2OD2A

Crystal structure of yhst2 i117f mutant bound to carba-nad+ and an acetylated h4 peptide
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
296
structure length
291
Chain Sequence
MASMSVSTASTEMSVRKIAAHMKSNPNAKVIFMVGAGISTSCGIPDFRSPGTGLYHNLARLKLPYPEAVFDVDFFQSDPLPFYTLAKELYPGNFRPSKFHYLLKLFQDKDVLKRVYTQNFDTLERQAGVKDDLIIEAHGSFAHCHCIGCGKVYPPQVFKSKLAEHPIKDFVKCDVCGELVKPAIVFFGEDLPDSFSETWLNDSEWLREKITTQQPLVIVVGTSLAVYPFASLPEEIPRKVKRVLCNLETVGDFKANKRPTDLIVHQYSDEFAEQLVEELGWQEDFEKILTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for nicotinamide inhibition and base exchange in sir2 enzymes.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
molecule keywords NAD-dependent deacetylase HST2
total genus 94
structure length 291
sequence length 296
ec nomenclature ec 3.5.1.-:
pdb deposition date 2006-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1600.10 Alpha Beta 2-Layer Sandwich SIR2/SIRT2 'Small Domain' SIR2/SIRT2 'Small Domain' 2od2A02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 2od2A01
1PVDA 2Q27A 2Q5QA 1EFVA 3K35A 2VK1A 3HWX1 4UUAA 2PGOA 3JWPA 1HZZC 2AG1A 1M2GA 1E3TA 2C31A 2JLCA 4RMJA 5D7NA 2JI6A 3F6BX 4I5IA 4TWIA 1ZPDA 1PNQA 2EZ4A 4V1CI 2EZ9A 1XLTC 1Y9DA 1ICIA 2A1TR 4KPUA 4TWJA 2PANA 4L2IA 5K2OA 1Q6ZA 4ZP1A 1UPCA 3ZG6A 2VBFA 1DJLA 4JU8A 1M2KA 1U28C 2QQGA 4IF6A 1D4OA 2NXWA 4QPZA 4RJKA 2IHVA 1O96B 2OO5C 2VBIA 4GG1A 4JD5A 4JUCA 2H59A 4K9QA 4JUBA 1V5GA 5FEMA 5EJ8A 2VK8A 1M2HA 2QQFA 1S7GA 1YC5A 4UTVA 1YI0A 2EZ8A 1UPAA 3OE1A 4J1TC 4JUAA 4BV2A 2FR8C 4V1CA 4GM0A 5EJ7A 5IMSA 3U31A 4BN5A 1Z8NA 4J16C 3GLTA 4JT9A 5MFPA 4BUZA 4D5EA 4D5GA 4UU8A 4KXQA 4UTZA 4G1CA 3EYAA 4K9PA 4IG9A 5MF6A 2H4HA 1M2JA 2OD7A 4Y6OA 4BV3A 2UZ1A 1OVMA 2OD9A 1V5EA 3CLRD 4GP9A 2H2DA 5K6TA 1V5FA 5DGDA 2Q5JA 1YC2A 4BVBA 3GLRA 3D7KA 4FEGA 4X3PA 2H4JA 2FN3A 2H2IA 4MPRA 2UZ1B 3ZGVA 2BRUC 4GM1A 1YBHA 4C7BA 1QPBA 1YNOA 1MA3A 3JR3A 4BVFA 2Q28A 3FLMA 2H2FA 4BVGA 1PO7A 4FVTA 2AG0A 1YI1A 2JIBA 3HWWA 1PTJC 4ZZIA 2JLAA 1SZCA 4UU7A 1POWA 2FSVC 2WVGA 4JT8A 4R8MA 5EJ5A 4HD8A 5BWLA 3GLUA 2V3WA 4F56A 4X3OA 3CLUD 1OZFA 1POXA 4K9NA 4FEEA 3ZGOA 2OD2A 1S5PA 4Y6QA 1NM5C 4QQ8A 5EJ6A 3PKIA 2JI8A 2VJYA 2X7JA 5EJ4A 4Y6LA 5EJMA 1YHZA 3CLSD 5K6RA 1N0HA 4QELA 3U3DA 2IHTA 4O8ZA 4JSRA 5MFZA 4HDAA 2PGNA 3GLSA 1YTLA 2WVHA 2W93A 4F4UA 1T9DA 5BWOA 1U2GC 4UTNA 3LQ1A 2A1UA 4JUFA 4MZXA 2H4FA 4BVEA 2Q29A 5K3SA 1OZGA 2EZUA 4COKA 4FZ3A 4UUBA 3CF4G 3RIGA 4UTRA 1Q17A 3PDHA 1PNOA 3EA4A 4L3OA 1T9AA 3RIYA 1U31A 4GPEA 4K9MA 5AHKA 2VBGA 1Q14A 2VK4A 4MQ5A 2B4YA 1UPBA 1T9CA 1OZHA 1JSCA 2H2GA 5MGNA 1PT9A 3E9YA 2DJIA 4K9LA 4RMGA 1U2DC 3FSJX 4MPJA 4K9KA 3D4BA 4BN4A 1O97D 4C78A 1EFPA 5BWNA 2Q5LA 4UTXA 1M2NA 4IAOA 1BFDA 1PYDA 3F6EX 3IAFA 4JUDX 1T9BA 1YHYA 2JI7A 3EY9A 5FYQA 2WVAA 3PKJA 2HJHA 4KGDA 4RJIA 1Q1AA 5DEIA 2NYRA 3IAEA 1SZDA 4V1CB 4Q9DA 1J8FA 2EZTA 4BVHA 2IHUA 1PI3A 2JI9A 2OORC 2FWNA 4JU9A 4K9OA 4RMIA 3D81A 2H2HA 4MPPA 2FRDC 4RMHA 5EJ9A 1MCZA 4GM4A 3FZNA 5DGTA 5EJAA 3CLTD 4RJJA 2Q5OA
chains in the Genus database with same CATH superfamily
1FUUA 1OX6A 1EJBA 2P2ZA 3CSUA 1GPH1 2ZUCA 1C3XA 3EXHA 4BTEA 1G3RA 1KO7A 2GAJA 4EX6A 3H2SA 1GZDA 2FPGB 2QL6A 3D31A 4XUCA 3RFFA 3NDRA 1E2QA 1T6XA 4G07A 4C1NA 5E1MA 2GBFA 2IYYA 1DQPA 2VQ6A 5GM1A 2HW8A 3V2IA 3I9KA 5K0EA 4ZV9A 5CURA 2NU6A 3GYBA 4GOKA 3A3PA 2JFPA 3PUVA 4E21A 1W73A 2O8CB 4L27A 1TTHA 1GGKA 2JFBA 3TI7A 4QM6A 4GE3A 4XKJA 4YAUA 2PSDA 2H3HA 2ZS7A 2QTBA 3K96A 3EJ6A 1KEKA 3WB9A 5TS2A 1ZXLA 1IOLA 3HJCA 1ULZA 3WK9A 3B1FA 3COZA 3QKRA 4GKAA 3VM6A 3WDKA 1YF3A 1I3NA 2MSCB 4E2WA 1F8YA 2LR0A 3P2JA 2GI4A 1CVRA 1D3AA 4AKEA 2P1RA 4AG5A 1C3EA 3CBGA 3LGXA 3OY2A 2LD4A 1VP9A 3NORA 1ZNQO 2EFDB 1V5EA 2XUIA 1UBOS 4Y1FA 4C0LA 4L57A 3ELUA 3HPQA 3I1JA 5DGDA 5IAEA 4OSOA 5CDYA 2IS6A 4KRGA 4PIMA 1DUVG 4JOCA 2PUAA 1OWPA 4WXPA 3D0OA 4PVCA 3ZVLA 4D9GA 5BQ5A 1FRFS 4N3CA 4EPWA 1UDRA 2OENG 5JDCA 1YUNA 1KH1A 5D5QA 1EUDA 4K81B 3BMOB 1Q0QA 5F7ZA 4B6RA 1PO7A 1FDSA 1RP7A 1O5TA 4WVFA 2X4LA 3IUEA 3EUFA 4IHJA 4WEQA 1YT5A 2XWPA 2WK1A 5MHTA 1AHIA 2PL5A 4I5DA 2XEDA 2WB2A 1XU4A 2NVBA 4FCTA 2CHQA 3B9PA 3P0IA 3R8CA 1UXGA 4GOJA 2IW1A 4RDCA 1V8DA 2ZGVA 4WKCA 1HSOA 3JARA 2E5WA 4JC4A 3DW3X 4WZBE 5HJ2A 2QUIA 2ZRAA 3EGXA 4M53A 5E6SA 3STVA 3SYTA 3RVJA 1R4MA 2EW8A 3R3XA 3VR3A 1M9NA 4BB9A 3L8DA 4OLHA 4F2HA 1Y8QA 2HMVA 1G8PA 4OJNA 4QRIA 5JISA 3U5TA 3V8EA 1ZJWA 1RMQA 5HVNA 2Z5FA 4PTLA 3H9CA 2QL7A 2Q29A 3N5CA 3AFMA 1WM1A 2VZ8A 3LCRA 2XSZD 3L5KA 5I47A 1HL7A 5KTRA 5JCXA 4ED9A 1RZVA 2ID7A 3IVXA 4AJPA 1GGEA 1AY0A 3PUZA 3RODA 4F3CA 1CZHA 1PT9A 3K09A 3BJZA 1SU6A 4GF5A 4FOTA 3B3FA 5LQCA 1X7GA 2BBSA 1GEGA 4YAJA 1JIKA 5KCZA 4QC2A 2FWPA 4KGVA 3G13A 2IXEA 4ZVRA 3SDSA 1IVSA 5AW1A 4NEHB 4GSYA 4U2GA 1IONA 3AIMA 3GQVA 4GWKA 4JOQA 4PGFA 1SQFA 2P5SA 4KXMA 4MQFB 1XQ9A 2OOKA 1XZPA 4BO5A 5HUJA 1QMGA 2HRRA 4YT5A 4YFVA 5E7QA 1OWLA 2IYLD 3QEMB 4WESB 1FJXA 1T9GR 2DPMA 2D54A 1FU4A 3WKDA 5FI1B 3AJAA 1LGYA 1KOFA 2ZIZA 3QWBA 4KO8A 3TZ6A 4KL8S 4DTCA 4PNZA 4R31A 5B57C 3SC6A 4KNYA 1NJ1A 2E0IA 3KWJA 3WMRA 3QV1A 1I7LA 3DE6X 4TRJA 3ICCA 4OQFA 5CGQB 5D85A 2FEMA 4Q48A 4RE5A 5E4YA 3W04A 3GA5A 4KPUA 1GZVA 1U8FO 