4DWJA

Crystal structure of thymidylate kinase from staphylococcus aureus in complex with thymidine monophosphate
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
203
structure length
200
Chain Sequence
SAFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRKIVLEGNDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNSRDQNRLDQEDLKFHEKVIEGYQEIIHQRFKSVNADQPLENVVEDTYQTIIKYLEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Thymidylate Kinase from Staphylococcus aureus in complex with Thymidine Monophosphate
rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Transferase
molecule keywords Thymidylate kinase
total genus 81
structure length 200
sequence length 203
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2012-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4dwjA00
1EESA 3JZAA 4NP6A 4A82A 3DEFA 4PHTA 3RWMB 2AXPA 2XZPA 2DWOA 4DEXA 3DOFA 2WMOB 2J41A 3BFKA 1R8SA 4UNSA 3CPEA 3T61A 4MYCA 3U3OA 5BWMA 2O8DA 4OI1A 4W9MC 4LZZA 1EWQA 3BIFA 3I92A 3SYNA 3DKVA 2P0EA 2PZEA 2EFCB 2VBCA 3MFYA 3REFA 3AKCA 3LBIA 3VAAA 4YMUA 2AX4A 5KUTA 4W7SA 1XZQA 4FMBB 2GDJA 5CM8B 2FGKA 5KNBA 2ODWA 3BGWA 1VECA 1KJYA 3SQXA 4X8HA 2BBWA 4JS0A 2Q3FA 4KBGA 5FOWA 3K0FA 1J99A 3BAFA 1E96A 3PUYA 4IDPA 2WSSA 5C4GB 3WMGA 1W0KD 2VTKA 3I62A 2JATA 1LV7A 2XB4A 1I2DA 2IUTA 3A1WA 1Z0KA 3MWYW 3T5GA 4Q4JA 1QG2A 5UKDA 3SJCA 4XSGA 4JYBA 2W58A 1L8QA 1W5TA 4M0LA 3LVRE 3SJZA 1BKDR 4PPGA 3EIEA 5FUXA 1O87A 1YZKA 3NVAA 4BGDA 1U8AA 2QPTA 4ABYA 4DDWA 3E5HA 4TZ0A 2GETA 3AUYA 1ELOA 4WXPA 1XF9A 1G3RA 2N42A 1DEKA 1T4GA 2RHMA 1TMKA 1LNZA 2O52A 2GEVA 1E79A 3AP2A 4QG7A 4PTLA 4B34A 3AVXA 4PSKA 3U61B 4GDFA 4OQNA 1N5JA 4EPXA 2C2HA 2ZYTX 4ZDIA 2UZIR 1XPUA 4Q5IA 2CBZA 1JR3E 2WM9B 4I1VA 3HU2A 3QXHA 1P5ZB 2VP5A 5JZVA 2JAQA 3BERA 2H18A 4OBEA 5C2JB 1DELA 3S1AB 2JLUA 2BCGY 3A1SA 1YKSA 3X1ZA 4DDTA 3I61A 1IONA 4BFWA 2GHIA 2OILA 1TU4A 2WPDD 3IIJA 1ZBDA 1IN4A 1Z0FA 3FVQA 1RPZA 1OF1A 3U4QA 2WVJA 1R0XA 1NSFA 1E9AA 3N2EA 2GEDA 3QXJA 4IDQA 3RS3A 3I1FA 3R9IA 4D0LB 3TSZA 4XIGS 3A4NA 1A2KC 4TTRA 3NBXX 3TE6A 5JHGB 2HT6A 2CVHA 1N6RA 4WIAA 2JDID 2R6AA 2QZ4A 3C5HA 3O47A 1NKTA 4AYTA 1KGDA 3QXCA 4PAOA 1EFHA 2BIFA 3VR6A 1Q1EA 1IJEA 2JJ2A 1XCPA 2WWHA 1WQ1R 4XSHA 5BN5A 2ZS8A 4QHTA 4JSYA 1YZLA 1XXHE 3FWYA 2NZJA 2VP9A 1HYQA 4EPWA 1VG9B 5DNYB 3ZS8A 2WWYA 1ZCBA 2IT1A 1EK0A 3OE7A 2V4ZA 4BFZA 4I1SA 4XTRA 3U5ZB 5IDVA 1IOZA 2B21A 4AI6A 1AK2A 2W83A 5BYKA 2FPKA 3ONWA 1E2KA 3QBTA 2AKAB 3QKSA 2UKDA 2XNDA 3W3ZB 3OEHD 2QBYA 1WDTA 1R7RA 2W0MA 3H84A 2QROA 2ZU6A 4ACAA 3HJNA 2GJ9A 3NEJA 1ZNZA 1NBMD 4B71A 2OUKA 5FOTA 4C7OB 4X8OA 4L4UA 5FTKA 5F98A 4OQXA 3AVYA 5AUNB 4D82A 2QN6A 2QSZA 2G6BA 2CL6X 3C4JA 4PPFA 3VU9A 1OV4A 1E2PA 1ZW6A 2IYWA 1L2TA 2DY1A 3I4LA 2ANBA 4K81B 4NU0A 3TMKA 2BBTA 5IT5A 1UFQA 5H68A 1U0HC 2A78A 2D2FA 1OPXA 1GRRA 4WVFA 2A9KA 2DWQA 1GUAA 1LS1A 5B64A 2BJVA 1UBEA 2W0SA 1MV5A 5GADl 3T34A 2ZRBA 5J4HA 2NMVA 1XTQA 4CT5A 3VTKA 4I1OA 4JLOA 1VYTA 2C9CA 1WE2A 3GJ5A 3LXRA 1MKYA 4DC9A 4H9GA 3AKDA 5D3QA 4TLEA 1OIWA 1RRGA 4L9SA 1XMIA 3U6BA 4BLSA 1HA3A 3W34A 1R5NA 5JSZA 3KQLA 1Z3IX 1N5KA 1DOAA 1UKEA 4YQFA 5KTYA 5ELXA 5TB5A 5FUWA 2REXB 2OO7A 3CNLA 3ZGXA 4EIWA 6Q21A 1NVUQ 5SZHB 3MSXA 4KXFB 2AR7A 4DCNA 2Z6VA 5BW8A 2BDTA 2QA5A 3WXMA 1SXJB 4P4SA 2BBOA 2FEOA 5JSZB 4JBWA 3NH6A 4RZ3A 4R98A 2GF0A 2ZJ5A 2GXAA 2WIAA 1H8ED 2HLDD 1CULC 1NVVR 4P31A 3PIRA 1PUJA 5FUVA 4UXHA 2ZM5A 2JEOA 1UEJA 1AZSC 1ZNYA 2DFTA 5E7IA 1KNQA 4EJSA 1N0UA 3QG5A 1J8YF 2YYZA 1E9EA 1Y3AA 1N6LA 1U9IA 1WP9A 4PX9A 2HCJB 1XP8A 3H2YA 1FFHA 1A5TA 3KKPA 1W44A 3Q3JB 3KQNA 2QORA 4DIDA 3OZXA 2F6RA 4CF7A 3UG7A 3FFAA 3L8YA 5CLLA 4HUTA 2ZE7A 1T9HA 2WPDA 4HATA 1BYUA 3EPJA 5KSOA 2VLIA 3C41J 5FTLA 3RANA 3LV8A 1YVDA 3QI2A 1US8A 1BYIA 1KI8A 4Q4AA 3GLFB 1Q57A 1GRNA 1UKVY 4QC2A 2ZRMA 3CRMA 4TQUS 1M7BA 3V00A 4DUGA 3KTAB 3NKVA 1G8HA 2ZU0C 3K70C 5KDOA 4JMPA 4WW0A 2DFKB 5TARA 1P60A 3SC3A 2H7VA 3IEVA 1TADA 2RCNA 1G6OA 1KMQA 1DADA 3TUIC 4F38A 3E1SA 1ETUA 2NPIA 1IAQA 2NG1A 1KMHB 4ZI3A 1UKYA 4C7OA 1JEDA 4GOXA 4QGGA 4RKEA 1RKBA 3QKRA 4A92A 2O8BA 2ERXA 2CHGA 2EYQA 2Z5FA 2ZR9A 2ZXUA 1VDZA 4LYHA 2R62A 4TT3D 1N5LA 2GK7A 1F2TA 2D3WA 2QMEA 4M1TA 2WSSD 1TF2A 4IEEA 4MRSA 3CX7A 4CEJA 1KOFA 4JVNA 2H17A 4OI0A 4XJXA 3PEYA 3QJYA 4TSFD 3NDPA 4MUBA 1NIJA 3C5CA 3MWLA 1AS2A 4MQBA 2IYYA 1ZM2A 3DM9B 4QJ4A 4LPKA 2GKSA 4Q9HA 3VNVA 1JAHA 1JBKA 1IN8A 5FR2A 3O8BA 4HDOB 2ZS7A 1U99A 1RRFA 2HJVA 3I3SR 4L8GA 4OJKA 4ZO4A 4P0TA 4Q4HA 4JBYA 4GMDA 3O8RA 3F3YA 2YC2C 1RRCA 3U44B 1RYHA 4AK9A 1G1MA 4O2RA 4ARZB 2X8AA 2ZJYA 121PA 3WY9A 2CJWA 2ZJZA 3V9PA 4Q7MB 2E87A 4ESHA 4V02A 2JGNA 4BZXA 3CLVA 4IVQA 2CE2X 5GJWC 1G18A 2GXQA 2VHJA 1CBUA 2IC5A 4HB0A 4V03A 4A2QA 1A7JA 2FPLA 2A5JA 5KOYA 4PSAA 2RH5A 4QOSA 3GLHB 3QKRB 3VR3A 3EARA 1S1CA 3B1ZA 1P2TA 3IBYA 3EIQA 3U3KA 4XWOA 1OIVA 2WV9A 5JWHA 2Q9AA 2OFOA 1N6KA 1HQCA 4H1UA 1XMJA 4IJMA 1CR2A 3HP1A 1XXHA 4IRUB 4ZKDA 2Z83A 1XEWY 1ZM4A 1AN0A 4W5JA 3PEWA 1G3QA 2B8WA 3FKSD 1JECA 2QPAA 2FV8A 2QAGB 3QQ5A 3X1DA 3RS0A 4DHEA 1R0ZA 4GSYA 3AH8A 3TR5A 2ZAOA 5CIQA 2XB2A 1G9XA 1AS3A 3KJGA 2RGEA 4OI2A 3FE2A 3K9NA 4Q9JA 4QM7A 4CVNA 2IWHA 