2VDUE

Structure of trm8-trm82, the yeast trna m7g methylation complex
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
221
structure length
201
Chain Sequence
QLEYPVSPQDMDWSKLYPYYKNAENGQMTKKVTIADIGCGFGGLMIDLSPAFPEDLILGMEIRVQVTNYVEDRIIALRNNTASKHGFQNINVLRGNAMKFLPNFFEKGQLSKMFFCFPDPRIITNTLLSEYAYVLKEGGVVYTITDVKDLHEWMVKHLEEHPLFERLSKEWEENDECVKIMRNATDKFVACFTRLPTPAIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRNA (GUANINE-N(7)-)-METHYLTRANSFERASE-ASSOCIATED WD REPEAT
publication title Structure of the Yeast tRNA M7G Methylation Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
total genus 61
structure length 201
sequence length 221
chains with identical sequence F
ec nomenclature ec 2.1.1.33: tRNA (guanine(46)-N(7))-methyltransferase.
pdb deposition date 2007-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02390 Methyltransf_4 Putative methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2vduE01
2IGTA 2YXDA 3EGEA 3P2IA 2GS9A 3DP7A 3M33A 4DA4A 2AOTB 1SUIA 1OR8A 3LCVB 3I9FA 4PCLA 4KDRA 2PY6A 3OU7A 2ONYA 3UJ9A 5EVJA 1JQ3A 3E05A 4IV8A 3FRIA 4FS8A 4C03A 3AWIA 5LSAA 1FPQA 2AS0A 5P8WA 5GOZA 1NKVA 1L3CA 3PX2A 1R00A 2ZFUA 1ZG3A 1JR4A 3SGLA 2O57A 3Q7EA 3IV6A 4R05A 5FWDA 3G88A 1KR5A 5E2BA 5CM2Z 1XDUA 4GOMD 4RVHA 3OFJA 4V0QA 4YMHA 4IWNA 3M70A 3OZTA 5CVJA 1IY9A 3G5LA 3T7RA 5EQJB 1RI4A 2IFTA 5K8VA 4KIGA 2QM3A 5EC8A 4OQDA 1R8XA 1UIRA 5F2OA 1EQAA 3LBYA 1R18A 1Z3CA 5DM0A 4OQEA 4CKEA 4PIMA 1N2XA 5GP1A 1NE2A 2OBFA 1T43A 1SUSA 4HTFB 4E30A 2BR5A 4ER3A 1YZ3A 4AZTA 4YMGA 1R74A 3ELYA 3FZGA 3P71T 4HC4A 3FPJA 2YTZA 4IKPA 5EMKA 1JG1A 3KQWA 5E1BA 4PYIA 1NW7A 3E7PA 3EEYA 3HCDA 5D1NA 2OXTA 1RI5A 2FK7A 3HNRA 4E70A 1RJEA 2HWKA 4AZSA 1V39A 4YUVA 5EMLA 1ZGJA 3HVKA 5H02A 3T0IA 2VP3A 3UJ8A 4CKBA 4DZRA 4E31A 2AN5A 3HCAA 3I5UA 3KQTA 4YUXA 3V97A 4PYMA 3K6RA 3EVCA 4M36A 2UYCA 2P40A 4OA8A 5HIMA 3NVKI 4ZTBA 3AXSA 2YQZA 3NWBA 4HGZA 4P7JA 4YV0A 3EMDA 4DMGA 4M7RA 4CTJA 5M5BA 1WXXA 5K0NA 4U7TB 3T7TA 4U7PB 3FUXA 3M6WA 4MHTA 1P91A 3CGGA 4ER7A 3DXYA 1ZGAA 3NTVA 2P3OA 4G56A 2IBTA 2G71A 3CJTA 3KPUA 3HVHA 1L3IA 3CKKA 1Q0TA 1I9GA 3EVGA 1N7JA 5E8RA 5EEHA 4YUZA 2XVMA 2ZWVA 2EG5A 3A7DA 3DXXA 3SVZA 4X60A 1PJZA 3KPJA 3C6KA 3G2OA 4DQ0A 3ELDA 4PCAA 1I1NA 2YUIA 2QY6A 3G7UA 3ME5A 4C05A 3P2KA 3MTIA 3PVCA 2O07A 3EGIA 3I53A 4MWZA 3G2MA 1SKMA 1XCLA 2V7EA 2ZTHA 3REOA 4DM3A 5K0CA 2BH2A 2N47A 3CBGA 5HIJA 2ZZMA 5ICEA 1WG8A 3EVZA 1JG4A 4L7VA 5FA5A 1WXWA 2B3TA 2P35A 5EIWA 5FCDA 3UJAA 4P7KA 4EVIA 1D2GA 2IPXA 5EHGA 4H0NA 3GDHA 2WK1A 2PWPA 3PT9A 4RVDA 2H11A 4BY9E 3WSTA 3LCUA 3CVOA 3NWEA 2B25A 2OB1A 3H2BA 3KQOA 3OZSA 4F84A 5E8JA 1AF7A 2PXCA 3P97A 2VZ9A 5ICFA 2Q41A 5CIYA 1EG2A 5CUQA 2QRVB 3KR2A 3TR6A 2YXLA 4KWCA 2AOTA 5GM1A 1YFJA 4CKCA 2CWWA 3KR0A 5DSTA 3TM5A 1L3BA 3OFKA 3PFHA 4QVKA 4A6EA 1BOOA 1ZKDA 3EVAA 3Q87B 3FUUA 2PXXA 3NVMB 3OU6A 5U4XA 2WA2A 1XXLA 1D2CA 3LHDA 4HH4A 1EJ6A 2ZIFA 4OBXA 3M4XA 3G89A 5E9WA 3TM4A 4B17A 2G1PA 1XDZA 3LKDA 2Z6QA 3F4KA 1XJ5A 2NP6A 1JTEA 5KYGA 2ZZKA 2PBFA 1KIAA 3SXJA 1Q0SA 2AN3A 2P1DA 3FUWA 3ID6C 5EKUA 5T67A 3THRA 3OE5A 3GCZA 1MJFA 4ATNA 1INLA 3JWHA 2AOVA 3GNLA 3TLJA 5E1OA 3FPEA 3BT7A 3IYLW 2IIPA 3R24A 3MAGA 2Z6AA 2AOUB 2PLWA 4FGZA 3EVDA 2VDVE 2IH4A 4BP3A 2NXCA 3BWCA 1YB2A 2O05A 3KPWA 4QDKA 4C04A 2PVCA 4C08A 2PV0A 3R0QA 1AQIA 4RTLA 2XBMA 1QYRA 3TKAA 4PYOA 3FYDA 3D2LA 3PX3A 4HTFA 2UYHA 3HCCA 5DM1A 5LQUA 4OX9Y 2PX2A 1JG3A 2HR1A 4CXMA 4PWYA 5EMMA 2PKWA 3EGVA 4RTRA 4GOLD 4GF5A 5LR6A 2I7CA 3MQ2A 2Y1WA 1KXZA 3L8DA 3G8AA 2PWYA 4AX8A 2FYTA 5K01A 4IV0A 4O29A 3BWBA 1JSXA 3P9NA 3RODA 1VP3A 4R6XA 3JWJA 3LECA 2IDJA 2JHAA 5BW4A 5ICGA 4DKJA 1ORIA 4P7GA 4HSGA 1AQJA 5EGSA 3P9KA 4KVZA 2UYQA 3CC8A 5CCXA 4GOOD 4F86A 5K0LA 1NT2A 5FWAA 2I9KA 2IBSA 1KPHA 2P8JA 1WZNA 3NMUF 4RTOA 2OKCA 3BUSA 5DX8A 3T7SA 4E2ZA 5DTMA 5DWQA 3BGIA 5DLYA 2JHPA 5F2NA 3UJBA 3NW9A 2P3QA 5F2KA 5BW5A 1DCTA 1EAMA 5G02A 4AZVA 1AV6A 3DH0A 3HEMA 1RJDA 1VQ1A 2DPMA 5EEGA 4RTSA 5IKMA 4PNEA 5HZMA 3EPPA 5E2AA 3UJCA 2ZBPA 2BM8A 3A26A 3DR5A 4CTKA 4E2XA 3HCFA 2C7OA 4X61A 3MB5A 4RTQA 3KHKA 5K03A 1Y8CA 3ER9A 3HCEA 5DX1A 4GC5A 5BP7A 3EVFA 1BKYA 1NBIA 1JQEA 2GLUA 2OO3A 4WVLA 2I62A 1NW6A 2XYVA 1KYZA 3FTCA 3GWZA 1P1BA 2CKDA 3DUWA 3VC2A 4BLVA 1M6EX 3KQMA 4GEKA 3ERCA 2EX4A 2G72A 2ZLBA 1IXKA 5HIKA 3FPFA 4A6DA 1UFKA 4OA5A 1SQGA 2ERCA 3UJ6A 2BR4A 1X1AA 5CVUA 1SVUA 4GC9A 4X41A 2HMYB 3BGDA 2C7QA 3UJDA 2Y1XA 2ZW9A 1X1CA 5DM2A 3U81A 5HIIA 3ORHA 4HG2A 4M37A 4MTLA 5CVDA 4EKGA 1O9HA 4RTJA 3PTAA 2AVNA 2ZIGA 5E1DA 4YUWA 3FUTA 3GIWA 3KQYA 3O4FA 3VSEA 1MHTA 3PLAE 2P7IA 2ZCJA 2QRVA 5FQNA 4MQ4A 2NP7A 2HV9A 3JWGA 5EHIA 4PYLA 2GA9A 3DMHA 4E33A 4EQZA 2Z6UA 2IH2A 2EFJA 3ELUA 3LBFA 2H1RA 4RSRA 3TPZA 3KQVA 3SMQA 4NECA 4YV2A 3MERA 3KPVA 2PXAA 1QZZA 2QYOA 3HVIA 3KR1A 1QAQA 1F38A 1NV9A 3GRZA 4QTUB 5FQOA 5FHQA 1ORHA 1G6Q1 1I4WA 3UFBA 4Z2YA 5CD1A 5DTRA 2YR0A 4ISCA 4PINA 4Y30A 1VE3A 2G8NA 1VP9A 1D2HA 3UZUA 2A14A 1P1CA 3KKZA 2QE6A 4R8RA 3ER8A 3LX6A 3R9XB 1F3LA 1JQDA 2G70A 2AOUA 2LD4A 3P9CA 5DT2A 5E9QA 3DULA 3X0DA 5T64A 1JG2A 3FPHA 2VS1A 3LDGA 4RVFA 2B9EA 2ZBRA 3B3FA 2VDUE 3DMGA 3I64A 4QQKA 4KW7A 5E1MA 