4DWJA

Crystal structure of thymidylate kinase from staphylococcus aureus in complex with thymidine monophosphate
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
203
structure length
200
Chain Sequence
SAFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRKIVLEGNDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNSRDQNRLDQEDLKFHEKVIEGYQEIIHQRFKSVNADQPLENVVEDTYQTIIKYLEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Thymidylate Kinase from Staphylococcus aureus in complex with Thymidine Monophosphate
rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Transferase
molecule keywords Thymidylate kinase
total genus 81
structure length 200
sequence length 203
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2012-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4dwjA00
1NKTA 2MSCB 2F1RA 2X8AA 3LXRA 3EA5A 1HT2E 2V4ZA 4EJSC 5F9HA 4TYWA 4NCHA 4EQ6A 1EG7A 4OHWA 3TH5A 2P5SA 2QNRA 3WXMA 3K70D 2DHRA 1F5NA 3BXZA 3IDQA 2H57A 3W3ZB 2PEZA 3T1QA 1GIAA 2A5JA 2GBLA 4OHZA 2WMOB 1OFTA 1Q57A 1SVKA 5DSZA 5CB6A 1TQ6A 3TAHA 3JVUA 2XAUA 2OFOA 1G291 2EW1A 2GJ9A 1EWRA 2ZRAA 2GK6A 4LZZA 4QM7A 5H1YA 4Q4JB 2AXPA 4TZ6A 4RSGA 3RHFA 1QDEA 1S1MA 2FGKA 4GOXA 2VHTA 1V43A 3P20A 4TL7A 3RRYA 2ZRCA 1MRSA 5HKKA 3AGQA 3QBTA 4POAA 4NZYA 5JSZB 5HZHA 1G7CA 1HEIA 1FPMA 1VTKA 3KKQA 2JJ1D 3O8CA 4ABYA 2G1JA 1R10A 1D2EA 1UKVY 2FMXA 2WAXA 4MRRA 5L3SB 2O8DB 5KTYA 2I1VB 3BFXA 2Q9BA 2ZS7A 2R65A 2OCBA 2CHVA 2ZJBA 3QXSA 4JL6A 4CEIA 4CDGA 1Q3TA 3EARA 1ZM2A 1OF1A 4LWZA 3BBPA 4BFWA 3KJHA 3G5UA 4S2EA 1JECA 1CLUA 3A1WA 4JLPA 4O25A 2ZRIA 1QZXA 4W5JA 1IN6A 3SI7A 1SXJE 3P4YA 3RAPR 2AFIE 5EXSA 2ZI9A 3X1XA 2F6RA 3HWSA 1IONA 4FMCF 4JZKA 1NN5A 1OHHA 2G88A 3RS7A 4JT2A 3UK6A 1ZUNB 3X1WA 3ZIAD 4LJ4A 4QHYA 4DJTA 2ZSDA 3C8UA 4DWJA 4QXAA 3X1YA 1A7JA 1NKSA 1E2PA 1I4DD 2IS1A 1ETUA 2R44A 2A5DA 4FCTA 3VX3A 2N42A 2UZ3A 4DIEA 1I2MA 4B47A 1ZMXA 2OE2A 1P2VA 3H1TA 2Z0MA 5BQ5A 4AIIA 4ZDKA 4YC7A 1WE2A 2XSZD 3K0EA 4JVSB 3FKSA 1GM5A 1A1VA 1Z0FA 4F4CA 1AIPA 1WCV1 2OLJA 2J0SA 3RLFA 1U8AA 1SVIA 1AA9A 1E2MA 5CJ2A 2L0XA 4HEJA 3QKTA 4OQMA 3ZLJA 3EWAA 1HE8B 3UANA 4GOKA 1XB2A 3X2SA 2D06A 2GKSA 4E07A 5KHOC 2C78A 4URWR 1FW6A 5J4HA 4JYBA 5EJEA 5KSYA 4DIDA 4C4PA 4KHZA 3VR6A 5B58C 5E4FA 5FUXA 1E9SA 4L9SA 1NF3A 4BWYA 1SHKA 4JLVA 4JS0A 4EKDA 2JLXA 1JR3D 4QGHA 3B7GA 1FX0B 1D2MA 1LY1A 2AL7A 2CJWA 2J7KA 4JBXA 3SEAA 2PT5A 4ACBA 2JJ8A 3THYA 1KMQA 3BC1A 3CWZA 3LD9A 1LV7A 1MH1A 3WMGA 1M2OB 3SR0A 2QTFA 3GFPA 4M4SA 4PQFA 2IYZA 5DGXA 3L2OB 4AG6A 4P4UA 2YNMA 4QGFA 3U3KA 2PCLA 3GMTA 3CB4A 3PUVA 2WBLC 2FJUA 5CM8B 3JZMA 4RCZA 4NTZA 3SJAA 5FPTA 2H92A 3FPAA 1YVDA 4GT1A 1ZM3A 4IOKA 2XNSA 1KSGA 3IGFA 1OH7A 4HDCA 4KLNA 3R9XA 4TQAA 3EZ2A 2QN6A 2OAQ1 3GLIA 1EFRA 1SZPA 1TNDA 4RJLA 4F92B 4RFVA 1DG1G 4OK3A 1SXJA 1GKYA 4MQBA 3QXHA 2CL7X 3FHCB 4PPQA 4RD0A 1YZKA 2GAAA 4A4DA 1LF0A 2F3TA 3MD0A 3KJIA 4XWOA 1WBBA 2JIZA 2VO1A 2ERYA 5HKKD 5IK2D 5HCIA 2W6JA 3B2EA 4MDEA 4ZI2A 1AGPA 1H8EA 1E2JA 3QUSA 1E2QA 2ZRBA 1XXHA 2XXAA 3IBYA 1FUKA 5UKDA 2RGNC 2CCGA 1XEWY 3FFBA 1ESNA 4EJSA 4FN5A 5JCZA 5L3QB 3TR0A 1DO2A 3PIRA 1KK3A 2ZANA 3QBVA 4MYCA 1TF7A 2QPOA 3D8BA 2IF2A 4HLUA 4UNQA 4UNSA 4BFYA 2AX4A 4Z1MD 1YZNA 4KFRA 2HLDD 1NN0A 4BRWA 2O0KA 3THYB 1NBMD 3AVYA 4XIGS 2J5XA 5KPJA 1Q20A 2OXCA 3MUFA 1U99A 4BLOA 1DPFA 1M34E 5GJBA 4F91B 5JWRA 2ZSAA 2DPXA 3H0KA 2D2EA 3TUIC 5KU1A 2JLYA 3SN6A 3R8FA 1JR3E 4LYAA 3RC3A 5BW8A 3EZ6A 2B7CA 3VHLB 4TL6A 3CX7A 3KTAA 1N0WA 4UXIA 1X8JA 2HF8A 1GRRA 2DBYA 1AZSC 3IEVA 2R62A 1XTRA 1P9NA 1KNQA 3Q9LA 4IFEA 1KHTA 3TW8B 3TUJC 1OFHA 4LOAA 2FSGA 3A36A 4LC0A 2N46A 3Q72A 5BYKA 2CMKA 3THXB 4C0LA 1E1QA 1N5KA 2OILA 3F0TA 5GJCA 1W36C 3MMPA 2W00A 1GILA 2YVUA 4MUAA 1GITA 1C1YA 2IF0A 3BAFA 3I61A 4EPTA 3QVVA 2G77B 2WSMA 5AJXA 3CX8A 4RD3A 2H8KA 2NZJA 4YQFA 4ON9A 2AWOA 2NGRA 4Q7LA 1E2DA 5CM9C 2HCBA 4G5RA 2F1HA 2ZVPX 4PTLA 1SKYB 3ETLA 4Q48A 1B0UA 2H5EA 4NPHA 4Z54A 2Q3FA 3GLGA 3KQNA 1OH5A 2NQ2C 2FEOA 1VCIA 2A2ZA 4JLMA 5JFGA 3TE6A 2KE5A 3O8DA 5K8UA 4DCUA 1MV5A 1T3SA 5FTMA 3CPJB 1P2UA 4ESVA 4HUQA 1IN7A 2VHCA 3ADKA 3M6AA 3B82A 3GEIA 3KQLA 4NONA 2CXXA 1SVWA 1CEEA 1E9DA 1W4BA 1GRNA 4FMDB 5KUTA 5L3SA 2O8DA 4YLGA 3EXAA 3PQCA 4B3GA 3DVLA 3PG5A 3QKSA 4QNMA 2YOGA 3BB1A 3GLHB 2GXSA 4C0SA 1AQYA 1JB1A 1VYUA 1W1WA 2PEYA 4MITA 4NCIA 4OJQA 2CNWD 4ZIRA 2VF7A 4KJZA 4MRVA 5TVKA 4TMZA 4URXR 1T0JB 3TSWA 3C14C 3D6TB 4MDFA 5EE9A 1CS4C 2GJSA 2CCKA 2QAGA 3MJRA 3F8TA 4NKRA 4OHVA 3PEVA 4M22A 2WWIA 1NN1A 1OHHD 4NCKA 3CRQA 3DEFA 2V7QA 3X1ZA 2JLWA 4BQSA 1QHHB 2GF0A 5BXQC 1A5TA 5DHAA 1KDRA 1CR0A 3K0CC 4TMVA 2P6UA 4GI7A 1IY0A 1AGRA 1U90A 5K8LA 3EG5A 2HXYA 4PC2A 3CZQA 2D2FA 4PPFA 5B64A 1Q1QA 2DR3A 2WMNB 2OV2A 2Z6VA 4TL9A 1EFHA 1VYTA 3KXIA 5EUMA 1AS3A 4WOPA 1G7SA 1XD2B 4EPWA 1UAAA 3W34A 1P9RA 4F93B 1W5TA 1R0XA 3LLUA 1R0WA 1AS0A 1IN4A 1NIPA 2RGGA 3EA0A 2EVWX 1QHIA 2Q3HA 4Q1FA 2NPFA 1K5GA 2VP2A 3TSZA 3E1SA 2JLZA 4Q7MB 4EPRA 3IHWA 1BOFA 3GJXC 4Z1MA 1K5DA 2IBMA 2ERXA 3GJ3A 2F43A 1GL9B 1U9IA 4NYMQ 1SQ5A 3IILA 4M1WA 2Z43A 3A58B 3AP2A 521PA 3WNCA 3QI2A 1R6BX 3GLHA 4KSCA 4D0LB 3B1ZA 5FI0B 4R2IA 2QAGB 1E2EA 2ANCA 3HU3A 