4WY2A

Crystal structure of universal stress protein e from proteus mirabilis in complex with udp-3-o-[(3r)-3-hydroxytetradecanoyl]-n-acetyl-alpha-glucosamine
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
310
structure length
308
Chain Sequence
EKYQNLLVVIDPNQDDQPALRRAVYIVQRNGGRIKAFLPVYDLSYDMTTLLSPDERNAMRKGVINQKTAWIKQQARYYLEAGIQIDIKVIWHNRPYEAIIEEVITDKHDLLIKMAHQHDKLGSLIFTPLDWQLLRKCPAPVWMVKDKEWPEYGTIVVAANLSNEESYHDALNLKLIELTNDLSHRIQKDPDVHLLSAYPVAPINIAIELPDFDPNLYNNALRGQHLIAMKELRQKFSIPEEKTHVKEGLPEQVIPQVCEELNAGIVVLGILGRTGAAFLGNTAEQLIDHIKCDLLAIKPDGFTCPITV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Universal stress protein E
publication title Crystal structure of universal stress protein E from Proteus mirabilis incomplex withUDP-3-O-[(3R)-3-hydroxytetradecanoyl]-N-acetyl-alpha-glucosamine
rcsb
source organism Proteus mirabilis
molecule tags Structural genomics, unknown function
total genus 105
structure length 308
sequence length 310
ec nomenclature
pdb deposition date 2014-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00582 Usp Universal stress protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12370 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4wy2A00
4WY2A 3CISA 3MT0A 5CB0A 4R2KA 3AB7A 4R2JA 3OLQA 3AB8A
chains in the Genus database with same CATH superfamily
1A1SA 1N5IA 4LZJA 4NQRA 4BNGA 1X0XA 1R0RE 3KJNA 4MEBA 3JARA 2ABWA 1QG2A 2CHEA 4REQA 3LF1A 4KUGA 3NBMA 3OIVA 4Q7MB 5AKIA 3TR0A 3JALA 5EJMA 4OFBA 4BWGA 1Y1LA 2FN3A 3TAUA 4H6XA 4F2GA 1V25A 1V1MB 3R6DA 5JYDA 2A9QA 4QBGB 1ZA1A 4IIXA 4MV7A 4YYEA 1AGPA 3PFBA 4BO4A 2JLRA 3WLLA 5B3JA 2I6TA 2E7ZA 3AY6A 3FBTA 1A5AB 3NIBA 4M4SA 5D1HA 3FVQA 3T7AA 2Y1XA 3WOHA 4C07A 4CJXA 2WTBA 3PDWA 4JUBA 5JHGB 3ZX5A 3P2MA 2O2ZA 5LA6F 2C2MA 1E79A 1F1BA 2H07A 4P1ZA 3UANA 3FPJA 3IUQA 2M98A 1GPJA 4EG1A 2DBVO 1UEIA 5DO9A 3LNCA 2GZ3A 1WPXA 5JFGA 4UFOA 3LYLA 1CVLA 1LPSA 3WGQA 1KO4A 3VNBA 1YDWA 1ZO8A 4NR0A 2NYAA 2C4WA 1O97C 1DO8A 2NTVA 4R2XA 1KEKA 3MMSA 2W2VA 3B6EA 3O8BA 5EFZA 1O9GA 2IYEA 2ZJZA 4NIMA 4OGLA 2V7EA 5FA5A 3GJQA 2IIVA 3PPIA 4DHEA 2YQZA 5DX1A 1RXWA 5JNTA 2UVDA 4I4TF 4F3RA 2Y1EA 4EB0A 2LR0A 4Q3KA 1YMUA 4IZIA 1EQ2A 3E03A 4LXQA 1G8GA 2C4UA 4ER0A 1GZ3A 1M8FA 1SBIA 1YBMA 2ZWOA 5B3KA 4RDXA 2HHHB 3FTQA 4N9WA 1SCDA 4NLLA 2I4MA 2X2FA 5CYGA 5I7SA 3LRXA 1G6HA 1P1CA 3R0XA 4G8CA 2JASA 3WAGA 1QYXA 4PRYA 3PGKA 5T4EA 5CG2A 4CTJA 1UBSB 3HJHA 4ZVLA 3ITNA 3PDHA 2R11A 4KDFA 5I9IA 2PKRA 2ZRCA 3DHVA 4GOLD 4AMYA 1KY2A 5JV5A 3EJ6A 4K88A 3MJFA 2F1IA 3ZWMA 4JCCA 4O2AB 4HEHA 4MCHA 3PKJA 4GPAA 2ZR8A 1KQ3A 1KTVA 2Y66A 4MRSA 4R41A 5KYGA 3GLFA 1TMGE 3CZ4A 5F7XA 4MKHA 4YRQA 1WPRA 4NOLA 1D1SA 3IVXA 2PSDA 5JYEA 4UCQA 1BN7A 1JFVA 1T4CA 2LD4A 2VJQA 3GR6A 3RO7A 1RQGA 4E5UA 1NM5A 2OV1A 5H3HA 2V7VA 2CF5A 4HLCA 3PLNA 2AC2A 3L1KA 2XYQA 3LDHA 2WFLA 3VDQA 5KTYA 5DK6A 2GZMA 1RKBA 2NSLA 3M6MD 3KS9A 4YS6A 3NHYA 2ZSEA 4BZZA 1N2EA 3MSXA 4EF6A 1U8TA 5BV8A 1ZI9A 2J9YB 2GN4A 4Z4GA 2PKQP 3WA7A 2H92A 3SQNA 2IYRA 1CQIB 1LPMA 3DWEX 2Z8YM 3I9V1 4DGSA 3RJZA 1PDOA 4U5QA 4NYIQ 1J2JA 3CH4B 1WD5A 5E1BA 1NVBA 1VJRA 3AM5A 3IOYA 1UJMA 1KMNA 2BEKA 3P8ZA 4BATA 2P6MA 2OQRA 2BVNA 4P4UA 1IUPA 4XIFA 3FKJA 3ZCUA 1ZKMA 2G7MC 3NIWA 5HS6A 1LI5A 4F4IA 5KIAA 2XRYA 1LD3A 2EATA 5TEVA 1AA6A 3B1ZA 1EWRA 1Q0PA 4PAQA 4LK3A 3TRFA 4PWZA 4EUEA 4EUKA 2ZBFA 4JI4B 3TCXB 4TZ0A 4BQIA 1NLMA 4M8IA 1WHTB 3NYRA 2VJMA 2V5VA 1CDDA 3KPWA 4MV6A 3F47A 4WUVA 1AGNA 3WLOA 3P2JA 4EGSA 1OT5A 1AZTA 4OJQA 3MW8A 1NJ1A 5E6RA 1XA3A 1K5PA 2C2GA 3HDGA 4MMZB 1A9RA 1ZH8A 1CG6A 1ELOA 5D6OA 5DHRA 5G2OA 3DO6A 5C34B 3RC1A 4D7AA 4DNQA 1GJRA 1ZMRA 4DM4A 2V7UA 4XCVA 3LY7A 4FHFA 1K2VN 3UAVA 3CE6A 4OQ4A 1I14A 4JI3B 3Q7QA 3FF4A 2VUTA 2IW1A 1HNWB 1IYZA 1I4DD 3C39A 3FCYA 1SVOA 3VPXA 4PN7A 1Y8RA 3GI1A 3LHKA 1IVSA 4I9UA 4TKLA 2OWDA 4BLSA 3NHBA 5AW8A 2JF0A 3RBVA 2N9UA 3PRKE 4HRXA 4HADA 4UBMA 3WTCA 1NW7A 2V6MA 1T1SA 5AK3A 2VQ3A 2MSWA 1ZOSA 2HF8A 2GEJA 4H77A 4MI1A 3SQLA 1GTG1 4MULA 4EABA 5IM4A 3K73O 3NHWA 1CPYA 1K92A 1L1EA 3MGGA 3Q9NA 2QQ0A 4X24A 4E5VA 3LD9A 1BDJA 1NW6A 2I8CA 2NT4A 2XUQA 3NKLA 1OOEA 1XLWA 2WG1A 3NTOA 3WYBA 3T9DA 2I4NA 3CVUA 4YT5A 3LT5A 1W4LA 3GV0A 1EFTA 1XTRA 1XR3A 1XZJA 3NI2A 3NBZC 1WUJS 4KBFA 2AQ8A 1T36A 3C3KA 3C7DB 1N33B 4GMGA 4YAKA 2MYPA 3PNPA 1VHLA 4M53A 1ULSA 1N8TA 1XZ8A 3K0EA 3LK7A 1XZQA 4E5PA 5JO0A 3KT8A 3KV1A 3Q8MA 2OHOA 2GZHA 3IDAA 4I50B 4DQXA 2ECPA 2FG5A 3V7YA 4BNTA 