2OD2A

Crystal structure of yhst2 i117f mutant bound to carba-nad+ and an acetylated h4 peptide
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
296
structure length
291
Chain Sequence
MASMSVSTASTEMSVRKIAAHMKSNPNAKVIFMVGAGISTSCGIPDFRSPGTGLYHNLARLKLPYPEAVFDVDFFQSDPLPFYTLAKELYPGNFRPSKFHYLLKLFQDKDVLKRVYTQNFDTLERQAGVKDDLIIEAHGSFAHCHCIGCGKVYPPQVFKSKLAEHPIKDFVKCDVCGELVKPAIVFFGEDLPDSFSETWLNDSEWLREKITTQQPLVIVVGTSLAVYPFASLPEEIPRKVKRVLCNLETVGDFKANKRPTDLIVHQYSDEFAEQLVEELGWQEDFEKILTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for nicotinamide inhibition and base exchange in sir2 enzymes.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
molecule keywords NAD-dependent deacetylase HST2
total genus 94
structure length 291
sequence length 296
ec nomenclature ec 3.5.1.-:
pdb deposition date 2006-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1600.10 Alpha Beta 2-Layer Sandwich SIR2/SIRT2 'Small Domain' SIR2/SIRT2 'Small Domain' 2od2A02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 2od2A01
4I5IA 1PO7A 2H4FA 3OE1A 5K6RA 4BVEA 3EYAA 2H2HA 5FEMA 4IAOA 4RJKA 1SZCA 1UPBA 4GPEA 4MQ5A 1YC2A 1M2KA 1M2GA 1ICIA 3GLRA 2OD9A 3GLTA 5FYQA 1XLTC 1Y9DA 2EZ4A 2Q5OA 4RMGA 2A1TR 3PDHA 2VBFA 4O8ZA 2OO5C 4MPRA 5DGTA 4FZ3A 1T9BA 4KXQA 4X3PA 1Z8NA 2PANA 4MPJA 4UTRA 4RMIA 3HWX1 4K9PA 4R8MA 5K2OA 2H4HA 4TWJA 5MF6A 2VJYA 2X7JA 1PNOA 4KGDA 3K35A 4IF6A 1V5GA 1YC5A 1PVDA 2UZ1A 1PI3A 4MZXA 2JI6A 5MFZA 4JUFA 1J8FA 2A1UA 3CLSD 1T9CA 2Q27A 4BN4A 1JSCA 5IMSA 1ZPDA 3GLSA 5BWLA 1POWA 4K9MA 3IAFA 2IHTA 1DJLA 3JWPA 2FSVC 2IHVA 1UPCA 2VK8A 3D7KA 3F6BX 3F6EX 4RJJA 2QQGA 4UTZA 1YHZA 5EJAA 4GM4A 5EJMA 4K9NA 4UU7A 5EJ6A 5D7NA 2AG0A 2W93A 1HZZC 4UU8A 2WVAA 5EJ7A 2V3WA 1PYDA 1PNQA 4V1CI 2QQFA 4K9LA 2VK4A 4J1TC 4ZP1A 1T9DA 5K3SA 4RMJA 4TWIA 1BFDA 1V5EA 3RIYA 1UPAA 2JI9A 2JLAA 2FRDC 2OORC 3FSJX 3EY9A 4UUBA 3CLTD 3FZNA 3HWWA 4D5EA 5K6TA 2EZUA 3U3DA 4JUAA 4V1CA 4BUZA 2FN3A 3PKJA 4BN5A 1OVMA 4FEGA 1YTLA 2B4YA 2NYRA 4Y6OA 1OZFA 3E9YA 3EA4A 3PKIA 5MGNA 4HDAA 1O97D 5EJ9A 4BV2A 2NXWA 2UZ1B 1D4OA 2VK1A 4JD5A 1S5PA 1OZHA 4JU8A 4UTXA 2H2IA 1YI1A 5AHKA 1EFVA 1Q6ZA 4JT9A 4BVHA 1U2GC 1T9AA 2DJIA 5EJ8A 4GM0A 1SZDA 4Q9DA 4G1CA 2Q29A 4QQ8A 4Y6LA 5DGDA 4IG9A 1Q1AA 4UTNA 2OD7A 5BWOA 1M2JA 2C31A 1O96B 2HJHA 2FR8C 2JI8A 3CLUD 2IHUA 1U2DC 4FVTA 4BVBA 3FLMA 1M2NA 1PT9A 4JUCA 4L2IA 1EFPA 2H4JA 1YNOA 3RIGA 3LQ1A 4GG1A 4D5GA 1QPBA 2H2GA 2H2DA 3JR3A 4J16C 2VBGA 4F4UA 1YHYA 1U31A 1YBHA 3CF4G 4ZZIA 2EZ9A 4HD8A 4GP9A 2Q28A 4UTVA 4K9KA 1S7GA 2BRUC 4JT8A 3ZGOA 1PTJC 3ZGVA 2WVGA 1V5FA 4FEEA 4JUBA 4QPZA 3U31A 2EZ8A 1N0HA 1M2HA 2PGOA 4KPUA 5EJ5A 4MPPA 2JIBA 1YI0A 4JUDX 4K9OA 3D81A 4C78A 3IAEA 4V1CB 4BV3A 4JU9A 4L3OA 4JSRA 4X3OA 1MA3A 4F56A 3CLRD 2FWNA 4QELA 2JI7A 2H59A 4COKA 2PGNA 5BWNA 4Y6QA 3D4BA 1U28C 5EJ4A 2EZTA 1Q17A 1E3TA 4GM1A 1NM5C 2H2FA 1POXA 2Q5QA 4C7BA 4BVFA 4BVGA 3ZG6A 3GLUA 4RJIA 2OD2A 1Q14A 1MCZA 2WVHA 5MFPA 4UUAA 2JLCA 2Q5LA 4RMHA 4K9QA 5DEIA 2AG1A 2Q5JA 2VBIA 1OZGA
chains in the Genus database with same CATH superfamily
2OOKA 3OQ1A 1L4BA 5BSMA 3GLIE 1ODCA 2XNJA 2PD3A 5CEFA 1PTKA 1QIHA 3X44A 3X0DA 3AKZA 4O4LA 3WIDA 4WCFB 5CT5A 3FNFA 3GT7A 4LYJA 2IW3A 1SKMA 3I3OA 5F3WB 2XRZA 4PYOA 1UQRA 3IXLA 3PWTA 3VMFA 2ZI4A 1M6VB 1ZK0A 4L8VA 4H7KA 4RGVA 1LBIA 1NL3A 3RFUA 5IKMA 1D09A 4PFQA 1EA7A 4FN4A 2J0QA 2KJQA 3TDKA 4RQUA 4EJFA 2NPOA 2UZAA 2CKMA 2DFVA 1GPKA 1KFCB 2OCAA 3OKFA 4AKEA 1NW7A 3DMGA 1NI4B 4QYIB 4C6HA 5L7WA 3THWA 2ZQZA 3JY6A 4LRSB 1JDBB 2CMKA 4H1VA 1MN6A 4DLTA 3ZK7A 1YRQA 5COQA 1Z2EA 2DRIA 4ZOLB 1SCKA 1QYCA 3BXZA 2W22A 5H9VA 2A9JA 3T1NA 3TLEA 4YJ2F 1Y8CA 2PX2A 3V4PB 4IGIA 1VP3A 5JEEA 1JR3D 3ZJTA 4LHEA 4ARZA 1EU1A 2VDQB 4A27A 1QQAA 2VPWA 4P82A 4DA7A 1H9AA 4HH3C 4GZLA 4RWEA 3WK7A 4C4AA 4M1EA 3FDZA 3CRNA 3JQ7B 3U0VA 1ZX1A 3B7GA 4JVLA 4XASA 3UB4A 5JFGA 1N1EA 1G21E 5DVZA 4Y7DA 2OV3A 1KJ9A 1F0KA 1TM4E 1F2VA 4PFJA 3MD0A 2P3LA 4FYKA 4KAAA 4L0QA 4O2BA 1OWMA 2PK3A 4TXNA 9MHTA 2EBUA 5FP0A 4A6EA 3IPCA 5DSXA 3OEYA 1WG8A 1IXSB 4W7IA 3RV3A 3BJIC 3EFOA 3QI2A 2ZB7A 4GM0A 1EVQA 2UKDA 4KXVA 4OATA 4YJGB 5DTRA 4BP8A 5J4LA 4L74A 1W5SA 2JD1A 4H3SA 5CEEA 2C31A 4C7XA 2VPZA 4NG5A 2YHUA 4LY3A 1SHUX 2WD7A 3E2PA 1ZG3A 1NPYA 4XR4A 3A58B 3DTYA 1VB5A 2FP4B 3P8ZA 1XD2B 1NJ2A 1UAYA 4LV6A 3LWDA 3NO4A 3GNSA 3UFXA 5IHPA 3WGGA 4KXLA 3OIVA 4ZEMA 3KKPA 1KKUA 3C43A 4JGIA 5CA0A 5KU7A 1GAQA 3KJXA 5CH5A 4BBPA 4XRGA 1E79D 3QW2A 2ID4A 1COWA 4R3UC 5F76A 4PFKA 3RC8A 1FFDA 1KRWA 3ED1A 3IOEA 4X71A 4ND2A 1YWGO 4R8LA 2ONJA 3SX4A 5BV7A 5CLLA 4KQIA 2H31A 1JLHA 3ENNA 4FGUA 3TTTA 5BNWA 2BJWA 2VAWA 1NVAA 3ENZA 3M5CA 4P31A 4PYQA 1PR9A 3VNRA 1LDMA 4BHTA 1FC0A 4BATA 1VGVA 4G2TA 3IP1A 3GARA 2F67A 1G21A 3CE6A 2FXVA 3O3MB 1OFUA 4LZOA 5H68A 2W0MA 5JAUA 4FMCB 2PL3A 3F6CA 3GC6A 5EXXA 2VKQA 3KO8A 3N39C 4RAOA 3UUEA 2XEDA 5G53C 1QX4A 4YEDA 2YASA 1IHYA 1DBPA 3GZNB 4IHKA 1EA5A 2QZ9A 1V6SA 2GZRA 4B6SA 5JDIC 3B1KA 3MSXA 5IM4A 1N9GB 4R54A 4ZHQB 4V3BA 2HUNA 2NU9A 4O1MA 3BTSA 2I4OA 4I81A 4JDUA 3V4OA 1JECA 5T64A 1LLQA 1S1MA 2ODBA 1IZ0A 3BWYA 5D7BA 2OOSA 3KHSA 4CHGA 5IFKA 2I3ZA 4FNMA 5EWMB 2FWJA 4ZVSA 1KMHA 2V4MA 1JHVA 