3RRJA 1RWKA 1U0RA 3EG9A 4LCJA 2E21A 1N5MA 4PLVA 2OOSA 4WXEA 2B34A 3OO0A 5F23A 1AS2A 3DKRA 3H05A 4TKVA 1P0FA 5C1IA 4YP9A 3ZHOA 1A4RA 1ZC4A 4Q82A 3CNLA 5AKYA 1QMPA 4RHUA 3OZ7A 4GI1A 3RUDA 3SZGA 1GZSA 3E22B 3AXTA 3A9TA 3FAKA 3P2OA 3PHHA 1AXGA 1JI3A 1U7XA 3D5QA 2QN1A 4RQTA 4ZO7A 4ZYTA 4UUPA 1LDYA 3MELA 4ON9A 4E32A 4R9VA 1VM6A 4PG8A 1LPSA 2CCGA 3N6XA 4WOPA 4UOZA 2H4HA 5AI0A 1U9YA 2FXIA 4NG4A 3OPNA 4IFIA 4TRRA 4XUDA 4CT0A 1UH5A 4WLOA 1XXLA 4M36A 2YX1A 1IVYA 1SHJA 1S3FA 2HSGA 3ER9A 1ZGBA 1E2BA 2BTQB 4LCEA 1NF2A 1IFXA 3TW6A 2VH1A 4OP2A 1AM4D 2HMUA 2UAGA 4I5GA 3ONWA 2UZ3A 3OQNA 3C8DA 4WLUA 4NMLA 4QUBA 4CG2A 3MGCA 1QG2A 5C8VA 3BCSA 2BH9A 3LYLA 4X0EA 3W7VA 1NASA 2QAIA 1BXGB 1DJMA 5TB5A 5IABA 1BXRB 3SSAA 4B73A 2ZXFA 1TEHA 2OL4A 4X5OA 3ZV4A 1PR0A 2PUHA 5K03A 3H2HA 2V7WA 2V7TA 3VSEA 4C7MA 1CG6A 1ZS9A 2JW5A 5CPBA 4MR7B 1A8UA 4DKXA 2OHXA 1HDIA 1XZHA 1Z8HA 2Z4RA 4Q5IA 3UWPA 2XB8A 3GFQA 1F06A 3HN2A 1TIPA 3PHJA 4AWBA 2OK8A 3U2QA 3D8RA 4WNAB 1YIOA 3DAOA 4QO7A 1SGWA 2CEKA 1XQYA 3DOHA 2ZI3A 3PWSA 4FGKA 4GW3A 1JV2B 5AK3A 3E1SA 3TI9A 3WJ2A 4DV4B 1VPWA 1U6IA 4P0PB 3Q7SA 4BVEA 5DHPA 2NIPA 3PNSA 3PDHA 4AJHA 4L3OA 2P78A 2SKEA 5JVDB 2VK4A 1FFXA 4P83A 3UMYA 2I62A 2DG2A 1DJNA 1G6Q1 1TVEA 3DEHA 4Q9JA 5DV9A 1LRKA 1PR9A 1VJ5A 3D4BA 2DR3A 3CNBA 4HYQA 5E3IA 1XRPA 1CP3A 1Z8FA 2I4IA 4EG7A 2J45A 4NMMA 1EUDB 1Y8RB 4M1EA 1CR4A 2ZR8A 3P9KA 3WGLA 3KZOA 2CVOA 2PX2A 3KFLA 4FYPA 4O4JA 3ZHUA 4EW3A 3HUEA 4JY7A 2PGLA 1GKLA 4FHEA 1TM2A 2P1DA 1QVWA 3DBRA 4AMVA 1N2HA 1SN7A 2VHZA 3PQEA 4HFNA 3EVFA 4YDQA 2F6RA 1BE1A 4ZCPA 2BFDB 3RUHA 1YOVA 1C1YA 1LSOA 4G2NA 4C76A 2Q45A 2K2WA 3B1VA 1X7HA 5DNEA 1V2GA 5AVJA 1QV6A 2I2XB 4LW8A 5DX1A 3DOIA 2BR4A 3O9VA 4M0PA 4ER5A 1ZZGA 1WMBA 2JGAA 1TUBA 3OG9A 1YR2A 4UAGA 4KNWA 2WAMA 3E7FA 3DXFA 4MDYA 1L5YA 2INGX 2VBFA 3B3AA 2VO1A 1X9HA 2FX2A 1NP6A 2QVXX 2WJVA 4RJKA 5DI3B 3V7FA 3QTLA 4YP7A 3J7AC 3ZWKA 3GAZA 1TLTA 1U3DA 2Y9MB 3MCAA 4AMUA 4KN9S 4J1TC 4OHWA 4A4DA 5HCNA 1ZUIA 2CWWA 3N0XA 2FE4A 5F3DA 2VJMB 1TU4A 2Y93A 3KE8A 1DTWA 1SCDA 4MYRA 5CK5A 4ACBA 3EYAA 1C30B 2G3YA 1N8NA 4TZ6A 3W2GA 1OWOA 3GX1A 3QGMA 2XTZA 3IVRA 5KTYA 1FXWA 3NMUF 5HFJA 2J67A 5JDCC 5LNK6 4GMDA 5EEHA 4CDRA 5JANA 1SXHA 1ORVA 1AKMA 3MS7A 3R3ZA 5FBHA 2ZREA 3BH7A 5BO5A 4FR5A 1E2KA 3O4JA 1XRSB 3TZHA 3C48A 4HTAA 4ND5A 5E7IA 1XZLA 4Z4CA 5J40A 1C9EA 1Z5UA 4C7BA 3BVPA 3NDJA 3ZKWB 2FLWA 4AZ0A 3LPLA 2H8GA 3I9JA 4WOJA 4EVRA 3BRCA 1DC6A 4YMTA 2X86A 1Y4SA 2PV0A 3FUUA 4PR0A 4QFCA 3OCUA 4WRRA 1PJ8A 4KPUB 2QT9A 2YCLA 1LBIA 2HGZA 3I1IA 4HR7A 2ACWA 5H02A 3WFIA 4KB5A 4S12A 3KCNA 2V7BA 1PFKA 1PE0A 1X9GA 2EFGA 3DWGA 3Q1KA 4UDNA 4Y9SA 1N3BA 1KRWA 3GLUA 4GLLA 1OGIA 1JJVA 1G21E 2HQSA 1A7AA 1VLLA 2OD2A 1Y1KE 1QPZA 2XT6A 2A4MA 2OXIA 1W1WA 1H2BA 2CHEA 2PM8A 3FSGD 4J1NA 5G0SA 4NCNA 1M8JA 5M5BA 4H1UA 5DSTA 3WBFA 1A69A 4FKZA 2QRHA 1T24A 2XNJA 3LHSA 4LE2A 2YUIA 3CX8A 3NETA 3UAXA 1NW9B 2HUPA 1RDFA 3R7BA 1PHRA 1BC5A 2A2ZA 5CTJA 3NVDA 3W6ZA 3TZEA 8ABPA 1PHPA 2IU4A 3ZDZB 2J1LA 5FOXA 1U2SA 3GR6A 1I30A 2EARA 2X8JB 3F78A 3PPXA 4JJ6A 1IHXA 4Q93A 4UOQA 4XQ0A 5BUCA 1DUSA 3MQ4A 1KZHA 3L06A 1ZVMA 3EC1A 3SZRA 1VG9B 1CQXA 10MHA 5JBNA 5AICA 4CL8A 4RS4A 1M7GA 1U2GA 3ETJA 2IS2A 1Q20A 3I8SA 3OM8A 5AD1A 3I3OA 3HZHA 4CT5A 1SG0A 2A9OA 1B1CA 1GA6A 2W37A 3EGEA 3PU6A 4WBNF 4LZLA 1A9TA 1HXHA 3JZAA 2FKAA 3UMVA 2W2OA 4PC1A 1M75A 4ID9A 2JFGA 5BMOA 4KQ6A 1XZJA 4Y2HA 1KFEB 1Z7GA 3BDAA 4RMHA 3AUKA 3IDOA 4KHZA 3NHUA 2H00A 3G5MA 1EFKA 3CLTD 4GGPA 4AP9A 2BHRA 1G9TA 1A4UA 4BNZA 1QH8A 4KVFA 3B5EA 2Q3BA 2VF8A 2D5IA 2PRJA 3OX2A 4LOLA 5DRTA 3S5JA 2HLPA 1WPGA 2GYUA 2QW1A 4NPHA 1RMTA 4AO6A 3MAJA 4BFLA 3HY6A 3IIKA 3S70A 1T6BY 2D3WA 3IBCA 1N2BA 4IILA 1SJ9A 1BA2A 1IE3A 1N6IA 3TMKA 2DKFA 5IM4F 3S2IA 2IP4A 2C2WA 2IPAB 4KMOA 3L2OB 4YV7A 1AA9A 1NVEA 1PBTA 3ELWA 4UZSA 3SC3A 4Z3DA 4UNSA 2A6PA 1AGXA 4U7WA 3KM0A 3FOFC 4PLFA 4XDZA 3K9HA 5ESWA 2B7BA 2VSNA 4DUPA 2Y1XA 4U6SA 5TNXA 3MHTA 1L3CA 2XNCA 1SQGA 3D0RA 2OQVA 4A2WA 4MW0A 1N2GA 3FZGA 2FEXA 2G5PA 4IG9A 4K2HA 1QGZA 3HRIA 4EKIA 4CCYB 4CM6A 5C8YA 3ZWPA 3NJ4A 3QU9A 2PXCA 1E62A 1KY3A 3BXOA 3SVTA 1XJCA 4UU0A 4CETA 1TVKA 5AJZA 4BO1A 1Q7TA 1R6VA 2GEJA 2HV8A 1UQTA 5L95A 4W5OA 4CQNA 4B3BA 4CQMB 1SQ0A 2A5GA 3I04M 5CIQA 4BWYA 1QGAA 1YOVB 2C83A 2I6FA 1JEOA 4QGAA 4RFLA 2AD1A 3MJSA 1HMYA 3FRHA 4U7GA 4UNIA 1FP7A 1D0SA 2CNLA 3NHPA 2TMDA 1A71A 1RI1A 2GYWA 4M0CA 1Y9EA 5K1ZA 2JIBA 3E9CA 3RBXA 3L1VA 2RDMA 2WNSA 2CMHA 4JFAA 4TYPA 3PPYA 1AKYA 4EQ6A 2N42A 1X77A 1XR3A 4JKYA 4RLFA 4ZOEA 1ZK0A 1W59A 3BMQA 3OU7A 4LNHA 3R8XA 1ZRSA 2XE8A 2D8MA 2EWMA 2WJAA 3J7TA 4F56A 4YAWA 2Z09A 4L9WA 5TPZA 1Q77A 1ZD2P 2V7QA 1VL6A 1IL0A 2JAPA 3LHKA 4US2R 2GN1A 3UCFA 1VPLA 2R7LA 2X13A 2FTKE 3HACA 2PVCA 3M1LA 3V97A 4OMCA 3EGWA 4R9RA 4ME6A 4CFYA 1S1MA 1PZHA 3VR5A 1GYPA 4CCSA 3N87A 3REQB 2JJ2D 4KXVA 1JFVA 1D0IA 7ABPA 2QQEA 3BD7A 2RHOA 4N76A 1KDRA 2AEEA 3ENNA 1PQPA 2FP3A 2CCJA 4N47A 1JJIA 1YXMA 3EAGA 1D2RA 4R5HA 4OFZA 1H2XA 5CHYA 3BCRA 3JRNA 3OQ1A 5GMOA 1DFHA 3TKYA 1Q3HA 2IX9A 2R86A 4A2CA 5F4BA 1UKAA 1YI8A 1VJCA 5L6LB 1FZTA 4ND3A 5AVRA 1EHIA 5IJ0B 1PJ4A 4V0QA 5CM9C 2PX3A 1E9BA 2PZFA 2PSHA 1S3SA 1GITA 1MQ8B 2OXEA 3F6EX 2B99A 