4WY2A

Crystal structure of universal stress protein e from proteus mirabilis in complex with udp-3-o-[(3r)-3-hydroxytetradecanoyl]-n-acetyl-alpha-glucosamine
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
310
structure length
308
Chain Sequence
b'EKYQNLLVVIDPNQDDQPALRRAVYIVQRNGGRIKAFLPVYDLSYDMTTLLSPDERNAMRKGVINQKTAWIKQQARYYLEAGIQIDIKVIWHNRPYEAIIEEVITDKHDLLIKMAHQHDKLGSLIFTPLDWQLLRKCPAPVWMVKDKEWPEYGTIVVAANLSNEESYHDALNLKLIELTNDLSHRIQKDPDVHLLSAYPVAPINIAIELPDFDPNLYNNALRGQHLIAMKELRQKFSIPEEKTHVKEGLPEQVIPQVCEELNAGIVVLGILGRTGAAFLGNTAEQLIDHIKCDLLAIKPDGFTCPITV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Universal stress protein E
publication title Crystal structure of universal stress protein E from Proteus mirabilis incomplex withUDP-3-O-[(3R)-3-hydroxytetradecanoyl]-N-acetyl-alpha-glucosamine
rcsb
source organism Proteus mirabilis
molecule tags Structural genomics, unknown function
total genus 105
structure length 308
sequence length 310
ec nomenclature
pdb deposition date 2014-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00582 Usp Universal stress protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12370 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4wy2A00
4R2JA 3MT0A 5CB0A 3AB7A 3AB8A 3CISA 4WY2A 3OLQA 4R2KA
chains in the Genus database with same CATH superfamily
2EVWX 3BN3A 3IBCA 1E7MA 4JKYA 2ODWA 1C1YA 2QE7A 4RMNA 3CZMA 1DC5A 1P3DA 4RTLA 4UTXA 3R23A 3OM1A 4HQLA 3FTFA 2B5VA 3OH8A 3ZHQA 5JS6A 5K0LA 1LW7A 4KPEC 3I2YX 4X63A 1TQDA 3D4LA 3OBBA 1SC1A 1X7XA 1ZH8A 4MWZA 2Z83A 3DKIA 4XDHA 5FA8A 1G59A 3DBHB 4K3UA 2G1JA 1JTVA 5KREA 1CU1A 4YP7A 3Q3IA 4N65A 2X8WA 3JVVA 1R6BX 1E3DA 2HV9A 3SVZA 3IEIA 2O0KA 3FHLA 2EP5A 4WBSA 1L9XA 5B6PA 2I2AA 1RHRA 3THYA 3L6OO 5CB6A 1MPXA 1DIBA 2BFNA 1M7GA 1HDCA 4IDPA 3ZHBA 2GPJA 4CDRA 4ESHA 2G1AA 4OHUA 3FSGA 4D3XA 1EFPB 1TF7A 2G1UA 3LY5A 3Q85A 2NNLD 2YMPA 3AGPA 1L7XA 4R8MA 1YKSA 4WXMA 5IT0A 1MEOA 4ZCLA 3UC5A 1MAUA 4MVJE 4WWHA 1W34A 4YT4A 4RSHA 2NYUA 1FDOA 3W34A 1VC2A 2ERYA 3E03A 1EG2A 4JLOA 5JECA 5DMHA 2FWBA 1QC5B 3PNQA 3IL2A 1FL9A 1U0LA 1M72A 2NO6A 4E07A 3LUPA 4P3KA 2NU7A 2LDBA 3BYZA 3IAEA 4FD3A 4LWOA 3UH0A 2E87A 4YMIA 4QNRA 3FPLA 1AKMA 1JIXA 2UVQA 1ORDA 2B83A 1NXVA 2FWNA 4QU0A 1ATZA 4V0OA 5AHRA 3BIXA 3PV0A 2JCVA 2WJHA 1NGSA 3PRKE 5IVIA 5C1IA 2VTBB 5I7SA 1WR8A 1KZ1A 3E35A 1SULA 1E3EA 3ZXSA 3L4KA 2BGTA 2Z30A 4EJSC 4BGUA 4LDRA 5JW6A 5HF6A 4PG4A 4B6QA 2FN7A 2JLQA 2O1SA 3HP4A 2MJLA 2WF5A 5CBPA 2FLVA 2PSFA 2Z3VA 5K20A 1HDEA 3Q40A 4OEHA 3G79A 5KVAA 2O8DB 3O4RA 4RIGA 4UE3S 1RFLA 3JWPA 3ISJA 3DTVA 1CHDA 3DMYA 1F4LA 3EPRA 5BPFA 2OC9A 2EL7A 4V03A 2CLOB 4PSAA 4WN3A 4W1PA 4NBTA 1JHOA 1GRVA 2PUEA 1CQXA 3E5NA 2X9VA 2RBEA 2YXEA 5L45A 5A0VA 4U39A 4PC1A 1ADCA 4A0FA 1FZTA 3W5DA 4AT1A 3ZU3A 1H4QA 2I2CA 3R4VA 3PJFA 3NOXA 4J90A 3OURA 2XITA 1OXUA 4GXRA 1GG2A 1MHPA 2XD9A 2ZSUA 5EINA 1KYZA 4MW2A 1NPDA 1YMQA 4Q7MB 4AO8A 4HLUC 5K6AC 2OWDA 1XQ1A 5IDVA 3OFKA 3PPXA 1AV6A 3OTHA 1A8SA 3LQQA 4L3WA 3RVJA 1SJ9A 3HVJA 2Y9PB 3L8FA 4M9RA 4PF1A 1ADBA 2VHYA 3K5HA 2C2MA 5AK3A 3RIMA 1DLJA 3NJRA 1GU0A 1GZ4A 1U04A 2VXBA 3DB2A 4C4OA 5AESA 2AFIB 1LJLA 1W1UA 2HU8A 3UV3A 1AN0A 1K75A 4X71A 2NYAA 4IDOA 5G0WA 3EPKA 1ZIPA 5IMSA 4YA6A 2I65A 2Q9BA 2WINI 3HWSA 3NOOA 4QOGA 2EZTA 1ZHOA 1KO1A 2JGDA 4K6OA 3VO1A 2HIMA 1YR1A 3WWDA 2DBVO 2PA3A 1BHO1 3I04A 4QUDA 5ALFA 3SSAA 4PYQA 1FRVA 3PI7A 2GBIA 4EUKA 5IJ0A 2NO9A 1QWSA 1TZ2A 3ETGA 1A95A 3NALA 3RJ5A 4JC8A 4KSCA 4EH1A 1HKHA 1MOPA 2OBYA 3A9UA 1IB6A 2AX4A 1YRQA 2UYOA 4QL3A 3VO9A 4NARA 1H85A 1YMUA 3JD2A 3OOWA 4L76A 4CJXA 4MI6A 5TR9A 5IRCD 1N57A 2QR3A 1V4NA 3NAZA 4IDEA 4DJDC 1Z0AA 2ZRGA 1P62B 2DLDA 3IQZA 2FPIA 5B37A 5GQSA 2B8JA 4DA4A 1TPYA 1VLVA 1ZMRA 4JKOA 2CW5A 4KI0A 4JS0A 4V1CB 4R16A 2LPMA 4OMUA 4EVRA 4DLSA 5LIRA 4F1KA 3U7QB 1S2IA 3OI7A 1FTNA 1VJRA 1EFVB 1B8OA 2H85A 5HGXA 3N58A 4CBVA 2WUDA 4KWHA 4Q3EA 4DAEA 3GLTA 4INOA 1TRHA 4YVFA 5KTPA 2R751 2JKZA 5THQA 3ZDRA 2VP9A 4ZRDA 4G4IA 3BQ9A 1YR9A 2QVZX 4DIFA 5DHQA 2BHLA 1ZVJA 2DPGA 2WPNA 3PICA 4HDRB 3W8EA 4UTVA 2P7IA 3I9OA 2B35A 2WUGA 1F51E 2HPAA 1E61A 2IXDA 4KCGA 4XJSA 4ZC1A 2YWBA 4OMDA 2O3QA 4A6XA 3BIWA 4M0CA 5TVGA 2GO7A 4ER5A 4DJAA 3ZJVA 1D2GA 5AICA 3T5MA 1LCIA 4B3GA 3P71T 4ZEMA 3HACA 3R0QA 2JGLA 5HIMA 4P92A 5FI1B 3V4SA 3F7NA 5EE5B 1ADJA 1RLJA 2HSDA 2Z5VA 4R69A 2PEZA 1KZYC 4NNOA 2VLIA 1CUEA 1QLHA 3BGIA 4L4RA 4B6RA 3NIBA 5KDOA 2F1OA 1SURA 3DEHA 4FLMA 5EXTA 3Q3JB 1G66A 1I5RA 2DFTA 2C3YA 3SIWA 2DJ5A 3AC0A 4EUNA 1WVIA 3ZDCA 2WHXA 2AT1A 2IEBA 4QGFA 4JYZA 3CW8X 3KPYA 4H31A 4NULA 1IUPA 1UT6A 3DHWC 3ORYA 2HO5A 4H0CA 2HRRA 4L08A 4ZO9A 2XTJA 2V98A 1LF5A 1N7GA 1R9GA 1WNTA 3A9RA 1ANKA 3KFVA 3DEFA 1TT7A 2BFBB 2PNJA 3T34A 5LQCA 5DM70 1SD1A 1I13A 4LNUB 1HT1E 1J8QA 1PR1A 2CHUA 2QK4A 2H2FA 4H0NA 4NPHA 3ZCQA 4EO9A 2Q2VA 1VE9A 3B70A 2OT3B 4KFTA 3ZBUA 3D0QA 3IP9A 3R44A 4YFYA 4EYOA 5TPZA 3Q7SA 2OP0A 4R2LA 3ZDZB 2KLBA 2EARA 4H35A 2IUTA 1I4WA 2A86A 1H1TA 2A9QA 5GV8A 1O7JA 2DKOA 3AL2A 4EL0A 1IVYA 1NRIA 2VPXA 4ZI7B 4X3CA 2AOTB 3SJAA 1MQAA 3SKXA 3OLQA 3IIMA 3A36A 5B3JC 3WAGA 3I5YA 1XPUA 3LC2O 1VCOA 3B5IA 3MWJA 4KWIA 1TU4A 4LA4A 2OLJA 5BWCA 2A3NA 3I9V6 