3LCUA 2WYOA 3OZ7A 3UWSA 2J59A 2XBLA 1JHMA 2ZJFA 3K8YA 4O4HA 4ER0A 2Q9BA 2IPOA 3D02A 2ZIXB 1E6MA 1QFZA 2VAPA 1P1KA 1XRMA 3HU3A 4P3YA 3ZU4A 2GA8A 1OXSC 4L8LA 3V7NA 2HU2A 5JCOA 1M75A 2PRYA 3CEPB 4CKCA 2AOXA 1RLUA 5F5LA 5IH7A 4QM6A 9LDTA 2DHDA 4PG8A 5BUZA 4B6EA 4KOAA 1OKKD 2A92A 4YLEA 4D3XA 3EUAA 3IUQA 5EJFA 2XH8A 1PKXA 3DP7A 4O4JF 1WNFA 2VF2A 2XDWA 1X92A 3K0CC 1FP4A 3GLQA 2MINA 4Y30A 3T1TA 4U7TB 2W9XA 3HFRA 1JUDA 2LV8A 2WVAA 5M3BA 1I36A 3AESB 4PVCA 2XAUA 4AJJA 3QMMA 4L27A 4OAQA 4I55F 4IYRA 4Y3UA 5DI3A 2OBNA 5F78A 2QRMA 4CQNA 3VAZA 2DPLA 4RMJA 3MQ2A 3NWBA 3R8FA 4D6PA 4S1WA 3CLTD 4EJ6A 4RM2A 1OFGA 1X0XA 1N0WA 3HM2A 3B6KA 3KUUA 2WV9A 4QTXA 4JP2A 5THXA 3D6NB 5IHXA 1Y3CE 3F6PA 2QRHA 5LOVB 5CLQA 3ADBA 4LYDA 2ZCUA 3PHCA 3EZYA 4LX0A 4QDKA 3C41J 3UB2A 1A7UA 4EGJA 2C92A 3G9TA 1GJRA 1TZKA 2YXPX 4QG7A 4S35A 5AW4A 3CR7A 3NDPA 2NOAA 4MIYA 4A0RA 1Z13A 1AH2A 1ANKA 4MKZA 1DIHA 2CHGA 3RSLA 3WWOA 1UBRS 1W36B 3E23A 2IITA 3DR3A 2DFLA 1B2RA 1TEZA 1TAHA 1G42A 2G9VA 1FMTA 2PX5A 2H4JA 3VOBA 2R47A 4MRMA 3KD2A 1YS2X 4KX3A 4P4SA 2IYQA 4WNAB 5I01A 4LJ8A 1FVFA 3I0NA 3UYLA 4ID9A 3CCFA 3N2KA 1T25A 3HNPA 3KB1A 1A7JA 2WG1A 2HTFA 1B76A 3DUFB 1V1MA 1NP3A 2QV7A 4H6VA 1I9GA 1MB3A 1UOQA 1Z4KA 2RSLA 4GW3A 4GLJA 5I5GA 3UUWA 1LI4A 4PCAA 4N41A 1CNEA 5FV4A 2LCFA 5E3HA 2AV6A 4WL0A 3AIIA 4ATNA 2B1JA 4LBVA 2A8YA 3C7CB 4OMCA 4OTZA 2JFPA 5H81A 3VH4A 4DV3B 3PD0A 3FDIA 1O95D 2GBCA 2QLNA 1KETA 2I6XA 3FPLA 2VLIA 2XIQA 3GRKA 3ET5A 2PA0A 1Z4MA 2O07A 3AQ4A 4EY5A 5FUWA 3USCS 3TFOA 1H6CA 4TT8A 3RC7A 3FGPA 2C29D 2GA9A 1MC5A 1N3IA 2O4UX 3A6EA 3I23A 3HI4A 5IDVA 1I3LA 3RAPR 1M7BA 2A9KA 2MSDB 4GR9A 4KMMA 3AF6A 4YBZA 1P33A 3HSKA 4MXDA 1RYEA 1WUJS 4FKBA 1LPMA 2FSFA 3S70A 3IP5A 3SGLA 1GQSA 4B48A 1OXXK 2B0JA 1C3OB 1IH8A 2CBZA 4E4YA 4J0HA 2VTDA 4YT5A 3HBJA 3W78A 5B57C 3L8DA 4MA5A 1T13A 4B33A 2DR0A 1F7UA 1H23A 2E4UA 3ZWAA 3LIIA 3VR2A 4BO1A 3DKPA 3ZJUA 4TKUB 3HA2A 1YBMA 4FBLA 3IBYA 3MBKA 5F64A 1EWQA 4D0GA 2G0AA 2J6BA 5K8TA 2IP1A 2WW8A 3TSCA 4ZJPA 4GI2A 2QZPA 5K4GA 2R97A 3EBPA 1N4DA 3WL8A 4XOUA 1TAGA 1PGQA 2FEMA 8AT1A 5C46F 2JGLA 3MOIA 1MP0A 4OAOA 3MUFA 4EW1A 4CLDA 4Q6WA 2XY4A 1L3BA 3IQFA 3HDGA 3ON5A 5KC8A 4IJKA 4NBNA 3RK1A 1PS9A 4YV7A 1VRWA 1XROA 4CJXA 5AKIA 2HWKA 1VYTA 5DDIP 2VHTA 3K70D 3FRHA 1H8EA 4HTAA 1ZUNB 4G56A 2H5JA 5DLPA 4PSDA 4DC9A 1JIXA 1K0FA 2YXDA 2BFCA 4BLSA 1JPVA 1T2NA 3DW3X 4MDFA 3LUBA 3AJ9A 2GPWA 2CL5A 1II0A 2NQ8A 3EQZA 1U4NA 3CWQA 4WPGA 2HH9A 1OVMA 1VHTA 2G5GX 1RBYA 2QSUA 5FQNA 3FJYA 5FUXA 5LYJB 1C8VB 3WZ2A 2ACEA 2FZEA 2PGAA 3WLNA 3WMWA 3F7MA 4HB4A 2MSNA 4PZCA 2OXIA 1KFJB 5EMLA 1TLTA 3B89A 4AL4A 4LSMA 1NULA 2OXRA 3H8VA 4D02A 4F2HA 3LRXA 2Q0QA 1WSWA 2J46A 5AQEA 5IF3A 4G4GA 1QE3A 4GBED 4EP1A 6REQA 3BMXA 3GFFA 4FDTA 5I5EA 4J49A 4QQ8A 3TTSA 1R74A 4PLHA 3UMCA 3NTRA 2JEOA 1RYBA 4H2DA 2I8CA 4XDZA 3RVNA 3RSZA 5F2OA 2JIPA 5DCUA 3UMBA 2WJHA 2COKA 1LJ8A 3CZMA 1SB9A 3KR9A 3RIGA 3CLKA 3VI3B 3VR3D 1W46A 3UMRA 1MQAA 3L7MA 4HEHA 1MMFB 3R8XA 4MUYA 4BTEA 2Z0MA 4PR3A 3UK2A 1EXVA 4H0NA 1YRWA 3B48A 3W7VA 4KFTA 4FEEA 3LQQA 4LWPA 3ROXA 2VNJA 1EESA 1MUUA 4NZPA 5FR2A 1JJ7A 1KS9A 2R1TB 3ISJA 1W4ZA 2BEJA 1KRXA 3KYCB 3OFJA 2BFFB 4S1OA 4B0PA 2HU7A 2QP9X 1XZJA 1SUDA 5BW6B 4IGAA 1MD9A 5G40A 5TGZA 5JXGA 2XCRB 2DUWA 1K88A 1GADO 1UWCA 1Z33A 2RAPA 4G01B 4RJTA 3KT0A 5FULA 1VPWA 3NDRA 4NXMB 1C3LA 2B8TA 3SC2B 4TPKA 2IWRA 1V7QA 2RJOA 3IMKA 2Y67A 3TEMA 4DDHA 1W5AA 2NO1A 3TOXA 3QWIA 4FOLA 4P3KA 3G89A 1LLDA 2PKWA 3MCZA 1FZQA 3RRFA 1UKBA 4C0QC 2QVCA 3ROZA 5M29A 2QUHA 3F6SA 1X7GA 1W48A 4XD7D 3LT2A 2FPWA 1X1SA 1HA3A 4BO6A 1QFSA 3LX5A 5DX0A 3K31A 1N5MA 4UAGA 1W4CA 3QOYA 4PCUA 3FR8A 3AOEA 4YVFA 3RVPA 3VVBA 5DTMA 2ZIFA 1NUQA 5DHTA 1I4LD 3NOQA 4UU0A 5G1OA 4E08A 2R65A 2FK8A 2ODQA 3D3WA 3K5WA 2JKVA 3DHWC 3Q7EA 4IMPA 3WLJA 2AR0A 4UBOA 5K3BA 3U4GA 5TV2A 1PR0A 3GVCA 3T15A 2AJ8A 2C0CA 1ECFA 2FQYA 4PIMA 1D2NA 2DTEA 3GFOA 4WEQA 4FIDA 3ESBA 4PO8A 3V7WA 1TYCA 1UPUA 2TMGA 3AVOA 4TKLA 4NKRA 4X00A 3RC9A 1NBHA 3F2VA 1GZ3A 3O83A 1T34A 4DZTA 2XMZA 3FUTA 1JEQA 4QAJA 2P3QA 4ESOA 3TQQA 2OWEA 1OX5A 1YHZA 5EMHA 2Z3VA 2C95A 4E1AA 5A4MS 1ULAA 2WEKA 1DX6A 4UU8A 1U0BB 3PP8A 1JS1X 4RPGA 1U7XA 4M6WB 3NV7A 2O8BA 1E66A 1ZK2A 1THGA 2NUPA 5BYBA 2ASVA 3PGLA 1CW2B 4EB6A 5JZBA 1F9EA 3MGKA 1NQUA 3N0XA 4EX6A 5CM9C 3W5CA 1K97A 4AMGA 1TW2A 3WGIA 2QAGC 4YH1A 2R6FA 4UDNA 1GEGA 1N2OA 3AKEA 4NQRA 2OVFA 1A5ZA 3QWAA 3L43A 5BMVB 1MEEA 2PQ6A 3A6HA 3TLKA 3HCCA 2ZCJA 3GLGB 4TMKA 2ZSIA 2F6RA 4P4UA 1VL8A 5TVKA 3FGZA 2IZ1A 3PC8A 4C76A 4BVHA 2REQA 3T38A 1UM9B 2G28A 3G6KA 4HMPA 3RVMA 1FIUA 1SZDA 1I32A 1KMIY 4G1CA 1U3GA 3Q6IA 1ABEA 4OO3A 2LGJA 1T29A 2RAVA 3HFJA 4EOGA 1B0ZA 3QBTA 1JQBA 3QE9Y 1QKKA 5EKTA 1Z36A 1C9KA 3O26A 2BBSA 5IBCA 4M6WA 4B2LA 5CMLA 3IKMB 2O8BB 4DDUA 3FUCA 3HB9A 4YP0A 3P2YA 4GG1A 2FPMA 4MUEA 5CB4A 2Q07A 4WKOA 4R69A 1H1LB 2E4ZA 3BWCA 5CHEA 3LW7A 4YAGA 2BF4A 3MCWA 2YFKA 5D3MA 1EX7A 3F2IA 2C96A 1UZAA 3OSUA 2HSDA 3GDOA 4EGAA 5BMVA 3B5IA 2B1QA 4K3VA 3CBQA 5AJUA 3I62A 3IR7A 3P1JA 2CJFA 1G4AE 1XRLA 3PE3A 5I48A 2DPMA 1PCXA 1GFSA 3QYAA 2BYTA 4RY8A 4QOJA 1QRRA 2PGXA 2F4NA 3EOZA 4JSRA 4NX2A 1G55A 1WXQA 3GDGA 1F3OA 1T36B 2FZ4A 3VPDA 