2VDUE

Structure of trm8-trm82, the yeast trna m7g methylation complex
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
221
structure length
201
Chain Sequence
QLEYPVSPQDMDWSKLYPYYKNAENGQMTKKVTIADIGCGFGGLMIDLSPAFPEDLILGMEIRVQVTNYVEDRIIALRNNTASKHGFQNINVLRGNAMKFLPNFFEKGQLSKMFFCFPDPRIITNTLLSEYAYVLKEGGVVYTITDVKDLHEWMVKHLEEHPLFERLSKEWEENDECVKIMRNATDKFVACFTRLPTPAIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords TRNA (GUANINE-N(7)-)-METHYLTRANSFERASE-ASSOCIATED WD REPEAT
publication title Structure of the Yeast tRNA M7G Methylation Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 61
structure length 201
sequence length 221
chains with identical sequence F
ec nomenclature ec 2.1.1.33: tRNA (guanine(46)-N(7))-methyltransferase.
pdb deposition date 2007-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02390 Methyltransf_4 Putative methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2vduE01
2JH9A 1NW6A 3G8BA 1O9GA 4FZVA 3P2EA 3MQ2A 1FP1D 2FYTA 4P7FA 1G60A 3HCAA 3FPEA 3A4TA 3FTDA 3H2BA 3DTNA 4KDRA 4RVHA 5H02A 1ORHA 2YXEA 3HA3A 4AUKA 4AZTA 5K03A 2UYHA 3M6WA 3KQQA 3KQMA 4CWAA 3SXJA 3Q87B 3KPUA 3ELWA 2GA9A 5CVVA 3QOXA 1HMYA 4C06A 2BR5A 4KVZA 4PIPA 3SR4A 3UJBA 3F4KA 2YQZA 2Y1XA 1UFKA 4PYQA 5IH3A 3TM4A 2Z6QA 3B3GA 7MHTA 4QVGA 4ER6A 4EQZA 3EMDA 2PWYA 3ID6C 4K6MA 5FUBA 4UOEA 1NT2A 4AZWA 10MHA 3LPMA 5DLYA 1KP9A 1X1CA 3ELYA 3HM2A 4CKEA 3PTAA 4QDKA 1RI5A 3P71T 4NECA 4E2YA 1XTPA 2UYOA 2YTZA 4WVLA 2ZFUA 3IYLW 1TPYA 2OPBA 3G2QA 4YUYA 1TW3A 2DULA 4ATNA 3LGAA 4E2WA 1L1EA 1DCTA 2XVMA 8MHTA 2YR0A 3NDJA 1KPGA 3JWIA 2WA1A 2HMYB 2G72A 3KR1A 4C04A 5MHTA 1FPQA 1F3LA 1PRYA 3GIWA 3SVZA 4YV2A 4CXMA 4BLVA 4GC9A 2ZBRA 3HCEA 3DMGA 2ZIGA 3ANXA 3THSA 3GXOA 4E33A 4YUXA 5K09A 5LR6A 3BKWA 3S68A 2OKCA 1Z3CA 1IXKA 3SX0A 3HVIA 5DSTA 2CWWA 3EGEA 3KR9A 5DX0A 4DQ0A 1P39A 3HVHA 3G8AA 1V39A 3L8DA 4PONA 3NMUF 2JG3A 3K0BA 3GDHA 3E7PA 3EGIA 3EVDA 5K0JA 4HC4A 1RI4A 4LWOA 3GRRA 3OE5A 3GRVA 5DWQA 5EKXA 2VP3A 2GH1A 3MERA 3P9KA 5EMLA 4F84A 3B5IA 1G6Q1 5P8WA 1NV9A 5K0FA 4ZTBA 4RTMA 3OU6A 2R6ZA 2P7IA 2QYOA 3R0QA 3FZGA 1TW2A 3NW9A 5GWXA 2B3TA 2EJTA 4WXHA 3TOSA 4E2XA 3EEOA 1JG2A 4V0QA 4C4AA 1WZNA 2P3LA 3G89A 5GP1A 1G55A 3EEYA 1IY9A 1XVAA 1SQGA 3ELUA 5E8RA 5K0EA 2EX4A 2YX1A 3HEMA 3MAGA 2AZTA 1VP9A 1R74A 1XCJA 1G8AA 3HCCA 3GWZA 3VC2A 2PX8A 3T7TA 4P7KA 1JSXA 1SUIA 2P40A 2AVDA 3OZSA 1PJZA 3NTVA 1ZG3A 2OB1A 3C3PA 3I5UA 3QV2A 4PWYA 3I64A 3M6XA 4LWPA 5CIYA 4YV1A 3G2MA 1N2XA 2B9EA 1O9HA 2ADMA 4QTTB 1DUSA 4RX1A 2PT9A 3OZTA 4DA4A 3BT7A 4U7PB 3BWCA 3P97A 4PGHA 2PVCA 2ZIFA 2AOTB 4GOMD 4YUWA 5G02A 2PBFA 5E9QA 3I58A 5EHGA 5E1BA 4BLUA 4RTOA 3RW9A 5BW5A 1XCLA 2XYVA 1WXXA 1X1BA 2FK7A 2ZBPA 5CVEA 3TKAA 5K0NA 3OPNA 4QVKA 5FHQA 2HWKA 3PX2A 4IV0A 4MQ4A 4X61A 2VDUE 5IKMA 4DKJA 3BWBA 2ZSUA 3HCDA 3TR6A 5ICCA 3KPJA 2ZLBA 5EIWA 1R8YA 2AVNA 3HVKA 3LECA 2JHCA 5LQUA 3O7WA 1P91A 2EJUA 4KW7A 3LHDA 4PYLA 4QPPA 4EVIA 4ER0A 4PYOA 4HGZA 1Q0SA 3SMQA 4KIGA 2AOXA 3EPPA 3X0DA 4C07A 3P9IA 4GOND 4ISCA 3BZBA 3PS9A 5F2OA 5ICFA 2IBTA 4GUAA 2G1PA 3HCFA 4PNEA 3CGGA 3DLCA 1VQ1A 1L3CA 3FPHA 3C0KA 3E23A 3LDGA 1NW8A 3R24A 2ZCJA 2PXXA 1JTFA 4M36A 4P7JA 5E2AA 2ESRA 5DM4A 1I1NA 2GS9A 2Y1WA 3BWMA 1AQIA 3CC8A 3MTEA 2XVAA 5FTWA 5HIIA 1WY7A 4DZRA 3GNLA 3GCZA 3DUWA 5EEGA 5EMJA 2OB2A 4P7GA 3MTIA 2UZ4A 3R9XB 4DM3A 2QY6A 1T43A 5F2KA 1B42A 2OBFA 4R6WA 3OFKA 5LQJA 5E1OA 5K8VA 2CMHA 3FUUA 4OA8A 3FUVA 2BR4A 3FTCA 3LCCA 4GBED 3SM3A 2ZIEA 1QZZA 4E30A 3VYWA 3KQOA 2PWPA 3G88A 5EHIA 1Y8CA 3KPWA 1WXWA 3KKZA 2NXCA 3DH0A 1FJXA 3ORHA 4EMSA 2P1DA 2P8JA 5DX1A 2UYCA 3PX3A 5DSXA 2PXAA 1R6AA 2HV9A 5E9JA 2B2CA 3B3FA 2P35A 1JSZA 2F8LA 2IDJA 2ONZA 4CKCA 2QRVA 1YB2A 2FRXA 2PY6A 4CKBA 2HR1A 5FADA 4ER5A 4MWZA 3LKZA 3WSTA 2K4MA 4FS8A 4L7VA 4C03A 3NVKI 4QQKA 2P3QA 1YZHA 3PVCA 4YUVA 3KR0A 3LL7A 2NYUA 1L3IA 3TQSA 4YV0A 1QYRA 1YUBA 1VLMA 3EGVA 1MHTA 1AV6A 5K0CA 5EEHA 5CVJA 2ZBQA 3GRYA 3UA3A 4M38A 3KQTA 5CD1A 2PJDA 2AN5A 3MCTA 2ZWAA 5DRTA 5CCBA 3DMFA 1KIAA 2PX4A 1X1DA 5EMMA 2JHAA 5T64A 2ZZMA 3DXZA 5HIJA 3SSMA 1UWVA 4BY9E 3UJDA 5GM2A 2IH5A 2JH8A 5JUWA 1VPTA 3CJTA 2KW5A 2ZTHA 4H0NA 3CJQA 3UJ8A 1QAOA 5FCDA 3FYCA 2DPMA 2ONYA 4YMGA 3A7DA 1P1CA 3PB3A 3AJDA 1JQEA 5GIOE 2BM9A 2IFTA 4RWZA 5CUQA 3EVFA 3SGLA 3TRKA 5KVAA 4RTRA 5LQCA 3NWBA 1ZKDA 1RJFA 4GQBA 2ZW9A 5DPMA 5HILA 1YFJA 3HCBA 1HNNA 2YXDA 4M7RA 2PV0A 4QTUB 4U7TB 5EZQA 1YF3A 3GGDA 1IM8A 1XDUA 3BGIA 1KPHA 1XJ5A 3EVBA 5ERGB 2PT6A 3LCVB 5ICEA 4RTNA 2C7OA 1EJ0A 4E70A 3DR5A 4GOLD 1JQDA 3DP7A 4PYNA 2IP2A 2FCAA 3JWJA 3PFHA 4A6DA 4CTJA 4R6XA 5HIKA 2H1RA 1EG2A 1I9GA 1I4WA 3GO4A 3HVJA 4MTLA 3U81A 1KR5A 1KPIA 5GM1A 1DL5A 2IBSA 3LX6A 3NWEA 4PCLA 5CVDA 3UJ7A 1MJFA 5CCXA 9MHTA 2BM8A 5DX8A 3V97A 4P58A 1ZGJA 2XYQA 2AR0A 1ORIA 2H00A 4RVFA 4PGGA 4PYIA 4PYKA 4RTLA 3KQWA 4XCXA 4RV9A 5BW4A 3BKXA 1JG3A 5EGSA 2NP6A 1RI3A 3MHTA 4PIMA 2ZULA 3A7EA 3UFBA 1SKMA 1RJGA 1EQAA 3AXTA 3PFGA 4IV8A 2QM3A 4PCAA 3V8VA 3AXSA 3NJRA 5EIFA 3P9NA 3C6MA 4GF5A 1XXLA 1KXZA 5DTRA 1YZ3A 1WS6A 4RTSA 5CM2Z 2PX5A 5KQSA 3AWIA 5DTQA 2FK8A 3JWGA 2VDWA 4F85A 5LQNA 4HGYA 3TKYA 1NKVA 4A6EA 5B1SA 2PGXA 5E1DA 