4L5JA 3RGGA 2EFGA 3QU2A 3EGEA 2PRZA 2WWHA 2FOLA 1ECJA 2ZRJA 4EKNB 3B12A 3M5CA 3VNQA 1D2CA 3L7NA 4QOEA 1Y6ZA 3TJMA 1K7YA 4CVNA 2JBWA 3C43A 4XRRA 2JFNA 3OCJA 5JXJA 1K6EA 4LV5B 2HMTA 1U1DA 3Q0EA 2ODNA 2GM9A 4RA9A 3OJLA 4NJMA 5JJ5A 5KTSA 1Q0QA 3QPDA 1UDBA 4IJ6A 3S6JA 3U60B 2ODQA 1GG5A 1EZ1A 4W1PA 3HCEA 4TLAA 1FLVA 2ZSHA 4RJTA 2VL7A 4L95C 2IPMA 4LTDA 4UXHA 1MAHA 3K1YA 1E2KA 3OUZA 4WXMA 3T7SA 2BISA 2JGDB 4LXYA 3U3ZA 4CIXA 2DHDA 4XQ0A 2P9CA 4QFMA 3K9HA 3KKQA 3DFZA 2IDMA 1SVKA 1NC3A 3EA4A 3EFEA 3HP7A 3OBIA 3QENA 1A8UA 2GA9A 1GPKA 3EC2A 1S2OA 4JV5B 3DF9A 3F4LA 3WWYA 1UXGA 4ZHQA 2ZZMA 2WNSA 1KA9H 3CF4G 3H11B 3I0ZA 2I29A 2I2AA 4M0FA 4F4FA 1TLFA 2P9JA 5M3BA 3IPCA 5ALQA 5JJLA 1N2XA 1SA0B 3OKFA 2H7YA 1FNDA 1DZ3A 2FXVA 4OXYA 4E3ZA 1FUKA 1TM5E 2NUPA 3GLVA 1N77A 2ZIAA 2Q28A 5FIUA 1T8YA 1L1FA 2JFQA 2YQ4A 3CNOA 16PKA 1C7QA 1CKEA 1SBHA 2PZBA 3HB9A 4FN5A 3SS9X 5JU6A 4FDVA 2XADA 4F9FA 1QO7A 2V8OA 2FWJA 4P7BA 4M1KA 1QP4A 3AEYA 1R15A 4FBMA 1ZMTA 2R8YA 3QJYA 3WGNA 2BGTA 4BTLA 2CXUA 3VH4A 1X1SA 4PCVA 2JGAA 3UHFA 1S3GA 1CVRA 4QXOA 5LD2B 4ZQHA 4GGOA 1FFWA 4KAJA 2P41A 3GRFA 3PE3A 3ZK8A 5MN6A 3RS2A 2BKUA 3M89A 4AJKA 3QEAZ 2GJKA 3LFHA 5E9AA 3W9SA 3CUUA 1H5UA 3L0ZA 3NP7A 5L7YA 1E77A 3F74A 4MDFA 2QD5A 3OWOA 1ISHA 3K0BA 4XIGS 1Q7CA 1NHGA 1UBGA 2CEKA 2PH7A 3FW1A 4EJSA 1N2CB 1G0OA 1I2DA 2OV3A 3F7MA 2PD4A 5HP4A 3OE4A 5KPDA 2ZRPA 4IF4A 4YJGB 1E6MA 1P5JA 3U4QB 5CFNA 5E8RA 3TIIA 3Q88A 2VP2A 3ADDA 3I72A 3HK2A 1U0RA 4UASA 3NBAA 2WIJA 4AFNA 1CHNA 1J99A 3LBYA 4JCOA 4DLRA 1MV8A 3F9CA 3SYLA 5JD4A 1QGAA 1PUJA 4LDNA 1XXHA 4RSRA 3PPVA 3FOCA 4Y6RA 5C3UA 2ZR7A 5SYAA 2HDOA 1TEVA 1BKYA 4ZV4A 1M2OA 2ZRFA 8GPBA 3NIGB 1CUVA 1SULA 1ZCBA 2OBXA 4Y6LA 4BKQA 3WHLA 2PT7A 3OFVA 1XMOB 1ECFA 3TRJA 1LJ8A 3FDFA 3T99A 1UXOA 1Z88A 1JHRA 1CDZA 4G36A 1EGQA 4NXNB 1HFEL 3NH6A 3OOEA 1Z0SA 2E85A 3GT4A 3DAPA 5H4HA 2X0EA 3ESAA 1AC5A 1ISRA 2NSJA 4YQYA 3CRQA 3OY2A 2FZ5A 3I5AA 4UCFA 3WOVA 4CM9A 3THWA 1B8VA 1OBFO 1GDDA 3R3UA 1EK1A 1VLHA 4X71A 1DCTA 4BMXA 1H3NA 2Q0QA 3PC8C 4CXMA 5CH5A 1S7GA 4ZVOA 4EPRA 1KO8A 2OUKA 1YCDA 2AOXA 4L8FA 1L4GA 1N7JA 1XRJA 4QPJC 2WFZA 3MRSA 1VRCA 2QQFA 2OBLA 2YJ3A 4LC0A 4AZ0B 1AUXA 3E15A 3IDSA 5BQXA 3GRYA 3KPVA 1XJ0A 3RIHA 3FTFA 1K63A 5FPPA 1ZEMA 1IWPB 2PWZA 1JVNA 2DKOA 2E89A 1N2SA 4CCSA 4BVJA 1VXOA 1P6QA 2W9XA 3FGPA 4FDTA 3PIRA 4RZQA 3VR5A 3WR5A 2CXPA 3GEBA 4OHFA 1VJDA 1LLFA 4LHEA 4Q7KA 5TQ0B 4Z7OB 4H59A 5FLYA 2ZUWA 1NBME 4EI8A 2D4AA 2GPSA 5I6DA 1WB9A 4ZI5A 5LU9A 4G1BA 5BSRA 5HM6A 1LDGA 2BP7B 1TEXA 2E1RA 3BVPA 4M8SA 2X4GA 1MD9A 3KCQA 4D4IA 1UM9A 1GPMA 1Z5UA 2F1KA 2QXYA 3OX2A 3Q9SA 4C0JA 1L4MA 3J7AC 1M67A 3LUGA 2APJA 5KYXB 1KMMA 2EG9A 2IPOA 1RXVA 2N1BA 2ZU0C 3UAGA 1LK7A 1JEQA 1C2TA 4OLFA 1QLWA 3JQBC 1CP3A 3IO3A 3JAWB 3KB6A 3BHNA 2J6IA 2B5OA 3SBEA 4GE0A 4D74A 3U09A 4IR7A 1LBQA 5A2GA 3B2QA 1F12A 2DH5A 3EJWA 3ZZTA 2R8XA 3G89A 5GY7A 2SKCA 4F1JA 3ZDAA 2SBTA 1ESZA 2IF2A 4TL6A 4J7XA 1ZN9A 3ZYZA 1KJZA 3QW4B 2IOQA 1Q2XA 5TT1A 4D80A 4IKOA 2FZGA 4A9AA 2V03A 4UM9D 1N0HA 3I5MA 3R0VA 1ZD4A 1RABA 1Q3KA 4I99A 3DJFA 5D00A 5IMSA 3Q3JB 1TADA 3DE3X 4YCMA 3DXYA 3EQ9A 3VRHA 2O3QA 3B1XA 3D2CA 3RFVA 3DVRX 1Z5WA 1AXGA 4Q1BA 5EQJB 5EEHA 1VSVA 4BAGA 3BMNB 3AUUA 3QVJA 4HMPA 5ALFA 4DN6A 2M6RA 1PGPA 3H8SA 4UEOA 5CFRA 5DN6D 4AS1A 2VJYA 4P9NA 4WW0A 4EEXA 1J20A 2GM3A 3SZMA 2GF0A 2REBA 2B1GA 1AQ6A 1PSWA 2OAP1 2JBAB 1XVAA 1ZRSA 3HS3A 4HVAA 4MWDA 4QUEA 3WB1A 3FROA 5CGZA 4AJLA 1OPXA 2WSSD 4GOJA 3P0FA 1T2FA 2ZS7A 2CLFB 5CGQB 3PQ2A 4ZCPA 5KNBH 4N3BA 3LTNC 1GGFA 4UREA 4XWWA 3BJRA 1G4HA 4IINA 2JFWA 2FSVA 4MUIA 2FDCA 5DGIA 4DEXA 1ZGHA 3TNDA 5L6LB 1KJYA 10MHA 3AT1A 1SQ0A 4D9FA 521PA 4E31A 4YI5A 2CFSA 4DDWA 3HUEA 2X8JA 1Y9ZA 1ND6A 3HDVA 2QLLA 1U5BA 3FCXA 4MPPA 1ZVMA 2P6PA 4PIPA 3ZTWA 1TQ8A 4EUNA 4UTPA 3A6PC 3WHKA 2H1HA 2X7HA 2OZVA 3NRJA 4LDZA 1DG1G 4HQ6A 1E1NA 4NYIR 5EKSA 2PMFA 1EEXB 3B6MA 3HCPA 2DWOA 2X4LA 4ZYUA 3QFCA 3LGSA 2EERA 4E7PA 1U1IA 1RRVA 721PA 1P3DA 1PFYA 1WO8A 2ACEA 3DE7X 4J7UA 4NZOA 3WA6A 3OPQA 4ILKA 3OQMA 1LF0A 1NQXA 4R31A 2J0QA 2XR1A 1J6UA 3X1WA 4N1AA 5EZYA 4LFCB 4YT2A 4P0TA 1XVVA 3KYJB 4MRNA 3PVCA 3SFZA 3WQQA 1TZ2A 4DY4A 2GB4A 1VOTA 4I8IA 3MWFA 1OGJA 3N6RA 4PYRA 4ZQIA 3I2YX 1QIMA 1NR1A 2HU7A 2BL4A 4HGQA 3FRIA 5CJJA 3VISA 1LJLA 3ABIA 1XYVA 1SIOA 1UFKA 2O6HA 1FA9A 4KDCA 3RSQA 1OF1A 1SBZA 3EAGA 2DHEA 4ETMA 3U16A 1QV7A 4IRMA 4B83A 2RGCA 1Y0BA 5K8VA 2ARKA 2AN4A 1AZSC 4FSXA 3GGSA 4H08A 4LJ5A 3WJ2A 5IAAA 3JVEA 