4DWJA

Crystal structure of thymidylate kinase from staphylococcus aureus in complex with thymidine monophosphate
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
203
structure length
200
Chain Sequence
b'SAFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRKIVLEGNDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNSRDQNRLDQEDLKFHEKVIEGYQEIIHQRFKSVNADQPLENVVEDTYQTIIKYLEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate kinase
publication title Crystal structure of Thymidylate Kinase from Staphylococcus aureus in complex with Thymidine Monophosphate
rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Transferase
total genus 81
structure length 200
sequence length 203
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2012-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4dwjA00
4PAOA 3I72A 2OG2A 1VCMA 2HLDD 2VP2A 1W48A 4DLXA 3KQLA 4TL8A 1SXJC 5HTKA 2J0UA 1W2HA 2VF8A 3C41J 3WNDA 3AH8A 1OHHD 1SVKA 2QP3A 4RZ2A 3LVRE 2GXQA 3NKVA 4TZ6A 1ZIOA 2HYIC 5IHPA 3J81k 1U81A 4V02A 2N42A 4IVRA 2RMKA 2YC2C 5JJIA 3H84A 4N3NA 4PPQA 1OXXK 2CCJA 1OXSC 4PSVA 1P6XA 4OYHA 2IYRA 1SVLA 2QTHA 4LYAA 3ZIAD 3AKYA 1W0KD 1ESNA 2WV9A 3OIYA 1SKQA 1ZRHA 2WKRA 2NPFA 3R9IA 1NKTA 2PLRA 3C5CA 3LQQA 3QXXA 4D6PA 2XB2A 4L4UA 4LJ8A 4ARZB 1KI1A 2Z0MA 4HDOB 3WNBA 2JLYA 2IXGA 3EPHA 3VFDA 4P0TA 3ETLA 4B3BA 3ZS8A 2P3SA 4XWAA 1G1MA 1JR3A 1NG9A 4OHVA 4N0DA 4A8JA 2WSMA 1BS1A 1JPJA 3U2QA 2BCGY 5D3MB 4AKGA 1XTKA 2LCFA 3UG6A 4B74A 5EZ5A 3QVUA 4B75A 3KZ1E 3GLHA 4TTPA 2WWWA 3RRNA 4LC0A 5E95A 4LBWA 3U60B 3HP1A 5SZHB 2JASA 4KBFA 3C15C 1MO5A 4B6EA 2XSZD 4NPHA 4TMZA 2VHUA 5IF9A 3B1XA 2QU8A 4Q1CA 2QBYA 1T4GA 5FI1B 3W6NA 5L3SB 1CR4A 1E9BA 3LD9A 4I1OA 1RYHA 3TNFA 1QHXA 3X1YA 3K0FA 5BXQC 2JA1A 2ZJZA 4UJ5A 4BFYA 4DWJA 2FEOA 2ZYUX 4JT4A 4D0LB 1XEFA 1G4UR 1CR2A 1W4BA 2WWFA 4DLVA 1R0ZA 3Q7QA 1BMFA 3GLIE 3Q8XB 4WXPA 2J59A 1VCNA 3V4RA 1KO5A 1A2BA 2RKOA 5J5CA 2WJHA 1D9XA 3UWOA 3AVVA 3BRWD 3IKJA 3IBYA 4QBFA 3ASZA 2XTMA 4NYJQ 1PLJA 5EP4A 3ZD7A 3M6AA 3A8TA 2RGBA 4MRNA 2BJVA 4CEJA 3SOPA 4DSOA 4CW7A 2ZRAA 2ZTSA 4M22A 2CDNA 4MDFA 4IRUB 1SXJE 5BWMA 4OK3A 3WXMA 4FMCB 3G5UA 2JJ1A 3NBYC 1RFLA 2Z5FA 2GK7A 4AKHA 3B85A 4D4KA 4HDQB 5H70A 3BB4A 3I8SA 1Q20A 3ICQB 2FSHA 3FWYA 5FUVA 2LKDA 3B82A 4ZKEA 4Z1MD 1GFIA 2IUTA 1RRCA 1F6BA 1NN5A 5E7JA 1OIWA 3QKSA 2ZSEA 5FPSA 3REFA 5DH9A 5JSZA 3BBPA 1VG0B 1X6VA 1ZINA 4JLDA 1E2IA 2FZ4A 3KXKA 1DAMA 4Q19A 2J9RA 3EZ7A 3GCGA 1XTIA 4CYMA 3B13B 2WIBA 4DIDA 4DDTA 2IK8A 1OYWA 2FU5C 2IS6A 3CKLA 2CVFA 4C0AC 3K0CC 1YZNA 1Q57A 1X3SA 1JI0A 1COWD 1Z6XA 2GA8A 4IFEA 4X8LA 3U6KA 2NO9A 3PUYA 4NONA 2GJAA 1EWRA 5LDDC 2ZI9A 5CJPA 2G3YA 2BBSA 1G3UA 2XXAA 2MSDB 1IN7A 4JLBA 1KJWA 4HAVA 4IXMA 4BZPA 3VX3A 521PA 3GEIA 2AXNA 1KDRA 3UWKA 3CNLA 3T15A 3GFOA 4W7SA 1P9RA 2J87A 4Q4AA 1FX0B 1Q0UA 4MRVA 3QG5A 2QRNA 2PH1A 2ZE7A 1ZVQA 1U99A 1U9IC 2WICA 3TAHA 3NH6A 4ZDKA 3ECCA 1E9DA 2WWIA 2OHFA 3Q5DA 2QRZA 2JJ1D 3W3ZB 4KYIB 2KWIA 1N5LA 2D4HA 4TMTA 1U8YA 4M1SA 4LYJA 3EWAA 4M1WA 2B7CA 2QP9X 2PEZA 4G5SA 4MUAA 5EXPA 3WRXC 4F91B 1GL9B 2R6FA 1N0VC 4ZO4A 3L0IB 5BW8A 8OHMA 3KFXA 4E09A 3SYNA 1XD9A 2IEYA 1G8GA 2PT7A 2UVQA 3IO5A 2BIFA 5FR1A 1SULA 2IUUA 1KSJA 2ZANA 3HU1A 3RSLA 1LW7A 1M7GA 2V4ZA 5GADl 1ZW6A 2Q21A 4Q18A 5L3VA 1P7CA 4ZKDA 1I2MA 4MRPA 2A7QA 4K46A 5EE0A 1M2OB 2OCYC 2KE5A 1W0JD 1QHHB 4A0FA 1FW6A 4YDHB 3KQKA 3A1VA 1DOAA 4YQFA 3QXSA 3MLEA 4XTRA 1FUKA 4B34A 3CX6A 2FGJA 4OK6A 3K1JA 3AKEA 2DWPA 1G3RA 4M9QA 3A36A 4B33A 4BGDA 2IUSA 4PPGA 1AK2A 1HT1E 4B73A 2CCKA 3NVAA 4JVMA 1L7VC 1WF3A 2FDCA 4HZUB 1Z08A 1Z8FA 1CKEA 4GOXA 4PZYA 1TEVA 1IN5A 3KDSE 5J4YA 4RZUA 4MGKR 5KPDA 4HLQB 3CF2A 5KSZA 3SBDA 5CK4A 1NY5A 2IYLD 1E2GA 1GRRA 1G9XA 2C78A 1MO6A 2JJ2D 1OT3A 4M53A 5FL7A 2GEVA 5CJ2A 4A0HA 2IC5A 5KOYA 3AVQA 3ZH9B 3M0EA 5KSPA 2MSEB 4QHSA 2ZRJA 2IYTA 4AWXA 1Z63A 1XP8A 3OESA 4ZI3A 3SEAA 3LLUA 5JFGA 1W5SA 3VQTA 6Q21A 1AKEA 2PMKA 2ZE5A 4EDHA 4I1VA 1FMJA 2XOKD 1KO7A 1XXHA 2JLRA 2HV8A 2RH5A 3B7GA 3FTQA 3P20A 3VKWA 1NVVQ 1Q1QA 3LX8A 5FOSA 3F5FA 3G82C 5A4JA 3RABA 5SZKB 5JWHA 2JAQA 2FMXA 3E5HA 4HLCA 1LVGA 2ZE8A 4CDGA 3GLGE 3LA6A 2GEUA 2CHGA 2RHMA 1OE0A 3L0PA 4D2IA 2CL7X 1JXMA 4HLUA 5AJWA 4HYYA 1RKBA 1YZLA 5A0FA 3CR7A 3T1TA 1R5NA 1GL6A 3F8TA 1CJMA 3EA0A 2IW3A 1RVDA 1T0HB 2FH5B 1CRPA 1G8FA 2PJRA 1US8A 3GEEA 5C4GB 1JQJC 5IK2A 3FE2A 4HZIA 4WW0A 2WWYA 3LY5A 3W5IA 1P73A 2QN6A 1IBRA 2J45A 3LXXA 1QF9A 1VMAA 1KJZA 3I5XA 2R65A 3FFBA 2ONJA 2IT1A 4MA4A 2GJ8A 1PUIA 4C7OA 4AYXA 4OQFA 1IM2A 5B57C 2CE2X 5FBQB 4LYHA 4B2IA 2KI5A 3MWJA 4AC9A 2ZSDA 5HPYB 1PLKA 3QKSB 1W47A 2GVDC 2YINC 3V9PA 1G7CA 4IJMA 4RJLA 4CT5A 1VG1A 4ESHA 4ZDWA 1R10A 3TR5A 3RS5A 1P3JA 1D9ZA 1E32A 2ZU6A 1EWQA 2AK3A 3TW8B 3SJCA 4KHZA 1RIFA 1ZBDA 4JSTA 5JI2E 3D31A 2WMNB 2WJVA 4B3FX 4TTRA 3THXA 1Q22A 3CH5A 5J4LA 1TTTA 4OJQA 1OIVA 1G5PA 1J8YF 1NI3A 3N2IA 2VRWA 1QHGA 2QAGA 4DLWA 1VYVA 1UM8A 2VHJA 4NMMA 4M0LA 1GOTA 1E98A 4ASUA 1N5KA 3BFKA 4KO8A 3HPQA 4OI1A 4DC9A 1S1MA 4ZV4A 1ZM7A 5CLLA 2J0SA 2YWHA 2NO0A 4OQNA 4DLZA 3SFVA 4HB4A 1XZQA 1EFCA 3KTAB 3KQHA 1MKYA 1R8SA 2RGNA 1E1RD 3WP0A 4P4SA 4DJTA 1F2UA 4WVFA 4BEBA 