2OD2A

Crystal structure of yhst2 i117f mutant bound to carba-nad+ and an acetylated h4 peptide
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
296
structure length
291
Chain Sequence
b'MASMSVSTASTEMSVRKIAAHMKSNPNAKVIFMVGAGISTSCGIPDFRSPGTGLYHNLARLKLPYPEAVFDVDFFQSDPLPFYTLAKELYPGNFRPSKFHYLLKLFQDKDVLKRVYTQNFDTLERQAGVKDDLIIEAHGSFAHCHCIGCGKVYPPQVFKSKLAEHPIKDFVKCDVCGELVKPAIVFFGEDLPDSFSETWLNDSEWLREKITTQQPLVIVVGTSLAVYPFASLPEEIPRKVKRVLCNLETVGDFKANKRPTDLIVHQYSDEFAEQLVEELGWQEDFEKILTA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD-dependent deacetylase HST2
publication title Structural basis for nicotinamide inhibition and base exchange in sir2 enzymes.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
total genus 94
structure length 291
sequence length 296
ec nomenclature ec 3.5.1.-:
pdb deposition date 2006-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1600.10 Alpha Beta 2-Layer Sandwich SIR2/SIRT2 'Small Domain' SIR2/SIRT2 'Small Domain' 2od2A02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 2od2A01
2X7JA 4BV2A 5BWLA 4G1CA 4F4UA 1Q14A 1O97D 4FEGA 3F6EX 4F56A 1OVMA 1JSCA 1S7GA 4Y6OA 2JI7A 2JI8A 1SZCA 4QELA 3CF4G 1PYDA 4UUAA 4Y6LA 3FLMA 1PI3A 3D4BA 1PVDA 2JIBA 4BUZA 4JUAA 4HDAA 4JUDX 3ZG6A 3GLSA 4C78A 2PGNA 4UTXA 1Q1AA 4JU8A 1J8FA 2H2HA 5EJ4A 4JT8A 2H2IA 3F6BX 1U2GC 4O8ZA 2C31A 3D7KA 2QQGA 1PTJC 4QQ8A 4X3OA 4V1CA 3JWPA 2VBFA 1ICIA 5DGDA 4HD8A 3PKJA 2FWNA 1EFVA 2EZUA 1YC2A 2Q5JA 3JR3A 4I5IA 2Q5LA 4J1TC 1YI1A 1YHYA 1POXA 1BFDA 2A1UA 5K2OA 1M2JA 2PANA 4JT9A 2H2GA 4KGDA 1PNOA 3FSJX 2IHVA 4X3PA 2UZ1A 1D4OA 2VK1A 5BWOA 2EZTA 3IAFA 4D5GA 4RMGA 4RMHA 4UUBA 2EZ9A 4FEEA 2FN3A 4K9MA 1E3TA 4TWIA 2IHUA 5EJ6A 4K9NA 2H2DA 1YC5A 4V1CB 4BN5A 4UU8A 4BVFA 4C7BA 4UU7A 4Q9DA 4Y6QA 4ZZIA 2OORC 2H4JA 3CLUD 5EJ5A 4BVHA 1UPCA 4D5EA 4GM1A 4IG9A 4MPPA 1YBHA 3CLTD 4GG1A 2FSVC 1T9BA 5EJ8A 4JUBA 4K9LA 5MFZA 2AG0A 2H4FA 4IF6A 5MF6A 1YHZA 4JUCA 1PO7A 1POWA 4FVTA 3EY9A 4TWJA 2FRDC 1ZPDA 2EZ4A 4MQ5A 2OO5C 1T9CA 5EJ9A 2FR8C 4QPZA 2VBIA 4RJIA 4BVEA 1U28C 2JLAA 1YNOA 1YI0A 3PDHA 1NM5C 1M2GA 4ZP1A 3GLUA 3U3DA 1V5GA 4GM0A 1OZHA 4MZXA 1T9AA 5IMSA 2H2FA 1HZZC 4IAOA 5FEMA 4L3OA 2OD2A 4UTNA 2HJHA 4K9QA 4RMJA 1Z8NA 2NXWA 2H4HA 2H59A 4JD5A 1UPAA 1U2DC 1MCZA 4R8MA 5BWNA 2WVGA 1MA3A 1Y9DA 4UTVA 5MFPA 5DGTA 2AG1A 2EZ8A 3FZNA 1T9DA 4GM4A 4V1CI 1M2NA 2VJYA 4K9OA 1PNQA 2Q29A 1M2KA 2A1TR 2VK8A 4BVBA 1XLTC 2PGOA 3HWX1 2QQFA 4BV3A 3K35A 2JLCA 2WVAA 4FZ3A 3EA4A 4L2IA 4JSRA 1EFPA 2W93A 3E9YA 1Q17A 4COKA 2Q28A 1YTLA 2Q5OA 1M2HA 2BRUC 2V3WA 4JU9A 2Q5QA 5EJMA 2UZ1B 2VBGA 3CLRD 3IAEA 4J16C 4RMIA 1S5PA 3ZGOA 5D7NA 1U31A 4MPJA 5FYQA 2JI6A 1N0HA 2Q27A 2B4YA 1UPBA 3PKIA 5K3SA 3ZGVA 4K9KA 4KPUA 4RJJA 4RJKA 1OZFA 5K6TA 2VK4A 4GP9A 1SZDA 3RIGA 1V5EA 3GLTA 1QPBA 5EJ7A 2JI9A 2DJIA 3HWWA 4K9PA 5EJAA 3RIYA 4BN4A 1OZGA 4BVGA 4KXQA 2WVHA 1V5FA 3LQ1A 2IHTA 3U31A 4GPEA 3GLRA 3EYAA 3OE1A 3D81A 1Q6ZA 2OD7A 4UTZA 4MPRA 5K6RA 1DJLA 4UTRA 5AHKA 1PT9A 1O96B 3CLSD 4JUFA 2NYRA 5MGNA 2OD9A 5DEIA
chains in the Genus database with same CATH superfamily
2WIBA 3K1YA 4ZCIA 3M89A 2AJLI 3D64A 1IBKB 1DAHA 2H5IA 3OQNA 3RYTC 1RM3A 3MT8A 1CJBA 3ZDXB 1OYYA 3CLHA 1D2HA 1GN9A 4ID3A 3HCDA 3ETCA 2HRDA 3G13A 5BUCA 2R6CA 2CDBA 2IY9A 4MWSA 3V1YA 2UVPA 4OYRA 1EQUA 2QTBA 4YJ3F 4PNEA 1EVEA 3BQMB 2MYPA 3HV0A 4WUTA 1GL9B 1I30A 3ID6C 5A3SA 2ZT5A 3P2EA 1GN8A 4I66A 3OZIA 4JVMA 4MUXA 4REMA 3ZDAA 4BXOA 1WQ1R 5KWIA 2FPPA 1TQ2A 2PZEA 3N7UA 5CVVA 2ZB2A 4AWXA 3SVLA 2BF4A 3DSRA 4MP3A 4KO3S 3ZDDA 1CUEA 1DTEA 2I7DA 3LUFA 3OCYA 3EGXA 4HGPA 2X3FA 1X19A 3BA6A 4Q16A 2WILA 5HRAA 4OHOA 4RJ2A 1K6MA 3HA5A 4RPJA 2SCUB 2JGEA 4EHNA 4WOCA 1D6NA 3L93A 2WFLB 3B5EA 3VQTA 3VNUA 2IP2A 4YN3A 1Y1KE 2O8CB 1A5AB 1P0QA 1DC6A 1Z7WA 4TUYB 1F8YA 3I1FA 4E5DA 4EARA 2PRJA 3HUDA 4MI1A 4OUDB 4CW7A 1YACA 2E2WA 2RH4A 3QFTA 1QO0A 4BPRA 5J4VA 2I8LA 1T25A 5HZHA 4KQMA 1GFZA 2ACKA 3NIBA 3PQ8A 1AN0A 1CXZA 1Y8AA 1Z0IA 1E3WA 1FDOA 1V71A 1Y89A 2LXNA 2PRIA 3KOZA 3U3MA 1Q7TA 3AG5A 1I01A 4U4AA 4WTOA 4PZ9A 4ZOLB 3RJZA 3IL2A 1YRQA 5JZMA 1U5AA 3CVXA 2ZSBA 1SUPA 4PLVA 5ALJA 4JJAA 5GONB 1O57A 3ZH2A 3ZK7A 1PSWA 2JIDA 1DWPA 2IY7A 1R8YA 1H3FA 4FHEA 4KACA 1EE1A 1LWNA 2PN1A 2ERCA 2XVAA 3LDHA 5AKXA 2YJGA 3H5OA 4MRMA 1SCBA 2ZFUA 1Z5PA 5CT6A 2W9XA 4EG0A 3N74A 5CVUA 5IDQA 3N0TA 1MOZA 2RHOA 4LYEA 4MMYB 2NG1A 4YX9A 4HEJA 2PPLA 2X1HA 1S3FA 1Y5RA 2CUZA 4ITRC 4W63A 4YDRA 3R5JA 2ORYA 5CT5A 3CB4A 3E9ZA 5JS6A 3DZFA 4DQXA 1Z68A 1ENYA 4HP8A 5FKJA 3W9YA 3V7WA 5ALLA 3AEQB 1TQHA 2DB3A 2WJAA 4H60A 1O3YA 2Y1GA 2PS3A 3D6TB 3IO5A 1MNQA 1ZGCA 4XD7A 4LXIA 5DWVA 1YK1A 1VKRA 4B80A 1HT3A 2INGX 4Y9DA 3FSEA 3OCJA 1THMA 2C8KA 4B2IA 5ESDA 1SU4A 3ELUA 3RVLA 1PD0A 1QDLB 2XIJA 1UMBB 5AJVB 3BTVA 3MHTA 2YMMA 1GD1O 3BK1A 3L7DA 1VSVA 3CNLA 3FVTA 4CF5A 1RNLA 1D2GA 1TADA 3ZLBA 3JAWB 4ZEOA 1GRRA 2AZ4A 1T0HB 4IGAA 4NI5A 3WJAA 4EX7A 2HLDD 4DGSA 2C2KA 4BLOA 7MHTA 5EL0A 3ZN2A 2QT1A 4CG0A 3AUJB 3QWFA 3BWEA 1J9ZA 1V1JA 2QG9A 3MF4A 4YJ3B 1DC8A 2LPMA 4Q1EA 5BSUA 3W3AA 4CLRB 2FMUA 3VDXA 4KGDA 1SQ0A 4L72A 2CJYA 5A9SA 1KO1A 2PT7A 5LL6P 3RSGA 4NZ9A 4DTCA 1FEZA 4NPCA 2CXXA 2ZSEA 3TW4A 3OX4A 