4DWJA

Crystal structure of thymidylate kinase from staphylococcus aureus in complex with thymidine monophosphate
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
203
structure length
200
Chain Sequence
SAFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRKIVLEGNDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNSRDQNRLDQEDLKFHEKVIEGYQEIIHQRFKSVNADQPLENVVEDTYQTIIKYLEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate kinase
publication title Crystal structure of Thymidylate Kinase from Staphylococcus aureus in complex with Thymidine Monophosphate
rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Transferase
total genus 81
structure length 200
sequence length 203
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2012-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4dwjA00
2YWEA 2CXXA 5IF9A 1E2PA 1KHTA 4JS0A 3AVYA 2J46A 1VCOA 1E79D 5A4JA 3LQQA 1NRJB 721PA 1W44A 3NEYA 1QVRA 1UKVY 4O0MA 3LFUA 3MFYA 4RSGA 1F2TB 4ZCLA 3GLGA 5HKKA 3HYTA 1NVXQ 2ORIA 2GXAA 4I1UA 3DVLA 4POAA 4TTPA 4URVR 1U0JA 2YOHA 1CU1A 1E3MA 1BIFA 4V0NA 1Q1ZA 2OCBA 3HR8A 2IXEA 4B33A 2ZVPX 3BH7A 2ZS8A 3B1WA 4QXAA 4XD7D 4LHVA 2DFKB 1W4BA 2ZRJA 3QENA 3TR0A 3X1DA 5H68A 3A1UA 4IVPA 1XU4A 5BWMA 1RYFA 4Q9KA 4TL6A 4G5SA 4B3DA 3KJEA 4US0R 3U4QA 3K0FB 3CO5A 2QMOA 3UWKA 4YONB 3B78A 4P32A 4FCTA 4QHSA 4UJ3A 3ZJYA 1G3RA 4F4IA 3N5CA 4MRSA 1FUKA 4M1TA 5TVKA 1NVUQ 1F60A 1OIVA 2OCPA 5E7MA 5EE9A 1Z6TA 2XJ4A 5EE1A 4TMZA 5DE3A 2VTKA 3ADCA 3AKDA 5E95A 2P0EA 1NY6A 2Q9BA 1WMSA 2A3RA 2HJVA 3I92A 3VAAA 1Z0FA 3OZXA 2W00A 3SHFA 2OUKA 3ETLA 4KYUA 1DAEA 2X2EA 4JSYA 4MRNA 1H8HA 1N3BA 2V7QA 1AKYA 1QVAA 4Q21A 3AVXA 4TLCA 3IIKA 3UMSA 3OF5A 4IDNA 3AVOA 1S9DA 3LO5A 2O8BA 1US8B 1G8FA 1EX6A 4Y0VA 4EJSB 1IN6A 4XSGA 3DM5A 3PCRB 4XVQA 1N2CE 3CZPA 3I73A 4ZI2A 3QXJA 4PPQA 4R9UC 4XJXA 1KJYA 1EFCA 4RKFA 3T06B 4DT1B 2FN4A 3L43A 2C9CA 3CLVA 4RFSB 3F3YA 4C30A 3VR3A 5C46F 1JQLB 2GEUA 3IILA 5LBIA 2AK3A 4N1AA 4HDOB 1CIPA 3DL0A 1Z0DA 4OI0A 2O8CB 1CLUA 1M7GA 2C2HA 2WJJA 3ND9A 3GFPA 5LD2B 2PX3A 1LW7A 2V55B 3JZAA 4KFSA 5JMTA 4TSFA 3U44B 4ZI3A 5EP3A 4NDZA 3A6PC 3IDQA 4UQOA 4Q19A 4W5HA 4B71A 3EARA 1YVDA 2EFCB 1S96A 3MUFA 2J1LA 2ZEJA 2RHDA 2BDTA 3JZMA 5CIWA 4RFVA 3OIWA 1CR0A 3NHAA 1ZM7A 3IBGA 3WP0A 3ZZUA 2ZYWX 4LHZA 4NONA 1ZYUA 3TVDA 1ZRHA 3NXSA 1NSTA 3I8SA 5CLQA 4NCIA 2DWPA 4LI0A 1FNNA 3AUXA 3SZRA 5C1BA 1AGPA 3F8TA 4DDWA 4YDSA 4GFDA 1E0KA 4HZIA 3THWB 2YZ2A 5J4KA 1GRNA 5E7IA 1XXHA 1FQJA 3SOPA 4FCWA 1W36C 3J81k 3A4NA 1E0AA 4EAQA 1XZPA 2ZU0C 4UNPA 5AR1A 2ZRDA 1EFRD 3UG7A 1H8EA 2WJVA 3CRVA 2CK3D 3AF0A 2WKPA 1ESMA 3IBYA 1ZM3A 4BRWA 3C8UA 4M22A 3PEUA 2VHJA 4A1FA 2AXNA 5JRJA 3M1IA 2WWWA 3A1WA 5C4GB 4B6FA 4P4TA 3CWQA 1E1QD 4A6XA 4LV8B 5EZ6B 1IJEA 3CNLA 2WWGA 1T4GA 5KDLA 2QT0A 1OKKD 2RHMA 4FW9A 1NMZA 1U8AA 4L9SA 3T1VA 2J59A 1HUQA 2QP3A 1I2MA 5B2ZA 3BH6A 4B6EA 1JALA 5AJWA 1KKLA 1TUEA 3HDTA 2HCBA 2NG1A 2NO1A 3BOSA 3THXB 2B21A 3QY0A 1T91A 1XD9A 3KTAA 4B48A 4V0KA 2B7BA 1FW6A 2W6ID 1F2UA 1E2LA 3EXAA 4PC1A 1KK3A 2EU8A 2WV9A 5JCZA 3KXIA 2VP0A 1OXVA 1HQYE 1TEVA 2AXPA 1XD2A 4PR0A 3DZDA 1Z28A 3VMFA 3GJXC 1DAFA 4MITA 2GF0A 2GBLA 1L4YA 2F1RA 4TYPA 1E0JA 1KKMA 2GJ8A 3O8RA 2W0MA 2FE4A 5JS7A 1FTSA 1KI6A 2PZGA 2WSSD 2ZJBA 1R5BA 3UANA 3LBNA 5J5CA 5GJVC 2FU5C 2HDNB 3HWSA 3ZZ0A 4QBHA 3HYRA 3RSLA 4C0SA 1RRCA 4BQSA 5JFGA 3BRWD 2VHUA 1U8ZA 3PEVA 1A2KC 2ZUCA 2GBLC 2NQ2C 2RGEA 3LW8A 5FTNA 1NY5A 1XJ0A 4C0JA 1CRQA 3TSOA 5A5GA 4R2IA 4TZ6A 1DTSA 5BYJA 4DSNA 4DSOA 4QKQA 4F92B 5JJLA 1OH7A 1CBUA 1E1RA 5M04A 1ONBA 3GJ8A 1F48A 2E87A 1UPTA 4X8LA 3QQ5A 3U61B 1Z6AA 4MYTA 1VIAA 1S0UA 2FSGA 3DMDA 4IVQA 4JZKA 1RYHA 2MSDB 1NLFA 1YRAA 2LWIA 2G88A 2FSHA 1G19A 4TTQA 4BGDA 1G291 5KSPA 1ZCBA 2OAQ1 4RD1A 4M1OA 5L3QA 4E5UA 2CLCX 2JGNA 2OV2A 3EA0A 4BLOA 2ZE6A 2UKDA 5J40A 3WY9A 1G5RA 2YC4C 4HYYA 4G5GA 2JJ8A 1G3QA 1C9KA 1M74A 2EFHB 3CNOA 1Z0AA 3PUZA 1II8A 1EX7A 1N25A 2QM8A 5C2JB 3Q9LA 1ZMXA 1RVDA 1HT1E 2IBMA 1XPUA 4OJKA 2ZUBA 2VSFA 4Z8YA 4PO1A 1GIAA 5DI3A 1QHHB 1W0JA 2X19A 4DLUA 4TN1A 4ZCIA 1H8HD 1MR3F 2V7QD 3BH0A 1LS1A 4ZKDA 2IS1A 2Q9AA 2R2AA 2F1HA 5JECA 2ODNA 1WQ1R 2QROA 3IEVA 3QKSB 2H17A 2BEKA 4DDUA 5FPKA 2DFNA 2QQEA 2YC2C 1HEIA 1P3JA 3RS3A 1MO4A 4EFLA 3EPJA 1NF3A 3I5YA 4TMWA 5A0FA 2UZIR 4DLWA 4B3XA 1E2QA 3FB4A 1VG0B 4BASA 3L8ZA 3LY5A 2JLVA 2CNWA 1NVVR 4LJ4A 3BORA 5FUVA 1DAHA 4LOAA 3GJ4A 4W9MC 2ZU6A 4G5RA 2WWYA 1G7SA 4M1WA 3U4QB 2WJHA 3SJAA 2YWFA 2Z5FA 4CEJB 4P4SA 2KE5A 2GCOB 4G5QA 2QENA 1EESA 4ZDJA 4QM7A 2BC9A 2FEMA 3IPXA 5EE0A 3C7KA 2H7VA 1NG9A 3ADDA 421PA 2JATA 4KLZA 4DIDA 2YVUA 1XF9A 3B1VA 5DSZA 1JXMA 1G18A 4EFMA 4R71A 3AVQA 4A8JA 1Y63A 4K8OA 4D2IA 5JLJA 2CLDX 3AF3A 1MOZA 1LY1A 3RAPR 1G6HA 2R6AA 4TMVA 2CVHA 2C96A 2JLSA 2GA8A 1COWA 2D3WA 4MQBA 2IYXA 4BFVA 5IT5A 4A4DA 1IN4A 2ZJYA 4WZBE 1A2BA 3PENA 3SE0A 4HAVA 1XBTA 3T1TA 5BXQC 1R0WA 2XZLA 3AGQA 4OBEA 4YMVA 2O8BB 4NYMR 3QVUA 1M2OB 2QQ0A 2OBMA 2GF9A 1NN5A 4UKDA 3CNNA 1W5TA 1T8UA 3KL4A 1QG4A 4A8JC 3SYLA 4WVFA 4B47A 1W5SA 3EPKA 1Z6YA 1AZSC 1U98A 3ZDQA 1SVMA 2C03A 2F43B 1EGAA 1FFHA 4UJ5A 3ZIAD 3SDZA 4O2LA 4HDQB 2DFLA 1NN3A 5CDFE 1ZC3A 