4DWJA

Crystal structure of thymidylate kinase from staphylococcus aureus in complex with thymidine monophosphate
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
203
structure length
200
Chain Sequence
SAFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRKIVLEGNDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNSRDQNRLDQEDLKFHEKVIEGYQEIIHQRFKSVNADQPLENVVEDTYQTIIKYLEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Thymidylate kinase
publication title Crystal structure of Thymidylate Kinase from Staphylococcus aureus in complex with Thymidine Monophosphate
rcsb
source organism Staphylococcus aureus subsp. aureus
total genus 81
structure length 200
sequence length 203
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2012-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4dwjA00
4RSGA 1N5IA 3CNNA 4LY6A 5HZKA 5JEEA 1G64A 3K0EA 3ZGXA 2RB4A 3FKSD 4M21A 3PUVA 1N6NA 1Q12A 1EWQA 3GLHA 5CLQA 1E3MA 2YC2C 1Z6GA 1D2NA 2ZRBA 1ESNA 1T0JB 3W3ZB 4EPYA 1YZTA 3B1ZA 5CDFA 3BOSA 5AR1A 2F7SA 1E96A 1IXZA 2FFHA 3B1XA 1ZM4A 1E0JA 4OQMA 1FX0B 5L3VA 3B6EA 1CJUC 1KDOA 5H70A 2VBCA 1DOAA 3BORA 2ODEA 3EAQA 3TUIC 3RDPA 1AK2A 1J8MF 3EWAA 3Q3JB 3JVVA 4TLEA 1KOFA 2C95A 1B0UA 3C16C 1AS0A 1JECA 3ZD7A 5SZJA 3WRXC 1TQ2A 1TX4B 1NN0A 2BCGY 5C1BA 3SR0A 1ZRHA 2OUKA 1HURA 4Q19A 3VTKA 3SYKA 4FXPA 4B34A 1MH1A 1R5NA 1KDRA 1OYYA 1YZLA 2FFAA 4HB0A 5H1YA 3ADBA 4BFTA 1DPFA 3REGA 1WMSA 3TBKA 3BB4A 4HLDA 5B2ZA 2CCGA 1CR0A 3B85A 3JZMA 1IJFA 3M4YA 1TTTA 5A4JA 1IN4A 4TT3A 2OO7A 1XMVA 3LLUA 2IW3A 2VH5R 4JLBA 1N6OA 1YHNA 1KSHA 3VR6A 3X1DA 1P72A 2O8CA 3SJZA 1P5ZB 2QMEA 4JBWA 3GLHB 3ICEA 2V1XA 1T8TA 1GRRA 2CJWA 3N2IA 4CEHA 3H0KA 4NCJA 1ZINA 4XVQA 3WNDA 3KQLA 4M1KA 4EPTA 1A2KC 1S2MA 1NJFA 4H9GA 3AM1A 1JEEA 1EX6A 3IKJA 2BEKA 3HR7A 2G0TA 1OJLA 1T6NA 2A3RA 2Z4SA 3K70B 3RRZA 4US1R 3A1WA 4HZIA 1I4DD 1CJTC 1E0AA 1E69A 4HB4A 4RVCA 2RGDA 3GLIA 4PC3A 1S8FA 1IXSB 4P4TA 1MOZA 2XOKD 5TMPA 1CU1A 2YJTD 1JR3D 3GEHA 4QM6A 2WPDD 3WYGA 4DDUA 4WVFA 2VP4A 2NG1A 3HYRA 5GVRA 2FWRA 1KIMA 2V1UA 3RVBA 2GZHA 4QGFA 1VDZA 5B64A 2VO1A 4PHFA 5CK4A 3LVRE 1KHTA 4IW3B 4DLRA 2QPAA 4V0MA 5EJEA 1OB5A 1XD9A 4Z8XA 1JR6A 2RGNC 3RWOA 4BFSA 1W1WA 2C9OA 4GL2A 3U4QA 1CLUA 4M2LA 2G3YA 5KUTA 2W6JA 2ZS9A 4NP6A 3I92A 1YVDA 3FMFA 1ZM2A 3T1OA 4BLSA 2O8CB 3Q7PA 2BC9A 4RD0A 5EP4A 1GWNA 2OE2A 3NHAA 2PZGA 1DO2A 2CJWB 4TTQA 3ZVNA 3UK6A 4CEHB 1CR2A 1LS1A 1PLJA 1E98A 4B44A 2BKUA 4AG5A 3GCGA 4JL5A 3ZS8A 4PPQA 4C9BA 4LJAA 4C3ZA 1IY2A 4I1UA 5EZ5A 3LX5A 3TMKA 4C0SA 5BN4A 3C14C 2ODNA 3WMFA 3J81k 1E0KA 1PJRA 3R20A 1M7GA 4XSHA 5HR5A 2GEDA 1FUKA 2IYYA 2A7QA 4B43A 2PLRA 4RZ2A 2V7QA 3GLIB 3B82A 1E2EA 2FA9A 4TYYA 2ECKA 3ND9A 3EASA 1A4RA 3CKLA 2V9PA 3H84A 3HU1A 1A1VA 1U0JA 2IS6A 1SVMA 3WYFA 5FBWB 3K0AA 5DIFA 4NDZA 2OSBA 3P4YA 2BIFA 2D2FA 2IUSA 2AWOA 2WVJA 3SBEA 1GFIA 2D3WA 2O0KA 4OI1A 2CMKA 2JJ2D 3AVUA 3U4QB 2V55B 5BN5A 4DLZA 2FN4A 1GUAA 2W83A 4AYXA 4ZCMA 1G1MA 2WJVA 3PEWA 2C2HA 1UEIA 4IFBA 3UWKA 2E1RA 4MDEA 2QGNA 1GVNB 1PV4A 3OEHA 3OIYA 3AP3A 1GRNA 2EVWX 3P27A 2XXAA 4LZZA 4BECA 2FNAA 3BGWA 4MYUA 1OXXK 4V02A 1OXTA 2GCPA 4KLNA 3I61A 1P73A 3FE2A 5JS8A 3LV8A 2A5JA 3AKYA 4O3MA 2QA5A 1X8JA 2HCJB 2WJYA 1HV8A 1Z2AA 5LB2A 4M1TA 4U5XA 3DMNA 5EE9A 2FFBA 3FHOA 2E9SA 3HPQA 8OHMA 5AUQA 5HZHA 4FWTA 4IOMA 2V4ZA 5LD2C 1VECA 4ITRC 1GM5A 1W36C 1RYFA 2ZRKA 4DLUA 3K9NA 1XEWY 2DBYA 1E9CA 1OSNA 4R98A 2Z5FA 3K0AB 1Z08A 1EFTA 5G41A 4C4PA 4CT5A 3M0EA 2GBLC 2VSFA 2CLCX 3VKHA 1AM4D 1E32A 1WDTA 3FMPB 4IDQA 4OQFA 2H8KA 2GTPA 3WNCA 1Z0DA 2FG5A 4PQRA 4PR0A 3T5GA 4IVRA 1JJVA 1KI7A 1B23P 5FTJA 1VCNA 3B78A 1VHLA 1ANKA 3NEJA 4QJ3A 5FH9A 3CH4B 1YZGA 1LF5A 4UKDA 2ZEJA 1AGPA 2BJWA 1KMQA 1J99A 1NBMA 2R65A 4YXWD 3LAWA 3QXHA 2B8WA 5EP2A 2XXAB 3HJNA 1UBEA 2JLUA 4PTLA 3TAHA 1W44A 3KKQA 2XX3A 5IK2A 3IEVA 1DAMA 2WJJA 2ZI4A 4KITB 3O47A 3PJRA 1ZYUA 3GMTA 5CJ2A 1E2MA 2IC5A 5FI0B 5JRJA 3N2EA 2XSZA 1YZQA 2ZETA 1JAIA 2CCKA 1G3RA 1X8LA 1NJGA 2NO1A 3ASYA 3CB4A 4A8JC 1ESMA 3K1JA 1FMJA 1G8GA 4QGGA 5FTMA 1OKKA 2ZE8A 3FKQA 4D25A 4BWYA 5JJIA 4TLBA 4M8NE 1UM8A 3VKWA 1S1MA 3Q9LA 1AQUA 4L9SA 3AP1A 1GL6A 1U98A 3RSOA 1D6JA 4MGZR 3GJ4A 1WA5A 2PLFA 4L16A 4XWOA 4TZ6A 1U0LA 1ZUHA 1A2BA 5E7JA 2R6AA 1IN7A 2PCLA 2RMKA 3CRVA 3L43A 2IEYA 5FPHA 4B2IA 2Q3FA 1HE1C 2VF7A 3I3SR 4LBZA 3LWNA 5DNYB 2O8DA 5FL7D 2MSCB 1G5TA 3Q8XB 5FUYA 4LJ5A 1R8QA 2CEAA 3TUJC 2GCOA 1XPOA 2OFXA 1YE8A 1MO4A 3X1YA 2BBSA 3AF3A 4B3FX 4DLVA 4JYCA 2OLKA 3EPJA 1XJCA 1KK2A 2QM8A 1HE8B 2VHUA 2XITA 4M53A 4PZLA 3NIBA 4CVNA 4I99A 1M74A 2A2ZA 3DVLA 4NYJR 3U44A 3OFND 2JLSA 2CE7A 3NDPA 4CT4B 5B58C 4N3NA 5K8UA 4H1VA 1M7HA 1WRBA 1X8KA 1ZNZA 3I32A 2PT7A 5A5GA 1NN5A 2ZIAA 1ZJ6A 1ZW6A 1S3GA 1YR7A 4PSAA 1OV4A 1RRFA 3AH8A 3C41J 1KTVA 2C98A 2ZPTX 2JLVA 2Q9BA 1NN1A 2HLDD 1VCIA 3T34A 1HUQA 1EFHA 5KDLA 1Z0FA 4G5GA 1AIPA 4Q7KA 2J7PA 5JBQA 1GAJA 4JIMA 2O5VA 3TR5A 1QHXA 5EE5B 1EGAA 1X3SA 2BDTA 2OEPA 3RANA 2O8DB 4A6PA 4AG6A 4OK5A 2GCOB 4JYBA 4RCYA 2GJ9A 3VQTA 2G1JA 3K70C 4A4DA 2WICA 2GK7A 2F3TA 5KTYA 5GJVC 2ZS8A 3P1JA 4PHHA 1E9AA 4AKEA 3IPYA 1Q3TA 3EX7C 5BYKA 3CZPA 4MUBA 1HT2E 2QP3A 3B9QA 