NRJB 1W0JD 1RVDA 1G19A 1P61B 4ABYA 4E03A 2A9KA 2UZIR 1Q1BA 4XTCS 4IRUB 3SJCA 4LBVA 1X86B 3Q3JB 5CIWA 2VSXA 3X1DA 5BN5A 1OYWA 1M7BA 4PZYA 1W0JA 4TSFA 1KGDA 1DAHA 3QKSA 1SKYB 2PX3A 1LW7A 4CRWB 1D8TA 1GWNA 5KSPA 1E2PA 1OJLA 5IRCD 3PQCA 3V4RA 5DSZA 1VPLA 3R7WA 1KJZA 3V9PA 2W6ID 2VO1A 2IS4A 3IO3A 3SYLA 1U0LA 5FBWB 4Q7JB 4C0AC 2OAP1 3R8CA 5DYGA 4DZZA 1GSIA 3F5FA 2FJUA 3TLXA 2VF7A 1ESMA 4OL0A 1QHSA 1DVRA 3BFVA 2CE7A 3KFVA 1AJEA 1XJ0A 1G3MA 3QNUA 2G83A 1GNPA 2XOKA 2XGJA 1Z0KA 2H5EA 2IUTA 3AVWA 1N6NA 1US8A 1CJVC 1TUIA 4P4TA 1XZPA 4QKQA 1P2SA 1M7HA 2R6CA 421PA 2E87A 3QI2A 3THXB 1OSNA 4BLPA 5DGXA 3B1WA 4RZUA 1ESNA 2R6FA 2V1XA 4TWZA 1UKZA 1ETUA 1E2EA 3T34A 3QQ5A 1OXVA 4IFBA 1IY2A 2P67A 2O0KA 1Z0IA 2J1LA 3T61A 1W5TA 1Z0FA 5FL7A 4B3DA 1G7CA 2IYUA 3BE4A 5CM8B 3WRYC 4AG6A 2JATA 1W4RA 2NO1A 1CP2A 2ZJYA 3GEIA 4OI1A 4Q1AA 4GP6A 4AYWA 4ZIRA 5M04A 4LJAA 3VNUA 1QHXA 2PMDA 2QQEA 3BORA 4X8OA 3TE6A 4A82A 4DIDA 3H0KA 1Z29A 4U7DA 1GRNA 5GADl 3ADKA 4Q19A 1P7CA 4P4SB 2O8CA 1TF2A 4XOIA 4LYAA 2CJWB 4P0TA 5SZIA 3OEED 3RSLA 4DT1B 4PHGA 1G8YA 1P75A 4XD7A 2KSQA 3Q8XB 3X1ZA 4DDTA 1KI7A 3TAUA 1UM8A 4EJSC 2D3WA 4HZUB 4NBSA 2FU5C 2YV5A 4C0LA 2X19A 4XWKA 1YR6A 3GD7A 3GLHB 2G0TA 1GRQA 2OHFA 3QVUA 3WBKA 3KUDA 2RGNA 5FH9A 3KL4A 3FHTA 3U3MA 4B44A 4DJTA 3BGWA 3ZVRA 1TNDA 1OT3A 1R5OA 2HEIA 4Q00A 1RJ9A 1C4OA 4EDHA 2C04A 2GETA 3C4JA 2ZPTX 5IF9A 3CR7A 4AI6A 1ZM9A 3F0TA 1GITA 4A6XA 3S1AA 3EWSA 3I8XA 3GJ5A 1Q3HA 4IDQA 2EWWA 2O0JA 3PFIA 2ZSDA 3RHFA 2JLYA 3HDTA 5H68A 2F7SA 1WA5A 3VHXA 4IDHA 2WWIA 3RRYA 4OK5A 2ZRJA 4JLAA 4JLNA 1QDEA 4L16A 4RD2A 2QSYA 5JSZA 4N1AA 1QG2A 2GVDC 3KKPA 3BAFA 1JQJC 3NH9A 4KCGA 1PLLA 4TYPA 4Q9IA 3CUEF 3G5UA 1XEXA 3HR7A 1IAQA 3KB2A 4RZ2A 4U02A 3TUIC 2C9OA 5AWFC 2WOOA 3CX8A 5J4KA 4EPRA 5E7MA 1Z6YA 2C77A 3A1SA 5K8LA 1CXZA 3L0SA 1IQPA 2VP9A 2QTFA 2VBCA 2QAJA 4HUQA 3FB4A 3FPAA 4D4MA 4QHSA 1W4AA 3SI7A 2GJAA 1DAFA 1E9FA 4M1TA 4LK2A 2CHQA 1AM4D 3U44A 2GZHA 2FN4A 1GL6A 4WIAA 1T5IA 1YR8A 2F3RA 2DHRA 2R8RA 2RHMA 4G01B 4UNSA 2D62A 2XAUA 1E4VA 5IT5A 3TJZA 2QGZA 3MCAA 1NG1A 4ARZB 3IBGA 3GLGE 4BFZA 2SHKA 1F60A 4JBWA 3TNFA 2ATXA 2CXXA 4TLAA 3QOFA 1KNXA 1AQYA 3GJ8A 3NEYA 1C1YA 2R2AA 1N5LA 4Q4AB 4UXHA 4MQBA 3UMFA 2XTNA 1HEIA 2CK3A 3A1TA 4TMVA 3TW4A 2BKUA 4NCHA 1CEEA 3LLUA 2BEJA 4G5GA 2ECKA 4HLUA 3C5CA 2FOLA 3CZQA 1SGWA 2JDID 2B7BA 1OXUA 3OZXA 3T1VA 3GQBA 1UF9A 2RGDA 2WHXA 4KI0A 5C4GB 1E1RD 2FEMA 4W9MC 2RGCA 1S8FA 1NVVQ 1SXJD 2IBMA 2WJGA 5A5GA 1KKMA 4OHXA 1Z0DA 3IEVA 4GL2A 4TYYA 3I62A 3EA5A 1E2MA 1WDTA 2PCLA 2NPIA 2ZSFA 1L8QA 2FZLA 1XWIA 2OILA 3L82B 2HDNB 3K0CC 4GRAA 4TQ9A 3MLEA 4BLOA 1OLOA 1Z3IX 3R20A 3CB4A 3B82A 1P2UA 2ZSEA 4WA7A 5IDVA 2X8AA 1RKBA 3NKVA 1YRBA 3HR8A 3BS4A 1UBGA 2IF2A 4S2EA 4O2RA 4PO1A 3DPUA 2REBA 2IWHA 2GCOB 4GBMA 4M1KA 5DLQC 4HDQB 1ZNYA 1E99A 2ZAMA 4BWYA 3LY5A 4I1OA 3CO5A 3PENA 1JJVA 3UKDA 2YNMA 1ZM2A 4BGDA 2X2FA 2QSZA 2ODEA 5G3YA 2KI5A 3K9GA 3QUSA 1NLZA 2DY1A 3BD9A 1NVVR 2E1RA 5DISB 5IHPA 4YLGA 4H1UA 2QROA 1MOZA 1YJ5A 1A82A 2CCKA 4A8JA 4PR0A 2IYRA 3TR0A 1ZNXA 4NCJA 4PPGA 4TT3A 3BIFA 4M22A 3ETLA 1VYVA 3MJHA 4LBZA 1XTRA 1XTSA 1R5NA 2GCPA 5JHHB 2I1VB 4TMXA 2ZRKA 1NN5A 1F3OA 1DG3A 4PSKA 4CW7A 2OV2A 4RFSA 1KOFA 2QAGA 2ZETA 4QOSA 2ANCA 2BIFA 3DEFA 5EUQB 3RYTC 1FX0B 2GDJA 4GFDA 4M1WA 2ZYWX 1P9RA 3GLHA 2WSMA 4XVUA 2QAGB 1RRFA 1QHHB 2PEZA 3QEJA 1ZD1A 4RFSB 2IWRA 3NBZC 4HZUA 2OM2A 3UG7A 2XSZA 4A92A 1E9EA 1G7SA 5KTYA 3CF0A 3EZFA 1SVLA 4KHZA 2QU8A 2ZI5A 1NJGA 4DT1A 1E0SA 2D2FA 1CRQA 3ZQ6A 3SN6A 3IUYA 5KOYA 2CCJA 1G8FA 5KSOA 3I92A 2QENA 4TLCA 2GBLA 4LHVA 3JZMA 4P4SA 3TK1A 3O8RA 1B0UA 1BOFA 1OYYA 3SR0A 1ZINA 1U8ZA 4QJ5A 3PUXA 1NLFA 2WV9A 1VG9B 2ZI3A 4JT4A 2F1RA 2VIIA 3CRMA 4BASA 4URVR 2BWJA 1G5PA 1J8YF 1HTWA 4NU0A 2AXPA 3QIAA 4Q1DA 2ANBA 4ZIRB 1A7JA 3CF6R 1G5TA 2A2ZA 4D4JA 2P6NA 4HDOB 1KY3A 1JR3A 3W6PA 3CW2A 4LV6A 5J4LA 1W7AA 1FQKA 2AWNA 3NHBA 3AF1A 4MRRA 4QGGA 4BLRA 3MG9A 2YWGA 2VP2A 1Z2AA 4KFUA 1E9CA 3D8BA 1Q22A 2HUPA 3G82C 4KU4A 1SVWA 2X77A 4MDFA 2JLVA 2VLIA 1VCMA 3D6TB 1RRGA 2GF9A 3IO5A 1M8PA 1ZBDA 2ZREA 4PSVA 4DLVA 1DAMA 4YMVA 4H1VA 2K5UA 5KPDA 1RYFA 4MKFA 4UJ3A 3TQFA 4F4CA 5K8UA 5AK0A 3IPXA 1W0KA 4XWAA 5CYPA 3OEHD 1JJ7A 2NG1A 5JWRA 3T1TA 1XRJA 2J87A 5LB2A 2NQ2C 2ZRIA 4QHTA 1IJFA 1VHTA 1KKLA 2FZ4A 4JLDA 4JL5A 5KU1A 2ZROA 1ZYUA 4ZCLA 3GJ0A 4CZ2A 4FMDB 4D0NA 1DO0A 4HAVA 2XJ4A 1W36D 2UZ3A 2V6JA 1F5NA 1ZD9A 5KDOA 4Q21A 1OHHA 3GEEA 3SQWA 2GILA 2D06A 2OESA 4IJMA 3ZJYA 4UNRA 1NSFA 2MMGA 3A1UA 4TMTA 2VL7A 2WJIA 4RY2A 1TEVA 4BLQA 3H84A 4Q1CA 4G3XA 2HF8A 4MUBA 4TMWA 1OH6A 1KSGA 3WY9A 2J3EA 3AUYA 2Q9AA 4ILEA 2FFQA 3AUXA 3W3AA 4KXFB 1MH1A 3TMKA 4DBLC 2J7KA 4DDWA 3A37A 5FBLB 5E3HA 1B23P 1NP6A 1KZ7B 1N3BA 1Z6GA 3LDAA 1VG8A 2J9RA 1LTQA 1UBCA 4C0SA 3U44B 1X1SA 1Q20A 1YZGA 1IN4A 1ZJ6A 2YHSA 3BFKA 2HT1A 1SVIA 2CMKA 4PTLA 4L15A 5FBRB 1HH4A 4ITRC 1N5JA 4Q1FA 3EZ6A 4HUQB 3ADCA 5G40A 