2Q21A 4JLAA 1KJWA 2WAXA 3BB4A 1N0UA 3GEEA 2IUUA 5LPNA 1F2TA 1HA3A 1T3LA 4TQUS 4Q9IA 3TKLA 1OXSC 3HU3A 1D2EA 1P9NA 2ZYVX 1KYIA 4PC7A 4MKIA 2JLZA 3FYHA 3W8RA 3P4XA 1G41A 2CJWB 1LVGA 2QAGB 5EP1A 4KBFA 1VG9B 2NTYC 1U90A 4IDPA 3TNFA 3L8YA 2FGJA 3OAAD 4TT3A 3SFVA 4DUGA 5CM9C 1OB5A 5F2EA 3WXMA 2QG6A 4GSYA 2C9YA 4JVLA 1LS6A 2C77A 3QI2A 4QG7A 1WBBA 2P6UA 4YLGA 3OE7A 3ADKA 4PAQA 3LX8A 1NBME 1VG8A 3B6EA 2R8RA 2F3TA 3K0FA 5EP4A 4EPYA 2WM9B 3A4MA 4U00A 4BUJA 2F6RA 2FNAA 3IIMA 1TL7C 3VFDA 3DOEA 4II7A 4LRWA 1PUJA 1XX6A 4AYTA 4PZLA 1E79A 3RWOA 2OT3B 1W47A 2JJ1D 4A82A 4LJ5A 1KI9A 3AQ4A 2OLKA 5E4FA 1VCIA 4TZ0A 1NJGA 1TAGA 4A0GA 5DGXA 3TW4A 4K81B 3ZS8A 1UBFA 5TDHA 2XB2A 3V9PA 5CYOA 4IKEA 4DCUA 1T0JB 5KOYA 1KDTA 1KY3A 1HQCA 3K70D 1P9RA 4WAUA 4A2PA 4EJSA 3NWJA 4BFWA 5F9HA 1UBGA 4QM6A 1IN8A 4I1OA 4C0AC 2NMVA 3QG1A 2GJAA 2P3SA 2PMDA 3KB1A 4M9XA 1KMQA 4AD8A 4XD7A 4Q7MB 3OFND 5FTLA 1DAGA 1VPLA 4KI0A 4AYWA 4Q9HA 5AK0A 1Q3HA 2RGAA 3QXHA 3RS7A 4XVUA 2GHIA 5AUQA 2OAP1 1UBEA 3BD9A 1YZTA 3THYB 3MJRA 1KSFX 1XTQA 4G3XA 4EJSC 2DYKA 5FOSA 3OEED 1O3YA 3U44A 3P27A 1E2JA 2VQSA 3LV8A 2BCJQ 2QTFA 3MLEA 4BLSA 5H1YA 2IYLD 4E07A 3KUDA 3U3RA 5CK4A 1T6NA 1W4CA 2V9PA 3MRSA 1RIFA 1ZD9A 4TLBA 4FD2A 1GFIA 4IEEA 1NBMD 2R6FA 3QVVA 1HH4A 4PPNA 4PZYA 1UF9A 4KFUA 2ZXUA 1OXTA 2RKOA 5IRCD 2BV3A 3ZLJA 2WJYA 1OHHA 3VR1A 1X8LA 2QE7A 1S8FA 3FFBA 3OIUA 2IYYA 3TE6A 3DEFA 3WNBA 4DRZA 1W0JD 1SVWA 2AR7A 3QNUA 2BMJA 2FFBA 3TVTA 4BE7B 3R8FA 4B2LA 2ZRGA 4MYHA 3KKNA 3THWA 1XMVA 3EASA 5DH9A 3FVQA 4ACBA 2AHOA 3CONA 1M7BA 2CE7A 3K70B 2HLDA 1G64A 2ZRPA 4L16A 5B30A 5EP2A 2WWXA 3M4YA 4M9ZA 1Z29A 3U7HB 2QSYA 1IXSB 1Q0UA 4GP6A 3CRMA 1DELA 2ZI9A 2ZE8A 1J90A 5JHGB 2BBSA 4DCTA 1U8YA 3FOZA 4EUNA 3IQWA 3PITA 4S2EA 3NDBB 4ILEA 3RHFA 1Q1QA 2VF8A 1S3GA 4F91B 1CJMA 2VHCA 5JRZA 1NJFA 1C1YA 2OG2A 4NP6A 5CB8A 3GD7A 1DEKA 3KB2A 5L3QB 3FMPB 2IA5A 4P31A 3VU9B 1ZW6A 1P61B 2GDJA 2J0VA 2KJQA 3FPAA 4YMSA 2WMOB 3GJ7A 2FPLA 2N42A 1VIYA 3LBIA 4EPXA 3Q5DA 4IOLA 2PLFA 2QM7A 1Q12A 4C3ZA 4OK6A 1GILA 1II8B 1G7CA 3U3OA 4BFXA 2ZRAA 4F93B 3THXA 1OYYA 2J45A 3RRZA 4RZ2A 1ZAKA 1DAIA 1NMXA 3U3MA 4CF7A 1RRGA 3QUSA 4Q1DA 5DI3B 2N1BA 4GMXA 3BIFA 1TQDA 5EUQB 1COWD 4I4LA 2BJVA 2PCLA 3GEHA 4K46A 4Q4JB 3GP8A 2PZEA 3NBXX 5FBVB 3ZD6A 4NZYA 4C0QC 2YYZA 3E2IA 4M1MA 2ZE5A 1G3IA 2FF7A 3E1SA 4LUCA 4G1UC 2VIIA 1NKTA 2WKRA 2O8FB 3TK1A 3EPHA 2CK3A 1IAQA 3BS4A 2ZTSA 4XOIA 5EE5B 4UNSA 4FMBB 1Q21A 4EPWA 1S1MA 2BMEA 1R4AA 3NKVA 2IYTA 4P0TA 4PX9A 1NSFA 4KAXA 2IK8A 1CKEA 3Q7PA 4N0EA 4Q01A 2ANBA 1E1QA 2A5GA 3Q8XB 4NBSA 5FPYA 1JEEA 3B82A 1XTIA 1BMFA 1HTWA 1Q1EA 3QF7A 5B58C 4A0HA 1EFTA 1YZQA 1RJ9A 4UNRA 1E9DA 1OV4A 3MD0A 4M2LA 4HAYA 2BKEA 5FTMA 2ZRNA 4KVGA 4XWKA 1XMIA 5J4YA 1XMJA 3K09A 4OQFA 4GMDA 3BK7A 2XNSA 5EXTA 3U2QA 2NIPA 1VTKA 2ZRCA 1TF7A 4PHFA 2W2VA 3LXRA 2EWWA 3ZVNA 4AG5A 5DHAA 1ZU5A 1CEEA 1EWQA 3AF2A 3I3SR 4RD3A 1G5TA 2CMKA 2W6IA 3LNCA 2VP9A 3ZH9B 3FWYA 1KSJA 2W58A 4FMCF 4FXPA 2IHBA 4PO9A 5J4HA 1W0KA 2OXCA 3SBEA 1TUIA 3AP2A 1VDZA 5C18A 1G1MA 3L0IB 5FTJA 4TQ9A 2PJZA 4O2RA 1FMLA 4BWYA 2WICA 3H4MA 4A6PA 2ZJ5A 3E70C 4MUBA 1OIWA 2OBLA 2EVWX 2WSSA 3WMEA 2ZYUX 3CX7A 3V4RA 3FHCB 3C16C 4BFYA 4DIEA 3DZ8A 1UKZA 2CCKA 4BLQA 2H8KA 5FBLB 1JJVA 3UMRA 2JJ2D 4ZO4A 1J99A 1E9RA 2XOKD 3W9YA 1QHHA 2W0SA 1N6OA 1ZUIA 4DDTA 2GEDA 4H9GA 4Q9LA 3MJHA 1NIJA 1OFIA 4RD6A 3AGPA 4IEIA 2QTVB 2FX3A 1R8SA 5FPSA 4B2PA 521PA 2TMKA 1WP9A 1CJKC 4FINA 3ICEA 1GDDA 1TQ4A 5G3YA 2X77A 3QKSA 2D4HA 2QU8A 2X8AA 2AWNA 2D7DA 4TL9A 1U0HC 2ASEA 1OYWA 4Q4LA 5ANRB 4AYXA 2VF7A 4QBGB 1MRNA 1TU4A 2NZ8A 4F38A 4DC9A 2YKGA 1PV4A 2PL3A 3PQCA 4B3CA 1JAHA 4Q7JB 3KQNA 3CF6R 2ZQ5A 1T5LA 5KO2A 4URZR 3K0CA 2UVQA 4Q1BA 3FTQA 4AURA 5BYKA 3M0EA 1P6XA 4CEJA 2BEJA 2GCOA 4V0MA 1CXZA 1GKIA 3FFAA 3VR4A 4L9WA 4EPVA 1GP2A 1Z2AA 2PLRA 1SVIA 1SVKA 5JSZB 2J0QA 4LPKA 4C0BA 2WJGA 4MDFA 1CP2A 1NN0A 2QP4A 2Z4RA 1ZIOA 4CEIA 4HI0E 2GCPA 2ZJ8A 4M4SA 1UDXA 1PZNA 2P65A 1OH6A 2O52A 1BYUA 1KNQA 2PX0A 2EFDB 3UWOA 2E1RA 4HATA 2ZE7A 3H2YA 1OHHD 4GL2A 2XNDD 2QE7D 2ZR7A 3EZ2A 4JSTA 4Q48A 2F3RA 3TSWA 1QHGA 2RB4A 4ZDWA 1V5WA 3K0AB 1OW3B 3LX5A 1E2IA 2HLDD 2GVZC 1IBRA 1GZSA 4JLPA 2V3CC 2ERXA 4M1SA 1OF1A 1IONA 1QG2A 3MSXA 3TLXA 1J8MF 5FR1A 1T8TA 4OQMA 4WXRA 2ORWA 2F43A 3EWSA 4GPTA 1K6MA 2CL7X 4IOMA 5FI0B 4D4LA 3AF4A 3MG9A 1P2UA 1Z06A 2ANCA 4FMDF 1T0HB 1N5LA 2ZROA 3ZQJA 4HB3A 1Z6XA 4HLUA 3O8BA 1DG1G 4LHXA 5KNCA 5FBQB 3IIJA 1J8YF 5GVSA 4OHWA 2ZR0A 4TYNA 1HV8A 2CJWA 1E2GA 4YMUA 1D2MA 5TARA 1Y3AA 2QAGA 4NTZA 5BN3A 5JWOA 1TQ2A 4ERNA 1DO2A 4WOPA 5TV2A 4AIIA 4KYIB 2IC5A 4EFNA 3Q7QA 1TX4B 4MH0R 1R2QA 3VX4A 1KY2A 4KVAA 2EYUA 4DKXA 4A36A 4JLBA 4HLUC 3TMKA 2RGXA 1DG3A 1N6KA 3FDIA 3FMIA 3K9GA 1CJVC 3Q72A 3TBKA 2IT1A 2DR3A 2WIBA 2BM0A 4Q02A 1N6IA 4LYHA 4PHTA 1QHXA 2QAGC 1W2HA 2N46A 2OHFA 2ZSEA 4DBLC 2LCFA 4GZLA 3V00A 2MMGA 5KTYA 3C5CA 4FN5A 2R62A 4D0NA 1RRFA 4HLCA 2B7CA 2IXGA 2DBYA 2OO7A 3ONWA 1ZC4A 2VSXA 5HTKA 1H65A 2DPXA 2QRZA 3SYNA 5KDOA 3GJ3A 1T9HA 3BGWA 3PUWA 3ZIAA 1CS4C 2FPKA 3RS4A 2I3BA 2A78A 5FBWB 2CEAA 3A4LA 2CHVA 3T5DA 1LF0A 2GILA 3B1XA 3T34A 2JLWA 2VO1A 1KIMA 1BMFD 3I61A 3TAUA 4GI7A 4KFRA 