2OD2A

Crystal structure of yhst2 i117f mutant bound to carba-nad+ and an acetylated h4 peptide
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
296
structure length
291
Chain Sequence
MASMSVSTASTEMSVRKIAAHMKSNPNAKVIFMVGAGISTSCGIPDFRSPGTGLYHNLARLKLPYPEAVFDVDFFQSDPLPFYTLAKELYPGNFRPSKFHYLLKLFQDKDVLKRVYTQNFDTLERQAGVKDDLIIEAHGSFAHCHCIGCGKVYPPQVFKSKLAEHPIKDFVKCDVCGELVKPAIVFFGEDLPDSFSETWLNDSEWLREKITTQQPLVIVVGTSLAVYPFASLPEEIPRKVKRVLCNLETVGDFKANKRPTDLIVHQYSDEFAEQLVEELGWQEDFEKILTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords NAD-dependent deacetylase HST2
publication title Structural basis for nicotinamide inhibition and base exchange in sir2 enzymes.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 94
structure length 291
sequence length 296
ec nomenclature ec 3.5.1.-:
pdb deposition date 2006-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1600.10 Alpha Beta 2-Layer Sandwich SIR2/SIRT2 'Small Domain' SIR2/SIRT2 'Small Domain' 2od2A02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 2od2A01
2EZ9A 4V1CA 2WVHA 3FLMA 2EZTA 5D7NA 3FZNA 2WVAA 4UTRA 1Q1AA 5MFPA 3RIYA 1V5FA 4RJKA 1D4OA 4K9OA 4UU8A 3EA4A 2IHVA 5IMSA 4O8ZA 1S5PA 2QQGA 2QQFA 4D5EA 4K9KA 4GPEA 4RJJA 4MPRA 1T9DA 3RIGA 5EJ4A 3JWPA 2H4FA 4JD5A 3JR3A 4JUBA 4RJIA 2FR8C 1EFVA 2WVGA 1E3TA 5K6RA 1YNOA 2UZ1A 2Q5JA 4FZ3A 4IG9A 1MCZA 3F6EX 4FEEA 4UTVA 4Y6LA 1UPCA 1PTJC 2PGNA 4UTXA 4BUZA 4F4UA 4GM0A 1QPBA 5EJ9A 2PGOA 2EZUA 4JT8A 5EJ7A 4JUDX 4ZZIA 4V1CI 4JT9A 4X3OA 1T9BA 4K9PA 1PO7A 1POXA 4RMIA 4UU7A 1Q17A 2NYRA 2IHTA 4COKA 3CF4G 1POWA 4Q9DA 3F6BX 4GM4A 4BVGA 4HD8A 3CLTD 4JUCA 2Q5QA 1PI3A 2VBIA 2OD2A 1YHZA 4K9MA 2FSVC 4QELA 1BFDA 4MQ5A 4BN4A 3PKIA 5K2OA 2EZ4A 2JIBA 4BV3A 4BVHA 2JI6A 4MPJA 2H2DA 2H59A 2PANA 1N0HA 2Q29A 3ZG6A 4JU9A 1O97D 2A1TR 4L3OA 3U31A 4FVTA 4C7BA 5BWNA 3PDHA 2VK4A 1PVDA 2B4YA 1UPBA 4V1CB 2V3WA 1M2JA 1Q14A 2OORC 2JI8A 2NXWA 4JUFA 3LQ1A 3FSJX 1ZPDA 3K35A 4RMGA 1YI0A 5DGTA 4BN5A 1S7GA 4I5IA 5K6TA 2Q5OA 4MZXA 1YBHA 5EJ8A 4BV2A 4K9NA 4MPPA 1OZHA 4QPZA 1OZGA 2JLCA 5FYQA 1PYDA 4GM1A 1U31A 4J16C 4KXQA 1T9CA 4IF6A 1U2GC 1Y9DA 1Z8NA 5FEMA 5DGDA 2VK8A 1PNQA 2H4JA 2IHUA 3PKJA 3CLRD 1U28C 2OD9A 3EYAA 2AG0A 3IAEA 4R8MA 3E9YA 4BVFA 3OE1A 3ZGOA 3GLSA 2H4HA 3CLSD 1DJLA 1SZDA 1NM5C 2H2FA 5MGNA 2FRDC 2AG1A 1YC5A 5EJ5A 5MF6A 4J1TC 4BVEA 4C78A 1V5EA 4Y6OA 2BRUC 3U3DA 2VBFA 4UUBA 5MFZA 4KGDA 2JLAA 1U2DC 1UPAA 4RMHA 1HZZC 2C31A 2DJIA 5BWOA 1ICIA 2Q5LA 3GLTA 3D4BA 2Q27A 4G1CA 1M2HA 2EZ8A 4F56A 1YI1A 4Y6QA 2HJHA 2FN3A 1YC2A 4JSRA 1Q6ZA 1OZFA 1MA3A 4IAOA 4JU8A 4ZP1A 4L2IA 1M2GA 1M2KA 1XLTC 4K9LA 3EY9A 1PNOA 4HDAA 2VBGA 2VK1A 4GP9A 3IAFA 4GG1A 4K9QA 1O96B 1PT9A 1YHYA 1OVMA 2H2GA 4UUAA 2Q28A 4D5GA 2UZ1B 4JUAA 1YTLA 2JI7A 3D81A 1V5GA 2A1UA 3ZGVA 4KPUA 1T9AA 1SZCA 3CLUD 2VJYA 1JSCA 4BVBA 2OO5C 2W93A 2OD7A 4TWJA 3GLUA 5K3SA 3GLRA 2X7JA 5AHKA 1EFPA 4UTNA 4FEGA 2FWNA 1M2NA 2H2IA 5EJ6A 4UTZA 5DEIA 3D7KA 5EJAA 4X3PA 4QQ8A 3HWX1 4RMJA 2JI9A 4TWIA 5EJMA 5BWLA 1J8FA 3HWWA 2H2HA
chains in the Genus database with same CATH superfamily
4CKWA 3GJZA 1QCZA 2D1TA 1BOFA 5KQMA 3V3KA 1AXEA 4ADSG 3JQDA 3D7RA 1RZUA 3WL6A 1EVJA 2P9EA 2W2MA 2ZK7A 4B3HA 5IASA 1C7ZA 2YFQA 2IPNA 3O83A 3VMMA 4E5VA 4FHGA 1PWZA 3MS7A 1FU8A 4WY5A 5DFAA 5LC1A 3R7WB 1QLJA 1SNYA 3H9GA 2ZIAA 1RC8A 1MXFA 3MT8A 4BRWA 2XZDA 1DKPA 3U13A 1BXGA 3T5DA 3BMOB 3DNPA 1GQFA 1R15A 3GFQA 4OHPA 2WICA 1V5FA 2HOQA 3CURA 3PRYA 5DW0A 4B0PA 1OH7A 1E3JA 4KPYA 4Q1VA 3D2CA 1HDRA 4RJLA 2COEA 4ZCIA 5BV8A 4DV7B 2O7VA 1PQYA 4AXXA 5SZJA 3O94A 3CB2A 3U60B 1P72A 3CS3A 3KYIB 1JHOA 1NW4A 1EHIA 2O5RA 3A25A 2X2OA 3OT4A 3UGQA 3LWZA 4XX1A 1UR5A 4L9WA 3WGKA 3IULA 3ZVNA 4LWZA 2Q3CA 4BTVA 3H9CA 3WIUA 1Z7WA 4KRXA 1Z75A 3VSDA 4HVLA 1PQUA 5EI5A 4G0WA 2HLPA 1T1IA 3BTUA 4D80A 1Z13A 3GEIA 2BUBA 5JVDF 3KJXA 1OHHD 3W9SA 2WTBA 1IPHA 1FX1A 2OZKA 3HKEA 3ZNQA 4BMDA 3RYIB 1B0AA 3HSSA 3SN6A 1HTWA 1ZSVA 4W82A 4RC9A 1RPZA 3DB1A 3FNEA 2GN8A 4OMCA 1UK9A 4KNYA 3CVUA 1O57A 5ISMA 1YVRA 4L7VA 3CZMA 2PVCA 3ANLA 5CURA 3KJGA 3D6FA 1KEVA 2FPGB 2P1DA 4IIVA 4FEEA 4BP9A 2E9SA 2IEBA 5H16A 3RUEA 2R3SA 1T1RA 2PJUA 3DV0B 4BZPA 5L51A 1MX1A 4QVIA 4P9NA 4DILA 1XRSB 4QYWA 1JTFA 4LHZA 2KI5A 1ZZGA 2Y0DA 1R4MA 4YMIA 3EA5A 2IV2X 3V42A 3R75A 1PP4A 1L4NA 2M1XA 3EGWA 4PIVA 4YASA 5CA0F 4WKOA 3NXKA 4XW2A 1OX4B 2NWQA 2QX4A 1QYDA 1YVDA 2V7EA 4B8YA 2R5FA 5D87A 1XNGA 4FGUA 4UASA 4HNTA 1QHHA 1JFFB 1KNXA 4JI7B 4PN3A 2GNOA 3KG2A 1NF3A 5AW9A 4NBVA 3GWZA 1CUXA 3J81A 1ACLA 1Y3AA 2ZBPA 4Z0HO 1GGNA 3ICOA 1X74A 3JVEA 1VDMA 4H2DA 3H86A 2QT0A 1HDXA 1OKKD 4Y2SA 1F51E 4AMZA 2IYVA 3K0KA 1YD7A 1JTVA 4MLZA 2PSHA 3AEXA 2GK4A 1Y4AE 3FFBA 1J07A 2C7RA 3KKZA 3O8QA 4BJHB 1QTRA 4YFYA 2OGTA 2G1PA 1TIKA 3KHKA 4BMCA 1JKMA 3U9SA 3QJYA 2GAIA 5DISB 1K97A 1WF6A 4JWKA 3VVMA 1VI6A 3WE7A 3LHIA 1JWAB 1PX0A 3B1KA 4IYRA 5FTKA 5KC9A 2AGVA 3DQZA 2X8JA 1KOGA 1KI7A 1AKUA 5FX2A 1Z2OX 1ZC4A 3UA4A 4AG5A 2VTEA 1OA0A 1JDVA 1KEEB 1NE2A 3GRPA 4K8OA 3CKKA 4NYIQ 4R2HA 5GJCA 3VNAA 4LZAA 3VISA 1EX9A 4L9AA 2YDXA 4UVIA 3N0XA 2X0RA 1E6WA 3USCS 3O2QB 2XVMA 5JANA 1MO4A 2QPOA 3QE4A 5EIOA 4EK9A 4DXHA 1EZ4A 2CJXA 1ZEMA 1T6ZA 