1KIMA 1KO5A 4A15A 4Q66C 4OI0A 4UJ5A 4DSTA 1E3MA 3CH5A 4LZZA 2AD5A 3AF4A 1N0VC 4ZDIA 4YMWA 4V0LA 3I72A 3LXXA 1XEXB 2ZU6A 4MUAA 1BO6A 1DG1G 1LS1A 4YC7A 3CIOA 5IK2D 2GXAA 4B2LA 1Z6XA 1XPRA 3TVTA 4IDPA 4P33A 3PXGA 5GVSA 3E1SA 1PUIA 4LJ7A 1QVRA 1JBKA 2Q6TA 1H8ED 1FOEB 5JSZB 3QY0A 2IL1A 3LX8A 3CX7A 1Z0AA 2IYSA 1FP7A 3L0IB 1ZM7A 1A4RA 4L5BA 3VFDA 1EGAA 1GL7A 5JBQA 2B21A 3LA6A 3CNOA 5JHGB 2O8EA 2QP4A 2J0UA 1ZU4A 2JJ1A 1R7RA 4F92B 2ZJBA 3IPYA 3B6EA 2PCJA 2A3RA 1R0WA 2EFHB 2O8DB 1T3HA 3C41J 4WZAE 2CLCX 4O0MA 1AZTA 4AIIA 1CS4C 5DN6D 4IDOA 5ANRB 1MO5A 2QM7A 3PVSA 1LFDB 2B8TA 4FINA 5EP1A 1OFHA 1U94A 3K09C 3P26A 4R2IA 3FHOA 4RFVA 3B7GA 3ZVMA 2MSDB 3KFXA 2ORVA 2CL6X 2QNRA 5TV2A 3U4QB 4YQFA 4LUCA 2BBSA 3ZS8A 1KI9A 4KJZA 2GZAA 1W46A 1ZU5A 2Q9CA 3C14C 3THYB 3QPWA 2OO7A 2G88A 5EZ6B 4OI2A 4DKXA 4MRPA 2XB4A 3GFPA 5FOWA 4DCUA 1CJTC 2FWRA 3BFXA 4HEJA 1OH5A 3UPUA 3EC2A 2JJ2A 3ASYA 3AP2A 2PZFA 3LV8A 4PPFA 5FPKA 3OIWA 3PV0A 5FPHA 3DHWC 3GMTA 5KPJA 621PA 2RMKA 1T5LA 1IXRC 3QSYA 2RKOA 2LKDA 2IYQA 1XF9A 1OFIA 1ZC3A 3FOZA 4M53A 3QPVA 3QG5A 1TMKA 3KQNA 5CYOA 1D2EA 3TIFA 4LPSA 5FOUA 3I3SR 4AD8A 2PL3A 1OXSC 2DWOA 4QBIA 5EXTA 3A8TA 4A0GA 1XPUA 2REXB 1WXQA 4GP7A 4NE2A 1L2TA 1HQCA 4P31A 1GTVA 4LYFA 3PEWA 2F1IA 2JAQA 3PUWA 4OK3A 3U7EB 4HAXA 1FNMA 3RLFA 1IJEA 1HV8A 2A30A 2V8OA 2EVWX 4BEJA 3W8RA 1NI3A 4BZXA 3QEOA 4LC1A 3THXA 1BMFA 1IONA 2CHVA 3C15C 1FZQA 4H9GA 1EFRD 2QUZA 3IILA 2ZIAA 3EIEA 1DEKA 1KY2A 1US8B 2FNAA 2QPAA 4JT2A 4KSBA 1G4AE 4YONB 4C0KA 4PAQA 5J4VA 4LJ5A 5BN3A 3IIKA 2EYUA 3A1WA 3LFUA 1RYHA 4GSYA 1RZ3A 1W4CA 1G8HA 2P0EA 3CNNA 3IQWA 1AGPA 2CE2X 2G6BA 1NIJA 1EFRA 3QBVA 4AG5A 3KZ1E 2P6UA 3BB1A 4QNMA 3SNHA 1LF0A 3QJYA 1KHTA 3QXHA 1OV4A 2D2EA 2GTPA 1U81A 4Q9LA 4URYR 1RRPA 4GZMA 3TSZA 5EXSA 1CR1A 4GDFA 2IW3A 2F6RA 2ZEJA 3ND9A 2WOJA 1GIAA 2QPTA 2B6HA 4RCYA 3RC8A 1HE8B 3R9XA 2QE7D 1EK0A 1CULC 1EX6A 4HZIA 5EXXA 4L9WA 2ERYA 3REGA 3WYGA 3K0AA 4XD7D 4DSNA 4WOPA 1XBTA 1GVNB 2FGJA 1GG2A 4ZKEA 3SHFA 4A6PA 4QJ3A 1V43A 2QE7A 1Z06A 2V4ZA 1RC8A 4E07A 4LX0A 2GEUA 2IXGA 3VAAA 5LD2C 3QF7A 4NYJQ 2JLSA 4TL8A 4JLPA 1X3SA 1E2GA 1M1YE 4KVGA 4Q4LA 4OQFA 2Q21A 1KDPA 1D9ZA 3L43A 1OKKA 1N6RA 3BRWD 1J7KA 4TYNA 4EKDA 1Z63A 1XMVA 3Q85A 4V0NA 3U7GA 1I4TD 5BXQC 4B6FA 1SXJC 3WMFA 1CF4A 2GAAA 4PO9A 4C2TA 1J90A 2CLDX 2QL6A 2RB4A 5HCNA 3EZ2A 1NBMA 2PEYA 3P32A 3B85A 3QVVA 1NIPA 3QF4A 2AFHE 1HUQA 3HU1A 2WPDD 1Q1QA 1ZD8A 5JJKA 5AUPB 3RS2A 1CKEA 3FMFA 2QQ0A 4FCVA 4NZYA 4C9BA 3SFZA 3LXRA 4M2LA 5UKDA 2MSCB 2JASA 3NDPA 6Q21A 1F6BA 3RS7A 2O52A 3EG5A 1NNEA 3TKLA 3K53A 1Z2CA 2HCBA 1RIFA 3B9PA 4KSCA 4P32A 3VNVA 1U0HC 4KITB 2CNWD 4L9SA 5G3ZA 3W6OA 3IIJA 1J8MF 2WWXA 4MA4A 2Q3MA 4B74A 1T6NA 3VR2A 1YR9A 4FI3C 4DLYA 1KYIA 4JL8A 5TY0A 1I2MA 1F2UA 1DADA 3KJHA 4DLWA 3DMNA 4LJ9A 4Z1MA 1MABB 3ZD7A 5BYJA 2C96A 4AKHA 4Q4HB 5CLLA 2NTYC 4OYHA 2JGNA 1K6MA 3LBIA 2CEAA 3AF3A 3AVUA 4EQ6B 3IGFA 4PHHA 1EFHA 2O8FB 1WP9A 3KTAB 4G5SA 4RVCA 3VMFA 4JJZA 3UXMA 4DB2A 4QGHA 1JB1A 4V02A 2GJ8A 1YVDA 1K8RA 2BHRA 2H7VA 2AXNA 4II7A 3SQXA 1XMSA 3CR8A 5J5CA 2O0HA 4M1MA 2QA5A 4L8GA 4IEEA 4M9QA 4RKFA 3F8TA 4XVQA 2Q3FA 2NOAA 2PJZA 4IVRA 4HATA 5B2ZA 4XJXA 1FMJA 3JVVA 1XDBA 5GVRA 4A0RA 2GAOA 2JLQA 2NIPA 3BJIC 4IFEA 5FPSA 4K46A 1JECA 5F98A 5JRZA 3MWLA 3FE2A 4YXWD 4K81B 1XJQA 2D7DA 3HU3A 4A2PA 1JEDA 1KDTA 1SVMA 1DE0A 1ZAKA 4KFRA 1CJUC 4PQYA 5SZJA 3RVBA 1E1RA 1P4SA 1N6KA 3THWA 3TBKA 3DM9B 1G64A 4CEHB 4ZV4A 3VR4A 3M1IA 5C4MA 2XB2A 4OHZA 4N0DA 1PJRA 2PT5A 1AIPA 3MWKA 2WWWA 1QRAA 4HLDA 1NN1A 2HF9A 4BECA 1JALA 2DB3A 1VG1A 2ZYUX 4EPTA 1S0UA 2J46A 1IBRA 4RD3A 4QM7A 2WWHA 5FTNA 2FPKA 3NTUA 4G5RA 5EP4A 2FG5A 1G6OA 3MGCA 1II8B 1UDXA 4QRHA 1U8AA 2DPXA 4BZPA 1OW3B 5D3MA 3BWDD 3PUVA 4MYUA 4Z8YA 2ZANA 4D26A 2W58A 3A4LA 2CVFA 4WXPA 3SJZA 3DKPA 3ZDQA 4GMXA 2AR7A 3OHMA 4TN1A 3WRXC 5JEDA 3THOA 2PH1A 5L3QA 3BB4A 2Z5FA 5KDDA 4HAUA 1WB9A 5B30A 4CEIB 2FFHA 2JIZA 1JXMA 2VPPA 1G3QA 2NZJA 1Z0JA 1Z83A 3FDIA 4I1VA 4I1SA 4MYTA 3EC1A 4G5OA 2WZQA 4JVNA 3SJBA 1S3GA 2P3SA 3AVTA 4A2WA 4TT3D 3B1ZA 4B71A 3ZD6A 1G8GA 5EUMA 1VHLA 3CH4B 2ZE6A 2Z0MA 2IX3A 1N6HA 3EARA 4HAZA 3JVUA 3OIYA 3WYFA 2R6GA 4PC7A 4ZKDA 2HYIC 3CZPA 3AVYA 1J2JA 3I32A 1XTKA 2OCBA 4B2IA 2G77B 2IYYA 2FH5B 5AR1A 4DIEA 1ZVQA 2IYWA 3RS4A 4M9ZA 3ZZUA 1MO3A 3D31A 4V03A 2IUUA 3FMIA 2FF7A 2R6DA 4I1UA 1QVAA 4XH9B 1E2KA 1G8PA 5F3WB 2ZE7A 2ZRMA 3TGPA 2OXRA 4BQSA 2WIAA 2VF8A 1JR6A 2G1JA 1OFUX 4BUJA 4F38A 3UK6A 4M4SA 2HXYA 3U3OA 2IUSA 4TQUS 4DUGA 1T0JB 5LPNA 5C46F 2E9SA 3U3JA 3EPHA 2QI9C 4KYIB 2FFAA 3MMPA 2OBMA 2Z4RA 2RGGA 5JJIA 4MITA 4BZQA 4NCKA 2OLKA 2BC9A 1Z22A 3GLFA 3EWAA 1KSHA 1T3SA 1XP8A 1XCMA 4HLCA 2CLSA 4ASUA 4NYJR 1X8JA 3BERA 2ZJZA 2G9NA 4Z8XA 3ZIAD 4Q4JB 5AJVB 1E79D 1EFCA 2P5TB 5FPYA 2F9MA 1T3LA 5JI3E 2JEOA 3NBFA 5KDLA 1E0AA 1RW4A 5FL7D 3K0EA 2JA1A 4CT4B 2HLDA 4Q03A 2I3BA 5TVKA 4RSGA 4M1SA 4O25A 1SVSA 3O8DA 4Q5IA 