3RC3A 2FFAA 2IYUA 4B43A 5C4MA 2ODWA 2P2LA 2QAJA 3WYAA 1G6OA 4NYJQ 3NIBA 1N6PA 1VKJA 3B9QA 4F7WA 4ZCMA 3CZQA 3OAAA 4NHOA 3CBQA 3WYGA 2QPAA 4QC2A 4PSKA 4LSGA 1EG7A 4BLPA 2WAYA 5GVRA 4V0ME 3NH6A 4U5XA 2V8OA 2FH5B 3THYA 1JI0A 4NYIR 1KO7A 4I1VA 1XEXB 1W0KD 2HF8A 4HLDA 2PEYA 2KBFA 5HZKA 4DVGA 1G3MA 1BYIA 4RD0A 2FEOA 5EE3A 1QDEA 1U9IA 4I1SA 1Z2CA 3ZVMA 1XWIA 3LH5A 3ICQB 3B1ZA 3TH5A 5CYPA 4KFTA 2B92A 4O25A 3C15C 4KXFB 3R7WA 4JLNA 3EZ9A 4F4JA 4HAZA 3KQKA 3C41J 2JJ1A 1FP7A 4DLSA 2D2FA 5FL3A 4B73A 2RH5A 2G0TA 3QEJA 4QFMA 3B2EA 1E2EA 1SKQA 1AS2A 1XB2A 3X1YA 1E2MA 5L8VA 4JJKA 1M34E 1YJ5A 4DLXA 1TMKA 1JXOA 1XPRA 2ZSFA 1DARA 1RJ9B 3IEUA 3CF0A 3QXCA 1DO0A 5CDFA 5J4VA 2IYRA 5K8LA 3CPEA 2P67A 4A0FA 2QMEA 3QPUA 4A9AA 3QE0A 4TL8A 2W6JD 2O5VA 1WF3A 2G1JA 2W83A 3A58B 3OFNA 4MYCA 1KTVA 1FL9A 2ZRFA 1D8TA 4LBZA 3ZGXA 1JECA 2A9KA 2FDCA 4FIDA 2H16A 2XXAB 3CUEF 4ACAA 2I4IA 2XSZD 3TRFA 1D6JA 4R7ZA 4ZDKA 2VBCA 2RGNA 1A5TA 2FG5A 1R5NA 2CL6X 3K70C 4JBYA 3QKUA 3OEEA 4OJQA 3W3AA 3VU9A 2OXRA 3A1TA 5E3HA 4Q47A 1A82A 2A5DA 4UXJA 3T1QA 2VP5A 2GRJA 3F5FA 1Q57A 1Z8FA 3R8CA 3ZD7A 4B75A 1Q22A 1P7CA 1NBMA 2FFQA 3QOFA 4XWOA 4C2UA 2R6CA 1ZD8A 4C0KA 3U7FB 4R2HA 4Q00A 3NDPA 3G82C 2RGNC 1PUIA 2YHSA 2ZI4A 4A0RA 2RAPA 1KAGA 3O8CA 5G41A 3QKTA 3VR5A 1GL9B 1NVWQ 1E2DA 1KK0A 2ZAMA 4M1KA 2C9OA 4US1R 5DNYB 4Q4JA 5SZKB 3U6BA 3GLFB 3RWMB 5LD2C 3EC2A 1UADA 2EYQA 4M9QA 1GUAA 4LJ8A 2O8FA 1OH5A 1QHNA 3Q5EA 1YQTA 2J41A 3CB4A 4JT2A 3TSZA 2HV8A 4GT1A 3UG6A 1PLLA 3IHLA 3SHWA 3PEYA 3W6PA 3O8DA 3WHKA 3CR7A 1UAAA 3REGA 1UEIA 4ZIRB 3W3ZB 5BN5A 4LBVA 1TEXA 2IEZA 2CBZA 4PSAA 5CB6A 1P72A 2QN6A 1IXZA 2O0KA 2QY9A 1AS0A 4Q03A 2AX4A 1YZNA 2WOJA 1GNRA 4QOSA 1IN7A 2MMCA 2VYFA 1KO1A 4X8OA 2HYIC 1GSIA 5JEEA 1XJCA 1X1RA 1VECA 1G16A 4D4MA 2V4ZA 4CIDA 1KSGA 1F3OA 3QJYA 5FPTA 1E9BA 4BLTA 2V1XA 4TL7A 4JLKA 4CEIB 4JLMA 4FMCB 4KO8A 1QBKC 4CW7A 3LBHA 2C04A 3MWKA 1ANKA 4LYAA 1OXXK 2OEPA 3LW7A 4G5OA 5IHPA 1XCMA 3I4LA 2XTZA 3HPRA 3AF1A 1BKDR 3GLIA 3FKQA 4PC6A 3L0OA 1PLKA 1P2SA 1X3SA 4MGKR 4D0LB 1KO8A 4BLRA 4MRRA 5J4LA 2IWRA 2BMDA 3U5ZB 1E9EA 4OL0A 4E22A 3QEOA 2BJWA 1G20E 2AWOA 2HYDA 2Q9CA 4NPHA 1CR4A 4FWIB 1Z07A 5JCPA 4XH9B 2CDNA 5FFMA 2YV5A 3RABA 4D80A 4L5BA 1XTKA 3NG1A 2QEQA 5FOVA 1SHZA 1OB2A 1S4QA 3OIYA 5GJWC 4B76A 2VA8A 1VCMA 4AG6A 4US2R 2JLXA 2IEYA 3L2OB 1CR2A 3EIQA 1XCPA 2UZ3A 3OHMA 4PHHA 2XTMA 3L82B 1V43A 1N0VC 4RJLA 4RCZA 3OEHA 2IYVA 3GLFE 3IPYA 1GITA 3NTUA 2BOVA 2ZAOA 2WJIA 4V0LA 4JYCA 2IW3A 2IYSA 4BECA 2J9RA 4CT5A 5ELXA 1U0LA 2REOA 5EQTA 2ZJ2A 1GRRA 5TB5A 3ZVRA 4B44A 3DM9B 1FMJA 3QPVA 4B2IA 3PFIA 1II0A 4HZUA 4WW0A 1GG2A 4LY6A 4DB2A 1JR6A 4UXIA 1J70A 3LQRA 4LHWA 1EFUA 2HJGA 2SHKA 3AVVA 2C95A 4WXPA 5LB2A 5HPYB 1LFDB 3UMFA 2GZHA 4LV6A 1NMYA 2J7PA 1ODFA 2ONKA 4HAWA 4QGGA 5JSZA 1E4VA 1UFQA 4J0QA 2ZSDA 3BERA 5JJIA 2QTHA 4HDCA 4JKIA 4DWJA 3AEZA 3CIOA 2FSFA 2V1UA 4GBMA 2JJ2A 1GL7A 2Y8EA 3H1TA 3SN6A 2OESA 5FUWA 2YINC 5TXGA 5GJBA 1G3UA 3WNCA 2XOKA 3EPLA 3RANA 1G4AE 4GZMA 5UKDA 1SXJE 2GEVA 4AKEA 2ATXA 4PPGA 3D6TB 2ZREA 1ZM9A 4N0DA 3QF4A 3CWZA 3NBYC 3O47A 2D62A 3S1AA 5B57C 4MGIR 4P3YA 3FMFA 2GZAA 3K0AA 2L0XA 1R5OA 2I1QA 1WDTA 3CRQA 3PUYA 2WWHA 2ZI5A 3VKGA 2YNMA 4H1UA 4V02A 4ESHA 3B7GA 3D31A 3QG5A 1KGDA 2IS2A 4FMDB 3KZ1E 4ITRC 2OLJA 1IY2A 4PC3A 4XIGS 2JASA 4Z1MD 1S3SA 2QP9X 1P75A 2XEXA 4XSHA 3B9PA 2B6HA 3RNLA 5JBQA 1FX0B 2VLIA 3VR2A 5FBRB 4B32A 1WRBA 1Z6GA 4LYJA 2ERYA 2JA1A 4YMWA 3VTKA 3B60A 3GLIE 4CEHA 2MSEB 3R7WB 2JEOA 3TW8B 4IW3B 3ZS9A 4IJMA 3KKPA 1ZU4A 1J7KA 2ZS9A 2ZETA 3BFXA 4CRWB 2H92A 1RC8A 2OSBA 2XNDA 2IUTA 1KI4A 3K1JA 3KKQA 1N6NA 4RY2A 1OJLA 5CITA 2FJUA 3A1SA 1JB1A 4LBWA 1E2FA 4ARZA 1OLOA 1K5DA 2ONJA 1OSNA 3MWLA 2OCAA 4P4UA 4Q9JA 5K8IA 1XEFA 4N3NA 3E5HA 5FUXA 1XP8A 1SXJD 2HEIA 2GVDC 2D2EA 3DDCA 4ASUA 2O8EA 1XPOA 2ZVQX 3KQHA 4GDFA 2ZI3A 4B35A 5JI3E 4DXAA 2QPTA 2VHTA 1YZUA 1K8RA 2OBNA 4M53A 4ZKEA 4AC9A 2Z0MA 4CDGA 2IX3A 3AM1A 3GFTA 4TMKA 3DKVA 5EXPA 3BB1A 4KCGA 1MABB 1N0WA 4X8HA 5KYKA 1R7RA 3CH4B 2VP6A 5DN6D 2IXFA 4TQAA 3GMTA 5D3QA 5AJXA 4OHZA 2Z6VA 3LXXA 2WPDD 3BBPA 2ZSBA 3VHLB 3MAAC 4RVCA 4JJZA 4EKDA 5DIFA 2REBA 3CX8A 2F9MA 4NCNA 3BFVA 4XTRA 4W7SA 4WIAA 5IK2D 2R44A 4IOKA 4IDQA 3W34A 4CZ2A 1DBSA 3FE2A 1T3SA 3DO6A 1XTRA 3Q85A 1S2MA 3RDPA 3KXLA 4LWZA 1O87A 1E9SA 1P5ZB 3SS8A 4DDVA 2ZRMA 2G9NA 1N5KA 2XJ9A 1XEXA 2KSQA 4OHVA 1GNQA 1F6BA 2HT6A 2P5SA 3RYTC 1OPXA 3WRXC 3NHBA 1SVSA 1GL6A 3G5UA 1SXJB 1N6RA 5L3SB 2GAOA 2B8WA 3B85A 2EFGA 4B34A 4LPSA 2A30A 2QPOA 5KSOA 4DEYA 3AVTA 2PT5A 1HURA 2DCUA 4A2WA 3TAHA 5FL7D 2A7QA 1G8YA 1Q3TA 1ZUNB 1ZM2A 4DLTA 4URXR 2FZ4A 4IHQA 1AQYA 3VHXA 2J0UB 1PJRA 3B5JA 3KUCA 3KQLA 2G77B 1GAJA 3W5IA 3I32A 1YHNA 3JVVA 1KO4A 5HE8A 3OEHD 1L8QA 2PEZA 4KHZA 2ZJAA 3LA6A 3VNVA 4URWR 2WSMA 1HE8B 1KDPA 1RE0A 4IFEA 2GKSA 2FMXA 4MGZR 1WBDA 1KI2A 5KNBA 4FWTA 1VHLA 5CIQA 3RSOA 2CE2X 3GLHE 2ZRIA 2XXAA 1Z83A 5JZVA 1NVVQ 4WZAE 5FOTA 3N2EA 3GLIB 1E6CA 4MRPA 4BEJA 4HB0A 4M0LA 3K09C 4Q1FA 4Q7LA 1G21E 3EC1A 5BW8A 3NVAA 1NIPA 5SZHB 1E2KA 3T15A 3MMPA 3M6AA 4JKYA 4TMTA 1A1VA 2ZM5A 2J7PD 3UK6A 2JDID 2NGRA 4Z8XA 3P32A 4QGAA 4IFBA 1ZNWA 5GJCA 1ZIPA 3ZQ6A 