3WIDA 2OILA 5A02A 5A7FA 3KFVA 4HN2A 4QWMA 1J2RA 4W1SA 4G9BA 3KPJA 1Z7BA 4IF4A 2IUUA 2DHCA 4G8DA 4BVHA 1I9CA 3MNFA 4NBSA 1ECLA 4PZEA 3PC7A 5IPFA 3F2VA 1P19A 4DRXB 1TJ4A 4Q4LA 4B71A 2BUAA 2VAWA 2WP8J 1GPUA 2X2OA 3F8TA 2CVHA 1WHTB 1YL7A 3ILXA 3M70A 4E2ZA 5CIYA 4I81A 5T8KC 5PGMA 4EOGA 3ZK9A 3SHVA 4KREA 3BIOA 2ZRCA 1FOEB 2QQ0A 3FYTA 5EWMA 4ZYZA 1OY1A 5B1YA 4NDAA 4BNFA 2QAJA 1II9A 3HWSA 1SCAA 1KBOA 2AWNA 4TS9A 5D1HA 3EEOA 4B81A 2CFIA 2PTHA 3UVEA 4XGNA 4ARSA 5CT4A 1IBKB 2I29A 4TKUA 1UJCA 4S04A 4X6XA 1RFLA 1BIFA 4IH9A 1E7YA 2C3PA 3EARA 2JFXA 3FTFA 5CDSA 3IULA 3UAVA 4ZQHA 3TXXA 1CIPA 2V03A 1PJSA 2P9JA 3BE4A 3EF3A 1GPBA 4JZYA 5AJUA 3OF5A 1N8TA 2VTKA 1L7AA 1T26A 3Q0TA 5LXTB 4LAFA 2ARKA 2F3PA 3G6WA 3ADCA 2XE4A 1B3BA 1BFKA 5JMWA 1QVZA 2JBAB 3P71T 3QQPA 4BQNA 4ESHA 2NO9A 3H1PA 3BXZA 5AKIA 2EDCA 4RDHA 2KSQA 3W2IA 2RMKA 3AF4A 1ENOA 4QM7A 3DTNA 3PNMA 4HYEA 3WL4A 3K0AA 3SVLA 3TLYA 3QI7A 4C6TB 1AX9A 2C5FA 1O1YA 3ABOB 1TYEB 3G5TA 4QT0A 1Z36A 2ZR0A 2VDLB 1O95A 4S1NA 3HDTA 4RTQA 2WUGA 3ZGXA 1XZAA 3N7AA 4DNQA 1Y4AE 4Q4JA 3DF9A 3KQYA 2OKGA 4O0MA 2I0FA 4XIFA 1Z0ZA 1BGXT 5CR9A 3D8TA 5I7EA 3PQCA 3PCTA 4FI3C 2XWBF 4PE5B 1YKSA 2XF8A 3ZI7A 3J80A 5G0TA 3FUXA 1YCGA 1FYFA 1OGJA 3EXEB 5C5CA 5LWQA 1CUZA 2BE9A 2ISCA 1U8ZA 3GDOA 5DFAA 1Z37A 5ALHA 3NHWA 4HF7A 3SFZA 1WDTA 2V7GA 3HWWA 1KORA 1VIMA 2EEPA 3WZMA 3ZHYA 2DBZA 2HJWA 3K0HA 1XPUA 2ZSAA 4KIJA 1W4AA 2V8BA 4RM3A 3TR0A 2WOOA 3VKGA 4MR8A 2YXLA 1FW8A 5DTEA 5IXJA 2IK8A 3C1TA 3GVPA 2V9CA 4OGGA 3OLXA 5B12A 1ZM2A 3DF7A 4RJLA 1E8MA 5KVQA 3CLSD 4HUJA 4HQOA 3F8SA 5EZYF 1I7NA 4IP0A 3RR2A 2QPAA 1UBJS 1ZGGA 4EB6B 1KP3A 1V45E 1VE5A 2AF3C 4P3YA 4U00A 3FNGA 1AHNA 1U94A 4RZXA 1FW6A 4FZ5A 3VSAA 2F43A 2ANBA 3BS4A 5CHEA 1VJTA 3CY6A 1DPGA 2VDNB 4EVQA 5K8IA 4GKBA 2EQAA 4LRQA 1Q5PA 2EQ5A 2CFOA 5HF9A 5HJ5A 3R3VA 4IUDS 4YUXA 5U1PA 1D6MA 1U0NA 2QDXA 4MO9A 3RCBA 1F2UB 3E22A 3H9EO 1D2MA 4P9NA 3OFNA 1E6UA 3SKYA 4ZQIA 3HFJA 4Q7EA 821PA 3T61A 1T9BA 3R5KA 3JPWA 1G8JA 4PPGA 2NO1A 3WE7A 4CR6A 4QVIA 4ABYA 1MFPA 3DMDA 1LH0A 1EZZA 3FWKA 4X63A 4NNJA 5KOYA 4UDYX 4UVGA 2HXSA 3QX8A 1ZVKA 1E1RD 3O8OB 3Q72A 2C8KA 4EF6A 1N1GA 1I7DA 4QVGA 2B98A 2B8NA 1JF8A 4MUXA 4G8BA 4KZPA 3VYVA 4EHHA 2DZDA 3DDCA 4IS2A 1F1BA 4N40A 2FF5A 3U81A 1W0KA 5AKJA 1PJ3A 2G8LA 3W5CA 2ZAGA 1PNQA 3MWFA 4MMZB 1O8CA 3LFTA 4MGKR 4YQEA 3OZEA 3ZU4A 2A8YA 1YRBA 1KZGB 2FG6C 4P53A 4TUYB 5DWVA 5JS8A 5KQGA 1SHLA 2I99A 3D4PA 3X2SA 2FWRA 2AJBA 1G2QA 1J24A 1Q16A 2V74B 3TLBA 3QZUA 2CK3D 4EGJA 3W9BA 3NBXX 4V0NA 2Z6UA 3RC8A 3T3EA 1KETA 1KOJA 2V98A 2ZI7A 4HDSA 4LEIA 4TRMA 1UZLA 4UU1A 3RU7A 3T41A 1KDTA 2AN4A 1NZJA 3CH6A 4L4ZA 4Q9AA 4C1BA 2GN0A 3N8KA 4E11A 5H81A 5AXDA 4WNAA 3FDXA 4S1TA 3VU1A 3GJ6A 3BWVA 4MWSA 5IAOA 5MF6A 3I8OA 1SZPA 5K3AA 4RHEA 1ZGHA 3E15A 4LQCA 5AK4A 4I3GA 3ILVA 2AR0A 4PRKA 3P4YA 1RM0A 2BZGA 4Y9UA 1SA0A 4Y2TA 1DQRA 1SXJC 1IY9A 4BQEA 3V2HA 2EL9A 4DIOA 3B2NA 3L7LA 1CRZA 4UCQA 1J97A 4KQEA 1GD1O 1KVRA 4GC5A 5GTDA 1YACA 1JLMA 2GS9A 3R09A 1C0IA 2WD9A 1NMYA 2MDTA 2O3QA 4WY2A 2O0HA 1WDLA 2J4CA 2XIQA 3GDWA 5B6JA 3FYCA 4ARBA 1U7DA 2JDIA 1MX3A 2GHTA 1CY8A 2YJ3A 3BJEA 3O1IC 4Z9AA 2W83A 1NW7A 4TOIA 5KWEA 1QR6A 4O2RA 1J49A 3HCAA 1Z2OX 1DWUA 1FYVA 1FNDA 1V8PA 2P41A 4J90A 1ODCA 4HQRA 4RH0A 3PI7A 5ADUS 1H93A 2RHWA 4ALNA 1POXA 2PEYA 2HU8A 2YVUA 1FPQA 3FTQA 2XZLA 5KU1A 1F3LA 4TXMA 2P79A 1RE1A 2XNDA 1T2NA 2GX6A 2HMSA 1W25A 3UCEA 2WU3A 1NZFA 1VCMA 4Q3NA 4BX9A 1MOPA 2J41A 2XHZA 3RBAA 4PZAA 1A0OA 1LBEA 2HR1A 2Y1FA 3UFBA 2YH2A 4RBNA 2H48A 4LXGA 3QVGB 1Y34E 2VEOA 4F1JA 4JLDA 1AXRA 4KIGA 1RAAA 2HU5A 5KSZA 2ZRGA 5ESDA 2VN8A 2VDWA 3QF4B 1YFKA 4MZDA 3ZE7A 1L1RA 3PX3A 4E7OA 3BTOA 4FDAA 2RGUA 4PW0A 4TVBA 4TS3A 3QKIA 3LUPA 2EW2A 2IYSA 1UJ5A 1YS4A 1HDCA 2C7BA 4K9LA 4Y8VA 5T4FA 3VVMA 3N74A 4DMGA 1YHNA 3PNOA 5ECDA 3V8BA 1E2HA 3CS3A 5K8VA 4MWTA 3OPVA 1Z6AA 2CCKA 2C29D 1OW3B 2SKDA 2O7VA 4YRDA 5L51A 5J2TA 1RLIA 4D99A 4M7WA 1T2FA 1NBAA 4QYMA 1P7PA 3DOOA 3DMTC 3H6GA 3V34A 3MCTA 4AAYA 3A25A 3ZBQA 1KZ4A 1Z38A 4O4IA 1N8SA 4XYMA 5TQVA 1OXBB 4DLKA 4HZUB 2ZSIA 1N6HA 3CUTA 2RBEA 4TTSA 2PSEA 3A1CA 3EXIA 4Q9HA 4DM4A 5BNWA 1BVUA 1O4VA 2ORVA 2VF7A 4OXYA 1G20B 5B2ZA 3TSYA 2ZTUA 5KNCD 4BO3A 1DVRA 1ZK4A 3EVBA 3A27A 5BQXA 5ES4B 1KOGA 5FDFA 2CJXA 3T5CA 3KT8A 3OMXA 4JJ8A 1YQ9A 3GHHA 3IHWA 1WP4A 4H7DA 3BORA 1YJCA 1YR6A 1DX4A 3HUFA 1BXGA 1XTTA 1IMOA 2GYVA 2GNOA 2P62A 2Q1YA 4BNKA 1R9MA 5G53C 3MMNA 1QV9A 2ZRIA 3ADDA 5A5GA 1ENZA 1K27A 4ER7A 2HY7A 3CLSC 3JVVA 3KKQA 5IH7A 1PFGA 3DMGA 3I6IA 3UT5A 1J70A 1CQZA 3G3EA 1NM5A 1I3OA 2NZ8A 4QPZA 4G09A 4GNRA 3EPHA 4MI1A 2O8FA 1ECFA 3BA6A 3MJEA 3ZZMA 1XN4A 2NNWB 4DV2B 1CRWG 1H1LB 2RAVA 2FR8C 2ZZNA 3R7FA 5CW1A 2QBYB 3VH3A 3NEAA 1NMQA 4CMAA 1R2QA 2VKTA 1RCUA 1U0BB 3V4VB 2NT3A 4B35A 4OFXA 5AW5A 3UKOA 2YHBA 4HBGA 2XYHA 5K8JB 4G0PA 4JKIA 1YOBA 5JXGA 4PC2A 4QHYA 4U0JA 4Z4QA 3NUGA 1AVTA 4KX3A 5F73A 4YCLA 2PX8A 3G2IA 5JHHB 2YXDA 1XDDA 3FHJA 3UA3A 3OHPA 4PTYA 5JV5A 3E35A 2AOTB 3H2ZA 2JGRA 1QIGA 5D51S 3W1VA 4YUWA 5LVAA 2VSXA 3OJOA 4D74A 5ECYA 2XJ4A 3DOUA 3GB9A 4HAYA 4P33A 3AHDA 5SY9A 1ZUWA 3AEKB 3U7EB 2KLHA 5FBKA 3E4DA 5C51B 2OHVA 4JVLA 3TZKA 2V6MA 2ZYVX 3JYQA 4DMMA 4QLBA 1MKYA 