2YUIA 3BRQA 5CIWA 2NLOA 1JKMA 2AX3A 1UT8A 2QXTA 4B40A 4YUXA 1QGUA 2K2QB 2JIDA 3KJXA 4QDJA 5ALUA 3QOXA 1NIPA 4RVOA 2G3YA 4BMNA 1QP4A 4X65B 1TEXA 3MRTA 3OHPA 2I91A 1YDGA 3S5UA 3HB4X 2XUIA 2FW6A 3OIDA 1XMOB 4HTAA 2QRVB 2XT9A 3GF4A 3RTGA 1YZHA 1W94A 5DTMA 4YRRA 7YASA 4FHFA 1SBYA 1Q20A 1TZCA 2DUNA 4MVJA 2F90A 3FROA 2MTBA 3E5HA 1W9MA 4JVSB 1Q19A 3OZ7A 2FN8A 2HJVA 2GF0A 3UKJA 1AHHA 1YD7A 4FD2A 1E3SA 1JLLB 2V59A 3OX2A 1E18A 1ZIOA 3LY7A 3T4UA 5D1NA 5FB3A 1KFEB 2IP1A 3TVTA 4AZ0A 4RH3A 4OP2A 2QAGB 2VL7A 2JEOA 3PGKA 1OW3B 1VSUA 2BI4A 1RJ9A 1D0IA 2PJDA 4BLUA 5B36A 4J07A 4RENA 1U4OA 4FDAA 3NC4A 1JHMA 1UBSB 4HI0E 3WMWA 3FKSD 3MTDA 3HHPA 2VJPA 1YFKA 1ZJZA 3JASB 1P7WA 5FULA 3VKVA 3EH1A 4I19A 4PBSA 4HLNA 5BQXA 3HXQA 2X76A 3LX8A 2BZ0A 3L4JA 3ZU2A 4JLVA 1TIBA 4KYVA 4Y2GA 1X9HA 1QYCA 4JDUA 1GKLA 4WLOA 4DY6A 2I4IA 1NHGA 4ZVLA 4CQLA 2H7CA 1N6NA 2D0IA 2B4QA 3A1CA 3OQMA 2CLLB 2KX7A 2GCOB 3RE1A 1QLWA 2YMQA 3JD3A 2P6MA 1NVDA 3AERB 4X20A 3C3CA 3ZXYA 2O8FB 1F5SA 1I9GA 1H3NA 1TFRA 2VUTA 3PVSA 4R9UC 4C4RA 1R1DA 2JIPA 1THZA 1YZVA 2P3LA 3MA0A 4HUJA 4NFSA 5I3ZA 5HNKA 2J9FA 4EW2A 1MP0A 1DDOA 1E58A 1BD3A 1JQAA 1J0DA 3DHEA 1OROA 2KQUA 1XTZA 2G40A 4HJXA 3WFZA 3EIOA 1R3DA 2V8OA 3I37X 4KIGA 4AZWA 5FL7D 2BEJA 3VJMA 3EMVA 4G24A 4KYTA 1U3TA 1SOVA 1XDBA 4FFBA 2R6R1 4OB6A 4XQ0A 5C8ZA 5F12A 1FFGA 2YV3A 3ZOZA 2WHRA 5JTTA 2A9FA 4BGVA 2YY7A 1R9JA 3I8SA 3HB9A 3OQ6A 3S0JA 1N77A 3GARA 2EXXA 4HEA6 3QE0A 2ZCVA 4R1SA 3AONB 3W8RA 3AWDA 4B73A 4C5AA 4MO9A 2YXBA 4KMRA 4F56A 2A5GA 1V5FA 2Y05A 2ZIXA 4A23A 4JOCA 4NFHA 1EUDB 1WXHA 3I39X 4KE6A 3PNSA 4AY5A 5IX8A 2MU1A 1M1YE 1OVGA 1R00A 3PUVA 2OV6A 3MG9A 4ZXFA 3L0CA 5F3RA 3ZDDA 2Q7DA 2G4VA 1B8NA 1DRVA 1RYHA 4R98A 3H19A 1C0LA 4WOCA 1JI0A 1JGTA 4OJNA 1SUWA 2WT8A 1SXPA 4II2A 4B3HA 1VZ2A 3FKJA 5EWLA 3W8DA 3ANLA 5A4KA 3QMPA 4ES6A 3WL6A 2YOHA 4A5SA 2H59A 1BQ3A 4GPEA 1NW7A 3SVLA 4BNXA 2P68A 2MYNA 5J5AA 1TQHA 4NFYA 4P93A 4KRFA 5LKAA 1QPGA 2PZLA 3BSSA 4F2DA 4F5YA 2FW9A 1NOIA 3AFIA 2AE1A 3KJGA 3QJYA 3ED5A 4LZWA 1NZJA 1J2RA 1RCTE 4YREA 2N75A 4DOMA 5HVNA 3DMDA 1EE2A 3SAJA 4IMIB 4BZXA 1H2EA 4C0HA 2IYEA 4Q12A 2ZRCA 1L7DA 3NQ41 3LCMA 1A9ZA 1A96A 1V8OA 5CD9A 4AP5A 2WJAA 3NS7A 4NOLA 3ENZA 4LZNA 5JNRA 3KT6A 1MTOA 3Q88A 1EJBA 4YAEA 3ZHYA 2FN4A 5CBKA 3HC7A 1RM3A 4EEZA 2REOA 3FYHA 4KQMA 5I7VA 2V0NA 3M70A 2PUHA 3KUCA 4JJEA 4XJVA 5BRJA 1IQ0A 4GBED 3TINA 1ZGAA 2C9MA 3K0HA 5EE3A 3ZDQA 4D9JA 3KKZA 5AKHA 1BU5A 2C7VA 4B4VA 2PE5A 4GZ5A 1Z12A 1I7PA 3QUAA 4P98A 2RK3A 1MRSA 4HUTA 1OWLA 3OEED 1L4YA 4NCIA 4UZEA 3F8WA 2WU3A 3L1IA 3CH4B 1NT2A 3IAXA 4YJFA 5ED4A 2AN9A 4AK9A 5BQOA 2O2YA 2G8NA 1DC4A 1Q11A 3IDZA 4JBLA 5E1MA 3CO0S 1G291 5BOSA 4P4GA 3KVRA 1ECJA 3G8BA 4Q39A 5ALEA 5FOSA 5J58A 3SNKA 2VHXA 1FC0A 3KTAA 4HDKB 2A1TS 4BLVA 1H0SA 5J9FA 4OLAA 5G1PA 1U7WA 3FBGA 3GRYA 1G42A 1IN8A 5H9VA 3VPBA 1UDRA 3K2EA 1GQYA 2NPFA 4UDXX 3VNQA 1YDEA 4FOSA 3CUYA 2XRZA 3UW1A 1XNQB 4EVQA 3Q2OA 4Y6QA 2Q6IA 4B09A 3K5PA 2QEQA 1M2HA 3GCZA 1L5LA 3CT6A 1QRDA 5I8PA 2BRUA 1L3CA 3VSDA 3QXSA 2D3TA 3GD7A 2WWRA 5DX0A 1U7ZA 4B4OA 1ZK0A 4I4TF 4X60A 4N7BA 1UL1X 3C1TA 2I03A 3M1YA 5H3LA 2GLXA 4WK6A 3VO2A 2CEKA 1JSRA 3OUZA 4B6GA 4IIYA 5NLLA 4S0ZA 2FP4A 3QMVA 1RXSA 4FDUA 1OE0A 1XVIA 4XM2A 4HDSA 3NM5A 3TZBA 3WO0A 2FV8A 2Y76A 4IIGA 4RPIA 1YZFA 5ETJA 1PYDA 3SP1A 1HPLA 1V2GA 2OTCA 2ZRMA 3FYCA 2RCNA 4WNYA 4BP1A 4R2WA 5TS2A 2FSVA 3LLSA 2A7QA 4N12A 4B3JA 4M0UA 1MLDA 4IV8A 3RAJA 5JU6A 1UXGA 3KE8A 1WX1A 5SYMA 2COKA 1JXOA 4IO1A 4MLZA 3L4EA 3M6FA 1SGWA 3MTAA 4O6VA 4U02A 2A5JA 1IJEA 4Y2HA 1PT8A 1BS9A 4BZWA 3CMCO 2Z9CA 1NYQA 4B8WA 3GFGA 1IM2A 2AEEA 4U6NA 4AJPA 2DTXA 4N6OA 2GZHA 2FR1A 3R4CA 1CKEA 3GY0A 2R85A 1FIUA 1YJXA 4Z86A 1JA9A 2R8OA 2QV7A 4MUKA 1RPAA 2QL6A 4CMEA 3CT4A 5LZ4A 4KE8A 1DWOA 2ZYDA 3LRTA 5EZ5A 3V3TA 1XVUA 1Z47A 2DPLA 2J0EA 4R2HA 3ZTWA 2EV9A 3G1UA 2HQ1A 2Y93A 2Z56A 4U8GA 4MGZR 1L1FA 1JZQA 1JDZA 2EBUA 2HADA 4GC9A 5EJ5A 4J0JA 2B8EA 1TVMA 2D4AA 3P19A 1C3EA 1Q17A 3CGGA 3HKBA 3LBAA 4W5HA 2UYQA 1I24A 1FQJA 2CJFA 2HCBA 3IQDB 3MT8A 2P90A 3X1MA 1XK7A 2O3UA 4HBZA 1Y5MA 4ACAA 3UK1A 1MGPA 4PZYA 3UM9A 1D2CA 5BV2P 2AB0A 3F5MA 1EPUA 3C1OA 3SBXA 2GERA 2QRPA 3EDQA 1FNDA 1HDOA 1RBQA 3KZXA 2XCQA 2IYVA 1FQKA 1B0ZA 1PNOA 5F5LA 2BH9A 2EU8A 2NSJA 3LC1O 3QZUA 4FGZA 4PZ0A 4P4LA 4G56A 4OX9Y 1EXMA 4FNAA 3RROA 1CR2A 5KHLB 5JI2E 1YFZA 1JG1A 4IOJA 1UBKS 5A62A 3E7WA 4ZREA 1WV0A 4NDZA 4NG5A 4BASA 3UJNA 4MUNA 3UMJA 3WL8A 1WXDA 3OZUA 3RVQA 1G8PA 3O8OB 1N9GB 1ETHA 1SU6A 1WW8A 2PU5A 3LYHA 3O91A 3A1UA 4JK3A 2CZCA 5T6MA 1M0EA 4KIUA 2IELA 3AR8A 5KTYA 5JTUA 4AW9A 3FPSA 3OCZA 5JT1A 2KYRA 3WKCA 3OSUA 4ZGBA 4OHYA 5KNLA 1PG0A 3ID6C 3L8GA 3QF4B 5BPHA 5FV4A 5JADA 5KAPA 1NASA 3SJCA 2I29A 4LAFA 4RU1A 1J97A 3OIYA 4TSFA 2GK4A 1LC3A 2YJTD 1JQKA 2ZEJA 3CNLA 2W37A 4BATA 5EIEA 2BCJQ 2LGJA 1QQTA 1F20A 1XROA 3RIYA 4DCVA 1KIAA 1SHKA 4HADA 1JIUA 1JDSA 1M1YA 2OYSA 4Z9AA 1H0HA 4MVXA 3W3AH 1NVWQ 1Q0ZA 3V33A 2HBQA 4OYHA 1BCRB 3T99A 2BN4A 1PZEA 3FCUB 3RAEC 4CEHB 2O3RA 4S05A 3A14A 2WD7A 1ISRA 2WIJA 1SQSA 2WFAA 3F6YA 3OETA 1ZN8A 1EKXA 3F3MA 5JANA 1G0OA 1P0QA 2VDLB 1FW8A 4IJWA 1NYLA 3RSSA 1D3AA 4HTFA 1EWVA 1KPGA 3FN4A 3OY7A 4II3A 4NENA 3FOCA 4KODA 2D54A 2ZJFA 3A3OA 