3VKGA 3D8BA 3WRYC 4WAUA 4DB2A 4P4SB 3ZLJA 4QNMA 4LV5B 2H16A 2ZYUX 4EPVA 2RGDA 3OAAA 4GMXA 2EYUA 4KVGA 4B3CA 1E4YA 4KLNA 4ASUA 3PJRA 2ZI6A 3RSOA 2ZSEA 4WBSA 1K8RA 2BM1A 3VR2A 4WA7A 4DT1A 3T1QA 3TGPA 4JVLA 2XX3A 4G01B 1QHGA 3I72A 4PFSA 4B3DA 3BE4A 2ZRDA 4DCVA 1OB5A 3BJIC 1MO5A 3QUSA 4Q4JB 4N0EA 2VSXA 2J3EA 3BH0A 4G5OA 2NZ8A 4LBYA 4ZPXA 1KJWA 4WZBE 3FOZA 2OSBA 2WBLC 4B3BA 1P72A 2N1BA 3B82A 1GNPA 2FJUA 2A7QA 1YR9A 2RGXA 4FINA 1EFRA 1E2NA 2HXYA 3W3AA 4QL3A 3VR4A 1QHSA 4PC7A 1E0SA 4ON9A 3BC1A 3SJAA 1QHIA 2QP9X 1VCMA 3ASZA 4RY2A 4BZQA 1A2BA 4E22A 4XD7D 3VMFA 621PA 5EUMA 1PUIA 1T0HB 4TL7A 3ZIAD 3CW2A 4D4KA 1SGWA 5CB6A 2MSCB 1IM2A 1IY1A 1N6IA 4M1YA 2QSYA 1DAFA 2W6IA 4MGYR 2CNWA 3IO3A 5HKKD 2X77A 2YOHA 2IF2A 3ZZUA 4D25A 1PVOA 2B8TA 2W00A 1VYVA 1H8HD 2CLCX 2X2FA 3GLIA 4W5HA 1Z07A 5HPYB 3QEOA 3GEIA 2GCOA 4BEBA 3IGFA 3HU1A 1IN7A 3L0PA 4MA4A 1RJ9B 4R2IA 4K46A 4TQAA 1G7TA 3LRPA 3GLIE 2V7QD 1XB2A 2H5EA 4FD2A 2VHUA 2OBNA 1CTQA 2GA8A 5SZIA 3VNUA 5AJYA 5K8IA 2NO7A 5G41A 4Q7KA 2C77A 4GZLA 5L3QB 1Q21A 2QAGC 4OI4A 4Q1FA 1MH1A 4GL2A 3TVDA 2KBFA 4UNQA 4LHZA 5JECA 3TNFA 1MR3F 5EE9A 4RD1A 1KI7A 4TWZA 4HB2A 2QG6A 4DDUA 1V43A 4ZCMA 1W48A 2FFQA 2O0KA 3PUVA 4Q1DA 5JS8A 2Z4RA 2IXFA 2W6JA 2DR3A 1DG1G 2A2ZA 2R6DA 4XOIA 2XAUA 3D6TB 3QOFA 3B13B 5KSYA 3DM5A 4DZZA 4GZMA 5BYJA 1JNYA 2PCLA 4HYYA 2DFNA 1FQJA 2AD5A 3H1TA 1KZGB 4YDHB 3CUEF 1LF0A 1XTRA 2WWGA 3QSYA 2F1HA 2VHCA 4IFEA 2Q6TA 5SZJA 1KSHA 1NN5A 1P2UA 2P65A 4W5WA 2QBYB 4Z1MA 3QXSA 1KNXA 2OAP1 3EASA 2GK6A 3SYKA 2Q3HA 4JLNA 4LI0A 1CRQA 2IUSA 1IY2A 1ZJ6A 2OG2A 2MSEB 2JLZA 1SVMA 4BEJA 1R4AA 1E2JA 4GP6A 1JJ7A 1W1WA 1WB9A 2J7PD 5CDFE 3QXXA 3NG1A 1NVVQ 5JS7A 5JEDA 4PSVA 4GOKA 4QGHA 4FXPA 3ICQB 4B3GA 2RAPA 5J4KA 4Q7JB 1NN1A 2VP4A 2ZTSA 3BXZA 2FU5C 4DLTA 4LBZA 5J4LA 1GSIA 2Z4SA 4OHWA 2DHRA 4M21A 3R7WB 3VR5A 2BV3A 2P6NA 4B73A 3MUFA 2PEZA 4TTPA 2GWHA 3C16C 2RKOA 1JAIA 4KFRA 3OIVA 4RD0A 1KO4A 4EJSB 3FB4A 3NC1C 2YNMA 3G82C 3TJZA 2PL3A 4GOJA 1DTSA 1Q1QA 1E1RD 4AURA 1U8ZA 3KQKA 1VHLA 4HAVA 5B2ZA 5HCIA 1QHHA 2CVFA 1WBBA 1P3JA 4DUGD 1GKUB 5B58C 3VR1A 3GJ3A 4DCUA 4HZIA 4Q47A 4Q9IA 3ND9A 1BH2A 4PAQA 5FPTA 1PJRA 2G3YA 1XD8A 2ZUDA 4BQSA 3EPKA 3VFDA 2O8DB 2XSZA 3QVUA 4HAZA 3K0CC 4TL6A 5J40A 5GVRA 3RRMA 4MUAA 4TLDA 5EE0A 3V4FA 1EX6A 3ZVNA 5KO2A 1M1YE 3LD9A 4PR0A 2WJGA 1AM4D 2QM7A 2OBMA 5D3MB 1GKIA 3T06B 1DO2A 4D26A 3CB4A 4KV9A 3EW9A 2D7CA 1Z0DA 1D2MA 1C1YA 1XNJA 3B9PA 4NCKA 1ZAKA 1CF4A 4Q1EA 3I73A 4MRVA 1RE0A 4BFVA 4QHYA 2WKRA 1UF9A 4FN5A 1SKQA 4LJ8A 4ITRC 3SU8A 3OEEA 3ZQJA 4AYWA 2V8OA 1S3SA 2AD1A 1FPMA 3KX2A 3UG6A 1ZD1A 3MD0A 1MO4A 1Z6XA 2XEXA 3X1WA 4LPSA 3KKQA 3GEHA 3EZ6A 2IYLD 1E6CA 4LHXA 2VPPA 4QJ3A 2ZREA 1R0YA 4DLVA 3SS8A 1DVRA 3B2EA 3Q85A 5AJVB 4RD3A 5E4FA 5E7JA 3R9WA 1KO1A 3IIMA 2C8VA 3RABA 3GLGB 3TSOA 1E2GA 2AWNA 1P9WA 1KSJA 1UBCA 2FSFA 4DLWA 2JASA 4QGAA 3CM0A 1G7SA 3DZ8A 5DI3B 3IEUA 2ZRKA 4RD2A 1R10A 2WAYA 3M4YA 2PT5A 1I4TD 3DMNA 3OEHA 4D0NA 4DCSA 2XNDD 3RRZA 1QHYA 3EPHA 3WNBA 1YR7A 1DARA 1MABA 1ZUNB 2OHFA 4LUCA 2JLYA 1FOEB 3DHWC 2YVUA 1GVNB 2P5TB 3MAAC 1TUEA 4M2LA 3I5YA 5L3QA 4E09A 4PHHA 4A2PA 2FZ4A 4PANA 1CJMA 2PBRA 4R9UC 1QVAA 5A4JA 5EZ5A 1E98A 5FTJA 4HAUA 4TLAA 4D4LA 4UXJA 2V9PA 4BFXA 1Q12A 2X2EA 2JCSA 3LFUA 3GJ8A 3K09A 1VCOA 3GLFE 1KTVA 3DDCA 1D6JA 2ZRJA 4M8NE 2WAXA 4DIEA 2O8CB 4P4UA 2FH5B 3BB3A 4YC7A 1NMZA 1AS0A 2BMJA 2OCYC 4FCTA 4A4DA 1JEEA 2ZE8A 4A0FA 1W5SA 2VHQA 4B35A 5BN4A 3MWKA 1FP6A 1P6XA 2ZROA 4PHFA 1R5BA 1UKZA 4LRWA 2PCJA 2ZUBA 1NNEA 4HZUA 3KJHA 1TTTA 4PZYA 1G5PA 1G16A 5JJIA 3QE0A 5FOVA 5F9FA 4E03A 1V5WA 2CCKA 1AGRA 3GLGE 2AN9A 1SXJD 4MGIR 2DPXA 3EPLA 2HV8A 4MRNA 1P2VA 1QHNA 4BUJA 1ZYUA 4BLQA 3OAAD 3SZRA 3KKMA 2C96A 2QI9C 4RFVA 1OYWA 4RJLA 2PZFA 1PZNA 5KSZA 2QRNA 4HI0E 2HYDA 3HU3A 1YZUA 3FFBA 3F8TA 2O8EA 4PPNA 3NIBA 4OHXA 1G17A 4C2TA 3FHOA 3GFPA 4C0JA 1II9A 3IBGA 2NO9A 3GD7A 1UAAA 3CIOA 3CF2A 2GAAA 3C7KA 1VTKA 4BE7B 2OFXA 3NWJA 4FIDA 2ZR0A 2ZITA 1IJFA 3C15C 4TLBA 3ZVRA 1U81A 1OXXK 2ZR7A 1F2TB 3ASYA 4X8MA 3C14C 2QT1A 5FFMA 4Q66C 1XEFA 4GBMA 3QY0A 3TW8B 2D4HA 2QP3A 3SBDA 4AYXA 4POAA 1AJEA 4DB4A 4IEIA 3K70D 2W2XA 1SVKA 1YZTA 2BVNA 1N6PA 1NMYA 1HH4A 2ORIA 2IEYA 3AUXA 2ODEA 4HB3A 3K0SA 4JLDA 3TAUA 4M1WA 2J7PA 3TK1A 3SFZA 4EJSC 3ZD6A 2J45A 4R71A 1E9DA 1RRPA 1ESNA 3IO5A 1XWIA 2BCJQ 3W8NA 5FR1A 3TLXA 1EFCA 3CZQA 5DE3A 2PJRA 4ZIRA 1OHHD 2JIZD 1UJ2A 2WWWA 4F7WA 1SHZA 3JVVA 4DT1B 2WHXA 4GP7A 4B2PA 1FNNA 4ZDKA 1HE1C 1TQ4A 5HE8A 4TZ6A 2CXXA 1CLUA 2OLJA 1G64A 3DPUA 4B2IA 4N3NA 1CJTC 2BEJA 1WXQA 4L9WA 1M7GA 2ZS9A 3ADBA 5EZ6B 2AHOA 1C9KA 4IXMA 2C9YA 4IW3B 4KYUA 4LJ9A 3SNHA 1GDDA 4G3XA 2BM0A 3RSLA 4A0RA 1CEEA 1SVIA 3KJEA 2HT1A 2GZHA 1Z6AA 4C9BA 4P3YA 2CDNA 3EXAA 3HR7A 5EXTA 3WP1B 1KI1A 2CL7X 1G20E 3K0EA 1X8JA 2Q3MA 3P4YA 4BLOA 1SKYB 1T91A 2CK3D 5B57C 4AKIA 3ZZTA 4LY6A 4B6FA 2YJTD 4CDGA 1BS1A 4UNPA 3MCAA 4HLDA 4URYR 2PMDA 2VIIA 4CEJB 4Q1AA 3ADDA 2IYVA 3PR1A 4NYJR 2DBYA 1GILA 2OCPA 2ORWA 3BRWD 1GNQA 4XVUA 3VHLB 1T3SA 2A3RA 1OIXA 2ASEA 2KJQA 3Q5EA 4HAWA 3PUZA 1NY6A 2BKUA 2GBLA 1N2CE 3ETLA 4MDFA 2R2AA 1JQJC 4KO8A 1YHNA 1Z6TA 4RFSA 4AY2A 4Q4LA 4L16A 4Q4HB 4A0GA 