4DWJA

Crystal structure of thymidylate kinase from staphylococcus aureus in complex with thymidine monophosphate
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
203
structure length
200
Chain Sequence
SAFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRKIVLEGNDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNSRDQNRLDQEDLKFHEKVIEGYQEIIHQRFKSVNADQPLENVVEDTYQTIIKYLEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate kinase
publication title Crystal structure of Thymidylate Kinase from Staphylococcus aureus in complex with Thymidine Monophosphate
rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Transferase
total genus 81
structure length 200
sequence length 203
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2012-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4dwjA00
1IN8A 1G3QA 4CF7A 2XX3A 3I3SR 1JAHA 1Z8FA 2W6ID 4X8MA 2BVNA 2WWHA 1N6IA 2F1RA 5EP2A 3B7GA 1YZUA 2I1QA 1OIVA 3U3JA 1P5ZB 4F4IA 1ZNYA 3BXZA 4Y0VA 3KKPA 1TTTA 5AR1A 1X8LA 2HUPA 2O8BB 2QE7A 1WMSA 4MUBA 2B6HA 1XPOA 1TEXA 1XCGB 1ZUNB 1D5CA 4P3YA 3SJZA 3GEIA 1ZM4A 3DM9B 3ETLA 2IL1A 2IXGA 4IJMA 1S2MA 2ZM5A 1E79A 1LTQA 3UATA 2FNAA 5HE8A 4C0QC 2BWJA 3T06B 4ZI2A 3WMEA 1N2CE 1ZVQA 2DR3A 2ZROA 1GITA 4KYIB 1E2IA 1RJ9A 1S8FA 2YINC 3K09A 2V3CC 3NBYC 1VCIA 4M1YA 2G88A 5FUYA 2GAAA 1WCV1 2W58A 4B47A 5KDLA 3KQLA 1E3MA 4Q18A 3Q85A 3BAFA 4P4UA 3AF3A 421PA 2BCJQ 2B7BA 4B74A 1XXHA 5CDFE 3QKUA 3A4NA 2CVHA 1VDZA 4JL6A 3VKHA 3DEFA 3ICQB 1T3LA 4RCYA 4ZCLA 2BEJA 2FU5C 2EFEB 2ZPTX 3CPJB 1G3RA 1EG7A 3A6PC 5FR2A 1RFLA 3F5FA 1CP2A 3LBHA 2IX3A 3SYKA 5JRZA 1E2LA 1W44A 1KI2A 2EQBA 2RGCA 2RKOA 2AWNA 4RVCA 3SJCA 3CRMA 3ADDA 4I99A 4B6FA 4KITB 1GKYA 3QXSA 2CCKA 5ELXA 4NCHA 1F5NA 2NPFA 1EX6A 2MSDB 3HU2A 3WNBA 4BE7B 4A4DA 3W5JA 1YVDA 4KU4A 5JJKA 5FOUA 1GOTA 3IBYA 3PIRA 1W2HA 5D3MB 5HZKA 1XD2A 4JKYA 4LJ5A 1KDRA 4LJ7A 1OW3B 4FMBB 5CM9C 3RRYA 4C0JA 3IUYA 3KZ1E 5BWMA 2LKCA 3LW8A 1DAIA 3QKRB 4KBFA 1J99A 4EIWA 3T12A 4TYWA 4ABYA 2ZE8A 3QQ5A 3TSWA 2XOKA 2YOGA 2DY1A 3HU3A 3U5ZB 4NYJR 4TYNA 1XDBA 4P4SB 3FYHA 1P9RA 4W7SA 5IRCD 3G0HA 2V4ZA 5GVSA 1W4RA 3KJGA 3C41J 1NRJB 2PZFA 4MRNA 2OHFA 3NHBA 5J4HA 1CR2A 2O8EB 3VR4A 1CLUA 4BRWA 4JLDA 1LS1A 4ZKEA 4IDOA 3B60A 2PMDA 5JS8A 5J4VA 5JWHA 1QVAA 1G3IA 1K5DA 1ZU4A 4PSAA 4LI0A 5H1YA 2CHVA 4QGAA 2QRNA 1SHKA 2VTKA 1WP9A 2Z4RA 1M8PA 1N6RA 2RGXA 3AP3A 3OIUA 4ACBA 2ODNA 2O8FA 1Q1EA 3K70C 1F6BA 2J0UA 3Q5DA 3NC1C 4HB3A 3B1YA 3KXIA 1S4QA 2QMUA 4M1MA 1R5BA 2MSCB 3JVVA 2UZ3A 3M6AA 3T35A 4IVPA 2FGKA 3AVUA 4A0FA 4UXIA 2CXXA 1T0HB 3X1YA 2ZYTX 3DOFA 4TMWA 2E87A 1NMYA 2C9CA 3EC2A 3VHLB 3WHLA 1F2TB 4BLSA 2ZSEA 5EUMA 1RJ9B 3OAAD 4PAMA 2BV3A 2X2EA 1M7BA 1A5TA 1NG9A 2BIFA 5EE5B 1O3YA 4BEJA 4TL9A 2G3YA 1KKLA 2FZ4A 2KE5A 3DO6A 2RH5A 1W46A 4TN1A 3I8SA 4Q9KA 1K6MA 2GZAA 2C98A 2ZI5A 3B1WA 1PUIA 1JR3D 5E4FA 3QVVA 3EG5A 1JQLB 3EXAA 3JZAA 4JBYA 2O52A 2HYIC 2C96A 1EFCA 2NPIA 3GQBA 5TMPA 1LB1B 5FPKA 2KI5A 2ZANA 1KGDA 3FGNA 2WJHA 5DH9A 1IM2A 4QXAA 1HYQA 4CEJB 2J7KA 4FMDB 4OI2A 2ZVPX 3AKEA 4DSUA 3K70D 1DPFA 4N1AA 2OFOA 2XTZA 3MCAA 1KZ7B 4Q1EA 5JZVA 4HZIA 4PR0A 1E98A 5FUWA 4F92B 5L3QA 2RGEA 4L9SA 4YDSA 1JEEA 4DBLC 1E1RD 3J81k 3RYTC 1DG3A 2XJ9A 3WHKA 4G5RA 3WBKA 1KDPA 3U7HB 1NKSA 1LFDB 2JJ1D 2ZE5A 4LX0A 1E94E 4MRSA 3GLIA 121PA 2XEXA 1OXUA 1YRAA 2QORA 1F48A 2ZJBA 2EVWX 1F2UB 2KJQA 4CT4B 1Q44A 3U2QA 3S1AA 5A5GA 1AJEA 2Q3FA 2QBYA 3RANA 3AP2A 1Y63A 1YR7A 5GJCA 4HZUB 3L0SA 2JJ2A 4US0R 5C1BA 3AVTA 4UJ5A 1OYWA 4JMPA 1IY1A 5HCNA 3UG6A 1NP6A 4PO9A 4DXAA 1WRBA 4QL3A 1Q22A 2GZHA 3B2EA 3AGQA 3QVUA 1E2GA 2AXPA 1DAFA 4B2IA 1OYYA 221PA 4MGIR 1Z0DA 4LUCA 3THOA 4DVGA 4Q1DA 4GRAA 3RABA 1LVGA 2QI9C 2ZYVX 5C4MA 1SKQA 3GD7A 5KPJA 4AYTA 2F3TA 3QKSA 1XMSA 4OQFA 1VHLA 4CT5A 1XBTA 1W4AA 2BJWA 4A6XA 2C2HA 3E70C 4LYHA 1L8QA 3L43A 1NIJA 5LDDC 3TGPA 5TY0A 1R4AA 1JJ7A 1KIMA 3U3MA 2IS4A 4M9XA 4IDPA 1HT1E 4NCKA 2D62A 3BORA 4DSTA 1ESMA 3QKTA 4IFEA 4TTQA 1PV4A 1D8TA 3WNDA 2A5JA 1SZPA 3OHMA 4D4KA 1BMFA 1GZSA 2KB0A 1RVDA 4RY2A 4BFTA 2QGNA 2ZRFA 3Q5EA 5K8IA 3AF0A 2PH1A 1WXQA 4PQRA 3TW4A 1XF9A 4RZ2A 1YR6A 4B44A 4NH0A 4JLAA 2H7VA 4V0MA 4JLJA 5JFGA 5CB8A 2GDJA 4IDNA 3AF1A 2GHIA 4X8OA 1E2PA 2BBOA 3O47A 3A4MA 3W3AA 1WQ1R 2ZRCA 1UPTA 4XVQA 1GL9B 4B35A 5H70A 4WXPA 1VIAA 1TADA 2FFHA 5SZKB 4XVRA 3RLFA 1OXXK 4QJ3A 1US8B 2FOLA 4ZV4A 5DO9A 4YQFA 3EIHA 4LHVA 2IUSA 2VPPA 3EAQA 3A37A 5IK2A 1NN3A 1Z6TA 5DN6D 1KOFA 2A7QA 2Q9AA 3IQXA 2GWHA 2PZGA 4LPKA 3BOSA 2AFIE 2IYXA 4DLWA 3ZVNA 5FPTA 5G40A 2ZI9A 5KUTA 4M1TA 3HP1A 1U2RA 4P32A 2G6BA 5FFMA 1T8TA 2EWVA 2AL7A 1G7CA 2JLSA 2WSMA 1GRNA 4B3FX 5CLQA 2KBEA 3BRWD 1MR3F 1YE8A 3GLHE 2H18A 1E2DA 1TQ2A 1X6VA 1E32A 2Z0MA 3LLUA 2RGNA 3K0AA 1J8MF 1OSNA 1A4RA 4JBWA 4LCBA 4BZQA 3C5HA 3IPYA 2VP6A 1Z63A 4OI0A 2V7QA 1LW7A 1GKUB 3PR1A 4IDQA 2IW3A 5CM8B 4URWR 1J8YF 4MYTA 2G1KA 1GSIA 2EU8A 3SEAA 4Z54A 5K8LA 4UXJA 3LXXA 3CNLA 4QBIA 2F6RA 2ZE7A 4G3XA 5HZHA 1UKVY 1W2GA 5JECA 1W47A 1HY3A 2ATXA 1E9FA 1FMJA 4U02A 1QHYA 2E1RA 1RRGA 4C0BA 4PO8A 2GETA 4QKQA 5JJIA 3GLGE 1KMQA 4LJ4A 2G0TA 3FMPB 4M0LA 5B58C 3ZZTA 4GI7A 1P73A 2F9LA 4Q47A 4NBSA 1KK1A 