4R7ZA 2GXAA 4C2TA 4TYYA 1ZCBA 1U2RA 1JXOA 2RGCA 5LBIA 1BO6A 3IBGA 2WKQA 4PPGA 3V4FA 2XZPA 4TWZA 1FNMA 1NIJA 1CRQA 5FBRB 5TB5A 3AVPA 4GRAA 3RVBA 3VR1A 2G3YA 1ZNYA 2GILA 2ORVA 3LV8A 5DI3A 2YJTD 3W3AA 3VFDA 2REBA 2IWRA 3ADBA 1VIYA 1BYIA 2XX3A 3L0PA 3A4MA 4EUNA 1NY6A 2O0HA 3IIJA 4M0LA 1G8HA 5TY0A 1XEXA 4TLCA 3VNUA 3DOEA 2DCUA 5D3MB 1XD8A 1NVVQ 4HYYA 1JAHA 2PT7A 1IOZA 2ZRPA 1YHNA 4C0KA 3ZVRA 4MYTA 1N6NA 4IJMA 1N2CE 2G1KA 2GZDA 1OV4A 4J0QA 3A4NA 4D2IA 4BFVA 2OBLA 4LJYA 4Q1DA 3U3RA 2CE2X 5FUVA 3BGWA 3U7EB 1GG2A 1M7GA 3QPUA 2WPDD 1HTWA 3QG1A 2VP4A 3QNUA 5JI3E 2RGDA 1MT0A 2BKUA 3K9HA 3PXGA 2OSBA 3N2EA 3H86A 5FH9A 4IDPA 1MO5A 3FFAA 1Q1ZA 1T8TA 1A82A 2BVNA 2QRNA 4NCJA 4UJ5A 2ZS8A 1D2NA 2C5LA 4Q47A 1DBSA 1LFDB 2GNOA 2IS4A 3KFXA 2GJKA 1TAGA 1JEEA 2V8OA 2XB4A 3LWNA 1Z0DA 3NXSA 4QC2A 4UXJA 4XTRA 5EP4A 2Y8EA 2RGXA 2ZRHA 4HDOB 2O8EB 2Q3MA 2ASEA 1ZU4A 2FZLA 2H18A 1DS6A 2WV9A 2IT1A 2X2FA 2V55B 3K09C 1V5WA 1G4AE 1ZUHA 3WHKA 4G1UC 4V0KA 3K9GA 5GJWC 1E3MA 2IXFA 1N6PA 3MWYW 4QRHA 1X1SA 2C77A 1L2TA 1SXJB 1TADA 4XD7A 1W4RA 2FDCA 1UF9A 1KI6A 1T8UA 2WWFA 3K70B 4JL5A 4LHYA 4CIDA 1E2HA 2NO1A 1D8TA 3OE7A 1X86B 2X1VA 3NC1C 4Y0AA 1U8YA 4XTCS 4NBSA 1CJMA 4RZXA 2QENA 2ZXUA 2ZPTX 2QP4A 3CKLA 3GJ4A 1QHSA 3QPWA 3I4LA 4M2LA 5C46F 1W5SA 4ACAA 1E0AA 3KUCA 2H17A 4XWKA 3SYKA 4LGMA 1J8MF 1YJ5A 1XU4A 4HZIA 1TUIA 1G3MA 5JEEA 1OH6A 1T5LA 3K0CA 1GAJA 4EJSB 4GZMA 2BBSA 1XCGB 2BMFA 3REFA 4CRWB 3FB4A 1RRPA 2B6HA 5F98A 2BMDA 5DE3A 4U7DA 4IOJA 3QF7A 2RGBA 1CJKC 1NSTA 1J8YF 2GXQA 2C8VA 4PZYA 4UNPA 3RS3A 1NG1A 4K81B 2KI5A 2PJRA 1Z2CA 1E99A 3R9IA 2VRWA 3T5GA 4L15A 2VF8A 4Q01A 2EFCB 5JJLA 2YC4C 1AKEA 1TUEA 3HJNA 3TBKA 1GUAA 1Q0UA 3KUDA 2DWQA 3M4YA 4M9SA 3GCGA 4GDFA 2PH1A 3AVXA 1KI6B 2DFNA 1E4YA 5FOTA 4KYIB 621PA 1H8HA 2A5YB 3LDAA 1P61B 2V6IA 4TMWA 5CIQA 3SZRA 4LHZA 2QM8A 4Q9KA 3W6PA 1EESA 3FYHA 5SZKB 4DB4A 1CP2A 3NTUA 2FA9A 4FI3C 1II8A 5CYOA 1A2KC 4LJ6A 1OXTA 1YE8A 5SZJA 1M7HA 1IAQA 3NEJA 2W6IA 2BEKA 3U2QA 1NY5A 1KIMA 2P2LA 3O8BA 1DG3A 1Z2AA 2VHUA 3EWSA 1P62B 1XXHE 4NU0A 2H1LA 2J0VA 2NPIA 2FSHA 1EGAA 2EFEB 3CF2A 4FMDF 4CEIB 3HYTA 1OXSC 2WWGA 4QKQA 1RFLA 5C1BA 5FTLA 4GZLA 4XVQA 1X6VA 2BBTA 3CONA 3HU2A 4LV6A 1W47A 3DKVA 4HB2A 4ERNA 5FBVB 4Q9HA 3UMSA 1J90A 3I8XA 4C0JA 5B30A 3PJRA 4BZXA 3K0SA 3A4LA 1W4AA 3SS8A 1N5IA 5AK0A 1UKZA 2BKEA 2CL6X 4A15A 4BLSA 3IIKA 4AKEA 4P0TA 3CPHA 3FDIA 2CEAA 3HYRA 4BECA 1E2IA 2FSFA 2WIAA 1COWA 3U4QA 4ZV4A 3JZAA 3QXXA 1JPJA 5FOSA 4I99A 3RRNA 3C7KA 5E7JA 5LD2C 2AHOA 3FMFA 3I62A 5JJKA 4G0NA 3OIWA 1NBMA 1P6XA 3RRZA 3CH4B 3TNFA 5DH9A 4KU4A 1KI9A 2X19A 1E2GA 2NO0A 2HT1A 4NYIQ 4AI6A 3KB1A 4RD1A 3A1TA 1OW3B 1Y63A 2RGEA 3C5CA 3F3YA 2QMUA 1RRFA 1OXUA 1P5ZB 1CJTC 4L8GA 4UKDA 4A36A 4LYJA 1KSFX 1IN5A 1OFUX 2ZJ5A 3CF6R 4DLVA 3T1VA 2IUSA 4BFSA 3ASZA 3AP3A 4X8HA 5P21A 3AUYA 4HAUA 1OT3A 4RVCA 4YXWA 4TLBA 1KDTA 3WP0A 1NMXA 4D25A 2GJAA 2R6CA 4PAOA 2BBWA 4LRWA 1R8SA 4WBSA 4PR0A 2CHGA 2UVQA 3EIQA 4MRSA 2AD1A 2GCPA 1NL3A 4ZIRB 5AWFC 3B5JA 5C2JB 2C95A 2MMCA 4PFSA 5E95A 3CX6A 2IUUA 1VG9B 3N5CA 4JYCA 3GJ7A 3TVTA 4ARZA 3QIAA 4WIAA 3ZQJA 1E9EA 1UEIA 3T35A 1E6CA 4TSFD 4HAWA 2OESA 2ZE5A 1T5IA 1FZQA 3LBNA 1G8GA 4LSGA 4W7SA 3NG1A 1KO1A 3S1AB 3CWQA 2E9SA 3NWJA 4X8LA 1I4TD 4D4JA 4RZUA 2ZRMA 2XJ9A 4RD4A 3I5YA 2D62A 4UNRA 1T0HB 2DFKB 3OEHA 2FFHA 3IEUA 2IYQA 4HAZA 4IVPA 1KMHA 3AF3A 3K0AA 1UFQA 4HB4A 2WVJA 2ZI5A 4Q5IA 821PA 5FL7D 4KCGA 2XTMA 4LY6A 2GEVA 4DVGA 4OK6A 4MGIR 4P4SA 5A0FA 4PANA 3LXXA 2RGAA 2WKRA 1ZD9A 4C7OB 3W6NA 4HLUC 1DARA 4WZAE 2XZOA 2QGNA 4Q7JB 4XH9B 5JLJA 4TQ9A 4QM6A 3GFOA 3B1YA 1F2UB 2ZETA 4MGKR 4PHGA 3LW7A 4WAUA 4PAQA 1RC8A 1E32A 2O8CB 1RKBA 4TZ0A 3C41J 3T5DA 1ZM9A 4GPTA 3OAAD 4TTRA 3PENA 1G18A 1G8YA 1ONBA 2CL0X 5EUQB 1ZJ6A 2VP9A 1UM8A 5DHFA 1WB9A 3EAQA 1Z08A 1ZIOA 3U44B 2IK8A 2NIPA 2QP9X 3OHMA 4AYXA 4B32A 5EQTA 3A6PC 5EP3A 3H84A 1W0JA 2W2TA 3LBHA 2GVDC 2CCJA 2FWRA 1ZYUA 2XGJA 1J70A 2J7PD 1JXMA 2W2XA 3WMFA 4FW9A 2QBYA 1XEWX 4LDJA 3GEHA 4MKGA 1MKYA 2O0JA 3IKJA 1E1RD 2C03A 2QAGC 1E1QD 1G5TA 3KB2A 1RJ9A 3KJGA 3EPJA 4PC3A 2BCJQ 3NBYC 1DAKA 3PEUA 2ZVQX 4U5XA 2FN4A 3DM9B 2A3RA 3PUZA 1Z3IX 4XVUA 2IYSA 3NDBB 2WSSD 1LVGA 4DUGD 1F3OA 1UDXA 1NSFA 1P75A 2QQ0A 1KJWA 3EZ7A 4GBMA 4JJKA 3RNLA 2QORA 1BKDR 4DHEA 1KO4A 4M9QA 1EFTA 4DLZA 1K8RA 2V54A 3HPQA 5AUNB 1DE0A 4HATA 4LHWA 4PZLA 5AUQA 2J1LA 2RMKA 1KO5A 4QBFA 1F2UA 4Q1CA 3VKWA 1CR2A 3V4RA 3IQXA 2HDNB 1Q12A 2V3CC 4KVAA 2QSZA 4MUBA 2FNAA 1J7KA 4MGYR 4GP7A 4HLDA 3DO6A 4E03A 2P6RA 4HAXA 1E9CA 1JR3A 3QG5A 3WNDA 4DT1A 1Z0IA 4IXNA 2HLDA 3SDZA 2A30A 3UIEA 3K0FB 3U3JA 2JJ1A 4URZR 4NMMA 4HAYA 5HCNA 4IHQA 1GKUB 2QI9C 3U6BA 3P32A 1XEFA 4DSOA 1Z06A 4U02A 1MR3F 5LB2A 4R98A 2QP3A 1T3LA 1YZQA 1XP8A 1F60A 1NVXQ 4V0MA 4PO1A 3QPVA 4IEIA 3TW4A 3Q7PA 1QVAA 4C9BA 3ADDA 4YMVA 4K8OA 2PMDA 2F9LA 4L4UA 2AN9A 2PZGA 4Q4LA 1CKEA 1N3BA 3GD7A 2H16A 2RHMA 3X1DA 2GCNA 4N0EA 3THWA 4I81A 4I1OA 4LJ8A 2FOLA 4M1YA 3U61B 2O52A 3ZZTA 1LS6A 1OIVA 5DN6D 2G9NA 5C4GB 1VDZA 2WPDA 1S9HA 2ORIA 2NO9A 3QXCA 2ZR9A 2VYFA 4B2LA 1DOAA 1ZU5A 221PA 1R5NA 2F7SA 1CF4A 4AY2A 2VH5R 4KBFA 2XOKD 2FFAA 3A1UA 3TLXA 3L43A 2JATA 5FOUA 