2XTNA 1GOTA 3RHFA 3U7HB 1FX0A 2QMUA 2ZRLA 3EC2A 2FMXA 2Z43A 4OKSA 4FCWA 4ZCLA 4JLMA 4DLZA 1SVWA 2VQSA 3VKWA 2IYTA 1XZPA 4YMSA 4DCTA 2PH1A 2XXAB 3K0FB 3KKNA 4NONA 1Z29A 2FSHA 4JBXA 5EE5B 2PX0A 1NJFA 4LYJA 5HCNA 4DSOA 2F1RA 2V1UA 3AF4A 2JLQA 2J0UB 3L82B 3IQXA 1AKEA 2MMGA 5DGXA 3U3RA 2GILA 2C9OA 3GJ6A 3LQQA 2GESA 2YWEA 3AV0B 2HYIC 1D2NA 4C4PA 3R8FA 4HB4A 1XMVA 1QVRA 3LA6A 2J0UA 1E2HA 1G3MA 1N3BA 1ZU5A 4JVSB 2JA1A 4AKGA 1TX4B 3SR0A 5FTMA 2CHVA 1Q20A 2IYXA 3KXLA 4DEYA 1SHKA 1N0VC 3GLIB 1KAOA 2F55A 1LF5A 4DRZA 4G5QA 4Q00A 1NVWQ 4A8JA 1E2MA 2N46A 3LLMA 5FPKA 5DLQC 2I1QA 1HUQA 2ECKA 1ZUHA 1TEVA 2ZJ8A 1Z63A 3WNDA 2KI5A 3FMIA 4OJQA 3WHLA 2R9VA 3OHMA 1S2MA 1MT0A 4QNRA 1OT3A 2GJAA 2X19A 1KY3A 1Z06A 3I8SA 1KIMA 1IXSB 3JVUA 3U7FB 4D80A 2BHRA 1G5RA 4M1MA 1AIPA 2G77B 3IPXA 4PC1A 2ZEJA 1YZQA 4BECA 4PQYA 1PV4A 1OXSC 4I4LA 1D9ZA 1VPLA 4TMTA 1GP2A 1NL3A 1XXHB 4QBGB 1S96A 3NBYC 2G0NA 2GZAA 1GG2A 4WZ6A 4TYPA 3O8CA 4YXWD 2CEAA 1QHHB 3V4RA 2RHDA 5H8WA 2O0HA 3OIWA 2NO0A 1W0JD 2QEQA 5HKKA 2IX3A 5H70A 5EXPA 2FX3A 5C1BA 3W5JA 1Z28A 1IN6A 3FHCB 1CP2A 4TYWA 1S8FA 1OKKA 2QRZA 1W4AA 1YZGA 4A15A 5KU1A 1L7VC 4ERNA 8OHMA 4A6PA 1Z22A 3OE7D 1XTJA 2ZJOA 3THXA 2O0JA 2VH5R 3VX3A 3AGPA 4ZCIA 3Q5DA 1G291 3AQ4A 4HLCA 2EWWA 4AG6A 1M8PA 2EWVA 2LKDA 3CRQA 4YONB 2IYUA 1G5TA 4LDJA 4L5BA 2FDCA 4Z8XA 2OLKA 4EPRA 1T3HA 1E1RA 4JSTA 1IXZA 1I4DD 1W4BA 2F43B 1ZIOA 3B8HA 2BMFA 3NEYA 1N5IA 4IOJA 2O8FA 3CRW1 3E2IA 2RGAA 5EP4A 1KKLA 4BLPA 1ZD8A 4AG5A 4BRUA 1W36C 1NBMA 3OF5A 5JJKA 1P7CA 1NKSA 2A5FA 5C4MA 1FUKA 5G3ZA 2ATVA 2QY9A 3Q9LA 4M1OA 2ZSDA 3FYHA 5FPYA 4PC6A 5F3WB 2QQEA 4G1UC 5FOUA 2GVZC 3VX4A 1RFLA 1XD2A 1ZM9A 3RS4A 1GM5A 4NCJA 4IXNA 1B23P 2FF7A 1XEWX 4MKHA 4AIIA 4KHZA 1SVLA 3NBZC 4B6EA 1KYIA 1CR1A 1XEXB 1YU9A 3BOSA 3QKSB 4Q9KA 5LBIA 1KK1A 5K8LA 4G0NA 2CHQA 1LS6A 3RLFA 3H4MA 3D7MA 3AB3A 3QPUA 3ZD7A 1KI4A 1CJVC 1ZIPA 3PFIA 3B1XA 2QTVB 4O2LA 3R7WA 2CLDX 3U4QB 2IXEA 2F3TA 1U90A 4RD6A 1TQ2A 3FMPB 4IDOA 2NTYC 1YRAA 5KYKA 3GP8A 2C04A 2NQ2C 2ZE6A 1N6NA 4TN1A 3PENA 2KWIA 2GAOA 3CRRA 3PQCA 1OSNA 4TMZA 1G7CA 4FMCB 2C95A 4BFUA 3B7GA 4JLVA 2YWHA 1KI9A 3CR7A 1U2RA 4IOLA 2VP2A 3I32A 5KHOC 3EZFA 3X1XA 3NC0C 5DYIA 2PEYA 5DISB 3M6AA 1UEIA 2D74A 2OESA 3QIAA 4IVRA 2OFWA 2P6UA 1XTIA 3UKDA 4CGZA 3QKTA 4NCIA 4CIDA 1XPRA 1GITA 5DYGA 3TQCA 3IILA 4QKQA 5HZKA 2V7QA 5D3MA 2ZI4A 1GL6A 4JT2A 4PC3A 3REGA 4JJKA 2B7BA 2WJYA 3AVVA 1VMAA 4LX0A 3QEJA 4NDZA 1IBRA 5JHHB 1E99A 3B1VA 1GIAA 4JLAA 1DAIA 1KI6A 1KZ7B 2WKPA 2QGNA 4OK3A 1AQUA 4C0QC 2J5XA 5AUQA 3HPRA 2FFHA 3I8XA 1NRJB 4Q48A 4KSBA 3KTAA 4MRPA 4A6XA 1DPFA 4M1SA 2GTPA 1ESMA 2CL0X 1F3OA 5HTKA 2JLXA 4BFTA 4LJYA 3UMSA 1OXVA 2WOOA 2BMDA 2W6JD 2ZIAA 3K0CA 3QBVA 1EWRA 2O5VA 3A58B 3HYRA 4HLUC 5JEEA 1TQ6A 2QNRA 3L8ZA 3K9GA 3Q8XB 3CWZA 3SI7A 1YR6A 2G1KA 3AP1A 3NH9A 3B60A 1VYUA 3F0TA 3VHXA 1EFRD 3SYLA 1J70A 4LC1A 3KQUA 2H57A 4O3MA 1J90A 4WXRA 1JALA 1XCGB 4XWAA 3IHWA 2CE7A 2QAJA 3W90A 1GRQA 5LD2C 2QT0A 4RSGA 4Q02A 1XD9A 2JIZA 2HEIA 1OHHA 3CNNA 5CYPA 1P9NA 2B6HA 4M9ZA 1SKYE 1US8B 1E32A 1HEIA 4V0KA 4MRRA 5AUOB 2ZVPX 2QP4A 2ZJAA 3KZ1E 3T35A 4B48A 1XJQA 2CNWD 1Z6GA 1DAMA 1NN3A 2YWFA 2QMHA 2UVQA 2ZI9A 1LTQA 4ASUD 1COWA 2HXSA 3RC3A 4B3XA 1GL7A 4MDEA 4RZ2A 2IYQA 1E9SA 2ZE5A 3F5FA 4M53A 3GFTA 1R0WA 5A5GA 2QL6A 2XTMA 5TVKA 3W6OA 3MGCA 1BMFD 5GVSA 1P62B 2GCNA 3PVSA 2ONKA 3THOA 3K8YA 1AKYA 3X2SA 1XRJA 2QM8A 4ZV4A 4JL8A 3WHKA 4CRWB 1GNRA 2JLWA 2ZRGA 3FKQA 4PQFA 3K70B 2ZVQX 2GCPA 2WWFA 3BK7A 1FX0B 3WMFA 1SQ5A 4Q21A 4QRHA 4TYNA 1A1VA 1G4UR 1KI2A 3QVVA 5L3RA 3CWQA 3P27A 5CLQA 4AD8A 1BO6A 4C0AC 1E1QA 1IY0A 1W47A 2R8RA 3EWSA 4UKDA 1BMFA 1ZUIA 1XTKA 1OH5A 4AWXA 3A37A 3DKPA 3UXMA 3EAQA 4A1FA 1N0WA 2ODBA 4ZI2A 5BN3A 4BPBA 1ANKA 3DVLA 4BZPA 3ZVLA 1G8FA 4KFTA 1WCV1 3MJHA 4FCVA 1U98A 2WJVA 4YMTA 5CK4A 5BQ5A 5CJPA 1S9DA 3OESA 5HR5A 2H92A 4NBSA 5G40A 4ACBA 2OXRA 4U00A 3NBFA 2R6CA 3W9YA 1PLLA 4UNNA 1NMXA 1N25A 3BFXA 4A9AA 3VQTA 5G53C 3TRFA 1ZVQA 4M1KA 2Y8EA 2P3SA 3FGNA 1NVXQ 2VF8A 1T0JB 2QU8A 5EUQB 1UBFA 1FTSA 1RYFA 3AF3A 1KK3A 4LSGA 4I1UA 4TMKA 4DVGA 1G41A 1E9CA 3QF7A 3PV0A 1EX7A 2OBLA 421PA 1E0JA 4WZAE 4EDHA 4HUQA 4DKXA 2VSFA 4Q7LA 5L3VA 2O8BB 2FNAA 2DCUA 4GPTA 4MYUA 4BRWA 1WF3A 4P32A 4OL0A 5FL7A 2FA9A 4DBLC 2JLRA 4BWYA 3QPWA 1Z0IA 4ZKEA 4B2LA 3VKHA 4XVRA 1OJLA 3K09C 3WBJA 3SEAA 5M04A 3CR8A 1KK2A 1NLZA 3KKOA 4H1VA 1AQYA 4S35A 2KBEA 2ZRIA 4URUR 3L2OB 1F6BA 3W6PA 5JRZA 1X1SA 1DBSA 4US0R 2JJ1D 3KXIA 3TKLA 5AR1A 3IUYA 2IHBA 3LY5A 4CT4B 3ZDQA 4KYIB 2ERYA 2D2EA 4LJ7A 2IW3A 4C2UA 5L3SA 2REBA 1E94E 4DSNA 3U7GA 4TL8A 1DE0A 1LB1B 2MMCA 4NL4H 4QFMA 1KMHA 1P9RA 3GFOA 1Q3HA 3OFNA 3DZDA 1F5NA 1GFIA 4ZDJA 2XITA 3FTQA 3QF4B 2BOVA 4WOPA 1FL9A 5EP3A 3CONA 1I2MA 2GF9A 4TSFA 1P73A 1KO7A 4NYIR 2BJWA 3LH5A 3NTUA 1W36D 4HAXA 2NIPA 4F93B 1BOFA 4MKIA 2OXCA 1Q44A 2ZYWX 4JJZA 1VG1A 4D6PA 3U6KA 5CK5A 2OEPA 1ZM3A 2OAQ1 3CBQA 1X8LA 3RS7A 1T8TA 4M4SA 2ZAMA 2K5UA 4V0LA 1E9BA 3Q72A 4EQ6B 2F43A 1CR0A 4MITA 4XVQA 2G0TA 2AFIE 1CJKC 2HDNB 3LW8A 4GNKA 2WTUA 3KFXA 3TH5A 1ZRHA 4MGZR 4C0KA 4CEHA 3AVPA 2EQBA 4B33A 5FPHA 1NY5A 3RRNA 2OE2A 4DWJA 5AJZA 4LBWA 1QBKC 1ZU4A 4Q1BA 