1S8FA 3GMTA 4DRZA 5HR5A 3AVPA 1G64A 1N6HA 3OZXA 5EE3A 3AKCA 1Z0AA 3JVVA 1U8ZA 1MR3F 2AR7A 1KSHA 2YNMA 2WJIA 1P62B 5DN6A 4YDSA 3PV0A 1MO4A 4RCZA 4ZCMA 1IAQA 1O3YA 3CWQA 4B6FA 4XJXA 3QXHA 4UNNA 3WHKA 4Q1EA 1UPTA 2X2FA 2GF9A 4O0MA 2JCSA 3DEFA 2F7SA 3IEUA 1G8PA 3CNOA 4PSKA 1G17A 5DHAA 4ZIRB 5SZJA 1KK1A 3IIKA 3B5JA 1R5OA 4UQOA 1NBMD 4JYCA 1ZM2A 1ZD9A 4GPTA 4Y0VA 3VNVA 4ESVA 4IOJA 3U44B 1IONA 221PA 2JDIA 3ASYA 2ANBA 1CR1A 4FMDF 3OFNA 4YONB 3A1UA 3AUXA 4B47A 5JLJA 3DVLA 3CNNA 1MABB 3H2YA 4EPXA 2C77A 2PCLA 2ERYA 3RC3A 3QUSA 2GAAA 2XITA 5E4FA 4LHWA 1M1YE 4MGZR 4O25A 3RDPA 4RFSB 1EX6A 2VA8A 4Q7JB 4QJ3A 2VPPA 3BC1A 2D74A 3CLVA 2N46A 1NJGA 1EFRA 3QKRB 1E96A 4G5GA 2H5EA 4DLYA 3PG5A 1Z0IA 2KBEA 3GLGB 4LY6A 2QENA 1GKUB 2Z4SA 1UF9A 4DLSA 4EFNA 4NBSA 3VKHA 1WRBA 2CCGA 1J70A 1N2CE 1VIYA 2O8BB 1VCOA 2NO7A 2GZHA 3AGPA 1E2NA 3Q9LA 4AI6A 4UNRA 3B9PA 3H86A 3IBGA 1TF5A 1C9KA 2ODEA 1DS6A 1FQKA 2ZJBA 5JZVA 3MMPA 3KKQA 4XH9B 2HCBA 2ZRHA 2NO6A 3WY9A 3AM1A 4BFWA 2HF9A 3N5CA 3SBEA 3LO5A 1OH6A 2AD5A 2F1JA 3BB1A 5EXSA 4HSEA 1DVRA 2DHRA 4RD1A 3BGWA 2VH5R 1FFHA 4P4TA 2QPOA 3RWMB 3A6PC 3LBIA 4ARZA 4EJSA 2JGNA 4NCNA 5KSYA 1NVUQ 5CDFA 3TSOA 1VHLA 4KODA 2QAJA 1E9EA 1TUEA 3MRSA 3WBJA 2O5VA 1E9SA 5D3MA 1ZJ6A 1ZP6A 1US8B 3GJ0A 4WXRA 4XSHA 1R5BA 1YHNA 4DB2A 5E3HA 4XVRA 1E9CA 4GZLA 1Y3AA 2VIIA 3DMNA 4RD0A 3U7EB 2ZXUA 2NMVA 5KPJA 3DOEA 3QF4B 3MGCA 1F3OA 2GRJA 2PZGA 5P21A 3DM9B 2A78A 5FTMA 1A4RA 1YRBA 4DKXA 1XCGB 1Z5ZA 5L3SA 2LWIA 3QVVA 5FL3A 2BKEA 5JBQA 2ZREA 3I3SR 1T5IA 4DCNA 1VPLA 4UKDA 3PUZA 3NTUA 1G7SA 4B32A 1VDZA 3JVUA 4YLGA 5TV2A 1T9HA 4JT2A 2REOA 3PXGA 2YWEA 3P4XA 4LJ7A 5CM8B 1V5WA 3TW4A 4D82A 3B2EA 4BFTA 4PC1A 2ZUBA 4XD7A 1GWNA 2XJ9A 2IA5A 3TBKA 1ZNYA 3U4QB 3K0AB 2GXUA 1TL7C 1E3MA 2FG5A 2JLQA 1RYFA 1WDTA 2B92A 2ZS7A 2ZI4A 2X2EA 1E1QA 2DCUA 2QAGB 1T0JB 2IF2A 1UADA 4QBIA 3R7WB 4ON9A 4Q48A 4CEHB 5DIFA 4MRRA 3BIFA 4WZBE 4TWZA 1WBDA 4DT1A 4FCWA 1GRNA 2F9LA 4FMCF 3HR8A 1OXTA 2J46A 1G4AE 5J4KA 4ZCIA 1IY0A 3SQXA 2FFHA 2ZJ8A 1Z6YA 4J0QA 4RVCA 2A3RA 4F38A 4DEXA 2KB0A 2IXFA 3ZVLA 1ANKA 1F2UB 3PJRA 2VHTA 3OEHA 5CLQA 4YXWA 2IYVA 1OHHA 2ZITA 3HU3A 1E2FA 3AVOA 1WCV1 3IILA 4LHYA 3DHWC 1UBEA 3FHTA 4HAXA 2GAOA 1L4YA 3GJ7A 3K9NA 1S4QA 1E2PA 3BH6A 4D4JA 2ZR0A 4EIWA 2ANCA 2V3CC 2NTYC 1GNRA 2CJWB 2BOVA 4EAQA 5FPYA 3P26A 4FN5A 4B76A 5DYIA 2AL7A 1A7JA 1U2RA 4ZDJA 5LD2C 1JR6A 1TADA 3IDQA 4PQRA 1E6CA 2XEXA 4B3GA 2BM1A 2DFNA 5G3ZA 3ZIAA 2MMGA 1W0KA 1XMSA 2BVNA 4QHTA 1HE8B 2FZLA 1DTSA 3K09A 4R9UC 4A0RA 1XTQA 3L0SA 3R9XA 2GNOA 3BH0A 3DZDA 3L8YA 4MYHA 1Z29A 4XD7D 5JEEA 2FX3A 1HURA 1PJRA 2ZYTX 5AJZA 5FTNA 1E0KA 2WJGA 3S1AB 1GNQA 4F92B 1LTQA 2XX3A 1AS2A 3AP1A 4V03A 1KHTA 5L3QB 2F43A 2PBRA 1E1QD 1XEXB 2DFLA 3VHXA 2NIPA 3K9HA 1XZPA 4Q7LA 3ZZ0A 4LSGA 3EZFA 5G3YA 2IF0A 2G1KA 1AGRA 4DSTA 4AKIA 3T5DA 1OH7A 1AS3A 2PL3A 4D26A 3LW7A 1KKMA 1KDPA 2LKCA 5CM9C 3EIHA 4UJ3A 1AJEA 2XSZA 2ZE6A 1FTSA 2VL7A 2IHBA 4LJ9A 3VNUA 4YMVA 3NEYA 1RW4A 3T5GA 2VP6A 4PZZA 4R7ZA 3UATA 1D2EA 3OEHD 5TXGA 1K6MA 1U90A 4YXWD 2FSIA 1R2QA 1N5IA 4M1MA 2DYKA 4DDWA 1I2DA 4AKEA 2VP4A 2XNSA 5FTLA 3C8UA 4Q47A 2VP5A 1UFQA 1OH5A 1SVSA 3TQCA 1I4DD 3GQBA 4G1UC 3C7KA 1X1SA 5EUMA 5E7MA 4P32A 1JAHA 3MJHA 1P9NA 1L2TA 3NC1C 4LHZA 3QQ5A 4A2PA 1XFAA 2XNDD 4XWOA 2J7KA 3DPUA 4YMSA 2CHQA 1MRNA 1QHHA 3KL4A 2IBMA 3ZVRA 2R2AA 4MYCA 5DLQC 4PC7A 4I99A 3HJNA 2Z6VA 5AJVB 5EXXA 4EJSB 5KNBA 1L4UA 2V9PA 1S3GA 3OEED 2C99A 4PX9A 2ZJ2A 3T06B 4DUGD 4NH0A 2C5LA 1T8TA 4HZUA 2G6BA 5L8VA 1E2HA 1KAOA 1Z0KA 3MWYW 2ZRLA 1VIAA 2BJWA 3E1SA 4Z1MA 1YZQA 4MYUA 1KK2A 3CF6R 1JQLB 1KI8A 3BD9A 4KFSA 4Q9LA 1DO2A 4B71A 2HUPA 1VG9B 5EE5B 4HI0E 4NYMR 5AK0A 1SKYB 1G7RA 4U7DA 2ORVA 1DG3A 2QROA 3CPHA 4LRWA 1ZNWA 2ONKA 3I62A 1UJ2A 3CX7A 4LDJA 4GBMA 1IJEA 3TAUA 5FOVA 3MFYA 3PEWA 4DSUA 1G3MA 1W4AA 1D2NA 4WBSA 1NL3A 1COWA 4HB3A 2G9NA 2ZQ5A 1KO8A 1ETUA 4KFRA 1HH4A 2F3RA 1MOZA 5FTJA 4EPTA 5FH9A 5JJKA 2FPKA 4AYWA 2X19A 1EFHA 4TLBA 4HAWA 2FE4A 4E03A 4QBGB 4EKDA 2R6GA 1DBSA 3F3YA 4PHHA 3CO5A 3AVWA 1LB1B 4JLJA 3A4NA 2ZRIA 2YKGA 1KDOA 2YYZA 2P65A 2BBWA 2YOGA 2Q3MA 5ANRB 3FMFA 1MV5A 2OBMA 4NKRA 1TMKA 1DAFA 5KNDA 3H0KA 2CNWD 1TQ6A 4G5QA 2QM8A 3B1WA 2V1UA 4LC1A 5JCPA 1E2JA 4KBGA 4LJ6A 2D2EA 3IQXA 2BEJA 2BMFA 3ZQ6A 3WMFA 4TYQA 2D62A 1CXZA 4LI0A 4YMTA 1XNJA 2REXB 1JR3E 2G1JA 1Z2CA 3DO6A 4PR0A 2ODWA 1KJYA 3I4LA 4C4PA 1U0HC 2GBLA 3C14C 3NBFA 3T61A 4JVSB 2AFHE 4QGHA 1CJVC 2VSXA 2X77A 3GLHE 1TQ4A 1D6JA 3VKGA 2CEAA 1TF7A 2OO7A 4NCJA 2ORIA 2EFCB 3NDPA 2IL1A 2CLCX 4P3YA 3BJIC 2AK2A 3VU9B 5J4HA 4GI7A 4R98A 1P4SA 4LYFA 4A6XA 1SVOA 5DI3B 3B9QA 1QHYA 2L0XA 3A4LA 4RD4A 5FBLB 1Z83A 3U6BA 2GJSA 2Q9BA 1CULC 1SXJD 1QVAA 3LH5A 2GZDA 2XZOA 1P2SA 4OHXA 1I4LD 1W0JA 2XJ4A 3MSXA 1Y63A 4OKSA 3LDAA 4C0JA 5EUQB 1EXMA 3IUYA 2OCBA 1YR8A 2ASEA 1BH2A 2C95A 2Q3HA 4OQXA 4W5WA 2IWRA 1CS4C 2B7BA 4MKGA 3EPKA 2HT1A 4JLVA 2ZJOA 1JEDA 1W44A 4DIEA 1OKKD 5AUPB 2ZM5A 2EVWX 1HT2E 1WE2A 3QSYA 2IYZA 4GDFA 3PEYA 1ZMXA 2KSQA 2WZQA 3M1IA 3QEOA 3AVTA 3CRMA 3LXRA 4MKIA 4Q02A 5JS8A 3KTAA 3DZ8A 4EPRA 1E9RA 3SE0A 5CIWA 2F43B 3DDCA 4FWIB 4URXR 1Q1EA 2QMUA 2Q9CA 3RWOA 4QXAA 4TN1A 3UG7A 4RD6A 