4G01B 2WSSA 4Q66C 2CHQA 2AFIE 2QAGA 4C0AC 4KFRA 4BZXA 5G40A 5KSPA 3MSXA 4QHSA 4TYQA 3RYTC 1T3LA 1L2TA 2AL7A 3PXGA 4E03A 5EE0A 2J5XA 2OZEA 4FMBB 4G5SA 3TLXA 3F0TA 2F1RA 4LHZA 4M1OA 2F43A 2IXFA 1GRQA 2BM1A 3CR7A 1T3SA 1SHZA 2G1KA 4M4SA 2AK3A 5DE3A 4YQFA 1GZSA 3F3YA 2N42A 4QG7A 4ZKEA 3AF4A 3PEUA 4OQNA 2ZVQX 2EFEB 5DI9A 2ORWA 2EYQA 2NO6A 1TEXA 3ZLJA 1NP6A 4R71A 2WV9A 1N5JA 5C2JB 4HDQB 2CE2X 2X2EA 2W6IA 3DZDA 3HR8A 4KYUA 5IF9A 3IILA 2WOOA 3LXRA 1JAHA 2C77A 3WP0A 1N6LA 4KU4A 2P5TB 2ZR7A 3CX7A 1K8RA 1QDEA 5CB6A 4BLRA 2QL6A 1BYUA 3KL4A 1P61B 2PCJA 3CR8A 3RHFA 4HLUA 3QE0A 2QQEA 4XH9B 3LBHA 5H8WA 3PUXA 2W00A 4D6PA 2A5YB 1C9KA 1ZD9A 1OXVA 1R0ZA 2F43B 4YMSA 3K9LA 1F6BA 4KI0A 3QG1A 3U3JA 3LW7A 3SHWA 3TAUA 4ASUD 1QHSA 1IM2A 3EZ7A 5K8TA 2ZM5A 1E2KA 1QHHA 3ZIAD 3DKVA 4B47A 5GVSA 1GKUB 3BBPA 3EIQA 3WNBA 4DB4A 3IQXA 4G0NA 5CIQA 3U60B 1RFLA 2CLSA 4L5BA 3EIHA 1GTVA 3MWYW 1COWA 2LKDA 4LJ8A 2A30A 5FPTA 4KLZA 2QSZA 2ZUBA 4MGYR 5DGXA 5G53C 3QXSA 1KO7A 2KI5A 3CUEF 4K8OA 2PL3A 2XZOA 4FMCB 2OCBA 2JLZA 4EFLA 4HLQB 5JJLA 2JA1A 3AF1A 1TEVA 1W4BA 2D06A 3DMDA 3ZZUA 2HDNB 1Z0IA 1PUIA 1E99A 1VIYA 1WF3A 2DWPA 4IOKA 2X19A 2Z83A 1UKVY 4PQYA 4BFVA 1IBRA 2OCAA 1N0VC 2IYRA 1XMIA 2MSDB 4YMVA 5CITA 3FPAA 4TTPA 3SDZA 2D2EA 3CW2A 1CS4C 3FFAA 1OT3A 1P60A 1M2OB 3I8SA 4AURA 4DC9A 3UATA 2ZJ2A 2VHQA 5EXSA 2VP0A 1NLFA 2NO7A 2NQ2C 3AVPA 1KDTA 2HF9A 4PHGA 1QHHB 3LY5A 2I3BA 1Y3AA 2FPLA 1DELA 1RPZA 2ODBA 4DRZA 1XXHA 4JKIA 1G8HA 4JSYA 2V3CC 2FF7A 1VG9B 4KBGA 5CLLA 5J5CA 2C9CA 3ZVLA 4B3XA 2FH5B 3AGPA 1MO5A 3U3KA 1KSJA 4V0NA 4OYHA 2WMOB 4YMUA 3AQ4A 2GETA 5CYOA 2NMVA 4WAUA 1P2UA 3KQKA 2FGKA 3SNHA 1XP8A 3LQRA 1ZCAA 1XTIA 2JDIA 4RD1A 1KI6A 3ZZTA 4AIIA 1Z22A 4M9ZA 4R2HA 2Q21A 4TMTA 4O2LA 1TF5A 4PC1A 3T15A 3IIJA 5J4LA 1U8ZA 3H2YA 1W2GA 3Q7QA 4KFTA 2D7CA 2ZJYA 3GEEA 1SXJA 3P20A 5JFGA 2QY9A 4QHTA 2V8OA 4Q1CA 4RD6A 2ZR9A 1OIWA 3LVQE 2EFCB 3RWMB 2P3SA 4D0GA 1E2HA 3Q5EA 1Q22A 2F6RA 4NPHA 4ILEA 3CLVA 3AV0B 1XXHB 1D8TA 2OCYC 3EPKA 4EPWA 2WWIA 3CF6R 4TYNA 1E2FA 4V03A 1LTQA 2F9LA 2P65A 3X2SA 2VHCA 3OEEA 4TZ0A 2NGRA 4LJ9A 5AUNB 5L8VA 1NG1A 2ATVA 4TTRA 4ARZA 4AYTA 1XRJA 2WKPA 4ON9A 4DHEA 2J7KA 2ODWA 4WIAA 1E2NA 1LNZA 1QRAA 1IY1A 1OXUA 2ZJ5A 5HE8A 3ASZA 4IKEA 3LXXA 2ZAOA 3RNLA 5JWOA 5DN6D 2OESA 3IDQA 4B3CA 4MDFA 3I1FA 2IS2A 3L2OB 3AKCA 4DWJA 2XJ9A 1KI6B 1N5KA 3LBIA 2IYTA 4D2IA 1KZ7B 4US0R 1VPLA 1L4YA 2C5LA 5GJWC 1U9IA 2CDNA 2RHDA 1SXJB 4GPTA 1W2HA 5J4HA 4F92B 1DAHA 2H16A 3SN6A 1E9SA 2Q9AA 4MYTA 1GG2A 2FOLA 4MKGA 3X1WA 2EFGA 3W6NA 3B1VA 2ZSBA 2DY1A 1KO1A 3EPHA 2O52A 1H8HD 2RHMA 4UXJA 1EFCA 3KQHA 1OHHA 2ZI7A 3QKTA 4V0LA 2LWIA 1W5TA 1Z8FA 2V54A 2VP5A 4HAWA 4PC7A 1SVIA 4D4MA 3K0CA 4QRHA 1ZUNB 1M1YE 2BOVA 3NC1C 4NCHA 4ARZB 4Q03A 1D2EA 3HYTA 4OJQA 3BFKA 2CK3D 2I1VB 5CDFE 2WSMA 4LOAA 3EXAA 1FNNA 3OE7A 1LY1A 3U61B 4AI6A 4UQOA 3AVXA 4TMZA 4X8HA 1Z6YA 1EWRA 1LFDB 1D9ZA 1FPMA 3OAAD 4B48A 1E0SA 1N0UA 5EQTA 1OIVA 1V5WA 4LC1A 4GI7A 3EC1A 4UNPA 1NLYA 2FSGA 3GQBA 1UJ2A 4KCGA 3SQXA 3AVYA 1J2JA 2FGJA 3MMPA 4LPSA 2ANBA 4G1UC 4MITA 1J70A 4HUTA 3TNFA 3UG6A 5F2EA 3BH6A 1PLLA 4QNRA 4CEIB 4FMCF 2QROA 1W0JD 2YNMA 1VG0B 4OHWA 1J8YF 2PT5A 2JIZA 2OBMA 4DUGA 3PG5A 3MFYA 4KSBA 2JATA 1X1SA 2ORIA 4EFMA 2B7CA 2Z6VA 2ZRCA 1UAAA 4GOXA 3RRMA 1G3IA 4C30A 3KFVA 4TL8A 2ZYVX 1Y63A 3EG5A 1CEEA 1M8PA 1PLKA 3EA5A 2FMXA 2QN6A 4CGZA 1E79A 2UVQA 2ZJBA 1SKYB 2BJVA 5D3QA 4GBMA 1ETUA 3GJ7A 2GRJA 2F1HA 4TYWA 2A5DA 3BERA 4TL7A 3Q5DA 2J41A 5AK0A 2ZRNA 4WZ6A 3GLIE 4JLVA 3CBQA 5SZHB 3AKEA 1NSTA 3ADKA 1XB2A 3KKMA 4G5QA 1WBBA 1UKEA 1KK0A 1FZQA 2CL7X 4QFMA 3NHBA 2FJUA 5EUQB 4V0ME 1W49A 2JLXA 2XTMA 1XCPA 1QZXA 2QE7D 1NIPA 4MKFA 1KGDA 3W8RA 1P7CA 1Q3HA 1Z83A 3TE6A 1GNPA 5C46F 5JI2E 1ZM9A 1VG8A 4Q4HA 1IHUA 1FFHA 2QTFA 5HKKD 3IHLA 1E9BA 1TPZA 4IDHA 4A2QA 3GJ0A 4Q1AA 2WWYA 5FFMA 3AEZA 1SKQA 1KI4A 2BEJA 2W2XA 5FL3A 2P5SA 4WXPA 3EC2A 5FOTA 4A6XA 2JJ1D 4LV6A 4NU0A 3U6BA 3IEUA 2RGAA 1KJWA 1G5RA 5K8IA 1ZU4A 3H86A 3BE4A 4F38A 1VIAA 3GLGA 5ELXA 4S2EA 4LV5B 1Z3IX 2VYFA 2WM9B 4HLUC 4U00A 3T1QA 4DIDA 2IXEA 2Z43A 4IRUB 3WXMA 2ZR0A 1P2VA 1ZMXA 3KUDA 4MH0R 2I1QA 5E4FA 2VPPA 3BIFA 2W0MA 3ZQJA 5FPYA 1Q1EA 1W4AA 1KI3A 2IK8A 3GJXC 1G4AE 2YWGA 2IYQA 4Q9LA 3CWQA 1UDXA 2ZRLA 4YONB 1E9FA 1K6MA 4C0BA 1SQ5A 4TQAA 1IJEA 1BKDR 3QBTA 4XOIA 5FBQB 5HTKA 1R5BA 2X1VA 3QXCA 4O2RA 5KU1A 1X1RA 2HUPA 2VSOA 4Q4HB 4TSFD 3MD0A 4DDTA 2ZSEA 3PCRB 4DSNA 1GDDA 1XCMA 3GP8A 3GFTA 1DAEA 3L0SA 3LO5A 3I62A 4TMVA 5TXGA 3C4JA 4BPBA 2BBWA 2HXSA 1EFRA 4P4UA 1DAIA 1KY3A 4Q1EA 2LCFA 2NTYC 3VR3A 1MRNA 4JJKA 3GLGB 2OAP1 4HAUA 4JBXA 1PZNA 5TDHA 2SHKA 1H8EA 2VHJA 4FN5A 5FBLB 3TQFA 4B74A 3U5ZB 4JJZA 1W0KA 2CVFA 3VNVA 4DLSA 2GJSA 2XAUA 3SBDA 4DLYA 4Q48A 3NC0C 1NY5A 3W3AA 4TMXA 1W7AA 3ND8A 3BS4A 3KFXA 1A5TA 2EYUA 1YZNA 1N0WA 5J4KA 1IOZA 1F60A 3FKSA 3U7EB 1YR8A 2Q6TA 4DCTA 1HYQA 1V43A 3ZYCA 1R5OA 1GIAA 5FOXA 1XCGB 3VR2A 4JS0A 1FL9A 4NYJQ 4RCZA 1JI0A 4M9QA 4TN1A 1II8A 2GK6A 5HPYB 5JHHB 3B9PA 1IAQA 4LHYA 4E07A 1R0XA 3PQCA 4URVR 4FMDB 3EPLA 3ONWA 1KI2A 2GNOA 2DCUA 1Z29A 4A15A 1NBME 2IS1A 2OT3B 3TQCA 2PEZA 4LYJA 1TL7C 4L8GA 4RJLA 1N6HA 2GA8A 3SFVA 4CIDA 4Z51A 