1JLHA 3NAMA 4MGIR 5TMDA 4DYVA 2BZ0A 2NYUA 1HURA 4XASA 3WDSA 5AQ1A 1QUFA 4NJOA 5K3EA 3AJDA 4E94A 3WIOA 2RIRA 4H16A 5G1NA 3AUUA 1EM8B 3ZXYA 1GLNA 3VRHA 5H3LA 1WBDA 2QJTA 3WVNA 4XYLA 2DFNA 1W88B 3EIOA 5J5VA 1G2OA 3IT2A 5B1DA 2E6UX 2XNDD 1ZIOA 5CBPA 4P3PA 1RD4A 4G85A 4X65B 3ZLJA 5IDXA 1JIJA 2D0OB 3IQGX 4MDFA 1PS0A 4JBGA 3LY8A 3BEDA 4TGLA 1ZP6A 5FWXA 2QRZA 4DLSA 3MOIA 4IDGA 1PK8A 4GXNA 1QRSA 1F7VA 3VUEA 4JLJA 5F64A 3LC1O 1E5VA 3OPXA 2WT8A 3HHPA 1NVVR 3HR7A 3IUMA 2ZJ0A 4NH0A 3S8EA 5EIXA 4TMKA 2H4XA 3B1YA 2IY7A 2ZB3A 4J9UE 3MIZA 2EG5A 3WYBA 1QHSA 2XTAA 5BV2P 4PV7A 4EA6A 3GFGA 1ZEMA 2UUBB 4WASA 3SSMA 4UCWA 1ADFA 4NECA 4D6YA 4ZOAA 4OQLA 1VL5A 1VIVA 3HEMA 4YONB 4ZXFA 4KMSA 5K3DA 3WO0A 2I6QA 2P3SA 2J48A 3VHQA 4YCCA 1WWKA 1DAOA 2WV9A 3AY7A 1LLQA 1A1VA 4B3SB 4HFRA 1R1DA 1H0SA 2LDBA 4M9ZA 3NRBA 1D6NA 3N8GA 4IXMA 4UNQA 3RC1A 3VISA 1HZZC 3WP0A 5M7EA 4XAQA 1IMJA 3LQFA 1GU0A 4KDFA 4XZ3A 2JVIA 3EZ7A 3MZ0A 4X1YA 3S4YA 2XVAA 4YRQA 3HZOA 3KQMA 1WVMA 2PY6A 4ERNA 4DLYA 5AKLA 2NO6A 5F4ZA 1KBQA 2CXUA 1E59A 1PZMA 5JSQA 2B2NA 1QHHA 1P0PA 1EK6A 2PCJA 1CJCA 1G2IA 3VSDA 1JHPA 3OLYA 1Y1PA 2VOJA 4DMCA 3GL9A 5IT4A 4IHJF 2XCQA 4ZVQA 4EB0A 1QHYA 1C30A 2POQX 3HB1A 1NNLA 1GHTA 1BDJA 3U7RA 3N9IA 3F7MA 3VZCA 2XF2A 3ZNNA 1H5NA 4OJTA 1XQWA 3BD8A 3GFTA 3PJRA 1AKWA 5CXSA 2JA2A 5ITWA 1V1JA 3BAFA 4B6GA 1Q1QA 2IITA 5A3QA 3GD7A 2WZCA 4N7MA 4HWTA 3S44A 4DA8A 3GLIA 4MWCA 4TV9A 1SULA 4NVRA 3WNBA 5EQTA 1IK6A 3AH8A 3SYKA 4D57A 3QH4A 3HFGA 4YDHB 1G3MA 5JRZA 1DCTA 3EEBA 1TUEA 3GA0A 1RS0A 2NAPA 1Z63A 5JIBA 4X7RA 2BFOA 3VR6A 1UFQA 2OZEA 5DXFA 2NUAB 2WJWA 3BQNB 4BN0A 4NBVA 3RIEA 3MILA 4DT1B 3W2HA 1UBFA 1PG5A 3UT6A 2A1TS 5G4KA 4DA7A 1FTYA 3QFHA 1GZ4A 2EGUA 3DNFA 3ML1A 1TJNA 2DX7A 3HU1A 2FN8A 2FPXA 4OBBA 5LQAA 2ZYTX 4S2EA 3USZA 2BISA 5IJ9B 1ZR4A 1Z4LA 5LZ4A 2RCYA 4AS3A 1IWOA 1NLUA 3Q7RA 1C5KA 2ZWPA 2HF9A 2Q6KA 4XLLA 2JI8A 4HGOA 5AXBA 3O8QB 1PJZA 1YZYA 3F8WA 1VCNA 3F1LA 2FMIA 3W5SA 4EUHA 4AJ1A 3IEMA 5DGHA 3R6TA 2JLWA 1E9EA 3D6UA 4WN9B 3E1KA 1UKYA 1CY4A 4BMOB 4DA9A 2R97A 5CFNA 2FY8A 4D45A 4DLPA 4KR7A 1U6KA 2AI1A 1KR2A 1KYZA 4FD3A 1MHTA 1SUAA 3RYHB 2EJUA 3H19A 4CLHA 5KYKA 3CH4B 1C8BA 3TE7A 5AUPB 3I23A 3AR3A 2ZB8A 2FVYA 5E4JA 3ROPA 5CVTA 4LA4A 4XOIA 4D4GA 1K6XA 1GQYA 3MLEA 4J0GA 4DXAA 4IJ6A 2WPNA 2V0CA 2AV6A 1EVKA 3JALB 4MQ5A 1SKUA 4TV8F 4DHWA 2WTUA 3OTOB 4AI6A 2C2BA 1VKZA 5H4GA 1CUSA 2W7TA 2ORWA 2QR2A 1RKBA 5IVIA 4DY4A 1ACMA 5HQ3A 4AM8A 4TN5A 4HAZA 1Z73A 1E89A 2XI4A 5HKAA 4F12A 1E3MA 5DEIA 2PDAA 2BM8A 2EJWA 4OQMA 4L0QA 4P93A 3IE1A 3V7NA 1B8PA 1U2EA 3M5PA 1O95D 4UXIA 1W9MA 2OCLA 1XO1A 1ZSNA 2WMYA 4IR7A 5BRAA 3GOHA 3EIFA 3LG2A 4RF3A 1PS9A 1WIWA 2ZJ2A 3Q2OA 4RORA 1Y8AA 4UOEA 3PNQA 7GPBA 4BLWA 2IKQA 1U9ZA 3TFQA 3UQYS 2ZRKA 3VR5H 2D5LA 3LKZA 3W5DA 2CF6A 2NLOA 4QDUA 1V1RA 1E9FA 1KZ9A 3HCFA 3OWHA 4OK5A 2A0WA 5C8ZA 3SC4A 1Y9DA 4JJEA 4DQXA 1W36B 4E5YA 1L9XA 4F4JA 3CCFA 3VZSA 2BEKA 4CFSA 2V7EA 1QAOA 3EIXA 3F5DA 1XALA 2WUWE 3EPPA 3HVUA 3NIBA 1AQUA 5IC5A 1P33A 1ZM9A 1EDEA 1LQUA 2R4QA 1QVAA 3IVMA 4LHZA 4LY3A 3VPAA 2PLWA 1TO6A 4JBHA 5LBUA 3MN1A 2AJ8A 2Y6VA 3H9JA 4PSKA 4Y2VA 5NULA 3HSSA 2VHTA 3LY9A 3PUYA 4OYRA 4D44A 2BFFB 2GAOA 2J32A 3BHIA 3EHDA 3TXAA 3WHLA 4NENB 9ABPA 1FFGA 2XA2A 4WKPA 3EVZA 4CMIB 3BTUA 1CUEA 2BSAA 3C7DB 1TC1A 3NBUA 4JA2A 4Y7DA 1OXUA 1DEHA 1RJEA 2IUSA 3HMKA 4UJ5A 1OVGA 4HNHA 2IUFA 3ADPA 1NFQA 3T34A 4MW4A 2V4MA 4I36A 1ZH2A 2W2KA 2B0CA 2WFLB 3T7DA 1LS1A 2VLIA 3UYKA 3QLEA 4XVUA 4TMWA 2IV3A 2F3RA 1QK5A 2Q3EA 2UYQA 3ZW7A 5C52B 4Y9TA 1Z3CA 3WICA 4XX1A 2QZPA 5INTA 2C4MA 4S05A 5UKDA 4BRSA 4DV0B 3S8MA 3K05A 4E88A 2RGEA 1EVQA 4AXBA 3HO1A 3T3PB 3I2GA 1PT6A 3BOSA 3T9FA 3TLGA 1TZMA 2R6ZA 3F6RA 3QWAA 5F3WB 1JDTA 2WA2A 2O07A 3V4PB 4HD8A 1CHDA 1IAVA 3N76A 2AFHB 1KS2A 1N1DA 3EY4A 3HVIA 3D8UA 1U7TA 4IO0A 2WKQA 3OIYA 4XD7D 5FFMA 1BX3A 2FF7A 3BFKA 4TWAA 1KHTA 1NONA 1U6JA 2GPJA 1F9EA 3JU3A 3QG1A 3ZQUA 3CVYA 3AIKA 3EGDA 2AFIE 1EE2A 2WSMA 4BWGA 2FCAA 3OD5A 3LZCA 3OCJA 3FKJA 4ZT4A 4ZHQB 4C0QC 4M9SA 1T9DA 1CUYA 1V1RB 1U2GC 4QLOA 4WCFB 3LQ1A 2ZETA 3WV5A 4RV4A 3URMA 2EZUA 1O94D 1CY0A 3EA4A 3IEUA 5FR2A 2O14A 4BX2A 3GFSA 3H99A 3PT5A 2O8VA 5B4UA 2OXTA 5LD2B 4E1AA 3ZWWA 5B2EA 3X3HA 2VRCA 5EG5A 3ZPXA 2G17A 1OMOA 1XD9A 1G41A 1I5EA 1FFWA 2H63A 2NQTA 2OUIA 2Y1GA 3E8SA 3EE6A 3WMEA 3ZJTA 3R5JA 1KK3A 2VNAA 1MRZA 3NTOA 3OJXA 4MP6A 4QUGA 4C06A 2YIJA 2HJHA 3CVJA 3RV3A 1Q1AA 1LQTA 4NR0A 3K70B 3G79A 4LF4B 3A6PC 1FVFA 4Q24A 4M8SA 1WOMA 1GWNA 1DWQA 2FSFA 4QGHA 1JR3E 1VKRA 5T41A 2HI0A 3T1QA 2OORC 3B85A 3FYHA 4NLLA 1J2YA 1OIVA 2H1LA 3ICQB 3AONB 1RJ9A 1A97A 1Y6ZA 1HYGA 2N0SA 4EJ6A 3UFXA 5LIPA 5HKKD 4PZ0A 2O3RA 3BGIA 1F8XA 1QRRA 3LW8A 4D46A 5JJCA 3BEOA 3CZMA 2A30A 3GRYA 1DOZA 3DE3X 2AMVA 4RJJA 3T5GA 2H5JA 3VR2D 4E33A 2GPSA 1Y6FA 4A0QA 4Z53A 2FX5A 1XKTA 3DTTA 4FBLA 4HFJA 1FF9A 3N2EA 4K6HA 1WQ1R 3DFZA 2OYRA 2IXDA 2NVUB 1KXZA 4KR3A 2PMBA 4YCNA 8GPBA 4HAWA 1E2JA 4QHTA 3H4MA 2MSEB 3G1UA 4JK3A 1WB9A 3KLOA 5HDQA 2FFHA 2DFLA 4MVWA 3NIGB 2NSDA 3FNFA 3G2QA 1CVLA 4WLVA 4JVSB 4X71A 4CCWA 3JWGA 4LS3A 3R0VA 3O2NA 5DNAA 4MW5A 4MK4A 1YR8A 2W98A 1VDMA 5K8UA 2C9BA 4LC9A 3TLGB 3JAWB 3V8RA 3ZN2A 3RAEC 2UZ4A 