1S7GA 3VR0A 3ZHSA 4ZDKA 4QUJA 5KTMA 1L8OA 1V8PA 2XV1A 2WA2A 1C7FA 4TMXA 3SYLA 5L7YA 1HFJA 4A26A 3IRUA 1HDXA 2SKEA 3BJIC 1G5QA 1X7YB 4O2AF 3CU5A 3EXAA 4PG8A 1O0CA 5IH7A 3DHYA 3DV0B 4EZBA 3VISA 5K8LA 1K92A 1MFPA 1NDQA 1JR3E 1E89A 1XL1A 1K8YB 4LOKA 4A73A 1XMQB 2HXGA 3UGQA 1XLTA 3PKIA 3Q87B 1XQWA 1Z0DA 3KVYA 1F9EA 4XARA 5CX1A 1P9RA 1XTJA 1EG7A 3OMLA 1R6XA 4B33A 3IOCA 5EJ4A 3DO5A 5JWOA 2X6TA 1S3GA 5FPHA 1Q1AA 3TB6A 5JVDA 4BAGA 4EVIA 1KK1A 5MDHA 3AVXA 2P35A 1XEXB 4JYCA 2MIIA 4RD0A 2ZYAA 1IUNA 2G71A 3JQFC 4WOPA 4J0KA 3DOFA 1MJNA 1NTRA 1RWQA 1Z74A 2OO7A 2XNCA 3H2YA 4PAGA 3DE6X 4PLVA 1L3BA 5ALHA 1Z5UA 5L95A 3KZVA 1L4BA 3CY6A 2IZ0A 4FIZA 5CNKA 2J09A 4UXJA 3EQ7A 3OQHA 4XB1A 3THRA 1ZJWA 4IDDA 3NTQA 1GGVA 4EGAA 1U11A 3D9QX 2DPYA 4RK0A 1QUEA 3K3PA 4QVIA 2ZBRA 4PO3X 5DN6D 4EJ2A 4DA7A 1KPHA 3U3RA 4PZZA 4ZARA 4FYKA 1ECFA 4X54A 1OSNA 1QHEA 3O3OB 5IBPA 1T2VA 3CRVA 1YB5A 5KWVA 1CZUA 2XXJA 3BD9A 3IBFA 1NU8A 3H83A 4Z9XA 1IWBB 2HHHB 2TMDA 4PZCA 1P9WA 3HKCB 3ML1A 5DXJA 3C15C 3RSHA 4LGVA 4PV7A 4OK3A 1CUJA 2X5KO 3HZRA 4LJ5A 4PHCA 1HG0A 2QL9A 3KPVA 4F60A 2JH8A 3F8TA 2IV2X 1X14A 4LQ4A 5K8IA 4FDMA 3BJMA 2B2XA 3IDAA 4O4JB 5TY0A 3N53A 5DK6A 2EW1A 2C2KA 2MINB 3OSZA 5D7NA 1SXJD 4DTCA 2FJ0A 3X1YA 4QPPA 5CP8A 3T0FA 2VVTA 1XRNA 3B5EA 4PZDA 2WHQA 3HI6A 5K03A 1CRZA 3FYDA 1MABA 2WUVA 1ZI8A 4GI5A 5I48A 1EM6A 2NUPB 3FCCA 3N70A 3GD5A 2CXOA 2W9XA 3HN2A 4WN9A 4YNBA 1UBRS 2WZCA 3H5TA 2IEIA 3CEHA 1T3TA 4OV6B 3T3MB 1YI8A 3A25A 3KC2A 4D9EA 5DBGA 3R9KA 3N2EA 3AP3A 4QOEA 2RB5A 4OKNA 1GVHA 3VKUA 2ONYA 4U2EA 3HA5A 1G8FA 1U5CA 2NOAA 5I9NA 3JRXA 5IAAA 2DWUA 2JD0A 2VTDA 3LWDA 5J4VA 3GNTA 3GT7A 4V2UA 5ESWA 4Z8YA 1UMBB 3SOZA 4QO7A 4BP8A 4JLMA 3ZOKA 3VV2A 5I8WA 3EUEA 1X9IA 4EQZA 2WQ7A 1FE8A 1NULA 2CY0A 2CNDA 3H99A 2YQZA 2CWWA 4BFTA 3OMWA 4LGYA 1PR6A 2YWRA 5IDWA 4LTDA 1CLUA 4FI3C 3TLGB 1S0UA 1IBRA 1UBFA 1X7ZB 1OY1A 5JNUA 4TRNA 5BW6B 3BXFA 2ZKIA 1W59A 3BK7A 3MWDB 2PL5A 4I1IA 1MO6A 1XP5A 3B3GA 3S2YA 4E32A 3DZIA 4YHBA 1R4NA 1AO3A 5COAA 2XVAA 1Q74A 4MR7B 5CH8A 3HNPA 3OFJA 4N5HX 1EZ1A 1IXKA 1Q0UA 5SYNA 2OGTA 2FPPA 1QE5A 4P3NA 3NP9A 1ZM3A 2C1ZA 2Z09A 4ZWNA 1NVAA 3AT1A 3RVDA 5IFKA 2XE4A 1SWVA 3TNLA 1SHJA 3DUFA 3L0OA 3QELA 4G0XA 1TJYA 3KX2A 4YQEA 1C9EA 1D6NA 2ZWMA 3E61A 3U4IA 4JVOA 4WLNA 3AFNA 3DAHA 3IUPA 4Q21A 2ON6A 4JLBA 1KXJA 4AYXA 2GPYA 3K0AB 1L4MA 4IUYA 4JZYA 1AA6A 4B71A 3A6JA 2VPWA 1V25A 4ZIRA 2WTEA 1FS6A 2YFHA 2FFQA 3EVBA 3UJAA 2PWAA 3RVBA 3ZHCA 2HRQA 2AFHB 5LJLA 2DEUA 2JLYA 1QH1A 2G77B 3NATA 4KN6A 2BUAA 4OU5A 1A9YA 3U4AA 1ZCFA 4OL0A 5JQWA 4BE4A 3TEFA 4NAHA 3EXHB 1G60A 2BTOA 4CQMB 1QF6A 3HP1A 1BHSA 4UW9A 1WABA 2IDJA 4DLBA 1YF3A 5DI3A 2AV6A 4ZQGA 2YVUA 4YDSA 3QXHA 1V47A 4ED9A 2Q5EA 3H4TA 3H0KA 2Q5CA 2ZJ1A 2VDUE 4MUGA 4FYHA 2JJ8A 2LVBA 2EF0A 2OHVA 3QKWA 4JVLA 4DYDA 4YJ2A 3ONVA 3PX3A 1K8RA 2GDZA 3D59A 3L05A 3LL4A 4R5HA 4WSOA 5EZYA 1DFHA 2GCNA 1P3Y1 3HY3A 4G1VA 5KX5B 3B51X 2PVPA 3A6HA 1F8YA 1LRJA 1XVVA 2AUTA 3I9MA 4MDFA 1LDGA 4D1YA 1ML3A 2XUDA 4KEAA 3Q0EA 2WWFA 1ZGBA 5HIJA 3KV1A 3KUUA 5TQVA 4DBZA 4GOKA 4YAIA 2XCTB 2Q5OA 1PDOA 3GLUA 3HL0A 5AM1A 5HQ3A 5AQEA 1J42A 1A8PA 2VJDA 2ZS9A 1D2HA 1T0IA 3CZCA 3OTQA 4RK5A 3RJTA 3T1TA 4PPQA 1AN9A 3D3KA 3I8XA 2B69A 2CMFA 3S70A 3OJ0A 3BWDD 1KIFA 3R5XA 1DIOB 4IYJA 3B6KA 1KEZA 2BFFB 2G07A 3WHLA 3SSOA 1ZD3A 4MUYA 5JALA 2QW0X 4MKIA 4PN3A 2RARA 2RH9B 2YR0A 1IOZA 3E4DA 4KO8A 4UARA 3ZC3A 4AQ7A 3AHIA 2VP4A 1HURA 1US8B 1SZJG 1CVIA 1PD1A 3KTDA 3C97A 4TV9B 5A04A 5FFFA 3IALA 2QI9F 2BFAA 4HGOA 1DC8A 1WSBA 1OGJA 2C2GA 3AUUA 1JR3A 2P40A 1P7VA 3GU3A 1N2XA 2X5JO 3MYRA 4NBRA 3U7IA 1XKQA 3I5MA 1XDDA 1KSGA 3D4OA 2AC4A 2Z8YM 2XSZA 4RL6A 3RQSA 4DCMA 3PC6A 1HEUA 1SXJC 1X42A 1IY8A 3TRHA 1D0SA 1JQ3A 3LGAA 4HZUB 4CT4B 2PS3A 4MMXB 1IFXA 3PT9A 3KB1A 2ID7A 3OF3A 4D41A 4BX3A 4D8UA 2FG5A 2BTQA 2KJQA 2G9UA 2Y67A 3VQTA 3KOUA 3MW8A 1XOIA 1EP2B 2ATIA 1RBZA 1S9DA 3ISVA 3TRIA 3ESYA 2D5BA 4LDJA 4XWAA 2HBYA 2BLLA 3DP7A 5FA6A 3R9IA 5MGNA 5AI4A 3CNNA 4WKCA 3WI7A 4AC9A 3ZU4A 4HNVA 5ECGC 5JSQA 1OT3A 2ARKA 1AQYA 1Z6AA 2OEPA 2ZBPA 2ZIGA 5EJFA 3W3AD 3ET4A 3BMNA 4OXQA 4C76A 4RD3A 5FDFA 1E4EB 4P81A 1RMTA 2VK4A 4OHZA 4ZOQI 2ODEA 1JA1A 3RU2A 1U2QA 1H1DA 4RPKA 1UKAA 1BN6A 4UUPA 1FSSA 1NUUA 2EF1A 4GQIA 4WGFA 3AU9A 4DMCA 5CDFE 5A4IS 1VIAA 3KZKA 3ZYCA 2IVZA 3KKPA 3VR5A 2X0EA 3MOIA 1Q1BA 1A8HA 2J3IA 3A9TA 1GGNA 3T5CA 4ARZA 1UMKA 5ER6A 1XD8A 4RJ2A 2I99A 4FR5A 2Z6QA 3GJQA 1U8AA 3NXSA 3AF4A 3C6YA 3VV3A 1SELA 3CWQA 4CUZA 4C08A 1KYIA 3ASZA 3C3JA 4L5AA 5AVWA 4RTPA 4QYTA 3O73A 4O8ZA 2EDCA 4Q9LA 3TAUA 1C8LA 2WDPA 4FYIA 4TS1A 5CHYA 2YCBA 2OLEA 3G3EA 2ONJA 1I3NA 2XW6A 5AJVB 5F2KA 3ZWVA 3G0DA 4RLFA 3LDFA 4R2JA 5EUQB 4HPJB 4WKBA 3JR3A 2J67A 5CH5A 1Z3CA 2AKAB 1GTL1 1IN7A 2I9PA 4XJXA 4C7BA 3OJOA 3AI2A 3L7MA 2H17A 2P69A 4GOOD 4Q9AA 2H48A 4AG5A 5E6SA 5JZOA 4AP6A 4LF4B 2P9FA 2YVQA 4JU8A 2Q7OE 3U9SA 4EY3A 4GMGA 4FOPA 4YUAA 3SR4A 3KWLA 3TLMA 2SHKA 4ZI3A 4FYJA 4WUVA 3O8QB 3VTFA 1O4VA 1IYZA 3ITDA 4XUGB 4Y30A 3C6MA 1U8CB 4LJ7A 1QG0A 2JKVA 4WZBB 1M6EX 4Y0VA 1CRQA 2ZTLA 3WBBA 3ESXA 4M76B 4MW7A 5TEWA 3L0SA 3TGLA 2Q0XA 5L3QB 4L85A 3VSAA 4Z99A 4M36A 2JLZA 5CD1A 4NWIA 4RJKA 5M7EA 3Q5EA 2N47A 3GLGE 1LC0A 4HGRA 1WW2A 3A3YA 4Y9SA 