3UJ7A 2FK8A 3FRHA 1RJGA 4KIFA 5DSXA 5EMJA 3JWIA 3B3GA 2UZ4A 1G55A 2R3SA 1SQFA 1X19A 4C07A 4AUKA 2E5WA 5DRYA 5EKXA 1M6YA 2IP2A 3C3YA 3GRUA 3I58A 3GRRA 1QAMA 3KPYA 3M6VA 4GQBA 3UA3A 2GH1A 2VDWA 1VPTA 5EPEA 5T6BA 3BGVA 3GJYA 5ERGB 4CWAA 1O54A 2XYRA 3GXOA 1R6AA 1RJFA 2AOXA 1YZHA 4ER5A 4C06A 4YV1A 3GO4A 2C7PA 3FPGA 1JTFA 5LQNA 2JH8A 3KU1A 3LSTA 3HCBA 4FSDA 5HOQA 3UBTA 3EMBA 1FJXA 1XCJA 1EJ0A 4KRGA 1VBFA 5CVVA 2ZULA 3FUVA 4FZVA 4XUDA 3P2EA 3R6TA 3MTEA 3AXTA 5CVEA 5K0EA 2P7HA 3VC1A 3IEIA 2BZGA 3G2PA 2V74B 2PJDA 5LQKA 1IM8A 1M0EA 2NNWB 3G8BA 3HA7A 4FP9A 3A4TA 4V0RA 2NXJA 4FT4A 4QQNA 2OPBA 3TRKA 2R6ZA 2JHCA 3TOSA 5FADA 5IH3A 3S68A 3DMFA 3TQSA 1JSZA 4RTMA 8MHTA 3P9IA 4POOA 1PRYA 2HTEA 3MGGA 4XUEA 1FP1D 3C3PA 3PB3A 4BLUA 3SSMA 1XVAA 3C0KA 4F85A 1QANA 3GU3A 3BWMA 4LWOA 2FRXA 4RTKA 4LG1A 2H00A 3GRVA 3M6XA 1BHJA 2NXNA 5K09A 2HNKA 1YFLA 5EZSA 2CMGA 2OY0A 4BP1A 10MHA 2FHPA 3LL7A 3P8ZA 4FT2A 1NW3A 4PGGA 2OYRA 2JG3A 1L9KA 2XYQA 3FTEA 3G5TA 4PIPA 4DCMA 4C4AA 4GOND 4ER6A 3LCCA 3SSNA 1P39A 4K6MA 5FULA 3HVJA 1TW3A 2B2CA 5K0JA 2ZBQA 2OB2A 1G8AA 1KYWA 3LPMA 4XCXA 2KW5A 4M38A 5DXAA 4DCGA 4RTPA 1EIZA 4AZWA 2C7RA 3B7PA 3FTDA 5E9JA 2PT9A 4HGYA 2ZZNA 3DOUA 3OE4A 4FSXA 3FYCA 5HILA 3SX0A 3HA3A 3M6UA 2WA1A 5EG5A 5K0FA 9MHTA 3EVBA 1HNNA 3GRYA 3G2QA 3SR4A 1NW5A 2OZVA 1FBNA 5DM4A 4PYKA 5DTQA 4R8SA 2GAFA 3LDUA 1G60A 2GPYA 2GB4A 3AJDA 5DX0A 4HRAA 4QPNA 3B3JA 2AZTA 1QAOA 2CMHA 4OBWA 5LQCA 5GIOE 5FTWA 4RVGA 2PSSA 3LDFA 3E8SA 3MCTA 2IH5A 5FA8A 1VL5A 2UYOA 2ADMA 3MHTA 3ANXA 4X1OA 2YXEA 1L1EA 3A25A 1WS6A 5D1HA 3PS9A 1KP9A 3AY0A 3C6MA 2AR0A 2PX5A 3OPNA 2ONZA 3QOXA 3NDJA 1DL5A 1UWVA 2FPOA 2BR3A 2F8LA 3HP7A 3K0BA 3IHTA 5HFJA 3TFWA 1VIDA 2NXEA 4UOEA 2BM9A 1DUSA 5C0OE 1G38A 3PFGA 3QOWA 1BC5A 1NV8A 4MIKA 2YX1A 4QVGA 5EOVA 1XTPA 3KQPA 1KPGA 4FR0A 2DULA 2CL5A 5C1IA 2I6GA 3UA4A 5KQRA 1HMYA 1X1BA 1KPIA 1ZHFA 2ZIEA 4PYJA 1G8SA 2ORED 3LKZA 4X63A 5GIPE 1YF3A 1U2ZA 4GBED 1N7IA 4LECA 3E23A 4PYQA 5GWXA 1RI1A 2ZWAA 4WXHA 4P7FA 5JR3A 3RW9A 4JXJA 3BWYA 5LQRA 3CJQA 1SG9A 1FP2A 5KS2A 3FTFA 3VYWA 2EJUA 1WY7A 2EJTA 4PONA 4XUCA 4E2WA 5EIFA 5BXYA 5K05A 3BKXA 4BLWA 1TPYA 1X1DA 5FHRA 5GINE 3HA5A 3ELWA 5DPMA 3R3HA 3HTXA 2AOWA 5HEKA 4EMSA 2AN4A 2ESRA 2IDKA 3NDIA 3O7WA 3KQQA 1NBHA 3KR9A 3NJRA 2ZSUA 4GUAA 5EZQA 3B89A 4RWZA 5CCBA 2PX8A 4P58A 3EVEA 4EKIA 3EEOA 3BZBA 2NYUA 4RTNA 3O31A 3BXOA 3SSOA 4YUYA 5K0GA 2P3LA 2YVLA 2FCAA 5DXJA 5KVAA 5GM2A 5JUWA 3TKYA 3A7EA 3THSA 1TW2A 4Y2HA 2K4MA 4E2YA 5MHTA 4R6WA 3V8VA 2PX4A 4RV9A 4RYLA 5B1SA 5C9ZA 7MHTA 3DLCA 2B78A 3OCJA 3KQSA 4PGHA 1VLMA 3LGAA 1ZQ9A 2O06A 3DXZA 5KQSA 1B42A 1XDSA 2PT6A 4QDJA 5LQJA 1O9GA 3DLIA 3CCFA 2O0LA 1RI3A 3TMAA 2AVDA 3CJRA 2JH9A 1RI2A 2PGXA 4PYNA 3UWPA 4ER0A 5DRTA 4LWPA 5ICCA 3BKWA 1KHHA 3OU2A 3OZRA 4DF3A 1YUBA 3RIEA 3MCZA 1R8YA 4KDCA 2ZVJA 5K0BA 4E32A 1NW8A 4QTTB 4QPPA 3HM2A 5FUBA 3QV2A 2P41A 3SM3A 4EK9A 3GGDA 4RX1A 5LQAA 3B5IA 2XVAA 1H1DA 2JJQA 3DTNA 3A27A
chains in the Genus database with same CATH superfamily
1SR8A 4C2AA 4O59O 4DJAA 2R6FA 3BB4A 3F98A 3M33A 2ZQYA 3Q2KA 4O4HA 2IYTA 1KI7A 2WMNB 4QUJA 4BPRA 3MNFA 4DA4A 1ZHOA 1NRWA 3Q72A 1XMSA 1DRVA 4RABA 4TVKA 4A3SA 3DNPA 4WKOA 1WNTA 4PPGA 3BHIA 1ONSA 4ZCLA 2B20A 4MCIA 3LXXA 5GOZA 2HGSA 3UK2A 1E3EA 2RHRA 1KETA 5T4BA 4J9UE 3UAXA 1I7QB 1OKKD 1FSZA 2C83A 3TRDA 3SDBA 1QS0A 2FSGA 2GASA 4FHFA 4DQDA 3N87A 4YMHA 5JY1A 5IBCA 3S1LA 1QH8A 2GEFA 2WT8A 4OP2A 4P4LA 1CNEA 5IS2A 1XDDA 4QZVA 2EGGA 1L4UA 3HP1A 5LOVF 4FGSA 3KD2A 4WBNB 1YZVA 2VZ8A 1FFSA 2HLDD 2EGHA 1QGZA 1NQ5A 2HIAA 4LY0A 4RH0A 3L82B 5GP1A 1H65A 4BKPA 5BWMA 5TQ0B 4M9XA 3V4OA 3DKVA 1GPYA 3R6WA 2CCGA 5LFAA 2DWPA 3X1JA 4II7A 5KYTA 2J7KA 4NYIQ 3K1AA 3HNPA 1HE2A 3HKCB 1AHHA 1P4RA 5BSGA 3EWSA 3L8FA 4MHSA 1ZWLA 3TGPA 3F3SA 2LV8A 2VCHA 4DDTA 1W4RA 1K3TA 4PYIA 1Z7YA 2OXTA 3IPXA 3MTBA 3ZCPA 2E18A 1GTSA 4A03A 1HYEA 1NVEA 4C6TA 3QJYA 3JV7A 4YS6A 5L3ZA 5IUJC 3T0IA 3WJAA 2H1FA 2UUPA 3F4BA 4KOEC 1NMXA 3OEEA 4D3DA 1N4DA 1TMOA 2ZE6A 5ESWA 5F78A 5IYZF 4PSUA 4RJTA 3H8VA 2A5LA 1Y7TA 3RVMA 4DNQA 4ZQIA 4B9EA 2EJCA 2IJGX 5JAOA 4JQSA 2SECE 4XVUA 5EIXA 3I62A 1SC4A 1U7WA 3Q1LA 3WIVA 2PKXA 4MRPA 1JU4A 1KQ3A 2BBWA 2OG2A 2XADA 3CZRA 4U7TB 3REGA 5HUJA 1CEEA 3GEHA 4J0IA 2DU8A 3V34A 1NBMA 1ECCA 4MRVA 5BV1A 4B6EA 3AJRA 1X7WB 2AHOA 4B4DA 3T7IA 4JD5A 4EGSA 3G0GA 4B85A 5EEHA 3BMCB 4K2AA 4RLHA 2CVHA 3O1JC 2IEYA 4PQYA 4X60A 4BAGA 2VYNA 3B6ZA 5B2FA 1U0EA 4U2FA 4B3SB 3LQQA 1BEUB 3U4MA 1ECPA 2V7XA 4P36A 1EM6A 2WJZB 1VBNA 1WCIB 5KYWB 1Q3KA 4ZODA 1ADCA 2OFXA 3G2MA 3OZXA 1RAHA 1QU2A 1PNRA 5D01A 4OAQA 4ZMRA 4Z7JA 2EQAA 1XKTA 2PL9A 1NSTA 2X0NA 1OGJA 3EVZA 4HEQA 1M1NA 3ESZA 1PBTA 5EHQA 3RCBA 3FSRA 4QM7A 1YS1X 1VJGA 4JA0A 5DHPA 1JIUA 3KZXA 2C00A 3B48A 4YCJA 3WSTA 2DYKA 3CVOA 1X74A 3BM5A 1ML3A 3K5PA 3OZSA 3PFWO 4GVPA 4MKIA 3D4OA 4GZ3A 3QIVA 4WY8A 4F84A 1PD1A 4HOYA 4YAWA 4NCJA 2NTJA 3EXAA 4GLBA 4EPWA 4ERNA 2CVOA 1EG2A 2ZAGA 4KN6A 5CUQA 2OESA 4DHWA 4ABTA 4KPUA 4G24A 1YR2A 3MMZA 3AIKA 1BQEA 5KNCH 2REOA 1JW9B 3AESB 4EZEA 1CJKC 3JAWB 3I83A 3KKEA 1F8GA 2RK4A 4Z53A 1D2CA 1K6IA 1GL6A 2PO7A 1P2SA 2QJWA 2R48A 4G4JA 4JKYA 4AMYA 4X0EA 3S44A 3IEXA 1E98A 