1KJZA 3ZIAA 2ZSBA 1S2MA 3K09A 2ZSFA 3TQCA 1ZVQA 2BM1A 2C9OA 2IHBA 1G6HA 4RD2A 1XD2A 4LX0A 4Q1EA 1XPOA 2GWHA 3AVQA 3HDTA 2YZ2A 1Z0JA 1J2JA 2BV3A 5C4MA 3AVTA 3L82B 3U3MA 3UWOA 2YWEA 3DZ8A 3GLIB 3C5HA 4XSHA 5BWMA 3AQ4A 2DWOA 3I92A 3U7FB 2MMGA 2WAYA 1P73A 3BH6A 3EZ9A 4B71A 2FPMA 3BORA 1KTVA 2CDNA 5EZ6B 2ODBA 2R6GA 4US0R 3B9PA 3SC3A 4QBGB 3W5IA 2GCOA 3GLIE 5JCPA 2EFGA 4ZCIA 5JMTA 3ZD6A 1DO0A 3GJ0A 1IXRC 1KI8A 4QJ4A 2B21A 3IUYA 2IC5A 2OEPA 3OESA 1OYYA 1Q22A 3W90A 3AF2A 2RGNA 5CITA 3WP1B 2BM0A 3PUXA 3GLFA 4AD8A 1KAGA 4DLRA 2QMOA 2FZ4A 2ZROA 2QROA 3RC8A 4EFNA 3AGPA 1E2FA 1XCPA 2WJIA 3MJHA 1KI1A 2TMKA 4CF7A 4WXPA 2WZQA 4HUTA 2G83A 2P67A 2QU8A 3G82C 4U00A 1GP2A 3CRW1 3VR2A 2RB4A 5JS8A 2O8FA 1G6OA 1T3HA 4N1AA 4A6PA 1E2NA 1VKJA 1II9A 1XDBA 2AKYA 4OJKA 5JSZA 2HCJB 1C4OA 3AVOA 1G17A 3D7MA 5FOXA 1AJEA 2FSIA 2UZIR 5KNCA 2BMJA 1VYVA 2HT6A 1P72A 1G3RA 1T6NA 3W5JA 4R9UC 2WSSA 4DUGA 3NKVA 4C3ZA 5CB8A 4JBWA 4G5GA 3RS2A 2JDIA 3V9PA 1TQDA 4BLPA 2XZLA 5B2ZA 1XTIA 3OF5A 2JGNA 1XCMA 4DCNA 4TTPA 1Y3AA 2GK7A 5G3YA 1N6KA 5F9FA 2Z83A 1VMAA 3TGPA 3SJCA 3VKGA 2O8BB 1ZUIA 2HV8A 3K1JA 4A0RA 4CEJA 4BEBA 1UBFA 3PFIA 4TYPA 4A9AA 1W49A 1NG9A 2ZEJA 4AKHA 4ARZB 5G41A 4KFUA 1VCOA 3LX5A 2XNDD 3CNLA 1M1YE 3B1VA 3RABA 3Q3JB 2WJYA 1XBTA 3NBXX 3RWOA 3IO3A 3KTAB 2CE7A 1EWQA 4DLYA 1Z6AA 3SQWA 3VNVA 1E0SA 2QT1A 1XTSA 2BEJA 2AR7A 1K6MA 3K70C 2VQSA 2Q9CA 4XSGA 1SXJC 4ASUD 2ANBA 3GFTA 2WWXA 3BWDD 3UATA 3KQUA 1SVOA 2P0EA 4TYQA 2ZI3A 2ZREA 2IYTA 1XNJA 1DAGA 1IHUA 4FWIB 4B2PA 1W48A 4KXFB 1MABB 3G0HA 2GESA 2PZEA 4QFMA 1NBME 4M1KA 1Q1BA 2A78A 3UMRA 1W44A 3L8ZA 4TT3D 2FGJA 2CLDX 2OXRA 3BIFA 5J5CA 2RHDA 3EZFA 1YU9A 3W9YA 2B8TA 3TMKA 4PC1A 1TX4B 4JLDA 721PA 1QVRA 2JLSA 3L0OA 4L16A 1AQUA 1DAFA 4M1TA 4KI0A 5HE8A 1XTQA 2GXUA 4WXRA 4LJ7A 3SYLA 1UBCA 1XFAA 2OLKA 1U94A 1ZNWA 4QG7A 3QXJA 4JVMA 1N6LA 1OB2A 2DFTA 4ESHA 2REXB 2X2EA 1WRBA 2ZYWX 1IQPA 2ORWA 4IXMA 4DLTA 1C9KA 421PA 5TMPA 2ZJ2A 1KDPA 5LD2B 3UKDA 2CNWA 1XMVA 2ZRDA 4OQNA 2J46A 5KDDA 1F2TA 3BH7A 2GF9A 4MH0R 4ZKEA 5CLLA 3FMIA 3UMFA 1KAOA 3QF4B 2VLIA 3PITA 4G01B 1IY1A 3VKHA 4QGGA 3D31A 3WNBA 1BMFD 3Q85A 2ZR0A 4JT4A 3BE4A 1L8QA 2C99A 1OB5A 1AS2A 1XMJA 1MO6A 4LJ9A 5E7IA 2BCGY 1X8KA 2JASA 1CU1A 3C4JA 4AC9A 2HYDA 2WWHA 2FEMA 1CR4A 3LQQA 2XNDA 2ZAMA 1W36B 5IRCD 2FV8A 3NVAA 1KY3A 4B3XA 5IK2A 2VSXA 3CM0A 3IPYA 1SVMA 4EPYA 3IIMA 3RWMB 2GETA 1UBGA 2J59A 1S1CA 2I1QA 1WMSA 1S8FA 4B2IA 1FTSA 4QGAA 2CLCX 5L8VA 2CHQA 1YZUA 3BERA 5JI2E 4KAXA 4D26A 2C98A 1Z07A 4Q4AB 1GWNA 3LVQE 2QTVB 3J81k 1E9RA 4DCVA 4KFTA 4ZKDA 1NLZA 1OKKD 4HLQB 2RKOA 3KJEA 1TPZA 1UJ2A 3AH8A 2QA5A 5IDVA 3DMNA 2GVZC 5HZKA 1GZSA 4DEXA 1SXJD 5F3WB 1OJLA 5FTNA 4TMXA 3W8NA 1XMIA 1ZM7A 5ELXA 3RSOA 2P6NA 1F2TB 3LQRA 3UPUA 5FPYA 1FNNA 1Z5ZA 3U44A 2QE7D 4DDUA 5E7MA 1M6NA 2J41A 5K8TA 1TU4A 5D3MA 2O8EA 2C2HA 4DCTA 2LKDA 3KX2A 2ZIAA 2WJJA 4A8JC 5JRJA 3SE0A 1MO3A 3GLGE 1D6JA 1YR8A 2ZJZA 4OQFA 1N5LA 2VSFA 3GLFE 2YWGA 4IDHA 4RD6A 1GSIA 3CNOA 4MGZR 1L7VC 4B3CA 1XPUA 3PVSA 5FTKA 3ZS9A 2IW3A 4YXWD 1W7AA 1XJ0A 2ZRKA 2J3EA 2ZRGA 1PJRA 2ZRFA 3LRPA 3OEED 1BIFA 1E0KA 2CVFA 1P2SA 2J0QA 4O0MA 4WW0A 2VP0A 1LF5A 1TF5A 3MAAC 2R6AA 3TVDA 2NG1A 2YWFA 4B3DA 2VP6A 3OZXA 3NEYA 3U7GA 2ZAOA 2IEZA 4Q9JA 5FBWB 1CR1A 2P3SA 2FFBA 4Q66C 1IM2A 1PLLA 3KXKA 1ZBDA 1N5JA 1UDWA 5JWHA 2GZHA 2AFHE 1QG4A 4Q9IA 2WHXA 2J87A 2QM7A 4QBIA 3QKSB 3SJZA 1JBKA 1NJGA 2IEYA 2OBMA 3THOA 2BHRA 1R7RA 1EK0A 4PSKA 4YONB 2B7BA 2YC2C 3K8YA 1CTQA 4Q4JA 1RRGA 5FOWA 1KJYA 4HUQB 4BGDA 1YRBA 3K53A 4GL2A 1P2TA 2ZJYA 4NE2A 4DDWA 3QSYA 1GL6A 4GFDA 5KSZA 3GLGB 2WWYA 3DL0A 5DISB 2MSDB 3CLVA 4AK9A 1HA3A 5FTJA 4H1VA 3CR7A 5KDLA 3WMEA 1JPNA 5LDDC 3E2IA 1UKEA 2GA8A 2NO6A 2LWIA 3RYTC 3Q7QA 2GRJA 3DMDA 4A2QA 5CK4A 4PQYA 4NL4H 1GRQA 3I5XA 1W36D 1DAHA 5J40A 4A8JA 3CRVA 2IYXA 3LNCA 3FTQA 4BFTA 5A5GA 4QJ3A 3BS4A 4WZ6A 1NI3A 3A8TA 4I4LA 1VIAA 4JSTA 4D81A 1G1MA 3CIOA 4B35A 3DKPA 5IHPA 1G7RA 1BS1A 2ZJAA 1N0VC 3AF4A 1UEJA 4KVGA 4D80A 5HPYB 4NYMR 4B34A 4PSAA 1IXSB 3KL4A 3DPUA 1JQJC 4G5SA 4HB3A 4WZBE 4CZ2A 2NZ8A 1MO4A 2VBCA 2EWVA 1YR7A 4MKIA 5IF9A 5J47A 4LPKA 3NC0C 1PLKA 4LI0A 1S96A 3GQBA 1OXVA 4UXHA 3T34A 4OL0A 4P3YA 2EWWA 3FMPB 2R2AA 4IRUB 3KXLA 1ESMA 5TARA 3W6OA 2ZRJA 2HJVA 2ZU6A 1Q21A 5SZIA 1N6RA 5M04A 1KKLA 4FCVA 1ZRHA 1SULA 2J9RA 3B1WA 2GCOB 5H70A 4C0HA 4DLXA 1D9ZA 2G0NA 4FD2A 3V00A 3VR5A 2VP5A 5G40A 3FGNA 4PHHA 1YQTA 5DI9A 1R0ZA 5KSOA 2FX3A 3I8SA 4EFMA 3BOSA 1DAEA 2ECKA 4IKEA 5CDFE 2R8RA 2V1UA 1FOEB 3TAUA 3AP1A 3QKRB 1H65A 5EXXA 2FPKA 1FMLA 1TMKA 1KKMA 1XMSA 3L8YA 1E1RA 4MYHA 1DTSA 4Q4HA 1AZTA 1XXHB 3K0FA 1R8QA 5TXGA 1Z28A 2ZYUX 4N0DA 4RZ3A 5EE3A 3THXA 3TUZC 1JAIA 1RIFA 2QG6A 1E98A 4E09A 1U0JA 3AF1A 2ODNA 4B43A 2A9KA 1G4UR 1IBRA 1VHTA 3HR8A 3ONWA 2SHKA 2QY9A 5C18A 4LV8B 1T4GA 1FUUA 3AF0A 2IXGA 3FOZA 4D0NA 4M1SA 1G3QA 3WYGA 1Z63A 2EYQA 2ZUDA 1KO7A 1YZLA 2OO7A 1QG2A 2ZRLA 1TQ2A 3B1XA 4JLJA 3GJ8A 4JJZA 2W0SA 1VG8A 3ZQ6A 2QMEA 1VCMA 4A0GA 1E2KA 2J45A 3AKEA 4C2UA 4FIDA 2F9MA 2WOOA 3E5HA 1G9XA 2YINC 1PLJA 4W5WA 3NHAA 4HB0A 3KKNA 4AYTA 3THWB 3KDSE 1KSHA 1R4AA 3Q8XB 3WHLA 1NNEA 1NJFA 1CJVC 5FL7A 1NP6A 2JEOA 4PHTA 