3K53A 1XTSA 2WMNB 2ZAMA 3SJAA 1Y3AA 2RMKA 5GJVC 1E2QA 2JGNA 4A8JB 2IYQA 3B6EA 3KXLA 2V6IA 4HDCA 4QC2A 4KVAA 3W9YA 2CMKA 1R7RA 2J1LA 4EPTA 1W48A 5EZ6B 1UFQA 2B8WA 5P21A 1N5LA 4JLPA 1EWRA 4DEXA 2BBWA 1T3SA 1KO1A 1WBBA 5L3SA 4YC7A 4G5QA 4WBSA 4TSFA 5EXSA 2QTHA 5IDVA 1W0JD 3AVOA 4Q66C 1KK2A 4QBGB 2C77A 1VKJA 1OFIA 3QF4B 1JBKA 2NO1A 4IFBA 4JYBA 4A15A 1YHNA 3O8BA 3U6KA 1RC8A 3AVXA 1ZC3A 2ZR0A 1BIFA 1CKEA 4DKXA 1I4LD 3NH6A 4LBYA 2BEKA 1OKKA 5DHAA 4GOKA 4HAUA 3EARA 1F3OA 3ASYA 2WSSA 1W36B 4S2EA 2ZRAA 2NOAA 1N6PA 4I1SA 4OK6A 3MLEA 4CEHA 4OQLA 4TYYA 1GNQA 2ZI4A 5EP1A 3OE7A 4LGMA 3LAWA 1Q1BA 2O5VA 1EFTA 1VYVA 2FWRA 4ZPXA 4D25A 5FBQB 3VTKA 1AS0A 1ZU5A 4B3GA 4TMZA 2D74A 3SFZA 1WF3A 1NLFA 1NVUQ 3DOEA 4NKRA 5IT5A 3K1JA 1IN7A 2WJYA 2GJ8A 2ZRBA 1E2HA 2GJAA 4X8LA 4RJLA 1FPMA 3TUIC 5FTJA 3W90A 3N2EA 3IQWA 1N6KA 2HEIA 4Q7KA 2J7PD 3Q72A 3R8FA 2QTVB 4RD0A 3RS0A 1HA3A 1SVWA 5EZ5A 1XMVA 4MYUA 2CLCX 3VNVA 1NLZA 5H68A 4CGZA 4DDTA 3M0EA 2Y8EA 3K9GA 3ZDQA 2G9NA 4EUNA 2R6AA 1GNRA 4NYMR 3ZS9A 4L15A 5FL3A 1SXJE 5LD2B 2OCPA 4EPYA 1COWA 2ZRJA 2FN4A 4GMXA 4KLNA 1Q12A 3B8HA 2R2AA 2PL3A 4PFSA 3T34A 4JSYA 1DTSA 1P6XA 3A8TA 4ZDIA 1GUAA 2V54A 3BK7A 3K0EA 3EIEA 4FIDA 1CJUC 1XZPA 3EWAA 4M21A 3TK1A 2VF7A 4XOIA 1KSFX 1QDEA 3WYGA 3VR6A 4E09A 1OPXA 1R8QA 2WOJA 2GVZC 1E2NA 3BD9A 4DLUA 1ZIOA 1P61B 2VHUA 3LQRA 2BCGY 3E1SA 3R7WA 1CJMA 1UBCA 2OV2A 1ZAKA 2WAYA 3EIQA 3I62A 1Z22A 2X8AA 3CWZA 4LWZA 5JI3E 3LA6A 3GFTA 4QOSA 2ZU6A 4ZO4A 1IJEA 3NDBB 4DT1B 4MGZR 3L82B 2D06A 1SVIA 2WWGA 3KJIA 3AQ4A 4LHXA 3THYA 1V5WA 3B1XA 4BLTA 1OXVA 2VL7A 2YYZA 4V03A 4L8GA 1G9XA 3PXGA 2CNWD 2P67A 4OK3A 4V0ME 1P75A 3CRVA 4MKHA 4NCNA 4ASUA 2Z4SA 3A1UA 2ANCA 4PO1A 3RS3A 2GBLA 4DCUA 5KDDA 2YKGA 3B9QA 3ND9A 4MGYR 4OHYA 3NH9A 4QGGA 3MWKA 2ORIA 1UKEA 1ZP6A 3GLGB 4WZ6A 4GMDA 1G17A 4QFMA 4N0DA 4RKFA 1EFHA 4I1VA 3TW8B 2D3WA 1OV4A 2A5FA 4B3BA 1Z0AA 3MGCA 1XTQA 5KU1A 1G3UA 2QAGC 4G5SA 5DISB 2VEDA 3EPLA 4M1OA 5LPNA 3MWLA 1UM8A 2GBLC 4IXNA 3C7KA 3PEYA 4PQYA 3PJRA 3RHFA 4C3ZA 3CKLA 1XEWY 4TLBA 2GRJA 4A1FA 5JS7A 3KQNA 2FV8A 4HLUA 3IGFA 1FNMA 4AI6A 1TF5A 2PX3A 1G20E 2IEYA 2W6IA 3G5UA 3B13B 3NEYA 4K46A 5CYPA 4OHWA 4BEBA 2WMOB 1BO6A 2YHSA 4QHYA 4RFSA 2QA5A 5AUOB 2CK3D 2ZUDA 1IY2A 3TE6A 2JLVA 2BBSA 1E9BA 4YMTA 3KFVA 4ZCMA 4OYHA 4FMCF 2GKSA 1E9RA 1KSGA 1TQ6A 4Q4AA 3QBTA 2IYZA 4DRZA 1BKDR 2CHQA 3LH5A 4Z51A 3CONA 4BFSA 1G3MA 3BH7A 2ONJA 1TX4B 2F55A 1IJFA 3IO3A 3KKNA 3I32A 4ZI3A 1DARA 3IIMA 1G291 4PPGA 2ZSBA 4YXWD 4BGDA 3SDZA 1DELA 1AS3A 2QMEA 1QHIA 2OEPA 4KFSA 3KQUA 4RD4A 4B73A 4TMVA 4LY6A 5EE3A 4LBZA 2ERXA 3AVVA 5BXQC 3DPUA 3NBXX 3WRYC 5AJXA 1ODFA 2C04A 4GBMA 4NHOA 4GZLA 1A82A 1P7CA 1X86B 4Q4LA 3KKOA 5EJEA 3NC0C 5B2ZA 2WICA 521PA 4PC6A 4LJ8A 3SBDA 1WDTA 4KCGA 5JI2E 5L3RA 2HLDD 2PJZA 1R0ZA 2EYQA 4MRRA 3CLVA 3THWB 4D4JA 1P2VA 3FMOB 4DCNA 4LJ6A 1CR1A 3E5HA 3K0SA 3U44A 1EXMA 1SXJB 2IBMA 1KKMA 1UAAA 1QBKC 2NZ8A 3A1WA 3HR8A 1UKYA 4N0EA 2FF7A 4RFVA 4HDQB 3RS5A 1QRAA 5LB2A 1LS6A 2CHGA 2WIAA 2F43B 3PUWA 2P6RA 1E1QD 4L9WA 2DFTA 5EUQB 2EYUA 1I4DD 2ZRPA 3A4LA 1N5JA 1E2JA 3TVDA 4C0HA 1GIAA 1MT0A 2FSIA 3L8YA 4IOJA 4KFTA 1P62B 4A82A 3IO5A 4TLCA 5L8VA 3ICEA 4QHTA 2ZRDA 2O0HA 2HF9A 4PSKA 1EFRD 1WA5A 3L0PA 3T1QA 3ZGXA 1HUQA 6Q21A 1XXHE 3HJNA 2ZJ5A 2GVDC 1N0WA 4L4UA 1JQJC 4U5XA 4FCWA 5HCIA 3EPJA 1ZUIA 4WW0A 4MDFA 4AKIA 3PCRB 4V0NA 3QOFA 4LOAA 3AUYA 5K8TA 4Q03A 1MO4A 3PQCA 2AXNA 1PVOA 5HKKD 2ZJ2A 2QL6A 1G41A 5JWOA 3MSXA 3ZLJA 2OBMA 2PCJA 1P2TA 4Q4JA 2ZITA 4Q1AA 3PENA 3D31A 4B2LA 2P6NA 1GTVA 5G3ZA 1AZSC 1E0KA 1HE8B 3A1SA 4DDWA 4R7ZA 3QXCA 1YRBA 5DYIA 2X77A 2ZS7A 4DLZA 3SHFA 4DB4A 4MRPA 5KSOA 1VYUA 1GNPA 2OCBA 3K8YA 4JL5A 3ZQJA 1P9NA 1Z0JA 4AKHA 4QGFA 4M8NE 3RS7A 1DAHA 4B3DA 2VHQA 3IHLA 1WBDA 3PUVA 3TJZA 1KZGB 2Z43A 4P4TA 2WWWA 3OAAA 3BWDD 2I3BA 4TLAA 1T8UA 1S1CA 1VG0B 3AVYA 2RGDA 1EGAA 2JEOA 4MYCA 1KI9A 4M9ZA 3GP8A 4PPQA 4NDZA 4WOPA 3PUZA 2XXAB 1BYIA 3UWOA 3JZMA 2W6JA 3BFKA 1RE0A 3NG1A 4PC3A 1BS1A 1JR3A 2GK7A 1KI6B 1G4AE 3O8CA 1Z6GA 4A92A 3G82C 4XD7D 3U6BA 4EKDA 2HXSA 1DAKA 3NWJA 2DWPA 4D82A 2BJVA 2F1HA 2OFWA 2QP9X 4C7OB 1CEEA 1I2MA 4JZKA 3NVAA 4DEYA 3IKJA 5DGXA 2BHRA 1A7JA 5HPYB 3U44B 3QNUA 2ODWA 2FJUA 4XIGS 4LC1A 4C30A 2YWGA 4US2R 2J0VA 1FUUA 2C9YA 5FPYA 1FL9A 2IYSA 1YZLA 2PBRA 3M4YA 4AWXA 1ZNZA 4EFNA 3U3OA 2JJ1A 2GCNA 3BJIC 1P72A 4AC9A 2C78A 2REBA 1RKBA 2VHTA 3K0FB 5HR5A 2DFNA 4JT2A 4D0LB 5JSZB 4W5WA 2FPMA 1U94A 1R10A 2JATA 2PLFA 3C16C 5UKDA 1OXTA 2QENA 4JS0A 3AM1A 2DBYA 4DWJA 3KUCA 3UK6A 4OL0A 1DAGA 4TYQA 1E79D 3AVPA 3MJRA 5JMTA 3W6OA 1AQYA 4RKEA 1OHHA 4BPBA 4J0QA 2IWRA 2GNOA 2C03A 3A36A 3N2IA 5HTKA 1Q20A 2BOVA 2RAPA 4HAWA 4A2PA 4LHZA 2ZRKA 2B92A 1EX7A 3P1JA 1S9DA 4Q19A 5FOSA 1OIXA 1RZ3A 3SBEA 3ZVLA 3GLFA 1JXOA 2QUZA 1U9IC 2GEDA 3TSOA 1I4TD 621PA 3LV8A 1ANKA 2ZAOA 1NN5A 2UVQA 3FB4A 1IHUA 1K8RA 2DHRA 2OLKA 5CLLA 3SNHA 3PEUA 4PTLA 1G8HA 3PFIA 4JL8A 5SZIA 2W00A 3B85A 2C95A 4PQFA 4Q4JB 2VBCA 4JLOA 2WAXA 1XXHB 2ZI6A 4LJAA 2DCUA 1G8PA 2DYKA 5FBLB 1N3BA 1UADA 2ZI7A 3TR5A 4HUQA 1XP8A 5G53C 2AKYA 4Z8XA 4GP7A 4M4SA 2EFCB 3K9HA 3QEJA 2OILA 4R2IA 4KVGA 1HQCA 5CITA 4RSGA 1Q1QA 1ZUHA 4OKSA 