4PC1A 5IVIA 3I1JA 3N0WA 3PC4A 2JS7A 1ZU4A 5F64A 3SE0A 2ILVA 3T1QA 2PO5A 4CLRA 3OE5A 4I7EA 3M9LA 2M32A 4ZCQA 2AOVA 4I14A 3HE3A 4DS3A 4PPQA 1Z25A 2DT8A 4OF4A 1NNLA 1HDZA 4MQFB 2PLWA 3IDZA 2R7MA 1YJXA 1D2MA 3ILVA 4W1RA 3GT3A 4GWLA 4MWGA 1RRVA 2ECPA 4C08A 3JQQA 3GJRA 3VVMA 1LV8A 4G5SA 1W0CA 2WE8A 2UYHA 4HAXA 2FQXA 2O8CB 5BNZA 1P2TA 2J9XB 5EMMA 3IVCA 1K3FA 1KK2A 4LJ7A 4M8NE 3SK0A 4PCUA 3B9PA 5EPOA 4ZJPA 4J0JA 4Z86A 3DDCA 3TL3A 3G9TA 3QOFA 4F4HA 2EHJA 4EGJA 4WUTA 4NG5A 4TLCA 4M88A 1L5HB 2VRBA 1LZKA 2ZJFA 2NLOA 2FG5A 2IHJA 2JGDA 4L02A 5CT5A 4OFBA 5EFOA 2GKGA 3GZ4A 4FGWA 3REQA 1B0AA 3HMKA 3RSHA 1G3QA 4Z3KA 3K9NA 4LE1A 3T3OA 2XSZA 1U2DA 3NMUF 1ST2A 1FS4A 3HL0A 4O3FA 3QHQA 4D3SA 2BJWA 1UZMA 2OCXA 1X7ZB 2QE7A 3BDIA 2VHCA 4DR1B 1AGNA 1T6YA 4MQLA 4ZQBA 1T2FA 3OETA 4F4IA 4K5QA 2I4RA 5EJ5A 4AT1A 4LDRA 3ZIUA 2EG9A 3AEXA 3HUTA 3OOWA 4KFRA 2P27A 5FI0B 4OOFA 3MJTA 4EYSA 1J8DA 4QJBA 5DTEA 1RP7A 1VE6A 3C74A 3V8NA 5HR5A 1HZZC 2XCTB 3UJCA 3K70C 4M54A 2JIDA 3SHTA 1GPKA 4HDNB 3KXIA 1Y1RA 4UBJA 5K03A 3IQWA 4C5CA 1ENPA 2WD7B 3RC8A 2BI4A 3S8MA 2G4CA 3HGMA 2JFUA 3DZCA 4YMUA 2QL9A 1WDTA 3TEFA 1BW9B 4GMHA 2IU0A 1OY1A 4LTDA 3GWZA 1P62B 5HKKA 4OH1A 1HDEA 4ZA2A 1QE3A 4QTXA 1P9NA 5CLLA 2F62A 2V6JA 2Y66A 3TDKA 3RVOA 4Q01A 3WHKA 4ZTUB 1JGTA 4TVSA 5FP0A 1JAZA 3EG9B 2XCLA 1C0EA 3F9RA 1PR0A 3K9BA 2X2FA 5AJYA 3LW7A 2WHPA 3NATA 5H4GA 3LRXA 5KEIA 1NWCA 5DFAA 2G36A 1KDYA 3J7AC 2AFIA 2AG1A 2EKPA 2IEIA 3DFMA 3K1JA 4PRKA 2IY7A 2CW5A 1X80A 3URKA 4X85A 1RPTA 3D43A 3T3GA 5AHKA 2JASA 3EF1A 3HPRA 3UJNA 1GPH1 3F1LA 2QE7D 2PGAA 3K9FC 3V8RA 4N76A 3WLIA 3UUFA 5AVRA 3NP9A 3W9UA 2DLCX 5JSZB 3EAFA 1FQWA 3B78A 1ORHA 3OZAA 1AQ6A 6CHYA 1SPBS 1T1IA 4LJYA 4NZZA 1BX3A 2ZXEA 4UATA 3BH0A 2QROA 2OORA 5LYJB 3DTVD 3PICA 5CEFA 5JD5A 1C3LA 1POWA 1DGQA 1I7DA 3A6LA 3GPCA 1I3OA 1C0KA 5FWYA 4PHTA 2F00A 3T3DA 2V9CA 1P0PA 2AJLI 2CKMA 4JBYA 5EERA 5EWMA 3UFXB 5EE0A 3ZXXA 1H4SA 5HZHA 3I28A 4ZC8A 3K2QA 4KIFA 1Z29A 1BE1A 2OSBA 2WRZA 3RROA 2F43B 3TF5A 3AKZA 4OB7A 1V5WA 2BC9A 4MZXA 2DQYA 5D6NA 4C4PA 1CF4A 1A9PA 1FYWA 1EE2A 1U8UA 2N42A 5T4FA 4AJOA 2QVGA 4CT5A 1T8SA 2OHGA 1TKAA 1ESDA 1OOEA 2AL7A 2P91A 3PITA 4K26A 3RTBA 3UA3A 3AY6A 4FDTA 4P5PA 1Q44A 4AUNA 5EE9A 3RBVA 4LVCA 2GLTA 2I2AA 1Y4SA 3DDOA 2OOKA 4HVTA 4J7XA 3BJZA 5EFZA 1R6AA 1RJFA 3HR4A 4JLKA 4JYAB 1W2HA 4PW0A 4TMTA 3ZU4A 4QUKA 1B0ZA 1O4WA 4WERA 4BNNA 4EW2A 1RRCA 2X3FA 1WB9A 2L19A 4ZCSA 1T9GR 4KIJA 1WU7A 2QD4A 1C1DA 3ULKA 3P19A 2Z2ZA 3HKBB 4U5XA 4EJSA 5K0EA 1GEGA 1LQ2A 3BD6A 3UMCA 2BZGA 1N2OA 1X1SA 2Q50A 4RM2A 1TZKA 3G8BA 2WPDA 2VDWB 3GRKA 4TVBA 3WNBA 1PF7E 4OY3A 4WZBE 7YASA 2PVPA 2CV0A 1RVDA 2VPXA 3VO1A 2VJBA 4TTPA 2CHGA 4WGFA 2KQUA 3BEDA 2G08A 3F97A 3JZFA 5I9SA 4GKVA 2ZKIA 2A1TS 1VL0A 2O2HA 2WP8J 3OCYA 4CMEC 3GLFB 2P4QA 5DBGA 1LSJA 1WHSB 1YIOA 4EA6A 1YFLA 4CQJA 3GP3A 4GD3Q 3H87A 2YC2C 4BP1A 2JFGA 1GTMA 1UXJA 4WXYB 5KJFA 3THXB 1PG0A 3AWDA 1CZNA 1EK5A 1P1IA 4O8CA 5LQMA 3H1FA 1RZRA 1EFUA 3LOPA 1SC3A 4WFQA 4DLXA 1W8IA 3L6RA 1EIZA 2NZWA 1XHFA 1W73A 1TAUA 2ZIVB 4UFPA 1AMNA 2ZSBA 2C2GA 4HGYA 3PDHA 5BN5B 4FR2A 5LIRA 1EK2A 3CEJA 3FYCA 2FWNA 2DTXA 1KS2A 1ST3A 4DNOA 2O3UA 2WIBA 3O75A 1EFCA 2WB2A 1TT5B 4R8SA 2X4LA 4BQNA 1AXRA 3BX1A 2AKYA 3T5GA 1JWLA 1QCCA 3NAMA 3CNQS 5GIOE 1QAOA 2VJNA 2WYWA 4B47A 5CT9A 4NCAA 2HU8A 2IXGA 4EGCB 4MLZA 3V00A 5CM8B 2C84A 4ED9A 3SJZA 5H9WA 4KFCA 4OREX 1KP9A 3K0KA 2BHNA 3RU7A 3H2JA 2WVAA 3LUJA 1OV6A 2WPDD 1ETHA 5EHNA 1MOPA 2V7PA 4C0JA 3H75A 4B75A 4CETA 1FX1A 2Q9UA 1GU7A 1NUUA 4BB5A 4F06A 2VFAA 1MX9A 3WLKX 2YX1A 1UFRA 2Z30A 3DWFA 2WIAA 2Z1DA 1Y89A 4IYRA 4URWR 4YCDA 1C2YA 4F45A 1UKCA 1E5LA 1NMZA 3OJCA 1K9VF 4NBTA 2ZIEA 2PG3A 4KRFA 2R00A 3D3JA 2Y93A 4KMMA 1U1EA 4YJGB 4P6VF 5GWXA 4PYQA 4MMYB 1N5RA 1RI1A 1OSNA 2HO4A 2I4NA 2WKQA 2ET6A 3AEKA 3KAPA 3QPWA 5KYUA 3SQDA 3GLGB 4MDFA 1FVOA 2FP4B 2VQEB 1WY7A 1ZIYA 2X8JB 1R2QA 4FD2A 2NZVG 4KO4S 4PONA 4E2WA 5B4TA 4BLWA 3BJMA 5K3AA 3BERA 3P2YA 4CM6A 3OLZA 1BXGB 1L4LA 5KMGA 1WMDA 3I37X 3IIJA 4NK4A 3RAEC 4KE7A 4EMSA 4BN4A 1Z83A 1BS2A 3C8UA 3U44A 2XR1A 1ZI8A 4CMIA 2Q8PA 2H29A 1LVGA 3EDMA 3JARA 3H04A 4G5HA 5DWDA 3P9SA 2VJLA 2B0JA 5FTNA 5DI3A 5B30A 2OBMA 1WUKS 1N2JA 2Q6IA 3HJBA 3VPGA 4B7CA 1ODLA 3MJHA 4EHFA 1XTBA 4QA9A 3LA6A 1R9JA 2O6HA 2XUHA 3ANNA 3WLTA 1XAIA 2XF8A 3SLGA 4BZXA 3MMSA 4U0KA 1JMYA 2I2BA 1G63A 3DBHA 3DYVA 5CDFA 1Y4ZA 3F78A 1VLMA 4BCDA 3LC7O 5REQA 4OLHA 1WMBA 2HJ9A 2R44A 1PJQA 5K6RA 1QFZA 5E4TA 4E46A 1TM3E 4QGAA 4HS4A 2PGXA 4WEOA 4ER0A 4GGPA 4QDTA 5JRJA 2OBNA 5C5EA 2HCRA 4UBNA 4RHTA 3V4RA 1FTSA 3HWSA 3MWDA 2V55B 1SHUX 4FR5A 4V0KA 4Q9NA 4YC7A 5LMUB 1Y8QA 4X90A 1VHDA 3LO8A 4HMOA 1BU5A 1NMSA 1PAUA 3GFRA 4P3YA 4QUBA 1VG1A 5K0BA 4CEJB 1V8FA 2H17A 1C9DB 3DONA 3K92A 3T61A 2P6PA 4HNGA 4EB3A 2AV6A 2NTNA 4ZT6A 1P3JA 4UCXA 3BL5A 4NU0A 1GCIA 2B4RO 4ZI7A 2JJQA 3HHEA 5ALQA 1MVOA 4AJKA 2R7LA 1PEAA 1I6WA 1UK7A 2C58A 4LCJA 4NEQA 4NYIR 1ZIXA 2PD6A 2YZ7A 1MB4A 3G0CA 3LCVB 3SEZA 4E5KA 2QUIA 5FWNA 1T15A 4M1EA 5AW1A 2W0SA 4RA9A 2P75A 4PCLA 3RS5A 3PR1A 4HADA 5F2EA 4BE9A 1F12A 5FIUA 3R3VA 4IZ6A 3SKYA 3JZIA 2V7UA 1VLQA 4E5YA 5C7YA 3KE8A 3LLMA 3S1AA 5JDIA 4HUQA 2XRMA 