4ZIRA 1KYIA 5K8LA 2OG2A 1MKYA 3PIRA 5KPDA 1G3UA 3NH6A 5EE1A 4BFYA 4JT2A 5JHGB 3ZQ6A 4JLPA 4D4KA 2ZS7A 4BZQA 4RD3A 3BH7A 2N1BA 4Q1FA 4EFNA 1AKEA 1E1RD 3E70C 1P2SA 1NNEA 1NIJA 4I1VA 3DO6A 3N70A 3U3MA 3OF5A 4G5RA 1UBFA 2FZ4A 5DI3A 1GL7A 3BC1A 3KXIA 1G18A 1AS2A 1SXJC 2R62A 2C96A 1ODFA 4PQFA 1D9XA 4Q9KA 4OKSA 3Q72A 1E2GA 1G291 5J47A 1FW6A 4JVMA 1G3QA 2F1IA 4GP7A 1Z5ZA 2RGEA 3DHWC 4ACAA 2OFWA 1WQ1R 1OH5A 2H5EA 2ZXUA 3QXJA 1R8SA 4XJXA 4AY2A 2BBTA 1II8B 2CNWD 1LW7A 2A5FA 2IXGA 2ZU6A 5FUWA 2FDCA 2QTVB 2YV5A 4RFSA 1HTWA 1CBUA 2XEXA 5FUXA 2OAQ1 3B2EA 1US8A 1QG4A 4MQBA 2WIBA 2P6RA 2ATXA 2B7BA 4ZIRB 1TQ6A 3GJ8A 2XOKA 4NYIR 1JR3A 1ONBA 4EUNA 2WPDA 2ASEA 1YZUA 4MGKR 2MSEB 1CIPA 1E1QD 2GCNA 5JCPA 2VP6A 4JLOA 2ZI3A 3L0IB 3NXSA 2H7VA 2QT1A 4LCBA 4QBGB 2J59A 2KBFA 2QMUA 2VQSA 5D3MA 2ZI9A 5KSOA 1G8YA 5F98A 4XTCS 4QC2A 1L8QA 4O25A 3I72A 1U9IC 5DI3B 1G17A 4KHZA 4EPVA 2FPMA 1W47A 1G7CA 4LSGA 4EQ6A 1KY2A 5IT5A 1CKEA 3A36A 2AK2A 3B7GA 4ACBA 1G16A 2OLJA 4LJ7A 4Q9JA 3VMFA 3QJYA 1ZC4A 4JLMA 3SHFA 1U90A 1FTNA 1ZNWA 2QQ0A 4NE2A 4M1WA 4B3BA 5HCNA 1UBCA 1U8YA 3PENA 4RFSB 1RC8A 5P21A 3K0CC 4JMPA 2AXPA 1MT0A 4Q7LA 1MO6A 1US8B 1X6VA 2WKRA 5UKDA 4ZI2A 2ZRAA 3FYHA 3W90A 5E3HA 2EWVA 1Z0JA 2XGJA 1E6CA 1E9EA 2FSIA 4DLTA 4C0QC 3A6PC 5BWMA 2YC4C 4YDSA 5GADl 3LD9A 5D3MB 2CL6X 2OCPA 1M6NA 3KZ1E 3QKSA 2QZ4A 1R6BX 1E2LA 2JJ2A 2HJVA 3QVVA 4J0QA 4W5HA 3P32A 4UNQA 4O0MA 4EQ6B 3LW8A 1CR4A 2ZE5A 2J87A 4HYYA 3WRYC 2Z4RA 1CRQA 2RH5A 4GP6A 2HT1A 1L4UA 1G4UR 3TSWA 4BLPA 1DAFA 1XEWX 3TW4A 2IUTA 4EAQA 1E9RA 1R0YA 3AGQA 2QTHA 3EW9A 3NTUA 3VHLB 3IO3A 1YKSA 3NVAA 1W48A 1EK0A 2ZU0C 3IO5A 1Q44A 3T35A 2D74A 2JJ8A 4PZZA 2TMKA 3THYA 1MABA 5L3SA 2DWOA 5FOSA 4A0FA 1W4CA 3V4RA 4EPXA 4BUJA 4CF7A 2NOAA 1JPJA 5KSZA 4CW7A 4KO8A 1XF9A 2ONKA 1U0HC 2GESA 2Y8EA 2K5UA 3C7KA 4QGAA 1KSFX 2G88A 2R2AA 5TVKA 5FPSA 2QSYA 3O8BA 3CPJB 4N1AA 3NH9A 3TRFA 2HXYA 3LRPA 4ZKDA 2YZ2A 2IYXA 2ZRGA 3QKSB 1Z2CA 2IYSA 3FB4A 3MAAC 4GMXA 4HDCA 4FMDF 3U44B 1OH7A 2YWFA 1KK1A 1FP6A 4RZUA 1KDPA 1F3OA 5DLQC 4Z1MD 1YJ5A 1MR3F 2AR7A 1KJZA 2ZSFA 4GZLA 4IOJA 2LKCA 2AX4A 2R6FA 2VLIA 4GZMA 3A1SA 2ZRMA 4YXWA 4TL6A 2W0SA 3GFOA 1UDWA 2OBNA 2GXSA 1KO4A 4X8LA 3WBKA 1ZP6A 1DS6A 4EJSA 4JLDA 1SVKA 5DYIA 3THYB 4MGIR 1MABB 4RD4A 2OBLA 4XD7D 1LB1B 2DFKB 4DVGA 1G41A 1BMFD 1NVUQ 5L3SB 3D31A 2ERYA 2FV8A 4CDGA 1GNRA 1U81A 2GF0A 621PA 1N3BA 3WHKA 3I4LA 1P4SA 3FDIA 3OZXA 1JEDA 3BRWD 1Z63A 3CPHA 1T0HB 4DKXA 3ECCA 5EXTA 3AVVA 2C8VA 1P75A 4TQ9A 3G5UA 3RS4A 4A2PA 4EDHA 1G7TA 3AUYA 4BFWA 3O8RA 1JXMA 1F2TA 1MV5A 4P31A 4HATA 4Q01A 1AGRA 2ZI5A 5JMTA 2AFHE 3QNUA 3P26A 2FFQA 3TR0A 2QAGB 3Q85A 4C0KA 3ADDA 3DOEA 4GMDA 1PVOA 1T91A 3HWSA 4V0OA 3LLMA 5DHFA 2NZ8A 4HI0E 2BMDA 2ZYTX 5FOUA 1W36D 1D5CA 3VX4A 2O0HA 4WOPA 1UADA 2P67A 2BHRA 1QHGA 4URWR 1GKYA 2O8BA 3AVTA 2XTNA 1YRAA 1FNMA 221PA 3OHMA 2GXAA 2G77B 4C0JA 1XMJA 3QKRA 3C15C 1RW4A 1XEXA 3B5JA 3AVQA 4EJSB 2GZDA 2Z0MA 5FL7A 4WXRA 4HZUA 1P62B 3KKNA 3A1VA 3C5HA 5IRCD 2AD1A 3BK7A 1RZ3A 1GKIA 3JVUA 4QGHA 4W5WA 3SJAA 2ZJAA 2WWWA 5FTNA 4LBVA 4TMWA 1TMKA 3W5JA 2WJHA 3AB3A 4V0KA 6Q21A 5DISB 1KI1A 3KQNA 1FQKA 4EKDA 4KYIB 2FU5C 3OFNA 1XPRA 2OV2A 1F2TB 1OFUX 4NTZA 1C1YA 3S1AA 1JPNA 1VCOA 1DEKA 1G20E 3KUCA 1NMYA 4M22A 4F91B 4IDPA 1VCMA 2XTZA 4TL9A 2RGCA 5KDOA 4GOKA 3E1SA 5DYGA 2HLDA 4PZYA 1H65A 1WP9A 4KXFB 2O8BB 3WYAA 1NVWQ 2R9VA 2NPFA 4PSVA 3QKRB 1XEXB 2QMOA 4RKEA 5AJYA 4P4SA 3QBVA 4HZUB 3E5HA 5LDDC 3KTAA 3GJ3A 1SXJE 2H92A 3L0OA 3I5YA 2WWGA 3VAAA 4Q21A 4OHXA 4AWXA 5LB4A 1DARA 3TGPA 3OIUA 3JZAA 4GSYA 4DB2A 2GXUA 3KJEA 3LNCA 4NZYA 4BFZA 4B2LA 1FTSA 1ZD1A 2FZLA 4JVSB 4E09A 1I2MA 5TB5A 1G6HA 3CO5A 4DIEA 4WW0A 4Q4AA 3S1AB 5B57C 3CRW1 5FR1A 4QM7A 4MYHA 3NBFA 4L9WA 3DPUA 4PSKA 4ZDIA 2H1LA 1ZIPA 4B6FA 1XMSA 2QUZA 4NHOA 3IIKA 2PJRA 1ZAKA 3GLFE 3DL0A 4UJ5A 3KXKA 3FOZA 2GAAA 4M9XA 2G0NA 5H68A 5TARA 1NKTA 1QBKC 2XZPA 2XNDD 5BQ5A 1DBSA 2EFDB 1S9HA 1CP2A 1XJQA 2X8AA 2RKOA 4P4SB 1QHNA 4OI2A 2IF0A 4U7DA 1SVWA 4OK6A 3KTAB 1WB9A 2ZQ5A 4Q1DA 3CX8A 1XU4A 1G3MA 4QOSA 1XTRA 4MA4A 3M1IA 4ZCLA 5E7MA 2B8TA 1E2PA 2R44A 3RABA 5F9FA 4N0EA 4FW9A 3ZD6A 2V6JA 1L7VC 2QT0A 2W2VA 3GPLA 2JLRA 4XWAA 1KI8A 3VFDA 2Q3HA 3THWA 2FX3A 1GP2A 2AN9A 4Q4AB 4KJZA 4XVRA 4I4LA 2RGXA 3KQUA 2QP9X 2A5GA 2MMGA 3K70D 4LHXA 4DBLC 2NO9A 2W2TA 5JWRA 2GJKA 1BO6A 1OFIA 4HAVA 2VEDA 1G6OA 3CIOA 1WCV1 2QRZA 4KFSA 3VX3A 4ASUA 4B3GA 2C03A 3K9GA 3VR1A 2ZSDA 3MWLA 1SKYE 4F4CA 3MJRA 4FIDA 2ZJ8A 3RS3A 2PX3A 1ZM7A 5BN3A 2UZ3A 4OQXA 1G5PA 1XTKA 3HDTA 3L8ZA 2L0XA 4GOJA 4R2IA 1SULA 3ZIAA 1TAGA 1RRCA 3DEFA 4A0GA 4UXHA 1KAOA 4LJ6A 2IS4A 3HU2A 1VYTA 5FOWA 4TT3D 3TK1A 4Q4LA 2QPOA 1R4AA 3DKPA 4PFSA 3KKOA 1KZGB 4E22A 2RGGA 2QU8A 5JECA 2B21A 4E5UA 4OI0A 2VP9A 3WMEA 3THWB 3B1YA 3HU3A 4P33A 1Q1BA 1QVAA 4A92A 2CLDX 2QPTA 2GEVA 1A7JA 2WWXA 3K53A 4MKHA 5FR2A 4LYAA 1Q0UA 3GLHE 2QBYA 5FUVA 3IHWA 4NBSA 4DZZA 3BB3A 3CH5A 1GNQA 1FMLA 1GILA 1VHTA 4F7WA 1Q20A 3SS8A 2WJIA 1ZNXA 4BRUA 3K09A 3O8DA 3W5IA 2ANCA 1WE2A 4JZKA 2BMJA 4H1UA 3MWJA 2KB0A 1ZCBA 2XB2A 3QEJA 5G3YA 1CR1A 2FEMA 1M7BA 4FCTA 2VIIA 3A4LA 3VR5A 1HEIA 3A4NA 4NMMA 1S1CA 2PX0A 1W5SA 2ERXA 