5CB4A 2QN6A 1JEYA 2YHAA 4MKFA 4YR9A 5ENDA 4F21A 5CLJA 2AUTA 4FFMA 4BAUA 4QVKA 2ECQA 1KAQA 3H84A 4GZ6A 3ZW8A 3QMMA 1ZD4A 1SOWA 5AH0A 4E1BA 2VEDA 2YHSA 3K5WA 4W5TA 4KXQA 1J8MF 3TRIA 5I48A 2ONCA 1XRQA 4DMLA 1FFHA 5FIUA 1OXMA 3K9GA 2AC4A 4BHTA 1NFRA 1YCHA 4ZI5A 4BNIA 2CKDA 2O1SA 521PA 1ZEJA 4OYHA 3DA8A 2GF2A 1G7TA 4I4TA 2XOKA 2O5RA 3JAKB 3RJ9A 3WGHA 2DLCX 2GKOA 1GCGA 4E2XA 1OBOA 1UFVA 3OWOA 5GVRA 4IGEA 4L7QA 1XTBA 4P32A 1BDHA 4LMRA 3F5FA 2NV0A 1A9XB 5AVZA 1OCEA 5I4CA 1OLOA 2HHJA 3EZ2A 1ZKDA 3B3QA 4LYFA 2ZANA 2Q7OE 1X7DA 3TYXA 3H1BA 4M8IA 1IYZA 2AJTA 5KSPA 2Z5VA 1VKJA 3MPUA 2AYZA 1XMOB 1AMUA 3WLSA 1NVMB 1IZ9A 1GCOA 3RREA 4RYDA 3PZRA 3D3WA 4LE1A 3IL2A 3FKSA 1TRHA 1U3WA 2FQYA 2I8CA 3ORRA 2GTIA 2HREA 3QYAA 1KWKA 5BWLA 1LNQA 4WOKA 3IAS1 1VQ1A 3R7SA 4DJEC 4EI9A 5HS6A 1G55A 2DFDA 1EDZA 4V3BA 1LBQA 4EJSA 3LUFA 2XNHA 4B80A 2NZ2A 5ITZB 4QBFA 3LWDA 5ITSA 1WVIA 2B2XA 5FPYA 6ADHA 2IHZA 3FDZA 5LYJF 2ZJAA 5K3FB 2NZVG 3BC1A 2KWIA 1LLCA 3LPDA 3MM4A 2PXXA 5CT8A 1XF1A 5C31A 1V8FA 4TTQA 3WBBA 4ZIRB 3RRZA 2R6CA 2VNJA 3NB0A 2WUVA 5IT9A 3GEPA 2BP7A 2HPZA 1EVYA 3TAXA 2CC2A 3N75A 4AUNA 3VNUA 1NW3A 1C9YA 4M2LA 4UM9D 1YE3A 3V4FA 3MQ2A 3EW7A 2C96A 4GXRA 2QTRA 4QTTB 3GLKA 1DKUA 3EQ9A 5FOTA 5H9VA 2Z8YA 1ZJZA 1RWVA 4WY5A 4AJJA 5K0JA 5BYBA 1AE1A 1XDWA 3N7UA 4FFDA 1U0FA 2O2GA 1J9EA 4NP6A 5ALOA 3X1WA 5CA1B 4K40A 2O52A 5CB4F 2G70A 4GE0A 5JS1A 3H5VA 2GTHA 2G67A 4X61A 2P9QA 4NCKA 1FSZA 3BCHA 5ELLA 1P6XA 4WZAA 1QHEA 4LVOA 4E5PA 3ABIA 2C94A 4DJJA 5BV0A 5JH7B 5EJ9A 5TLSA 3LUDA 2X4IA 1BYUA 1GRVA 3AM3A 4HLDA 5FUBA 1XNRB 3ZE0B 4D0RA 2Q5OA 3KR2A 4G2TA 5H68A 4O63O 3A4IA 1FSSA 3HBFA 3OQIA 4YASA 1BMDA 1DB3A 1E58A 4BRZA 1W94A 3N8NA 1L7MA 2J4FA 3GH3A 4FLEA 4LDRA 5IC4A 3NALA 3T7KA 1GTMA 1MGPA 4B46A 1B76A 1A3CA 4FBGA 2HHCA 3HCPA 2Y0PA 1CZOA 3QX3A 3A1UA 5G4LA 3RJMA 4LHEA 4EHIA 3LT4A 1QE3A 4L0DA 4LJ5A 3MJTA 1S7GA 1TIKA 1JSRA 1KSFX 1OLXB 1SIUA 1SUIA 2GK4A 2E87A 2O2JA 3DPSA 1X7YA 4PINA 4TKMA 3UJBA 1GIAA 1BSVA 2AEFA 1SNYA 3DTVB 3HBAA 3NOOA 4IMPA 4R8KA 3UWOA 2MSDB 4ROTA 4UBLA 2C5GA 1I33A 5DYNA 1M10A 4D6XA 1XXHB 1EVJA 4NBWA 2NU7A 4MYHA 4YC7A 1TYAE 2OCGA 2B36A 1NMXA 3NOVA 4AJ4A 2VYCA 3VDNB 2OESA 3GJYA 1PSDA 3BRQA 3O21A 3UUGA 3VYSB 3WGVA 2WZDA 4GUAA 1UR5A 4L6AA 4TPKA 1R15A 4YCMA 1LXCA 1VYVA 3O3OB 4DYHA 2ZE6A 3VR6H 2PX5A 5CAEB 3IP7A 4NE2A 1SOMA 3D0KA 1RC0A 3NHBA 1U9JA 4YQFA 2FOIA 3KCQA 1XKQA 4Q18A 4D4JA 4DDHA 1G8AA 2BHNA 1UPFA 4F3NA 5EJIA 4B3TB 5H3CA 3N6VA 2PG3A 1FUIA 1JBEA 1HKUA 3RUFA 2H1CA 2IIQA 5JZOA 2LUOA 2ZSEA 5KYYA 2BLLA 3UGJA 3FETA 4TMTA 2E49A 4ZRNA 1PG0A 1QDUA 4XD2A 4MIKA 4NU8X 5CP8A 1DCKA 4EO7A 4MAFA 1F17A 4CF4A 3O90A 3A4YA 3UK0A 2IXBA 1RCTE 1TT5A 5JSFA 1R9GA 3KQLA 3K8ZA 3NP9A 3I1FA 1I80A 3TPCA 2WF8A 1VHTA 1RNLA 3CCBA 2C59A 4DPKA 3P20A 1P7VA 5BT9A 4BBZA 1OTYA 5H5JA 3ZWCA 1H0HA 2JFNA 4HWGA 4Q4HB 4LBVA 4AP5A 4OOFA 2C77A 2MR6A 3N5KA 3CZPA 4PFSA 5HWSA 5F76A 3RSGA 3IMCA 1FVXA 1MC4A 4AY6A 3THXB 3DG9A 3RF6A 4BN4A 3DZCA 3SOPA 4KRYA 4I9HA 3QXHA 3K6RA 3R6LA 4YIHA 2F9LA 3MJ4A 1MB0A 3R3UA 5CNJA 3GLVA 2ODEA 2FW8A 3ZWOA 3ZZNA 1DU4A 3OJEA 3ZU3A 5TGZA 5LR6A 2R1TB 3BXGA 4UARA 3X1YA 1J2TA 2G9NA 1YJXA 1Z26A 1LPOA 2R8OA 3PL5A 4BNNA 4ENSA 4DR7B 1P2DA 2J0UA 4GKJB 1IVNA 1RSZA 2FMFA 4PAMA 4B5KA 1CEXA 1TUBB 3LHIA 4L74A 5BW8A 2GAIA 2OSBA 2WTEA 3L93A 5J5AA 3SIRA 1B16A 4BB5A 4DA4A 4PLHA 4H6VA 1XD2B 1FTWA 5DBIA 5TDHA 4AQ7A 2UYOA 3BWYA 3DYBA 1SBTA 2JVJA 3SQXA 1UJMA 1QOZA 2MSKA 3K8QA 4RVUA 1NPTO 3L7DA 4NS4A 3WKAA 3RYFA 4YMLA 2P9ZA 3ZDEA 1WR8A 1PJLA 3QEJA 1ZI9A 1TEZA 1V48A 2BEVB 3ND5A 1FU8A 1GVHA 3PPWA 2GRJA 3HR4A 4R1OA 1DO2A 3N05A 5CA0F 2FWMX 4NYIQ 1SOAA 1K8RA 2Z2YA 3AUAA 5D6OA 1ZGAA 4DY6A 1T2VA 4YRTA 2ZI9A 4IFEA 4B4KA 2UU9B 3H2JA 5EKTA 3A6JA 4P4LA 2PU5A 3UEOA 4QBKA 4JUAA 1F1JA 1PR3A 2Z83A 2EFEB 3KTAB 4N01A 3IKTA 4JT9A 4NBLA 1TAQA 1AUQA 2ZRBA 4I4NA 1RI5A 1R12A 1ND6A 4R1MA 4JLKA 2FYTA 1A7UA 4RPJA 4ZI7F 4HXGA 5DNVA 3GK3A 1K3UB 1X1QA 3IPAA 4YR7A 1IOVA 4E1VA 1IZ7A 1VIAA 4U2KA 3X0DA 1D9ZA 3EGCA 5EQFA 4KXWA 3SC2A 1Z4JA 3BMOA 3WFJA 3ZK7A 7REQB 5CCBA 4O6VA 2OYCA 2JD1A 4J0CA 1GXSA 2D2EA 2BMEA 2RJ3A 5ARDA 2RHMA 4CMBA 1XELA 3OQIB 4O08A 4OGFA 2JPDA 3OFND 3Q2KA 2BMJA 1W8DA 2I22A 4Q3OA 2QJOA 3A1TA 3ETDA 1NN1A 1CJKC 3UBMA 2C95A 4IDAA 3A3YA 1F6DA 2HCRA 1X70A 4H08A 1SIBE 5TV2A 2OXRA 1QUEA 2C4KA 4O4JB 3SEAA 4R8RA 4YLEA 3N2IA 4KHPB 1N6OA 3E1GA 3MTIA 5IG2A 2W00A 1B0ZA 4JT8A 1S02A 2J9YB 3WLAA 4LSWA 2B3TA 1XX6A 1TA4A 3ANNA 4UPEA 5HKOA 1E2MA 2BFCB 4TXJA 5E4FA 3Q3HA 1GAWA 2CGEA 2RC6A 2YIMA 2HBYA 1YFLA 2PNJA 1SXIA 4YVFA 5CK4A 5DW0A 4H1WA 1F5NA 4JC8A 1QAMA 3FBWA 5J9FA 4CLXA 2C61A 1GZ7A 2DWUA 5EC8A 4YXWA 7ADHA 5FWXB 5JVDA 1EQ2A 1J8QA 4Y30A 2QJRA 4F86A 3NHMA 1X1TA 1PFQA 2G9VA 2RK4A 3IAXA 4H35A 4P31A 3FNHA 4R2MA 4MGHA 3AEQA 3EEIA 4MMYB 1V7QA 1XXHA 1XYYA 4OJYA 4GYJA 2FDRA 4UCXA 4COKA 5MDHA 5H59A 3UZUA 2PS1A 3PFNA 3RG2A 4F5DA 4CKEB 1ADGA 2I34A 1P5RA 1QTIA 1A04A 2OC4A 2QMHA 5ICEA 2NZYA 3GLHB 3K0FA 3PXBA 5FA8A 4ZVKA 3C3MA 4FC7A 4HTFA 2J0VA 2QRPA 1XZBA 4FFWA 4HNGA 2IUEA 3PC6A 3FDFA 3L1UA 1CZRA 3Q8XB 4LY6A 3OQHA 1IRIA 4HAXA 3C8UA 2GF0A 1GCIA 2I2FA 3LCMA 4R6WA 4EFKA 2XH8A 1A2QA 1JG3A 1SVOA 2HRQA 2IHUA 