4FCTA 3ZS9A 4BLQA 2ZS8A 4II7A 4B44A 2VLIA 3U5ZB 3CWZA 2ZUCA 3GPLA 4N1AA 3OIUA 4CVNA 3ZQJA 2JJ2A 1YZTA 1NSTA 1K5GA 1QRAA 4JBYA 1N6LA 1ZD1A 1KSGA 4FW9A 5CIQA 2O0HA 2WM9B 4M1YA 2ZETA 821PA 1E9AA 1AGPA 3TUIC 1KGDA 2H92A 3EARA 1NIJA 2V54A 2XOKA 4HUQB 2V7QD 2ZVPX 4Z54A 1DAHA 4DBLC 1U0JA 2OAQ1 4KVGA 4D4MA 1DAKA 5CK5A 1P61B 2Z4RA 3X1XA 4ZIRA 2GEDA 4A1FA 3U3JA 2QI9C 1KK3A 2FPMA 4PHFA 3VHLB 1P72A 3U3MA 2AN9A 3EIQA 2WOJA 5HKKD 2ZUDA 5CB8A 4QM7A 3U44A 5AUNB 3SJZA 3DOFA 4U5XA 1XTJA 1Z47A 4QHYA 3OAAD 1GUAA 3K8YA 4L9SA 2YZ2A 3FMIA 3W34A 1MABA 2RGAA 4D80A 4FWTA 2JATA 5J40A 4LJ5A 3RYTC 4DCVA 2JLZA 4O3MA 4RFSA 3AKDA 4A92A 2DFKB 4B35A 1YE8A 2BCJQ 3QKRA 4KSCA 3NHAA 4M1TA 3GLIB 2IYWA 3GLGA 2AWNA 3VAAA 3THYB 1YVDA 1G6OA 4HLUC 2QQEA 1R0WA 1IJFA 3WYGA 1OJLA 4GMDA 1R8QA 4LOAA 4RFVA 1NLZA 3N70A 4Q21A 2ZI7A 3T1QA 2DY1A 2O8BA 1AA9A 3TGPA 1XBTA 4IDNA 4L15A 4NCHA 4BZXA 1Q44A 1ZIPA 2C03A 1IY2A 3ICEA 2GESA 3MG9A 1RJ9B 4JS0A 4C30A 3ND9A 1SXJB 1X8LA 1HQYE 3T34A 2C8VA 4WZ6A 3T35A 5JEDA 2PX0A 4OQMA 3CW2A 5JMTA 4IW3B 4D25A 2O8CB 3OF5A 4L8GA 1N5JA 1KK0A 4AURA 2OESA 4A2WA 1W2GA 4JKIA 1HE1C 3EG5A 4CEIA 1H8ED 4I1UA 4UXJA 2OBNA 2VHCA 3I61A 4BRWA 3LWNA 4IXNA 5EP2A 1XJCA 3HDTA 1NIPA 4DLRA 4PZLA 2VQSA 3QPWA 1GSIA 4LBZA 2AWOA 1QG4A 3ZD6A 2R62A 1ZNZA 4WA7A 3X1DA 5JI3E 2GDJA 4RY2A 1E1RA 1NF3A 1QHSA 5K8UA 2J3EA 4XSGA 2YC4C 3B1VA 1IHUA 2WWGA 4IKEA 4GL2A 1KYIA 3UMFA 4D81A 2RCNA 1B23P 4MGIR 1UEJA 3ZVNA 2B21A 2C9YA 3KQUA 2O0KA 1QHIA 1YJ5A 2P5TB 1G291 1ODFA 2GJKA 2EWWA 1YQTA 3IPYA 3RRZA 3NHBA 1EX7A 3CIOA 3QF4A 3PUVA 1FNNA 3R20A 4P31A 1ONBA 3GFPA 3GEHA 2W6ID 2AKAB 1N6NA 3SJAA 4BLPA 1L8QA 3EAQA 4V0KA 1W36C 2R44A 2BHRA 1PZNA 1A5TA 5DO9A 3Q7PA 1LS1A 2XZPA 3K9LA 1XD8A 1NBMA 1R6BX 1T91A 2CBZA 4M1OA 1NMXA 2F9MA 3RS0A 2IYYA 3EWSA 2WPDD 2BM0A 4LUCA 1XXHE 4B3CA 3U4QA 1TQ2A 3K0AA 2ODNA 4ILEA 3FMPB 4IDHA 2E9SA 1TU3A 3T1VA 3K70C 4NYJR 4LZZA 3R7WA 3BERA 5UKDA 4Q1DA 4CEHA 2F1HA 2YOFA 2F1RA 4Q66C 2BDTA 4JBXA 1KI4A 2REBA 3AF3A 3I92A 3PEUA 3PUXA 4PFSA 2VTKA 5FBVB 4TL7A 3LBHA 3SDZA 3LW8A 3CR8A 4PO1A 5EJEA 3FHOA 3I73A 3AVUA 4Q01A 1DEKA 3OE7D 1HY3A 2D06A 2O0JA 4C0QC 1N6OA 4JL5A 3DKPA 4Q7MB 3K0SA 3W90A 1BKDR 2EW1A 1UKYA 2RGCA 2WWHA 5K8IA 2NGRA 1XD2B 5HE9A 2F6RA 4Q4LA 4GZMA 4LBVA 4LPSA 3E70C 1TQDA 2A9KA 4OK5A 4Q4HB 3CBQA 3KJIA 3P27A 4Z8YA 1JALA 4PC2A 1AZSC 4MKFA 2QPTA 2CJWA 2HYDA 4XVUA 1ZM9A 1JPNA 4V0NA 3ZDQA 3H4MA 4EFMA 2IXEA 3RS4A 3QEJA 4CZ2A 4AG5A 4FCVA 4IEEA 4LJYA 3AF2A 4DLTA 3U3OA 2O8FB 5B2ZA 4IDQA 1D2MA 2YJTD 3KJEA 1QDEA 3PIRA 4JJZA 2W6JD 4DCSA 2IYUA 3NBXX 1UKZA 4TMXA 4XOIA 3WNCA 2Z43A 1GVNB 3SN6A 5CYPA 3Q85A 2HJGA 3S1AA 4BPBA 1J90A 1JJ7A 4KITB 2H7VA 2YHSA 4RCYA 4LK2A 5L3QA 3SYLA 1N6IA 421PA 4FD2A 1XEXA 2G83A 4AD8A 1UEIA 5AWFC 1P2TA 3WMGA 2QGZA 1ESMA 1XJQA 5EP3A 1J7KA 2ECKA 5H1YA 1NN1A 5B58C 2VHQA 2R9VA 2PX3A 1D8TA 2HEIA 3SHFA 5GJBA 5TARA 1XRJA 3PFIA 5IDVA 1R0XA 3AP3A 3SHWA 3FKQA 2AHOA 4Q4JB 5JS7A 3CRQA 1C1YA 4KV9A 1CJUC 1CRQA 4RSGA 1E94E 1A1VA 1PLLA 1GIAA 3PCRB 2O8EB 4HB0A 3TSZA 3X1WA 2WJJA 1QHNA 1JB1A 1YR7A 2KJQA 1XTRA 1X86B 3F0TA 4Q9JA 1RRPA 4G5OA 2G0NA 3TSWA 1KY3A 3KKOA 4PAMA 5FOTA 2GJ9A 3LRPA 1F60A 4BFZA 1EFUA 4TSFD 2E1RA 3CZQA 1KI3A 1FMLA 4BFVA 5LPNA 5FTKA 1CIPA 4BRUA 3IGFA 3MCAA 1W36D 1OXVA 2KBFA 2WWXA 2K5UA 5G53C 4NDZA 2AFIE 4CEIB 1ZM3A 4PANA 2ZRNA 3CRRA 1NMYA 5FUYA 3KXIA 3DMDA 1FP7A 3FGNA 2FGKA 3QXJA 2AKYA 3WBKA 1P2VA 3THWB 5KHOC 1P5ZB 3BFVA 1I4TD 4AIIA 1MH1A 3TUZC 2XGJA 3RRMA 1II0A 2CMKA 4M9XA 3O8RA 1Z6TA 3K70D 2QT0A 2QTFA 2R6CA 4S35A 3TQFA 2GCPA 2D7CA 1N25A 3GJ4A 2DPXA 4TT3D 3X2SA 1NG1A 2A5GA 4KSBA 2FV8A 3PITA 4LV8B 2O8DB 3VTKA 4A15A 1S9DA 1T6NA 2WHXA 3IQWA 1TX4B 5TDHA 4E07A 2IS1A 3C16C 3CZPA 2XB4A 3A1TA 4V0MA 2WBLC 5AR1A 4K8OA 4XTCS 4Q1BA 3ZZUA 2GXAA 3IHWA 3AP2A 4Z8XA 3NBZC 721PA 1NSFA 1CF4A 4B43A 1G8YA 3LFUA 3FB4A 4TMWA 1XMJA 4QGGA 1Q3TA 4PSAA 4G01B 2F3TA 4RKEA 1NVVR 1NN3A 4GP6A 2Y8EA 1UKVY 3AQ4A 2D7DA 3HU2A 1B0UA 2Q3FA 2GWHA 1KI9A 4JLMA 4LV5B 1VTKA 4BFXA 5B30A 3MAAC 4TQAA 4BLOA 5FPKA 3EX7C 3U7GA 1RPZA 3Q72A 5FBWB 4BUJA 1IXSB 3GJXC 5DI9A 3TMKA 1R0YA 5TVKA 2AXPA 4TYYA 2D3WA 2QMHA 2OFWA 4UXHA 3CH4B 1N6PA 3MWLA 4KJZA 1YZUA 2MSCB 2ZI6A 4UXIA 3GJ8A 2ZEJA 2C9OA 2I3BA 4G0NA 5CDFE 5HCNA 1GRQA 2A5JA 3K09C 4FINA 4KLZA 5BN5A 4CT4B 1WMSA 3N2EA 4KI0A 4EQ6B 2WSSD 1Z07A 5G40A 1NKSA 2PZFA 3GJ3A 4ZDIA 5F9HA 1KZGB 2UZ3A 2VP0A 2AX4A 2P5SA 2JIZD 2FFBA 2VSOA 3LNCA 5AJYA 4A9AA 4ACAA 4DXAA 4LJAA 2JLVA 2JLWA 4GNKA 4Y0AA 4S2EA 4GOKA 4DB4A 1V43A 3VU9A 1W4CA 1XDBA 4BEJA 3RC8A 4YC7A 4BFSA 1YR6A 2V55B 2J7PD 5DI3A 5EZ6B 3VR2A 3GLFE 1MRSA 2OZEA 2V6IA 4N0EA 1AKYA 2CLSA 3EASA 3SJBA 3B6EA 2P2LA 2XNDA 4GT1A 2EFDB 4AYTA 4OL0A 1W36B 3NXSA 4JZKA 3UXMA 1PV4A 1DG1G 4DDUA 3AVXA 1U94A 3C4JA 1VCIA 1KDTA 4F7WA 3HPRA 1E4YA 3PEVA 5BYJA 2BEKA 4QC2A 3IEVA 1YZKA 4Q1FA 3KQNA 1M34E 5C46F 5F3WB 2CK3A 3OEEA 1YRAA 1ZM4A 5J47A 1F2TB 4DUGA 1XCMA 2WOOA 4QBHA 3VR5A 2FOLA 2OFOA 4B3XA 5F9FA 1Z0JA 3R8CA 3K70B 1G7TA 1VYTA 1Q3HA 4KLNA 3CUEF 1UBGA 4IOMA 4P4UA 4B2PA 3QPUA 4TLDA 2FJUA 4TYNA 1SQ5A 4IVQA 3KJHA 3QBTA 1VG8A 3CRVA 4NTZA 3R8FA 2ATVA 3MWKA 3BXZA 2FEMA 1GP2A 1S1CA 2IHYA 