1W46A 3MTQA 3MWFA 3N3AC 4G5OA 2QRJA 3LC7O 4M1MA 2QX4A 3REQB 4DDKA 5A5VA 1Z0JA 5BWOA 3KPVA 5BW5A 2SNIE 2QMYA 1IPHA 2ISCA 3D6HA 4MI3A 2Z8YA 4IDPA 1PTKA 4RFVA 3FFWA 3R4CA 4W5JA 3T7KA 1DQYA 3O4RA 1DARA 3GLHA 4RL4A 3W3AH 1SCIA 3JPWA 4E2WA 3AI1A 4Y9SA 4K9MA 2GCEA 1XCGB 4M0UA 1GPKA 3BWDD 3U17A 1NMZA 3DOEA 4TS3A 1N92A 3F74A 1U8ZA 2HDHA 2AQIA 3K4HA 3HCOA 4LRWA 3DOHA 4KZKA 4DMUB 5J47A 4P0TA 3I6QA 1G3RA 2PZLA 3EQ6A 1H4SA 3ROZA 1RBQA 4UU7A 3CEAA 3CPEA 5ALSA 4NXNB 4PPFA 1ESDA 1L7AA 2W2NA 1EWVA 1QQ5A 4HAUA 4JQYA 4QHTA 1TYZA 4QUEA 4BKUA 5IXJA 2ZZMA 4CT4B 1P6QA 3V4RA 1M0WA 4E0BA 1UM8A 5LC1A 1NFFA 5J43A 4I81A 4WESB 3YASA 2O1XA 4MITA 4BU0A 4E46A 1T13A 3IV6A 4Q93A 3WR5A 1FW6A 1M1YE 1WIWA 2V7UA 1PS9A 1CDEA 5L45A 3GFTA 4CDGA 1AKMA 1CLUA 3WMFA 4GM1A 1E5LA 1GG2A 3O8OA 1AS0A 3ED1A 3M2PA 3P4XA 4MGEA 2AWNA 4QFBA 1KRXA 4EVIA 1II9A 4MJ3A 1X80A 4FT2A 1WPGA 4JJKA 3V33A 3CUYA 5C80A 1CP3A 4BFCA 4ADSG 1VE7A 3HCWA 4FLFA 4IUBS 2GKGA 4PC7A 3TX6A 4A15A 3UK0A 1JQ5A 2WSIA 3T3OA 3FDZA 3LBYA 1E1QD 2OYSA 2R87A 1X1DA 4P84A 1CULC 1UJ2A 1PG0A 5K0LA 4P5EA 4EY7A 1NW4A 3ITKA 1TIBA 1H8ED 2EYQA 4AVYA 4D6XA 2H16A 2J30A 3W9BA 4OSEA 2OO5A 3QXSA 4WNAB 2C88A 1VYHA 1PLKA 2BE7A 1U9CA 2GEBA 3L5OA 3NWJA 4LDZA 4LPKA 5FT9A 4IWYA 4S1VA 4QUIA 1ZH8A 1POWA 4WA8A 3UK2A 1ZM3A 5H0IA 2R9VA 2O8BA 1K08A 1MIOA 2REQB 3RCBA 2ZTVA 3JQ7A 3P2MA 2QUAA 3C98A 2ZCVA 1UODA 3LBNA 3HDJA 4YMWA 2EZ4A 1ZW1A 1ADYA 5CTJA 4MKIA 3T5CA 3F73A 5CFRA 1ULHA 2XAUA 3KR9A 4QPDA 2AW3A 1GR1A 4GOJA 3TLYA 2RHGB 3E1GA 5BUZA 3AERB 4M7RA 3T5GA 3AVVA 5FOUA 2XDQB 4WCVA 4RTPA 3DJFA 1CZOA 3B6IA 4E33A 5L53A 4XM2A 1JHXA 3SNHA 2FA9A 1TJ5A 4XCXA 4C87A 3I9OA 2A78A 4MQ4A 3WL6A 2AEEA 3ANYB 3TWOA 3SSOA 4GRDA 4O2RA 2XE8A 2V7QA 4X7MA 4Y2UA 4Z7JA 4BZPA 3W6OA 3KT3A 3L0DA 4OHWA 1Z3IX 3KETA 5FD8A 4C6TB 5D5PA 3H2GA 4AY5A 3ROGA 3L4EA 4HL6A 4X3CA 1E99A 6PFKA 1K1EA 3FSGA 5AKKA 2B30A 1PK9A 3GB9A 3OJXA 1XRNA 4I2VA 3EXHC 3WGMA 4LF4B 4F6LA 1VJ5A 3CKLA 3AHDA 3DAFA 1S01A 3VR5D 4V0SA 2OV2A 3RSSA 2QSUA 1XA3A 4XFDA 2GCPA 5BPHA 3QEBZ 1IOLA 1BXGB 2ZITA 2JAXA 1BU8A 3WK4A 3NHMA 4F85A 5F3WB 2FXVA 2G09A 2ZJAA 4BJ5A 1UOEA 5HCIA 4Y2XA 4I50F 4Q3AA 4NIMA 4XEHA 5C1DA 2HM7A 4NBTA 3D9QX 2G8LA 1W6RA 1L7VC 2QRZA 3OCUA 4BU1A 4WA7A 4ZYWA 4WZAA 1JXAA 1QNLA 2CXTA 2JCSA 1RJEA 3ZZ1A 1NXOA 4LYHA 4CLEA 2ZIZA 3HCEA 5C0OE 2Q5EA 5IPFA 4NHOA 1SQ5A 1YMQA 4N6GA 1A96A 1VJ1A 2I4LA 2VSFA 1HXHA 1OLXB 3JCZA 2IV7A 1YCHA 2E5FA 4E2ZA 3GDFA 4KDRA 4NSNA 4H1UA 4ATNA 4JB2A 2P4UA 5AIBA 3Q8XB 1KE2A 1L1RA 2W22A 4TL6A 2RK3A 1LK7A 1XD9A 2II6A 1M75A 2PD6A 3LP8A 4Z4QA 1MFZA 2OVBA 4OMCA 4INAA 3RRFA 1GCIA 1R50A 3HXMA 1DG3A 3NUQA 4NPHA 4P0PB 3OFND 4FPXA 5I7FA 3RO7A 1XRQA 1Q74A 1DCTA 4KUGA 5I6DA 5DM60 2NTYC 2ZYVX 3PLNA 2R5WA 3L6DA 1PL6A 2BZ0A 1NW5A 2XJ4A 5CT8A 3PLRA 3VDQA 4B3SB 3TEMA 4TN1A 4EAQA 2VIIA 1TGVA 2QM8A 1AC5A 5HVNA 5CD1A 1C0PA 3M9WA 2I2FA 1NXTA 1CQXA 4MW9A 4M88A 1WVIA 1J5XA 1XNQB 4UE3S 4F97A 4ZVQA 5L7YA 4JFAA 1J0BA 2PGOA 3AHIA 4X54A 5T67A 4HB4A 2YXNA 5CCDA 4CR8A 3QKIA 4ARIA 2PEZA 3K9BA 3DHYA 5CYPA 3V7YA 2WJJA 3R0QA 1YWGO 3KSUA 3SYNA 3F46A 1XZBA 1VBFA 2FFQA 2AF3C 3QXHA 1P1KA 1HWYA 2CYCA 5CR9A 1OWOA 3T3PB 2BRUA 3W0LB 3PEFA 3IEVA 1BA2A 4C4PA 2ZKIA 1I4LD 1IZ0A 4GL2A 3RC3A 3JD2A 2XMGA 1QRUA 4TOIA 1KEEA 3C7TA 5CXUA 4TROA 3IP8A 1SIWA 2VOJA 3L2OB 1YQTA 3D1VA 4LZOA 3HXKA 4WL0A 5D85A 2QN9A 2BPOA 2CDRA 4PLFA 5JXIA 3L4JA 1WPXA 1M6VB 3BFJA 1M8GA 4UAGA 3KXDA 4J16A 1GITA 1NMEA 1QPGA 4B40A 2QNRA 3WRVA 4B1FA 1WAMA 1WMBA 2GXQA 2G72A 2EEZA 2WRZA 2WUDA 1GPMA 4OG2A 5H81A 4YRPA 4O25A 1F06A 5AXCA 4FZRA 4EHDA 3FYUA 1ODLA 2P79A 1IOVA 1JDBC 1P3JA 1XP8A 1Z39A 4MKGA 1FU7A 4KXUA 4TTTS 4BO1A 7AT1A 2FPWA 5AW2A 4LECA 3PX7A 2QN3A 5MF6A 3L5KA 3FCEA 3B5IA 2KBEA 5E4TA 2HJ9A 1YL7A 2VDJA 1NVFA 1O6FA 1S5PA 5L51A 5DCUA 2QI9F 1E5DA 1E0KA 1JDUA 4KXFB 4FYXA 4I50B 4X8OA 5H16A 2NU8B 4PYNA 3WGNA 4ZCMA 3N05A 1A9ZA 2DYKA 4QNMA 4I08A 4IIYA 1SC6A 2NU6B 4ZVRA 2EFJA 3U4DA 5DZSA 2EJBA 3PUXA 2XQVA 4HXFB 1ANKA 2P40A 2V7TA 3EA0A 6YASA 1XDGA 3I5MA 2G9UA 4CBVA 1UUFA 3QG5A 4W7SA 3JZDA 3GQBA 1NIJA 1XMJA 2IQ5A 3PKZA 2ZETA 2FPGA 5A5DA 4JI0B 1K68A 3EGDB 4TMYA 1T6XA 3AHFA 4BB0A 3HL0A 5I5GA 2BKAA 1FXSA 1HDCA 1NJ8A 1X7GA 2IOHA 4I1RA 4CEIA 3GO4A 4PQEA 5EERA 5ADVA 4Y2HA 1AKRA 1VA5A 3EJ6A 4KPUA 1WTCA 1JJFA 3DGEC 2BP7B 3VKUA 3I9FA 1MX5A 4Y0VA 2AXPA 5E2IA 4AY6A 1HR0B 3JWIA 3ZV3A 4OV6B 3KYDB 1WOMA 4BJ3A 4Q7QA 3GHYA 2PO5A 2ZZKA 3ACBA 1YKSA 2P67A 2CD7A 3EZYA 1NHWA 4LZNA 2PSEA 1FP4A 3DCJA 4QYIA 3GV0A 4B35A 2A5LA 3TRFA 4KAJA 1LY1A 5B1IA 2WKWA 3T0FA 2FMIA 3HACA 5KX5A 3W5AA 4IO1A 4LWPA 2YS6A 2P6OA 5F52A 4DDHA 1Y8ZA 4ROSA 2FKNA 5DHUA 3VR1A 1CQIB 3N8DA 3WNVA 1ZKDA 4JX9A 5FBKA 1TIPA 4GXQA 1HQYE 1IQ0A 1U6KA 1M6NA 3UJ3X 2JEZA 3R6TA 3ROPA 2AMJA 3N5KA 4XTCS 1ZIXA 4MZDA 3VHXA 4DA6A 2Z9BA 4PNPA 2I80A 4CYMA 1N75A 1OA1A 1AGYA 2J1LA 4FR0A 4G37A 2YYZA 4RA6A 3REFA 4BLSA 1MEJA 2RC5A 3G8BA 2BI8A 1U7HA 4U2CA 4XSVA 5I9NA 4R1LA 4BMVA 1J9EA 2ZB7A 3FETA 3S2YA 2A0YA 3ANSA 2X5JO 3CZCA 5HFNA 2B35A 1LF5A 1AZSC 1TLFA 4RFSB 4BP1A 2MTBA 1RJDA 1TLLA 2QTFA 3DFZA 3NEPX 1QK4A 1P2TA 4R0VA 4F11A 5LBIA 3NVKI 2OD7A 1O03A 4YMIA 5IN4A 1J2UA 2FKAA 5CW1A 3B6MA 2C7PA 3A4YA 2HT6A 