3MC1A 4FPXA 1ZW6A 4HGRA 3WBJA 5JVDB 3SHWA 4TLMB 1M1XB 2C9DA 5BT9A 1LDBA 3B53X 4K26A 3KB1A 2JK1A 2IYQA 2RGEA 4GM4A 1YQWA 4NOMA 3NVKI 5A3JA 1Y8ZA 3T9CA 2QYTA 3BH6A 3L77A 2OXEA 3EQ6A 2NN3C 3VPBA 2PCJA 2F4NA 1GRCA 2KX7A 4V0LA 4X63A 3DS8A 4RGBA 3W8RA 3T12A 1MIOA 1MT3A 2D3TA 5CIWA 3KVYA 3W8NA 4FFSA 4Y9DA 5EKTA 4CKEA 3G59A 5JANA 5KVAA 1MUUA 4LOIA 2FUG1 4LIPD 2BFEB 2PDAA 3TW6A 3ZDZB 2JD0A 4M76B 5HIJA 6ABPA 5D5PA 1NWCA 2QW0X 3EIWA 3HBFA 5KYWA 3W5VA 3FLBA 4G1VA 1NLUA 4Q3BA 4M7OA 4KFUA 1USIA 1IZZA 4L0QA 4RGVA 1HOTA 2FSGA 2JFOA 4X3CA 2QPAA 3QJGA 3RNLA 5IU6A 4L3WA 3AI2A 2IYXA 2ANBA 1KDOA 3LX6A 3MHPA 2WSYB 2H16A 3I6MA 3QEOA 1KZ1A 1O95C 1RMTA 4DAOA 2A9RA 4JJAA 1ZA2A 4XCQA 4WK2B 3GFBA 2YS7A 1B0PA 2P62A 1VXRA 4FQ8A 3H2SA 1SCAA 3UJ9A 3W9YA 2OSBA 3BB1A 2C4NA 2EZTA 4DLXA 5DHQA 4YMIA 2PGLA 3TUZC 4YV2A 4K87A 3CGWA 2FQYA 1VPWA 4QHSA 4HEQA 5IKEA 2XMRA 1BU8A 2IP4A 4MQFA 2W5UA 1A9ZA 2G1KA 2AIRA 2HRQA 4FYXA 5CT4A 3CXRA 1MABA 2DVMA 2VYNA 1TYZA 1VB5A 1JHZA 1NX6A 1P44A 2NTEA 4ZV7A 2O0LA 4JIGA 1LKZA 1X7XB 3FB1A 1YHYA 1KERA 1L7VC 2EEPA 2PK3A 3KR9A 4FFBB 5HYVA 2BC9A 1FOEB 2A7XA 3AJAA 5IC5A 3N58A 3FSEA 4P7GA 2XD4A 3OD1A 3KAJA 1G21B 4A2PA 1FYEA 1UQUA 4DDHA 3CH5A 5JAOA 1F6DA 4RV4A 3ROFA 4YUZA 1YQEA 4BJ3A 1HX7A 3JY6A 3G5LA 5JCXA 2A57A 1YI0A 3M7IA 2PRKA 5EC8A 1BG6A 2F4VB 2R1TB 2WSLA 4TWZA 3M4JA 1XEWX 5GAJA 3RJ9A 4CHTA 4DMLA 2J9FA 1KZHA 4ENQA 1A5BB 4LWOA 1L7PA 1M6WA 2AI2A 4KC0A 3KKLA 4UUBA 4XVCA 3HI4A 1IQRA 5ER9A 3IUJA 1X14A 2OTCA 3VVMA 5AM2A 1R27A 1R64A 3GLRA 2AMFA 2C5GA 5HG0A 1Y5LA 3E23A 4MVJA 3RSGA 3GLGE 1Q1NA 1ZUIA 4U2EA 4AY6A 4ZOLF 3RROA 3H99A 3L40A 2O5VA 1WSDA 5B7QA 3DL7A 1EH5A 5TDHA 1U81A 5LXTA 3EDQA 2XXJA 5K8TA 1J8DA 1TMYA 2WT4A 3UN1A 4GI2A 4HYQA 4Z51A 3PQCA 2JIQA 2C8JA 3G2MA 1WZCA 4ZEWA 4P3XA 3RUHA 1JTEA 4J91A 5LMNB 1U5AA 3ZZ1A 2QLFA 4CQMA 4HK4A 3LYHA 2HGSA 3EPHA 4PAGA 3QLVC 1V43A 4KGDA 3SXUB 2Q6IA 2IZ0A 3HPRA 4IYJA 3X43A 4CBVA 1KU0A 1AUQA 3GEIA 5ALMA 4IDEA 4UC0A 3T5PA 3H3FA 3TSCA 5KVCA 3LO5A 3CONA 4N49A 1N6HA 5EWJB 4C5BA 2G6TA 1JTVA 3MZ0A 4O4JA 3ZI7A 1ZLXA 3DBRA 5J9FA 1T5OA 3FPBA 4FOTA 3E3MA 3NH9A 2W58A 3ZHZA 5FLXA 5FBQB 4B45A 4R0VA 4KBYA 4H7KA 1SOMA 1V7QA 2BEWA 4OM8A 5BVGB 2HT1A 2R62A 4P5EA 1H2WA 2XXAA 3FPCA 4O2AF 4YRJA 1Z2PX 3WNDA 2J4DA 3O8QB 3LBIA 4QLBA 4LJRA 1R8YA 4DR7B 2X14A 1VE6A 4JKOA 2VK8A 3NWOA 4MUNA 2CHVA 1EM8B 3V4PB 3WGYA 4KIJA 1JDBB 4EMSA 1MXFA 4M0EA 3DFKA 3HJGA 1GRVA 1YZGA 3A2KA 1PQWA 1G20B 2ZB8A 3KQMA 4PSVA 2EP5A 3IUBA 3QELB 1Y9JA 2J6CA 4P84A 4F3NA 1VGVA 3C8MA 4B6OA 2AYYA 4WXPA 1J8MF 4M1MA 5BV7A 3L46A 4DNFA 2FP4A 1QOPB 3M0EA 4IVRA 3THSA 1A8HA 4B3HA 1PE0A 1WY5A 3ZXUB 3C3DA 4YV0A 3KWLA 4PE5B 2YFQA 4PBSA 5BURA 3QFRA 4LMBA 1GNVA 4AQYB 3M4NA 2HSZA 4NH4A 2ZG6A 5I5EA 1UBJS 2C31A 3HJCA 1GTVA 2OCGA 1DZIA 3VSCA 3EDOA 4O4HB 2OBYA 4R3UC 1M8PA 2CVZA 1DEKA 3DO5A 1C0LA 1MORA 2BFCB 2CLKB 2FX2A 1KI6A 3ECAA 1Z4NA 3T7CA 3FKQA 4CG1A 2I6SA 3KKOA 5A7FA 3LZ6A 2P3SA 2W2OA 3UIEA 4ZO9A 5IJ0A 3JD1A 3JATB 4MI6A 3BBPA 1FP4B 2WWVD 5ILQA 3I1IA 4GBED 1RYDA 5H59A 2QS9A 4DV0B 4BY9E 3KB8A 2YBDA 2L82A 2NZ2A 4BPBA 2B25A 2KLBA 3GPBA 1GL7A 2W70A 4ZYZA 1T6ZA 3RVBA 1JDSA 3ILXA 2P4QA 3CEAA 4GYWA 1VHQA 4WLFA 3DD1A 4WNYA 4X6YA 3PUZA 5I7WA 4F11A 2QLJA 3UG6A 4NY1A 4FKMA 3EGCA 3WS7A 5E9QA 1DQRA 1NURA 4GMKA 1L4KA 2PANA 1U7PA 2Y4NA 2J41A 3JQFC 3UWSA 4DJ5X 5A5GA 3ZU6A 4YAEA 2I2WA 1NXTA 3JASA 3CH6A 1P7YA 2C2ZA 3ZWDA 2C4TA 2VPYA 2RBKA 2P40A 4PZUA 5IEJA 4HN4B 2RFLA 5KKAA 3CFYA 1LX7A 3VU1A 2ON6A 3WMXA 2UVPA 5FLEX 2XOXA 1OW3B 4J4TA 2WU0A 5ESXA 1ODFA 3B78A 5KZMB 2P7IA 1NRXA 4NBRA 4PRLA 3B3JA 2A59A 1C3OB 2XUOA 3JV7A 1ZQ1A 2FP3A 2HYDA 2K4MA 2NXJA 3GEGA 3PQDA 5B4UA 3OWXA 5ABPA 1NR7A 1FBTA 2B8EA 3W6PA 4GR9A 1YF3A 4N01A 3WBBA 5AVZA 2IHYA 1U1FA 3JRXA 4CUKA 3LLMA 1GGMA 1XV5A 4RDIA 3LC1O 2P9HA 1XZPA 4V1CI 3VZRA 4JUFA 1KDVA 1U3VA 1U3FA 1PEKE 1R4AA 3ISTA 5HUHA 3UWKA 4EKDA 5IZ4A 3U1BA 4PQEA 3AYZB 4UEJA 4YMWA 5CD9A 4DV2B 1PJ3A 4JA2A 1N25A 4QKQA 4C6SA 2DH6A 1E6UA 4P32A 3ST7A 1MAAA 4CF6A 4HNSA 4F84A 3AEKB 4I50F 9GPBA 3DFIA 5CIYA 3MAJA 1BZYA 1U3UA 2FOIA 3DBIA 1FPMA 4TZKA 4F21A 1DE0A 1A5TA 1YS6A 2I80A 5ALYA 2J8ZA 4KUEA 3T54A 4CKWB 4MW1A 1I0LA 2Q8QA 3KM0A 4JEUA 5IKPA 2DPHA 4JZKA 2XUJA 3MK31 4QOIA 5EWMB 1F51E 3TJRA 4BNIA 3QNMA 4KXMA 1GT91 1SCUA 1Y5MA 4Q02A 1K7CA 4EITA 4P58A 1TF7A 4O4LF 5A5DA 1GG9A 4HHEA 1W75A 4QGSA 4HMQA 3LF2A 4HKTA 4JGGA 1MGPA 3EVGA 2HNBA 1RI4A 5CP8A 3VU3A 4A3SA 3O9ZA 2XWJI 4RK6A 2A8YA 2VPTA 1E58A 