3UH1A 4D98A 3OF5A 3NLLA 2W58A 1C3VA 1NKSA 1M34E 4DARA 3G49A 2BKLA 2RGDA 2Q8QA 2DWOA 2WWYA 3P9XA 1BE6A 4RELA 5C8YA 4FYPA 1LFAA 1YZUA 4ZIRA 4FLMA 2NT3A 5KTYA 1EFDN 1RXVA 3G5LA 3OIFA 1XTSA 5K8VA 2CYBA 2XOKA 4D4KA 1UIRA 2RKBA 5C5IA 5KNLA 5EXEA 1J56A 1H5UA 1LTKA 2HIGA 2YICA 3RGWS 3RVJA 3IDQA 5EZYB 3H6KA 4EKEA 3BDAA 1QHEA 4D3ZA 5CA0B 5I7FA 1RQGA 3PE3A 1K7EB 3IOCA 3QLVA 3UYLA 1E77A 3STWA 4MR7A 5U1PA 1KVRA 3U3OA 4LKOA 5A4IS 2GWRA 3S8YA 2HSJA 1NJ8A 1NJ1A 2GXSA 3ZLTA 1GA1A 4J1SA 4ZOLA 3DO6A 4BNZA 4PGFA 3TUZC 4TYPA 3BRQA 3FPJA 2YTZA 1LPAB 2CWDA 4LZPA 4XLTA 2HLHA 3PK0A 4OV6B 4WASA 4CN8A 1P4GA 2C5HA 2QTFA 2FZWA 3AONB 5DASA 1W4BA 4I1IA 4K7JA 3HNRA 4CQLB 2BISA 1T3SA 4F6RA 2L42A 3BXFA 3HR8A 4BBPA 4MUAA 2OV8A 2GEKA 3HVKA 2QTGA 3VPAA 4XYLA 2FW0A 5BNWA 2XB2A 1NOJA 2AN5A 2PANA 3WL4A 1WMAA 4I3FA 1FS6A 3SEAA 2QTMA 3BWDD 2QNRA 4DIUA 3FKSA 4TV8A 1IUNA 2VP0A 3GXBA 3WK5A 1T2AA 1VRCA 2P30A 2FEPA 3DVQX 2F7SA 1Q21A 3I8XA 2J5XA 4GVXA 3WL3A 5ICMA 1Y3FE 3ZWBA 3GJ7A 3OFVA 4BC0A 1U8YA 2GYYA 2Z56A 1E5DA 2LIPA 1FUIA 2ZTSA 1GSHA 3Q7PA 4HJRA 4OHRA 1DT3A 4QLOA 1QTRA 3FUXA 3M6WA 5DBIA 4EY3A 5KOHB 1SBIA 3MQ4A 2WF7A 4G56A 4K6FA 2DT5A 2VTKA 2I7DA 1E6CA 5LP1A 1NE7A 1EUDB 2GK4A 2XOKD 2UUBB 3JPYA 4YUZA 1YDWA 1OTXA 4MVJG 2C9BA 4XYMA 3MTAA 2XMZA 4KUHA 1I3KA 4OFWA 5FPSA 3ELDA 1B6GA 1YQUA 2UUOA 3HBAA 4LDAA 3N28A 4X1YB 3G17A 1GNLA 2OYSA 2PEZA 2ISQA 1CIVA 1OROA 1ZN7A 4UVHA 3UB4A 3DXFA 1X2EA 4GW3A 4IS2A 4F46A 2V7EA 1AK2A 1OI7A 2ST1A 3WV5A 1THGA 4U02A 2OOSA 1G2IA 1W25A 1YI1A 2X86A 3JYLA 2C2KA 4BV2A 2PZGA 4WLUA 2WE7A 3FWPA 4G26A 1EGMB 1RBZA 1A8SA 1GGKA 1VIAA 3PQ6A 4C6SA 1LDGA 3PT9A 2QTZA 1QPZA 4FPXA 1FUYB 3M4YA 3LCUA 1OX6A 1VLVA 4GNRA 1JKMA 1W5SA 2J5QA 2GEBA 5E8JA 2COKA 5IP5A 4MR8A 4CQMB 5CIYA 3KVYA 2ZRAA 4TS1A 5TMEA 1RXWA 3ZLVA 3EGDA 4KWCA 1Q11A 3DFZA 5DVZA 4A16A 2Q5JA 5A2QA 1PS8A 2Z9DA 4LDQA 4O1HA 5DHSA 5F7JA 3VTZA 1LQTA 2D5CA 4A7PA 3LZCA 3H83A 1K68A 4IW3B 2WYHA 3PGJA 1AUOA 1CLEA 3L0DA 3PWKA 3EPJA 5EJ4A 2O3RA 3ZEAA 5AW6A 1CUEA 2O8DA 2H52A 1FA9A 2E4VA 3MLEA 2XV1A 3FUWA 1TVMA 1VBMA 4R0NA 4BLOA 1FOEB 1SOUA 3JVDA 2FZVA 1D2AA 3H65A 3TLJA 1DWOA 3FPEA 4BQOA 3G2LA 3JW8A 4GEGA 2WHYA 1P3Y1 4GPZA 4CLHA 1A69A 3TTXA 2NM0A 2UKDA 1FEZA 4E5SA 1HK7A 1MIOA 2QTHA 3KPWA 4KE8A 1QIFA 4GKAA 2PZAA 4EHDA 1ZOOA 2CJPA 4RQUA 4ZCIA 2I7XA 4D9HA 1RWXA 1YRLA 2W6QA 2YNMC 5FOQA 4XGKA 1OVMA 1X7XA 3TFOA 4DNXA 5AW5A 2VAMA 1U81A 1OFGA 3GEDA 3QQPA 4D9MA 2VPTA 4U9UA 1DAEA 1P0FA 2OD9A 2VIIA 4NFSA 3SJCA 2PQMA 2GGSA 4AKEA 3CNLA 4QOIA 5JARA 3TIFA 2G9ZA 2HJVA 2XCUA 4ND2A 3OEYA 1KKMA 3C4JA 4GMGA 4HH0A 3ZR4B 5HSGA 3Q3GE 2UZ1B 2QF7A 3G8CA 3O9MA 3LECA 5DNDA 3WK6A 1V11A 1A5ZA 2IITA 4P92A 3V9AA 4L0CA 2C5FA 5HW0A 5HXAA 1Z13A 3E5HA 3EASA 5EGSA 5I7AA 1V48A 1GA6A 2D5BA 4JUBA 4D6XA 4MJ7A 1JLHA 1U31A 1X8XA 1F8UA 4H0FA 4OHMA 3E48A 2XA1A 1NBWB 3BD8A 4PAOA 5AJVB 2IBSA 4PNZA 1CS0A 3RJ9A 4F2PA 4E2ZA 1JFLA 1BMFA 2O2JA 3M5PA 4HY3A 2HSGA 5CK5A 3QPCA 1PJRA 2PJZA 1J8VA 5BMVB 4IWYA 3U5TA 2N3ZA 4CTMA 1U4OA 2V5VA 4KBFA 3QXHA 2POCA 2HQRA 3GVXA 4P81A 3B1FA 1EP1B 1VQ1A 1T9HA 4CG2A 2GM9A 3CEMA 4B8WA 1XR3A 4FC7A 1H2HA 9LDBA 4OX9B 3DBLA 2XZOA 1KZHA 4ND4A 3E7WA 1JT2A 3BD9A 1SBHA 4NCIA 5HZKA 2GXUA 1SGWA 3AEQB 3JALA 3O03A 1UOQA 4FYJA 4GC5A 4XZ3A 3UIEA 4BGIA 1A1VA 3O3CA 3VPFA 2NXWA 4RIEA 1RWKA 2I62A 4YJDA 3TOXA 3VR4A 1E1CB 1SCJA 2XQGA 4HEJA 4HMQA 4QPZA 2HA6A 2VJKA 1LDYA 1YJ8A 3QLTA 2Z09A 4GGMX 5AP9A 2GCEA 4DADA 2AMJA 2OSVA 4JGIA 4D8WA 1R6BX 1E59A 2ERCA 4JB2A 4ON9A 2V1XA 5AOCA 1XRQA 4UD2A 1E2KA 2GX6A 1V3QE 1L4KA 3L0SA 1KMHA 3EXEB 1QFMA 1NYRA 2CNKA 2NU6B 4LVOA 4LOJA 3RRFA 3PNVA 1YK1A 5E1DA 2XY4A 2B94A 1DC3A 3WZLA 1G59A 2A7QA 2EOAA 1DX9A 1MHTA 3PA6A 1O95A 3PUWA 1B00A 1CE8B 1X1RA 2PFKA 2Y8EA 3JWGA 3NORA 3TINA 1AZLA 2PR2A 3R3UA 2ID9A 5LNK6 5IKXA 3WLPA 1IY8A 1IBCA 1U02A 2WJYA 2X6RA 3HB5X 3QNWA 2WFLB 5EJ9A 5TDHA 1ZM7A 2EFJA 4F8EA 1QV7A 1TQDA 1DG1G 3VPHA 4HXEB 2H1RA 3PKJA 4RGVA 4B79A 2YOGA 2HFKA 4MRAA 3VOAA 4EP1A 1LPPA 4KE6A 4M99A 4RXMA 1U7TA 2E89A 3FI9A 5DYNA 2W70A 2WHXA 4ALNA 5KSOA 3U61B 3ZE7A 5LP6F 2OCYC 3AB7A 1RQLA 5FQOA 1PBNA 4Q47A 4ZGBA 4ARIA 1EGVB 3HFJA 4DR3B 3TYXA 3QG5A 3TSYA 4HRXA 4CTOA 5TQ2B 2XTJA 4IDAA 3H9UA 3LX6A 3UNXA 2FZKA 2X8AA 4CHGA 2ZDGA 4ILKA 3P9CA 4LUCA 4IQ8A 2ZT8A 1D9ZA 4KGXA 3O91A 1U28C 4RUKA 2AMVA 1TUIA 2XWJI 4I46A 2VDRB 1JZSA 1M74A 1RLIA 4AECA 3GI1A 2YYAA 3WDKA 1JMKC 1ZM4A 1Q1BA 2D5LA 2RHWA 5EMJA 5GVRA 4B5KA 3RS0A 5EJ6A 4ZRMA 3JQBC 4I4NA 2TYSB 4PZEA 3PX7A 5DCYA 2IZ7A 1SVOA 4YMLA 1M6YA 4O4LF 4BP8A 3PNQA 1IHDA 5FJIA 1J1IA 2VTVA 2XMRA 2HWXA 2HMSA 2ZXUA 2BVNA 1VPTA 3IJRA 4WECA 5HMMA 3GJZA 4EMUA 5TF0A 3K05A 5MGBA 2JFZA 1JFFB 2GBLC 3LOQA 4WLEA 3DFFA 1YZHA 3U4HA 1Q1NA 3G1UA 1O95D 2JGAA 1IQPA 1M7HA 4S1VA 1T26A 3VYRB 3EVNA 3LH5A 3OX4A 4B84A 1Y9DA 3QVLA 1VJ0A 2V0NA 3PE6A 4HFJA 5TV2A 4FGLA 4I6JA 4OHVA 2QWXA 2MYNA 1P4JA 4QWMA 1QK4A 4XA8A 1O0CA 5TXGA 2QIOA 4NEHB 4GPAA 1EFPB 2ZU0C 5EKTA 5SV2A 1IM8A 4EG8A 5KQPA 2X9VA 3O84A 5FPTA 2P2SA 4JBXA 5AM0A 3ZHRA 5FPPA 2V0CA 2R6ZA 4DT1B 8ADHA 2PKEA 3K0AB 1JFSA 3EB9A 1C3XA 4GSYA 2Q0QA 3QG1A 1PT7A 3TRHA 4YQYA 1P8AA 1DV2A 2EHDA 3DMNA 1HYBA 4XM1A 1U0NA 1ZXLA 5AJZA 3F7NA 