3OF2A 2V0CA 3VH2A 5FOQA 4GOOD 4B46A 2FR0A 2Y77A 4FYMA 1BWPA 5FWDA 4K6MA 3MYYA 4FYVA 4BMXA 4IMIB 5BNIA 3NDBB 3ICOA 4PBSA 3B6KA 1RADA 3WDLA 3KYBA 3DNPA 3RS5A 3DO8A 1NVKA 4KR0A 3OIYA 3VO1A 3R9WA 3A6KA 5TPZA 4LSZA 1EQAA 3O1HB 3EB9A 3MOIA 4OI2A 2XXAA 3LPNA 1DIAA 1E3SA 1JQ3A 4GS5A 3KB6A 3VBCA 1RHKA 3KLNA 2RKOA 2WJHA 1ATIA 2X8JA 2ZB8A 4H1VA 4JBNA 1BXZA 2VTKA 4D4MA 2FK8A 3D5EA 3RAJA 3A6DA 3GNTA 5TX7A 4BLRA 2BDUA 3MD9A 2Q1WA 3RARA 3VNSA 4H3HB 4PWZA 4P4SA 4F4UA 1FYXA 4KEAA 4AG5A 4B3HA 4QBFA 2C8VA 2N46A 4M7PA 5G3ZA 4DY6A 5C2JB 3U4MA 4EFDA 3THRA 1NDUA 3PWZA 4MI6A 2GF9A 1U8XX 1JSCA 2FTKE 3ROQA 3B1YA 3V1KA 2EP5A 2HREA 4C3UA 1R0ZA 4ZDWA 1QYIA 4KMRA 5DHQA 1JQJC 3HCPA 3M1LA 4FFLA 3L1HA 3A37A 2FYTA 3ZD6A 1XN1A 3A9CA 2JI8A 2Z08A 4R31A 5EHIA 3E9MA 1EWRA 4QTXA 2YVAA 3WYNA 4YRMA 1SZCA 3PSAA 5ARDA 1D1TA 1WCXA 1JKXA 1K3FA 1UJMA 1ZI6A 4UUAA 1V9LA 5EUMA 2H4WA 4FYHA 3EFBA 3JQAD 4KMSA 2Z8YM 5KYVA 5T4FA 4I5DA 5DYGA 1P62B 1BGVA 5B6PA 1LX6A 2HHLA 1YRYE 2EX4A 5J63A 2MSWA 3NT5A 3ABRB 1RFLA 1O89A 1ORRA 2GZDA 3PWKA 1L4LA 1SOVA 2GB4A 4PNZA 4AURA 3K70D 1LSSA 2HFJA 2IRWA 1FL9A 4B3DA 1OAKA 4CFZA 1NLFA 1BXRA 1ORTA 3EXG1 3GOHA 2ZS8A 8ABPA 2JLYA 4UTXA 2BE9A 4RKQA 3D6AA 3MTEA 1H65A 3JASB 2LDXA 4C5BA 3BKXA 5GVRA 1OKKA 3B3GA 4QOIA 3NASA 3U9SA 1Q1EA 3F0TA 2YJ5A 3OJFA 4ZIRA 5FH9A 2IYPA 4ZOQI 1CUGA 1G5IA 1QYWA 3AVPA 2G36A 4RHEA 3VO2A 2JD1A 2QTVB 4C0AC 3ESXA 1CUDA 3CT6A 3RVRA 4JYAB 4UPEA 3R5FA 4NBWA 2OCGA 2MMCA 1C9KA 4XWWA 4S0ZA 2FV8A 4MHOA 1J5EB 2XCUA 4RJTA 2C9OA 2O3QA 1GTL1 4IGFA 2VLIA 3S99A 3GGCA 3HU1A 5IN5A 1IBMB 2V7VA 3TSOA 4WN9A 1EI9A 3RVKA 1UP4A 1AKUA 2B34A 4KYVA 3L7BA 4FNMA 2AFIA 4ZICA 5AOCA 2A14A 6CHYA 1SXJE 5C52B 3K6SB 5B36A 1J07A 3C74A 3H04A 1UC8A 1YBFA 3SIPA 2LP4Y 1WB6A 1YQWA 3EYWA 3RAPR 1Y1SA 5HOEA 3QPDA 5KMGB 1OJ7A 2OO3A 2XSZD 2CVOA 3ONVA 5ALMA 1VLJA 3M3DA 1HTWA 3WLHA 4MAMA 3JR3A 1H8HD 1Q21A 3L7YA 2DWOA 2F6RA 1X7ZB 1KJIA 1R4NA 2VAXA 2YFKA 1FFHA 2GRUA 1YHYA 3LT0A 1XWFA 3UGJA 4F7WA 3LXUX 1I0ZA 3BEDA 3QKRA 5BSKA 4P32A 3RC2A 2AMVA 1ZGAA 2IDKA 4ZANA 3WMEA 2XNHA 4A6XA 3WB1A 4D82A 1JPNA 4LHEA 2V9CA 4F92B 3T06B 2IITA 4YUYA 1V7ZA 5T6BA 4X93A 3W9SA 3DAYA 4FYPA 3CW2A 4WY2A 4IMPA 1PNOA 1QH9A 1M2EA 3G9TA 4NMXB 4RXMA 2HA3A 4DZTA 3IIMA 5G4LA 3U49A 4F3NA 4QKQA 4H7PA 2IEIA 3RT1A 3ZNOA 1FFBA 1OXSC 1ZXXA 3JY6A 3N2LA 4ZYVA 1P2FA 1QAMA 5BT9A 5KTNA 2NV2B 1MO4A 2X9VA 2FP4B 5KOJA 2A0FA 4C1BA 3PFFA 3EW9A 1G8JA 1ICEA 1T36A 1XGKA 2R86A 3IAFA 3UAXA 4QJ4A 4AIRA 4MR8B 4Z9AA 3KS9A 4CJXA 1BQ3A 4C7JA 4YMSA 3B8HA 3TH5A 5CFZA 2C7QA 4HQOA 4FEEA 4NP6A 5CP8A 5KNBD 1VXRA 4H27A 1U1FA 1QVVA 4HDMB 2ETVA 5HEKA 4ZC1A 1U3WA 2AFHA 1LLDA 2Q62A 1FPQA 1N2XA 1WLYA 3CX3A 4U7HA 2VJOA 5BSFA 2EV9A 4GZMA 1K8XB 1QR6A 3LDUA 2HA4A 3LWNA 4YRFA 2Y76A 5FF9A 3QF7A 4KL8S 4ZI7F 1E6WA 5TJHA 3INRA 2I6TA 4CV3A 4P36A 1THGA 1XKLA 5BVGB 3IPCA 3MMNA 3MTIA 3SKXA 2BI4A 4ENWA 2QNIA 1XD2B 3IFSA 2UU9B 3WHPA 5CH8A 2A59A 2BZ1A 5HR5A 3A3NA 2CGEA 4BQOA 3ZVNA 1BVUA 2GEDA 4JEMA 1KO7A 5JHGB 3VNRA 1T5IA 3CEMA 3PFIA 4ND5A 4Q47A 421PA 4XPZA 3MM4A 3O4FA 2HA7A 4D3XA 3ZK9A 2H18A 1II0A 4LMPA 3H3XA 2KJQA 2Y92A 1E0AA 4ZCTA 1IPFA 2A3RA 3UWOA 3MC1A 3SD7A 3O95A 3A70A 2NSDA 4E6PA 2GPNA 4MKFA 1JZQA 1R6UA 3IMGA 4D46A 2CXPA 4PU0A 1GOTA 5JU6A 3DE3X 3NZEA 3S28A 3JQ9A 2CL7X 4KR3A 3HYRA 2I4MA 1GG8A 3UK1A 4EHLA 4NJEA 2DTEA 4F71A 3UN1A 4BE9A 4NDNE 3TTUA 5BXYA 2RGGA 1IFXA 1JPJA 1T9BA 1D1QA 4QEDA 3UY4A 2HGSA 4BRUA 5DNDA 3I28A 1ILWA 1XQXA 1ZK4A 3AP1A 3TW0A 3BB1A 3QELA 2ZUFA 3QVUA 4UM5A 1SBYA 2EJWA 3NBXX 2ENWA 3F6YA 4RIFA 2OP0A 3QLTA 2H1OA 5B7PA 5LLSA 13PKA 3C4QA 2FEOA 1DKLA 1EVZA 1NR5A 1UJCA 2IF0A 3ETNA 2ASEA 3FCCA 2X13A 2OBXA 3L06A 3NEJA 1SRRA 4FCTA 3A9UA 4QYSA 1YB6A 1YRWA 4FB4A 4CMEA 5T8KA 4WLUA 1C1DA 1U28A 3EOAI 4TS9A 5GY7A 4MQ5A 4BZWA 1VI5A 1D4ZA 4FCWA 1NC3A 2ZIVB 5I4KA 4QATA 4O4JF 3TIFA 2XGGA 1P7YA 5HKAA 2C7OA 3IOMA 2NO9A 4O1HA 3QITA 5F1OA 3HB5X 5K0EA 1N2GA 1QV6A 2QR3A 1O94A 4P38A 2PVPA 1JQBA 1ODSA 4XKJA 1E1RA 3K8OE 4PG8A 3K05A 3MGBA 1DDIA 4RHYA 5FI1B 2BM1A 3IALA 4MQEA 5TT1A 3UWDA 4R1TA 2YXLA 2A5GA 1N2CA 3A04A 1GZSA 3JQRA 3RTEA 2IYSA 3D1LA 2W8BA 4NAUA 5JJ5A 4BQSA 2EG5A 2L0XA 1ZC4A 1F6DA 1HNNA 3I8XA 4BQIA 4DQDA 4NONA 3DXYA 4HKTA 3K5HA 1GZ3A 1RJ9B 3PD7A 3A1NA 3HI4A 2V4MA 2WFMA 1Y6GA 5TPWB 3AESB 4E30A 4G0WA 3SLGA 3I30X 3GI1A 2R6HA 2BGWA 2KBFA 1H5NA 4G07A 4JLWA 2O2HA 2VXYA 3L02A 3M9XA 4PXYA 2W42A 5CAEB 4G5RA 1JLHA 4ND7A 4X5OA 2JCXA 4B85A 4XJSA 5DXAA 4D99A 3PE3A 3CE9A 3DNFA 5D1HA 4RTSA 2XMDA 1SCJA 1X1TA 1MVNA 1NOJA 4G84A 4BX8A 4RH3A 5HGXA 1UC5B 1LPMA 5A5FA 1SD1A 2JGJA 3I6IA 4EJSC 4PCLA 4DZZA 4HNSA 2EW1A 3ADCA 1QKIA 2D6FA 4IXNA 5CLHA 5BWMA 3AR2A 3DZJA 2PGJA 1JJBA 4FKMA 4ODIA 4UTVA 1B26A 5TS3A 2QPOA 4E5PA 1SVUA 2DY0A 3ROMA 4HVLA 4QPJC 2F43A 4LE0A 3OEHA 2P78A 2J6CA 3TZEA 1AZTA 2GSDA 4KGVA 2R97A 2PJDA 2H1VA 2XRMA 3IQXA 3CRNA 2GKSA 3R7BA 2JFOA 3WYAA 2ZJYA 1EK0A 2GTHA 2PYZA 3EZ7A 1EP2B 3CTPA 3IUBA 1DZIA 1U98A 4QUDA 3P96A 2YWHA 2J0UB 1A69A 1MPTA 1P7CA 5FB3A 5GJCA 3BHJA 5P8WA 5FPKA 3FTEA 3AFNA 3RNLA 2EFEB 2ZG6A 3BH6A 3DEJA 5IYZA 1ID1A 4G0ZA 1P4AA 3FZNA 3PX2A 3QXCA 2VCHA 1OI2A 4NNOA 1QWSA 2Y0DA 2WTNA 2QP4A 5I7SA 2Q6TA 2VJYA 2E4UA 2ZREA 