1ZBDA 1GOTA 2ZRHA 5DLQC 2BCGY 2GJSA 3VX3A 4JYBA 3B1YA 4NKRA 4BFSA 2VL7A 4D4KA 4TTRA 1BOFA 5LDDC 1QZXA 5G40A 1G8HA 2NPIA 2ZITA 3SJCA 5FTKA 2DHRA 3CM0A 3RRYA 4D4JA 4NH0A 3KJIA 4NYMQ 1E2NA 1P4SA 1TF5A 1MO3A 4JIMA 2YWGA 1LB1B 3OESA 1T3HA 2FGKA 3KJHA 2W6JA 3HP1A 4ZPXA 4TYWA 3WNDA 4C2TA 2IYZA 2X1VA 1II9A 2IYQA 4OQLA 5GADl 1XJQA 1Z47A 2JIZA 2FPMA 4DEXA 2OFOA 5CLLA 1E96A 4PQFA 2FWRA 2LKDA 2R9VA 2GWHA 1P2TA 1G9XA 1AS3A 2D7CA 4BZPA 2VHQA 4PQRA 1UBCA 2ZRBA 2XSZA 4HZUB 4ZIRA 4RZ3A 1XZQA 5AUNB 1TTTA 2O8DB 3CW2A 2GETA 2OM2A 3RLFA 1ZINA 1WA5A 5AUPB 2FSIA 2WZQA 2WIAA 1OE0A 3PR1A 4LZZA 4XVRA 1WCV1 1UKEA 3R9WA 1SHKA 1M7HA 2HUPA 3MWJA 1ZM4A 3LLMA 1B0UA 5IDVA 2A5JA 4WZ6A 1BS1A 1DPFA 2AD5A 4JLJA 4AY2A 4JLOA 2JLYA 2PH1A 1KO5A 2GXQA 1LTQA 2A5YB 2XITA 1VYVA 2AN9A 3TUIC 4MDEA 2VSOA 1E98A 3K0CC 1SULA 4KSBA 2IUSA 5KSZA 2LKCA 5CJPA 4JL8A 3AVUA 2BKUA 1IY0A 3QF4B 4QHYA 1OFHA 2CHGA 1XRJA 4LJAA 3N2IA 5CJ2A 2NO6A 5DI9A 3S1AB 3B13B 1JR3E 1XCGB 1AZTA 1GKYA 1Q20A 1F5NA 4IDOA 1MH1A 2RGBA 3IKJA 4ASUD 5J47A 1DAKA 4NCJA 5HCIA 4XWAA 4DHEA 1Z5ZA 3PUVA 4OK3A 1AJEA 4PHGA 4LGMA 4HSEA 2ZI7A 1FNMA 1OIXA 1ZVQA 1JPNA 2VH5R 1JEDA 3CKLA 2H57A 2D06A 2IL1A 3KFXA 4G01B 4Q5IA 3EG5A 1YE8A 2ZRKA 4JVMA 1TF2A 2FFHA 3CH5A 5KNDA 4KU4A 1X6VA 4JLVA 3GLHB 4TWZA 3QXXA 1I2DA 3AVWA 1E9AA 4Z51A 5JEDA 5DISB 3T35A 2QT1A 3MWYW 1XNJA 3I62A 1U2RA 3VNUA 4CGZA 4YDHB 5EUMA 4JMPA 1SQ5A 2ZRLA 1ETUA 1YKSA 3FKSD 4EQ6A 1XFAA 3WP1B 2F1JA 1FPMA 1UDWA 3PJRA 1IHUA 2K5UA 4CEHB 1P9WA 4OI2A 3PVSA 4NCKA 4D82A 2QMHA 4CT4B 3U3KA 5DO9A 3NH9A 4C0HA 1OFUX 2ORVA 2C5LA 2E9SA 2R6GA 4DZZA 1ZUHA 1W2GA 1IJFA 4ARZB 4DCVA 1WB9A 4W5WA 3MCAA 5KU1A 4PC2A 3K0EA 3RC8A 2JLRA 1PVOA 3PG5A 3SNHA 3NEJA 2QSZA 1Z22A 1UKYA 1CRPA 4Q4HA 1T5IA 2J7KA 3ZVLA 4ABYA 1FQKA 2H1LA 2O8EB 1QRAA 4L4UA 3JVUA 3TUJC 1GRQA 4OK5A 5LB4A 1WXQA 3EX7C 1SZPA 1L4UA 1MT0A 3UXMA 1JBKA 2GXSA 2DY1A 1JR3D 4LK2A 1E4YA 1DVRA 3H84A 2OFWA 3BJIC 3C5HA 2OZEA 2GCNA 2V6IA 1NNEA 2CL0X 2WWFA 4CYMA 1TQ6A 4MYUA 2X2FA 1K5GA 4FI3C 4LC0A 2HCJB 1CR1A 3H86A 2W2XA 4IVRA 4B3GA 1ZNXA 4QHTA 2IWHA 4AKGA 4V03A 4YMTA 3AH8A 2RCNA 5JS8A 4PAMA 1XDBA 2KI5A 3CRW1 3K9NA 1PLJA 1EWRA 3QXSA 3GLGE 2OCYC 1AA9A 1X1SA 2GK6A 4OI4A 4MKFA 2WKQA 2HT1A 1P62B 1VMAA 1KK1A 4AKHA 2P5TB 3EWAA 1AGRA 4YXWD 3GFOA 3HPQA 4QGHA 4DLYA 5KSYA 2QGNA 2O0HA 4I99A 4Q1CA 1RW4A 2CCGA 2RGCA 4PZZA 1UEJA 4NCHA 1FX0A 1YR6A 1E94E 3IUYA 821PA 2FV8A 4HUQB 4AKIA 1P73A 3TGPA 2BVNA 3RS0A 2AK2A 2I1VB 1ZCAA 1XTJA 2Z4SA 3A1VA 1KMHA 1A7JA 4NE2A 2XGJA 4C4PA 1MRSA 2ZYTX 2ODBA 3AKEA 1ZP6A 2G83A 2QL6A 4YQFA 4LJ9A 2Z83A 3GCGA 2XX3A 4I81A 3SFZA 2Q3MA 4BEBA 3RS2A 4TLEA 1OXUA 1U9IC 4TYYA 3TUZC 4NU0A 4B74A 2ZSAA 2QBYB 4MUAA 5FOXA 1FTNA 5HE9A 1Z0KA 2F1IA 3SI7A 3WBKA 4PO8A 4EDHA 5EXSA 4LC1A 2NO9A 3F0TA 5D3MB 3TJZA 5JJKA 4LDJA 1KDOA 4BZQA 1JPJA 2GZDA 2JIZD 5FOUA 4X8MA 3AUYA 4EPTA 3GLFA 4QGFA 5FPHA 2XB4A 4YC7A 2W2TA 3T5GA 2GK7A 2MSCB 1MABA 2P6NA 1ELOA 2H5EA 3DOFA 5B64A 4Z1MA 3PV0A 2GXUA 1G4UR 4D0GA 4OYHA 5HKKD 2OFXA 3AP1A 1W4RA 4LHYA 5KPDA 1IQPA 1I4TD 5FI1B 3W6OA 3IHWA 2GESA 1U94A 4V0OA 5HZHA 1NI3A 4Q66C 1I4LD 2BWJA 2HXYA 4M1YA 4R98A 3LAWA 2ODEA 3UKDA 5F9FA 1S9HA 3CF2A 3NBFA 1G17A 1GTVA 5H70A 3SU8A 3KKOA 3TQFA 3I8XA 3LVRE 2BBTA 3ECCA 2A5FA 3PIRA 2WVJA 4HB2A 1KDRA 121PA 4KITB 1E69A 2PZFA 1S1CA 4Y0AA 2VPPA 1TADA 3CPHA 3QKRB 4JL6A 2ATVA 1CJTC 4QJ3A 3SR0A 2GTPA 4PQYA 4A92A 2GAAA 4JL5A 1FZQA 2Z43A 5FH9A 4LBYA 4LJ6A 3THOA 1IOZA 1KI3A 4TYQA 4JVSB 3SJZA 4D26A 1KI8A 4Q4AB 1KNXA 1SXJA 2G1KA 5L3SA 2G3YA 1NL3A 2J0SA 3D7MA 4KLNA 2BBWA 3VKHA 2RGDA 2AKYA 3K9LA 4NMMA 5JWHA 4OKSA 1BH2A 1E2HA 1R0XA 1ZJ6A 2F7SA 1YZGA 2R6DA 4ON9A 4OQNA 4LJYA 1XXHE 1W46A 3EA5A 1OFTA 3KKMA 3LD9A 4E09A 1IM2A 3K0SA 5F98A 1D9XA 4Q1AA 3EIEA 1D9ZA 3TQCA 2WMNB 3GLGB 3IO3A 4DJTA 5DN6A 2XAUA 3T61A 4QRHA 3KQUA 2J0UA 2ZANA 3IGFA 2V54A 1KI7A 2YOGA 2F9LA 3X1ZA 2WHXA 2WPDA 1SGWA 1SXJC 3FHTA 2ZS7A 3ASZA 1YR9A 1AIPA 4UXHA 3SQXA 4KSCA 3EAQA 4LCBA 3LRPA 1TU3A 4EPRA 2GNOA 1NKSA 4M9SA 1TNDA 3A8TA 5IK2A 4W5JA 4DSTA 1RFLA 2JCSA 4LX0A 4G0NA 4ZV4A 1RZ3A 4GOKA 4FCVA 1CTQA 3P26A 3SEAA 2CVFA 3C4JA 1QHYA 1HT2E 4KODA 5H8WA 3OIVA 5K8TA 2FOLA 1IY1A 5EZ5A 3EZFA 2BHRA 2JLQA 4BFTA 4MGYR 3C14C 4DB4A 1JAIA 3K53A 4RKEA 3WMGA 4GOXA 1M1YE 2F55A 2PCJA 3FGNA 1L2TA 2CHQA 3MGCA 4GOJA 3U6KA 1Z0JA 4TSFD 2J87A 4PSVA 3REFA 4URUR 3UPUA 1LF5A 5BQ5A 4C7OA 1W4AA 4IDHA 4HEJA 4JBWA 1W36D 2QGZA 2BMFA 2ZPTX 2NOAA 4DCNA 2QZ4A 1ZNYA 1DOAA 4IXNA 1A4RA 4QJ5A 3EZ7A 1D2NA 1B23P 2AKAB 3CRRA 3K9HA 5FL7A 4A15A 4HAUA 1OH8A 1YZLA 2EW1A 1X86B 1LNZA 3AKYA 3FMOB 3BFKA 1ZD1A 4QNRA 1R0YA 1CULC 3GQBA 221PA 1KAOA 2ZJZA 1M6NA 3AP3A 4QL3A 1N6HA 2IS6A 1SKYE 1KSHA 1GNPA 3P20A 3IQXA 5HCNA 3HJNA 2Q3HA 4AWXA 2KB0A 4Q1EA 2RMKA 1H8ED 2DWQA 5AUOB 3QIAA 1RPZA 1LV7A 3V4FA 4EQ6B 4B3FX 1MO5A 2R65A 3SBDA 3W8NA 1ESNA 3GPLA 3R9IA 3NBZC 3H0KA 3EIHA 4PANA 3ZYCA 2HF9A 1VG1A 2ZR9A 3BC1A 3DMNA 2O8DA 3RVBA 1G8PA 1C4OA 3EW9A 3DKPA 4A2QA 1XD8A 3AKCA 1W1WA 2Q3FA 3EZ6A 4RZUA 4B3BA 3T1OA 4KV9A 1YZKA 1NN1A 1GWNA 2PT7A 1NLYA 2OE2A 1EK0A 5JWRA 3W5JA 1W36B 5FR2A 1CF4A 4DLRA 4Q4HB 2AFHE 2JDIA 2C78A 3BAFA 4PPFA 1JJ7A 4JT4A 1I4DD 4HLQB 