3BH6A 3T1OA 1CIPA 3FHTA 1F60A 1Q1ZA 2C78A 1K5DA 3B1YA 1DO0A 3SN6A 5E95A 3ADKA 3K9LA 3NHBA 3W8RA 5L3SB 1TU3A 3MG9A 3P1JA 1ZINA 4KJZA 2R44A 3RYTC 4F4JA 1RJ9A 5FTNA 4C30A 5GJBA 1ZD9A 2ZRFA 2ZSFA 1RC8A 5IF9A 5AJXA 1G8YA 2AK2A 3TW4A 3OIYA 1JQLB 2EFGA 3BD9A 3KB1A 3PEVA 1G3UA 2MSDB 3KL4A 5FI1B 4LHWA 1SXJA 1M34E 1DAGA 1SULA 1F48A 3LBNA 4E5UA 3N2IA 1XX6A 4M9SA 2C99A 3EC1A 3B5JA 3U60B 1W49A 2CJWB 5ANRB 4PO9A 4KSCA 4QBFA 5FUYA 1SXJE 2CCGA 2GNOA 1E9RA 1K6MA 3Q7QA 2IS1A 2SHKA 4E07A 4BFSA 2ZYVX 3QPVA 2WKQA 4LYFA 1MRNA 2KSQA 1KDPA 1VCIA 2F3RA 4JKYA 1JJVA 4M9QA 3CKLA 2IUUA 2OT3B 2YOGA 2GJ8A 4YDSA 4Y0AA 1G8GA 4Q1CA 5K8TA 3A1UA 4V0NA 4QJ5A 2YWGA 2VP6A 2XXAA 1TAGA 4DJTA 2IYSA 1VIAA 3LX8A 4PPQA 4Q01A 5EE3A 2BC9A 1XJ0A 3BWDD 2D62A 4DXAA 1OFUX 2G83A 2VO1A 2FGJA 4MYTA 1Z2AA 1R8QA 2VL7A 4HDCA 4A8JB 2ZI5A 1U0JA 2J0VA 5FL3A 1XEXA 4TMWA 3K9HA 2FSIA 1JXMA 2DYKA 2J1LA 2IBMA 3UANA 4KITB 3RAPR 1HT1E 3ZVMA 3AVWA 1H8HA 3ZJYA 4X8LA 1UM8A 1KY2A 3U2QA 1W2GA 1UDXA 4R7ZA 2GRJA 5CDFA 4C0BA 1OKKD 4I99A 4BFYA 4OQFA 4PZZA 3UMRA 5DN6D 3THXB 3WNCA 2IS2A 1VG0B 2H1LA 5JJLA 2LCFA 2RGNA 4DDVA 1E3MA 1W0JA 2GBLC 2ZSAA 4LBVA 1CKEA 1E2FA 4NZYA 3S1AA 2X1VA 4RVCA 1R6BX 2CLSA 4IDNA 1SXJC 3EZ7A 4Z8YA 1JR6A 4OQMA 1BIFA 1RVDA 2NGRA 3MLEA 2ZANA 5HE9A 5H1YA 4DSTA 4DLYA 1DAKA 1TNDA 1OLOA 4TL9A 2ZETA 3G5UA 1WRBA 1ZC4A 2QENA 2OV2A 2REOA 1KI3A 3AP3A 3M0EA 3W6NA 3THWA 4IKEA 1ZC3A 4Y0VA 3PUWA 2WIBA 3BORA 2NO6A 3GCGA 3OEED 4GRAA 3OIUA 4JL5A 4KU4A 4JYCA 5FPSA 3AVUA 4JIMA 1CS4C 4B74A 5JCPA 1HY3A 1U94A 2YC4C 4CEHB 4TTQA 1RW4A 1P2SA 3WP0A 1ZP6A 2RB4A 4UJ3A 3ECCA 4B47A 3A36A 4NYMQ 3FMFA 2XZOA 5JMTA 2IF0A 1AZTA 4Q9LA 5KSPA 5CYOA 4B44A 4URZR 2WJHA 2UZ3A 1Z47A 5KPJA 3DO6A 4JLBA 3L0IB 4NCNA 2WICA 1W46A 2XSZD 3ND8A 4O0MA 5CB8A 5AK0A 3B9QA 1E0KA 4S2EA 5EE1A 5GJCA 3SDZA 3CF6R 2RGNC 4EFMA 2JDIA 3T15A 3FKSA 1H65A 5DH9A 1E2IA 3BBPA 4KFSA 1S4QA 1OYYA 2GCOB 4B76A 2AKYA 4CW7A 4O25A 5CJ2A 3N70A 3CX6A 1Z0JA 3AF2A 2KE5A 2WWXA 3LNCA 1EGAA 4G5RA 2Q0HA 3GQBA 2D7DA 1OE0A 2PJZA 4IOKA 4B43A 1KDOA 2HUPA 2VP0A 4A2WA 3IQWA 2VSOA 3L43A 1W36B 3GPLA 2GZDA 1XBTA 4JLPA 1C4OA 3KUDA 3QENA 2Q9CA 1G19A 1Z8FA 5E7MA 4RCYA 1COWD 2OCAA 4RZXA 4JL6A 1W0KA 1KO8A 4HLQB 2QTFA 4OK6A 4PHGA 4RCZA 4CYMA 3K0AA 1TPZA 1YR8A 2QAGA 5IHPA 2EFEB 3TSWA 4PO1A 4ARZA 2RGCA 1OB2A 2ZJBA 3LDAA 4HZUB 2R6GA 2FG5A 1FMJA 2FEMA 2GXSA 5F9HA 1L4YA 1O3YA 3P4XA 4RFSB 4C3ZA 2J7KA 1CU1A 4TYQA 2QE7A 4KAXA 3SE0A 1WBDA 3LO5A 2ZJ2A 2B92A 3P26A 1LY1A 4LK2A 1NG9A 1A82A 2VRWA 2QGZA 1HURA 2BKEA 4IDHA 1AA9A 4AKHA 3A6PC 2PLFA 3GLHA 1XDBA 1XU4A 1PLJA 1NLFA 1X86B 4CZ2A 1L4UA 1W4CA 5J5CA 3TR0A 4F91B 1QRAA 3EIHA 3GMTA 4KBFA 4Q18A 1OFTA 5KDDA 1XMSA 2BWJA 2IHYA 2JLSA 2XTZA 4QHSA 3B6EA 3IPYA 521PA 3B78A 1S0UA 2AL7A 3JZMA 5IRCD 5AUPB 3SJBA 4GFDA 4FMDB 3AKYA 4LOAA 4LYAA 1VHTA 2NPFA 2Z0MA 4LV8B 2L0XA 3BH7A 1TEXA 1KJZA 1R5OA 1OFIA 4PC2A 3NDBB 1M74A 1X1RA 4I81A 5SZKB 4RD4A 1T8UA 3KJIA 2HJGA 1GL9B 1YZNA 1P75A 1NP6A 4NTZA 3LXXA 1KI6B 1F2UA 5GJVC 5TDHA 4GT1A 1Z5ZA 3FPAA 1D2EA 5TXGA 2YKGA 2C98A 2C03A 3HPQA 4G5SA 1MO6A 1P61B 1S9HA 2YV5A 2PT7A 4IOMA 5BXQC 5EXXA 4EAQA 4ESVA 1M6NA 1JI0A 5HZHA 2GVDC 5LPNA 2PMKA 3X1YA 2V1XA 2YZ2A 1TF7A 3L0SA 1T6NA 3GLFA 4QXAA 5K8UA 3H0KA 2A5GA 3CZPA 1IHUA 4IVPA 4C0LA 4ZIRB 5EJEA 2NO1A 4LJ6A 1I4LD 5F2EA 1WA5A 1XJCA 1RZ3A 4TT3A 2W2VA 3T1VA 4XD7A 1UADA 3SHWA 4QGFA 4KI0A 821PA 3EZ2A 3GEEA 1M7HA 1SZPA 2J87A 5LB4A 2A5YB 2EFHB 3R9XA 3R20A 2FFBA 4JT4A 2IYZA 3ZQ6A 5LD2B 3W5IA 3GJ0A 4BASA 3U3MA 3WMEA 1NG1A 3MMPA 1T3LA 3RS2A 1P4SA 1UBGA 2P5SA 2XOKA 4HLUA 2G9NA 3I5XA 1VKJA 3RRYA 2XZLA 1G21E 1VIYA 2C5LA 3CH4B 4Q4AB 4B3FX 3B85A 4V0OA 4D4JA 1ZNXA 2Q21A 3CPHA 4EUNA 3CF0A 4TYYA 2F1IA 2ZRNA 1AGPA 1NN0A 2BBSA 1U0LA 2VEDA 5TY0A 3UK6A 1HQYE 3M1IA 221PA 3AM1A 3G0HA 3DOEA 5LB2A 1QG4A 1KHTA 2LWIA 2QTHA 2EVWX 1KK0A 3H86A 3K1JA 3MJRA 1EFUA 4CEIB 2LKCA 1E2EA 2RGGA 4PQRA 3DMDA 4D4MA 2P67A 2FWRA 4OHYA 3IIKA 5JCZA 5JBQA 4G5GA 2O8CA 2ZPTX 4US1R 4YLGA 4NKRA 5IK2A 2GEUA 2FOLA 1SVSA 4MKGA 4HUQB 1OFHA 3LW7A 2XOKD 1OW3B 3UMFA 2FSGA 3CNOA 4EPTA 3AVTA 4KFUA 1YE8A 3FMOB 1H8EA 2HLDA 4EQ6A 5B30A 1X8KA 4KLZA 1GAJA 4JKIA 3QG1A 2ZSBA 4FI3C 2V54A 1QDEA 1QHXA 3WBKA 2Q9BA 3MWJA 1Z08A 2WJJA 1G8PA 2GJSA 2WSMA 3QKUA 3AVQA 2V6JA 2WOJA 2WZQA 1Q0UA 2XJ9A 3GJ7A 2PLRA 5FI0B 4LHVA 1Z2CA 2FE4A 3WRXC 1JR3A 1CXZA 1FUUA 1NBME 5JI2E 2ZI7A 1X3SA 3EA5A 4EPYA 4QBHA 1K5GA 1F2UB 3KFVA 4Z51A 2IS4A 3T5DA 2O8EB 1GKYA 1YQTA 4DLUA 4OK5A 4OQLA 4A0HA 5L8VA 3SQWA 2F9MA 1E69A 5DN6A 3A1VA 2RGBA 3AGQA 3DL0A 2GJKA 3P20A 3TUZC 2WJIA 1E9FA 3FDIA 5J4VA 5JWOA 4CEIA 1MABB 4J0QA 2V3CC 4FMCF 4FMDF 1U9IC 4NYMR 1VG8A 4U7DA 3EA0A 5J47A 2IXGA 5DIFA 4U02A 1Z6YA 2OM2A 3MRSA 4LV6A 4KVAA 4Q03A 5FOXA 4NPHA 1B0UA 3THYA 2ZRCA 2FFAA 4DLSA 5FOSA 4JVMA 1NJGA 4OHZA 3NHAA 3O8DA 4LJAA 1EG7A 2J46A 1E4VA 2E1RA 3VU9B 4YMVA 1OH7A 3D3QA 1EFTA 3PEUA 3A1TA 5IK2D 1N6HA 3PUXA 5DHFA 1OXTA 1OH6A 1QZXA 4PAMA 3TAHA 1KO5A 4R2HA 3SFVA 5DO9A 3ZH9B 1ODFA 4AC9A 5AJWA 2IEZA 5P21A 1ZNWA 3J81k 2F7SA 2A5DA 3AEZA 1Q3TA 1LVGA 2IWRA 3RWOA 1FP7A 1E0AA 1FNMA 1MRSA 3CH5A 1TQDA 3A4LA 5TV2A 2DFLA 3QF4A 1S1MA 1GZSA 3LLUA 2EFDB 