5CIWA 5C4MA 1SHKA 2W6JD 4LGMA 5IHPA 5LBIA 3WP1B 4DLWA 3ADCA 4IXMA 2HCBA 1LS6A 4PAQA 3ICQB 2ZE7A 3QF7A 1S96A 3UMFA 5FI1B 3KJIA 4TMKA 2J0VA 2ZRFA 2BV3A 1DTSA 4HAXA 4DEYA 4IEEA 3AKDA 5EP1A 2HJGA 3BJIC 5AJWA 2QBYB 1WXQA 4UNRA 3SYLA 2CVHA 2OXRA 1RJ9A 5JSZA 3QPVA 1AS3A 3L8YA 4P3YA 4LWZA 4OBEA 2QAGC 1NLZA 4RY2A 4NCNA 3A4MA 5E7IA 1Z06A 3GLGE 1Z6TA 1NI3A 1CTQA 3W9YA 4BE7B 1EESA 2RAPA 2WBLC 3TW8B 2F9MA 4DCVA 1U8AA 3BXZA 1DAGA 2YHSA 1OFTA 4EJSC 2H18A 1EX7A 2J45A 2W58A 5L3RA 4D82A 1R7RA 1UKYA 1NVVR 2QENA 5CYPA 2IT1A 4B3DA 3D3QA 1VMAA 3A1TA 2IHYA 4OHYA 3CNLA 3IBYA 3ZH9B 5C18A 5JCZA 3OEHD 3QQ5A 4ZI3A 1CJKC 3CRRA 4QL3A 4Q9IA 5KNBA 3MGCA 5DN6A 4I1SA 3NBYC 3QPUA 4OQLA 2ZTSA 1IONA 3PV0A 4KVGA 3SJCA 1YR6A 2O8EA 1FUUA 2IHBA 1RJ9B 5JSZB 5KYKA 1GSIA 3CF0A 4QKQA 2J3EA 4WBSA 4XTRA 2O0JA 1P9RA 2ZYWX 4JLJA 2B6HA 1N6RA 1W46A 3IUYA 3T12A 1TQ4A 3PEVA 3OESA 1XJ0A 2D62A 5EXPA 5AJVB 1NKSA 2N46A 4IVQA 4TWZA 1OE0A 4DSTA 1Z0AA 4NYIQ 3MLEA 1H8HA 4FI3C 1OH8A 1AJEA 3QENA 4KFUA 4F93B 4B73A 4G5OA 1N6IA 4P32A 2NPIA 2ZJOA 4C0HA 1DAKA 3NBXX 4PANA 1AZSC 4TLCA 2AXNA 3H1TA 1OB2A 4KVAA 4PC6A 3FHCB 3U3RA 1S4QA 3R8CA 2CHGA 2IUUA 4BGDA 2ZRIA 2DFTA 3T1VA 2CK3A 1NBMD 5ANRB 4OHVA 1U94A 1IQPA 4JSTA 3AF0A 5JWHA 2DYKA 5IK2D 4B75A 2UKDA 4W9MC 3OIVA 2O8EB 5KSYA 3AUXA 3OAAA 2A9KA 2PZFA 3EZ6A 4JT4A 5HCIA 3T5DA 2F55A 4C0LA 2XSZD 5FBRB 4LDJA 5F9HA 1IXRC 1XTJA 1Z6AA 2EW1A 4YDHB 2FE4A 2QAJA 1ZC3A 1XX6A 3SEAA 3FMOB 1BOFA 4HDOB 2HYDA 3TJZA 4AC9A 4IFEA 3P4XA 5AJXA 4NYMR 5J40A 2OXCA 3BWDD 1GOTA 1OKKD 3RLFA 1G7SA 4U02A 3SYNA 5E95A 4ABYA 1W0JA 1KSGA 1Z47A 3WHLA 1G7RA 4LRWA 3U7HB 4BLQA 3RC3A 3D6TB 3A8TA 2DR3A 3MJHA 3C8UA 4JLAA 1DADA 4YC7A 2ZJZA 4WA7A 5JLJA 1Z0KA 4Y0VA 2O8FA 2PH1A 2GKSA 2YOGA 5KPJA 4CEJA 1YZKA 4A9AA 2ZVPX 4B71A 3LH5A 5KO2A 2XB4A 4X8OA 4D81A 4JLKA 1A82A 2RCNA 2GXQA 4A0RA 3FMIA 3VHXA 4DXAA 1OF1A 2BKEA 2YWHA 1YRBA 1E94E 2ZUCA 3VNUA 3FGNA 4YLGA 2DWQA 4TQUS 3G82C 1G8FA 1DG1G 1UKZA 2ORVA 2R6DA 3BH0A 2OFOA 3LQQA 3SE0A 4BLTA 3D8BA 1JR3E 1KKLA 1P9NA 4RD2A 4M9SA 3CRMA 1Z6XA 2KJQA 5CK5A 1XFAA 4CYMA 1CXZA 2REBA 5BYJA 4ZV4A 4IDOA 3QKUA 4L4UA 3FHTA 4ERNA 2VHTA 1QHIA 3BD9A 4W5JA 3RS2A 1N6KA 3RSLA 3BB1A 3LX8A 4WZBE 2QE7A 5GJBA 4ESVA 5GJCA 3QVUA 4ZDJA 1IN5A 4QNMA 3CRQA 3AVWA 3KKPA 4URXR 5M04A 4OL0A 5HKKA 2REXB 3UKDA 3IPXA 4QXAA 1AKYA 2O8FB 4CEJB 4ESHA 2GAOA 1DG3A 4PAOA 2J7PD 5FTLA 3AP2A 3F5FA 3EARA 2GVZC 5IDVA 3UANA 1P2TA 2YKGA 3ETLA 3CX6A 2JJ1A 4LPKA 2XZLA 3SZRA 3TSOA 5BW8A 2XNSA 2V6IA 1Q1QA 2QGZA 4AKIA 3X1XA 2IL1A 2ONJA 1P9WA 1SGWA 1OFHA 1GITA 2D7DA 4URZR 3ZZ0A 4DJTA 3A58B 4HAYA 4D0LB 4HEJA 4BASA 1OYWA 4Q02A 4Q5IA 5C4GB 2WSSD 1KK3A 1CULC 1T3HA 2WIAA 1RVDA 4PAMA 2D4HA 2R6GA 2WMNB 3EWSA 4BEJA 2JLWA 2F1JA 2Q3MA 3RC8A 3V00A 4HLCA 1IN8A 4DCUA 2IX3A 1QVRA 3K9HA 1BYIA 3B13B 4NL4H 4QBFA 5J4YA 2GDJA 4QBIA 4A0HA 1E4YA 1TF2A 2MMCA 2Q9CA 5CJPA 1G8PA 3TVDA 4TSFA 3TSZA 3ZS9A 5DSZA 2BWJA 2IYLD 2H57A 5F3WB 1JALA 3PUZA 4JVLA 1I4LD 4UNNA 3RAPR 4Q7MB 1TU4A 5L3QA 1TUIA 1K5GA 1OLOA 3PUWA 2R8RA 4DDVA 1MO3A 2IBMA 2ZE6A 3LFUA 4JLNA 3T1TA 1CJVC 3TKLA 5TV2A 4LI0A 1XTQA 4DSOA 4LBYA 1AQYA 2CCJA 2C99A 4D0NA 2W6ID 4KBFA 2OHFA 3NEYA 1N2CE 4G3XA 3KJHA 2HYIC 1NVXQ 1S3SA 3QY0A 4K46A 1OH6A 1VYUA 4NCIA 3THXA 5TY0A 4II7A 4Q4JA 1S0UA 1JQLB 1UPTA 4ZDKA 4MRPA 3K09C 1VYVA 4D26A 1KJYA 4AKHA 2VA8A 4PHTA 3I5XA 2J0QA 1JXOA 2QMHA 1VKJA 2YOFA 3A37A 1FP7A 3GD7A 3LBNA 1XZPA 1C4OA 1NG9A 5SZKB 3WY9A 4PPFA 4AK9A 1ZIOA 2QRNA 721PA 2NIPA 1XNJA 4L15A 4D4JA 4QHYA 2JGNA 4HAZA 1N25A 1ZM3A 4K81B 2BMFA 4Q47A 3UPUA 4BLOA 1EFUA 3PITA 1RYHA 4GNKA 5L3QB 1X86B 3K0FA 2CBZA 4F4JA 5HE9A 5CM9C 1OPXA 2DHRA 3PFIA 4GRAA 4LV8B 3QF4A 4GFDA 3GJ5A 2G6BA 2GVDC 3QIAA 4C2TA 1DE0A 1COWD 2B92A 4PC2A 1HA3A 4Q18A 1KO5A 1E1RA 3FFBA 2BCJQ 2IYUA 3AVOA 2F3RA 5KOYA 1QG2A 4DCNA 2JAQA 3THXB 1IN6A 1P6XA 3LDAA 4Y0AA 3SJBA 121PA 4Q4JB 1ZD8A 2I4IA 1MRSA 3SOPA 4XWKA 2ZRPA 1LVGA 2BBOA 4PO9A 5DH9A 4B76A 2GILA 1E2QA 4DDWA 4FINA 2DFNA 1J90A 3GJ6A 1LV7A 1T5IA 5FPKA 2GF9A 1G21E 4MKIA 3NWJA 4Z8YA 2YYZA 5LPNA 1NN3A 2CNWA 2X77A 4LJYA 1TNDA 4URUR 2KE5A 2ZITA 1T8UA 2VF8A 3HPRA 4FCWA 2VSXA 3K0FB 4HB3A 1U99A 2AHOA 2JASA 1NMZA 3B1WA 3MWKA 4JL6A 2IWHA 3QEOA 2IF2A 4NKRA 2HV8A 3QF4B 4RKFA 4TLDA 3VR4A 2UZIR 2J0UA 1CRPA 1E1QA 1KAGA 2PMKA 4ZPXA 3MCAA 4Q00A 2VTKA 4NCKA 1E9DA 2WWFA 4M0LA 3MUFA 4MRVA 3CNOA 3SI7A 2C78A 1E2DA 3QXXA 3VKGA 2CL0X 3CF2A 4PX9A 1O3YA 3GFPA 1U2RA 1HQYE 2JDID 4DEXA 4R7ZA 5AUOB 3O8CA 4GT1A 2YOHA 1R10A 1SVSA 4PXAA 3DM9B 3UXMA 2JCSA 421PA 2WOJA 4XIGS 3DDCA 2EFHB 1S9DA 3RS0A 4OK3A 4DLXA 3G0HA 3VU9A 1NMXA 1RIFA 1SXJD 2BM0A 4PPNA 3ZJYA 4MYCA 4LBWA 4KSCA 4ZCIA 3HP1A 3H4MA 2EQBA 4B32A 1TU3A 1XZQA 1TADA 4LUCA 2J46A 1NSFA 2PMDA 1Z07A 3TIFA 1OXSC 2J0UB 4FWIB 1AA9A 1XD2A 4BFXA 1KI9A 3WBJA 2AD5A 5EE3A 1UBGA 1DO0A 4CRWB 4QBHA 3OEED 2PJZA 3SU8A 3EZ9A 2OILA 1QHYA 4Q9HA 1XXHE 2ZRJA 2FEOA 2ZYUX 2WAYA 2WKQA 3PR1A 2E87A 1KMHA 2QORA 4IVPA 4HUQA 2C9YA 1KNQA 2YVUA 2ZAMA 2IA5A 5A0FA 4MUAA 5EP3A 1EXMA 1N5LA 2P6NA 3IIMA 1TUEA 4UXIA 3W34A 3SFZA 5B30A 1WBDA 2KSQA 3DOFA 4MRSA 2VL7A 4BFUA 4Q1BA 2H17A 2RGNA 2ZROA 1YU9A 3FTQA 3R7WA 1XBTA 1KKMA 1W4RA 3VU9B 