5FOWA 4Q7KA 1MO6A 2AL7A 1R6BX 2P6RA 2V6JA 3X1XA 4F4CA 1JNYA 2KWIA 5AWFC 3K8YA 5EJEA 5L3VA 2BBOA 3N70A 2IS4A 2ECKA 4OQXA 1X8JA 1U81A 2ZJOA 2VP2A 3U7EB 1XXHB 3QBVA 3L0SA 4DCSA 4L8GA 5G3ZA 1JQJC 3QBTA 1N6LA 2QA5A 3AV0B 2PMKA 5P21A 4U02A 1P2VA 3KXKA 1KOFA 2B8TA 2JLUA 3PUXA 4URYR 1E99A 1KJZA 4PXAA 1G8GA 4KJZA 3RRMA 4OHXA 3SQWA 2Q0HA 3UIEA 2A2ZA 3AB3A 4RD2A 3AVPA 1EXMA 1R0ZA 2FA9A 3I1FA 4PTLA 5KHOC 1DADA 4XTCS 3KJGA 3R20A 1M8PA 2OILA 3GLHA 1US8A 4O3MA 3WRYC 3HR7A 1E9CA 1MKYA 1AK2A 2GJ9A 2ZUDA 2FZLA 3P4YA 2G6BA 6Q21A 1E1RD 4LYFA 2ZI6A 1NG1A 1XTSA 4H1VA 4AK9A 4DT1A 1BO6A 1KMHB 1UM8A 4HB4A 1SVLA 4RFSA 3KTAB 1QHIA 1Z0IA 4ZDIA 2NPFA 4WBSA 3FHOA 2NO7A 2EWVA 2QMUA 3D8BA 2DFTA 1F2UB 1G7RA 3GJ0A 1WE2A 2O0JA 4NYIQ 1E0SA 4TLDA 4BZXA 3IO5A 2O8CA 3SYKA 4RD4A 1XD2B 5KDDA 3BB3A 1E32A 2KBEA 3WHLA 1HYQA 5KUTA 3DPUA 2YWHA 2JAQA 1G7TA 1Z3IX 1AM4D 5BN4A 1XMSA 2AFIE 4TLAA 4QBFA 3RS5A 3LDAA 4RCYA 4DLVA 5L3RA 1KI6B 3U7GA 3ADBA 3HU2A 3X2SA 3KX2A 3BE4A 2D74A 3BWDD 1SKYB 4WA7A 3I72A 1ZNZA 3P1JA 1VCNA 4JVNA 1FOEB 5AJZA 4RZXA 3VQTA 4D6PA 4OHYA 2EQBA 1XEWX 5TY0A 3B8HA 4S35A 2H18A 1DAMA 2WOOA 1N5IA 2VEDA 2J5XA 4TMXA 4QBIA 3Q3JB 4MA4A 5HR5A 3U3JA 1N5JA 3U60B 4LV5B 3BXZA 4L15A 2C8VA 4BRUA 4Q18A 3GJ5A 5G53C 4CVNA 1OT3A 2XTNA 3WBJA 4LJ7A 2WTUA 1G5PA 3LVQE 3QPWA 3CPJB 1D5CA 2QRNA 2YOFA 4D25A 3G0HA 2CCJA 1AKEA 5SZIA 2XZOA 3FKSA 4NYJR 1NLZA 4OI1A 3SJBA 4HUTA 1UJ2A 3HU1A 3KFVA 3ZZTA 2QUZA 2WWIA 4HAXA 4MKGA 5JI2E 1RRPA 3CR8A 1P60A 1VYUA 2REXB 3ASYA 5CK5A 3UATA 2CNWD 2QNRA 4C0LA 5TMPA 1TPZA 4U7DA 3PEWA 1U99A 4BFUA 2DB3A 4QJ4A 1Q1BA 1QHSA 5AJYA 3PXGA 4HUQA 4GRAA 4GNKA 3TIFA 2NZJA 2HXSA 1HY3A 1CJUC 2AD1A 4Z54A 1AQUA 3CX6A 1E9FA 4JLDA 2IF0A 2DWOA 4EIWA 1R8QA 1YRBA 2XZPA 1R10A 1Q44A 2GJKA 1JR3A 2IYWA 3QSYA 3R9XA 1SVOA 2C99A 2NO0A 2WBLC 1W7AA 8OHMA 1EFHA 3LLUA 1IN5A 4NL4H 3D3QA 3WYFA 2QBYA 3NC1C 5AJVB 4M8NE 3ND8A 3VR6A 1NP6A 1KK2A 2G0NA 5FUYA 1EFRA 1W49A 5D3MA 5KPJA 1X8KA 1AN0A 1XEWY 1W48A 2VP4A 3GJ6A 4UNNA 1VYTA 3A36A 4BPBA 4AI6A 4QNMA 5DHFA 1DE0A 1YR7A 1KZ7B 3A37A 1GVNB 4MKHA 4PFSA 1GM5A 4P33A 2PJRA 2CLSA 3DHWC 5K8UA 2QI9C 3L0PA 1VHTA 5JHHB 1YU9A 4MRVA 4YXWA 4JBXA 2QORA 1DS6A 1Z08A 1IXRC 1QF9A 3X1WA 1YR8A 1RKBA 3T12A 5CM8B 3WMFA 1KZGB 2ZIAA 4D81A 2IHYA 4C9BA 1J2JA 1OKKA 1KI1A 2IF2A 4P4SB 4M21A 4C7OB 2RGGA 2Q6TA 2VRWA 2BM1A 3W90A 4E03A 3SC3A 3KDSE 5EXXA 1FUUA 1HE1C 1GKUB 2YJTD 1MV5A 4IXMA 4TT3D 4DUGD 1L7VC 2EFEB 3LWNA 3NC0C 4IOJA 5SZJA 3TR5A 3W6NA 4IRUB 4A8JB 621PA 4ESVA 3I5XA 1Z63A 4DLZA 3QKRA 1FP6A 2PBRA 5F3WB 2BIFA 2C98A 5E7JA 4PAOA 5DYGA 4DSUA 3OE7D 3VKWA 2J3EA 4GP7A 3GEIA 4UNQA 4KBGA 4BFZA 3RRNA 5DYIA 4Q4AA
chains in the Genus database with same CATH superfamily
5JAQA 1Y3BE 2FEKA 4L0QA 3GPDG 3HCFA 4ZQIA 2NU7A 4QULA 3LGAA 4TLMB 2D5CA 2HRDA 1CQJA 4P1ZA 1RI3A 1U8TA 3ZIUA 4X62B 1YFJA 1OPRA 1A50B 1KPIA 2WTBA 4KPGA 5DSTA 1QVRA 5CUQA 4B7UA 5IAJA 4WKBA 4CI0B 4BVGA 2E6UX 3A04A 4L3OA 3LJKA 4U3JB 5ED4A 4PIPA 3UXEA 5HKKA 3IP5A 3HYTA 2RJNA 1KEUA 3DVLA 3L0YA 3KR9A 5EIOA 5BUQA 1U0JA 2FWJA 1HNWB 1H94A 2XWQA 2YOHA 4UCWA 1O95D 1RXUA 3KR2A 3MBIA 2RBKA 3L1UA 1E3MA 1QOZA 3V7FA 1ZJWA 3ELBA 3HY6A 1MP0A 1Q1ZA 2CVPA 2EZ9A 2OCBA 2VRBA 2WK1A 2ZAYA 1O8CA 3HR8A 3NIGB 4PY2A 3UMCA 4ZVKA 1DUIA 4LHVA 1L8LA 3BA6A 5J1SB 3H2JA 5DTIA 3VYTB 1TM3E 2YXDA 4HWKA 2HCTA 4OFZA 4R51A 1L0BA 1IWBB 4RCVA 5CLJA 1SMKA 1D07A 3P45A 1N4DA 3K92A 3UUFA 2VUTA 5H68A 2OPHA 4I9NA 5FNVB 6AT1A 3ZEAA 4G5SA 1NTRA 3SVZA 4US0R 5K51A 1WZIA 3W3AH 3EXEB 2HJWA 4RPKA 3U4QA 4HTFB 3CW8X 3CO5A 3UWKA 4AQYB 1YJCA 2VDQB 1CC1S 1Y7IA 1L5GB 1NDQA 3Q88A 4LNUB 1XTBA 4P32A 3V8BA 3ZJYA 3NKLA 4F4IA 4AS2A 4AMVA 1FUKA 2HKIA 3STYA 1OIVA 3K1TA 4QUKA 5BO5A 1HSZA 2WWTA 1BDIA 3QE9Y 3F73A 1Z6TA 2Q07A 1P18A 4P22A 1EVIA 2BZGA 4F9FA 1RBYA 1UMDB 3NZEA 4OEHA 2I55A 1OBHA 2X0NA 3OPNA 5AI4A 1Z0FA 3QVXA 2B3DA 4R8VA 2W00A 3SHFA 2BDEA 2OUKA 4KYUA 2ID7A 4JSYA 4G1EB 2F59A 3B1JA 2V7QA 1L7OA 1AKYA 4Q21A 4E32A 1Z35A 3JD0A 4MX8A 4N49A 5TQ2A 1QGED 3K7EA 3LO5A 2O8BA 1G8FA 2J3JA 2HBQA 1AVTA 3RU9A 3LKVA 1Z2PX 4KH1A 5JAMA 3FRHA 4E14A 2AYYA 3FFWA 3MT8A 3AIKA 4ZI2A 3QXJA 1ZEMA 2QTBA 3PPVA 4B5LA 5CD1A 1B6SA 1PNOA 4O4JB 4QA9A 1E3LA 1YFKA 2C9CA 1WMEA 5ESDA 2GEUA 5K01A 1F4PA 2BCEA 1G21B 5KYWB 4K9PA 5LBIA 3JQ8A 3L02A 3WLOA 3R5TA 1QKIA 2YVAA 2WAOA 1CIPA 3DE5X 2RBEA 3LO8A 2X58A 1A7KA 4ZQEA 2E55A 2P6MA 2YCLA 1X8XA 2C0QA 4AX8A 2XXBA 4AJLA 5LD2B 2PX3A 4KBYA 1LW7A 1BC5A 1BWRA 2V55B 4LZNA 3RR2A 4C07A 4TMYA 5LQNA 2Y76A 1O9GA 3IDQA 3AM3A 4HFMA 3IOBA 4Q19A 4BE9A 3ZLVA 5FI5A 2J1LA 5D5PA 4Y6GB 3UC9A 2J5KA 4RFVA 5KHAA 3GT4A 1E6UA 1WY5A 3IBGA 2GYVA 4IV8A 1P7PA 4LHZA 2D1SA 1ZYUA 4E2XA 4MVJH 3RU3A 9MHTA 2DSNA 3I8SA 1BGWA 1K2VN 5JPIA 1VI5A 1FNNA 3AUXA 1DAPA 2NVOA 5IN5A 4DDWA 4OHFA 1VL6A 1AO0A 3TDNA 4AY3A 1LVHA 2YZ2A 3M5PA 1WULS 2M2IA 4L5YA 5SY9A 3E4DA 1W36C 3CQ9A 5A3RA 2HJSA 1DC7A 1EFPA 2Q2NA 2OV1A 2FMIA 3SSNA 1P4HA 1GA6A 1H8EA 2B9VA 3JZIA 4XIIA 4TWBA 3TTTA 1ZCZA 2XRZA 5DX0A 1VZ2A 3IV6A 4D74A 5ARCA 4TTAA 3WLQA 3C8UA 4BRWA 1B00A 3PEUA 1ULUA 5M3BA 3IXQA 2AXNA 5TNXA 3NYIA 3A1WA 1W9HA 3PR3A 3JY6A 3UOAB 4C2BA 2DHCA 4R69A 2Y05A 4JU9A 2V6GA 4GVPA 