3I61A 1RAGA 4R84A 4YT8A 1HLGA 1W76A 3TIGA 1JU3A 4DV7B 4JFRA 1NC3A 1AXRA 1ZEJA 3HCPA 4GBGA 1HQDA 2P6UA 4DDKA 4DT1B 1O2DA 4Z2YA 2REBA 5DTIA 1LC3A 3VH3A 2B5VA 2IIBA 2YWFA 1UK9A 2O0LA 2OLKA 4N3GA 3WFIA 3WLHA 2RGEA 1TT5A 2HZ7A 3LT0A 3NHPA 2VP0A 4TYQA 4WE3A 2C1ZA 3U19A 5KNLA 1DBQA 1W5TA 2H5LA 4O29A 3A6PC 3FNGA 4FD2A 1MIHA 4JP8A 1W93A 5A3RA 3EG9A 5ULLA 4BB0A 1M83A 3GBPA 4UD6A 3CX7A 2NVOA 3OCXA 2WWHA 5DZSA 1XTUA 3KXPA 3CUSA 5DCLA 1C0LA 1P8JA 5K4HA 5TPWB 1TGVA 1HG0A 1P1BA 1XTKA 2BHRA 1XBTA 3JVUA 3TYXA 4BMPB 2R6R1 1SR8A 4RV9A 3TCXB 1OE0A 3IRVA 4QKQA 1J8FA 1T15A 5LP1A 2FP3A 2E0IA 4TRJA 1P4SA 3PDJA 1RP7A 1YVDA 3WB1A 1A8PA 1FJXA 1AK1A 1Z73A 2QM0A 2OM2A 1BTOA 1ZOPA 4L75A 3E1KA 1XCLA 4ZYZA 4NCXA 3WYDA 4F85A 2L69A 4GOJA 5F9MA 1Z12A 4K9NA 1LZLA 5JDCC 1NVXQ 1BDIA 3V4VB 3HKBB 2XE7A 1Z0ZA 4KQMA 4ZU1X 1U65A 4H6XA 5IWCA 3KUKA 4JQZA 3JRXA 3NEJA 3P5BA 4K9LA 4J1TC 1T9HA 2OK8A 3M33A 2MU1A 3FZNA 4RS3A 4DAEA 3AI1A 2QXYA 2ECPA 3QHAA 1MAUA 4JXKA 2SBTA 4KGXA 1P91A 2VT2A 2DY1A 3OPYA 1YONA 2QGFA 3OCJA 4LE2A 4QYSA 3ERCA 5EJ9A 4ARSA 5JJKA 2Q3LA 3B3FA 2EIHA 2R66A 3GEBA 4WERA 3KL2A 1LW6E 4B6QA 3I37X 1OD6A 4GQBA 2OO7A 1JR3A 4JT9A 2CNNA 3TMAA 3N2IA 4WJKB 4GZ5A 4O59O 5ARDA 3DVAA 4CG1A 1RPZA 1T24A 2J5KA 2ESRA 2X0KA 4LNUA 3V80A 5PNTA 3FNEA 3GGSA 1R0CA 1UC9A 3K0FA 4AULA 2CDNA 2IH2A 1A9XB 2VP9A 5KNCD 2OECA 3OQIA 4ZODA 5D6NA 5AXDA 4ALMA 1X42A 2YC2C 2O5RA 1V1JA 1GA6A 4BLVA 1FPMA 5H82A 2ZSJA 1P2TA 2IIVA 3OD1A 1QHGA 1QGDA 5HBGA 2V3CC 1I2BA 4WMLA 3UKJA 1USWA 3JD4A 3I52A 3R3SA 5BNZA 2M98A 3E58A 3I2IA 4YUYA 2DC1A 1TJ5A 3DD1A 3GWGA 3MCAA 4DSZA 3WBFA 1DIAA 2BKAA 3IX7A 4YRKA 2HF7A 2GXUA 1DOAA 4RTOA 2ZWVA 5G2OA 4PTLA 2AYYA 3DXFA 1U3DA 4L85A 5CFQA 5H3CA 5KJFA 3FPSA 5HX7A 1TAQA 5LWQA 1O94D 4J6EA 3P2EA 4KO1S 3FH0A 4POAA 1BXZA 3H3XA 4RE6A 4W82A 1GZ7A 3TMKA 4LNUB 4NMHA 1T6NA 3HPRA 4UUNA 4PYIA 5F77A 3A2KA 2W98A 4K3UA 1OI3A 1KNXA 1GKLA 1V7CA 4M0UA 2WSBA 5DBEX 3IMGA 3MB5A 2YV5A 4EKNB 2I6FA 1LVUA 3CZRA 1MAAA 4IDHA 5EA2A 1EIWA 3ESAA 3IE2A 1VMEA 4XIYA 3VTZA 4JV5B 1GOTA 1MO6A 2BZGA 3UJBA 4W5TA 4RBNA 1DTWA 5HCUA 3IT1A 2FPPB 1FPQA 2FEWB 1G6Q1 2ZP1A 3L3BA 4PLYA 3SKXA 4IGFA 1C1DA 4QVGA 3SJ7A 4NU6A 1YC2A 5ESDA 5AW7A 4IIFA 1A95A 3NHUA 4KQXA 1U2GA 3VOTA 1BOFA 4ZVRA 2TYSB 1W2HA 5LYJA 1EBBA 2HGZA 2R00C 5JS1A 4ZYXA 2CD7A 2Q7DA 2RHCA 3T9CA 4ANFA 1GP2A 4DLUA 1T8RA 4M8SA 4UVHA 3TM4A 1IUPA 3TAHA 4BE9A 1YL5A 2OHHA 1P4JA 2OO5A 2WU3A 2ZBPA 4P4NA 4W1RA 1PVDA 5TMEA 5BVHA 3QXGA 4CLRA 4QWWA 5EKUA 4AF8A 2HRQA 2OP0A 2QTVB 5KS2A 5EUMA 4OQQA 4KN6A 3UOGA 2PJDA 3JARB 3SBDA 2HYDA 1NJSA 3RU7A 2X8JA 3WYBA 1T8UA 3B6ZA 4EECA 1WZUA 1E94E 4IDAA 3O31A 4QXOA 3T8YA 1ITZA 2GZMA 4FFBA 5AJWA 2JA2A 1BS1A 2FK7A 1A5AB 4FP9A 3DE0X 4M1OA 4Y1GA 3SQMA 1ILEA 2HEGA 1CLEA 3N05A 2IWHA 1MLDA 3CH6A 4JQSA 2BFBB 1F3LA 1ELOA 3RODA 4CV0A 2CUKA 5KTRA 2CV0A 2IY8A 2C2YA 2XX3A 2WSMA 2ZI7A 3LO8A 4AF6A 2GN2A 4F2WA 5AIBA 4E4TA 1PYGA 4GDFA 5DN9A 1TMKA 2JLSA 1ESMA 2YVQA 3ORSA 4RHEA 2ZYRA 3T0IA 2M2IA 4EY6A 4HGRA 1TFRA 5BSUA 3W5UA 4D26A 2P4UA 3RYTC 2ZANA 3NFRA 2X19A 1D2MA 3V8QA 1SUFA 2GSDA 3RTGA 1GTRA 2ID8A 5AOBA 5TQ2A 1XALA 3VYSB 4HB2A 2HCBA 2W58A 3DMTA 1QLHA 1N3BA 4B4OA 1QYXA 4C5BA 2DUMA 3LCVB 3C3PA 3S68A 1NKVA 1E1DA 3T54A 3JALB 3KUXA 2CD9A 3UO8B 3ZVNA 1CJMA 2IU3A 3OBIA 4W6ZA 4F6CA 1B3BA 3N3BC 1UFKA 1IPHA 3PQCA 2EZ9A 1VJTA 4BLOA 1ONPA 1RJEA 3AEKB 5E8RA 3FYHA 4BVKA 4R9RA 3FKSD 1TNDA 1V5FA 2O7SA 4BZPA 4DLNA 5LXTA 5A6SA 1P77A 3HCRA 1M66A 4PICA 4MR7A 4QPPA 4EKYA 1BW9A 1RI1A 4JUDX 5EPEA 5KKNB 4Z53A 1W0KA 2FVXA 2WWGA 5EUQB 3KPVA 2PX4A 5TQ2B 3L02A 3RBZA 3EEIA 4URXR 4I19A 3A2NA 3IO3A 5LA6B 1SVNA 2CHUA 1UFQA 3AR5A 2R8RA 2JH9A 1ECGA 1Q3HA 1ZD3A 2X5XA 3ACCA 4WLEA 4COKA 3LL7A 3RAFC 1A4RA 1JE0A 4CMAA 4EHIA 1UWVA 3MYRA 3W2GA 4UBJA 4RPJA 1QIIA 3PL5A 3UWDA 2GNAA 4ROTA 4ER6A 5JXWA 1JIQA 1DMSA 2HMUA 4OI0A 2VTEA 2FMXA 2NUBA 3C70A 4RYLA 2K7FA 2QYTA 1S8NA 1W85B 3PEVA 4PRZA 4EKIA 5BV1A 3OZGA 2ZKLA 3WLOA 2VVTA 3O2JA 2NSHA 1UKVY 2O5VA 3PPIA 1O6FA 5C9ZA 4I4CA 4OJNA 4KXFB 2Q8NA 4O4IF 1SPXA 2NUPB 1VE3A 4LDRA 3U7IA 1XN1A 3K6JA 3Q3CA 4BNDB 4HNVA 5TQ0A 1GRRA 5ALIA 5K5EA 1ZM9A 2EGGA 2GAOA 1XAIA 3CHYA 3H11B 4HGNA 1BNCA 1KNQA 2QG9A 1K92A 1ULTA 2GOYA 1UXOA 2XZPA 4XOIA 1R8QA 1VE6A 3DLTA 5EZYF 1IY1A 3OIUA 2WSYB 2VHWA 2HLPA 2YJ5A 4AJNA 4BC0A 4CF7A 1JQLB 2CJWB 1TMYA 1C3VA 3PRYA 2C5HA 3RRXA 3PSAA 3LZ6A 4LS3A 2BGNA 2Q4BA 1QV9A 2YXNA 2D0IA 5EYPB 3JZFA 4N9WA 1WEHA 5CFOA 4KW7A 1J97A 4HUJA 4JGBA 5AJZA 3R9IA 4DE5A 2I0FA 4H7FA 3VC2A 1P18A 4PBRA 5IAGA 1WABA 3SZLA 5LIRA 1P2DA 1Y7IA 4JB0A 4L9SA 4C3UA 4YRZA 1RI5A 2PSEA 1FXSA 1A9QA 4NXNB 3KD3A 1KU0A 2ZQ5A 3EVZA 5H0IA 4ADSG 2PRIA 2WYWA 2H7CA 3UW1A 2E55A 2VG8A 5DGTA 4MQUA 3H5WA 5MDHA 3ZZ1A 3OJWA 2FDRA 1IDN1 4F9GA 1UJ5A 4RA6B 4C0LA 3FB4A 4YCSA 2R8BA 3FIUA 1KQ3A 4CN9A 3FVWA 4ZEVA 4P34A 1ISFA 1UK6A 4D9NA 2B2XA 3EXHA 1XMPA 1N33B 2XDQB 3ROEA 4JWKA 4JVSB 4P08A 6ADHA 4ZOEA 1X1AA 1VL1A 4EITA 4N8EA 1N5LA 2O1XA 4WKCA 8ABPA 1KH1A 3LBFA 2G71A 1IOLA 4UTNA 3BMCB 4ARVA 1Z2AA 1Z2DA 2AMYA 3HJBA 2W6QA 2DWUA 3R5SA 3HN7A 3EVGA 2A5DA 1U1GA 4Q4LA 2C59A 1JXOA 4E5KA 4QNNA 2Y1FA 1H1DA 2Q9CA 3AERA 1FRZA 1UXIA 3BB1A 3IOCA 1UH5A 3EDMA 4LXIA 4BNKA 