4WASA 1GVHA 4NEHB 3LDGA 1XP5A 2H9AA 5DLEA 5DN6A 5JC1A 3B51X 1JG1A 1W1IA 1QOQB 2B4TO 1CZNA 2G7ZA 2BFBA 1BGWA 2QQEA 3GAAA 4QUHA 4TN5A 4UUPA 3VNAA 4I5EA 4D9KA 5AVRA 4BMZA 5LDHA 3L0CA 1M6NA 4UHBA 1IBCA 2AVNA 4F38A 1EA7A 1QVVA 1O77A 3HPQA 3GEMA 5I7UA 1DNPA 3GLTA 4WMLA 4NS4A 3AR6A 3DTTA 3AFIA 1YCFA 2J9GA 1KYZA 1QK4A 3MCVA 4W5JA 2WBLC 1TUIA 1WW3A 2JZNA 1XP8A 2VNIA 3HJUA 4B3MB 1R3UA 3AVYA 5FKJA 4QGFA 1UH5A 1O9HA 2AN5A 1UIMA 3CLTD 4J43A 5CFQA 3Q12A 1TYAE 2PBLA 4V0RA 4GP6A 1VFPA 3K31A 4RD3A 3E3AA 4DYDA 3GJRA 2LKCA 1TPZA 1WKVA 4TXJA 4NK4A 4DSZA 3A1CA 1P7ZA 2Z2YA 4EA8A 3Q9LA 3ZHQA 2NT3A 1ZH4A 1M2VA 3I1YA 1AIPA 3LAWA 3SDBA 2OBNA 2O2CA 3VGPA 1VG9B 4PZ9A 3GFTA 2BZ1A 4X92A 2ONYA 2JGLA 4OAQA 1JVBA 1YDFA 5JNVA 3O1JC 2O05A 4IV5A 4LOLA 3PQ7A 1UZNA 5A06A 1WCWA 2BW0A 4ZK6A 4R6XA 1I13A 1L7EA 1V39A 3N2KB 1IG3A 3A1DA 3IR7A 2I9KA 4N9QA 3B36A 1SVIA 1KJQA 1ABEA 1TYBE 1R6DA 5JNRA 4U1RA 4EHAA 3AR8A 3CWQA 3H83A 2QZ4A 3DDNA 3IP8A 4UATA 1N5DA 1DJQA 3KSDO 1QV9A 4GBJA 3ZU2A 4A36A 2HFJA 3T9EA 1N8SA 3ZZ0A 4N7BA 5I3ZA 2PT5A 2HADA 1W6RA 3PXDA 4A23A 3Q5EA 1FMLA 2HHLA 3SC3A 4FFNA 1U0OC 4E5SA 4LE1A 2V0NA 1JJAA 1JLLB 1KMHB 1VYUA 3SEZA 4E2ZA 1UQTA 3A25A 4B5KA 3SQWA 2GDZA 1JTFA 1AHHA 5CG1A 2Q2WA 3BS4A 2Q2NA 5AJHA 4XLZA 1CTQA 3QLUA 5KOJA 2E18A 3OPYI 1RWQA 3T8YA 3H1TA 3OZFA 3BSSA 4FGUA 2RG7A 3HJFA 3FOBA 3SP1A 3IPYA 1E6LA 1X7YB 3DV2A 4LXXA 5KSPA 3RG2A 2VQEB 4KV9A 2HJRA 1J09A 3AB7A 3O95A 3WWCA 4ZKDA 4GD3Q 4F9EA 5IG2A 2DUNA 3K0HA 5E7QA 1HF3A 3PPWA 1RFGE 3W4JA 3GDFA 2IW3A 4QAJA 3CLRC 3AERB 2IEAA 2W2XA 4J2OA 1TIBA 5K0JA 3KSAC 3OU2A 1DSSG 3F5DA 3K1AA 1QBKC 2ONKA 1THZA 3KKNA 4I55A 3LCUA 4J1SA 2FMKA 1FDOA 2A9FA 1L5MA 1XEFA 1EXWA 1H1LB 2NYRA 3A10A 1M7BA 4OHRA 5JO9A 4JEMA 2RGGA 4GMXA 4RU1A 4R1MA 2C61A 1J39A 4AKTA 4AYWA 1G291 2GVDC 4FHEA 4CQJA 4EECA 3PL5A 4OXRA 1FFGA 1E3SA 1I51A 1MZVA 1IIBA 1UL1X 3N3BC 4I5IA 4LMRA 4NJEB 2VK4A 1I6KA 2HWXA 1U31A 2I55A 3T7EA 2BCEA 2YXEA 3BIWA 1FYXA 4DANA 1BHJA 1AVTA 2WU4A 2QM3A 3L05A 5EJEA 4NS1A 4WNAB 3EYAA 3CB2A 3INRA 4RD6A 2CNKA 2VDVE 4TROA 3OLVA 2P8JA 2W6PA 4TTAA 4UJ5A 3MTBA 1E61A 1AM4D 1L3CA 1HDCA 1WVMA 4INPA 2J9ZB 4RYDA 1N0VC 3WWZA 5D3MA 1HETA 2CLOB 4KNWA 2NTYC 4ND2A 3E9EA 2PU5A 4YONB 3NNSA 2NZWA 3WI7A 1SOUA 4JELA 3BA6A 1BSVA 5KOYA 2V54A 5GVSA 2CB0A 4RLHA 2O0KA 1HPLA 2C95A 1X87A 2D59A 4NZ9A 4PCLA 6AT1A 3IT1A 3J81k 3BTUA 4KQ6A 1TZJA 5J3JA 5I4BA 2YWEA 5AI9A 1M76A 1SWWA 2NMVA 1H4SA 3M1IA 4FYMA 4RZ3A 5K0CA 1GSHA 1Y5IA 1BXRA 2LBPA 1LQTA 4MMXB 4IXWA 5DCLA 1OFUA 2DT5A 4B6JA 5JS6A 3LQKA 1M6VB 4JYCA 1DFHA 3GZNA 4WK6A 3C0KA 4D9GA 2NWQA 1XB2A 3OEEA 4JLWA 1U1EA 1Z7EA 2XCLA 3G2LA 2HZ7A 4PSDA 3MLEA 3UC9A 3EZ7A 3O38A 3QJ5A 5BRAA 4FYYA 5DHAA 4Y2QA 3KPUA 5DM1A 1UOEA 2CYCA 3EIUA 4IZOA 4LSZA 5D8DA 2QVYX 1YJ8A 4EKGA 1II8A 5DYYA 4BUJA 1P45A 3EXHB 5C1BA 5A7GA 2JCSA 1Z6TA 1SKQA 2YDXA 3AYXB 4LC1A 3TD2A 3ACBA 1WIWA 2OFXA 1EVEA 5BSMA 3Q2OA 3ZZUA 3LJKA 2WSBA 1GFIA 2FZEA 3H1GA 4L0CA 1EX1A 1CEQA 3E9ZA 3H3JA 3CQ9A 4DADA 2ZW9A 4D9CA 4INZA 3TD6A 1SXGA 3I9OA 1THMA 3BREA 1EFVB 1R0KA 1IZ8A 2H57A 3L8YA 1A5ZA 3VOBA 4DRXA 2JGRA 1T2VA 3GCGA 1G19A 1CUWA 2WMDA 4WZBB 1GADO 4I4TA 4QDTA 3M9LA 3GJ6A 4NENA 5DBGA 1V11A 4U7WA 1B6SA 3KAKA 4M0CA 3ERCA 1Y1QA 1IHPA 2XY4A 1PL6A 3UENA 1EK5A 2YHSA 2WHXA 5F51A 3WB9A 5THXA 2C82A 2B94A 2W6MA 4FEYA 2R6JA 1T1JA 4Q37A 1SRQA 3OZDA 3PFKA 4LA4A 1ZWKA 4WJKB 2WY2D 3CGGA 4GC9A 5IYZF 1RWXA 1FJGB 2FX3A 1Q0RA 1E1MA 3LKDA 5DI9A 3SC4A 2JLVA 5D5HA 3NHSA 3X2FA 3CSDA 1Y42X 2AUNA 4DTIA 5I7FA 3O5AA 1JLKA 1XE3A 4CDNA 5K45A 3DMPA 1FTQA 4LQLA 4L4RA 2CGEA 4OATA 1K8QA 2IOYA 2VF2A 1T2EA 2QUHA 2X1MA 2C96A 2YINC 3FMFA 4MEAA 4MR7B 4PR0A 5HGJA 3ZVLA 5F52A 3EVFA 2FSIA 3AHFA 2CBZA 1I3CA 1G5QA 2OO5A 2OAQ1 1MPTA 1JZQA 3BEDA 3I4CA 4FI3C 2Q27A 4JT2A 5LDGA 4R8SA 3TGPA 1D07A 1E1RD 1LVGA 1PQYA 2OBMA 1G3RA 1GN9A 5EYPB 1IBMB 3NM5A 3HFSA 5I8WA 2QTWB 4LYHA 1ZITA 4UVIA 3CF2A 3F6BX 1DC3A 1E0KA 1NVEA 1B0AA 1Q5PA 5MF6A 4I5DA 3IV7A 1J8YF 3NS7A 4RQAA 3RS4A 4LGMA 4RXMA 4EJ2A 3OJXA 4KJZA 5J4YA 3THXB 5EOVA 1I10A 5EEGA 4D97A 2P0EA 3CH7A 3K96A 4GLLA 4UUOA 3AJ9A 1M2HA 2DE0X 1FF9A 2AH5A 5DCYA 1QU3A 2OENG 1E2HA 1XTVA 3WGGA 1HE1C 4DT1B 2AEJA 4GI5A 5KVQA 3OX3A 1S2GA 2VDQB 4DVGA 1F9AA 2WSSA 3AUXA 2XBUA 1ZL0A 1KGSA 5CT6A 3E8XA 1XZHA 2WTEA 3SFVA 2QGFA 4X7MA 5HF5A 1L5OA 1TTPB 1GZ5A 5IBPA 3FDXA 4ZAVA 4M9SA 3WNQA 4N8DA 3X1MA 5B58T 4DLKA 1VQ1A 3OZEA 1SZPA 1CJCA 4MINA 1F60A 2EFCB 3KSZO 3ETDA 1GNTA 3NB0A 4PLPA 3ACDA 1BCRB 