3O47A 1HQCA 2CK3A 2R6DA 1EX7A 5EE5B 1KO8A 1YR9A 2XTNA 3DDCA 3EIHA 1QHXA 4Q19A 2WJVA 2IL1A 5DI3B 4F4JA 3KZ1E 3VMFA 2GAOA 4PQRA 4A2WA 2BWJA 2JJ2D 4GP6A 4HAVA 5KSPA 4JLOA 5TV2A 4V0ME 4B3BA 1MOZA 3CRRA 1G16A 4TSFA 1XX6A 5LB4A 2IX3A 2WWWA 2DYKA 1ZC3A 4B6FA 2Q0HA 2O8CA 1N6IA 4Q1AA 3RRMA 1R5OA 3GPLA 2W58A 2XTZA 4TLDA 5G3ZA 3LA6A 3VHXA 3BD9A 3B78A 4OQLA 5FR2A 3VTKA 1E2LA 2QEQA 4OYHA 2QQEA 3SQXA 4TLAA 3OE7D 5AUOB 3A37A 5EXPA 1X3SA 1IJFA 1XD9A 1ZW6A 3BFVA 3T12A 4IFBA 4LYFA 2YOFA 4BLRA 4OBEA 1Z0AA 4B33A 3VX4A 4BRUA 2V1XA 4V02A 3VR4A 1W2HA 1IXZA 4W5HA 4ASUA 5GVSA 2OCAA 4KODA 1QHYA 5H8WA 1DVRA 3QE0A 1ZCAA 3ND8A 1YRAA 5H68A 4E5UA 2DFLA 1KGDA 4YMWA 1G5PA 4BZQA 1M7BA 3KKPA 3AVVA 3ZVNA 1S4QA 4M21A 1XF9A 2EFDB 1RW4A 2NTYC 4G5QA 3CNNA 3T1OA 2ZE8A 2CJWB 1VG0B 1XJQA 3AB3A 1N6HA 2ODEA 4E22A 3PV0A 4O2LA 1HT1E 3SU8A 4JVLA 4LJAA 3ZYCA 3EPKA 1SGWA 5GVRA 1SHZA 4LK2A 4JLNA 3GJ5A 1PVOA 1EFRD 2ZQ5A 1KI3A 3AV0B 1GFIA 4KYUA 4ILEA 4AKIA 2VA8A 2QE7A 2E1RA 2FE4A 4OI1A 4M9ZA 4LCBA 1VG1A 2EFHB 1YKSA 1XPRA 1ZNZA 4M9XA 4CEHB 3ZH9B 2MSEB 4RZ2A 1FP7A 1U0LA 1UPTA 1XWIA 2D4HA 3HP1A 4OQXA 4YMTA 1KYIA 5GADl 3S1AA 2IHYA 3SFZA 3W8RA 5JS7A 2F43B 3U3OA 2ONJA 4Q00A 4KITB 5AJYA 3FHTA 3LAWA 1FP6A 3RS4A 1TEXA 2OBNA 5CYPA 2Q9AA 4DCSA 3B9QA 1IY2A 1S3SA 1FQJA 1GNRA 2G0TA 4UQOA 3AVWA 4CEJB 5LPNA 4P4SB 1W46A 1CJUC 1KZGB 4M8NE 4RFSB 2JLVA 2JLRA 1JEDA 4A0HA 5FBQB 4URYR 4A1FA 4I1UA 1US8B 2DWPA 5KDOA 3ZDQA 3OEEA 4P32A 4P31A 1BH2A 3LH5A 1KI4A 4QHTA 3TQFA 1JALA 3RSLA 4NDZA 4TQUS 4JSYA 4CGZA 1X1RA 3KKOA 3P4XA 2D7CA 3KKMA 4UNNA 4RKEA 1Q1EA 4F38A 2YKGA 1OIXA 3FMOB 1DAIA 1WXQA 2JIZD 4D82A 3BJIC 2R9VA 3AKYA 1M74A 2HUPA 4BFXA 2A5FA 5BN5A 3PR1A 4B73A 2QPTA 3GEEA 2BJWA 3QOFA 3KQHA 3N2IA 3ICEA 1ZD1A 3WYFA 3ZZ0A 2B92A 5BYJA 1OIWA 3EASA 5SZHB 4V0NA 1AM4D 2PX3A 2OUKA 4ZDIA 4JVNA 4CT4B 4PHFA 2YV5A 3U7HB 4MKHA 1KSJA 1LB1B 4BFUA 5FOVA 2ZI4A 2NMVA 4LUCA 1WP9A 4D4KA 3KQKA 1OH8A 1QHNA 3P27A 5HTKA 4D6PA 1XTKA 4KV9A 4ZCLA 2YOHA 3EC2A 3T61A 1OXXK 2ZS9A 5IT5A 1HH4A 1G8PA 3OIUA 2IYUA 1S9DA 1WBDA 1Q44A 4OI2A 1KZ7B 4QL3A 1A4RA 1HYQA 4BLTA 5J4VA 2PLRA 5L3RA 1ZINA 2A5GA 4GMXA 4I1VA 4KBGA 3I72A 1E9BA 3R7WA 1YZGA 1Z8FA 4Z51A 4DSUA 5FPKA 5J4YA 2FPLA 5KNBA 4II7A 1R2QA 2GTPA 2OFXA 5DN6A 2IS2A 1RPZA 5EXTA 1ZNXA 3C16C 2BOVA 2QMHA 4FWTA 4EQ6B 4NP6A 1ZIPA 3VR3A 1SVLA 4TL8A 3OAAA 2ZM5A 4V03A 1ZC4A 1W0JD 1CBUA 2PCJA 1H8HD 2J0UA 1E0JA 4FCWA 4LBVA 1OLOA 1JJVA 5HR5A 4DKXA 1II8B 1PUIA 4YMSA 5CK5A 3A1VA 3ASYA 1M8PA 4B6EA 4KLZA 1LS1A 1FQKA 1Z83A 1UADA 2EU8A 3CH5A 5JJIA 2IYLD 1KY2A 4TLEA 2REOA 1O3YA 4CVNA 5KNDA 1U0HC 4FMCB 1OYWA 1Z6XA 4B76A 1W0KD 3GP8A 4HZUA 4RKFA 4GSYA 1G64A 2JDID 3LO5A 3WRYC 4LBYA 3T06B 1XJCA 2GHIA 2ZR7A 4IDOA 4NH0A 1JNYA 2YWHA 4URUR 3MLEA 4NCNA 2BIFA 3QQ5A 4IDQA 1E69A 4LHVA 5AR1A 4ZI3A 3QF4A 4JMPA 1Z0KA 5A4JA 2B8WA 1PUJA 2WTUA 1NVVR 4DLWA 2KBFA 3EIEA 4QOSA 5BN3A 1E9AA 1KDOA 3CPEA 4TMKA 1WDTA 4URVR 2WIBA 4DXAA 4FINA 2HYIC 3AVUA 3BH0A 2IA5A 4F4IA 4DLSA 4HSEA 3A1SA 4WVFA 3CBQA 4US2R 1NLYA 2ZUBA 4Z8XA 3MFYA 2QAJA 2ODWA 4Y0VA 4YDHB 3UG6A 2VTKA 1F6BA 3EW9A 3EPLA 4BASA 121PA 2PL3A 2J0UB 1EXMA 3NHBA 3QVUA 3CRMA 5EP1A 2KJQA 4DB2A 2BDTA 4V0OA 5TDHA 3TKLA 1EFUA 3B8HA 4NYJR 3VQTA 1XZPA 4IW3B 4LBWA 4PSVA 3NH6A 3HR7A 3M1IA 3ZD7A 1R5BA 4HZUB 1KK2A 2IYWA 2Z4RA 4JKIA 3FKSD 1BMFA 2JCSA 3ZZUA 4CW7A 2AXNA 1RRCA 3WYAA 1VECA 2GBLC 2CBZA 2BMEA 3JVVA 2PX0A 1KOFA 1H8ED 3R9WA 2PJZA 1AN0A 1QBKC 1CULC 2XEXA 3DZDA 5FUYA 3K9NA 3BRWD 3MRSA 1FX0A 3AEZA 3LLMA 1RJ9B 4ZDJA 5JWOA 4IVRA 1LNZA 2ZSEA 3DM5A 1CXZA 2ATVA 2GEUA 4B44A 2Q21A 4WA7A 1G5RA 4TTQA 3TK1A 1R0YA 1RVDA 4XJXA 2V7QD 4C0BA 3OEHD 3Q5DA 5CLQA 3SNHA 1E79A 2CVHA 2H7VA 3NH9A 1GNQA 2NO7A 3SYNA 2QTHA 5KPDA 1TL7C 2FFQA 4QJ5A 2IWHA 3ZGXA 2PMKA 4BEJA 1VHLA 4PC6A 2ZI6A 1G8FA 2IYYA 3CW2A 2D74A 2DY1A 1ELOA 4MKFA 3RDPA 3CF0A 4BUJA 1ODFA 1Z6TA 1I2DA 5K8IA 3MCAA 5J4KA 2VHJA 3O8RA 2AD5A 4IVQA 1EX6A 3AKDA 2V6JA 4DRZA 4AG5A 3DHWC 1GVNB 2QUZA 3KFVA 4IOMA 3MGCA 2IYVA 2ZU0C 3FVQA 4XD7D 1KMHB 2VSOA 3K0AB 2FH5B 4JIMA 4QNRA 1W0KA 5CIWA 3R7WB 1WF3A 4GMDA 4JLBA 3ADCA 2ATXA 5E3HA 4JBYA 1QHHA 1QHGA 2C04A 3MWLA 1U9IC 1RYHA 2BC9A 1NMZA 1P3JA 1QF9A 1FTNA 4G5OA 2O5VA 5FR1A 1PV4A 3SBDA 4D4LA 3I1FA 2E87A 1ANKA 1Z6GA 3LY5A 3ND9A 5FUWA 1HV8A 2ZUCA 2ZJ8A 2PZFA 3EC1A 5FPSA 1GTVA 2GZAA 5DIFA 3TSOA 1GDDA 2V9PA 3TIFA 3WBKA 1XEXB 1HE1C 3P26A 1OSNA 2ZTSA 5JECA 5AUPB 6Q21A 2KSQA 1ZD8A 2ZYTX 3WBJA 1Z22A 4MRNA 5EE0A 4B75A 4LV5B 2GJ8A 2D3WA 1L4YA 4KFSA 1D9XA 4AURA 2WJHA 1WA5A 2Q6TA 4V0LA 4CEHA 4S35A 3D3QA 2IXEA 1JQLB 2VIIA 2OZEA 3HPRA 2A7QA 3WY9A 4G3XA 3ZS8A 3RS5A 4ZCMA 1IN8A 4MRPA 4BPBA 2VHQA 1W2GA 1JI0A 4JKYA 1A2BA 2PBRA 2HEIA 1LTQA 5FFMA 1HUQA 5FL3A 1GNPA 4PO9A 4A2PA 2OCYC 2EQBA 3EPHA 1WQ1R 3ECCA 2F3RA 5DO9A 3WRXC 1G41A 3QEJA 4EFLA 2ZRNA 4Q1BA 4C7OA 4R2HA 3TJZA 4M1MA 3MSXA 2AK3A 2JLQA 2QL6A 1US8A 1NRJB 2O8BA 4KO8A 1TEVA 4Q21A 3DOFA 1HY3A 4YDSA 2JAQA 2R6FA 4Q4HB 3SFVA 4A0FA 2ZE7A 1KK1A 2X77A 4NHOA 1P7CA 2LKCA 1GOTA 1B23P 1FFHA 3NBFA 1DADA 3ICQB 3R20A 1DELA 2C9CA 1W4CA 2VPPA 3AUXA 1MRNA 1E4VA 2IYRA 4C0AC 1NLFA 2GDJA 1SVSA 5KO2A 1RYFA 4XVRA 1PZNA 4D0GA 3AM1A 4RFSA 