2W6IA 1T5TA 3D3KA 1V4VA 3UAZA 3I5AA 2WDZA 1REQA 3D2LA 3KVOA 1ES9A 2FQ1A 1NDQA 1J0XO 4ZYLA 2QX8A 2MYTA 3EASA 1JQJC 4GM4A 1YFZA 1JHUA 3DV0B 4LI0A 5MN5A 3W7BA 2HO5A 3MK31 3MQFA 1GA4A 2R60A 4Q05A 3TG2A 5ELXA 1OH6A 2Z57A 2KBEA 4IFTA 2CNWD 1SUEA 5IUKC 2ZIAA 3DZIA 5IYZB 3L01A 1YS6A 3K5PA 4S2UA 4W5WA 2QW8A 1JMVA 3K20A 3OPYI 2B69A 1GT91 3CLUC 4U2CA 4ARZA 1BVRA 1Z35A 5KZMB 5TMBA 1CIJA 2WG0A 1YONA 5IKOA 3TLMA 4B31A 4QNRA 4A5SA 4DB2A 1QXSA 2I4TA 4JUIA 2VJMA 4Q4HA 4EG5A 4E22A 5AM2A 3R5XA 4TM8A 5B1SA 1T8PA 1R6DA 4R69A 4REMA 5D6NA 3JSXA 1A77A 4D9EA 1ECGA 3K1YA 4PAWA 3S6JA 1Y8ZA 2WU1A 3GAMA 1H2WA 3QVXA 4ARUA 3GW8A 2WFAA 2B5VA 2EGGA 2MMGA 3RC9A 2H11A 3FGNA 1O03A 1OFGA 2CXNA 2CFTA 3LC2O 4WN9A 1TCUA 4DJTA 5BPFA 5KJ6A 3R9XA 1XK6A 3BCUA 1YB1A 3PZBA 5FTLA 3F67A 2ERYA 3G0HA 4OHYA 1NNEA 1TU3A 3G7UA 4ND1A 3V1LA 3AI1A 5A9SB 4G0YA 4OIFA 5I8PA 1E1YA 2HQOA 4EGQA 4F92B 1ESNA 5IXSA 3FGOA 4IIDA 1CY7A 1P6QA 2G6TA 1MMFB 3LCJA 3LX4A 1EGMB 2DJ5A 2RD2A 3BYZA 5TPWA 5HF6A 3ZV6A 5HXAA 1EK1A 3C4JA 4HDQB 1WKCA 4MPRA 2EAUA 2DWCA 4FE7A 1VHJA 4KWTA 3STXA 3GY0A 5K20A 2BOVA 3KKPA 4FNMA 3RVBA 4FJ2A 5F78A 4YUYA 5IVKA 2FEWB 3DEAA 1S89A 4GXQA 3FY4A 3MWDA 2Q3DA 1IIBA 4QOHA 3I52A 4E15A 5KOIA 2ZSBA 3LRTA 1C7IA 1DEOA 1PKEA 1L8XA 3L6OO 5F35A 1OLUA 1MV5A 2H7XA 2V45A 5DLEA 2Z9BA 2JGJA 4GZLA 3NNSA 4WKOA 3UMGA 1KEEA 1G5PA 3CPJB 3Q7QA 5CX4A 3BH0A 4HAVA 4ZZ2A 1IHOA 5HIMA 3CEPB 4N0EA 1WU8A 4TLBA 3HFRA 4Q9KA 4DW8A 4DZZA 1Z34A 2O2SA 1KEUA 3HTXA 1L7NA 4J0KA 2OWEA 5LQRA 5HK8A 2O8BB 3ORYA 4DVJA 1UEIA 1ODTC 4ZGBA 3BMCB 4CF6A 1WNFA 2XLBA 3IUSA 1JAHA 3AU9A 4O4HA 4WLEA 4F5EA 4EW1A 1CUVA 2CFSA 4JP1A 1OREA 4BUCA 2Y3IA 3PLRA 2IH2A 3EA5A 2B8WA 1JKMA 2NUAA 1OLSA 2RBGA 2YOHA 3K1ZA 4HXFB 2RGYA 3Q1LA 4ZOLA 1UBCA 1GXSB 4GWGA 3GUHA 2F1JA 3S1AB 1XPOA 1EFPA 3T8YA 3BKWA 4BO0A 3GWGA 3PG5A 1ZH4A 2CB9A 2JL1A 2LP4Y 2Q3CA 4MUJA 4I46A 3RSSA 1MG0A 2OMEA 4WA7A 1P7WA 4BAGA 2AZ4A 3MOGA 3NXSA 5AVVA 4N82A 5ESRA 3Q8KA 2QEQA 2X9LA 2YZ2A 2FUNB 1DHTA 1NRXA 2P4UA 4KE9A 4GMFA 2FWNA 4JU9A 3PEWA 4ZAZA 1XJ0A 1J00A 4JCOA 2H0QA 1N7JA 2IZ0A 2ZROA 3K3PA 5KCMA 3PF8A 1IUPA 4I4TB 4R8SA 5K0SA 4DDTA 3I2HA 4B3XA 3KQVA 2ZWAA 3MT7A 3NANA 4ZDIA 1Z83A 3RHTA 5DNWA 4MHSA 4JBYA 2DHRA 4QAJA 3DD1A 1KDVA 2J30A 4RMJA 2B5OA 3ICVA 4PPQA 1W48A 2DP4E 3C5HA 4B6EA 4O4LF 5L3QB 4KH1A 4DIFA 4YHBA 4CNBA 5CFRA 3HC7A 2DFPA 2UVDA 4UVIA 5FBRB 4BJ3A 2OV8A 3BL5A 4IGAA 1CS0B 3W8RA 8ADHA 2I7DA 1AQNA 1WZUA 2OLKA 3IUBA 1D4ZA 3OC6A 4Q1FA 1J7JA 2YZKA 4KU4A 2QQGA 5BT8A 1VZ2A 2R47A 1KF0A 4ESEA 3DM9B 3EF0A 1VMEA 1OX5A 1YL5A 3MXTA 1YC5A 2QRNA 2OZPA 5CJ2A 4RLSA 1JI0A 2O7QA 2PK3A 1S6YA 2RG7A 1MRSA 2Y1DA 3KUUA 1DKLA 1R0KA 5BN4B 4DWWA 4GZ5A 2R6R1 1H6BA 4LYEA 2PZMA 3KFXA 2RI0A 5EPEA 3ZX4A 1W46A 4DC0A 2VWGA 3PDUA 1MX1A 3AW9A 5KBYA 2P6PA 2WYVA 2P0EA 5B3KA 4MNTA 5AW6A 2NTYC 3AG6A 4JHXA 1JR3D 2ZR7A 4P0QB 1GCAA 2FZGA 3SYRA 3THOA 1UBMS 1SKMA 4DCNA 2X7HA 1AGRA 1J1IA 1U1EA 1ILEA 3RUEA 2QIPA 3DOFA 4ZQCB 5H83A 2ENUA 4MV0A 1PDVA 2C54A 2JZOA 3ER8A 1J1ZA 3RKRA 2PZAA 1AKNA 1BW9A 2HIHA 3CVOA 5EIHA 3RIHA 3ZEIA 3KQKA 2CLCX 1ISGA 1P62B 2HWYA 5ALDA 3KWLA 2XJ9A 3RUCA 4BLQA 3LIPA 1J42A 2FSIA 3IQZA 2EVWX 5L3SA 2XW6A 1VP3A 3E2MA 1DRJA 4PXAA 5LBIA 3U49A 4IIYA 2J3EA 1XYGA 3KD2A 1X2BA 3KK0A 1ZINA 1SCBA 3RARA 1NSFA 1ESDA 4J9VA 3UWSA 1XRRA 2CBZA 5EZ5A 4PXSA 4IHAA 1KERA 1L8QA 3QELA 2PNFA 4YRIA 1A8IA 4AN1A 3URKA 3W90A 3MBIA 3B8HA 5DM1A 4IDBA 4HUTA 4R1LA 5IDQA 4FR0A 5CX1B 4JLNA 1E4EB 3KUXA 5D5HA 4F6RB 5KNBA 1RZ3A 1ISSA 2VCHA 5DHSA 4DLBA 2EBUA 4RELA 3JVIA 4UMFA 2RGNA 3OUUA 4UUQA 5F98A 5ADHA 1C3LA 5EUQB 5BSFA 1F0KA 3AF1A 1HZZA 2VTDA 1J20A 2JH9A 1SIWA 3SSNA 2RGCA 3R3SA 4HT3B 3JD2A 4Y6GB 1XNGA 1C0EA 5KOJA 4LJRA 3ZE2B 1JG2A 1B6TA 5LXTA 3FW1A 1IATA 2XD9A 3A1FA 3ESXA 1MOZA 1LTQA 4R3NA 1I2ZA 3NASA 4C07A 4MYTA 2IXTA 3FCEA 3LPNA 4HI0E 3FBGA 3KPWA 3O4VA 4Q39A 5G3ZA 2FMXA 2A67A 4IDNA 1IJEA 1J2UA 3MWDB 2ZPUA 4YJDA 4JELA 3ZOZA 3GROA 1T6YA 3OKAA 4S35A 3IAUA 1F3OA 2ECKA 4H6WA 4HFMA 4I55F 4MYSA 3W5HA 4BP3A 1ISPA 1ABFA 2H2HA 3WLRA 3ZWXA 1RLTA 3LQKA 2BGMA 4NDZA 5C18A 4I4CA 4URUR 2QROA 2YXBA 1VJRA 2XRMA 4F97A 1IHUA 1Z45A 2AMJA 4W8HA 1O6FA 1G98A 3TD9A 5BR8B 3IVCA 3NWBA 4BTLA 2OCBA 5SZIA 2YVKA 4I50A 2DFVA 3IAS6 1YA4A 3F4LA 3L18A 1SXJD 3G2NA 3NXKA 4U7HA 4EMUA 4K1XA 1PQUA 2Z2IA 2VHYA 2FCRA 4F06A 2ICAA 5KHOC 4ZJUA 4KSCA 2B8JA 2P9FA 4UQPA 3ANTA 4DYDA 4IF6A 3LF1A 3LP8A 1E66A 2XYPA 4JD5A 1AZSC 1EUCB 1N1MA 4OREX 3GEMA 4GI3A 4NH4A 5G0VA 5IJWA 4GS5A 2H4YA 2WLTA 1MO2A 1DDOA 5JCPA 2AC2A 4XPIA 1NT4A 2OGWA 4IIVA 4G8JA 3U31A 2CFRA 5JYEA 2PKRA 1IZ0A 1PJTA 2QTZA 2GLUA 2X0NA 3H75A 1KSGA 3EGDB 3KYIB 1NVDA 2E4ZA 1DCMA 4XSGA 1I7SB 2NP7A 3V1KA 1JVBA 2QENA 2YJ6A 1XCBA 2C9CA 2WINI 2FR0A 3KV3O 3N0TA 1JECA 2GLXA 5AJXA 2FN3A 3UW1A 3ZZ0A 4D9NA 1OROA 5JW6A 5K4GA 3AERA 4EUKA 1NLMA 1ZJ6A 4L8FA 4RKYA 4CF7A 5CH3A 2WILA 5FA6A 3LL7A 1KMHA 3T9DA 3HBJA 4YV2A 4DL9A 4C6HA 1PJRA 5FPQA 1LU9A 1RWXA 4LOJA 2GFHA 4IS3A 4DGSA 1Q0ZA 2BT4A 2GZDA 1UBGA 4H27A 1QORA 2YZGA 5F7OA 2CE2X 2YN2A 3DUWA 4C01A 1QRTA 1YZ3A 3GNTA 4XWWA 3B2EA 5TJHA 3W3AD 4LDNA 1YDGA 2AJCA 2ZBVA 1RJ9B 4Y6QA 3O8NA 3L82B 4FFLA 4FEEA 5DGCA 5G02A 1AMOA 2I4NA 3OF3A 3A6KA 5BN3B 