4XIGS 1NNEA 3GJ6A 1KMQA 3IIJA 3LBNA 3D3QA 3FPAA 4DSNA 4HUQA 4A8JC 2MMCA 5FPTA 1ZNXA 4HB2A 1ZU5A 2ZRBA 1ZYUA 3C5HA 1KI6B 4KFTA 4C2TA 4C2UA 1UDXA 3FKSD 3SR0A 5KO2A 1W49A 2A30A 3BS4A 4NE2A 4Z51A 3HR7A 1Q12A 2C04A 1G16A 4JLPA 1OFHA 2ZR9A 2BWJA 4L5BA 4Q1AA 2NQ2C 4IHQA 3SI7A 1NRJB 2EFGA 3E2IA 4X8HA 4LX0A 2V1XA 2OCAA 2CNWA 1KO1A 5AUOB 1E2QA 4A6PA 1AN0A 1HQCA 5B64A 2IEZA 2CXXA 5KDLA 1UKEA 4HLDA 3QKUA 1HA3A 1BIFA 4GSYA 5JRZA 3FOZA 4PQFA 2CK3D 2UKDA 2PMDA 3I1FA 1G20E 3BAFA 3V00A 4IOKA 5FFMA 2YV5A 3NC0C 3QY0A 5BN4A 4CGZA 1HEIA 1E0AA 3GLIA 3B1YA 2RGEA 2ZS9A 2EWVA 2BBOA 4JVLA 3AF4A 5D3QA 3EPLA 3L0OA 3THYA 4IDPA 3IPXA 4URUR 3EC2A 5LBIA 1IOZA 4CRWB 4HUTA 2BMEA 4XVQA 3I32A 3TK1A 3KKNA 3PUWA 3REGA 1OV4A 5A5GA 1KY2A 3KKPA 2QE7D 3LQRA 4P33A 2EQBA 4DT1B 2QZ4A 1E69A 1S0UA 1Z22A 1D5CA 1T5LA 3VR3A 1OLOA 1EFTA 1G3IA 5KUTA 1RJ9A 4ABYA 1SXJA 4URVR 1F5NA 1YKSA 3ADDA 3UIEA 1AQUA 1MO3A 4BLTA 1G5RA 2O8CA 3KUDA 2GBLC 4KCGA 3HYTA 3WMEA 2QY9A 5KSOA 3CM0A 3RANA 1XX6A 5KTYA 1E0SA 2C98A 1Z0DA 2WJYA 2C2HA 1M6NA 3CPEA 1OFUX 1OKKA 4KAXA 2R8RA 3A1SA 3KXLA 4JBWA 2FFAA 5CB6A 4JIMA 2E87A 2IYQA 3FMOB 1CLUA 2NOAA 4AG6A 1DO0A 2PEYA 4TMKA 4TLCA 3GLFB 4DCUA 2ZJYA 3KX2A 4M21A 4IVPA 4M1KA 3AGQA 1IN6A 3EA5A 5DISB 1HUQA 1H8HA 1CBUA 5JWRA 4GRAA 4RD3A 1Z3IX 1GL7A 5FI0B 2ZU0C 4QG7A 1Z0FA 3BORA 1KMHA 1CEEA 3G0HA 1E99A 4BZQA 3UANA 3MD0A 1NMZA 1FL9A 3CRW1 1KSFX 3LVQE 4JL6A 2QORA 5TB5A 3WYFA 4K81B 4V0LA 5C1BA 1XWIA 2FSGA 2V7QA 3EC1A 2QPAA 2OLKA 4JSYA 4KYUA 5DYGA 1O87A 2H57A 3AF0A 2QA5A 2QSZA 5HE8A 2BV3A 1CJKC 1W4RA 1IN8A 4C0SA 4RZ3A 5H8WA 1LF0A 4H9GA 2A5FA 4A4DA 3PVSA 3W8RA 3WP1B 4AK9A 2ZRCA 4WIAA 5HKKA 3WYAA 1A2KC 1JR3D 2CL6X 4Q5IA 1BYUA 3OAAA 3GD7A 1AQYA 2YVUA 4D0GA 4L9WA 3O8CA 1AM4D 4QRHA 4H1UA 4X8OA 1ZUNB 1T3LA 1T8UA 4PAQA 2WAYA 4A82A 5C18A 3GP8A 4TMVA 2ZJAA 4PTLA 2ZRDA 2SHKA 2P6RA 1YZGA 3ADBA 4JL8A 1G19A 1HYQA 1II8B 3RS2A 3ONWA 1JECA 2C9CA 3BFXA 3D8BA 4Q9KA 1RRFA 1SVIA 1TU4A 4KVAA 1H8HD 2VSFA 5LB2A 2GK6A 3QI2A 5HCIA 5DGXA 4TLEA 4WAUA 2GCOB 3P4YA 4F4CA 3I5YA 2FNAA 1E0JA 4MGYR 2H8KA 3R9WA 4M2LA 2DFTA 2A5DA 1S96A 1XD2A 2QQ0A 3DKVA 1BMFD 3AB3A 3U3RA 2A5YB 2ZVQX 3O47A 3OIVA 4Q4HA 2B8TA 4OHYA 2GTPA 3EXAA 1ZU4A 4OI2A 3SU8A 4LHXA 5JJLA 1OFIA 3L2OB 4E22A 5IT5A 1G21E 1XCPA 1XMIA 5FOWA 5FUXA 1OXUA 5K8LA 621PA 2RHDA 3OHMA 1RZ3A 4DVGA 2O8FA 1H8EA 4FI3C 1ZUHA 1YU9A 4BLSA 1DARA 1XPRA 2G0TA 1ZUIA 2OT3B 4KFUA 2VYFA 1JXOA 2A2ZA 2GVZC 2ZI5A 1GILA 3RS7A 1TF2A 2NZ8A 1CTQA 2QTVB 5GJWC 4OI0A 4Q03A 4DDVA 5LD2B 4PC3A 4I81A 1GG2A 3BWDD 1RE0A 2J0UB 3CX8A 3IHLA 3K0CA 3EZ2A 4KXFB 2P67A 3GJ5A 3A37A 3BH7A 1LFDB 4EPWA 5DHFA 3IO3A 4ZCLA 1M8PA 4DEYA 2H16A 3UMSA 4OI4A 1EESA 4C0LA 1X8JA 3QG1A 1G5TA 3LLMA 4PC6A 2OILA 4OBEA 2QL6A 2ERXA 1Q1ZA 1S9HA 1UDWA 4EPYA 4NCIA 3W5JA 1NN0A 2WMOB 1YR9A 2XAUA 1CJTC 4I4LA 1II9A 4Q7KA 4NZYA 4MDEA 1Q1BA 2W6IA 2HXSA 2QUZA 4Q4JA 3VX4A 1GKIA 1SHKA 2OLJA 2V8OA 3L82B 4C3ZA 3RNLA 3ADCA 2XZLA 4TTQA 3U7HB 1U9IA 3TH5A 1C4OA 2O8EA 1P75A 3K53A 3X1ZA 2IX3A 3QKTA 4O2RA 1XPOA 4ZI2A 2ZYWX 4JVNA 3QXCA 1X1RA 2RGDA 1VECA 2IS2A 3QIAA 2OSBA 2WPDA 2JLXA 1KI7A 2ZSAA 1E79A 3KKMA 2XTZA 4JJKA 1DADA 4A8JB 1E2KA 2OCPA 1QG2A 2C96A 5GVSA 4PHTA 4HATA 2HXYA 3W8NA 1SVWA 5JHHB 2OXRA 1IXZA 3GLHB 2W00A 4KU4A 4M9SA 2Q0HA 2CLDX 4NCKA 1GNPA 2W0SA 3SC3A 2WKPA 1JBKA 1XEWY 4HAUA 3FDIA 1UBFA 4A0GA 1J2JA 5FOUA 5C2JB 2W2VA 3THWA 3RLFA 1JJVA 2QBYB 2WVJA 1LY1A 2HCJB 3NIBA 3FYHA 2QT1A 4TYPA 2ZSFA 4DCTA 4US2R 4TYWA 1RRGA 3OE7A 2ZAMA 2DWQA 3CF0A 3RHFA 3K0FB 4D0NA 2HJVA 4RD2A 4TL6A 3EIEA 4HEJA 5FR2A 2QAGC 1KMHB 2O8DA 4TLAA 3QJYA 4NYIQ 4JYBA 1AZTA 1JAIA 5GJCA 3LAWA 4QGAA 2OE2A 4R2HA 3HYRA 1ZCBA 2J0QA 3GFTA 2CHVA 2CE7A 4OJKA 1W46A 4V0OA 4H1VA 1G41A 1ELOA 2RGNC 2P6UA 4TL9A 2Q6TA 4LWZA 2DBYA 2OBLA 4C0HA 1FZQA 5HZKA 1W5TA 1WB9A 4CEJB 3QF7A 1QZXA 1P2UA 3THOA 3Q3JB 1E2EA 1U0LA 2W6JA 2I1VB 2ZAOA 1LF5A 3L8ZA 3H1TA 2GILA 3AUYA 4W5JA 1Z06A 1E79D 1GTVA 1NP6A 1OFTA 4BE7B 1ZCAA 2W83A 3A1WA 2AD1A 3B8HA 1BOFA 2ZYVX 1U8AA 1BYIA 1OPXA 5DNYB 2EYQA 4CF7A 4ACBA 2W2XA 2OFXA 2NG1A 2IYXA 3VR1A 5JSZB 4L16A 4UNQA 5FPHA 3HWSA 3QBVA 3OIWA 3ZLJA 5FL7D 4G3XA 2YWGA 1EG7A 2JLUA 4JLKA 3ADKA 5JHGB 3ND8A 4B48A 4JLNA 4MITA 5DE3A 3UK6A 4JLOA 2H17A 2NZJA 1DPFA 3EZ9A 4UNPA 4D4LA 5F98A 1G3QA 1S3SA 1J8MF 3DL0A 4EQ6A 1CP2A 2OAP1 2DR3A 3ZJYA 4URZR 2QM7A 1IY1A 4PHGA 3ZZTA 4MQBA 4XWKA 2GZAA 2H1LA 4W9MC 2HDNB 4IDOA 5L3RA 2ZJ5A 1A82A 1N6RA 2GHIA 1XTSA 1P60A 5TY0A 4IFBA 3NH9A 3SNHA 5TMPA 4GFDA 1TUIA 3NWJA 3MJRA 2BMDA 4Q9IA 4OQLA 3TE6A 2XXAB 3W3AA 5H68A 3RSOA 2ZRPA 4URYR 4QL3A 5FUWA 1N6KA 4TQ9A 3UPUA 4MUBA 2EU8A 4U00A 4TSFA 1VHTA 2V6JA 1KO4A 5KDOA 4A2QA 1F48A 2QGNA 1N3BA 1E2LA 4Q4AB 3ZVMA 3P32A 4M4SA 1NBME 2EYUA 2YOHA 1HTWA 2FPLA 2JLSA 2WIAA 4ERNA 1QBKC 5IK2D 4B3DA 1OIXA 3PQCA 4CIDA 1TNDA 1GM5A 2P0EA 3ZYCA 2EFHB 1W1WA 4IOLA 1GITA 3EPJA 1RC8A 4U02A 1PUJA 4QGFA 3T1OA 3VMFA 2CL0X 2N1BA 4MKHA 3L43A 1F2TA 5HZHA 1KNXA 1E2MA 1SZPA 2GCNA 1DAIA 2WKQA 4MH0R 3VR6A 5BN3A 1WBBA 3LX5A 4TT3A 2J41A 2HT6A 1IXRC 4HAZA 4FMBB 2H18A 1XF9A 1KI2A 4NU0A 1Q21A 3W9YA 1E4VA 1NVWQ 5M04A 4E5UA 3A4MA 5JWOA 2OUKA 4F4IA 3TLXA 2G77B 2GETA 4PO8A 1N0WA 