5FPSA 1A2BA 1ZD9A 3GJ3A 2V6JA 1R0YA 1ZC4A 1ZW6A 5GADl 3E2IA 2P2LA 1CXZA 2A9KA 1M1YE 3AF4A 5E7IA 5J40A 2VO1A 4Q00A 4E22A 5F98A 4WZBE 2ODBA 3AP1A 3AKCA 3O8DA 4II7A 3UMRA 3ZD6A 1Z6XA 5DI3A 1DO0A 2F9MA 3MD0A 1KI7A 2Q6TA 2OT3B 2YOHA 1XD2B 2CBZA 1RRCA 3LFUA 1D6JA 4NL4H 2IYWA 1M6NA 2YNMA 5JWRA 1SVKA 3TUZC 4BECA 1HQYE 2WKPA 4Q1FA 1TF7A 4KAXA 2JLWA 3LQQA 4PZLA 1D9ZA 2KBFA 2XNDD 3LLMA 2WPDA 3C15C 2YVUA 1YU9A 4PC1A 3I5YA 4GT1A 1BOFA 1KY3A 3X1DA 5FL7D 2X2FA 2R44A 4FMCB 1M2OB 1KJYA 2LCFA 4OJQA 1O87A 3GCGA 5J4LA 4MH0R 5F3WB 2IYYA 2ECKA 4LYFA 2CLDX 3NBZC 4KBGA 4MQBA 5AJZA 1NMZA 3TRFA 2YJTD 2P3SA 4DLRA 2FMXA 3F8TA 2O8DA 2C8VA 3QPVA 1YZKA 4L5BA 4XTRA 2REXB 1XEFA 2QAJA 4A0HA 4DIDA 2EFHB 1TMKA 4DHEA 1G6OA 1R5NA 2Z5FA 4WA7A 2O8FB 2AD1A 1RIFA 1Z6YA 1AZTA 2FGJA 3RRMA 5E3HA 4O3MA 2V55B 4K81B 5K8UA 2GEVA 2J0UB 1AA9A 4JLVA 4LBVA 4R2HA 4WXRA 3I5XA 5C46F 3MUFA 2R8RA 2B7CA 5KDOA 3QBVA 2XB2A 1U90A 2EFDB 3ZJYA 1F60A 2V8OA 4O2LA 3NEJA 4RZ3A 1G21E 4TT3A 3RDPA 1ZINA 2ZRLA 1FP7A 4MKIA 3EWSA 4DSOA 3VX3A 2BMEA 1TQDA 2ZQ5A 1LF0A 3VKWA 3GLFB 4JVSB 1G8FA 4DLTA 2OCAA 1NBMA 4EQ6A 4Q9LA 1IBRA 3DMNA 3I4LA 3QG1A 4O0MA 5EQTA 3V4RA 2ZR9A 1QG4A 2OXRA 2FH5B 2VRWA 2SHKA 4EAQA 1SVSA 3F3YA 4F4JA 2FFAA 4JLKA 2H5EA 1XWIA 3OESA 2WM9B 4MUAA 1TEVA 2NG1A 2N1BA 1N5IA 1UEJA 1FNNA 2QROA 3VX4A 3THXA 1UBFA 5E7MA 2IYUA 2ZUBA 4HUQB 1R0WA 3MWYW 4HB2A 5DE3A 1XJCA 2VSFA 4UNPA 1TU3A 2PEYA 3T5GA 4A8JC 3GLFE 2IXFA 2HV8A 2CE7A 3AB3A 3OFNA 4CZ2A 1FQJA 2QRZA 2QT1A 3L0OA 4G1UC 4ACAA 5BW8A 4Q4HA 2JLQA 3RC3A 2XNSA 4XSGA 2CVFA 2FEMA 4GNKA 3U3KA 2FSGA 1NF3A 2AR7A 2OUKA 4DUGD 5AJYA 1KI1A 2O8CA 2IUUA 2UKDA 3EZ7A 1U8ZA 5AJVB 4TL8A 1M7HA 3CX6A 4M1KA 5L3QB 2ZSAA 1XTKA 4UKDA 3QUSA 3A58B 3GLIB 3LBNA 1AKYA 3SU8A 3CRW1 4JLNA 3A1TA 3VHXA 2J45A 2AHOA 4F7WA 1N0UA 1W36C 5A4JA 1E99A 3QY0A 1C9KA 2ZJAA 4BUJA 1AM4D 4OHZA 3QXJA 1EFUA 2R65A 4NE2A 3DL0A 2H17A 4A6PA 3C5CA 3S1AB 1AN0A 1M74A 1YKSA 3T61A 1GWNA 2R9VA 3CH4B 2QBYB 1G18A 1IN4A 1RYHA 3FVQA 3H0KA 3X1XA 3GJ7A 2V1UA 4RD1A 2ZSFA 2QQ0A 1KO8A 1JR6A 5E7JA 3GMTA 4B3XA 3K9LA 1XEXA 4XSHA 2R6DA 2VSOA 4HB0A 2RGAA 4QGHA 5BQ5A 2WJGA 1E2FA 2C5LA 4QBFA 3DMDA 1II8A 3SHWA 1MABA 1XJ0A 4FWIB 4RCZA 5EP3A 1CRPA 4MGKR 4KJZA 3V4FA 3W8RA 3I1FA 3RC8A 2WWXA 2AK3A 3M1IA 4GZMA 4QHSA 2JDID 3QKSB 5GJWC 3SC3A 1MRSA 3QPWA 3K0CC 3RSLA 4TL7A 1W0KD 5JRJA 4O2RA 2FFQA 3P4YA 4JLBA 4GDFA 3RS4A 1BMFD 1G7SA 1SKYB 1LF5A 4IOKA 4V0KA 3EPKA 2XB4A 1NY6A 5J5CA 2QGZA 2HDNB 2IS1A 2K5UA 1NMXA 3MAAC 2P65A 1W36D 2FA9A 3FWYA 2J3EA 4CDGA 3BS4A 3KJHA 3OEED 2CL6X 2RHDA 4QJ4A 5FBWB 4BFWA 2ZXUA 4US1R 2G1JA 1GAJA 2L0XA 1H8ED 1OH5A 2BMJA 2NO7A 2CL7X 2Q0HA 4WIAA 1PLLA 2GCPA 1V43A 1P3JA 1UJ2A 2DFKB 2IYTA 1XU4A 1W4CA 3LY5A 3MJHA 4DCTA 1NVXQ 1OXSC 4ZIRA 1ELOA 1Z6AA 2GJSA 2XZPA 2C9OA 2WWFA 4CIDA 2ORWA 2CNWA 2WKRA 3MG9A 3SN6A 3SI7A 2PCLA 2XITA 3VQTA 5KHOC 1FQKA 1MV5A 3R9IA 1P4SA 3IEVA 1NKTA 2PLRA 4PC7A 3RWMB 2RCNA 2QG6A 2ZYUX 5FOTA 2R6FA 4F38A 4QG7A 2F1JA 1SULA 4JJZA 5G41A 4D6PA 1DVRA 4PSVA 1PUJA 3HWSA 2AD5A 4EJSC 2EWWA 4TMXA 2D4HA 2QU8A 1Z06A 1OJLA 1DAEA 2QMOA 4NU0A 3UXMA 3KDSE 4IVRA 5FOXA 3T1OA 4DLXA 1GRQA 2OSBA 4D4MA 3CB4A 5H8WA 3KB1A 1NSTA 1OIWA 5KOYA 1E0JA 1LY1A 1YZGA 2GF9A 4RD3A 3TR0A 4M9QA 3WP1B 2V7QD 3KUDA 1E69A 3C14C 1Q1ZA 2G0NA 1L2TA 4GFDA 1UEIA 3CX7A 3PEWA 2F3RA 1CF4A 3CNNA 4JVNA 5FTNA 4MKFA 1XCPA 2ZS9A 3K0AB 2W2XA 1TF2A 3ADBA 2JIZD 2WJVA 4OQMA 1KJWA 1NSFA 2QEQA 3AV0B 3ZVRA 2JASA 1J2JA 1H65A 2CK3A 4UNRA 4OHVA 2Z6VA 4HLDA 1IXRC 4OJKA 4CEIA 3FKSD 1IOZA 4BFUA 1W4BA 1PJRA 4XWAA 4HAYA 3IDQA 1S9HA 2G77B 2JLRA 2XZOA 5SZHB 4R71A 4TZ0A 1GG2A 1Z29A 1G7TA 1KAOA 1NVWQ 2O0JA 5KSZA 3DHWC 3Q7PA 2WWYA 1CR4A 4YXWA 4HSEA 3VR3A 1XMIA 4G5OA 5BN5A 1OFTA 2PJRA 1KNXA 1P9WA 2R6CA 2A30A 2MMGA 3OEHA 2ZJZA 4W5JA 1Z2CA 3SE0A 3FHTA 2XTMA 1XD9A 1ZM9A 4LRWA 1YZNA 4KFRA 5A0FA 2WIBA 1NN1A 4JKIA 4E5UA 2QAGA 3LXRA 1G6HA 1HT2E 2ZJOA 4C0LA 4B2PA 721PA 4C9BA 1ZD8A 2IEZA 3U4QA 2ONKA 1GRRA 1KDTA 1KJZA 3GJ8A 1OFHA 5BYJA 1ONBA 4Z8YA 2HLDA 5L3SB 5F9HA 1KMHA 2OE2A 3KB2A 2WSSD 4IW3B 4QBHA 2IF0A 4Q21A 4HATA 3X2SA 4HI0E 1E0SA 4TMTA 4U00A 2J5XA 1E9EA 4BZXA 2P0EA 2OZEA 1MO3A 3REFA 4DCVA 2VYFA 1FP6A 1GFIA 3BE4A 4R9UC 2FPKA 4H1VA 3DKVA 4JVMA 5L3VA 4CEHB 4NYIQ 1SXJC 1QG2A 4KFUA 2WJIA 3GJXC 1E1QA 4TWZA 1E6CA 2O8BA 3A1VA 3FFAA 3SS8A 1H8HD 3ZYCA 1Q3HA 1ZBDA 2NO6A 3X1ZA 1MH1A 4JYCA 4OQNA 3NHAA 3QIAA 2FDCA 3OF5A 1UDXA 3FE2A 4BRUA 3CZPA 1EFRA 5TB5A 1TQ4A 1QHSA 3DZ8A 1NJFA 5J4KA 5FTMA 4EFMA 3ZIAD 4KODA 1KHTA 5FI1B 2IUTA 4O25A 3CR7A 2GK6A 3U61B 2YV5A 4Q7MB 1N25A 3D3QA 4Z1MD 3LDAA 1JEDA 2YC4C 4IOMA 1COWD 8OHMA 4PAOA 1DE0A 4AYWA 3CPEA 4Q02A 1GL6A 4AY2A 4C0AC 4F91B 3LWNA 1E96A 1Z0KA 3EX7C 2HCJB 2WV9A 4JVLA 3L0IB 1CJVC 1JNYA 1UF9A 4Y0AA 5HKKA 2XSZD 2QY9A 4ERNA 4ZDJA 1HURA 2AFHE 4TQ9A 5C4GB 4YMVA 1DADA 4FCTA 1U0LA 1KO7A 3WBJA 4AG5A 3ADCA 3T1TA 1XNJA 3NIBA 5CK5A 4CEIB 5BN4A 2N42A 4GOXA 4AG6A 1SXJD 3TQFA 2QSYA 1ZM7A 3ZZ0A 2LWIA 3LNCA 2OAP1 4RD6A 5FBRB 2IYRA 1AGPA 3WYFA 4BFVA 4LSGA 4LC0A 1XTJA 1JECA 1JI0A 2CCJA 3FKQA 3PITA 4UXHA 3R7WB 1N6HA 2WJJA 1FTSA 3N70A 5D3MA 1ZNXA 2A3RA 3X1WA 5KNCA 3RNLA 5KTYA 3CRRA 4I1OA 4M22A 