1JEYA 4PX9A 5CFRA 1XCMA 3NRCA 4GGOA 3HVJA 4RTQA 4K9KA 3WWPA 4RF3A 1GQRA 1K1EA 1G41A 1I2ZA 1N2CA 3I0MA 3WBJA 2JJ2A 3K0AB 5T6BA 3CVUA 4IDCA 2LPMA 4V03A 2HQOA 4ZCQA 1BVHA 3EG9B 4PHTA 1VBKA 1E5XA 4C4RA 1WZIA 3QFFA 3X2EA 1ZZGA 1LNQA 3G6WA 3FMIA 3WMRA 1IHXA 2IP4A 3ISTA 4M89A 5AKZA 2B1IA 5B36A 3IBFA 3HJFA 3DCJA 4H4CA 3C4QA 4NJOA 3ZTTA 1SXPA 3COPA 3X1XA 1D7AA 1EWVA 1VSVA 2O7VA 3NI2A 3S8MA 5IUNC 4WI1A 1IN7A 1PHPA 2YJNA 1YR6A 3GH1A 5AJTA 1R6DA 2C94A 3HYTA 1IL0A 3HA7A 1NF2A 1M7GA 1BC5A 1EUDB 3PPYA 3IS3A 3ZDRA 4G5XA 4RYDA 2DVMA 4WW0A 4RJIA 1MCZA 3I2HA 2CLFB 2V54A 4Z3OA 3AWDA 1CQIB 3O8BA 5ER6A 3CIFA 3E03A 2IY7A 4E6PA 5ED0A 3PTLA 5LR6A 2DHEA 3BIFA 4U2KA 1J2TA 5IDYA 3CH7A 4C1BA 2E82A 1OGJA 2GRJA 4JVMA 5BSGA 4ZV9A 1U94A 5DOVA 2LTAA 1IUNA 1T8WA 2B83A 9GPBA 1YRBA 4MCAA 4UZFA 1TEHA 4I1OA 5LQUA 2D5CA 2JBWA 1JQJC 1RHUA 2HM7A 5AHXA 4ITVA 5IKEA 1CEYA 2EF0A 1QAMA 3H2SA 3L8EA 4Q66C 5ILGA 2TS1A 2CN1A 4BMDA 1R0YA 4CYMA 3T5AA 3BWEA 2R2GA 1WZNA 4HEA1 3G2NA 3EEQA 3CW8X 1CG6A 4HN4B 4IIYA 2UZ1A 3U7EB 2JI6A 3NT5A 4GBJA 5IJXA 1NGSA 3MFQA 3S28A 2CLIB 4HH0A 4B6JA 1L5MA 3HCFA 5B53A 5IULC 2O14A 1FJHA 4HX2A 4Z54A 1NVBA 4DW8A 4ITRC 3GNLA 3LLMA 4Z4GA 4DLWA 4E5NA 2OY0A 4DUGD 4ZTUB 2VO1A 3FF4A 3Q41A 3VSEA 3RT1A 1L2TA 2L17A 2SECE 2TSYB 3QKRA 3SHFA 2V6IA 1G5RA 2JLAA 1JXAA 3DTTA 3KKEA 5TEVA 1AMUA 2B3TA 4ENUA 1WU8A 4K87A 4JUAA 3H8SA 1QHYA 1O9GA 3T94A 1JJAA 5CBKA 1ZH4A 4MOWA 3ELYA 3QF4B 4WZAA 1BMFA 1SNYA 3N0TA 2JCSA 1Q0SA 1SOVA 2J07A 1LPPA 4JD5A 1G9SA 3L0DA 2VCYA 4F92B 3G2HA 2G09A 4BMZA 2GJKA 1TVCA 4BNMA 2NW6A 4CFZA 3E8XA 2ZEJA 1Y1KE 1MBZA 3NCTA 1M1YB 5FOTA 4GZ3A 4IV0A 3PEEA 2BR3A 5LKAA 3G85A 4LZAA 3RFTA 2GXQA 2PUJA 3ZIDA 5ARCA 2P9ZA 3HCBA 1WO8A 4QOIA 3N70A 3AMVA 4JUCA 4EJSB 4F12A 4ZREA 3OEHD 3HWSA 4EAAA 1XKLA 5K3EA 1LPNA 3DDHA 5BN1A 4JSTA 4QT0A 2Q6TA 4MJ7A 1CUYA 3IIEA 3OX1A 1U31A 3AUAA 2H1HA 3DFZA 1AV6A 4PRKA 1D9XA 3DJFA 2HNBA 3QQ5A 1FNNA 3EUWA 3AT1A 2O6HA 1Y4ZA 1K4KA 4M1SA 3RT7A 2I1QA 4OHKA 3RYIB 4O5OA 3H2BA 4OBWA 4U7FA 4XGQA 2QAIA 3E22B 3OCWA 1EP1B 3ZS9A 1SVOA 2JAHA 4RL6A 1BHQ1 3G1WA 4E32A 5I9MA 3JZDA 2BMAA 2X5JO 1EVIA 3LWNA 2PZFA 2GEVA 4KMSA 5C1DA 2P9BA 3CZCA 4GLLA 5KQPA 3PUYA 2OV2A 3HDYA 3MCUA 2VQ6A 5AKYA 8LDHA 4UAVA 1OHHD 2B36A 2Z58A 1N4AA 4L4XA 1RWNA 4J03A 1NSYA 4HDNB 2GCOB 1NVMB 4NCJA 2BTEA 3EMBA 2CLLB 2VT3A 3BFXA 4N5HX 1Q1ZA 1CFZA 3E9QA 4QASA 3VNBA 3IT0A 1UFVA 3N8IA 1ILWA 3G0IA 5JI2E 1QF9A 2OZEA 5I51A 3CPEA 1TADA 4Z1MD 2YS6A 1PG2A 4OP3A 4YQEA 3CLSD 1CUXA 1U0JA 4KDRA 1EM8B 1VMDA 1MA0A 2FQXA 4UNSA 2VT6A 5A9SA 4AN1A 3ND7A 1N6HA 4PLTA 3CLHA 1WU7A 4A2CA 1AA6A 4M0DA 1P39A 1EINA 2X15A 3MTIA 1L4KA 3IPYA 1XPUA 3IDQA 2V97A 3GCZA 3PR2B 2DERA 2F3SA 5GQSA 3ET4A 4CT0A 1IUOA 4IOLA 1L4GA 4BJ3A 1FY2A 3QMVA 1WP4A 1M6YA 5FTKA 3DDWA 1JALA 5DHUA 2E9SA 2PMDA 1Q0PA 3WOHA 3KUDA 5KYTA 3RG2A 4ZRDA 3FZEA 3QU9A 1PL6A 4I4LA 2Q6VA 1OBCA 2AT1A 1LS1A 3ABZA 3BHMA 4R83A 1K6EA 2VYFA 3BMOB 2Z2JA 3NKLA 5KJ1A 4MI1A 2ZUUA 1JMKC 3EQ8A 2DQSA 4G1MB 1EG2A 4ZI7B 2C4KA 1A72A 1Z5UA 3MWKA 1RXSA 3ANXA 4FX2A 3NHAA 2OMEA 1GY8A 4AO7A 3EOBI 4URVR 1DZIA 1G8JA 1TEVA 1FDWA 1R6AA 3DMPA 4ZVQA 4JASB 1L4LA 2VPTA 1NF9A 2YNMA 4EJ0A 4QT4A 2ZVJA 2G7ZA 2RK4A 3FOCA 3HEBA 3I8SA 3CCCA 1WKBA 3GFRA 3PF8A 3QUQA 4PG7A 4QECA 1ZDMA 3W8DA 3WL7A 3TTUA 2ZTVA 3NEPX 4YHBA 1UBTS 1CUZA 4MIKA 1KJIA 3L0YA 5T8KA 3N8DA 1E7MA 2AXEA 3ZKWA 3SZ3A 3IV7A 4DB2A 3M4XA 1GNQA 5DCYA 3I9MA 4FXOA 4O0MA 2EP5A 5ICEA 1E6CA 1SN7A 1JQ3A 4UUPA 3GRCA 1NV8A 4KQKA 2BGGA 4BB9A 4IIGA 2QRVA 3SXUA 2E37A 1NNEA 2ZRFA 2WMNB 1RFGE 3BFKA 3G13A 3MA0A 3N74A 2F90A 1CUVA 1MEOA 1CZKA 1R8YA 2J0UA 3IP6A 3ZZUA 2FRXA 4ALJA 1ZSYA 2G70A 2QIPA 4EB3A 4YRBA 4ZK2A 3EWNA 4LYHA 4EY4A 4P32A 1QPBA 4ZICA 4WLNA 5CPBA 3TLGB 1ADCA 3FW1A 1V3VA 3FE2A 3PDIB 3UTDA 3F5DA 4BL5A 4KLRA 1V26A 4Q05A 3HMQA 4ZVKA 4XB6B 5B1HA 4C7OA 4HB3A 3MWLA 1UEJA 4QREA 4YMIA 2OHOA 1U98A 4X44A 1PLKA 1CUAA 2VRCA 2QTRA 3HGQA 3P9IA 2OFFA 4D9MA 3LQKA 2ONYA 3AUJB 1NU6A 2AJCA 1E62A 3IAEA 4JIMA 4EI7A 1AQUA 1RM5A 4JU9A 3EW9A 3JPWA 4HS9A 4AT1A 2NM0A 3KLOA 3PYXA 3ZQKA 2J8ZA 1WIWA 3GAMA 3EXEA 4HZGA 1RRFA 3L1UA 3F73A 1LXCA 1VIVA 1C7EA 1KIFA 2NZWA 2W2KB 4TLEA 1N8TA 4BAZA 2XJ4A 1SBYA 2VSFA 2PM8A 3EFOB 4G0OA 3DH0A 4XJTA 4CR7A 4EZBA 5A3JA 5L4SA 4IDGA 1WD5A 4M1KA 3ETCA 2FFJA 1EK0A 2Q0SA 1GD1O 5B55A 4LDPA 1BVYF 1QK3A 4PZYA 1KI4A 1RE0A 2AE2A 2O6LA 2PLRA 4N6GA 2VZ9A 4NYIQ 5CD9A 2GEJA 4EEKA 4OIMA 3OE5A 4BNNA 4E70A 2BL4A 3ELBA 3FOEC 1ZW1A 3D31A 2BAGA 4X97A 2ADOA 4ACBA 4GPEA 1RCUA 4OU4A 4XX0A 1WDTA 1NQXA 2WJYA 2HIHA 3FCYA 3PUZA 3D2LA 5AK6A 2X76A 5ALXA 2DFTA 1W44A 2PANA 4QYIA 1QZZA 3OPMA 4H1UA 3A9VA 4UZSA 5T4BA 1AMOA 5IVHA 1GL6A 1SJ9A 3L4EA 1R0KA 2Z9CA 2CXTA 2DGDA 4PHGA 3DLPX 2DF8A 4MW0A 2PSDA 4R9VA 4TS9A 1ZNQO 3KEOA 3KYBA 1L7AA 2NYUA 3AHHA 2SCUB 1BWQA 3BFPA 3OUZA 3S2IA 2CF5A 2Y2VA 2NSLA 3MS2A 3ZQ4A 2R8ZA 1KVUA 4I1SA 2GFHA 3T7AA 4ZVNA 1Y1SA 3KEFA 3NIDB 4GI7A 1D1PA 4MAAA 4XJSA 2Z8ZA 4PLVA 1ES9A 1E1CB 2ZUDA 5F52A 2DR2A 1BE1A 2AE1A 1VXRA 3MELA 3P26A 3QU4A 4Z1MA 1G64A 1JPJA 4ZGGA 2JCBA 3V8NA 1P7YA 5BRAA 1B00A 4B6RA 3OCUA 3L4KA 3KTAB 3ZHTA 2FWAA 3I58A 1U7OA 3OC6A 1SVLA 2YBDA 2AVNA 3OMLA 3D6JA 2FSHA 3AIOA 5HKAA 