4K9NA 421PA 1Z6ZA 1KEZA 3K0CA 3FNFA 1D09A 4Q9KA 2Q4OA 1IC6A 1UKZA 3TDMA 2WAXA 3VBCA 5KBYA 1S7CA 1DG3A 2ALJA 5FA6A 3IERA 4NHOA 3CRMA 4IQ0A 3ILVA 2FZKA 3ADBA 1MJFA 3RYFB 1TKAA 5LUAA 1M8JA 4QOHA 2IE0A 4GHWA 1H2XA 1CJTC 4MAAA 4N47A 5LJIA 2WSIA 5LP6B 1FEZA 1NFRA 3L1HA 1ECCA 1Y6QA 3HA3A 1C29B 2R2GA 3PQ8A 4NOKA 4IVQA 4A4DA 1JU4A 2PRYA 1E3DA 3L8CA 1JMVA 5JYCA 2MINB 2OZKA 1T8SA 2Q8PA 1C5KA 5DLDA 2PS1A 4JKYA 5B3AA 3MGBA 3ITEA 1AQJA 3ZBTA 1LGYA 3U26A 1QIIA 1H0RA 1IXZA 2PZEA 3N2NA 1BW9A 4YRIA 4WGGA 1Z38A 2O8DA 1DC4A 3HLTA 3S1AA 2FN9A 3BIOA 3LSYA 3LP5A 1PGQA 2QRHA 3O73A 1ETUA 1NRIA 2PD6A 1SZCA 2R6HA 2G83A 3GDWA 5K1ZA 3BT7A 1LLDA 1NW4A 4PPGA 5D7NA 2DY1A 4B46A 4Q4HA 1TQHA 4ZT7A 5CIQA 1I7DA 1WCIB 2BI8A 5B6JA 4LEIA 1LTHR 4D2IA 5FOWA 3P19A 4Q9HA 2QU7A 5CUQA 1JLHA 3CSUA 5CT5A 2P9EA 2A0XA 1FMFA 1EUDB 3R8XA 2KI5A 3FH0A 4OYLA 1PK8A 2VAPA 4BP1A 2AOVA 3UV6A 5DWVA 3USCS 1U65A 3B7PA 2Z30A 3ECCA 3U49A 1KO7A 3I34X 1C1HA 1F0KA 4FVTA 5AJWA 1W581 3U3MA 5ADVA 2XV1A 4L9SA 3LLCA 2OLEA 4GBMA 2ZSIA 2GCOB 4RM2A 3EHEA 2C77A 3BFXA 2NUAB 4ZEXA 3ZK7A 3OQHA 1JLMA 4Y8VA 4Q5IA 2GD2A 5DI3B 2IPXA 2WJGA 4JI5B 1OZ0A 1SB8A 1VP3A 4X20B 1JI3A 4GRDA 4FOPA 1PNTA 3I04M 4JR2A 1R9MA 1RWWA 5DW3A 3TBFA 3COZA 1NBAA 2ANCA 5A62A 3HABA 1XN4A 1A9SA 3UHAA 4PLYA 1FDSA 4BFVA 2HWYA 2O50A 1EFRD 2QT0A 5KTOA 1L8QA 1NVDA 3F78A 3BGSA 3ZD6A 2YXPX 2HJHA 5E1DA 1P2GA 2ZRAA 4BX0A 5G0SA 1UMDA 4DA6A 1SCBA 5I48A 3ETEA 4EF5A 2A33A 2C3UA 3RVQA 2EZ9A 4PWYA 2LUOA 2C78A 1S96A 3JWIA 3OP1A 3ELYA 3A05A 3A9CA 3IOEA 4RKRA 4DBVO 1W5EA 2CYBA 3W9BA 2WNHA 3MQ2A 4RJJA 1E1YA 2B34A 4RHCA 4PV7A 4ZC1A 5C5DA 4N0MA 4BQEA 5ISMA 2PX4A 5BNTA 2JCYA 1VPEA 2WIFA 5E3IA 3N9IA 4ZT5A 4AJ2A 1EGVB 3IILA 3OH8A 4IGKA 2QLMA 1P75A 2NZUG 4HQ0A 4JYAB 4FNOA 4YC7A 4RKWA 1HYHA 2QD2A 1W4AA 4QTZA 3UQYS 1P2UA 4MHOA 3EBOA 2FWRA 1QQ6A 4F3KA 5JWRA 3UMGA 4CKCB 4EYKA 3H2GA 1U2DC 4E5DA 1YZHA 4LRTB 4V24A 2RH9B 1I2AA 3FPEA 5BPHA 2W83A 5DN9A 1EVJA 3RAJA 1A4RA 2C7OA 1N5RA 5UKDA 1EU1A 4AK9A 1YCGA 2QQ5A 4TWRA 1F17A 3OFND 3OTIA 2AOTB 2B8JA 3IAEA 4GXTA 3FCSB 3DC2A 4GOND 4HF7A 4XVUA 5CLFA 3K94A 3Q6NA 3TMKA 4DMUB 3AHIA 1W96A 3O6VA 4M1OA 3UMFA 4HNVA 1ESMA 2HWWA 5ELXA 3EB9A 1TA4A 3NONA 4LYAA 5JMPA 1QGOA 3HKBA 4M1EA 4RKFA 2GPWA 4Z2YA 2RK6A 1CHDA 1JHAA 4FNGA 2DKNA 4DTCA 2VPIA 1NJGA 2A84A 1G18A 3KD2A 4I6JA 4OUDB 4B4DA 1IEVA 2RAFA 3QKRB 4RBNA 1ZSVA 2GZ2A 2XBMA 5EMMA 2O7QA 3W6OA 4C3VA 4AUKA 5IRCD 4HXGA 2J3HA 3WLAA 1XMXA 5FTLA 4C0BA 4Q4DA 4BQFA 4X8LA 3KZCA 4YJ3B 4Z9AA 2AC7A 2GN8A 1SVLA 1ST3A 3ZDCA 3M1LA 4DHWA 1NJ6A 1IM8A 4Q4AA 2ZXEA 1NNUA 3GLIA 3EF1A 2W2KA 4ZO4A 4FJ1A 3B3AA 1ZCFA 3C3AA 4PYMA 3AZOA 1U0NA 4C6TA 1GZ7A 2FGKA 3HKEB 1C7EA 1M1YA 4HOYA 3ETNA 3RYIA 3ZQKA 4DIDA 3QVGA 2HC9A 3MWEB 3T15A 4O8CA 2PZJA 2VQSA 4ZGGA 3HO8A 1JHUA 4WXYB 5A5VA 1P62B 4K40A 3MD0A 2D8AA 1ZRNA 4JOSA 2GZRA 4MHSA 5A5EA 4URYR 2C0PA 2FMFA 1OI2A 3OEYA 1KXJA 3EXIB 1P0MA 1QVRA 3FZQA 3VBEA 3RM3A 4URVR 3I83A 4UDXX 5K4GA 1SGWA 4GBGA 1QWOA 4DLNA 4XUGB 4ZAYA 3BCSA 1QGZA 2LV8A 2WWXA 5B12A 2YVQA 2O2EA 2BSXA 4WY2A 4D3SA 3VO1A 2F1OA 2FSUA 4X93A 2LP4Y 2CUZA 2V6IA 2ZE5A 4PYIA 4Y9SA 4AIIA 3D3WA 3UB2A 4AMBA 4PHCA 1FW8A 4TQGA 3SSMA 5LVAA 2LRHA 1QFZA 4J0EA 1AZWA 3H6HA 4LMPA 3RS9A 2XQKA 1FU4A 1PN3A 4KXQA 1TFUA 1N5LA 1HL7A 4JT4A 2X2PA 4JQSA 4MKFA 1X1EA 1II9A 1YGYA 3WIUA 3I52A 1EB9A 1TK3A 4LF6B 1WP9A 4MTCA 3AJDA 4UOZA 4PS0A 3PUHA 2CL6X 4R1LA 1Y6JA 2GVZC 1JA9A 5HKOA 3TKLA 1RSZA 1A8IA 1KEEB 4P0QB 1P60A 4CMIA 2RC6A 2JLQA 3DWGA 2AR7A 5AP9A 1MC8A 4LQDA 2YVUA 5C31A 2FE4A 2HQOA 2HXYA 3D2BA 5AESA 2PZGA 4EEKA 3ER6A 1DLJA 4IUDS 5LZ2A 1MQ8B 2I76A 5K0FA 2JI4A 1SHLA 4DXDA 5IZCA 1RRGA 4TOIA 1BOFA 5ANRB 2MSNA 3EH1A 3GAZA 1R9JA 3PUIA 1NP3A 2D62A 4J76A 3SKYA 5TMPA 5BOSB 2Q9UA 5IAKA 3C5VA 3PHHA 2IYNA 1QTNA 3GRZA 3DV0B 5LZ7A 4U2GA 3GJXC 1P2SA 4KWEA 1EKXA 2AV6A 4F2HA 3LCMA 2ZTMA 1QHSA 4HD8A 1I8TA 4UOQA 5KNLA 4ARVA 1LK0A 4BZXA 2JHPA 1I9CA 4QTXA 1YR9A 3D5TA 1QDEA 1WY7A 3ORQA 4BEBA 4HB3A 4X6LA 5G41A 1WS6A 3L1UA 2EV9A 3F3MA 3QTLA 3EPKA 5JH7B 3ZWWA 5CFZA 4BMNA 5HQJA 4GWKA 4UM8B 2JD2A 3HVHA 3QFSA 5D3QA 5TEWA 1P73A 1GZUA 1N32B 2UV8A 4JLSA 5KNCH 2IELA 2BDTA 3TFQA 1EDZA 4C78A 4OOFA 3ZQ6A 4RACA 4KXUA 1RBYA 4W7SA 1QB7A 5LWHA 2GBCA 4BO9A 3BF7A 4G9BA 2DUWA 2GK3A 4WOCA 1SUIA 1YXMA 1NKSA 2NTNA 2XCUA 3MS2A 5BN5A 4BWFB 4TVKA 3CN7A 3WHIA 3ZU5A 2OB1A 3EWNA 2QY9A 3EEQA 1P9WA 3LPDA 5P21A 5C8YF 1LS1A 5EXDA 5LZ8A 2PU7A 1E2QA 3ROXA 3AXSA 1L9KA 2BSAA 4GVLA 5E0OA 