1E2DA 1SVOA 5FBVB 4DSUA 5KDLA 1G4AE 4LC0A 5DI3A 4F92B 4BLRA 1W2HA 4US2R 4NYIQ 4B32A 4RZUA 2JJ2D 4XWKA 4N1AA 5JRJA 2VHTA 1KAGA 3P32A 5JWRA 1IN5A 721PA 3KDSE 1GWNA 1D8TA 2WMNB 1G7RA 5AWFC 1XTSA 3UATA 1HE8B 3TVTA 1XCMA 4UJ5A 2BEKA 3C8UA 3LBHA 1TL7C 5FBRB 3AF1A 4Q19A 3LVQE 1CRPA 3RC8A 2FZLA 1VCNA 1J7KA 2J0SA 4DLXA 3NXSA 5KNDA 1RIFA 3Q7PA 2BMEA 1EXMA 2IS6A 4IFBA 1KKMA 1W4RA 1YJ5A 3RDPA 5JLJA 5CIWA 2H8KA 2VF7A 2ZRPA 1CR4A 1XFAA 4BLTA 1DS6A 4ILEA 1FZQA 3U44A 1UPTA 2RMKA 5KPDA 3AVOA 1ZMXA 4HAYA 4PO8A 1T5LA 2VA8A 3OFND 2D06A 2AK3A 4DLRA 1II8B 3UPUA 4A36A 2P2LA 2HF8A 2ZI3A 1KSFX 2I4IA 4FWTA 4V0MA 1Z83A 1W7AA 3GLHE 1OXUA 4Z1MD 1Q1BA 2IL1A 5EXSA 2AWOA 3K0AB 3LQRA 1KSGA 4NHOA 1X6VA 1D9XA 3PG5A 3D31A 4IHQA 4AKEA 4F4IA 5LDDC 3ADCA 2AXNA 4K8OA 3RNLA 4N0DA 3HR8A 4UNRA 1JXOA 3TQFA 2QQ0A 2IA5A 3A8TA 1II0A 3UWOA 4HDQB 2ZRAA 2IK8A 4C0HA 3BS4A 2DB3A 3PCRB 3AF0A 2YOFA 1Y63A 4MYHA 3U7EB 3WYAA 4EFNA 1JR3D 1HV8A 3EWAA 4RKFA 5EP2A 4Z54A 4U5XA 3B1WA 2O8FB 3THYB 3ZZ0A 4LWZA 4D2IA 4YXWA 1T5IA 5CITA 1XPOA 1HTWA 4OYHA 1WMSA 1ZM7A 3A4MA 5C46F 1UDWA 5FBQB 3TBKA 4GI7A 4OHVA 4EFLA 3KXKA 3EZ9A 2EU8A 1DAEA 1N6OA 1TF5A 3CO5A 3IKJA 5EQTA 3N5CA 5FH9A 1NIPA 3R8CA 2QE7D 2QMOA 3KB2A 2FPMA 3PITA 4A8JC 2J0QA 4NH0A 5A0FA 1M2OB 1NI3A 2PZGA 2E9SA 3E70C 3BFVA 4TLCA 2JLVA 2F1JA 2QUZA 1PLKA 1Q22A 4HSEA 3ZS9A 2JJ1A 2YHSA 3ZIAA 1G3IA 3HDTA 3KQHA 4B75A 2A30A 2W6ID 3GJXC 3UIEA 4C0SA 2JJ8A 1ONBA 3LWNA 4MH0R 3LX5A 4URVR 5J4YA 3PXGA 2CMKA 4TMVA 3EG5A 2HF9A 1FMLA 1TUIA 4LJ5A 4FWIB 4ZDWA 2ONJA 3RVBA 3T12A 2ODNA 2V55B 1LW7A 1GTVA 5FL7D 4TQ9A 3ZYCA 4KODA 1J8MF 5JI3E 5DHAA 2F9LA 2J9RA 1JPJA 1NF3A 3AKEA 2TMKA 3K53A 4LHYA 4P33A 1FTNA 1NLYA 5DSZA 4MGKR 3HYTA 4XH9B 4JZKA 3LAWA 3UWKA 3ICEA 4NMMA 3SHFA 3WYFA 4LCBA 3SOPA 2PX3A 2B7CA 2I3BA 3T1TA 2AFHE 1ZCAA 4M22A 4NE2A 3TIFA 2P6RA 2ORVA 1U8YA 1XD2B 4M9XA 2I1VB 2XNSA 1DAHA 2OZEA 5E3HA 2FN4A 4PZLA 4NYJQ 2OCBA 1KDRA 1II8A 4II7A 3WYGA 5TMPA 2HCBA 1HT2E 4P4TA 2ATXA 4F4CA 2YINC 1DG3A 4JLKA 1KDTA 1YRBA 5FBWB 1NSTA 3CPJB 3HWSA 2VYFA 2J59A 2R65A 5KNCA 2XJ4A 1MO3A 1IXRC 1A4RA 2KB0A 3CX8A 1E1QD 2W2TA 2V6IA 3CRVA 2R6FA 3TUJC 2DWPA 3EX7C 1E79D 3U3JA 1E2QA 1D5CA 3L0OA 3SBEA 1MOZA 2GXUA 1G6HA 1S3GA 3GJ4A 4URWR 3RS5A 5FBLB 2QPOA 1QF9A 1LFDB 2ZUCA 4EKDA 4D0GA 5G3YA 4TMXA 2G1JA 4KCGA 5EP1A 1JPNA 3QNUA 4LJ4A 4PXAA 4D81A 1OH8A 4URXR 2NOAA 1J2JA 2CK3A 1FW6A 4QBIA 2WWIA 3IDQA 3BB1A 5DI9A 4V0ME 2ZRHA 2CCJA 4FW9A 1IQPA 1Z0AA 2ZQ5A 4HEJA 5C18A 2IYRA 4QM6A 4MKFA 1JB1A 4NCHA 1R2QA 5JFGA 1FQKA 2XGJA 1CJUC 5CM9C 3THWB 3GLGA 4UXIA 2ANCA 1E2LA 3BB4A 4YMWA 2G88A 4LGMA 4L15A 4UQOA 3KUCA 4JLJA 4XTCS 3IHLA 2EW1A
chains in the Genus database with same CATH superfamily
2IZZA 1SBYA 2A0XA 3JZAA 4NP6A 2C2ZA 2E3JA 2R96A 3LMKA 3CEAA 3HGMA 2XZPA 4DIMA 3EF1A 1N2HA 2AUTA 2H29A 3NTLA 5ALPA 3D7RA 3CPEA 1L1RA 1W5EA 4JJEA 4RTKA 4OI1A 3TAXA 5ALUA 1UXKA 4ZA2A 4JYPA 4QBTA 1JBQA 2VHZA 3ZHQA 2P0EA 2PZEA 1JWLA 2EGGA 1SUCA 3MFYA 3REFA 2ESRA 1SOMA 2Q6KA 3AKCA 3GLVA 3K73O 4HWRA 3RD5A 5IJZA 3V3KA 2AX4A 2AT1A 1WMFA 4KBYA 4QQKA 2BLNA 2M6RA 5EIAA 1E3QA 1GZ4A 1SNYA 4MLCA 2I76A 4RNDB 5CM8B 1SB8A 2PWBA 4JT9A 3PC2A 1MFZA 3PJDA 4JOCA 2JK0A 3CWCA 4X8HA 4ZEWA 1T2DA 5FOWA 4FGWA 3K0FA 4MZXA 1B1AA 3LQ2A 4OQQA 2DXIA 4IDPA 4PEVA 2OCKA 1ZL2A 5ICCA 3I62A 2JATA 4QLOA 3PDIB 4KQWA 2Y0EA 1U3TA 2WSBA 1FP4A 3CFYA 1Y34E 2P8JA 2Q2QA 2UAGA 5UKDA 1QG2A 3VU8A 3PBKA 1FK8A 3WO0A 5IG2A 4QE3A 2EFYA 1L8QA 2A1TR 4R7TA 5KOHB 1Y98A 2WYIA 1BKDR 4I4TF 4JQOA 4QYTA 4BCDA 3VZPA 4Z0PA 1L1FA 3AR8A 3QLEA 4ABYA 1DT5A 3KCNA 4KLCA 2NUPB 4IXTA 5GINE 1JRLA 1KJ9A 3E5HA 2A1TS 3GT4A 3E5NA 2GETA 3S2SA 1RCFA 1B1CA 1J9GA 1ELOA 1V3QE 1IZYA 2GUWA 2G9QA 2DFDA 1XF9A 2VXOA 3HKEA 4G37A 4TKZA 3ZQ4A 2I9KA 3DYVA 3MGBA 1GTSA 3IMFA 2GEVA 1CQIA 1FFXA 3D8SA 4QG7A 2MR5A 1P9LA 3KOUA 4GDFA 1S01A 4HDKB 4OQNA 3EY4A 2ZYTX 3HB7A 5ALYA 4K6OA 4LKOA 4EP1A 3KQTA 4BKOA 2O6LA 1X39A 3AXSA 5JZVA 4R8MA 1JFVA 2C5GA 2VH2A 2H18A 4CM1A 4KO4S 4OBEA 5C2JB 3BD8A 5LLDA 1AO3A 4DV4B 4KQHA 4Z9AA 3BTSA 2EP7A 2BUAA 1YKSA 1CQPA 1TQHA 3JAKB 3O4JA 4M7OA 5K3FA 1DGQA 3T5TA 4H08A 1CHNA 1P5HA 1TU4A 4ENUA 4RXUA 1IN4A 1CNFA 3FVQA 5LMCA 2QTWB 1RQXA 1RWXA 5DT9A 3U4QA 4MYSA 3FOFC 2WTNA 2DFPA 5AXBA 1GN8A 3OJ0A 2QTMA 2RDMA 2K6GA 3N2EA 3RSZA 4OD0A 3I1FA 3LTEA 4D0LB 1SCUA 3DP7A 4UAUA 1B6GA 3OPVA 5ES4B 2ISQA 3T4UA 3L4EA 1PJTA 1Y7PA 3JATB 4TTRA 3S2FA 1DTEA 4ANFA 5AW7A 1P33A 4TVKA 2JDID 2R6AA 4GLLA 3IQHX 3KUUA 4AYTA 2IYPA 2DHQA 2OO5A 4PAOA 5ICFA 4CNQA 2JRCA 4PFQA 1SCUB 1HE4A 2ZBPA 1LGYA 3DL2A 3OJFA 1XCPA 2PIDA 1TK9A 3GXOA 2CJXA 1XXHE 3FWYA 4IIXA 1D1TA 1U7UA 2O14A 3UT5B 1SBQA 4PCUA 4CLHA 5DXFA 1HYHA 1I7NA 1MQ9A 1W76A 5AIAA 5K0GA 1TD9A 1JG6A 2V4ZA 2XWQA 3A9TA 4BFZA 3A2KA 2Q4RA 1O96B 2B21A 4AI6A 2Q5FA 3FNFA 1IHOA 3FWZA 3S28A 1CZNA 4AT1A 4AJEA 4H31A 1SCBA 3E7PA 3OEHD 2QBYA 4QATA 3E27A 3PKZA 4JEIA 5K0NA 4C7KA 3KBBA 2XB9A 2IH4A 1UWLA 2GJ9A 4P83A 1ZNZA 4G63A 5FLKA 4I8IA 2QX4A 2V9ZA 4TN5A 4F5ZA 3M6LA 1H2FA 4MJXA 1IPHA 2QN6A 1NMSA 2CL6X 3L06A 3EBOA 1QAQA 1WZIA 3JCZA 1JILA 3TX2A 1TLFA 4XCXA 3AHHA 4K81B 4NU0A 2ANBA 2BBTA 4R05A 1RHUA 5H68A 1JS1X 5DEIA 2D2FA 1OPXA 