4DWJA

Crystal structure of thymidylate kinase from staphylococcus aureus in complex with thymidine monophosphate
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
203
structure length
200
Chain Sequence
SAFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRKIVLEGNDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNSRDQNRLDQEDLKFHEKVIEGYQEIIHQRFKSVNADQPLENVVEDTYQTIIKYLEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Thymidylate Kinase from Staphylococcus aureus in complex with Thymidine Monophosphate
rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Transferase
molecule keywords Thymidylate kinase
total genus 81
structure length 200
sequence length 203
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2012-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4dwjA00
4EPVA 4GI7A 2IYVA 3NWJA 1Q12A 1P3JA 1IBRA 1AZSC 2WWYA 1EK0A 1KY3A 4JJZA 4QFMA 3WRXC 3K70D 4YMVA 3DZ8A 1KNQA 2ZRNA 1KI6B 1VHLA 4IDNA 2GK7A 4Z1MD 3SZRA 3T1QA 2QT1A 4OHVA 3TR5A 4PC6A 3QOFA 2QAGC 1VG9B 2KB0A 3F8TA 5GJBA 1GL9B 4PAMA 2XGJA 2RCNA 2XSZD 4YMWA 1VMAA 2QE7A 4WZBE 1BS1A 3UG7A 2WBLC 4ASUA 3UPUA 1QZXA 2HJGA 3B9QA 5DGXA 5FUVA 3SBEA 1NNEA 1DTSA 1G21E 2BBOA 3A6PC 1N6RA 1HT2E 2B8WA 4PXAA 5DHAA 2ZROA 1PZNA 4LY6A 4UNSA 1GNPA 3ZVMA 3JVVA 3QKRA 4B3XA 1VG1A 5DISB 5H70A 2P6RA 2H7VA 2OXRA 3AQ4A 4IOJA 3RS2A 3QIAA 1UKEA 4PTLA 1Q21A 1KSFX 4CEJB 4C0QC 2FGKA 2H8KA 3LX5A 4MKHA 3A37A 2HF9A 3GLHA 1G8YA 3MRSA 4B33A 2GWHA 4M1TA 1OFUX 4D82A 4US1R 4H1VA 1D6JA 1EXMA 2W2XA 2WWGA 4A2WA 5C2JB 1U8AA 5JCPA 3FTQA 4KBGA 1EESA 4RD1A 4LJ8A 2AWNA 1IN4A 3IPXA 3PFIA 4KYIB 2PMKA 4C0LA 2F1RA 2ZJOA 1RRGA 1ZCBA 5JZVA 2GRJA 2WSMA 2QMHA 3ND8A 5EXTA 3KQNA 3HYTA 1JQJC 1AIPA 3FYHA 4BE7B 1OXUA 2ZJYA 3NIBA 3HPQA 4LJ7A 3EZ2A 3SI7A 4MDFA 4CGZA 3WNCA 4DLYA 3QENA 1U0HC 4TMVA 1NN3A 3K9LA 5FOWA 1VTKA 1KI2A 5D3MA 5F2EA 4BZPA 1ANKA 2Z0MA 4NYIR 4PHFA 3CUEF 4DSUA 4DLUA 3IDQA 5BXQC 5TVKA 3AF1A 4KXFB 1H65A 3OE7A 1YZUA 1MABB 1XU4A 1XZPA 1NN5A 1IOZA 1X8KA 3LLMA 3SJBA 1OKKD 4JLNA 2KE5A 4TTPA 1XJCA 4H9GA 2NG1A 2H5EA 1BH2A 5FTKA 4ZKDA 4CEIB 3K0FB 3GLIA 3Q72A 3A1WA 1JQLB 4XD7D 3RRZA 1G1MA 1NIJA 4CRWB 2ZR9A 4NKRA 3I8XA 5AUQA 3PENA 4CVNA 5FUYA 3GLFB 3EIHA 2BHRA 1I4LD 2ZI7A 4FI3C 1YHNA 2IXFA 1KJWA 3I32A 4N0DA 4OHXA 4Q03A 4LX0A 1DO0A 4PPGA 5FH9A 2Q0HA 4QBFA 2FN4A 2WIBA 1WQ1R 1E96A 4Z54A 2O8EA 1P4SA 5F9HA 1G3IA 4K46A 1RRCA 1E2FA 2F9LA 2IS6A 4JT2A 5TXGA 2WPDD 5IHPA 3U7GA 2ZITA 2JIZA 3OHMA 3QKRB 4BFUA 2WOJA 3B13B 3L0SA 4TTRA 2GXAA 5JI3E 3I61A 4JT4A 4UXIA 1ZM4A 4D81A 2YOFA 4R2HA 1KI8A 1FUKA 4HAVA 4FN5A 1T9HA 3NDBB 4HAUA 1XPOA 1N5KA 1S1CA 3AGQA 4F4JA 2XOKD 3T15A 1KY2A 4DDTA 2QE7D 1IM2A 3CNNA 4US0R 3R7WB 4A0RA 3BGWA 1OKKA 1RIFA 4C7OB 3MGCA 2X8AA 3B2EA 4LPSA 4M0LA 4DLZA 2Q3HA 2FU5C 3KX2A 3K1JA 4HZUA 5AUOB 2GNOA 3VNUA 5L3SB 2C9CA 4FCWA 2HJVA 4M1KA 4YMTA 3GFOA 1WBBA 2AXNA 2AN9A 2BEJA 2R6DA 3D31A 2FV8A 3W90A 5KDLA 1DARA 4GMDA 2MSCB 2AR7A 3A4NA 4JBWA 4IOMA 3WHKA 2IF0A 2NO9A 4BASA 3CX7A 2WKRA 2RMKA 1U0LA 4P4TA 3TE6A 4Q9LA 3SYNA 4M21A 4RD0A 5KYKA 4QGFA 2QGNA 5G41A 3SYKA 5FTLA 2ZRCA 1GRRA 1EWRA 4IXNA 4GOKA 4JVSB 1OHHD 4US2R 1Z8FA 3N5CA 1KSGA 3SR0A 3T35A 1LW7A 2QP4A 5GJCA 4O0MA 4MYHA 4MRSA 4KVGA 5G53C 3ICQB 3UG6A 3ZVRA 4PAOA 1KK1A 2O0JA 4MKGA 4X8OA 4B34A 2UVQA 2Z43A 5H68A 2OXCA 2CL0X 1WA5A 3T1TA 2ODBA 3FVQA 3ZZ0A 5B30A 1CRQA 4NONA 3RWMB 5SZJA 1A4RA 1ZUHA 3BBPA 3DOFA 1SKYE 1RW4A 4EFMA 2GCOB 1ZM9A 4G0NA 1OXXK 3KDSE 3RVBA 2J46A 4HB2A 1RYHA 1B0UA 2WPDA 3MCAA 2C78A 4F92B 3L0PA 3GLGE 2FG5A 2GAAA 4RVCA 2JGNA 3HDTA 2JLZA 4JBYA 3ETLA 1X6VA 5KNBA 2AHOA 1E1QD 5P21A 3GPLA 2HCJB 1W49A 3AF0A 3SOPA 1TTTA 1HEIA 1BYIA 4WA7A 4EPYA 1ZW6A 4H1UA 4TSFD 4I81A 3U4QA 4JL5A 2NZJA 4GBMA 5IF9A 1AKYA 2BVNA 4RCYA 4Q48A 1I2MA 1NP6A 3HR7A 4MKFA 1XMVA 3QSYA 4Q1DA 5E7IA 2WMNB 1S0UA 2OLJA 1EGAA 5CITA 4HATA 4UKDA 1QF9A 3FE2A 2HLDD 3B1XA 2XXAA 1LTQA 1R0YA 1SULA 3A8TA 2P2LA 4IRUB 3AVQA 5AWFC 4Q00A 3WYGA 2YOGA 1Z6XA 4WIAA 4BPBA 1BMFD 4I1OA 4IVRA 5G3YA 5ELXA 1Z6AA 3TVTA 3F5FA 3QE0A 4DBLC 5HR5A 1XEFA 4PPFA 5AK0A 1P61B 1Z2CA 2CHGA 5E3HA 1KNXA 1KSHA 2Z83A 2CCJA 3PUXA 3K0AB 2RGDA 3GMTA 5KDOA 1ZD1A 1BMFA 4RKFA 3W6OA 3QXCA 4TN1A 3QEJA 2O8DA 4DXAA 1R0ZA 1PJRA 1VYVA 2O5VA 3KXIA 2HV8A 4G5OA 2WZQA 4HUQA 1XP8A 4BECA 5LD2C 4UQOA 4W5WA 4XOIA 1XD2A 4B43A 2HT1A 5B57C 1LY1A 3V4FA 2NO0A 1H8ED 5CLQA 1E4YA 4EPTA 1JR3A 4C9BA 5HCIA 3FMOB 1JR3D 3BH7A 4JLDA 2VSOA 2AL7A 4PPNA 4WAUA 1XXHB 4Q4JA 5SZHB 1XZQA 4EPXA 1OYWA 3EAQA 1DPFA 4LCBA 1NL3A 2J7KA 2ZRPA 2FSHA 4D4KA 5J4LA 1AGPA 1D2EA 1JBKA 2F9MA 4HLDA 3TSWA 2A5YB 4D0LB 2GESA 1CLUA 1GVNB 1OF1A 4WXPA 2ZUBA 3VR6A 1KK3A 1ZNZA 5JEDA 4Q21A 5DYIA 3SHWA 6Q21A 2R2AA 4DJTA 2OCPA 2J59A 2ZSDA 1JXMA 1GKYA 2GXQA 4JL6A 1GNQA 1QHGA 2PJRA 2ZVQX 4JYBA 1FMJA 1R7RA 2GAOA 3AP3A 1L2TA 3KJEA 1OFTA 2WMOB 4A6PA 2MSDB 721PA 3N2IA 4JL8A 3ADBA 2W83A 1X8LA 2G77B 2B6HA 2FGJA 2V1XA 1OW3B 1AJEA 1CJMA 2QAGA 3KB1A 4ESVA 3U7HB 4Q7LA 4FMCF 3R8FA 3QI2A 4HB4A 2R9VA 3SU8A 3AKCA 4JYCA 4BLOA 5JS8A 4O2RA 3BFXA 3VR2A 4JLVA 2VBCA 2W2VA 3KKOA 3TNFA 2J7PD 1UJ2A 2P67A 4KFUA 4MKIA 1T5IA 1GIAA 2ZS7A 4IKEA 5CIWA 3S1AB 