2OM2A 4M8NE 4EJSC 5EP1A 3NG1A 1FTNA 4TQUS 4EPVA 4EFLA 1NLYA 3V4FA 2F55A 3B60A 1KTVA 1T3HA 3KB2A 5CYOA 2QEQA 4B2LA 1T3SA 2B6HA 4QKQA 2IWHA 4QJ4A 4QNRA 3CONA 4BLRA 4X8MA 4FIDA 5KNCA 1ZAKA 2ZRMA 1ZC3A 3O8BA 3WHLA 1KI6A 4ASUD 1WP9A 2WTUA 3AVYA 3CB4A 1XPUA 1UBCA 2JJ8A 2W0MA 1M7HA 3BOSA 2IYSA 2VBCA 3PENA 5FOXA 4F4JA 4WZAE 2I1QA 1K5DA 3NEJA 4GMXA 5EQTA 5FBRB 5EE1A 3IIMA 3RAPR 2QMEA 4QM6A 3KB1A 1NY6A 2FWRA 4PPNA 4C0KA 2RB4A 5LB4A 1TPZA 3KFVA 3M4YA 1XB2A 3QENA 3TIFA 4EUNA 2VEDA 1KIMA 4QNMA 4IEIA 2J1LA 4NYMQ 3SS8A 5DN6D 3A58B 2X1VA 4PPFA 2O52A 2ZR7A 1H65A 3AV0B 2DB3A 5E7IA 2WSSA 1DAEA 1AIPA 1FQJA 4BWYA 121PA 1XXHB 2RAPA 3BK7A 3RRYA 3TVTA 2QMOA 4C0BA 1OB2A 2BKUA 4Q00A 3JZAA 3NDBB 4RKFA 1KOFA 2JIZA 1G18A 4F93B 2ZRFA 3UMRA 5CITA 2B8WA 2OXCA 5AJXA 4OHWA 5KU1A 1G8HA 4NL4H 5KYKA 1S2MA 3JZMA 1GDDA 2NO1A 4HAYA 3TRFA 2FFQA 1OYYA 1R4AA 2P6NA 3U3KA 2R6AA 2J7PA 1JEEA 2JDID 4NHOA 4PQYA 3BE4A 3O8DA 4BQSA 3OFND 3EW9A 3SQWA 1AS0A 3K0EA 4DZZA 1OSNA 3FFAA 3WRYC 4NP6A 4LHVA 4LPKA 1EGAA 5F2EA 3QNUA 2RGXA 1SHZA 1X8KA 5K8TA 1XU4A 1XJ0A 2DWOA 1Z6AA 4BASA 3EZ6A 4ITRC 4URWR 1EFRD 3KUCA 2FA9A 4POAA 2OEPA 4AY2A 3VR4A 2CVHA 4R2IA 2ATXA 1HV8A 5IRCD 4DHEA 1VKJA 3Q5EA 1DELA 3GLFA 5KDDA 2ZRKA 4C7OB 2QSYA 2FN4A 2BC9A 2NPIA 4GOJA 4R71A 5GVRA 1FNMA 4WOPA 4TZ0A 2PT5A 5DSZA 2ORWA 1KNQA 5J4VA 2FSFA 4BECA 2ZROA 2EFEB 3AEZA 1XMVA 2YWFA 1P9WA 2W2TA 4QOSA 5AUQA 5JRJA 1FPMA 4A36A 1CR0A 2ZSBA 2X8AA 4NYIR 4DLUA 4LGMA 2GF0A 3W6PA 1CU1A 4LJ4A 1J99A 5GJVC 2Q9AA 2PZEA 1JNYA 1MT0A 5G41A 1E2DA 1M74A 2QNRA 1WQ1R 4PO9A 3THXB 5SZIA 3QE0A 3SFZA 1QVRA 3FVQA 3U61B 5ELXA 5BYKA 1GKYA 3P1JA 1EK0A 2XTNA 3QOFA 3D7MA 4MRSA 2ZIAA 2ZPTX 5JCZA 2I4IA 2ZRGA 1FUUA 2FF7A 4ZPXA 4V0ME 3UKDA 1SKYE 4PXAA 2JEOA 5C4MA 3FKSA 4W5HA 3B78A 1OF1A 1K8RA 2BBTA 3FHCB 4US1R 3TR0A 2D2FA 4G5RA 4LCBA 1OH8A 2IS4A 3ZGXA 4I1SA 3RS3A 4MYTA 2HLDA 4RZXA 2VP9A 4P4SB 4US0R 1Z6GA 4LV6A 1GZSA 1M7BA 1TEXA 1DAGA 2W58A 1UAAA 5EE9A 4HDCA 1NVXQ 1SGWA 4M9ZA 1Z28A 4YMWA 4BFUA 1BO6A 1LS6A 1E9FA 1R7RA 5BQ5A 2GKSA 2J5XA 1ZC4A 1GAJA 5JECA 3LV8A 3TJZA 1II8A 3TVDA 4UNSA 1FP6A 1KZ7B 4JMPA 1KAGA 3CPJB 2VO1A 3D6TB 4C9BA 2OV2A 1Z2AA 2ZI3A 1DE0A 3QPVA 3RVBA 3SZRA 1WA5A 1LNZA 2BMJA 1NLFA 1SVMA 1IQPA 2R6DA 1OB5A 1WXQA 1KKLA 2F1IA 3B1ZA 2GCOA 2PJZA 3TKLA 2WAXA 1IN4A 1FOEB 1N0UA 1ZD8A 2QE7A 1NJFA 3BB3A 3KJGA 3T12A 1PVOA 5EXTA 1U98A 2J0VA 3AF1A 4QFMA 4LBYA 3K9GA 4QJ5A 2VF7A 3U7FB 2QP4A 4FXPA 1XEWX 4FMDB 2RGGA 4Q9HA 2Z83A 1TAGA 2TMKA 4OHZA 4JLAA 4YMUA 2GXSA 4GP7A 1LV7A 1OW3B 2QG6A 3SYKA 1FX0A 1VYUA 3PR1A 2G88A 3TUJC 4O2LA 2UZIR 2HF8A 3DM5A 2PCJA 3W6OA 1G6HA 3MUFA 2ODBA 4JKYA 3I8XA 1W7AA 2PLFA
chains in the Genus database with same CATH superfamily
2OG2A 2QTVA 2HLDD 2VP2A 1GUDA 1WCYA 3BWCA 1SXJC 3O4FA 4TL8A 4NABA 4BNTA 2J0UA 4KACA 4EGAA 3KJNA 4HNAA 4RF2A 4BMXA 1F6DA 1OHHD 1QF7A 4FUQA 2ZQZA 5TQ0B 5BXYA 1EUCB 2JHCA 4NZMA 2H1VA 3M81A 4KBYA 4RZ2A 3C3EA 4X63A 2XDAA 5KWEA 2OCKA 2J5KA 1SOUA 4NHEA 4EJFA 1ZIOA 2HYIC 5IHPA 4EZEA 4UM9D 2H4ZA 1QUEA 3P2EA 2XUQA 2D5IA 2I6XA 3ESDA 2E3JA 3JRWA 3PYLA 5CX4A 3GROA 2WNHA 4WXEA 4ZTZB 1JIKA 1O96B 4N3NA 1MIOB 1SOAA 3AB8A 3DC7A 3O0TA 4WKOA 4WK2B 2J6CA 4V1CA 4ZT7A 1OXSC 4B3MB 1P6XA 2VJMB 4RA6A 1K8ZB 3V6MA 1H6CA 2D8MA 4LYAA 3ZIAD 4BX3A 3AKYA 5LJIA 1R9JA 4IGAA 1UDBA 1V1MB 2WV9A 1AT1A 3HFJA 3EGCA 1ZRHA 4JJEA 4A10A 2NPFA 1PUXA 3R9IA 1IATA 1VIDA 3LQQA 4D6PA 1RE1A 3IDSA 2CHFA 4LJ8A 4KK4A 1TZKA 4HGZA 2PSJA 1QIDA 2Y66A 2Z0MA 4HDOB 2I2AA 2AZ4A 2IXGA 3IQFA 4BXOA 1WOYA 4P0TA 2VNKA 3VM6A 1B8PA 4P2BA 3ZS8A 2DMRA 3HM2A 4YRZA 3W78A 2ONZA 1N3IA 3G88A 4OHVA 1QE3A 4QUEA 1JHUA 4GSKA 3OPYI 4W9NA 3VO1A 2WSMA 1JPJA 3Q8MA 1JAZA 2BCGY 1XTKA 2LCFA 3F1LA 1UXIA 1TYZA 3SQNA 4EKIA 4EYQA 3V80A 4L5CA 2YJGA 3KZ1E 5A9SA 4TTPA 2XRFA 1ISMA 3RSSA 4YUZA 5THKA 3HP1A 3PTLA 5CH5A 3Q3CA 5HM6A 3ANMA 1M6VA 3C15C 4BEVA 2XSZD 1E3LA 2Z56A 1KBQA 3EZNA 3GXBA 4G8BA 7ADHA 4LISA 4XM0A 5KINB 3LS2A 3ZW8A 1GGHA 4J1SA 4RWZA 3ACDA 3QPDA 3DB2A 5FI1B 2J9FA 3WLTA 2QXTA 1TIBA 4L5YA 1KVTA 4OHPA 4WOJA 3OCZA 1ABFA 1CVIA 1E9BA 2CJPA 2BW0A 5KJ1A 4CV1A 5TF4A 3SVTA 4PY2A 3RC2A 3TNFA 1TC1A 3LDGA 5CURA 5BXQC 2ZCJA 5DPMA 1VE7A 2IIVA 3PHBE 2FEOA 3P97A 3EB9A 1XRSB 3FJ1A 2CNOA 1CK4A 2WTXA 3OMLA 2WWFA 3E8MA 4KN8A 5ALWA 2FP4A 3TKAA 4C6HA 4DLVA 4M6WB 4I4IA 4R16A 3BX1A 1M34B 3H1GA 3Q8XB 1CYDA 4IHJF 5ITVA 4ZFNA 2Q1YA 2XEDA 1IVYA 3E05A 1KU6A 5ALUA 1QR2A 1N2OA 3UWOA 5ADVA 5KMGB 4FFBB 1MFPA 3ZR4B 5BVHB 3EMVA 1HDCA 3ID6C 4Z4QA 3UK2A 4JD5A 1PLJA 1M76A 3KLBA 1LWOA 1AH2A 2NUPB 3BIWA 2NV6A 4HFMA 1O8CA 3A8TA 2I4RA 2R48A 4MRNA 1ZJ5A 2RJ3A 2JC3A 1RKQA 2FPGA 2VDVE 1GU7A 2ZRAA 4CW7A 5KOJA 2HU2A 2QVZX 4D56A 3EXIB 2QR2A 2WJAA 4IRUB 1LBTA 3P8ZA 4KK3A 4NFYA 5BWMA 1SRQA 1H9AA 3L6CA 4FMCB 4M36A 4O3FA 5IBRA 5ESDA 5K3FB 1MJHA 3U81A 4E21A 4Q4CA 2Z5FA 2GK7A 2NVUB 1XRQA 4DBVO 2IBSA 4YCJA 1PK8A 3DUWA 5FUVA 1IZ0A 4ZOCA 5ARCA 3OM0A 4E3ZA 4HT3B 4Z1MD 4Z4HA 3SS7X 3MUEA 3EW7A 4MQFA 2GI4A 5FPSA 3LF1A 4HR7A 4ZMSA 2Q5CA 3FNEA 4ZZ3A 2JHFA 4KPYA 3SVLA 2RHOA 2JFYA 4FEYA 3KAPA 2GO7A 4TROA 5CTJA 3ROGA 1HZJA 3IT2A 4HS4A 4Q19A 2J9RA 4QO7A 5AK6A 4CYMA 3K1TA 3MGBA 2NZUG 4V2IA 2HA2A 