4FI3C 1DAMA 4ASUD 2CCGA 3TBKA 3QPUA 4UQOA 2ZEJA 3D7MA 2F1IA 2WZQA 4OK5A 2IS6A 4EFLA 3QKRA 4G01B 2BM0A 5DNYB 3THYB 4DCSA 1NY5A 1LNZA 3FFBA 1AQUA 1G16A 1NVVQ 3ADKA 4W9MC 3L8ZA 1JPNA 1KTVA 2IC5A 4QJ5A 3WP0A 1A1VA 2IHYA 3PV0A 4P4SA 2QAGB 5AWFC 1SVOA 3QJYA 1WB9A 1Z28A 2PX0A 2AKAB 2BBTA 1YJ5A 4IHQA 4JLMA 3AF2A 4XD7A 2J87A 4PHTA 2GILA 3Q9LA 2O8EA 4LDJA 2B8TA 3P32A 1JJVA 4G0NA 4OQXA 3AVQA 1Z3IX 4NMMA 1RRFA 3OIWA 4GP6A 1T4GA 3DVLA 5D3QA 3EA5A 2CLSA 1U81A 4HEJA 2YWFA 3WRXC 1TU4A 3B9PA 1EESA 1DBSA 2HF8A 2WVJA 4IEIA 4UNQA 5SZJA 2W0MA 4FINA 2D2EA 2P5SA 4KO8A 4I81A 2IF2A 1KO5A 1D9XA 4NTZA 2BMDA 1SVMA 4FWTA 4JBXA 3TLXA 4XWOA 3R8CA 2DB3A 2JA1A 5LBIA 4B6EA 4RFSB 4FN5A 4BLQA 1N6NA 4QRHA 3CF0A 4HAVA 1Z2AA 3QSYA 1GL7A 2X19A 1F2TA 4D81A 4Q4AB 2HJGA 1YR9A 5CJPA 1JR3E 4ZDKA 1QHNA 1E2EA 4C4PA 5KYKA 1P2SA 3B1ZA 1X3SA 4LYAA 4RZXA 4KXFB 3TQCA 3GFOA 1XTIA 4DLYA 4OBEA 1ZCBA 3W3ZB 4LV8B 1IY0A 3AH8A 1Z0FA 1KO4A 1ZRHA 4B76A 2IA5A 1S3GA 2NO9A 3ZZUA 3EZ2A 1G1MA 5KNDA 4Q9IA 3WMGA 2JLZA 4GPTA 4UNNA 1NJGA 3K09C 4JSTA 1OH6A 2VSXA 2XJ4A 2NQ2C 3TH5A 4PXAA 2W83A 3DDCA 4HYYA 4CEJA 2MSEB 3QENA 1G4UR 1JXMA 1ESNA 1YZTA 2ZTSA 3RAPR 3DKPA 1HEIA 2J46A 4E07A 3IIKA 4IVQA 1X1RA 2ZRHA 5CDFA 1UBEA 3I73A 5AUNB 5DLQC 1MRNA 4URXR 2WKQA 1IN5A 5AK0A 3P4XA 3D8BA 2H16A 1E4YA 1R8SA 3P27A 3AKDA 4LZZA 3VFDA 2GA8A 1U0JA 3SYNA 3DM5A 4DC9A 1OFUX 3BB4A 4B3CA 3UANA 4BQSA 1F2UA 1E1RA 2ZI3A 4LYJA 3ZS8A 4PPFA 4BWYA 1J7KA 1S96A 2ZS8A 1AKEA 3MMPA 4BFZA 4MDEA 1FMLA 1FW6A 1Q3TA 1U9IA 1W1WA 1T3HA 3RSOA 4MITA 2QE7D 1II9A 3BGWA 2AX4A 3HPQA 1SGWA 4HZUA 4DZZA 3QXHA 4AKEA 1VCMA 2QZ4A 2XNDA 2Z83A 5JEDA 2CEAA 3I61A 2QP3A 2P6UA 3BERA 1Q21A 3AUXA 1AS2A 4BASA 5FL7A 3PUYA 1D2NA 3PVSA 2FG5A 2FZLA 3W34A 1XPRA 1ZMXA 4NCIA 4YMWA 3CIOA 1K5GA 1TUEA 4URZR 3U7EB 1G8YA 1SHZA 2OLJA 1E9AA 2ZSDA 5CJ2A 4F93B 2RHMA 4PX9A 2KWIA 1BYUA 5EXXA 2A5YB 2ZRGA 1X8KA 2J59A 4I4LA 1XCMA 4EDHA 5CYOA 1AIPA 1GILA 4F4CA 1KSJA 4CRWB 2O0KA 3UKDA 1IONA 1JB1A 2H1LA 2JAQA 1W49A 5ANRB 2OCYC 3SJBA 1NLYA 5FUXA 5DYGA 3W6PA 3GJ4A 1T5IA 3UMFA 1R2QA 5KNBA 4TL6A 1KAGA 3HR7A 3QEOA 4KYUA 1JALA 3GLIE 3CNOA 3OZXA 2D2FA 1Z08A 1CBUA 4A0GA 3IBGA 4AIIA 2VQSA 3RS2A 4NCJA 2VHCA 3LVRE 5CK4A 1J90A 1IN6A 1Q0UA 1KK3A 4NYJQ 1XB2A 1T5LA 4IXMA 2H92A 2W6JD 2H8KA 5KSYA 2AWOA 2WHXA 2A78A 4CVNA 1G64A 1US8A 2ZU0C 5JCZA 2Q3HA 4I1UA 1L4UA 1P2UA 2IK8A 2XOKD 4YMUA 1P60A 2VP4A 2BKUA 3ND8A 5AUQA 1FUKA 2TMKA 4BLRA 1DO2A 2QSZA 3HYRA 2C99A 4URUR 3TMKA 3HDTA 1RRPA 2GAOA 4DDUA 1RYFA 2QN6A 1R5OA 4PZZA 3EC1A 2NZJA 4D0NA 5FI0B 1OH7A 1I2DA 3UMSA 2B21A 3TUJC 1GVNB 1B0UA 2I4IA 1NIPA 5AUPB 5DN6A 3TKLA 1T0JB 3K70B 4CW7A 2ZJYA 5M04A 3KQKA 4D80A 1KDOA 3GEHA 3HPRA 4DB2A 3NKVA 3UG7A 3KFXA 4DUGA 2JLYA 4PZYA 1SKYE 4HAZA 3FHCB 5FR1A 5B30A 4WAUA 1MO6A 3PG5A 2NTYC 4BZPA 1U0HC 3TAUA 4EPVA 4XTCS 3B78A 2QM7A 3CPHA 4HB4A 1NBME 1IXZA 1OHHD 4TYPA 2JLXA 2NGRA 1PZNA 3QXXA 1JPJA 3D6TB 4C2TA 4AK9A 2QMHA 2HT1A 3CR8A 1J70A 1GKIA 2YOFA 3VR1A 2YWEA 1N6OA 1NL3A 2JLUA 2AN9A 3KXKA 3R20A 1X8JA 4M1SA 3EASA 1KNQA 3TIFA 1HH4A 2X1VA 3L2OB 2FSFA 2WTUA 5BN3A 2OFXA 3T15A 1G7RA 1GP2A 3VR2A 2NIPA 1EK0A 4B75A 2IYLD 2OBLA 2VHJA 3VNUA 3I92A 2VP5A 2ODEA 3BBPA 4IDHA 1TPZA 1M7GA 4EPXA 5JJLA 2GEUA 4A8JA 4P0TA 4S35A 4DJTA 4AKGA 2CL0X 1DOAA 1M34E 1IQPA 2VA8A 5J4YA 3CF2A 4XJXA 4DDVA 4X8HA 3PEVA 1NI3A 2JJ8A 3NTUA 1EWQA 4B71A 2JDIA 2OBNA 3ZVMA 1ZCAA 2CJWA 1G8GA 2WOOA 1CS4C 1W0KA 3Q7QA 2IHBA 3QF4A 3UPUA 1G5PA 3CWQA 3KTAA 1T9HA 4YONB 5EP4A 3BIFA 2BKEA 3CBQA 4TQUS 1ZIPA 5EE1A 4LPSA 4DLVA 4ZCIA 1B23P 1W0JA 2UZIR 5TXGA 2HJVA 5GVRA 3VAAA 1BH2A 1XD8A 2IS2A 3OEEA 3GJ6A 2FX3A 1H8EA 2OO7A 1Z47A 1Z83A 3LRPA 4KSCA 4QM6A 1OLOA 1E2KA 5DI3B 4D26A 2BDTA 3BH6A 5TARA 1HE1C 2H57A 3LX8A 4PC2A 4TTPA 5DHFA 2WPDD 1FZQA 3NDPA 1N5KA 1FX0A 2YZ2A 2GZDA 1II0A 3MWJA 2QQEA 3K9NA 4K8OA 4OHXA 3SYLA 2NMVA 3H86A 3AVWA 4Q7JB 1TL7C 2JJ2D 2NO0A 5FBVB 1KK0A 2A5DA 2J41A 4IRUB 2V9PA 3LW7A 2GXSA 2ASEA 5HE9A 1VG8A 3CX8A 4RZUA 2REOA 5F2EA 2DFLA 2ZETA 5FTLA 1A2KC 2KSQA 3ECCA 2VLIA 3K0CA 3LBIA 4BFXA 2VP2A 3U7GA 1R0XA 1MO5A 2J7PA 2WBLC 4Q9HA 4Q5IA 1QHHA 3ONWA 4C0SA 1OE0A 1VTKA 2J0QA 2PEZA 2CDNA 2O8DB 4YDHB 3VU9A 4A2WA 2GXUA 4Q1CA 2DPXA 4WVFA 5JBQA 4OI4A 3IHWA 2R62A 5C2JB 4TT3D 3SR0A 3QF7A 5DSZA 3H4MA 4AYXA 5TV2A 1MOZA 5DI9A 2JIZA 4BFYA 4GSYA 3VKGA 2W2TA 1SVLA 3CZQA 1XPUA 3BH0A 4LV6A 5KPDA 1OH8A 2ZIAA 4ESHA 3I72A 4B32A 3NBFA 5LD2C 3GLHA 1CU1A 1DS6A 1NBMD 3CF6R 3FKSA 3SZRA 2GXAA 2W2VA 5JEEA 1N6LA 2RGNC 1C1YA 4IEEA 3ZQ6A 1E9SA 3PUXA 1ZNWA 4DT1A 2VIIA 4KV9A 4D0GA 3R9WA 3SOPA 4A9AA 2BMFA 2F7SA 1ZD1A 3Q8XB 4B34A 4GOJA 4KLZA 4EQ6B 3WXMA 1QHGA 4KHZA 4QNMA 4B48A 4Q7LA 4PHHA 2GJ9A 2I1VB 3FMIA 2XTNA 2OAQ1 4M1WA 4KSBA 2PT7A 2XAUA 4PHFA 2D7DA 4ZDWA 3BB1A 4EJSA 1AGRA 3TSZA 3REGA 2VF8A 1N0VC 5JLJA 1U99A 2CJWB 3OFND 4G5GA 2P5TB 3THXB 5IK2D 4MRVA 1MKYA 3GLGA 2GJKA 2W0SA 3ZH9B 3FMFA 3KTAB 4JT4A 2ZJ8A 5CIQA 2GTPA 3R9XA 2VH5R 1DEKA 3CRQA 1ZM3A 5JHHB 4P31A 3FTQA 3BC1A 3GEEA 4A0RA 1E0AA 4B43A 4ITRC 1QZXA 3KX2A 1VECA 5EXPA 3P26A 3V9PA 5JHGB 3T5DA 2BC9A 2VP9A 2VP0A 1VG9B 2QM8A 3KKMA 4HLCA 4Q4HB 4AURA 4H9GA 2IYVA 2O8CB 3P20A 1IAQA 4WZAE 1LV7A 2ANBA 