4IKPA 4XUDA 3B89A 3KPYA 3T0IA 3EVCA 3UJCA 5ICGA 5FA5A 1X19A 4BP1A 1XDSA 5FULA 4MIKA 3TMAA 4RYLA 4E32A 3UJ9A 4HRAA 1M6EX 1M6YA 3NVMB 3OCJA 2I62A 2VZ9A 2OY0A 5HEKA 1NW7A 5HZMA 4R05A 5DM0A 1INLA 1X1AA 5KS2A 2ERCA 2R3SA 4XUCA 4RTPA 5M5BA 2Z6AA 2G71A 1JTEA 2ZZKA 3O31A 4R8RA 1VIDA 3A26A 3G7UA 3IHTA 3KPVA 2WA2A 3LKDA 4RTJA 5DM2A 1N7IA 4E31A 4FT2A 2JJQA 3CJRA 3HA7A 2O07A 3UZUA 4B17A 4FSDA 4HG2A 5EMKA 5F2NA 4G56A 4OQEA 1ZGAA 4DMGA 3M70A 4HTFB 5DRYA 4BP3A 4F86A 4YUZA 4RTQA 2QE6A 2GLUA 2NP7A 4R8SA 2C7QA 3DXYA 1N7JA 5EPEA 2O06A 4FR0A 2HNKA 4X41A 4RVGA 1R00A 4EKGA 4GEKA 3OU2A 4HTFA 4QDJA 4LECA 5DTMA 1AF7A 1D2CA 3KU1A 2P3OA 1XDZA 3SSNA 3G5TA 5E8JA 1QAMA 2QRVB 3OFJA 1NW5A 5GINE 4KRGA 4AX8A 3K6RA 4KIFA 3OE4A 1NW3A 5BP7A 5HOQA 2LD4A 1SQFA 4OBWA 1R18A 3NDIA 4KDCA 4E2ZA 1NBHA 3VC1A 2ZVJA 2BH2A 3LDUA 3KQPA 2WK1A 2XYRA 3DLIA 5EQJB 5LQRA 2VS1A 4HH4A 5FWDA 5EG5A 1QANA 3EVZA 2O05A 3KQSA 1U2ZA 2VDVE 4OX9Y 3FRIA 1BC5A 5K0LA 1F38A 3MB5A 2E5WA 5EZSA 4ER7A 1AQJA 3RODA 3DULA 4DCMA 3PT9A 2IIPA 3SSOA 1P1BA 3B3JA 5GOZA 1BKYA 3KQVA 2A14A 4EKIA 5JR3A 2YXLA 4LG1A 2C7RA 4KWCA 5EVJA 3O4FA 1RJEA 1Q0TA 1WG8A 2GB4A 2PLWA 5CVUA 5FQOA 1SG9A 3C6KA 3OZRA 2FHPA 3HNRA 2G70A 2YUIA 3I53A 2OXTA 2CKDA 2IH2A 3P8ZA 5C0OE 2EFJA 2PX2A 3LBFA 3T7RA 4X63A 4XUEA 1ZQ9A 5EC8A 2O0LA 5T6BA 1KHHA 5K0BA 4C08A 1JG1A 2AOUB 2G8NA 3P9CA 4PINA 5KYGA 3B7PA 3LDFA 3TFWA 5HFJA 5LSAA 2AS0A 3ME5A 2PXCA 3FUTA 2GPYA 3REOA 1RI2A 5DXJA 1D2HA 2AOUA 1EAMA 2NXEA 3OU7A 2OO3A 3GRZA 1EJ6A 5E9WA 5EKUA 3FYDA 3IEIA 2ORED 3UJAA 5K0GA 1YFLA 5D1HA 4MHTA 4DCGA 3P2IA 3BUSA 3TPZA 3LCUA 5EOVA 2OYRA 4OQDA 1SVUA 2PSSA 3E05A 3KR2A 4GOOD 3KQYA 2AOVA 2ZWVA 1G8SA 3M6UA 5E2BA 5T67A 5C9ZA 3UBTA 2P41A 3CVOA 2IPXA 2XBMA 1R8XA 5K01A 3DOUA 1M0EA 4RVDA 2AN3A 3FPJA 4BLWA 1D2GA 1VP3A 5DXAA 3EMBA 1QAQA 3KHKA 2FPOA 4HSGA 4O29A 4X60A 2Q41A 2AN4A 4QPNA 1NV8A 3BWYA 4OA5A 3T7SA 4Z2YA 2IH4A 3LSTA 3PLAE 1ZHFA 2O57A 3DXXA 3FPGA 4Y2HA 1BHJA 3FPFA 5KQRA 2V74B 5LQAA 4DF3A 1VBFA 1L3BA 5C1IA 2JHPA 3AY0A 1JR4A 3FRHA 1UIRA 3QOWA 4PYMA 4CTKA 2Z6UA 5DM1A 1VE3A 1FP2A 3UA4A 2V7EA 3D2LA 4IWNA 5E1MA 4POOA 3R6TA 3UJ6A 1NE2A 4EK9A 3G2OA 4PYJA 2ZZNA 2I7CA 5GIPE 1FBNA 1SUSA 3DMHA 4FP9A 1KYWA 3P2KA 1L9KA 4JXJA 3A25A 4RSRA 2BZGA 3C3YA 3FUXA 3M4XA 2IGTA 5FQNA 3HTXA 1NBIA 3EVAA 1OR8A 4OBXA 3THRA 3FTFA 3R3HA 5FHRA 2BR3A 3ELDA 5FA8A 5LQKA 3BXOA 2NNWB 3BGDA 2H11A 3EVEA 4ER3A 1RI1A 2NXNA 3I9FA 1JQ3A 4V0RA 2OZVA 2IDKA 3UWPA 4GC5A 5D1NA 3FUWA 3IV6A 2AOTA 1RJDA 1EIZA 3HA5A 4AZVA 4QQNA 4AZSA 1H1DA 5K05A 2EG5A 2I6GA 2UYQA 3A27A 4FT4A 2P7HA 2YVLA 3BGVA 1BOOA 3TM5A 4RTKA 3RIEA 3ER9A 4FGZA 3GRUA 2GAFA 3MCZA 3VSEA 1VL5A 4C05A 3ERCA 3CBGA 3LBYA 5BXYA 2B25A 3G2PA 3CCFA 4FSXA 3TLJA 3GU3A 2C7PA 2CMGA 2NXJA 3G5LA 5FWAA 3GJYA 3Q7EA 2I9KA 1JG4A 3M6VA 3M33A 2HTEA 4YMHA 2N47A 2AOWA 2B78A 4X1OA 5U4XA 3JWHA 5DT2A 2CL5A 3HP7A 2PKWA 3EVGA 1O54A 4M37A 3MGGA 5HIMA 4Y30A 3ER8A 1KYZA 3E8SA 3FTEA 3CKKA 1G38A
chains in the Genus database with same CATH superfamily
3HCRA 5JEEA 3TF5A 1BN7A 2JH9A 3WRXA 4L0QA 3F3MA 1UOQA 1RQRA 2CDCA 2C4KA 4UHJA 4ZTZB 1Y5MA 4Q9IA 2A5JA 4HZUA 4ZXPA 2Q6OA 2QMUA 4AUKA 1I1HA 2MHCA 3IAEA 3JQGB 3C85A 1IUNA 4DIFA 2WKRA 3SXJA 1PS9A 3GLIE 4R1MA 2X3UA 3LW7A 1CY6A 2VOEA 4WIAA 3HBMA 1VFPA 3S2FA 3HCWA 4E88A 4KVZA 3D3JA 4GFDA 2YMQA 4LXHA 1OW3B 1JLKA 3TM4A 4HAIA 5MN6A 2XWPA 3B3GA 2OGUA 3DHYA 3OTGA 3ISVA 4DIDA 4NFYA 3E22B 4R68A 1IB0A 4W5RA 3UC9A 3MA0A 4YQZA 1JTVA 4K6MA 4AZWA 5LNK6 3PHJA 3PUWA 4ZQHA 1OGJA 4R1OA 4L8VA 4J6EA 3F2IA 4LXYA 5A2GA 4CKEA 4ESOA 3HUUA 1XTKA 1YQXA 2DZDA 2HHAA 3GUUA 4FDMA 5TPZD 4YQFA 2X4GA 4OI4A 5KYYA 2CLOB 3Q7IA 2BGRA 2O5RA 3B82A 3T06B 1TPYA 5EWLA 4K9SA 4K81B 1MW9X 2QHXA 1HQDA 5JBIA 1QP7A 1P8AA 4AQDA 4U6NA 4PZPA 2B30A 1DCTA 1KO8A 3OICA 4TSRA 3DQQA 3K1ZA 4UUQA 1OC2A 1SIWA 2YR0A 1D6NA 1NP3A 2QU8A 3CGWA 3W04A 4BNTA 2XZDA 5JYDA 4MXDA 1KOFA 1ZN7A 3MJCA 3L7MA 1H2EA 4Z1MD 1CCWA 2IOFK 3KSBC 1R0RE 2UVDA 2FOLA 4GX1A 1B76A 1M73E 1W1IA 3RYHA 3OCYA 5KQPA 2X0RA 5D86A 3IV9A 3PI6A 1GG8A 5DSTA 1AHIA 4G0QA 1NI4B 1JIUA 1N9GA 4YC7A 1G5PA 3QVJA 5JRJA 4IHJA 2Y93A 3H13A 4EO4A 2P9HA 3SOPA 2Q4OA 3P9PA 1DXQA 4YRRA 1U4NA 1IHOA 2J3KA 3OF3A 4MVJA 4XDYA 2VXBA 5KNDA 3NWJA 1VYUA 5U9CA 1NUUA 2QLTA 1ZFNA 5IDWA 3NV7A 1CR4A 3SJBA 1USIA 1UDAA 2DHDA 2GQ0A 2YMPA 3MERA 3FX2A 2YHIA 4TZKA 4CV1A 5KNCA 1TK9A 2WU1A 5GZ1A 4H08A 5K0FA 1NV9A 4IDCA 4ZTBA 1A95A 1CZRA 1MGPA 3LY8A 3SBEA 1KMMA 4HVAA 2VUHB 3FZGA 1TW2A 4HXFB 4Q18A 3G1UA 2X19A 1K0FA 3JQCA 3C6QA 4RHTA 4CYMA 2Y2VA 3Q9SA 3ZWBA 3F7NA 1V8FA 3QP9A 4OB8A 4D0LB 2IYVA 2V6BA 3PIIA 2FWBA 3GL9A 1SQGA 4FGSA 4WI1A 1V43A 4BMOB 1V11A 2EX4A 2I4IA 3OOYA 1YR9A 5KTNA 5HVNA 1AQYA 1K89A 3UK2A 1G9SA 4ERXA 3U1BA 4I6JA 4I1IA 3SZ3A 5ED4A 3AJEA 4KXFB 2Q3MA 2O7QA 4GMFA 4YBZA 1WM1A 2HLPA 3F6SA 4UNPA 2F8MA 1K7XB 4FMDB 4DA4A 2E4ZA 1UKZA 4LJ7A 1W8IA 3P27A 2C8JA 4MYTA 5EA2A 1IAVA 2GFIA 1J1ZA 2R00A 4MI6A 4BLUA 3U7IA 3KB8A 4BZPA 1Z5VA 4LZWA 4GX5A 1R7RA 5IAEA 5IVIA 2FK7A 1JA0A 1MC1A 2BKUA 5BMVF 2OECA 1NONA 5FKJA 5SZJA 1E4YA 4G2NA 4AN1A 1X87A 2HIAA 3GVHA 3ODPA 1PV4A 2AFIA 5CFMA 3N28A 4ID9A 1CHDA 3VR6D 1NLMA 2GD1O 2XI4A 2C5FA 3BQ9A 