4JVNA 4DCSA 2CXXA 1R2QA 1IY0A 4M1MA 2BVNA 3B60A 2XJ4A 521PA 1T9HA 1ZUIA 1ZU5A 3CZQA 5JS7A 3NDBB 4C7OA 1QF9A 4BRWA 3DM5A 4IDNA 5JJKA 3FWYA 1NY6A 3R9WA 2ZRHA 2OM2A 4HB2A 1T5LA 1YQTA 3PUYA 5JI3E 1FQJA 1G19A 1HQCA 3W6OA 4PO8A 5AJZA 1Q57A 1XD2B 2ZRDA 1KO8A 2GEUA 1OHHD 1JB1A 3QG5A 4LYFA 1NF3A 2IYWA 3RRYA 2YINC 1F2UA 2JLYA 1Q1ZA 3IGFA 5KNCA 5KHOC 1HY3A 1D2MA 1RRGA 1E2IA 3R9IA 3RS5A 1K5DA 1I2DA 2J1LA 3KX2A 4PPGA 5JZVA 2GHIA 4URYR 3F8TA 3UG7A 4Z1MA 1KMHB 4LK2A 3OE7D 1OW3B 4HUQB 2NZJA 4JKYA 3FVQA 3N5CA 3L0PA 2WTUA 4OJKA 4UNSA 4R9UC 4OHZA 2PBRA 1DVRA 3T06B 4FCVA 4LHWA 1BH2A 3R7WB 1M34E 2WZQA 3PVSA 2JLQA 4RZ3A 4XD7A 3MRSA 1BMFA 3UMSA 4M1YA 4POAA 3CONA 4LC0A 2HT6A 4AD8A 4XVUA 2P0EA 1SVLA 2WAXA 4LX0A 4C7OB 2QP4A 4KV9A 3U7GA 1CJMA 2PZEA 3BFVA 4RFVA 1UEJA 3SQWA 3W6PA 2JIZD 3A1UA 4DUGD 2DFLA 3RRNA 1JNYA 2R6CA 5DO9A 4RZXA 5AWFC 1CF4A 3OIWA 4LYHA 1F2UB 4Q7JB 1FOEB 1TQDA 1OIXA 1RRPA 4TYPA 4KAXA 4A2WA 1P3JA 3EZ2A 1Z28A 1F5NA 1UF9A 1XTSA 4DSUA 4IJMA 3QOFA 4ZDWA 2AKYA 4JL8A 4TLAA 4YMTA 4AYWA 1AZTA 1NVVQ 4PO1A 4CZ2A 2QI9C 3IQWA 2EWWA 1E79D 1SVOA 3QI2A 2ZUDA 1EG7A 4IOLA 4B33A 2G9NA 4A1FA 3WMGA 2QNRA 2GBLA 2WWHA 3BAFA 4DT1A 3L82B 2KBEA 3EZFA 2WHXA 4EIWA 1T4GA 2ZREA 1E2JA 3KDSE 2NO0A 4F4IA 2QG6A 4US2R 1Q21A 2YWEA 1BIFA 1J7KA 1O87A 3B8HA 3M6AA 4S35A 3THOA 4IEIA 3NKVA 3K0SA 4IHQA 1XPUA 3BFXA 3CPEA 2JEOA 3KJGA 3E2IA 3QPWA 4I1OA 1ZBDA 2P6UA 2WJGA 3DZ8A 4W7SA 4MRRA 2FSFA 2ZANA 4WZAE 3NBZC 2EU8A 3I73A 1RE0A 5CM8B 3GEIA 3GLFA 1II0A 3LA6A 2VRWA 2REOA 2C04A 5CB8A 1LF0A 2P2LA 3W8NA 3C5CA 4UJ3A 3R8FA 1XD8A 2Q0HA 2DB3A 4D4LA 4P0TA 3R9XA 2A78A 2FPKA 2GWHA 3U7FB 5BXQC 1RKBA 3RS7A 5LD2B 5EXXA 1W36B 1TF7A 3MG9A 4HSEA 5KDDA 2DPXA 4A8JA 3IBGA 4ZO4A 1G9XA 2BMEA 3EIEA 5EUMA 1YR9A 821PA 3QSYA 4B6EA 5J4VA 3UIEA 1JBKA 1VG1A 1I4TD 2G83A 1E4VA 2QEQA 4LHVA 3V4FA 4BQSA 4DT1B 1XEFA 3REFA 2HEIA 3SC3A 2QM7A 1NRJB 4B2PA 4CEIA 3TVTA 1GL9B 1ELOA 1UFQA 4LJ4A 3X1ZA 4GDFA 4X8MA 2CHVA 2FSHA 5FTKA 3ZVRA 3K8YA 1F48A 2GJ8A 2X2FA 1R0WA 4NH0A 1HH4A 3T61A 3I8XA 1HT1E 4D80A 4A82A 4B35A 4M1SA 5EZ6B 5JRZA 2AWNA 2GJAA 2VP2A 3CM0A 4FD2A 3KB2A 3QUSA 3D7MA 1JQJC 3NG1A 4XSGA 5JEDA 3ZVMA 3U2QA 4MRNA 2J0SA 4NONA 3AF2A 2HF8A 4N0DA 4QJ5A 4NYMQ 4EPRA 3GLFB 4BZPA 3UMRA 3U3OA 1XWIA 1FX0A 4JBYA 1II9A 1ZNYA 2ZSAA 3PEYA 3CWZA 3UWOA 3KB1A 2PEYA 4I81A 2AKAB 4YMWA 3TH5A 4BEBA 3TUZC 4C2UA 4IXNA 3ZDQA 1EFRD 5FOVA 3U6KA 1BS1A 4A36A 3V9PA 4A8JB 5SZIA 2IYVA 2RGBA 1XDBA 4QJ4A 2IEZA 2ZI6A 1ZVQA 1VTKA 2XNDA 4Z54A 2J9RA 5AUPB 1SZPA 2IYZA 1AN0A 2GZAA 3KXLA 4OI4A 1JJ7A 5FBVB 1N6PA 5G3ZA 2V7QD 5DHAA 3EA0A 1H8ED 4KODA 5KNDA 1PUJA 4AKGA 2KWIA 2IWRA 1W0KD 1KNXA 1NL3A
chains in the Genus database with same CATH superfamily
1RLIA 4R83A 4M1ZA 3H2ZA 2ERCA 5COBA 3T7CA 2HWXA 5HZKA 1KU6A 3FSRA 3LOUA 4WK0B 1NJ5A 4IXDA 4XUGB 1N5OX 1X1DA 3JAWB 3FKSD 5AVUA 1M1YA 3K6RA 3EJWA 1SB8A 1BXRA 3PNVA 3U4HA 4F45A 2W90A 4QVIA 4L27A 3PWSA 3ZEAA 4BDSA 3VR2D 3W3ZB 4EPYA 2RHGB 1UPAA 2X0KA 4DMCA 4CFZA 4DMRA 4Y9SA 2X9GA 2W6MA 5AR1A 6ADHA 3KYCA 3B1XA 4GSLA 3UJCA 1E0JA 4DV5B 2R25B 3PGJA 2P7HA 1RPNA 2VBCA 3KD2A 3BORA 4OGKA 2P2GA 5AHXA 3ZW7A 1J8MF 3T3MB 1PJ8A 3H18A 4OUDB 4TN5A 4WT7A 5T8KA 4OU4A 2X42A 3ZLBA 4JYAB 5H80A 1AKMA 5DM70 1TT7A 4ER6A 4HADA 4IAOA 3RVMA 4EKYA 5C1BA 1B4DA 1QRRA 3LYLA 1T6YA 4Q19A 5DM0A 4MYRA 2FTKE 3K32A 2IU3A 3KG2A 4FXPA 1E8NA 3BZUA 3Q0TA 4KGVA 1R5NA 1KDRA 4MQ5A 2FFAA 3PIIA 1RBZA 2DAPA 4HB0A 4QULA 1UBOS 5H1YA 3R7LA 4BFTA 2HA5A 1XJWA 2XB6A 1I80A 1AXGA 2Q6OA 4KPGA 1WMSA 2CXNA 2WKWA 1UBRS 1GGVA 1LBHA 4C89A 1M83A 1CR0A 2YRWA 3B85A 3H8WA 3RWBA 1RQ7A 4YCAA 1DKNA 1TTTA 5A4JA 1P8JA 4BGEA 2OO7A 1XMVA 2CHFA 4ZYVA 2FVYA 3BIXA 2YMPA 5KZMB 2C5SA 1D4ZA 2Q4OA 5IMBA 1YHNA 3H97A 2X14A 4ZVUA 1WB4A 4I4TB 1P72A 3SZGA 3OF3A 2QMEA 2NACA 5D85A 5F4ZA 1GRRA 3KLOA 2AG0A 3QVMA 4ES6A 1AKRA 1LFAA 4ZV9A 2O3QA 3SJ7A 4XVQA 3JWJA 5LM3A 2NW6A 1JYEA 2ZT8A 3KQMA 1NJFA 3OZRA 2B4TO 4BCBA 4PSCA 3OC0A 4EPTA 3AM1A 1O96A 3HR7A 1OJLA 1T6NA 3LPDA 4MI6A 3QVTA 2IP1A 3K70B 2BGKA 3RRZA 1B00A 5ALXA 1NR7A 1ULZA 1S2IA 1YZ3A 2BH9A 2Q2QA 2Z56A 1HLGA 4FHEA 4HZIA 3UAOA 4LF4B 1CJTC 3LCCA 2BR5A 3JQDA 3MUEA 1VI5A 4PC3A 2WM2A 3GLIA 4P4TA 3VGPA 3WLAA 4P4LA 3U19A 2YJTD 2GAFA 1KJ9A 6PFKA 3DAGA 4QM6A 4UE2A 3WBBA 4DDUA 3JQAB 2VJMA 1GPBA 2W6OA 4WVFA 2NG1A 3MTJA 1ESZA 4PXSA 4RS3A 2FWRA 2G6TA 2V1UA 1XP5A 4QGFA 4R8VA 2VO1A 5B64A 5CK4A 4MQ4A 3TSCA 3UGKA 1OROA 5K0GA 4RHYA 2CFRA 4XW2A 3CU5A 4B8ZA 2CXPA 5EJEA 4MR9A 5FNVB 3RWOA 1W1WA 1QGOA 4GL2A 1N2XA 3LA8A 3U4QA 5EKUA 1CLUA 3FRHA 2W6JA 1YQEA 3I92A 1YVDA 4BLSA 1V48A 2G8NA 1C3XA 4PIMA 4U3JA 4Z53A 4DM7A 3ZVNA 2YFQA 3UK6A 4YRLA 2D1TA 1NLMA 1PLJA 1E98A 1Q74A 2GZMA 4IWYA 3S7ZA 4B44A 2CMFA 4JL5A 1F0YA 1Q6YA 3UAZA 4H3KB 4I1UA 3W1EA 3WI7A 3WMXA 1SFRA 2ZJ1A 3CZMA 4E88A 1O57A 1E0KA 3FBTA 4ZCRA 4Q82A 1FUKA 2IYYA 3BWCA 1SHTX 3PGMA 4DJ5X 2H2DA 2A94A 2DF8A 3AR7A 4EP1A 2V7QA 4E6PA 3B82A 1Z2EA 2ARKA 1E62A 1V71A 2ECKA 3IERA 3JR7A 4K9KA 1IHOA 3EASA 2V9PA 3JSAA 5DNAA 2RI6A 3CLTC 3WYAA 3KU4A 4MS1B 2H6EA 4PRZA 5AM4A 1PGOA 2PLNA 1KKUA 4LW8A 4LZOA 4CM8A 2FDRA 5IYZA 1YVPA 4EF4A 2A59A 3E6AA 5CLHA 2OSBA 2D2FA 1YHZA 5A6VA 