1IJEA 3CNLA 2RI0A 3REQB 4UU1A 1N9KA 3JWJA 5FEUA 5H3LA 2ZR8A 1WR8A 1XV5A 5ECDA 4EK9A 4EUSA 2QP3A 2DPYA 3QVGB 4NMXB 5A62A 4WXMA 5B2ZA 4D3YA 3ZXIA 1C4XA 1EWKA 4MEAA 3V1UA 1CQWA 1TUEA 2WHEA 3DP7A 2NG1A 1XGKA 3EBOA 4KRXA 3BOSA 4O2BB 4TWJA 4D56A 4EUFA 3QY0A 2WIKA 4FFLA 5BUSA 3KTAA 3ES9A 3O21A 1L7MA 4DNOA 2HUNA 5DM4A 2IEGA 2ZYAA 3EXAA 4UM7A 3RJMA 2WV9A 5JCZA 2HTEA 2VP0A 3HYNA 1HQYE 4EG5A 2QTZA 3HJAA 2GAIA 4XYLA 3TL2A 1P4JA 4RU1A 2AFRA 2FE1A 2G63A 2XCLA 4BMDA 2B7LA 3LUDA 4IQ0A 3E05A 4L4YA 4BGIA 2QD5A 2JIBA 4TYPA 3UT5B 1T0BA 4ZO8A 4S0XA 3O3NB 1QFYA 4F8JA 1IAVA 3O8RA 5JS7A 1N2ZA 5LYJA 4LF6B 1XDDA 4KQIA 5A9SA 2D1FA 1TJYA 2J48A 4H7PA 1Y34E 4G09A 3RTCA 4W63A 5GJVC 1TM5E 2C59A 4FR0A 1SU8A 1ECLA 1M0SA 5FUQA 1GZ7A 1VBFA 3ZZ0A 4YUYA 1RRCA 4IWXA 4P4GA 4J4TA 2YZMA 3GJZA 2VHUA 3KTOA 4C0WA 1OAOA 4F46A 4W5QA 1A2KC 4M1ZA 4BMVA 3VTAA 1PZFA 1TMGE 3OP4A 3M6WA 2NQ2C 3IB3A 1HDCA 3AEKA 3ZJVA 1D4AA 3O2NA 5FTNA 1JHQA 4C0JA 2XGGA 3PXAA 5HF5A 4TZ6A 5BYJA 3HDYA 4GWLA 4RVHA 4F92B 4W99A 1L5OA 4YRJA 2OD2A 3AUSA 4ZFNA 3ST7A 2C29D 1HZJA 5M04A 4RTMA 1ONBA 2IODA 1F48A 3BJRA 2ICAA 4JR2A 5HDQA 2QRLA 3HJGA 2X5OA 1MG0A 3I1JA 1A96A 1W5FA 2FSGA 5CXSA 5C7YA 2LWIA 2FSHA 3OURA 5T57A 4DCCA 1QPZA 3M2PA 4KQJA 3DBLB 1G291 1MBZA 1QONA 1YQGA 2UZ0A 5L3QA 3CNHA 4LECA 5J58A 1ISGA 2ALJA 4I50B 4BKRA 1W96A 1D2GA 1FP2A 3OCVA 2OQIA 2EEZA 1EZ4A 5IAEA 1AH2A 4G5GA 3W1EA 3IVMA 1UBRS 4ZI7F 4IG9A 3CH6A 2VDWB 1WPRA 3K31A 4JGIA 1BS2A 1Z0AA 1EX7A 2PM8A 5F5LA 4BLUA 4RF4A 5C2JB 4NS1A 1MHPA 3IDFA 4FX2A 1UM9A 4KPUA 4DIKA 1IE3A 4DKJA 5AHWA 2ZUBA 3CUSA 2VSFA 5FYQA 1JQBA 3RK4A 4Q3CA 5EC8A 1W0JA 3OZUA 5DTJA 1U1EA 4DLUA 5CDSA 2ZWOA 4HPWA 4C4RA 4ZCIA 2IHNA 4IJVA 1P0IA 5BNIA 2IS1A 3QYJA 1VE3A 4P0QB 2W2NA 3HU5A 3C43A 7REQB 4BX3A 1WXGA 1WQ1R 1BCRB 3IEVA 1UBSB 2H17A 1PJZA 2BEKA 2B35A 2FAXA 3FOEC 1M67A 1U3VA 2AI1A 2QQEA 4OFWA 5G1OA 5DFAA 1HEIA 1P3JA 4XDGA 5AYVA 3TCXB 2NYAA 1NF9A 3SXUA 2SICE 4R68A 2VOJA 5EKSA 1X1AA 3KALA 3EPJA 1JN0A 1NF3A 4JWKA 4TMWA 4OB8A 1P5HA 3NMUF 2EJTA 4B3XA 3FB4A 5DM60 2WYIA 1WF6A 2P30A 3L8ZA 2JLVA 3I30X 5JUWA 1R0SA 4LJ4A 3TXYA 4LOAA 1VSQA 2ZU6A 5TRTA 5IJZA 5CX1A 1W75A 2WJHA 4TZKA 3PRKE 4CEJB 3WLJA 2KE5A 4G5QA 5JSQA 1MEEA 4QU0A 3D5EA 1M0TA 1YAJA 5E2IA 3E7XA 4BB0A 4OOFA 4NMHA 4IRMA 2FEMA 3C7KA 2H7VA 4B8ZA 1NG9A 3ESYA 3RD5A 1DHTA 4MW2A 3NTQA 4GAEA 4P3OA 3B1VA 2AFIA 2FPRA 4RULA 3KXPA 1ZL0A 3M7IA 1Y63A 4ALNA 2QK4A 1MOZA 5HJ5A 1GLGA 4MKRA 1SQSA 3RJ5A 2J3QA 5IAOA 2CB0A 3ZHTA 3OOSA 3K32A 1NHGA 4DWWA 1FW8A 2AX3A 1IN4A 3CHYA 3E27A 3H9UA 3NEPX 3Q7RA 1D2RA 2HTFA 1CUGA 4RDIA 4QWWA 3T1TA 2XZLA 2MOKA 3AGQA 3OLVA 1NYTA 1EGMB 3QFCA 2DHQA 5FTWA 1DC3A 1V5FA 4ENRA 2OWDA 1BEZA 1NN5A 2GF9A 2PR2A 5IUKC 1W5TA 2R1TB 1K75A 5EKUA 1LD3A 3KL4A 1QG4A 4UOEA 3A11A 4WVFA 3PT9A 1TVKA 1U98A 2GPYA 2AMVA 2IIPA 3JQQA 4JDUA 4Q34A 5AJHA 3HVIA 3ZDQA 3ZIAD 4LXIA 4UJ5A 4EG4A 3SDZA 4LF9B 1BU8A 4HDQB 1NN3A 4H17A 4KKXB 3N0RA 5EUCA 3GX1A 2C1ZA 3KYIB 3Q87B 4JLAA 2F67A 3BB4A 2CJFA 4C04A 4BU1A 3ZY4A 3RHZA 1BQEA 1T3LA 4RH3A 1L6RA 4YLEA 2YXBA 3DE7X 3RVJA 1P9NA 1I2ZA 3O7WA 2ZYVX 4JI1B 1PGOA 3PYMA 4N3AA 3UTDA 3FYHA 4ZJUA 4CLRA 3INTA 2QLMA 1G41A 2NYRA 2E18A 1ABEA 3P4XA 3P0HA 2Q7OE 5BR4A 5FUMA 5ER9A 1HEYA 4IDPA 4A3SA 2O2EA 4TKMA 1C8KA 1IUNA 2C2ZA 4DUGA 5CM9C 2YV4A 5F2EA 3WGTA 1U7DA 4XR9A 4EA7A 2R86A 5IJWA 1W1IA 1O2DA 3LQFA 4JVLA 4YT2A 3A06A 2GPBA 4MIKA 3O38A 5CAEB 1NI4A 4UPDA 2JKVA 4MVJG 3GWZA 3DC7A 4J1NA 2O05A 1GT91 3N7AA 3K2BA 4WX2B 5EP4A 4EPYA 2Z09A 2CF5A 4U7HA 3RYIA 2WQ7A 1NM5A 3RV4A 3QLVA 4U00A 1EUDA 5BWOA 2ECQA 4ZRMA 5LJIA 2W43A 2AV6A 2WSBA 3CVXA 4AS1A 1GU0A 3IIMA 1TL7C 3LT2A 3M5WA 3ZDFA 3N2GB 1LDYA 4LRWA 1XX6A 1NR7A 2HJRA 3Q98A 1FFXB 1E3SA 3RWOA 4JEMA 4B87A 1DHRA 2JJ1D 2VC2B 1FZTA 3QEMA 1FRNA 3AQ4A 4TXJA 4RPCA 2P9HA 5E2AA 3JSAA 1RWOA 1NJGA 2Z4TA 1E1YA 2Q4OA 4R1OA 3R7BA 4A0GA 3QVOA 3O94A 3ZS8A 1AHNA 4KJXA 4BJ3A 5CA1F 5IWCA 3V9PA 1PV1A 5LQKA 2NU9A 2BD0A 2W37A 4IKEA 1OWMA 1QO7A 3BWYA 3I0MA 1HQCA 3MS7A 3U0VA 4QM6A 1PX2A 2PUVA 4UDXX 4BJHB 1A7AA 1UDRA 2W11A 4RMHA 5K8CA 4ZD6A 1I7SB 4R40A 2GJAA 2P3SA 1TLTA 4FFOA 5AKKA 4XD7A 3TD2A 5FTLA 4MJ3A 1HXHA 4K6KA 1XNGA 2WHPB 4KI0A 1C7ZA 3GNLA 4RA9A 1QH8B 1VYHA 3AW8A 4CLHA 4EUEA 4KE9A 2RGAA 1MJFA 3QXHA 1UINA 4LSMA 3GZNB 3EGDB 2OAP1 3IP6A 3LYHA 4IUDS 5B3JA 2FPIB 4U7GA 1ORHA 2OXEA 2Q3EA 3TB4A 3U4CA 4I1IA 1FFAA 2R7MA 2ILVA 1KSFX 3WJ1A 3WSWA 4A8HA 4F8EA 4AO7A 2QTCA 2V7EA 1MAVA 2PX6A 5K3EA 1O95C 2YVKA 4EJSC 5FOSA 1TTHA 1RJFA 1EU1A 1NQOA 1ORVA 2BKLA 3MT7A 2EDAA 3CGWA 2AJDA 5CLGA 4Y9UA 5BSRA 3MLEA 4EVRA 1HNXB 3ZV4A 2Z9BA 4E07A 4QPZA 2NUPA 5IT4A 1W4CA 2V9PA 3D3WA 3Q2KA 1DX9A 4H0CA 1SCIA 2IE0A 4OFBA 2R6FA 3QVVA 5BV7A 5I45A 4OAPA 1U0TA 5JE8A 4JEIA 3WKCA 3ZLJA 3VU3A 1J5PA 1OHHA 1F1BA 3LTEA 1I32A 1JDBC 1S8FA 2XUKA 2GHTA 4CHTA 1LLQA 2FWNA 1AA6A 1PUXA 5CX4A 5EJAA 3R74A 1DJOA 3VR5D 1TAUA 3M70A 3THWA 3KKNA 2GD1O 2EHJA 2VK2A 3MTQA 1MG5A 1BG6A 1BEEA 3ESRA 2HCRA 1M7BA 3CONA 3D2CA 4MWTA 4YP6A 3TJRA 1WXWA 1NPTO 1B0AA 3D8TA 4HK4A 3H42B 1G64A 4KO1S 3UTCA 3JQBA 5FO1A 5JANA 1O6FA 1WHSB 3U49A 4ZYZA 3QUQA 5LBUA 3PXEA 4HV4A 3V8PA 3M4YA 2CDRA 3V8EA 1TAQA 3U7HB 3GFFA 1NVAA 