3JVDA 1RTKA 1XVLA 4NPAA 5A0VA 1U8UA 2GN9A 1JKJB 2Z04A 1H42A 4GOXA 4OA8A 2OV1A 4WTOA 1N5IA 1LK7A 1HSZA 4Q1BA 4BMPB 2IT1A 4Q1VA 5P21A 4R9SA 3PFHA 5HJ7A 4D26A 5EA2A 2FAXA 3OH8A 4NZYA 4AT1A 1D6SA 5BQOA 3FMOB 2VUUA 2WAOA 1OZHA 4I3FA 3TZLA 4TTJA 1PWEA 2P4EA 1HDZA 1L5RA 1O5OA 1Z4MA 4DMUB 1FDUA 3G2HA 5LZ5A 1T5BA 1VI6A 1LVUA 4IJQA 4JUDX 4JDPA 1P39A 1QAQA 5BMVF 4HNUA 5JH7A 3PQDA 2ZP1A 2X3YA 1FRNA 3WRYA 1XQ1A 4XPIB 3PE3A 4V1CB 1VMAA 2VXCA 4EPTA 5KEIA 5KYWA 4O02B 1E9SA 3GN1A 3V6LA 3PHGA 4XA8A 3JRXA 5IWCA 3VNVA 4ZO4A 4JQZA 5EQDA 4AQYB 2FU5C 5L3SB 3UJCA 3O92A 5I9IA 2HK8A 1RMYA 2WG2A 4L51A 1J0CA 1VSUA 2BCEA 1JDBC 2G1PA 1SC1A 3ETHA 3G2MA 1PWYE 1EWYA 4A0SA 1Y5LA 1XZNA 3PFCA 1FCJA 2E4UA 3RSZA 5FUQA 3LXRA 4EG0A 2AG6A 3BMNB 3IR5A 3Q98A 1Z22A 3AKCA 3EDOA 5CBKA 4C2TA 4TWIA 3LWZA 2UUAB 1TADA 2ZT7A 3JQCA 3GNQA 3F90A 4JGBA 5JJ5A 2BDUA 1DO0A 3DT9A 5DXJA 3F3KA 1YB4A 3K7EA 2NMVA 3KB6A 1V43A 3P9XA 2X9VA 3N2GB 3OU2A 4KIWA 1WQ3A 4EQ6B 4H77A 3VZDA 4ENQA 2IHVA 1O96B 1V96A 2H6EA 4HDRA 4JUCA 5DK6A 2HBQA 5A04A 5JC8A 2ZZMA 2IS4A 1M2HA 1RJFA 1C9NA 1F4PA 2FI1A 4WXRA 2XWQA 2JFZA 5LLSA 3WWOA 4BB0A 1YU6A 3JQBA 4XFJA 3OIWA 4DCGA 2JHFA 3S68A 3IMGA 1V95A 4Q7KA 1PZNA 5AK5A 2REBA 3M89A 5LQJA 1M2VA 1N2ZA 1TEXA 3HSYA 2KE5A 4KQCA 4OI0A 3C0KA 4QJBA 4DIEA 1DXQA 3R75A 1VJDA 3RK4A 2Y4NA 1HE8B 2RKWA 4BEVA 2ZCUA 4D4MA 2C04A 5CB6A 1D6JA 4BVBA 2VUTA 4OB6A 2BONA 3HBLA 3B7WA 3PJDA 2GCNA 2HDNB 4YRKA 1JX6A 2OVBA 2ZWVA 2ZVQX 4H6XA 4NMHA 2YRWA 4QYIB 4R1QA 1M8GA 5H82A 3L5OA 4BCBA 2ZRDA 3OT5A 1KO4A 1SD1A 1Z0UA 1NF9A 4I8IA 4OXKA 4RPLA 2IX3A 2EF0A 1UDAA 1EFUA 3GEHA 4G86A 2QLBA 2QSZA 4NHOA 1X1AA 2XUHA 4U2FA 1DLIA 4ZO8A 2VXBA 4GPD1 3AR8A 2R44A 4G4GA 5IWAB 2I80A 2X2FA 1NIPA 3KTOA 4B6PA 2FEKA 2COEA 3I39X 4N9WA 3U6KA 4K0KB 3DC7A 3ZKWA 3IALA 4RX1A 1N2CA 5J3JA 1YRWA 5K8CA 4C0AC 1NFFA 3AP1A 3IQIX 4QPDA 1ZWKA 4NAHA 1J99A 1UUFA 3DVSX 3K2IA 3Q9NA 4CODB 4HYTA 1P4GA 1S2OA 3LQ4A 3PGA1 3VVCA 3VV3A 1X7WB 4EHFA 5K6RA 3GEIA 4ZEMA 4LBZA 3LT5A 1NVUQ 3CNOA 3G6KA 3L46A 4GSLA 1SB9A 1T15A 4ZI3A 5L53A 1WXIA 2YINC 2K7ZA 4AO8A 5BXYA 1LSJA 4C7JA 2E2WA 3VZQA 1JQ5A 2O3UA 4KI0A 2AKAB 2AZTA 4OCZA 1KYXA 2XD4A 4MYCA 3D2CA 4ML3A 5EMHA 4QGBA 2YJNA 2I66A 2I78A 4ZVLA 1U8TA 3RS2A 2EGHA 3JSAA 3QWFA 4HNAA 3ZTTA 1VSQA 1KZ1A 3P5BA 2X58A 3UXYA 5IARA 3MS2A 4IAOA 1V1MB 2JJ1A 1PYDA 4FMCF 1L5MA 4Q02A 1KOLA 3SM9A 5E4TA 1DI0A 5LB4A 5AVKA 3V1TC 4FCWA 4YTEA 1PYGA 2L18A 2B94A 3DHNA 3QXSA 1GU1A 4GR5A 1USGA 3RAGA 4L28A 4US1R 5JS6A 4AY3A 3RFTA 3TRKA 2HCTA 1GPWB 1UPTA 1D8AA 2YDYA 1ITZA 1N0IA 3OPMA 3RUPA 3F0TA 5IF3A 1N2XA 4X7PA 2HDWA 4IKPA 1DBPA 4Y2UA 1H1TA 3A1WA 3JQFC 5JD3A 4YUVA 3NVKI 2C2YA 2BTOA 2RE8A 4CI0B 3TSCA 1JEJA 3KDAA 2WD7B 1M5RA 2JATA 3VOSA 3QF7A 3UGQA 3MERA 1TQ2A 3PX7A 1M2GA 1AQ6A 1SKQA 4BDSA 1V3QE 4BLSA 4PICA 4EKGA 2IPNA 2QJFA 4EX7A 4GGOA 4UPVA 4I5IA 1E1RA 2IEGA 3JQ9C 1GZ3A 1P5ZB 4K86A 4REOA 4LV6A 3L4JA 3KLPX 4JKOA 3TD2A 2Q9UA 1PFUA 1E77A 2CLHB 2REQB 4HPWA 2WTNA 4G4SO 5DASA 1XMPA 3NAQA 3JS5A 5D84A 1II8B 3KEQA 3W5UA 3QW2A 4D80A 3AVTA 1C81A 3LFHA 3I58A 2AG8A 3IIMA 4G4JA 2VDRB 4MQBA 3DDUA 4RETA 1T4CA 4JS0A 5JYCA 4A26A 3SAJA 3UENA 3T4PA 4DKJA 1PSZA 3RHSA 4RKEA 1P6UA 3O6VA 5DH9A 2OAQ1 1P7CA 4B3CA 2YRXA 3HYRA 4OHPA 3DSRA 1E1MA 1W88A 2IP1A 2FZEA 1RQPA 3JR7A 3T6KA 4DGQA 1GGFA 4JCCA 1O0CA 5F3RA 3R9WA 3B9BA 1TT5B 4AP6A 1K98A 1FMCA 1GILA 3FOEC 2P4QA 3NJRA 5IX8A 4W5RA 5F2KA 3G2KA 3IT3A 3L0ZA 2R7KA 2VT7A 4CKEA 1DFIA 3R0IA 5IJ9A 4D8VA 1V39A 3DDZX 3LVRE 2E7ZA 2ZYHA 2ZBPA 3KVVA 3B7PA 4KNVA 1AUVA 2HB6A 3UAWA 1ADJA 1M67A 5TT0A 3SQLA 2CJPA 1FP2A 3BRSA 1CERA 2OBYA 2BFEA 2O20A 4LDJA 1GM5A 4ZC1A 2PAAA 5REQA 3AEXA 3OSZA 2JFYA 3DAYA 5I7FA 2GZ1A 5DN6A 1RHKA 4EP1A 3WGUA 2AG0A 1PLJA 1TTPB 3FNQA 5L3ZA 3NHZA 3KJFA 4F6LA 4N7JA 5LFAA 2RI6A 4P58A 1G3IA 2IBMA 5A71A 3RRFA 1I13A 3C4VA 5DOZA 4D3ZA 4RZIA 5CFLA 4F96A 3B89A 3HVRA 1U2ZA 2ZIGA 3ITNA 1RYYA 4Q47A 4P1ZA 3AUJB 1OZFA 2YASA 1TPZA 2JZNA 3IAAA 4QUAA 3FF4A 5DYTA 5B55A 3QU7A 4IYJA 3ZE1B 3DL4A 2QJWA 4YUZA 2GTPA 1L7RA 1N7IA 2UUCB 3TKAA 1TGVA 3LLUA 4JSYA 4RKQA 5HQ3B 1N2EA 1CB7A 1KI4A 1OV6A 4UEJA 1QOPB 1XLVA 2G1UA 2XQKA 1X38A 2DE0X 2XXBA 3L7MA 3O83A 4LXHA 4MWZA 3ES9A 3BGWA 4OX9B 2QU7A 1QZTA 3GFPA 1OT3A 3EC2A 2C2MA 3AR5A 3A9CA 5BOSA 2Q8QA 4RZSA 5EE3A 4J49A 1J07A 3O73A 4ETNA 1ULTA 3U7QB 5T8KA 4QOGA 4UAJA 1W4LA 2GF9A 4B74A 5LQDA 1IHDA 1WEHA 4QQRA 2RGDA 3HB4X 3TVYA 3V8MA 4D3XA 1OH7A 2XB6A 3LSTA 4G97A 2R48A 4BVJA 1ILWA 5JNTA 4IX1A 1U0EA 3CLRC 3GJSA 2HEGA 3C5EA 3ISVA 3GRKA 4NULA 3AVQA 3LC0A 4PSUA 4NBNA 1G3UA 1NSYA 1XUOA 4K9OA 1P4JA 4M0EA 3LKDA 3UOWA 2B8EA 1FP1D 2YY7A 1UM9A 2MCFA 4EHKA 3GU3A 3UHOA 2XNKA 2WF5A 4B6FA 5JNRA 2WWFA 2PQ6A 3A9WA 1SIOA 3RTEA 5E8RA 4K05A 2D74A 1BMFA 3IJ5A 1VKOA 1HNWB 1P1KA 2EXXA 3GLGB 4XWKA 2FPRA 1GQSA 2ZTSA 3PCRB 3HU5A 3QKWA 5EERA 4CPDA 2AQKA 1DWPA 4Y6RA 2HF2A 1QTQA 2O8NA 2WLSA 1Q50A 2O8FB 2A9VA 1LX6A 1UPCA 1C1DB 1ORWA 5JPIA 4DLNA 1SU8A 3Q8WA 4DLLA 4LZNA 3GQBB 3C2QA 1A50B 3AFNA 4DCTA 1OH5A 3AVUA 4L0CA 4JR2A 4Q15A 3ZK8A 2J9GA 5JAIA 4MCIA 4L2IB 1NXPA 1DXOA 2QMQA 1UPAA 3OE1A 4LMBA 3U1VA 4MV1A 3ZU6A 3OEEA 3MT8A 1XAHA 5DTJA 5FLKA 2VRBA 3JQAD 2CLSA 5AM3A 5JY6A 3L41A 