5EJ6A 1GRRA 2Q2WA 3CT6A 4M1ZA 1N1MA 4FYIA 5BT9A 5B1IA 4W82A 4CM4A 3EG9A 1QE0A 3OJLA 1EFLA 2Y1GA 2W9XA 4FQ8A 3SIXA 5GADl 1UBUS 5J4HA 2IUYA 3MJVA 4ZC1A 1ZWKA 4CT5A 4DR3B 3NUQA 3T3NA 1WHTA 2C9CA 3GJSA 4EG4A 4Y1GA 1XCJA 1WE2A 1XG5A 2WAAA 3TFOA 3DNMA 2JCYA 5HOEA 2B9VA 3GJ5A 3WL8A 4HBZA 3LXRA 2MT9A 4KMOA 2Z3WA 4H9GA 4U2GA 3FPFA 4DC9A 2RK4A 3NFRA 4PE5B 4ALJA 2YS7A 1OYOA 4WACA 1C3OA 3SEFA 2ZBEA 1VI6A 1BG6A 1LK0A 1R5NA 4PQGA 1EFPB 3L7BA 4BYGA 3G13A 4H3VA 1BZYA 1RWVA 1UKEA 5KTYA 1TA9A 1UOOA 2V7WA 4MSUA 3DE7X 1PWXA 2REXB 2ZJ1A 3CNLA 1C3EA 3ZGXA 4EIWA 1PYGA 1B26A 4KXFB 2AR7A 4DCNA 1XALA 2Z6VA 2I9PA 3L3BA 1H2HA 2J8ZA 1AURA 3U5TA 4P4SA 4P98A 3QFFA 4R9NA 4U4AA 1WXWA 4G07A 4YCBA 2Y0DA 4OLFA 4Y2UA 3KIPA 2GF0A 4ZN6A 4R6XA 1SKMA 2JI6A 2WIAA 2WKSA 1MU0A 1C9DB 2MYUA 4P31A 1NVVR 2CFIA 1PUJA 1N5RA 2FI1A 1QRTA 3UGJA 2X1LA 1C14A 1UEJA 2DFTA 1GAWA 1RWNA 4K3VA 3RAJA 4NU6A 4W4TA 3S2ZA 1J5XA 1JZQA 3EFOA 4BMDA 3FF1A 5CDTA 1U9IA 2PSEA 1VLQA 1XP8A 2P3OA 3G2MA 3H2YA 5AKGA 3ANNA 1PQ4A 2WV7A 1L1QA 1W44A 3Q3JB 3HGQA 2DUNA 5C0OE 4DNXA 5KWSA 3OQBA 4U9UA 2QORA 2R1VA 4DIDA 4ZU6X 3EEYA 3OZXA 5JXIA 2F6RA 5DKFA 1H1DA 4I50B 4OBXA 3AIMA 1JVSA 2A3NA 2Y92A 4HUTA 3G2NA 3C41J 5KSOA 2X5NA 4JGGA 4ZQHA 4YUVA 3WR5A 3ZWCA 3WTCA 3LV8A 1DQYA 5EHQA 3QI7A 1KI8A 2L69A 2ODQA 4P81A 5TQVA 1CEYA 4KRYA 2QL9A 4IIJF 1KZYC 2QYOA 2OHGA 3G8AA 3KRTA 5HMLA 3BCHA 3CW8X 2ZRMA 4I50A 3OMLA 5ICEA 1T9GS 4MR7A 1IRXA 1M7BA 3HJBA 1NLUA 1PW7A 2N1MA 2QD3A 3DFMA 3KQPA 4J0EA 2ZU0C 1ORRA 1XKQA 5EZYF 2B5VA 2XCIA 2J3JA 5DBGA 3FPEA 1VE3A 3WMWA 4ZJYA 2DFKB 3SC3A 4WXHA 1SOVA 1TADA 3F74A 3OM9A 4D9CA 3M4XA 5MDHA 4MGEA 1YFZA 2Q6IA 4XFDA 4F38A 3FR7A 4NOLA 2I71A 1ETUA 1Q0QA 2EHJA 3MGKA 2ZWMA 4JDPA 4TS9A 4GE0A 3OMXA 1UP4A 1V5GA 2ZZNA 4HWTA 1HZZC 2DQYA 4LOLA 2IFTA 3A6GA 5EIFA 3FSGD 1E4OA 4JUDX 2I4TA 2X8JA 3EVBA 5EJFA 1L5OA 1N5LA 5GIOE 3KSBC 2WJ4A 3QX7A 4DANA 4GR4A 2F3PA 2DUWA 5JD5A 4UOQA 2EXXA 3SEZA 4CEJA 4PZUA 3GLSA 5JMWA 5IJXA 2D4AA 1DG9A 1QSGA 4MCIA 2NUTB 5K3CA 4ZEXA 1FFAA 3QJYA 4X66B 4NQZA 4TSFD 3VNBA 4LF7B 3EWIA 4MUBA 4NBVA 2YXDA 1AS2A 2IYYA 5ED0A 1B42A 4QJ4A 1K5PA 1JHQA 4LPKA 5DNAA 3UJPA 3NFYA 5AM2A 9MHTA 5H9VA 1KY4A 1IN8A 3A70A 3O8BA 3C6XA 2OZVA 3DZIA 2ODPA 3QVWA 1SUAA 2CF6A 4RIFA 4Q4HA 4KREA 3O8RA 4OG2A 1RRCA 3VH2A 4BJ6A 3EZLA 5HM8A 2AEEA 2A9QA 1DWUA 4TX1A 5EXEA 3ESQA 3DE3X 2CJWA 4OP3A 4R0VA 5DGDA 1TUBA 3TDKA 2I7VA 4ESHA 2PPVA 2C1XA 2HQRA 3N87A 3EUEA 3O84A 2BFCA 1PR0A 1QB8A 2JGNA 3G49A 3LY7A 3P9YA 4IVQA 1FNSA 4L2IB 2BJHA 3IT1A 4IDFA 3W5CA 1OWOA 1GXSA 2K7FA 1G18A 1K2WA 3PPYA 4JY7A 2IC5A 3KHTA 4WCFA 1RYBA 3ITDA 4O4IA 4C3OB 1NW7A 2A5JA 4ZZ0A 3D0QA 5KOYA 2C58A 3UW3A 2RH5A 4OFBA 3AM5A 3VR3A 3EARA 4UHBA 1P2TA 1V3VA 3IBYA 4MK4A 1B14A 4NEGA 3CGWA 5AVZA 3ITNA 4J43A 3BIJA 4YT4A 5C5DA 1JHDA 1S7CA 2PX6A 1J2RA 4RACA 5HGXA 4PNZA 4E2YA 3KWJA 3GLQA 1D1QA 4AUNA 1XXHA 4IRUB 3KYJB 2BZGA 3Q3CA 4TRNA 4UATA 3CA8A 1XEWY 4MS4A 2WYHA 4W5JA 2OHVA 1DBIA 4LI3X 4OQPA 3PEWA 1EKXA 5KB3A 3OZBA 2EEPA 2ECQA 2QPAA 2UYGA 2FV8A 3C8DA 3IR7A 2QAGB 4X7PA 2PRSA 2M6KA 1AH2A 1VL6A 4GSYA 2V4MA 2OBFA 5FBZA 5AQ1A 3KJGA 4MVCA 4RPKA 4OI2A 5C7YA 1EU1A 2WHQA 4IBOA 4NJMA 4QM7A 4CVNA 3D8BA 3CZMA 1V1RA 3ZGZA 1R3UA 4EJMA 4Q6WA 4WAUA 3DAFA 1IATA 4TRRA 5T3YA 4R3NA 1F12A 1FMTA 2H16A 3C3PA 3U3ZA 4EPVA 2XRMA 2G17A 1H2WA 2XAAA 4X60A 5AM0A 2FRDA 1E4YA 3QKWA 1R6AA 4FPXA 2BFEB 2WF9A 3AUUA 4P08A 3CCFA 1DX4A 4WBSA 1T1GA 4ERXA 1K8RA 4WA7A 1UDCA 2B4KA 2HLPA 4FR5A 1BXRA 4MMZB 3M5PA 4I0WB 5JVDB 2TMYA 3LP6A 2XX3A 4J1TC 4I08A 5FUMA 1X38A 1TQ8A 3H11A 1MBZA 3LPMA 4GI3A 5CX1B 2I7XA 1M34A 1XLUA 1RPTA 3HHEA 1IBCA 4MV6A 3ASVA 4YCDA 4OB7A 4AS3A 5AI0A 2FVYA 3NGMA 3BH0A 4RH3A 3TGLA 2C4WA 4JLWA 3BJEA 4ZV9A 3VBCA 4BKMA 1PN3A 1Z62A 3OEWA 1SRRA 5J2TA 1YR9A 3HI6A 3E9RA 4HQNA 5JCOC 4JJ6A 1EFRA 3ZXYA 3SX2A 3QV1A 3NUZA 3WGTA 4CKBB 3HDHA 5IVDA 4B84A 4B2YA 2HAEA 3WGZA 3VH3A 3ZZNA 3TNYA 3NDIA 2O3JA 1D03A 2HNAA 3ANXA 4X63A 3RU7A 3TTWA 4ARIA 4NBRA 4MA5A 1V8OA 1N2JA 3V7FA 1KZ9A 3MT8A 4FKZA 5K4GA 1R9NA 4BQQA 1OGIA 4D4KA 3K5PA 1AKTA 1N6IA 2EL9A 3EXG1 3E6AA 3I6QA 1XZGA 3KQNA 3F46A 2QUKA 3GFVA 2H4WA 4L50A 2NV2B 3W4IA 2X77A 2YOHA 2IF2A 3ZZUA 4UTVA 2OOKA 1ZA1A 2B8TA 4Y6QA 1VMIA 5A5DA 5L4LA 1VYVA 2VG8A 3CUWA 3BIWA 4OV6B 4YX9A 1RZUA 4I4IA 3WC4A 2X2FA 5BW6B 1EBBA 1Z07A 3H5OA 5AKHA 4GMHA 2P9FA 1V5EA 4ND5A 4DV6B 1QFXA 3ON5A 4P54A 3WBBA 3QWIA 1AHPA 5A5VA 1TI7A 2DWCA 2WFLA 4Q3LA 1PR1A 3THRA 1HK7A 4TZKA 2V7QD 4ZHQB 1H6AA 1GKLA 3C5EA 3DUWA 2OBNA 3A27A 3QY9A 4D42A 1YAJA 3VNUA 1GXSB 5AJYA 3SGLA 1SU7A 3WISA 1Q7CA 2BSAA 4N4AA 5K2OA 3RARA 3BE6A 1D0VA 2I2WA 4AZWA 3WWDA 4RPCA 4WLOA 4ZYZA 4RABA 3DTVB 3IB3A 3KR0A 3LPDA 1Q21A 3LHIA 2B69A 3LC7O 2KBFA 4ND3A 1Y3IA 3M2PA 4UNQA 2D2VA 3FPLA 4K2AA 4AJ9A 4LHZA 3TNFA 5FA6A 2A35A 3PVCA 2FPSA 4FNOA 4GI1A 4RD1A 5EE9A 1N78A 3OT5A 4MW9A 2WA1A 4OHPA 4RF3A 4DDUA 3EXEA 2QL7A 2QRPA 3HCFA 4ZCMA 1HLFA 1WTCA 3PUVA 1NM5A 3HV0A 2Z4RA 5DLPA 4D0RA 5LP6B 3C6BA 3KBOA 2A2ZA 4KH1A 1N7GA 4LZOA 5CA1A 1MIOA 4U8GA 1FJGB 3HJHA 3D6TB 2C1ZA 3VSEA 3QOFA 3CPSA 5F76A 5AOAA 1DIHA 2ETVA 4G85A 5I8PA 5AESA 1QYIA 4WLNA 3W1VA 4G81A 3AXTA 1UCFA 3JR7A 1XTRA 