3E5HA 3TRFA 5FR2A 4TLDA 1JI0A 2JLRA 2GVZC 2H57A 4Q9HA 3QKRA 4LBYA 821PA 1EFTA 1Y3AA 4QGAA 1LB1B 4MGZR 2PZEA 3OESA 4TL9A 1Q1EA 1NMZA 2BKEA 1ZUIA 4MGKR 5JWHA 3U3RA 1M6NA 3DVLA 1E0KA 2ASEA 3G0HA 2XZLA 4OQXA 1S1CA 2IYZA 3RWMB 2YOHA 4C0JA 3NVAA 1KI8A 3KKQA 4RKEA 2Z6VA 5DYIA 5FUVA 2OEPA 2W00A 5KNDA 1W5SA 4ZDWA 1CR0A 3U6KA 4A4DA 4FWTA 3MJRA 1Z28A 2YC4C 3QXCA 2R62A 3TQCA 3IEUA 3SE0A 1XB2A 4IVPA 1IN8A 1AN0A 4CEIA 5E95A 1AZSC 4C0QC 3GLIB 5L3QB 1D5CA 1G291 2ZVPX 3AEZA 4TMZA 5KYKA 3ZZTA 2EFCB 1XXHB 2IXFA 3NC1C 5K8IA 4XSGA 1MR3F 1Z6TA 3PITA 3VR3A 1Q0UA 3B1YA 3LQQA 1WF3A 5FUXA 3RSOA 4RZ3A 3RRZA 2IYTA 5EQTA 4EIWA 2VP0A 1U0JA 1R0XA 4KLNA 3L2OB 3C7KA 4HSEA 3BB3A 2H1LA 2C98A 2NO0A 2OUKA 2WKPA 1YZNA 5DHAA 3AH8A 4MRVA 4QNRA 4ERNA 1G9XA 4LBWA 1YQTA 2IEYA 2CVHA 1H8HA 3R9IA 3KJIA 4A0FA 1YHNA 1FFHA 1VCNA 3T06B 3W5JA 3Q7PA 1I4DD 5EE5B 2KB0A 4E09A 2WAXA 3NXSA 3L8YA 3BH6A 1XXHE 3VKWA 1M7GA 4CEHA 5HTKA 2P2LA 3WBJA 5JRJA 3B8HA 4Y0AA 5A4JA 1H8HD 4MDEA 1KAOA 4OQMA 4XWOA 1DO2A 3H4MA 3N2EA 4MKIA 4C30A 3AKDA 4URWR 2ZSAA 2ZITA 2FA9A 3QKTA 1VKJA 4R98A 1YR7A 5B58C 2OFWA 5KUTA 3TUJC 4QG7A 1QBKC 4AC9A 3GLIA 1OB2A 2OFOA 1P2TA 1OXTA 4QBFA 2A7QA 4KV9A 4LV8B 3I61A 1AKEA 1IHUA 1W36B 3RRMA 2ZJOA 3CLVA 1GDDA 4FCTA 2JDIA 5CB6A 1E2JA 5ELXA 3AKEA 3GJ3A 1GM5A 5JEEA 4HI0E 4MRNA 2CBZA 3KTAA 1NN3A 2DFKB 4A0HA 3RWOA 2V3CC 1KO8A 1XTQA 5DN6A 3SBDA 3T15A 4EQ6A 5CB8A 2O8FA 4M1YA 4G5QA 3PEYA 2MMCA 4HAYA 1NN0A 1QHGA 1VTKA 4B3CA 3EASA 1JXOA 1G5RA 4EJSA 2BMJA 2FEOA 3VU9B 2QM8A 4MGYR 3ZVNA 2OT3B 3MUFA 1F2UB 1NG9A 2XITA 4JLBA 2AN9A 4TTQA 1TPZA 3FGNA 1X8LA 3V4FA 1M2OB 4ZPXA 1YZUA 3B60A 4JS0A 4PHTA 2HYDA 2N46A 3VX4A 2YOFA 1DPFA 2HJGA 3HP1A 1E98A 1TADA 3EX7C 4B3FX 5D3QA 1PZNA 3L8ZA 4JVMA 4QBHA 2QMEA 2CHGA 4A9AA 2AWOA 2FSGA 3LNCA 3P27A 4ESHA 1W44A 3WNDA 3HYRA 2W0MA 5CK5A 4NP6A 2P6RA 1II0A 2J41A 4DCSA 4F91B 3JZAA 4JLOA 2I1QA 4CT5A 2OE2A 2Y8EA 4PXAA 1KJWA 4GT1A 1CJKC 5CK4A 4LHXA 3CBQA 4IDNA 4US0R 1YE8A 2XEXA 1EXMA 1Z8FA 3MRSA 1QHIA 2WWGA 1W49A 1CTQA 2QPOA 3UATA 4EFMA 1W47A 3X1XA 3DZDA 2F1JA 3SBEA 3K8YA 1E2NA 2ZI9A 3K0FB 721PA 5P21A 1HE1C 4IXNA 3KKMA 4TYQA 1R0YA 1U98A 3IKJA 3TSWA 3VQTA 5LDDC 2W2VA 5JFGA 2V54A 4WW0A 2VYFA 4ZI2A 1XNJA 1FUUA 4XVRA 1BMFD 1KO7A 4EAQA 2IS2A 4QC2A 3C8UA 4TLBA 2BMDA 3WXMA 3ADDA 1KI6B 1RFLA 1AK2A 3MAAC 5E7IA 1QZXA 1Q1ZA 1S96A 2IYLD 2ZRHA 5HCIA 2XSZD 5DE3A 1EWRA 1KSFX 4FCWA 1HA3A 4HDCA 2EQBA 4PFSA 4HLUC 2AK2A 3DOEA 1DTSA 3VR5A 3QE0A 2HV8A 4DSUA 4JMPA 1KDOA 1NY5A 4FMDF 4POAA 2QP3A 1E96A 1T0HB 2PT7A 3T1OA 5GJBA 3VHLB 4CEJA 3AM1A 3U60B 2NZ8A 5L3SB 2ZE5A 3AF2A 4PZZA 4D6PA 2BVNA 1BYIA 2QT1A 4OHYA 1TUEA 1GKIA 1X8KA 1FL9A 4LI0A 1KO1A 4Q7MB 4DLZA 3X1YA 4JLMA 2KWIA 2VHUA 2VTKA 2C78A 2WAYA 3I73A 4KBGA 1NVUQ 2JJ8A 2NO9A 3X1WA 3D3QA 4PPNA 2IS6A 4ZI3A 1U90A 4FD2A 5KSYA 1E9DA 2EFDB 4MGIR 4C3ZA 3RDPA 4KFTA 2F55A 4LWZA 1T91A 2VHQA 3U3KA 4JZKA 4D82A 3P4XA 4B2PA 3ZQJA 4HB0A 4KODA 4BEBA 4EFLA 4HLQB 4NYIR 4E5UA 2AHOA 2CL7X 3VX3A 1U8YA 4EPYA 1MRNA 5HKKD 5HE9A 4NMMA 1T4GA 5KO2A 2Z43A 1XD8A 2REOA 4TZ6A 3HWSA 2XNDD 4WVFA 2ZRNA 3GLIE 3NHAA 2WJHA 3SJAA 2JCSA 4MKGA 1FTNA 4LRWA 3W8NA 1J99A 4FXPA 2IS1A 2YC2C 1SXJB 3DKVA 1IXSB 3IHLA 4OHWA 3J81k 4KYUA 4Y0VA 4AKIA 1GRRA 4BE7B 1G7RA 2KBFA 4YMUA 4AURA 1W4BA 2XJ9A 2W83A 2J7PA 2LKCA 2FE4A 4DB4A 3K9LA 1XCPA 2PBRA 2QRZA 4B3XA 4GOKA 2PX0A 4N3NA 1KMHB 3AGQA 1XEWY 2DFNA 5TARA 3WP1B 4B75A 5LD2B 2OG2A 1ZUNB 2QG6A 4JYCA 5FOXA 3T35A 2IHBA 3EAQA 4UNQA 1N0UA 2XXAB 5EP3A 1CIPA 2FPMA 2P5SA 1AKYA 1F48A 4QJ4A 1H65A 1KAGA 3ECCA 1G7TA 3NH6A 1YZKA 1OHHD 1MV5A 3MWJA 4Z1MD 1HT2E 1F2TB 2R9VA 2WJYA 1RRCA 2J0QA 1DAGA 1MABA 5G41A 2YWHA 2ZJAA 5H8WA 3AVOA 1XFAA 3FWYA 4TL6A 4V0ME 4D80A 2WJJA 4DCVA 3ZYCA 3ONWA 5HZKA 2R44A 1JPJA 3KXLA 2HT6A 3GJ4A 2YINC 3CX6A 3KDSE 4WXRA 3U7HB 3PCRB 4I4LA 2ZSBA 2WWYA 2QY9A 2J0UB 3BH7A 3DL0A 4MYHA 1E0JA 1PUJA 5H70A 1JAIA 5AUQA 4DDUA 4CGZA 1M74A 3IHWA 4PC1A 4PQFA 2B92A 1YU9A 5IK2A 3I5YA 3Q7QA 1G41A 1NBME 3DZ8A 1H8EA 4DHEA 4LDJA 5CLQA 3K70D 5BN4A 4Q7KA 1FTSA 1TF5A 1GILA 2PZGA 3CPEA 1DAIA 1G1MA 3W34A 4AWXA 4Q18A 1WCV1 2JJ1D 5FUWA 2TMKA 2XZOA 4RD4A 3KXKA 4X8MA 2AL7A 2GJKA 3DO6A 2PLRA 1P72A 4RD6A 1U9IC 2D7CA 3NBYC 5C1BA 1COWD 1U2RA 3GJXC 1KDRA 2JLWA 4GPTA 5BQ5A 4EFNA 1E2DA 1VCIA 2VEDA 3NBXX 2ZRCA 1P60A 4NYMQ 4LOAA 4BFSA 1KI4A 2OCAA 221PA 4D4LA 1W2HA 3SYKA 4PANA 2PJRA 3OAAD 3C16C 2BCGY 4C2UA 4BFVA 5FUYA 1RE0A 2EFGA 1UJ2A 4UXIA 5DI3B 4AKEA 5GJCA 3OIUA 1S3SA 1NVWQ 4DCNA 2QGNA 3ND8A 1MO6A 3OAAA 2WTUA 1ELOA 2W6JD 5JCPA 2JIZD 3AVVA 2X1VA 2RGBA 2VP6A 1QF9A 3CPHA 4MH0R 1N6LA 4W5HA 3EIHA 4JJKA 1UKVY 4B73A 2FSHA 1IOZA 1F2TA 2ZJ5A 1E9BA 3CWQA 2W6JA 3CM0A 5L8VA 1R8QA 2CDNA 4ZCMA 2ZUDA 3AB3A 4IVQA 5AUNB 1ZRHA 2JJ2D 2ZTSA 3TR5A 4V0KA 2J59A 3A6PC 2ZI4A 1FPMA 3GPLA 3L0PA 3BK7A 4MRSA 4OJQA 5EP2A 1ZM3A 2FFBA 1S9DA 3QXSA 4G1UC 4TMKA 3FHCB 3RS0A 4MKHA 3TSOA 4Q9KA 1OPXA 2YWFA 4LGMA 