4ACAA 4TMKA 4F06A 1XNJA 4KH1A 4EL5A 5IUNC 2O5EA 2QG4A 3HCRA 2MIIA 1ECBA 2WIAA 1T0PA 1H2EA 3MCUA 2XGGA 4AG6A 1RXEA 3ENZA 3AP1A 1ONBA 4HQOA 2X8AA 4M8LA 3IT0A 2XVZA 4MRVA 4FE4A 2QRLA 2C7BA 4KX3A 1JKFA 1I3KA 2QROA 1PYOA 2CJYA 2VJLA 3EGVA 2A14A 5THKA 3TM5A 4MLZA 3KR2A 5CB0A 3HI6A 1DKOA 3H5AA 1OTHA 1DAFA 4H0CA 3RJMA 2H2HA 3AF4A 5EERA 1MC5A 3DCNA 5A0FA 3DYIA 4H4DA 1ZISA 2GTIA 2GA8A 2HBZA 3TXXA 2RHWA 4YO8A 4ZTUB 3QI7A 1P2DA 5G0TA 1D4OA 1JIJA 1VE9A 3UJBA 4YDQA 3KB2A 3G8DA 4CETA 2XW6A 2F00A 3OOYA 4BBJA 6CHYA 4LF8B 1VBKA 3LPNA 1RPZA 2GH1A 4BJHB 1ZZEA 3GFGA 4H60A 4PAMA 4AX4A 3WLNA 1GYPA 3A1WA 3KXIA 2ZETA 3ZDBA 1JA0A 5LBUA 1HTWA 5GQSA 2BY4A 1E9AA 5BUSA 4S35A 3RK0A 1OTXA 1YTLA 2JARA 2F55A 3TOVA 3HU5A 4BMCA 2IU0A 4RY2A 4WZAE 5ALJA 5BQ5A 3VKVA 4R0MA 4J4BA 3O2NA 4FMCF 1QO0D 2QN6A 2NACA 3PYLA 1K88A 1GAJA 1IK4A 5HW0A 3EWSA 3H86A 4ISBA 3RTBA 1ID8A 2HTFA 3OQJA 5LYJF 3F98A 1RQPA 2WP0A 3KKPA 2HPZA 3ELWA 3KXDA 3YASA 1K0FA 3CVYA 1JBEA 2IOHA 5TT0A 5GP1A 2FUKA 4IG4A 1TJ3A 2HA5A 2FG6C 4HC4A 1WAMA 4ND8B 4N39A 3ZHBA 2WC1A 2YHUA 1OR8A 3EG9A 3CRNA 3I6QA 2FMTA 2I4LA 3OZXA 3AFNA 3I45A 3KUXA 4QQRA 2FY8A 2B92A 2CF6A 3H2IA 1D2EA 2XUDA 1ZD2P 4NV3A 2DPLA 3RAFC 4NCKA 2FFQA 1CF9A 1XG5A 2AJDA 2TMGA 3GY0A 3WRYA 4WBXC 4R7TA 1SXIA 1RHMA 1MH9A 1W4CA 1A2BA 1NUAA 1GARA 1XDDA 2MSKA 5DM2A 1RE1A 5AHRA 5A3QA 3IEUA 1ZESA 1IDN1 1VLVA 1WUYA 3AF2A 1G8JA 4Q9LA 1HY3A 5ALVA 2EQAA 1OX4A 3OECA 3DBHA 3UUEA 4G4JA 2Y2VA 1KZYC 2ZT6A 1CFZA 4F6RA 5IUKC 4CG0A 4DQDA 1NBWB 3FA2A 2EKQA 3Q3EA 2FB9A 4QA9A 4GI1A 3GRUA 1QKJA 3ABQB 3CO5A 1GU1A 3STTA 5JBQA 2E21A 5EIXA 2BGMA 2OPBA 3UGKA 4GYKA 1XLTA 3TE7A 4F1KA 1G3QA 1I6MA 4I4LA 4RMNA 5E1MA 5DZSA 1OWNA 2CXOA 4G0VA 1JKJA 1DV2A 1L4BA 1ZHHA 2G80A 3H5NA 2BUBA 2H9IA 3ASZA 3PE6A 4L51A 1YFLA 2DHRA 4DR2B 4K6CA 1QC5A 4ALMA 2WVJA 4FB4A 5ES4B 1NM5C 4NDAA 4V1CB 3NBYC 3AR2A 5FNVF 2OILA 3PNSA 4AO6A 2XCQA 4W1SA 1F2TB 1KMIY 2OZEA 2DQZA 4MWEA 4QBTA 1RPNA 3TG2A 1UJ2A 3EEYA 1V16A 2YMQA 3QFFA 5IJAA 2O8BB 1I4OA 3HYTA 4RJLA 5CDHA 5K09A 3SXJA 4NAVA 5M7EA 3EK2A 3ZI4A 2W6JD 2CSXA 1F2DA 2IWHA 4ZFNA 1L4HA 2CDCA 3NVDA 5K4AA 3CTMA 2Z2IA 4CI0B 3ESYA 3MMZA 4Z0PA 2GHQA 1IM5A 4HXFB 1ZG3A 5KHOC 1RZ3A 3WK6A 4J3NA 2C9MA 4PHGA 2FLWA 4R8MA 4WRRA 3RRZA 3ZHTA 3DW3X 4UEQA 1HRDA 1Y5NA 4CR7A 4ZT6A 5A4KA 1BDIA 2C59A 2XMQA 1W8IA 1P17A 2ECQA 3C1UA 3QSGA 4PHFA 5F23A 1JPJA 1PUXA 1UEJA 5EI5A 1NI3A 4YP7A 2YWFA 3B1FA 5DNCA 1QG0A 3KTAB 3V6LA 2Z09A 2G04A 5E3HA 4WA7A 4ZOLA 3RODA 4D4KA 1SUFA 4KPUB 3KC2A 2G8NA 4ENSA 2W00A 5J2UF 3N1UA 4IIGA 4TGLA 3UXYA 1V8BA 1MF7A 1NN1A 3L0IB 1AS0A 5K0ZA 3NBKA 3WKDA 3ZJ4A 1OWLA 4YLYA 1GQFA 4O33A 1NX9A 3CC8A 3IV6A 3VR0A 1YU9A 4AMVA 4WNIA 4BWYA 3IQZA 3AY0A 1P1JA 2EW1A 1XJ5A 3REQA 2B20A 4MR8B 2ZAMA 2CFOA 4CFYA 1NJFA 3EZ6A 1GGNA 2QRJA 1TQDA 1U2EA 2ZEJA 5BWOA 2R68A 5HQ3B 2B61A 4NOJA 1M73E 3AC0A 2GPTA 5T67A 5EUMA 4HNHA 4GL4A 1H9BA 3ROQA 5HA5A 1KDTA 1QDLB 4PGMA 3C3XA 4M0MA 2PX6A 3HB4X 3PX2A 1FYFA 2OQIA 1PYGA 1TC1A 1IXRC 1AJEA 5E4FA 1Y6GA 4YRZA 1ORHA 2IBTA 1PFGA 1O4VA 3A58B 4KSBA 3IUPA 2XX3A 4FUTA 2HDNB 2QRGA 3AILA 1KFKB 4V39A 4EPVA 2F90A 4OX9Y 2DBZA 2QPLA 4DSUA 3LYUA 4PAOA 4XKJA 2O0MA 1Y98A 5CFPA 4RLSA 2Y1DA 5KVVA 2WJIA 2ZB7A 2QN9A 4UARA 1Y8QB 3RVKA 3UXHA 3ZHUA 1FYDA 2FSPA 2Q99A 3LKVA 4KQFA 2ZXFA 4FDAA 1LPOA 1SXJE 1L5HB 1K66A 5BMVF 4BX2A 1CUEA 4FR2A 4M0UA 5BNIA 3U3OA 4HAYA 1VLJA 2UUAB 1FTNA 3DWIA 5ICFA 2FPOA 3ZVRA 5KNBD 3ZE7A 4TV9F 4MLCA 1H3EA 2V7XA 4Y2TA 3VTFA 1G4AE 1VL2A 2VT7A 2XRFA 1NBMD 1SBYA 5KNDA 1KC1A 5I47A 3WWDA 1L4EA 1TZCA 1XHEA 3E8MA 3FNRA 2AG8A 4BNLA 1QCDA 3SZRA 4C3UA 5DBEX 3JVDA 1IIRA 5F4ZA 3ORYA 4EELA 1SUAA 2YJ6A 4Q47A 1TM3E 1A1VA 2UVQA 3UFXB 4Y1EA 1ZVVA 4KVFA 4QNNA 3K8QA 4RO0A 4UU8A 5L3VA 3M83A 1T26A 1EAMA 2XMPA 4CT5A 4QXMA 2WAAA 4BLWA 2BGJA 4GOOD 2PR7A 4XEHA 4XLTA 2JIPA 3TR5A 4ID9A 2CJWB 1KEUA 3OPYB 2ZM5A 1FLNA 1HWYA 4RSMA 3TUIC 2D0DA 5I7EA 1E2PA 1IHUA 5ALUA 5J1SB 1RFLA 2HT6A 1CS0B 3GPIA 3PDIB 4R4JA 1W35A 2HF9A 4TMXA 4WACA 3GPLA 1VL8A 5TPWA 1JBKA 2YCLA 4Q34A 1Z0JA 1N9KA 2AFIE 2I54A 2J3KA 4ZO6A 1VYTA 2CXSA 5EXXA 5B53A 4DCCA 2X0RA 4JB2A 4G81A 5JXWA 3HEBA 2Q1TA 3ICOA 4ZRMA 2GRUA 3D4BA 4KWIA 3FWZA 1GCGA 4HVTA 4DS3A 4F46A 4MP8A 2PFGA 3M49A 3EVAA 3GLUA 3GHYA 4TX1A 1E1RA 1N5MA 2B9VA 2O1WA 2PEYA 1L5KA 1QTQA 2F8MA 1R4NB 2QZJA 2GSWA 2QVZX 3DLCA 3EZYA 3PD7A 2DUMA 2P0YA 5FPQA 5I9TA 3KBBA 3VC7A 2I1QA 2FFAA 4QEZA 5LLDA 2R96A 2ZM6B 3IBTA 4MVJI 2QG9A 1ZD3A 2FPGA 2GNPA 2PFSA 2D1TA 1P18A 