1RYYA 2WIBA 3NBUA 1GAQA 5CVCA 1JV2B 1K7YA 4DDTA 1WSBA 1T4MA 2EX4A 1UQRA 3CKLA 2AZTA 2ISQA 4P8RA 4B3SB 2G76A 3D3NA 1YZNA 2QM3A 3K0CC 4MDYA 4FFRA 4WDRA 5K6TA 3JVEA 5E6RB 4R6WA 4NOJA 5FPQA 2NO9A 4MCIA 2ALJA 3NAGA 1HE5A 2V6MA 1FK8A 1W25A 3U9TA 3KVOA 1EWRA 2ZIXA 4RJTA 2XKBA 2BBSA 4WT7A 1T0UA 2MSDB 3G9UA 4H7IA 3ZEAA 1K0UA 3EBOA 1HM5A 4HAVA 3K6KA 4BZPA 3VX3A 3AY0A 2XWQA 4RY9A 521PA 2FRDA 3BJMA 2AXNA 3PUIA 4PLWA 2FR1A 1PNQA 3GFOA 4W7SA 5KNDD 3ZU4A 4RTPA 4BB6A 2J87A 3RSHA 3CIFA 4DMKA 1ZH6A 5G4KA 4IG4A 1PJ4A 2NUBA 4FFSA 1Z2EA 2QRNA 4UHEA 4BNNA 2PH1A 2ZE7A 3IV6A 4KO2S 3WWOA 3BRCA 4CTOA 1U2PA 5L53A 2WICA 3RNOA 4JJFA 3LPDA 1IM8A 3PD7A 2Q5IA 3R0QA 4BVHA 2Z5VA 1NPYA 1KEUA 1Q0RA 3DP7A 3OKAA 4EJ6A 3EFBA 1K2WA 2V8BA 4UCQA 3O9MA 5CA0F 4ZI5A 3CLTC 1WVIA 1Z18A 2HJRA 2PEZA 4G5SA 4MWBA 1YVRA 3B51X 5EXPA 4QLOA 3W4JA 5IZCC 1GL9B 4ZV7A 3P9XA 1L5OA 1PHPA 4ZO4A 2ZIZA 4UTOA 1ZCJA 5KHAA 4HS9A 1H69A 4II2A 4E09A 5DYWA 1L3IA 2IUUA 2HIGA 3DZIA 2OR3A 2OP0A 1UEXC 1M7GA 3T94A 5GADl 1G66A 2WVAA 3H9JA 1S6YA 5IWCA 4Q18A 2E37A 1UM9B 2E5WA 2I2DA 2VK4A 1ZKDA 2R4UA 2AMFA 5DTMA 4MOWA 2UZ1A 5CT6A 2QMZA 2YZGA 2ZZMA 5DGIA 2C4HA 4AWBA 1H5UA 1SJ9A 4D8WA 4IXTA 5KU7A 4AO8A 4OK6A 4B34A 2VH1A 5DTJA 1RAEA 2XVZA 1PKEA 3ROQA 2JANA 4MEJA 3ZCQA 3JZIA 1CQJA 1G3RA 1OAKA 4GBED 4MK4A 4UVDA 2HX1A 3UOGA 5JBNA 2HBQA 1AK2A 2QN2A 1WDLA 2ZT5A 4E08A 2CFSA 3GPBA 1C3LA 2CCKA 3FPKA 4YRCA 5FLYA 4BNHA 5BWBA 1QLWA 1Q1GA 1U1FA 4HZUB 4KMSA 4QOIA 4PZYA 1H2AS 3DAGA 1J2TA 2X6TA 4G85A 2JI7A 3SEQA 2VJPA 3I1JA 4N48A 2R25B 2GM3A 1E2GA 4ENRA 4HWGA 2C2BA 3B3AA 2PG3A 5FLEX 5CJ2A 2OC9A 1WM1A 3U17A 4F6CA 2P30A 2A0FA 5KOYA 3ZH9B 3O8LA 1SNYA 1FJGB 3A0RB 4BU0A 2AUMA 1BFUA 1INLA 1RHRA 2RJOA 3LOUA 4ZI3A 3VQTA 2C7VA 2ZE5A 4EDHA 1L4MA 1KO7A 2E49A 2HV8A 3HEMA 1E6UA 2P5UA 3HB9A 1Q1QA 3P45A 2DPHA 1Y6RA 1W88A 4J9UE 3G82C 5IJXA 2Y0EA 1J9EA 4K9LA 2FW9A 1H9BA 1PFWA 5FHQA 4QDOA 4AULA 5JWHA 5H9WA 4J3NA 2ZE8A 3GLGE 4B4UA 4G41A 2CHGA 2WHPB 4F2GA 3PNBA 2Q6OA 4ZJUA 2PGLA 1X3LA 2WU8A 1UPCA 5AJWA 4D2IA 4HYYA 2Q4EA 1J56A 3Q7IA 5A0FA 1LCIA 3F8TA 2WUGA 2H9AA 2P8SA 1M2FA 3U39A 1RVDA 4M7OA 1JEOA 3AIOA 3DOHA 2G82A 2AS0A 1NUAA 2X86A 3IJEB 2PJRA 4R84A 3FDFA 3FE2A 1EK1A 1FSPA 1VXRA 3S1LA 3LY5A 4UMFA 3G9QA 2QN6A 4UVHA 3KEQA 3CZMA 3ZDFA 5LMUB 4H0CA 1Y9DA 2ETXA 2J48A 4NBTA 3V7UA 1KJZA 3HN6A 4I1PA 2B0JA 1QS0B 2WHQA 3FFBA 2YVLA 1X8XA 3ETEA 4CMIB 5ISMA 4JCOA 1PUIA 3GCDA 1NV9A 4LGCA 4NF2A 1S02A 2ZUEA 3G6WA 1C7FA 4BYGA 4JGIA 3CVWA 1TI7A 3BWYA 4DHWA 4AC9A 3E81A 5HPYB 2A8YA 4M8IA 1ECBA 2GPNA 1HGXA 2R7LA 1W47A 2GVDC 2YXNA 2G06A 4M7WA 2QLBA 3IAHA 3N0RA 1K27A 1OX6A 3C3KA 4R1UA 4RJLA 3ZKWA 5I9LA 2ZB2A 3OJXA 1OXBB 4H1WA 3GYBA 3KEGA 1TMYA 1E32A 4N6OA 5B6IA 1JFVA 1JAXA 1XIVA 3OPNA 4KHZA 1DBQA 3SJCA 4NBLA 4JSTA 3UAWA 3HN7A 4ENWA 3D31A 2LNDA 2WMNB 4FK8A 5IDWA 2H2WA 2H2AA 3THXA 1PR6A 1Q22A 1TTTA 3FNBA 4OJQA 2POCA 3GJQA 3T0FA 3T5BA 2FJPA 3N2IA 1FS6A 1QHGA 3KEMA 4HYQA 3QUCA 4L9AA 4EGQA 3SR3A 4DLWA 1VYVA 1JQBA 1UM8A 2AXEA 3GYGA 5ALQA 2FR8A 1TFUA 3BFKA 4OI1A 4ASUA 4DC9A 1K86A 1S1MA 5FAXA 1EA5A 4L3WA 1WU8A 3D5TA 1VB3A 1P81A 3WG9A 2QD4A 4BO4A 5A3QA 3BMCB 2NO0A 4OB6A 1B1CA 3KTAB 3QJ5A 2BKXA 1KF0A 3QE3A 2ZYGA 2RGNA 1NFRA 3OEYA 1IOLA 1E1RD 3WADA 2PPLA 3KOOA 3DVSX 1F2UA 2WJWA 4WVFA 1DJPA 2RKWA 4ZOLF 4LNAA 5AJTA 2DQYA 1T8YA 4HL6A 4QFCA 3OZXA 1ECFA 4OG2A 4YT5A 5JLAA 1L7EA 4J0IA 2Y1OA 4D3FA 3P2KA 1FDSA 1B3RA 1U8ZA 3JVVA 5LYJB 1MR3F 1M2GA 4C05A 3SHVA 2IZ6A 2Q6IA 3AONB 5IT0A 3TJRA 1SWVA 5B7GA 3NOXA 3C8HA 1G1AA 3KHUA 1CUHA 2GPYA 1IAQA 4RCZA 4UM8B 3L6EA 4V39A 4TXHA 4DNPA 5B6PA 1LSOA 1NAHA 4PRYA 4LZJA 4CFSA 1KYZA 3IEUA 1G8PA 4Y6PA 2P68A 2Z30A 5AVTA 2YVAA 4PSKA 3ROZA 1BQ4A 5SZJA 1UBJS 3L1JA 2P4QA 3IIKA 4P5DA 4GXRA 1NU8A 3L4EA 1V25A 4Y2VA 5FOQA 4KGDA 2AFVA 3KSMA 3GFRA 1VE5A 2FEPA 4DE5A 4ER6A 3LUBA 3OEWA 1NFQA 2F3PA 5CEFA 1ZD9A 2Z9DA 4Y0VA 1BCRB 1X94A 3AU9A 4NAHA 5I3CA 1F14A 2O7QA 3NWEA 3DXYA 2XY4A 2HU8A 1CR1A 3ONVA 2E0IA 3JD4A 4FKMA 4OEHA 5CA1F 4J1TC 5GZ3A 4M87A 5JLJA 1JU4A 2R5FA 3KKEA 3UGKA 4CQMB 3CNNA 3VYUB 1JLRA 4G8CA 3EVAA 1BHSA 3EDQA 3FVWA 4HGYA 3WL3A 4PN7A 3KUKA 3VDQA 4MUIA 1P4HA 2AJ8A 1H5QA 2O2HA 3ICCA 4FYHA 5DM60 1YONA 1IBKB 4JI0B 3TLCA 2UXCB 3DEYX 3PWTA 3BC1A 3K15A 4WVLA 3ZCVA 3JQAA 3M2PA 3RC7A 5LU9A 1QO0A 2OFPA 3ILXA 3QKRB 1OQAA 5AI5A 3VYTB 3G1UA 3WX0A 5EPEA 3DR3A 1PZMA 4ZAVA 1Z0IA 4UDXX 1P9LA 1LDYA 5DT2A 1H2RS 2BGKA 3WK9A 1WDWB 1JTVA 1QPGA 2Y0BA 1DZIA 1PJBA 3C87A 4L78A 3ZI4A 4F5WA 3S27A 1XDSA 3UHJA 4D9IA 4OQPA 2PTGA 3SC4A 1N2CE 4TPKA 4URFA 5AJUA 1YA4A 3EYWA 1VIYA 5GOZA 1VCOA 2I4MA 4FOLA 1E2NA 1JZSA 2JGDA 2RAFA 2X9NA 3Q9LA 4XCQA 1WUJS 2PUCA 2Q6VA 3IBGA 4AI6A 1IUPA 2BCEA 4JOSA 4IIDA 4KQCA 1DS6A 3BTVA 5JZVA 3BAZA 3E9MA 1MA0A 2HCBA 2RB5A 1E1CB 2D2VA 2NU9A 1ZCZA 1L5ZA 3DBHA 3CNHA 3I83A 4TSRA 5AXDA 5BT9A 1USGA 3PPIA 2W2QA 3IB3A 3PDIA 4LOIA 5LXTF 3I2KA 4KKVA 1NJ5A 2Q2QA 1LEHA 5A4FS 1M2NA 3V7WA 1W6RA 2O07A 1HQKA 2XE8A 4L6IA 5L95A 1AV6A 2B4QA 2HCTA 2R2GA 3DCIA 3RSZA 1DX4A 5FWNA 2BGMA 4DM3A 3OY7A 2DRIA 2VH5R 4DV7B 1QONA 1MDBA 3A6HA 1XZAA 1W96A 3ETCA 4CLOB 3L8DA 4UFNA 2FN7A 2BZSA 3ZCSA 4BLUA 4M1QA 3CKYA 3NAZA 3RVQA 3AUTA 