3ZY5A 3DKPA 5BSFA 4ALLA 3IAHA 1RKQA 3PEVA 5K6AA 3ABZA 4HLUA 1Z6PA 4H7PA 5T64A 5DWQA 3OIVA 1YNSA 2DUJA 2PSEA 5LQDA 4A6DA 4LX8A 3M5CA 3SZOA 4CG0A 1M5TA 2OD2A 4Z9YA 3DG9A 3HRKA 1DJOA 4A03A 1IZ0A 1H8ED 4OQDA 5TGDA 5DNCA 2QJTA 1VRVA 2Q1TA 2JNWA 2HL6A 1ZINA 1GPUA 1Z7GA 1JFFB 1FNBA 1IZZA 1SCNE 2PO7A 4ZOLA 2CKMA 4WNIA 1KDVA 4YYEA 4Y2VA 3OICA 3ZTYA 1Y42X 1R18A 2OZLA 4C3OB 3AR4A 5I5EA 4MX8A 1GPJA 1I2AA 1LVGA 2QTTA 2WJ6A 1YZKA 3LGSA 4FLEA 2BKEA 2KSQA 4L5CA 5JD5A 1UC9A 2QVXX 3STYA 4YRMA 1FFHA 2CZGA 3WLHA 1Z08A 2WIFA 5C7LO 4RTNA 1N9KA 5UKDA 3STTA 2FPWA 1SUPA 5KYWB 4H2DA 3VDQA 3HCNA 3TNYA 4KSYA 1ZRMA 4V24A 3ZGZA 3OO0A 3DP9A 3MBKA 1LX6A 1XCBA 3NOVA 2AVNA 1OLOA 3R6WA 2DG2A 4PGFA 1FX1A 5LUAA 4ZU6X 2WYUA 1V7PC 4S2EA 2OFFA 1GZDA 4F3YA 3HXOA 2AMLA 3R20A 1ODLA 5DYYA 4H4EA 1JEQB 1BROA 4YCBA 1ZQ1A 1GZ7A 2IUFA 4IKEA 1N4DA 4G5SA 8GPBA 2YC2C 3QA3E 2P9CA 4D96A 3H4IA 2LIVA 1ZEMA 2JGMA 3GNSA 3O3NB 4F45A 1YUNA 2JVKA 9LDBA 3WMGA 2OYCA 1YL5A 2E4WA 1NLYA 4FYVA 3DCNA 5BXYA 4I14A 3L1KA 2QU7A 2EHDA 4F4DA 4TMTA 4EFLA 1QAQA 3VOTA 5I9MA 2CVFA 3JARA 1CUSA 3O2QB 3QHQA 5SY4A 4B83A 1RYZA 1X1TA 4QIHA 4TVKA 3U80A 3V4OA 3I04M 1JI3A 3ZXXA 4EO4A 3EXEB 4IUDS 4TLDA 1ZAYA 4D3ZA 2BGNA 1XTUA 2XDQA 4DV0B 3LPCA 3UUGA 3KLMX 1TM7E 4UBIA 2O59A 3GCXA 1UOQA 4ARCA 1IJBA 5LP1A 1ORTA 3W3ZB 1FPQA 1T36B 2RGGA 2V03A 4B9EA 5BVGA 5I51A 1Z6QA 3LUFA 4U7DA 2JHCA 1ESNA 1BA2A 3I12A 4EG5A 5FWXB 5SV2A 2C04A 1KQFA 3I2KA 1G20B 3G8AA 1LPPA 3OJEA 5GIOE 2F3QA 1R9MA 5HZHA 5I7RA 1U0GA 3DTTA 3GMTA 2VZ8A 1H3FA 3Q9NA 2PUWA 1TYAE 3D6JA 1W46A 3OIWA 3F7MA 2IYSA 4HWKA 4CM6A 1Z4KA 3C8UA 2MCFA 3WLAA 2PU7A 3AOGA 1ZRNA 3C5EA 4FR0A 4A16A 2FDCA 4QO8A 3WBFA 5K3OA 1NI4B 1UT5A 4RULA 3PEUA 3BD6A 1Z75A 3C24A 4M7WA 2PAAA 3LP8A 4QXOA 5CHEA 1NDUA 1NWCA 2XB8A 3I34X 1WUHS 4K88A 4LXXA 3NBYC 1FYVA 1LQ2A 3AEUA 3N6RA 5HM6A 3C3MA 2FP3A 4EGCB 4WHMA 4L78A 5DBEX 4BS9A 2HDNB 5K8CA 1J8YF 3E1KA 4M53A 4XX1A 2HEIA 1TOAA 2CLMB 4NYMR 1IAVA 2D1TA 2IGBA 2W6QA 4GX5A 5C5EA 1UZMA 2DPXA 3O4HA 3B52X 2AW5A 3UT5B 3U56A 3AR5A 4PHHA 4NCAA 3LCCA 2IRWA 4BN4A 1K08A 4ND8A 3SNHA 1E2GA 3NHAA 4L07A 4BMDA 4KOEC 3STUA 4KI7A 1TYEB 3MJVA 1DPGA 3ND6A 4RFVA 5T3UA 4CMIA 3RTCA 1GCIA 1UEIA 3FUWA 5K2MA 3M6AA 5I7FA 4MA4A 3WB1A 1O8CA 1NJSA 3C5CA 2OD7A 1AZSC 2YH2A 4YV7A 3Q2KA 2H1HA 4H0FA 4LJSA 2VUSA 4MICA 2OXIA 1J24A 3BAZA 4IINA 3G89A 2I3BA 1M2VB 1OXMA 3II6X 1RYMA 3G2PA 3MN1A 2GN9A 2Y1XA 3O2JA 5TARA 5CDGA 4TWJA 1HR0B 4O25A 5CDFA 4E5UA 2H4WA 1E5TA 2JLXA 3CUSA 3HGMA 3PKJA 1AKRA 1UPTA 1VYTA 3JWIA 2JBAA 1IU9A 5D3MB 3EH2A 3JYQA 4JB2A 3DAYA 1WY5A 1J7KA 2VKTA 1DKUA 3K2BA 4OUKX 3EOAI 4L7VA 2IZ5A 1T8YA 1KJWA 1QP8A 2HNBA 1W7AA 1K5DA 4NDNE 5AKIA 1CY4A 2BD0A 2OCDA 4TMVA 4QQRA 1M67A 3KJEA 2GD2A 1D2MA 4JITA 1WM1A 5A2QA 2FMIA 2H1RA 2IS2A 3O75A 3UKOA 4RH1A 3UK7A 3QA9A 3UFBA 1WAMA 3SJUA 3PCTA 1U5AA 1MA0A 4Y2YA 1U3DA 3U4HA 3N2ZB 3BMOB 5EJ6A 4ZQIA 4LF7B 3N28A 2PSDA 2QLLA 4JT9A 3VRHA 3OU2A 3DR5A 4REQB 1KI6B 2E4AA 3FUXA 4P22A 2F6RA 3FSJX 4FWIB 1HFEL 2Y1DA 3LF1A 2OBXA 3FGPA 1PNTA 4L9SA 2FFBA 4S35A 2QRNA 4Z4CA 1K98A 4C87A 1TA4A 1XF1A 2B1QA 3CE6A 3VX3A 3PUJA 3NIDB 1PKEA 4XQGA 2VIIA 3UWSA 4LXQA 2BHRA 4CG1A 4UCFA 4G0VA 4CKBB 4BOYA 4MB2A 1O6ZA 1UJ5A 3BIOA 3QW2A 5CT8A 4XVUA 5F73A 4GXTA 1OFVA 1R6UA 4JBHA 4QAJA 4F9GA 3OZDA 2WABA 5CJPA 4BFXA 1IDN1 4O4IA 4BFYA 2FSSA 3IB3A 1T6ZA 4LS3A 5A9RA 2AHRA 4WPGA 4DLAA 4YGXB 1M6NA 3KCQA 3GLGA 5EIFA 1HE5A 2VA9A 4OI1A 3WNVA 4RA6B 1KI9A 1A4IA 3TRDA 3C5WP 4QUGA 4UFPA 5AVVA 4MUJA 4Q24A 2Z8XA 1VPVA 3WLOA 2Y1WA 4EMBA 3IV6A 4U7TB 3GUHA 2Q4OA 2QX7A 3AM3A 3SEAA 3VH2A 4XYMA 1I6KA 2AXNA 1ZM4A 4H6VA 1P1HA 2XYVA 2G5PA 3ZZ1A 4J0HA 4OGFA 4PO9A 4Y9TA 2YV1A 1QS0B 2DU8A 3A7DA 4UUOA 3SEFA 3KHKA 2C4UA 4RTJA 2ONZA 1BVRA 1Y89A 2P79A 2FPRA 4Q4CA 3HR8A 1W36B 4UNRA 1LDNA 3HJBA 3EA0A 3CUEF 3V9AA 3GZ4A 1C3OB 1WDTA 3RLFA 4IQFA 4B85A 4OA8A 3W4IA 4LXYA 2QYHA 3LUCA 5BQ5A 4WIAA 3GAZA 3OEYA 3OQPA 2CDRA 1CXZA 2GJ4A 3U9LA 1VMIA 3GEPA 2OENG 4MQEB 4ND6A 3STHA 4B87A 2X14A 4BLRA 3U3MA 4D0GA 4Z9BA 3I2IA 2ZBUA 4DQ0A 2UU9B 4PYJA 1N0HA 1V7ZA 2IE0A 3A0RB 1W2GA 3EGVA 4I46A 5EKTA 5BRNA 5BVHB 2ZT8A 3DEYX 4B6PA 1EWYA 1L7RA 2WQZA 3R7DA 1JIJA 2FZKA 1ZD5A 4CR6A 3IJPA 4RAOA 4GDMA 3UPDA 4JJ8A 1KR5A 2FSHA 5JNVA 2QSJA 2ZUVA 5D3ZA 4AY3A 4F21A 3UWKA 2IQ5A 4AQYB 3OJLA 2O8CA 1RZVA 1TA9A 2VN8A 4PQRA 3JQ6A 2WSLA 3EPLA 1IK6A 1EB8A 3IOMA 2WHPA 3AHDA 1K8QA 1UZAA 1GUDA 3FOZA 5AHKA 4P5PA 4GQAA 4WK4B 3R0IA 3Q5GA 1NSFA 4GMHA 3E5RA 2H1SA 4XR4A 1BYIA 1IMOA 2OBFA 3N87A 5B1IA 2NUAB 3A06A 3I5XA 3IS3A 2ZXEA 4QU8A 4HDCA 2J0QA 2PJRA 3T7RA 1LWOA 3CN7A 3DZGA 1JHDA 4DC0A 5EHZA 2B2NA 2JW5A 3F74A 3DWIA 3P20A 1NT4A 4GM0A 4BCBA 4JBGA 2CHGA 3FGZA 2J0UB 3KD2A 4HYEA 3HDVA 3VOBA 4YRPA 5CB4F 3O8LA 5KQGA 4EPXA 2CBXA 3ZWWA 1RI3A 1E9RA 3EULA 5BWNA 1J0AA 1HC7A 3HUTA 2ZXUA 2ISQA 4GM1A 1PNVA 3MEQA 4RELA 3EIQA 2FB9A 4EKGA 4A6PA 2NV6A 2HJGA 1L4UA 2XTAA 3ECSA 2V1UA 4CF4A 1SC9A 3MWEB 4JMLA 4YROA 3N8DA 1E1QA 2GBPA 4B8ZA 1PVDA 4E7OA 2QX4A 3RBZA 3CVVA 2AVDA 4KBFA 4B3MB 5K4HA 3CLHA 4BFCA 4JI7B 1SQGA 1Y8CA 2CXQA 3EIUA 3ONNA 1IQUA 1LBTA 1WZEA 3EBOA 3CHYA 2OFOA 2GPBA 3FKSA 1A9RA 1UQUA 3VNUA 2XUFA 1GTVA 1Z6ZA 3D3WA 3IE0A 3RDPA 5A5EA 5IC5A 4N8EA 5FUBA 3U5TA 