2WWFA 1ZMOA 3PVSA 4HX5A 4MUEA 4B87A 4DCOA 2AS0A 4TM8A 2IZOA 1NZDA 5SZJA 1O1YA 1J4AA 2FLVA 1NW3A 1JDZA 5DRYA 1EXVA 4GI7A 2IQIA 3G9ZA 3PPYA 4B6PA 3WYFA 1KWKA 3UMSA 3ZKWB 2H6EA 2DUUA 5ALHA 4BIIA 1JKMA 1KFJB 1SU4A 1Z0ZA 3JXEA 1EYZA 2JKZA 5JAQA 3QXHA 1OBOA 4I50A 3RW9A 5BW4A 3OPXA 3ENVA 4HEA6 2CV0A 4TKVB 1R3DA 3RCBA 4DIBA 4Y6OA 1FK8A 4FGSA 3HUDA 4JUIA 3OZTA 5MN5A 3AR4A 1JEDA 4M1QA 4N0DA 1E1DA 1XHFA 3PCTA 4D25A 3GEPA 1VJGA 4PC7A 3CLHA 1PSZA 5LOVB 1BXGA 1EVLA 4O4LA 2A5FA 2CHFA 2GZAA 4L4YA 3X1DA 3P9KA 4HSGA 2DCMA 3MWKA 2KYRA 3VNUA 2RHHA 3NT5A 1Y4AE 3WLHA 4JLJA 5JROA 2YV3A 3PQ4A 1UP7A 1Q11A 3K09A 4PFJA 1RIFA 1Z5GA 3FPHA 3AESB 2VDWB 3I30X 3L7AA 4TYPA 3UG7A 1O89A 1ATZA 4BZPA 2JAPA 5K2MA 4YRRA 4NARA 5FUXA 4OLBA 2I78A 5DSZA 5IAEA 1CF4A 4BN0A 4OK3A 4TKUB 3C6BA 1RJDA 2RGYA 1R0XA 2X0FA 1S8OA 4CEHA 2VK2A 1JYFA 3RUPA 1XPOA 2G63A 2R6CA 4IQGA 5T57A 3H11A 3LQ2A 1RYHA 1U0SY 3GQBB 2E4XA 3ME5A 3I3SR 3NTRA 4KXNA 3ELUA 4X60A 2VF8A 2VZ9A 4PTYA 3QBJA 3S7TA 3IAHA 2CVOA 3V8BA 5HKLA 2VPXA 3SJCA 3V46A 3EGXB 1EP9A 5EN4A 1HDZA 5D51S 2C2BA 4QRHA 3AMVA 3NGMA 1CK4A 4WCDA 4DJAA 3L7BA 1BE6A 4PZZA 1LFAA 2PLAA 2NVOA 3DVAA 3WZLA 5EJ9A 3HWSA 3IXQA 3C7KA 5AOVA 3X1XA 1IVNA 3GBSA 4NBNA 3RT7A 4B4UA 1NR5A 3G2HA 4GLJA 4QHYA 3HXMA 4AJHA 4RTPA 2VXCA 2X3UA 4FHZA 1NP6A 6GPBA 7REQB 1DXHA 1OGIA 3GRKA 5C53B 4U7JA 3IMEA 1OI7A 1CUDA 4FDMA 2CUTA 3KQSA 4IEFB 4UNSA 2XCRB 4L27A 3FYUA 1D6SA 5ETJA 1GZSA 4XE5A 3LOQA 3GIDA 1FS4A 3PJFA 3CB4A 3HSSA 5E4YA 1PFUA 3ZQUA 1EVKA 3QHPA 1ZRHA 1GPYA 3UATA 1ST2A 1ULHA 2BR4A 2B6NA 2H9YA 2CXTA 2HIGA 1CYEA 2YXBA 4RHUA 1QZUA 3DZGA 2OVFA 1T5LA 4TXNA 4BCCA 2ZI5A 1GM5A 1JFFB 3H04A 3O92A 3IAAA 3P2OA 4L50A 4LUCA 5F33A 4BNDB 5A0VA 1EFRA 4J49A 1J7KA 1T8PA 3BUSA 4B8YA 4X1KB 3DOOA 3ZN2A 4YJ3F 1KSHA 3GRRA 5LKAA 3H84A 5FF9A 2ZJ0A 2FPMA 3M6IA 5K3DA 4GOMD 1Z15A 3QE4A 2VHJA 3HY3A 1ZGJA 1IG0A 3D7KA 3I58A 2O1XA 4HAZA 2PFKA 3ZG6A 2HF2A 3WGIA 1X92A 4HY3A 5B55A 1DUSA 1FMTA 2FFJA 2QR3A 2ZI7A 3Q3GE 4JJKA 1HR0B 1AKQA 2LTAA 2I65A 3NHFA 1TUBB 3P1JA 2RHDA 1GUYA 2Z3WA 3MJHA 1L5WA 2BEUA 4U9HS 3R9WA 5TQVA 2JH8A 4E32A 3IXMA 1BMQA 3PZBA 1EAYA 1RIIA 5EE3A 2PD3A 3CKYA 1TTTA 3OLQA 3KUUA 4OSPA 1PU2A 3FDIA 2IYPA 3PF8A 4W9NA 3G7UA 4QVIA 2C88A 1XNHA 3AF3A 3U19A 1OH8A 2D00A 1G41A 3DO8A 2IY9A 3TOSA 4QG3A 3AX6A 1H2HA 3R5JA 1O95D 4AZ0A 1LSSA 2QYSA 3AQIA 4RL6A 3RDPA 2YJTD 4H7DA 4K7JA 1HK7A 3A6JA 2FSVC 3OFNA 1C9YA 1TU4A 3JARB 4KQ1A 4MGKR 2PA3A 3OCVA 4REQB 4QUKA 3P96A 2C58A 4EOGA 3JALB 1KY5A 4OBXA 5HR5A 4YCBA 3TWOA 4BWVA 1T91A 1NY5A 1ULTA 1P5FA 1RM0A 3I5YA 3A1VA 3BZBA 3QFTA 1E9BA 2VWQA 2F8LA 4MUJA 4YDSA 3H2JA 2A67A 4LOAA 1IOWA 4I6GA 3PSAA 2B2NA 4K6MA 4RELA 3RVOA 4K81B 3ZWPA 1MTOA 5C8DA 1OVMA 2Z58A 1C81A 3LC2O 5E38A 1QM5A 1EA5A 3EGOA 1G5TA 1IJFA 4B4KA 3QE9Y 5B1DA 4G8BA 3HN7A 1CUAA 1JPUA 4FLMA 5KOIA 1D4AA 2JAXA 5BSFA 2PWBA 1QGYA 2XUHA 4PLHA 1LS6A 5ICSA 4UBKA 4OL9A 1ULBA 2XVYA 1PF7E 3L49A 4EVQA 1FB5A 3R4CA 3E1GA 1ZH0A 3MCZA 4M37A 3E3NA 5LQSA 3DF7A 2QRKA 2YZGA 2HJVA 4TYQA 1DI0A 4G85A 4XUDA 3T0FA 3UHJA 4CU2A 3E2MA 4BAUA 4UHCA 2Q4EA 4MYRA 1K8ZB 4XXHA 3VC2A 3KJZA 3P71T 1AXEA 1M34E 1RAHA 4ND4A 3L8MA 3T1YB 4KKXB 4NMMA 1PJ8A 5KQMA 3WRVA 3EWAA 1DKUA 1ZOOA 1P77A 1IXSB 3OFJA 3QHQA 4EF4A 4WA8A 5I3CA 1ISGA 2CMGA 2HM7A 3V2GA 1BYIA 3CUEF 1LBHA 2P9TA 2Q21A 2B6HA 5DF1A 3V8QA 3V9AA 2JK0A 4BX9A 3GLHE 3SFTA 5FPHA 1TGVA 3G2QA 2CCKA 4R3NA 3VI3B 5CA1F 4DL9A 4XQ9A 2HO4A 1FXWF 4X7BA 5BP7A 1Z4QA 4LDQA 1T8WA 3T7KA 5JNWA 4F85A 5CRIA 3BIFA 4B71A 3GLFB 4WLEA 1MT0A 4PGHA 3HUFA 3BRSA 4YJGA 2ECOA 4AJPA 5AVWA 4OHMA 4D3ZA 3E81A 4GPBA 1FMJA 4UULA 3NTUA 2ODPA 3HBMA 4IVPA 2X4DA 4RAQA 3VXKA 1LTKA 4PW0A 3V7UA 1UDXA 4LY9A 4NBWA 3AM1A 2ZUVA 1G1MA 2ZE6A 2WFLB 1EB8A 1YULA 4W7IA 3N2YA 2BJWA 3P4UA 4BNXA 3SJBA 1IM2A 3ZDQA 3C41J 2H11A 3TD9A 4QJ5A 1YQXA 3DE4X 4IGFA 4CMCA 4CT4B 1E0SA 4U9IS 3K53A 3TINA 1U1GA 4B0OA 5IYZA 4MYCA 2I2CA 5AR1A 4YT8A 3BM5A 4ZDKA 2E87A 1NPTO 1I7PA 2Q8NA 4IEIA 4HGZA 2NZVG 3UKOA 2A2ZA 5IBQA 1KETA 3QP9A 4D81A 4A0RA 2VS1A 4LJ7A 5BUCA 5HEKA 3P20A 1K68A 1KYXA 1T5IA 2FCAA 4IOJA 1L7MA 4ETIA 3T9FA 3L8HA 1P3Y1 2VJMB 1M6HA 1KP9A 1HM5A 3L7IA 1VZ3A 2H5IA 1GXSA 5DHTA 2WVHA 1UKVY 2QT9A 2XYGA 1L7RA 3JRWA 3QPCA 4HLNA 4IVNA 4Z99A 1OAAA 1XZIA 4NDZA 5JALA 2I1LA 2ZIGA 4B17A 4YUAA 2GHIA 4K3VA 4DLBA 2I5PO 3BJIC 4IH9A 4RS3A 1P29A 3OZWA 3NTXA 4BNKA 3CJRA 1KAQA 1XVIA 2QMOA 3BXFA 4C3ZA 5HFNA 3RPEA 1CUXA 3ZBUA 4YWHA 4WAUA 4XPIA 4Q18A 3OZCA 4TRJA 3DR3A 