3T1VA 1XTRA 3IILA 1SQ5A 3UWKA 2J9RA 5EE9A 3RRNA 3KL4A 4KI0A 5FTKA 4BLOA 5IF9A 1CRQA 1OB2A 3LVQE 2OG2A 1FX0B 1Z07A 4LJ9A 5CIWA 2DWQA 4LHYA 2CE2X 3TAHA 4P33A 4TTRA 1W5TA 4IOLA 3UIEA 4PAQA 3DZDA 2FEOA 1H8HA 2QTFA 1CJTC 3W6NA 2PMKA 2LKDA 1YQTA 2GF0A 4TLDA 1FOEB 1KI4A 3SQXA 4UJ3A 1CIPA 1VCOA 4NYIR 5F9FA 5CB6A 1UBGA 4M2LA 3RRZA 5J47A 1OB5A 1NG1A 3OIVA 3WNCA 1XMJA 3ZIAA 4D2IA 5TVKA 3KKQA 2ZRIA 2IWHA 2WWIA 1R6BX 1T91A 3VMFA 4ESVA 4LHWA 5EXTA 1HTWA 5FH9A 2ZVQX 4Z1MA 4YLGA 3WMFA 4B33A 1VYTA 2RB4A 1VPLA 4DIEA 1CR0A 1QHHB 1XEXB 4QM7A 1NN0A 1HV8A 2BM1A 4JJKA 2QPAA 4M9SA 3VU9B 5LB4A 1II8B 2RGBA 4URVR 1MABB 1VHTA 1VIYA 3B5JA 4ARZA 4D4LA 2V1XA 4LV5B 3EZ9A 4HUTA 4UNSA 2OXCA 3QG5A 2XSZA 4PANA 2E9SA 2D7CA 5TDHA 5FOWA 4Q01A 3Q3JB 1RW4A 2N46A 2R6GA 3AEZA 1L4YA 5FUVA 3CM0A 4V0OA 4TSFD 3VR5A 4ZKDA 5KO2A 1U8AA 1E2MA 4XVUA 3FOZA 1AK2A 2YWHA 5FOVA 5C18A 3THWA 4V02A 3W5IA 4LK2A 3GLHB 4XWKA 1G5RA 3CW2A 1OF1A 4EPRA 3LO5A 1SXJA 3EPHA 3FHOA 4YMSA 4JIMA 3KQHA 3AGPA 4TMKA 2QPOA 1GM5A 4HLQB 1OKKD 1XX6A 4Q9JA 5KSPA 4EPWA 4A36A 1DG1G 4AD8A 3GJ0A 3IPXA 2YC2C 3EW9A 2OM2A 4FW9A 3MRSA 2F43A 2GCOA 4C0KA 2ZR7A 3OE7D 3IEUA 3EZFA 2GESA 1L7VC 2HXYA 1E9CA 1CTQA 3C4JA 3CO5A 4M53A 2HYDA 3WYAA 1KI3A 3QI2A 2AK2A 2DWOA 4Q1BA 4V0LA 4EJSB 4QNRA 1ETUA 4E03A 4ZIRB 4HDOB 1NNEA 1KI8A 2ATVA 3HYTA 4BLPA 2HT6A 3ASZA 4LJYA 1UKZA 1CULC 2ZYWX 4FMDF 3LD9A 4HAXA 4CYMA 4FCVA 4XH9B 3C8UA 4ON9A 4NYMQ 3TNFA 3LX5A 2J0SA 1PLKA 4FD2A 5JCPA 1E9DA 1NVVR 2ZRMA 1S0UA 1WE2A 3KJEA 1Z0IA 2FE4A 2Q21A 1G19A 3F0TA 1ZYUA 4L16A 3BFVA 4MA4A 2XZLA 3EA0A 3HU1A 4NP6A 1Z5ZA 5FPHA 3SQWA 4NZYA 5G3YA 3GJ5A 4OI1A 3BB3A 5BYKA 2ZREA 821PA 2Q3MA 3H2YA 3EZ6A 5B57C 2GXQA 1U8YA 2Q9CA 3RVBA 2JCSA 4DSNA 4Q48A 3U7FB 3WY9A 3CH5A 1XJQA 3BFXA 5DIFA 1GDDA 2ZE6A 4IKEA 4PHGA 4W5HA 3FDIA 1KSHA 1QVRA 1QHXA 1CJKC 3QE0A 3U60B 1ZJ6A 4URYR 1TUIA 2PZEA 2HCBA 3B1VA 4MKGA 3SFVA 3H84A 3GPLA 1E4VA 1VG1A 2IXEA 2IT1A 2Q9BA 5IHPA 2QPTA 1OT3A 1TAGA 1YZQA 3RWOA 3W8NA 4HLUC 5AJWA 2G83A 1VCNA 2EFGA 3JVUA 1Q57A 1XFAA 4A2QA 1XRJA 2ORVA 1C4OA 2RGGA 1IXSB 3AKYA 3FPAA 3OEHD 4TQAA 4GL2A 4ILEA 2A2ZA 4PPNA 3U3RA 4U7DA 1T6NA 4R98A 3O8RA 4NONA 2XXAA 1JAIA 1S1MA 2ERYA 1RPZA 3H1TA 2FFBA 1TNDA 2MMCA 3GFPA 3CUEF 4H1UA 1D2EA 2A5GA 1KI6A 4POAA 2QNRA 4ARZB 3N5CA 1ZM2A 2OESA 5B64A 1YR8A 1W5SA 1X1SA 1FFHA 1KYIA 1D2MA 3NXSA 1KY2A 4MYHA 1U98A 1UDWA 4FXPA 3ZD7A 1PLJA 2EW1A 3I8XA 4C7OA 4RD2A 3U4QB 2XGJA 4N3NA 3B82A 1XEWX 1W7AA 4DLSA 5E95A 1FTNA 3OIYA 3TVTA 3V00A 1KMHB 1VMAA 1XZQA 2QP4A 4TZ6A 1S3SA 2PT5A 2ZRNA 3IIJA 4TLEA 2QT0A 2GCOB 1G5TA 2FSHA 3K0FA 2FPLA 2ZUCA 4LBWA 5EE0A 3MFYA 5GJBA 5JSZA 1QF9A 4NPHA 4C2UA
chains in the Genus database with same CATH superfamily
1G3QA 1OBHA 2XX3A 1FU4A 3VSBA 1Z8FA 3CUTA 1OCEA 1H1LB 1FYXA 4LE2A 2F8LA 5ECYA 1KERA 3UT5B 2JFHA 2X5XA 3HN7A 3IVAA 4CFSA 4UHJA 4RWEA 4Y0VA 1GAEO 2EP7A 3A3YA 1PR1A 4PZUA 3WJ1A 1NJ6A 2J9XB 4BNIA 1RT9A 3NTXA 4MUBA 2I2FA 1ZUNB 3EVGA 3U7IA 4P3YA 5F5XA 3WB2A 3GEIA 3D7KA 3DM9B 1VBNA 3HSKA 3NQ41 2IL1A 4R41A 2ADOA 1NYQA 1E79A 4XRRA 1PNOA 1TRHA 3TWOA 1JILA 4GAEA 4C0QC 3OY7A 1YQEA 2BWJA 3T06B 2HWWA 3JQDA 8GPBA 2UYOA 4YQYA 3PHBE 4ZI2A 1P81A 1LNSA 1N2CE 1Q11A 4ALLA 4A5SA 2R86A 5AVUA 2V3CC 2PQMA 2X7JA 1RHRA 4P7KA 2DP4E 4M1YA 3SAJA 2GAAA 2W58A 4LF8B 4F5YA 3L8FA 4M9CA 3ZWXA 4XQEA 3KQLA 1E3MA 2Q4EA 3LQFA 2YRFA 1T2FA 4URHA 4X62B 2ZCJA 4NS4A 4EZEA 3QKUA 3A4NA 1D1SA 3P71T 1UL1X 4XEUA 4H6PA 1RJDA 1G8SA 2ZT5A 3COWA 3QU4A 3PA6A 3F5DA 4ZCLA 2JH9A 3VNAA 1YR1A 4O8ZA 1IK4A 5BR1A 1BGWA 4WMLA 4MS4B 2ZPTX 4ZT5A 1A2QA 1VLJA 1ZOOA 3I2JA 3CS3A 4X1KB 4F9GA 3LPNA 1O2DA 3F5FA 5HCUA 4N6GA 5TJ9A 4G0VA 5JRZA 1J2EA 3F1KA 5ALRA 1KI2A 1O89A 2H6EA 3W05A 3CRMA 4KGZA 3UF0A 7ADHA 3NHRA 4CJXA 3QY9A 5MFZA 4QNNA 2PFSA 1G20B 4NCHA 1F5NA 4BE7B 3HU2A 4GH5A 3WNBA 1JFLA 2Q45A 4OXYA 1XZDA 5FOUA 1D2HA 2FMTA 1JWBB 3IBYA 1DHRA 2WA1A 3QV2A 4HNGA 1XD2A 4MRAA 3WO0A 5JUWA 5KTRA 2ZRQA 1LC0A 1OW3B 2E3JA 4FMBB 3T7CA 4Z6KA 2XUDA 4ZOAA 3VMMA 4DJJA 3VJMA 5LOVF 5B6PA 5FNVB 4I3HA 1W9MA 4N3GA 3ZJVA 3U9LA 1J99A 2VRCD 2XOKA 3NT4A 1YZ3A 2DY1A 4BBZA 3U5ZB 3QELA 2GO1A 4TTJA 4GOLD 4H3HB 4R5MA 3ONDA 3WDMA 4AKSA 5IBPA 2VUHB 3BTOA 3KOXA 3ORHA 4UHBA 3C41J 1NONA 5GVSA 2PUWA 4HWKA 3A6LA 2OHFA 3NHBA 4FDAA 5KTSA 5J4HA 3SXUA 2O8EB 1EM8B 3VR4A 1C8LA 3ST7A 5CG2A 4L75A 4EGQA 2QRJA 2DC1A 3DYBA 3MCZA 4UUPA 1WCXA 1D7AA 2YDYA 3MBOA 2XQGA 5JWHA 3FOWA 4TOIA 1G3IA 1K5DA 2OUIA 3EOAI 4PSAA 4HH3C 4LSZA 5H1YA 4AWAA 2CHVA 1XVTA 5D8DA 4EW2A 5DCWA 4LZWA 3ZBQA 3UHFA 4CGYA 1P1RA 3GAMA 4ENTA 5KNCH 3WMRA 3JZDA 4ACBA 2ODNA 4NABA 3HHPA 1HLGA 2Y1KA 4QX6A 4F12A 1EB9A 2Z8ZA 2J0UA 3Q5DA 4PQEA 3ZJ5A 2XCRB 1FLDA 1SPXA 1TM7E 5EVJA 3NC1C 5CW2A 3ZHUA 4JITA 3JVVA 1KWKA 4B3SB 3KQOA 1XTVA 4R1UA 4A0FA 5H3LA 1PFKA 1ZKDA 2BFPA 1T0HB 3I1IA 4UXIA 4LZPA 4K9LA 2GVNA 4XW2A 4ZARA 3TZLA 3X1YA 1XIVA 2NQ8A 3ZV4A 4LYEA 5B7QA 2I4MA 3ZX5A 4WPGA 1UQUA 4ARVA 1MAWA 3KPYA 1GGFA 4HVAA 1DXHA 3RBZA 1LKZA 4OHBA 2HLNA 5REQA 1J06A 1F2TB 2BFCB 2EFJA 4MUXA 3PFGA 4BLSA 1RWQA 3GZNA 4MW1A 1OGIA 2R00C 2GD6A 4NWIA 3PLAE 4HH1A 3R5FA 3EMKA 5H4GA 3BHNA 1X80B 3M6IA 4M46A 1P9LA 1NG9A 1LDBA 3EE6A 2E5LB 