2W8BB 1ZSVA 3C6QA 1E1KA 2F1HA 5D00A 3HB5X 1THZA 1QKKA 1HYEA 4LMRA 2Q6TA 1G2IA 5ALEA 3QIVA 2OKGA 1NN5A 4I4CA 2P65A 4UEOA 2OXIA 4YEDA 3ROEA 1QNFA 2OAP1 3EASA 4LW8A 2HZBA 4TUYA 3AOEC 2DR2A 1ONOA 1CRZA 4GMFA 5G0SA 5EKTA 1U5BB 4BAUA 2CGEA 3JZFA 4LI0A 4OREX 4AJ2A 2IPAB 3H8SA 1IY2A 1G2OA 5LYJF 2JLZA 4O1IA 3OM8A 1AUOA 1SVMA 2OL4A 1Z4LA 4N3BA 4U2FA 3RFXA 3UJ3X 5JRDS 1D1PA 4C7XA 4EG8A 1MVOA 4NXMB 1DLIA 3LHKA 4I3FA 4IICA 1JHOA 5ER9A 5I9IA 2FG6C 4QUIA 1LNQA 3ICQB 4B3GA 5G0WA 3P96A 3ZY2A 4DRXA 1IZ9A 3AUSA 4FN4A 1NN1A 4OMUA 4J2OA 3AL3A 1T2AA 2WUGA 4O5OA 2K4MA 4EW1A 5MFZA 4BNHA 3G7UA 4IGEA 3GRFA 4OHWA 3BHIA 1XQVA 2IHVA 3E9DA 4M21A 1GFWA 4QARA 1N92A 4N5LA 1H5NA 4NG4A 4B73A 1OA0A 5CW2A 4DC0A 3BICA 2PEZA 4D96A 1W581 2SBTA 1B6RA 2NVOA 5IYZF 3KTDA 1QH8A 3LUJA 4LZJA 3TQRA 4EJSB 5G1NA 4KN5A 1HM5A 2PL3A 3UKJA 4AJJA 1DTSA 1Q1QA 4C08A 2AN5A 3DAHA 1U8ZA 4Y6GB 4HAVA 3DZCA 5B2ZA 4QDXA 1PZGA 3FX2A 3G0IA 4IDDA 2WU3A 3HKBA 3SXJA 5B58C 4Z1OA 3C8ZA 4F3NA 3ANYB 5HFNA 2XB8A 3AU9A 4ID3A 5FPTA 4RLHA 1UBHS 2XTAA 3G9XA 1XHLA 1NBEA 2BKVA 3IOBA 3TOSA 5C1OA 3GI1A 4YAUA 1UQTA 5BSMA 3BWYA 1NYLA 3BJMA 3P5SA 2W4IA 5ECGC 1ODCA 3G0GA 3V4FA 1AK1A 3MTBA 3LD9A 3PHJA 3GGOA 4BWGA 3Q87B 1DXOA 1JVBA 1FP1D 3AR5A 3N8GA 4B87A 2OBMA 5F3RA 3KSZO 4N0PA 1SXPA 1BQEA 1GUYA 2CLLB 4YR9A 1DO2A 3CB4A 3LCVB 4DDHA 3VDNB 5DSTA 2XRZA 3A05A 2D7CA 4MUKA 1Z0DA 3AOEA 1C1YA 5DHSA 4DABA 3LOPA 4PLYA 2FN3A 1EGMB 1FRNA 3OPNA 3D3KA 3D0OA 2BMWA 2VH1A 5E9JA 3KLOA 4LJ8A 4FN5A 4QHYA 1HDRA 3ABZA 1D6MA 3DWEX 2ST1A 3B9BA 2F8TA 1LQUA 3JASB 3D8HA 2VDUE 3LM8A 5FWDA 1FPMA 2ASVA 2DPGA 3UG6A 1Q5PA 1JDSA 5C8VA 4GGPA 4H3KB 3X1WA 2QJTA 3WSTA 4EW2A 3KKQA 3GEHA 4KR2A 1PAUA 1E6CA 2Y99A 4LHXA 2VPPA 2CUKA 2JAHA 2Q9UA 3LRTA 3NIFB 3LPCA 3Q85A 4TKMA 1V9SA 5E7JA 4CLDA 1I3CA 1CEQA 3IIMA 1X9IA 3GLGB 3WRWA 2P2YA 5LP6A 1RRVA 1YS6A 1U0SY 2P1RA 2QXYA 1T0IA 2QUHA 3SZGA 4N40A 3LSYA 2NLOA 5FFFA 5EHIA 1UBCA 2AE1A 3D2LA 3TRKA 4B6RA 1Z5WA 1GYRA 2YV4A 1T5HX 4PPFA 4QGAA 1B8VA 4U2DA 1Y3BE 5FHRA 3TEJA 1JAYA 3IEUA 2OCGA 4K9MA 3M4YA 2WAYA 4ZQFA 1E3TA 1R0CA 3EVGA 3ZDYB 4D0NA 4BQEA 3UQYS 3I01A 3STYA 5F52A 5HKOA 4KK3A 3IC5A 2Y77A 2O7RA 2OHFA 4WESA 2C4MA 2PRYA 1FOEB 2H0QA 2WNIA 1GVNB 2Q0QA 2P5TB 1K7EB 2QD4A 3LGSA 2G0AA 2OYSA 3FH0A 4L78A 3OQIB 4EY4A 1SK9A 4QQFA 3IE0A 1TUEA 1WQ3A 4JOQA 1SUPA 2MSKA 2BGWA 3KYBA 4H0NA 1LLFA 3EXIA 4A27A 1Y4SA 1LDMA 2C9DA 2O3RA 3DMPA 2VNKA 3FHLA 1JDTA 2FZ4A 2GN8A 2PBRA 1DB3A 2J3DA 4K6FA 2OK7A 4OGLA 3V8EA 1TVKA 5BV1A 1V4BA 5ECWA 3A28A 4D4LA 2V9PA 2VXCA 5LJIA 5JXHA 2ZSJA 2A9JA 5EWMB 5JNTA 1FYEA 5EEGA 1ECJA 2LE0A 4G0ZA 3I9LA 1CSEE 2G4LA 3M1YA 3QLTA 1P74A 2DLNA 4KTVE 4C5BA 2O8CB 3PXXA 1VKZA 5BORA 2IQIA 4FCTA 4G0WA 1P6QA 3PX2A 2ZE8A 4A0FA 5K6TA 1JB9A 3QVMA 5T6BA 2JLYA 4DA4A 1Y6ZA 3BMNA 1R8JA 5E9AA 2ZROA 1WW2A 4UBJA 3GH1A 2P6PA 1R5BA 3HBMA 2N0SA 5DMHA 1KARA 5FFNA 3N58A 3Q0EA 5BN5B 4EKIA 4PZYA 4OM8A 1L7RA 5E6UA 1E7RA 5EJIA 4YS6A 5DU2A 4QEKA 3LUCA 2QRGA 1DJOA 3O2NA 2YASA 5AQEA 3WYBA 1I4OA 4E03A 3QMPA 3GLGE 1WUTA 4FB5A 3EPLA 1JPVA 4B40A 1P2VA 1QHNA 3SDBA 2IHZA 2C96A 4RFVA 1OYWA 2VDRB 3UJBA 5DHUA 1PZNA 3RSFA 3M49A 5ADVA 2QRNA 1ZO8A 3HU3A 4HI0E 3A0RB 4YBRA 1YZUA 5CAEB 5LR6A 2VEOA 3L7KA 4N18A 1U0EA 3CLUC 4R2XA 4OHXA 2O8EA 3VR6D 1EMDA 3GFPA 4C0JA 4BGEA 1I5EA 4UVEA 1UAAA 1QYCA 1Z17A 2X15A 1MEJA 1ZX1A 1VTKA 4FFPA 4FT2A 2Z09A 4BE7B 4DCCA 3DZFA 4EUEA 3IOEA 4FIDA 2ZITA 5JROA 1MJGA 1QUFA 1IJFA 2XGGA 3JALB 4GHWA 2C2KA 3R4VA 4TLBA 1YUBA 3UY4A 3HBLA 3ZVRA 4PFKA 5A3RA 5CVVA 2TS1A 5CVJA 3RRFA 2XADA 2ZR7A 1NF8A 1F2TB 1MB3A 2VHYA 4BNVA 4IHKA 2F1KA 4JENA 1XEFA 4CKEB 4QO8A 1YCFA 5JTUA 3TW8B 2B7LA 1M67A 2QP3A 1SBCA 4M87A 4NBUA 5ALFA 1UKAA 4AYXA 3URKA 5D85A 4IEIA 4UCWA 3K70D 2W2XA 1SVKA 4KO1S 5FBKA 4BMZA 1HE3A 3P9SA 2XMZA 2QW1A 3A6JA 3CNBA 1K66A 1WZEA 2ORIA 3KG2A 3R3UA 4KMSA 4N49A 1VCHA 5CPFA 3A6KA 3ZWMA 2ODEA 3K0SA 1SBIA 3TAUA 3N6VA 2J7PA 5BRAA 3TW8A 4PGFA 1T13A 4JBLA 2IQ5A 4GPBA 1RRPA 4Z4HA 5EHZA 2WVGA 3D5TA 1FU8A 1OAAA 3LYLA 3JQBA 4QOIA 3TLXA 4M83A 3D5EA 5DE3A 5K8JB 4OPMA 5K4AA 5HCUA 3OQMA 3IUMA 1XZDA 3K05A 4F8JA 1Q7RA 1UJ2A 2WWWA 3O7MA 3HR4A 3MPOA 1E5XA 1E8MA 4MVJM 2KLBA 5E1OA 3VOBA 4GP7A 1U3VA 1GG8A 4HH4A 4H18A 1HE1C 4G0OA 5TT0A 3M6XA 3PZBA 4AMZA 1J24A 1ODKA 1PFWA 4N3NA 2Y1WA 4HD8A 4R7GA 4DY4A 1CJTC 1GTL1 3DF9A 3I5UA 3L7AA 2BEJA 1WXQA 2YJNA 2OV6A 4L9WA 1YK0A 2QTRA 3ADBA 2AB0A 2J5RA 3LDHA 4JOSA 2AHOA 4UHFA 3TXYA 1FBNA 3VDQA 2JKVA 4JBIA 3NM5A 1ND5A 2I5PO 4LJ9A 1GDDA 1EAYA 1SVIA 2J09A 3KJEA 3HVUA 1Y4ZA 3IQEA 1Z6AA 1ACMA 3DWGA 1O77A 2BPOA 2R7KA 2IOQA 3EXAA 2NV0A 3X1KA 4ZT4A 3D4OA 4HEA6 2Z3VA 4HCJA 4BLOA 3IAS1 2Q3MA 2C7RA 4YAOA 2BR4A 1J39A 2C07A 5LA6F 2P2DA 4CDGA 3VBEA 2C3YA 4HLDA 4EMSA 3V2HA 4FHCA 2PMDA 1F8YA 3G3EA 4S24A 3EGVA 5BSGA 1VBKA 3DPIA 2C5HA 4KQXA 3U4CA 3I30X 4BO3A 3TYXA 2CJFA 2ZUUA 1ZK2A 3O8OA 5IKXA 1Y1RA 1E20A 1G0NA 4A73A 4BMOB 4EI8A 4AM8A 5T7BA 3K0BA 2A3RA 2H6EA 2TECE 3CUTA 4FGKA 2KJQA 1NU6A 4JUBA 4HAWA 1FNDA 2OGSA 3PUZA 5AJUA 4HVLA 1I2ZA 5KNCH 1QKIA 3BVPA 3ETLA 3PNMA 3F47A 4MDFA 2E4UA 2R2AA 4NMLA 5LQUA 1PT8A 3DLCA 1Z6TA 4AY2A 4HQKA 4A0GA 1P39A 3KT0A 4X41A 1RXSA 1DUIA 3P0HA 1GR1A 