3IB6A 3TDKA 4DQDA 4UUBA 2O8CB 2FW6A 4DRZA 1LV8A 3MWGA 2R7KA 4DCVA 1K7FB 4TLCA 5AOAA 3WG9A 3MTBA 3Q1LA 3VNUA 4IIXA 3EFOB 1G63A 1GEEA 2BGMA 1E0DA 4KW7A 5AI0A 4BO8A 1IOWA 2DP4E 4HGZA 1Q0SA 3R3ZA 2DQKA 4F5ZA 3BMOB 5JYBA 3TZKA 4AZ0A 1NSYA 2F62A 2HNBA 3P9IA 3PS9A 3RLFA 4DFDA 5A62A 5B64A 3DR3A 1OFTA 1RHRA 4W5HA 4YWJA 3FPHA 1GYQA 3LV8A 4FR2A 4QFMA 4AF7A 2ZI4A 3PTZA 4KQ9A 4YA6A 4Z51A 1JTFA 4M36A 1FFAA 4LDRA 5DBHX 3LT1A 1KY5A 4D2IA 3GJSA 1J0XO 4MYSA 1XLTC 1I32A 3QFHA 2BGWA 4Q4AA 5DFAA 5GY7A 4OQPA 2HY7A 1F8UA 1DO8A 1O08A 3FGOA 3PKIA 1YL5A 3INRA 1B42A 3IIMA 3OFKA 5ALDA 3RU7A 1ATZA 4MR9B 1Z4JA 4FZ5A 4X64B 3WGUA 1XLVA 5JD4A 2OBNA 3KVYA 2C99A 4QKQA 3GEBA 2I54A 1I1QB 1QH1B 1IBCA 3NAQA 4PSDA 1U7HA 2OA0A 3K9HA 1SD1A 4AYXA 4DLVA 1SK9A 4Y0AA 4KNYA 4P4NA 2BFNA 1PYOA 4REQA 2C9DA 1N8NA 2YXPX 4U39A 3N39C 4EMSA 2N9UA 2A35A 1H42A 2FV8A 3EXAA 1ISIA 1AUQA 1T36B 2IYWA 5DSXA 3W1WA 2FFQA 1HEIA 1EJBA 1USKA 4GZLA 2NZUG 2X2PA 3RUCA 2JJ8A 2Q3HA 3NIGB 2IDJA 3OHSX 5ES3A 3DB1A 4CKCA 4IFTA 3D7MA 1HFEL 5LMZA 1KK0A 1WUHS 5IBCA 3DVLA 4OAOA 2PH3A 3NC1C 4RVOA 2QD5A 2NSDA 5EXSA 1QC5B 5FT9A 5G40A 4MUYA 1V3UA 4NBLA 3TLMA 3PUVA 2YS7A 3BDAA 4V0NA 2LBPA 5KYKA 4RC9A 1LLUA 1FVHA 1V5IA 1G3MA 2Q4RA 3PVCA 3L6BA 4YUVA 3U3RA 3UV6A 1LXCA 4CKWA 3D2AA 5DNEA 1U7OA 3GY0A 3NHBA 2JEOA 2PJDA 4FYKA 4I50B 1ZITA 2XGOA 3PLRA 5H68A 2XZTA 5I9IA 3FGPA 2IYTA 2ZB8A 5BMVA 5JECA 3HCNA 2ZZMA 4KXNA 3OIFA 2VK4A 4JWKA 5KKAA 4J0IA 3U0BA 3SSMA 2E21A 1VJ0A 1RYZA 5ULLA 3ZGXA 3ZXXA 4EKYA 1K4MA 1NJ2A 5BV8A 3FIUA 3ZZ0A 2CZQA 2IH5A 6GPBA 3GRFA 4E5PA 2NVUB 5HRUA 4Q1CA 5J2TB 5EN4A 1FNMA 3UAWA 4AW9A 2GESA 1Z0ZA 3BIJA 3K70D 2R11A 3EHDA 3LS2A 2AG6A 1CRLA 2IFTA 4RWZA 3FYTA 3PGVA 1OFIA 2PBLA 2VP5A 1NQXA 1ST2A 1MX1A 2NQ8A 1JEQA 3R6WA 4FFLA 1BZYA 3Q40A 1ZKDA 4H2DA 3U4CA 3CLHA 1Q1BA 4G63A 1F20A 3WMXA 2LRHA 4ZVOA 2DR0A 4XM2A 3RS8A 4AG3A 3IC5A 3ZHVA 4R8VA 4M2LA 3FF4A 5EZQA 2D74A 2J3QA 5CJJA 5E95A 4EDFA 5HUJA 2J3LA 5EE0A 1Z29A 3PEWA 5ERGB 1E1CA 3IVCA 3J81A 4DR6B 1FFYA 3LCVB 5AD1A 3HN2A 3KELA 4LV5B 4GOLD 5C5DA 5C8VA 5K45A 2DUUA 1T0PA 1YI0A 2BUBA 2C83A 1QFZA 2VKTA 4EL5A 2ORIA 4OI1A 4MGHA 2G5CA 1I4WA 1YR3A 4LE2A 4Q24A 4XJVA 3ZDEA 1ZOIA 4YMWA 3ZG6A 1E7WA 1DL5A 4X0EA 2CLKB 2FEPA 3UOWA 3ZKWB 2RGRA 1F4VA 1P0FA 3THXB 4HLCA 2X76A 4PFKA 2OG1A 1S8AA 1CB7A 1ORIA 5AW7A 3HUTA 2GJ9A 3HB7A 3CLUC 2IIBA 4BBZA 1Y1KE 2XXAB 4PIMA 3GK3A 3A7EA 1XQ1A 3BXZA 3OOSA 3UYKA 3D3NA 3LIIA 1EHCA 4MV0A 4DW8A 3B1YA 2V65A 2MYUA 5EIFA 2LXNA 4NI5A 4LXQA 4AYTA 1NN3A 3W5SA 3AP3A 3PHLA 4JOSA 3O84A 1FXWA 3KJEA 2I2DA 2XMSA 1WMEA 2VUIB 1R5OA 3HWRA 2EL9A 5B3JC 2XJ4A 2R97A 1CF9A 1KJQA 1VLJA 3H2SA 4C20A 2XVZA 2XMDA 3OMWA 4U9IS 1VBNA 1HDXA 1Z0SA 4HDSA 4ALIA 5REQA 2V0GA 4MUHA 4D44A 1DMRA 2CNOA 4CDNA 2HUPA 4ZEMA 2WUWE 5KWJA 2C5EA 4ZCQA 3ZV5A 1QQ5A 3D4OA 3GAMA 3R7DA 2BONA 4LDZA 3K30A 4GQIA 4NESA 1T6XA 4E12A 1L5WA 1ULZA 4K3VA 4CEJA 5FPYA 1HFKA 4ZYWA 2ZE6A 2C2KA 4M1SA 5JCXA 4OHZA 3A1UA 4GKBA 4PAOA 1GLNA 5FI1B 1NJ1A 3VNBA 2OOSA 3MMXA 1T1JA 4RTJA 4ZIRA 4CCAA 3CNLA 1JJIA 2WLSA 3EZFA 1YFKA 4B17A 2V6JA 5LB4A 5A5EA 4MQLA 5CCDA 1ZJ4A 3ILVA 3KD2A 5LP1A 3VA7A 3ZTWA 4GDFA 1H65A 4GM1A 2XEXA 4ZVLA 1OZAA 2V45A 3VYUB 2PSEA 3HP4A 4IXMA 3V1LA 3KJHA 2UUAB 1G3UA 2IQ5A 1Q2UA 3IR6A 1I36A 5CXUA 4C6TB 2C29D 4A8HA 1FFWA 1HE8B 2ZPTX 2HTFA 2AFVA 1KMIY 3EN0A 4V0MA 3OHPA 4QOFA 1ZJJA 1XDZA 3OE1A 1RZUA 3G5TA 3ZKAA 1W46A 1CUFA 2QRVB 4H6XA 4HLQB 1RFLA 2IHKA 4NYMR 4NABA 4TROA 3IRUA 5UKDA 3KUKA 3ZXSA 3DV9A 3OE4A 4BFWA 1FFXB 3CVYA 3N8GA 5EJ6A 4BGDA 1EDDA 1EXWA 3S2UA 5J4LA 3WB9A 2BH2A 1TUGA 4EH1A 3LDUA 3BILA 4C0AC 3GFSA 3D54D 1ZR2A 4OQZA 2NG1A 4CM9D 4PBRA 2WTNA 4A0FA 4E13A 4A0HA 1LRJA 3BE5A 4ER7A 3WYFA 2WNHA 1CQXA 2XYGA 3DULA 4YXWA 3S2EA 4EHAA 4V1CA 3Q3CA 1RKXA 1U2PA 4OHWA 1EX1A 1BKYA 1MJNA 4U02A 3PUXA 2XF8A 1KQFA 3BRCA 3NHLA 5AHOA 2WD9A 4AN0A 1XJWA 2BGKA 1X1SA 1XV5A 2Y68A 3HRKA 1TRHA 2HZ7A 3C6KA 5DN6D 1ZBDA 4J1TA 4QOGA 3H1AA 4INAA 4KO2S 3BMCA 4K9MA 4KR9A 1WMFA 2R79A 4AO8A 1EP1B 4DMMA 1GYPA 1XZCA 3M7IA 1L1FA 4RORA 1EZZA 3ZNPA 2Q3BA 1Z0FA 1NXPA 3ETCA 2X7XA 1OBFO 2B6NA 1C4WA 1UAGA 2Y99A 4AF6A 2FQ1A 4Z7QB 2Y4OA 1D2HA 2BEVB 2GF0A 3KZOA 4FR5A 4QE3A 4WVFA 2GCGA 4LPKA 1LRKA 5EWMA 5K0GA 2GHIA 4BMVA 4MMXB 2X9LA 2Q7XA 5I9LA 4OUDB 4AKTA 3FLAA 1JHUA 3U3MA 3DKRA 4BGEA 2DERA 5HNKA 1QU3A 1G8SA 2J9YB 3Q6MA 5CP8A 3E2MA 1M2KA 1Q84A 4MYRA 5T67A 3LLMA 1SXPA 2L42A 2A3NA 3HUFA 3AERB 4A8PA 2HT1A 2A1TS 5FFNA 1Y5LA 1C8BA 1HDYA 2X2EA 3SF0A 2H5LA 3LCRA 5DXAA 4HSGA 5DCUA 3WDLA 1QVAA 3A9UA 2V7QD 1S02A 2Q41A 4UM9D 5G4KB 4IJ5A 1P7YA 4C0XA 4B7CA 1SM4A 1SUDA 5EJAA 3LSTA 1N8TA 2O57A 3QEMA 4KR2A 1S1CA 2QTAA 4ABTA 4Z4IA 4P36A 3WAKA 2NZJA 2VZ8A 4QNRA 2LPMA 5KOJA 1FSZA 3DV0B 3I3SR 4Q3AA 2FEOA 2R6R1 2PHZA 4GXNA 3CHYA 4BO0A 1JXQA 2IGBA 2OWEA 2YJTD 3D43A 1UBEA 4LOIA 1ZC4A 4NCXA 4NYJR 1FBNA 4NPAA 4Y1GA 3WGOA 1EE9A 2Z2KA 5A4DA 3T7DA 1BVUA 4G97A 1LX7A 1SC3A 3WJ2A 2BZGA 2EW8A 3EXHC 3NCHA 5CGQB 4A0QA 3GIDA 1KOJA 3VO1A 2HCTA 1N0HA 1U5AA 1Z38A 2BR3A 3UB2A 1KJJA 4ZICA 1VSVA 1NQVA 2KHZA 3ZLTA 4IIJB 2JI4A 1IBLB 1K9SA 1JQ3A 4PX5A 2ZSJA 2DH5A 4D3ZA 3A9VA 3C3MA 5F98A 2G9RA 4PHHA 1N7GA 4G5HA 4JYMA 3TIVA 1RJDA 2PJZA 