1DBIA 1SZDA 2HRRA 3BGDA 3SBEA 1EFKA 2GH1A 3IQGX 2O50A 3ORSA 4QNNA 3TQRA 1X80B 4XJTA 5H3CA 4C05A 2QN2A 4C29A 2IYPA 4EVIA 1RHQA 3ABRB 1H6DA 2V55B 3HBJA 2EGGA 1BXGA 1ZZEA 1XLWA 2VYVD 1GUAA 2Y2UA 3EMKA 3AMVA 1Q7BA 1G1MA 2C2HA 5JSYA 3DEJA 3UWKA 3H8SA 3WIBA 1AQNA 2VBIA 1NU8A 3CT4A 3E5RA 1DC6A 4RMIA 1PV4A 3AP3A 3MGAA 3DOIA 3TX2A 3CISA 4BBJA 4BECA 3PJEA 2G28A 3A7DA 1OXXK 1OXTA 4K3VA 3I61A 1XDUA 1FXUA 2ID9A 2WWRA 5FT9A 3T5BA 5JS8A 4TWAA 4TQGA 2QA5A 3WDLA 2IRWA 5K3FB 1QMPA 2ET6A 5K3EA 1T4MA 2NZ2A 4PYMA 4XM2A 5LQRA 5CD1A 2RONA 3FTNA 4DADA 1UKCA 2QMZA 1OLXB 5EE9A 1PHRA 3AR2A 1NT4A 3ZWWA 8OHMA 4X0EA 1XZAA 4IOMA 3HJAA 2V4ZA 1VECA 5EZSA 2PR2A 1RYFA 2PYDA 2VG8A 3FNHA 3ZGNA 2OGWA 2OY0A 4DIOA 1OSNA 5K05A 1EFTA 3RROA 3AYZB 2X40A 1IULA 1FFYA 4C4PA 3M0EA 5CYFA 2I3ZA 4HWRA 3DL4A 4FHDA 4IZIA 4R84A 2UXDB 3CUUA 1E32A 2NXJA 3VKHA 3PHIA 2XNKA 2RB5A 4OQFA 3L4JA 1DV2A 1NW4A 3UCFA 2FG5A 1GVHA 4IXTA 3T5GA 4BVFA 2VZ9A 4DR7B 1JJVA 2OC9A 2VOJA 4XOUA 2QUKA 1KI7A 5BN5B 1O03A 5FTJA 1E1YA 1SBZA 1VCNA 1KVTA 2ISSD 2OPBA 3FG9A 3F9CA 3HFRA 3FOWA 1KS2A 3IAXA 4QATA 3TQSA 3CSSA 4FB5A 4QJ3A 1GEGA 1DOZA 1EE9A 1LF5A 2C2XA 1S02A 2W2OA 3QTLA 2NSHA 4X20B 2C2GA 5E2AA 1OAOA 2BJWA 3J7TA 1NBMA 2CYBA 1R4NB 2GFQA 2B8WA 4L5IA 5DGIA 1S2NA 1UBEA 1HBJA 1XUOA 3HJNA 1IH8A 5EP2A 2XXAB 3I2IA 3DW1X 5CURA 5IK2A 2Z1MA 4EKEA 3G3EA 1DAMA 2WJJA 2ZI4A 1VJ1A 3H11B 4J2TA 2AH5A 1E2MA 1NQVA 3KKKA 2Q2NA 2HMUA 5E9QA 2XSZA 1XDZA 1O08A 5ED0A 2ZETA 2R47A 1JAIA 4G6ZA 2YY6A 4ZI7A 4AN1A 1ZXLA 4X6LA 4X1YB 4ZPJA 3ZDBA 1B6TA 1VLJA 3GBVA 3KYBA 5B1SA 3CB4A 3OCUA 4W5OA 3K1JA 4IHAA 5GGYA 2JNWA 2JGIA 1OKKA 2I2AA 2ZWOA 1DQZA 4TLBA 1F06A 3PGA1 4HRYA 4UULA 4ZOBA 2QN7A 3VKWA 4HQ6A 2A9OA 4LDPA 1AQUA 1TQ8A 2JD1A 3AP1A 3GZNA 3QVKA 1NA5A 3QU5A 3GJ4A 4QO7A 5IM5A 1BDHA 4YRDA 2FFRA 2XDWA 3HGTA 4OAPA 3L7MA 4QTTB 4JYMA 2ZJ7A 4PQEA 1VKNA 5KYXB 3N8HA 1XWFA 1WP4A 3KOYA 4KZKA 1WCXA 5MHTA 1NMSA 2VNKA 4LXQA 1Z2OX 1ARZA 1ONOA 1KE2A 2ZT7A 4FGZA 2KW5A 4DSZA 4OMUA 5BY2A 2Q3FA 1FU4A 2PGOA 2YIDA 4IWXA 3T9BA 3LWNA 3K5IA 4XRRA 4I6JA 2B5WA 2MSCB 3D2BA 5DYNA 3MJCA 3IX7A 2GCOA 4N8EA 1FFSA 4D45A 1QB8A 1QDUA 1OBCA 3AF3A 3NHWA 4B3FX 1GUYA 3TECE 4AZ0A 2B34A 1ZQ9A 3KO8A 2O8VA 3H4VA 1LVHA 2ZOSA 4PVDA 2OLKA 4L72A 1UPCA 1XJCA 2VHUA 5TJHA 2IEAA 3MNFA 3S8YA 1K63A 1N1GA 5HK9A 1M74A 3IR5A 2A2ZA 2HL6A 3DVLA 4NYJR 1KYTA 2ZVJA 2DBRA 4U2FA 2JLSA 3RUAA 3QE4A 4HDSA 3U44A 1UMKA 4CT4B 4KWCA 5B58C 1CT9A 4N3NA 5FQNA 1I7PA 1M7HA 1T9BA 4H1VA 1X8KA 3I32A 3KLPX 4UBNA 2PT7A 5AKHA 4CDNA 5A5GA 5BUCA 1T5OA 4RJKA 1HDRA 2C4NA 1F12A 2G63A 2OZLB 3AOGA 4ZD6A 1S3GA 3NR2A 1YR7A 2XE8A 3STWA 4BRZA 1OV4A 5CVCA 1KJQA 5CG1A 2Z2IA 3DH0A 1P1FA 2MINB 2OGTA 1Z4IA 2XWPA 4MZDA 2ZPTX 4N4AA 4YVFA 4BJHB 4F6RA 2Y1KA 4X3PA 3Q2KA 1EFLA 2RC5A 3EIWA 1YI1A 1JT9A 1NN1A 5JAQA 1V5FA 1Z0FA 3A6LA 1XRMA 3DUFA 4MW1A 2J7PA 3BAZA 4IEFB 2R6R1 1LUAA 4JODA 4QECA 1Z73A 3TLCA 3SIRA 3KE8A 2B83A 3AESA 5HJEA 2E4AA 3DOCA 1SKAA 1U0SY 4DQDA 4KR9A 4AG6A 4DMLA 3DFZA 4OK5A 1I7DA 3RIGA 3KFLA 4RCYA 3ZNQA 1T2VA 2G1JA 4LWPA 5HDQA 4BVJA 3VH2A 1ZR2A 5BV1A 3K70C 2JCVA 2WICA 3S2SA 4ND1A 2F3TA 2RJ3A 4B7AA 4ZJZA 4RDCA 4PHHA 2CZGA 5JSUA 3CNBA 3GNLA 1Q3TA 5BYKA 1QE3A 3BKWA 3A1NA 3VNSA 4RTMA 3GRVA 1XMPA 1OLSA 1YIOA 3QFFA 3B9QA 2Z98A 2X9NA 4G01B 2FMIA 3PPWA 4Q66C 2QAGA 4NNJA 3V3TA 4ZVOA 4K9QA 1T4CB 3G0DA 2KLHA 5LLTA 1C2YA 4QHSA 3EAFA 3BMXA 5DP2A 4DR2B 7MHTA 1T3LA 1Z45A 2CJPA 2XDQA 1HE2A 2YCBA 1E7WA 3KWFA 3CMCO 3O9MA 4LRYA 1H85A 2AL7A 2OKGA 3SF8A 1O0BA 5I4IA 1B2RA 4AIRA 4DA7A 1R9GA 1A5BB 2LV8A 3F0TA 3M1LA 1WXFA 4JENA 4ZO7A 2O2GA 2ZWVA 4QREA 5T67A 3R7SA 2BLNA 3SSAA 4AJEA 3VA7A 1LX6A 1XKXA 4WL0A 1FIUA 3QFRA 4YQFA 5DE3A 1GAXA 2E4VA 3MILA 3LLSA 3ANLA 1JDZA 3C3PA 3IT2A 4QG7A 3T54A 3ZGOA 1KYQA 1UK7A 3DDWA 3PEUA 4I2NA 4Z7NB 4BVAA 5CVUA 1XZGA 1C50A 2ACWA 3GT0A 2GEFA 2ORWA 4Y2UA 2EYQA 1RXVA 4B6OA 3P71T 4YP1A 4AJIA 3MGKA 3V1UA 4RYDA 1NP6A 2WV9A 5C2JB 4HDQB 2CNOA 1WW2A 3A9RA 1COZA 3IILA 1FDTA 5AT1A 3V8QA 1QB7A 4L57A 4YFYA 5THKA 3LXRA 1W9HA 1O8CA 1IOWA 5AVWA 2QTBA 3AV3A 2I9PA 3E7PA 3N7TA 5TQVA 4ND8A 1K8RA 1NHGA 4PZ9A 3P0FA 1ADGA 4HGNA 4JOQA 1KQNA 2PCJA 3VOTA 5FV4A 4GIBA 2YV3A 3OJCA 1QP8A 1Z33A 5F1PA 5CDSA 4QRIA 3IELA 4R1UA 5H8WA 3PUXA 4D6PA 4MJ7A 3NP9A 4PBSA 3TB4A 4C06A 5CDUA 2F43B 1R0ZA 1G8AA 3NTOA 4MPTA 3U3JA 1L4NA 1Q17A 1QHSA 1A5AB 4MV0A 2Q1TA 4DV2B 1Y1SA 5LZ2A 4BNWA 1IM2A 4U39A 2I7DA 1AF4A 2ZM5A 1E2KA 5IUJC 1D8AA 1NT2A 1QHHA 3DKVA 3IJ5A 1EEXB 3PGXA 3UHAA 4MP6A 1GKUB 3KUKA 4F86A 4DB4A 5T4HA 2SICE 4G0NA 4MP3A 2AOUA 9LDBA 1RFLA 3EXIB 2IIQA 2QR2A 1KP9A 4LE0A 3NAMA 2J5BA 2H2GA 2QY6A 2K4MA 5BSVA 1U1FA 3QLUC 4L5AA 4I4NA 3BMCB 4JC5A 1TM5E 2C4WA 2P9FA 2QSZA 4QOJA 1VRVA 5ERXA 3ZK8A 4BO6A 4ZYUA 1PD1A 2QTCA 1XN1A 3DFIA 5IJXA 4KQIA 5CJJA 4BNKA 4G8JA 1ZIXA 1KO7A 1P31A 2XT6A 4UC0A 5AVRA 2KI5A 3CUEF 4FTWA 4K8OA 2XZOA 4DS3A 3EZGA 1B2LA 1Y1TA 4JR1A 4ZA2A 1KMCA 3STUA 5JJLA 1QGZA 4AF6A 2ZQZA 3B3GA 3HB7A 3TLYA 2XYQA 2EX0A 5CA1F 1KFKB 5JYCA 3Q7RA 1XCOA 4DDKA 1Z0IA 3I9MA 3MCVA 4BOYA 4XRGA 2DWPA 2WD9A 3BE6A 2XIJA 5L3SA 3QBJA 1TZKA 2OCAA 3QJ5A 4OQYA 2MSDB 5ESDA 4C4ZA 2J6IA 2BCEA 2D2EA 3CW2A 3HSSA 1CS4C 1IEQA 