4B3TB 4YRLA 4EA6A 3ZWBA 3GUHA 1DRKA 1JU3A 1BHJA 1V45E 2KE5A 4YASA 5C5IA 4TN1A 1FXUA 2QQGA 5BVGB 1GAQA 4GI1A 1PUIA 2PIAA 1JR3D 4RVOA 1M6VA 1C1HA 1EGMB 3EG5A 3IB6A 3EXAA 1TCVA 3A9TA 3Q2IA 3ELDA 3QVVA 4S1PA 3T7AA 5CAEA 3WK7A 2PUGA 1C3OA 1RM3A 1CW2B 1A4UA 3DBOB 3GQBA 5TMPA 2EDCA 4IINA 1UMCA 3MS4A 4RTRA 1JH8A 3TTUA 2KI5A 1TW3A 4U39A 3PRYA 5LQAA 1D2GA 3NXKA 1IM2A 4QXAA 5HK9A 2QLTA 1QO7A 2J7KA 5D5QA 2FWBA 5E2BA 4MKXA 1QYIA 4RANA 1M5TA 1TJ3A 2OFOA 3AJDA 2Y77A 4AMYA 3OZIA 4TYMA 3BDAA 2P6PA 5HX7A 1ZJZA 2QZZA 2RGEA 2RKWA 3L3BA 3AHDA 1CQIB 4FB5A 3OJWA 2MOKA 3MEQA 4FTWA 1L4KA 3WHKA 4M0DA 3F4BA 4G5RA 1NKSA 1LFDB 2FKAA 2ZE5A 4IG4A 1DT3A 4JQCA 4LX0A 2A5LA 4H17A 3KEOA 3I76A 1KH2A 4X94A 4D44A 4EA7A 3B70A 1YRAA 4UPVA 1KE2A 3F97A 2QORA 1L7OA 4DYHA 2A57A 1B26A 2CZQA 1SUSA 1IIRA 4XB1A 3HTXA 2KJQA 2LCQA 3HVKA 1Q44A 2RHOA 2RHWA 4MQ5A 3U2QA 4HADA 4A91A 1KIFA 1NX6A 1V8ZA 3S1AA 1AJEA 1M1YA 4Y7DA 3IT1A 2CW5A 2QTTA 2FRVA 4M1ZA 1GR1A 2EERA 4POOA 3C8MA 1DIRA 2FPWA 4IO1A 1YR7A 3C3JA 4WZBA 4FWBA 2VWHA 1A97A 3HJAA 5C1BA 1NRWA 1BN7A 2V7UA 4MV4A 3SBXA 1PK7A 1OYWA 1FX1A 3SXUB 2XY4A 2ZYDA 1IY1A 4ND8B 2I22A 3GQVA 2Y2UA 5HSGA 1Q22A 3B2EA 3AGQA 1AXGA 4NQZA 2AXPA 4D8TA 1P1IA 4ZQHA 4MGIR 1N7HA 2WM8A 1G0NA 1Z0DA 2EZTA 2NZVG 4AXBA 1L8XA 4LC9A 1GTJ1 2EZUA 4GLLA 1LVGA 2VPYA 3ODGA 2GO7A 3EHDA 5C4MA 4BO7A 3Q3IA 4L08A 3RVOA 3ZE6A 2EQ5A 3AESA 2AG6A 3GD7A 5M5BA 1RACA 1E2BA 3QKSA 5CDUA 3LHKA 2SCUB 4FBMA 2JD1A 3CVUA 2OZKA 3CWCA 3RVKA 4A6XA 2BJWA 4HNUA 1JIJA 4HDNB 4L2IB 1HFEL 4MK4A 4LYHA 4S05A 4D9FA 3MTQA 3MGGA 4ILKA 2WUVA 4TMYA 5JDIA 1JJ7A 1KIMA 2J3KA 3J81A 4REQB 2YY5A 1IOLA 2FPGA 3PDCA 3U17A 3AUAA 1HT1E 1N3YA 1QOZA 4JUIA 4NCKA 5H0IA 2H3EA 1KBZA 2QQFA 1ESMA 1D8TA 3WNDA 2A5JA 5HJ2A 5BSGA 3BMQA 5J2TA 4N48A 1UFVA 1X9GA 1BMFA 3HK2A 1RVDA 3GZNB 1R18A 2Q28A 3CLTD 4OLBA 3AF0A 3H0CA 2QTAA 4R9VA 4RZ2A 4XYLA 1YL7A 7ABPA 2H0AA 4QUJA 4NH0A 1WJGA 4JLAA 1RKXA 1NMEA 1W88B 4N5DA 3T5AA 2GHQA 4DA6A 1U7UA 1R6XA 4IDNA 3TRJA 2H2HA 1NPDA 2GHIA 4X8OA 3OMLA 3O47A 4S1NA 5K0EA 4MZDA 3W3AA 4IIHA 4EY8A 3F6CA 1UPTA 1HE2A 1L5VA 3OVMA 4ZANA 4AUNA 2AFVA 4WXPA 2WZCA 3EH1A 1M6VB 1OMOA 1TADA 2WT8A 3E48A 3HCPA 3S5UA 3T0FA 4QJ3A 2HR1A 1PEYA 4KAJA 3V7NA 2A1IA 3PICA 5EIBC 5DCUA 4YP1A 4LZJA 4CHTA 3Q8KA 3GQBB 4LHVA 3IAUA 3CEHA 4QQRA 1C81A 4W8GA 3GC6A 4M0MA 1H85A 3ETJA 1MF7A 2CB9A 2R96A 1GQQA 3FGPA 1Z6TA 1L5YA 1E7MA 3F4KA 2A7QA 2Q9AA 5JAZA 5DOVA 3VISA 4Q0MA 2ODPA 3IQXA 2GWHA 1B4DA 2PZGA 2ZP1A 2NVUB 5CDHA 1WULS 2AFIE 5AH0A 2IYXA 5IYZA 1ZMTA 2XGMA 3K1TA 4E32A 3PDUA 2QTVA 1U2RA 1F0NA 2I4TA 3D3WA 4WKGA 3WDLA 4D5GA 2QZSA 4IJ6A 1U1GA 2P4HX 2PKCA 4MX8A 1L5OA 3JR7A 2IH4A 5FFNA 4CF5A 2B78A 2WSMA 4B3FX 1C0PA 2KBEA 3BRWD 5CLQA 1MR3F 1YE8A 4CL0A 2YIMA 4CETA 4QTXA 3KETA 4HJXA 2AZ4A 3E1GA 2DEUA 3FYUC 1RPTA 1E32A 2Z0MA 4OVKA 4RVSA 2QV7A 1RZUA 4BBPA 3MINB 4DJFC 3FD8A 1H94A 1EFLA 2IVZA 2R68A 1WW3A 1IE3A 1J8MF 1GLNA 2DQZA 3LXUX 4JBWA 4LCBA 4FHEA 5TEWA 3C5HA 1OGYA 4RA9A 2E82A 3V33A 1UBRS 4AVYA 3QWIA 5AD1A 2C4KA 1T6BY 4LY3A 4S04A 3LY8A 3WK9A 5KYUA 3L0YA 1DTEA 5JS1A 4U63A 1MA0A 3BA6A 3OLCX 4FYPA 4GDMA 4WZBB 1J8YF 3JASA 4MYTA 3SHOA 1TO1E 4AO7A 3EDQA 1H1TA 1CRZA 2BGWA 1N34B 4P2BA 4UXJA 3BTSA 1YQ9A 3H5NA 4OHCA 5EHXA 5LLTA 1UFKA 4H7DA 1W2GA 1D0IA 1W47A 4XA8A 5IMSA 1USIA 2PH5A 2QRKA 5KAPA 3GX1A 5CEEA 5AW4A 1QHYA 5CVDA 1QGUB 1I80A 5ERXA 2QX7A 1LLQA 1LH0A 3I9OA 5JJIA 3FCOA 3Q0TA 4DNXA 1KMQA 2K7ZA 2IYNA 1WOYA 3V5NA 5B58C 1BCSB 1Y4UA 4BNFA 3NALA 2F9LA 5EHNA 4NBSA 3ROEA 4PGMA 2FPPB 3NRCA 4R16A 3GPBA 5LKRA 2XNKA 3AESB 2HY7A 2RMKA 3UVEA 4PLHA 3HCEA 2Z30A 2JGNA 5BNZA 3VNBA 1H4TA 2YMLA 4RHEA 4DNPA 4K7JA 5LOVB 4ID9A 2H29A 5JXIA 1JHDA 1YQWA 3H1AA 3PUJA 2R5WA 5P21A 2DY0A 3V8PA 1AQNA 2FWNA 2GRAA 1WBBA 4JLWA 4YC7A 4WBSA 1H05A 2VBFA 4TSFA 2QTHA 1Y34E 1W0JD 2E4ZA 5IDVA 3AVOA 4Q66C 4EYKA 1TIKA 1N8KA 3BRSA 1BXRA 1DIBA 3QF4B 3IQDB 4IZHA 5E4TA 4JYBA 2AE2A 1M6EX 2R7MA 2X0RA 2H1SA 1RC8A 3RAFC 1ZC3A 3ZDRA 2OV1A 1BIFA 1CKEA 3R4VA 4X1YB 4DKXA 3RADC 1ZJWA 4LBYA 5IVPA 3AFOA 4YCBA 2JB9A 4C43A 2WSIA 4A73A 4XIIA 4S2EA 2ZRAA 1EM6A 2NOAA 2NT4A 1N6PA 1OWPA 3BWVA 5JY1A 5EP1A 2A92A 2WD7A 1QE5A 1Y8CA 5BW4A 3KSUA 4LGMA 1BDIA 5FJIA 1Q1BA 1EFTA 3FRHA 2FWRA 2C2KA 4NSNA 5FBQB 3VTKA 1AS0A 4H4CA 1TAQA 1X42A 5FWXA 4YV0A 2PUTA 3CSSA 4TMZA 2YWCA 2CLEB 3DW1X 3HUFA 3R3XA 4YJFA 3BSFA 3SFZA 3HP7A 2VHVA 1C3EA 5JS2A 4ER7A 5J1SB 4NKRA 1RMQA 1FRFS 2JFOA 5IU6A 2VNKA 2ZDQA 5IT5A 4CMHA 3LL7A 5IKEA 1AVTA 4F1WA 1DCTA 1IN7A 1N2IA 3GRKA 2GJ8A 3MTJA 2VZEA 3ZE7A 2GJAA 5LP6B 2VCHA 5IPFA 2FDCA 2JAHA 2P0YA 3NIGB 1U0NA 5CA1F 4C22A 1OXMA 3Q72A 4P08A 2BP7B 3FSGA 2QTVB 2ZW9A 4RD0A 3RS0A 3D3WB 2HJSA 2CLFB 1DFHA 4DV1B 2AG8A 4CGZA 5A6SB 1BA2A 2ONCA 5G0WA 4EZBA 4DJ5X 2OKGA 2P4QA 3BX1A 4L15A 2AR0A 2C4UA 2OCPA 2H4WA 3C7CB 4BN5A 4EPYA 2J09A 1GZUA 1YIDA 1ATIA 3AYXB 3KT6A 4GMXA 4IF6A 4O33A 1MEJA 1RHMA 1L4HA 5C7IO 4P86A 5IEJA 5KVQA 3VDNB 3K4HA 3T34A 1LLUA 4JSYA 4LFBB 2QLNA 3UUEA 2Y9PB 4KUEA 5SYNA 1GUAA 2OZVA 4C6TA 3K0EA 5AICA 4HMPA 2WUDA 4AJOA 4JJEA 3FLEA 5DHQA 4CMIA 1F14A 2MIIA 1G5QA 2D0PB 4OKNA 4E09A 2YR0A 4YRBA 5CA0F 1YZHA 4AP9A 1E2NA 4DLUA 3OJLA 2VHUA 3EXG1 