1JFVA 4QULA 2DQSA 3NHRA 2V5AA 3B36A 4P3OA 1CEQA 1C4WA 1FBNA 1C14A 1T4CA 2O2DA 2J08A 4FMPA 1CZNA 1X7HA 3H1TA 4HGNA 2IDKA 1L1EA 4MR8A 2BKVA 1F2TB 1O5IA 1ZBQA 4UDYX 2V7UA 1IEQA 5ITSA 2AN1A 3G0GA 3ZJ4A 3HZZA 4BN5A 2CFCA 1UBMS 1SHLA 2B0JA 3VR3D 4QZVA 5HUJA 3URMA 4AWAA 2WM8A 1P3JA 5JSYA 2W22A 4DLNA 3LIIA 1A3CA 5DTJA 3RGWS 4HWGA 4B5KA 3TX6A 2P0AA 1DVRA 5FL7A 4KREA 1SCKA 5AW0A 4WCVA 4YR9A 2BMEA 1Y9DA 4W63A 4IQ4A 3WGYA 2XMGA 4FFMA 1TQ4A 4AVYA 3HO8A 4Q0MA 5JIBA 3WK5A 1B0UA 1K7CA 3CX6A 1NOJA 1VYHA 4R41A 4DMHA 5E7JA 5BN4A 3S2IA 3HDYA 3TTXA 5EP3A 3GGSA 1A9QA 4Q7LA 5F33A 2QM3A 1JUDA 3JCZA 2ST1A 2C3UA 4NESA 4O3MA 3A4TA 2WU4A 1XFAA 3UMRA 4D8XA 3AVVA 1RJGA 2WF7A 1YQDA 3JYHA 3OZFA 3QIAA 3OM8A 5C80A 5ICFA 3EB9A 2FZ4A 4YACA 3K35A 5AW1A 2EWVA 4H1UA 2CWDA 1M1UA 4HFNA 2DAPA 3IQWA 5DBIA 4ICIA 2ODTX 3O31A 1RLTA 1C0PA 2N0SA 1S2OA 2QT9A 3ZLUA 2YIDA 1JB9A 1NW3A 2WHEA 3NIGB 3R3UA 4TUYB 3JATA 4AJ9A 4YJGA 4BV2A 4NYJR 4IIVA 2VHCA 3I1JA 3BS4A 1TYDE 4G0YA 1OTXA 1R0RE 2R65A 2IZOA 3C6KA 3CIFA 3LNCA 4NZYA 3H5AA 4NQZA 3KQTA 2PKCA 4GMDA 3S6JA 4YRKA 4O2BF 4ETMA 3CR3C 1X1CA 2GAIA 3SZGA 3ETCA 4A91A 5FF9A 2WQ6A 4L1KA 4IJUA 4UEKA 1FDIA 4IP0A 1ZR4A 3WZMA 3VR2D 2ODAA 1JALA 3B5JA 3P2OA 2ZIVB 5F2NA 2VPIA 4C0JA 2XCIA 1V3QE 1G7CA 4ZHQB 4CV0A 2DR3A 3GRKA 3RR2A 3O38A 3SZLA 3T5DA 5DLDA 4E31A 1VKJA 2WR8A 1LSUA 2GCIA 1ZJ4A 1RPJA 2A57A 5E7QA 4AAYA 3ZZ0A 3H05A 3V2HA 2WT9A 2R6ZA 2I34A 1D4FA 4OVKA 3QWBA 3IX7A 5K7SA 3OAAD 4IDGA 4HQ0A 5BUZA 4MYRA 2PZ8A 2W42A 1R0KA 2EJCA 4TXJA 1JHQA 3DD5A 3OEEA 1UBLS 2M1ZA 4LCJA 4M1MA 4CNBA 5GMOA 4C01A 1QH0A 5JNSA 1RC0A 3CZQA 1A04A 4CZ2A 3OF5A 1XDWA 3T7SA 5BYKA 2VQDA 4PYMA 3SM9A 5FXMA 1U0FA 2R84A 2UZ3A 3MMSA 3PSAA 2ZAGA 3I6IA 3JQGB 3L8HA 4Z7NB 1C9JA 1WUIS 2P2YA 2QN8A 5KTKA 3TRJA 3JTMA 5HZKA 2PFKA 1SXGA 3O9MA 2DR2A 3GMSA 3PNOA 5DWVA 2PBLA 1WJGA 2WKSA 2QTMA 4KGDA 2ECKA 3NCHA 3HADA 2BONA 3ND9A 2Q3DA 5HF8A 3ZHRA 4EF4A 4GFDA 2EX1A 3ROPA 1GITA 4UASA 3SJZA 2NV2B 3FCYA 3FUCA 3K8QA 2YHSA 3PR1A 2UDPA 2DQZA 3LECA 1QQ6A 3EZ6A 3N76A 3OF2A 1EUZA 4J0CA 2H18A 3EEIA 4CETA 3E8MA 1FDVA 4B6SA 1LI5A 1W35A 3S8YA 2VDWA 2Q6TA 4NCKA 1T6NA 1NRJB 2GCGA 2GEJA 2Q07A 4CEJB 5ITZA 2PBFA 2I7VA 1YJCA 2NO0A 1SXJE 5EIHA 4F6LA 3PD1A 1G18A 5J1TB 3USES 3WLKX 5JD3A 3MGCA 3AI7A 3SOPA 2UZ4A 3S2SA 1F14A 1SG9A 1KAQA 4JBIA 4K9LA 4LOLA 3WL3A 3D6VA 4CM8B 1TYCA 1GDTA 3F6PA 5DASA 1DZIA 1XCJA 4DNXA 4CTKA 3HWRA 3QP9A 4HB2A 4PAMA 1NJ1A 2AN4A 2W2VA 3QSGA 4L15A 4PC3A 4C6TA 4LFBB 4URYR 1NSYA 1JU9A 4NQRA 3M6XA 1D9XA 4WFJA 1F2UA 2I8CA 5EWJB 2V4MA 1T29A 3NM4A 4AUKA 3I1FA 2C5LA 4EY4A 5CIQA 5LMNB 4WY8A 1RKVA 3BM5A 4H60A 4BV3A 1FVXA 1ND6A 4D3FA 4QGSA 2MMCA 3ODPA 3AM4A 1GNQA 4RPHA 4EJMA 4KQFA 4XD7D 3MWYW 4ENSA 3KYJB 5A6SA 4RHFA 1JVBA 1ZUNB 1JKFA 3U6BA 4R81A 3WLEA 5JJKA 4WCFB 4B3CA 5K0TA 4D9CA 4ZA2A 3KPUA 3UH1A 5IKPA 1C2YA 1KJZA 3GBSA 4CV1A 4DV1B 1UM9A 3LE8A 2B8TA 3RWOA 4YJ3F 2PH5A 2VNJA 2W8BB 2X1MA 3GB9A 4M0MA 2PKRA 3GYGA 2QSUA 1HTWA 2D0OB 1TUEA 2HHLA 1XR3A 1O4WA 3A3NA 2NT3A 3NAQA 4Y6SA 5CT4A 1M6WA 4HXFB 5JBNA 1PYGA 3U3OA 4KFSA 1WB5A 2YUTA 2HK6A 4FFOA 5FLKA 4MJLA 4D3DA 4OYRA 3H2HA 3N7UA 2XHZA 5CH3A 3WGJA 4HWRA 1VL8A 1Y7HA 1N9ZA 3G0OA 3JQAB 4QE3A 1Y7IA 4BPRA 1QONA 5LA6F 3RVOA 3HDJA 2XMQA 2GFQA 2FUCA 3GHHA 2G17A 1NVUQ 4OAQA 4RK7A 1N2ZA 8OHMA 1FA9A 1JF8A 2PL1A 1CY0A 2EG5A 1JG7A 2H65A 3BRCA 3NHWA 1D04A 5HGJA 5BMOA 4F12A 3OX1A 1Z18A 3K1TA 4ZPJA 4JSYA 3RRZA 2A84A 1XXLA 4A7PA 5ALKA 2CHEA 2GYVA 3F78A 4XIYA 3TLKA 3AF2A 1FPMA 2IYTA 2QSYA 1QE3A 2BEVA 5A9SB 3F4KA 1WEKA 4TXNA 1YQ9A 2IOYA 1ULBA 1HV8A 2HM7A 1TECE 2WJIA 3B1XA 4BMCA 2FA9A 1PFUA 1Z7BA 1X86B 3E5MA 4IJKA 1NVMB 3IJRA 5B58T 4FC7A 2F3SA 1T9ZA 2OA0A 5FWYA 3ASYA 3P2YA 4ZCMA 5DNYB 4P4SB 1V39A 1A9SA 5FA5A 4W5QA 1KDTA 1HKUA 3JQ8A 4MVJI 1CY7A 4MIKA 4Q02A 3B60A 5G0SA 2Q8PA 4Y2XA 3RFCA 5CG1A 1AZWA 3AYXB 2JCXA 4LYGA 1CNMA 3GQVA 5TRTA 4C4SA 4EG7A 4B3TB 4L2IB 1JBKA 1JKIA 2AWNA 2Y66A 2Z58A 3PGVA 3BCRA 4CQMD 5K0FA 2ZETA 1ZNQO 3EGDA 3AESB 4N9QA 2GARA 4ZCIA 1G9SA 3JU3A 3IODA 3EGXB 3M6MD 1R0SA 2FRXA 1Q0HA 2WC1A 3TJZA 5BMVA 2GVDC 2CE2X 3INYA 3LQRA 3QYFA 5EAIA 5JDCC 2HKIA 4C89A 3COJA 1NXWA 2JLVA 2OO5C 2B1RA 5G0UA 2IZZA 4YRFA 3NEPX 3FRJA 2ZYUX 3AETB 1A5AB 1FUUA 1A8IA 5I7WA 3ECAA 1A5TA 3CVYA 1B76A 4Y2PA 2N3ZA 1QG4A 2HJWA 2P6PA 4EI2A 5DHAA 1VFPA 2P4SA 3FPJA 1DEHA 1NJ5A 4TSRA 4OH7A 3TE7A 5ITVA 2QP3A 3A3KA 1C3VA 1R4ZA 3S1LA 2IHZA 1T3GA 4YLGA 1PEAA 2QUBA 3UOWA 2LRHA 3DGEC 3I42A 4AIIA 2X5XA 4Q47A 1M83A 4X91A 1F3LA 1WPRA 3UMCA 1V7QA 2YXLA 3ZWYA 1R2QA 4GGPA 1LI4A 2YZMA 4LHWA 1E79D 2B4TO 3U26A 1QIFA 5BSGA 1E2JA 1Z2OX 2WKRA 3M5WA 4MQ5A 4GQBA 3S8MA 4BC1A 5KKAA 1AG9A 2Z43A 2OQIA 1Z17A 2D2IA 3E3OA 1BX0A 1ZKMA 2OPBA 3FB4A 4KK3A 2OVBA 2YBDA 1QK5A 2H2DA 4F71A 4MRVA 3ESQA 5C7YA 5HRAA 2WZBA 4RMIA 1FY2A 1SHUX 1X3SA 2GM9A 4KRYA 1AZTA 3EEQA 2XADA 2VS1A 4N8DA 2M9MA 3KNZA 4G6ZA 3TFWA 1HDIA 3A9VA 4PPYA 1Z0JA 1KK2A 4TV8F 4WA8A 4D8VA 5C7IO 4XPIB 4AJ1A 4ASUA 3F7OA 2Q1SA 5FLXA 4MKHA 1OGYA 5EIBD 3HCPA 1C9DB 1IN4A 1P2VA 1RVDA 3P9XA 3DQPA 2PX6A 2G7MC 3G9UA 3LQ1A 3K73O 4H7EA 4KGVA 3VHXA 3F67A 4LYFA 5CFOA 1IIBA 4RPLA 3S99A 5FBQB 1U2RA 2QTFA 5DN6A 3UK2A 4Q3OA 1SXQA 1JECA 1FUEA 4AY2A 2Q28A 4YI3A 1MOQA 2PS0A 