4ZVLA 3HVJA 2D1TA 3R3JA 9MHTA 1U5CA 4OAOA 3I6MA 3WSTA 3UOAB 1GGNA 1DJQA 1HPLA 2HSDA 4ZQEA 5K3SA 1R88A 1ZJ6A 2OAEA 4DA9A 4JOQA 4Q12A 2GPBA 3HB0A 1NBOA 3NKLA 4Q9AA 5DBHX 5EMMA 2AMJA 4RQAA 3JQAD 1SO8A 2AG6A 2M1ZA 4QD3A 3I6YA 3MZ0A 3RT1A 4DB2A 1E3QA 2NXCA 4G5XA 2FLVA 1SCJA 4NRDA 1AK9A 4LNHA 2NMVA 2IIPA 4BWFB 3P0FA 4S1WA 1Q92A 2FW1A 2V7UA 3I6IA 3KSBC 2GRJA 1Z62A 2MCFA 4BLVA 5FTMA 2A78A 4O4JF 3NXKA 3TNJA 9GPBA 2H4WA 3L0CA 5DDIP 4D4HA 3WC4A 4KDFA 4U7GA 4KR7A 3MWDA 4FGUA 5JBQA 4J6EA 2ZREA 4IH1A 4ETWA 4IIJA 4DCNA 4I2NA 4UUPA 4U6NA 4LGYA 5HF9A 1PAUA 1XT6A 4Q82A 4UVIA 1PYDA 3FDJA 1PX2A 3JAMA 2REOA 3KB8A 2H7XA 3E9ZA 4TTAA 4P22A 2D00A 2I03A 5CM8B 2FMUA 1RWQA 4BFTA 2P1RA 2CXPA 2RFLA 4DMRA 3E7WA 3QELA 3U4QB 4KYVA 2GXUA 3FNQA 4G4IA 4FXOA 3QVSA 4MS1A 4OU5A 3RVMA 1E3MA 4L4XA 4QU0A 4OBXA 2PSFA 2YHUA 2WYVA 1E1QA 3LUGA 1UCFA 2EW8A 2J32A 1F0PA 1ZGZA 2IF2A 1CC1S 1DQPA 2QAGB 2W93A 3DLIA 4HDMA 4JKOA 4ON9A 2I4LA 4QBIA 2EJVA 4X84A 4Q48A 1BVRA 4WXHA 4CV3A 4CF6A 2YFKA 1YTUA 1WBDA 4EA8A 2XZDA 5CNMA 5DBGA 1BKYA 2PKWA 1EM6A 1OXTA 1SC9A 1G4AE 1SUEA 2J46A 2YDXA 5E9WA 5J4KA 3KTOA 5JXGA 5L7WA 3M3DA 1MQSA 1QYIA 1Q83A 1Z6YA 3WRYA 4J0QA 1RHMA 2G7ZA 4HJRA 2IXFA 3ZVLA 1ANKA 3DP9A 3JRXA 3M5CA 3TZ6A 5HUJA 2HWUA 3PJRA 3E48A 4KX5A 4G1MB 3OEHA 5TMDA 1FP4B 1GVHA 2QTWB 5LUAA 3V97A 1EFDN 3QE9Y 3HU3A 3U3XA 1WCV1 4LHYA 1KR2A 4HAXA 4XXHA 4YRGA 1X2EA 1JDJA 1L4YA 1MFZA 3VC1A 1DCFA 3V1UA 1S4QA 3PDHA 1XEAA 3RDPA 3OIFA 1KVSA 1U7TA 3H5LA 4NZNA 5DVZA 2VYVA 2ANCA 1EB8A 2OGWA 5FPYA 4JJ4A 1NNUA 4WH0A 1VI5A 2HCRA 3C6MA 3H1PA 4GIBA 2YX1A 4W1SA 4WXMA 4WNAB 3I2GA 2XCLA 3IDQA 3RRJA 4B84A 4EJMA 4B3GA 1E6CA 4OX9Y 2R8XA 2MMGA 3ADOA 4Z4EA 2VAMA 3EGEA 4ETMA 3HA5A 2W48A 4WUVA 3T1HB 1DTSA 4DA0A 3TTSA 5ALNA 2IH2A 3BH0A 3DZDA 4MYHA 4RDCA 4CM7A 2WE7A 2FX3A 5FCDA 5JEEA 2DQSA 5FTNA 5K6AA 2VOJA 2CXQA 1P80A 1LTQA 4G37A 3KR9A 3KB6A 3NHSA 3E27A 2WJPA 3UJPA 1SIWA 2Q2WA 2PBRA 2WHYA 4BS9A 1E1QD 3BWEA 5K0FA 1X77A 3LTNC 4LDPA 2CB0A 4WEQA 4YASA 1REQB 4XWGA 1ZN8A 3MQ2A 4CQLA 3JYQA 5B7NA 1YS9A 4FFVA 3MWEA 1AGRA 1DFHA 4JENA 4D26A 4P54A 4DWVA 2YJNA 3T4UA 4LOHA 3LW7A 2VT7A 1AHNA 4JSRA 3T0IA 3ZK8A 3EIHA 4BO2A 1SZCA 1QVZA 1C80A 2QQFA 4IUCS 4HC4A 4FHCA 1UWVA 2IHBA 3ZCXA 4EBFA 5ELLA 4MV6A 3ZLBA 3C3MA 4QBTA 3T5GA 4H4CA 1KEVA 3OEHD 3OOJA 3WWPA 4H2DA 4S0ZA 4CODB 2NU8A 1RJDA 4DDWA 1QWSA 2V98A 2XNSA 5TMBA 3DVRX 4Q47A 5CDHA 3KCQA 2PHZA 4ETIA 3GQBA 4G1UC 3TPZA 3WQQA 4L85A 1I7PA 1DX6A 3KEFA 1RRMA 1YCFA 1JAHA 3CRNA 3OF3A 3VYRB 4YJ3B 1CZHA 1S5PA 4EJ2A 2I8LA 3QQ5A 5F2NA 1XFAA 4YMSA 5BWNA 1F7VA 3UJHA 1X70A 1SUPA 1QHHA 3BRWA 4O1MA 5JS2A 2H1IA 4FR5A 2WWVD 3ED1A 3M6UA 4O4LA 3TZQA 2WSBA 3UPTA 1NRWA 3AUAA 3OU6A 1XZFA 4DR5B 2Z6VA 3D8TA 3IA2A 1FDWA 3P0IA 4RVGA 4AZVA 1MGPA 1W5BA 3PB3A 4D7AA 4MCJA 4E5DA 2V9PA 2IY8A 3EC7A 4INAA 4YCCA 4PX9A 1NF2A 4KQ1A 1BA3A 3OJCA 1YBMA 3C3WA 3BDIA 2Q6LA 4Y2HA 5EPOA 1Z0SA 2IDJA 2L19A 4MZXA 4EO4A 5CFNA 1CZNA 3EGDA 5L8VA 1K9VF 5JVDF 1EHIA 4XM2A 3K6SB 1HFJA 1EGMB 5BV7A 2ZRLA 4D0SA 1VIAA 2HQ1A 3FKJA 3S70A 2X1LA 4TS3A 3TEMA 4UTRA 4RHYA 1JQLB 1QGOA 3KBBA 1SBQA 3WO0A 5IT4A 3IULA 4GXNA 2EEZA 3ZHQA 4KFSA 3DHYA 3IQDB 3LC7O 1F06A 1Q7BA 4A03A 1WS6A 5JROA 3EIFA 3FTPA 2R8BA 4NYMR 1G7RA 1DKNA 3OZCA 3I6ZA 4H3VA 1T1SA 5EMLA 1M1NA 4FLFA 1ZNWA 3A3PA 3GCWA 5DM4A 3Q6MA 4OMDA 4QTTB 2VAVA 3B2NA 3R77A 2EOAA 4G0ZA 2HA0A 5A4AA 1NL3A 3CY6A 3EXHB 3GHHA 2ZQ5A 1KO8A 1ETUA 3HBLA 3U4GA 3LUJA 3ZK9A 1LQ2A 1PCXA 1XDZA 4B6SA 4EPTA 2ZSKA 2P2ZA 2WVGA 2YH2A 4MR8A 4TLBA 1QO9A 1T8RA 4GP9A 4FC7A 1Y6JA 3G0BA 4EKDA 2UUBB 1DBSA 4HDNA 1YBHA 4H31A 3CO5A 1LB1B 4P92A 2ZRIA 3G79A 4DQDA 1DWOA 1B8VA 2Q3MA 2WF7A 3FMFA 1JDBC 3I0MA 2OBMA 3BMNB 4Y6SA 3SC2B 4BWGA 1A9OA 5DBEX 2AVNA 3DFZA 3SICE 2V1UA 2X5KO 3B1WA 1MAAA 4JQSA 4PF1A 5JCPA 2QG4A 3O75A 2JCYA 2D2EA 1AC5A 2O2JA 2BEJA 3DE4X 2GJ4A 5DHQA 3WMFA 3T7CA 3W0LB 4TYQA 1VGRA 2JG3A 1JLLA 4O2AF 4B4DA 1JFLA 3OBBA 1U3VA 4HDAA 3L01A 2REXB 3MTEA 4DMUB 4RIGA 1Z2CA 6ADHA 3GDGA 4O63O 3T7KA 3I4LA 4C4PA 1QC5A 3D0RA 1EJ0A 2BSAA 2C3PA 4WBNA 3DPSA 3L02A 1Z25A 3N8HA 3NBFA 4FDLA 3T61A 4BDSA 3MT7A 3UCXA 1KYXA 1HOXA 1YS7A 1YWGO 1TQ4A 2FRDC 1A7KA 2CEAA 1BQEA 1Z12A 3AEXA 3GLHE 4NCJA 4P5PA 2EFCB 3NDPA 1B8UA 3HVRA 2PZJA 5I8PA 1FQOA 4OLFA 3C1UA 3EQ2A 3DYIA 5J4HA 1IOVA 1P4SA 2DKNA 4RHTA 4X1KB 2W9XA 4XUEA 4B8ZA 1A5ZA 3G8DA 2M9MA 3A4LA 5K3DA 4D5GA 4R1PA 4G5YA 2RHRA 4MIKA 1KYVA 3DBLA 2NXWA 4O5AA 2ICAA 1HR0B 4CNBA 2ZPUA 1P2SA 4I19A 3F8WA 3K1AB 1LLCA 3KC2A 1FDOA 3MSXA 1DIAA 2BZ0A 1YB4A 3LOQA 1DCKA 2ASEA 2C95A 2FWAA 2Q3HA 3G2NA 4HDKA 2IWRA 5CBKA 4UEWA 3AETB 2ZJOA 1W44A 2W4IA 3IQEA 4D98A 4Y9TA 3EPJA 5AUPB 3AEUA 2ZM5A 1I36A 2DU8A 2GK4A 5BMVB 1Y7PA 3P2OA 4W8OA 3KE9A 1O95D 2AOTB 1PS0A 3A6FA 3JQ8A 1OAOA 3FUWA 4KXUA 2X5XA 3QEOA 3AVTA 3LT2A 3NATA 3N0TA 3LXRA 5JS8A 3DZ8A 1RCTE 3I6BA 4ILKA 4ZXFA 4FWIB 1J9ZA 1ZOLA 4QXAA 1X9GA 3HH8A 1HETA 5KYXB 1EUQA 1Q0PA 5CB4A 2VLIA 3U5ZB 2CLHB 1DTWA 4RL4A 1N9GB 5I7EA 3R5KA 4EG3A 1FIUA 3OIUA 4W1QA 4F0JA 2JJ2A 2NTEA 1QRAA 4JBYA 2AZMA 4AF6A 2BI7A 3WLHA 3VDMA 5KTNA 2FJ0A 2HMUA 3G2IA 5ICFA 4PIVA 2KLHA 1VPDA 2WUFA 1JDVA 4IUDS 1NVEA 1D2RA 2ZUUA 2ZETA 3OKPA 1L4HA 