3GJ5A 1G19A 2NTYC 2BV3A 3K0CC 5CJPA 4EUNA 4NHOA 1GG2A 5EE0A 3KXKA 4RJLA 4HDCA 4XSGA 1E2LA 1HQCA 1QG4A 4Q9HA 5SZKB 2YVUA 3MUFA 1GL7A 3SJCA 5FPKA 1C9KA 1TEXA 3PUZA 2TMKA 3MD0A 5EE3A 5E7JA 1EFTA 4C0BA 5H8WA 1Q1ZA 3QXHA 2CHVA 2Q3MA 2QN6A 2KSQA 4B3GA 1NLFA 3H84A 1Z3IX 1XEWX 3U3JA 1YVDA 3UMRA 2R6FA 4OJKA 3T5DA 2IA5A 1YR8A 2ZUDA 4F7WA 2NGRA 821PA 2Z6VA 1QHXA 3FFAA 3I73A 1N6OA 2FEMA 3CWQA 1Q3HA 3D8BA 4OHYA 1AM4D 1E9SA 3U61B 4P4SA 3AP2A 1NRJB 3SQWA 5JSZA 2JIZD 2ZR7A 1GAJA 1KO7A 1Z6GA 4RCZA 1UDXA 1HH4A 2XZOA 2GEUA 1J7KA 2P6UA 3IIJA 4PO9A 3ZJYA 1IN7A 1SVSA 2O8EB 1Z08A 1DADA 2ATXA 1TAGA 4RFSB 1XMJA 5LB2A 3LWNA 3NBZC 4NTZA 1X1SA 1RRFA 1I4TD 3QUSA 4IVQA 1ZRHA 3GEEA 1T8TA 1MT0A 4ASUD 2DYKA 5JFGA 1LV7A 2ZRFA 1OH8A 4KO8A 1SXJA 3HR8A 2AWOA 3RRYA 3W5JA 2FOLA 2RGBA 2GXUA 2ZR0A 3IO5A 2O8FB 2P6NA 2F6RA 2RKOA 3V9PA 3HJNA 1VYUA 2BM1A 4DLVA 3TUZC 3GP8A 1SVKA 4V0KA 1XF9A 1R8QA 2EQBA 1W4CA 2GZHA 2QTFA 5DLQC 4KVAA 4QRHA 3OIWA 4M9ZA 2DWOA 3OEHD 4LJ4A 1KI7A 1ETUA 1KDRA 4II7A 5LDDC 2DY1A 3AGPA 4HEJA 1NVUQ 2D74A 4QJ3A 1FOEB 4V0ME 2D2EA 4HLCA 4B2LA 2AKYA 2ZRAA 3DOEA 1LNZA 2PH1A 1Q22A 4GL2A 2DBYA 4LJ5A 4TL6A 2IYQA 2F43B 4BLRA 2G3YA 1E9CA 1KZGB 2F43A 2BMFA 3K0EA 2AFIE 1JJVA 2IC5A 4PC2A 4ZCMA 2GBLA 3NXSA 4PQYA 2PLRA 4TZ0A 2P3SA 3GD7A 3L0IB 4BZQA 1ODFA 3A1UA 3TH5A 1Z0DA 4V0MA 1IJFA 1SXJE 4TQUS 2CDNA 1F3OA 4BZXA 1CKEA 1J8YF 1NJGA 3CIOA 3K0CA 3R9IA 3NC1C 1LF0A 3SFZA 2IXGA 2QBYB 2WWHA 4G01B 1ESMA 521PA 1YU9A 3K9HA 1UKZA 4P31A 4DC9A 3KFXA 1J70A 2G1KA 4MYCA 3U7EB 1EFUA 3QF4B 3CPJB 5L8VA 1N6IA 2JLQA 3V00A 2ZRLA 4KCGA 4X8MA 2O8CB 4AG6A 3TMKA 2EFGA 5BN4A 1AS2A 3CW2A 4HB3A 2R44A 3EZ6A 1FP7A 2ATVA 3IHWA 3MWYW 3X1DA 1H8HD 5C18A 4YXWA 1DAGA 1AQUA 1KKMA 3QF4A 1KO4A 1G41A 2VYFA 4QNRA 4RFSA 1OE0A 2A5FA 1N0VC 2AD1A 2Q3FA 2JDID 3LDAA 1KO1A 1RJ9B 2OBMA 1FX0A 3TW4A 3WBJA 3ZS9A 4RFVA 2FFBA 3TQFA 2QEQA 4M4SA 5DO9A 4PO8A 3ZIAA 1N0WA 5J4VA 5FBWB 4M9XA 2XZPA 2GF9A 1G64A 1CBUA 1KI4A 2DWPA 1R10A 4NYMR 4Q02A 4BWYA 2RHMA 2QSYA 4OK5A 2ONJA 1D8TA 4F38A 1N6NA 1DAFA 1M7HA 1NSFA 1A2KC 4QGGA 1U94A 5FBVB 1ESNA 8OHMA 1RPZA 4EJSB 1SHZA 4LRWA 4FMCB 4CEHB 1KTVA 2OCYC 3EX7C 1EG7A 3RWOA 1S9DA 2K5UA 4XSHA 4LWZA 3R7WA 3NTUA 3CR8A 4URUR 5KSOA 1P73A 3GLGA 4QBIA 1W0JA 4OI1A 4LGMA 2QY9A 1OH5A 1CR1A 3QF7A 3QXXA 1S9HA 5J4YA 1AN0A 3ZIAD 3OFNA 2VEDA 1NY5A 4A4DA 3U44A 4TYNA 4J0QA 2CLDX 2QP9X 3C5CA 1VPLA 4IFEA 2JLSA 2IYRA 1CR4A 2YC4C 5L3QA 3AVPA 4A36A 4Q9IA 3AB3A 1WBDA 4A2PA 1FNMA 1W4AA 1XMIA 2XZLA 1N5JA 2V6JA 2CBZA 1QVAA 4E03A 4DSNA 3KFVA 1W36D 1II8A 3I92A 4XWAA 2J3EA 1MRNA 3ASYA 3W9YA 4AK9A 3TQCA 2FPKA 3CBQA 1P62B 3WY9A 1P9NA 5CIQA 2GBLC 1JAHA 1T0JB 4Z8YA 4EFNA 1CP2A 3W3AA 4AYXA 3Q85A 2CVHA 4W5JA 4BRUA 3K9NA 4IJMA 4P4SB 3TBKA 4R71A 1VG0B 2RGNC 3ZGXA 1B23P 2YOHA 1FTNA 2VP9A 1U98A 4DVGA 4BLQA 3W3ZB 4MH0R 3DKVA 3TVDA 1KJYA 2LKCA 2Z4RA 2JJ2D 3NH9A 2ZE8A 4HI0E 3IEUA 4N3NA 1VG8A 2QBYA 1QHSA 3EG5A 3MMPA 2IS1A 1UEIA 1WXQA 2J41A 4D2IA 4BEJA 4CF7A 5KDDA 4DZZA 2C99A 1E2EA 1KI6A 3C7KA 1P72A 1MV5A 2ERYA 4DHEA 3EZ9A 4QOSA 2F1HA 1OXVA 3ADDA 1T3SA 1E9EA 4M1YA 1K5GA 4KLNA 2XEXA 2ANCA 2NQ2C 3THYA 3SNHA 3OEHA 2OZEA 2WWWA 3JZMA 2RB4A 2W6JA 4LBZA 121PA 1S4QA 4TL8A 2FX3A 1R0XA 1NG9A 1BKDR 4Q4HB 3T12A 1ELOA 1YKSA 2A5JA 4QNMA 1R5BA 2QMUA 4FXPA 2B92A 1SGWA 2FPMA 3DO6A 4W7SA 3THYB 5EXSA 4UXHA 3THXA 4PFSA 5KTYA 2H16A 2QTVB 4EDHA 3BFKA 4EPWA 4NMMA 4ON9A 1A5TA 4TMXA 4TSFA 3PEVA 3U2QA 3GJ6A 4TT3D 3P27A 3EC2A 3LX8A 3K53A 2VSXA 5DE3A 5FPSA 4DUGD 5E4FA 2ZIAA 4WVFA 2FWRA 2OV2A 5HTKA 4B2PA 1L8QA 4DDVA 1NLZA 1UADA 2XTZA 4M8NE 3F3YA 1RYFA 1G7TA 1ZC3A 3ADKA 4HAXA 4UJ5A 3SC3A 2ZPTX 4M22A 4TYQA 4AYTA 2C03A 4V0LA 4AKGA 2FFHA 1N6LA 4E07A 4WZ6A 1E2GA 3QBVA 1QHIA 5TDHA 5CYPA 4MGIR 2IYUA 1HTWA 2VHTA 4E22A 1G17A 4GNKA 3BE4A 5HPYB 1E0AA 3LNCA 3KUDA 3RABA 1E2IA 4KV9A 4TWZA 2FDCA 2CJWB 3I5YA 3CWZA 5G40A 4Z51A 1MH1A 3IBGA 1F2TB 4Q1AA 1E0KA 1G3QA 3C41J 3EASA 4QGHA 2CE7A 1OIWA 3EPKA 2GJKA 2YHSA 3TSOA 4LC0A 3O8DA 2WICA 2ZQ5A 3AUYA 3I5XA 4D0NA 3AV0B 1HYQA 2QMEA 1S3SA 2Q9BA 1TEVA 2BKUA 2RAPA 4IVPA 4Q1BA 2ZI6A 1IN5A 4A1FA 4PSAA 4RSGA 1IXZA 3CKLA 4RZUA 4WZAE 1KKLA 3MWJA 1VIAA 4HLUA 3A1VA 2QORA 1X3SA 5EE9A 2XXAB 1Q3TA 2KWIA 1YZNA 5A0FA 3MJHA 3ZDQA 3FMIA 1S8FA 5FOSA 2REOA 3DPUA 1P2TA 5FTMA 3FPAA 1U99A 5CB6A 5TARA 2J9RA 2KBFA 4I1UA 3PUYA 3X1WA 2JLWA 3KQLA 1SVMA 3O8BA 4R9UC 2HDNB 1W36C 2J0UA 3T1VA 3CRVA 1W5SA 4NE2A 4UNPA 3SJZA 1AS0A 1G291 3PVSA 4IDOA 5CB8A 3W6PA 2MMGA 4JKIA 4GZMA 2D7CA 1GWNA 1CXZA 2GZAA 5HZKA 2I4IA 3EC1A 3PEWA 2GDJA 4BLTA 1E0SA 1N3BA 1SVLA 2RGCA 3VHXA 2FNAA 1FX0B 1US8A 1W2GA 3Q8XB 4IOLA 4AG5A 4Q1FA 1US8B 3LVRE 4OBEA 3X1XA 2VP4A 1OPXA 3BOSA 1MO4A 2VH5R 4LYJA 5AJXA 5JJIA 1QHHA 1WMSA 3TGPA 3IUYA 1E2NA 2BCGY 2GCOA 4Q47A 4B47A 3OEEA 2RGNA 1TL7C 3QG5A 1W7AA 4B76A 4JLMA 2GILA 3M1IA 4LV8B 1TUEA 2IYXA 3LA6A 3AVYA 3NG1A 1NBME 4PQFA 4DCVA 1UKVY 3ZQ6A 4QM7A 3EPJA 4MYTA 2WAYA 5KPJA 3BD9A 5TY0A 4R7ZA 1PUJA 2ZRIA 5KSYA 2FFAA 1JAIA 4OK3A 4DT1B 2IWHA 3P32A 3WYAA 4M1MA 3BIFA 4WOPA 2DFNA 3CNLA 3BAFA 4LUCA 5FFMA 2PLFA 5IT5A 1JEEA 4AWXA 5JEEA 1ZUNB 2FZLA 5FBRB 1JJ7A 3H1TA 3CLVA 3W34A 3WHLA 1AZTA 2DFTA 3D6TB 