3AGPA 4DLXA 3V00A 3LD9A 2GWHA 3R9WA 1I2DA 2XOKD 1GNRA 2GESA 2HCJB 3AVPA 4US1R 4URZR 1E9RA 2LWIA 4FIDA 1VDZA 1TU4A 3CRVA 2W6IA 4A2QA 2QAGC 4I99A 1PV4A 4XIGS 1UEJA 2IA5A 1PLKA 2ZVQX 2GEVA 4IKEA 3SDZA 1XTJA 2PMKA 1YZQA 2BDTA 5DIFA 4O3MA 2OFXA 3LAWA 4K8OA 4FMBB 3SU8A 1U9IA 1E79A 2C9YA 2WVJA 2OXCA 1UKEA 3KB1A 5AUOB 4PPQA 3FYHA 2XX3A 1U99A 1DOAA 2QZ4A 2GRJA 1EESA 1HQYE 1VMAA 3FTQA 4X8LA 3FFAA 2ZM5A 3NC0C 2GBLC 1HURA 1K5GA 3PUYA 2YYZA 2QT0A 4UXJA 2H17A 1GFIA 5J4HA 4Q7LA 3OEEA 1ZP6A 1QHHA 4BRUA 4URUR 5JS8A 2VSFA 1MKYA 5FTLA 2VP5A 1G3UA 3AKCA 3BC1A 3U4QA 1FX0A 2Z4SA 2ZU0C 4D25A 2ORIA 1AQUA 2RGEA 4JBXA 1KI2A 2GXSA 2IYXA 2XTZA 1FP6A 1LY1A 2BEKA 1LF5A 1OFTA 4ACBA 4CEJB 2C03A 3R8FA 5AJYA 3QKUA 3W90A 4Z51A 2JLZA 2QTVB 1ZIPA 4Z54A 5KSZA 2O8DA 1WMSA 1A5TA 5CIQA 1N2CE 2ERXA 2IHYA 4OI4A 1ZW6A 4GOXA 1D9XA 3OE7D 5DI3A 4GOJA 2BBOA 3FKSD 1S2MA 1CBUA 2VHTA 4HB4A 5C18A 2ODBA 3I8SA 1CR2A 1ZC4A 2WKRA 4IXMA 1GAJA 2FSFA 2ZI6A 1XMJA 4BFUA 5F2EA 2FMXA 2WPDA 1OKKD 3OE7A 1KI6A 3A58B 4U5XA 3FKSA 4D81A 2N1BA 5LB4A 4NCIA 3LVRE 2GEDA 1ODFA 2GKSA 3AQ4A 4KAXA 2VRWA 5HE8A 1UEIA 4DXAA 2Q3HA 2IC5A 4M0LA 4Q01A 2CL0X 3K9HA 4M9XA 1P73A 2PLFA 4JVSB 4LY6A 3RAPR 3VR6A 2XTMA 5A0FA 4E22A 5EXPA 1YRAA 2FPLA 1UBFA 4B33A 1LNZA 3OFNA 4RZXA 1XPOA 4QM6A 4EPVA 3K70B 1VIAA 1Z6AA 1YKSA 3K1JA 3UG6A 4JKIA 4DCTA 3SEAA 4HUTA 3TUZC 2QORA 2OCYC 3KX2A 3ICQB 4U00A 2BMEA 2VHCA 1KJYA 4AY2A 1WE2A 5E4FA 1NF3A 2GK7A 2A5JA 2OZEA 2UKDA 4LYJA 2V7QA 1V5WA 5L3RA 1MO4A 1ONBA 3SYNA 2GA8A 2CNWA 1Q12A 2QMHA 4JKYA 5FPTA 4NCNA 1TQ2A 2V7QD 1AS2A 1UFQA 3PJRA 1DELA 4JSTA 4TL7A 1NVXQ 3B2EA 4YDHB 2H92A 4W5JA 4GZLA 3B1VA 4ACAA 2VA8A 3O8CA 4FWIB 4NPHA 2QEQA 1NKSA 5FOVA 1CRPA 2NMVA 1HY3A 1FUKA 4QHYA 1D6JA 3RS5A 1Q3TA 2CK3D 2ODWA 2V9PA 4D0LB 3CPJB 2IK8A 4NYMR 4YXWA 3VU9A 1KI1A 1TEXA 1X1RA 1XEFA 4EJSB 3U61B 4PC6A 2ZXUA 4WZ6A 1WBBA 3FMOB 1SZPA 3KKNA 1SHZA 3QG1A 5L3VA 2ZRAA 3A36A 5KNBA 4G0NA 4ARZA 3EZ9A 4URXR 1Q44A 2WIBA 2ZQ5A 3TVDA 3QXJA 4DVGA 3AVXA 1N0WA 3ZGXA 3ZVLA 3ZH9B 2ZR0A 5BYKA 4NH0A 4NYIQ 2XXAA 2VSOA 2DCUA 1ZNZA 521PA 4NTZA 3ICEA 2ZAOA 2H18A 2EFEB 1NY6A 1LV7A 1KMHA 3T5GA 2RHDA 4PQRA 3AKYA 3PG5A 1KK0A 1R2QA 3IDQA 4CYMA 5TDHA 2NGRA 4PSAA 4LV5B 5EZ5A 1XTIA 1JR3E 2YZ2A 3EIQA 3LO5A 4Q9JA 4TLEA 3MSXA 1D2MA 4Q48A 1EFUA 1S4QA 5CJ2A 4OBEA 1I4LD 1NL3A 4FW9A 3LQRA 1VYTA 4F93B 1N6PA 1E69A 3PUZA 1R0ZA 2WMNB 1SXJA 2BM1A 3PR1A 2NO7A 2GZDA 5FOTA 5EE0A 1MT0A 1E1QD 3UANA 1PVOA 4HYYA 5B64A 2AFIE 4C0HA 1KMQA 2WWFA 2ZE8A 4OQLA 1E4YA 4UQOA 5JS7A 2BMFA 4LJYA 4BFTA 5K8TA 4TYWA 3A4NA 4J0QA 3U6BA 2GJ9A 4IHQA 1KI3A 2YWEA 1GKYA 4W5WA 4S35A 1W1WA 2ZYTX 2B8WA 1RPZA 1XXHA 1R8SA 3UMSA 4L4UA 1FW6A 4TSFD 2BJWA 3HPRA 1W48A 5FR1A 3GJ6A 2J45A 2ONJA 1XZQA 5L3SA 5F9FA 4FMCF 1GUAA 3TW8B 2A78A 4JL6A 2AX4A 3M4YA 5E7JA 5JCZA 1E2FA 4PC2A 4M1OA 4DLSA 2I4IA 2WBLC 1E2HA 4UKDA 2VQSA 1G4UR 2QMOA 5FOSA 4MYCA 4PC3A 4IEIA 1IY1A 1JQLB 1XJCA 1YZLA 4OK6A 4A8JB 5CM9C 3RANA 4B43A 3KQUA 3ZIAA 1OXXK 4O2LA 1Y63A 3DDCA 4B48A 5KNCA 3SZRA 2WKQA 2DFTA 2OCPA 1ZCBA 2YJTD 5FFMA 4DUGD 2JLUA 3BOSA 3MFYA 4Q1BA 1D2NA 1TF7A 2ZJ8A 3FFBA 2Z83A 4YMSA 1SULA 2EU8A 2B7CA 2HLDD 3CKLA 2GK6A 3E70C 1G21E 3IQXA 3RABA 2WSSA 2GCOA 3K0SA 5HR5A 4TQAA 3WNCA 2ZI7A 2RH5A 4PAOA 4ASUD 3K0FA 3AP3A 1JR3D 3LRPA 4DEXA 3MD0A 4BLSA 3MWYW 2DFLA 3TAHA 3PEVA 3B1XA 4LPKA 3GCGA 2WSSD 3EPKA 3W5IA 3K70C 5DI9A 2XNDA 1FMLA 3A4MA 3E2IA 4US2R 4QBGB 3KJGA 1G17A 2GCNA 2YOGA 2BV3A 5HPYB 1GKUB 3B78A 1ZCAA 2IEZA 2ZS8A 2JLXA 1NJFA 5KHOC 2GXQA 2R65A 3UWKA 4W7SA 1UADA 2V1UA 1GZSA 3W6NA 4WZBE 5F9HA 4LHWA 1TX4B 2DBYA 1EG7A 1QHYA 4D2IA 3OEHA 1UKYA 2J0VA 4QL3A 1KK3A 2ZRPA 5AJWA 1JEEA 3K09A 3QKSB 4P4UA 5CJPA 3SS8A 3CRW1 1JAHA 4HB2A 1G3IA 1SHKA 2QTHA 1P9NA 1R6BX 3WYAA 4JIMA 1OH7A 2R6AA 2C9CA 3T12A 4LJ8A 1O3YA 3FKQA 4Q4AA 3I5XA 3VKHA 4KVAA 5H1YA 2ZRLA 1A2KC 2GHIA 4V0MA 1W0KD 3GLFE 3Q72A 3SFVA 5FTJA 4BFYA 2ZRGA 5CDFA 5AJXA 1NMXA 4P3YA 3X2SA 4JLJA 2AK3A 1ZMXA 2VH5R 4KLZA 4XSHA 1TQ6A 3EXAA 2ONKA 1M34E 4F4IA 1A1VA 5FBQB 4M21A 4OKSA 1OIWA 4HB3A 1OF1A 1SKQA 2EWVA 5LBIA 1Q21A 1ANKA 2ZR9A 4RCZA 4TTPA 4DLTA 2C5LA 1TQ4A 1XU4A 1L4UA 121PA 4AK9A 1NLYA 4NL4H 1X6VA 1G6HA 5J4YA 4BFXA 3P1JA 5B57C 4R2HA 1WQ1R 3ASZA 1HT1E 3KQHA 2HXSA 4FMCB 1E9SA 4IOLA 3M6AA 3WHLA 2BBWA 2UVQA 2DWQA 5JZVA 3U5ZB 2BOVA 4Q1EA 1S9HA 3KXIA 1XD2B 2KBEA 1G18A 4N0EA 3VTKA 4ESVA 4BPBA 1A2BA 3ZS9A 1AGRA 3WNBA 4PZLA 1GNQA 4PHFA 4ZCIA 4OQNA 1UBEA 1QHNA 3WHKA 1HYQA 2F3TA 3S1AB 1TTTA 2D4HA 3BBPA 3I4LA 1JPNA 4D0GA 3THWB 1XMIA 4LJ4A 2OLJA 1IN5A 2W2TA 3D7MA 5EE9A 3N70A 4OHVA 1RJ9B 1SVKA 2OAQ1 4IW3B 4GI7A 2GF0A 3T1QA 5JWOA 3RNLA 4XTRA 1BKDR 2LCFA 2AKAB 1UAAA 4Q02A 1TAGA 4F7WA 1VYUA 4EPXA 5SZHB 5EJEA 4WAUA 1KZGB 2H16A 1G20E 4D4KA 4IOJA 2ZRFA 2WICA 5FI0B 4DC9A 1VECA 3FVQA 5GJWC 3RRNA 3W9YA 2KJQA 4HAWA 2GJSA 2QMUA 4DRZA 2XNSA 1T9HA 3KJEA 1BH2A 2RGNC 4ON9A 3DMDA 4PAMA 3GJ7A 4BRWA 1NSTA 