2OV6A 1DKPA 1F5SA 3S6JA 1JE1A 2OBXA 3LFHA 3S81A 5KIAA 4MLZA 1SWWA 3D7NA 3F6EX 4BEWA 5EIAA 3R6DA 5LDGA 2QF7A 5IAGA 5CA1A 3FSGD 3PITA 3KD2A 3NDBB 3GIWA 2ZLBA 1Z7GA 4Y2XA 3AFHA 3V80A 1S3GA 4FE7A 4MCAA 1U0EA 4D97A 5KTNA 3IQFA 3KQVA 3ERCA 4L1KA 2OG2A 3PEYA 3GD7A 3N58A 5BRNA 3E3AA 1IOLA 3AY0A 3GN1A 4YRGA 4KACA 2GDJA 1P61B 3LC2O 4CDMA 4KWEA 4D4GA 5DVZA 1XTTA 3P9ZA 4B7ZA 2GNAA 1RM5A 2WSLA 5JAUA 1C3OA 5H9WA 4IOLA 2FHSA 4HXGA 3EMDA 3KVOA 1GILA 1G7CA 4L4SA 3QVSA 2H06A 3AU9A 3HI6A 5A5EA 3U3OA 4BFXA 2VDRB 1EJ2A 1A88A 4LMRA 4RQUA 4F93B 3JAMA 4KW7A 1U3UA 1DAIA 1NMXA 2X8BA 3HWRA 5REQB 2J6BA 2WVHA 3NHLA 4EZEA 5AKLA 1H1LA 4HVLA 2ACEA 3RBXA 1WG8A 4GMXA 1RAFA 5EUQB 3CZMA 2BJVA 2HFKA 3QVWA 3VNAA 2W2LA 1QYCA 1SG9A 2R6ZA 3NBXX 2FKNA 1BMDA 3MIZA 3PQDA 4NZYA 2AZDA 3E2IA 3WKBA 4C0QC 5C8XA 1TIPA 1NA5A 5C35A 4G1UC 2VIIA 4BKUA 1IPEA 1VKZA 2IZ5A 1BN6A 2DLDA 3JQAD 3NYRA 5AHOA 4C7XA 2CK3A 1VJTA 5F9HA 1U8XX 2YJ5A 4XOIA 4LQCA 3AERA 4GQIA 4LVUA 4EPWA 2HGZA 3NKVA 2P3LA 2D8AA 4Y2RA 5AI9A 5KQMA 5JDCA 4Q9NA 1K4KA 3AHCA 4N3CA 5KQRA 4G0WA 4JA0A 4Q01A 1O03A 4J29A 1RI5A 2A5GA 1V1RB 4NBSA 4ND8B 3HJHA 5JO9A 5BN5B 1JEEA 1LK5A 4IY1A 1PR0A 4EX7A 3TECE 4LZPA 4HX9A 5YASA 1YMUA 4MS4B 1I3CA 2QS9A 1W88A 4RK1A 4D3XA 1XZDA 4INAA 3V1TC 3I5MA 4UNRA 3DNPA 4OGWA 3CVJA 3NV7A 3SIXA 2BKEA 3W6ZA 2G1AA 2ZRNA 4XWKA 1XMIA 3K09A 3JQFA 1QV9A 4QDKA 1QB8A 4YV1A 1ADCA 3U48A 1JG3A 2HSZA 3AEXA 1N2EA 1VTKA 1TM2A 3DV0B 4YI5A 3RM3A 1DEHA 2EWWA 4UUMA 3ZVNA 3HCPA 1Z2DA 4I1RA 1Z4MA 1ZU5A 3FLBA 5DHAA 3QJGA 1N2BA 1L8AA 3HBLA 5EQDA 3UFXB 2QQGA 2CMKA 2VDNB 2W6IA 5CEFA 1WZNA 1X7ZB 2W58A 4H6PA 1W0KA 2PYIA 2ZBDA 3HUUA 1H4VB 4QECA 4DCMA 3OT4A 3HUTA 3O4HA 4L76A 5A3VA 3FTFA 5FTJA 4TQ9A 4Y2VA 3INYA 1NWHA 1KIAA 2WICA 3H4MA 1OBCA 3L1IA 2Q5QA 3F3SA 5TE9A 4A6PA 4W9NC 1OIWA 4XWTA 5I7OA 2OBLA 4K1XA 5JMOA 3LUPA 3RSHA 4ZQHA 3NT5A 5B7GA 1LPOA 3WMEA 1NVMB 4ED9A 1T5SA 5A71A 4PLFA 1D2HA 3WK9A 5DN9A 2HJ9A 2AG5A 3LOQA 4AJNA 3ELDA 1OX5A 3UMRA 1ZN2A 2CXRA 4GGMX 2CDCA 1CIJA 1ZH4A 4ZO4A 1SXPA 1ADBA 5FF9A 4ZO9A 2G72A 3D8HA 3E8MA 3TPCA 3KOYA 4YMHA 3Q8LA 2JH9A 2H1RA 1CSEE 1PEDA 2AG6A 1QZUA 2FUCA 2R00C 3R6WA 1ZR4A 1PF7E 4ZHSA 3MJHA 1OFIA 2C4UA 2QTVB 1THZA 1ZWKA 1SZCA 2QSUA 4FFNA 3T5PA 4HDNB 1T1IA 3AXSA 3GUCA 4MB0A 4RAOA 3WKEA 2A0XA 3ZZNA 4MHOA 5ALIA 3ICEA 1GDDA 1TQ4A 5B55A 4TL9A 4TQGA 5FA5A 3NR2A 5I9TA 4WNAA 2VJAA 5CLIA 3GF4A 4BNJA 1RZRA 4Z5XA 1SD5A 5H4GA 4GX0A 4NYIQ 1MRNA 4HNSA 1ZRNA 3F6RA 2DR0A 4NENB 1Z73A 1NVGA 1VRWA 1MIOA 3EIFA 1DKRA 1JAHA 1KXZA 1R9GA 2CNOA 1I0LA 1LC0A 3KJQA 4TTJA 4CKYA 1PU2A 4OOEA 5LQDA 2PZKA 1OXMA 2A3NA 3HL4A 1EWVA 3GA7A 2UVQA 4MMZB 3IPCA 1LLUA 1NLUA 4CTOA 3M0EA 4H7DA 3VYVA 5IKMA 4DM3A 2N3ZA 1RQLA 5KX5F 3GMIA 2HPVA 5F1PA 4RTSA 4EEZA 2Y92A 5E1DA 1A4UA 4MS3B 3RVSA 5HNKA 4EPVA 2AEMA 2J0QA 1F9EA 2EKBA 3ORSA 3BMNA 4LPKA 3I1IA 4A23A 2Z4RA 4MDFA 4CEIA 4P36A 2O7SA 3DKIA 4GXNA 1PZNA 5CVDA 2B99A 4OO3A 5K3CA 2JJQA 4ZMRA 3HB4X 2R6JA 5DW0A 5DWDA 1MB2A 1V1MB 1LTHR 2ZE7A 3WWCA 4M37A 4EYOA 2QE7D 1ZVJA 4KQFA 1NYRA 5BWNA 2ZR7A 1CZRA 4K9LA 4X45A 4LDRA 2WWVD 1QHGA 3AZOA 3GG9A 2XUQA 1VHWA 1ZVMA 2RB4A 3O1JC 1M6VA 4JGGA 3WWYA 2HLHA 3U7QA 4DIUA 2DE0X 1JSRA 5GV8A 1WZUA 2VTVA 2CXSA 1RYZA 2H29A 3JYHA 3LX5A 4JQCA 2LPMA 4K9NA 3QU5A 3X2FA 4PCVA 1IBRA 4KAJA 4TKZA 2V3CC 2UUPA 1OF1A 4M1SA 1PGJA 1YT5A 1QR2A 4H3HB 3ER9A 2BUAA 3MSXA 2PKEA 2H1HA 3JYQA 2RK4A 1XQXA 3OQIB 2XOXA 5DK6A 4CMHA 2HD4A 1XVUA 2F43A 4GPTA 5FNZA 1CZOA 1J56A 1QP7A 5DNEA 3ZUPA 2BZSA 4F86A 1X1EA 4NV3A 2QTLA 3AF4A 3VNRA 1R18A 3EZLA 3I6QA 4DW8A 4MUNA 1EKXA 1C7FA 1N5LA 2ZB8A 2ZROA 3HKCB 5E2BA 5TGTA 4BYMA 2HMAA 4KR6A 4BGVA 3S3TA 2XBUA 1PR5A 1R4NB 2RHWA 5L6LB 5AKZA 3L7IA 1R6VA 4AZTA 2QHXA 5K1ZA 4JLWA 4Z4GA 2WTEA 2PYDA 1QZTA 4D9CA 2CJWA 2R8PA 1P1FA 1A2OA 3E9NA 2PNFA 2QAGA 2WTAA 3JR3A 3KTDA 1KP2A 1OFUA 3F6CA 3O8LA 1DO2A 3SK0A 3LDGA 3WWDA 4BDTA 1JFRA 2ZSIA 3PRHA 4MCJA 5K6RA 2A5LA 1L9KA 2EJUA 3C3XA 4E3WA 3HUDA 2G8LA 2WHQA 3PDCA 1PEAA 1JHMA 3DBHA 4KMRA 4KQ6A 3TQRA 3S27A 1QF7A 2JFQA 1DG3A 2NVBA 2RGXA 2YWJA 3FDIA 1Q0LA 3H9EO 3Q72A 3RC1A 3V1NA 1TD1A 5KX5A 1UMBA 2DR3A 4MLCA 4OYLA 1I3NA 3ZE9A 1C0LA 1XO1A 2PZMA 4LMPA 4ABTA 2AE2A 3AFOA 5HHTA 3WC4A 3UGKA 2EEPA 4R1NA 2D5AA 3IS3A 1JZQA 1E6WA 1ZK3A 1BVUA 3ND5A 4LDPA 4O4IB 4PEVA 4MICA 4RACA 1YFLA 2D54A 1IZ9A 2R62A 1A9XB 3U80A 3UGQA 4D0NA 2DLNA 4BVEA 3PJEA 4RETA 2IXGA 1KS9A 4BVAA 2HRBA 5KDOA 3BGWA 1NAHA 2FPKA 1SU7A 2CEAA 1C7RA 2XEDA 2GILA 3T34A 2XB6A 4A10A 3K30A 1YONA 1PR3A 2ILTA 2VF2A 2AR9A 3IA7A 1KIMA 3PJGA 4KLAA 1FTGA 5CH8A 1BMFD 1Z68A 3ILYA 1G9TA 1GPYA 1L8XA 1V3UA 2EL7A 3CXUA 3ZGYA 5K03A 2EHDA 3DHNA 4DUPA 1RADA 2MYTA 1YKFA 4G0XA 2CZCA 2VJBA 1U7ZA 3BHNA 3LPCA 5K05A 4REOA 4B43A 1GPBA 5K4AA 3LUAA 4E46A 2P2LA 2QAJA 2C4KA 5C4MA 3NIBA 2N1MA 5KB3A 1VKJA 2MDTA 3B9QA 3MA0A 4WLNA 3OAAA 3HGMA 4CKXA 1YIAA 1U0SY 5FLXA 4PSKA 3N76A 4EY3A 2ID8A 4RY0A 4WKCA 1ZH2A 5GVRA 4XLTA 3NH6A 4U5XA 1JI0A 2JIOA 4NYIR 4KQ9A 1KO7A 4I1VA 3DW1X 1XEXB 2LBPA 2C5SA 4RQBA 1NPYA 4YV7A 2C7VA 5HZKA 3UXHA 1ESDA 1QWOA 1O5OA 1RRKA 1U6KA 1XMPA 1U9IA 2DBVO 2JB9A 5EI5A 1FRZA 2GM9A 3O90A 2O3QA 2VDVE 2OM6A 3ZVMA 1CUDA 4RLFA 3NTRA 