5G1NA 3T7TA 5EMMA 4EO9A 3VZRA 2ISCA 3AERA 3SLRA 4EITA 2B6NA 3BE8A 2VHQA 1GZUA 3EUAA 1NLFA 3C3YA 3ZE9A 3AVPA 4ENTA 5JW6A 4Q05A 2EQ5A 4AM8A 3V55A 5DBFA 5F51A 3OJEA 3LY5A 4P3PA 3QV2A 1WUJS 4WRRA 5K4HA 3A9SA 3TDNA 1N2GA 3PDHA 3AZQA 2FJ0A 3PYMA 1BVRA 1XXHA 2VJYA 4JKIA 4EKIA 5IMSA 2M9MA 2JJYA 1VG9B 4NZOA 3R5HA 5F2OA 3TMYA 3IAM1 3ZVLA 1H4QA 2NP7A 1NFFA 2FH5B 3AGPA 3FNRA 2AFHB 3SIPA 3U3KA 1CF9A 4ID9A 2G70A 4CM4B 4PYQA 2ZB3A 3PTLA 4R9SA 3WG9A 2G0AA 8LDHA 2FZWA 1T4DA 3AUUA 1W581 5KNCH 1C9NA 3W5HA 1WMFA 4WAUA 1PU2A 3KQKA 3VSBA 4MCJA 4EL0A 4UCXA 3Q0EA 2ZB7A 4KH1A 1XP8A 2JDIA 5ALLA 5HRUA 2JH8A 2QD5A 3ZZTA 4M9ZA 4EG6A 3OD5A 4F72A 3O4IA 1LV8A 1C30A 2BGRA 3P9PA 2PT9A 2W5UA 2QU7A 3LM8A 1RCUA 4TMTA 1TF5A 1XL1A 3T15A 3FCUB 4RH1A 4L1KA 4O4JB 1W2GA 1G42A 2X0NA 3CF4G 3EXFA 4KFTA 4KGDA 3GEEA 4O8ZA 3P20A 2QY9A 3LUJA 2V8OA 4QHTA 3H1AA 4M46A 3Q7EA 4CIWA 4EHHA 3EQ7A 3PXUA 2ZR9A 1TRHA 1OIWA 4IIJA 3RUEA 2X3FA 4OUKX 5D3KA 2POCA 4DNOA 1RVV1 4RY0A 3WIDA 4GZ3A 3UHOA 3AY3A 1CB7A 1HSZA 1MJHA 4TROA 1QV6A 3OJ0A 4FDLA 3A3OA 2PWYA 4IJWA 1MW8X 4EPWA 2WWIA 3F8SA 2P35A 1F20A 1HMYA 4JP3A 4DPLA 5KOHB 1DEAA 1HDEA 2VAPA 4UCQA 5H3HA 3RG2A 5CVTA 5EXDA 3VYTB 5L8VA 1NG1A 3S1LA 4TTRA 1SQSA 1PZMA 1XRJA 4ON9A 4AYTA 1CC1S 3GVPA 2ODWA 3ZWDA 2G4VA 2X15A 5HQ3B 2PSHA 3M2PA 1AUXA 1U3UA 5JWOA 2R1TA 4MRMB 3CKMA 4CDGA 2Q4DA 3KYJB 4QSHA 2XJ9A 1RAEA 3C6MA 3LBIA 1XGKA 3TFQA 3OO1A 1EFDN 3LP6A 1YDHA 2WKSA 3OJFA 1DCFA 2ZCUA 4NDAA 4XQ9A 5IJ9A 1JMYA 1KZ7B 2JGDA 1JIVA 3T3PB 3FTEA 3DZJA 1U9IA 5TMDA 5JD6A 3PNLA 5JALA 1SXJB 3PZBA 1W2HA 4YCCA 2QUHA 4F92B 5J4HA 1E7MA 2RE8A 1L3BA 3SN6A 4LXHA 1EUDB 2VNSA 5SICE 3OPVA 2YIVX 1IB6A 1L7XA 1YTLA 3K8QA 4F3KA 2W6ZA 2OG1A 5BRAA 5H7XA 3HR4A 4JH0A 3O90A 5J2UA 1ORRA 1M66A 3DXFA 2RHMA 3RIYA 1FDVA 3PDIA 1KQ3A 3KQHA 3AINA 1JRLA 3UOGA 3WWZA 1FRQA 2K2WA 1T3TA 2LWIA 1W5TA 3E18A 2NU6A 4W9NA 3T38A 3ZXXA 4BE4A 5LKRA 4D4MA 3K0CA 2IY7A 1ZUNB 5LA6B 5JSHA 1MJGA 2BOVA 2B4AA 3VUEA 3IALA 1JDUA 3V2UA 1ZGHA 3HYTA 3OOJA 3UCXA 1EM8A 4OJYA 1MORA 1Y5LA 5AW4A 2CK3D 2IPMA 4JUAA 5CXUA 4Z7OB 5EHNA 4CQLB 3PS9A 2OC4A 1FNNA 2PPVA 4A8TA 4DJFC 4X8HA 4X7RA 1EWRA 4NEGA 4ITVA 2WWVD 5FHQA 2QQGA 2CUZA 4YPOA 1N0UA 2J9FA 2PVCA 1QQBA 1ZUD1 1V5WA 1M1XB 4OB8A 5ECDA 2BFFA 4LC1A 2OBYA 3GLQA 4I6EA 3ST7A 1RHJA 2WHRA 1SVNA 2D2XA 3EC1A 4OXKA 2JIQA 3GQBA 1UJ2A 1TYCA 2GPSA 3IAM6 2VI5A 4TV8B 1LGYA 4ZWNA 4CFSA 3C0KA 1J2JA 1D03A 4MQMA 4EW6A 3PZRA 5L51A 1HYGA 2V5VA 1AY0A 3AJ9A 4BP1A 1QGUB 3MOSA 3TNFA 3E81A 2ZUEA 2C2ZA 4FMCF 2C1EA 2WE7A 3BHNA 2XMCA 3CZ5A 3I2FA 3HA3A 4RTPA 2C9ZA 1FY2A 1PT8A 4ZGWA 4OHWA 1J8YF 2PT5A 2PSSA 4TKVB 4LKOA 4OVKA 5LMCA 4KQJA 1VB5A 4GP9A 4KSBA 1EAYA 4H7HA 1VBKA 1X1SA 2O2XA 2VZ0A 3DFFA 3F4LA 3VSEA 2ZPAA 5A3SA 4EFMA 4TKZA 1G3IA 5JSQA 1CUWA 4EGSA 2CFOA 2C4MA 5ALFA 2XNHA 2HGSA 3R7AA 5IM4F 4TL8A 2X8JB 3LT5A 3TLAA 3H2KA 1QV9A 3EA5A 4OSPA 3COVA 3D8SA 3KT8A 3PFGA 3F98A 4Y2JA 3ZTTA 1YVRA 4H7IA 1YACA 4YUWA 1NUTA 3CZ9A 4KO4S 1T24A 3QBDA 3ZHRA 2CNLA 2GRJA 4TL7A 1H2BA 3BERA 3ROQA 3Q5DA 5JAOA 1N5RA 1YJXA 4WKOA 3WGHA 4HH4A 1RWOA 2ZRNA 5AK0A 4D8TA 1L4LA 4RZHA 1CF2O 4K9DA 2WUGA 1TTHA 1B41A 3TZQA 1UXKA 4QUAA 3TNYA 1ZH0A 3RF7A 4Y9TA 5MDHA 3A1EA 1T6BY 4YECA 5IW8A 1WMAA 3NHBA 3QMWA 1CRWG 3FLAA 3MGBA 4V0ME 4O4IA 5AKXA 5EUQB 1MB2A 5TGDA 4EARA 4C7BA 3BCSA 3BSYA 1Z83A 5TS2A 2DSNA 3BWYA 1FLAA 1H22A 1VFPA 1ZM9A 5C46F 4QFBA 4G8CA 1CETA 1L4KA 2OO5A 5I8PA 2WIJA 3FPGA 3A7EA 1UJ5A 3G2MA 3QNMA 5KHAA 4HMPA 3AEZA 3I1JA 4C4TA 1RHKA 3VYVA 4ZMBA 1KOGA 4G1CA 2W2XA 5FL3A 3WGNA 4WXPA 4ZVRA 1DMSA 1JEJA 3EC2A 4U9HS 5ICFA 4HWTA 3UGQA 4A6XA 4BJ3A 4DR1B 2FR8A 1XDSA 4FOLA 1QLJA 3WGQA 2G17A 4NBLA 2NT3A 3Q10A 1KJWA 4WA8A 1ZU4A 3H86A 3D8RA 3DEKA 4FBMA 4ZMRA 5E0OA 5JTUA 1JBQA 4J2HA 3RVRA 3OECA 1MOPA 4LV5B 4K6GA 4HLUC 4JXJA 3H5NA 5ILOA 4IRUB 4TVKA 3WXMA 1QAMA 5H16A 4EHNA 3II6X 4BEVA 4UBIA 3NHJA 1BVYF 1YQUA 1KI3A 4PRYA 2C3YA 1BHSA 2ATEA 1G4AE 2BE9A 3GJXC 3ZLTA 1XN4A 4Q9LA 1KAQA 4ATNA 1K6MA 1BCRB 4MWBA 2R8ZA 4OBWA 5DW0A 3GJSA 5HTKA 1PP4A 3TN7A 5KU1A 1QG6A 1X1RA 3ZWAA 4GXRA 4WOKA 3VU3A 3QEMB 4DLKA 4YB8A 4PCVA 3MD0A 4GMFA 2Z6AA 4DDTA 2ZSEA 4QYSA 4DSNA 3OSUA 4JJIA 2B4YA 3JASA 3M3DA 5BPHA 3MW8A 1KJJA 3EB9A 1XNQB 3BF7A 3PC6A 1DAEA 3L0SA 1BDMA 3KUXA 5AKJA 2GM3A 5EJ6A 5TXGA 3C4JA 3K9BA 2C5HA 3B48A 3IJPA 4JDPA 3I6IA 2NTNA 1DAIA 2BHLA 2NVWA 5BQOA 4EB6B 1DTEA 1BS2A 1BX3A 3C6BA 3ZNPA 5KQLA 1MRNA 1WEKA 3ICPA 3GLGB 3MD9A 4HAUA 1J22A 2NVOA 1T1EA 4HYQA 2QTGA 1ADCA 2Q3JA 2EJUA 4EHFA 3KSAC 2D5BA 2F4VB 1QYWA 2QN1A 1QH8B 4WERA 1RQGA 4ND6A 1R74A 3PJDA 1LLFA 3TQOA 3U5ZB 3KQLA 3MTBA 3S2YA 4QARA 3EJ6A 3SBDA 3JTMA 4Q48A 4W8OA 5T5QA 1V1MA 1X15A 1L5GB 3RJ5A 3KFXA 4L95C 4RDXA 1FXSA 1YR1A 4BRSA 3FKSA 3AHJA 2YL2A 5IZCA 2Q6TA 4ZREA 4U8GA 5I7EA 1D2HA 1Z68A 3E84A 5E6UB 3FGZA 3A0UA 1QF7A 4MUXA 1XCGB 1FNCA 1QZTA 2G5PA 2YMLA 3GLVA 1V35A 3O2QB 4NSNA 1Y4UA 1ORWA 3VR2A 1PZFA 2IBTA 2QJRA 4NBKA 3RVKA 1II8A 3KHKA 1NWCA 4X64B 2VUSA 1PBNA 3B9PA 3BWEA 4LHYA 4E07A 2CXRA 1KC3A 3ONWA 1KI2A 2DCUA 2V98A 4A15A 5AVKA 3TUZC 2IS1A 1DWUA 2ZAYA 3FUXA 4BNNA 4LYJA 4RJLA 1N6HA 2CXHA 1D0IA 2IPOA 5K8LA 2QW1A 3QX9A 3OY2A 3EGCA 4GBED 2OG2A 