4ZO4A 1OH8A 2CJWA 3RC3A 3K9NA 4DWJA 1WRBA 3QBTA 2O8CB 5DO9A 4JLKA 4Q4HA 1EWQA 4EUNA 1N6OA 1EX7A 1S1MA 4A36A 4JYBA 3ADBA 2QRNA 5FTMA 1KSJA 2X2EA 1N6IA 2FX3A 4C7OB 5J47A 2A5FA 1KNQA 4LC0A 1O87A 1OE0A 4GNKA 3QKRB 4B35A 4B76A 3TH5A 1R4AA 5JMTA 1N5IA 2G1KA 2N42A 4CF7A 3LVQE 2EYQA 3CF2A 3GFTA 2NPFA 1FNNA 1OIVA 3EPLA 1CU1A 4BLTA 3ZZ0A 2ORWA 4A1FA 1XX6A 2RCNA 5C2JB 8OHMA 2ATVA 3AV0B 4JLVA 5FI1B 2C95A 2BCJQ 2ZJ2A 4CIDA 1PLJA 2D74A 2C8VA 2W0SA 3CONA 4JVLA 2MSEB 1VG0B 3N5CA 4Q4JA 4UNNA 1P9WA 4DLRA 3LW8A 3O47A 3W3ZB 4LYHA 2DR3A 4LSGA 4IOMA 1XEWX 2FV8A 3PEUA 2A5YB 3GLFB 5JI2E 4FN5A 1Z47A 4F4JA 3A1VA 4R7ZA 2RGXA 3R7WB 4B47A 3KQKA 1Z07A 3LBNA 2O8BB 3T5DA 1AA9A 4KBFA 3DOFA 2HJVA 4NKRA 1J70A 1T8TA 1LS6A 3CRQA 1JNYA 3LBHA 1DARA 3EZ7A 4TZ0A 5FBVB 1KO4A 4QXAA 5EE1A 4R9UC 3OIVA 3Q5DA 3WMGA 3OF5A 3C5HA 3NG1A 3H2YA 3K0AB 3P4YA 1CR4A 5JJLA 3REFA 3VR1A 1GOTA 2ZRBA 3P20A 3AF0A 3M0EA 2G3YA 5GJVC 2O8BA 1XCGB 3CNLA 5CITA 5HKKA 1E2IA 1P6XA 1ZUHA 2L0XA 2DYKA 2BJVA 1DBSA 1TU3A 1P5ZB 1SQ5A 4UNPA 4AKGA 1ZM4A 1AS3A 3HPQA 3EPJA 3EW9A 1BIFA 4QGFA 1R10A 4ZDJA 3AVQA 4V0OA 1E32A 2KE5A 3LWNA 3N2IA 3K0CA 2RAPA 1KTVA 3GP8A 1CJMA 2GNOA 1P62B 1P2VA 3GLGA 4JSYA 1L4YA 3LLMA 3F3YA 2QBYB 3Q9LA 1WBDA 3H1TA 5D3MB 5HZHA 2ZR7A 3Q5EA 1II8A 4PX9A 4LHZA 1QG4A 2ZUCA 2YVUA 1TQDA 1E2LA 3HU2A 2QN6A 4GMDA 4RJLA 1G16A 1NBMD 3SC3A 1UPTA 3FMPB 4YDSA 4DDVA 1SVOA 3BXZA 2G0NA 4B34A 2IXEA 1ZIOA 3NWJA 4NDZA 3RS3A 3KQLA 4Q47A 5JECA 4CVNA 2FDCA 3NDBB 1W36C 2P65A 1E9AA 3DM5A 3QXXA 1DAEA 3OFND 2OBLA 3NIBA 2F9LA 2QP9X 1GP2A 2J7PD 4YMTA 4DLUA 4C7OA 1DS6A 1OB5A 4A8JC 3GLHE
chains in the Genus database with same CATH superfamily
3IE0A 1L5YA 1WSDA 4REQB 4WKPA 2F43A 3QP9A 1II9A 3OH8A 2OBNA 3HLTA 3V8NA 4EYSA 1J20A 1Q6YA 3RFFA 4B6EA 1LSOA 2UYYA 4ZTUB 3HZOA 4N40A 2AC7A 1Y33E 2AV6A 3BXHA 1IN6A 1H1LB 1W1UA 1C4KA 1YOVA 4MZXA 2R7KA 4RPIA 2Q4TA 4LCBA 5KIAA 1UDWA 3EQZA 4XLTA 3EA0A 1VIYA 3PC4A 3DZFA 1NMQA 3UWOA 2E18A 2OSBA 3GBSA 3F8SA 3RNOA 5JRJA 2PUAA 3KT8A 3O8BA 1LVGA 3O9VA 2P30A 2H06A 4TKUB 3QUTA 3KQSA 4DEYA 4B6OA 2JB9A 5EHNA 3THYA 1NDHA 4IUCS 3W3AD 1U0BB 1WZCA 2FXVA 5TF4A 4DJEC 2PNFA 1E94E 3QWHA 4BU1A 1UOOA 2R7LA 3GFOA 1BE6A 1N5MA 3AHEA 3B9QA 4ZVKA 5HM8A 1U8FO 1ZNWA 1YJXA 3G3EA 3M5WA 3QENA 4NHOA 4YJ2B 2BELA 2P9CA 4D6XA 1Y6FA 3LYAA 2CCGA 2X4IA 3K16A 3NCHA 3PXUA 4PG6A 4REQA 2WI8A 4DR6B 1UBSB 2X86A 4UBLA 5DNYB 2A5DA 1A9TA 2YKGA 1BS1A 3TPZA 5AHKA 3I4FA 4QYTA 4RKWA 4KO8A 4RVGA 5BNTA 4DV7B 4CIAA 2AKEA 1T9BA 5H16A 5IBPA 1Q77A 1K6JA 1RYEA 3I23A 2GXUA 5REQA 3IDAA 3UGQA 5HQ3B 4YIHA 5BYAA 1WULS 2O8EB 3NEJA 5H7XA 3IOMA 4HH3C 4IFIA 1C9MA 3CGWA 3IIMA 1E6LA 4M89A 3GG2A 5DTJA 4AJIA 2DWUA 4G4SP 2BBTA 3FPBA 1XD2A 5AJZA 3C8DA 1GSOA 5FL3A 3P94A 4D56A 1QS0B 1Z7GA 2ODNA 2PE5A 2C3MA 1K5DA 2ORED 3DTNA 3VUFA 4Z9AA 3NMUF 5FTKA 2F1HA 2WHQA 4WOKA 4RD1A 1KL7A 2DG2A 1ZIYA 4MDHA 5LP6C 3T38A 1TGVA 5J40A 2OV3A 4BEVA 3WGVA 5JYCA 2CFIA 4Y9SA 2WM8A 4CM4B 3B13B 4LXXA 3GLGB 4Y0NA 2C1ZA 2IHZA 5KX5A 1MXFA 4WCFC 5F5LA 3LMKA 3R24A 2ZYAA 3ZEIA 1Z5ZA 3AFMA 1CDEA 4EPWA 1SPBS 2X0NA 4D3XA 1XA4A 4DSOA 4X54A 3INYA 5DJ5A 2VAPA 1P7VA 2WMOB 4R71A 1N7GA 1RI4A 2ZUBA 3NM6B 4AJ2A 2PL1A 1OLSA 5BW8A 1OQAA 1EP2B 3CZCA 1TCCA 3ME5A 4MV5A 4LJ6A 3LKVA 2CV1A 3TG2A 3QFSA 1XD9A 4M9SA 4I36A 3LPNA 5MDHA 3SKVA 5IKOA 4C4TA 1EWYA 1R5BA 1XAGA 2Q9BA 1VE5A 4X24A 4ZEWA 5BYBA 2GO7A 1NRJB 1W0JD 1TM1E 3IAM1 1JG7A 4K9NA 2JFPA 3RGGA 3UW3A 3F4KA 5KJ1A 1F7UA 4OB7A 1CZUA 4ABYA 4I4CA 4PY2A 2V7BA 3BCUA 2FP4B 2F59A 2V7XA 4E03A 5DF1A 3A0RB 3O8OB 4XTCS 3SJCA 2VNAA 3KJXA 3X1DA 2DU8A 1M7BA 3AB8A 3DBHA 4CFZA 1YB1A 1O6BA 1UPXA 1S7GA 4V24A 3JAKA 4TUYF 3N7AA 3PXAA 3PL1A 3E9RA 1FBNA 1VIVA 2PX3A 1GCAA 4KNYA 1E2PA 1KXJA 2FPSA 4QEZA 4Q1VA 3V4RA 5DSZA 1GQQA 4HUJA 1E4OA 3TOVA 3V9PA 4EG8A 4AAYA 2IS4A 4Q3KA 4KC0A 4XD2A 5L7WA 2QJTA 3ITNA 4C0AC 4ARCA 1G8JA 2F3UA 4DZZA 1TKRA 3BSWA 2FJUA 2P4UA 3H1EA 4WFIA 3TQSA 3W2FA 1QHSA 2VK8A 3RVNA 4LNUA 1TC1A 5A3SA 3BFVA 1PE0A 1AJEA 5DX8A 4ZVTA 1HNXB 3N53A 4O2AA 2G76A 4J4TA 1VPTA 1C4XA 2VK2A 1GNPA 1YXMA 1XDDA 2RC6A 2R1VB 1N6NA 2VK1A 3U1TA 4HNAB 4MVJG 4QKQA 1XZPA 2GM9A 2ENWA 4OUDA 4JI6B 3U9SA 3UV3A 5CDHA 4L75A 3AZQA 2D1QA 1YAHA 2V59A 4GVLA 4LRUA 1OSNA 421PA 1Y7HA 5BWLA 1P4JA 4Q0MA 3THXB 3FD8A 1AKVA 2R6FA 3AU9A 1ABEA 1EVKA 1Q5PA 3M89A 4RTJA 1VPWA 1L4GA 3F4BA 1E2EA 3T34A 3IR7A 1AKTA 4L2IB 4IF6A 1F2VA 3VV2A 1AXGA 4CMJA 2J1LA 1LCIA 4HSGA 5CBPA 5JQGA 3BE4A 2AZDA 2CVQA 5AVWA 5TJHA 1R0LA 1SOMA 3QLVA 3O2QB 4AIRA 4CLEA 4F4HA 1N8TA 4UVDA 1O94C 1R0BA 4ZIRA 4Q1AA 4GP6A 5M04A 3TKAA 1WCIB 5KZMB 4ITVA 5I7OA 3HI4A 3NBUA 3HU5A 5EZYB 3C3CA 5K45A 4DIDA 4I4TF 1GRNA 4UFNA 1P7CA 5ALHA 4GI1A 4MVJD 2JHAA 2A84A 4PGMA 4DMRA 1SQGA 1Q17A 3GX1A 3ZHYA 2JGDA 1THMA 3K1AB 3DF9A 4M0MA 2C4NA 2CJWB 2GN4A 2C7BA 1JMKC 1NX6A 1VL2A 3HO8A 1BA3A 2QI9F 1N2OA 1P44A 2O2GA 3R3HA 2NU7B 1KZ4A 2Q2NA 1JU9A 1YD7A 1Y5IA 3NHWA 