2HSZA 4JCCA 1HKUA 2PO5A 5JFTA 4RHUA 1BX0A 1TA0A 3D3WA 1WHSB 1Y7TA 2GBFA 4II7A 4FIDA 2XNKA 3GRUA 4FGZA 3TLZA 3T99A 3I34X 5KTSA 1H8HD 3NIWA 4CR8A 4II2A 1Y5IA 1JVBA 3LBIA 2B25A 1Z35A 3PFNA 4FKZA 4KV9A 3AR3A 2CMGA 4E31A 3QA9A 4HV4A 2CJPA 4MVJP 3A10A 5ALEA 2WHPB 4B3XA 2WUFA 3M33A 2HTEA 5JJBA 2PUGA 1JG7A 2EQ5A 5JBNA 2UZ1A 2ZRFA 3PNSA 5TT1A 4G26A 2H9AA 3QH4A 4Y30A 1R88A 4Y9RA 4TL9A 1Z6YA 4HZUB 5A0FA 4Q39A 4EEXA 5GJVC 1OWOA 4A91A 2EKDA 4WLVA 3WHPA 4ALJA 2QTWB 3A36A 1Y6RA 2QSJA 3HY3A 4CLXA 4POAA 1N1EA 3KUDA 3SJAA 2ZCUA 3QPBA 3JX9A 1G60A 1XQXA 3DTVA 2GETA 3N2ZB 5AYVA 1YT5A 1SKYB 2G09A 1CUHA 5K8LA 2UXDB 1GRNA 4TM8A 2DHCA 3ZUPA 2OMKA 1DIGA 1TVKA 3NHPA 4YRCA 4O3FA 5KSYA 2ZUWA 3R0ZA 3LWZA 4DJ5X 1TUBA 3OZXA 5EIOA 2HC9A 1GN9A 3CX4A 1ZM7A 1GITA 5FOSA 3C7DB 4ALLA 2Z6QA 1SXHA 1TM4E 4KYIB 1TRKA 3AHEA 3FVWA 2BN4A 3E0XA 2YC4C 5ELMA 4R5MA 5ED0A 3EMDA 1C0KA 3UUGA 2R0QC 3R5XA 5ILGA 2VHJA 5EWLB 3RRBA 3TCKA 4YCLA 2GCIA 1NNEA 4QA9A 4YJFA 3AB3A 3L93A 3TLKA 1Y1TA 4QDKA 3TFQA 2XT9A 5JS6A 1KETA 1W0JD 3O8LA 3OTQA 1YCGA 3ZLUA 4TKUA 3PD0A 5B58C 2EYUA 2Q3DA 5K0SA 2PUWA 3H9QA 2GN8A 4G0XA 4Q4LA 4ERNA 1A4XA 1RKQA 5CTAA 2PKCA 1QE5A 5JI2E 2R8BA 1NDUA 2Y1FA 4A7PA 3U7QB 4UASA 4IDPA 4TQGA 1GKYA 5B5SA 3IT1A 1PR2A 2HMYB 1IY2A 4CGZA 2JAPA 2AG8A 4X8OA 4A2PA 4I14A 1WX1A 2CLLB 1QGUA 2QR3A 2ZIGA 3KTOA 3NBAA 4FEGA 2OV4A 5B1EA 1XFDA 2J3EA 2BPOA 3AVPA 4ZAZA 5ILOA 3J81k 4KR0A 4A16A 3HVIA 4URWR 3EGEA 3FAKA 4KQWA 2ZJ1A 1MC4A 1A7JA 2AWNA 1XMSA 2NM0A 4IFIA 4MIOA 5BPFA 4A15A 1E66A 2VLBA 1W0CA 1FU7A 4ZC8A 2F2TA 4ZI3A 1ACJA 2XECA 2DWOA 1U0BB 3NETA 1IZ9A 1GWNA 1PU2A 3CZ5A 1KY2A 2FG6C 2YICA 1PZEA 5HYVA 3SYKA 2GX6A 4GH5A 4D46A 1YR2A 2W2LD 4L4RA 1JVNA 2ODQA 2GH1A 4P8RA 1BTOA 4RPHA 4Q12A 1YBMA 2QORA 4QFBA 4PANA 3PRHA 4RY0A 2WSBA 1V11B 3KLMX 2JJ2A 4R83A 1XJ0A 3B70A 1BIFA 3MNFA 2EGGA 3EEYA 1USWA 1JYFA 1QQTA 3ELUA 1TCBA 4B3TB 3VR2D 1ENZA 4TVBA 1BMFD 1IY1A 1IVYA 1N6IA 3AYZB 2FZ5A 4N8DA 1CQPA 3KLOA 3ZDQA 4CIAA 3H83A 4Y7CA 3TQOA 3D4NA 4ENUA 2NPFA 1KARA 3A04A 4UBNA 1IZ0A 1OASA 3CF6R 5SYMA 4C4SA 4B2LA 5AKIA 3T34A 4RADA 1JKIA 3OEHD 1XN4A 4HVTA 2FP3A 5JROA 2VSFA 2WDPA 3UMRA 2AOTB 2ZUTA 4J91A 3KK0A 3WKDA 5KYUB 2XMZA 3AL3A 4AICA 4LZPA 2B4RO 4D98A 1Z16A 2AFIB 2ZROA 3GLTA 3J7AC 3NOXA 2VC2B 1XCLA 4ZZ0A 2X0NA 3LZDA 1X1BA 4Q48A 5BNIA 3VU9B 3B3AA 5IVPA 1M0SA 1PE0A 1XB2A 1L2TA 1WE2A 3RT7A 3O4HA 4LCBA 3QEBZ 2Q7DA 2YBDA 4HLNA 1MMFB 1MOSA 3L01A 1OVGA 2VDUE 2DHEA 3F5DA 4IGIA 1VG8A 1P31A 1WLYA 1ZJWA 3G9XA 4FYYA 4O4HA 4RKYA 4CI0B 5G0SA 1GPNA 1E4EB 1FTNA 1P91A 2F1HA 3CA8A 1QRAA 2F9FA 3SIPA 4D99A 3BE8A 4G84A 2Z0MA 3IJRA 3IO3A 2PR7A 2FG5A 1Q3TA 1NN0A 2VYCA 3DZKA 4QXRA 5DP2A 4I5EA 2VWPA 1P2GA 2QIOA 3R4CA 3PJRA 4A73A 1PSDA 5MFPA 1F0YA 2B20A 3HCFA 3OJXA 3CGGA 3DLCA 4HF7A 3RSZA 4PNEA 1VQ1A 1XQYA 3BB4A 5HDBB 1IOZA 3FVRA 1MFZA 1E9RA 3QBTA 2NUBA 3D8RA 1BEEA 2HK8A 4S04A 1VC2A 4QYWA 3MTEA 4ADSG 4W6ZA 2EJWA 4BEWA 3CRNA 3VYTB 1I10A 2QVLA 2VF2A 4QYMA 4P7GA 3BQNB 4N76A 1CDDA 2P67A 4YMIA 2J9ZB 4EG0A 3NRJA 4EW2A 1EXVA 4IVPA 4QJ4A 3EPJA 3IAFA 1ISHA 1SKYE 4L0DA 1TZ2A 1BFUA 4WK0B 1E3EA 3CX7A 3A9SA 3AL0C 5LA6A 1NBEA 4BBAA 1T4CB 4GSKA 3ZU3A 3AVVA 2NQ2C 1BHQ1 3LCCA 3NYRA 3E7DA 3GRCA 2OORA 1A77A 1SCJA 2ODTX 2PWPA 1J8QA 1ZU5A 2NAFA 4YR7A 3COYA 4FYHA 4CMIA 1I0ZA 2P8JA 3EPKA 3M6MD 4X92A 3FLMA 4NZPA 3K0SA 1RLTA 3MBKA 1DEOA 4F9TA 4G89A 3A6HA 2QUHA 1E8DA 1Z4KA 2FEAA 2Q5IA 1FTGA 1G2QA 4BP9A 4G5YA 5IU6A 1X8XA 3PZBA 1BVHA 2ZWPA 5K6AA 4X1YA 2YOFA 4OQYA 5CA0F 3K9GA 5ITSA 2CVFA 3HLTA 1E9VA 2I1VB 3KKNA 1UP7A 3R0VA 3WE7A 4FFDA 2B0CA 2Y76A 4V2UA 2BZSA 2WWFA 3N2IA 1YGPA 3GEHA 1VJ1A 3M4NA 5J9FA 2BD0A 3BEOA 4CM4A 4QUDA 4HNTA 3IUSA 2ZVDA 5FLYA 4CT0A 3QF4B 1F2DA 1UH5A 2VHWA 2CVZA 4BUZA 4CF7A 1CIJA 4I5FA 1J21A 2WI8A 2ZJ5A 3RBZA 1Z83A 3AV0B 3NHSA 3O9ZA 3S2IA 1Q7BA 4ZKDA 3DVSX 1SHTX 4X65B 4MVJE 4WCFC 4KN9S 3BH7A 3IMKA 2GNPA 2E6UX 4DMFA 1JEQB 3R7LA 1KZHA 4CMCA 4PX9A 3STHA 1WMSA 4AWXA 5GVSA 2DR2A 1I2ZA 2L17A 2QPTA 2QZZA 3A6FA 1FFHA 1ORWA 1JQEA 4LDJA 4YMSA 5J63A 1P2VA 3C3JA 4WZBB 2WSYB 3F8TA 1VCMA 1X80A 3MBIA 1U9YA 3ZBQA 3A3PA 4KR3A 3NWBA 3ZQJA 4TZ6A 5IAKA 3LA6A 1E1CB 2HPHA 1M2JA 5HJ2A 2BV3A 1UPCA 2CXQA 4AJ1A 5LOVB 4OHBA 1UKCA 1L7VC 4LGYA 1MQAA 4U7TB 1FYDA 1DPGA 2XGGA 2J4CA 3GGDA 1UFVA 3B48A 2IELA 3HDGA 3F98A 4M98A 2IP1A 2QD4A 3MN1A 3MS2A 4HCJA 1RYMA 4CDMA 5AFSA 3FTPA 3AKDA 4CTJA 2QTTA 4KAXA 3USCS 4XVHA 2RE8A 2AN1A 2AXPA 2GMWA 5T4EA 3BULA 4EUEA 1X8KA 2Q5HA 2QV7A 1QTQA 3BIOA 5DISB 4PN3A 1TVCA 1EM8A 2WKQA 3GD5A 4V38A 1TTTA 1ARZA 2XIJA 3OAAA 1ISFA 2VXCA 1QNFA 3AP2A 1YFLA 4XPZA 5HSGA 1IXZA 1JRLA 2VH1A 4FKMA 1CEEA 2N1BA 3RE1A 1XZJA 4UDNA 3I5YA 4DPLA 4KH1A 1ZEMA 2YXNA 4MITA 1WXQA 1B74A 1C1XA 4I9HA 4BPRA 1EQAA 3OKAA 1DBIA 4IV8A 3ASVA 3AJAA 1PQYA 3AXSA 2NSHA 5BN4B 4QL3A 4HL6A 5ENVA 1NNLA 5K51A 5REQB 4G1VA 4Z0HO 1YZ3A 4HDAA 4K1XA 4RMGA 5HZGA 1OLXB 2Z56A 4CMGA 5JWRA 2WF9A 3EAFA 3UVEA 5HG0A 1L4KA 1DKRA 5B1SA 5KQLA 1WD5A 2C5GA 3O4GA 1LVUA 1U8XX 5CA0A 1QZXA 4D9EA 2WHXA 1TA4A 5CLIA 1VZ3A 1N2GA 1MA0A 3EB9A 5AW3A 1D3AA 5IAJA 2Y71A 5CBKA 4WXEA 5KAMA 2EZ4A 1WNFA 3GWGA 3HFGA 2FMTA 1VZ2A 3U16A 2G71A 3THOA 2GGSA 3FHTA 1HYQA 1DJPA 1KBZA 