3NS7A 4MV4A 3ZZMA 2JJQA 2A0FA 3OFKA 1DQYA 3F6CA 4F85A 4UBOA 2VWPA 1Q2XA 4OYRA 4RUKA 2AMLA 2ZS7A 4FGJA 4DCJA 2N1BA 4G0YA 3D6UA 4EFNA 3A3PA 4KXQA 1E1RD 7REQB 1XAHA 1NIJA 1UBFA 2FZ4A 1Q5PA 4BXOA 1GL7A 1AS2A 1PDWA 1X39A 1SXJC 5KQRA 1ZL2A 2R62A 3WO1A 1D9XA 4OKSA 2Y66A 3H9BA 4YGYA 2KQUA 1FW6A 1G3QA 2BF4A 4H6VA 1Z5ZA 4E0BA 1YJAA 2OFWA 4H27A 3VYSB 4D9GA 3GK3A 2AQIA 1FSFA 3VPXA 3NNDA 3R4VA 4RSMA 5KHLB 2IHTA 2OKCA 4FZRA 4XJSA 3E5NA 4YTEA 3TTVA 3UN1A 4X1OA 2C7OA 2ENUA 1IMOA 5IS2A 2CNWD 5EJ4A 2XE6A 2YHBA 4DOMA 3QWFA 2YV5A 4RFSA 1AT1A 1G2PA 1HTWA 1V7CA 1B3BA 2C59A 2XEXA 4EHJA 3HDYA 4RULA 1UQTA 2OAQ1 5HS6A 2VJNA 2HIHA 3NPAA 2I76A 3UXEA 3ROPA 1QG4A 1CUXA 1HFEL 4P1ZA 3J81A 3FX2A 1XL0A 3W4KA 3X0DA 2B7BA 2H4JA 4ZFNA 1IFXA 1ZJWA 2JFGA 2P6RA 2GPAA 2B1QA 2F48A 1HYHA 3H5VA 3VR4D 4KTTE 3X2FA 1FJHA 2B5VA 5JS6A 1TAUA 1K98A 2QZ9A 4BB6A 4EB3A 1CIPA 2QZZA 4MTLA 4G0QA 3U7RA 2H7VA 2OAGA 4DCPA 3TG2A 2J59A 3LDHA 3RODA 1ZMBA 2DPLA 1HK7A 3JCZA 4M7PA 1JU3A 4RIEA 4YRBA 4MPJA 1FP4B 4O25A 3WYCA 1FQOA 3GJTA 4KVZA 4U2CA 5DI3B 1QOQB 2HNAA 4BMYA 1W47A 1G7CA 3NXKA 4QDUA 5LFAA 3O83A 1DB3A 5IT5A 3G7NA 1U7HA 3P7MA 1D6NA 2C00A 2V96A 2XMSA 1ECJA 1DIAA 4Q9JA 1FFAA 2HK8A 3LC0A 4I14A 3QFCA 2A1UB 3TOXA 5ITSA 3AL2A 1U90A 3PVZA 3S28A 1QLWA 1Q1AA 2P9EA 1GG9A 3HYNA 2AZDA 4YN3A 2H31A 1HF3A 1LPAB 2BFCB 4M1WA 4XDZA 3UXHA 1TIKA 4B3BA 1XU7A 1Z18A 2WQZA 5DCLA 1RC8A 1DX4A 4XYEA 2AXPA 4Z0NA 3E9ZA 2I4MA 1RI2A 1XRLA 5HF8A 2CDAA 3ZY2A 1US8B 1EVQA 1MO6A 1LQUA 1X6VA 2WKRA 3JARB 4MV8A 1ECCA 4YP5A 5UKDA 2DY0A 4C3VA 3TPZA 4CJXA 5CA1B 1IDN1 5D6OA 2HJ9A 3W90A 5E3HA 4K6KA 5BWBA 3ELYA 2EWVA 3DULA 1P5JA 5JQGB 1X77A 3B36A 3FAKA 3O8OB 3QH4A 4Z2YA 3GA0A 4I55F 4Z3DA 2OYCA 1LPPA 3MT7A 2QQ5A 3C45A 4HGQA 1AZWA 4DLTA 4YJ2F 2G25A 3B5IA 4A8HA 2XXJA 2PUTA 3OFJA 1OJ7A 4U2EA 4HN4B 2IHJA 4OA8A 4JI5B 4FBLA 2JANA 1SKUA 4WXMA 4IG4A 2QZ4A 3SQMA 1E2LA 3D7SA 4EQ6B 3QVVA 2RI1A 2J3LA 3ZWYA 4B6GA 5C8DA 3GBSA 3LW8A 4HLNA 3U49A 4Z4QA 3H0CA 7MDHA 2Z4RA 1N92A 2VYVA 1I8TA 2RH5A 1N2ZA 2CZCA 3JW8A 4J0JA 4O4LF 2Q62A 3KQPA 1L4UA 2UZ1B 1N34B 3VSDA 3WTBA 3V3KA 2EG5A 4BLPA 1XEWX 3IKMB 3TW4A 1B0PA 2IUTA 1FSSA 1AXRA 1MOQA 2YNMC 5BQ3A 1FCJA 3IAS1 4MR8B 2QTHA 3U5TA 5FA5A 2A5LA 4N5HX 2Z1NA 3LUCA 4JQZA 3NVAA 1TMGE 5IUKC 1EK0A 2BSAA 3IO5A 3TLGB 4F1JA 3W2GA 2JJ8A 1U9ZA 3THYA 3TM5A 1RKXA 1B42A 1QYDA 1SXGA 1LJ8A 2DWOA 3CW9A 1WX1A 4BQRA 1W4CA 2C9MA 4E14A 1SUAA 1X94A 2JBHA 2JCYA 2RAVA 3DL2A 3IAUA 3KDAA 3MT0A 1V7QA 4BKQA 5E1BA 4WE3A 5KSZA 1UL1X 3BMNA 3D0KA 3LCMA 3L7CA 1QSGA 1RT9A 4TRRA 1SHJA 5JPDA 1BJKA 2G9UA 4CDRA 1C3EA 1VSBA 2GESA 2PWPA 4QGAA 3B51X 4FVTA 3N1UA 3OM0A 3KR2A 2VK8A 4DJEC 1NX9A 2FI1A 2H06A 4FEYA 2VUTA 3CYFA 1DXYA 3EY4A 4FYJA 4W8HA 4R2KA 9GPBA 3TRFA 5AESA 5KOIA 3LRPA 1QKJA 3PFBA 4F2PA 2IYXA 2ZRGA 3HCNA 3QKSB 3ROGA 4A5OA 1VKRA 1WXEA 3CLRC 4DFDA 1ECPA 1RR6A 1Z2CA 2LE0A 4ZYWA 4A3SA 1PAUA 1NXXA 2R751 3F2IA 2HMAA 2PGDA 4R54A 1FP6A 3G9TA 3I6BA 1JTEA 1V9CA 4RZUA 5EPEA 3VV2A 2ZSFA 3PB3A 4DNPA 2BGGA 2AX4A 5GM1A 3U37A 3IUQA 5K3CA 4D8UA 2VHXA 1M0EA 2ZRMA 4BCCA 2W0SA 4MIEA 2E2WA 5ULLA 5CFRA 2V8BA 4X8LA 2HEGA 1NUAA 4EUHA 4HNVA 4R68A 4XPIB 3M9XA 4IKOA 4IH1A 4N9QA 1AV7A 3DS8A 4RLFA 3GGJA 5CR9A 1GZ7A 1MABB 4XD7D 2OBLA 2ZG6A 3FJYA 1NVUQ 4UUPA 1KE1A 4DVGA 5KWIA 2ERYA 1RQNA 2C4UA 2YJZA 3IOYA 3RAGA 1GA6A 3B53X 4R81A 5HKOA 3EZXA 2WTBA 4BMPB 4BO2A 3RYFB 4XDHA 3I4LA 1P4SA 2ONZA 2Q4TA 3FDIA 3O93A 4X1KA 4CTMA 5HNKA 1NWHA 5JV5A 4ZOCA 1AN9A 4DKXA 3ECCA 3R0XA 4WEOA 1T0UA 2C7GA 1RJEA 3FNEA 4NMXB 4MI3A 3NPMA 5KYUA 2P2SA 3ES9A 5KYYB 1G7TA 3I04A 3DBHB 3IXLA 2FUEA 3KM0A 2A9FA 1JXMA 1F2TA 3K35A 4OIMA 3IVGA 5JVDB 2BFAA 3IEPA 1JR2A 4NV1A 2AFHE 5K8JB 4CMEC 5C8XA 3SYMA 3JQ8A 3ZCPA 2Y1OA 5ELMA 1YQXA 2AJTA 4C0KA 4TT8A 3DOEA 5L95A 1PVOA 5ICEA 5DHFA 4V0OA 2NU8B 4DV1B 2NZ8A 2ZYTX 2H1RA 2Z2JA 4XYBA 4UU8A 2P67A 2PLWA 3ESCA 2GHTA 2O7NA 1ODSA 4F5ZA 5JJ5A 1YIAA 2XTNA 1TJ3A 221PA 3HI6A 2GXAA 2DLDA 4C0JA 3C15C 1T8RA 5KTNA 3PPVA 1RW4A 3AEUB 1M8FA 4EJSB 3T9AA 3Q8LA 1YHYA 3BCRA 3OU7A 4Y6RA 4NZNA 3U3DA 1OI3A 1EX1A 3CLKA 1UKBA 2DX7A 4ZAWA 4J0EA 3BN3A 4POOA 2GN4A 4B7ZA 3B6JA 4ZO6A 2VVTA 3AT1A 3RYCA 5FTNA 4OH1A 2FB9A 3IRUA 3MJVA 1TMKA 3CCBA 4WLOA 5K0ZA 1OWMA 3T1HB 1Y6RA 3GRPA 5ECYA 4R1OA 4V0KA 3LT4A 1KI1A 4P3NA 2OBXA 3AZOA 3PHJA 1X92A 3Q7IA 2BZGA 4KYIB 1VMKA 2ADFA 3FUCA 1UMBB 4Z0PA 2YMMA 5LP6A 1OFUX 4J7XA 3GRZA 3IAS6 4JWTA 1OTHA 3CB2A 5I5EA 2BR3A 3IV6A 5C7YA 5JO0A 5CXSA 2KX7A 2O2HA 2VTVA 3ZQUA 2XKAA 1NMYA 4IX1A 4H1TA 5JY1A 4HX9A 4L3WA 3KOZA 2HLNA 4R0MA 3EEQA 1G21B 4XLZA 3ZHXA 4FT2A 3UAGA 2RGCA 4XUEA 2AC2A 2JAOA 4GGPA 4HV4A 3GXOA 2YW2A 3PFHA 3RRJA 1BTOA 4PZYA 1C3VA 2F17A 4KXFB 2O8BB 2IHVA 4W5NA 1KVSA 3M6UA 2VJBA 1N2BA 2GO1A 1YVUA 3LL7A 2R9VA 3ZJVA 1R6UA 2JFFA 3QKRB 4JP2A 4PSVA 2QMOA 3E3LA 1AUPA 1PWHA 1Z7YA 4RE6A 1OVMA 3DCIA 3DV9A 4CLRB 1V16A 1SXJE 1LPOA 3CN9A 4Z4IA 4HQRA 5FKJA 2WSYB 4G8DA 1DJLA 2R8BA 1TT5A 2XQKA 2VPTA 2VDWA 3G5MA 4BGVA 4OHXA 2I4OA 4L76A 3H5IA 4TRNA 3UK7A 3TGPA 3OIUA 1VJGA 4GSYA 1KEZA 1VL8A 1GKLA 3KJEA 4BFZA 3TLMA 3H6KA 5GY7A 1DWPA 4B2LA 1FTSA 3WB1A 1ZD1A 5KAPA 2V0GA 3H7AA 3WNQA 2DPYA 4JVSB 4E09A 1Z2DA 3ZW9A 1RKUA