4OHBA 4RADA 821PA 3A6GA 4TQGA 4J16A 2CLEB 3TUIC 4QUJA 2W2PA 2V54A 4YV7A 5E9JA 4WRRA 1Z7BA 4DBLC 3ZG6A 1DAKA 1P61B 2CMGA 2G9QA 3I4CA 1G8KA 3T6KA 1ZJWA 3FTDA 2DE0X 2GEDA 4XE5A 2FMKA 5DM2A 1U63A 4IIVA 4OVKA 4DA7A 2QI9C 4PHFA 5H3LA 2HPAA 1BE8A 3LQ1A 1J2RA 2AN9A 1MB0A 3EIQA 2WOJA 5HKKD 4NMLA 2XTAA 4LE1A 5CB8A 2R4QA 5AUNB 1JEYB 2XKJE 1MB4A 4IRMA 1CY4A 3IVGA 4YACA 1Z47A 3ET5A 4EYKA 5C51B 4DJ5X 4YAIA 2WWTA 2YZ2A 4DN6A 1R74A 3SYTA 1MABA 2JATA 5J40A 4O3MA 1CCWA 2FEWB 1VRWA 4O4HB 1X0VA 4IQGA 3KQVA 3SXUB 4X1OA 1PR0A 1JHPA 3KR0A 4RFSA 3M1YA 3T9DA 4EY7A 4CU2A 1EFAA 1OT5A 4RHEA 1U4SA 2DFKB 4FT4A 3OSUA 4XEHA 2H1RA 1O2DA 2ZM6B 2B3TA 2C2OA 3GUVA 1IK4A 1SZDA 3O4IA 2HLNA 3OPQA 4KSCA 2NUTB 1D7AA 5E1DA 5EJFA 3ZBPA 3LY8A 1U6JA 4M1TA 3DMHA 2DCMA 1GR0A 4IGIA 2C7RA 4DYVA 3L7AA 1FDTA 1G6OA 3P9ZA 3WYCA 2QD1A 2ZAGA 1VLLA 5ECWA 3S6JA 1ULSA 4B4WA 5B36A 4EABA 4LOAA 4ZTUB 2WV7A 1HO3A 3TSAA 5IULC 4FEAA 3D3WB 4Q21A 5M5BA 1HEYA 3HO8A 4XA8A 3T1QA 2R7KA 1ZG3A 1KXJA 3A9WA 3E1GA 3TGPA 5DBIA 1WTAA 5EEGA 4CIBA 4EVSA 2AN5A 2C03A 3NIGB 5COAA 4U2KA 4ZAZA 1MQ8B 1OV6A 1IY2A 1V4BA 1ZWLA 3ICEA 5AK5A 2XT6A 1MOPA 3FPHA 3MG9A 1EZ4A 4C30A 2GLXA 3T3HA 4PYJA 1X8LA 1HQYE 2JJQA 4I9UA 1CDOA 1YUNA 2D1FA 3OFKA 5JJ5A 2C8VA 3OZEA 1GXSA 1DC8A 5F9MA 3DFIA 1FFXA 2CXRA 3FJYA 3KR2A 1NRXA 5IUNC 1N5JA 1XE3A 1D0SA 3C6BA 3RAGA 1IPFA 3WOVA 3AB7A 3OQBA 2IPXA 3NIDB 1DTEA 1WB4A 4GLJA 2V4UA 2RCYA 3U09A 3EG5A 4LHEA 2SCUA 1H8ED 4FDMA 2Q4BA 1V9CA 1CB7A 4GLFA 2OBNA 3E1KA 1KAMA 2VHCA 3FI0A 4UXJA 4N18A 1DI0A 3LWNA 5IU6A 2C9ZA 3PPXA 4F8YA 1MW8X 2A88A 5DLDA 5GZ1A 4FYWA 1WKCA 3ZY4A 3ZHTA 2P2NA 1Y3DE 1O03A 1OR8A 2J6IA 2WG0A 3BFJA 4ZCPA 1PJ8A 4U8HA 4HPWA 3LWBA 1MGOA 1VBNA 3C39A 4Y2PA 4L5AA 4M9CA 2R62A 1MZVA 1ZNZA 4RXMA 2X7XA 3A6JA 3JCZA 3RFTA 3WLLA 5ICSA 1NF3A 4IRXA 2J3EA 4NCXA 3RUFA 2VZ0A 2VNSA 4RL6A 4AZ3B 3ELDA 3CB2A 3K0HA 1KYIA 3FYUC 3UMFA 4PAWA 2RCNA 1K7XB 3CUTA 4IM7A 4YA6A 1Y98A 3FPFA 2B21A 4L28A 5ALEA 5HMMA 5HX7A 3W5UA 1E18A 4AJJA 2P5TB 2W90A 5FNVF 4AO7A 4DIMA 1TYCA 2QZPA 4BX8A 1PP4A 1YQTA 1CRWG 3IPYA 1NOJA 3RRZA 2Q1WA 5DM70 4HDRA 1A8QA 3NM5A 1CUXA 2PY6A 3GEHA 1A7UA 2AKAB 1N6NA 2K7ZA 2R1TB 2WUEA 4MWTA 1Y9JA 1XK7A 3EAQA 1W36C 1I7LA 2AF4C 3CLRC 4RDHA 2OK7A 3HLTA 4EMBA 3QNMA 3LRTA 4QG3A 2PX5A 1LS1A 2VWQA 2W2KB 3K9LA 4X65B 3VVCA 1XD8A 1PFYA 1NP3A 1NBMA 1R6BX 2AN4A 2CBZA 1NMXA 2HN9A 2I8CA 3PPVA 1Y7LA 2W2OA 3STUA 3TTWA 2GS9A 1EE9A 3D4BA 4MYSA 2BM0A 2RG7A 2VAWA 1UMKA 3BCUA 5H59A 1N0IA 5G40A 2AA3A 3K0AA 2ODNA 4FDAA 1UBNA 1SBCA 2E9SA 3UFXB 1RLOA 4B3HA 3TGLA 5FUBA 4S05A 2ZJ4A 4JROA 5I5GA 4DTIA 1UFRA 5IC4A 2MOKA 4LZZA 4JOCA 1RNLA 1X7ZB 3RYFA 2DPGA 4CEHA 3O2JA 4YB8A 3SC6A 2F1RA 4QT4A 2REBA 5HF6A 3PRKE 5FBVB 4TL7A 3JU3A 4REQA 4PE5B 3SDZA 3LW8A 4PO1A 3TN7A 1EB9A 1EFVA 1Y5RA 4FYVA 5E8RA 2XDQB 3LT5A 3RRFA 1B73A 1GPNA 1DFIA 1DEKA 1D1TA 1M75A 1O0SA 5AVWA 2D06A 4C0QC 4W7HA 3WLIA 3UT5A 1N6OA 2FF5A 1MIHA 2VDPB 4J29A 3ZCTA 4KWTA 4HH0A 3VSEA 2W22A 2V7VA 1NW7A 4Q7MB 2O3JA 2RGCA 1QCZA 5LQNA 4EB0A 4DGQA 1PR3A 1Z4KA 1KDZA 4Z9YA 1XD2B 2CFOA 4WK0B 2F6RA 4Q4LA 1Z7WA 4LPSA 1ZW1A 1TQDA 2A9KA 2YTZA 3E70C 1A72A 3RHZA 2QZSA 5B2EA 5CLJA 5KYTA 2P9ZA 3ZHVA 2HSGA 1JALA 1AD2A 1AZSC 2Z08A 2QPTA 3B3QA 3JWGA 3MAGA 3UF0A 3V8BA 4KR2A 4XVUA 1IQRA 4ZGWA 1ZM9A 4OCZA 4B4OA 1FTGA 1JPNA 4KP7A 1EGQA 2PUWA 3ZDQA 5K5EA 1YB7A 4B45A 3UHAA 1QYRA 1TO2E 4LVNA 2MINA 3P7MA 4FCVA 4P7JA 3MT9A 4RGVA 2EZ9A 3EGWA 3LPNA 5C1DA 1D2MA 4PGMA 3KJEA 1B7GO 4JJZA 1QGZA 2Q5FA 1UBKS 3R7SA 4B7ZA 3FMGA 1SXIA 4KN6A 5D5PA 4BMPB 1J5XA 1E3WA 3HYNA 4JU8A 2WSLA 1QIMA 3Q85A 3EVZA 3IP5A 4R1SA 4X92A 3BCRA 4F46A 1DB3A 1NNI1 3HWX1 3KCNA 3ZDYB 3BMQB 1LTKA 1XEXA 2J8ZA 3AM4A 1OBCA 2OZKA 3DE3X 3EZLA 4K6OA 1V5IA 1XJQA 2E4WA 1LJUA 5HKBA 2X8JA 2REQA 4K6CA 1E5TA 4CN9A 3ILSA 1H94A 2VOEA 1GZ7A 3BYZA 4BJ3A 2WE8A 3FUVA 3CU5A 3Q1KA 5FWXA 3HHPA 4HDSA 1TKCA 3AMVA 3P9IA 4QPDA 5TARA 3ICVA 4UE3S 4ZZ2A 4L4ZA 4BX2A 1W6UA 4ZO6A 5IDVA 1GQ2A 1DMRA 3UWPA 3GT4A 2AHOA 4Q3OA 4QRIA 4PLTA 2ZK7A 2TMDA 4E94A 1YQGA 3GX1A 1ISIA 4KV9A 1E94E 1Q7EA 1PLLA 2OC4A 4G1CA 5C80A 1GIAA 4YLEA 1A1VA 4TYMA 1LPMA 3KDAA 3TSZA 4IGEA 1J33A 3Q2OA 4BKRA 3SNKA 5TGTA 2WJJA 2QUJA 4F6RA 1QHNA 2CSUA 1YR7A 2KJQA 1XTRA 1X86B 4W4TA 4E32A 1GY8A 5EJ4A 4G5OA 1QP8A 4A2CA 1U2EA 4RM2A 1KY3A 3LIIA 4XAQA 5FOTA 1F60A 4H7EA 4BFZA 3AFGA 3L1VA 4OO3A 5LPNA 4QPNA 4AX4A 5C9ZA 1CIPA 1R8YA 2YICA 4BRUA 4RUKA 2WWXA 1O58A 3HKDA 5EL0A 1VE1A 3OBIA 2IOYA 2A9RA 3GOQA 3R6GA 5K20A 3D3JA 1NUUA 2AFIE 3HL4A 1P0QA 3OZDA 4OFXA 1Z2OX 3KZVA 3C8ZA 2OHGA 2UV8A 3M2TA 5FUYA 1NZDA 3KXIA 4J75A 3DMDA 5KQPA 3FGNA 3T9CA 5JQWA 2JFOA 1KC3A 4X1YB 4E2XA 2AKYA 3TFOA 1P2VA 3ISTA 3BFVA 2J6BA 3NHKA 1NXTA 4WHMA 4Z3KA 1V3TA 4EY8A 3E9RA 1KJJA 1N33B 2WJ3A 4XYEA 2XBMA 2R4TA 1Z6TA 4J7AA 4LMAA 4TKVA 3VR6D 3D64A 2XDWA 1O5OA 3X2SA 4WOBA 2XADA 3AR5A 3GJ4A 3NJ4A 4PRLA 1W52X 4TT3D 1NG1A 1MUUA 5EKXA 4C0XA 1DIHA 4DS3A 2HGSA 2J5BA 4J91A 4LV8B 4R1MA 4ZCSA 4MW9A 2O8DB 3HEAA 1Y89A 2HZBA 2PU7A 3E3AA 1S9DA 4LSWA 3O3OB 1T6NA 2WHXA 2B61A 3GUHA 1BX0A 5M3BA 3VUEA 2IS1A 2GD0A 1Y7IA 3CZPA 3N9IA 4FT2A 3KQTA 1Q15A 2HBYA 4F1JA 5AR1A 4N0MA 3CRZA 4XTCS 4I08A 3SBOA 1TQ8A