2A5YB 3E70C 3ZQUA 5I7FA 4Z0TA 3NT2A 3GNQA 4L0CA 4N0QA 1KI1A 3PEWA 2C3UA 4IF4A 3BILA 3N2YA 3NV9A 3BE6A 3N5CA 4US2R 1PV1A 1PNVA 2P6NA 2XBUA 2P2YA 3UA3A 3DV9A 3IPRA 4UMDA 1JEEA 2M6LA 1P0MA 2JVIA 3I9KA 4Q1VA 5C7LO 3LX4A 3T7DA 4HQ0A 1N5JA 4GS5A 3UUFA 2HA3A 2Q29A 3WDLA 4ZMRA 1G2PA 4P98A 2I6GA 1WDMA 3SQDA 4C7JA 4F71A 5J4YA 5JMTA 5L9AA 4BO3A 2QMYA 2W8BA 3EGXA 3K53A 4AJHA 2ZSFA 1LBQA 3UBTA 2OXFA 3KTAA 3H9BA 5CM2Z 3AZOA 3M5DA 1MDBA 1DWUA 3I1JA 4EHBA 5JD6A 4OHMA 3WA7A 2Y92A 1OX4B 4K26A 4TRRA 4CCYB 5BN5B 1JEAA 2BGJA 3L6RA 4MO2A 5CB6A 3EVBA 2B78A 1VA4A 3ER9A 4D44A 2F4VB 1HM5A 3TE6A 2YZGA 1YIOA 5E4YA 1X8JA 3HKDA 3WFJA 4BBZA 8MHTA 5J5VA 2WNHA 3VU1A 3C4JA 2C04A 2VPPA 5JD4A 1M1YA 1Z5WA 1KDOA 1HMYA 3HUDA 5EERA 2E5LB 1EDEA 4Q3NA 5ICMA 5EWLA 1DTSA 5C81A 2VWGA 4FS3A 2Q4RA 1QKJA 1ZQ1A 2Z2XA 2X0NA 1A8QA 3DZDA 3HB4X 4Q93A 2Q8QA 4QUIA 5CYPA 2BEKA 2ENUA 3KVYA 4FDLA 3CLRD 3NBMA 4O25A 5EP3A 4DNPA 1W49A 3RYFA 2XQFA 3TX2A 1TT5B 3OPNA 1U2SA 4NBKA 2BFFA 1A8IA 2UU9B 1HO3A 3AF4A 2QTHA 5A2GA 3JD2A 1JIUA 3UK6A 1CZRA 2GZSA 3AC0A 3FFTA 3PSHA 3KOXA 3Q1KA 4M7OA 1JR2A 4QUKA 4ARBA 3X43A 4CM4B 3O91A 1WXWA 4PLZA 1XMJA 5FPQA 5C3MA 1P7PA 3MOSA 1GDDA 4YMTA 3RTEA 1T9ZA 1GL3A 4HB0A 3SSAA 4RMHA 4OA8A 3NIFB 3CPHA 4RVSA 1EJ0A 3DE1X 5KVVA 3M5WA 4ZQCB 5K6AA 4CWAA 2HL6A 4ECEA 1HT0A 3EF1A 3IUEA 1K8YB 5JYEA 2SKDA 4GGMX 4RMGA 1Z9BA 3DG9A 4AMZA 2MDTA 4IJ5A 4JENA 4BQEA 3AKYA 4QAQA 4AECA 1YCFA 2BP7B 2Z2KA 3KLPX 2ZRBA 4OQEA 1CZLA 4UHBA 1RKBA 7MDHA 1SHJA 3QEMA 2I7VA 1AURA 4LC0A 1R10A 4KFRA 1U3VA 2O8EB 1EUCA 1IK6A 2R68A 3C3MA 4JJKA 3AVXA 3VJLA 4OHOA 4DEYA 5IDXA 2P1DA 1ODKA 1TZ2A 3AESA 3HKBA 3L4BC 4QE3A 3ZHCA 3ZU3A 5ITZB 1XDBA 1PBNA 1YU6A 2IODA 1BEZA 1N1GA 3H1EA 3K1JA 4GOND 3TXYA 1KSHA 4YDQA 4Y98A 2WAYA 3K96A 3R3VA 3N87A 5IASA 4AYXA 5FF9A 2PJRA 4PHFA 3PENA 3B1JA 4WAUA 2QB5A 1MX3A 10MHA 1W0CA 3GMTA 4ZP1A 4LSZA 3CA8A 3G02A 4K0RA 1O03A 3W4IA 5JO0A 2IYNA 4MIEA 1NT2A 1NR5A 1OA1A 1LI5A 5TGDA 3U3DA 4QDXA 2OGWA 2OAEA 5LZ7A 4BX0A 3ZLJA 3M70A 3PC2A 1MH9A 2FR0A 1UDWA 4E7OA 1OH8A 4NWIA 3CU5A 1SKQA 1SM4A 3BN3A 2GYVA 2VK1A 3DMFA 1KORA 2D2XA 3E53A 2DM6A 4XDYA 1N1DA 4CM1A 4ZT7A 3GP8A 5C37A 2P0YA 2DBYA 1NUSA 2XDAA 3GMSA 2WYHA 2M1ZA 3I5MA 2RKBA 2YJ6A 2XVXA 5DOZA 4R71A 1OXMA 1Y5NA 3NOXA 1JHDA 4PPYA 4E07A 2ZT5A 1NBMA 3C0KA 3JATA 4EO9A 2B7BA 2QM7A 2JLVA 1CLUA 1DUVG 1MJHA 1RPJA 1NMYA 1X7ZB 1QHHA 4U7HA 5CCDA 4AUEA 4V0NA 3WRWA 5IBQA 3B9RA 3ETNA 3IVMA 2HBRA 3KFVA 4CKCB 1PWHA 3C4VA 4M0PA 4F45A 1RQ7A 2AWNA 2IYSA 1BYIA 5H83A 1KYVA 3KJQA 3QFRA 4M54A 1Q0RA 4DM4A 2XMDA 4K9SA 1U0LA 2Q6KA 4IFEA 4W6QA 5JH7A 1DELA 1G8KA 1H0KA 4Q3LA 5B58C 3SMQA 1J5XA 1FVOA 1NASA 1RCTE 1TU4A 1H2HA 2JIMA 3PA8A 4J9UE 3VC7A 3ZBPA 2JGRA 3MTBA 2CV2A 5E7QA 1JWBB 4I1PA 1Q0HA 4OGLA 4X95A 1HC7A 3FMPB 4E3WA 1DOHA 4HGQA 4QU5A 4QLBA 2NZVG 4LXUA 3GLHE 5C80A 1W2GA 2GLUA 3TQOA 3V7UA 3FYUB 1T1RA 1M5UA 1VDZA 3GJRA 1ZONA 4GXRA 4MR9A 5KWSA 4XWGA 3CRW1 1POXA 1FMJA 2F1RA 2O57A 1R16A 4JR1A 2JK1A 4DCUA 4BVGA 3EX7C 4GIBA 1P6XA 3DAGA 3BMOA 4D1YA 5DYNA 1OXKB 3EPKA 4DCTA 2OD2A 1FSFA 1Q1BA 2BDUA 4CEJA 5HM8A 1S4MA 2FLKA 3RVJA 3BZWA 3TGWA 4FCTA 1WMFA 4TV9F 1HSOA 3ZH2A 5BXQC 1M73E 4TWZA 1BGWA 2CMHA 1PEYA 2W2KA 3HYRA 4W9MC 1XCBA 2ZE7A 2GMWA 3UA4A 3I2JA 1SIOA 1IU9A 2RAUA 3QPCA 4S04A 1TKRA 4X60A 2N75A 1U02A 5ENVA 2OPHA 5K2OA 1SWWA 3DNMA 1A1VA 1IHDA 2I80A 2R1TA 4HATA 3M4ZA 3ASZA 5LP6B 3VO8A 3MPOA 4MQFB 3GCXA 3OPYI 5DYWA 4OXRA 2OB1A 1R0WA 2P9QA 3EE6A 1KJWA 2QJFA 5G1PA 4NFYA 3BXXA 1GSHA 2C58A 3C7KA 3UJAA 4BLQA 3GBVA 3T1QA 3T3MB 3F7TA 2WUGA 4JROA 2GCIA 2X0JA 3BSYA 3ELUA 3RSCA 3MMXA 3JZAA 1II9A 3MXOA 3BJMA 4QHYA 1YB7A 3IBCA 2RHGB 4FLFA 3V7FA 1VBMA 3X1JA 4UU7A 1M2OB 1V6CA 3RFFA 3WNDA 1G0NA 4LCEA 4RETA 5DMXA 3RHTA 1WP9A 2NO6A 1EHCA 2AN5A 1KDRA 1N2CB 1SOMA 1ZUIA 5EP2A 3S44A 3BWDD 3ZZ0A 1EKXA 2VP2A 3I28A 4O3FA 2LR0A 1JJIA 4XVCA 4UHCA 1HFJA 2JAWA 4RDHA 3AW8A 3LVBA 1F1BA 4N40A 2W43A 3KWJA 2HWUA 2MMCA 4JNKA 5B58T 3E27A 3TRJA 1PUIA 3NHJA 5BUQA 4RK6A 3S2EA 2H52A 4HLCA 3CF0A 2YIJA 4N6NA 3QNMA 3ZE8A 5IABA 1S5PA 2DWQA 1P0FA 3O3OB 4B5KA 5BSHA 1ABBA 4Y2QA 1F8FA 3AI3A 3I9V6 4KH1A 3UAZA 4JOSA 3SNKA 5LQAA 1XXHA 2EATA 5KOJA 3G0HA 5EKXA 4J7XA 1Y9JA 2FSVA 4FILA 4R9SA 4R6XA 1Q1AA 3L18A 4IRMA 1UJNA 3P0JA 1GT6A 3VNSA 2K4MA 4B3BA 2Y1OA 2AX4A 2OC9A 3B3AA 4GPD1 2WPDA 1V9LA 4YAKA 1N0VC 2HZBA 2B25A 3BZBA 3GFSA 5K0NA 1Z0IA 3SIWA 2H2GA 3ZGXA 3ICVA 3G9XA 1GNRA 4D99A 1LQUA 2IE8A 1MR3F 3AB7A 3MD9A 2IS1A 3CZ4A 3I72A 3VHRA 2GR9A 2X1LA 3EIXA 4JLBA 5IFLA 1VLQA 3H2JA 2DSNA 4YWJA 2PRJA 3QEOA 2OBLA 4FFPA 1QIJA 3S8EA 1AGPA 1UEXC 1VSUA 2F1OA 3N0RA 3UAYA 1GNSA 2L0XA 4HAIA 1PR1A 4TYMA 3KQVA 4ARUA 1U0NA 1Z83A 2P4EA 4Q4JB 3NZEA 1RKXA 1H6DA 3LK7A 3QEKA 4ASUA 1TA0A 1NJ8A 1LK7A 3U1VA 2G07A 3FPHA 3PGA1 6Q21A 1X13A 4TTRA 4MUXA 1LTKA 1V3UA 2AZDA 3ELWA 4Z9AA 1QYIA 3W34A 1STOA 1USKA 5JQGF 2YWCA 2HLHA 4BVFA 3EIUA 4XIFA 4MYDA 1U80A 4L08A 4GQAA 4YJ3B 1GEEA 3ZHSA 1B0AA 1DBRA 1T3SA 4B8WA 3HBFA 3PGMA 1MV5A 4WJZA 4EUNA 4ZCTA 1I2MA 4DLXA 3GH3A 5IMBA 1IXYA 2HT1A 1V4VA 2J08A 2VZEA 1JG6A 3PQDA 4I5IA 4MQBA 3ZQJA 3G68A 3TUZC 4HMOA 1YL7A 1QWOA 3KT8A 4ZVMA 5JWHA 1FVHA 1TJYA 1BE6A 1XKXA 3L4SO 2SICE 1K5HA 