1NVUQ 4Q7KA 2F55A 5JRZA 2D7DA 4DSTA 4BE7B 1KI2A 1Z47A 2I4IA 2WICA 1Q3HA 3F5FA 4B3FX 3I73A 1DAMA 2P65A 2F1IA 1Z6YA 4HI0E 3SJBA 2PLFA 4L9WA 1OE0A 3N70A 2JLUA 3BFKA 5F2EA 3MWKA 4BLQA 1U81A 2QPAA 4LYHA 5FBLB 2BBOA 2W2VA 2W6JD 5BN4A 4FMBB 2OAP1 3QJYA 1AKYA 3VAAA 3CR8A 5EZ5A 3L0SA 5DYGA 2I3BA 4C0QC 2XB2A 4CYMA 2FU5C 3GLFB 4US1R 2CLSA 4UJ3A 4ZO4A 4LJ5A 2YHSA 3PCRB 1G19A 2KBEA 4TMTA 3IQWA 4K46A 4ZPXA 2XJ4A 4D4MA 2IS6A 3T15A 2WKPA 3I3SR 4H9GA 4GOJA 5KOYA 3U5ZB 2WM9B 3IO5A 5KYKA 4LC1A 5AJVB 5HE9A 3BB4A 3EX7C 1E79D 2UKDA 5DNYB 1GL7A 4B74A 4DC9A 4EDHA 2KWIA 1LW7A 1N6OA 4W9MC 2Z4SA 1TQ4A 2JJ2A 3UWKA 2HJGA 3CUEF 3U4QB 3P1JA 2G6BA 3LFUA 2XOKA 4DEYA 2ZI7A 1S3GA 4JLAA 4C30A 4P33A 3B85A 3PEWA 2DB3A 2VL7A 5ANRB 4MYUA 3PUWA 1GKIA 2F1JA 4L5BA 5JEDA 1KI7A 4JLKA 1O87A 4RY2A 3QENA 4M1OA 3OIVA 4OK5A 4PAMA 4IOLA 3GJ6A 2Z5FA 4B48A 1SKQA 2WJGA 3CZPA 3L0IB 4OI0A 1CRPA 4Q9LA 4N3NA 3C15C 3FKQA 5CJPA 1KK0A 3B13B 3SHWA 4LBZA 2K5UA 1DEKA 2W83A 3B60A 3VU9B 1X8LA 1IJEA 1VCNA 2FG5A 4PXAA 4QBHA 2C96A 3LX8A 4X8MA 3UG7A 1U8ZA 1OPXA 1QRAA 2EYUA 4QHSA 3CO5A 5AJZA 2AKAB 2ZJOA 5AJWA 3PEYA 4FXPA 4DDVA 3Q5EA 4PZZA 1F48A 3K9LA 1G3UA 3NDPA 3QKUA 4JL8A 4Q4AA 3TRFA 2AK2A 1T91A 3H2YA 4GNKA 4Q18A 5B57C 4P4TA 8OHMA 4AYWA 2NOAA 1I4LD 1N25A 5FPHA 4PO8A 4EIWA 1P9WA 5JBQA 5EE1A 3LBIA 4RCYA 3SOPA 2AWNA 4MA4A 3ZVLA 1COWD 1L4UA 1XRJA 5L3QA 3IHLA 3QEOA 4DT1B 4OKSA 4NYIR 3R8CA 3MG9A 2C9YA 3RS0A 1P4SA 5G53C 2N1BA 2XXAB 3MWJA 3AKCA 3FE2A 3OFND 3T1TA 4BFZA 2VEDA 1E94E 1XTJA 3PUYA 3U6KA 4M53A 3RANA 1ZP6A 4EAQA 5CDFA 1SKYE 2OFWA 1RE0A 4DDTA 2OT3B 3ZVMA 3BK7A 3E70C 1NN3A 1G21E 2YYZA 4TT3A 1T9HA 1OKKA 2GEDA 2W6ID 4I1SA 4HLCA 3SBEA 3VU9A 1ZAKA 2W0MA 2ZITA 4BZPA 3QKRA 4H1UA 5EP2A 1FMJA 1ZM4A 2J7PA 1YR6A 3FWYA 4ITRC 4LHXA 3TR5A 4PC7A 1XZQA 5L3VA 2CK3D 2RH5A 4OHXA 2OHFA 3UXMA 2ZYVX 2QT0A 3B6EA 2LCFA 4LPSA 3LVRE 2ZE6A 2ONKA 1E9FA 1HURA 4NYJQ 1Z29A 4PPNA 1U98A 1CIPA 2OM2A 5FI1B 2FF7A 4DLUA 4ZDWA 1AK2A 4KSBA 1YZTA 2QBYB 1TTTA 2BJVA 3FHOA 2JA1A 2IUTA 3H4MA 1EFCA 1MABA 1G3IA 1JJ7A 3SHFA 3OIYA 5D3QA 1OFIA 4O2RA 2RAPA 4AWXA 3NIBA 2XITA 1KNXA 2WOJA 2XSZA 5DLQC 4Z8YA 3GLHE 2QGZA 2QZ4A 1HQYE 1J99A 3I32A 1NMYA 1D5CA 3ZJYA 4A6XA 4AKGA 1BYUA 4O3MA 4IDNA 4XWAA 1TU3A 2O8FB 1UKYA 4R71A 2QSYA 5JHHB 4F7WA 2RCNA 2HF9A 3REGA 1G20E 3QY0A 2OCPA 5DYIA 1S0UA 3LW8A 1FL9A 2KB0A 1NVWQ 2OG2A 4A92A 5JHGB 3HU1A 1RZ3A 4IEEA 3OFNA 4DBLC 4HDQB 1VPLA 5GJVC 4DZZA 5J4LA 1N0UA 4PX9A 3M0EA 1JR6A 1TF2A 4EPXA 4OI4A 1UBEA 5JZVA 1E96A 2HXSA 4A82A 1II0A 1P60A 2QRZA 4YMUA 3IPXA 4TN1A 4EPVA 4X8OA 4Q02A 1G7TA 4CT5A 4TYNA 4XOIA 3U60B 4OHYA 3BB3A 4A8JB 4DSNA 4Q03A 3NBZC 2P5TB
chains in the Genus database with same CATH superfamily
4FW8A 4XFKA 3S70A 2H4YA 2QMZA 1YHYA 5BYAA 2F1RA 1QQTA 3HJFA 2IEAA 2XUGA 1S01A 3LXRA 1FNBA 2V4ZA 5ADUS 5KCZA 4AJOA 4B0PA 4FHDA 5F9HA 1UCFA 4ME6A 3TH5A 4EQ6A 2ZKIA 3K70D 3WISA 3U81A 1X0XA 1JR2A 3DBIA 3KSUA 5DIZA 3T1QA 1QZ3A 2CV1A 4FDMA 1GIAA 3LT5A 4JITA 4KLRA 4OHZA 1Q57A 5DSZA 1OYVA 5FOQA 1PG2A 4RZQA 4AUKA 4ARBA 4YWHA 1NXTA 1TQ6A 4AB1A 4ALLA 5CFZA 4D92A 5BQFA 2EW1A 1BCRA 1EWRA 2ZRAA 1C4WA 4QM7A 3NOVA 4GKAA 2ACWA 2GMWA 1L5LA 2BYTA 2C7VA 3K94A 1LQTA 3QIVA 1Z9BA 1S1MA 3N58A 3OLYA 2VHTA 1I6MA 1V2HE 4HG2A 4TL7A 1XRNA 3ZHZA 3AGQA 4XEUA 3RFFA 4UTPA 4NZYA 2KLBA 5KNCH 5HUJA 1JHMA 4HVCA 3C39A 1HEIA 3KKQA 3AG6A 4BB5A 4E7OA 1TJ4A 2QPLA 5LWHA 5A0VA 3CUSA 2Z5GA 2RH4A 3ORHA 4XQGA 5EMKA 2G1JA 1M9NA 1UKVY 2H5JA 3KWFA 3MW8A 3NFYA 3JALB 4HDRB 2Z08A 3PPYA 5E2BA 4AJEA 5KTYA 1JDBB 2II6A 2ZJBA 3EARA 4D8VA 1WLYA 4KDRA 1W4ZA 3G5UA 3BBLA 5HQJA 4JLPA 3A1WA 1HKHA 1JFLA 2RG7A 3JQBC 4HDMA 2I6XA 4TOIA 4W5JA 3VV2A 2IX9A 1C5KA 2R8EA 2AFIE 2JCYA 2YCBA 4PX3A 1BX0A 2F6RA 1DXOA 2C4WA 3HSSA 4FMCF 4ZMBA 1ZEMA 1NN5A 1OHHA 2A14A 3A3PA 3VTFA 1V16B 2CW5A 4E70A 1YA4A 3IA2A 2H2DA 1U7PA 4MWBA 3DL2A 1C7JA 1GL3A 3C8UA 3DBOB 3WWDA 4DWJA 2Z56A 1A7JA 4R1LA 1I4DD 5FNVF 4YAGA 2G5TA 2M1XA 2IS1A 1ETUA 2PKWA 2FR0A 4IFIA 1TYEB 1M8KA 5ALKA 2B3DA 2A5DA 3LUBA 3LYLA 4FCTA 1PBTA 1YS9A 4MP8A 3CUYA 5H16A 2UZ3A 4DR2B 3HTXA 1UWCA 4PZCA 4DR5B 1ZMXA 2YW9A 1X15A 2VQ3A 4ND2A 2PNFA 3H1TA 1AD2A 5A6SB 3VR6D 3SWWA 4MKRA 3V1YA 5F64A 1M0TA 1K4KA 3EMBA 1QDUA 3FH0A 1DC3A 3G49A 3OU6A 4Y6RA 1PO7A 3KQOA 1NRXA 8MHTA 3GEBA 4DJJA 4AQ7A 3IOBA 1K2WA 5SV2A 3JQGA 2GZRA 2J3JA 1PWHA 1SVIA 3M49A 2R0QC 5BSWA 3FA2A 1GLVA 4QTTB 1BEZA 3TW8A 2L0XA 3ZDFA 4PEVA 3O83A 5CM2Z 5K2MA 2I8CA 4IIXA 1F8GA 1ODJA 2D06A 2GKSA 2X5NA 2GCGA 5K3DA 3TSYA 2C78A 2EHJA 5JQGB 2W70A 1ND6A 4EQZA 3VUFA 3O38A 4YRBA 4DIDA 4CCAA 2OOSA 4UHFA 4CXMA 3CUVA 3A6KA 5FUXA 1TM3E 1NONA 2RCYA 3NAZA 1U3UA 3FNHA 1JA0A 1F4LA 1GNVA 5KQMA 2FEXA 4ND5A 1JE1A 2A59A 2WIFA 1M1XB 4OSEA 3L01A 1D2MA 4OUKX 2QR3A 4ZXPA 2W22A 3HJUA 3CWZA 3G02A 3EFOB 3LD9A 3U0BA 2V8BA 4ZGGA 5CLFA 1U1DA 1UDRA 4FFMA 1M2OB 4HGOA 2CLKB 1JHDA 3R5TA 4LXUA 4AG6A 3WLSA 3GB9A 4NMWA 4P4UA 4RDCA 3UBTA 2R8OA 1U0BB 5FJJA 3EEFA 3TL6A 4UUQA 3PUVA 1IBCA 4CLOB 1MEJA 1EHIA 4GQBA 4NTZA 3WX0A 5ALMA 5C8YB 1Z2EA 3FPAA 5JCXA 4GT1A 3FSJX 4L75A 4S0ZA 1KSGA 2JGAA 3IGFA 1SU8A 1WCYA 1H0SA 4QPNA 4RY9A 3AF6A 2RHRA 3LLCA 2QJOA 4S0XA 4TQAA 3WIDA 2WNHA 