3B6EA 4RY2A 4DB2A 3QBTA 4CIDA 3BB4A 4M1SA 1T91A 4HZUB 2NO1A 2AFHE 4LYFA 4P3YA 1ZYUA 4BFWA 3IGFA 1DS6A 2PL3A 1P2SA 5J4HA 4A9AA 1BIFA 4LV5B 3IILA 1YRAA 4MGYR 4FIDA 1ZP6A 2WTUA 1AA9A 4M53A 2WJVA 1LS1A 2VL7A 1AKEA 1JXOA 1S96A 2PCJA 4QC2A 2WV9A 3V4RA 1E4VA 1VKJA 2NOAA 3BJIC 2IS4A 4AKHA 4JVMA 1U2RA 2CHQA 2ANBA 5CM8B 2CJWA 4NBSA 4TLDA 1QVRA 4CDGA 1II9A 2QT0A 1Z2AA 1M34E 2QM8A 2CK3A 3A4MA 4G3XA 4LJAA 4ZDIA 5FUXA 1E94E 4IDHA 2J0UB 3IKJA 2EFDB 4JLOA 1XCMA 2VTKA 1NG1A 2ZE6A 1WRBA 5L3RA 3SDZA 1FP6A 4LJ9A 2QPTA 2V4ZA 4XJXA 1CR2A 3NBFA 1JNYA 1V43A 4X8LA 1V5WA 1UAAA 1G16A 3AKDA 3KTAB 4LSGA 2C2HA 5DN6A 4KBFA 3QNUA 2N1BA 4OHWA 1YR7A 1NVVR 2CLCX 3U60B 1KDTA 2C5LA 3VKWA 4S2EA 3CRQA 3KJHA 2BMDA 3BK7A 2ZI9A 2D06A 5FI1B 2N46A 2GXSA 3WNDA 1P9WA 2W2TA 4Q9JA 4CT5A 4CEIA 4LK2A 2BEKA 4QL3A 3E5HA 4BFSA 2B8TA 3P1JA 4OQLA 4ARZA 3NBXX 1E9DA 3L8ZA 1Z6YA 3GLGB 3THOA 2E9SA 1GKUB 1MR3F 2A3RA 5EXPA 2JLRA 1VCOA 5C4GB 1FPMA 1GSIA 3FKSA 2JLUA 2WJJA 2HXYA 2AK2A 1SKYB 2MSEB 2IYTA 2PT7A 4AD8A 2WSSA 3FOZA 1BOFA 2W6IA 4IEIA 3UANA 2A78A 4GP6A 2EWVA 1WCV1 3NEJA 1XTIA 4JLAA 4QHSA 5JHHB 1TPZA 5JWRA 3QXSA 1VYTA 2QSZA 4GPTA 2X1VA 3JVUA 1GZSA 3DMNA 4PHTA 2J7PA 2PX3A 4XH9B 1IAQA 1E9FA 2Q6TA 1E0JA 3NDPA 5JMTA 2V1UA 4B35A 5FPYA 1YZKA 1XJ0A 4HLQB 1DVRA 1RFLA 3KKQA 5DH9A 4AYWA 3RLFA 1TMKA 1Z28A 2OLKA 2IXEA 1Z83A 3P26A 1P2VA 4DEYA 1DOAA 3GEHA 1RKBA 5HKKA 4TTQA 1GM5A 3OIVA 4B48A 4DWJA 3NEYA 4OQXA 3DL0A 4WW0A 2GJ8A 4EQ6A 4KU4A 2P5SA 4FMDB 2BCJQ 4OQMA 2ZREA 1EFCA 4C4PA 1J99A 2JDIA 4XIGS 2QMOA 2Z4SA 2JLXA 4TLEA 2VHQA 5KHOC 4B3CA 4EPRA 5F9FA 2G83A 2FJUA 2WIAA 2IBMA 3R20A 1CTQA 1N6KA 3B1YA 5DYGA 1K6MA 1A2BA 3FGNA 4B2IA 2XNDD 3B78A 4PC3A 1D2NA 4JJKA 2V7QD 1W0KA 3UMFA 4D80A 2HXSA 2VLIA 3LH5A 3PCRB 4NL4H 1II8B 2QRZA 1ZVQA 4QJ5A 2VP6A 5HE8A 2ZRGA 4NCKA 1GL6A 1NMXA 3IQXA 4Z1MA 2L0XA 1XTQA 3NKVA 2W6ID 4PQRA 2GF0A 2AX4A 4TLCA 4DCSA 1I2DA 3EXAA 2QA5A 5H1YA 2XJ9A 4DUGA 4GSYA 3P20A 5BW8A 3SYLA 5AJZA 3LBIA 1MRSA 1Z6TA 1PUIA 4G1UC 2FPLA 2XAUA 3LQQA 1Q1EA 2YINC 3CO5A 2BJVA 2JAQA 4RD3A 2DR3A 3TK1A 1QHYA 3J81k 1XTRA 4PHHA 5LPNA 3B8HA 1G7SA 4BFZA 3BB3A 2VF7A 2IHBA 3ZZTA 3U6KA 1M1YE 1I4DD 621PA 1NBMA 1MABA 3HYRA 2QU8A 2V54A 2GTPA 3G82C 4XTRA 1Q0UA 2EU8A 3VR1A 4D25A 1CIPA 5HCNA 5JWHA 4XTCS 2ORWA 4Q7JB 3PUWA 4CEHA 5CLLA 3U3OA 1LS6A 2V6IA 3OESA 4DRZA 2GVZC 5K8IA 1G8PA 3OIUA 4X8HA 1E2DA 2PZEA 3SBDA 3ZLJA 2Y8EA 1X86B 3GCGA 3QVUA 1P7CA 4BFTA 3RHFA 1TU4A 3I1FA 1ZUIA 3LO5A 4BGDA 2D3WA 4U7DA 2J0SA 1Z0KA 2H18A 3FWYA 3GJ4A 2W0MA 3OZXA 4TMTA 3U3KA 2BMJA 2FFQA 4JIMA 3RSOA 4O25A 4EFLA 4C2UA 4KYUA 3BH6A 1G6HA 3LRPA 4GOXA 4AI6A 5DNYB 5LD2B 2VP2A 1IY0A 2C9YA 2KI5A 4ZCIA 5SZIA 2JLVA 1RJ9A 3GLHB 3PR1A 1NVXQ 1T0HB 3H4MA 5FL7A 1DO2A 3ZZUA 4DB4A 4DLXA 2FSIA 2B7BA 3VTKA 4HZIA 3Q7QA 1U8YA 4EIWA 1SXJC 3C14C 3K09A 3LXXA 1UPTA 2IWRA 2JJ1A 2FZ4A 3REFA 1W44A 3RS5A 3GJ7A 1JB1A 2BBSA 1KMHA 1TQ2A 1GP2A 3RANA 4BUJA 4PAQA 3QVVA 1E1RD 2EW1A 4MYUA 3NH6A 4FD2A 1S1MA 3EA5A 4HB0A 3FDIA 3DHWC 4B71A 4OQNA 3THWB 5F3WB 1NMYA 2F55A 5HKKD 3M4YA 1JR6A 2BKEA 4MRVA 4C30A 1BYUA 2DPXA 1MO5A 3DKPA 1P75A 2P5TB 3MJRA 1PLJA 1YR9A 5JSZB 1U9IC 5EP1A 5J4KA 4ZI2A 1T6NA 3S1AA 2A9KA 2NPFA 2YWGA 3GLFE 3EIQA 1WE2A 3FHCB 3GEIA 4B74A 2B21A 2CXXA 4OJQA 1QG2A 3OFND 1AGRA 2G0NA 3N2EA 3SQXA 1OV4A 4QHTA 3B85A 2IT1A 5FUWA 4RD6A 1E6CA 1G5TA 4RD2A 1NBMD 2IUTA 2O52A 2AD5A 3R8CA 3R9XA 3PITA 4URZR 2JASA 2R6GA 1Z29A 1KDPA 4JLKA 4Q4LA 4BLPA 2KBEA 1KMQA 3U3MA 4Q5IA 4E09A 4HUTA 2OFOA 2R8RA 3LW8A 4KI0A 3THWA 2GEDA 4QG7A 3QY0A 1YZLA 1KAGA 2W00A 2ERXA 1KDOA 3KB2A 2ZSAA 1QBKC 1XDBA 3KUCA 3LAWA 3DZDA 1DG3A 2BBTA 1IONA 5KUTA 4L16A 1OFIA 2EFHB 2OESA 4ZV4A 1DEKA 2CMKA 4EKDA 3PJRA 2G88A 2OEPA 1PLKA 1GUAA 3PXGA 3CH5A 2QPAA 5FOXA 3D7MA 3PQCA 4NCNA 1UBGA 1U81A 4KFRA 4QGAA 1KI9A 4IDQA 2F3TA 2YC2C 2V3CC 4LZZA 3QKSB 1U0JA 1CJTC 3WP0A 2XSZA 5FPHA 3Q3JB 5FOVA 5F98A 3O8CA 3BWDD 5FI0B 3BC1A 3QPUA 2IEYA 3SFVA 3WP1B 2REXB 1KK0A 1DAMA 4CT4B 2PZFA 3FHOA 1E9BA 1G20E 2VSFA 5IDVA 2RGAA 3QQ5A 1G3UA 4G5QA 4M1WA 4A6XA 1KZ7B 2PEYA 1XCPA 2GHIA 4Q4HA 2H1LA 2ZRDA 3BORA 5GVRA 4XVUA 1UBEA 4B3DA 1N0UA 5DIFA 3B60A 3K0AA 4LI0A 2FH5B 2OCAA 5AJWA 2J5XA 2JA1A 2OT3B 2ZE5A 1D9ZA 4JMPA 2F7SA 2MMCA 2QL6A 2ZU0C 4ITRC 4KJZA 5J40A 2JATA 1OJLA 4XVQA 1VHTA 2GJSA 2NIPA 4B6EA 3EZFA 1Z07A 4DKXA 3WMFA 1DAHA 5LB4A 1XMSA 1FL9A 3CF0A 2EYQA 1JEDA 1MKYA 4KFTA 5EZ5A 4U00A 2JJ2A 3X2SA 4Q9KA 4URVR 2XB2A 5EP3A 4P4UA 5DI9A 2WKPA 2QG6A 2WM9B 3Q9LA 2O8DB 1XFAA 2ZRBA 4CYMA 3RNLA 3UMSA 2W0SA 2ODNA 2ZRKA 3A36A 5LBIA 3TW8B 1KHTA 2JJ8A 3EIEA 3RRNA 4W5HA 1W1WA 3EWSA 3UK6A 1RRPA 4M1OA 2YWEA 2ZJ8A 1E1RA 1XRJA 2C04A 2HLDA 4HAZA 1L4YA 4HSEA 4TQAA 4YDHB 3ZH9B 4DLTA 1L4UA 1NIPA 5TV2A 1JECA 3BXZA 4ESHA 1W0KD 421PA 4BEBA 1GTVA 5FTJA 2I3BA 1SXJD 4F93B 3SE0A 2HCBA 3SJAA 3ZD6A 2REBA 2F3RA 4KFSA 1XB2A 1W48A 1T4GA 5C1BA 4TMWA 4C0AC 1CULC 4JKYA 3CZQA 1SQ5A 2FE4A 3K09C 4L8GA 1XD8A 4M9SA 2DB3A 1G8FA 4MA4A 3T06B 3IEVA 1NKTA 4RZ2A 1NN0A 1L7VC 2RGEA 3CR7A 2B7CA 3CZPA 4DCTA 2WWIA 3JZAA 3QKUA 3CH4B 2J0VA 4OKSA 3O47A 1ZIPA 2H17A 3VU9A 4B6FA 2IYLD 2V9PA 1MO6A 4W9MC 1PVOA 1XD2B 1XD9A 3ONWA 1PV4A 3EPHA 1ZJ6A 4GT1A 