5ALGA 5FCDA 2A58A 5B6JA 5JANA 2VJNA 2E5FA 3RVRA 2JGDB 4B44A 1WNTA 3UHOA 3EHEA 3LLVA 5IAKA 4X3PA 3F5MA 1HQYE 2XKKA 1GZ4A 1RKQA 2D00A 2VUUA 1CUDA 2YW2A 4NAHA 3GA5A 4PO1A 3ADKA 1F2TB 3TVYA 3U5TA 4G0YA 3A2LA 1U7WA 1A7KA 3LCRA 4RVNA 3KHKA 2WQZA 4QUHA 4C0XA 4PYJA 1EDBA 4CLOA 2IOQA 2V6BA 4CUKA 1Y48E 1DLJA 1ISGA 1PWZA 3Q3HA 1ZPDA 2JFXA 2Q3EA 3B53X 1D2CA 4KLAA 4BZQA 2W42A 1SD5A 3WMEA 2WT9A 5AOCA 4X9XA 4XEHA 1ZMBA 2BGRA 2JATA 1VJDA 5AYVA 1NR1A 2C5GA 1FTQA 2O7NA 3IOBA 1XJWA 3ZV6A 1M2EA 2XGOA 3LXRA 3R0ZA 2Q3BA 8OHMA 2P9FA 1JU9A 5G1NA 4D4HA 1PTJA 5AQ1A 1SVWA 3OP4A 1P29A 4KK4A 1QTIA 2SKCA 4UEQA 2R9VA 5AP9A 2LE0A 4CCSA 3OZEA 4F11A 3OEHA 2ZR7A 1YDWA 4QOSA 2C4VA 2Y0EA 2QSZA 3M1YA 4S1NA 1WMBA 2CVHA 3I6IA 1ZJZA 3RS7A 3NAZA 3WBKA 3B36A 4DREA 4F3CA 5A5VA 2GVDC 3ETEA 4RPKA 4GU5A 4U02A 1BJKA 5I9TA 5L53A 1KDYA 3KT3A 1CY4A 1YZNA 3GZTB 1JYFA 4MV3A 1P7CA 5CBPA 3ZJVA 3R9XA 3BEOA 2C9DA 3HR8A 3WK8A 2ZWAA 1R0ZA 1QPZA 1YGYA 2AEJA 2WWFA 2WP0A 3F6EX 3KFLA 2XB9A 3KSZO 3NBAA 3OKCA 3O03A 2ZULA 3OMXA 2AOWA 5JCPA 4M21A 4ZZ2A 4KZKA 4X7PA 4OSEA 3H4TA 3O2NA 5AVYA 1E1LA 5AO9A 3AL0C 4J16C 4HG2A 5CK5A 1UOPA 1JHZA 4LI3X 4PF1A 5TC4A 3SQWA 2FKAA 1PT8A 4MUNA 4UM5A 4AJ1A 1Z74A 1OPXA 1Y4UA 1ZCJA 4D6XA 4ONEA 4YB8A 1T35A 2AFHA 3NJRA 3DM5A 4H7EA 4OJTA 5TJHA 4CDGA 3IDZA 3IHKA 3NKVA 3NX4A 2XUZA 2C9YA 5J9FA 1RD4A 2QVXX 5TMBA 1W1UA 1DAHA 1XXHE 4MJ3A 4GSKA 4ROSA 3P4UA 3WV5A 4RGYA 3BZUA 3KOZA 1XRRA 4FB5A 1IOVA 4MVXA 2HSZA 2NLOA 4WZAE 1NM5C 2AXNA 3GJ6A 3GJZA 5CXUA 2H17A 2XZDA 1DC7A 1JA9A 1NBIA 1ZKDA 3QKWA 2I22A 4RKWA 2OYCA 4BFUA 1EFUA 4RY2A 4HNRA 2XT6A 1M6WA 2IGTA 3K0FB 2CCKA 3FOZA 2EG9A 5ENZA 4Q9IA 1DAPA 1Z2CA 4L9AA 2EJWA 2GERA 2AMJA 4YMVA 1J1IA 3UHJA 3GPLA 2JJ2D 4RM3A 3V1KA 4B3HA 1XZHA 4D8YA 1IYZA 1I01A 4MW1A 2AFHB 3DDSA 1L1EA 3MJFA 2HMVA 2GASA 3TD6A 2JVJA 4AYTA 3RASA 1CUEA 1GZHB 2PBLA 3RFVA 3DB2A 1K3TA 2HK7A 1PQYA 2P2SA 3A9SA 4IJWA 1B1AA 5FOXA 3ONNA 3VR4H 2JAPA 3TL6A 2IRWA 1WCXA 3BK1A 1FX0A 5TS2A 3RU3A 4TTAA 4RMNA 2XMPA 1J1ZA 2CMGA 4XUCA 1ODTC 3UAGA 4N5IX 3PPWA 3WWDA 3SJBA 4B8ZA 4PSAA 5LYYA 3G8CA 3FN4A 3HH8A 1ZL2A 1P6UA 4FSDA 1QWSA 1ZU4A 4NE9A 4X0EA 1LS6A 1E1KA 3RF7A 3OQOA 3COSA 4MUGA 4Q4HB 3ZY5A 1W8DA 3U3XA 3BTUA 4F9TA 3EMDA 4ZYUA 2XMCA 3EPHA 3EGDA 3FHLA 4ZGBA 3PDUA 4F3NA 3DE4X 5A5FA 2AZXA 2Q9AA 2VHVA 2B2NA 4BO2A 4CV1A 3MLEA 2LWIA 5A4AA 1Q57A 1UPXA 2CVOA 1NZJA 2XVMA 4UUBA 1NMQA 4XGKA 3V1UA 4B2YA 4MS4A 1ZXLA 1T2UA 4AUKA 1HE1C 1YKGA 1Z16A 2PV7A 2FJUA 3VPAA 1ZHOA 5PGMA 2HEIA 4MULA 1UBLS 1DV2A 2NG1A 2ASEA 4D79A 3C3JA 1MT3A 2NZJA 2C00A 2EJUA 4F4DA 4FZJA 3MTJA 1LWOA 1ZJYA 1RHQA 3GWZA 3FROA 4QARA 4B4DA 5A02A 4ZO6A 2IHYA 1VCOA 2FWPA 3Q0EA 4OM7A 4UZEA 9LDBA 2JBAA 2V0NA 2QG6A 2QZJA 1FFEA 2IEIA 5EZQA 1Z6TA 3BORA 4IVRA 4WKGA 2NXEA 1C8KA 4RTSA 1HEIA 4BJ6A 5KSYA 2I1VB 2FZLA 4KWIA 4W9NC 2O2CA 1TKBA 3HDQA 3AFHA 2ZUCA 4S1VA 2Y66A 2XQIA 4D4MA 4Y1RB 3KJFA 1M8JA 4MUMA 1RXIA 2HX1A 5F3RA 2JLUA 4KH0A 1XQ6A 2IUFA 5G0UA 2R1VB 5B7GA 1K8ZB 4OBXA 2PZGA 2R7AA 1E9EA 2DUNA 1GL7A 2QRKA 2ZE8A 3EASA 1O94C 1P9RA 2RGAA 3QA3E 4M8IA 1YFLA 2JLRA 2AXQA 3UJ3X 3MLAA 4GKVA 2BGKA 2EFEB 1XNRB 1U04A 7ABPA 1PG5A 1M0TA 1XDDA 3QG1A 3WXMA 1PJRA 1H1TA 3Q3IA 4BRWA 5BSWA 1NQVA 1ZWLA 2NV0A 4V38A 1MZPA 2X9GA 4DR5B 4Z4EA 3D7MA 2ATEA 3DEKA 4UE3S 1JJFA 1M6EX 1Q7CA 1E8NA 1D9ZA 1XZ8A 3GGDA 2YKGA 2VR1A 3ZI7A 1LVHA 2HDWA 4C20A 3IVRA 4MYUA 1B43A 2XNDA 4ZCMA 3W5JA 2YHBA 2P4QA 1AY0A 3T4XA 1R66A 3CVOA 4MO9A 4FYYA 4DARA 1O97C 4FCWA 4OXXA 4AG6A 5KOHB 3P27A 4PC2A 3O4GA 2BTOA 2D2EA 2L18A 1P73A 1VE9A 1MB4A 3NNSA 5A04A 5KYNA 1WCYA 1A9PA 1Q21A 4CIAA 2I4MA 3IILA 2PMKA 2D06A 2FSUA 2PYZA 4FOPA 5GONB 4WCFC 4YAJA 3LOPA 5C8YB 1E9SA 1U0HC 2A94A 3JAMA 1GYQA 1OC4A 3RC1A 3ZX4A 2GT1A 3QVUA 4H08A 4HSGA 4K86A 3F5QA 4B3TB 2ZBRA 4JNCA 3GJ3A 4U2DA 5IW8A 4P92A 1PJQA 3F5SA 3GA0A 4NV1A 5KYUB 4RAQA 1IVYA 1DXHA 4ZZ3A 1CY0A 5EXSA 3NANA 4BN4A 1XC7A 3QWBA 1H5NA 4EJSC 2TRSB 4DB4A 1IEQA 1W1IA 4J0JA 3WL6A 4Z7OB 1WV0A 3KB8A 1JWAB 2C9OA 3UGKA 1KHTA 2YW9A 4GM4A 4I1UA 3PPXA 2WSSD 3QE0A 2BIFA 1IWOA 2O3QA 1XI2A 2BH9A 2X2OA 4WUTA 5I45A 2QRUA 1P3Y1 2P0EA 1LLCA 2F1KA 3L1KA 4J3NA 3I01A 3ZY2A 2ZI3A 5C7IO 1C7FA 2PZJA 3K0HA 2CJYA 1VMKA 5H4HA 4KC0A 4KV9A 3JX9A 2H08A 1QQ5A 4V1CA 3K0BA 3FTEA 2C57A 2QVYX 4U2EA 3DZGA 4WFKA 5DHQA 1HMPA 1NLYA 2Y1CA 5BR7A 1E77A 3OJ0A 2QRVB 1T8TA 1BIFA 2PWPA 5F7OA 1EB9A 1WSAA 1XRPA 1A9TA 3AR2A 4MVJI 2F9LA 3H0KA 4NJMB 5A0FA 3GW8A 1XG5A 1JE1A 3B1VA 3ZGNA 3RQIA 3DCIA 4OFBA 4OH1A 4A8HA 2IS2A 4DYHA 1Z5OA 4FCCA 2BW0A 1KI6B 4DILA 4PO3X 2FQ1A 5GZ1A 1DBWA 1WCWA 1EG7A 3TNJA 1WXFA 3DHEA 3LVRE 3NORA 3ENWA 5JCXA 1BCSA 1GNPA 4HBGA 3WMGA 3ZIAD 1RYFA 3QVJA 2CXNA 2VSXA 2V98A 1K4YA 2W4MA 4MV4A 1I6KA 3QFSA 1AOXA 4JCCA 3PGVA 2FWRA 2Z95A 3H8WA 2BOVA 3DBOB 3JQDA 1R4MA 2EAUA 2NPIA 5AH0A 1MXHA 4DIFA 4FZ5A 3O5AA 4KXYA 2IYUA 3WL3A 2EFGA 4EB6B 4BJHB 3W79A 3V6LA 1J06A 3SHTA 3KQQA 5DNYB 3UBMA 3ZJ5A 1RZRD 3MJCA 3RUPA 4BV8A 3RKUA 1K63A 2PGJA 5LZ2A 2MTBA 4EYSA 3EH2A 3CG4A 1WHTA 4I66A 2NPFA 3U4HA 5JZOA 5COAA 5CLIA 1UBUS 4R2XA 1RWPA 4CL2A 1KVSA 2NACA 3GLGA 2FKNA 2WBLC 3ZXSA 2P7IA 2HK6A 4J4HA 4KG7A 4YMSA 1RWWA 1S2LA 3DDNA 1W8IA 5CDFE 3WYCA 2B4RO 3DFUA 2C3YA 4GM1A 