1B26A 2B92A 4YV0A 3KAQA 3GRFA 1L5NA 3THRA 2WQ6A 1FMCA 1BD3A 5FEMA 3DBVO 4YYEA 2UZ4A 1KERA 1VE9A 4O4LF 2VR1A 4DV0B 4KXFB 3KB6A 1YR1A 2IYNA 4LVOA 3L6OO 5FWYA 2EZ8A 1QC5A 4F4JA 3KQKA 3C41J 2YYYA 3M4XA 1R6XA 3I5UA 3QI7A 1KPHA 4IGFA 4JIGA 4DLSA 4DREA 4TKVA 1HDOA 1KARA 1QCDA 2RH5A 3NT4A 2XIQA 4NATA 3A27A 1E2EA 1N2CB 2X2OA 1QDUA 3PWSA 3VHXB 3GD5A 2JVKA 5BW4A 1KEZA 4FD3A 3TG2A 1XWFA 4QYWA 4JJKA 4BIIA 3ZCUA 3PRYA 4P82A 3SICE 3UN1A 1NGSA 1RJ9B 3CZ9A 2R60A 1J23A 3GRAA 3P4UA 2IYRA 2Y0DA 5K8LA 1E18A 4DGQA 4CIAA 1YDGA 3QE0A 3QU2A 2FLWA 2O5VA 1C7QA 2VQEB 3KYCA 2W83A 5L45A 4MWSA 5L4LA 4BJ5A 2R8XA 1WCIA 3ANLA 3EIXA 4MR7A 3HBNA 3LCMA 3DKKA 1GA1A 1FK8A 3MW8A 4JOBA 2NZYA 4L6IA 4RV9A 4XQ9A 5IXYA 5KHLB 1E1LA 1AKVA 1PZGA 4AICA 1AHHA 2ODTX 3KNZA 1JILA 2XUPA 3ZQKA 2DTXA 2VBCA 4ESEA 4YMUA 4UEJA 2RGNA 4DMGA 2IGBA 3KQQA 3ETCA 2O23A 2HMTA 4JJGA 4MWEA 3QKUA 2JBHA 3OEEA 2ZG6A 3FPGA 4HO1X 2OXRA 4YT5A 1P5RA 4TKUA 1JHRA 2FW6A 4UXJA 5GGXA 5JDIA 1L7EA 2I34A 2O07A 3HB0A 1U5BB 5HFAA 4MB2A 1Z8FA 2SKEA 4B75A 1RBQA 1E62A 1MC4A 1NBMA 3GVCA 2A84A 3ND7A 1UBLS 4FUTA 3S2EA 1QYDA 1ZVKA 2HRQA 3GARA 4LS3A 4P4NA 4F5EA 3AIIA 2Z5LA 5JSHA 4C0KA 4HN2A 4C7MA 5JOQA 3U7FB 2WYUA 1XCLA 3OSZA 2DRIA 1F8YA 2LIVA 2YHSA 4XQ0A 4A0RA 4WT7A 5G41A 3F6PA 5IW8A 1LQUA 4WQMA 2UYQA 5I6DA 4JXKA 1E2DA 4US1R 1NQUA 2HQ1A 3G6WA 4V39A 3S70A 4Q4JA 1L5MA 1SIBE 3LSTA 1XVLA 5SZKB 3ZNPA 4XWWA 2RDMA 3A4VA 3EC2A 3PGLA 4O4LA 5THXA 3ANMA 4FC6A 3SKVA 2AN3A 5ILQA 3AMVA 1E0DA 1T8PA 5H80A 3JQEA 2XYRA 4YRQA 1Q19A 1JE0A 2H11A 4HH4A 4CG1A 1JMYA 3TSZA 2WB2A 2XF8A 4C6TB 4WNYA 2IZ7A 3UG6A 3SFTA 1EFVB 1UANA 4W5OA 2ZW9A 3IHLA 4UATA 3O8DA 4I1YA 4W6QA 1YS4A 4JP3A 1WXIA 3REGA 3H11A 4ZIRB 4YCMA 1JEJA 1ZUWA 2QYTA 2YBEA 4LBVA 4M38A 4AROA 3CUVA 1JAYA 1R9MA 4PSAA 3TLEA 1K7SN 1P72A 4EHKA 1GXSA 2QY9A 5KNDD 1AS0A 3HA7A 2AX4A 4Y2HA 1J4AA 4H3SA 1IN7A 3HJBA 5KNCD 1AK1A 3C24A 2I2DA 1K97A 4FW8A 4N6OA 5L7TA 2HYIC 1ZBQA 5HS4A 4D4MA 3HNOA 3RAEC 1KYTA 1P2FA 2PXAA 3ROKA 4TT8A 3GBPA 3EHEA 3UJ6A 4PNPA 2A1TR 1YIOA 4GYKA 1AXEA 4CW7A 5G1NA 1WXFA 2C04A 3KSZO 4LYAA 3H9QA 3LW7A 4G5OA 4KUGA 4QJIA 4D8UA 3LG2A 2VAMA 3BE8A 2CLEB 2HHLA 3I4LA 4FNGA 5DWQA 3PXCX 2H7CA 4E4RA 1TMYA 3ENNA 4BXOA 1Z5GA 3MUEA 2YIJA 2VJYA 3FNHA 1IIRA 3WSTA 3Q3IA 1V5EA 4WMLA 3U4IA 5AVRA 3B38A 1M6HA 2X9QA 3ISJA 5LP6F 2MCFA 2XKAA 2BJWA 4X71A 5CXXA 1G20E 2A0UA 5B2EA 5AM4A 3F9CA 4FWIB 1NBEA 1QTIA 3R5JA 2CF6A 3EMKA 3KZXA 3ITKA 3NHFA 4MI9A 1Y5NA 3RABA 4D80A 4ZAFA 2BE9A 3O8OA 4Z7JA 3R75A 4TS3A 4N5DA 1J0CA 3IHKA 4EW3A 5EAIA 1S4QA 3OIYA 2Y2VA 4NE9A 4ZJPA 4EZIA 4US2R 1MOQA 5JARA 3PSAA 3L2OB 3ZWQA 3OCYA 1TC1A 4RHEA 3P52A 4INZA 4YCNA 1U1DA 1TTQB 1M10A 1O7JA 2H0QA 1IXKA 2RHOA 4JNCA 3L04A 4ETMA 5BV1A 5HRUA 2ACWA 5MHTA 5FPPA 1UFRA 1A98A 2GFHA 3FW1A 3NTUA 3O2SB 3HCDA 4HH1A 2PLWA 2WJIA 2Z56A 4V0LA 5C1OA 2HY7A 2IYSA 1MX5A 4QUEA 1JIQA 5DBEX 2YN0A 3R3XA 5JY1A 1YWGO 4I3FA 4NSNA 4OFXA 3A9CA 1QMGA 1ZW1A 2ZJ2A 2HDWA 2J3MA 3S5UA 3UUGA 1BW9B 2X4DA 4GR5A 2NU8A 3DM9B 3LRTA 3QPVA 2PMWB 5F33A 4B2IA 5IN4A 2M9MA 1G63A 1L5SA 1DINA 1ZMBA 3FUWA 3ZW9A 1YNSA 2EWMA 4EY4A 1S5PA 3VDRA 4DB2A 2RD2A 1QFXA 1NV8A 2FLKA 4YGYA 3WLNA 4LHWA 5CDYA 1ML4A 1DV2A 1C80A 5EIWA 3A1EA 3L0DA 2X13A 1CF2O 2C95A 3A9UA 4FNOA 5LB2A 3TYXA 2LCIA 3LDHA 2Z2XA 1ZUD1 5D84A 2GZHA 4LV6A 2AOUB 2XTAA 3D6NB 5EYPB 4S1PA 1UOPA 4ZQCB 4J07A 4OBXA 4RVDA 1Q95A 2JRLA 5DHUA 3U1VA 2ZZNA 1Z5NA 3JZFA 5JJIA 2A57A 3AEZA 4UU0A 4ARVA 1V8OA 1L5FA 1GL7A 1RJWA 5CFRA 1XTVA 1NV9A 4C7KA 1PO7A 4E7OA 2HWXA 1G3UA 5IFLA 3U81A 3LP6A 4QOIA 4XUGB 1SCAA 3A2LA 4GZMA 2PBZA 4AKEA 5K7SA 5KKCA 2SNIE 1AB6A 3D6TB 4IMIB 5JD4A 1H3EA 1G4HA 1V48A 1SBIA 3QF4A 2B20A 2D62A 3Q12A 1KWGA 1V8FA 4PYOA 3VC3A 5BQFA 9LDTA 4MGIR 4JXZA 4DCPA 5B7NA 2L0XA 3LDUA 1K8YB 1L5WA 2I1QA 1H0KA 3H18A 4ND5A 2PUDA 3PUYA 4W1SA 3M6LA 2YNMA 4BYGA 4CR7A 3TRDA 1T6YA 3B6IA 3OY7A 1ZR2A 3D31A 2EJBA 3KKEA 1KGDA 2Q5OA 2OV4A 1T1RA 1Y1LA 4G9BA 4FMDB 1ECFA 3ZGOA 5BNFA 2NYUA 4RTKA 3HXOA 1XQ9A 3NIFB 1YC5A 4XIGS 3A6KA 5TT0A 3JVIA 4Z1MD 4X85A 2E5LB 4XSHA 4D43A 3B9PA 3BD6A 5JBQA 3RNLA 1X13A 1X7WA 1ATIA 1DEOA 1FX0B 2VLIA 4ND6A 4NFSA 2Y0EA 2CBXA 3JAWA 5K3FB 1AV6A 1SCKA 3ANYB 3SHOA 4P08A 1Z6GA 3PHGA 3VO8A 2X9NA 4XVCA 2AVNA 2Q41A 1SUPA 1BJRE 2IEBA 1R4ZA 2HHAA 3O9MA 3B60A 3HWX1 5U1PA 2FZCA 1GZDA 5TLSA 3OOWA 2IDMA 3VSCA 3ZS9A 1USWA 2P0AA 3CS3A 3KKPA 3KXDA 1CRLA 1DRKA 1RDFA 1GZVA 2NYVA 2RHBA 3TE7A 2OSBA 2IUTA 1G20B 4RY2A 5GONB 2Q4DA 4AMBA 4UUNA 4C4SA 4KDEA 2YZGA 1E5VA 1K8XB 3FZEA 1Q7RA 2ONJA 4WADA 2IOFK 3VZQA 1RQGA 4MWDA 2ZVDA 5A9RA 1Y6FA 2OCAA 5HEKA 1XG5A 3FBGA 2AZMA 1U8EA 3IV9A 4R1LA 4N3NA 3H87A 4Y2SA 2PUWA 1CRZA 2B98A 1BXGA 2D2EA 3LHSA 5T4HA 4PYIA 3SJUA 3OEWA 1D6MA 3NHYA 2QNBA 1E3IA 4GDFA 1N32B 2IH4A 3WO0A 2OAEA 1ZEJA 4EJ2A 1PNRA 5FX2A 2OHXA 2VHTA 2IX3A 2A33A 4CDGA 3L1JA 3AM1A 5IVPA 3DLPX 5EXPA 3IEKA 1K4MA 2ON6A 1OI7A 1AUXA 5TQJA 5KYKA 1MC5A 2QLBA 5D3QA 1JSXA 3IP1A 3N3BC 4XOUA 5IASA 2Z6VA 4WH0A 1IZ0A 3LXXA 5EJ5A 4RL4A 2OGSA 3BBPA 4G1MB 4JJZA 4HL6A 2MSNA 1CS0A 3JRNA 1JDJA 4U6QA 2VSQA 4FYKA 1JHZA 1H05A 3CSDA 1N5OX 2X3FA 3EF1A 4NCNA 4ZTZB 4W7SA 5AESA 4D9NA 4K9OA 3GBVA 3W34A 4IOKA 3B9BA