4WV3A 1J2EA 2M6LA 2R11A 3CVWA 5IZ4A 1GAJA 3GJ6A 1R5JA 3GDHA 3LY9A 3GRPA 4EY7A 1KJIA 4RKFA 3EBPA 3WAKA 3TM4A 4JQOA 5KYYA 2WVJA 3G49A 3I6QA 2P3SA 3R6GA 1NNLA 1KO7A 1E1RD 1QGED 2ZBQA 3RTDA 1VLZA 3W8FA 3TSCA 3DDCA 4FQ8A 4X3PA 4Y6RA 1OA0A 1W49A 4Z2YA 3MJSA 4KH1A 5H82A 3W2IA 3RRJA 4PPGA 3H1BA 1G5FA 1Y5LA 4X1KA 4BTVA 4E6PA 1F6BA 1YH3A 2R60A 1XCPA 3L9XA 2V7XA 2YTZA 3ESAA 4RORA 4CCAA 3FM9A 4OHBA 2O0HA 4ISBA 2V58A 4H7JA 4NBSA 1SXJA 4LY3A 3OJFA 3SEZA 4DRXA 3WGHA 1P1IA 1DB3A 4D92A 1ZIYA 4DGSA 2AFIE 2O1EA 4BUCA 3SHOA 2EX0A 4DNFA 1L4GA 2I4NA 1XTSA 3JQDA 1ZQ9A 3LC0A 1NY6A 4E4YA 2HCRA 1XJQA 1T9GS 2QTGA 1RBYA 3CRQA 3D6UA 3IJEB 4YMGA 1M34E 2BSAA 3RRFA 5A4DA 3D8TA 1VCMA 4DZTA 3A8TA 3IEUA 2PMEA 4F5ZA 4YP5A 1E62A 1A7UA 2Q3HA 4OXYA 1NXQA 3LUAA 4ID3A 4A2QA 1APBA 2XMPA 4LRTB 1Z29A 4QAQA 4QOSA 2IVFA 3BQNB 3ERCA 1FLVA 2AOVA 2CXXA 1MJGA 2VYCA 2VRWA 4G07A 1QHXA 4L5JA 2H54A 4DLVA 4C4ZA 4CLEA 4XGRA 3L7JA 4EKNB 3KOYA 4MXDA 2H2AA 3OT1B 3QU7A 1NF3A 5FO0A 1Z7EA 2Q3CA 1ENZA 3CURA 4I9FA 2CBZA 1QVWA 4A2WA 1DKMA 2AMFA 2H6EA 2ZJ3A 1GYQA 2FQWA 3EFOA 3JSXA 3KWMA 3MOSA 2C4KA 3MT9A 4Y2SA 5LOVA 3I72A 3OZBA 1Z6TA 1ZOSA 2B8WA 3AEQB 1BRTA 4XM1A 2QNRA 3HRHA 4QXRA 1W85A 5M04A 1OVMA 2DLNA 1PAUA 3IURA 4QJBA 1X1RA 3TQRA 4CM5A 4EG4A 4XJTA 3G1TA 1M66A 3A4IA 1P6UA 3UY4A 4DABA 2XA1A 2XMSA 4LJ4A 3D8HA 1PP4A 1CETA 1IZ7A 4ZAWA 1DRKA 1L7MA 2PEYA 4WW0A 4Y7DA 4OKIA 4ZAVA 1TVCA 1D1TA 1YRBA 1MNAA 3LPNA 3NEJA 4XFJA 1QNFA 5HFJA 4GMKA 3TSAA 3UJ8A 2AI3A 3HNRA 5KO2A 4M1EA 3WLFA 1TXGA 1F2DA 1YO6A 1Y4SA 4JHXA 1PSZA 3KQQA 1XYYA 4B46A 3NHMA 1YCDA 3REFA 3LUJA 2VHZA 1DMRA 1AC5A 1R8XA 1EVEA 2EYUA 1E3WA 3JALB 4ND4A 3T0GA 4QFMA 3G2IA 4EHJA 3D43A 4G65A 1N34B 4MKFA 4NCNA 3TZ6A 4OXNA 5NULA 2VJKA 4ZMSA 3C6XA 1K7EB 2QRMA 2YJNA 4NJMB 2JFHA 2QTHA 3HVRA 1E6MA 1BEEA 1VXOA 2W6ID 5JSKA 4YRLA 4DLYA 3BWVA 4QU9A 1FU8A 2XE8A 1RIIA 4QYMA 4IIJB 2IPXA 4I4CA 4ESOA 1JAZA 1WHTA 3IR7A 1EU1A 4ZAYA 2UUCB 2H4ZA 4R40A 1JG4A 2ZR7A 1A5ZA 4R51A 5EC8A 4ARIA 3T3OA 1IQPA 1FYFA 1OAKA 4MLPA 1MEJA 3RFUA 2O5RA 4IZHA 1T0HB 3Q7EA 1GCAA 1ZPDA 3RF7A 3RLIA 4IPTA 1P73A 3AINA 2PRKA 1ZSVA 1E2DA 2D1QA 3H97A 1RWBA 4IJQA 1KWKA 4PCUA 1R6VA 2XY4A 2GT1A 1K4YA 1ODFA 4UVIA 1BVYF 2XBMA 2JKYA 2WLTA 3ZDXB 121PA 4MS1B 1XZPA 8MHTA 1S2DA 1GVNB 2AYZA 5ALWA 4IZIA 2VJCA 3L6DA 4CCWA 2QUAA 3LHDA 2ZUBA 3TECE 1VMKA 5EIBC 2FCRA 5F7XA 4ZO4A 4FGKA 4F3TA 2VXOA 1NL3A 1R8SA 1ZL0A 2J31A 3ED1A 3HXPA 3WGTA 3JZMA 1OZGA 1XPJA 3PQ2A 3AF6A 1IUKA 5LMUB 1BDMA 3DW1X 4R3NA 5U9CA 2JFYA 4GI1A 4U6SA 1L7PA 1MVOA 3GFPA 1A71A 621PA 5FV7A 1TT5B 5J47A 5TVKA 5EZYF 3VZSA 3WR5A 4DV3B 3VHQA 3ZW8A 4MWEA 3KSBC 1S7CA 2CNKA 3LLCA 1EFPA 1SZPA 2G4LA 3GDOA 3HFJA 4RK1A 1LLDA 1XELA 2JAOA 3ZBTA 4HQOA 1U8FO 1E2IA 1UH5A 3ZVNA 3HU1A 1M3SA 1EGQA 6Q21A 2GCEA 2OXFA 3RC3A 3I9LA 3SU8A 2ZYSA 3MNFA 2ZTUA 4DG8A 1CUVA 1NUAA 1X1SA 2FY8A 2I22A 4QLAA 1RKBA 1V7CA 3RM3A 2WWXA 3FIUA 5DRTA 1DRUA 4H16A 4KLAA 4I6EA 2X8LA 1NXTA 4MUIA 4FYMA 2O8VA 4JXKA 3RKUA 5JAPA 5K9ZA 5KUTA 3ACBA 4M1ZA 1QIHA 4X6XA 5DM1A 3HWX1 1GG8A 4FYWA 2C61A 3GJ4A 3WQQA 3P0IA 4FQ7A 1MG0A 3A1VA 1LTKA 4EY8A 1QGOA 1LA2A 1R10A 3MBIA 4DVJA 2F8MA 2AUNA 3TG8A 3ZJUA 3H65A 3TBKA 1BDJA 3MIIA 4EEKA 1JYEA 2IK8A 2Q5HA 3CZRA 3QVOA 1F06A 3G82C 2GOYA 2KBEA 3W3AA 4EZEA 4F2WA 3URKA 4QODA 4KXMA 3DEJA 3QM1A 4KP7A 4H27A 2NU6A 2W6NA 2WJYA 4KXVA 5B2ZA 1X92A 3GG9A 1HM5A 5DSXA 4L4ZA 4JBWA 1PNQA 1GTG1 3AP2A 3N8KA 1RWWA 2P9ZA 3KM0A 3A28A 4M7RA 3SE7A 1B73A 2VDPB 4YCAA 4DQUA 1CF9A 5LWQA 1TADA 1S2GA 3LGXA 5JCPA 2WMDA 3IQEA 5TE9A 3T3HA 3OEWA 4A27A 2RC6A 2B3DA 3WLPA 1CDZA 3BZUA 3EOZA 3FCXA 4J4HA 1QJ4A 1RWMA 3N3AC 1FNSA 3RUAA 2P2CA 1II9A 3JQ7B 3LA6A 1IATA 4MJ7A 5LWHA 3SC6A 1V71A 4P38A 4RFLA 3I30X 3JVIA 1CV2A 2QUJA 3I4LA 4RAQA 2NNWB 3PDWA 2QORA 3QUBA 1N6HA 4LC0A 1GJRA 2XAAA 5EGSA 3F96A 1NBEA 5JS2A 3IUBA 4YN3A 2IJGX 1N2CE 4HNHA 4S1NA 3FX2A 3ISTA 4HNAB 2IIBA 1RRMA 2JJ1D 1M2FA 4M0KA 3NDRA 2Z2YA 1X8JA 5L40A 3KR9A 5EXXA 4O08A 2AFIA 2H5JA 1P4JA 2A5YB 4UUMA 3EQ2A 1DJNA 1R0WA 1YBMA 1Z0FA 5JJ5A 1QVVA 1W5BA 3O1LA 4DPKA 4DV7B 5TV2A 3ZEIA 3GEGA 2OCBA 3O94A 4FDLA 4JR2A 2IXBA 4ZO6A 2JFGA 1QE0A 2OP1A 2C83A 4PICA 1LPBB 3VYTB 4QBIA 4GECA 3CCBA 2WKQA 2WTMA 1HQYE 1ZD1A 4TYMA 4WKPA 4X24A 3AM5A 4ZCRA 2CXNA 4EWLA 1LPMA 4MYDA 2DH6A 5A7HA 3ZH2A 3BE4A 4BMYA 1B3RA 1Q0LA 5DP1A 2X23A 1TAHA 1VL0A 5TT1A 3QWIA 3EWSA 2CFRA 1QIGA 3OUTA 5LKRA 5CYPA 3MQ2A 4Z3DA 2Q0SA 5DDIP 2I8AA 4K1LA 3Q7PA 1SVKA 3NM6B 1LFDB 1MO5A 1R4MB 4OA5A 4S2UA 1JHAA 1ZK3A 2ZSEA 1H8EA 3IMGA 4IOMA 4QFCA 5CM8B 5T6BA 1N8TA 5BO5A 3H8WA 3U7QA 1G5PA 1U94A 4Z3OA 2I3ZA 3OLCX 1GA1A 2ZRLA 4JCOA 3K32A 5I45A 1EK5A 1ACMA 1BYUA 2JJ2D 1WMBA 1NX6A 4QBFA 4ER7A 3JQBC 4YCSA 3T3PB 1I2DA 3WGLA 5A4FS 4ESVA 2BEKA 3E53A 5DGHA 3LRPA 1VE6A 3K94A 1OYYA 4K05A 4JL6A 3TTTA 3I28A 4BFSA 2DERA 2PYDA 4HDRA 4RKRA 2YNMD 5KIAA 5CFZA 4W4TA 5EKDA 3ZKAA 4D4GA 2CB0A 4X8HA 3SXPA 1V16A 2GUGA 5I7HA 4TWBA 5JEEA 5DSZA 4IICA 5F4ZA 5H83A 5I3CA 1HSZA 4TYPA 4YC7A 1U28C 2EYQA 3PFIA 4Q4AA 2WLSA 1O9BA 1KEUA 1XMVA 4B7AA 1I1QB 5IN4A 4ZOLF 2E3JA 4RA9B 2GRJA 4LFCB 3AVPA 4Z3KA 3ZV5A 4Y9UA 1XTVA 1KI7A 3BMQA 2R5WA 1DJPA 3ORRA 4MZDA 4OK5A 3TOVA 5KNBH 1DO2A 3EDCA 3OZEA 2PMCA 3UB4A 3WYFA 5DNUA 5FTMA 