1EUZA 5BOSA 3EK2A 1KI7A 3D5TA 5F2OA 2DQZA 4LISA 1L8OA 3LQYA 4ZQEA 3CZRA 2OQIA 3NEPX 2WU1A 1AMNA 2NTEA 4DA6A 3NFRA 3GD7A 2Q8PA 3GLHB 2X9NA 4J2TA 3QVGB 4TVOA 4F5YA 3FNHA 3KUDA 2BKXA 4JYPA 1YMQA 3R0ZA 3PCXA 2R25B 4M3NA 4PCLA 3CVWA 4DJTA 7MDHA 2J3DA 5K09A 3OWHA 1OT3A 1R5OA 1QO0A 2HNKA 3FPHA 4E5NA 2ZZNA 2EHJA 3SNKA 1AQIA 1I3MA 5HIKA 3BWYA 3PSAA 1TZKA 2GETA 3C4JA 1QIDA 1KGSA 3KL2A 4AI6A 3F0TA 4FZJA 1AV7A 2Q5HA 4MGHA 3D2LA 3I8XA 1TUBB 3GJ5A 4OGFA 1Q3HA 2B34A 2BM9A 1MZVA 1SJ9A 4I50B 2J32A 4Y2SA 2ZSDA 5H68A 5KVAA 3F46A 3VHXA 5JU6A 3BYZA 3MT9A 2HUNA 4IDHA 2WWIA 3PNSA 3DQQA 2ZRJA 1DV2A 4YAKA 4ZEVA 4RD2A 1QYCA 4CLRB 3LGSA 4N1AA 2VH2A 1JQJC 4KCGA 5AHOA 2CUNA 1ILWA 2AOUB 5EGSA 4H1WA 3RQIA 3T54A 3WJ1A 2F8SA 2JC3A 2H7YA 3G5UA 2E4UA 1XEXA 1KVQA 4YCCA 2QTAA 1IAQA 3KB2A 4X5OA 4I4TA 4PLWA 2QR2A 3DE2X 4FD3A 1U7DA 3TEMA 1YAJA 4BEWA 3RTBA 3B6JA 1RLIA 2QMQA 5EWMA 3TJMA 5F77A 4EPRA 4CUZA 5J4KA 4J91A 5E7MA 3ODGA 3W04A 4AU1A 1Z6YA 4IJQA 4JSRA 3F7MA 4B9EA 4BDSA 1TFUA 3ZJUA 3ZCTA 3M1YA 3KD2A 3EEIA 4D4MA 2Q3JA 3VR2D 2GJAA 3CZAA 5T4BA 2V9CA 4NU6A 4IO0A 5EHXA 4LK2A 2JI6A 2CHQA 3OY2A 1AM4D 2WFAA 3HCWA 3PPYA 2GZHA 4UM5A 4ARAA 1ZXXA 4R40A 4ZAYA 1UIMA 1F8YA 1GL6A 3ETDA 2VXOA 4RL4A 5JYEA 5JO9A 2XMPA 4RETA 1MFZA 4PCUA 1R27A 4JR2A 1KR5A 3KOWA 3MCAA 4PG7A 3VR6H 4ARZB 1LC3A 1P4GA 2A1TR 2AT1A 1IJBA 2SHKA 1F60A 4MUGA 5I45A 2FG7C 2W4IA 4KLCA 1LW6E 1PG0A 1H6DA 5A06A 1OLUA 4EY7A 3PQ5A 1QF6A 4UXHA 1N5LA 2XB9A 4MQBA 4XUDA 2DHQA 4KKXB 1LJ8A 4LDRA 3IIIA 1C0LA 1WZNA 1XZLA 4TMVA 4UU1A 3UT0A 2PUBA 1WOYA 4DNXA 4TVKA 1DMSA 3ZV7A 1FUIA 3S2ZA 2C9BA 2BEJA 4G5GA 2ECKA 3C5CA 3K4HA 3FB1A 4P53A 4F4FA 5JC8A 3BXEA 3F9IA 4BX9A 5JAIA 3E5NA 1SGWA 3QVLA 1L4BA 2JDID 4UUAA 2QG4A 1OLUB 1JHYA 3T3HA 5A9SB 3OZXA 4RULA 3GQBA 3OPQA 2WHXA 4TUYA 4KI0A 3RSHA 3PRJA 1O08A 4AMGA 2I8AA 3O6VA 2WYWA 2CW5A 1E6WA 4DSZA 5A5GA 2Y92A 3LGXA 1Z0DA 4OHXA 3AU8A 3IEVA 4OQ4A 3GV0A 3A9VA 5AESA 2VVTA 3DLBA 3OI7A 2DE0X 1G2QA 1E2MA 2OCXA 2ZSFA 4D8UA 2P9TA 3L9XA 5KVQA 3UA4A 4JJ8A 2FZLA 3K0CC 1I1HA 3AY0A 1ZK3A 4MVXA 2ID4A 1PFUA 3PQ8A 3WWYA 1DC4A 4ARIA 1BZYA 1FMTA 4WA7A 3DT9A 4XXHA 4JGGA 3LT2A 3PFHA 3UK7A 3TOCA 1YRBA 3HR8A 4BAGA 1OA0A 2YVAA 8ABPA 3TFOA 4PO1A 4MV7A 1SUAA 2REBA 4R84A 2INGX 2CZCA 4GBMA 5F12A 2DSNA 5DLQC 4I8XA 1F6WA 5DM70 2NYUA 1NU8A 2V6FA 1U3GA 4I1OA 1GTMA 2AFVA 2XPCA 1RWQA 4FGWA 2YNMA 2FI1A 2AG6A 3MLAA 3R3WA 3KQMA 4BGDA 1Y1QA 3OKPA 2YASA 5G3YA 2OORC 2R8XA 4HFNA 1GA6A 1K2VN 3OZUA 5AP9A 4UM7A 2VZLA 4DR7B 5DISB 3X1JA 5IHPA 4EJFA 1F0PA 2YNMD 2QROA 3ZHVA 4EUKA 1RU3A 3K8ZA 5K4AA 5AKXA 4DAEA 2CCKA 1OTHA 2AS0A 1N2IA 2IYRA 1JFRA 2JIOA 4PPGA 4YO7A 2O1WA 2XZDA 4M22A 5ALOA 3UK1A 4LBZA 1WP4A 1MX9A 3TQHA 3KQPA 4H0NA 1QWSA 4ESEA 4YRIA 4GKBA 1X1EA 2J6CA 3ENKA 1GGJA 1R0CA 3U4GA 2PZMA 3C0KA 1NN5A 1F3OA 1U0EA 4JZYA 1M2WA 1PHPA 4TX1A 4UDXX 4ZT4A 4EHDA 5J1TB 4D0RA 4D3YA 2ANCA 1K1EA 1KEWA 1P2BA 2GDJA 3RFXA 4RYLA 3FJOA 4M1WA 1RXUA 1CUAA 2C59A 4II3A 4JUIA 5AXBA 2J07A 4ZMSA 3AKZA 4XVUA 1W85B 5ER6A 1RRFA 2IWRA 3CIFA 3QEJA 1ZD1A 1O9GA 3HUDA 3SKXA 3NBZC 1RAAA 3C2QA 1E5LA 2IVZA 3UG7A 5AVZA 2P68A 1TAQA 1H6CA 1VL8A 1ORRA 3T5PA 1H23A 2D5CA 5BVGB 3KZMA 4Y7DA 2QRVB 4PEVA 2IUFA 3HNOA 4OHRA 1G9TA 1BE1A 4X1KB 2CYBA 2NZXA 1FRVA 3BD7A 4XLLA 3SN6A 3ZQ6A 4CMHA 1SC1A 2HQOA 1G8FA 1JW9B 1V9LA 2GZSA 2QENA 4P81A 2JFFA 1CG6A 3JZMA 4P4SA 5FULA 5AK3A 5HF6A 2R7AA 3PGJA 1OYYA 4YP7A 3V1LA 2EV9A 1U8ZA 4W1SA 1TM5E 3KXDA 3JPWA 1K8ZB 2G06A 2VIIA 3CRMA 1YACA 1S3FA 2BWJA 5LZ5A 3EAGA 3JZFA 3QIAA 5HK8A 4ZIRB 3EXHB 1S2LA 3A6ZA 4HDOB 1PFYA 2LD4A 1IDN1 1BD3A 1BQEA 1JR3A 3OO1A 3W6PA 1EE2A 3CW2A 4JJIA 4H7IA 2XMGA 3WRWA 1W7AA 1Y9AA 3EN0A 1WAMA 2VYCA 4BLRA 2XUAA 2XTJA 2PWAA 2YWGA 5IBRA 1I7DA 1E89A 1M6VA 3NHMA 3PD1A 1E9CA 4GBED 2HUPA 3SQMA 3G82C 4H6PA 1SVWA 3K72B 5A5FA 3AK4A 4A8TA 3WAKA 2F3QA 1RQ7A 3R2JA 4YRQA 1BE0A 2R8EA 2X1HA 3C3YA 4J2OA 1L1FA 3D6TB 3IO5A 3OP4A 2B98A 2MSKA 2VXYA 1I6WA 4GC9A 3WLEA 3I4CA 3Q88A 5JSUA 3UJNA 1FDSA 2P35A 3KKZA 4UJ3A 2F8LA 3JPYA 2H0RA 1N92A 3NETA 4TRJA 5B12A 1ZGHA 4CTKA 1Q0LA 4DBVO 2WILA 1JJ7A 4FCCA 1BRMA 2FZEA 2XUOA 4JCCA 4EUSA 4PRYA 4ZCPA 5LB2A 4QHTA 2VQDA 2B35A 1UBJS 5CW2A 3UKOA 2OGUA 5B1IA 2B8JA 1KKLA 3COWA 4J43A 3DE4X 5KU1A 4NV1A 1CVRA 1X1CA 1YS4A 2HDOA 2ISSD 1ZYUA 2R48A 3BXXA 3EWIA 3GJ0A 4ZCLA 4CZ2A 2YJGA 5KC9A 4HAVA 1Z8NA 3V32A 1F5NA 1X9HA 3M2TA 4RORA 1H2AS 2YHAA 1IULA 2FR0A 1SUBA 3GEEA 1LSJA 3PF9A 4KMOA 4Q21A 4BN5A 5JNLA 3ESAA 2D06A 3W1VA 3AERA 3ZDEA 3L4EA 4L85A 4N49A 4F1WA 3IP5A 1ETHA 3PP8A 3VOTA 2WJIA 1NUTA 4HRVA 1C50A 4H0CA 1SUPA 3BXFA 1Y82A 4MLZA 4Q1CA 4J4BA 2HF8A 1D8AA 2Y77A 1HSZA 1GCIA 3WY9A 1R16A 2J3EA 2FFQA 3GUHA 3W3AA 4FJ0A 3IAAA 1QZZA 4TKLA 2OUIA 3VC2A 2IGTA 4CLOB 1D0IA 4ZVRA 3RFUA 2J7KA 1USVA 3NT5A 5H02A 1NP6A 1KZ7B 1N3BA 1U8XX 4HQRA 3GT3A 2M1ZA 1VG8A 1T1EA 2F90A 1X1SA 1Q20A 4WNIA 3BFKA 2VHVA 3ZDFA 1I30A 4DE5A 1LX7A 3A9SA 4BPRA 1HL7A 