1TJ5A 2J8ZA 3CUUA 3VC7A 2OV2A 4ZYUA 1XZ8A 1FSZA 2WAYA 4GMHA 1Z22A 4G09A 2H1WA 2JH8A 1Q0HA 4FEEA 5TMBA 3TD6A 4MRMA 4EJ6A 13PKA 2ZU6A 4Q3CA 1ID1A 1IJEA 2C4HA 2R1ZA 4BB5A 4YYZA 1R8JA 4WDRA 4MGZR 4LJSA 1IOWA 1SFRA 2HA7A 1MTOA 4NNJA 1V5WA 3B1XA 1QTIA 3DMTC 1OXVA 3KNZA 4OHKA 1X7WB 2J5QA 4JI6B 4QYWA 3JV7A 1Y48E 2Q0SA 4V0ME 1GZ6A 4DY4A 4QOJA 5AFSA 4K0KB 4MKHA 2XUJA 3LT5A 4PO1A 1IVYA 4HNHA 3V4LA 3HEMA 4Y1EA 2CLIB 4P7JA 3DVQX 3WAGA 4PGFA 4OHYA 3EOZA 3NH9A 4QGGA 1Y33E 4C7MA 1SOAA 4QPJC 2XA2A 5HF6A 4AQYB 3L41A 3MWKA 4YP6A 1YB4A 3GLGB 4WZ6A 2JFNA 1DDGA 4QFMA 4N0DA 2HU7A 3IXMA 2UZ1B 2XCQA 1PWEA 3IUQA 5CCBA 1OV4A 1UFOA 4R9SA 1UP7A 3MGCA 3A1EA 1XTQA 4HFMA 5KINB 2NZXA 1KR5A 4F4HA 2OYRA 4MI9A 4GF5A 4P0QB 3BD7A 3GLUA 1RE1A 4G5SA 5JS6A 3CXRA 5D3KA 3NVDA 4R1NA 3PQ6A 5IS2A 3EXFB 5TPZA 2GBLC 3WO1A 4IXNA 4Y98A 3C7KA 2YVLA 2WD7B 3I6BA 1DRVA 4PQYA 2W9XA 5F2OA 3EEBA 2I0FA 3JRWA 3LQYA 1F4PA 1ZBQA 2OC9A 3N0TA 3LFHA 4TLBA 2BGRA 1SPBS 2WG2A 2ZZKA 3IGFA 1WM1A 5FBKA 1QOQB 4ICIA 5K0TA 3T3DA 3HEAA 4PN7A 2CZCA 3PWTA 2W6IA 4NJMB 2H8GA 1NDHA 2I78A 1F6WA 3BULA 3ZTYA 4C2AA 4KLAA 5AUOB 2VHYA 1UOPA 4YMTA 1GEEA 4FMCF 3KKZA 1DIGA 3HQ4O 4OYHA 4F3RA 4LDNA 3JATA 1T3TA 1VLMA 4K0RA 4N76A 3QVJA 2CHQA 1JBQA 1FUEA 3AR2A 3IAXA 3IVCA 3CONA 4J2TA 5K2OA 4AZ3A 1QLHA 3Q8WA 4QYXA 3ZGLA 1FK8A 1G3MA 1SK8A 1W19A 2J3JA 2XMCA 3BH7A 5T4EA 1VI5A 1GPMA 4QYTA 3IE0A 3HO8A 3KKNA 3SEZA 1XAGA 2WFAA 5K0LA 1K6EA 3VSAA 4EY4A 4GI5A 3ROGA 1XZBA 4B4OA 3U09A 3B8EA 4M37A 2YXLA 1UFRA 4YXWD 2XDQB 3SDZA 5PNTA 4A27A 1ID8A 2WJZB 1AS3A 2QMEA 2V7GA 4KFCA 2OEPA 4KFSA 4ZVQA 1XDUA 4B73A 1OI2A 4TMVA 1Z8NA 2CUTA 3AVVA 2BEVA 3I4CA 4LY9A 4J4TA 4EW6A 3WRYC 2IZZA 2P9YA 3HCOA 5F35A 4C6TB 2JIDA 3R4CA 1VBKA 3C6MA 2Q0QA 1X86B 3KLMX 4GZLA 3RB8A 3H2HA 4CMIB 4UDOA 1Y0BA 1OI7A 1WDTA 3HXLA 1YVUA 1Y81A 2C4VA 3QP9A 3I2FA 4XGQA 3DMFA 1EX1A 3CVYA 3N8HA 4MRRA 2A0FA 5K0SA 3UMJA 1H2RS 4ZO7A 1P2VA 2EXXA 2I3DA 4ZVKA 3ZDEA 4DCNA 3TCXB 4KN8A 4UFOA 3K0SA 1BH6A 4OYLA 3CJQA 4X64B 4CTNA 2CV0A 4FOLA 1XL0A 1H9BA 4FHFA 5KOJA 2IBMA 4L28A 3ABRB 4BQPA 4FZRA 3V4OA 2BN4A 2WWVD 1QBKC 3NWBA 1NKVA 4XUCA 3DT6A 3KR1A 3HR8A 1GAWA 2I4LA 5CCXA 1ZHOA 2VNJA 2WLSA 1IEVA 3N87A 3RS5A 1QRAA 1GPKA 4YUAA 1RSZA 4H2DA 4P53A 3WJ2A 1L1RA 1R5JA 3LVBA 2C8KA 4QECA 2P6RA 5CVJA 2HH9A 2YIJA 2B34A 4GKAA 3CU5A 3JQGA 4G6ZA 3TVDA 3N07A 1E2JA 4C0HA 2DUWA 1R4MB 2XV1A 4MIYA 3IO5A 5JSKA 5L8VA 3ANYB 3O03A 5IAAA 1WSAA 5H02A 3ZI0A 5IANA 1Q2XA 3B6MA 3HG7A 3U4GA 4HX5A 1EFRD 2JI9A 4DS3A 5DLDA 3VVMA 4PV7A 4INPA 2B2CA 4XGRA 5CXXA 3VR6H 2ZQZA 4ETNA 3ZDDA 2YMMA 2CUNA 3HJNA 2KM1A 1KMCA 4E5NA 4C87A 1MX1A 1YAHA 3NBMA 4L5JA 3W2IA 3WIUA 4U5XA 3VPFA 3EPJA 3ZW9A 2I6UA 3QYFA 4DNQA 1QU3A 1GUBA 1YDMA 1A8IA 1W87A 4AKIA 3H5RA 1XLVA 3DOCA 1BHQ1 2V5UA 2HPVA 2WE8A 5K4HA 1HI9A 1WS6A 2YYYA 2BAGA 1RYDA 3L18A 1FMTA 2Q3BA 3E9DA 4L9RA 4UMFA 5AO9A 3N6XA 3UPDA 2OBYA 4IQFA 3GRYA 1P7WA 3JSAA 3V32A 4LOAA 4ZQFA 2P5UA 4EYQA 5F21A 1OYVA 4MEJA 2VUIB 3HKDA 2NTJA 4Q03A 3TM5A 4AX8A 5B7GA 4JBLA 5JU6A 1PV2A 2QL6A 1G41A 5E0KB 3NNSA 5JWOA 1Q0ZA 1CNMA 1IDOA 2VPIA 4UUMA 3IMFA 1NE7A 3O74A 4AN1A 4Z4HA 3CLHA 1JEYA 4TV8F 4QTYA 5HA5A 5LU9A 1GTVA 3A1FA 1N57A 2QF7A 2HA6A 2QI9F 1E6LA 1T2EA 4R7ZA 3QXCA 1QQBA 1FS5A 4CIBA 2J6IA 4RNCA 1JG4A 3QLUC 1JA9A 1YGYA 4V24A 3IRVA 4X90A 4D0RA 1LDYA 1TMOA 3C24A 2NAPA 1F20A 1GNPA 4IICA 5K8VA 1DLJA 2IIVA 1GA1A 1P9NA 1YMVA 4Y30A 2D1YA 5IBQA 2IFTA 1PFGA 4R83A 2I65A 3A4VA 3IQFA 1DDIA 5ADVA 3IHLA 4O4JF 3ZWOA 5FI3A 3TJZA 5DOZA 1O5IA 4P4TA 1ZCJA 3OAAA 5B5SA 3BWDD 2I3BA 1IUKA 3ELUA 3OKCA 2I5PO 3ZK7A 4CQLA 3OOWA 2VNHA 4MIEA 4Y2JA 1EZ4A 2RGDA 3MUOA 3QNMA 4FR0A 1KPHA 1M5UA 4MYCA 4QODA 2L17A 3B9BA 3QBJA 4NDZA 4G97A 1NJSA 1T6ZA 3OFSA 1K4MA 1R6TA 3PUZA 1T34A 4Q34A 3KQVA 4X7PA 3UWOA 1FVXA 1MW8X 2OO5A 5IZCA 4LG1A 3EGXA 2ZB2A 1V8OA 1U28A 3M2TA 1KI6B 3R2JA 1QYWA 2FAXA 1Z6GA 3ANTA 4N82A 4OQDA 3R7SA 4A92A 3FYDA 4G1EB 2IODA 5ES4B 3RBAA 5IUKC 1DAKA 2R4TA 1GNLA 5KEIA 3ZGYA 2DWPA 2BFFA 1G38A 3ITNA 4X6XA 1SBNE 2F1HA 1O9GA 5DWDA 5KYWB 4QT0A 3JS5A 1I2MA 1UMBB 3C39A 4WJKB 4MV8A 1ZDMA 2O3SA 3NONA 2B4RO 3NVAA 2IV2X 4J2OA 3OPQA 1VGVA 3IBTA 2VCEA 4XI9A 4BAUA 2EV9A 4L8LA 3U3XA 7YASA 4G0MA 4LC1A 4NESA 4ARAA 5CA1B 4US2R 4AQ7A 1F8UA 4HYEA 2YJNA 2QL5A 2IYSA 4Y1FA 3DQZA 4EFNA 3CCFA 1ZNZA 3EMDA 3VOTA 3ZC3A 5B6JA 3UMVA 3L04A 5KYXA 4AC9A 2GDZA 3K0FB 4RF5A 4CLRA 2PMEA 2VWPA 1ISGA 1F5SA 3C43A 5FWAA 2HHLA 4LDRA 3G7NA 1U94A 4WH0A 3UBMA 1R10A 4ZQCB 5UKDA 1LU9A 1I2CA 2DBYA 1MFPA 3HJUA 4QASA 4DWJA 2HWKA 4EECA 1DAGA 4TYQA 1E79D 4G1FA 4QLOA 2B36A 3W6OA 5DU2A 3GNSA 4BPBA 5ETJA 1M2EA 2C03A 1LK5A 2AQIA 3D6JA 4EATA 4MGHA 4A2PA 1RJWA 1WEKA 4IIBA 3UJAA 5CA0B 2B92A 4H35A 1K75A 5FBHA 5I8PA 2GEDA 3TSOA 1PFVA 2IDMA 1P2FA 1Y9EA 4FYYA 3T52A 4AMZA 5HRCA 1I4TD 621PA 1OVMA 3TLGA 1ANKA 3FETA 4RLFA 1NN5A 2UVQA 3DVAB 4UEKA 1K8RA 2F8MA 2OLKA 3AY3A 3F78A 5CLLA 7REQA 2Q8QA 1QE3A 4PTLA 1D2AA 5CB4A 1JFTA 3B85A 3B1KA 2C95A 5J1TB 4E13A 4WOCA 1E4OA 2M6LA 1TA9A 4JD5A 4ETWA 1NW8A 2WAXA 1O08A 1XXHB 5M7EA 5J43A 2O3UA 4HEQA 3I12A 1Z26A 5M34A 2OP0A 1YE3A 3PA8A 1K3TA 1JTEA 4JLUA 3WQQA 2BFNA 2CNOA 4TTTS 1ODLA 3HCNA 3BHJA 