1W581 2OBLA 1YZYA 2YR0A 5A5EA 3EPKA 2VT6A 5EVCA 1P4GA 4UDOA 4FFBA 5EKXA 4C0KA 1TPYA 4UHFA 4DMFA 3G2KA 1GRQA 3ZTTA 2KPOA 4IM7A 4QT4A 2H85A 4YP5A 5E9AA 1NBWB 5IDWA 2PJRA 3TL6A 5CFQA 3G9UA 4I6JA 4W99A 2Z9CA 2NACA 4EG7A 4Z4IA 1Q7RA 4CV0A 3N7TA 3O8QA 4O4JB 4XGQA 2UYQA 4YIKA 1IZ9A 1T8YA 3MTJA 1ISIA 4NH0A 1BKYA 2QUZA 2YV4A 3LM8A 1LPSA 2EFHB 2FW0A 3V3KA 2V59A 2Z8XA 2A2ZA 2OCYC 4GKVA 5LU9A 1ZJYA 4I14A 4AKSA 4NV1A 5EZQA 3SHWA 1B8UA 2JZOA 3DLCA 3TRKA 1H3EA 2QLBA 2HV8A 1XD8A 1DJOA 4CQMD 3T3EA 2WKPA 3W5IA 4J3NA 5K20A 3E9NA 1AQYA 4HMQA 3TQQA 1XK7A 2ZB4A 2OP1A 5JS8A 1CUFA 2XUHA 5K05A 2AOTB 2PE5A 1QV9A 2XGJA 2NZWA 3S29A 3HDQA 4YI5A 5KNDD 2SKCA 3EFOA 4OHKA 3ZHZA 2AYZA 4CEHA 3PI6A 5IVIA 3DPSA 4PR3A 2VRCD 1NUPA 3GRFA 1FXWA 3KEOA 1Z2DA 4L07A 5FJJA 4EL5A 4JU9A 4ZPJA 1TEZA 4FUTA 2QQ0A 2CF5A 2G40A 1SBCA 1FX0A 4R1QA 5EVJA 2YBDA 3IXLA 3RWBA 2VP5A 1ONPA 1PZFA 2PA3A 2VWGA 3SFZA 4MCIA 1WPRA 4EYQA 3BAZA 1C9MA 3LYUA 4L95C 4Q4LA 2NO7A 1KGDA 1ZGHA 3CLRD 3QFHA 3D6UA 4ZU6X 2NGRA 5JG7A 4FSXA 3HR4A 4L0QA 4PYJA 4BHTA 5KKNB 1MZPA 3JU3A 3ESRA 1J8QA 1WXFA 1U0NA 4NU0A 2IU3A 4J4TA 5IXSA 1W88B 3O93A 1VL0A 2WU4A 3HBNA 1FQJA 2BJHA 4F2GA 1CEQA 1DE0A 1KH1A 2ZJ2A 4TV8F 2ZRLA 2J85A 5B4VA 1HDGO 5CFPA 1JKJB 3GJ5A 3LX5A 4K7JA 2IYEA 1KZHA 2OT3B 2BGNA 3EQ8A 3H75A 1M5TA 3M6WA 1OH7A 4LJRA 1DRUA 3UJPA 4YMLA 3GRYA 1PR6A 2VDOB 3W1VA 3THYB 1EP3B 2WT8A 1UC4B 1QUEA 3DBHA 2NU9A 1QYCA 4HUJA 4NNPA 5EUCA 1D8TA 5K3SA 1M1YB 2IPNA 1ABBA 1EFRA 4AG3A 1N8TA 1NLYA 1QIIA 1K5HA 4C4SA 4W9RA 2MSEB 1J99A 4P0QB 4MA0A 3GLIE 1EFCA 3TVTA 5U4XA 4IIGA 1B14A 2Z4SA 3W1EA 5K6TA 1HT2E 1ADCA 3PR1A 3TZCA 1MGOA 3ORRA 2HNAA 1WW8A 2GGSA 4JIGA 5K4HA 1E32A 2PV0A 3CEPB 4OOEA 4JASB 5FNVA 4HZUA 5LQKA 3PQ4A 4Y6PA 3O1JC 5I5EA 1RMTA 2XMCA 2DT5A 1ML3A 1Z28A 3OQIA 4Q3DA 4LGYA 3KQTA 3MTBA 2IYFA 3MWGA 1J2RA 3B7GA 3B1FA 3HJTA 3AEYA 1J2EA 2ZRCA 4IHJA 4UDNA 1HUQA 1KYZA 4UUMA 4Z1MA 4FNAA 1P4JA 2E37A 3BYZA 1DV2A 3GDHA 3RIXA 3CWZA 3RE1A 5JCJD 3KQLA 1ZGZA 4M53A 2WUGA 1R5NA 1T6BY 1YB5A 1NQ5A 3HHEA 2ARKA 3JVUA 1I2ZA 1TTHA 3O0TA 4QU9A 3GCGA 4RF5A 3WNDA 3QPCA 2FE1A 3R7SA 1T3ZA 4MWZA 2P1RA 2RKBA 3WRXA 2W37A 1VIYA 4S35A 3WGKA 4E13A 4BEJA 5DIZA 3ZIUA 4HYYA 4OQPA 5PGMA 3COVA 3WMWA 1Y5MA 1DJQA 3NAGA 5CNKA 3VSEA 4IV0A 4UDXX 4BNDB 4UOQA 4CCYB 2XECA 3RJ9A 4RZXA 3ZU3A 2RGYA 3ZHRA 2RH8A 3H6GA 2C59A 4GVPA 5HYVA 4G1FA 2I62A 4NULA 2GN2A 521PA 4GVXA 1QRTA 2PU5A 4S05A 5LQSA 1KEPA 1Q6ZA 3ZK8A 2XUFA 4ME6A 3TPZA 1RYBA 2FPSA 1QHXA 4DJJA 4AF7A 3FTFA 3FR8A 2V0NA 2NUPA 2XYRA 3KZNA 5SICE 3O2NA 3RG8A 4IEIA 2ZKLA 4JI7B 5C8YF 1L5YA 1A2BA 4EM6A 1R6DA 1SGWA 4B6JA 4RPHA 3MERA 4D0RA 4KC0A 4DM4A 4WEOA 4OBWA 3V55A 1LK5A 2GHIA 2WWRA 1G59A 4KRFA 3PXBA 4IKOA 1XXHE 3T7IA 4DLAA 4WFQA 1O96B 3B2QA 3D3WB 3TMAA 2GCOA 4QPNA 1Z35A 1KPGA 2WSSA 3OT1A 1H1TA 1RTTA 4HLUC 4XAQA 3EWSA 1NX6A 3S6JA 4ZARA 4P3PA 5E6SB 4DVJA 2H7CA 2BFAA 2OCPA 3PXAA 4QEKA 4TV8B 3F96A 3KQOA 2AC7A 3IE0A 2NYRA 3LT5A 2I3GA 1Q7BA 2ZIFA 1IL0A 1EVYA 1O6GA 4XVHA 1U5CA 3DBVO 4A6DA 3WNBA 1G66A 1TQDA 1A7AA 1TTPB 1XZAA 2D2EA 2GZ3A 3HXTA 3MJRA 4QDJA 5CJ2A 5DHPA 5BY2A 5AVXA 4EVRA 4YDSA 4OJQA 2PUBA 3CMCO 3N6VA 5AK6A 1K4MA 5JNRA 2Z6QA 4YRSA 5CXQA 2ZAMA 1HYBA 1LRJA 4ZT2A 4R2JA 5L8VA 1V6SA 3GT0A 1A95A 3GLKA 5EY5B 2FJPA 1Z5WA 5EWMA 4UTOA 1LI5A 4DN6A 3Q3JB 1P7WA 3K2IA 3IP6A 4P4TA 3DAOA 3SHQA 4FEGA 5BOVA 4PLWA 4YA6A 5GPBA 2JI4A 2EQ5A 3H9CA 2N1MA 1DBRA 3A2NA 4YAJA 1G63A 2A1IA 4EI9A 1LLQA 1Y8RA 4RE6A 2OB2A 4ARCA 3JYPA 4LMAA 5DCYA 4CM9D 4D8UA 5LXTF 1EFKA 1WSDA 5F3DA 3CVUA 4R81A 2AJ8A 1EB8A 3H2ZA 1LJUA 3AWIA 3UZUA 3FJ1A 3EEFA 4LY0A 1JEYA 3AVWA 2Y1WA 5HRUA 3QENA 4Y6LA 3EF1A 3KSBC 3GWGA 1INLA 2D06A 2Q2WA 3EGIA 3HEBA 1GSAA 4OI4A 5GWXA 2HRRA 3JYHA 4FBMA 3HA7A 4ZOAA 4DT1B 1KI7A 2JZNA 3WGIA 1AK1A 3MT9A 3QVTA 2E49A 4R9NA 3G68A 4OFXA 3DLPX 1J97A 2D1QA 4GOXA 4DE5A 2OGTA 1HLGA 1GA4A 2PZJA 4OQ4A 2WYIA 4QA9A 2QYTA 4P2GA 5LA6A 1JDTA 1IHUA 4IWNA 3RC1A 4NZZA 4RPGA 3FROA 4YUAA 1W4RA 1NJ2A 1WR8A 2F1OA 1XF1A 4JH0A 3QVMA 2FWMX 2LKDA 2VJPA 4J9VA 2K2QB 4MW2A 3BD8A 2K6GA 3O90A 4A5SA 4IBOA 4R68A 2WNHA 3FNIA 2NP6A 5DXJA 1EGMB 2Q2OA 2GAIA 1HGXA 4PFKA 2GRAA 2ILTA 3BXHA 2DPMA 1QORA 2F1RA 5JSQA 4JLVA 5KTTA 4CL0A 2I1WA 3DW3X 3AVQA 4BNKA 4HN4B 1D2EA 1IJKA 3OAAD 2J5RA 2DEUA 2D59A 4B47A 5AR1A 3W06A 3LBFA 5EP1A 5BW8A 2QQGA 1M66A 3HUTA 4IQFA 3EIXA 4L0DA 4YAUA 5KKCA 1SCNE 3RKRA 4WBNF 5C8YB 1E61A 2VEDA 4PW0A 3RSQA 3SDBA 3GL9A 2DCMA 3SSMA 3UJCA 3ZE8A 5IK2D 3QOWA 1NXWA 5EIWA 1Y1LA 4DUYB 3AP2A 1TYDE 1YJAA 1DU4A 3NU1A 2LDBA 1Q77A 4F3TA 3GNQA 2O54A 1VJTA 3LGSA 2WWWA 5DGDA 5K45A 4ZA2A 1JB9A 3PXCX 3KDAA 4R01A 1R4AA 3PJRA 2FPRA 2G3YA 3DBOB 4US1R 4A7PA 3IELA 2FWNA 3M6XA 1KXJA 1UBSB 4D98A 3AR9A 5THKA 3ZV4A 1JH8A 1DL5A 4JLNA 5B2ZA 3S2ZA 5B3KA 1NNI1 1P9NA 2HCJB 3TOZA 3IKTA 2P5YA 5IARA 2F8LA 3G9QA 1GJRA 3HRHA 3FLBA 2HO4A 4YT2A 4JIMA 1BFDA 1E2KA 2A1UA 3TKLA 3BGDA 1KJQA 1EINA 3NTXA 3RYHB 2EVWX 1I5RA 4YHHB 3FUUA 4BCCA 1G5HA 1KARA 4JSTA 3I5UA 3OPNA 4RPCA 3ZPXA 4E31A 2HA2A 4URYR 2UKDA 5AK5A 5BQXA 3WLTA 3DOJA 3MTAA 3DE6X 2X9NA 3Q9NA 4KIFA 1ZAYA 1DXQA 3JYOA 2AVDA 4WCDA 3DWEX 3K0KA 4JJ8A 4QUBA 4YRDA 3TRDA 2J9GA 3EGOA 1DBWA 3FUCA 3UM9A 1UZAA 3OEWA 