3HN7A 4Q3AA 1JEJA 1F9AA 4OK6A 1G20E 3ZTWA 4AJ9A 4DREA 4M6WB 5FAKA 2I91A 1DARA 4E3WA 3VZBA 1W35A 1Q1QA 1XE3A 1NW3A 4FT2A 2WVGA 3WBFA 5IABA 5IVDA 4JSTA 3G5TA 1O6GA 1FFWA 4C0WA 2F8SA 3X3HA 3F5QA 4R1OA 1X8JA 4J0HA 4D7AA 3OJOA 1YJ5A 3DQQA 4YRSA 3MQFA 5EXTA 4WJZA 1DKPA 3LZ6A 2VCEA 3F7MA 1P31A 1WCYA 1ONNA 1ZWKA 2PT9A 4O4JA 1C7RA 2EBUA 2J87A 4FFDA 5H70A 4CMBA 2ZZNA 4Q1CA 3AVXA 1CY6A 1UMKA 1ONPA 3A8TA 4RLQA 3TKLA 2IELA 2NU9A 3TXAA 5BPHA 1M1XB 4QC2A 2ZI7A 3N6RA 3QWHA 1G60A 4YTEA 4RNDB 1XZHA 1SA0B 2CLMB 3CNHA 4QREA 4C4XA 4OMUA 3EX7C 2CLIB 3AR7A 4A8JB 1JA0A 3ROTA 4Z4QA 3Q7SA 3R76A 3X1DA 3T38A 3CONA 5G0VA 3JQ7B 1RIIA 7MDHA 3K0FB 2P11A 1TZMA 5D1HA 3QE2A 1EX9A 1WKVA 4BNMA 4XB6B 4GRDA 1GV0A 3VNSA 1QUEA 1VL6A 4BX2A 4F7DA 3LHFA 2P77A 4NCXA 2O8NA 1JE0A 3HXKA 3UXYA 2LTAA 2WTAA 2BH9A 1ZBDA 3PUIA 1NVMB 3ODPA 2IIVA 3T1TA 2V3CC 1CT9A 1Z07A 1YUNA 1GPMA 1G17A 2XGSA 1QLHA 1RXCA 1F0NA 5HA5A 3D8NA 3EZ7A 1BJTA 1XN1A 3QKRB 2V3VA 4O5AA 3SVTA 4O2BF 1UBFA 4NAHA 5SY9A 4GZ6A 4FHDA 4RPGA 3X1MA 2IPAB 3OT5A 1VKHA 3RS7A 3SOPA 1WZIA 2CVPA 3EZLA 3C39A 3DJYA 3H9CA 1RPNA 4J9VA 3UB3A 5CDYA 5KS2A 3GFQA 3EN0A 4AO8A 3BKXA 1X1DA 1XELA 3MT0A 5GINE 5CYGA 4YJKA 2C4VA 2CNBA 5IYZB 1R9MA 5K0ZA 5E6RB 4DRYA 2AD1A 3A2NA 4MWOA 2DEUA 3A1FA 2XUFA 2R6AA 2YWEA 4N0PA 5TMDA 5ALKA 4PS1A 5CX4A 4E03A 1BZYA 1O8CA 1W5FA 4L78A 5LA6A 1RFLA 1Z4IA 1WHTB 2L2QA 3CKMA 3I12A 3QNUA 3EBOA 4K8OA 1S4MA 4ZAXA 3KVRA 4PX5A 2VTBA 4ZO4A 2I80A 1KEWA 2XBLA 3DG9A 2F3QA 3C7KA 4MW6A 4NE7A 3R9IA 3CUYA 2C7PA 2KYRA 5G0UA 3AERB 4HGPA 1N25A 3CH7A 3DLCA 3ZV4A 2FN8A 5LYJA 1M33A 1SNYA 3AVWA 4Q6WA 1JDBC 2I1VB 3FMIA 4QUGA 1UK8A 1QDLB 1NBAA 1GZ5A 1XDSA 1MX1A 2IXTA 2PWZA 2WIDA 3EARA 2E4XA 3H5AA 4M0DA 1Y6QA 4RFVA 4YDRA 2HC9A 4FZRA 4V02A 3VBCA 2FN3A 2PU7A 3PEFA 2X2EA 4YP6A 1LB1B 5SICE 1CDDA 2JAHA 4PSAA 4XCVA 5LBIA 2V4UA 1LRKA 1A9RA 4IXDA 3A9CA 3BRCA 1KJ9A 1R5JA 4RAQA 1RP1A 4IKOA 4L27A 1UMDA 4QKQA 3LTNC 3W9YA 2N1MA 1EMDA 3AUKA 4TMFA 2ZYIA 2CK3D 1R8YA 4PC2A 1B2LA 3TJRA 2ZVJA 1NI3A 1NW8A 3VZCA 4QPPA 3ORQA 4ZP1A 1GG5A 2OMEA 2AG8A 3CQ9A 1BFDA 2EX1A 3M5DA 1HDGO 3PPXA 4TRRA 4EK9A 4AS1A 3OD1A 2VSOA 3U2QA 1RS0A 1KH1A 4Q16A 1RQXA 2AZXA 4AUEA 4MLDA 5AJTA 1Z0UA 2YYZA 4FUTA 3ROPA 2QLJA 2ZS7A 3D02A 3VM6A 2R79A 3G2KA 1FDWA 3DHVA 3MS2A 3F46A 3BHNA 3PFKA 3GCXA 2O7QA 3KLMX 5CYFA 3RRBA 3ENZA 3VISA 1FW6A 4TMYA 5KTKA 4B3MB 2ZYTX 4NXNB 4WESB 1P1JA 5KYXB 3AEUB 1VIYA 2DLDA 1EWTA 5J4KA 2HXGA 1LVUA 1U3UA 3O9VA 3HKCA 3QX8A 4KXVA 3I9NA 2ZSHA 4HQ0A 1OLSB 5BSFA 3Q0EA 1RAIA 4GOMD 5J5CA 3UC9A 2PX0A 1JIVA 3DOOA 4ZYTA 5KTOA 1KTIA 4PLVA 3Q7IA 3CLKA 4DIEA 4JI8B 4ZEOA 3KBOA 1J2EA 1R8XA 2ECOA 1V16A 1NBME 1ZGZA 1P2VA 2PNJA 3TD6A 4AF6A 1EQAA 2JFYA 1SEPA 4O4IA 4J0CA 5HPYB 1IJBA 1Q14A 1VE9A 1YL7A 5D3ZA 2I2FA 4F3NA 2JIRA 3NO4A 2X0RA 3VH2A 2OBFA 5K3DA 3G7SA 3H3JA 3I2JA 1Y6ZA 3GT0A 3PNYA 1I13A 2VT7A 1XTUA 2BEUA 3CN7A 3HJFA 4ER3A 4N8DA 4F1WA 1YZ3A 1WBJB 2IC5A 2QRMA 2X40A 2C4NA 2R86A 4TKUA 1A76A 1RIFA 1XQYA 5CA1B 2XTMA 4HC4A 3PEEA 1BAPA 1SCAA 4QUAA 3RVPA 4FX5A 3QEOA 1JG1A 5DP1A 2M9MA 5J1SB 2DPXA 1KSGA 4LYJA 4E5NA 3WKEA 1SBTA 1X9IA 1XZ8A 3OQIA 4FILA 4FSHA 4V2UA 5EMLA 3HRHA 3FNIA 4K88A 1CJUC 1VOTA 1LTHR 5KWEA 2V3WA 4BS9A 4E94A 2Y0BA 3I09A 3V97A 3W7BA 3DT8A 3GHYA 3W3AD 4ZTBA 3IBFA 1T4BA 1KQGA 1TJYA 3IOBA 3QMPA 1WCIA 4RKRA 1GTG1 4D02A 4BNJA 4ENUA 2X41A 5JZSA 4A8JC 1ZVMA 1M67A 1CJBA 3JVUA 1FSSA 1ESMA 1LPSA 3M6IA 4Z7QB 5L3QB 1MZPA 3KWMA 3SX2A 2ATVA 5AIAA 4BGEA 2MYPA 2X7JA 2W48A 4EQ6A 2QNIA 3V4FA 1BEZA 3WJ7A 4XVQA 1XB2A 3CKKA 2YVQA 1KO5A 1KIMA 4NNPA 2XMQA 3ZZ0A 3ZJUA 4CGYA 3QXGA 5AJHA 3I1IA 1Q0QA 1CR2A 2EG5A 1E5XA 1EUCA 2YDYA 3GFVA 1J21A 3OKAA 3EJ6A 4OPMA 2V5UA 4RORA 3WRXC 5AVXA 3BOSA 4B7AA 4FB5A 2BE9A 2ON6A 4EG7A 1E7YA 1OBVA 1UOOA 1AQLA 4LGYA 5DLPA 2YMQA 1D07A 2CJWA 3W90A 5U9CA 3LUPA 3RWMB 3BILA 2O0JA 2ZTHA 3JAWA 1SXPA 2HU2A 2D00A 2HTFA 1XVIA 2BHLA 2PPLA 4K46A 1Q22A 5M7EA 1PHRA 1TB4A 3CZ5A 4GUDA 1T9DA 1WG8A 4L7VA 2B3TA 3D5TA 3JVIA 3RHSA 3SBDA 2ZIWB 5AH0A 2H8KA 4PBTA 3WS7A 4CM7A 4DSZA 1PW7A 1YBVA 3LX4A 3UAOA 4C3ZA 2HT1A 1JU9A 3I23A 2Q62A 4RMHA 2QOEA 2O2EA 4RVDA 4DANA 1UDAA 3ESQA 1KK1A 2CVQA 1YB5A 4NU5A 2XPCA 2ZK7A 3CTPA 1N2CA 5AJUA 5TC4A 3IJ5A 4LGMA 4RGYA 3D6TB 3LG2A 1VDMA 4I1YA 4NRDA 2BMJA 3OCWA 2JJ2A 1T3HA 1IOVA 3PFHA 4L4XA 4PAQA 1V25A 5EXSA 2OILA 2VNHA 1TZCA 1QTQA 4MVJM 4R31A 3T7CA 3N6VA 4R98A 1GTRA 4BWGA 4MQEB 1YS4A 5G2OA 4CL0A 1E96A 4CMEA 3IIKA 4FLFA 3G89A 4NMWA 3CURA 3JQFC 3NAGA 3QX7A 4D9GA 3TTUA 2MSWA 1IWPB 2BGJA 1Z2OX 4MO2A 4WOCA 1BE0A 3FMGA 5EQFA 4YRAA 2OLJA 5T67A 4C14A 2MR5A 1V4BA 1EE9A 3ETCA 3JQ8B 1VSVA 4IJWA 1NN0A 2VHJA 3EXG2 3I5XA 5K3EA 3LPDA 1NJ2A 4X44A 4TMWA 5FUYA 3YASA 1SBQA 2YWGA 3DE4X 5B3JC 1JHMA 3KWFA 1DC5A 1GQYA 1TJ5A 2IIPA 1ZGGA 3BGOS 3IT3A 4PRYA 3S70A 4KP7A 4K0KB 5CYPA 4C0AC 4Q12A 2OXIA 1Y98A 3AFGA 3R5SA 5K7SA 2H06A 1QYRA 5I7EA 2ZWMA 5KC9A 1KO1A 3QJGA 4N6NA 2IW1A 3QFHA 3WGQA 4FWBA 3ROZA 3X1XA 4B6QA 4PWZA 5LQUA 4OX9Y 1Z7GA 3A9UA 4X7BA 3SXUB 3U60B 2PJUA 1U0RA 3PDIA 2DH5A 1Z5GA 2IPOA 5FPQA 3VPSA 2VH1A 2XQKA 2I7CA 1HG1A 2RG1A 2ZVPX 4Q82A 4C0KA 3GARA 3RTDA 4ARCA 2E6UX 3HGTA 1UZNA 4FUQA 2MSCB 3RODA 4F60A 2F1OA 4MDEA 