2OECA 2QN6A 3EDQA 3PNQA 4KPUA 4D99A 4ZJUA 4DV5B 2O59A 1WKBA 2UZ4A 1DG1G 1GAQA 2GQ0A 1DRJA 1GUBA 4KXUA 4DAOA 6REQB 1BHJA 2PG3A 3DT9A 1EE1A 2J5QA 3O03A 4PPQA 1WM1A 1E5TA 1U3WA 2R66A 3NALA 5H82A 3GR6A 1T15A 3MD0A 2R4QA 3H9CA 1JV2B 1XQYA 3A05A 3AEYA 4OX9B 1VMEA 3EBLA 4C01A 1C1DB 4JYZA 3Q4GA 4GVLA 3HRKA 4MTLA 3B2EA 2IDJA 3EEYA 3EDYA 4ZJZA 1H8EA 1UJMA 2QX6A 4DG9A 4GUAA 2ZRBA 4TVSA 3ZE7A 1NW8A 1XXHA 3U7JA 5KTOA 3D5EA 2GYWA 4X92A 4JK3A 2Q6OA 3MJFA 2XY4A 5ECYA 3O91A 2VF2A 2ZQYA 2FEAA 1Y3FE 2IOFA 2QRVA 4FSDA 4EM6A 3OX3A 5C37A 3KSAC 2PV0A 4YAFA 2BISA 4BFYA 4AWBA 3M2PA 1KQPA 4HFMA 2PBZA 2GJ4A 4I55B 1HETA 1SHTX 3KB6A 3V34A 1BU8A 2HLDD 3RUIA 1HYHA 5KNBD 3SSMA 2H3HA 3S8YA 4TKUA 5IM4A 2O0KA 4E1BA 4WNIA 4XIGS 2OP0A 1NV8A 2RIRA 1Q20A 2C07A 4ICIA 1EX9A 5BWCA 1U99A 2QIPA 3C87A 1Z74A 4BLOA 1FRFS 1M34E 1P74A 2JZNA 3GUUA 3ICWA 3ENZA 1IMOA 4MS3B 2NTJA 1Z5WA 5KHAA 3SN6A 4JH0A 4NE9A 3WWYA 1JR3E 4ND1A 3VH3A 4H0CA 4RAQA 2GWRA 2EWMA 2B7CA 2A1TS 3IUJA 4OVKA 5D85A 3WLFA 3KTAA 4QE3A 1N0WA 3D1VA 1SPBS 1X8JA 1GRRA 1QVVA 1KL7A 1LBTA 2K6GA 4FQ8A 4K87A 3SF8A 7GPBA 3IEVA 4AROA 4X6XA 2QDXA 5EUCA 4KWEA 1Q77A 3DP9A 1J39A 2YN2A 2E7ZA 4KRFA 2OGZA 4N18A 3KCQA 4EMBA 3BFJA 2N46A 4TXHA 5DBIA 2NN3C 5J2TA 3Q72A 1GGKA 4L95C 4ESEA 3B8EA 2H31A 1USWA 4C0LA 1N5KA 3WMRA 4G0UA 4AZ3A 4MJLA 4O4IB 5GWXA 2F8SA 2Q49A 1R0KA 1OBCA 1C0EA 4J4BA 1XZDA 4KUEA 2QTZA 2JHCA 2YVUA 3DFZA 2IF0A 3GT4A 4WY8A 5EJAA 2P9ZA 3QUBA 5AJXA 3DE1X 1PNOA 5ESXA 4PM4A 4U2DA 2QXTA 5CFNA 3B2QA 2D0IA 2NGRA 2G5CA 2PVPA 2X1MA 4MPRA 1R0SA 3WGIA 4OBXA 1ZJWA 2WU8A 1QKIA 4Z54A 5DGTA 3GLGA 2Q3FA 2NQ2C 3EGXA 2VAVA 3CXUA 3ZNPA 1NW4A 3Q8LA 2BMWA 1P2UA 3DE6X 1SQ6A 1IN7A 2VHCA 4HUQA 4UVEA 2X2OA 4GBED 3KQLA 4N54A 1V8DA 3R3WA 1Z16A 4GKVA 5DOVA 4CKEB 1SVWA 3MJVA 4E46A 1CEEA 5CEEA 4X1IB 4KOAA 5JTTA 2WJPA 1TUBB 2DR2A 2BGJA 2PH3A 3QKSA 4K6HA 2QLJA 4TN5A 3D1JA 3GLHB 4GP9A 5ALGA 1OMOA 4CN9A 1P1CA 2DWCA 2GXSA 1AQYA 1VYUA 3HCCA 4MITA 4C0SA 3U31A 3F6BX 4KBYA 1AUPA 3EVZA 1JMYA 1Q6YA 4NR0A 3DBLA 2ZATA 3GG2A 1JKMA 4PBRA 4YHBA 5ALEA 2IPAB 3C14C 3TSWA 1DIHA 3CLSC 3DOJA 5BN1A 2NU6B 5DW3A 1K9SA 1SC9A 4KRXA 5HG0A 4KQEA 1JLRA 2GJSA 1AKQA 2WUDA 1Y3IA 3HYCA 2F1OA 4LOLA 4A26A 3GOQA 3IUNA 1NGSA 3ED5A 4HADA 4OHVA 5EYPB 1MUUA 3X1ZA 2Q99A 1Z82A 4NBWA 1FU4A 3LT0A 1D6NA 1JDBC 1M75A 1DKUA 4Y67A 3WIBA 1TCBA 2LW7A 2RJ3A 3NP7A 2HWWA 4LZLA 2D2FA 1HGXA 4PPFA 3OVMA 1QS0B 2IRWA 3CCBA 2R79A 4GAEA 1Q1QA 4LY9A 2Z6VA 4TL9A 1UOQA 1EFHA 1MAAA 1HBJA 4EYEA 1VYTA 3EGXB 5DM1A 2J9FA 4JI2B 1AS3A 2I1LA 1W96A 1G7SA 3D3WA 1NFQA 4I5EA 4YAEA 4DKJA 2G06A 1HEYA 4RPCA 4AN0A 4OYYA 4QXPA 1W5TA 5C9ZA 3AC0A 3RC7A 3LLUA 3ZXXA 3UA3A 3EA0A 4C06A 5TPZA 4QUDA 3HI6A 2GN4A 2CMFA 4Q1FA 5JSFA 1K5GA 4BN5A 5IT9A 3E1SA 1VJ5A 4Q7MB 2JLZA 3H1AA 4EPRA 2ZK7A 1BOFA 2PH5A 4I1IA 4X60A 4J0IA 2AN3A 1I10A 4UATA 3DMHA 3QMVA 3L7JA 4CT0A 4X20A 1K5DA 1Y4AE 3QU5A 2ERXA 1UBRS 3GJ3A 3I9FA 1U9IA 3HL0A 2R25B 5E6UA 1E3SA 2DFDA 3HADA 2V3VA 2W4MA 3IILA 2FLKA 4L6IA 2D1YA 3A6DA 4M1WA 3NPAA 4I4NA 3WNCA 4A3SA 1R6BX 3GLHA 3JSAA 4FR2A 2VDWA 4D9BA 1XXLA 2YXDA 3E2MA 1H5QA 2XT9A 2HSGA 2J8ZA 4R2IA 3RH0A 1R9JA 4MLZA 1CY2A 3HU3A 4R7ZA 1KYWA 1UQTA 3DEKA 1U2RA 4X1IA 1HZJA 3B52X 5IVKA 1ZS9A 3GNQA 5LBIA 3R5XA 5JR3A 1O97C 2DC1A 3PWSA 1W0CA 3L6RA 4PPGA 1J2TA 2C4HA 2UU9B 4EKGA 3OQIA 5SY4A 3QEBZ 2AGVA 4XIIA 2JFPA 2D4AA 5JJBA 4PN3A 3GEGA 3RVBA 4OFWA 1JEYA 1PYOA 3JVIA 3FCEA 4R8RA 1GDTA 4CV3A 1GJRA 2ORVA 2PMFA 3LV8A 3AFOA 3G2MA 3PXBA 2IDZA 3QYFA 4QXOA 4U8HA 5DI3A 3ROMA 2QN9A 3QOXA 4DQUA 4ZICA 1RZRD 3NV7A 5E6SB 3CB2A 4CUZA 4MWCA 4CKEA 2IVFA 2FAXA 2OO3A 3P9KA 5HILA 1OX4B 2ZBPA 3COZA 5JAQA 4EUNA 4EYKA 5IN4A 1FZTA 2P1RA 4PYJA 2ZAGA 5JNUA 3DOEA 3VNUA 1V2GA 1OD6A 4KWHA 3MJDA 1C9YA 4GR9A 4HN4B 1Z4OA 5EKSA 2O3TA 3BL8A 3HG7A 1DXHA 2I8AA 5FHQA 3UB2A 1KP3A 3N6XA 5BVHB 5FKJA 1I1QB 2JCXA 2AFRA 4M88A 4C0KA 1A9XA 1LA2A 3H3FA 4G4IA 2CYCA 1ZUWA 2GCIA 1UXOA 1Q0PA 2GHTA 1ZR2A 1MFZA 4CM1A 1Z7EA 3IP1A 1FQWA 2G1KA 2GZDA 1X70A 4WLFA 4RA9B 3W05A 4D2IA 4LJYA 1FFDA 4JC8A 2M32A 3BGWA 3H2JA 1EJ0A 2ODAA 1WSWA 3KTFA 4N6OA 3FMGA 1S8AA 4O33A 1ZW1A 1AKUA 2G4LA 1PNTA 4OJMX 4AJHA 2RGDA 3PXGA 2P79A 2POQX 3EJWA 2NVWA 4IDPA 3WLPA 1F20A 3FYUC 2F3QA 3FFAA 3W2IA 2BVNA 5CBPB 2QRNA 2BEWA 2GI4A 1A9PA 1ISPA 2MSNA 2P9CA 2VZLA 3BZUA 2WUGA 3GGDA 3NGLA 4L7VA 5AFSA 1DPGA 5IEBA 3KFXA 5EP3A 5MGNA 3LWNA 1Z0DA 1W94A 3LYHA 4UXJA 3H8JA 4L5IA 2XGSA 2PWBA 3VJRA 2Q3MA 3ZWQA 3MUOA 1DS6A 2WV9A 3ETHA 2IT1A 1WJGA 3H11B 4ZVMA 2QGFA 2P90A 4HEHA 1YOVA 4PRKA 1QRRA 4F8EA 4MAMA 3WHKA 4G1UC 4V0KA 2FYTA 3INNA 1G98A 2JGLA 5TEWA 1JIIA 1G5QA 5EHGA 1JEAA 2X2PA 5CDTA 1X1SA 2DHEA 3BXXA 1KMNA 1L2TA 1SXJB 3PXUA 1JH8A 2BFCB 5E9QA 2DUJA 4UUOA 4V1CI 5DASA 5J3JA 2BW0A 3KWLA 1L4NA 3ENKA 1Z3CA 5EINA 2OM6A 1F06A 2EJCA 4Y2YA 1DFHA 4P93A 3QFTA 1D8TA 3OE7A 3OM1A 4NU5A 1JAZA 1J00A 1P5HA 1RHMA 4U6SA 1A9RA 1CJMA 3DVAA 4NZZA 1OZHA 4Z49A 1CE8B 4KSYA 1WCWA 2ZPTX 4GOND 2QW8A 3N9IA 2V0GA 3M3PA 5CLJA 2H1CA 4MR8B 5JY6A 4M9UA 2Z6AA 2DULA 1P1JA 5IMBA 4FYHA 2C5FA 2XDQB 5AYVA 4HH3C 1CUYA 4LGMA 3R0JA 1TUIA 1G3MA 2VJMB 2FB9A 4MPJA 1E1LA 4F3NA 1DQYA 1J0EA 3K0CA 2X14A 3S6JA 4GZMA 