4GP7A 1H8EA 4YXWD 2ZEJA 1TQ6A 2C95A 1U9IA 5FBQB 3ZVLA 1Z22A 1ZNYA 3AVWA 3B7GA 1OHHA 1FUUA 3B9PA 3RC8A 3DVLA 2GCPA 3ND9A 4NH0A 1F5NA 1KAOA 5EUMA 2R6CA 2OM2A 4M9QA 2Q21A 4ZIRA 4IOKA 1Z0FA 1GDDA 1E69A 4ZO4A 1NVWQ 1NKSA 2NO6A 4Q7KA 5K8LA 4PPQA 1OB5A 1E79A 1LVGA 2I1VB 5JRZA 3CX8A 4MRRA 4MDEA 3AKYA 1ZC4A 2ZANA 1GOTA 1NSTA 1EFRD 4NZYA 2J1LA 1EFRA 2QM7A 2HT6A 1YQTA 4NU0A 4E5UA 2W58A 3B5JA 2HEIA 4AKEA 2D7DA 2QTHA 2ODWA 2CNWA 3UWOA 3U5ZB 3VU9B 1VECA 3X1ZA 2CE2X 3KKPA 1KO5A 3C16C 3C8UA 3NHAA 1G4AE 3BFVA 1KO8A 3IIKA 4RKEA 3TRFA 3Q7PA 4Q18A 1FFHA 3MAAC 1C1YA 1XTJA 3CPEA 2NZ8A 2IYZA 5L3SA 2XX3A 3LV8A 1G7CA 2ZAMA 1XWIA 1RVDA 3KQHA 2XOKA 3FKQA 3L82B 3U3RA 1E2PA 2V8OA 1RZ3A 4TL9A 2VHJA 2JLYA 2ZS8A 1LF5A 1ZNWA 3GJ0A 3UXMA 2DFKB 1KSJA 3I8SA 4P33A 4PANA 3QEOA 3NBYC 3MSXA 3NHBA 3TUIC 5AUNB 4C2TA 1KGDA 4JLPA 4PZYA 5JHGB 1JPNA 1XNJA 1Z63A 4RD4A 2WJYA 5KOYA 3SHFA 5K8TA 4XVRA 1P5ZB 2QP3A 4KAXA 1DAEA 3Q5EA 3AEZA 4RZXA 4LHXA 1XXHE 2XTNA 4Q1CA 1OLOA 4ZDKA 1GITA 2ZXUA 4UNQA 4Q4AA 1FTSA 4ILEA 2XTMA 3PEYA 3DM5A 3RS4A 4NCIA 1ZM3A 2Q9AA 1W4RA 2ZJAA 5AJYA 2ZJZA 2F1JA 1Q1BA 3VHLB 3DEFA 4A8JB 2OFXA 5DHFA 5CK4A 3MWKA 1NLYA 4ZKEA 4L5BA 3KQUA 2ASEA 4CW7A 2PX0A 1GKIA 1FZQA 1GRQA 3R9WA 2F1IA 2QQ0A 2X2FA 3K0FA 4DSOA 1TQDA 3B1VA 3GLIB 4POAA 3BB1A 1YZTA 2CCGA 1QRAA 3U4QB 3ZD7A 4B73A 1CR0A 1TUIA 2IUSA 1FQKA 1OFHA 3GLIE 4TZ6A 5DSZA 5D3QA 1FNNA 1SXJB 2ORIA 2P65A 4GZLA 4JSYA 4ZDJA 1KI1A 4Z8XA 2YWHA 5BN3A 2SHKA 2BDTA 1QHHB 1Y63A 1Z0IA 3UKDA 4BQSA 5B58C 4U02A 2X77A 5J5CA 2VP0A 1CJVC 1K5DA 2D62A 4MRNA 2HF8A 4L9WA 5B64A 1R6BX 4JZKA 2KJQA 4V0NA 3REGA 2A2ZA 4F4CA 3WXMA 1GILA 4MUBA 3PEUA 3WYFA 4F4IA 1NN1A 3WRYC 1ZD9A 3GLHE 3TKLA 2O8FA 4YMUA 1WP9A 4LBWA 2ZRMA 5EP2A 3ADCA 4ZCLA 2YV5A 4FMBB 4IFBA 4LJ6A 4WXRA 3LLUA 4ERNA 2VP5A 3B82A 3FMPB 4TLBA 2C98A 4DDWA 1HE1C 3IIMA 2ODEA 1ZMXA 2O0KA 2VHUA 1F2UB 4NP6A 4CZ2A 1Q57A 1R5NA 1DELA 1YR6A 2IYWA 5AUPB 1BO6A 3GLFA 3C4JA 1NI3A 2GJAA 2YJTD 4URYR 2OBLA 4YMSA 3GJ8A 3M6AA 2JJ1D 1E98A 2FSFA 3I72A 1SVIA 2CLSA 2R62A 4UNNA 4BFYA 2WHXA 4DCUA 1E2KA 2AKAB 4PSKA 1IHUA 3W5IA 1G18A 5CDFE 3ASZA 1TNDA 1DG1G 3GJ3A 4C0HA 2LCFA 2A5DA 1G5PA 2ZU6A 3VKHA 4K8OA 1YRBA 2GVDC 4KSCA 4HLUC 4L15A 1R0WA 3LBNA 3VX3A 4A2QA 2EVWX 2OAP1 1ZM7A 2UKDA 3TUJC 4A0FA 4LYAA 2GKSA 3AF2A 2OBNA 2RGXA 3K70C 2YZ2A 2IW3A 5BN5A 4P0TA 4QXAA 2QAGB 3CF2A 2PMDA 3IQWA 2IYYA 2VA8A 4BRWA 3GFPA 4QM6A 4OL0A 1XEXA 1ZD8A 5EE5B 1UKYA 2FA9A 3KJGA 5ANRB 2O8BB 5FBLB 1OXSC 1DBSA 2WJIA 1G5RA 1HA3A 4HYYA 1JR3E 3ZQJA 3A1TA 1E2QA 4TYPA 1OIXA 3PUVA 5JS7A 3TJZA 3FFBA 1T3LA 1IN8A 3DMDA 1TX4B 2OCBA 1P60A 2ZM5A 1R2QA 1OYYA 2JEOA 2VIIA 3LW7A 4L9SA 2ZSFA 4UJ3A 4N1AA 4MGZR 5FR2A 1P9RA 1UDWA 3N70A 3RSLA 3AVTA 3OEED 5DN6D 3C15C 2FEOA 4DIDA 3Q5DA 4D26A 2A5GA 2DFLA 2PBRA 1Z5ZA 4M2LA 1KMHB 4CEJA 1Z0JA 2V7QA 2E87A 1H8HA 1YE8A 4KODA 4LOAA 4OI0A 1U90A 1XXHA 2IUUA 1G6OA 4YDSA 4PX9A 1FQJA 3UATA 1AK2A 2BIFA 2C8VA 4Q4JB 3TR0A 4PO1A 3I4LA 1DAIA 4D6PA 3AVOA 1R4AA 4URXR 2XITA 4GFDA 1MOZA 1ZINA 3KZ1E 4TLAA 4AKIA 4DIEA 2O8BA 3W8NA 4L4UA 4QHYA 4AURA 2CNWD 1VCIA 4TQ9A 1NMZA 2XNSA 2GK6A 1LFDB 2IK8A 2ZJ2A 5FTNA 4OK6A 5TB5A 5A4JA 2ZTSA 1XEWY 4Q01A 1ZBDA 1M8PA 3RS7A 2OO7A 3QPVA 1S3GA 1X8JA 1HQYE 5CDFA 2HYIC 2ONKA 4RZ3A 2XB4A 2ZI4A 4JLBA 2PCLA 1SHKA 4MUAA 4NYIQ 1CEEA 3B1WA 1Q44A 2WWXA 2PEZA 1GRNA 1AS3A 3PG5A 3F0TA 5IK2A 2IS2A 1OIVA 1FMLA 1D9XA 2QZ4A 5KSZA 1ZNXA 4PZLA 2ORVA 4Q66C 2QNRA 1OXTA 1XTKA 5EXXA 1VCNA 4A8JA 1F60A 4KSBA 1S2MA 1DE0A 1SKQA 4D0GA 5FOTA 4D4MA 2AK3A 2N42A 2YYZA 4I99A 4JSTA 2EYUA 3SEAA 2XNDA 5JWOA 1R8SA 3RDPA 3WBKA 2ZSEA 3CM0A 4OYHA 4EJSA 1QHNA 3IBYA 3KQKA 3K70B 1G7RA 1OH6A 2VO1A 2RGGA 4BFXA 4ZI3A 1XX6A 3AF4A 3QKTA 2ZI5A 4V0OA 3RAPR 2OE2A 4DLSA 1Z47A 3NC0C 1G3MA 1O87A 4I1SA 4QKQA 1E2HA 2UZIR 1N5LA 3VR3A 3G5UA 3HP1A 3I62A 1VDZA 4AY2A 1E9RA 2J87A 1W2HA 3QKSA 3D3QA 5IRCD 3HU3A 3VKGA 1KI3A 4G5RA 3T34A 4YQFA 3E1SA 5BWMA 2VRWA 2OHFA 4FWIB 3H86A 4HDQB 3AUXA 2QQEA 1Z06A 4KITB 1A1VA 3CF6R 3DM9B 4V03A 5UKDA 4OHZA 1M2OB 2A30A 2CEAA 4Q19A 4GMXA 4QJ4A 3WMGA 5BYKA 2VPPA 5J47A 4XWOA 3EA0A 3VMFA 1X1RA 3TSZA 2VQSA 5JI2E 1OT3A 2G0TA 3KJIA 1F48A 4LHWA 2WKQA 2O8CA 1E2MA 1F6BA 4A82A 1IY2A 2GJ9A 1E99A 4B3FX 2VHCA 2PT5A 3UIEA 4LHZA 3CRW1 1HURA 2ZVPX 5M04A 3U44B 4WBSA 4LV6A 4OI4A 1CF4A 3E70C 2J0QA 1N25A 2QI9C 4IW3B 4HAYA 1KJZA 4MITA 3BS4A 3PIRA 5KSPA 2DCUA 4DEXA 1WF3A 4ABYA 4TT3A 4AC9A 5KPDA 4S35A 2WOOA 4HUQB 1E3MA 4FCVA 4OI2A 3QXJA 4JBXA 1EWQA 2UZ3A 1SVOA 4LYHA 5HE9A 2DHRA 4PC7A 3K8YA 4U5XA 1CRPA 4LJYA 1CU1A 1UEJA 2ZE7A 2OFWA 2AXPA 3HPRA 1IJEA 1G8HA 2ZUCA 3OAAD 4HAWA 4Q4AB 3A58B 3BERA 4R98A 4TMKA 4ACBA 3ICEA 1CJUC 5DI3B 3B1ZA 4JS0A 2GEVA 4ZPXA 1XBTA 3TAUA 2ZYTX 1P2UA 2CVFA 3A4LA 1XEXB 1ZAKA 2JCSA 3MG9A 5EP4A 1OSNA 1WB9A 3AVXA 4B44A 1ONBA 2ZYVX 3LD9A 4G5SA 1JPJA 4LHVA 1W4BA 1CJKC 3KKMA 4Q1EA 4NPHA 2C9OA 4NYJR 3P4XA 2PJZA 1J90A 4IHQA 5IK2D 1YZQA 4A8JC 5KO2A 2GETA 2R6AA 4QBHA 4KLZA 2GA8A 3AVVA 3AF3A 4B32A 1AQYA 2ZAOA 1EFHA 5C46F 1FW6A 1M7BA 3FHTA 3RS3A 3G0HA 3VQTA 5KU1A 3VR4A 1PLLA 1EX7A 3FKSD 5FL3A 3E2IA 1HV8A 4HDOB 4LHYA 2QGZA 3U7FB 1Q20A 5JBQA 3RC3A 3QJYA 1YJ5A 3L2OB 1ZU4A 4YLGA 