2EP7A 2J3JA 3BCUA 3WFZA 4CLRB 5JI3E 2IZ5A 3QY9A 4Q3EA 4FD2A 1LU9A 4UBIA 4EARA 3O1JC 1O77A 3C98A 5AM3A 5ESRA 1KQ3A 1N9KA 2I8LA 4MGHA 5A3JA 4N41A 3VUEA 3Q87B 1M1NB 3PFWO 4FGLA 4XASA 1T9GR 4W9MC 3GGGA 3JV7A 3USES 4YRIA 2YZ2A 3S2SA 1XFDA 1E6MA 1DKMA 2XB8A 1NZFA 5AKZA 4CEJA 1NN5A 4IQGA 1UK6A 2AW5A 2SKDA 3PNPA 3CVOA 4M53A 4BV3A 3K09C 3KVNA 4XQCA 5A7HA 2HKIA 3IOBA 3RR2A 5ALNA 2IE0A 4M0CA 4JODA 5EWJA 3EARA 5JYEA 2ZWVA 3MRXA 4ALIA 1H9CA 2J48A 2EV9A 1C7EA 1T8UA 1G21E 3MGAA 1E1CB 1GPLA 4HS4A 1QP4A 5AESA 3H2YA 1GZ6A 1KY4A 1BROA 1KXJA 2PANA 5F5NA 4B32A 4ZVVA 4DV6B 2QVZX 3L4EA 4L5BA 1HEYA 3DL0A 4PO8A 1JBEA 2GEKA 2PBLA 1E3WA 4G56A 3W4IA 2WWWA 4F4DA 4ISBA 4QLBA 5JS7A 1T35A 3AGPA 4WZBB 1ESEA 1C9YA 2PX8A 1N57A 4ZDKA 3RRMA 4MHSA 4UHHA 5L3ZA 4JLNA 3Q7PA 1UODA 3NBUA 2CB0A 3BD7A 2QJRA 1XVVA 4YV0A 4L7QA 4HK4A 1HG0A 1X1QA 3QXCA 3HJUA 4YJ3B 3L8YA 1U7WA 3OZTA 2ZJYA 1M0SA 3VOSA 5GTDA 1WPXA 2PAAA 5DCUA 1EDEA 3N7TA 3N2EA 1M83A 4RYDA 1ISPA 4MW7A 4H7EA 3NHZA 4UVEA 3X0DA 4RJTA 1OB2A 3H7AA 1KWKA 1XRJA 3NDBB 2NNWB 4GNKA 2WF5A 3RG2A 4RHTA 1R6TA 4Y6GB 1LK0A 3QWHA 3ZK8A 1ODFA 5E9JA 3BB1A 1FNMA 1FYDA 1BX0A 3D3WA 3FNBA 4C89A 4F91B 3JQPA 2IY7A 5EIHA 4TL7A 2HLDD 1FU7A 4L28A 5DWDA 3TIGA 2YVQA 4BTLA 3WMGA 2AFIB 4H7FA 1Y48E 3K1ZA 1IBSA 3CSUA 4OI4A 3ZKAA 2XA1A 2ZP1A 4OIFA 4AMVA 5JI2E 2PO7A 4W9NC 3U26A 3PE3A 4RF3A 4OLAA 2CUZA 4MMYB 1SIOA 4OK5A 1IDN1 4I5IA 5HCUA 2I65A 4GGOA 1FK8A 4QBIA 2IEDA 4V2UA 3KNZA 2O9JA 4CMCA 2FOLA 3QPDA 3O6VA 4B79A 2B8WA 1P2TA 1W88A 2L17A 4KAAA 5I9BA 1H2FA 4OHFA 2PX0A 2V98A 5EP3A 1CD5A 1ECGA 1V47A 3SI7A 4I5EA 1W46A 1N25A 4YVFA 1UDXA 3CRNA 4LIPD 4BP8A 2GEBA 4C76A 1YFJA 4TTPA 2ZUEA 4K1XA 1KFJB 5J58A 4HDQB 3YASA 1CUZA 4RPIA 4JOBA 2JLCA 3A6DA 5ADWA 4LG1A 4HYTA 3I5XA 3NOQA 3UYLA 2A92A 3QVGA 2K6GA 4GM1A 2FAXA 1GAQA 2O3TA 3K9WA 4Y0AA 1QTNA 4ON9A 3ZE9A 1NPTO 2O06A 4JDUA 4FWTA 5IC6A 2H29A 1S6YA 2WSSA 3PQ5A 5K09A 3GVIA 4OQZA 5COBA 4AF7A 1G2IA 3RVKA 4TZTA 2RGWA 4BNMA 1AIPA 3OCCA 1JQBA 2N1BA 2VK8A 1FMJA 1W8DA 4Q3CA 9MHTA 1U8ZA 4JJ4A 2YRWA 2BD0A 1FA9A 4RD6A 1YGPA 1JR3A 4N48A 1I2CA 5KC8A 4FC7A 4CV0A 3DHYA 4BLVA 4JBHA 1WKVA 4R7ZA 4CM8A 1DIRA 5IJAA 4YMUA 1Q0UA 1O9BA 2C9CA 2WAYA 3BWCA 3LK7A 2QRHA 1B3RA 4LYHA 3S2UA 2OMEA 1QJ4A 3DOHA 3L07A 4BBJA 3GGSA 4ESOA 5M7EA 3QKIA 4UBLA 1U9CA 4XLLA 2XT9A 2ZB2A 3ADKA 2YY6A 4P83A 4S1NA 1C0EA 1IC6A 2RHHA 4IIJB 4QUBA 2ECOA 4ILKA 3J81k 2OXFA 2W6MA 1LS1A 3R5JA 1E9RA 4S1TA 3A4MA 5KDLA 3F98A 3JALB 5E7IA 2L18A 3Q3VA 2VKQA 4FDUA 5CHEA 1QG2A 3NI2A 2TMYA 2JFXA 4KCGA 4U00A 3D2BA 1J22A 5TMEA 5KX5B 5E38A 3VYUB 2Q2QA 2BHLA 3DCJA 3NJ8A 3THRA 3UC9A 5JAMA 5CBPA 2GJ4A 1WMFA 4TKUB 4XDYA 3T5PA 2IW3A 1JDJA 4Q24A 3LQ2A 1Y7TA 4O0LA 1G8AA 5EJ5A 3HR4A 4X71A 2QRLA 3OZWA 2V96A 4YP7A 1ZL0A 2VUHB 5EY5B 5EIBC 2HT1A 3TE6A 4C78A 2B4RO 1AUPA 3L6DA 4WXYB 4PSDA 1E6CA 2QW1A 3R6DA 5AJWA 3RU3A 1M5TA 1QFYA 1PX2A 2PXHA 1YK0A 2C1XA 2Q9UA 3C5HA 4XD7D 3A10A 3RVOA 5EHZA 1M76A 2UVPA 2R8BA 3DD1A 1EK6A 1N2BA 2O07A 2VWQA 2ZYTX 4K40A 2D5AA 4PW0A 1OLSB 4ZV4A 4IUDS 3NBFA 5CX4A 5TX7A 3RJMA 2YWGA 3O7MA 4Y9SA 4UNPA 2IZ0A 4BNLA 3FTNA 5B3KA 3N2YA 2QLMA 1NHGA 1T9GS 1RAHA 2GPSA 4OK6A 4TLLB 5E9QA 4Y2TA 2EBFX 4OQEA 5B6PA 2Z98A 4UD2A 4BN0A 1N7HA 4EYKA 1VRCA 4KWIA 5SY4A 5FH9A 1K86A 3G8YA 2JJ8A 2WR8A 4XB1A 3RJTA 1S0UA 5ARDA 2X5NA 3WMXA 5FNVA 5L6LB 1HETA 3IKJA 1IHOA 3SDBA 1J7JA 2GXUA 4R2XA 2R8ZA 4UCFA 3Q15C 1V2GA 1BCSB 1NI5A 2BC9A 2I4RA 3O7WA 5HE8A 1ORRA 5HF8A 3U49A 2G0TA 1DZ3A 1QO0A 3O4HA 3LO5A 3TMAA 1O6FA 4ARUA 4DLSA 3Q3GE 1Y6FA 2I34A 2PFKA 4RLQA 1DCKA 1VLHA 4IIDA 3KKQA 5H9VA 1J8DA 2FG7C 3A1FA 3W3AD 1E63A 1K3FA 1HFEL 1IOZA 1QZUA 2R97A 3LHSA 4Y98A 2P4EA 1YZQA 4MV8A 3IOCA 4NL4H 4OSPA 4O4JF 1E77A 3NOVA 5EKUA 3A70A 2FPPB 3T4EA 2DQZA 3ZDQA 4EZEA 2J6IA 2WFMA 1BWQA 1K2WA 1RE1A 2RONA 1PDVA 1U7ZA 1QSGA 4BQSA 3WSVA 4NEGA 3OF5A 1Z2EA 4V0KA 1JQKA 4DV0B 1N3LA 1DQYA 1XN1A 1XNJA 2JGLA 4AJOA 1ZRNA 2O8DB 1E8MA 3JAKA 3DMRA 3KXPA 3EMDA 1GG5A 5K0GA 3HBAA 1NYRA 1EBBA 2X8WA 1AO0A 2ZYWX 2XB9A 3I6YA 2C95A 2JKYA 4GT1A 1QZZA 4HH3C 4I9UA 4L6AA 4JOCA 5FKJA 3MYYA 2C42A 3DDUA 5EE0A 3I4CA 3ZE6A 4R71A 4MRMA 1X38A 3CUUA 2EQBA 3PUVA 2OZVA 3ZXYA 4TSFA 3CR8A 1UXIA 3C8MA 4KLAA 4X65B 2LE0A 3MWDB 3GN2A 3BC1A 4UUAA 1NVTA 2XUDA 2BF7A 4N4AA 2ZYAA 4DQKA 4B81A 4QEKA 1P2BA 3E7DA 3SGLA 2IWHA 2C57A 5JBQA 2ERYA 4PAQA 2PVPA 4WA8A 1YTLA 3NHUA 3OM8A 3E22A 5FPPA 5DN6D 1Z6GA 5E1MA 1QGOA 1F5NA 5BSMA 1R74A 3P2JA 4GLLA 4OXNA 2O2JA 4MVJG 4R31A 4FGKA 3I42A 4Z7NB 1IM5A 5AYVA 2ZS8A 3FRIA 3NAQA 1Q74A 1ZNZA 3QFHA 4RSMA 1X92A 4MR7B 1P6QA 1SU8A 1M3SA 1P5ZB 2ZIGA 3O73A 4TWJA 1XXHE 2PLWA 1K0UA 2Q9BA 4BB5A 1GUBA 3HUUA 2DLCX 3GLRA 4XRRA 5A0FA 5IYZF 3ZY2A 4L74A 1FJ2A 1EFPA 4Z53A 1K89A 4Q5IA 1I01A 3FYHA 1UBFA 3OQ1A 4M4SA 3NWBA 1KERA 3BM5A 2OT3B 4X1KA 3SBEA 3BMXA 2VYCA 3BBPA 5AO9A 1J0CA 1DXQA 1KAEA 1U0JA 4I50F 2XVAA 4XIGS 2F90A 1IJBA 4QFMA 3ILHA 1AH2A 1SVSA 5E0OA 1F5SA 1U2RA 2C4WA 1JSXA 3G9ZA 4I2VA 4JB2A 4RVOA 2I6XA 1J0XO 2UDPA 3KD3A 3SXPA 5K3EA 4TL8A 1OIXA 3MN1A 1Z4LA 2N42A 1PL6A 2RGEA 2ZJ6A 3DONA 2ZRFA 3GZ4A 4Q7MB 5G4LA 3WGTA 3HWX1 3JQ8B 2AG8A 1N92A 3FWKA 1NXVA 3OECA 4DV5B 4TN1A 1GSHA 5ALMA 2Y1EA 3QP9A 4LJAA 2DETA 2QGZA 