3LCUA 1XCGB 2AQKA 2BMFA 2ZWVA 4CRWB 3FB4A 1S7CA 1WB5A 4NJMB 5ICMA 1RRPA 2V6MA 3I42A 3KZMA 2IUFA 4L8VA 4MA0A 4NEHB 5DE3A 3CVYA 3GRCA 4HOYA 4HS4A 1UXIA 2C2OA 5E9AA 4IOJA 2H1FA 2UZAA 3TNYA 3ZHUA 1LU9A 1CJKC 2O2GA 2RGBA 2X8JA 3HMQA 1IZ8A 1NSTA 3C97A 2PUTA 3EBPA 3MNFA 4PZYA 4F2GA 6CHYA 4UNPA 1PJCA 3DTVD 1GT6A 1RHRA 2XT0A 4MAFA 1T4MA 1PJBA 2WW8A 5DW0A 4JBHA 2AYXA 5CURA 4UREA 3ETEA 1Z2CA 1E99A 4FP9A 1A3CA 3T5GA 2W6OA 2EFCB 1YO6A 4AMGA 2AZTA 2Z2YA 3OURA 4KW7A 4DA0A 1Z8HA 1LC0A 2WKWA 1GFZA 2OHHA 3HS3A 4M9SA 1YRWA 3GCGA 2DFNA 1E4YA 2YZKA 3IXQA 621PA 1INLA 1ULHA 2Q8NA 2JIRA 2XADA 3LDAA 3SZRA 1PZMA 3ZWXA 3JR3A 4DAEA 3PQDA 4L73A 3LHFA 2RK4A 4HEA1 1RZVA 4O4JF 4G0QA 5BP7A 1EESA 1XTZA 2CKDA 3BMOA 2FA9A 5CYOA 1II8A 2HLPA 4XZ3A 1YZFA 3PI6A 4LJ6A 3RNOA 1OXTA 2XH8A 2Y4NA 1XYVA 1YE8A 3NYQA 1D1SA 5EKDA 1ZXLA 4GIBA 4NG4A 4PFJA 4ZARA 5TQ0A 2E85A 3T9FA 4DJFC 2HUNA 1QRDA 1KIMA 1RI2A 2P2LA 3TGLA 1T4CB 4Q9AA 3NC4A 4WKBA 3L7BA 3E4DA 1GPMA 4CFZA 2RHWA 3EWSA 4YS6A 1JLMA 3S55A 5JJCA 2A8YA 2H1LA 2R8ZA 3UNXA 5TT1A 3T9EA 2FSHA 1EGAA 1XGKA 4S1NA 4FMDF 5JQWA 3HYTA 3BD8A 5M34A 3FTEA 4EY3A 3ELBA 1G2IA 2D7JA 3ED1A 1OXSC 2GSDA 1CD5A 2WWGA 3IH5A 3JY6A 2YW2A 4PBSA 3MCZA 5F4BA 1HDRA 3T4UA 3UY4A 5C1BA 4GZLA 4MUFA 4XVQA 1X6VA 5DCYA 4F6RB 4RL4A 1JEOA 1P8JA 1A7UA 3OO1A 3Q6NA 4HB2A 1F38A 3SBXA 1K97A 2EERA 4YLYA 3SVLA 3DMTA 4IIHA 1U6IA 5H4HA 3GVHA 2GM3A 2UYQA 2WRZA 4J4HA 3UMSA 4C0JA 1KQFA 4ZT4A 3PJRA 3K0SA 2CNKA 2QM3A 2XECA 3SS8A 5BYBA 2KYRA 2GAJA 5TQJA 1N1GA 4RBNA 3WL4A 5I8PA 1RXIA 4JZYA 2O20A 2WHQA 1LH0A 2VQDA 3F1LA 4FYIA 4QYXA 3SIRA 5EERA 4B2YA 2JNWA 5I8WA 3UGJA 1G0NA 3L7AA 1DT5A 4RTJA 4N41A 3JAWB 1U0GA 1COWA 4TSRA 1U3GA 2AMJA 4NS4A 3U4QA 1KYZA 1Z26A 4I99A 2VOEA 5E7JA 5LD2C 3VDRA 2IZ6A 2BKXA 1R64A 3UMMA 4LA4A 1GZ6A 4LXXA 3WGVA 3CH4B 1YI1A 4R4JA 5BOVA 1D09A 1NYRA 3DMFA 4IUBS 4EGSA 1KI9A 4LE0A 2F3PA 2HT1A 5J23A 4AI6A 3KB1A 3KEFA 1XRPA 3C5CA 4K6GA 4R81A 1ORWA 4ND7A 4B4UA 4DDKA 4ZV7A 4LDNA 3HGMA 1HO3A 1JDSA 1AHIA 1OXUA 2B99A 4GPAA 4UKDA 4PLWA 4YJ2A 4LYJA 4BAUA 1KSFX 4L4YA 4NH4A 2ZJ5A 5LJIA 1A7AA 1PR3A 3FVRA 5DXFA 1PEYA 5BORA 1Z4KA 1U3CA 1Y5MA 3JQ9C 1YS2X 4FX5A 3PWZA 3T1VA 4B83A 3Q7EA 2O3SA 4X8HA 3G2JA 2PE5A 2YY6A 4HAUA 1E1MA 4RVCA 4U7WA 3C3EA 1KDTA 4TLBA 1NMXA 3WP0A 2JBAB 2GJAA 1AXEA 2R6CA 2X0NA 3PZBA 3SMQA 4LRWA 4PS0A 2ONZA 4RXMA 4WBSA 4XCQA 5DKFA 2CHGA 2NO5A 4FYMA 3DUFB 3EIQA 5DNAA 5AVJA 3N7UA 3RAGA 1XFDA 3CVJA 4IJ6A 4W9NA 4X6LA 2C95A 2G9QA 3BSFA 4RSMA 1V4NA 3E22A 4JYCA 2PYZA 1ORTA 1UEIA 3QJ5A 5HK8A 3DG9A 1TVKB 3OUUA 4HAWA 3IC5A 4QDJA 2NACA 2ZE5A 1T5IA 1FZQA 1NXQA 2HBZA 4ZGWA 2ZZKA 3DHYA 3GRFA 4RVGA 4LSGA 1N2SA 4UMDA 3K30A 3S1AB 3DYIA 4IQGA 2XF2A 4DC1A 4CMIA 2I8LA 5FADA 4ZANA 4X8LA 1E6WA 1R8JA 2TSYB 1R0RE 2H00A 5FLXA 4KYVA 4RZUA 1C0KA 5AW4A 1BQ4A 3I5YA 4KXWA 1HFKA 2D62A 4UNRA 1DC6A 2DFKB 2NXEA 3QVTA 1A77A 1WHSB 4HB4A 2WVJA 5B58T 1H6AA 2LP4Y 3KHUA 5FL7D 1MX3A 1PNQA 1ZCZA 1YIDA 1HI9A 3ZPXA 1KIFA 4JX9A 4CLHA 5CA0B 3LBFA 4AX4A 2BGGA 1FFBA 1JU4A 4QPPA 3HA7A 4EARA 3Q15C 3TRJA 4MVJD 4P2BA 2EL9A 4HWRA 4IG9A 1DARA 3N2ZB 1ILEA 3MJCA 2XZOA 4L0MA 4E08A 3DLHA 2ADFA 5K2OA 1AV7A 4N7MA 1GU0A 5AI8A 3IEIA 3GFOA 2PUJA 4WAUA 1F2UB 3O82A 1VSQA 2J6IA 3SLKA 2QNBA 1VPWA 2X23A 4MIYA 3X2FA 3T5DA 3M9XA 4R2WA 1SPXA 4GPTA 2F8LA 1SC4A 1Z4LA 3PENA 4ZAXA 4Y9UA 4P34A 3H2KA 1ONBA 1QKJA 3LTNC 4UUBA 3DKIA 4PLPA 2VT7A 2VCYA 1WB9A 1PKXA 4TWBA 4FIZA 2XMBA 3LP6A 2EKZA 1Q74A 5IYZB 4H6WA 4R5MA 2X6RA 3I2KA 2W90A 4AYXA 4PRLA 5EQTA 2ATCA 3FFWA 1W0JA 3P9IA 1Y42X 3Q7TA 4D42A 5MN4A 3SM3A 2J08A 2FWRA 3G5AA 4DQLA 3WLKX 3WMFA 3I2IA 1D07A 4M98A 2AMFA 4E5KA 4UMFA 1MBZA 3G23A 1AUVA 2NU9A 3A9VA 2GRUA 1RT9A 3PGLA 3MQ4A 4LX8A 2XCQA 2PM8A 4LFAB 1A5AB 3KJNA 5A05A 4EHIA 3M6MD 2C03A 1N2HA 1E1QD 1G5TA 4UAGA 4YJ2F 1GZUA 4PC3A 4A8TA 4FB4A 5HOEA 4KNYA 2V5VA 4HAOA 3WZMA 4J9UE 3TEFA 2GBGA 1YULA 1BJRE 1CUXA 2P8JA 3BJEA 3A2KA 1KC3A 4W9NC 3PUZA 1H3EA 1HK7A 2X6QA 5KAMA 4L28A 4DUGD 5FA6A 1F3OA 4FDUA 1KJWA 2D1TA 3K1TA 3I39X 4WN9B 2BLNA 1IWPB 2OYSA 1L5ZA 3WZ2A 3EAGA 4CIWA 3TF5A 1UJNA 5IJ9A 5E2AA 1EPUA 1FNCA 4IX9A 2DP4E 4REQB 1P45A 1NUHA 4U7HA 4MWSA 2B9EA 2PZKA 1GZ3A 2C8LA 3CZ4A 4EBFA 1PR2A 2HSWA 3AF5A 4Q1CA 4RVOA 1MW9X 1RYBA 1U28C 4O4LB 4U3JB 4V3BA 1EFVA 3PQFA 2AT1A 1XPJA 2OPBA 5C1IA 2FNAA 2ICAA 5CW1A 4DIOA 4KN9S 2C9DA 3LT1A 3HB1A 3O4JA 1JR3A 1WP4A 4HAXA 4X6YA 1OH8A 1WMAA 4EELA 2A30A 3BHNA 4BKRA 1J24A 2PR7A 5J2UA 1VIDA 4O29A 3U4MA 2G08A 4CMEC 1Y98A 4KQXA 1Z5OA 4K3UA 3VPDA 3P32A 4REMA 2CHEA 3ESCA 4M86A 4YT5A 1Z15A 1BWRA 1JBEA 1Y33E 3Q98A 1EP1B 4FNOA 5LB2A 1XP8A 2NU9B 1CUHA 2DPYA 1XCBA 2UVPB 4PO1A 5KQRA 3Q7PA 3SZMA 3EGEA 4YMVA 4AS2A 4YECA 2QV0A 2JIBA 5CT8A 3B6ZA 2W6QA 3M1YA 1JFFA 4L4UA 2AN9A 4LI3X 4Q4LA 1L5HB 2CDBA 3Q0TA 4MKZA 4QPCA 3R5JA 5LZ8A 4CR8A 1GNSA 5AKEA 5L51A 2NP7A 1SOWA 1QG6A 4LZPA 4CKWA 3HO6A 3NDIA 4MUIA 4R3NA 2RHMA 4WNAB 1QGUB 2BDUA 2I4LA 2CYAA 2OCKA 5ALYA 5IX8A 2GPWA 4I1OA 4I81A 4XWTA 5H9VA 4M1YA 3U61B 1LS6A 1N0HA 2QWXA 2ZB2A 4LNUB 1VDZA 5C4GB 4F5WA 5DN6D 1UAYA 2JFVA 5BSUA 2ATEA 1KJIA 1PG5A 1J56A 3H65A 3PGVA 3GYGA 3NT5A 2MDTA 4AG3A 1IEQA 2BGUA 1SHUX 2MIIA 3PQ7A 3STTA 1AH2A 