3RYTC 1HY3A 3M0EA 4P32A 3ZVNA 1R5OA 2RH5A 5EZ6B 1G8GA 3TAHA 4NCJA 1SZPA 3KXLA 1A7JA 1VCMA 3VNVA 2OAQ1 1KIMA 3QPWA 3BRWD 1N2CE 3GFTA 5AR1A 3LY5A 3EWAA 4BLSA 3HU2A 1JI0A 4FCTA 3OE7D 3AVUA 5EUQB 4I1VA 5EQTA 4ZDWA 5JJKA 3TLXA 3THXB 3AM1A 1Z0AA 3L8YA 3TIFA 1NF3A 2I1QA 3VX4A 1T3HA 2WVJA 3H0KA 2VF8A 4ZIRB 5TMPA 2YKGA 4EQ6B 2LKDA 3AP1A 2XJ4A 1E1QA 2EFEB 1TQ4A 2WWFA 3PV0A 4NCHA 4PZZA 1XPUA 1N6HA 4PHGA 1IQPA 1E79D 4YC7A 1ZU5A 5CM9C 2A7QA 2HUPA 4V02A 4Y0AA 3CX6A 3WNBA 4D4JA 1K8RA 5EE1A 5L3QB 4JVLA 1D5CA 1TF7A 2G9NA 1KOFA 1TADA 4DLWA 3OF5A 4IXMA 5DI3A 3L0OA 2WJHA 1W0JD 2BM0A 4BFVA 3EPLA 3HU1A 4R2IA 2D4HA 3CPHA 5JCZA 2YWFA 3IPYA 4O3MA 1C4OA 4B3BA 1HE8B 1XJQA 2C96A 2ZJ5A 1W46A 2C77A 4A0HA 2BWJA 4GRAA 4XWKA 5G3ZA 5JRJA 4TYYA 4PC1A 3LVQE 3KTAA 4LBYA 3A1SA 1SVWA 2FF7A 4C7OA 2QPOA 5L3VA 1UF9A 2E1RA 4Q7MB 4UXJA 4LBVA 5GJVC 4DCNA 3GJXC 3U6BA 3W8RA 2IHYA 1MO3A 2G1JA 1F2TA 5JECA 1D2MA 1E2JA 221PA 3WMEA 1COWD 4PSVA 5E7MA 3KL4A 2OG2A 2QENA 4ARZB 4K81B 5GADl 4MRPA 1HUQA 4A15A 5B2ZA 5C4MA 1IY1A 2PZGA 3IO3A 5KNCA 2QUZA 1IXRC 4XD7A 3VR5A 1W5TA 4A0GA 3K9GA 1KK2A 3MFYA 3MLEA 2IX3A 3AKEA 2CL7X 5JJLA 5KNDA 1NY6A 2QROA 4TYWA 1TU3A 1RC8A 4GDFA 2J45A 1UBFA 2ZRHA 1TF2A 4B75A 4NYMQ 1Q1QA 1N5IA 3GQBA 2EWWA 2BC9A 1YZGA 4Y0VA 3MWLA 4NDZA 1W36B 3ZS8A 1J2JA 3ECCA 4JLJA 4UNRA 3KKNA 4QBGB 3DDCA 1NVVQ 1II0A 5K8UA 1LB1B 2GZDA 3CONA 3FB4A 4FMDF 3SS8A 2ZI3A 3AH8A 4FW9A 2CL6X 2GCNA 3UWKA 1UM8A 3X1YA 1U8ZA 1IXSB 2IF2A 1G4UR 4G5GA 5GJWC 3IHLA 2Q9CA 2H92A 4GOJA 1JALA 1G9XA 3RS0A 2ZETA 1ZIOA 4OQFA 5D3MB 4TMZA 2RHDA 3CRMA 2OSBA 1HT1E 2CCKA 2OUKA 3LQRA 2LWIA 2O0HA 4JVNA 4DSTA 2BOVA 4NYJQ 2X2EA 1M6NA 4F91B 4C0SA 4URWR 4D4LA 2H57A 3QG1A 1RE0A 4O2LA 2QAJA 2HYDA 1M74A 4C0JA 5FPTA 1KYIA 5JLJA 2P0EA 4FINA 3CNOA 3H2YA 1GFIA 4FWTA 3L43A 3T5GA 4C3ZA 2BMEA 2ECKA 5FOUA 2BBWA 3OAAA 5AJVB 3I3SR 2IYSA 2CK3D 3LXRA 1OH7A 3CB4A 2WSSD 3P4YA 2FMXA 3NVAA 1N6PA 2ZS9A 4KHZA 4DLRA 2G6BA 2ZJBA 3EW9A 1IN6A 2NPIA 4YONB 2ZYUX 2OILA 2QRNA 1XCGB 5HZHA 1WDTA 2FSGA 4DT1A 4ACAA 2WAXA 1F2UA 3EARA 5BYJA 3SN6A 1OB2A 4LPKA 4MGKR 3RRMA 4A92A 5E95A 1A82A 3FMFA 1Y3AA 1UFQA 4LDJA 3ZYCA 1COWA 1VIYA 5EJEA 1NJFA 1TF5A 1O3YA 2ZSBA 5FL7D 1T5LA 5GVSA 1P6XA 3T1OA 3VAAA 1CS4C 1M7GA 3HWSA 1ZM2A 1DAKA 1GNRA 5BQ5A 2W6JD 2ZYWX 3K0SA 1XPRA 4DDUA 1J8MF 4AIIA 2R65A 2IEZA 2X19A 3C5HA 3O8RA 5CK5A 5FR1A 4EJSC 4IEEA 2NO7A 3CRRA 1G3RA 1EX6A 3LFUA 2WJGA 3VFDA 4C0KA 2D2FA 1UBCA 4N0EA 4IDPA 3EZ7A 2BJWA 4I4LA 2DWQA 2Z5FA 2V55B 2EFCB 1ZCAA 3T61A 2IL1A 4EAQA 4LC1A 1E32A 2NMVA 1T8UA 1W47A 2YNMA 3BH0A 1XTSA 4MQBA 4TL7A 5CJ2A 3LBHA 5CYOA 2ZRJA 3OIYA 5A5GA 4PR0A 1QDEA 3W6NA 1E9AA
chains in the Genus database with same CATH superfamily
1IAVA 3FPFA 3H11B 2AMFA 1RAEA 4L8WB 3I1YA 3HYSA 5DYNA 4M60A 5LBTA 1Q12A 4YNBA 3T3IA 3G2OA 3K05A 1P3JA 1IBRA 3NONA 3R3YA 4XPIA 1KY3A 2LPMA 2JAOA 3GEPA 3NCHA 3WRXC 4D45A 2Q5IA 2WABA 3HK2A 2NU8A 1C3OB 3VVCA 1URPA 3HL4A 3LHDA 3JAMA 1L3BA 4XKJA 5I45A 4P3XA 2FW0A 5EHIA 4KR3A 2ZIXB 3IV6A 1TUGA 2R66A 3SZRA 1E58A 3FPCA 5AKEA 2DOKA 5AKXA 2WLSA 1O4WA 3TR5A 5BV8A 5BVGB 3QOFA 4CFZA 5A04A 3PF8A 1GCUA 4YACA 4BV9A 3THRA 2RCNA 3GRRA 4OUKX 1O95A 4M1QA 4MS1A 1UBKS 4WZBE 1BS1A 4YMWA 5H5JA 4PG5A 1ORIA 3UG7A 2FJ0A 3ZNNA 5TF0A 2XKAA 5DGXA 5FUVA 4IDCA 1GNLA 3KOOA 3R3VA 5E0OA 1NNEA 1YVPA 2JFQA 2G5CA 4CG2A 1HEUA 3A6PC 1XFDA 3X0DA 2BFFA 4PXAA 3W2IA 1W6UA 2XGSA 3HRHA 3VU3A 4Q12A 2WIJA 1M5TA 4RPHA 2WC1A 3GVCA 1WZ2A 1PZNA 1QR6A 3K73O 1QLHA 4AKSA 5LZ2A 2BF7A 4FOPA 4LZAA 1O58A 4C21A 5H70A 1NULA 3I05A 3MERA 3Q6IA 2WM3A 2HHHB 2ZB8A 4IQGA 1QRUA 1I5RA 3CV3A 2NTNA 1C4WA 4PTLA 3PE3A 5ALQA 4J0GA 3GUHA 4HYTA 3QPCA 3EGCA 2V3CC 3H2SA 5BO5A 3TG8A 1I24A 1JG2A 1Z0SA 3G6KA 4U2CA 5KCMA 1F2DA 1XOIA 3MRSA 3ONNA 3QU2A 2C20A 4AN0A 2YJNA 3I5MA 4M1TA 4NBNA 3HA2A 3IT0A 3PYMA 2W2XA 2WWGA 3B6JA 4A2WA 1R12A 1UMDB 3FTQA 3WGQA 3CCFA 6YASA 1FTWA 3I2JA 4L78A 3QYJA 4P0QB 1Z25A 1V26A 3QX3A 2OV3A 5J1TB 1B43A 4UHFA 3UHPA 4X6LA 5MN6A 5JNWA 3KOYA 1H2RS 3KV3O 4C0LA 5JZVA 5BR8B 2GRJA 4FX2A 4QJBA 4MUNA 4L4SA 5EJIA 4B7CA 2XA9A 3ND8A 4EX7A 3HYTA 4Z3OA 3WFIA 3FYHA 3UA3A 2HRZA 2JIDA 2XT6A 4RZIA 4YFVA 2TMGA 5HKLA 4B87A 2V45A 4BE7B 2Y0EA 2IEGA 2L2QA 3NBUA 3QV1A 2V5AA 3FPGA 3QENA 3A4IA 4NULA 2YH2A 4M38A 1VTKA 1KI2A 3VPAA 5JD6A 3CKKA 2FSPA 4G4JA 1U2GC 1DMSA 3WLKX 5HK8A 5CEJA 5TVKA 3AF1A 4KXFB 1H65A 3X2FA 5KNDH 2DQSA 5LQUA 3BWYA 1XU4A 4G0MA 2Z1NA 1IOZA 3SY8A 4V1CB 3PC6A 4DV4B 1CY1A 3MTQA 1RQXA 4O5OA 4JLNA 2YRXA 4MRAA 3BE8A 4TTPA 5ALIA 1FW8A 4ZKDA 3GLIA 1M2FA 4OHRA 3HCWA 1YJCA 2HC9A 5CXXA 4C3VA 2YIDA 4O4IB 2X3UA 4KC0A 3I2YX 3FTCA 1QFMA 3HXLA 3L02A 2XE8A 1QPZA 2PVPA 4G6ZA 3SM3A 1Y5RA 2GNAA 1OGJA 3ETEA 3FXAA 1YHNA 4KH1A 3CG4A 5NLLA 3BZUA 5IJZA 4OFWA 3EQ2A 2FN4A 2DGDA 2WIBA 1E96A 4P1ZA 4YRZA 4HWOA 4Z54A 1UBTS 1RRCA 1E2FA 1JG1A 4JT2A 2OBXA 4DILA 2A1IA 2JIZA 2ZB7A 2AIRA 2ZITA 3ZCRA 4BVEA 2WOJA 4XWGA 2ACKA 4WXEA 4EOGA 4ZARA 3HKDB 4Y2PA 4JJGA 2VQ6A 4D81A 2M6SA 1NYLA 1UFRA 2WINI 2YOFA 2Z6UA 1WDMA 2VCHA 4HAVA 3NDBB 4CR7A 1IBCA 5DXJA 3TINA 3MB5A 5CTJA 1N5KA 4NSNA 3C1UA 1XZNA 1YRWA 2O57A 1KY2A 2XOKD 3KYCA 4FR0A 4BMNA 2PUCA 1NNSA 3FAZA 4BGIA 