1T4MA 2YJ5A 1MX5A 4YECA 4US2R 4GE3A 2ZBVA 4R54A 3UK7A 1ZA2A 2ZWOA 4G1UC 4RWEA 3L01A 4EPVA 4PN7A 2C1ZA 4OGLA 4ZXPA 2FPRA 3H5AA 4NJMB 4TS3A 3PNMA 3THWB 4DTIA 4EYOA 5FEUA 4PLCA 4YRPA 3K6JA 4MJ7A 2P6UA 1H6CA 1V71A 3C6MA 5ECWA 3PPWA 2POCA 1KU0A 1T2NA 1DXHA 2DY0A 3NBXX 1KDPA 5EVCA 1UJ2A 2UKDA 1LV8A 4GVXA 4HMQA 10MHA 1QS0A 2ZW9A 5IABA 4JI8B 2EJBA 4ER7A 3C6XA 4WACA 2C94A 2WVHA 3VHRA 1V8OA 3QEOA 3FUUA 3KSBC 221PA 1AQYA 5C53B 3SIXA 2UYYA 3EVBA 1XCOA 3D7SA 4WJKB 3FUCA 2PMDA 1H2HA 2WVAA 4MR9B 2GQ0A 5FFNA 4N0MA 1UM9A 1NUAA 2YXPX 2FE1A 4D43A 5HJ5A 2R68A 2VS1A 3FWNA 4HDNB 2ZI4A 1QHGA 1KVQA 3P20A 4P84A 5B55A 2ETVA 3HXLA 5A9TA 3K4QA 3UZUA 3AEKA 1C29B 1NBOA 1SC1A 4D9GA 2CHGA 3U56A 5FI1B 1I14A 2CFCA 1AZSC 4AJPA 4GXQA 4K87A 5K8JB 1UXJA 5CGQB 3N9IA 2DBQA 4KV7A 4RTSA 1W5FA 4BCCA 3HABA 5FAKA 5E6RB 2YNMD 3KKMA 3TZHA 3QF7A 4RV5A 3U7GA 1NPDA 1TQHA 2XY4A 3EZYA 3L8CA 4OOFA 4PX2A 3EIQA 3BWMA 1HKHA 4FBGA 5AJTA 5REQA 3U09A 4K6MA 4LY9A 2VNHA 1X1BA 4G1FA 3LW7A 1WHSA 2ZSUA 1GFIA 2GYVA 3ZCUA 1Z4OA 3DVLA 4HYEA 2CD7A 2DFNA 2G17A 2WIFA 4W5RA 1FFDA 1WPQA 1OFGA 1YRQA 2NO1A 3KYDB 1IPFA 4O2BA 3ZV5A 4F72A 4QJ3A 5IX8A 2JHAA 3IUNA 1EFVA 1YS6A 4MPDA 1XVLA 4KU4A 4UM9B 1MX9A 2ZRGA 2ODNA 3ZV7A 2AZMA 2AYXA 1N2XA 1I7DA 4Q9JA 1DO2A 2G8NA 1TMGE 1DOAA 4JVOA 3BJEA 2REBA 2VDWA 3SZGA 4D26A 3JQFC 5KDOA 5DNAA 2XAAA 3M6FA 1HZZA 3BQNB 2CZQA 4HZGA 3SVZA 3MFYA 4JJFA 5IZCC 2EAUA 3C3JA 2I03A 4AVYA 3PS9A 3B3AA 1C0LA 3A4VA 4HUQB 4EATA 3PC4A 4CLDA 3S1AB 1K6XA 1S3SA 2IXBA 1DJQA 1FSGA 1TECE 1WHTB 5CU7A 5BURA 3S8YA 1U2QA 1YJQA 2RC5A 2YWCA 3Q2IA 3CRMA 5EJ2A 2VNSA 5JY6A 4KP7A 2D54A 3ANTA 4M21A 4MYTA 2QX8A 1PQWA 1XCLA 2WM9B 3BS4A 3LL4A 3NBYC 1EZZA 5CB4F 4BP3A 2FDCA 5HHTA 1JHVA 2ID9A 3CWZA 1ENZA 4TV8A 2BEVA 2XV1A 2DP4E 4RK4A 3ZV3A 4A6PA 3AMVA 1KZGB 1L5HB 3NRBA 3NPAA 4UATA 5TRTA 1THTA 4AKTA 4DCVA 1P7CA 4FOSA 1LC0A 5EEGA 1QH9A 5LOVF 3P2KA 1J8VA 4HNQA 2VATA 1HDYA 2H4ZA 2EFJA 3LCCA 3T4UA 1MC5A 2ZRIA 4ND4A 3W2IA 2AZXA 2GVNA 1JAYA 3LDAA 2W58A 1ZUIA 3PUWA 4J76A 3RS5A 4YT2A 2OP1A 1S3FA 3KEGA 1CCWA 4LHVA 5LYJB 1YZYA 1GXSB 4ZCQA 4A7PA 4UU7A 5G1NA 1AGRA 1OI2A 3W2HA 4OMDA 3C7CB 2CCJA 2EL7A 4PGFA 1AN9A 3HP4A 3QPBA 3UATA 1E9FA 1US8B 3U4DA 3EG9A 5EE5B 1J4AA 2BEJA 2UUPA 4LRTB 1HNNA 4TRJA 4ZU6X 5JVDB 4M0FA 5AR1A 3LUDA 4JVSB 4MSUA 4RPJA 4BMYA 4D97A 1PNRA 2XWSA 1PKXA 1P7PA 4UTOA 3L7IA 2QUBA 3V2IA 1NXWA 4JP2A 1W1IA 4JLUA 3KX2A 4GM4A 3IPCA 1P7YA 2OM2A 4OQNA 1K27A 1G6KA 3IUEA 4JUCA 1QGED 5LB2A 5TEWA 4R8LA 4REQA 4IIUA 3GX1A 3TTSA 4YMLA 2NTJA 1W0KD 2ZBRA 1SVWA 2I3GA 1HX7A 3BHNA 1U0NA 3I8XA 3I8SA 1V6SA 2PEZA 2VNIA 3NGMA 1FPQA 4K9MA 4O1MA 3SIPA 3AHFA 4CRWB 5HQ3B 5C8YB 1M8FA 4WY2A 5LIRA 4KO8A 2MR6A 3CZCA 1DQZA 1P18A 4GW3A 5ICCA 1DKOA 3C24A 1I94B 3IVRA 1NBME 3ECSA 4G9BA 1WVMA 5IDVA 3CMCO 1ORIA 3NIBA 4RY0A 2ERXA 2FP4B 3EODA 4S12A 1YWGO 3UMRA 1TGYA 2RHLA 1UDWA 3N86A 2V03A 4OHKA 4WLOA 1RXIA 3OT5A 1UFVA 5AOBA 5HKOA 1CJBA 3H4VA 4A9AA 3A6ZA 1PL7A 2OCPA 3KT6A 4BO0A 2XUPA 1UJ5A 1H23A 1QOZA 2JGEA 3ZNNA 3DWFA 4GRAA 1LSUA 3ZIUA 1T1JA 3N2GA 3T1TA 3VU1A 1XDDA 5DV9A 3WG9A 3B89A 3SKYA 2FETA 3QEJA 4M89A 3F5MA 4MEJA 3MINB 4CQLB 4CYMA 4F8EA 4NI5A 2NTVA 5FWXA 3GNQA 3KKEA 3CNBA 5HNKA 2C03A 5I5GA 3L7OA 1TQ2A 4MYHA 5DM4A 2C58A 4OY3A 4GMHA 3KE8A 4ALJA 4X8MA 3RWOA 3NC1C 4LXIA 3PC6A 3IH5A 1Y3FE 4ENUA 5FADA 5T67A 3TZKA 1PQPA 4BKUA 2B25A 5B1YA 4P7GA 3H8WA 1OLUA 3AKDA 4CG1A 2E1PA 3V33A 1E1RD 1I3OA 4QUEA 3KLOA 3F7NA 4OCZA 4U9IS 4GQIA 3WLAA 4BKPA 2XT6A 3A1WA 4ZVSA 4BB0A 4Z3DA 4V1CB 1H22A 3K8ZA 5CB0A 3HY3A 4MUFA 4CMIA 2QTBA 1TA9A 2JIDA 1HL7A 2PXCA 4Q7LA 3W1VA 2B30A 3MJVA 4X62B 2WYOA 1ZD2P 2EXXA 4LHSA 2PX4A 3QWFA 3TLJA 3V6LA 2XOKD 5DI3A 5BT9A 4UJ5A 3UAWA 4LRSB 5LDHA 1PJ2A 3LUCA 3M4ZA 4R2LA 5G4KB 1U2EA 3T4XA 3TK1A 4LTNA 3TR6A 3WVNA 4D3SA 1SA0B 3HRHA 4KKXB 5DYYA 1QX4A 4X92A 4ZVOA 4NJEB 4BZWA 2BTEA 3ADDA 4DCSA 1RM0A 1H0RA 3SC4A 5G3ZA 3ST7A 2IXDA 1H9BA 5IBCA 2IX9A 3D3KA 5ADHA 4MTCA 1YASA 5ER9A 4AIIA 2QMOA 5F1PA 1CZRA 1KVSA 4JI5B 3MUOA 1RRFA 3IIEA 3WS7A 5BVHA 1YZFA 4QPJC 1IPEA 1IAQA 1PJLA 1KRHA 1DG1G 2P3QA 4CDMA 1K63A 2VDJA 4NV1A 1OH5A 4EHBA 3IDZA 2Q6KA 2BGLA 2GWHA 4EOGA 2QQEA 1J7KA 3D8NA 3OU6A 2AUNA 2EQAA 4B3MB 5I9IA 2QN6A 1KYWA 1EFRD 2I1VB 4G1EB 3SC6A 1GTSA 2XMDA 3C41J 1Z7YA 4KQ1A 1LV7A 2EP5A 2OBYA 2I2BA 2F67A 4FKBA 4GR9A 4KXXA 5DLYA 3DP9A 5FBLB 2GJAA 1H66A 5BP7A 5AP9A 3UAZA 4MCJA 1ZM7A 1KO5A 2PKWA 4H7DA 1VHTA 1I4LD 1FRFS 1T5IA 2P65A 4GU5A 4I3GA 3EQ8A 3OICA 1EDOA 3K5PA 5D85A 1IZ0A 3WA6A 1DINA 1O6ZA 4E1AA 5JNWA 2Y9PB 3R20A 3V1KA 2O2XA 3F71A 5L7WA 1BS9A 1XF9A 2H00A 4H60A 4H1HA 4O2RA 3NTLA 3QA9A 4NIMA 3MTJA 2XQGA 5J1TB 3I1JA 2OXIA 1QQAA 1OMOA 1W4CA 4ENTA 4G07A 3LQ4A 3FPJA 3H87A 1MX3A 4K9DA 5DTJA 2XRZA 1QNFA 2J3QA 3GWGA 1T0BA 4JLKA 1X80A 4LXGA 2XWPA 4YV1A 5KEIA 1SFRA 4H35A 4I1YA 1M74A 2QY9A 4FKMA 5DCYA 1A8QA 3DBLA 4LHWA 3RWBA 3KSDO 4AS2A 1SULA 4YO8A 2GF2A 1BVRA 4O8CA 121PA 4TVSA 2Z9DA 3CCFA 3GAAA 5G0WA 1WLSA 1XCPA 2H4HA 4JHXA 3AM3A 3U3MA 3KV3O 2CB9A 5E7MA 2VDKB 2PNJA 3T3HA 4C01A 4BGUA 4FEYA 1NM5C 2XGOA 2OHOA 4P80A 1TM3E 3OE7A 1U7TA 4PBTA 3MTEA 5HR5A 3AP1A 4ZHQA 3RIXA 2HEIA 3TGWA 4DARA 4EFDA 1WMAA 3WK5A 3SHQA 4ENRA 1RHJA 