3LD9A 4E07A 2PSDA 1GAJA 4O2AA 4N8EA 3JQDA 2A5YB 3T5AA 1ULTA 2JJ2D 4F9GA 3MMXA 4I8XA 1HQKA 2WT4A 3DTYA 4EFLA 4LSMA 5GADl 1S9HA 2FWPA 4FMCB 5FI3A 4KQFA 4NX2A 1W4AA 3JZDA 3NOXA 1BW9A 4NULA 4HSEA 4KMSA 2IWRA 5HJ2A 3C7TA 2HQ1A 2AFIE 3EDOA 2G67A 4S1WA 1WZ2A 1O77A 1ZMTA 3OPVA 5F2KA 4B40A 1GZ7A 2BWJA 2DUUA 3R7WA 1PFUA 1R4ZA 2PRIA 4JHXA 5JS7A 4P2BA 1PYDA 1TRHA 3S2IA 3AVUA 1ICIA 1VL1A 3EPPA 4N3NA 1ZFNA 3HLYA 3DAFA 4RA6A 2W6JA 3OTHA 3SPXA 1GEEA 1KK0A 4CIDA 4DY4A 3KHKA 3B2EA 4HN4B 4ETIA 1NN3A 5DX1A 4GBGA 2Y1OA 1ZGCA 4IZIA 5CJPA 5CB4B 4D8YA 2WSLA 4NBUA 5KOIA 4W5QA 1N5JA 1R66A 1ATZA 1MOZA 3TZLA 2C59A 3RRNA 4Q3DA 3OPYI 3FTCA 2I8AA 4LHVA 5ALLA 5ITZB 2QJOA 2ZRPA 5TRTA 3SN6A 2A4KA 3TB4A 4I6EA 4U3JB 1IXKA 1SB9A 1I4DD 3N2YA 1EP2B 3NHLA 4BATA 4C7KA 4Z7OB 3IVMA 3CCBA 2R7AA 1SUBA 2A33A 5A2GA 4IIHA 3RVKA 1WOMA 2PDAA 1OZFA 4URYR 3JYPA 4M37A 2H4JA 1VMKA 2RHLA 2ACEA 4RV5A 2IP1A 1VSBA 1SKAA 2ZIGA 1F8FA 1QFYA 1YR1A 3Q7RA 4FHGA 2ZRMA 1ARZA 1CR1A 4JLPA 4R2XA 2WAYA 3LHKA 4OP1A 5JANA 4P32A 4UULA 1PKEA 2Q3BA 1RPJA 4OJYA 2C29D 1PQUA 5EHIA 5JVDB 3W5SA 3LF1A 1U3CA 2B6HA 1MJGA 1GJRA 1OI4A 4JJ6A 4YRPA 3U3MA 2GLXA 4BNYA 3C6QA 4IF4A 5AVVA 1OAKA 4NCHA 4X20A 1UFVA 3TPZA 2ROQA 1Z4OA 4I0WB 1NX9A 1U3FA 4RZIA 4UM8B 4YV2A 3I5YA 3A1SA 3AVOA 1VKNA 1I7PA 3NBKA 3L4JA 3UPUA 2WWVD 5AW7A 3CWQA 5K3OA 5JZBA 1JQ5A 3WAKA 1E0JA 3G5AA 3GRZA 1Z75A 1IMOA 4JEUA 4PPNA 1AF4A 3ZWDA 5DTRA 3ROKA 4E14A 4ISCA 5FNVB 4L5AA 1HYGA 2HWWA 2XMPA 5FL3A 5LM3A 1FMCA 3QBJA 1P1CA 2W6JD 1IBLB 4EPYA 3QX3A 5KHLB 4NH0A 2JLUA 2J6IA 4KMOA 2OBBA 3D3WA 4JP3A 2CYAA 1P1RA 2GTIA 2HDHA 1BCSB 1K0UA 1IJEA 2RHCA 3NASA 1D7AA 3RC9A 3A6DA 4PN3A 1J1ZA 4ZI2A 1QDEA 3FVRA 1T5SA 4DCTA 1O94A 3UMFA 1DZ3A 1PEDA 3FOZA 1SMKA 2GZMA 4B74A 2ZRJA 5A7HA 3HKBA 5I4BA 4KO1S 4W9MC 5EJGA 1IEWA 2YASA 2HD4A 1UDBA 4B87A 2NQTA 3VH4A 3EQ8A 4NFLA 3W8FA 2PD4A 4XB2A 4DPLA 2EFEB 2PHZA 4HB4A 3WHPA 1JEQB 2VDWA 3NEAA 3WMGA 4PLWA 1GFZA 2ZIUB 4DEYA 1SIBE 3IILA 4FB4A 1OFHA 2CVFA 4CWAA 1XDWA 3N8KA 2E4WA 2EZ9A 4FI3F 3UAZA 4LYYA 1ZXXA 1Y5NA 3V33A 4AU1A 1N0UA 5LVAA 2JGIA 4IEIA 2ALJA 3ZXIA 3AMVA 5KTSA 3O8OA 2GI4A 2CV1A 2P6UA 3NANA 4N0DA 4R9SA 2OXCA 4HQFA 3GLFA 1D2RA 1XNHA 2YWCA 2R0QC 1VBFA 1WHSA 1JR3A 2VDJA 1BN7A 3A3OA 1MW9X 3BZUA 4YFYA 4MKGA 3NDRA 4CUZA 2AB0A 2X9LA 1ZCJA 3VC1A 3A04A 2ZI4A 3IEIA 4EELA 5B55A 5CDHA 4JLUA 4YGXB 2JJYA 4ETWA 1XJCA 2PRYA 1OILA 4HNRA 1FP6A 2PT7A 4GXNA 3TRKA 1KERA 3ECSA 3QH4A 2HA0A 2WF9A 2OZLB 3D0OA 1NVUQ 1YR8A 3DMFA 4AW9A 4EI7A 1M5RA 2I6XA 8MHTA 1KZGB 2Y0CA 4YJ2F 4IDHA 4IUYA 4XUEA 3PB3A 2QGFA 3B2NA 1COWA 3P5SA 3TTTA 2WJ3A 5D00A 3A2KA 3GJSA 3C0KA 1TT5A 3GU3A 1MR3F 5HJ5A 2WABA 1O1YA 3ND5A 3RSZA 721PA 2OY0A 1E66A 10MHA 3P8ZA 3DEIA 1JG7A 1O94D 1OCEA 2J7PD 2JH3A 4I81A 4AJ4A 3KT3A 1JH9A 1WTCA 2GZ3A 3OZIA 3RSFA 3WAGA 5LZ5A 4WQMA 4J0FA 1DJQA 1JLKA 3D2AA 5DXAA 5HCUA 2JI4A 2JIZD 2F9FA 3ESDA 3WKAA 1JB1A 4A0FA 4DW8A 3I72A 5FBKA 5CNIA 3FCXA 2R6R1 3RK1A 3O3NB 3H5TA 4NQRA 1NUHA 5IKPA 1FLAA 1HFWA 5DZSA 4IX1A 1G2QA 3C1OA 2VKTA 5ER6A 4DSUA 5IN4A 4KB5A 4G85A 4CCWA 4J90A 2EFGA 2AI2A 1NFRA 1Q2UA 2NO6A 2R1TB 2REBA 4P35A 4QPNA 1LSUA 2BHRA 1FRQA 2AW5A 2G1KA 4IZHA 4PQFA 5SY4A 4YI3A 3WWYA 4DA8A 1E1KA 3LL4A 3MWKA 5ECWA 2BFEB 4EI8A 2IH5A 1M8JA 4ZHQF 2EZ4A 5DBEX 4KK3A 2OPHA 5JW6A 1GV1A 3PS9A 2W6PA 2XNDD 3INTA 3I32A 4J49A 4L15A 4UCFA 4G81A 1N4AA 3GLGA 1TTTA 1QO7A 2FG6C 4CKWB 1VL2A 3C3AA 5L45A 3OFSA 5A03A 4ETMA 1DRKA 5C8XA 2QQ0A 3IHTA 4XIYA 2G6TA 5JFGA 1IAQA 1UEIA 5K5EA 2WILA 4LYEA 2WV9A 4AYXA 3H3FA 1G38A 2O2ZA 4QVGA 2GNPA 4IO1A 4LMBA 3NOQA 1Z17A 3D6JA 3OOHA 4V39A 2KPOA 1NJ5A 3L0IB 3E18A 1ML4A 3QBVA 4JEIA 3QENA 3DW3X 3IOMA 3BICA 4F5ZA 3LLVA 4R81A 3VUFA 4YQEA 1FNCA 1U2ZA 1GYPA 4DRZA 1TJNA 2WKWA 1LI5A 1HL3A 4XVHA 1POXA 2LIVA 3LUAA 1GUAA 1UKBA 1FDVA 1S3SA 1UJBA 3IHWA 2W22A 4M1KA 4MW2A 5BSTA 5I7WA 1YNOA 1Z2AA 2AJCA 4P86A 4XUCA 1DIHA 1PT6A 2R6HA 4H7IA 1U7ZA 4LKRA 3GA5A 3WA7A 5HE9A 4A5SA 2SICE 3JSAA 5ELMA 4DBLE 2AEFA 2I33A 1PJLA 3WADA 4EJMA 1QFJA 1BNCA 1T35A 4IMJB 1T34A 8ABPA 3B89A 2ZSEA 3CXUA 1JHXA 4M1YA 2RAFA 4U00A 3BZBA 4LNUA 4I2NA 4TXMA 3VNRA 5LC1A 4DLPA 1K66A 1V5GA 3BXOA 3PWZA 3SKVA 5K0GA 2FCAA 1I0IA 4RY9A 1S1MA 4CEJA 3A28A 2C7GA 5F3RA 3TMKA 1ZSNA 3VA7A 1IZYA 3A2LA 4BQQA 1QH1B 3U7IA 1LEHA 1X70A 2CBZA 3I04M 4YXWA 5B6JA 1Z4PX 3WP1B 3DOFA 4MTCA 4URFA 3LZDA 4HWOA 1X7YB 1AO3A 3HFSA 2QP3A 4OQQA 5LQJA 2MSKA 5IM4F 3W3AH 1CJCA 4YK7A 5AD1A 1LKZA 4AJ2A 1P4HA 4RHUA 2FWRA 2JH9A 2Z8YA 1C30B 3OCXA 1U80A 2ZU6A 1ZNXA 5EIBC 1N33B 3A4MA 3KAJA 3AHHA 1JXMA 4Q4DA 1AIPA 4QM6A 3R7LA 3KKLA 4FNAA 5DGIA 1G6HA 5GOTA 4RJKA 1FRZA 2XMGA 4G1VA 2YN0A 3PQ4A 3EIQA 3HM2A 4YAJA 1U0HC 3CPHA 3L40A 2NUAB 3KJQA 4PSVA 2G9RA 3BMOB 1EQ2A 2FNAA 2GNAA 3LS2A 4JFAA 4JJGA 3A27A 4GS5A 3KTAB 4IIUA 4NL4H 2BGGA 2XZDA 4L8YA 4O4HF 4UARA 1YRWA 2FZEA 3ICCA 4WFIA 5MF6A 2C78A 1EKXA 4YH1A 1GTZA 1PR4A 4B3HA 4G0VA 4R1TA 3OAAD 2EXXA 4JLNA 1I1OA 3CX4A 3GD5A 5G53C 5EZYA 3X2EA 3A1CA 4EFDA 2PY6A 3OU7A 5E38A 3T3EA 4UXHA 1Q83A 1LC3A 1YIDA 2ZT7A 3UJ9A 4D8UA 4EHAA 4CG0A 2EEZA 2Q21A 3H2SA 3IRUA 5IULC 4EFMA 3KQUA 1I0ZA 1Q17A 1DCKA 3FGOA 1U63A 3H2IA 1KZ7B 2I4MA 3H42B 1JSCA 2E4YA 2GAOA 