3COVA 3PE4A 4UBJA 5AW8A 2UU9B 2IZ1A 3LKDA 1WBBA 2X0KA 4F4HA 1H23A 4OQEA 4ECEA 1NYRA 5LJLA 1BGWA 1YU6A 3M70A 1ULBA 1X9GA 4U7WA 1N4DA 2ZRPA 3EWSA 1HZZA 1AG9A 1AZSC 1N7JA 3FWHA 1Y6FA 1U02A 4HHEA 3Q2OA 4QM7A 1V6AA 3DDNA 5KU7A 1NQUA 4KGDA 4FFNA 3WBBA 4F0JA 1RIIA 1ZONA 4CMHA 2JBWA 4BC1A 1GUZA 5TQVA 2W58A 1K3UB 4MV7A 5CD9A 1LNSA 5H4GA 1LK0A 1VLLA 3PLNA 4H1TA 3S2SA 3TEMA 4KRGA 2O9JA 2MSWA 3M5PA 1EFKA 1NPYA 2BBSA 3PP8A 1LSUA 5E7QA 4JI1B 5CFOA 5EE1A 5AUOB 2C9ZA 4HEHA 3TQFA 3WL6A 4CUJA 1M66A 2ZVJA 3EFBA 3FD8A 4V1CB 2A0FA 1E6UA 5F77A 1ZD1A 3HQ4O 1QANA 2XUIA 2O05A 2NIPA 2V03A 3MS7A 2Q6TA 4US2R 3JRXA 1IWOA 4CJXA 3EWIA 2HYIC 4IOKA 1NM5A 4HS9A 3PT9A 2IIPA 2ZSBA 1QSGA 4AECA 2DWUA 3DBLA 4UBIA 1PR9A 1I0LA 2REQB 1M6NA 2AI3A 2MJLA 2QDXA 4LZAA 4UNNA 3UAYA 2EKPA 2O6HA 1GARA 4A8JC 2CLIB 1T15A 3WB0A 4BU1A 4I1VA 3ZYCA 5FQOA 4GICA 2TMKA 3BMCB 4Y7DA 2JAHA 3JQFC 1YI1A 3IBSA 4G67A 3HCOA 3CVWA 5THXA 3DD5A 1RYDA 1Z4QA 4PC6A 3VO8A 2V7TA 5C7OO 5LU9A 4WNIA 3FSRA 2QAGA 5E7IA 2IH2A 1XEFA 2FW0A 4QEKA 1O95D 2X13A 3QFCA 3DVQX 3EQ7A 2AX3A 1YKFA 3L6UA 2BEJA 2A1UA 1FA9A 5IKXA 1D2NA 2WM8A 3OPVA 4HP8A 5EWMB 4JNKA 4WE3A 1YQQA 1GPAA 3TFWA 4TYMA 3AUTA 1KH2A 1U0OC 3U80A 3GEEA 4JX9A 1V95A 3C5HA 4EABA 5DT9A 1NPDA 2G1KA 2I6UA 3EUFA 3NC4A 1FX0A 2WF5A 3ZU4A 1UK9A 2NP6A 2CL7X 4ZGWA 2QPOA 5FOQA 1VA4A 2P3SA 2ZJAA 3GLGE 1Y6ZA 2QL7A 4UFNA 3KQHA 4FDLA 1KO5A 2HSEA 4MGKR 1OI3A 4L50A 1IOVA 2GZDA 5IJZA 2J9XB 4DRXA 4MUEA 1BXGB 2ZSKA 4E6PA 1YS1X 1Z62A 4IW3B 3GP8A 1OH8A 3ABZA 3K5PA 5HM6A 4LY0A 1KRHA 2AN3A 1B8OA 2GEBA 4JWTA 3E0QA 3QEMB 3STUA 1PZXA 1QYIA 1PFYA 3R0JA 3EMBA 1E3IA 4BNXA 4DAEA 2PE5A 2JVIA 4GR9A 4HGOA 4DDHA 5KINB 1JZTA 2A78A 2H7YA 3OJ0A 4GOKA 4H77A 4QPNA 4DM7A 2G7MC 2V3CC 1K2VN 3UXMA 2ENUA 2Q2QA 3PLAE 2GCNA 3GLFB 1DINA 3KM0A 3O1LA 2JIZA 2V74B 1J7JA 3VKHA 4LNUA 1J25A 5LZ8A 4W82A 2JHGA 3UOGA 2AJBA 3SZLA 4RCYA 2Z6UA 2ODBA 5ALNA 5GJWC 3IBFA 1G64A 3K72B 3WLHA 3PXUA 2C78A 1A27A 4P4GA 1GUAA 1FDIA 1Y8QB 3H86A 1GRCA 3M83A 1HT3A 3PJGA 3TTUA 3IB3A 3ZDXB 5EIXA 1SUSA 5FXMA 1Z06A 4NOMA 3WTBA 1FZTA 4D3SA 1D6SA 4XQ9A 2QTVA 1NX6A 3K0FB 3NNDA 4CKXA 2Q0SA 1JHQA 1KU6A 3OT5A 2UVPB 3ELDA 1HDOA 1KY3A 2PZ8A 3IR5A 2PBZA 1CJVC 2A0WA 3T94A 1GY8A 1YZFA 3DE4X 4RF3A 2WD8A 3PC3A 5I51A 4EI9A 4P08A 2A3RA 2JCGA 1WCIA 1RJ9A 1W52X 1W34A 3O74A 4HGQA 2J5BA 3GFBA 1H1DA 1NZFA 1E9AA 2FZVA 3KL4A 3OJLA 3RIEA 1Y34E 2DY1A 1Z4OA 1LBSA 2GAFA 1ULUA 4ZT5A 3DE1X 4WA8A 3ZXYA 5A3QA 1SR8A 3QELB 4OBBA 3NG1A 1N8SA 2J09A 4FNAA 2C59A 1YB4A 3ENQA 3LTEA 4RIFA 3SP1A 1A5AB 4EJSB 4HDMA 4RLHA 4W5TA 3AEUB 5DK4A 3L02A 1H94A 2QJTA 4QDOA 2Q5CA 5T8KC 3WNQA 2DKFA 2QTCA 2EDAA 4AKHA 3B1WA 4S0XA 4KQCA 2AK3A 2MWMA 3COSA 3JQEA 3MS4A 3C3KA 5JE8A 3DTVB 2R7MA 3LU1A 4EYSA 5D6OA 2FPPB 5BNWA 2GEKA 3FBGA 4IHQA 1TVKB 5KTMA 4EFNA 2PYIA 2ZR0A 4PPQA 3P2EA 3VU3A 4AJLA 3B20A 3QWFA 3UMVA 1C30A 1TUBB 1NOIA 2WYVA 1P0QA 4MUIA 4J16A 3ZE8A 4TT3A 1C9KA 5CM9C 2OK8A 2XQGA 3DL7A 3B36A 2R87A 2PWZA 1GTJ1 3TRIA 5K0TA 3I6QA 1J56A 4DCPA 5LMUB 5CVVA 5B4TA 3DDOA 2QP4A 4DREA 4GKVA 5DMXA 4HUJA 3AFNA 1CYDA 4YJFB 5DBFA 3WIDA 5DCLA 3P45A 4NEGA 4DNXA 4Q47A 3Q1KA 3Q3GE 4HFMA 4TLMB 1XDGA 3OQOA 1PG2A 3ANSA 3K05A 1TCVA 4JBGA 2DPYA 3A9TA 4TKUB 4IVRA 1ZW1A 1FK8A 1KI1A 3RAFC 2YL2A 4I1PA 1TM2A 4MRMA 3RYTC 1Q20A 3CZCA 3LI2A 3K35A 1N77A 3S27A 3GVXA 5DEIA 3EZ7A 2I8LA 2XEDA 2OQVA 5BSUA 4X97A 4LBWA 1E3TA 4JUFA 4RK4A 1FJ2A 1Z2AA 2Z8YM 2I7XA 5DYNA 3E3OA 3R20A 1REQA 3QIAA 4IM7A 1QGUB 2BHSA 2VT7A 3MJTA 2E4AA 1YJXA 3NDJA 4TWIA 3JWIA 4B44A 1FIUA 1GVNB 2NZXA 3GUYA 1J33A 1QK5A 4Q19A 5DEOA 1W5FA 3ICWA 3EGXB 4HAYA 3CLVA 5B37A 4B6OA 4YV2A 4BLVA 4CXMA 2ZBRA 4DXHA 3R44A 5IJXA 1KYVA 3K1TA 1X2EA 4JYAB 1Z7WA 2B5OA 4KK3A 1VRCA 1ESZA 2UAGA 2YINC 1GSIA 3ICVA 5D00A 1BMTA 1C7QA 1SCNE 4TWBA 1J06A 1H0HA 1YTLA 2B1IA 3F4LA 4WCVA 4B8WA 2J3HA 4JI8B 2FRDA 3LM8A 4EJ6A 1VL2A 1VSUA 3IEPA 1BXRB 1A9ZA 1Y48E 1T5SA 3G8AA 3L0YA 3PYMA 2EVWX 4P3XA 3T6KA 4YK7A 4BX3A 5ESWA 5BWMA 1QH8A 4TMWA 3LX5A 3EVDA 3CWCA 1HURA 2Z5GA 4M49A 4P83A 5AI9A 1DXHA 1KAQA 4EM6A 2HL6A 4M4SA 1IJEA 4MVJD 3S6JA 1RAFA 1TXGA 4XIGS 2GT1A 5KNDD 3QU2A 4PLVA 5CH8A 5M2QA 4MQ5A 2IS4A 3EA5A 2R8RA 5P8WA 3KEOA 4I9GA 3V7WA 4RTMA 3DMDA 2QYOA 4NBTA 4ETIA 1IMOA 3G9TA 2VT6A 4DDWA 3HE3A 3ZQKA 6ADHA 3D3QA 1G2PA 1K5GA 1W2HA 2IYPA 4JBWA 3EC1A 4PIVA 2Z3WA 4G0OA 1C7IA 1YL6A 2Z1MA 3UK0A 3YASA 4BPBA 3FNRA 3KHSA 3VC3A 2FWMX 1R74A 1NWCA 4S12A 3NDRA 3GWZA 5IABA 1ZOLA 2PX8A 1QK3A 5LL6P 3AILA 4ARZA 4C2UA 1ZG3A 1D2EA 4TL7A 1RAEA 1ZY2A 4NU5A 4GAEA 4HDKA 3M2TA 4JLAA 3GLSA 1MX3A 3WA6A 1FVOA 1HE3A 1IC6A 1PS0A 2WKWA 3ACDA 4OTZA 5CJ2A 5BRNA 1D9ZA 2ZPUA 3SR3A 4GD3Q 2FPLA 3FB1A 3HBAA 3LXMA 4FYMA 1ODCA 2K7FA 3VU8A 5CB4F 1Z6GA 3I58A 2OAQ1 3Q7PA 5E1BA 2O2EA 2OCBA 1K6JA 5IWAB 2XYHA 2TSYB 1MDFA 5CVEA 4O4HB 1P44A 5L40A 4DSUA 3ZX5A 2QP9X 2WF7A 3L1VA 2CVHA 1PTKA 4H1HA 4K6KA 1V1MA 5C5IA 5E38A 3IKLA 4KFTA 2BZ1A 1J09A 1CZKA 2DMRA 4GOXA 4BIMA 1KAGA 5AHKA 2EIHA 1YJCA 1JLMA 1T2EA 3I28A 1I6WA 1LS1A 2VDOB 2CCJA 3ONVA 3EOZA 2ZBDA 2D06A 4B80A 4CVNA 1Q1AA 2X7JA 3UAZA 1WSDA 3GA7A 3WK4A 4ER0A 5CX1B 2XVYA 1GUFA 1KNQA 3C97A 4K6CA 1FYWA 4A03A 2IPAB 1QCDA 1J2JA 1ZGCA 1UMKA 