5AVZA 4ZI2A 2Q2OA 1C1XA 1RP7A 3IPYA 4M2LA 5FUYA 5TDHA 4CGYA 1I3LA 3OFNA 3BGVA 3AOGA 3UKDA 3N2LA 5DT2A 2P6MA 5FOTA 4EM6A 4J1TC 5IVKA 3UYKA 2HSGA 1DKUA 1AHHA 2O8EB 1B8OA 1IB0A 1GR0A 3EWIA 4R6WA 3FSRA 1GCIA 4N18A 5DASA 4FILA 3A9VA 5I6DA 5HUJA 3FYUA 4NCAA 1D1SA 1O4WA 5AHOA 4FLEA 3NYIA 2JEOA 3CVJA 3QEMA 4RHCA 3RNOA 2YVUA 3SXJA 5BSKA 2DQKA 3GLFA 1ZGGA 2C7OA 2WU0A 4MDFA 1FUIA 3NDRA 3UJPA 5IBRA 3SLKA 5ESXA 4LFCB 1M2FA 3VRHA 1GITA 1Z2CA 2ZYDA 3IMEA 1UMKA 2Z3ZA 3PGA1 4UNRA 3CIFA 1NJFA 1YDEA 3QFSA 3W05A 2FQWA 1VE1A 5BY2A 1GHTA 4XM1A 5DMHA 4DANA 1ODJA 4E4RA 4UARA 2W2VA 3QLUA 2XMQA 1BCRB 5TT0A 3RS2A 2A9OA 1UKEA 6REQB 2H17A 4JQCA 1SCBA 1T25A 4WBNA 2JLUA 1XTVA 1I2ZA 1GEEA 4G1CA 3RC7A 3MSCA 5AOAA 2IFTA 2FPOA 1OILA 3I61A 2PQ2A 3LUPA 1RACA 3OURA 4E2WA 3JAWA 2I2FA 4CKCA 1L5NA 3OG9A 1VPTA 2JFGA 2YC2C 1YR7A 5FJJA 1I5EA 1BE8A 3L0IB 4HYQA 5J2TF 3VNQA 3ZBQA 1GN8A 3SMVA 1J1ZA 3JQGB 2V9PA 1AQNA 4NCXA 4HQNA 1Q6ZA 4LJ5A 4GXNA 4B33A 3RSGA 3BK2A 3OJOA 2ZIXA 1P2VA 4TQGA 3T9BA 1OXVA 1NSYA 4H08A 3TN7A 2YIMA 1JHYA 1XLTC 3KQYA 4UU0A 1PG5A 1E8NA 1XMIA 2DFDA 5DHSA 4NSNA 1XXLA 5EIWA 3RRXA 4U3JB 2B98A 5F9MA 4ALLA 1D9XA 4E21A 1M8KA 4HL6A 3U7HB 1TO1E 1SUSA 3TJRA 4A0QA 3DE5X 2QN1A 4QBTA 4G4SP 1G8MA 1OI3A 3PR1A 4TOIA 1W76A 1U5AA 2ROQA 1ZC3A 1U0FA 5EHIA 4YJGA 2MTBA 3PB3A 2JK1A 2NG1A 1X19A 4HDKB 2FW7A 2X6TA 1BO6A 2A9FA 1GFZA 2AX4A 1BXKA 3HXOA 1O3YA 1OI7A 2EDAA 2NUAA 3OKAA 2R62A 2Y0CA 2JGIA 3D7MA 5EIAA 1EHYA 1BX3A 2WQZA 3N2IA 1N2HA 2W48A 4JUIA 4CEHB 4D46A 4QUAA 4J7CA 2YZKA 3M5PA 2V6MA 2ZJ0A 1IK4A 3CE9A 3IQGX 4DJDC 2CWWA 5EXDA 2J9FA 2J8ZA 3ENKA 4PGHA 3EUFA 3CLUD 1THZA 3I32A 3H6GA 1SD1A 4V3CA 1A71A 3L6EA 2Z57A 2GCGA 4QRDA 2XWJI 4ZVPA 3GJ8A 5F3WB 3AU9A 2QM8A 2GCIA 2KS6A 3QVVA 2PCJA 4I9NA 2VZ0A 3N2KA 1TJ5A 2EIXA 3KSZO 1CJCA 4IDAA 4E5SA 4URHA 3NG1A 4GGPA 2ZLBA 3GOHA 4BATA 2CNLA 3RRNA 3G5AA 3G9TA 4WLFA 4FE7A 2JFQA 4QATA 4YT4A 5BUSA 5CA1B 4RVFA 2FWNA 4YIHA 5HWSA 1M2NA 4Y30A 1Q1ZA 2QQ5A 3LUGA 2WPNA 4HJRA 4JQZA 5G0SA 3SOZA 1R1DA 3PQ8A 5C80A 2QE7D 1TPYA 2QNBA 3KBBA 4O4JB 5A7GA 3D5TA 2B7CA 3WIVA 1MQ8B 1P9OA 1PR0A 2GD1O 2JLVA 4WBXC 3I5AA 7GPBA 2IYUA 3EGIA 1MAAA 5DEIA 4PYNA 1TVMA 1KA9H 1VB3A 1E2GA 3MF4A 2OXTA 3FOZA 2TSYB 4WFQA 3C97A 2WF7A 2NU6A 3O2SB 5EQFA 2G7MC 1JPJA 1ZOSA 2OLJA 5LR6A 1T1EA 4KMSA 3Q72A 4JY7A 2I4TA 3BMCB 3PRJA 1T4CA 5CYOA 3G5TA 2O7SA 1OFUA 2HNBA 3BD8A 1KYTA 3FCXA 3RYTC 2AN9A 4C04A 4NDNE 1HNZB 4L1KA 3ENNA 4EUNA 1VG1A 2J32A 2ZIEA 4EI9A 4GZ5A 4J16A 1T4DA 3DAGA 4Y6PA 1DAKA 5EJMA 1SCAA 3EQ6A 3TL3A 5T3YA 1XKXA 8OHMA 5LMZA 4NBKA 1D1QA 4YAEA 2P2CA 3JQCA 2NO4A 3QPVA 4IFEA 3TFQA 4W5NA 3AEQA 3FPAA 4QOEA 2ODPA 3HMKA 3P9IA 1PJAA 3MAAC 2R1TA 4OYLA 5FUMA 1IXKA 1E0SA 2H1OA 1MAVA 2GERA 3R2JA 3GOQA 5L3SB 1RQNA 1RXUA 2RHOA 3COVA 3HJRA 3R24A 3W8RA 2WQ7A 3BAFA 2I9PA 4J91A 5BNFA 1GSIA 2O1EA 4BNVA 4DIFA 4EF6A 3HLYA 3LLCA 1N0VC 3ELUA 2QX9A 4HEQA 4I2NA 1AZLA 2D2IA 4BTEA 4DSNA 1NVMB 1U7UA 3E4CA 3H4TA 2QS9A 5BV2P 2Q07A 1F12A 1FBNA 3EEFA 5H68A 3TIIA 3UANA 2OESA 4DF3A 4ER0A 4B3SB 4CV2A 3I8OA 2R7NA 2W6NA 1B2RA 4UZFA 4A4DA 1ZBDA 5IMSA 5FWYB 3FPGA 1VE6A 8AT1A 2YXBA 3C3PA 3FI0A 2TECE 3N0TA 1UOEA 2JJ2D 5AKYA 3V8RA 2ZM5A 5DGCA 2FW0A 5T8KA 2VEDA 2QQFA 2EBWA 5CDGA 1VA5A 1QWSA 5DHPA 2CBZA 4C0JA 4I50B 3SF8B 3I1YA 4Z4IA 4HNGA 2N47A 3GJSA 3H6HA 1JA1A 2V6GA 4DLXA 5BMVB 4L4YA 4MS1B 4NE2A 2ZUSA 4DDHA 1EGHA 3TRIA 3WMEA 5JFTA 2GCEA 1R8QA 3EPKA 4MCIA 1JR4A 4B2IA 4L6CA 3QFTA 1GNPA 2HREA 2Q7DA 2VHWA 1E1LA 3OUUA 4H9GA 4YAUA 1SVIA 3MUNA 3MW8A 1NQ5A 2LKDA 2V45A 4DM4A 1YRAA 2M1ZA 4ZPXA 3IDOA 3WWEA 2JIPA 1BA3A 3AY6A 3KCNA 2ZCJA 1ZY2A 3KPJA 1M0EA 3V7WA 3IP9A 1TD9A 1HMPA 5DYIA 1NA5A 2OFOA 3M0EA 3H2IA 4RGYA 4A73A 3KZMA 4TKZA 5HRCA 4II2A 4FC6A 2ID4A 2NZVG 3GG9A 521PA 4CCAA 1C50A 4AY3A 4FW9A 4FIZA 2HK7A 3TRKA 1U2SA 3UFBA 4A10A 5JT1A 4ABTA 1TJPB 4J0HA 4W1RA 2Q2VA 4IYJA 1RHRA 2R8PA 3UMSA 1PK7A 1XZEA 1FNDA 2QV7A 1GCOA 1NU8A 2YMPA 5EP2A 4BMSA 2XTMA 3G2MA 5LZ2A 4L2IB 3DT9A 5K4HA 5FUBA 1UC8A 4IOLA 1KZHA 3X2FA 3QBEA 4E03A 4JUDX 3WGMA 1JPUA 2WUGA 2PWZA 1CY2A 3BAZA 1JG1A 1FXWF 4H77A 5DCLA 3BWBA 4F97A 2FW9A 3NTRA 2PZBA 3EVFA 4ZZ1A 2AJCA 4BKMA 4W5TA 3E5NA 5EZYA 5JS1A 4IKOA 2WHRA 4AZVA 2IUSA 1NFQA 4Q15A 2R44A 5CFOA 1PK9A 2AS0A 2R5NA 5LBTA 4KQHA 4YRZA 5K8CA 1RI5A 1ZAKA 1W2GA 3RGGA 1ABFA 4ALNA 3N59A 4DWWA 2QMEA 2I78A 5KYWB 2LR0A 2H7YA 4N82A 2H3EA 3UBMA 3PXGA 4PNEA 1M6VA 3IAM1 4NU8X 3F0TA 3SJ7A 4GOXA 4DAEA 5DNCA 3ASVA 1YCDA 3FPSA 1XAHA 1P8AA 1T3ZA 1T9HA 1CE8A 4ODIA 5CYFA 2WU8A 4AU1A 4EHLA 1R16A 4C6HA 2HA5A 4EDHA 4DMRA 1W47A 3IJPA 1B1CA 3A6JA 4EGJA 1E4EA 5D3KA 1EH5A 1X2EA 4RTKA 1Y98A 2H1HA 4Z99A 2BFBA 4BFVA 4CJXA 2CLDX 1WSAA 3BA6A 1YMQA 2GHQA 1QBKC 4ZEWA 3KJIA 3B1JA 1EJBA 1IOLA 4MCAA 2BE9A 4M37A 2B1RA 2AMYA 1YRYE 4V2IA 5AKEA 2Y0EA 3EZ9A 5DIZA 4XLTA 1OUMA 2CXUA 3ROKA 4PONA 1QP0A 4DXAA 2PUWA 1SEVA 3LP6A 3KQHA 2OD2A 1FFWA 3KWJA 13PKA 1E5TA 5D86A 5HG0A 1DEOA 3L40A 5DYTA 5KSPA 3UNXA 3WNQA 1K9VF 5L7TA 1PW5A 4BN4A 2OC9A 3ID6C 5A71A 2R9VA 3FRJA 1RRVA 1YZNA 3OCZA 3KZVA 3PL5A 4GPTA 3ZDXB 4J2HA 3GAZA 1PLLA 1YU6A 2FZ5A 2HRRA 5ICSA 2OK7A 3CFYA 1DC4A 4J49A 4BFYA 1CF2O 5AD1A 3GG2A 4QREA 3IRUA 2IK8A 1JAZA 5KYTA 2AIRA 