1JDNA 1M2VB 1WLSA 5BUZA 3QEJA 1SBZA 3L06A 1N92A 3LCRA 4R2IA 3VI4B 1HQCA 4BC0A 3FWZA 5CITA 2K2WA 2BELA 4C29A 1Q1QA 1O95D 1SUPA 5EZYF 3SS9X 1ZUHA 4OKSA 3H04A 3L40A 3PVCA 3GJ3A 3P9SA 4FMPA 1NNI1 3DBRB 4IFIA 3B2NA 1ZC4A 1ZW6A 4PE5B 1VI2A 3E2IA 1PTJA 4L9AA 5GADl 3LGAA 4NNOA 3PFWO 1U1CA 3AF4A 4GZ6A 4YJHB 2TYSB 4MVJM 5E7IA 5J40A 5AI5A 5ITZA 1GLVA 3RYIB 2VO1A 2GH1A 4OUDB 5D5PA 1HR0B 3O82A 4II7A 3AKCA 1XXLA 3G89A 1Z6XA 2V97A 3QOWA 3WLJA 1T5TA 4HXYA 2EEZA 1MB2A 2D8AA 3HDGA 1MH9A 5GOZA 3L0BA 2QRHA 2O3RA 2WTBA 3DV0A 2BYTA 1D6JA 2XDYA 3X1MA 4R1LA 3F5MA 4PAGA 1V5IA 1TCUA 3BL5A 1JE0A 1DI0A 1SVKA 2Z2YA 4HQ6A 5T8KC 4DY6A 5AHKA 1LC3A 3TUZC 3UMMA 4Q1FA 1RRVA 1TF7A 4HQRA 4TVOA 4XKJA 1RAHA 4PZLA 2Y71A 1JF8A 1XSEA 3C15C 2YVUA 3WB0A 2FKNA 3CLTC 4I4TA 3DO8A 3HRHA 4TV8A 4GT1A 4CMEA 3X1DA 1QAMA 1JHZA 1DSSG 5FL7D 4FLFA 4NPAA 9ATCA 1YO6A 4XPZA 1Q7CA 1K7XB 4FMCB 4WESA 4MS3A 1QRDA 1KJYA 5JCXA 1O87A 1N0HA 3LF1A 4PM4A 4E15A 4RMHA 5K99A 2CLDX 3C3DA 3L5OA 4RE5A 4DV4B 1PNTA 1XRNA 1WD7A 2JGEA 1JKIA 2V98A 1H3FA 1WZUA 2VT2A 1QX4A 3VHRA 3D4LA 3ZTWA 2GBCA 1PJ2A 1DB3A 4O4JA 1GPJA 2FRXA 5M3BA 3T95A 5KYXB 4IGIA 4TTIA 4XTRA 1A88A 1ZMOA 2REXB 3A26A 2CJYA 3GZJA 4IH1A 3MSCA 5K0BA 3T9DA 4ZV7A 1R5NA 2YHIA 4FM9A 1O96B 3T3PB 1RXYA 2AD1A 2QYHA 4OFZA 2OENG 2OAGA 1Y7PA 4KQEA 2CSUA 2GEVA 2GGSA 2NU9B 4AJHA 1K8ZB 2NU6B 2K87A 2OVBA 3A6FA 4JROA 5AK3A 2WVAA 1U90A 1TYBE 3PCXA 4HGRA 3ZJYA 1BOOA 2QN3A 3T1NA 3FDFA 3NEJA 4FFVA 3W0LB 1C7JA 1YQUA 1DG9A 1FP7A 4W6QA 3EWSA 3SZUA 3I1YA 1U5BA 2I76A 3GK3A 3VKWA 4HPXB 3F5QA 1ZHHA 3UAXA 3OIFA 4HN9A 4JVSB 2ZM6B 3Q1KA 1ISFA 1H1DA 1U65A 4CM5A 1DZIA 1NBMA 4DLTA 4EQ6A 3SD7A 3BF7A 4WQMA 1IBRA 3VR4H 3C6QA 3ISTA 3BDVA 2YQ5A 3EQ2A 2ZR9A 4KDCA 4F1KA 1AV7A 1CETA 1NJ5A 3EBOA 3MCUA 4XCQA 1F7VA 1JQ3A 1GQFA 2PRSA 3K6JA 3HB1A 4EAQA 2GPJA 4LF9B 1SVSA 1KOLA 3V1UA 4MVYA 2EJCA 2XKAA 3OFVA 2PO5A 4M0CA 1JA0A 2OO3A 1L1FA 1DDOA 2ZIVB 4YUXA 5TQJA 1RNLA 5E6RA 4DYDA 1ZH2A 3ONEA 1QLJA 1Q3KA 1UBFA 2VDJA 2PPLA 3M8KA 2KS6A 3GFBA 3MWYW 5DE3A 1XJCA 5EJ7A 1XCOA 1M1XB 4UNPA 1TU3A 3T5GA 2XE6A 4A8JC 2I8CA 5BYAA 4JR2A 5I7EA 1FZTA 1X87A 1FTYA 2YZGA 3OFNA 4Z9BA 4CZ2A 3PEEA 2PS0A 1FQJA 4XE5A 4G1UC 4ACAA 1S89A 5BW8A 4Q4HA 2XYPA 4MAMA 4QPNA 4QFDA 3UT6A 2FEMA 3EUAA 4GNKA 3U3KA 2YMPA 3EXHB 2FSGA 2AR7A 5BSMA 1X77A 1LBTA 5AJYA 3PUHA 2IUUA 1L7XA 1F38A 2JRLA 3HBAA 4GSKA 1U8ZA 1BVUA 2HRZA 3N8DA 4K9KA 3IP1A 2ZSAA 3IE2A 5C1DA 2R8XA 1MW9X 2WZBA 3RF7A 1YRYE 4DA9A 2ZJ4A 2WHYA 1EIZA 1PE0A 1AKYA 1GPH1 3SU8A 4CM8A 3UXEA 3A1TA 1ST2A 3MCWA 4Z2AA 2J45A 3A10A 3D1VA 2ATCA 4I9NA 4RPKA 4U2FA 2KQUA 4ED9A 3PDJA 1RTTA 3CX3A 3R3VA 5CFQA 3JX9A 4PLZA 2XZTA 4OA5A 1QTQA 4ZVPA 4B6PA 1X70A 3QOYA 3DL0A 3I6YA 2LPMA 4A6PA 5HTOA 1I1NA 1LEHA 1M74A 1J8FA 3T61A 2GN2A 1GWNA 4BNTA 4RA6B 3R75A 3OQVA 3BTVA 2DJ5A 4AMUA 1O5TA 3FAKA 4WESB 3H0KA 3K20A 3X1XA 2YN4A 3F8SA 3NLLA 1JNXX 1YRHA 2QQ0A 4J07A 5FF9A 3AL3A 5EZYA 5DHUA 4FZJA 4B3XA 4AWBA 2VZ0A 4XSHA 3KJNA 3SIPA 3BM5A 3R40A 1P80A 4IJKA 4J7XA 5C8XA 3DCNA 4ZAVA 2RAFA 2D2XA 4O4JB 3P5SA 2WJGA 4H4DA 3P0RA 4W7HA 1THZA 2RARA 3LHSA 3LT0A 1CUZA 4L3WA 1MABA 4FWIB 4BVFA 4QPCA 3T5BA 4K6FA 2PT6A 4MGKR 1WWKA 1FRZA 3P9PA 1B8NA 3OD1A 1R88A 4TKVB 2WWXA 1UCFA 2AK3A 2YY7A 3MBKA 4PPYA 3SC3A 2CDRA 1IPEA 1MRSA 3QPWA 5CFRA 3RSLA 1JZTA 3PXCX 1PL6A 5KC9A 1RXWA 2QTCA 4P83A 2H48A 1JLMA 4EI7A 5JRJA 5DNDA 3SYMA 1YJXA 3TXYA 5HJEA 1NBWB 3JPWA 3FVVA 1BMFD 1SKYB 4P8RA 2V59A 1LI5A 2XB4A 1LZKA 3EBPA 4RDHA 1D3AA 1JPVA 2K2QB 4QTZA 4MVJA 2ZYGA 2D5LA 1NMXA 2XTJA 3IUEA 3PQ2A 1JQAA 1Z36A 2FA9A 1K7EB 2J3EA 2QTRA 5B1IA 3KJHA 3OEED 3R24A 5KJCA 1JKXA 4QJ4A 2AOWA 3PXAA 3VC1A 2XWQA 4KB5A 4US1R 1L3IA 1OH5A 2FN3A 3JYHA 2HK6A 2PZMA 4M7PA 5BV1A 2WJWA 2OZLA 4WDQA 2CMDA 4NU5A 4YO8A 3MJHA 3LY5A 2IYTA 2I3AA 1XU4A 2V6GA 5EJ2A 4ZI7A 1ZLXA 1HL3A 4LHEA 1NVXQ 1GUFA 2W2KB 2FLVA 1Z6AA 2XB8A 2X40A 2D2VA 4EFKA 4GEKA 3WK4A 1G21B 4IIUA 5EL0A 4I66A 2XITA 2HL6A 1FQKA 5AHOA 3R9IA 3UHJA 5K51A 2FQYA 4DIOA 2J31A 4RZIA 2Q62A 4PZ0A 4PC7A 5EA2A 1XKLA 3RWMB 4YRZA 3COZA 4JNKA 4EL0A 5B12A 5CFOA 2H4ZA 4KR7A 1Q74A 4MLZA 3IUMA 2WFZA 4QG7A 2VRNA 2ZLBA 4S1VA 5G41A 4U8GA 2HW8A 4PZEA 2AD5A 2Y1LA 2V6MA 3F2VA 3HXKA 4EKIA 1JWLA 1IVSA 4F4FA 1GTL1 1UJ5A 3P2YA 3UQZA 3TZCA 3UXMA 3GUZA 4TS4A 2W2NA 3GD5A 3T1OA 2L2QA 2YWJA 3F98A 4GP9A 4KN6A 2NLOA 4QDJA 3DUFA 4BVGA 4IUBS 5KOYA 4Q9DA 4FCCA 2GN4A 4RD3A 1YI1A 2H00A 1MORA 1BW9B 2Z5VA 4MLDA 1EUDA 2OBXA 3VZSA 1UEIA 2Z3WA 3E4DA 1NM5A 2ZBPA 2F3RA 3GEBA 3H83A 2Z1MA 3G2JA 4JJ4A 4X60A 5BOSB 3PEWA 3W3AH 3TW0A 4FFMA 3IOCA 4O4HF 3QI7A 1T36A 2JIZD 2Q27A 1CNFA 4UM8B 1NSFA 5EMNA 5I8ZA 4II3A 5E0OA 2FG6C 1ULHA 2CK3A 4UNRA 4FDMA 4LS3A 1IXRC 4OJKA 2HHAA 4CEIA 4XM1A 1FRNA 1SA0B 1IOZA 3WE7A 4BFUA 4WZAA 2GAIA 2FEWB 3G2LA 1W4BA 5EZQA 1PJRA 3EZGA 1XTPA 1VB3A 3AETB 4WEQA 1A95A 1S9HA 2G77B 2JLRA 3IDQA 4FUTA 5EZYB 5SZHB 4CODB 1EK5A 1XJ5A 2NUPB 3RYFA 1M8JA 3QE4A 4WA8A 1L4NA 5KSZA 2QW8A 1XCBA 2FPIB 3PWZA 3ROKA 4S1TA 1Z7EA 2HMSA 3LCMA 4X41A 3AOEC 3L1IA 1CR4A 3OTHA 3VRHA 4HSEA 5IHXA 1XMIA 3NNDA 3GVPA 4LOKA 2IZ0A 1P9WA 2YHUA 2JFGA 4KH1A 2A30A 2XTAA 3ANLA 3ZU3A 3DGEC 5JDCA 3R7DA 2ZJZA 2ZDHA 4MZXA 5ABPA