3R9XB 1KY3A 1QE0A 1GYPA 1L4HA 2K87A 1EA5A 5LXTB 3ORQA 3GMSA 3EBOA 1ACJA 2D2VA 5BSRA 3R3WA 4XGRA 4K0KB 1YB1A 1YKFA 3C4VA 4KTVE 2B2CA 4WZBA 5FTMA 3WLFA 1A71A 1T6YA 1V16B 1L4YA 2B4TO 3BXPA 4ZCPA 1SKMA 3ICVA 3ADPA 3ZGZA 4M8NE 2FN3A 4PHFA 1V95A 1UWKA 1X0XA 2V58A 4U00A 1FJXA 3WHKA 1OT3A 2ZRBA 2CZQA 4BV9A 3VU9B 1TJPB 4FFMA 1Z8HA 4CM8A 4EJ0A 1YC5A 1W8IA 3KJEA 4M0FA 5CB6A 2GHQA 1NOIA 2AOVA 3ASUA 3FNQA 2NZYA 1ODIA 3DB1A 5EHQA 1TQ6A 1BCSA 5DNEA 4YASA 2HF7A 4C76A 3UMSA 1DWQA 4ZZIA 1JX6A 1WDWB 3B85A 3GCXA 4BLUA 4BO8A 4BMSA 2I4RA 4AG6A 4F45A 1I6LA 1KJZA 3Q7QA 4V0KA 2WLTA 1N7HA 2AE1A 1N4DA 2X14A 4FM9A 2IOQA 5IVKA 3VZBA 2DFNA 4JCCA 2R2GA 1XCBA 2QPAA 3C8MA 2VDKB 2PNJA 2BFBA 1M0TA 1S9HA 1JF8A 3EVAA 1PBTA 1FF9A 1E96A 4L08A 3O83A 4LRXA 4DV0B 2EOAA 1WXHA 2ERXA 1HDIA 1JU9A 1YF3A 1G16A 2F62A 4ZD6A 4BDSA 4WBNB 4AQ7A 4IUYA 2QAGC 3ONNA 3WK6A 1XEXA 2XAAA 3DBLA 1PJZA 1XHFA 3W4JA 3J7AC 3PS9A 2JBAA 4MGIR 3BFPA 3NP9A 4EFNA 1GPLA 1T0IA 3HJUA 3HSYA 4JP1A 5AVUA 1SULA 4U8GA 3FNHA 3OEEA 5K0NA 1CZKA 3H05A 4LJLA 5BW4A 1EWKA 1C4OA 1QFJA 2WPDA 3F3YA 1C3VA 1F38A 3V46A 1XQ9A 3UFXB 1M54A 2QY9A 4P93A 4DLZA 5CPBA 5K0GA 5EIBC 1SKBA 5LNK6 2NX2A 4UVIA 5CM9C 4I2NA 4IF6A 1NVWQ 3D4NA 4NCBA 3CX8A 3ICEA 4Q9JA 5F1YA 1QVWA 3SYTA 5CEFA 1JDJA 1M1UA 4PXSA 5AO9A 1AF4A 1L1QA 4ZQBA 2VHCA 2NU7A 2Q3BA 5DYNA 1JG1A 1PT5A 3TUZC 4FVTA 4EYOA 4AJHA 1BAPA 3KT6A 3WLSA 2FRDC 2H1HA 4RPKA 1OVGA 4YK7A 4ZVSA 3T7DA 1U02A 1TZKA 1WDLA 3U0BA 1B8VA 4BO2A 5LDDC 3UXEA 3E22A 3KYCB 1L9XA 4ZO6A 1OXXK 1HE8B 3T9CA 4ZT3A 1WQ3A 3VAZA 1GQSA 5CFMA 4PZEA 3ZQKA 2W6CX 4CCWA 2VTBB 2V3CC 2M2IA 3V8VA 4G2NA 1E0DA 3G2JA 4Z3KA 2AEMA 1JEDA 2G17A 2C4KA 1K27A 4UCXA 1SK8A 2CVHA 2IXDA 1Z6TA 3HUUA 4WWHA 3X0DA 5CEEA 3DWFA 1VL8A 3AVXA 3IT0A 1QF9A 4W8HA 4G81A 1DUIA 2VPXA 3G6KA 5TGDA 3VKVA 2F8SA 2GMWA 1XAIA 5AP9A 2BTQA 2QEQA 4QLAA 4A2PA 2BZGA 4TSFA 4G0UA 1R9NA 1T5OA 2IX3A 3SYRA 3PICA 1ISMA 1MOSA 2VP9A 2JHPA 1MT3A 4B71A 1OI4A 2RHMA 3EVTA 2PYDA 2Q3HA 5LCXA 4DSUA 3H65A 3D3NA 3IUQA 2HPVA 2V45A 4RNDB 3ZX4A 3QJ5A 2FUG6 2WQZA 4IAOA 4X00A 4QBTA 4JAVC 4QUGA 5EZ6B 1MB0A 2XT9A 2AN5A 5CB4A 2YUTA 1J39A 2PT9A 4HQFA 3V1NA 1XZIA 5JYCA 3D3EA 3DBRB 2ACVA 2A5JA 2QD5A 4TLMB 2H59A 3TLZA 1YR6A 5HJEA 3PHCA 2FFJA 3I83A 4U1RA 2G63A 2PKQO 2IWRA 3LT2A 5A1TA 4CQNA 1MA3A 4NENA 1Q91A 3X43A 3LVBA 2PJZA 3GUCA 4MRPA 5FI3A 4DUPA 3LF1A 4QICA 3RS4A 2I91A 3HCCA 2AEFA 3F98A 1QRDA 4MS1A 3EIWA 3QQ5A 5BR4A 4B3GA 1IHYA 3ZUGA 4FJ2A 2IZZA 4TZTA 4FKBA 3JWJA 1EEXB 3JW8A 3M5CA 3R8CA 3RTGA 4Q4DA 2ZRAA 2YWGA 4LV5B 5AVJA 1P4RA 2GX6A 2OZKA 1G38A 2ZDGA 1C3OB 1NASA 2HXSA 5L3QB 2H0RA 5GM2A 2OAQ1 4OLBA 2XB9A 5CK5A 1FLDA 3FIUA 3H5RA 1PL7A 2R751 4RK4A 4Y8VA 4YRTA 1ZZGA 2ZI9A 2JLWA 1SXJB 2XPCA 4IH4A 1VIMA 5H1YA 3MWEA 1GLNA 3FMPB 4FONA 1ECLA 3AW9A 3AUYA 1ODCA 1Y48E 2WFAA 3T9EA 5HQ3A 1QIDA 2Q99A 1L4EA 3PI7A 2P5UA 5HG0A 2P77A 3GA0A 1T5LA 1WS6A 4AK9A 4PZDA 3QKSA 5ALXA 1UBJS 3JPYA 5J2UA 1IXZA 1UAYA 2P1ZA 1GWNA 3O82A 2YWCA 2FPLA 3S70A 4DIBA 2BHTA 2V7WA 1QTQA 3AW8A 3PG5A 1ZHFA 1UEIA 1LLUA 3D2BA 1T9GS 2H06A 4BGVA 4ECEA 2EL7A 4HNHA 1Y4DE 4D81A 2QHXA 5E2BA 3I9KA 1EFPA 2LZ0A 3ZCXA 2YFQA 3FKSA 1U2EA 2Q2QA 3FPEA 4G89A 3ZXIA 1TA0A 4HRVA 5JNSA 5KYUB 1EUYA 1E8NA 5C5IA 1F7UA 3L92A 3KZCA 3PEEA 5C34B 4MR9B 1KYTA 2RG7A 5DNAA 1JAZA 5EYPA 5SY4A 2PUFA 1N8SA 1GVHA 1XTKA 3OJOA 5HS4A 4TYWA 1BSVA 2FWAA 1Z7EA 1BCRB 3D6MA 3PTLA 2H4YA 4G0QA 4HNAB 4IO0A 4L27A 5AUNB 3HL4A 2I4IA 4QAQA 3ZWDA 2ZAGA 5GJVC 2WSBA 3CGGA 4BAGA 2Z95A 3LYHA 3WGQA 3FRIA 2KWIA 5MN6A 4ICIA 4JBYA 4C6RA 2DF8A 4MVWA 1T6NA 3I04M 3PVCA 2R6GA 1OOEA 2ECKA 1MW8X 2OK8A 2POQX 4RDIA 4GWKA 4DIMA 4JNCA 4K40A 4QUAA 1C81A 2Q4BA 3NHJA 5JYDA 3E2IA 4Q3OA 1YE3A 1O95C 3SSNA 2ID9A 2VRNA 2QJRA 2W8ZA 2VJMB 1M2OA 4X90A 3P9QA 1S8FA 1TC2A 1VCOA 2VHZA 3DXZA 1S2MA 1GPNA 5TQVA 5JJCA 1XE3A 2BFNA 1NA5A 2EF0A 2FVYA 3DB2A 1D9XA 2EF1A 4BO5A 1EM8A 4WOPA 2IYVA 4F4HA 4J0HA 3WK8A 1OXVA 1HE4A 2QRMA 2CL6X 2B4YA 1JMYA 2Q0XA 1D8AA 3GRVA 4IIHA 3RVMA 4YR7A 3I5YA 2JC3A 1LRLA 5J2TF 1D2MA 3BIWA 2R4UA 3KR0A 5KJCA 2Z2KA 1OT5A 4IUCS 3WKCA 1AQ6A 3CRRA 4DPLA 5AVQA 4PHHA 3EXEA 2ZR0A 3ZDZB 3ASVA 3LNCA 3SHTA 4Q1CA 3DP7A 1MO2A 2F8TA 1JHYA 3UJDA 4L28A 5BOSB 4MA5A 4RJKA 1A4IA 5FR2A 2VLBA 1CHDA 4NQRA 1EBUA 2QUBA 1R74A 2VK4A 3AY7A 3UJHA 5M7EA 3JZFA 4I9FA 5KOHA 1JJAA 3TN7A 1SZDA 5A71A 3BL8A 4QXAA 1YBMA 3PR2B 5LNK1 4RW0A 1BRMA 1EFTA 1EMDA 1R3UA 1V5EA 4AYWA 4BX2A 4YCLA 1BROA 1FTQA 3DE5X 4LBVA 5LQMA 2G6BA 2V5UA 2JI9A 5HS6A 3LVQE 3DEHA 1ULSA 1VI2A 3AY3A 4XB2A 2H4XA 3W2HA 2WTUA 4F9EA 5FHQA 4D6YA 2C99A 3E1SA 3EAFA 1U8TA 1EFAA 4PZUA 5A04A 2JA1A 3VSDA 1UFQA 2W2LA 1A82A 3H6KA 4D9GA 2HXYA 1HY3A 4XYGA 1ZSNA 3G89A 2XA2A 3LKVA 3BD9A 4L5BA 4Y9RA 3FBWA 3TQIA 4J2HA 5I8ZA 4EELA 3TQCA 4ILKA 4PF1A 4E09A 1ZIOA 2B1JA 4LGVA 1PFWA 3OIFA 3Q3IA 4R84A 4KQFA 1EFUA 2J32A 4GYJA 4F60A 4DWOA 2JKVA 4JITA 1EX1A 1EJ2A 5DT9A 3WGVA 1QCZA 5KQPA 3MEQA 1U5BB 3N53A 3U4QA 3ESBA 1GR0A 4EMBA 2YH2A 3D7MA 4L9AA 3G8DA 2IPLA 4BWFB 3KSZO 1YVPA 3VVMA 3DZGA 1ETHA 3PNBA 2B37A 2JFYA 2MINA 1N0IA 1AUQA 3GAZA 3V2GA 1IQPA 1OAOC 2CN1A 3GGPA 4ZRMA 2X42A 1SB9A 2Q4OA 4MUAA 4YJFB 2FETA 2BKXA 3KQYA 5G53C 4B6RA 5A0TA 1DJLA 1XTPA 3GLFA 