2IUFA 2FR1A 4RQTA 4CQLA 4CE6A 5INTA 4B7AA 3T3DA 4KI0A 2R47A 2GVZC 5ICMA 3QX7A 5JG7A 4N54A 5DSXA 4C1NA 1X1DA 1R6UA 2VP0A 1E2DA 3HVIA 3OAAD 1CDZA 4G4SO 4XR9A 3TSOA 2IUYA 4LGMA 4MTLA 1RWPA 3JZAA 4KXYA 5DOZA 2XDQB 5D84A 4LX0A 5AK4A 2D2VA 3IPXA 3DMHA 4LWOA 5CPFA 3UK2A 1YFZA 5JCJD 1SQ6A 5KYXA 3QSGA 5LOVB 2B8NA 2Q1TA 4DYDA 2CMGA 4R2KA 3ZWXA 1T0HB 5JTUA 1DI0A 3P96A 3BKXA 2PWAA 5BT8A 4R51A 2YIVX 3NIWA 4JXKA 3W5DA 2WJ4A 5JADA 3QU2A 4ND5A 1A2QA 1QFZA 4QPDA 4EVSA 4LYAA 4U4AA 1VLVA 3HM9A 2O8CA 3CRRA 4WK6A 3JASA 2DPXA 2GYUA 4N12A 4P38A 2GXAA 3H17A 2B78A 1PVDA 1Z62A 3IQIX 2BGJA 2HCTA 4GI7A 4KC0A 4M88A 4CKWB 1GTG1 5IK2D 3T0FA 2HR1A 2NXJA 1U99A 4UXHA 1NN3A 1WUKS 3GZNA 1P77A 3BZWA 3EVTA 4H4DA 4PWZA 1OBVA 2CVPA 3LC0A 1VECA 3SQLA 4FXPA 5LWHA 2NZJA 4D56A 5DNEA 3KVVA 4CKZA 3TSZA 3IB6A 4CKEA 1JMYA 2XNKA 4BWFB 2JAUA 3ER8A 2W2KA 3ERCA 3E3LA 3Q11A 5FA6A 5BSHA 3VFDA 1BXGB 2X8LA 3KB2A 5ALGA 5GONA 1G55A 1QVRA 2O0LA 2CLKB 2WIGA 3QUQA 4L8LA 1BW9B 4J9UE 4PRLA 4BMXA 1ZPDA 1P4SA 1D4FA 1U65A 2OMKA 4NG5A 3FTCA 4DCCA 4F4HA 2PRIA 3K35A 3ELWA 2EF0A 4LE0A 3STYA 3C43A 4YT8A 4BO4A 1XWWA 1CXZA 3IIIA 3LH5A 4ZV7A 3KPVA 4NARA 5BWCA 3CVXA 1CJMA 3KUUA 4ZVTA 3SR4A 1Z33A 5H5JA 1IN7A 1RS0A 1C9KA 4LPKA 5HZMA 2CW5A 2O05A 5J4KA 1GCAA 1NFFA 1AUOA 5AMXA 3HH8A 3KJFA 1EAMA 3TQOA 3BK1A 4AWBA 4AKEA 4EVIA 4OIMA 4NMLA 3R9XA 3L41A 5EJ8A 1S2GA 3VZSA 2QZSA 4MJLA 3MXTA 1S4QA 4BCBA 2ZZMA 1QFXA 4F85A 4BPBA 5IN5A 3BH6A 1NNUA 3ZHCA 4F6CA 4Y2PA 3ORSA 1G6OA 2RMKA 5BQOA 5C31A 1XHFA 2YMQA 1MVOA 1WU8A 3LCJA 1FSPA 2GKGA 5K5EA 3CF4A 4KO2S 1VMAA 5CD1A 4HGQA 2JJMA 3RPEA 3SS8A 4FR0A 1HZJA 4NVRA 1CUFA 2BI7A 3BVPA 5DXFA 3VDNB 1JIKA 1YQDA 1ZOLA 2J0UB 1JSRA 1NNSA 3FUVA 3ONWA 5DH9A 4Z51A 4IXTA 3UJBA 4EKDA 1EXDA 3QIVA 4MUYA 3SFVA 2P7HA 1GIAA 3ULKA 5ITSA 3F6YA 3BDIA 5I4BA 4O6VA 1IYZA 1QHHB 1N5DA 4ZCMA 5KI6A 4BO2A 2D4AA 1ZRHA 3IERA 2J3DA 2BVNA 4CT0A 1GRRA 2OV8A 3CY6A 2IC5A 1M34A 4JJZA 5IFKA 2PUGA 2WYUA 2O2GA 2PH5A 4B6PA 5E2IA 5DNYB 1CY0A 1BS1A 2BGUA 1U3FA 2BE7A 3GUHA 3NJ4A 5DXAA 3EZ6A 2O2YA 1XL0A 2RBEA 2YWXA 5FUXA 2P9TA 1H9AA 3AR6A 3GCGA 3W2TA 5ELLA 1T3GA 5CFRA 2RHBA 4EKYA 2MSDB 3O8QB 1K2VN 2X1VA 1DTSA 4TWZA 1LBTA 2X2FA 721PA 4LFBB 3OZAA 2VEOA 3P2IA 4QUJA 1P3DA 1Z34A 1CP3A 1YJ8A 1I33A 2BP7A 3U80A 2QVCA 4FFOA 4AL4A 4DLRA 3N7AA 5U4XA 1JHRA 1N6RA 1QR6A 1HV8A 2PGIA 2VP5A 3OEED 4HDSA 5BPHA 1LVGA 2Z5GA 1EZ1A 4KDCA 1HEUA 4M9RA 1D2AA 4AY2A 4ZTZB 4BEWA 1QCYA 4URVR 1QVVA 1XTQA 3D3EA 2PH1A 3D2LA 1U0EA 4RF2A 2R751 3QKRA 2J9RA 4BNDB 5PGMA 1DE0A 2IITA 1X0VA 4F12A 2YZNA 2C54A 4HQ6A 4MW5A 2P4QA 1E7MA 1WW8A 3MWKA 4KGDA 4Z4EA 3FVTA 2VUSA 1T9ZA 2QTFA 5I01A 2WJPA 3NBZC 1USKA 2GUGA 5DW3A 2E5LB 1EP9A 1NX9A 1TAUA 1PYGA 2XWBF 3COSA 4ZT2A 3RRBA 2PV0A 4LJSA 4ASUA 4HV4A 1UBTS 2B69A 2B99A 1ZSYA 1T8TA 3NVDA 4DSZA 3NDIA 2E6UX 4NOKA 5AKJA 5JCOA 1UDRA 1PDOA 3NANA 3FBGA 3JQ7B 1G16A 1O7JA 4LMAA 1PJBA 2Q5LA 3KDSE 1MXHA 4XVHA 4BQRA 3G0BA 4WQMA 2YASA 5D3QA 5FBWB 3H5NA 3W5JA 4XVUA 2BJWA 5I7EA 1C14A 1V9SA 5KQLA 2ZGVA 3UGKA 3Q1KA 2AFRA 4MB2A 2B8JA 1DTEA 5EWJB 3DT8A 3VZDA 2AEFA 4EPXA 1YC2A 4JLBA 5HTKA 1XEWX 4B2YA 5M2QA 2YRFA 4BVKA 3TLAA 1LVUA 3TX2A 2F1OA 4ICIA 4BYMA 3DBRA 2GBGA 2CD9A 4IL5A 4K0KB 3N5CA 5ED0A 1MA3A 5KVVA 1LNZA 3VM6A 4ZYWA 3BIJA 4L73A 2N75A 3AEYA 3DYVA 1QK5A 4OJNA 1OXTA 1ZLXA 4DR5B 2V6BA 2XZLA 1E3WB 1UXGA 4IIHA 2CT8A 2DPYA 1ZN7A 2HA0A 3HCNA 3PSHA 1P8JA 2QUKA 1PL0A 4QHYA 3WYEA 2VK1A 3SM3A 4XEHA 1CG6A 5HJ2A 3LSTA 4W5QA 3GVHA 4GG1A 5CDUA 2YN2A 4JLJA 1QCCA 3CHYA 3I34X 1VCNA 3OJFA 4K9RA 3FW1A 4PLTA 1E8DA 3DVAA 3LUKA 1ADYA 2AKYA 2HPZA 1UPTA 1OYVA 1U9IA 3CC8A 5CGZA 1BDHA 3P0FA 1TZCA 4N8DA 1G2OA 2QI9F 4X64B 3MB8A 4RZ3A 4CUZA 1ZKMA 1LY1A 2BMDA 4K0RA 4R1UA 3RHZA 3BJRA 4XWOA 3FN4A 2AUMA 2PSEA 1C3VA 2ZRJA 3HFGA 1O6BA 3LWBA 2ATCA 2Y1GA 2I1LA 3V7NA 2VTDA 1TA0A 2X41A 1ZI6A 3TAXA 4ALMA 3LIIA 2C9YA 3FMFA 3M2TA 3OPNA 3CUKA 2FZKA 3GUUA 4TS9A 4CMGA 2GCOB 4IEEA 1RJWA 3O9MA 2FMTA 1O97C 2KLBA 4LC1A 3EWSA 1JL3A 4BQIA 2GLTA 2XT0A 1C7JA 3I2GA 1P4JA 3WAGA 3T1OA 3O9ZA 4ZIRB 3IUJA 4BKRA 2UUAB 1O8BA 2OORA 3IP6A 4EQ6B 1SUEA 3KSUA 3EGEA 4KHZA 1MB3A 4R4JA 3V3TA 3DVQX 5FXMA 1E1MA 2XDYA 2XI4A 3GGJA 3OOJA 1NMYA 5DJ5A 3W2EA 2DQSA 3FUWA 4AJ1A 2G4VA 3IMGA 1G7RA 4MGYR 4WXHA 3LCVB 4ZQIA 2WLTA 2FZCA 3NFYA 2G0AA 2C2ZA 3GJ6A 3HE3A 2WMNB 4MYCA 4PS0A 3DF9A 5AHXA 2F1KA 3LYUA 2ILVA 3EOBI 4Y9TA 4XRGA 2PSFA 2P8SA 2QY6A 5J2TB 4QFDA 5KOIA 3O3NB 1NQAO 2JIQA 3DCIA 3K1AA 4TRMA 4D74A 4MV3A 5CT4A 1YMUA 2V6IA 4DLTA 2C7GA 4CODB 3KQNA 1BOOA 1RVV1 5J40A 3ZD9A 4BNKA 3S2GA 1Y6QA 3G0DA 3LLMA 2XYHA 4MYSA 3LLUA 2MSLA 2VUUA 4LHYA 1NN0A 2IE8A 2PZFA 3QVGB 1T0JB 2B1QA 3PNSA 4EMBA 4X91A 4XB2A 2L42A 3IP8A 4I5FA 1PCXA 3N6RA 3AOEA 5EXTA 1U1GA 2Y93A 1KAHA 3TTWA 3ZJVA 2JI9A 3NKFA 4GFDA 3MCWA 4OBXA 1ESCA 2E2WA 3C7KA 4BQOA 3GPLA 3V34A 2WSSD 5K51A 6CHYA 1F9AA 4BZXA 2ZAYA 3QLEA 3JWJA 3ZV6A 3WHPA 1YA4A 3DV2A 1NG1A 3HCWA 2ACKA 2RB4A 1JI0A 3EZ2A 4RQAA 2JLXA 1ILEA 1E98A 2OYSA 4HGRA 3TTUA 1CS0A 1A8HA 1BE1A 1G8KA 1P4AA 2BM1A 2DT5A 1AHIA 1ZBQA 2JGNA 4GSKA 4MVJP 1CQJB 3RFXA 3RS7A 3GFPA 1A5TA 4R3UC 1U1FA 1W0JA 3OLXA 3OESA 4OMFG 3UM9A 1L4HA 2I7CA 1A4RA 3ILSA 1A9RA 3PXDA 4Q21A 1BD3A 4QDOA 