1LPAB 1MFZA 1H66A 1IY2A 3LLSA 3GRZA 3ZG6A 2QMUA 2P9EA 1GTG1 3ANLA 4FMDF 4MLDA 5A62A 3VZDA 4E5PA 4LWZA 4AI6A 5EIBD 2XRYA 4HGYA 1YDFA 2LZ0A 4HNGA 4CQMB 5CIYA 4R9UC 1OXVA 3H9UA 2GHIA 1QJCA 4YASA 1I3KA 4NZOA 2GI4A 2JFZA 3EBLA 3OLQA 4C4YA 3KSAC 1QP0A 5BSKA 2FWMX 3ZZTA 2QLLA 1N2EA 2QLJA 4M36A 5AOVA 2C2BA 3DLBA 3THOA 3BM5A 4OEHA 1XA4A 4RTNA 2XCSB 4E7PA 4LZWA 1X74A 1AUQA 3ADDA 4HGOA 1RM3A 3X1MA 4BMXA 5IT4A 5FRDA 1S9DA 2OGTA 3GELA 4EY3A 5IX8A 1BHJA 1SD1A 4WOKA 3U13A 4IH4A 3TLAA 3WOVA 1BHSA 4HJRA 1WVGA 3TR0A 1E1CA 4BNIA 1N7IA 1C9NA 1XR3A 1XQYA 1XZQA 3PEUA 4H9GA 5LU9A 1DT3A 2ATCA 5LBIA 1X7ZA 1NAIA 3ZR4B 4YRDA 3ZYCA 2QY9A 2D8MA 3OA2A 1XD9A 2VXYA 1GKKA 3ER6A 3WI7A 1C3OA 1ZGGA 1JPUA 2PT5A 4C88A 4CCYA 2FW1A 3LP6A 5LQJA 2PUFA 3HVHA 1ZIXA 1EIZA 3MCVA 2JIZA 2ON6A 5B4TA 3K70B 1JG3A 5DBGA 3VR5D 2R6CA 5JVDA 3MWFA 4Z8YA 3LBIA 1DI0A 3QUSA 3A3YA 5C8XA 4ND3A 4LHWA 4MJXA 4LXTA 2FRDC 2ZITA 1NW5A 1QDUA 1SPBS 4OFXA 4TKZA 4TV9B 3RO7A 4C04A 3W7AA 2VPXA 4AKIA 3ZJYA 3CWCA 2YJ3A 5ICSA 1LSOA 1SB8A 5GV8A 5ITZA 1J0CA 2NXNA 5IZ4A 4LOLA 3F98A 3K09C 1AE1A 4OFZA 4QIHA 1U1EA 5DNEA 5AVUA 2VJCA 4GPAA 3RIHA 3S1LA 4ESEA 4CG3A 4MAMA 3UF0A 3IP9A 4H18A 3G2OA 4M4SA 1R27A 5ERXA 4UHEA 2DXIA 1P5FA 2O52A 4P8RA 4S12A 2OV8A 4X84A 1F6WA 1Z2OX 2KSQA 2QT1A 3GFVA 3K3PA 3KQTA 4FD3A 4L2IA 1V0JA 4NVRA 5AW9A 1U9IA 2QJWA 3BSWA 4TMTA 3A25A 4KMRA 3G8DA 1DO2A 2PZEA 3L0BA 4Y6RA 3ICWA 2AEMA 4LVNA 2RGUA 5BN4A 2I7DA 2YZ2A 3BMQA 3CINA 4OHYA 4NE7A 2Y93A 3I6QA 2GM3A 3QXXA 1V48A 4N5NA 3VVCA 1RKVA 1JNYA 4FHZA 3H1TA 2ZM5A 3NWOA 3QKRB 3ZWDA 2X6QA 3D3NA 3O3CA 3PXUA 3WYAA 3IO5A 4E0BA 1V25A 1XU7A 5H9WA 1GUDA 4NU8X 5HQTA 5JALA 4MP6A 4EW2A 1ZR2A 1YZUA 4OSPA 4XW2A 4KPYA 1G20B 4P35A 4P3PA 1FFAA 2HO4A 2JCYA 4TL7A 3AHJA 4CV3A 1J5PA 2JFVA 4JA0A 4RD4A 2RGCA 2PUVA 1NFFA 3NH9A 3RTDA 5LOVF 1F60A 2CXXA 4K6CA 2FDXA 5BOVA 4JKIA 5D5QA 3V2UA 3F47A 1HKUA 1V16A 2JNWA 3WTBA 3M6UA 1OKKA 3KZOA 5ALNA 5E6RB 1J90A 1E5LA 4L7VA 4M1MA 5IN4A 1QU3A 2ZROA 1JAYA 5EI5A 3TB6A 4EVIA 1QRUA 1KAEA 4D45A 4PLWA 4G0VA 4HQOA 1GG8A 2F3UA 1JKIA 2XNKA 2XE4A 5K0SA 4K03A 4MQMA 4JLWA 4JI6B 3PHLA 2ZW9A 3FNIA 1YJXA 1QK5A 3CR8A 2ERYA 3D0QA 1SC3A 4WKBA 4XE5A 5K6RA 3NDBB 4CMEC 3PJRA 4RFSB 3GI1A 3KALA 3EGIA 2WHRA 2GS9A 1VQ1A 4URHA 4WXPA 4B6GA 4DMKA 3GP3A 1SQSA 1WL8A 3VX3A 4IHAA 2RB5A 1QIKA 5J59A 1PDOA 3HWX1 1TVKB 4WXRA 4K6MA 1IEXA 1I9CA 1GLGA 1P1RA 2JI4A 2OHVA 2WAOA 5AESA 4M22A 2Q7XA 2IEZA 1VZ3A 4LPSA 4GWKA 2PX6A 4TT3A 2HPVA 3AFMA 2FR1A 4CM9D 1CF2O 3ZW7A 4RZQA 4KXMA 4GE3A 4BLTA 4DBLC 1NVFA 3G2QA 3P9QA 2PPLA 5AW6A 1WKCA 3V6MA 3E84A 3PXXA 1OV4A 4RCZA 3HZOA 5KJEA 3HXMA 1PGJA 1VYHA 3T5DA 2Q4DA 4QPDA 4ZCSA 4IQ0A 3TLGA 3VR2D 1NTOA 2P2CA 1N3LA 1VJGA 1OGIA 1JHAA 1W2WB 5EFOA 3VZPA 4R2LA 3ZQ6A 2H00A 2HQSA 1MXFA 1U3FA 4JITA 4A0FA 1GN9A 2Q0HA 1XQ9A 3BAZA 1OAOC 5IBRA 1PDWA 2ACVA 2W70A 3EHDA 5LNK6 1E2IA 3BK7A 3HUUA 5F1KA 1QHNA 1JEJA 3I04A 1C1DB 1FJGB 2A0YA 1BEUB 5IKPA 3IUJA 1RWOA 4RKYA 2BISA 2C5SA 3NTOA 3E2MA 4ODIA 4MP8A 1QC5B 4XUGB 4PZLA 1C30B 1TC2A 3D6TB 3T7EA 2Q7OE 2P6PA 1AKNA 2OCDA 3VHXB 3KLMX 3RJTA 2N1MA 3OJCA 3IA7A 3JQBC 4FR2A 4IXNA 1QPGA 4Q3EA 1XD8A 4DSNA 3I5YA 2COUA 1K66A 1S2OA 1TZMA 1EDZA 4DAOA 3FFBA 2OGZA 1ZESA 2HFJA 2WFMA 5E9WA 3IALA 4BKQA 5B3LA 1WY5A 3N53A 3H3JA 4FWTA 2DQYA 3IELA 3BQNB 5CXSA 3SDBA 1HDCA 2E6KA 4GP9A 5C1BA 2AIRA 3EIEA 4ALKA 3BDIA 4KNWA 4PQEA 1Z22A 1YR2A 1EUYA 1QVWA 1V5WA 3PNKA 2ZBVA 3RUFA 4OD0A 3S1SA 3O38A 5ES4B 1E4EB 4Q9AA 2XADA 3I9OA 1I1HA 3R0IA 4OLAA 1JDUA 1C2TA 1GLVA 3P94A 1OUMA 2QNIA 3DL2A 3DTVD 5DYYA 1QE5A 3EGCA 3FPFA 1YZGA 3K0AA 2PV0A 3K4PA 4PWYA 4CLOB 3FCXA 4YR7A 5CJ2A 5DE3A 1DJOA 2NIPA 3BWVA 3DBLB 3TIIA 3ZW9A 2OCIA 3MXTA 4GVXA 4TKVA 1B26A 4M98A 3OU6A 4Z8XA 5JSFA 4DKXA 1HFKA 2Q5QA 2C8LA 1M34E 1U5AA 1UQUA 2J3LA 2XTNA 3GDHA 4KNVA 2WFLB 4NBSA 4YRRA 4CBVA 5A9SB 1LKZA 1QRAA 3H11A 5AXBA 3RYFB 4Y6PA 3MW8A 4INJA 3VFDA 5ESXA 1RJGA 1TYEB 1SO8A 5JW6A 4ZYWA 1TKAA 3AHFA 2D5AA 4BO7A 2JFQA 4AIIA 2VQFB 5CVUA 3G5AA 4ZN6A 1JF8A 1LY1A 2FMFA 3A1FA 2CHQA 3EPJA 1R6VA 5BSTA 4MUIA 4XD7A 3B52X 3QPAA 4WVFA 1R0LA 4O02B 3UJCA 1JVNA 1LTHR 4NNOA 2BPOA 3HXTA 3LUHA 4IWYA 4MUJA 4EVRA 1S2DA 3BB3A 1VYVA 2ZJ8A 5HZGA 1FMCA 3BD6A 3JQQA 4ASUD 4CF5A 4EEZA 1EVLA 1F48A 1QHFA 5B1YA 1FLNA 4AM8A 4TN1A 1GHTA 4JWTA 1KEVA 1FFHA 2HBZA 5L3QB 3GMIA 1MDFA 1QH0A 3K30A 3KQWA 3NXSA 1W73A 3IDAA 1OPRA 3A7DA 5G4KB 5HOQA 5BYKA 3EXEB 1DIRA 2YHSA 1I51A 3HRHA 3L6CA 4PGMA 1F0NA 4QTTB 5E4TA 5ILOA 2IS4A 4PPGA 3UHPA 5J43A 4TWAA 3OF2A 2DUUA 1A88A 1YT5A 3D0KA 4QX6A 4YQYA 3DEAA 1RRGA 3IB6A 1DUIA 4MIOA 4RXUA 4M37A 1HZJA 2M9MA 1D0SA 1P8AA 4G1UC 5IYZF 4ZVUA 4YCLA 2QQFA 4J76A 4JJ8A 4N0PA 1AX9A 3BVPA 4CZ2A 3R5KA 3ZKWB 4TZKA 1V5EA 5LDDC 1CY1A 4DLRA 5KHOC 4KYVA 4IX1A 2GILA 5FWXA 2DHRA 5SYAA 1YAJA 2Q4TA 4UE6A 3A36A 2VDPB 3EMKA 2GJ8A 3VYVA 1HL3A 1RC1A 1YRHA 4TQGA 4IIDA 1CP3A 2W4QA 2W71A 3A28A 1YIAA 4X20A 4NEQA 4AXXA 1LDEA 4RWZA 3OLVA 4ZVOA 5CB8A 5IS2A 3Q2KA 3M81A 2NXJA 1FVXA 1ZMTA 5F1PA 3R75A 3EVTA 3ZWBA 4EUKA 3FHTA 2KW5A 1DC5A 3PZRA 1V3QE 1EGMB 5IYZA 1KP3A 4PNHA 3HL4A 1WLSA 1DFHA 3HCWA 3HCEA 3TK1A 3KE9A 4BFWA 4FUQA 4TXMA 3CISA 2XT0A 4UCWA 4DHEA 3QITA 1M0SA 3O8DA 3PS9A 