1OAOC 3IVAA 4FYMA 2KJQA 1SBYA 3L6DA 3HJAA 3HACA 5FWDA 4P54A 3CX6A 3THOA 2R47A 5DM60 3NBQA 1PR1A 5H3CA 3P96A 3G59A 1OZAA 2GKOA 3USES 1OT5A 2YXBA 1SXIA 3VU3A 2CNWD 3TQHA 1NUTA 3E5MA 1Z3CA 3BORA 3HB9A 2HV8A 2O1SA 1CR6A 5EIHA 3B3QA 5F98A 3FR8A 3GC6A 3QV1A 4HAWA 1GNVA 4JVMA 3J7TA 4MV4A 4HTFB 3GJTA 4ZVVA 1QE5A 4G23A 3R0IA 1SVLA 3PFCA 1XYVA 2QRZA 4Q7MB 1JHAA 3ELYA 3FZGA 1YZQA 3K7EA 2QRKA 5MGNA 1U04A 2D54A 1N1DA 1LPMA 2CF6A 4HF7A 4N4AA 3RH0A 3SZOA 5KOHA 3KKOA 3AHCA 4C7OB 3T9EA 3L8ZA 5D5HA 5I8PA 5D87A 5ALRA 2VZLA 1J6UA 1EUDA 1QKIA 3DT6A 3UJ8A 5A5VA 5C5DA 2R5FA 3NXSA 5HZGA 1CUJA 3T0FA 3EH1A 3G6KA 3HCOA 5E3JA 1QIDA 5ALSA 2O1XA 4MNTA 2A1UB 1E3JA 1HF3A 3L4EA 2ZSFA 4MKXA 3NVKI 2OXEA 3WNQA 1OJLA 4BFXA 4ZZ3A 3ZVKA 1Z0FA 2J9YB 4JQYA 4RC9A 4XE5A 3AF6A 3A6PC 1KRXA 2ZJBA 2RGBA 1U28A 1UOEA 1MP0A 2XDWA 1YWGO 2ANCA 1PWXA 2O23A 4JC4A 3VR5D 3D5QA 3ESBA 4IOJA 1UPXA 5ALYA 1IATA 1KZYC 1OZHA 1GZUA 2O6LA 3A1DA 5F3DA 3RS2A 3JQBA 1T2NA 3A1VA 3CZQA 4QE3A 4W6ZA 2QXUA 1E69A 2NPFA 4B45A 4UTVA 3W2TA 1MQAA 3UMGA 5E8RA 4ZMBA 2HIHA 1N2IA 2BP7A 1G8FA 4NU6A 3G2NA 2IXDA 1II0A 1Z33A 3GFPA 2ZSJA 5FKJA 3C6KA 3UN1A 4CQMA 1FCJA 3W2IA 4HNTA 4Y6LA 1RKQA 5F7XA 5TGTA 3M2TA 3ZD6A 1I1NA 4M0UA 2GBLA 4M49A 3LC2O 4AI6A 5DO9A 1TZBA 3EGIA 3I53A 5E4JA 4A8PA 2GR9A 2R25B 4BNUA 1GGNA 1IVNA 3T9FA 4EY4A 5KJ6A 2I1WA 1JHZA 2QA5A 2ZRGA 4W7HA 3QLUC 1DAOA 1E3DA 5J5VA 3IL2A 2VPWA 2ZZMA 4FOSA 1HFEL 1QHYA 3ZPXA 4WT7A 4E5PA 1PJCA 4ZU3A 4NU8X 2BMAA 3T9DA 3BT7A 1NUAA 5LXTB 1D0IA 4EVRA 3KQOA 2PS3A 4LPKA 4B4OA 4UPVA 4ZYXA 2ZETA 1X7DA 3OFNA 1P6QA 3TZ6A 2Q41A 2AUNA 4IIXA 3QEBZ 2COEA 2V97A 2XMDA 3F6YA 5FBHA 1VXOA 3NV9A 4QBGB 3IQXA 4I66A 3GBVA 1UL1X 3JATB 4L8GA 4M21A 1AKMA 1GZDA 2DX7A 1BD3A 2CWWA 2YDXA 3AR3A 3OZCA 1LFDB 2ZWIA 5GQSA 1QHNA 1BOOA 1GUYA 3Q87B 4KWEA 1RYMA 4B33A 1VKJA 2C20A 2C5GA 9LDTA 5LZ8A 3QLEA 1OPRA 1MENA 4GG1A 4BL5A 3KKMA 3MFQA 4HGRA 3DGFC 5A5DA 3OBIA 2AN1A 4EF5A 1EVIA 4Q9LA 1G16A 3RV4A 1PWEA 4FCVA 4MB0A 3UANA 4B48A 4X24A 3ZQJA 3GYBA 1OWPA 1WW3A 4PVCA 5LMZA 1GL9B 2DHDA 1INLA 3R7DA 3MMNA 1RKVA 4R8KA 1EK6A 1E94E 2UZ1A 2X9GA 3A2MA 3AZPA 3IYLW 4Y6RA 4ARZA 4UTOA 1M0TA 3H3XA 5NULA 3M6FA 5K0SA 1XQXA 3SU8A 2GETA 2ZYWX 1QG0A 4RIIA 2VSQA 1GAXA 2O05A 4LOAA 4KHPB 2XXBA 2R9VA 3MD9A 2YMPA 3R0QA 2YQ4A 1NMEA 3H11A 4L75A 3ZHYA 4DA6A 4GFDA 5JLAA 3VHQA 4Q3LA 1VPEA 3CLUC 2DERA 3NDBB 3L6CA 5DM1A 1Z6XA 1DP4A 4P93A 2QSJA 3EGWA 1SOWA 1W1UA 3RV3A 3OPMA 1X38A 1ZN8A 2B3DA 1W85B 2I3AA 4N3BA 4UVEA 3WO1A 3R9KA 1B1CA 2OECA 3ZI7A 5BMVA 4D3FA 1O87A 4O4LB 3COWA 2ODQA 2Y1WA 4M8KA 4HPXB 5CT6A 3H7AA 2B8NA 4K6GA 4YPFA 2WUVA 1N8NA 2BEWB 2A59A 2F3TA 4CM9A 3L7YA 4XJSA 3JWJA 5HE8A 2VLIA 4OJNA 4URZR 4X6YA 4J8PA 1PK9A 3MWGA 2JGMA 2ZYUX 5BW4A 5ICGA 4MGYR 3ZVRA 1SUPA 1EYZA 5CCDA 4AMUA 3BSSA 4NK5A 2DPLA 2HXSA 2X1HA 3AEQA 2JEZA 1N3IA 2I34A 1EXWA 2K2QB 4JB0A 3AP1A 2BE7A 1DWQA 3CLRC 2RJ3A 1JAYA 1M2VA 2HWYA 2J67A 2JFNA 2Q07A 3ANTA 3ODGA 5H7XA 1RM5A 3N2KA 2DBQA 1PK8A 1YE3A 4HFNA 4ZOCA 1KZ4A 1NC1A 3D3KA 2XGOA 2BGMA 1E8DA 3VDRA 2FW7A 2VDOB 5A06A 1M1YE 1U7OA 4NYJR 1JHPA 1T3GA 1WSWA 4DQUA 1EXMA 1FVFA 3BQMB 3NYQA 2IZ1A 5HIAA 2XJ9A 1OIWA 4LBVA 4MITA 4RTSA 3NIGB 1A1SA 2H65A 3AL3A 3DZ8A 1ZLYA 3WQQA 3SDZA 4ZYWA 4PO9A 5AW9A 2WAOA 1HDRA 2NU6A 3C3MA 1RBQA 3MB5A 3WMEA 2YWBA 4GYKA 1C50A 2JEOA 3HCEA 3HSYA 4BNHA 4MS3B 3UGJA 4I08A 4F4JA 1QYWA 3FFXA 4J3FA 1SWWA 2GF2A 4P7BA 1NRXA 1G18A 2AG6A 4PN7A 3CRMA 3Q5GA 3G7NA 4KBYA 1ZHHA 5FPKA 1JWBB 1CJVC 2H08A 2WFLA 3TPCA 3VI3B 4GXTA 2W4QA 2JGEA 4ARAA 1OXXK 1LRJA 2IHYA 4YREA 3CISA 4K9SA 1E6KA 1IHXA 1ZMRA 3UMJA 2QI9F 3AKDA 4YRKA 1MJHA 4UUBA 2BR4A 4CEHA 5CVUA 4ZAZA 1DLJA 3TVYA 5ADUS 3J81k 1KMCA 1FYFA 3IPCA 1XMVA 3HUUA 4G2NA 2ZW9A 1NVDA 3N58A 5DM2A 2C8JA 4DHEA 1Y9ZA 4UDYX 1N8SA 3SKXA 2W6ID 1Y4AE 2C82A 2PVSA 2P7IA 3W5AA 1GFIA 2QRVA 3SZGA 3VR3A 5CG1A 4UAVA 1HX7A 2I2XB 2YRFA 5HUQA 5C53B 1XXHA 2CFIA 4MLPA 4M0MA 2PNFA 4DLLA 5FBWB 1OHHA 3WGIA 1EWQA 3WGJA 2JIQA 4A9AA 2X77A 3CF6R 4RDHA 2IH2A 3BSYA 2A9RA 3FPSA 4LRUA 1GLGA 1ZDMA 4JA2A 4Q0MA 3FAZA 3FDFA 3TE7A 2ACVA 5IX8A 3DE7X 3INGA 2JGFA 2OCGA 3BE4A 1ZNZA 3H1AA 4UEOA 3KPVA 4MYDA 5E95A 3H99A 1E7QA 1GA4A 4M89A 1SU6A 3K2BA 2EFHB 3UHOA 4FW9A 4M53A 2SBTA 5BR1A 5C3MA 3ECAA 2FXVA 5FOVA 5CTAA 1IZ7A 1LBIA 4DE5A 2OCDA 3TMYA 5BVHB 1ZJ5A 2YR0A 2VYFA 4QRHA 4Y30A 4JZYA 1M6NA 4ZQHA 2WJIA 3AI7A 5BNIA 3MRSA 4RK6A 5AKIA 1X8LA 4OJTA 1JHDA 1JFFA 2X22A 1DEXA 3NEYA 1MEOA 3OQPA 4FYIA 4J6EA 4WZAB 5EN4A 4AN1A 1F6WA 1KBZA 4QXMA 1V7CA 1IY1A 2F3UA 2WMOB 4JJ8A 3FOEC 1PZMA 2PZ8A 4YP5A 1RAAA 2FK8A 4O2BB 4EENA 2WI8A 3STYA 3R5HA 3D4NA 3WJ1A 4ZGGA 3I05A 5E3HA 3WXMA 5GTDA 2VUHB 2WYUA 4QHSA 4Y1EA 1X19A 3OKFA 1DJNA 2OCBA 2E5WA 3S1SA 2ZPAA 4JLMA 3FUCA 4UVIA 4Y7DA 1IC6A 1D1SA 2PRZA 3IAEA 3MT9A 4JOCA 4DUPA 2JLBA 4DY6A 5JIBA 5K99A 1UBKS 2VH2A 4JUIA 5AM2A 1VA4A 3JASB 1TO2E 4AMVA 1IDOA 1N7GA 5IAOA 1O54A 1Q1AA 1S2IA 2EX0A 1E2PA 1D1PA 1RDFA 3K0AA 1DHTA 1TGYA 2Q6TA 5CFOA 1FSPA 3OJEA 5BWOA 4BAUA 3BRWD 2QMZA 1IN7A 2Q4EA 3SC3A 3AY3A 3COPA 3WGHA 1Q6ZA 1KI1A 1J2JA 1OHHD 2W2PA 4N6OA 2XUKA 2Y1GA 4M6WA 2WIJA 2LWIA 4ZKDA 3BEOA 1Q7EA 3DZHA 4OD0A 3V32A 2AZ4A 2P7HA 2NUTB 5LD2B 3THWA 3OBBA 