4BYGA 4DWJA 3WA7A 1U1EA 4EKDA 821PA 16PKA 1M8GA 5CPFA 2HMYB 5THXA 2JIOA 2HJHA 2WYHA 3K71B 3LX5A 4UDOA 1RI5A 4OGWA 3KXPA 5E1OA 1LI7A 1YBVA 4CL2A 3MCTA 3U44A 2BM8A 5L53A 5L51A 3RVMA 2H7YA 2KLHA 1XEWX 1ULSA 1XMPA 2IIPA 4W1RA 4KFRA 3VPXA 3Q11A 4D97A 1PE0A 4B6EA 1T4BA 4DSNA 1TZBA 4TMZA 3GBVA 4KQHA 9GPBA 5LDGA 4XYEA 1KP9A 5BYBA 4ZCSA 3NHJA 5BNIA 3K4QA 3L8CA 3VAAA 1Y1QA 1ESZA 4DCTA 5BUCA 3PFNA 3FH0A 4IF4A 1IBCA 5LP6C 4IH9A 3LOPA 4PLZA 2BW0A 2M32A 2VAPA 2Q99A 1QIEA 1ISHA 2CCJA 4PCLA 5FOQA 2Q2QA 2P4UA 1VOTA 4UBLA 2AOTA 3CIOA 2JI4A 3KALA 1TRKA 1UMDB 4RDXA 1H66A 3WAJA 1M9NA 4WXEA 2ZCJA 1AXEA 4P36A 2YV2A 1Q44A 1FXWA 3RTAA 4QHYA 5J4HA 2WYIA 4LZLA 5EYPB 1CCWA 1E2MA 1PJCA 3T3IA 3TRKA 5AQ1A 3FTEA 3DYIA 5AVZA 1FU7A 1SOMA 1ZOOA 2BELA 3EOBI 1J0XO 4P2GA 2PPLA 2QMEA 5DE3A 3HQ4O 2FJPA 2ZRKA 3EK2A 3IA2A 2W58A 3L6UA 2CYAA 3D7NA 1Y34E 3HXLA 1CC1S 4PAQA 2P7HA 3DYVA 3D6MA 5JG7A 4MW9A 3U6KA 4DMGA 1O96B 2GHTA 4DEXA 1YTLA 3O8NA 1JLLA 4AO7A 3QKSB 1EH5A 1RYDA 1K7SN 2V3VA 1L5VA 1G3UA 2C5BA 4IO0A 2G0NA 4PNPA 3HLKA 2XYHA 8ABPA 3R9XA 1T4MA 1JSXA 2IC5A 3NRCA 2EOAA 4MPTA 2VK1A 3RSOA 5EWMB 3IRVA 3EVGA 3PITA 2I4RA 1THTA 2IV7A 4K9KA 2JA1A 3IUJA 1Y9ZA 2CLSA 2HN9A 1P74A 1QG6A 3AU8A 1LXCA 3ILVA 5D86A 1WSDA 3P9NA 4TLBA 5AI5A 2PQ2A 3WTBA 4JXZA 3K1YA 4LIPD 2F8SA 1CULC 2CVHA 2G6BA 1PF7E 3SYRA 4EOGA 1F3OA 3NWEA 5AW2A 1H65A 2ABWA 4EQ6B 1F8UA 3GUUA 1EXNA 4ONEA 5AW6A 3RB8A 3KEGA 3G59A 2PXHA 1CUAA 1I3LA 2XDWA 2DT8A 2O8FA 3BD8A 4KR9A 5CVUA 4Z4QA 4IQ8A 1YA8A 4QBTA 3VDXA 2XVXA 1O3YA 1H22A 4H3KB 1T8UA 1KEEB 1VDMA 2MYTA 3QLTA 4FWBA 2PGLA 3BH0A 4HAIA 1NOKA 2QXUA 3TNJA 1Z63A 3PFBA 5IYZA 4BWGA 4MYTA 1K63A 4HAYA 5FFNA 1AK9A 1HDZA 1V8DA 3T7AA 4UXHA 1JZSA 2E1RA 2ZQ5A 3QEMB 4UMVA 2OOKA 1M76A 4NBKA 3VYRB 4J3JA 4MV7A 3NRBA 4Z5XA 13PKA 3EWIA 2CNLA 4KWEA 2DE0X 2WW8A 2KMLA 3HMQA 3AP1A 1UR5A 2Q27A 3GPDG 2W83A 3H7AA 4RADA 1KI3A 4KLZA 1QYXA 3GZTB 1VB5A 3QRWA 5JXWA 1N7HA 2ZAMA 3HSYA 4S1PA 1DTEA 1G9XA 5IK2D 2CV2A 2NSDA 4CIXA 3K20A 3N5KA 1JP7A 2ENUA 4KWTA 4V0ME 3KXLA 1N2CA 1GFIA 2P1ZA 3EVCA 4HRXA 5CNMA 3EWAA 4ZT6A 1A7AA 1PLJA 2FZCA 3FA2A 1H42A 3M4JA 3TPFA 3WL5A 5L4SA 3U2QA 2FR8C 3HFSA 5DNVA 2GSDA 3TSYA 3ZIAD 1H9BA 5HS4A 4W7IA 4RETA 3RNOA 4DCNA 3BTUA 4IIDA 3UO8B 2C0CA 4GSLA 5KVSA 3E7DA 1LPNA 3FAZA 2F62A 2WJPA 1AO0A 1VHJA 2HOQA 3TH5A 1WPXA 2WJZB 5JV5A 2ZLBA 1KE2A 1QDUA 4JJFA 3T8YA 5TMDA 1N6IA 4YGYA 4Q1DA 1QMPA 1UOOA 4XSHA 4F8YA 5F1PA 1E69A 1Y7LA 4IIHA 3FNGA 4LYJA 2HF9A 4MYHA 2CUTA 2BGRA 1G6OA 2H4XA 2J3DA 2PBZA 2VFAA 4EB6B 3PXXA 4F84A 5HOQA 4MP3A 1P9LA 4EI8A 1PJBA 3LZ6A 1NXSA 3QKRA 5D6OA 3SQDA 1VJ0A 1WW3A 1R15A 5BXQC 3OM9A 2GBGA 1DAHA 4HPWA 1GL9B 2RGCA 1A2BA 1ECGA 3RG2A 3QF7A 4IXDA 4GEGA 3HR7A 1ZHHA 1D5CA 1K6JA 3K2IA 3ZW9A 5E8JA 2II6A 3B1JA 1CUDA 2HPHA 1NAHA 3D0KA 3FIJA 3N9IA 4N82A 2WJVA 4GE3A 2R79A 3WGKA 5CITA 1Q0SA 1OFGA 1NBIA 2V4UA 2WFMA 2DY1A 3LX6A 2ZI9A 3J7AC 4MKGA 5LQKA 3ONDA 2DVMA 3KKEA 1AHIA 2QD1A 2YZKA 4H1WA 1Y1KE 1U2SA 2GPWA 3KDAA 2D2FA 2WB2A 1G64A 1GL3A 2JBHA 3F71A 3NTRA 2DZDA 3HDTA 4WEQA 3WHPA 1PEDA 1JAYA 3UCFA 3D1LA 3TR5A 3WMFA 4GICA 2IL1A 4JJGA 4FZJA 3WWPA 1D6SA 2ZWPA 3OMXA 4X1YB 4RSMA 3WRYA 4WBNB 2C8JA 1W93A 4FFSA 2DT5A 2RHRA 2DWQA 1XV5A 1VQ1A 3I9KA 5JZSA 4NDAA 3K9LA 5DBFA 4JVMA 3VZBA 4F4IA 5GVRA 2J3HA 2RGNC 1OV6A 6YASA 2ODBA 5CTAA 3ZE0B 2ZR0A 2JRLA 4C7MA 5BSRA 5CFRA 4F9EA 1IZ8A 2W8ZA 2UV8A 2KM1A 4U7HA 4QATA 4HB3A 4ZOBA 2CJXA 1BJRE 4TLEA 2GJKA 4XVHA 4ZYLA 5IM4F 1YA6A 3U4DA 1VL6A 5JO0A 3KAPA 1P60A 2IOFK 2VAVA 1OAAA 4Y67A 1ODTC 1ESMA 1K3TA 4J3FA 3UQZA 5FUVA 3W5SA 1JMYA 5TQ2B 3SZMA 3G6WA 3P4UA 1AGRA 4LHZA 4QDOA 5IARA 5GJCA 1PT5A 2Q4DA 3M82A 2D7CA 1JAHA 1XNGA 4URVR 1CR6A 1PT6A 5ALZA 3LPLA 5CNIA 1I7NA 3P0RA 1XKTA 1NVBA 4CIDA 1I2ZA 2QJFA 3D6FA 2G82A 4CFYA 4EK9A 1I36A 2DKFA 3GQBB 4NBUA 5JZVA 2ZZMA 1YXMA 4Q6WA 4BRSA 1LSJA 1L8QA 3JYLA 2RBGA 4IGFA 3ZXIA 1T9AA 1X8XA 2HF7A 1XYGA 3RYIA 3MERA 3BSFA 5GZ3A 1KJNA 5DIFA 1M2GA 3T9BA 4OO3A 1NBAA 4N3CA 3AVTA 4M89A 4G1MB 2D59A 2LXNA 4D74A 4QOHA 1W0KA 1W48A 1I9CA 3I92A 1AMOA 3BMXA 5FTNA 1XZHA 1P19A 1TM4E 2HYDA 5KYXA 3AZOA 1CF2O 4C03A 3O3CA 3TVDA 5JHHB 1UK8A 4AUMA 1DG1G 1NR5A 4TVSA 4A8JB 5LDDC 4LJ8A 4TKVB 4ZTBA 1WSAA 3QTLA 2ZP1A 2EZUA 1JHUA 2EG9A 4KXLA 2QVLA 3H3JA 2W2MA 1NN1A 5K0CA 1CVRA 2PMBA 4A0RA 2VAXA 5KNBD 2JARA 1RQXA 1YZGA 4GVLA 1WHSB 2I4MA 2RAPA 4BEVA 1E2UA 1KQPA 1U7HA 1G8KA 2G4CA 3BUSA 5ALVA 1G0NA 1Q1GA 5KI6A 1Z82A 2PMDA 3IVGA 2ZFUA 1Z2PX 5IULC 2ZT5A 3V34A 4QYIB 5C5IA 1YS4A 1L6IA 4D0NA 5HKLA 1LGYA 3U61B 3VR3A 4KWCA 3JQAD 1CZRA 2BI8A 3AVWA 1E63A 1F0YA 1VTKA 2NPIA 5L7WA 4N03A 4U4AA 5DHFA 2GB4A 2DFDA 5BYJA 4W5WA 3UUFA 1XA0A 1O8BA 1HQKA 4KVFA 4MWDA 1OQAA 3S68A 2NO7A 1USKA 1O95D 3IAFA 1MG5A 2B1JA 1FFWA 2WNIA 1FCJA 3GPBA 4NK4A 4E21A 2WWWA 3O4FA 3VVMA 2ID8A 4UULA 3S40A 4RFSA 2R1VB 5B3KA 1JG3A 2Y2VA 2CLHB 3BCHA 5CGZA 4DA8A 4R4JA 1WKCA 1L9KA 3G2QA 3RAPR 1GCGA 2VPTA 3ZNOA 3ZVMA 3L7NA 3UHFA 2IX3A 4MVJP 1H2AS 2J5BA 5D8DA 2C29D 3TR0A 5CK4A 2E85A 4Q4HA 2JHFA 3KIPA 1KXZA 3H5LA 4IH4A 4EGJA 3ZE6A 2XMDA 1J06A 4BX9A 2O5CA 4I4TB 3S1AB 4FUTA 1P2GA 4CI0B 3WLSA 1K6EA 1N2BA 3DVAB 3ZD7A 1Y3AA 2Y4OA 1UEXC 1NI5A 2VWGA 3HB0A 4K9MA 3BWEA 4EITA 1Y6ZA 1ID8A 2Q6KA 4ISCA 3GEIA 