2GQ0A 3N2KA 1QFXA 4L72A 4A0RA 3BGWA 4XPZA 9MHTA 2JGRA 2PGJA 1RIFA 5CURA 3PQ8A 1T2NA 3VPCA 1X9IA 2UYHA 3C3YA 2X8AA 1GRVA 4X54A 1L5NA 2C2ZA 2G71A 4KLAA 2JGDA 2Q2WA 4DLZA 1RMYA 2VKTA 3K1JA 2VJMB 4OGLA 3NIFB 4R3WA 3F7TA 1U7DA 4LOKA 2ECOA 3UV6A 5D84A 4ZRDA 4DA9A 2AN9A 2BEJA 2R6DA 3GP3A 2DPYA 2JEZA 2R7MA 3HVUA 3KR2A 4L95C 4PLZA 4X95A 4UU1A 2MSCB 1B8PA 4N47A 2F9FA 3TQQA 3TQOA 2WFMA 3DUFB 4BASA 5DT9A 2IF0A 3WHKA 2FPSA 4HWTA 1WG8A 4P4TA 4XCQA 1SEPA 3HWX1 3C48A 1XP5A 2NAPA 5AKYA 3SYNA 4M21A 2QGNA 5EJ6A 5G41A 3SYKA 3COJA 1ULZA 2QX8A 5LZ5A 1USWA 3KJFA 1EWRA 5KCZA 1JFFA 2WUGA 1HZZA 1OHHD 3QEKA 1JWLA 1MQ9A 1Z8FA 2Q5JA 1C1XA 3T35A 3ER9A 1JLMA 2HU8A 4LF7B 1IPFA 2QP4A 1NT2A 2CHFA 2VDJA 2I7XA 3OPXA 4O0MA 3V4OA 4KVGA 3GW8A 3U40A 3UG6A 4DIFA 2B34A 4II2A 1KK1A 3MWEB 2O0JA 4B80A 1V48A 1NM5C 2C5HA 3KHTA 3MS4A 3RBAA 1Z2PX 7REQA 5EPEA 2CL0X 4W1SA 3VPSA 5EKSA 4YB8A 2OCDA 3FVQA 3ZZ0A 3E0QA 1XZBA 4IKPA 4MV0A 2J9ZB 1J8DA 4R68A 3AB8A 3WWDA 3OWOA 3DOFA 1VLMA 1RW4A 5JXIA 4DRYA 1ZM9A 1M76A 3PFKA 5HIKA 1OXXK 1X9HA 2H85A 3KDSE 3VVBA 4NJMA 1MIHA 4Q4CA 1N3LA 4PIMA 2HZBA 4HB2A 1XLTC 4CMKA 5CB0A 3RVPA 2WPDA 2AFHA 3ZI7A 5BORA 3ZWPA 4R8SA 1J39A 1OR8A 1B1CA 2JGNA 2HA5A 3HDTA 5BV2P 3ETLA 4WCVA 3TNDA 2OHXA 4JT9A 1E1QD 1QJCA 1YDWA 3MAJA 1AC5A 4AJOA 3WWOA 5LQRA 3GPLA 1NJSA 1W49A 2ZYSA 3SOPA 1TTTA 4PBRA 5CVJA 2BMWA 4QOGA 2JRLA 5K3SA 3SZLA 3VYWA 1SB9A 1V1RA 3UVEA 5CDUA 2PRZA 2NZJA 2JFVA 4K6FA 1HM5A 1TDJA 1AKYA 4FDAA 4G0PA 4MKFA 3BWXA 1W1IA 3M6LA 3QSYA 5K8VA 3FRJA 5FNZA 3OOWA 3PDIB 5CITA 4UKDA 4B4VA 2AJCA 3N2GA 3QFTA 3BMCA 3UWDA 2IV2X 3GNSA 4PN7A 1LTQA 1HYBA 5DYTA 5CNJA 1SULA 2BL4A 2Q8PA 3RYCA 1RLIA 1ZEMA 4HNHA 3HBJA 2NV2B 4MUKA 4CETA 4NCAA 5AWFC 4JFAA 1PNOA 4YCCA 4I1OA 1EA7A 3TVTA 3OU2A 1RR6A 3QE0A 2PRSA 1XEFA 3Q3EA 4G8JA 3BEDA 4PQEA 2X7JA 3S99A 5HR5A 5JAIA 1LNQA 1S8AA 4R40A 2O5CA 2RHGB 3K0AB 3S70A 2CFRA 1ABEA 4MUFA 2R5NA 1GPKA 3L49A 3G2HA 4ND3A 1GCIA 1NI5A 1OBVA 2O19A 4AKTA 1P7VA 5H59A 1VHQA 1VGRA 3OPQA 2IHJA 3QXCA 4FDLA 4OHOA 1PBNA 2WQ6A 1KXZA 1R0ZA 2RHCA 4DXAA 1VYVA 1AQ6A 1HWYA 2HPZA 3KXIA 5DEOA 2C07A 4C6TA 5C1PA 4B2YA 2HV8A 1OFGA 4G5OA 3CRZA 2YV3A 1BZYA 5F76A 3WGOA 4YAOA 1FX1A 1U0EA 5J2UF 3I1IA 4W5WA 2PE5A 2ATIA 4U8GA 1XD2A 4B43A 4QULA 1WIWA 3V4FA 2WHEA 2OCLA 2OZKA 5CG1A 4XX0B 1DO8A 2JIRA 5CLQA 1QUEA 2JRCA 3R76A 2NUBA 3FMOB 4L85A 1DPGA 4WAUA 2AI3A 5AVJA 3CLKA 3BGDA 5JARA 3PFFA 2J6IA 3F8WA 1FRVA 2BGLA 3GHYA 3GZ4A 5IJWA 4CXMA 1OYWA 2QUIA 3OX1A 4P93A 4WN3A 1QLWA 4LCBA 2ECPA 1L4NA 2J7KA 2QL5A 1MQ8B 3PQ3A 3WA6A 4ITUA 1UUFA 5HX7A 4WBXC 1KVRA 2F9MA 2O4UX 3TSWA 1ZG3A 4E3WA 2XKJE 4Y2SA 4D0LB 1PR5A 2HNAA 1GZDA 1QFYA 4WXPA 2FVYA 3QE2A 2ZUBA 3VR6A 5CCBA 1JXQA 1KK3A 4W5NA 1HKUA 3KSMA 5DYIA 3SHWA 3I52A 2JARA 3KVVA 1XJ5A 5AI0A 5DBIA 5HFAA 3I4CA 4GYJA 1GUDA 2PO5A 2CVOA 1QXSA 2J59A 2Q62A 3U37A 3HEMA 5IXSA 4Y2QA 3AR7A 1T25A 3K5HA 2ZSDA 1BHJA 5KQGA 1JFTA 3S8MA 3Q40A 1I1HA 1E6LA 2H2GA 2ODTX 2GXQA 3WFZA 4DL9A 1GNQA 1QHGA 3CBGA 4HAIA 1T2DA 1RPNA 2PJRA 3OCZA 1XAGA 3MRTA 1Z2EA 1YS1X 1FMJA 1R7RA 2XDQA 4QO8A 1N78A 2WG1A 3STXA 4BGVA 1Q0QA 721PA 5JXWA 4R1UA 1MN6A 3R0QA 2V1XA 1AJEA 2PRKA 3PFCA 4ZVKA 2ZIGA 4FGZA 1QAOA 1ENOA 4ESVA 3ZPXA 2NO4A 4B84A 3U7HB 4FMCF 4HVAA 2UYCA 1Z3CA 5EHZA 2OFFA 4D0SA 1BMQA 4BS9A 3EFHA 1USVA 4YMIA 1BVUA 2H06A 3BFXA 4O2RA 5BQ3A 3KKOA 5HRAA 1TLFA 1UJ2A 3FY4A 4EY4A 3PU6A 3SC6A 1NW5A 2WM2A 5F1PA 5JCJD 1N2GA 1GXSA 2XLCA 3ZDEA 1J42A 2PUWA 1YIDA 4G23A 3ZQ4A 4F5WA 3O1LA 2OQIA 1GG2A 4OQDA 4QBKA 4NVRA 4RJLA 2IY8A 3H5LA 1MAHA 3CLHA 5EJAA 1FDIA 3QPDA 4Q9HA 2YVUA 1CNMA 4RQAA 1Z36A 2XIJA 5FPKA 3KVNA 1J1IA 2CFSA 5H4HA 4J75A 4AP9A 4QX6A 4C0BA 3A2LA 2Z56A 3N8IA 4Q05A 3ETNA 3QXHA 4WGFA 2CHVA 2HI0A 1IB0A 2P6PA 2Q3MA 1T36B 1IH8A 1NLFA 4MQEB 4PHCA 1XEWX 4AUKA 3K30A 2HJWA 3UMRA 3H3JA 3UJPA 2X3FA 5CH3A 3ABSB 4FZVA 1XVVA 1YR8A 4F7WA 4Q6WA 4D8XA 1CUBA 3BF7A 5AVTA 4D3YA 4D5EA 5HJ5A 2FQYA 5KOJA 2WHQA 5EIXA 1QOQB 4WSOA 2FEMA 2WA1A 3D8BA 2V65A 4G36A 4DV7B 4LXTA 1AM4D 1E9SA 2PDAA 5SY9A 3NC4A 2QNBA 4N0QA 2PKQO 4CM9D 1KQ3A 4BGEA 3GP5A 4YQYA 4KDRA 2CDCA 1P1FA 3DNMA 3F74A 3IAS1 4RK5A 1KO7A 4RLFA 4F85A 1POWA 2PV0A 4RCZA 1UDXA 4ZC1A 4EHLA 2XZOA 2GEUA 1UXHA 2A8YA 2P6UA 4LEIA 3AJAA 2IYEA 1L5RA 3EPPA 3OOJA 2O8EB 1Z08A 2ATXA 2HA0A 2AC2A 1TAGA 4TLMB 3GGCA 1BFUA 4L0CA 4U7JA 1RRFA 3GGGA 1SG9A 1AKUA 4R8VA 1T8TA 1MT0A 3BXHA 3GLQA 4I9HA 2WRZA 3PHHA 1OH8A 2NXWA 1N2EA 1WDWB 2FEKA 4BFCA 4R0MA 3VR4D 2AWOA 3I4FA 3MUNA 4IZ6A 4AM8A 4DLBA 1I10A 4CKCB 3RRYA 5K0BA 4FJ0A 4LMBA 3IO5A 4BVBA 2P6NA 2UVPB 2ES4A 2XA1A 4WUVA 1VYUA 2BM1A 4JP2A 4DLVA 2WD7A 3GP8A 4E6PA 4V0KA 1EM8A 2F90A 3L0ZA 4Z86A 2GZHA 3A3KA 2QTFA 1HE3A 5DLQC 2AX3A 1ECLA 4M55A 2DWOA 1ODTC 2DFPA 1KI7A 4X41A 3BMNA 1BROA 4F5YA 4KUEA 2G28A 3EVCA 1NVUQ 2D74A 2NZVG 1G2IA 2XVAA 2HN9A 1UP4A 3KZVA 4KQGA 3H5WA 5A4DA 1VKOA 2BISA 3K0BA 3S3TA 3PBKA 5LLDA 3NGXA 3NUGA 4FGKA 5CB4F 2ZQYA 1EX9A 1KP9A 4P7GA 2XCLA 2M6KA 3IEIA 5BWLA 3PZBA 4TL6A 1GADO 3D3WB 2ZUUA 2F43B 1ACLA 3KHKA 3KVOA 4LE2A 1B3RA 1W94A 2X8JA 3LPAA 2BMFA 4O2AA 4PC2A 1JJVA 1GTG1 1QYIA 1UBMS 3WWEA 4YRMA 3RUHA 2PLRA 4H15A 3OQJA 2QNIA 1K1EA 3GD7A 4INAA 4EEZA 