2WM3A 4C08A 2PUAA 4JV5B 2YOGA 3MJCA 4DLAA 1S7CA 1X7WA 4CHGA 3SLRA 1PV4A 3UN1A 3Q7SA 4NABA 4QVKA 2ZUCA 3TTVA 1R5OA 1UINA 3BJIC 3U9LA 3PI6A 2XAUA 2YTZA 4M36A 2VZEA 3JD1A 2CVQA 4HXGA 5EE9A 2XTAA 4ZVKA 5JMPA 1Q1AA 3KWLA 4PBRA 1Z0AA 1TYDE 3T7RA 5CCXA 2HBZA 4JZKA 1Z8DA 2DF8A 3OFKA 1WD7A 2ZR9A 3WRXA 1QANA 4ZCRA 1RU3A 1BHO1 5CD9A 2OZLA 3HBNA 5IG2A 5CBKA 3X1DA 4GKBA 2D7JA 1E18A 2BUAA 1RBMA 2ZZKA 3CA8A 4BB6A 4MNTA 2HIAA 3SJAA 3TM5A 4HHEA 2OV3A 1T9KA 4HVAA 5G41A 1H2AS 1RM5A 1Z8HA 3ORHA 5L40A 3KQMA 3PDWA 4US0R 1GYPA 3T7SA 3M4YA 1BQ4A 4X7BA 2A9QA 4P93A 1T9DA 3WB1A 3QI7A 3NTXA 4G4JA 4GKVA 4FM9A 1XGKA 3DDCA 2J6BA 5EJ4A 1PFYA 1Z17A 4RELA 5CFLA 3L7BA 1F1JA 3AG5A 2UUCB 4QSHA 4DABA 1YZUA 1JIUA 3I62A 2H8KA 4RAOA 1LRJA 1NLYA 1P1HA 3GU3A 3Q9SA 3LECA 2DWCA 2PCLA 2WINI 4M3NA 4U6SA 4C4OA 4I4TA 5K8IA 2BLNA 3DUFA 3FETA 3KVRA 2B37A 4I08A 1W35A 4N6GA 1WR8A 3DC2A 4K5QA 4AJ2A 5FNVB 2XOEA 1SKBA 4Q93A 4QUDA 5A3SA 1XEAA 4HGZA 3RARA 2C59A 3QVSA 1ODCA 3IS3A 3KU1A 4O0MA 1M8GA 4D3DA 2WJIA 4CLXA 2O3QA 3MOGA 2H1IA 1F4VA 1Z63A 3U40A 4E33A 4HPWA 1QO0D 5ALWA 5CVTA 1QM5A 1C5KA 4DADA 1KEPA 1DARA 4E4YA 4IMJB 4ZEVA 1WCWA 1D9ZA 1AMUA 1ISFA 1T0PA 3LBHA 4JP5A 2IRWA 1KPHA 2ZIZA 1QRSA 2E5FA 2O59A 1VE5A 1W44A 4U2CA 4DAOA 2ZSHA 1TPZA 1FFGA 2ACEA 3VDQA 3TNJA 3PD7A 1CNFA 2WAOA 5FPTA 1Y7HA 4ZRNA 4EPRA 1QHSA 4IJVA 1LJUA 4U8GA 5ALVA 3B48A 1W6UA 1HDZA 4DA6A 4L9RA 1XLWA 5J4YA 2PZKA 2VOJA 3BSWA 4B4KA 1II8A 3TNFA 3U61B 4HTFA 3DMTA 1RJ9B 3JAKB 4MARA 2F8SA 3QRWA 3KZKA 2Q46A 2C5LA 1QIEA 2AC7A 2HPVA 3DZBA 4K9PA 4N49A 3UAVA 1VIMA 4JBLA 2BGGA 1TCBA 4EG8A 3T61A 5BV7A 5LNK1 4R9SA 2G4CA 2KSQA 4FHCA 1BXZA 4MAAA 3U4CA 4M0MA 4E09A 1IZYA 1UKYA 2D5BA 1DAGA 3CTMA 3L1JA 4RVDA 3OEWA 1G38A 4JGBA 5E4TA 1HQYE 1I80A 2I2XB 3NUGA 3ZCQA 4JBNA 1I24A 4GGMX 3RYCA 5EGNA 5AM5A 4B3DA 5IUJC 1A9SA 1FDIA 4D7AA 1GLGA 1Y5LA 3R0VA 4JFAA 5K3FB 3B12A 2YOFA 4G5XA 3CMMA 2NYAA 4ZVQA 4GMXA 1I3CA 2AN4A 3OQVA 4PYQA 2BDEA 2NYRA 2BKEA 5TGDA 3F9RA 5FPYA 1AKWA 5BRAA 2GZRA 3H7IA 5A4FS 4BFTA 4M60A 2BFMA 3QKUA 5EE3A 2G71A 1Y3DE 3K0SA 1KMQA 3OPVA 3F67A 4ITVA 1WCIB 4XI9A 3STVA 3RBXA 4XJVA 1B6GA 1CUUA 3OE4A 4XYMA 2K87A 4ABYA 1E9DA 4C9BA 2HB6A 3PEYA 2OHHA 2Z95A 4RA9A 4YALA 3KO8A 2HK9A 3MJRA 4DFDA 5IWAB 2BGKA 2F4NA 5LMCA 4OAOA 1LW6E 4PM4A 1VE7A 2FHSA 5LZ8A 4JC0A 4AFNA 1R5JA 1EFPB 4ZOLF 4BMOB 5L4LA 3FLEA 4WJLA 3GUZA 3S1SA 1Z5PA 3QMMA 1LA2A 2EG5A 4JI2B 2LNDA 4X1KB 1PBNA 2QDKA 2EZ4A 3UHOA 3NDJA 1HRKA 4FYHA 5H7XA 1ZOIA 1ORWA 3FNIA 5M3BA 4CVNA 1W4BA 3FDXA 4YQYA 4G5HA 3QIAA 1QC5B 3E05A 3HEBA 2PRSA 4BVHA 2B61A 4DNQA 4XWWA 4NS4A 2F55A 4BXOA 5T4EA 4O5OA 2ZRNA 3R77A 3F5QA 2XUAA 2CMHA 4EMUA 2H2DA 5C52B 1K8RA 1XTTA 3DZGA 4JJ6A 5KSZA 1EWQA 5HGXA 1YBMA 2J45A 5KTRA 1G4AE 1PSWA 5JRJA 1LB1B 2GM9A 2O23A 1YO6A 4IHJA 1SG9A 1X7HA 4MS3B 5K3BA 4ND6A 1LPPA 3B20A 2IPXA 1DEHA 1K7FB 2P9GA 3I4FA 3UEOA 5AM2A 4ND2A 3KDAA 1F2UA 3OJLA 4Q1FA 4CM6A 1Y6JA 5ALKA 2MINA 2I91A 1JE1A 3WLLA 1QDUA 3WQBA 1JYEA 1XRQA 4PZZA 5J9FA 2AI3A 1V4BA 4EA9A 5BNZA 5JSHA 1ZKDA 3DDOA 4IFIA 1O95C 5DBHX 2O1SA 2WTMA 1U7OA 1YB1A 3K9GA 3U17A 3UJ8A 3RTGA 3RABA 3AF6A 2H2WA 4BLWA 4U7FA 5BWNA 3CH6A 4K6KA 3NDPA 4CMHA 4EJ6A 3FGOA 1THGA 3TLGA 3VU9A 2X7XA 3G6KA 3DQPA 4BBAA 4M8SA 1E0KA 4AO8A 3R6GA 3HXTA 3DL7A 3COYA 5FOSA 1BXRA 1ZI8A 2PWPA 3PVZA 4BIMA 5THKA 3QE0A 5A4KA 5IT4A 1D6SA 1DTWB 5LKAA 1W85A 2JD0A 4L85A 3ZKWB 4CUKA 2GTIA 3S55A 1TKAA 1B4DA 3P0RA 4W7SA 3ZGYA 2OCGA 1EP3B 4J6FA 4ZJUA 1UJCA 2X1LA 3DLBA 4JX8A 3LKVA 4U7GA 5F2NA 1UM9B 1A9PA 3U3KA 3I58A 1P6UA 5IXJA 1I13A 5HMMA 3EH2A 2DPHA 3M6MD 4LBZA 4IRXA 4FWIB 1Q3KA 3FCAA 1P5RA 3IJ5A 2XH8A 3GD7A 3TDMA 3ZGLA 2C5AA 2DGDA 2VI5A 1V7QA 3TQQA 3ZY3A 4AO6A 2B2NA 4CMEC 3A3NA 1H6AA 2EL9A 1DIBA 3FGPA 1H69A 1G8GA 2M6RA 4P32A 4R5HA 2Q2NA 3RQIA 3UV6A 4BN5A 4IW3B 3BEDA 3ZBTA 1S7GA 1GZ4A 2A4KA 3LM8A 4RSGA 1SHTX 3UPTA 1EEXB 2DYKA 5ES4B 2QYTA 1T5HX 1M2OB 1F2VA 2R7LA 5REQB 4BGEA 4IZHA 1U7PA 3ETCA 2G7ZA 3HN7A 3P4XA 4WEQA 1CB0A 5EUMA 1XXHA 1ECJA 2EJWA 1MO2A 1OC2A 4D9NA 2FPLA 3U5TA 3B78A 1EEHA 4CBVA 1ABEA 2AG5A 3IT3A 1BE0A 2WWYA 2A59A 1ZX1A 2HZ7A 2Q6TA 4YP0A 2R6AA 1Q0LA 2R86A 3DKVA 3IAM6 4G23A 1CNMA 1QVZA 1D03A 3PQCA 4R05A 3WP1B 4U6NA 5D3MA 1XD2A 4CU2A 4IQ8A 3S68A 5EP4A 1IJKA 5CLHA 5F76A 2V7VA 3AONB 4BAGA 4DLYA 1P62B 4KXQA 4B2PA 3DBVO 2G67A 1QYRA 4HQFA 3THYA 1YB6A 1F7VA 2DB3A 1WMBA 3KB8A 3R5XA 3RIHA 2EFDB 3INNA 2QAJA 3M81A 1LVHA 4MJ3A 4DR1B 3GELA 1JEOA 1QUEA 2BMAA 1O6CA 2C3UA 3AB8A 5ED4A 2X0NA 1SC3A 3TCXB 4LRYA 4WZAE 1WV1A 3DOFA 3H05A 4MGKR 2IHUA 1MAHA 4LY6A 3CU5A 4BE4A 2GOYA 3A26A 3WLRA 2UAGA 4ILEA 1NF2A 1OWPA 1K66A 2CBGA 2P5UA 3GGOA 4IJUA 3U0VA 3R3SA 4XTCS 4TV8B 2BEVB 3TD2A 5IH3A 2JD1A 3JQAB 4XLZA 1EIWA 1G1MA 1NVDA 3MWJA 5L3QA 1JG3A 2ECQA 1G5TA 4YGYA 1SZDA 2DFLA 2CYBA 2G77B 4YRSA 2XMPA 1MC1A 2YV4A 2INGX 2ZITA 1EGVB 4KAFA 2HJGA 3GDOA 4XCXA 5DHQA 5C8VA 3GCDA 3PDCA 2FQ1A 3IVGA 2Z4TA 1NW8A 4N8EA 2IUUA 2YS6A 4LK3A 1YC5A 4BY9E 1KQGA 2YWBA 1J2YA 4M8KA 1Z6YA 5K01A 3EBPA 3F3SA 2J09A 3IC5A 3Q6IA 5ALEA 4A8TA 2CDCA 3QYFA 3ZGNA 1EVIA 1Z2DA 1PFGA 4DRZA 4XQGA 5LMUB 1ZGCA 2Z6UA 1DZIA 1PSDA 1YDMA 2D8MA 3ZZNA 4UBJA 3QELA 3AL0C 5C7IO 2MWMA 1EB9A 1U3CA 1LBEA 