2FEXA 1PQ4A 4XGKA 1SJ9A 3RYCB 1JBEA 4I55A 1OILA 1CQJA 1B0UA 1BS2A 1KEUA 2EYQA 3HMKA 3RAJA 3KQNA 3BA1A 1C0LA 4RH3A 4FOTA 5EMHA 2OCIA 3T4XA 2FKNA 4HXGA 1NVWQ 4MR8B 5LA6B 4CIXA 2MIIA 3H19A 1TE2A 5GV7A 4IEFB 4ZT2A 1ZUNB 1IHXA 2OG2A 4OKNA 5AM0A 3AK4A 4QVIA 3H9GA 3SQNA 2JH3A 4G0NA 3B6MA 4MH0R 1QDUA 4R1PA 2BBWA 4U4AA 5AJHA 2RHRA 5DHTA 1BAPA 3ZD6A 1QTNA 3AR5A 4YALA 2QXYA 4ON9A 3P5SA 4XLTA 2BFOA 2C61A 1YQWA 3CUYA 2HBQA 4EWLA 2VHCA 1ZNWA 1HE2A 1OHHA 1W6UA 1E4VA 1YRBA 1ZUD1 2RBEA 1WXWA 3KKZA 2NXCA 2QTHA 3P19A 4N0DA 1UADA 3PQEA 5DI3A 3PL5A 4MB0A 1DJNA 3BL5A 2HMSA 1DWOA 4MINA 3TI9A 3GRKA 3ZHCA 5I9TA 1U28A 4FCVA 3H18A 4X3PA 2I9PA 4TS9A 4O2RA 4X1YB 2MYTA 1DOHA 3CSUA 4OQFA 5AK5A 4CMKA 5E2IA 1YB2A 1PDWA 4H4DA 1R0YA 2HR1A 3IUEA 4JBXA 5EIAA 3WWCA 5TMBA 3I92A 3RS3A 1D9XA 1MXHA 2IKQA 5B2EA 1LI5A 3I23A 3DVAA 4HGPA 1XU9A 2YQ5A 3WSTA 4C76A 4CF4A 5AJZA 3V1UA 5KEIA 5TB5A 3PPXA 3M5DA 1F06A 1KJ8A 1QPGA 4Q37A 1L3IA 1JBQA 2WP0A 2HIMA 2PZBA 1VKJA 2Z2JA 4FMCB 4D9HA 1TK3A 3JQAA 1WZ2A 2BFMA 5CD1A 3JRNA 4TYWA 1JMVA 3DWEX 3NT4A 4D9FA 1KDRA 4IDAA 4BO4A 2CMFA 1NBAA 2JBAA 3OOWA 1P6XA 4ED9A 3MRTA 3LOPA 1H6AA 2A7QA 2NYAA 4DCOA 2C1EA 2FEMA 1X8JA 3DM5A 1L7XA 2JH8A 2GSWA 4MUKA 4NVRA 4WY8A 2V6IA 1XMXA 2NTVA 1S2DA 2DUNA 1E7RA 2AMLA 3SHOA 4B79A 1N32B 1N5IA 4G4SO 4H6WA 3V7UA 4GYWA 2ERXA 3TW0A 2CLFB 3W78A 4X91A 4UNRA 4KGXA 3DF9A 2P0AA 2JVKA 2QN8A 4OLAA 1RS0A 1T4DA 3HO1A 2WUEA 1JYEA 1E6LA 4GWLA 4F8JA 2JG3A 3UCXA 4YAGA 2LDXA 1PNOA 1Y9EA 3I4LA 4GE3A 5DHFA 3CRQA 2DSNA 1KJ9A 1O3YA 4O1IA 2QSUA 3V8BA 4LE1A 1Z0JA 3QK7A 4R5HA 3KV3O 1T3GA 2HIGA 4LY6A 3U9SA 4AUNA 1IM8A 1XCPA 1P1IA 3A1CA 3OJWA 2VP9A 3P9XA 3C24A 3GP5A 4Y2GA 4B3BA 5ICEA 1E32A 3DP7A 1EM8B 4M7WA 4ECAA 1FSGA 1YQEA 2WTUA 3M1IA 2GEJA 5IBPA 1EXNA 4BB9A 1EG2A 4G1CA 1ILEA 2QGNA 2GNAA 4ND8A 4PZUA 1KDOA 5A5FA 2HHLA 1V0JA 3P0EA 1OT3A 1LJLA 1B8PA 5CVDA 5I7AA 1KDTA 3ZLBA 3C8ZA 4F7DA 5DTEA 3CKMA 5BV1A 5HK9A 4LAFA 3WZ2A 1FS4A 1HKHA 2COUA 1QWSA 3M2PA 4PGGA 5GJBA 2YWCA 2X14A 1RXWA 2W22A 2C2BA 2WV7A 3H0EA 1HOTA 1MB3A 3MUEA 3EDOA 4HDQB 5DNVA 2IYNA 2ZULA 2ANBA 3UFBA 1KORA 1Z2DA 4RDIA 2RH5A 4KRXA 2HK6A 3O8QB 4IFBA 3ZE9A 3CLTC 5F12A 3CWQA 4HMPA 3LUCA 1J9ZA 3DHEA 3BFKA 4C0HA 1RRFA 4GF5A 2FU5C 1KXZA 3SLRA 2AMJA 2CSUA 2ISSD 1MW8X 1E1YA 2C9CA 4O0LA 1ZAYA 1VI6A 5DNWA 2BAGA 2BFWA 3R09A 3JWGA 4AWBA 1XEAA 4Z1OA 1N6KA 5JLJA 4DUGA 2W2KB 3K32A 2OHIA 1EVYA 4WJLA 1I3CA 1K5HA 3ZDCA 2VYFA 4OX9B 5AJWA 3TSOA 2GCEA 2F3RA 4ZAVA 3PNOA 4RSMA 4BFYA 4DV7B 2NV6A 4HRAA 3SEQA 1UZNA 3WLSA 1YK0A 2OY0A 4PZDA 2ILVA 3K16A 3IODA 1E9FA 3LZCA 1WXIA 1VCNA 1N6NA 2XSZA 5HRCA 2JLRA 1YVDA 2FX5A 5IAGA 3SX2A 2EOAA 4R8RA 4NYJQ 5DGCA 1BWQA 1VJDA 4MVJM 1FS5A 2OBYA 3KPVA 3S5UA 3JALB 1DQNA 2C9YA 4JIGA 5DM2A 4Z0PA 5KTOA 2D00A 3HA7A 5EMKA 2PSJA 4MK4A 2BFPA 1U8FO 3ET5A 1O0BA 4RXTA 2O3UA 4R8SA 1D4OA 3KFXA 4A92A 5BW8A 1E1NA 2H4YA 3GJQA 1KEVA 5CK4A 1NLZA 3TS1A 4M8SA 4EKGA 3K2EA 4A2QA 1LDGA 4X1IB 5LWQA 1D2CA 3UGQA 1GQOA 2XMBA 4DYVA 1BCRB 3BMNA 4GI1A 5E8JA 5IC4A 3A6GA 1P7ZA 4AJIA 4GL2A 3ITKA 4C7KA 2IZOA 3EC7A 3K7EA 2C2HA 2CYBA 1SUPA 3GRPA 1R0SA 1U3WA 4XWAA 5EUCA 4L1KA 1PD1A 4EYKA 4J49A 2XYRA 2Z09A 3BCRA 3DLIA 1YVPA 1P2TA 2DX7A 3EY9A 3W2FA 5JNVA 5C51B 3L1UA 4LNAA 4R31A 1MG0A 4H17A 1A9TA 4I4CA 1AUVA 3RODA 3W8NA 1JB1A 1F5SA 1NJSA 4M1QA 1F8FA 4BB6A 3CUSA 1DRUA 2EU8A 4IOLA 4FQ8A 1Y1RA 2B82A 3SSOA 4RKWA 5CVCA 3DE3X 2E49A 1RM4A 2WU8A 4R1LA 3TBHA 4EKIA 4YXWD 1RADA 4RH0A 4ZQCB 1OI2A 1ULTA 3QQ5A 4JR2A 4M9SA 2R60A 4AP5A 1ZVVA 1PLLA 1U1EA 3S44A 3L0ZA 4LJYA 5LWHA 1W25A 2A1UB 1OZHA 4DR4B 5B3LA 1PW5A 3IALA 4B71A 4HH0A 1MTZA 1SUWA 1HM5A 2FTKE 9MHTA 4IINA 1MB2A 5H70A 1C9YA 1TUIA 2KMLA 3A9WA 2H2FA 5EE3A 3T7RA 2O2SA 3DAPA 4BZQA 3SJ7A 2R2GA 4JUDX 1FX0B 3E5NA 1Z7YA 4XFDA 2YY7A 3B51X 3I72A 2PSFA 5CRIA 3R75A 5HFJA 2PXCA 1R0KA 3DHWC 2OM2A 1XXHB 3VNAA 5K8JB 4R71A 2QV0A 1L0BA 1LZLA 2OV3A 4KOEC 1EAMA 3OU7A 1T1GA 2XA2A 4ZCMA 4OP1A 2BFBB 4B6SA 1H5NA 1PL0A 2I87A 4DCGA 2XUPA 3FNIA 3P2IA 4PPFA 3TPZA 1U2DA 1G3RA 5IK2A 1W93A 1V6SA 1JJVA 1U7XA 1JQBA 2AB0A 3IDOA 4N40A 4ZO9A 2O5CA 4LJ6A 2OO5A 1SA0A 4FX5A 3R9WA 1VLHA 3EWAA 3QUAA 1P62B 1ZK2A 1CFJA 2CB9A 2CFIA 4F04A 1Y3FE 3N8KA 1KDYA 4C5CA 4MWCA 3FPJA 3W5UA 3ZYZA 3K6SB 1XROA 1D2GA 4FUTA 4HQFA 5GMOA 4LRWA 5LUBA 4ARVA 3QU5A 2GXQA 5C8ZA 3TK1A 3WAGA 4UAUA 3HYCA 3H42B 4WDRA 4Q00A 2E48A 4HDRA 4WN9A 2OHVA 4RH1A 4AZ3A 4RV4A 4XASA 5KVQA 3WLJA 2FFAA 5DCYA 2JLVA 4AMYA 5DBOA 2UZ0A 3OA2A 4PG4A 4TYYA 4FI3F 4AL4A 3KOXA 2QTBA 3LHFA 1SQ6A 3AHJA 5B7NA 1H3FA 2Q1SA 2QTVB 3FPBA 3U0VA 5IULC 2IYSA 4F21A 1GFIA 2EG9A 4PNPA 3VAAA 2FMXA 2QW1A 3M0EA 1XEXA 4TMVA 1Y9DA 4FW9A 3UMSA 2CJFA 1I6KA 2CC2A 3A14A 3GDWA 3OETA 1KRXA 2H6EA 2XTZA 2LV8A 1KYWA 2H5IA 5EFOA 3WYGA 1FU8A 2PLAA 3N2YA 5FQNA 1RRVA 3QKWA 4BMDA 1NBIA 1PDOA 2WICA 1Z0AA 2IOQA 2ZCJA 2IY9A 3RSHA 2GJ4A 4N49A 4KKVA 4XFJA 1QB8A 4PSCA 4W9RA 1WCIB 5EKDA 3W5VA 3WGIA 4PO3X 2VK8A 3NONA 3DGEC 3P0RA 1NX9A 2IXEA 3OX1A 1Z68A 1XD2A 2O7NA 4EHHA 2V7VA 1PQUA 4X84A 3AW9A 4P0QB 2ZK7A 4RHCA 3L4EA 3B6ZA 1M5TA 2ZVPX 4HH1A 3HA5A 5CVTA 4LVCA 3BE6A 3H8JA 5DYYA 5EE9A 3B5JA 3KYBA 3H1EA 3K0HA 1PJSA 2VJOA 3O4JA 4DOMA 3HXQA 3RQIA 3MCZA 