3CWCA 5A4MS 3U0VA 3WWOA 3CUKA 2PLFA 3KHKA 2VP3A 5GIPE 2XA9A 5AW5A 3S27A 5JH7A 1IZYA 1HDEA 3EG5A 3R5TA 4XIFA 4HX2A 3SIXA 1USWA 1X7HA 1XEWY 1SU6A 1WF3A 1G6HA 5KS2A 1JIIA 1V11B 1Z29A 2MOKA 2C9ZA 3EQ2A 3NOXA 5DYTA 2PUWA 4EO9A 1TUGA 2ZR7A 3E48A 3LKDA 4EFKA 4QIHA 4D56A 2HSZA 3NXSA 4UVGA 3UJ7A 1RRPA 4CUKA 5MGNA 5B4TA 2A5DA 1OX5A 2A9QA 2VHEA 2YCLA 3P9CA 5LN1A 4REQB 1S4QA 4LVNA 1IATA 3WLNA 2AQKA 1IDOA 3B20A 3D2AA 4HTFB 5J2TB 5BWLA 1T5DX 1I4DD 1NMYA 3LUGA 5E6RB 2MSCB 4WOJA 1CJVC 2IYNA 2BEJA 1TJNA 3AHEA 1REQA 4U8HA 5BVHB 1W34A 3SQNA 2WV7A 1XDSA 1ZH4A 1WZEA 4HR7A 3SS7X 1A9PA 2HJVA 4BY9E 4EHBA 1KNXA 1JHDA 5FPYA 4EH1A 2CUKA 4ZJYA 3I3SR 4MH0R 1E1YA 1J2TA 1TKRA 1VMAA 3OX1A 3RC9A 1KHHA 1GQQA 3MVEA 4ZAWA 3ZWMA 2X22A 4MLCA 5CDSA 3L7NA 3B2NA 3BHMA 2J9ZB 3VGJA 2BHRA 5BN4A 5F9FA 1H6BA 5ERGB 4JI2B 2OG2A 4D8VA 3WDKA 1O6CA 3UW3A 2V5VA 1QVRA 1HFKA 4QFDA 1PI3A 3TEJA 3VKHA 1IHPA 2FCRA 3N7AA 1YVEI 2JIBA 3NT2A 4FN4A 3TLGB 1ZBDA 1YCFA 1ESMA 4K88A 4U2DA 2IZ6A 2OZVA 3H9QA 5ARCA 4E2YA 2I2CA 1TX4B 1P5FA 2V7EA 2X0KA 3EQ9A 5HTKA 5E3HA 3FDXA 3IT3A 3K9WA 4YGXB 2QL6A 4HXEB 1WUTA 3SY8A 2DJ5A 2RIPA 4CIXA 1YQUA 3UB2A 1NNSA 1T3GA 3KKLA 1VJRA 4HUQA 3IAS6 2CB0A 1KJJA 3ZHOA 3ZW9A 4DIFA 1FP2A 2YC2C 5E95A 5L4SA 1SHUX 4A8PA 2H2HA 2ZWPA 3VDNB 5CYOA 5BPFA 1VB5A 1QHGA 1KMQA 1GHTA 1YDEA 4M9ZA 2H1RA 3OQBA 3W4IA 2GM3A 1I10A 2IZOA 1ZNZA 2GOYA 3DW1X 4UARA 4C29A 2HBZA 1US8A 1PUIA 3IEXA 3PC7A 4UEKA 3PNSA 2OR3A 3BE6A 2R6DA 2C7VA 2O8EA 1OU4A 1R2QA 5LUBA 3B89A 4A0RA 3D5QA 1W76A 3WYCA 3S68A 5C5EA 3M5PA 5IBRA 1K63A 3D8UA 4RD3A 4AW9A 4M46A 1JNXX 3PD1A 3EUFA 1TM5E 4GXRA 1VCIA 2VPZA 4RIHA 1ICIA 1NZJA 3X2EA 3HY6A 5A62A 3RLIA 1C7FA 5I7RA 2FN7A 2IUFA 3COZA 4JYCA 2FRXA 4TM7A 5LKAA 2FZWA 1N2JA 2PH7A 5FBWB 1NY5A 2Y1FA 1QFSA 4H7JA 4R8VA 4EKEA 2J7PD 3TOVA 2W6JA 5JZVA 1QHFA 2QVBA 3C3XA 3U7HB 1GZDA 4GVLA 4J1TC 2ZVJA 4ZOCA 2VP6A 3GEBA 4UU1A 3VJLA 4LX0A 2VPWA 5IJZA 3W2IA 4RO0A 3FAZA 3OZVA 3CBGA 4HMPA 4JDUA 5JD6A 3PFGA 4IIUA 5CUQA 1YJQA 1M2JA 3G1TA 1KQOA 2O2JA 4ZVMA 3ZCQA 4JXKA 1YHNA 4PSCA 5CNIA 2PXHA 2P3SA 3KOWA 5HZKA 3KVOA 2XQIA 2VN8A 4ESHA 1RE0A 5AHOA 2JD2A 3DEYX 2VQEB 3BSYA 5C7OO 1KYIA 1M8KA 2FN8A 2QM0A 3LQQA 4NE9A 5AUPB 5A2GA 1U7ZA 1W49A 1VIVA 4U7TB 4JOSA 5AI6A 1WY7A 4X6XA 4EB6B 1Z88A 5CB0A 2Y0BA 3ESDA 4UM9B 4D4GA 3BH7A 4EQ6A 2GKOA 1TT5B 4JVLA 3ZE7A 3WWDA 2UZ1A 1Q3HA 3P0JA 4D9FA 4GBJA 1Z6QA 2PSSA 4FSDA 3QTBA 1HDZA 3MJTA 2HLNA 2D4HA 5KHAA 4MJLA 5IF3A 1NUAA 2NSLA 1N7JA 4PWYA 4EW3A 2HHJA 5AD1A 2GJ4A 4ZV9A 4H9GA 3GLIB 3VPFA 1NN1A 4WJKB 5CVCA 1ISJA 2HPZA 3OF3A 2JCBA 4A27A 2MDTA 2TRSB 1QIGA 4GMDA 1G20A 1EXWA 1K7XB 1A98A 1XCJA 1SCAA 4MVYA 3RQIA 1HLPA 3QIVA 1E3TA 4EIWA 3H9GA 1MD9A 2GARA 3M5WA 4YBZA 5EJ6A 4K9NA 1X13A 1UBCA 4MW1A 5L3VA 3ZVKA 1LSJA 3KLBA 3SFTA 4I55F 4LF9B 3EOZA 4G0PA 4HEA6 4OLAA 1NPYA 2H00A 3GGGA 1GCAA 2GFIA 2P41A 4YECA 5LP6C 1D3AA 5JZBA 3UAZA 1QG6A 4OY3A 3LX4A 1ZONA 3CZMA 3ZLTA 2PNFA 2JAHA 3E9DA 4XWTA 3UWSA 3IE1A 3W79A 4Q7EA 3C85A 1XVUA 2JEYA 3QKTA 3JAMA 2C2GA 3FLEA 2I4NA 5DPMA 2DT8A 3TYXA 5C4GB 1GGMA 1QF7A 1SA0B 3AK4A 3LD9A 2XNDA 2W6QA 1Z0AA 5I9TA 4C4TA 3SR3A 1JTVA 2UZIR 4I8DA 1QG0A 3VHXB 3SHVA 3U7QA 1E6MA 3CXRA 1WPQA 4E3WA 2QTMA 3GYBA 1T4BA 5IC6A 2EW2A 3CFYA 4TPKA 2W2KA 5HJ7A 3X1XA 1SKYE 2XUGA 4PFQA 4MPPA 2YWJA 3FTPA 2B4KA 1I3LA 3T3DA 2CLIB 4N3GA 3IURA 4II7A 2G9NA 2YHIB 3UV6A 4LF8B 1E60A 3IQEA 1AMNA 2CNNA 4Y2YA 4Y2PA 3IQDB 3EWIA 1P2BA 3OFKA 2AHRA 4IIEA 3EARA 4LC1A 4U9IS 4B9EA 2NVUA 3Q9SA 2IY8A 3GFGA 4WEQA 1JV2B 1RU3A 4K9LA 1WBBA 4RHXA 1HYQA 1JFTA 3KRTA 3TLJA 3EDOA 4KJZA 4UBNA 5TQ2B 3NB0A 2CBZA 2PEYA 1YDWA 4XSGA 3PPYA 3K0BA 4Q18A 1XXHB 3JRNA 3NTRA 3BTUA 1ORWA 3OPYB 2Y99A 3AL3A 3TZHA 5KNCA 4CV1A 1G2IA 3W5BA 1TVCA 3B78A 3H5IA 4NU6A 2HU2A 2F3PA 1RRKA 2Z57A 5C3UA 3R9IA 3IERA 3JQEA 2X9LA 3OLWA 5EP4A 2XT6A 4RF2A 4YLEA 1J42A 3SJ7A 1YS7A 1DKUA 1E9DA 2WG0A 4XCQA 4AN0A 1DINA 1K3UB 2JAPA 4N7RA 2OC9A 2KE5A 4MKRA 1YQQA 5AVZA 2Z98A 1W1UA 3TCKA 4PYKA 5JMWA 2BTOA 2X8AA 3AX6A 3NBZC 3KFVA 4MP6A 1A9OA 5D5HA 3X3HA 1S96A 1W4BA 5CURA 5F2OA 5EHXA 1GTMA 1XKXA 2R6R1 5KNCH 2XIQA 4EBBA 2YRXA 2I29A 5FLKA 3HTXA 6ADHA 1UK8A 5K0JA 4IXWA 1WCYA 4NBKA 5KQLA 1U7WA 4QOEA 3QXXA 1GYQA 3B70A 1H4TA 3PB3A 1R0CA 2XB4A 3L18A 3OZRA 2VDWA 4JOBA 1WD7A 2FSFA 3KPUA 2BZSA 2I6SA 3E0XA 3QVKA 4HWGA 1XLUA 4HGYA 4IGIA 4JGGA 1G8GA 2JIRA 5SZIA 3QLJA 2EHDA 4HVTA 2B9EA 1LNQA 3N0VA 2EDAA 3FF1A 1TW2A 1JZTA 1Z4OA 4KFSA 3DT6A 4EJSA 1WXWA 5T3YA 1TZBA 1KVRA 4JP3A 3CNNA 2XDWA 3ZWBA 1U2QA 5HOQA 1RYMA 2JAUA 4LF6B 4I55B 2QX9A 3NQ41 3OE7A 4MWTA 3Q7IA 5HFJA 4GKAA 1SVWA 1YR7A 3WJ1A 1OWLA 1VFNA 2FOXA 3CRW1 1OGIA 3EEBA 3PUWA 2WIDA 4P54A 4I9GA 5EKDA 821PA 3M6FA 1AGXA 1ZHHA 1V8PA 4OKIA 1S1CA 3LBIA 4H0FA 3O9ZA 3VOAA 2NV6A 1EXDA 1A9TA 1N3LA 2VKQA 4J4HA 1U2DC 2FSSA 5HILA 4LN1A 1QANA 1FX1A 1ULZA 3GCWA 4C01A 2FEKA 2WM2A 4HDRA 2Z0MA 5H3HA 4BGEA 3ZXYA 4RZSA 1Q95A 4BMCA 1UK6A 4Z7QB 2F1KA 2HSGA 1TO6A 1BJRE 4Y2SA 5CLJA 1JAIA 1MDFA 5FA8A 1Q2UA 4LOHA 3G0DA 5KQSA 2IA5A 3KU1A 3TXXA 5ER6A 5BN3A 5K0TA 3B3QA 2CLHB 4RMNA 4B17A 1JDZA 1WULS 2WWIA 2ZSFA 2P6UA 5BR8B 2Z2IA 2EJCA 3N58A 1PW5A 3L49A 4FHDA 4IIXA 4IIDA 5BORA 2GXAA 1KAGA 4ZYYA 1L5VA 1P6XA 