3BYZA 1E2UA 4O4JA 1FX1A 1LWNA 5DW3A 4D3YA 2GDZA 2VTVA 4YAEA 4HWOA 3STYA 4KZPA 1YI8A 4WESB 5AOAA 3SQOA 5CA0F 2ZSAA 3CXRA 3SQLA 1Z0UA 1JN0A 3BIOA 1VE7A 2UVPB 2JIBA 3LPAA 5BT9A 4C0HA 4KR0A 3D81A 4C78A 4DANA 2ONCA 5KYWA 1Q0UA 1WX1A 3GIDA 2XB8A 2HA6A 5L51A 2WOOA 4X45A 1WOMA 4O08A 1D0IA 2HI0A 5DH9A 2X0EA 1N6KA 5I7OA 3NBXX 1C41A 4UFOA 4A8JC 1KI9A 2JHCA 2P2GA 3GLFE 4FGKA 3OOYA 4WY2A 1DRJA 1ZM3A 3A9CA 2IDZA 3CX8A 1W6RA 2PH5A 4J8PA 4LOKA 4KE9A 3IEMA 3S5JA 5JQGA 4LVOA 3DTVB 4MK4A 3W6NA 3R3HA 6ABPA 5LL6P 2V1UA 1IN1A 2PWZA 1RAFA 2H06A 4HRYA 4EYEA 4OQYA 2FR8A 3OTQA 3OHPA 4K1XA 1EGAA 2YWRA 4L73A 3STXA 1QSGA 3N2KB 1QUFA 3AI7A 2JIZD 1TI7A 3IL2A 8ATCA 4OK3A 2G1AA 4RX1A 3VU9B 1OX4A 2H48A 3M9WA 1NMEA 4BVEA 2IX9A 2Y6VA 2YCLA 3DEFA 3EYAA 3OQPA 5ERGB 5FIUA 2H63A 4MQ5A 3UJPA 3IV6A 1GZUA 1IZ7A 1ODSA 1E8MA 2R6HA 4RXTA 1L5ZA 3DEZA 3KBOA 3U44B 1TTPB 4QEDA 4MWEA 2P1ZA 5BNTA 3OQJA 1XDGA 2ZBFA 5ALFA 4D8UA 3M82A 2GBLC 4I50F 4ZC1A 5CTAA 3HP1A 5HKKA 1KU6A 3OF5A 1XVAA 4XFDA 5BQOA 3GEMA 1H2FA 1FYDA 4ZMBA 1Y98A 1XGKA 4S2EA 4OMUA 1R4NA 4YJHB 5F2KA 2A1IA 3R1IA 1M1UA 2O23A 4WCDA 5HRCA 3BXOA 1NUAA 4A9AA 1T5TA 3VR5A 4W8OA 4HDOB 2FPPA 3R6DA 3JV7A 2GAJA 1B74A 4RGBA 3UAXA 1C14A 2P62A 4II2A 3FWZA 3P71T 3QU7A 3GEPA 2I29A 3U37A 4Y1RA 1ZN8A 4QTZA 2KHZA 4S1PA 3DVAB 4GAEA 4PX5A 2B1RA 3LKBA 1Z06A 3CW9A 1UBOS 1SZPA 2Q1SA 4WLUA 1MENA 3TBFA 3OPVA 5KIAA 4ZOLA 3PFIA 4YJKA 3SXPA 5ECDA 5DNWA 5CBPB 1A9XA 2QU8A 1GPLA 1IMOA 4N7MA 5LZ4A 3W5IA 1OZHA 4L95C 4GT1A 5JH7B 1DQNA 4U63A 1A0OA 1QO9A 1XLTA 3ZDYB 2YH2A 1LNZA 5J1SB 3PLRA 4LQDA 3ZCSA 2GRAA 3L7BA 4KVAA 4YO7A 3T5CA 1YDMA 2C99A 2Y27A 3QPWA 4F5DA 1QH1A 1I0ZA 3I09A 1N0UA 5FPTA 3TH5A 1O96B 3T6KA 4D56A 1JQEA 1QCCA 1JAIA 1BWSA 3QSGA 3V2GA 2H2WA 2P9YA 3CFYA 4G5OA 4A1FA 4CEJB 2D7CA 3WJ1A 5AW2A 3BAFA 5JPIA 1K08A 1LJUA 1U0GA 2O8CA 3MWDA 1P0PA 1MQ9A 3R6TA 2OCKA 3R74A 1PSDA 1V11B 4YLYA 5GP1A 4F4UA 3WK9A 2F3TA 1E5VA 2H07A 4PY2A 1SURA 4DCPA 3L8MA 1X77A 2ZETA 3C3KA 1Z8HA 3KPWA 3RK0A 4IHQA 2X41A 1Y8QB 4TTVA 3M3DA 3V00A 3GLGE 4C7OB 5AM0A 4K9OA 1VKNA 4E5SA 2AOUA 1E7WA 4M55A 3HKEB 4NYMR 1EFCA 4WH0A 3X1YA 1UP7A 3R0QA 2PO7A 1DTWB 2Z1DA 5DBHX 2W0SA 3N6RA 4G0UA 1NRIA 1Y3AA 2W2QA 1Q1EA 2ODEA 1J25A 2JH8A 2RARA 2YV3A 1A98A 2BI7A 3IJRA 3MJ4A 4GQIA 4U8HA 13PKA 2B98A 1AS3A 1E1QD 1KI8A 4YAIA 3QVLA 3PGKA 4PO9A 5CPFA 1VKZA 5DGHA 4DBVO 3R23A 1GPYA 2Q50A 3ESQA 1WB6A 1PT6A 4UXHA 3VZSA 2PX8A 1EAYA 1CQPA 1Q11A 3RG8A 2Y1DA 2OHIA 1QRSA 3P9PA 4MQLA 3EZGA 2FAXA 1M76A 4MINA 1L4UA 3R7FA 1M2KA 1S8FA 3ZLTA 2BBWA 1DE0A 1XLTC 4F06A 2FF7A 4ZIRB 5JFOA 2CYBA 1DIOB 3U40A 2ECOA 1JVBA 5GJVC 3RBAA 3QW4B 3G49A 4NBVA 4G0ZA 4V0MA 2JZNA 4ZO8A 4B73A 4TRMA 2AI2A 4XX0B 1UK8A 1RYHA 2HREA 4JY7A 4RIGA 5HFAA 2NYAA 4XPIA 2PUHA 2FN9A 4UXJA 2Y0DA 1DAKA 5A9RA 1BXGB 3GLFA 16PKA 2DBVO 3PI7A 3L7CA 4TQAA 4DDWA 5BV8A 5THQA 1CKEA 4B75A 1HDXA 4LCJA 4U0KA 3OCYA 5FT9A 5LZ5A 1MGPA 4D96A 1CDZA 2IUYA 2IKSA 1IULA 1YCGA 2AJBA 2PKCA 1HNXB 1M3SA 1GCUA 1T1GA 4QBKA 8GPBA 1PV4A 2IBMA 3AXTA 4C2AA 1JDNA 1T4CA 1HZZC 1RADA 1TYBE 3S2ZA 3KZXA 1J22A 2IXEA 4X6LA 2B9VA 2CZGA 2VFAA 4HAYA 3BA1A 1E2FA 1H1LA 2X7HA 4XIJA 3WB0A 2Q5EA 1ENYA 3KVNA 2F7SA 4CM9A 5DPMA 5E9JA 4OHCA 2KB0A 4G26A 4ZEWA 4EW3A 2FPRA 1P4AA 1P4HA 2ZJ3A 4FHGA 2C7PA 2NUAB 4LMRA 2JCGA 4AZ3B 3LVQE 3ZD6A 5GJCA 5F23A 4C43A 4K9DA 1H65A 4IQGA 1Z82A 3QYFA 4RD3A 1GQFA 1H85A 3UMGA 2XUPA 3KR2A 1JVSA 2YVAA 4FOTA 4IIUA 4K05A 5FKJA 4CCAA 1D6MA 4V24A 2ABWA 2FX3A 5LP6A 2XQJA 2AKAB 2WLTA 3FCUB 4DQVA 2RBEA 3QX7A 4ZVVA 3KM0A 3PUKA 1MGOA 3R3UA 3N3AC 3SOZA 1R6TA 2ZXEA 3LS2A 4J2OA 4YWHA 4KQ6A 4YAUA 3DEYX 3RFXA 1KERA 4Y6SA 3UK0A 1KFKB 2GFIA 1YE8A 2Q1UA 1AQLA 3GGGA 4TSFA 1V1RA 1P9OA 3IDOA 3NRBA 3HDTA 4RVCA 1SA0B 3EJ6A 4CQLA 4L50A 2DTXA 1FRQA 3W8FA 1EQUA 4GVLA 2V6FA 2LDBA 1E4VA 1IY9A 4L16A 3WLEA 3MNFA 5E6UB 5DNAA 1KEZA 3BKXA 3BDAA 3T1HB 4F8YA 4NRDA 1WV1A 4RTMA 1AZWA 3LTEA 4MROA 2PTGA 1SWVA 5B2FA 5LQCA 3UATA 3QFHA 5K0EA 5BPFA 1RMTA 4V0LA 1Q1NA 3FYUA 3R7LA 4HLUA 4V0KA 4BO8A 2JG3A 4A4DA 3TRHA 4JZYA 1RPNA 4Y2GA 5L4LA 1Q0TA 4BNHA 1PD0A 3WVNA 2IPAB 4TTTS 4YBRA 1PF7E 3ED5A 4KMOA 4Y6QA 3CLUC 1T91A 1N2SA 3G7NA 4TL6A 5ETJA 4D9CA 3WSTA 1BE0A 4QQFA 2WJ6A 1WMSA 3L07A 3AUYA 4TV8B 1I7PA 2WAMA 1NC1A 5FR1A 4G0MA 2BKLA 3PE6A 2O4CA 3QVKA 3A1TA 7REQA 3IE1A 4XWTA 2CCJA 3CNOA 3KQPA 1DO0A 3ROQA 3AZQA 4EKEA 1XHLA 3B2NA 4CIDA 4U8GA 2PSSA 2I99A 1ACJA 2XE8A 5GJWC 4IHJB 3T7JA 2PL9A 1CZUA 5AI4A 2FI1A 1YJ8A 5KCMA 1A2OA 2ZJ1A 1GQOA 1DKQA 4O33A 5B7QA 1QR6A 1AZTA 5AFSA 2X86A 3EIOA 1TC1A 4MWGA 1JKJA 3RWOA 5CFLA 1G19A 1Z8NA 2O2SA 2J9XB 4RZHA 4RMIA 3JS5A 4GRIA 4TWRA 3QU5A 1N77A 1RABA 3VNQA 1FSZA 1JG1A 2IHZA 2FZKA 5DKFA 3WRXC 2JFNA 4UE2A 5KDLA 4DT1A 3CRVA 4LZJA 2BEUB 4I8IA 1DKMA 1QDEA 3BE5A 2Q5IA 3PXEA 1NW9B 4PNEA 3WKAA 4UTOA 1MKYA 1RJFA 2ZPUA 4ZAWA 3OJFA 4J94A 5D5PA 3NHLA 2VUSA 4M38A 3QLJA 3LT1A 1UMBB 3ITKA 4GYWA 4ZV7A 3JD0A 2ZJYA 3O75A 1BX3A 4NPHA 1E9RA 2C83A 3KVRA 4CMIA 4NYIR 2B4KA 2X9QA 4L5AA 1KC1A 2VP4A 4XPZA 4R8RA 5BR4A 1E61A 4HX9A 5FFNA 3FPJA 5ISMA 1J8DA 2OORC 1PWYE 3O1JC 1DLIA 1S1CA 1I7SB 4NOJA 1Z4NA 2R7LA 4XA8A 1Y9EA 3PX2A 4B34A 4C30A 1HTTA 3KCQA 4F4FA 1NBWB 1BA2A 1YIDA 3GCWA 2X77A