4G1VA 4NTZA 4UUQA 2EYQA 3A3PA 2X15A 3G49A 1Z6ZA 2CXQA 3D4LA 3FBWA 4HNRA 3EGCA 1XQYA 1MW9X 1A97A 2BJHA 4IGKA 5C5EA 2JLWA 4HN4B 1CR1A 1FTQA 1L0BA 2QTLA 4TXNA 3RW9A 3ZCVA 2PMFA 3R9KA 3HJBA 2XCTB 3IKTA 2FOIA 1XZBA 1FW8A 1U2DC 4YMHA 2FE4A 2AV6A 2RAUA 5TB5A 3P97A 4N3CA 1KP2A 2C98A 1RRMA 2O4UX 2R00A 2WI8A 3D1LA 2R4TA 4G3XA 1HZZC 4R1TA 2OHVA 4KQWA 1KK2A 3BPSA 1OYYA 3ZY6A 2QYOA 3U4IA 1CZHA 1EFTA 1NJ2A 4JHLA 2C9BA 2PMCA 3G8AA 3GPIA 3E9CA 1KQNA 2AQ8A 1E2FA 3DH0A 4LZZA 3X43A 1XD9A 3WNCA 4TT8A 2HU5A 4E5DA 2RK6A 3HA3A 4P92A 3UQZA 3FDZB 3Q2OA 1TMOA 1ZEJA 2PUTA 4R0MA 3ZU6A 1TB4A 4BLRA 1H6DA 1UC5B 3LRTA 1AURA 3WL7A 2HXSA 3LZ6A 2Q49A 3T7DA 2W8BA 1QPGA 1E2LA 4C7OA 2NQ2C 2WWRA 3EFEA 1ANKA 2G1JA 4C5BA 4JA0A 5LU8A 2YIJA 2QRPA 3AZPA 3IE0A 4UUPA 4RTPA 3KFVA 3HKBA 1BKSB 4UM7A 5HK9A 2R8RA 1NP6A 5AT1A 1TYAE 3DR3A 3TI7A 3FVQA 3L4BC 3VKHA 2AYYA 1X77A 5AI8A 2YWFA 5TPZA 3NNNA 2WFAA 3F46A 4RCYA 1SQ0A 4JR2A 2XLBA 5FWXB 2OBLA 3W5SA 1IIBA 1V7CA 4YDHB 1XAJA 2RARA 2YHSA 1XPRA 4XFKA 4NKRA 1SC6A 2Q6LA 3M70A 1Z4KA 1YBFA 2J31A 3OUTA 4ZV9A 4QFBA 2R11A 5CXSA 1IBCA 4JQOA 4Q7KA 1Y1PA 3H11B 1VSVA 3ESAA 4H4CA 1E2UA 3PNQA 3L7KA 1OLUB 2DKOA 1LPOA 2D59A 3A9TA 1E5QA 4Q48A 3STWA 4OO3A 3FB1A 3DLCA 5HKKA 1KFBB 1P19A 1UANA 1G7CA 2R4UA 2J85A 2R8YA 1GTMA 1N4DA 2JZCA 3L8ZA 2A0YA 4WLEA 1RKBA 3LY7A 3UB4A 2NZ2A 3ZI4A 4IGFA 3R4CA 4IJKA 4CMIB 4S35A 1TGVA 1A77A 3C0KA 5H1YA 5GZ3A 3E9NA 4LF8B 3HRKA 4HATA 3O0DA 1P1JA 1WG8A 3IMKA 3QPAA 4UQOA 2GPBA 4P34A 1UDBA 2DTDA 3PXUA 4ZOBA 2IELA 2EQ5A 4M9QA 1CB7A 2WP0A 2Q1WA 2EKDA 1TAHA 2ZJ2A 3BK7A 3EF1A 3KJQA 2QJOA 1PVVA 2VF2A 1TTQB 2YYZA 4A6EA 4G09A 1BWRA 2GK6A 4B3JA 2OD7A 4KGZA 2MIIA 1FNBA 4X44A 3CT4A 2QSJA 2FHPA 2FJPA 1NMEA 2X40A 2IVFA 3WO0A 4D8UA 1YR2A 1B93A 2VO1A 1UXKA 3E1GA 4H7IA 5K3SA 2X7JA 3DLTA 4UKDA 5IKOA 3RRJA 1FDRA 3NIFB 4JDPA 3W1WA 4C07A 4MP3A 2E55A 3GJQA 4DV2B 1IQRA 2RH9B 4P3NA 3C1TA 1OCEA 1HT3A 2GUWA 4GVPA 4JVNA 2XKKA 1NW5A 3DXZA 3PJEA 4RLFA 4KIFA 3HL4A 4ZZ0A 5TY0A 4DDMA 4P5EA 4OB6A 3JWIA 4G63A 1JNYA 2PUJA 2JA2A 3LY5A 1WSWA 2VAWA 1JG7A 4I14A 4LOIA 4LUCA 3RBZA 3TMKA 4ZYTA 1JMVA 2PO5A 1GWNA 3A0RB 5FBQB 4DUYB 1NBMA 4Y2XA 3PIDA 4LY0A 1E5XA 2IYRA 2CXPA 4FS8A 2Z2YA 1UJMA 1NI3A 1A7AA 3R3HA 1HPLA 5C1OA 4GLJA 1Y9AA 2XXJA 3CPSA 3MTGA 1LWOA 1ST3A 2D13A 3ACBA 4QNRA 3WY9A 1N2ZA 3LBAA 3F1KA 1W87A 2Z4RA 3KT0A 4BIIA 3HP7A 4H6PA 3K0CA 4OFZA 1HDCA 1M73E 1FQOA 4KPGA 4TYYA 1YL5A 5KMGA 2GR9A 1T2UA 4Q3NA 1TKRA 1SBIA 2ZRDA 4HWPA 1TE2A 2VAMA 3DTTA 3TVYA 4M6WA 3CH7A 5CEJA 2HJ9A 4HFJA 3WDMA 3OX4A 5BWLA 1OFHA 3GLHE 4IXNA 4JLSA 4FFNA 2R2GA 1KAQA 3AY3A 4HDMB 1V1JA 2JAPA 5D6NA 4C0HA 2RBGA 1RHQA 4UHDA 2VPIA 1B15A 3KM0A 1BKDR 2Q3DA 3X2EA 3M8KA 3AVTA 1H4TA 5B5SA 3DBLB 3G9QA 2B3DA 4L5AA 2W2TA 3OCVA 4D57A 5F1YA 4TXLA 1ILWA 2QZJA 3FZYA 1Z25A 4BQFA 2ZREA 1LQ2A 1XD8A 3HQ4O 4TPKA 3HZRA 4MA5A 2ID7A 2C2MA 5IAJA 4LV5B 5FOVA 3K0FA 5D1HA 1Y8ZA 2CDNA 2JA1A 1MDFA 4LJLA 4RAQA 3AIKA 1T43A 5FV7A 1M54A 1WOYA 2PQ6A 1L7EA 4G5SA 4IXWA 4PAOA 2GZHA 5KKCA 3OE7D 2IIVA 1USWA 1Y82A 1J2JA 1UUFA 3IAUA 3WDLA 3M5CA 3KZ1E 1SUFA 3DC7A 4J2TA 3IEIA 4C7MA 1MNAA 1P2UA 1KMHB 1SN7A 3FYTA 4MV4A 4CF6A 1IY1A 1PZGA 4JXXA 1CU1A 3OFND 2AHRA 1PFVA 1KAGA 3AR5A 4F92B 1PYOA 2ZZNA 1GTJ1 2WJZB 2NU7B 2QDXA 1RHKA 4UDNA 2ZPUA 1HSOA 3OLVA 4YT5A 3KAJA 3SC2A 2WHPA 4X7MA 2BI4A 4PGMA 4WCVA 5DBEX 5E6SA 2Y0PA 3R5FA 3WO1A 3TEFA 4D9HA 5KNBA 1N6OA 3C8UA 4XVRA 3GLFB 1U0BB 1T3SA 3A1SA 3VO9A 5J63A 3DDSA 1V8PA 3KZNA 4MLPA 3PXXA 1M6WA 2J59A 3JWPA 5TMDA 1UFQA 4QTYA 3RVLA 3HEAA 4GOMD 1PR2A 3F6CA 5CK5A 4ZVRA 2OQVA 3VBCA 4YRGA 3W2FA 4P5DA 3IVXA 4JROA 4L4ZA 3FVWA 5HM8A 1KR2A 1N2JA 3AXTA 3ZK7A 4HLNA 3VYTB 1YT5A 3IALA 4C0WA 1KVTA 3CN9A 2ATEA 4WBNB 3AVPA 4CM3A 2Q3LA 3EVEA 2QI9C 2DG2A 3IKMB 3B6IA 1N7JA 3CPEA 2EBUA 1BGXT 5UKDA 3GUCA 3RFUA 4EEKA 2P9JA 3IIJA 2OCXA 3QOYA 3JAWB 3L06A 4UTXA 3BH0A 5C46F 4CKCB 1OI4A 4C5CA 1OJLA 1AS3A 5EIFA 3U7IA 2KE5A 2R8OA 4HWTA 4QDJA 4TTSA 1HOXA 3AGQA 1Z18A 4II3A 4MR8A 4R7TA 4A23A 3RVDA 1B76A 4PS1A 5I4CA 2ZIXB 1FUYB 4KAXA 5EJ9A 1X14A 3M5WA 3ZS8A 1YU9A 1KK1A 2KM1A 5IVHA 2IS1A 1E9CA 1FFCA 2Q4TA 3OLWA 1MTOA 2FA9A 4WOJA 1EGMB 1K5HA 4JJEA 4NCIA 4A16A 2IF2A 1IWPB 5D5QA 1XZFA 4NDAA 3SD7A 4AJNA 2HYDA 4FBMA 1ZD5A 3T9DA 5J5CA 2PMEA 2QD5A 4DIDA 2QN8A 3AR2A 2QU8A 1IBLB 4N6NA 1MOPA 1YDHA 5E2AA 3VR5H 1PD0A 4E4TA 4V0ME 4CV3A 5DXJA 2OGSA 2PX2A 2Q3MA 1EVZA 2PFGA 2ZB7A 5JAHA 5JBNA 1VLLA 2W4QA 4QLAA 1C7RA 2JFFA 2JCXA 1BTOA 1EFLA 1PEKE 1DQRA 2CE2X 4NPCA 4ND8A 4QECA 4X20B 2CVOA 2JFZA 4ZOEA 5G1PA 2NUAB 5K0SA 1DIGA 1NXTA 4NCJA 5BSTA 3TE7A 4ER6A 4EUSA 3K2IA 4X1IB 4RMIA 1RE0A 1X70A 4I1VA 1P1BA 4IFTA 1ISSA 2Z8XA 1RYHA 3G6WA 4TV9F 1H8EA 3TFWA 3B13B 3A1TA 5KOYA 3W8FA 2PFSA 3EMKA 3PHBE 2F3QA 1ONSA 4KLRA 1S89A 1E7SA 3DXYA 3FJYA 4NCNA 4TL9A 3O1LA 5ETJA 3D0RA 1QP7A 1UBUS 4C87A 1IG0A 2BFAA 3BA1A 4PRYA 3TEMA 4O4HF 5L53A 1MO5A 1L8LA 3W79A 3VA7A 1VYHA 2JGDA 3Q7EA 2QGNA 4LMRA 4EMTA 3QH4A 2C7VA 1P31A 2AZTA 1H0SA 2DECA 2EFYA 2HX1A 4J9VA 4F2WA 2V1UA 3G5UA 4JL6A 3HCDA 3W6PA 3LL7A 3VH3A 2BELA 3MK31 2Q5QA 4B80A 3QHPA 2P79A 3AINA 4L3VA 3F3KA 3Q0EA 3ZHQA 2DVMA 4ETWA 4OV6B 2G5GX 5TSDA 1SVMA 2Y3IA 1Q16A 3D6JA 1A72A 3EDRA 4QELA 