1GQ2A 3NP9A 4LQDA 1RE1A 1ZIDA 1V5IA 4V0MA 1IJFA 3NTLA 4BZXA 2DG2A 3ELWA 1QG6A 3S55A 3ZI4A 5CVTA 3DMTC 3M3PA 5F3DA 1DFGA 2IXGA 2ZBPA 2RIPA 3QFCA 4DR4B 4BX8A 3A7DA 3H5RA 3O4FA 4DQUA 2QBYB 3KVYA 1ZNQO 5C8YF 1T10A 4CG1A 1Y3FE 2XF2A 4P31A 1NURA 2BI8A 3OWHA 1EFUA 3CPJB 1D6SA 1O95C 3AOEC 3EIUA 1PDOA 4RE6A 4ZRMA 1TVMA 3FI0A 4RAQA 2O8CB 1A9SA 4Q3AA 3F78A 2EFGA 2AJDA 5CX1A 4ZVQA 3UTDA 4K9NA 5BN4A 3THSA 1NVFA 2YXNA 3EZ6A 1KZ4A 1FP7A 3QOXA 1YRHA 1N1MA 1Z5PA 1H8HD 5C18A 3BX1A 3P2YA 1JFSA 4IXDA 4DPKA 1LSSA 1A2QA 4YXWA 5KQMA 1RQPA 4FYPA 5DP1A 3USCS 3TBHA 1G41A 4QNRA 2VYNA 4V0SA 5C37A 3EFOA 1U2GA 1ISRA 1R8YA 2Q6IA 1ZIXA 3EDYA 3IP7A 5CBPB 2HCRA 3LDAA 1KO1A 1RJ9B 1E7SA 4IIJA 1W9HA 3L7IA 1IMJA 2JFXA 3NEAA 4KUHA 3ZE1B 1JSLA 4C7MA 3EK2A 3LKBA 2O9JA 2X6TA 1N0WA 3AFOA 1WQ4A 4BDSA 4DABA 2XZPA 2IYOA 4OQEA 3WAGA 1F9EA 3ZZMA 3PD7A 3NW9A 2FTKE 2DWPA 1JPVA 4Q02A 3E8MA 1TZJA 2IIVA 2QSYA 3PI7A 4TVKA 1YRLA 5HA5A 2ONJA 3ZDAA 4ZYWA 1N6NA 1M7HA 5EGSA 5LA6B 1A2KC 3ROZA 4QGGA 4UOZA 1NQTA 1R27A 4MJ7A 1RPZA 4MV4A 1DBIA 2Y0PA 16PKA 3R0JA 3EX7C 4OH7A 3FOCA 4HYQA 1WQ3A 4I66A 3IAXA 4LWZA 3C3DA 2VF4X 1RWNA 2ZT7A 4Y9TA 3ZH2A 1ACMA 1NAIA 1P73A 4LQ4A 2IHZA 1BFDA 2QY9A 3DOCA 1BWSA 4DAOA 3TOVA 1OH5A 1BDJA 2A0KA 2RI1A 1S9HA 3ELDA 3QXXA 3NHWA 3ZIAD 2GR9A 4HH1A 3ZWCA 1G2OA 4FFOA 1MUUA 4BKQA 4Z6KA 2HK9A 5LVAA 5CT5A 3AFIA 4Y6PA 1ZXXA 1KQOA 4OAOA 3QOYA 1MAUA 3FCCA 2PG3A 1U7TA 1VPLA 5FA6A 2DQZA 2IYRA 1DIGA 3DONA 3FIJA 3AVPA 3PVZA 4A36A 5CH8A 4BKPA 4Q9IA 4CUKA 2ZW9A 1H2FA 4Z4CA 4AQYB 1ZGAA 4D3SA 3PNVA 5AESA 1XMIA 1I2ZA 4ZYLA 3T1HB 1JT2A 4YV0A 1EGHA 4P92A 3UOGA 4B3JA 3KFVA 1LRJA 1Q0TA 1E3TA 1Q0HA 3W9YA 5A7HA 2FPKA 1IMOA 3NJ4A 1P62B 2XCUA 1L5YA 4IBOA 3ESXA 1FNDA 3I6IA 4U7GA 2C4WA 5JR3A 3Q9SA 4AYXA 4E2XA 4LTNA 1JJBA 5GWXA 1VKZA 3NFRA 3Q85A 1X7WB 4REQA 4MARA 2EDCA 4A10A 3YASA 1NXTA 2XE4A 2Q7XA 1G5IA 2ZTVA 1SD5A 4W5JA 1UBNA 2OD2A 3FMGA 5C8XA 1O94A 3R2JA 4IIVA 3MT7A 4O2AB 2OO3A 2QRVA 2ZWAA 1NNI1 3WICA 4X66B 1CEYA 4JZYA 5IVIA 2W4MA 3ISTA 3WGIA 4Q3KA 3E9MA 1U98A 2IY9A 3TW6A 2VZ0A 3W3ZB 2E18A 4F38A 1WZIA 3FWZA 4QE3A 1L0BA 1OU4A 4RV5A 4EBFA 2N1MA 2P0AA 4H17A 4V3BA 1IOVA 1I9GA 3CZ4A 3NTRA 5FULA 3L41A 3NH9A 3BSWA 1VZ3A 3D0RA 4HI0E 4M0MA 1GQOA 4EHHA 3H3FA 2WVAA 1VG8A 1B93A 2QBYA 1K7EB 4V24A 3MMPA 1N7GA 5CX4A 2H2WA 4GC5A 1E0DA 3W4JA 5F4BA 5T4HA 3TMAA 2IS1A 1XLUA 5K3EA 5L53A 3BD7A 4FFWA 2IVFA 3ZCXA 3K4HA 3RUIA 4F72A 3AZPA 3ICPA 3L6EA 5A1TA 2EKQA 1MV5A 2RH8A 5EQJB 1L4EA 4DHEA 1SIWA 2VF5X 3B20A 1CB7A 1S6YA 2X76A 1WMFA 3EZ9A 2ZWOA 1AGXA 3K92A 4JWKA 1OU0A 1T3SA 2AOTB 3ADDA 3TRIA 3ZDBA 1KFJB 4TTIA 3QI7A 4H1HA 2P8SA 2WDZA 5L51A 3CJQA 5C51B 5BSGA 1DNPA 2ANCA 4YS6A 4B4UA 1MB4A 1MJ5A 1XR3A 2JCGA 3D6FA 3N87A 121PA 2P69A 3ZTYA 4TL8A 1NG9A 3OZWA 1BKDR 2OHOA 4NAHA 2BTOA 1RXVA 3T12A 4FDVA 1TGVA 1DXYA 1XLVA 4QNMA 2XVYA 3LUDA 2YN0A 2CC2A 2FDRA 1WKVA 2FWBA 2Z57A 1R5BA 1DLIA 4FXPA 3HSYA 4WECA 4H0NA 4JI6B 3RGGA 2WB4A 3GNQA 1M73E 3DO6A 4GWLA 4HDNA 3THYB 4R41A 3E22B 4QVGA 3THXA 2OZPA 1MX5A 3S28A 3IHKA 2GDZA 2H16A 2P2ZA 2J3KA 3NR2A 4G1EB 1SPXA 5JQGA 4MA0A 4ON9A 1A9OA 2GGSA 3BQMB 1WULS 3U2QA 4TT3D 5K0NA 3ILYA 3P27A 5ITVA 5I8WA 3QWFA 3LX8A 4GPAA 1ZGCA 3IPLA 2P1DA 3Q2OA 4EYOA 4KPYA 1J09A 5AIAA 5C32A 3O8QA 2J4DA 4PFQA 5HK9A 2VDWA 2NP7A 4I9FA 4B2PA 3BIXA 1L8QA 2B4AA 3IKTA 2OL4A 5HJ2A 2QIOA 4LRTB 1DMRA 2VTVA 1JZQA 4HAXA 3RIMA 1L5KA 2WZBA 1BQ4A 1XZEA 3I04A 3M49A 2ZPTX 1BXGA 1SA0B 1CY8A 4TYQA 3EOZA 4V0LA 3BTOA 2FFHA 1EAMA 3OCXA 5EPUA 1VJGA 1TCUA 3C0KA 2Q4OA 3GVXA 4LHSA 5U9CA 3QBVA 4GMGA 4D9JA 4H0CA 1YJBA 3AILA 3M4ZA 2C00A 2BEWB 2IYUA 2O7VA 4LWPA 4D4IA 4ZEXA 2Y66A 4CG0A 2HHJA 3JARB 2ACEA 5KNDD 3EVZA 3BRQA 1NYTA 3KUDA 2NXEA 1E2IA 1R0RE 1CYDA 3HBNA 2CJWB 3EDCA 4MWCA 2YJ4A 2Y0CA 5EY5B 3CWZA 5G40A 4YUZA 1XZCA 1ESDA 2HSDA 3M89A 3AI3A 4PG6A 3H3XA 2FWIA 1FNBA 3IBGA 4PZCA 1UBLS 2JK1A 4Q1AA 4G0VA 2MR6A 3C41J 4IIUA 3OZRA 4IIDA 5AM5A 1RLJA 3UAOA 4QGHA 3EPKA 1ODCA 1YQ9A 1ZGBA 2W2LA 3MYYA 4RADA 1A4XA 2NAFA 4WESB 4S24A 2WICA 4L0QA 3TM5A 1EBUA 1QRRA 3F6SA 3TDMA 3KRTA 2RKBA 4S12A 2JVJA 4EYQA 4J1NA 3GPCA 2I8AA 1QV7A 3ZWDA 2O2SA 1P2BA 1UQTA 1TEVA 4HVLA 4IVPA 4Q1BA 5BNFA 3OZBA 4C2BA 2PUEA 4BNXA 4PSAA 5DNVA 3I6MA 2VXYA 2C3OA 5CLGA 4MMYB 2HK8A 2QORA 1T8SA 1CF2O 1U5CA 3H99A 5EE9A 5MGBA 4ZP1A 4UU0A 1EFVA 1VRVA 2REOA 3CF4G 1P2TA 4HT3B 1U99A 1HDIA 1P7YA 2J9RA 4LOJA 1F06A 1DV1A 2EJTA 1SVMA 3ND7A 1IHPA 5HF6A 1PQPA 2BEWA 3DOOA 3KYDA 3LT0A 4CTJA 3FNEA 5DTMA 2NZUG 4ZVTA 3V7FA 1TZMA 3SJZA 2CNKA 2W6ZA 4DWOA 1FJGB 3LYLA 4MR8A 1I7QB 4KPGA 3W6PA 3ZJ5A 4KR9A 1PNQA 1JG4A 2OZLB 3DL4A 3SG0A 3TFWA 1VFNA 1NX6A 3KT3A 3HJHA 4DG5A 2A84A 1SVLA 1BEUB 3HUDA 3WB2A 3BMXA 3WDMA 1W2GA 3FOBA 3KWJA 1US8B 3QBJA 4OBEA 3X1XA 1J20A 1T2CA 3BOSA 3O7MA 3OIFA 4LYJA 5COBA 3OPYB 5GPBA 3AIKA 1IE3A 3EGDA 1A9RA 3IE1A 3E7DA 1YR2A 1E2NA 3GK3A 4X3PA 1DHTA 1JJAA 4B47A 3ST7A 4UW9A 4JQCA 3AETA 4LVNA 2XQGA 1T2FA 4L4RA 3H9BA 2WA2A 3AWIA 3P9SA 3LOUA 4YCDA 1W7AA 2BH2A 1T5HX 2GILA 3ABIA 3C3MA 3M1IA 2ZBEA 2OBFA 1E5VA 2W7TA 4M7WA 4CR6A 3UUWA 1GTMA 4PTYA 4X61A 1TCCA 3KYDB 2SKDA 5IN5A 1UKVY 1XSEA 4DCVA 4X00A 1U65A 4ZHSA 5DX0A 2NSYA 3GB9A 4K9LA 