1CSEE 1SVIA 2CMKA 4P2GA 4PTLA 4O8ZA 4ITRC 4OY3A 4Q1FA 3S27A 3EZ6A 3JSXA 3OM9A 4F3YA 2Q1SA 4ECEA 2Q07A 3KWLA 3ZDRA 4OI0A 4DSTA 1OAOA 1E3MA 3CH5A 4LZZA 1QH9A 3AF4A 3LKZA 2BFEB 1XQXA 1I33A 4V0LA 3D6FA 2FXIA 1X0VA 1HEYA 2FEKA 4DILA 1XEXB 3M9LA 4H60A 3WAGA 2RJNA 1LS1A 4IS3A 4OJYA 3CIOA 4U6QA 5IAEA 2IOFA 1Z6XA 3GDWA 2GD6A 3PNQA 3TVTA 1H2ZA 1OA1A 1NXOA 4BKUA 3ZHUA 4RA6B 3E1SA 3O7MA 4CE6A 4LRSB 4LJ7A 1QVRA 3ENQA 1XT6A 1WPXA 1VSUA 1Z16A 2JBHA 2Q6TA 4IGAA 5K3FB 3KALA 3QY0A 1SK9A 3ZGYA 1Z6QA 2XLCA 1BWRA 1KYYA 2WG2A 2IYSA 3DXXA 2IIPA 3H4IA 3LX8A 1NQOA 1E62A 1ZM7A 1A4RA 3ML1A 3VFDA 1EGAA 2P6PA 2ZIVB 4UBKA 2UYHA 3CNOA 3JYPA 1NQWA 1L6IA 1YC5A 3NV7A 4NBTA 2X0KA 4NULA 2IOQA 2VZEA 2I6GA 3QLEA 3MJCA 4JLUA 4Q4CA 2C4VA 2ZJBA 1LSUA 3IPYA 4I50A 4PCAA 1ZGCA 2A3RA 2QTVA 3SC2A 3V7FA 1T3HA 5A0VA 3VPXA 6NULA 2CLCX 2Y1GA 1AZTA 4N39A 5AI9A 3LU1A 2J4FA 4BFCA 1IE3A 2QRJA 4AZ3B 1UWLA 1E58A 1TT5B 4FINA 1MEOA 4GD3Q 3UC5A 4CCYB 4RJJA 4RFVA 3D64A 3ZVMA 1SB8A 1QH1B 2W43A 4DTIA 1HR0B 3EQ6A 3T9CA 3NP9A 5L4LA 4OBWA 1VHQA 3BTVA 1W46A 2Q9CA 3HK2A 9LDTA 1GG9A 1NW7A 3QPWA 2G88A 2E4ZA 4OI2A 4UMFA 3WYCA 2XB4A 4DCUA 3L7KA 1NBOA 3Q12A 1W2WB 2H5LA 4FYMA 4XX1A 5EQJB 3BFXA 3VTZA 4DMMA 4LNHA 1GPUA 4ZGGA 5DNAA 3ASYA 2LTAA 3HJRA 4FYKA 3EZLA 3K5PA 3ZLUA 3HY3A 1EFPB 3HXLA 4DRXB 5JFTA 5JZBA 1CW2B 5E7QA 4PYMA 5FPKA 5K5EA 1TEZA 3OIWA 3IP8A 5CB0A 3FPKA 3DHWC 3R3UA 3L6OO 4K6MA 5AHRA 4EI7A 1IXRC 3BJRA 2M6LA 1EUQA 4EFKA 3L01A 1ZZEA 3H1BA 1BJKA 4WN3A 4AXBA 2IYQA 1P1KA 4HQ6A 4MO2A 2VHYA 1OFIA 3TPCA 2EBUA 1S8AA 3CJRA 3QPVA 2QWXA 1G59A 4MB6A 3PQ6A 1XKLA 1UBTS 1E59A 1GCUA 3I3SR 4K0RA 5FOUA 5L3ZA 4AD8A 4D4HA 2BP7B 2P2CA 1EFKA 5KQGA 5IAKA 5FORA 2YW9A 1NBHA 1WXQA 3B52X 1IZ8A 3E9QA 1ORTA 3EUAA 3NGMA 4I7EA 2QQFA 1AZWA 1HQCA 3NM5A 2VSQA 2R751 2FW1A 1V11B 2TMGA 3PEWA 2F1IA 2JAQA 3D3KA 3RLFA 1FNMA 1PFQA 3T7AA 3DTTA 5JNTA 1VJ5A 3WA6A 5DM0A 1UK7A 1J56A 2EVWX 2V8OA 3W8RA 4D8TA 3HVKA 1NI3A 1UDRA 3AESB 1ATZA 4RQTA 1WKBA 2CHVA 4YJKA 3EOBI 4EJ6A 2ZIXA 5JQGF 1DIAA 2QUZA 5CG1A 3EVGA 2WF7A 4HNAA 4KSBA 1KY2A 1US8B 1HI9A 4BU0A 3EB9A 3KHSA 4OQPA 3BQ9A 1N7HA 1UFRA 5C52B 4PLHA 4S1TA 3LFUA 4R1OA 1RYHA 4GSYA 1H66A 4KVZA 4RQUA 3WDSA 3L92A 4D57A 5K8VA 1EFRA 1V4NA 4F46A 1NQUA 2P6UA 3IJ5A 1AU9A 1BS9A 1V5IA 2QTMA 4WXHA 2IYPA 3ZGVA 3KYIB 1OV4A 1ZD4A 2YFYA 1J23A 4FW8A 4JYMA 4URYR 3FPSA 4Q9LA 1RRPA 4X7PA 4YJHA 3OCZA 4XE5A 5EXSA 3SPXA 4RPKA 2IHUA 1E3LA 2IW3A 4P0PB 3SX2A 1N1GA 2H8GA 3ND9A 4FGUA 1GIAA 5K03A 2B6HA 1NXTA 1HE8B 4OV6B 1QK5A 1I2CA 3OLXA 2LBPA 4B2YA 4MJLA 5DNCA 4RIIA 5EXXA 3WIUA 2VUIB 2E7ZA 1HZZC 2H2AA 3CISA 4EYOA 4WOPA 2ECFA 2FPXA 4E7PA 4QJ3A 2XT9A 1I7QB 4J3JA 2QE7A 1QG6A 3G8YA 1D03A 2HWKA 4M98A 4R1SA 4XUCA 4CV3A 4FLMA 4HDMB 1SBCA 1HDIA 1Z13A 3RTAA 3H5VA 1ZN7A 3V4ZA 3JU3A 4X95A 1XF1A 3TKYA 3VAAA 4A8HA 1V8ZA 1DRUA 2VAXA 3DMTC 4AZ0B 2IJGX 4KACA 4I6JA 5EESA 4COOA 2FKAA 2VXBA 1NZDA 4TT8A 4EKIA 2Q5IA 3CNBA 3HJFA 4DCOA 3L43A 1OKKA 1XDWA 3FIUA 5EKSA 3BRWD 1JR4A 3L04A 2W6NA 1KWGA 5IJWA 2BD0A 5U4XA 3WKCA 1I5RA 1Z63A 1XMVA 4AZTA 1O6GA 2EX0A 3AEUA 3U7GA 1I4TD 3D2AA 4WTOA 1CE8A 4B6FA 3P2MA 4DLKA 4P93A 1ESEA 5D5PA 4C20A 5C9ZA 4X62B 1GAWA 5C1OA 2GAAA 4F12A 1CF4A 3W9BA 1YR1A 2RB4A 1P0FA 1YQDA 1WEKA 1Y42X 4I8DA 3UT6A 2DM6A 2PWYA 3OF3A 4JX8A 4NSNA 3IUJA 2DPMA 1NIPA 3QF4A 2QLTA 2QRQA 3G68A 3WYNA 2WPDD 3AOEC 4J76A 2Z9DA 1PFVA 1Q1QA 4K28A 3DYIA 3RS2A 3V97A 1SXIA 5AUPB 3DUFB 1XPJA 4HWOA 2QQ0A 3N2ZB 4K9LA 5TIIA 2H29A 3GXOA 4FCVA 4C9BA 3SFZA 4PF1A 4CF5A 1XGKA 5K99A 2JI8A 4M0KA 3SBOA 1EAYA 4F2PA 1GLVA 6Q21A 4MROA 1F6BA 2P77A 2O52A 4UEQA 2H65A 1W88A 3VZQA 4ALMA 4D44A 5BMOA 1NNEA 3OZDA 2HCBA 4HFRA 2VQEB 5DXAA 3B9PA 1Z2OX 3D4PA 3UMJA 1C7IA 4QVIA 1DV1A 1I01A 2CNWD 2XMCA 3DL2A 4N6NA 1CPYA 2HJWA 2W4QA 5HIMA 2N9UA 1SIWA 2YXBA 4KE6A 3NVKI 3FLBA 3ETCA 2FX2A 1U2DA 1KVRA 3NHSA 1I2MA 4JL8A 1DADA 1JJFA 3KJHA 4KXNA 4NDAA 1N4DA 4QASA 1H2BA 1S8OA 3AMVA 2ON6A 4RW0A 3AFOA 2GZ2A 2JGNA 4QREA 3LBIA 4YCMA 2CEAA 3QVSA 3ZCSA 4YJ2A 1ZXLA 3AF3A 4XQGA 5KQSA 1QONA 4G5SA 3VMFA 3I0ZA 2Q3DA 5H3CA 1UR5A 3QEKA 4KEAA 1WVMA 2WNSA 5L6LB 2OA0A 2PKCA 3IT3A 4O5AA 3LUHA 4JUBA 4AF6A 4BVLA 3C1AA 1RLMA 4B4WA 3CR8A 3GCDA 3UUFA 3CR3C 4R9NA 4RKFA 4O2AF 1OI4A 4EAAA 2JGKA 1NF9A 1COZA 2WAOA 2PJZA 2JAXA 2YVKA 3TMYA 5BN5A 3RJTA 1P7PA 4U1RA 1E3JA 3GARA 4A0RA 2JLQA 2NIPA 1GTJ1 3CRNA 5FPSA 4K46A 1C8LA 2W11A 4AMZA 2PA0A 4Y2RA 3K6SB 4GMKA 5C5CA 3DEKA 3FE2A 2A0KA 4HY3A 2D7DA 1JLSA 5ITZB 1DWOA 1DU4A 1JEDA 1LI5A 1RJFA 1SVMA 2QD3A 2X7JA 1CJUC 3CWCA 5JMPA 4Y9DA 3ST7A 3GDOA 1DWQA 4ML3A 4R4JA 2BI7A 1Z26A 3AR7A 4RL6A 1KAEA 2QYTA 3VR4A 3EISA 2O3UA 3M1IA 1U6IA 1U0FA 4N0DA 1PJRA 1VL0A 2QX8A 3WLSA 4A26A 4C3VA 3ANSA 2WWWA 1QRAA 4ZVLA 1FEZA 5G4KA 1NN1A 1YDFA 3WSWA 5FRDA 3LQKA 1QCYA 3V1TC 3W2IA 2ZYUX 3DTYA 4C87A 4MUMA 2P41A 4RD3A 4IV0A 2C5AA 4FZRA 1NUAA 2FPKA 3IAEA 4Y6RA 1PKEA 4FR0A 3ZY3A 4NNOA 4FGSA 2IXAA 