5AI5A 5K3BA 1Y81A 1DEXA 1QO0D 2FMXA 1CR6A 2Z43A 3NBKA 1T4MA 4OKSA 4Z99A 4FCWA 3HBAA 3OZRA 5F7XA 3ZXUB 4DLZA 4EUHA 1DTWB 1L5YA 5FWXA 2IYTA 2VWHA 2V8BA 2UUCB 1WL8A 1XNHA 3K0FB 4YV0A 4ZYUA 4KW7A 1U5AA 1Z29A 1EHIA 2VK2A 1BD4A 4XOUA 3H1AA 4LJSA 1NJFA 4MUFA 5HCNA 3ZJ5A 2V1UA 3KT8A 5FEUA 4I50F 3E9EA 4NARA 2J0UB 1R9GA 3L82B 4S1PA 3NWOA 3U3RA 3OWOA 4PNPA 4X00A 1R6VA 2GESA 3OIFA 5HQ3A 5AVVA 1NAHA 3I5MA 4JUIA 3O8QB 1C50A 5REQB 2WWRA 4XX0B 3DCNA 3HABA 3T9AA 1TT5A 1NJ1A 3PFNA 4HB4A 1QVRA 3AUJB 3FTNA 4JBNA 2J0UA 1C4KA 1E2HA 5JAHA 1EG2A 3U0VA 3ETDA 1O6GA 1N7JA 3V1MA 3PRJA 3L8GA 5AW9A 3F9RA 2J07A 5HQ3B 4RKWA 4KXXA 1XFDA 4N9WA 1E1LA 1U7XA 1XDWA 4R81A 1FE8A 3RVOA 1NVWQ 4AMGA 1E2MA 2N46A 1HLGA 2JAUA 5FPKA 5DLQC 4ZYLA 2IOFA 1XGKA 2ECKA 3HACA 4EYSA 4RVGA 1Z63A 1I4EB 3K9CA 3ROPA 2B4AA 3WHLA 5HSGA 3OHMA 4L3OA 1ZMBA 1MT0A 5IJ0B 5HIMA 4Z4QA 1OT3A 3MJSA 2ZJFA 1L7EA 3HV2A 3E9MA 4XJTA 3JAKA 1XP5A 4Y1RA 3TLZA 4TTTS 3JVUA 4BFLA 1IXSB 4DJJA 4WY2A 4IUCS 5ESRA 4X1IB 2AIRA 5C1IA 1WCIA 1KY5A 3IPXA 3QFRA 4M1MA 2YTZA 2R1VB 2DLCX 1DJNA 3WQHA 1R4MA 5MGBA 1YZQA 2FW8A 3L02A 3M1AA 3I01M 5DW0A 3MJDA 3AL2A 4I4LA 1IQ0A 2QSJA 4TMTA 4IS3A 4WE3A 4V1CA 1JL3A 3NBYC 1CQZA 2GZAA 2WABA 3AI2A 3GY0A 5J2TF 4X1IA 2RAFA 2YHAA 4WV3A 1SHJA 2NU8B 4YXWD 2PLAA 2IH2A 1T4CA 4M99A 3ECAA 4YRSA 5H8WA 3VKUA 2O0HA 2X13A 3GN2A 4YRFA 5IEJA 1ADJA 2QEQA 1X7XB 3O75A 3KOWA 5HK8A 5DTRA 1MQ8B 2YFKA 3JARA 4LQ4A 3W5JA 1LZKA 4KE9A 2B2XA 1IN6A 1R4NA 1RQRA 1CP2A 3FHCB 3EGWA 2NU8A 1T8PA 4TYWA 2HADA 1DBRA 2HFJA 2HMUA 1T4CB 1YZVA 3FROA 1TECE 2QD5A 3A6EA 3DL7A 1L7VC 2ARKA 1NVBA 4KAFA 1XL1A 3TVYA 1Z22A 2JNWA 4CQNA 3HEAA 2XOEA 3PFGA 4ADSG 2O0JA 3K1TA 3ULKA 3VX3A 1ZA2A 4WN3A 4HLCA 2PIAA 1IHYA 3L40A 3RF6A 4CLXA 2FRDC 4CTMA 1H2YA 4AG6A 1UMBA 3QFHA 3I6IA 2Y93A 3CRQA 4CCYB 2G1PA 4ZAVA 1T43A 1G5TA 4LDJA 2FDCA 1VPVA 1OWMA 2OLKA 4EPRA 2UYYA 4F3CA 4E14A 1U2GC 1E1RA 5DLYA 1W4BA 1SN7A 3NEYA 3IUNA 3H87A 2BMFA 3K0KA 5D1NA 5AK3A 1PT7A 2NTJA 2AFVA 4WXYB 3N8HA 1BCRB 5EP4A 2RGAA 3OICA 1P29A 2AJBA 2GFQA 1GGNA 2AEFA 4KK4A 3L7YA 5DTJA 1KP2A 2A5FA 2E2WA 3KAJA 4HR7A 1NXPA 3S68A 2E6KA 3NOQA 1MTZA 2EJWA 1Y3HA 2QY9A 2X2OA 5EI5A 1IEVA 2TYSB 2ZSDA 5EJ4A 1I7QB 1TMYA 4IXDA 3CX4A 3NORA 4UASA 1YK1A 3MPUA 4RMJA 3L8MA 3VX4A 4CM4B 1DX9A 1RFLA 3K9WA 3O2JA 4UVHA 1ZM9A 2YUIA 3W79A 5EPOA 5HG0A 2D59A 3QUTA 5INTA 4LOJA 1X7WB 1XEWX 3WGVA 3OJOA 4MKHA 3T9BA 4KHZA 1A4UA 3V1YA 1KYIA 1BC5A 1CR1A 3DTYA 1GPAA 1RXEA 1XEXB 3BOSA 4DLLA 3QKSB 4Q9KA 5LBIA 4G4SP 5K8LA 4G0NA 1RYMA 1ZONA 2RK6A 4RDXA 3C39A 4O4IB 3RF7A 2XMCA 2V98A 1Z2OX 1VLJA 1UFVA 3GGJA 3AIIA 2AVNA 3NEPX 1KI4A 4M0EA 1CJVC 3WIVA 4JN6B 1GDHA 3B1XA 2QTVB 4TUYF 5AOVA 2YVLA 2CLDX 2C0CA 5KQRA 1VLHA 2BEUA 2FLWA 4Y3UA 4CL0A 2F3TA 3N8KA 4D9FA 4DQ0A 2AG5A 4ZCTA 5J43A 4HDMB 5KTNA 1CYEA 4LJKA 1JLMA 1N36B 5CFMA 2IPOA 1NE7A 2ZIEA 1VRWA 3R41A 1P81A 2ZE6A 1E5LA 1N6NA 1NE2A 3WFJA 2KWIA 3CRRA 1OSNA 4FMCB 1WOMA 3UEOA 1U2GA 3ROTA 3U81A 4BFUA 2X4LA 4JLVA 4C0WA 4CJXA 3DE1X 3R3WA 1PBTA 5JV5A 4J4HA 3UFXB 1PDOA 1YGYA 3FD8A 4IOLA 1P4GA 4OXIA 3FCSB 3IODA 1QGUA 2H8GA 4R8RA 1XRQA 5TMDA 4JP3A 5DISB 3N2KB 2WUWE 5A6SA 3J7AC 4QXRA 1UEIA 1T8RA 3EFOB 4W9NA 1U04A 2E1PA 1LI4A 3GEMA 4CGZA 1UOPA 1XKLA 4HRAA 1GITA 2W2PA 1MA0A 2IXAA 4ER7A 4PYJA 3COJA 3H8JA 5CUQA 2ZI4A 3TZ6A 4LX8A 3AO0B 3A26A 2CDCA 3REGA 3MHTA 2B7BA 2FR8A 1QIHA 4NATA 3MJCA 4LX0A 3UXEA 5JHHB 5K8CA 2H00A 5HS6A 5ICSA 1GPWB 2H9AA 3R0XA 3W1EA 2D00A 5BVHA 3B3GA 1KI6A 3RTBA 4ESEA 2WKPA 4EATA 2Y1KA 2YBDA 3UWPA 2SECE 4E21A 1GA1A 5HEKA 4ZCRA 3ACBA 3ZBTA 3WDMA 2XYQA 1IVYA 3WWZA 2J5XA 4C0QC 2BGTA 3GDGA 3I8XA 1NRJB 1KL7A 4FR0A 4J1NA 3R7BA 5KSWB 4MRPA 3SJ7A 4CF5A 1DPFA 1F1JA 1YJAA 3FWNA 4J0KA 4M1SA 1F3OA 3OTGA 4YJKA 2IZ6A 2Q62A 3I2FA 1Z7WA 3ENNA 2AQIA 3JD3A 1NXVA 4IHJF 4LJYA 3VRHA 2BMDA 4IWXA 3JAMA 3K0CA 5L53A 3TZLA 4HLUC 5CXXA 4DRYA 2QNRA 3H2JA 5AXCA 1FC0A 2OQVA 3Q2KA 3T38A 5FV4A 4IFTA 1XZIA 2H1WA 4KIGA 3Q8XB 4G8DA 4GX1A 3SI7A 4E11A 1C80A 3ICWA 4UQPA 1Z7GA 3RYHA 1RJDA 2HNBA 3B60A 2JANA 2WVHA 3F0TA 5CDGA 5HHTA 3GAFA 5K0TA 1AMUA 1ZK1A 3B3JA 1B2LA 4EB0A 1CF2O 4O3MA 4EHHA 1J90A 3NRJA 5I8WA 4FXOA 4XWAA 5BUSA 1PVDA 5LD2C 1IQRA 1GRQA 3HCBA 2R8PA 4GECA 4FHZA 4XQGA 5H59A 3CNNA 2PK3A 3FYSA 1ABFA 1A5BB 1R0BA 1HEIA 3BQMB 3FPBA 3IQFA 4MRRA 4MV1A 2JFNA 5COAA 2ZWIA 5KAPA 1WU8A 3KZ1E 4J94A 3T35A 1XJQA 3INNA 3SHTA 2CNWD 4E3WA 2ZI9A 3IFSA 5IM5A 1SQGA 4JI5B 4JUAA 3DEJA 5I7FA 4DWOA 1GL7A 1E9SA 2I8CA 2Q5HA 2ZE5A 3FPJA 4QDJA 3D7LA 3KKZA 1N0IA 4QGBA 2FSVC 3GFTA 2NVUB 4OHFA 2QL6A 3LA8A 1IG3A 5HX7A 2ZG6A 4ZI7A 5DASA 2EBHX 5EVCA 1P62B 4C4SA 1ZJWA 1NZFA 3DTVA 4FOPA 4EY8A 1XRJA 2A1IA 2NTEA 4RS3A 1RLUA 4TROA 4JL8A 1XIVA 4DTCA 2JLWA 5K8VA 1EXWA 2PYDA 2ZVQX 2GCPA 4GZ3A 3CYFA 2WWFA 2I6FA 1V47A 3BK7A 1BRMA 3ZNPA 3BWXA 3PE4A 2QM3A 2NTNA 2P9GA 3EHDA 3WI7A 4ATNA 1VL0A 5LP1A 1A1VA 2BDUA 3P27A 5T8KA 2FP4B 2R00C 3QYJA 3Q41A 3PSAA 5EN4A 5AT1A 3FN4A 2WW8A 2Y3IA 3Q1LA 1QGUB 1BN7A 1SBNE 4AWXA 4HMQA 1AG9A 4CM5A 1NVDA 1EZ4A 2ODBA 3ENQA 5BN3A 1AUVA 5F21A 3I64A 1N7IA 1W19A 4B83A 2JFUA 2O57A 3ZVLA 4ENRA 1IB6A 1WCV1 1YMVA 1ZK0A 4NE9A 5TGDA 4FCVA 2WJVA 2V0CA 4RK5A 4TTAA