3KG2A 3TMKA 1SVSA 2Q3FA 4IEIA 4ZVRA 4MUFA 1DAIA 3RARA 4U6QA 4OJKA 4UUQA 4V0MA 3O1JC 1XEFA 5BN1A 1DTWB 1ESEA 2LW7A 3QPCA 4XB2A 4ZP1A 4ZV4A 2WTBA 1ENYA 2AOUB 3QYPA 4BQFA 2IYLD 2VNHA 3H4MA 4DSAA 1BCRA 2BMFA 1G7SA 3MPOA 5F52A 3NETA 4QHSA 2K4MA 3HJNA 4JJ4A 4JUDX 2YWHA 2CVPA 1WZNA 5GZ6A 1X0XA 3G6KA 4ENTA 2ZYGA 1I1HA 1V9LA 3WFJA 4QXAA 3Q3GE 3VR2A 3PEYA 3O9ZA 2QE7D 2X2OA 2ZTVA 1LVUA 1QAMA 1YC5A 1ZP6A 3OE7D 3Q2IA 4R1OA 4A3SA 5TXGA 2RHJA 3B82A 2ZS7A 3USZA 3K5WA 1RAAA 2NACA 1VA4A 2X3YA 3CPEA 4B44A 3U37A 5KJ6A 3K70B 1J2UA 3UJ6A 3UJPA 3QMMA 4M9QA 3O0DA 4ILKA 4CTJA 1DC3A 3QFCA 1VKOA 3T3GA 2JEZA 3OAAA 4R9VA 5T4EA 1AKEA 1JH9A 3BXPA 1T1RA 1DQYA 3K31A 5DNDA 3WK6A 1Q0QA 1NW4A 1YBAA 5E0KB 3EEOA 2PKWA 3PDIB 1C9NA 4L02A 5IJ9B 4MJ3A 4L8WB 4AJNA 2OV3A 1ONPA 3KVOA 2AA3A 1CR0A 2Q3EA 5CVEA 1CY6A 1FSZA 1WWKA 1X39A 2FH5B 2ORVA 4IDHA 3E3NA 4BN0A 1L7AA 4P33A 3WBJA 2Y99A 5JDCA 1ZN9A 5FEMA 5JSHA 2OO5A 4LDPA 4YP0A 5LB2A 5SZJA 2ZUWA 3SS7X 1OX4B 5DF1A 1X1EA 1XZBA 4MUMA 3MRSA 2EFGA 4FZVA 3D3QA 2ZITA 3NH6A 4WBXC 1EK0A 1FUKA 4DKJA 1Z6XA 5KWSA 3AJDA 1DCTA 5C8YF 4A36A 1ZK1A 1V6SA 5HUQA 4Q03A 1X9GA 3B38A 3I3OA 1K4MA 5DK4A 1WMDA 3PR2B 2GVZC 2G67A 2W6CX 2ZU6A 4I5EA 4Y2RA 2X0DA 2WMOB 4REMA 3TSZA 3HBMA 1BH6A 4LXUA 4XR9A 2GPAA 3JAWB 2DUWA 2YS7A 1P6XA 3THWB 3DOJA 3I05A 4PXAA 2GZRA 4PYLA 4BFZA 2HLPA 3N59A 4H4DA 2CJWB 3A9CA 1MW9X 2GZAA 3DDUA 4IDFA 3BFPA 5J2UA 2I8LA 4IH1A 3DE1X 4M54A 3W90A 1Y8RA 1FZQA 1TK3A 4ZI5A 3EEFA 4IXMA 4LJYA 5KOHA 1XZDA 4EJFA 3M4ZA 3E23A 1F9AA 1PL8A 1BMFD 1SC4A 2JIBA 3PQ7A 2HDOA 3QBJA 2OPHA 1XZFA 4O4JA 3PQ5A 1L5WA 2C7OA 2IEYA 4P80A 4BLPA 2MINA 3HB5X 2WU1A 2V6IA 3PZRA 1H4TA 4V0NA 3R3JA 1ZITA 1NVKA 4HVCA 1Y3HA 3OC0A 3T38A 1XRLA 3IB6A 1ZGJA 2E4XA 2OV4A 3U13A 4AZ3B 3N74A 4P4UA 4GAEA 3IPXA 5C7OO 2AYXA 2HBZA 2NTJA 5K0ZA 2NUPA 3L8EA 1N2HA 2X58A 1EVLA 1UUFA 3ILHA 1O95C 4TWZA 4XD7A 1I80A 3KUDA 1KOFA 3E1GA 4W8GA 4W9NC 1E32A 2JGEA 4GR9A 5LN1A 3SCZA 1PV4A 4MP8A 3RYCA 3TM5A 5K8VA 4Y1GA 1DKLA 2A9RA 1U3GA 4O2AB 2NXJA 2SCUB 1FFSA 2ZSHA 3OTIA 1KKMA 2JFZA 4LVCA 4HAWA 4MVYA 3BMCB 3NBAA 5LQNA 3K1AB 4L0CA 3EEYA 2PMFA 4KV7A 2GEDA 3B1ZA 4LSZA 2R1TB 2ZUFA 4IFIA 3KSMA 3H8SA 4QWWA 2GZ3A 3L1HA 1YB6A 2Q0QA 2R8BA 2LP4Y 4LW8A 1JDTA 1GNPA 1A1SA 2JIQA 1IMJA 3KZOA 3WRXC 2P27A 3ZUPA 4DCCA 1RHMA 2HV8A 4TOIA 5AJHA 1RQ2A 3TLGA 4DQVA 3D54D 4EGQA 1W25A 3ZHVA 2OMEA 4CPDA 4WZAB 3LVRE 2P67A 3MWDA 5J4YA 3LHSA 3M2TA 4L0MA 4RDHA 4U7WA 3VYSB 3T12A 4LZJA 4N6GA 5M5BA 1NI3A 4WH0A 4GOLD 1Z0UA 5AKKA 4DIOA 4R7ZA 2O0LA 2EFCB 4D4HA 1X2EA 2OZKA 2IKSA 3B9BA 2FGKA 5THKA 1HOXA 5TMEA 3PFFA 3DC2A 4WX2B 1KOJA 4Q01A 1YULA 1KYXA 1OI7A 1UBGA 1ISPA 5DO9A 4MAFA 4HX2A 3V00A 2GASA 4TZ0A 3C3DA 3PI6A 2OCKA 4HL6A 5FL3A 4IDCA 2DHEA 4EZIA 2HHJA 1JXMA 1XDSA 4DIUA 2IXTA 1JQDA 3P0FA 5B1HA 2YDYA 5JARA 2IQIA 3IULA 1RTKA 1YDMA 4QPCA 1RP1A 2V6GA 2ZVJA 1Y3IA 2XMZA 5TSDA 1I5OA 4L5BA 2GNOA 3GLRA 5FNVA 3O4IA 4IIUA 2C2HA 2YXDA 3WVNA 3LF2A 2Y71A 3QW4B 2C96A 2AFHA 2Y6VA 2IZ6A 1BS2A 3T3NA 1E5DA 1DBPA 5DB4A 3GJ3A 3UUEA 1YWGO 2FDRA 1E3JA 2QD5A 4JLUA 6ADHA 1X1BA 2V7GA 1SD5A 3B7GA 3PNPA 3U1VA 4DC9A 4JLDA 1SRRA 3EXHA 4CQMA 4TVOA 2R8ZA 2G9RA 1KGSA 4PZEA 3KL2A 4GXNA 1ZVVA 5E6RA 1OTYA 4KB5A 5KKCA 2HCFA 3MWGA 4L51A 1QRUA 3LU1A 2UUBB 3DDWA 1X80B 3KQWA 3UWMA 5L3VA 2AD1A 3L77A 3F5SA 3GJ5A 1U2PA 3W5AA 4K46A 4Z4GA 1M6VB 3P1JA 1UKEA 1VG8A 2RCYA 2CF5A 1NPTO 4YALA 3SN6A 1YS7A 1XZCA 4JJZA 3SQOA 4YCCA 5KOIA 3E81A 2BVNA 5KVQA 4LPSA 1NPYA 1NKVA 2X19A 4FGJA 1NFQA 1IAQA 2JCBA 4UE2A 3VSBA 2R2AA 3NNDA 5K3FB 2FOIA 3I6ZA 4URFA 4RV9A 5E9AA 1GSHA 1OZ0A 3ZE9A 1OKKD 2D4HA 3PHCA 5EHQA 1KJ8A 2CHQA 1G20E 2Q2NA 4NNPA 3NASA 4LCEA 4R2XA 2HR1A 1NFFA 2F00A 3WWCA 1OLXB 1BXRB 5CEJA 5JCXA 3C8MA 2RD2A 1E79A 3OZSA 4JIMA 2P6NA 3AL0C 1PUIA 4LCBA 4HHEA 2OAP1 3HUFA 2GXSA 2I4LA 3IQXA 4P1ZA 1VI6A 1P77A 1P1RA 1P2BA 4AUNA 1QM5A 4ZZ0A 5AXCA 5HFAA 1T2NA 1W4ZA 4TV9A 4DUGD 2W11A 4CKYA 3WDSA 5JXJA 1E1NA 3V1TC 4W5TA 2L18A 1EVQA 1R6TA 2AN5A 2JD2A 2VC2B 3WGGA 5DLYA 3IVRA 3K1ZA 4Q3KA 3WWYA 3W9SA 5I4KA 1EZZA 2J6HA 3P0HA 4NCBA 4ZGWA 2M98A 5AI9A 1TYZA 3N39C 4URWR 3W5IA 2X4LA 5CCEA 3DCIA 2MR6A 1MT0A 4HZUA 4HATA 4GNRA 4UM7A 5TGZA 3SHWA 4E46A 2WYVA 2Q3BA 2X3UA 1GTSA 1HL3A 1L4FA 3CW9A 1A77A 2D0PB 2RGXA 4DR2B 1NLZA 1PGNA 2HQBA 4Z0HO 4DB4A 3G23A 3V46A 3VU9B 3SF0A 4JI1B 4KH0A 3HCCA 4E14A 2F1RA 3H1AA 2A1IA 2TSYB 2XNHA 3FETA 3K4PA 4R8VA 1KYQA 1VE1A 4ML3A 1RRGA 3PC7A 1RXEA 3EXIA 1FS5A 3EVZA 2J3JA 1JIKA 1FXSA 1JSZA 1UM8A 1UF9A 3TLEA 2GZ1A 4ECEA 2AF3C 4DC1A 5JJCA 3NVAA 5KTOA 4QUBA 1E4EA 4HWOA 1DFIA 1Z5PA 1QXSA 2JFOA 1QR6A 4RPGA 1BSVA 4B3IA 1T3SA 4EPRA 4HH3C 5P8WA 4NFLA 4LISA 4BQPA 3B9PA 1NVXQ 1QIMA 4ZVOA 3S4YA 2QT0A 3QY9A 2W70A 1KYWA 1TTHA 3TLXA 3P9CA 1OR8A 2WAAA 3CVJA 2QVYX 4FSXA 3B9RA 1E77A 1D09A 2P2NA 3TG2A 2PUFA 1ZD9A 3Q9SA 3PE6A 1T8SA 3ELWA 1SQ6A 1RDFA 3KZMA 2XUQA 2HMWA 5CDHA 1F48A 3P2IA 4X62B 1V1MA 2WOOA 1T0UA 3AG6A 1SH7A 3IUEA 2PGOA 1Z15A 3B2EA 5I7EA 2AR9A 3K92A 1XI2A 4MMZB 3BF7A 3BL5A 4R0VA 5FWDA 3ZCUA 4ETWA 4US2R 1ZXXA 1WCXA 2JFXA 3B1WA 4PLTA 2W6OA 5EKSA 2KS6A 3D5EA 1WDWB 1KH2A 2QMYA 4Q18A 4B43A 2OB1A 2W43A 4MDYA 1IPEA 1QORA 1QZUA 4K6HA 3DL2A 3V7UA 1JA0A 3F6BX 4A92A 4C06A 2HK7A 4F2GA 1BZYA