1O6ZA 2ZU6A 1R4MA 1ECGA 1KO8A 1Y3FE 1BXKA 2FG7C 2P9YA 4OSOA 3L9WA 4DILA 4YCNA 1HNXB 3HVIA 5JAIA 3UUWA 4QXMA 2QENA 3F49S 4JR1A 1KBQA 1KI8A 5F76A 3B1XA 3KDPA 2PWAA 3MA0A 4Q3BA 1Q6YA 3MTGA 1II8B 4OAQA 1H9BA 3NVAA 2GO7A 1OXUA 4HAZA 1KDPA 5D6NA 4GPBA 2VCYA 2X58A 5CDFA 2PMEA 1V1RA 3WP0A 4KNWA 4ZKEA 3WYBA 1SVIA 4X6UA 2XWBF 3FM9A 3IKMB 4ZO8A 1KDRA 4XVCA 5ITSA 1KH3A 1WSAA 4WK2B 3KZKA 1NRXA 3T52A 4XXHA 1V41E 2FPMA 4QODA 4JS0A 2C7BA 4M0DA 3SC2A 1MEEA 5KPDA 5IFLA 4MINA 2R7KA 3PQ7A 1RI2A 2H54A 4FOPA 3FNGA 1E89A 3AZPA 3MAJA 4I1UA 3DCIA 4QOFA 2J5XA 3HQ4O 2FUKA 1V3UA 2GAOA 3MAAC 3A4IA 4XQGA 1DO0A 5DTJA 3DV0A 4O08A 5SZHB 2V6FA 4L2IA 4IKPA 4OHUA 2OCXA 2PMKA 3TNYA 4JSRA 1NL3A 3EDRA 4NICA 1IONA 2F9MA 4C0WA 2XZDA 1BZYA 1EP9A 1SUWA 4LZWA 2R1ZA 2IV3A 1NZFA 3ZCRA 1EXMA 1GUDA 4U5QA 3UYKA 1JKMA 3WB9A 2DQ4A 5EIXA 5HUJA 2YDYA 2IGTA 5ES4B 3UMVA 1KS9A 1RXWA 1DEOA 4YUZA 2YX1A 2ZVDA 3WLJA 1P0MA 4R40A 5K3FA 1HFWA 1L6RA 3FGZA 4X1OA 3BWCA 1ZN8A 3JWHA 1FS5A 1V6AA 4IL5A 2PV7A 4KWCA 3VVLA 1TMKA 1VIAA 4CM4A 4WJLA 5JT1A 5DWDA 1Y8QA 1ZI9A 1PFGA 2E4WA 2UDPA 2X1VA 3I92A 5EPEA 5MDHA 4RK0A 3RYCB 5CDHA 3KUUA 3BSFA 3OU2A 3V1LA 3OZFA 4HEA1 5F9MA 2JJMA 4Q39A 4WFKA 1DBIA 2CT8A 2UUBB 3L41A 4C14A 2M6SA 3ZYZA 1KH2A 3RLFA 1T4GA 3FCXA 4ZMBA 5FYQA 3QYAA 2XVYA 4G5GA 2R1TA 3L7OA 4FOTA 4G5QA 4MVJE 4BOYA 4DPMA 1PVOA 2GUGA 2H7VA 1H85A 4LQLA 4B4DA 1V7QA 3COPA 3PNVA 4N0QA 3NANA 4ARVA 1WM1A 3C3EA 3ZXXA 4RGQA 2SECE 3A8TA 4OH1A 2XCTB 4IV5A 3EODA 2XZLA 2AR7A 2PX0A 3K8QA 1IDN1 1XU4A 4AJOA 2EFGA 5AJYA 4DR6B 1IB0A 1SB8A 2RDMA 1UPBA 3AU9A 5DTQA 1OXTA 2P9CA 3UQZA 5IWAB 1X15A 1ZJ5A 4F3KA 3UTCA 3DEZA 3ON5A 4KLCA 3IPYA 2V98A 3PUHA 3HC7A 3LJKA 2ID4A 4CIWA 1JFSA 1WWKA 4ZZ2A 4DC1A 5F12A 1YH3A 4O3MA 1SOWA 4RJJA 4BNVA 2HBRA 3GIWA 4PG5A 1JL3A 1YT5A 2QAJA 4BNZA 1PWEA 4EF5A 4OMDA 4YPFA 2YMPA 1V9SA 4FC7A 4CF4A 4UHJA 4JLOA 2IS6A 4JCOA 4E5MA 4I1OA 4EUSA 5D3QA 2HIGA 1UKAA 4DV6B 4GP7A 3BCRA 1KJYA 4XX0A 3F1LA 4MV5A 4NJEB 4L1KA 2OHIA 1VFPA 3ADBA 4K6HA 5HX7A 3LHKA 5IYZF 3TD9A 1G21E 2ATIA 2F1IA 1XZHA 4QGBA 2AKAB 4R1UA 3NOQA 4CMIB 3FBTA 1UMCA 3U4IA 2VYQA 3VUEA 4AUMA 3VM6A 3OIWA 2W6OA 2GDZA 2VDMB 5G0VA 4RORA 3BXZA 5IT5A 4GHWA 3VKWA 5K8VA 4LY3A 2CE2X 3NMUF 3DQPA 2WIAA 1VHTA 2Q6KA 3PX3A 4F9TA 2WHXA 3HVKA 3LGXA 1COZA 4PZZA 1N6IA 2ORED 4EQZA 5E2AA 2Q6LA 4RLFA 5BURA 3GLRA 5JV5A 3PEWA 4RGVA 1FUYB 2P9QA 2QTRA 3IPXA 1SQFA 1RHQA 3C7DB 4PR0A 4QL3A 3TZ6A 3TQOA 4CV2A 1BMFD 2VJLA 4IEEA 4R51A 4G4SO 3W8NA 4AO7A 1PV1A 2O5EA 1H66A 4HLUA 4PPYA 4FNGA 3F8WA 4E5UA 4MUHA 1DXOA 3BICA 3PHLA 2JFUA 1D03A 3QOXA 2NQ2C 4J0DA 1NQXA 1K7SN 2H9AA 4AMUA 9LDTA 2C4UA 2AOWA 2IDJA 1NVVR 3JQ6A 4MUKA 2ECOA 4O2AA 1L5MA 1FXWF 3DUWA 1LI4A 4R71A 4NEHB 4OLHA 3AU8A 5DDIP 1T35A 1KR5A 3JX9A 5A06A 4NESA 4X0EA 4JOCA 3NTOA 4R2LA 2WNIA 5JS1A 3RH0A 3W05A 4TL7A 3WGUA 3G0HA 4MCJA 1X9GA 4WLOA 5HE9A 3TGLA 2XXBA 3IPAA 3S1AA 4D9JA 3AM1A 1L5KA 1WVGA 1C4WA 3O7MA 1Z0UA 4A0HA 3RYFA 5IAGA 2KX7A 2Q3EA 5JMTA 2AX3A 5DM2A 3HKBA 4E1AA 4IJQA 3LU1A 2JGFA 3PJFA 4U9UA 5LZ5A 2G0NA 2H11A 4HJXA 4V24A 2MU1A 1Q0ZA 1HO3A 4X62B 4OHVA 3NP7A 1B3RA 1SWVA 3CRQA 3UMFA 2NUBA 7YASA 2UZ0A 2WSLA 2I9PA 4XSHA 1BQEA 1DC5A 3Q3GE 1YMUA 4DTIA 3N8HA 4M0CA 5CX1B 1RQPA 1RDFA 3KWMA 4LZLA 1W19A 3H1BA 5TMDA 1I33A 1Y5NA 2YHBA 3DT9A 3IMEA 4QOJA 4EGQA 1QH1A 4XJXA 2IYUA 3GN2A 3OPYI 5BV7A 3GVXA 1QYXA 3AI3A 2JJ2A 4TTRA 3T7SA 4LJ7A 1SC9A 1X7WA 1H23A 4OQXA 5IRCD 3K0HA 4O4LF 2LWIA 4JJ6A 2V7PA 5F4BA 4I3GA 5JXJA 4C30A 4ZVUA 4FHFA 3KELA 1X86B 4QWMA 1Q83A 5IYZB 4UPDA 2ZWVA 4B31A 3DEFA 2IL1A 4CM5A 4CM7A 2JGNA 4KXWA 3O8RA 1KIFA 1JECA 1J6UA 1MU0A 1YL6A 2B78A 2CLKB 3HYNA 4H0NA 5DULA 3DZCA 5HIJA 4BTLA 3O2JA 3ZJTA 4OCZA 1V8FA 5JJLA 2IU0A 1KOLA 5FNVF 4ZCRA 1TMYA 1QR2A 3ODPA 4TTAA 4D8YA 3FDJA 4NBUA 2IYWA 1GPH1 3L8FA 1CUCA 1ZNXA 2VNIA 3PTAA 2W7TA 3AUKA 4IHJF 3KSAC 2A57A 2H57A 2H63A 2P0AA 5ECYA 3DO6A 2FPKA 4DQ0A 4GUAA 3KWJA 3LSYA 5AJHA 4A6PA 1PR2A 2NNWB 4DBLC 1PJQA 4AJ4A 2DFLA 1UIMA 1T2VA 2A9RA 4YQYA 3ZV6A 4U7GA 4IDCA 3MCUA 2C8JA 3IP7A 1QP7A 4G1BA 2CFSA 2QJFA 1VPLA 3PRKE 4HSEA 4QGFA 1DP4A 2R5NA 1AXEA 4P53A 4UM7A 2OV3A 1YRHA 4V0QA 1LVGA 4YJKA 4QDZA 1P2GA 1TCCA 4Y2VA 3ULKA 3R3YA 3K9NA 2D8AA 1B0UA 4CEHB 2QT0A 1ZUWA 4HI0E 2GN9A 2MSNA 3KVRA 3ST7A 3WV4A 4QVIA 4TM8A 1COWA 2PIAA 4RQUA 5BQ3A 2YOFA 3GBVA 2IZ7A 1S2DA 4F6RA 3EG9A 4WKBA 4YMHA 4RLQA 3BFXA 5EWJB 2EC5A 1KVSA 2PXXA 3P4UA 3IXMA 3CVJA 3I62A 3W7VA 1WW3A 4LBZA 2Q7DA 1AU9A 2WJGA 2HMUA 2GF2A 4N1AA 3T3IA 1P0FA 5E9QA 2WUVA 1A9SA 4FTWA 1CF9A 2HW8A 1KDYA 5JAUA 1RABA 2X40A 3F9CA 3B8EA 4YAEA 1RYDA 2DY1A 5G1OA 2OQVA 5DIFA 1G8MA 5MN4A 2PL5A 2WYVA 4IINA 2VZEA 4J43A 4KLRA 4XM0A 2ZRGA 1LH0A 3BKWA 4MARA 3OQOA 1SBNE 1J0DA 3PNMA 4GZ3A 4JEUA 3VXKA 3ZY4A 2P4SA 5FUYA 4ZV4A 5C8VA 3LFTA 5DMHA 3LY7A 4BFUA 5CJPA 2BFMA 3DXFA 5EXSA 3SOZA 4AKEA 5JNTA 1DFHA 2R00C 2R8OA 3FBGA 2W4IA 3UPUA 1HKUA 3WFIA 1YZVA 3QWAA 4B0OA 4OM7A 1YFKA 2XD9A 1ZZEA 1P74A 3GRUA 3HKCA 4PRZA 1AQUA 4E1VA 1HA3A 1N7IA 5BSTA 4DQLA 2Q3JA 5K3AA 4G4SP 1O9HA 1JE0A 3JQQA 4S1OA 4CQLA 3FVVA 4O4LB 2O8NA 1SCUA 1DIBA 1V4NA 1Q1NA 1SMKA 4ETWA 4NCNA 3JWEA 8LDHA 2NO1A 1MX9A 1P9OA 4IDBA 3OKFA 5IM4F 4MKHA 4NS4A 5A4KA 5CEJA 3AEUA 