3NJ4A 3A1UA 1JA1A 1GA4A 1WKVA 2WU4A 2VAWA 1ECCA 2JATA 5FOUA 2ABWA 4MW1A 4L57A 5KNCD 4U5QA 4DMFA 2IV2X 5IT4A 2VUIB 5KWVA 2OQVA 2XLCA 3I30X 1S2MA 4M9RA 2DJIA 3FSGD 4KQ6A 2WD7B 5BOSB 3F2IA 2XA2A 3GG9A 2IEGA 4JROA 5E6UB 1JDVA 1M33A 2CUZA 3D8SA 2NZWA 3AVQA 2YZ2A 2B69A 2PN1A 3AY3A 2BV3A 3I0NA 3LK6A 3RUAA 2EP7A 4IJVA 4MV7A 5C4MA 3PKJA 1YBFA 3AHDA 1OLXA 3MWEA 4UC0A 4ZI7B 3AQ4A 4G26A 1VHJA 4IYJA 1S8NA 3HR4A 2P78A 2BZGA 3BMCA 4J7AA 3JRWA 4ISBA 3SP1A 3U7FB 5CYFA 1P73A 1RRKA 2FPMA 1KAHA 1GPLA 2C7PA 5KJ6A 3W5IA 4QBGB 1ODLA 1I6LA 3DDNA 2EFGA 3IRUA 3IAS6 5F1PA 3GZNB 4MQFA 3RARA 5JMTA 2Y92A 5BVHA 3UT5B 4FU0A 1IXRC 2HSJA 4PIPA 2B4RO 4QJ4A 4E2FA 1KPGA 1ABFA 2UZ1B 1JIQA 2Q4RA 5FNVA 2CL5A 1U2QA 5CIYA 4D8UA 4QAJA 5JXHA 2VYQA 4X85A 4WXHA 4AD8A 3PD1A 4JU8A 3NHSA 1LUAA 2J07A 1RYEA 1P6UA 1CDEA 5DULA 3I1JA 2WJIA 1KI1A 4G0PA 4WXPA 3PJEA 5LQMA 4R9VA 2GYUA 2XCSB 4WERA 4ZMRA 1ZH6A 2OCLA 2P67A 3LS2A 3JYHA 4I2NA 4XW2A 4K0KB 3CRW1 5C8DA 1RTTA 1C0LA 2FP4B 2RB4A 4YH1A 2HNAA 3P9ZA 5JS8A 2BEVB 4NAUA 1T3HA 5CNKA 4O3FA 4G8BA 5BMVB 1IBMB 1VKJA 1WZNA 3K1AA 4OJKA 1YL5A 1YRLA 2IFTA 2HCJB 2P0YA 2VK1A 4U2GA 1C4OA 3WRVA 3H9QA 1RU3A 3UH0A 3ZBUA 2DT8A 3AVOA 4LF8B 4R54A 5FOXA 3DQPA 4R69A 3G9QA 2FSIA 3TCKA 2UZIR 4NBVA 5AI6A 4QA9A 3TPFA 1RYYA 5LOVB 3QGMA 4K9SA 4BKOA 5T6BA 4DVJA 4ANFA 1TCVA 3NKVA 3PHHA 1ULTA 4JBWA 1JJIA 1RZRA 4XKJA 1OREA 2CSUA 5E6RB 3V9PA 1KBZA 1TQDA 1BDBA 2AOXA 3MYYA 5B2EA 5ARCA 3JASB 4NCAA 1ZN9A 3QVSA 4C21A 1IE3A 1XCMA 4BNDA 1X92A 1UXJA 2B35A 2FZVA 2V6GA 3PCXA 2GK7A 3ACBA 3ZTWA 1N6KA 2R47A 3N2KB 1VMAA 3TGPA 1H23A 1XJWA 5HS4A 3VKGA 1UWVA 1YMVA 1SO8A 4A0RA 1B3RA 4RE6A 1Z88A 4UQLA 4EVQA 1SG6A 2PJUA 2C42A 2RBKA 2VCHA 2ZEJA 1NG9A 4ARZB 2OGUA 5G41A 1ZSYA 2WG2A 2YS7A 1MB4A 1RM3A 3ZDRA 3WLHA 3IPCA 1XBTA 1PYGA 2ZYHA 4Y6OA 3RWOA 3JPYA 3AJEA 3JQ6A 4M83A 2AH5A 2C1EA 2CE7A 2P4UA 4A03A 2M6RA 3FBTA 4PG8A 1EUDA 4CM4B 3O8QB 4BNWA 5C5DA 1XTSA 3QFRA 2M2IA 3HK2A 2AR7A 3KOUA 3T1HB 4ARVA 3SXPA 4BV9A 1K6MA 4EG3A 4M7WA 4ZCSA 2VQSA 3L7NA 4FX2A 2IUYA 1B8PA 2E89A 3GVIA 2A4KA 4PWYA 5KQPA 1SXJC 5LP6B 1SUCA 2ANBA 3GFTA 5LMUB 4MVJP 4UEWA 3BWDD 1N3IA 3GEMA 1H4SA 5JAZA 5JSZA 2ID9A 4XX0B 2IYTA 1XNJA 4LMBA 4GLBA 4P3PA 3Q40A 4F5YA 4HQRA 4B2PA 2XUOA 2RGUA 4OB6A 3OTWA 5BNTA 1JKJA 4QFMA 1NBME 4IVNA 3BREA 4FFWA 3S68A 1H1LB 3G6KA 4E7PA 1W581 2FGJA 1F0YA 2OXRA 3I53A 5E0KB 1ISRA 3FNIA 4B4WA 1YSCA 1V25A 2FR1A 2RHDA 4F4FA 1YU9A 4TSKA 1LC3A 3W9YA 4YX9A 5C81A 1YFJA 1FMFA 2W8BA 4JLDA 5HM8A 1BZYA 3AWDA 3UICA 721PA 4I1PA 3ZKWB 3L0OA 5FT9A 1D4ZA 4YUAA 4J6FA 2G4CA 1DAFA 3I9MA 3H75A 5I7UA 4M1TA 2Q7XA 1UC8A 2I71A 3D8TA 1J22A 4PGHA 1YXMA 5EC8A 1R5JA 3OPNA 4BQPA 1GEGA 2JRLA 3TX2A 1SQGA 4YWJA 1U94A 1ZNWA 2WM8A 1N6LA 4QNNA 2AE2A 1W85B 4DLLA 1E6KA 4B09A 5DFAA 1JDNA 3H8WA 2ILVA 2Y0BA 4IXMA 1JU3A 5BSEA 1C9KA 3KKEA 4KPGA 5TMPA 1KDPA 3S2ZA 4LDQA 2AUNA 1O0SA 4QRDA 2WF8A 2J46A 4AJIA 3T4PA 5J58A 1F2TA 1XRRA 2XZTA 4GYKA 4QYIB 3R24A 2PY6A 3QF4B 2VLIA 4BTLA 4DZTA 3D31A 4YDQA 5HUQA 3QVGA 3Q85A 4LOHA 8GPBA 2VA9A 4UE3S 3BE4A 3WGHA 4HJRA 1AS2A 4B45A 4JNKA 4LJ9A 4ZOCA 2PSDA 1I80A 3C4JA 3GLUA 2O5EA 3ZI7A 3EHDA 2NUAB 3I8OA 3B7PA 2XNDA 1E3QA 3PUHA 3WGTA 3R2JA 2GN9A 3KJQA 2PX4A 2HHHB 1H0HA 1KY3A 1YH3A 4IIJF 4BN4A 1BGVA 1ZO8A 3FYTA 2I2XB 3OWOA 2QKYA 3MRTA 4FMPA 5LQJA 1UBGA 1BMDA 2FTKE 2OCIA 2YZ7A 2BF7A 1WMSA 1FTSA 1R8XA 1P31A 1M2OA 2CLCX 2FUG1 5L8VA 3BERA 3IURA 3HEMA 5JI2E 2ZBDA 2J6CA 3BSSA 4KAXA 3A14A 2C98A 1Z07A 1YS6A 3E8SA 1G8SA 2YDXA 1B43A 3II6X 1R6DA 3M2TA 1N2CB 5CGZA 1IBKB 3SKYA 1ADYA 1EDBA 1E9RA 2XTAA 3C3YA 3CT4A 4KFTA 4QQFA 4DCVA 2NZ2A 3MSCA 4KO4S 4ZKDA 1S5PA 4UVGA 2QIOA 3ENVA 3HY3A 4YPFA 2GVZC 2GZ1A 5TT0A 4B3JA 3GUYA 3WGNA 2J48A 1SXJD 3K6JA 4YYZA 4B5KA 1PNVA 2YHAA 3B6JA 3W8NA 1ZGHA 4INZA 2I6FA 3NPMA 1R18A 2I76A 1USUA 2AW3A 2PL9A 4DM3A 1L7BA 4YCLA 2VC2B 3BUSA 1C80A 5T67A 3UPUA 3VH2A 3OZGA 2NU7A 4C6SA 1NVAA 2VWPA 3U44A 4DDUA 4K05A 2PT9A 5E7MA 2EHDA 3UJCA 1TU4A 4DNXA 2ZXEA 3DLIA 3PD0A 2PMEA 4HYEA 3HCRA 4TT8A 5BNZA 4QTXA 4RENA 5JW6A 3KX2A 1K3TA 1QKKA 4XCVA 4HVTA 3GUVA 1SXGA 3JR7A 4B4OA 4OA8A 1MO3A 4YP6A 1MVNA 4MCHA 1P2BA 2H1RA 3ZXIA 5EJ4A 1N5LA 4OKNA 1GGVA 2PV7A 2YWGA 4IDHA 3CNOA 3T9CA 2MJLA 1RBMA 4FGJA 2X76A 4RK6A 5A02A 1V37A 4TZ6A 3GUZA 4U2EA 3LM8A 5EJ2A 3ZS9A 2IW3A 3BZWA 4BNIA 4OXQA 4YNBA 1JL3A 2XIQA 4I4TF 2ZRKA 3Q6IA 4CF5A 1PJRA 3RYIB 1EBFA 2GH1A 1BIFA 3FYSA 2PKYX 4N82A 4NBRA 3JAWA 1PEDA 3QM1A 1I5RA 1W88B 4WW0A 2V96A 3QRWA 3CISA 2FJ0A 3RC2A 3TDMA 3V1NA 1NT2A 4EYGA 2Q4DA 4WOCA 3TVDA 4GF5A 2QQGA 1NI5A 1U2EA 1FQOA 1V7ZA 5HF5A 3V9AA 1R66A 1NBAA 2YWFA 4KGVA 1AKRA 4TVKA 1U80A 1TYAE 4GI2A 3TEJA 2ZAOA 5H80A 2DXIA 2B7LA 2FFBA 3MTGA 1JG4A 1PLLA 3KXKA 1XHFA 1V6SA 1GA1A 1M0SA 2XOEA 3PICA 2X40A 1JQ5A 5BMOA 2GZHA 1O77A 2M6SA 3L0DA 3COJA 5BO5A 4DG5A 2WILA 1ZOOA 2J87A 2JFQA 3DBRB 3K6SA 2BGMA 1KXJA 3DDZX 5GTDA 2WD9A 1JIUA 3JVEA 4C5CA 2WQZA 1OI7A 3AR9A 3LRTA 3TX6A 4CV1A 3ISJA 1R7RA 3L8CA 1EK0A 1TK9A 1HDXA 2PRZA 2GD1O 2VF4X 2B7BA 4NNPA 4YONB 4EYOA 1HL7A 1NW7A 2AF4C 1DIRA 1RRGA 4Q4JA 3RGWS 4AF8A 4C3UA 5IYZF 3STYA 3F5MA 5A2GA 1A69A 1RAFA 1TJNA 4GSLA 4BFLA 2EXXA 4GL2A 2PZMA 1P2TA