4MVJI 3F5SA 2WSLA 4KZPA 5DNUA 1XZHA 3M3DA 1LD3A 3HFJA 4E07A 2VQDA 3GU3A 4GPTA 5CEFA 1W36B 1PNVA 3HLYA 3L40A 1AX9A 1JLLA 1G7CA 4PPYA 4OB7A 3I0MA 2UKDA 4OHCA 4YMHA 4IYRA 5F21A 3FYUA 2ZM5A 1KO1A 4EA6A 2Y0EA 2CL5A 1FMTA 1WD7A 2P78A 3BRSA 3EVGA 3HP7A 1Y0BA 1V71A 4LZJA 1C30B 1V8PA 2B1QA 2A9KA 3ENZA 4Q7EA 1ICIA 1M2WA 4YROA 1ELOA 3RK4A 1NW6A 1E77A 1XZDA 3U6KA 1EFCA 1U4OA 2I91A 2G4LA 4P54A 4U6SA 4C43A 3FTDA 1HO3A 4JLDA 4D6XA 4BUCA 4IX1A 4PQEA 1ZSYA 2PZKA 4YPVA 3HA3A 1AMUA 1TCAA 2WPDA 1S2OA 2C5LA 2YHBA 4RMHA 5JWHA 2GJ8A 2DECA 2QLJA 4KG7A 4R69A 5FNZA 3DTVD 3ELWA 4D5EA 5HGXA 1PEYA 2JC3A 2V6FA 2PANA 3OPMA 3OCXA 2BR5A 1MV5A 4GX2A 4RU1A 4C06A 3EXG1 2YQZA 4NMLA 4K0RA 5DASA 4DLTA 3W7VA 4MRMB 3WB2A 1G8MA 4NC9A 4BJ5A 1IYZA 1P5HA 3M1YA 5YASA 2X2FA 4UU0A 1PBTA 3PEVA 3W7AA 5BYKA 3L8HA 2IDMA 2I4TA 5TY0A 4LJ9A 4UOEA 2IWHA 1AKRA 1SB9A 4YO8A 4D45A 2I22A 1QP0A 3JYQA 1V4BA 2JKVA 4XB1A 3JR3A 1REQB 4B3DA 1CERA 4UBMA 3WRYC 2AYXA 3QBEA 4QHYA 3NX4A 5DB4A 4HQRA 4WVLA 3K1YA 4D79A 1PJBA 4JC8A 4A36A 2GDZA 4P38A 1TW3A 3ZDRA 1M6VA 1K92A 1ZESA 2WG2A 1L1EA 3KLNA 3QMPA 1ONPA 4Q03A 1HLDA 2N75A 4GI5A 4QYIB 1SBHA 2RHLA 4Z9FA 3TL3A 3ZCRA 2RHHA 2ZUUA 2R8YA 2CD9A 3WB1A 2XD4A 1E6WA 2L82A 4V0SA 3RTGA 1GCUA 2C20A 3FE2A 1G5TA 1NMXA 3K4HA 4IQ0A 3KR1A 2QMQA 3I2IA 1MOPA 3F6CA 4Q3CA 4WACA 3SE0A 4C04A 4EMUA 3A3KA 4PE5B 2PGDA 2HXSA 5C37A 2CK3A 2O7RA 4KPUA 5LP6A 2A9QA 1FNSA 2FSGA 1J0CA 1RLUA 2FZKA 4HX2A 4KE6A 1IXKA 1XA3A 1Y80A 3C39A 3PICA 4IMPA 5HBGA 1SD2A 4DQ0A 4ICIA 1X3LA 5K8IA 5LQJA 2EARA 4YJ3B 4KQ2A 2I2BA 1GU0A 4MEBA 3SAJA 4HPWA 1LFAA 1XA4A 4Z7OB 2ZT8A 3C1OA 2AT1A 3PXXA 1YMUA 4NATA 4KITB 4KH0A 5JNUA 5JQGB 2Z5LA 4OXKA 3CUKA 2NO1A 4LA4A 1G1MA 4Q05A 3RVJA 3WDSA 3ZY3A 3FOZA 2AR7A 2CXUA 2H4FA 3VKUA 4B83A 3B1KA 4URZR 4NSNA 4FFMA 4NJOA 1V1RB 1W96A 2YJ6A 4KRYA 4YASA 4H59A 5DNYB 3R0QA 1KDPA 4Z9YA 2X1VA 1N6RA 5EP1A 5GWXA 2X8BA 3SJZA 1U1IA 1MABA 1XL1A 2IVZA 3PTLA 3JWPA 4IUBS 3BHJA 1ZWLA 4KWIA 4HGNA 2OXIA 5FX2A 2PPLA 4PAMA 1IY9A 2B9VA 3FGNA 2PA3A 2HU5A 4KXYA 4CMJA 4LFAB 4EFDA 5BNFA 4E5MA 2JJ2D 4H3KB 5E8RA 3MAGA 2CKMA 1M6HA 2G6TA 1RXSA 1ZN2A 1CY1A 3DO8A 4KP7A 4P98A 1PSZA 4QDUA 2KQUA 2PJUA 3THWA 3DM9B 3OWXA 3MJDA 2N0SA 5COQA 3A2NA 1R4ZA 3MGBA 1RD4A 3SS9X 3M6XA 4CM8B 2VK1A 4J2TA 1LVHA 2ZBGA 4L15A 4DQVA 3NDPA 4RX1A 2IYFA 3HU2A 4D3FA 4O1MA 3BT7A 1OFGA 4ZVMA 1XEWX 1Z0UA 3WYDA 1WXGA 3BL8A 3TI7A 4WRRA 4EIWA 5G02A 3TINA 2JIRA 5E9QA 5U1PA 2IU0A 5IJ0A 1Q1GA 2Q1TA 3M1LA 1TIKA 1V1MB 4JT9A 4IICA 1JEOA 1WEKA 3R7FA 1YDMA 5I7WA 4QWWA 2ZXFA 4Q4DA 1UM9A 4ZU3A 3BXPA 2HCJB 1CZHA 3HN7A 1M2GA 1NMQA 4M8NE 4D4KA 1RXVA 2RHGB 2CMDA 1BU8A 4JBIA 5JASA 5BOSA 2BWJA 4MJXA 5D87A 2WKPA 3TR6A 5FH9A 5FFMA 2EIXA 5AHWA 2EP5A 4G07A 3UK1A 4CRWB 3AQ4A 3HYRA 2PRZA 1SU8A 3UO8B 2BGNA 5B3AA 2FDXA 1ZICA 3BQMB 3EGOA 1H8EA 4LTNA 4I55B 1DFHA 4PYLA 4QPPA 1GEGA 4P2GA 3S99A 1RC0A 2JJYA 3WLRA 3H4IA 4FONA 1YOVA 3LJKA 4K9NA 5EUMA 2DAPA 2XOEA 1U0JA 5HIAA 3R7WA 3P1JA 2QUAA 1X9HA 2B4YA 2QTRA 1N5KA 4HWOA 1FBTA 1ORTA 2R1ZA 4Y6GB 5DBIA 3PEYA 2R6CA 5CXXA 1GKKA 1XLWA 1KZ4A 1CQIA 3JAWA 3VAZA 4OKSA 2Y1WA 2GEUA 3ABOB 1VMKA 3NALA 1H0RA 1VG0B 1E9DA 5JS7A 2VJNA 3EXFA 1GG5A 1PVOA 4OFBA 4D9MA 2O8BB 1XVIA 4I46A 1QG4A 1RPNA 2QY6A 3AKYA 1GILA 1THMA 2VDRB 4BBPA 1JL3A 4BNFA 3UJ3X 1Z6AA 5E6RA 1QDLB 2OBFA 3AUYA 2FE1A 3BK2A 3JZMA 3OIUA 4FDVA 4QUJA 3RYIA 3WY9A 3B7WA 4EECA 4GBED 3KEFA 1WSWA 3I39X 4BNZA 3N0TA 1LQ2A 1IEQA 3ONEA 1GQ2A 5EHIA 4ESEA 4PO8A 2AWOA 4MR7A 3QNUA 5ALFA 4DNQA 1BE8A 4Q3KA 5AK6A 2C58A 5C8XA 2VT2A 3LX4A 5CIWA 5BWLA 1C14A 1UM8A 1JDTA 1QNLA 3KJIA 1M1ZA 2PYZA 2Y67A 1JHZA 4ZN6A 2F17A 1Y9JA 2GLTA 1HX7A 1XZLA 1ZK4A 3TB6A 2QJFA 4KV7A 4QOEA 4WBNA 1ZH6A 1KI4A 3HKBA 1U5CA 1HYGA 5B2FA 1EDZA 4XVUA 2HKIA 4FKBA 3V9AA 3AJ9A 3EJWA 3JQAB 2W0MA 3R3SA 3SQOA 2H85A 3WLKX 3SM9A 3LQ4A 2MSLA 2PH5A 4UQLA 2Q46A 3TQSA 2JBAB 3V1NA 3ZQ4A 1QYRA 2WB4A 4QGGA 1EXDA 1AV6A 4IEIA 2DQSA 2Z43A 3URKA 2ZBQA 5K0CA 3WL7A 2GYVA 3KKEA 1M8FA 3H4VA 4M8LA 2WWYA 1GNLA 1XZIA 1N5DA 2RK6A 2W2QA 3NUGA 2P2GA 4S1WA 5I8ZA 1IXRC 1IHPA 1ORDA 4R41A 1SK8A 1Z08A 2R85A 1N0IA 1IRIA 4UM5A 1BDJA 5ALIA 1A9SA 2ZPAA 3RSGA 3UWSA 3RJ5A 4LN1A 2MYNA 2O1XA 2WPNA 2ACKA 1GGHA 2WM3A 2HA3A 3TN7A 3O90A 5BWOA 3HV0A 3INNA 4FZRA 1NU6A 2D1SA 3KOWA 4M0EA 3WFJA 1NKTA 2EW2A 4G8JA 2QMHA 4XWWA 1CJSA 1M9NA 1PX2A 3FRJA 1N4AA 3V8NA 1UWCA 1P9WA 5AVJA 3RHFA 3VH1A 4BXOA 2XH8A 3LT4A 3B13B 5ALVA 2XUFA 2AV6A 2QYHA 3A4LA 4GQBA 4DHWA 3DMPA 1M8GA 4EP1A 4MPDA 2VDNB 3WLOA 3GAAA 1VGRA 2YXDA 1DKOA 2NV2B 2PV0A 2JW5A 3DS8A 1IPFA 3C6YA 4PLFA 4WKPA 4P5PA 4G5QA 1T2DA 3L6RA 4ND8B 5CBPA 4OU5A 3PPWA 1TCUA 3ZLJA 2PZAA 2C7OA 4B6FA 2CSXA 3DR5A 1TOAA 4L07A 1HR0B 2P9EA 2A58A 4X7BA 5HIKA 4L16A 1WLSA 3DT6A 2OC9A 4CGYA 3U81A 4D41A 1EGQA 4KVGA 3ZBPA 4V1CI 1T9AA 5ECWA 1OWPA 5K6RA 2X3FA 5AVRA 1ZGJA 4DZTA 5CYGA 5HF8A 3GUVA 3ORSA 5BW4A 3JQ7B 2GBGA 1PAUA 2NTJA 3HJTA 4LZLA 3AY3A 4YHHB 3VFDA 1RRKA 3OAAD 2WJAA 1QPZA 2HW8A 1OJLA 2VR1A 4KR7A 2WYUA 1OBOA 2FWRA 2IYQA 4LJ5A 3HDJA 4PCAA 4QYTA 4KBFA 3G13A 4FD2A 1T8RA 1EPUA 3MJRA 1XGKA 4MLPA 1SVNA 3T95A 4HNSA 5ARDA 3OD1A 3S7ZA 2JGFA 3IDAA 2DPXA 5DTQA 3ZIUA 3AETB 3PQ4A 4YWHA 2HQBA 