4MYTA 2GZ3A 5D7NA 3O75A 1PYGA 4OSPA 4QEZA 3S6JA 3WL4A 5FHRA 3INYA 3BXOA 2B20A 4EUFA 2C1XA 1PVDA 3IL2A 2PA3A 2ZDHA 1ZMBA 3JQGA 1HTTA 4UCXA 2VHXA 2XYVA 3CNLA 2OGTA 4BRSA 2ERCA 3E2PA 3VTFA 5AKHA 4AWXA 5JC8A 4UFNA 3D5QA 3QELA 4YP5A 1G8MA 1VGQA 2ZCJA 4H7PA 1K7XB 1Y98A 2DFTA 3HXKA 3D6TB 4A5OA 3EVGA 4RY2A 2C7GA 5U1PA 4CIDA 2C4MA 4M1SA 1Q7EA 1T91A 2VJMA 4IG9A 5JNSA 2NO1A 3I45A 4ER6A 4LYFA 4P3YA 5LNK6 3FSJX 1T2UA 3EXIA 4EKIA 3HXOA 1JQAA 2PL3A 5J4HA 1MP0A 4CCSA 4LV5B 1XA4A 1YRAA 2W22A 3EBPA 1IVYA 3H9UA 5CPBA 1E6WA 5DRYA 4N48A 2DJ5A 5M2QA 1AA9A 4K03A 2RGYA 4O4JB 1S96A 5EIWA 3N8DA 1EDOA 2WV9A 4EUKA 1VKJA 2NOAA 3BJIC 3WYNA 2X0JA 1IZ7A 2YY7A 2ZVDA 4ARAA 4RCVA 2O2GA 3RKSA 4MV5A 1LH0A 2CJWA 2H11A 2PZMA 2AZTA 3OIDA 3DC2A 3G2NA 2CD9A 3IR5A 5LKAA 4Z4EA 1L9KA 4JP5A 3LRXA 1E66A 4JXJA 3A4MA 1QIKA 4G3XA 4KOAA 2C5EA 4ZDIA 2G8NA 4U2GA 3V4VB 3Q8MA 2J0UB 2REQA 3MCWA 4JBLA 2EFDB 4JLOA 4LS3A 2LW7A 4H27A 3GJZA 1UC9A 2Q9UA 1FFDA 4NU5A 3EXG2 1NXQA 1U28A 4YVFA 3BTSA 3SDZA 4LJ9A 2AOXA 3H9QA 3ZXUB 3DFIA 2YXBA 4I2VA 3WQQA 4AXXA 3NBFA 1E5LA 1DAPA 1V43A 3M5DA 1GLGA 2Y2UA 4HQ0A 3AKDA 1UAAA 5DTJA 4Z2AA 4ZMBA 2NZYA 5BSHA 3KDAA 2N1BA 5DLEA 4OHWA 1CRZA 2CLCX 5E9JA 1KDTA 2C5LA 4YBRA 1MAVA 1PDVA 4KPFC 1VL6A 5IVDA 1ZSVA 2VT3A 1ATZA 4GM0A 5FI1B 3KZKA 3WNDA 1P9WA 1QNFA 2CUKA 2OGWA 2W2TA 2XXBA 1Y4AE 1V35A 3FCYA 3NAQA 4JENA 4X20A 4CIVA 3GDOA 3W1EA 4BFSA 4UE2A 2X9QA 5BSKA 3AJDA 1L4LA 3C5VA 5TQ2A 3GLGB 1Z6YA 3ID6C 1Y1KE 4QO7A 2E9SA 3SXUB 1GKUB 2E49A 3LLCA 3UJDA 4R8RA 2BFBA 2JLRA 4FILA 5KOHA 3R3SA 3U4CA 3VNQA 1P91A 1FPMA 3FKSA 2JLUA 3PTLA 3AOEA 2B0CA 2HXYA 2HMAA 4RZQA 3JZDA 4EJ0A 3L84A 1KQGA 3LHKA 5FWYB 4ZZ2A 1QU2A 1M67A 3GFFA 4JR0A 4QHSA 3K8OE 2JAHA 3KAQA 5JHHB 2G6TA 4ND5A 4JR2A 4XWWA 4GPTA 1GZSA 1U2QA 4PHTA 1UMDA 4XH9B 5ALUA 2OKGA 1E9FA 1YK1A 2Q6TA 3ZOZA 5JMTA 2FZCA 3ILHA 4U39A 1YS7A 2OK8A 1XJ0A 3TLZA 1YT5A 5J1SB 2IKSA 1JN0A 3AXSA 1K6JA 2J48A 1V6AA 3KKQA 4NIMA 4AYWA 4EVRA 4RE5A 3LTEA 3RU2A 1XF1A 3DFKA 1BDIA 3I3OA 1LLDA 2OLKA 1I36A 1P2VA 1V5FA 4L0DA 4UDOA 1XQVA 1V9CA 4DEYA 2QJOA 2V3WA 2W4IA 1SUAA 4R84A 4TTQA 2A59A 3H2ZA 3NEYA 4OQXA 3KB6A 4R3NA 3PPYA 3NHKA 5C3UA 2N75A 4OQMA 2E37A 2BCJQ 1CUWA 3OO1A 2C88A 4QUAA 1EFCA 3DQQA 2O3RA 2JDIA 2KMLA 3B5EA 2CNDA 4BAZA 3HA3A 1JZTA 3NBAA 4RHYA 3LUAA 1XMXA 3DF9A 1ZOIA 4NEQA 4OIMA 2O5RA 4IG4A 5DU2A 4EPRA 3G02A 3HN6A 2FJUA 2CV1A 4B2IA 1N6KA 3A4VA 1K6MA 1ZFNA 2G5TA 2SCUB 4JT8A 4EELA 1FDOA 3PLRA 4PC3A 1D2NA 4D9CA 4JJAA 1DRJA 2HXSA 4TVOA 4OLHA 3PCRB 2QSJA 1Q77A 4I3FA 1ZVQA 4Q9AA 5GTDA 1TZKA 4L07A 1BJKA 1VI5A 3O3MB 1QO7A 2ILVA 4B1FA 4KTVE 3WLIA 4NCKA 3C7AA 1GL6A 3EVDA 1Y6ZA 3M2PA 4F71A 2CFOA 3AKZA 1ONSA 1H2AS 2ASVA 3RD5A 4DUGA 4ID3A 1HRDA 1OILA 2QA5A 4RK7A 4DTCA 5BW8A 5CX1B 5AJZA 1MRSA 3LOPA 4G1UC 3WX0A 2FPLA 5EAIA 3LQQA 2JBAB 3CO5A 3FYUC 4FSDA 2JAQA 1VJCA 3TK1A 3UHJA 3EDMA 2GBIA 3J81k 1YAJA 1AB6A 4PHHA 1LI4A 5AVZA 3B8HA 1G7SA 1SCJA 3BB3A 4IV5A 5C31A 4BFZA 1K4KA 3U13A 1VSVA 5IM5A 3FW1A 1H9BA 3Q10A 3HJUA 4Z7JA 4LSZA 4QXQA 1X7YB 1NBMA 2C9ZA 3KLPX 3R41A 4E88A 4ND8A 2IH2A 3PQEA 1JZSA 3G82C 2I3ZA 1YL6A 4P54A 5BT9A 4ENSA 2Z9CA 1PG2A 1BVRA 4LJRA 1LRLA 2UYYA 2VEOA 3CE6A 2P2SA 2GPJA 2GCEA 3NX4A 4IUDS 2NZ2A 1QR2A 5I47A 4DRZA 4RPLA 3FZNA 3JTEA 4G9GA 4KNWA 1CF9A 2PZEA 3GGSA 3LXMA 1DC5A 3IESA 3OZCA 1QOPB 1MTZA 1FRNA 4PE5B 5CNIA 3GCGA 3ZD8A 4B3HA 3SN6A 3OJEA 4XASA 4B9EA 2CXQA 3F5DA 3RHFA 1ZR4A 1RLMA 1V1RB 2Q4DA 3X44A 2AFRA 4C7OA 2Z2XA 3GJ4A 1NASA 5LFAA 1Y42X 3AETB 3FSEA 4B6GA 5TF4A 1OAOC 3SZ3A 3RSOA 1SOVA 1TFRA 2FZ5A 2VAPA 3EIXA 1RZRD 2PD3A 1ND6A 1EA5A 4LXHA 4KYUA 1HLDA 1EVYA 3G2KA 3LP6A 1WUTA 3WMRA 1Y3BE 1U1DA 2XQJA 4XGQA 1IQRA 3P9NA 1YJAA 3H16A 2NU6B 5FL7A 2ZIUB 1NF8A 3ZXXA 1KQFA 3SYRA 2PUFA 3H5IA 1EK6A 4CHTA 1IWPB 4BBAA 4HZIA 5HP4A 3QEMB 2ZRQA 4EIWA 4IGIA 1XHEA 3DMHA 5T4BA 1Q0RA 2IWRA 1QZ3A 1ZSYA 4X0EA 2HEGA 5G1PA 1DCFA 4UHKA 1HX7A 4HWSA 2VK8A 4DGQA 4W5RA 3MGAA 4FFSA 3NHUA 1KPHA 2ZFUA 3L8CA 1KMHA 2OWEA 3WLNA 1OBHA 2VYVD 1D3AA 3A9TA 4BUJA 2H2FA 3MA0A 4PAQA 3ZZNA 5C5CA 1H0KA 4C4YA 1WEHA 1ISIA 2D1YA 1USIA 5F3WB 1YS9A 2F55A 3IS3A 3CLTC 5AW2A 1U1GA 3LL7A 4KQ9A 3WDLA 4AW9A 3EUAA 4MB6A 5HCUA 2H59A 1MO5A 2UDPA 4UD6A 3CUKA 1XQ1A 3AERA 4BQNA 3HU5A 1DWUA 1NNLA 2P1ZA 3F6YA 1JWBB 1G20B 1YFKA 2LTAA 3QUAA 4HO1X 1EG2A 1VJTA 5EERA 3V1TC 4G0WA 2D0OB 3AM5A 4ZI2A 3S1AA 4OYYA 3QUQA 3T3MB 1LLQA 5A5FA 2PUVA 5CEFA 2E48A 4KREA 2LXNA 2QKYA 5LDGA 1L5HB 2B21A 2OFPA 4WGGA 1PQWA 1XKTA 4M7OA 5BQXA 2JFPA 1TA0A 5G0SA 3P97A 1YS6A 3FGZA 2F48A 4FS3A 3SQXA 3BL5A 4QHTA 1TM3E 3B85A 2IT1A 2E5WA 2FPPB 3LIPA 4RD6A 1NBMD 2IUTA 2JL1A 2AD5A 2VQEB 3R8CA 2AI2A 2PZJA 1E2BA 3NHLA 1MB0A 2KBEA 3LFTA 3FA2A 3JPYA 3U3MA 1RWVA 3AZOA 4HWGA 4HUTA 2OFOA 1PJAA 2GEDA 4QG7A 3F49S 4IJUA 3WL7A 5LUAA 1OPRA 1H6DA 1KAGA 5JPIA 3WNVA 5JO0A 2W00A 2X42A 3BQ9A 2WUDA 4MVJE 2XMSA 1JG7A 3A6LA 4U7FA 4WTOA 1KDOA 3IJRA 1TO2E 2IXBA 3VPGA 1XDBA 3CT6A 3DEYX 2RHTA 5T3UA 2GK4A 1CZHA 2BBTA 4B45A 1IONA 2ID4A 3GQBB 4MQ5A 1Z18A 4DQVA 2PFGA 1M0TA 4NV3A 2OESA 4ZV4A 4XWYA 4BJ5A 3TX2A 2I54A 4YPOA 3QEAZ 2QR5A 4C0WA 1VIVA 2O2DA 2HO5A 1GT6A 2G88A 2WZDA 3F8SA 3QA9A 3WE7A 1OB5A 3CH5A