5AIAA 1QGUB 5LDGA 1EDDA 1JFLA 2YRFA 1N4DA 1OTHA 2VNSA 1GGVA 4FHGA 1LEHA 4TXLA 4P5PA 3T54A 4FONA 3V1YA 2QLTA 4BV3A 3K1AA 3GLFA 1LWNA 4J6FA 3QVUA 4MAMA 3C16C 4KPEC 1IXYA 4A1FA 4DV7B 1R10A 2Q5CA 3ROFA 4MRSA 3ME5A 2WW8A 1KJIA 4KFCA 1TKAA 2FPLA 5DP1A 1MXFA 2GCOB 4FEGA 1RBQA 4JJ7A 4NJEA 4TYQA 3V00A 3WLKX 4B09A 1P2SA 2CUTA 3NC4A 4B7UA 2R8ZA 2QRLA 1II0A 1YDEA 1NWHA 3O47A 2BCJQ 3ZE8A 2JAOA 3CUYA 1E3IA 4P5DA 1YI1A 2QR3A 1SAYA 2P4SA 3IA2A 3O3MB 1NC3A 3V4OA 3Q8MA 3CNHA 4QU0A 3R0ZA 2BH2A 4C05A 2FPPB 1GAJA 1X8JA 4M7OA 4CM9D 5CXUA 3SJBA 3O31A 3RSCA 5HK9A 3ESBA 1HEIA 2ZVDA 4RTNA 1JWLA 3KEOA 3IPXA 2AOVA 4B47A 1RQXA 3OPQA 3IB3A 5F21A 1Z2PX 1JTFA 4XTCS 4JROA 1AV6A 3VO9A 1GLGA 1S2NA 2EYUA 3BIJA 3L6RA 1GSOA 4ILEA 4YI5A 2EFYA 1BQEA 5BSMA 3U3DA 3T7IA 4JYCA 4MVJA 5IJ0A 4RACA 4JSRA 3GLGA 5A9SA 3KSBC 1JEDA 1O9BA 1SOVA 2XKKA 4WQMA 2VH5R 1A95A 8ATCA 3TAHA 2XMGA 2G9UA 3BE5A 4AD8A 4ITUA 3EZLA 2ZRMA 4DQKA 3ESRA 5EJ7A 1XZFA 1SUPA 2DTDA 5LP6F 2FZKA 2QI9C 3CWQA 3MMPA 4B8ZA 4PO9A 2RJNA 1KMIY 2IP2A 4KMMA 2RHRA 2BMVA 4PIVA 3FSJX 1E1DA 1SPXA 2YKGA 3U37A 1ZONA 4C78A 2C8LA 3VPBA 5KU7A 2AL7A 2IV7A 2OB2A 4M8LA 4H3KB 5CVEA 3W5AA 4RU1A 3AIIA 3SP1A 3S29A 1OI2A 3AETA 3GVIA 2LVBA 3V42A 3OZUA 4ZHQF 2HRZA 2VDOB 4ND2A 3DLTA 5EE9A 3W34A 5DM0A 4MJ3A 4YECA 2X9NA 5T3UA 4DA0A 2F1IA 1VECA 4PQEA 3DZBA 1AGPA 3FLBA 4UM7A 4A82A 5AI5A 3TFWA 5CJJA 1U81A 2BCGY 1AKQA 3TW8B 5ALNA 3ZBUA 2VA8A 3KC2A 3KLBA 3AVVA 1NP7A 1U0TA 4AF7A 3PJEA 2H85A 2PS0A 1E6EA 1I9GA 2IE0A 3QI2A 4BZXA 1O89A 2V59A 1RQLA 3AHHA 3HCEA 3KQPA 3LY5A 3AT1A 4G26A 1VIDA 4RKRA 3DDSA 3CF4A 1ZNXA 3F6SA 1ZNZA 1V37A 2BFFA 3GGSA 3GPDG 2PQ0A 4MSUA 4QASA 5HTKA 2Q99A 5DVZA 5BOSB 3CVWA 1IXSB 1H2EA 3MCWA 3O93A 1YCDA 3ZIUA 4UDXX 2GEVA 2QAGC 2DUMA 5EKXA 1BHSA 3DVLA 1MT0A 5GONB 2V65A 4EG3A 1JB1A 4MW7A 1N0VC 3C8MA 3M4XA 4HVAA 3L7AA 2ECPA 4BEJA 4EENA 5LU9A 2OZVA 1RHJA 1G8SA 3B6ZA 5LOVA 2VH2A 5FFFA 3CFYA 1Y3BE 4YJ3B 1KP9A 1JH8A 3LBHA 1WETA 3FCOA 2DTEA 3S1SA 4FWTA 1ZLXA 2YYAA 2XT9A 4AW9A 2R1VB 1OI4A 2XCSB 4L22A 4E5KA 5JO0A 3FWPA 2B1JA 2FOLA 3T5BA 2O4UX 1N1EA 2WU0A 4D3SA 3ZLVA 3STHA 1K2WA 4HGPA 3S7TA 2H4JA 2ZDGA 3RE1A 1G0OA 1E1QA 4ZMRA 1FX0B 2PX0A 3NIFB 4X66B 1ND5A 1XMXA 3OOHA 3CRMA 4TYNA 1D1TA 1J5XA 3E0XA 1K7SN 5CPFA 2CZQA 5LB2A 1YRQA 2FW0A 3FHLA 4KOEC 1Y81A 4R2LA 5AWFC 3RUAA 1BCSA 2GAFA 3BILA 2OGTA 3CLKA 3M2TA 4XVCA 5FUMA 4Z0NA 3BTVA 4O29A 4P98A 1QPGA 1KI1A 4IY1A 4MULA 2AXPA 4YMIA 1UKEA 5ICFA 2QTAA 3REFA 4RFSB 4YREA 3W2FA 3SXPA 2HXGA 2WG1A 1JT9A 2ZTHA 3KRTA 3GCWA 9GPBA 3D6AA 3HP1A 4FT2A 3DB2A 4IO1A 4L5CA 4RF2A 3SNKA 4GMHA 2DULA 4M38A 3M7IA 2H8KA 4R68A 1G7SA 1E0KA 1E5LA 1NW4A 5A3RA 1M72A 3K9LA 3TSWA 1QP0A 2WYWA 1CEEA 1DELA 1GG9A 3DOJA 1CJSA 1CLUA 1PX0A 5NLLA 1PNOA 3AGPA 1QHGA 1EINA 2OGUA 4ZZ1A 3N2YA 4BMZA 1CE8A 4K2AA 2HHLA 1K68A 3PUXA 4PSAA 4TM7A 4QD3A 3VDRA 3QTBA 5JCOA 1OXSC 1SUWA 4JL6A 3VSCA 5LYYA 3WLOA 1B6RA 4HNVA 5JROA 2QDKA 5EWMB 3WC4A 1CQIB 4G5YA 2ZSKA 1F9AA 3WRXA 1XDSA 2XOKD 1BD3A 3A1EA 4MVJE 1IB6A 3EXAA 3GFBA 4TTTS 5T67A 5CYPA 5AUNB 4L0MA 1GGNA 2QY9A 3P2EA 2G08A 3GCXA 2FRDC 3S7ZA 3TBHA 1PVOA 2O6HA 4GI5A 1FVOA 5HCUA 2OCAA 3OZWA 3VMMA 3K8OE 1T36A 3HWX1 1ABBA 1CF9A 1YGYA 2LBPA 1PCXA 4MWEA 1P81A 1QIJA 2XE7A 5DSXA 3P9PA 5JAPA 5KUTA 1TYBE 1VGQA 4UAUA 2P75A 3WYFA 2X0RA 1R6XA 4EYKA 1MT3A 1W36C 5ARBA 5HF8A 2A9PA 3VJLA 2DU8A 5K0LA 4F6CA 4F4CA 2G4CA 4AYTA 1T1RA 2DC1A 3U6BA 1PQYA 5ENVA 1JTVA 3FCAA 3TRJA 3I73A 2WAAA 1E8DA 4JMPA 1K7XB 1C3OB 3VNRA 2OYSA 1VSVA 1ZOSA 1HNXB 1ZMXA 3A1SA 3L6EA 4H6PA 5FEMA 1MQ9A 3O8CA 1EGHA 2O2YA 2H9IA 4I9NA 5HYVA 1WZCA 3PUIA 2C9YA 1KEWA 2JLYA 3E9DA 1RPTA 4HMOA 3JQGA 3IUPA 2C7GA 3E4CA 5AVTA 2X3UA 1OA1A 1V4NA 1XYVA 2CNDA 3ZIAD 2I6TA 1JH9A 1GUFA 4P0TA 2BMDA 1C9JA 1C1XB 3PVCA 1E7SA 2Y1KA 5HKKA 1LSUA 4JI0B 4G37A 4W1PA 3RGWS 1O0BA 4GQBA 3GF4A 3P5SA 2WB4A 4FGWA 2XCOA 4GAEA 4CLDA 3C45A 1F0PA 4ZK2A 4X6LA 1D1PA 3PJFA 3WSWA 1AKRA 2CJYA 3O38A 4PGGA 1CQJB 4YP0A 3ONVA 1QF6A 1Z33A 3E81A 4LF7B 4XVHA 3WKBA 4RCVA 4EAQA 4YI3A 4EZBA 3G5AA 4K3UA 1PGQA 2DHQA 3RRXA 4C5CA 3P97A 1P9LA 4M4SA 5KYWB 2PBFA 2QXYA 1L3IA 2GO7A 2X9QA 3S40A 1P72A 1W581 2W0MA 4UU7A 3WMGA 4J91A 5BYJA 1SC3A 3GFOA 4OXNA 3LLCA 1PEAA 1NQ5A 4I3HA 3RS7A 1PAUA 1TM1E 2ZIXB 4HZGA 1TCCA 1DKMA 2FDCA 3VTKA 3FOZA 3OQBA 4LC0A 1SHTX 1QQTA 4UUNA 4YACA 2CVZA 3E3NA 4JT2A 3RNOA 4TWBA 4A23A 1NVBA 1TF5A 4O8ZA 1UKCA 4O2LA 4EG8A 3QHPA 1O4WA 3LBIA 1TYDE 3DKIA 4N39A 3M4JA 2CLKB 5EYPB 3RKSA 4CU5A 4J4TA 3EQ8A 3LC7O 5KKCA 2DLDA 1L4UA 4RYLA 3WRVA 4TTRA 1QG6A 1KAHA 3N2GA 4NNOA 1HT2E 3R6WA 2ATIA 4KYUA 3DLAA 3PUHA 3IURA 4D1YA 4JYAB 2PZJA 2C78A 5BWNA 4QHSA 1M0EA 1EUCA 1JU3A 2Y0DA 4KKVA 4YO7A 1TIBA 4A8PA 3MXOA 5FYQA 2KHZA 3BXPA 3HN7A 3OTWA 1H6CA 3G2PA 1NI3A 4KYTA 2G82A 2JC3A 3OPYB 2PLFA 2IE8A 2TMKA 5BMVA 3K15A 5BWMA 1RI2A 1PNRA 5B5SA 4H1TA 2MYPA 2WHRA 2P6NA 3RAPR 4INZA 3CJTA 2IPMA 4NFLA 4ARVA 1GNSA 1MCZA 4ZMSA 3RS5A 1MW8X 1O77A 5ILOA 2PSSA 3E6AA 4DJFC 4XWAA 1YGPA 1EFVA 2E55A 1BNCA 1R6AA 1OD6A 1MQSA 2FB9A 2YWFA 5MN4A 4MI3A 1XCGB 3FTCA 1SBNE 3L84A 4WSOA 1XCJA 4RK1A 3F5MA 1VPEA 3HCOA 3HVKA 5B37A 3U62A 4GBMA 3H8VA 4MUYA 1N4AA 3AL2A 1QH1B 2ZBFA 1M1XB 2GRAA 2ZUUA 4XFKA 3A3KA