1QNLA 1D5WA 1KZ1A 2DH5A 3LGXA 4UBMA 5BOVA 3OQPA 1U7DA 1GQQA 2JIZA 2WSIA 1S3IA 4UTPA 2FEPA 3HCFA 4O2AF 4A26A 4NYIR 2DQ4A 3BMOA 1JEJA 2JPDA 2XNDA 1BA2A 1YRBA 2Y76A 3A1CA 3NS7A 4H7KA 4RK7A 1HE4A 4N47A 4ZJZA 4EUHA 3VC3A 3P94A 2KWIA 1E1NA 2GK7A 2QTHA 3GNTA 1RYFA 3JYNA 3NM5A 3ZW9A 4P6VF 5GV8A 5JYCA 2NYUA 1W4LA 1USUA 2BR3A 1VI5A 2C5BA 2VP6A 1IK6A 3JW8A 4PYMA 5G02A 1RI3A 2HMVA 2XUGA 1FZTA 2Z43A 4F3YA 4Y0VA 5EC8A 4Q19A 2QTMA 4GYKA 1FJXA 4G9GA 3MZ0A 5E9AA 2NU6B 3X1XA 1Z4IA 2DERA 1FZQA 1RFGE 3OPQA 1X3SA 4Y9UA 1VHJA 4FYPA 5JLAA 1EXMA 1EVEA 3ZTTA 4C0BA 1FTYA 3QU5A 3EXEB 4ZQEA 1T4CB 4TYQA 2FPSA 2G07A 1GPNA 1NATA 3AKYA 4IEFB 5ESWA 3L9XA 3B3GA 1C8LA 2GN9A 4ZO9A 2XTZA 4HNVA 4J1QA 3LW8A 4TWBA 3R7AA 3VZRA 1QU2A 4M9UA 4EI7A 1NDQA 1CQIB 1JDSA 1YR3A 3DLPX 3F2IA 4ZT3A 3WGZA 1UK7A 1H3NA 1YQUA 4LBVA 4LW8A 2ZBUA 4P3XA 1VDZA 5GZ1A 4MVXA 1DBWA 1R66A 1NXQA 1SG0A 2WILA 4BP1A 4DG5A 1CWUA 4X1OA 1R0ZA 1T4BA 3AIIA 1X1EA 4Y2VA 2QSUA 1E5LA 4WEOA 5JYBA 2NQ8A 3WDSA 2NX2A 3PQ4A 5THXA 3IIKA 3AEQB 3LX4A 2IF0A 2R1TB 3DV0A 3HR7A 3O5AA 4PTZA 3QHAA 1DB3A 3O9VA 1NGSA 1WABA 2WB2A 5EL0A 3SZOA 421PA 4FSXA 3TIVA 2HGSA 2MSCB 3G9XA 4KWTA 1HKUA 4F9GA 5C8XA 5I47A 3B1ZA 2GHTA 3JD2A 3LPDA 4I99A 4YACA 4EA7A 5C7LO 2VQEB 3AVYA 4N0QA 3II6X 2JH9A 2P11A 1OX4A 3CBGA 1PNTA 2ZRCA 2CNNA 3G0CA 3GEHA 4ND1A 1B8UA 3SDZA 5BUZA 1EESA 2J5XA 2RE8A 3K09A 3OTQA 1JFFA 1SB8A 4I9GA 3JQEA 4URYR 4CU5A 4HEA1 2PUBA 1W29A 2EF1A 2ILTA 2P3LA 1CJSA 4B3CA 4MH0R 2ZRBA 1ZCZA 3FPEA 2DBZA 5AK0A 2SNIE 4ZOLB 2PTGA 3MTDA 4WRRA 5ANRB 3UCEA 4AULA 3COWA 3SSNA 3SFTA 2A0KA 2QMZA 1DUVG 1T1GA 2XEXA 3Q7RA 4I8IA 4AP9A 3ETDA 5ABPA 5IDQA 4D25A 1PJCA 4YMGA 3W7VA 3FR8A 3TOCA 1TLTA 3T15A 2Q5OA 4U5XA 2YV2A 3H1AA 4P3YA 5JCPA 4XUCA 3PUXA 1HRDA 4A92A 1L1FA 4H1WA 4MKGA 5LNK6 1VYTA 3N70A 2EJCA 5AI5A 2P40A 1HYGA 1SQ5A 2VHZA 4Q05A 3ZZ0A 1K0FA 3RROA 3PDIA 1UF9A 4HAVA 4R8KA 1FRVA 2A0FA 2H1SA 4GBJA 1RDFA 4WN3A 1W581 1V37A 4KYIB 1J20A 1ZVKA 4R40A 4A8PA 2ZUTA 1NBEA 1LS6A 1Z12A 1IONA 1Y1LA 2BY4A 2NLOA 2QVLA 2XADA 3PT5A 4YJHB 3QY0A 4C22A 3R09A 1G59A 2I6FA 2C3MA 4P4GA 3BREA 4B4VA 1ENPA 5K3AA 1WZ2A 1PQ4A 3IA7A 4G67A 4J16C 2ZKLA 2OCBA 3RG8A 3RUIA 4Y6SA 2QL5A 3JYLA 4RLSA 4LMBA 3V9AA 3L04A 3EPLA 1YKFA 4WGGA 4HI0E 1SCQA 3S2FA 2YWRA 1RWMA 1K1EA 1PN3A 4H27A 4ES6A 5EOVA 2C92A 1JFTA 1ISGA 2NPOA 1V0JA 3A2KA 1CF4A 2IY9A 4TUYF 1ICEA 1TCAA 1G4HA 4EY4A 1M1NA 1T8RA 1HQKA 1X0XA 3SFZA 1U28C 4QA9A 1R88A 4JYBA 4IGIA 4XWKA 3P9ZA 4UXIA 5LKRA 1U2TA 4N01A 4KR3A 2JVKA 2D4HA 2WZCA 4ESHA 4W5JA 3T8YA 4B0OA 4BFCA 5IDXA 4OI1A 4NULA 1ZJ6A 4F11A 1U8AA 1ZXBA 4LQDA 5SY6A 2CMDA 3B1XA 2HLHA 4P31A 2OWEA 3WK7A 2RH8A 5KVCA 2J0SA 1EUQA 2MCFA 2RG1A 1NAIA 3LVFO 4O63O 3OKFA 4OX9Y 3MGGA 3H84A 1XMSA 3IO5A 1BRTA 3ECCA 4M0DA 3AESA 1GUAA 2W4IA 3D31A 3ENWA 3QOFA 5HKBA 2JH8A 5JNRA 4NAUA 3VPCA 1GZSA 1XJCA 1M6VB 1TT7A 2A78A 3A11A 1ADCA 1DJOA 1GT6A 3BQ9A 2Y1FA 3FVRA 2PG3A 4FNOA 1XCMA 1T36A 2QRZA 3D6UA 3LUAA 1ADBA 5JZOA 1DFIA 4UREA 4G2TA 3PHJA 1S96A 2QTZA 4ZVUA 4U9UA 2NNLD 4A2CA 1R0BA 4L15A 4B3RB 1AQUA 4HGYA 4MRVA 5TT1A 1E4EB 1MGPA 2W2OA 3RVSA 1L5ZA 4QDXA 4NZOA 2VNAA 4E46A 2BFBB 4QKQA 1CLEA 1FS5A 4Q6BA 1WA5A 4YJ3A 2PLAA 2XXBA 5E3IA 2RKOA 1FMTA 2ETXA 2YV5A 1CZUA 1O94C 3KUDA 4FKZA 1JLRA 4RA6A 1LLCA 1KDVA 5HM6A 1SVKA 1YVEI 5LWQA 1EWTA 4LBWA 1UPAA 2P6NA 2C78A 5F1KA 1NVXQ 2AEEA 1CY4A 1KEZA 3FG9A 4C88A 2CK3D 4G36A 4ZRMA 5B3JC 1U80A 2ONKA 5HUQA 3VSBA 1JMKC 3MCAA 1J2RA 1W1UA 3L18A 3SSAA 4EMSA 2V3VA 4HRVA 5CDYA 1FDTA 3HDJA 1QMGA 3K0HA 4QXOA 4G4GA 4EY7A 3HZOA 6ADHA 4MUIA 4WK0B 1RWBA 3GFTA 4TRRA 3PFNA 4N0PA 1I5RA 3L0ZA 4DTCA 3A0UA 3ZE0B 3EEYA 4Y6QA 3E84A 4TM8A 5EJFA 2PR7A 1JIXA 2P35A 1I0IA 2FN3A 2R65A 3GRFA 1V26A 3QXGA 5CYPA 3OQHA 4JSRA 1OREA 1KK3A 1N75A 3D4OA 3OEYA 2NXEA 1JALA 1I4TD 1KBZA 4Y2RA 4WZ6A 4DT1B 5TF4A 1L5SA 1KPIA 3QJ5A 1J6UA 2B5WA 2C84A 1KJNA 2FN8A 5HPYB 4HLUC 3STXA 2PSDA 1GD1O 2CHVA 5HDQA 3V8PA 1YCFA 3JVUA 4ZTBA 4HFRA 4PLWA 3E81A 5KYXB 4QU5A 2O2IA 2G9RA 1GGEA 1X8XA 3WBJA 3S0JA 5K0EA 2RHMA 1QOPB 1L5KA 4EFMA 2BWJA 4JNCA 2RSLA 1OIWA 3LK6A 1IHXA 2HA2A 1FLDA 4IRMA 4P22A 1Y4DE 4JKOA 1O9HA 3PFFA 5G1OA 4J4TA 5AI9A 5GGXA 4AECA 5C7OO 2O4CA 1BZYA 4JC5A 4F06A 3T52A 3JASB 3NH9A 4XWTA 2FYTA 2FWRA 1V9LA 3JQRA 3H5WA 2XQKA 4I6EA 3GDFA 5FF9A 5BN5A 2PBFA 3KVYA 2JKVA 4RKFA 4D0NA 5JPIA 1IRIA 2COUA 1L5WA 2XUQA 3N76A 4JQYA 4QYXA 2LWIA 3QEAZ 4LJ8A 2VYVA 1K4MA 3DW1X 3BZUA 4CKEB 3HDTA 4MV6A 4R81A 2DRIA 1BFKA 2AEJA 5KNBH 3ZI0A 3L1HA 4IHKA 3ZIAA 4EB8A 5CDFA 4KPUA 2FZGA 4M1TA 1JVSA 1RPAA 2PX6A 4XFJA 1GCGA 5FA5A 5GONB 4CIWA 5J4VA 3NASA 1P2FA 2C4UA 3ROFA 4DSTA 1JHAA 3OZXA 5JS6A 2EX0A 4IDCA 1CY6A 4D02A 1U04A 3DUWA 4WXRA 2W93A 4QOFA 5CFMA 3TQCA 4XYLA 1EUYA 2EIHA 2IYXA 3FTDA 5AUQA 3VR4A 3OTOB 3N8DA 4Z7JA 1K8YB 1VKHA 2FFHA 3P9KA 3TZEA 4EG7A 5JH7F 2NM0A 4QULA 2P2GA 3MMNA 4QTTB 5KX5A 1JG4A 2QRUA 3C8DA 2D62A 3AO0B 2ZT7A 4MV7A 4FFMA 3RTBA 1UK8A 1RPTA 5A05A 4UOQA 1HL3A 3CUTA 3PGLA 4DLUA 3T3MB 3TVTA 4ETNA 4R69A 1UDCA 1T6XA 1FP2A 1X7XA 2ZXFA 4PFKA 5TVGA 3ZQUA 4UHKA 5KOHB 3M5DA 1RVDA 2WDPA 4I5GA 5DM1A 1N5KA 4PHHA 3HVJA 4G1BA 1PLJA 4C0QC 4IM7A 3M6LA 4EJ2A 3FCUB 3N28A 4DJEC 1NJGA 4OJMX 4BYGA 3DHVA 4G8BA