3VNBA 2DPXA 2HM7A 1BJRE 3PUVA 4MYUA 2ZANA 5AM4A 3CEPB 2XKKA 4Y2JA 2HD4A 2DLDA 2CVFA 2QTCA 4K6KA 4V0RA 4YB8A 5ALGA 1OC4A 5F9MA 3TL2A 5J2TA 3VZDA 3DKPA 2ATCA 1BE8A 4QTTB 3VKVA 5A0TA 4K9RA 1VP9A 3DB2A 2PH1A 4V2UA 3OCUA 1RWNA 4G37A 4MYDA 4GP9A 2Z5FA 3O84A 1VCHA 4NJMB 4E94A 3E9EA 5MGBA 1O57A 1IB6A 1WUYA 1U5AA 4I1VA 3VAZA 4G5OA 2FR1A 4F8EA 5BWBA 5FFNA 3UENA 3H9QA 4A2WA 4XYEA 4BLUA 3H5TA 5IWAB 2VPXA 4TT3D 3TRIA 3ZCQA 3B1ZA 1Y1PA 3ZD6A 2PBLA 3CF4A 2Z1MA 4J75A 2HQBA 4JLWA 4CMKA 2CT8A 1FFYA 2ZJ1A 2RHOA 4FLFA 4XLZA 2R6GA 1NR5A 2IOFK 3A3NA 1E6KA 4A0SA 2V6GA 4ZKDA 4IZHA 2QRKA 4X61A 3DOOA 4XQ9A 4B2IA 1VRCA 3MM4A 1C80A 3KUUA 4J1TA 3BK2A 2R7NA 3ROZA 2NT4A 5FBKA 1JFSA 2N3ZA 2CZGA 4I1UA 1Z62A 2GDZA 1QVAA 2HMUA 2YWDA 4BVHA 1X7ZB 4FGLA 1Y4AE 2VYQA 2XT0A 3PF8A 2CJPA 3G0CA 2OV1A 3DLCA 3DBVO 4L0MA 5HILA 3I9JA 5IG2A 2ZTLA 4F38A 5KNCD 4KPYA 4LXYA 2HXYA 3U3OA 2IZOA 2CLHB 2N75A 1ZVJA 3B5IA 3K2BA 3QUAA 4GG1A 4DUGA 3U3JA 5C46F 4QX6A 2X9VA 1AZLA 4F2HA 4NS4A 1HYHA 3ZCXA 3ZN2A 1CZKA 2RGGA 2WE8A 4HKTA 2C92A 1H0HA 1WG8A 4NCKA 2EL7A 3UMMA 5EWLB 1Z22A 2NP7A 2BMWA 1EJ0A 1PFKA 4RDXA 1XCMA 4WADA 4FKBA 4KQWA 4ASUA 2C9DA 3BERA 3T3NA 2ZJZA 3CINA 4CG3A 3GRKA 3K1ZA 5AJVB 4RHEA 3G5LA 3L4BC 3Q6IA 2D0OB 3B9BA 5EPOA 1I5EA 2JHGA 1XXLA 4FFNA 3U7JA 5A6VA 1QP0A 3BILA 6YASA 3DMFA 1SZJG 1SRQA 4QFBA 5KDLA 2BUCA 3WA7A 1E3TA 4Y1RB 1FW8A 3GFFA 3C97A 4IDBA 4N8SA 5FIUA 4IZ6A 4R9RA 1I3NA 2JA1A 2BE9A 2HLDA 4V1CA 4UREA 4MQEA 3O8DA 3OUZA 4EW3A 1PGJA 2O4UX 4TLDA 4ZOCA 3VH4A 5CAEA 3RUHA 2GVZC 2H57A 1Y5MA 3ZVKA 1F0KA 3H9JA 1CY8A 2X3UA 1G8SA 5AMXA 4QGAA 3O4RA 1PTJC 1LB1B 4MGZR 5BVHA 4OQDA 1Q1EA 4TL9A 1JKMA 1GNVA 5JANA 1UXHA 1WU8A 1YU6A 2BKEA 1ZUIA 2NT3A 3VO8A 5DDIP 4NAVA 3V2IA 4C0LA 4YRKA 2LDBA 1M6NA 1DX6A 1QO0D 3CN9A 3WMWA 5B7GA 2YYYA 3D6NB 1DXQA 2QL5A 2XZLA 4YHHB 2A9JA 2CV0A 2IYZA 1MB3A 1JPVA 1TD9A 3QU2A 5J2UF 3EGVA 2PXXA 2QJRA 1WQ4A 2EKLA 1EP9A 2WD9A 2OZLB 4URFA 5DYIA 5FCDA 2OEPA 1RXWA 4W63A 1LDBA 3WHIA 3VOAA 4QUDA 4ZDWA 3U6KA 5ITVA 4L28A 4FWTA 2NSDA 5I5GA 4E1VA 1Z4KA 1NFQA 1YRHA 1IXYA 2YY6A 3IEUA 5D8DA 1XB2A 3T6KA 1BFUA 1H6BA 4DPMA 1AZSC 1Y0BA 3DLPX 3OJWA 5IBQA 2ZB2A 5DCUA 5E9WA 3TW6A 2UUCB 4KR6A 5AM0A 1D5CA 1WXWA 1G291 3AEZA 4NOLA 4Z3KA 3ZZTA 1M6YA 1USWA 1VB5A 2EFCB 4HDRA 5JSFA 1JLRA 3D6MA 2J3JA 3EVEA 1Z6TA 1KAQA 3PGLA 1Q0UA 5SICE 3GMSA 4DJJA 5BOVA 3LQQA 5ED0A 5FUXA 5A1JA 1RHUA 4RZ3A 1ND5A 2D1TA 1NDQA 4FYWA 4KO3S 1R0XA 2DQ4A 4EHIA 2WT8A 1C1DA 2NSLA 3L2OB 5FUMA 3BB3A 1MRZA 3ZE1B 2PVCA 2H1LA 2RK4A 2C98A 2NO0A 2OUKA 4LJKA 5EIBD 3AH8A 4MRVA 2GZ3A 1DBPA 2ZAIA 3KSZO 3LP6A 4QULA 3T7SA 4DY4A 4B09A 3ZBQA 4LBWA 3O8QA 5E9QA 1QYIA 1H8HA 1WOMA 3FWNA 1A72A 3OCYA 4MK4A 5FPQA 5IH3A 3T06B 1YHZA 2DHDA 4RA9B 3X1KA 3ZE6A 1I4DD 1M83A 4BV9A 3U0VA 2KB0A 4YQYA 2WAXA 4UU8A 3L8YA 3A2MA 1UMCA 5HTKA 5K0CA 2BGUA 1QGYA 1QQAA 1H8HD 3PLNA 1IXKA 1UMDB 3N2EA 3H4MA 4WINA 1SHTX 1M2FA 4XWOA 4HDRB 1H3EA 4OSOA 2R7MA 3AKDA 4URWR 1FJ2A 2HK8A 3IV9A 3UBMA 3T3OA 4WVLA 4ZRNA 4R98A 5B58C 1VZ2A 3TUJC 4QG7A 4E5MA 5CFZA 5JH7F 2B3TA 3GLIA 1P2TA 1X19A 1HEUA 3UCEA 2GTHA 4Y2PA 5AKHA 1EK1A 3I61A 2HO4A 4PN7A 2UVDA 2AOVA 4YUYA 3T94A 1W36B 4U2FA 2G70A 3RRMA 1L7MA 2ZJOA 4YRMA 2JVJA 5DGTA 4H31A 5NULA 4FCTA 1ZGAA 4DWOA 1XJWA 1VL1A 2JDIA 2GD2A 1DEHA 2YVLA 3UUGA 3AUFA 5ELXA 1QKJA 2ARKA 2EARA 1X39A 2XV1A 4CKBB 4DPLA 2PKEA 4LECA 4HI0E 3A9TA 4NBNA 3GLKA 2DFKB 1QM5A 3RWOA 3WG9A 1KO8A 2O8FA 2ACWA 3G0DA 3W0LB 4M1YA 4G5QA 4HAYA 2YZ7A 5KYGA 1QHGA 1VTKA 3AF5A 4BVJA 1M1NB 1JXOA 4GX0A 4DY6A 4C5CA 4EENA 1YJQA 3CVXA 1AQLA 4M8LA 3AEQB 2QM8A 2Q50A 4MGYR 5EINA 3VU9B 4LZAA 3ZU6A 3MUFA 3MWEB 3BMCB 1EUCB 5F1YA 2IY9A 1TPZA 3PQ4A 3V4FA 4IHAA 1YIOA 3NPAA 1M2OB 4X7MA 1YZUA 3B60A 2AJCA 2VT7A 1T34A 2PSFA 4GC5A 2N46A 2Q46A 2YOFA 5AI4A 3WFZA 4WOBA 2IPLA 2ZRQA 2G6TA 2P5YA 2ZYIA 4OFZA 4P3OA 1TADA 3C3JA 4LMAA 4N0MA 4Y6OA 4AJJA 3K05A 4HCJA 3HYSA 4TLLB 1ZH0A 2XXJA 1W88B 3F7TA 4P5PA 1JFFA 4DNOA 1AKUA 3AUAA 3HCBA 3R77A 4R2WA 2AWOA 4LS3A 3LNCA 2Q3BA 2O3QA 5TC4A 4A9AA 5LQCA 3G2KA 1SR8A 1W44A 5GM2A 4BQQA 4JI8B 2VTEA 3EUFA 5ALMA 2ZR8A 3IB6A 2P6RA 1U63A 4UW9A 2XA9A 1YCHA 1Z4IA 4MEAA 4JLOA 1W30A 3E7WA 4NCXA 4R83A 1MENA 2OE2A 4PXAA 3U7QB 5KTRA 1BJTA 4GT1A 1CJKC 3NS7A 4WFQA 4WCFB 2XOXA 4IDNA 1A9XB 1EXMA 1Z8FA 3L1IA 3MRSA 4ZTZB 5EIBC 1SXQA 3FG9A 3HN6A 4ZU6X 2YHIB 2FPIA 4EFMA 1XVTA 1Z18A 1C9DB 3SBEA 1Y8RB 3D6JA 1TVCA 1E2NA 4CHGA 4KHPB 3K9WA 1ADGA 4ES6A 3J7TA 4G65A 4X44A 3KKMA 3ZU4A 1R0YA 2JKVA 2PVSA 3DAPA 3IKJA 1BXGA 2GZRA 2N1MA 3OE1A 4JC4A 4ZHQA 5HUJA 2IZ0A 4CIVA 2VYFA 3IUSA 5FBHA 4ZI2A 5LMUB 1XNJA 2NXWA 4X3PA 3L0YA 4KQIA 3VXKA 5CA0F 2HJ9A 5ITSA 3P4UA 4GPD1 4QRIA 3EZGA 3IEXA 4R7GA 3MTIA 1HLFA 1HE2A 1QZXA 4YS6A 1ODSA 3LL4A 4C21A 2ZRHA 3NO4A 1GZVA 3FDXA 2QTLA 4FDTA 1YZFA 5EIFA 3QX3A 1U3FA 3R7LA 3HB4X 3QM1A 3ILHA 2QR3A 4BO8A 8AT1A 3GYGA 3AZPA 4HDCA 2EQBA 4HLUC 3QE0A 3PKZA 5E9AA 3N2GA 1TQ8A 4H4DA