4NBNA 2V74B 2CSXA 2FZCA 4Z49A 5IANA 2GERA 1YCFA 4MUEA 4QOEA 1DMRA 1VG9B 1ZH2A 3A4TA 2OA0A 4C7JA 4WRRA 1FLVA 3EXHC 3OX3A 1I01A 3FMVA 5A3VA 3MBIA 2HUNA 3EULA 2GA8A 4R1QA 1AK1A 3TLZA 3MGGA 4BIMA 1K1EA 4FNGA 3HBNA 2HADA 1GM5A 5TNXA 3RJ5A 1K89A 1NT4A 2YW2A 2R5WA 4NF2A 4FJ0A 1GG8A 2XRFA 5INTA 1UC4B 2IOYA 4BO5A 1VHLA 4LK3A 3JQ9A 5K09A 4DG5A 1J5EB 1W48A 5DJ5A 1GR0A 3EODA 5KX5A 4HMPA 5L53A 3GLIB 2OYRA 3V2UA 1AQNA 4K40A 4ZPJA 1USUA 4M9RA 2CZQA 4DCMA 1FFBA 2BJHA 1RR6A 4ZT4A 3V46A 4AG5A 3DAOA 1E9BA 2GZHA 4H77A 3BIXA 5E6SA 3L0PA 2OQVA 2F1IA 1XD2A 2NYRA 1OXBB 3Q11A 3QF4A 2Q2WA 4KGDA 1EX6A 3RVRA 1SHKA 4BLQA 3CWCA 1VLZA 1OLUB 3L05A 4L9SA 3PJFA 5F1KA 1FNSA 1K4KA 1UM8A 4X8HA 3WRXA 2NW6A 3HYSA 3LBHA 2RGXA 4MKHA 1TM2A 1AX9A 1U6KA 1RKXA 3OG9A 2AZTA 3BS4A 4IIGA 3OIUA 1QGDA 2R65A 3WBKA 1G7SA 5IK2D 2JBWA 4C4RA 5LB2A 3IUPA 5ALOA 1N2EA 3T9BA 1AN9A 3PQFA 4FLEA 3NBXX 5HTKA 3PHLA 2WG0A 2OV6A 2JF0A 1IJKA 2MYUA 3PD1A 4DC1A 2ZYSA 3ZOKA 3O8QB 3SEQA 1HORA 4ZJUA 5JU6A 3O95A 1KU6A 2FPOA 3NNDA 3FVWA 3R40A 4DV2B 2H31A 2HRDA 2XA9A 2CLFB 3L0YA 1F8XA 1J2UA 1CRLA 4D5GA 2DHRA 4UFNA 3OMWA 2CXOA 3O9ZA 2UYGA 4HB2A 5IBQA 5EQTA 3FBGA 4E5DA 3IUQA 2CL5A 4ND5A 1NF3A 2PL3A 4IQGA 4LOKA 4EJFA 9ABPA 1KOGA 2H16A 2OM2A 1UKAA 3K1ZA 2Q4OA 4N5HX 4TWBA 1N7IA 3IC5A 3PXCX 5D5PA 3RRYA 1JVNA 4PRLA 4DMHA 1SCDA 1YDHA 1O8BA 4U7WA 4TWZA 3JQFA 3ST7A 2C9ZA 3AERA 4JROA 3FTFA 1AXEA 3JXEA 2Q0SA 1XVLA 2EJTA 4FDMA 1BWQA 2QR3A 4K9KA 5EIFA 3U09A 5K6TA 3RSOA 2NU8B 1TPYA 1W75A 4RHFA 3PGKA 3RSQA 3SFVA 3E5RA 2FGKA 2YWHA 1J09A 2OO5C 3AFMA 4JLVA 3LXRA 3R5TA 4E6EA 2F59A 1T2EA 4BVBA 1G8GA 3T4XA 2XLBA 4NONA 4D80A 2CLSA 3MRXA 4GX0A 2Q6OA 4ARBA 1Z63A 2IOFK 2NYVA 1Q50A 4KXNA 1ZVVA 1B8PA 3IEKA 3PNPA 3EZNA 1F3OA 1PGNA 1UC5B 2UZ0A 2ORWA 3WIUA 2P3LA 2IUYA 3D8TA 3LY5A 4FEGA 4B3XA 1XGKA 4D4GA 4DM7A 2K4MA 1E9DA 2CLDX 1JR2A 2VYVA 2X15A 1L7PA 3IR7A 3MYRA 3BDVA 4EHNA 2FPGB 2GN0A 4BAZA 2XDYA 2B78A 2H1VA 1D2NA 3OCJA 3TR6A 1G4HA 4Q3BA 4AJEA 2AUTA 3GJ3A 4S05A 1P0IA 3JRNA 4QDJA 1UMBB 2VR1A 1J90A 2B34A 2C1ZA 3QFFA 5F21A 1Z4MA 1YKFA 4AQYB 4MWSA 2O8BB 1C9NA 2WWWA 1GT91 1I2ZA 3I9KA 4H16A 4ESOA 4YRMA 2Z95A 3TLMA 3VSCA 1PR9A 2HMWA 1P8JA 3BTOA 4L3VA 1A4IA 4MIYA 3C85A 4WPGA 3RC1A 3VR5H 3OU2A 4NS4A 4OO3A 2J3KA 3R74A 2HZBA 1BDJA 3AEUA 3ZCSA 5B6PA 4I9HA 1I10A 1YTLA 4YRTA 5JSUA 4YT5A 3MCWA 3KKNA 1OLSA 4RVUA 4ZI7F 3T52A 5DM70 4S0XA 3VV3A 2ZCUA 1UWLA 1YRHA 4LZWA 3TW4A 5A5EA 1X42A 4CM8B 1U2SA 3JQAB 2FUG1 1GAQA 5CYOA 3EOZA 3VRHA 3HKDB 3WQRA 4TYWA 2NO5A 4FJ2A 3UG6A 4CL3A 1AURA 1BROA 5FUWA 1ZH4A 4TSFA 5BYJA 2CXUA 1ZLXA 2C94A 5LSAA 1DRWA 3G02A 3RIGA 2E7ZA 4JKOA 3PU6A 4PFJA 3TTVA 1C4KA 1XTQA 1DUIA 3ZU3A 4OQLA 4YALA 5CA1A 5C8YF 5LD2C 1IXRC 4KL8S 3BA1A 1SY7A 3STTA 4TL8A 1RYEA 3WZMA 1SHTX 3ZY5A 3OPQA 2WSSD 4UNRA 1K5PA 1CR4A 1RI4A 5JV5A 1AN0A 2A9OA 2C5AA 2QG6A 4E13A 3LBYA 4UW9A 3KHSA 3OICA 4X8OA 1NE2A 4Q7EA 4X92A 5A1TA 2XI4A 2LNDA 1E6MA 3E6AA 1J2YA 1TKCA 1Y3DE 1YR6A 4FWTA 3FCEA 2F67A 1U3GA 3T34A 1IE3A 1KVQA 4RSGA 5A04A 1FTGA 1V1RA 3L7NA 2QN1A 5EMKA 1THTA 4Y9TA 4X91A 2PUWA 1J33A 4R8MA 4AY4A 3VDNB 2XHEA 4EYEA 4O8ZA 3FJYA 5JBIA 3M6LA 5AW2A 3O6VA 1C8VB 2AEJA 1FXWA 2NIPA 4TV8F 1MO5A 5JSKA 4EUHA 3KQTA 3LWDA 2J5RA 4AY5A 3IVXA 3WRYC 4AUMA 4G0WA 5FA6A 2PA0A 3QA9A 1N8TA 1DTEA 1YVDA 4X95A 1A04A 3VXKA 4BMOB 4EF4A 5I4IA 1WVIA 1N2CE 4MGZR 4MHOA 2W00A 4RCYA 4X8MA 5IDQA 4JR0A 2X5KO 3ITEA 3ICPA 4M22A 3ZNPA 3I9V1 1Y3IA 1XD8A 3KYIB 2VUSA 1MDBA 3IP9A 3N3AC 1X3SA 1TEXA 5DKFA 4CT4B 4MHTA 3CGGA 1KF0A 1LSSA 1ZGAA 2QTWB 1AGYA 3H7IA 3NTVA 1MABB 1QH9A 1QOPB 5DEIA 4BZWA 1I2CA 1JAXA 3OQNA 1RHKA 4FW8A 3FSGD 3BFPA 1U0JA 3FKJA 4DIMA 1QR2A 3AC0A 4LZZA 2FPXA 4ZQGA 1V9SA 4LDNA 1NUPA 5TPZA 5I7SA 1N6OA 4X84A 4COOA 2GJ8A 2QXTA 4MGEA 1LF0A 2HRRA 3G2IA 4OQPA 1E9FA 3N74A 3UOWA 1JDNA 4CDGA 3BXHA 3WYCA 3ZTYA 4CKXA 5LIPA 1KRWA 4JITA 3ND8A 3G7UA 2PPVA 3UV7A 3N2LA 1TYAE 3CNOA 4RD3A 4PG5A 3B8HA 3UHAA 4PY2A 4DA9A 4CFSA 4R3NA 4MQEA 4B73A 4XYGA 4YX9A 1T9ZA 2EWVA 3B13B 4YRIA 5CB4F 4FBMA 1Y6JA 3SQNA 2P35A 4RZUA 5BRNA 1I7SB 4EVIA 1PFWA 3HA2A 3VR6D 5KJ1A 1JHQA 3MW8A 1L6RA 5AK3A 3SIXA 3BF7A 3HQ4O 1QQ6A 1BDBA 1C8KA 1ZU5A 3ESAA 2XWSA 3MZ0A 5ELXA 1AF7A 4E08A 1GPAA 2WJGA 3VPXA 5F7ZA 4DCCA 5B2EA 4N47A 5EE3A 4B6GA 4BX8A 4C1NA 1U9YA 1F1JA 1X7GA 2OENG 2QJTA 3QI7A 3NZEA 4LJ6A 3QWIA 3DAHA 1GWNA 3TM5A 4ZI3A 3OFKA 4OQZA 1ZKDA 3OU6A 2FPPB 1T5BA 4GLOA 1AGPA 1NC3A 4EZIA 5CXSA 2W2KB 1RW4A 5C4MA 5B64A 2NV2B 4D0SA 2BFCB 2VXCA 2AEMA 3LBIA 1IONA 4H6VA 3C5CA 3CUSA 1T36B 4UDNA 1YA6A 1XHLA 3ITDA 5B5SA 1JN0A 4US1R 5FFNA 3VAYA 1TFRA 3ABSB 2V7BA 2V9PA 4MW0A 1OMOA 2QY9A 3VDXA 4G86A 1OLXA 1PUJA 1QF9A 4D4HA 2Q2VA 3SR0A 1PGQA 3M1LA 4N0MA 4B3RB 4QPCA 5A9SB 5BSVA 1EIWA 1N2SA 1CUGA 1WB5A 1IB6A 5F12A 1AUQA 5FUMA 5DISB 2OD2A 1DJOA 3K09A 5FRDA 2LGJA 4ZU1X 4EI9A 2D06A 3IQHX 4DJTA 4RZ2A 3LYAA 3A3KA 1BRMA 3L4SO 4KJZA 4M4SA 3TN7A 4F3TA 4MYRA 1N6KA 2IRWA 2CL0X 3PE4A 3KYCA 3UPDA 5CXUA 4ZREA 3M4NA 5FDFA 2YFHA 1EZZA 3RSGA 2ZJ3A 2D5AA 1YL6A 3A3PA 4UM9B 5A1JA 4TTQA 4Z4HA 4CXMA 4FFNA 4Q1DA 3UAYA 1L5WA 1ZI9A 4KIWA 1E3WB 1V5IA 2PZFA 1JKXA 5JXHA 5L4LA 4R1MA 4XI9A 3T35A 1KXZA 2P2ZA 1NDQA 4S3MA 2O20A 2XQJA