4TKVA 4YQFA 4FX2A 5B2EA 1W5TA 2VF2A 1PT7A 1UAGA 2LRHA 1W30A 3R7LA 1XZ8A 3CEJA 3WX0A 1WXEA 3QHAA 2X19A 1P5RA 3SR0A 1I2AA 1QQTA 3OCWA 4FBLA 3CLRC 1GG5A 4C0BA 2QLJA 4RTOA 3FZYA 2PWZA 1Y7LA 2HI0A 4FD3A 2FZEA 1JLRA 4Q03A 4PRLA 3WAKA 1KBZA 3JQPA 3PP8A 1NMQA 3WGHA 3N2EA 3ZIAD 2QAGA 4OIMA 3RV4A 4V2IA 1IY8A 1PKEA 1GAXA 1M34A 3FMOB 4YRRA 4UFNA 3KE9A 3AFGA 3VI3B 3CZ4A 4MRAA 4TV9A 4B6GA 3AKZA 2WIKA 3NHPA 4EPTA 1TUBB 2C9BA 4GAEA 4NHEA 2A9KA 4ETMA 3E3AA 2X0IA 1ZU4A 3A7DA 3OY2A 4L75A 4DLLA 2ZYWX 2XCIA 2JDID 3INNA 5L3RA 1UBGA 4GT1A 2B98A 4IQGA 4POAA 3PJEA 4IG9A 4UAJA 4KR6A 3WJ7A 4EB8A 2YWEA 1PQYA 3KKKA 4XFJA 2VYCA 4YY3B 2WAXA 2G07A 1R9JA 3UA4A 4FLEA 1MRNA 2E1PA 3A31A 4UASA 1PJ2A 2ZUSA 5BYKA 4JC8A 3P20A 1FVOA 2HZBA 3DMYA 3ILVA 4AC9A 1B23P 4JL8A 2NUPB 2QA5A 5ED4A 4RFLA 2ZPTX 1CS0B 3QJYA 2AI2A 4PLHA 1R37A 2FWBA 2AMLA 3MMZA 2NPIA 3MS4A 1CJMA 4GRIA 2ZUWA 1MH9A 4RCVA 2XYGA 3BMCA 3NRCA 3WKBA 3KO8A 3NM4A 4GSYA 4TTJA 2JVJA 3O2SB 1SKAA 3NIDB 3QU4A 4OQMA 5CVJA 4TWJA 1ZP6A 2WMYA 3V2HA 1SOAA 1AZWA 2NT4A 2ZJOA 3HXPA 5D5QA 2V8BA 3CJQA 3NH9A 3SSAA 2HXGA 1NU8A 3NBFA 1P44A 4AUNA 1QK3A 1EJ6A 2GXSA 1TYBE 3KYIB 4FW9A 1NOKA 3D3KA 2ZCUA 4NBRA 5SY9A 4D0NA 1YK0A 2GS9A 4DRYA 3HHPA 2OECA 4HHEA 1TC1A 5ALNA 2VH5R 3BILA 5FBZA 1MRZA 1R4ZA 3COYA 1JEEA 1SH7A 1YZGA 3IOYA 4TYYA 3PWTA 1P91A 1OLOA 4XR9A 2E18A 1TCBA 4Y7CA 3DTVA 2E6UX 4JQZA 1KYQA 2ZPAA 5DGXA 4JSYA 3B7PA 3DONA 4ND4A 1NM5C 1VCMA 2C58A 1SRQA 1VLVA 2QU7A 3A4NA 4A16A 2ZUUA 5AM0A 1GPUA 4ZGGA 3G0GA 4N65A 1LA2A 3CF2A 4UMEA 4LYAA 1FC0A 2NW6A 5IBCA 4JJEA 3CVYA 4MWEA 1CJSA 5LWQA 1F9AA 3CU5A 3LZDA 1QSGA 4NNJA 2LCIA 1RAGA 3HCNA 5IMSA 1VSUA 2BUCA 1VBKA 2I2WA 3T3MB 4EB0A 1JEYB 4RD1A 1XJ0A 3F2VA 3ZKAA 1OC2A 1P39A 2BM0A 4YWHA 3QOFA 3VYVA 3DOCA 3H9UA 3L8YA 5KREA 4L15A 3M3PA 2JNWA 1H3NA 2NXWA 4PIPA 4OXKA 5I48A 2G04A 2HYDA 1G1MA 2JRLA 3EGEA 3GT3A 4UVEA 5BWNA 2P9ZA 3IT2A 1I1NA 5E1BA 2CJFA 3VV3A 1R0LA 3A9WA 4F2HA 1N5RA 2WF5A 4HBZA 4JBLA 3SQDA 3BG5A 3DFUA 1N6OA 4KV7A 3S8MA 3V4SA 3HVRA 1RXVA 4F8YA 5JYEA 3FB1A 4RANA 2IHJA 2VJCA 4O8CA 1AK2A 2DETA 4RTLA 4EEZA 1M1ZA 2X86A 2OQ2A 3RI3A 5HUQA 1Q0UA 3E8SA 1WKBA 4RSHA 1TA9A 4LZAA 1WNTA 4DJEC 1U3UA 2MR6A 2REBA 2VHYA 4N48A 3R3VA 2YV1A 2ZE6A 4L4SA 7ADHA 1FP6A 3FPHA 3GFFA 5AKIA 1W25A 2NUTB 1KMIY 3QFRA 1QFMA 1T6ZA 1X2EA 2BKVA 3BMQB 2J5QA 1E1NA 4HWTA 1JIUA 1LGYA 1GZ4A 4ZOEA 5J9FA 3W5HA 2V97A 1Z2EA 2O05A 4ZTZB 4GH5A 4WBSA 2PH1A 2Y3IA 1WZUA 1Z47A 3KTDA 1XWWA 3WNQA 5HZGA 3LZCA 1Z7YA 3JQ8A 3NUGA 3EUAA 3OO1A 3CNHA 3EMBA 3SZRA 5DRYA 1RRCA 1PN3A 4MPDA 4QBHA 1E2LA 2HCBA 4RY9A 1K8YB 3GMIA 3T7RA 1NBOA 4O4HA 4Y2TA 1XLWA 1M6HA 3L0YA 1NNEA 5C37A 3GPCA 3EBPA 5KC8A 1S4MA 1CRPA 3G79A 2GNAA 3O47A 1UINA 1Q16A 2PSJA 4RVGA 1F6BA 1YE5A 1EFLA 3FAKA 3PGKA 5T4HA 3U7RA 5KJFA 2TECE 2WWFA 1Y7PA 1E2PA 1Z4KA 2NPOA 3IBFA 1N57A 4BZZA 1GTZA 1PYGA 1DCFA 1RWMA 4YYEA 4BVAA 2A5FA 2PGIA 3QEMA 2W93A 3AR8A 2BEKA 3HS3A 3U48A 3FHLA 1OFHA 2EKZA 2OLEA 2QN8A 4J1NA 4WRRA 5DFAA 2VNAA 4XDZA 5AWFC 4II2A 1XROA 4Z0TA 4S0XA 3CA8A 4C7VA 4ZCLA 2PQ2A 5LD2C 4KR2A 2JIPA 1KIMA 2BWJA 3TSCA 2B8NA 3ZWCA 3WI7A 2EGGA 1E2FA 2IYAA 2B5WA 2VPQA 1T3SA 2GCIA 2P9GA 1NP7A 2I55A 1GFSA 3G2MA 5ES3A 1CRQA 4TX1A 2QGFA 3E5HA 3RRYA 1NNUA 3MS2A 4HJRA 1PJ3A 2NVWA 1O4VA 4ZHSA 2FRVA 3FPLA 5EJMA 4IIVA 4HNRA 4LWZA 3PUZA 3T61A 2ZIGA 2NAPA 1Q0RA 1LBHA 3H11B 5C1PA 1DKNA 4CRWB 1Z6ZA 2P9JA 1PVVA 8OHMA 2NM0A 2YYSA 4F04A 1OH6A 5HWSA 4CM3A 3U7JA 1IIBA 2V5AA 2V74B 2ZU0C 5BV2P 3M6AA 1HURA 5DHFA 2JW5A 2G83A 2GJ8A 1D2AA 4FXOA 1L8XA 3GJ3A 4PRYA 3TD2A 5JC8A 2HLDA 4HNVA 2QTCA 5LYYA 1OF1A 5C7YA 3ZE0B 3QX8A 1N0HA 5I01A 5FXMA 1L4NA 1K8RA 1V1MB 1EHYA 2VAMA 3BGIA 4LWQA 3VZCA 2QS9A 4AF6A 1GPAA 4ARZA 4EYKA 5CB4F 2OUIA 3PGXA 2W98A 3FCOA 3K6JA 1UPUA 1NN0A 3B9RA 4BRSA 2HF8A 4MVCA 3ABOB 3SEFA 1XMOB 1Z4LA 3DVAB 4OK6A 5JSUA 1TMGE 2HDNB 2VRWA 4QE3A 4E11A 1NMSA 3PKIA 1Q20A 2ZBPA 4N5NA 2BM8A 4CKZA 1EESA 2IUEA 3TR6A 2Z2ZA 1NUHA 1GEGA 1BVRA 1KVQA 2H1LA 2COKA 3FTQA 3L0OA 1KZ9A 2M6LA 5A6SA 4LXTA 4YV0A 1TFRA 4K6OA 4PCVA 5IVDA 4BYMA 3FA2A 1JYEA 2YKGA 1IN4A 1XDWA 2CJPA 4DNXA 1AE1A 3N2NA 4HQNA 4EI8A 4QZVA 1SKYB 3ZD7A 3BWXA 1TM2A 4FOLA 1ZVKA 1FSSA 2AFVA 4FMDF 2CWDA 2GH1A 3GHHA 4C3ZA 4OKSA 5JEDA 2ZIXB 3VDMA 1QIFA 2QUJA 3LTEA 3MRTA 3NJRA 4R8SA 1PSZA 2VXBA 4BYGA 2ESRA 3ZHBA 3IYLW 3Q72A 5IU6A 5A0VA 4KE8A 3DJYA 5EUBA 3ZZ0A 3RIYA 3I76A 5L4LA 3ELWA 2EKBA 1X14A 3S7TA 4QXOA 2X5OA 1QO7A 2WIJA 5JARA 1FQKA 1HI9A 3I34X 2CNKA 2OMKA 2XCLA 1UPFA 4I1IA 3PRYA 4MWOA 5EMJA 5BQ5A 3U6KA 1ACLA 1E7RA 1Y3BE 1WRBA 4FINA 3L9XA 4PPNA 3VSBA 2GILA 2B8JA 3HKDA 5JAOA 1J0CA 1PR3A 2D1YA 2I87A 2WF7A 4GPEA 4MUIA 5G2OA 4GR9A 4GRAA 3UC9A 4P4GA 3N28A 4BNLA 2OB1A 4HRAA 2HPHA 5CW2A 3C48A 1QRSA 2V7XA 2IHNA 1NZDA 4WIAA 5EZYF 4UTZA 3H1FA 1M6YA 1YJXA 1L5ZA 4DKXA 4BKOA 1E1QA 4WI1A 3MJHA 4DBZA 1SUIA 3FX2A 4WFIA 5DI3B 5EXEA 5KQMA 4INJA 4IOJA 2OXCA 4IUDS 5EA2A 4Q01A 1YZ3A 2MSDB 4DLWA 1EWTA 1BHQ1 1YSCA 4MEJA 3SC6A 2RK6A 4FR5A 3UWPA 5JFOA 3GZTB 4Y6RA 4O6VA 5JO0A 4UTRA 1UDXA 3I2GA 1U65A 2AN9A 4MIYA 4MKZA 1W85A 1QFZA 1RSZA 5JVDF 5BNFA 3CW8X 1OV6A 2BEUB 4RZIA 4R2HA 4PC1A 4KXNA 2OMEA 3FPFA 3JVEA 5TIIA 1J8YF 1R9GA 1ZUIA 1CQJA 4G0MA 1ZD2P