2DTEA 5JPIA 5THQA 1SB8A 3UNXA 3IEKA 1QZTA 4XUDA 2A4KA 3B89A 1VMEA 1XQ9A 4GLOA 2RGNA 4BP1A 2H7CA 1KBOA 1EFPA 3MWFA 4S1TA 2W0SA 2QAJA 1M2NA 2VPZA 1CR1A 2P75A 3OCJA 1TL7C 2Q8QA 4L5IA 3TUZC 2DFTA 4X9XA 4JLPA 2NTYC 2F59A 4PG6A 3W8EA 3R5TA 1XZPA 3KFVA 3MILA 4RZHA 1K5DA 2I2WA 5K20A 1JXMA 4RTPA 3WGMA 1O6GA 3G5MA 3O94A 4BS9A 2EEPA 3AVOA 1SOMA 1OXVA 3RSQA 1PQPA 5KU1A 2CFRA 1W30A 3IOBA 1RQPA 2C5AA 4F4DA 5CB0A 1E6CA 4YMLA 5J23A 3CPEA 3H3JA 3T8YA 3V42A 2ZB4A 4Z54A 1KYQA 4K3UA 3MINA 5JI3E 3UK7A 1IWPB 3U7HB 4FR0A 2YFQA 4NBVA 3X2EA 3QMVA 1EQ2A 1RE0A 4NCAA 2VNHA 1N3LA 1T3SA 3DAHA 3HO8A 2J32A 3OZVA 2YJZA 3IEVA 2VG8A 3G0IA 1XI2A 3KQKA 2H1IA 4ZV7A 2EKLA 3NH6A 5EIBC 1FUYB 2BSAA 1UXGA 4P53A 2OORC 3OFVA 4ZRMA 4MB2A 1L4LA 3ZCUA 2G5PA 1RWMA 3M6IA 1ZVJA 5FBVB 3QKUA 4E2FA 3ZGNA 1KJIA 4E5UA 4MEAA 2Y0DA 4QQRA 4BNHA 3B9BA 4LF7B 5FIUA 3KWJA 4ZOAA 4IS3A 4D8UA 3AHCA 5K3CA 1T0IA 5LB2A 4KUHA 4KSCA 3HWWA 4B09A 3VJRA 3FI9A 4INOA 4JI2B 2OZKA 1CULC 4NR0A 1QCZA 1D0IA 2P68A 4KTTE 5NULA 3NXKA 3UFXA 4RHEA 4Y3UA 2C7RA 4R2WA 4ZOLF 5EVJA 1RJEA 2FGKA 2JBHA 1U0RA 3OZFA 1LBQA 5ALUA 2PLWA 1KVUA 4S2EA 4LXUA 5CW2A 5K3FA 2LZ0A 3UH1A 1ENYA 4NY1A 4X62B 2I6TA 2YUIA 1SXJE 2PCLA 3AF4A 1GG2A 1G8GA 4JLBA 5BVHA 4IIGA 2NN3C 2HX1A 2JAWA 3I61A 1PJCA 1Y4SA 3LG2A 3E61A 1L5OA 2YN2A 4H7FA 3DA8A 3BRQA 1J22A 4IILA 1ZNYA 3HGQA 3ORYA 2II6A 4KXLA 2IW1A 2NSJA 4BAZA 4G1EB 4RK5A 2XJ9A 1XPJA 3IQFA 4XRGA 1OQAA 1RI2A 3KYDB 3VSCA 4BLSA 5TIIA 1UKYA 4L5YA 4RD4A 3OLXA 3A28A 5TQJA 1TK2A 4FB4A 1SA0B 2XWQA 3KZ1E 1FVXA 4MV6A 2WZBA 2MMGA 3I1YA 1SKBA 4M0DA 1XPOA 1JHOA 1Y3IA 2IU4A 3MMPA 4MS1A 1S3FA 4BVFA 1L9XA 1Z39A 1VJRA 3C7CB 1UBTS 3F3YA 3VVCA 5EXPA 4ARSA 2HFJA 5FL3A 1DLJA 3SFVA 4BDSA 3DOUA 3GVCA 2FSVC 5CR9A 2LIPA 3D7LA 4X7MA 2UYYA 3CBQA 2QRUA 2V6MA 4HDRB 1C4XA 2E55A 4PR0A 2FPOA 4QASA 4WN9B 5TX7A 3SDSA 4AZ3B 1QB7A 1UR5A 3HUEA 2WIAA 4Z2YA 4CN8A 1HG1A 3KV1A 1G7SA 4O2AA 4MKIA 5KAPA 1KDZA 1A8IA 1C3XA 3CEPB 2I2CA 4DLUA 4MARA 2GJSA 1XEXB 1L3BA 2VAVA 4TXHA 3G6KA 1MGOA 2VZ0A 4TOIA 1JR4A 1TMOA 3C7TA 3FRHA 2BUAA 3KSRA 3VUEA 1GL7A 3ROFA 4GXTA 5IX8A 1VE3A 3Q0IA 2JIZD 2BL4A 3H6HA 4MP8A 1ZI6A 1SOVA 4ZPJA 4IWNA 1XTUA 3MTGA 3RGWS 1MAWA 3FZYA 1VXRA 2HUNA 2VDWB 1PJ8A 2RGGA 2ZJ3A 1A5BB 3DOFA 3AJRA 3F9RA 3LOUA 1KQGA 5GIPE 1UPBA 2WC1A 4LXXA 1SVWA 3P2KA 1MN6A 1PFGA 1V5WA 3CX6A 5CURA 4CKYA 3WZMA 521PA 2OHXA 1OR8A 2YJGA 1B0PA 1H2RS 1XD2B 4MVXA 5FBQB 4ONEA 3AF0A 1QFMA 4L3WA 1GYRA 1ISPA 3IUPA 3ZS8A 2WWWA 5H5JA 1DC6A 4EF5A 2IDKA 3EXIA 4MP6A 4XX1A 2QLBA 5F5NA 3GAZA 4O02B 2NWQA 3IMFA 1U7UA 2WAAA 5SY9A 1IZYA 2QR2A 4Z9AA 1K6EA 1WPRA 1LGYA 3WGLA 2JFWA 4N6OA 4PBTA 4G8BA 2NU7A 3T52A 1ETUA 2VI5A 3C3XA 3C5WP 4H7JA 4IXNA 1MU0A 5IWCA 1CFZA 3SK0A 1ONSA 3U2QA 4JT2A 1JLLB 4UMFA 1SGWA 3EIOA 2DPLA 2O20A 1J97A 3W79A 3QKSA 4QLBA 3FYUB 1N2OA 3LPAA 2ZU6A 2FUEA 3CIOA 1DTWA 1K3FA 2JFBA 3D0OA 1TUEA 3FCEA 3HACA 4Q3LA 1RQXA 4IQ8A 4B73A 1Y4DE 2I03A 2O14A 2W4MA 2BMFA 3GJYA 4HB4A 2CFOA 4JLWA 1BX1A 3VPSA 3RC1A 1MFPA 2P27A 3OM1A 2B78A 4NEQA 4AS2A 1DQSA 1ZK1A 1SY7A 5DT2A 1NJ8A 4IVNA 2XCRB 1GPMA 2PT7A 3G7NA 4PG5A 1O97C 1PZNA 1L5VA 3IJPA 3LYLA 5L3SB 4EJ0A 2I4MA 1SHZA 4WKOA 4BO5A 5JQWA 1L8LA 1RXUA 1P1FA 1W36D 1FUUA 4ZGBA 1JFFA 1YJQA 3FNEA 4H4EA 2ES4A 1U3DA 2AE2A 1U7WA 2I4NA 2L0XA 2OK7A 2XYPA 3FPEA 4ZZ1A 3JD4A 2I4LA 5IT9A 1NUPA 3ZQUA 4UNIA 3UHPA 4GPZA 5K03A 3CV3A 2WABA 4HQOA 1SRQA 2GDJA 4AT1A 3PSHA 3NTLA 4JP8A 4TT3D 3TBFA 4EEZA 2OHFA 1R9GA 1K98A 1V47A 3KYJB 4PFSA 5IH3A 3KJZA 4QVGA 1YJAA 2FUKA 2QX8A 3WOVA 1A72A 4QBFA 2ZUBA 5IXSA 1LF0A 4P81A 1E1LA 1CVLA 3FOBA 4I66A 4MCAA 2F43A 3ID6C 4JQSA 1QTIA 2WSIA 2E87A 4DN6A 1M6VB 1SUAA 3FM9A 1I4OA 5BSVA 4TXMA 3FKJA 2VP0A 2X58A 2QW0X 3JQ8A 5EUQB 4F2WA 3E84A 1M72A 2YTZA 4JGGA 3TSAA 5LMCA 1M2VA 3RVNA 4YUYA 1RYBA 2WVAA 3TTXA 5CYFA 1Y9ZA 2VJMA 5PNTA 2C97A 3X1JA 2SBTA 3FFTA 4HEA6 2IKSA 1MDBA 1YS4A 1B3BA 4KPUB 5LP6B 4JBYA 2G04A 2QGZA 2JZNA 3HB4X 3NEJA 3RT9A 3CF4G 3LQYA 4G5SA 4M1YA 4XQGA 5JEDA 1W581 2ZQZA 4P9NA 2QBYA 4OFWA 5JS1A 3HEBA 1FPQA 1Z18A 4KO1S 3SF8B 5JATA 2DM6A 5F64A 6Q21A 2FLWA 5KTKA 2EFHB 2VDLB 1V6CA 2ZUEA 4CFZA 1XTRA 1OB5A 1AGNA 4C2AA 4WKBA 3F90A 1T91A 5FBHA 4CR6A 4KGVA 1RQ7A 4PBSA 2HMWA 1E61A 2VSXA 2ZRKA 1G2OA 1DQPA 3NORA 2WY2D 1KFEB 1OXTA 3AF5A 3FF1A 3ORFA 1KC3A 1TF5A 4EJ2A 1KMNA 5KCMA 1C80A 4EHIA 3I5XA 4IIHA 3LRPA 3MYRA 4CG0A 3EGIA 1MVOA 3UUEA 3A37A 4CQLA 3KFLA 2X4IA 3WOHA 4CIVA 1H2WA 2HO5A 3IULA 4UTRA 3GRVA 4X71A 4DG5A 3D4LA 4HNGA 5JSKA 3TSWA 4C4PA 4NPCA 4M0MA 3C7AA 4MWTA 1HL3A 4B43A 5A9SB 1UXKA 2NO4A 3H2JA 1KGSA 2ID4A 1DG3A 2X5KO 1AT1A 3OU6A 4AULA 4GBJA 3QJGA 4KE9A 1I3OA 1OJ7A 2YIJA 2WZQA 2B3TA 3ANYB 1JHYA 3HM9A 2P3LA 4MW2A 3ZHOA 2ACWA 2JCYA 3IRVA 1EX9A 3BXXA 3KKPA 4HGRA 5JIBA 2MYPA 3LT2A 4YRKA 2D2XA 3QVXA 4GZ5A 2XRYA 3WGHA 2LWIA 1E64A 3FETA 3VC2A 5DHSA 1KQPA 1PG0A 1E5LA 3SEFA 5B4UA 1B15A 4DIMA 4E11A 5ITWA 1Z5OA 3GLHA 1ORVA 1QIHA 3G1TA 3G0OA 4DWWA 5IJ0B 3R8CA 5GONA 1CK4A 1NVVR 1DUSA 4G86A 2QUBA 4XGQA 3V3TA 1OUMA 1E98A 2QENA 3W6PA 1QYVA 5I7UA 3B38A 1KI9A 2IL1A 3NT5A 3O75A 3MK31 3ADBA 1I2AA 3H1FA 4W4TA 4GT1A 5BOSB 2G0NA 4Q4JB 1S2LA 3E35A 4PLHA 4LVNA 2ZBPA 1BEZA 5I8PA 4ZHQA 4XYLA