1Y8RB 2V7GA 5IFLA 1LW6E 4WN9A 4Y6PA 3D9QX 4JLNA 5B2ZA 1RWMA 5K0LA 2OK7A 4OCZA 3WGOA 2ZSBA 2RH8A 2C07A 2VJPA 3OAAD 5LYYA 1JIXA 5DCUA 1PTKA 4EB6A 4F0JA 1T9AA 2QUAA 2X86A 4WKNA 2FWNA 4PFKA 2ATIA 2BHSA 4DUZB 3CF4A 4KXWA 4YR9A 4D46A 4PHTA 1Q0ZA 3FUWA 4HNGA 4MIOA 1KU6A 5BQFA 4P0PB 1RKVA 4N7RA 4DXAA 5A7HA 2QV0A 1KZGB 1H1TA 2V6FA 4WSOA 4DR5B 2UYOA 2V6GA 1HH4A 3DVQX 2CMFA 1FXUA 4RVUA 5DIFA 1QR2A 4G97A 5ALIA 1QJCA 1P4JA 5KYVA 4EHBA 5A3VA 1KJNA 1EJ6A 1T36B 3KWMA 3OIYA 4FI3F 1HDYA 2OZPA 2HSJA 2I62A 1CQPA 1QFSA 1VTKA 2VCHA 2BFEA 3FUTA 3H8JA 5DM0A 2PL5A 5DXFA 4HQKA 5LM3A 4PQGA 2EF1A 2I67A 1YDEA 4ND3A 4LI3X 4KACA 2ZRGA 4DR4B 1I7QB 2PRIA 5CXXA 4FMBB 5GJWC 4LOKA 5K0EA 3N0VA 1I5EA 2G82A 3L01A 1QYCA 2VWPA 3JYHA 3OX4A 4YB8A 2UU9B 4ZAFA 2JDID 3NBXX 2OOSA 3E1KA 1AUVA 1IAQA 4DRYA 3FOEC 4OBBA 4AL4A 1T6NA 2PSFA 2ZZKA 3C5CA 1YVUA 4RA9B 1ZIYA 1SUPA 4NJMB 5ULLA 3UICA 4G25A 4DLTA 3HBJA 3HM9A 2AFIB 2LPMA 3OPNA 4DWWA 4RULA 5KB3A 4LKRA 5I7HA 4FYVA 3II6X 2OHGA 4P53A 5AOCA 1X70A 3WTBA 4OYHA 4IDCA 3JS5A 3I9LA 4NICA 1FCJA 2BKLA 3BXGA 1QO0A 4ETWA 4YRKA 4D0SA 1I5RA 1TOAA 2NXEA 1JFLA 2QRVA 1N0IA 1ZXXA 4UNIA 4PFSA 4II7A 1E5TA 2JIDA 2VYFA 5EIFA 3R41A 1TVCA 1FJ2A 1WCYA 3KK0A 4DT1A 2DGDA 4UHEA 4HVLA 4ZHQB 3IYLW 2R0QC 4JK3A 2WNIA 2VRBA 4YI3A 2E6UX 2C8KA 3L6OO 4CM7A 2R6GA 1NQWA 5AM5A 1YJXA 2PSHA 1PQPA 2NXCA 4P3NA 1SB9A 2VDOB 5FA8A 1QO9A 2NQ2C 4E46A 2NUPB 2YY6A 1J1ZA 3PXUA 1N3BA 4HNQA 2XE8A 4Z49A 2RGRA 2GUWA 3FZNA 3LVBA 4BFTA 4BE7B 3TBKA 4YRNA 3CUTA 5ED4A 2AVDA 4GX2A 4L78A 2QMUA 3BJMA 2EFEB 3IEIA 5G1OA 4ZJZA 2ILTA 4J9VA 4OMUA 1E2EA 2VVTA 4DQKA 3IVMA 4Q3DA 3SU8A 1KK3A 2OCXA 4MUKA 1JI0A 3W7BA 1VCOA 2EWMA 2ZB4A 3E58A 4ER3A 3GWZA 2IS2A 4UQLA 4JL6A 4UD2A 2XUPA 1UBCA 3D59A 3DAFA 4B44A 1YMVA 3FY4A 5FQNA 3W6NA 2FGJA 3FMIA 1XTPA 3ZD7A 2BGGA 3LVQE 4HDKA 4YMHA 1KJ8A 1AGRA 5D2CA 1O57A 1TGYA 3GNTA 4ISCA 1JN0A 4U6SA 2QEQA 2E82A 4K9MA 1VFNA 1KAEA 4RIGA 4EJFA 1SKYB 2ZVQX 4OHPA 2PMCA 2JIBA 2QV7A 4BNYA 2A9PA 3INNA 4OU5A 4F4CA 2O23A 1X3SA 4CM5A 2OGZA 2IIBA 3WQHA 4CLRB 4KP7A 2D0OB 3N5CA 5KWEA 5L40A 1ZIPA 3B82A 3HG7A 4OYRA 5AKZA 3AM4A 2HSEA 4X8MA 2VNHA 1FX0B 1PTJA 4PZYA 1X42A 2QN7A 4NNOA 4TTSA 2I2DA 4XUEA 1XXHB 2QRMA 1J25A 1JEOA 5AJZA 3HA5A 3OG9A 2J3QA 5EWJA 1D4FA 3D8RA 1PX2A 1M2OB 2HA3A 3BB4A 2XCOA 3Q15C 4HFNA 1AKTA 1W2HA 2C4VA 2G5GX 5F5LA 3ZE6A 1E6EA 5BVGA 5DTJA 3IIKA 2AN9A 3INTA 5EKXA 3O8QA 7ADHA 5FAKA 1LW7A 3NEYA 2Y99A 2IY8A 1Q7EA 3X0DA 3THWB 2W6JA 4KXVA 4OJMX 2JAQA 5JJIA 4WESA 3VPAA 3B52X 4GWLA 1X9IA 4GLFA 4X6UA 3AO0B 5DLQC 4L6AA 5CVCA 4MV0A 5T4BA 1LY1A 3LUBA 3STUA 1IXYA 3D81A 3S7ZA 1FFSA 5BV0A 1VA4A 5F64A 3AKZA 3ETJA 1HEUA 3I2HA 4OHZA 3TQIA 1YR3A 4YUVA 1M75A 3ZHXA 5BNZA 1PK7A 2TMYA 1I2CA 2Q2OA 1E9VA 2ZQYA 1TCCA 3R0JA 4OHKA 7AT1A 4MRAA 4G5YA 2AG6A 1ZWLA 3Q3HA 2D2XA 2H2DA 3WDLA 2Q1SA 4D79A 1DAMA 3RU3A 3FPFA 5K0BA 2N75A 3AFMA 1YACA 4Z6KA 1DC7A 1HXHA 3JZMA 3OCYA 1VCMA 2DFTA 1ZBQA 4E12A 2Q49A 4J94A 2XLCA 5GADl 1X77A 1XK6A 4MJLA 3ILYA 1LRJA 5ARDA 2YN2A 3RIGA 2IUSA 1DC6A 4DBZA 4UM7A 1GPLA 3ETGA 1ZY2A 5H9WA 1IY1A 3CLRD 2QTGA 2BLLA 5IAGA 3MYRA 2HHJA 5EVCA 3PEWA 1UM9B 2B82A 4G5FA 1GDTA 4ARIA 3VHXA 2ET6A 1C4OA 2ZRDA 2P2YA 3ZGZA 1B76A 2VHEA 2OYCA 3CR3C 1DBRA 3WLKX 1IBKB 4QO7A 1JEQB 2XYVA 1C7JA 1S6YA 4KYUA 3A9WA 4LK2A 4F5ZA 1GHTA 2BFWA 2QD3A 4EY7A 3KLPX 5D3ZA 3UCEA 4EHFA 5IDQA 4DLZA 1E20A 3OE5A 4M98A 3KQYA 4RVGA 4KFCA 2OHJA 1J5XA 4YAJA 2OCAA 4CN8A 3BYZA 1W48A 5CLIA 2PLRA 3P9PA 3UGQA 3UYKA 1NLYA 5LQRA 2UKDA 2PL9A 2DWPA 2VJAA 4ZVQA 3BXXA 3DZJA 5DW0A 3U31A 3ABSB 2IYLD 1TB4A 1HYBA 1E4EA 4OK6A 3HRKA 2WDPA 3C7TA 5SYMA 4JVOA 4LRWA 4RF3A 1NQVA 1XZEA 4OQNA 5C4MA 1EGHA 2FN8A 3F4KA 1MAWA 3HYRA 5C7IO 4H27A 3WSVA 3IESA 2XA9A 4HFRA 1DIRA 4UQPA 3UJHA 3UUFA 3JR3A 5KNBA 3NJRA 4GF5A 1QIKA 2X3FA 4G1MB 1VI5A 2NIPA 3PD0A 5EGNA 3SY8A 5FEUA 1G2OA 1H42A 1O9BA 1BO6A 3C4JA 4BV3A 1VMEA 4UHKA 5KJ1A 3IP6A 1NBMA 3PC8A 3WL5A 1O8CA 1YNSA 2KLHA 5BXYA 3HR4A 1XZAA 4K9OA 1PT8A 2OR3A 1QQ7A 2WM8A 4WOKA 4HLUC 3MTAA 2H4HA 1V7CA 3AEKA 3HVIA 3EPLA 1KO5A 4FC6A 3C24A 1JEYA 4G5XA 4M46A 5HRUA 5FTKA 4RTRA 4LG1A 2KPOA 4RXUA 1U9CA 1WPQA 3T3NA 3OT5A 4FYIA 1C50A 4K6GA 1UINA 2IY7A 3K6KA 3OF5A 2YV1A 4S1PA 1QHEA 4RZ2A 4O3MA 1MRNA 3JZFA 4LDAA 5GIOE 2HLHA 2HA4A 4OV6B 3O4GA 5AW2A 4HDQB 3FNEA 3N2ZB 4PNZA 3SIWA 4AJ9A 2QY6A 2X8JB 2C4HA 3K72B 4LCJA 1N3YA 1U5BB 2F3TA 2O7VA 2QLTA 4XM0A 2DFKB 3SS8A 1T9CA 1V8DA 4ZEMA 1D2GA 3MGKA 4OK5A 4CW7A 2F3PA 4M22A 2JGIA 1KZ7B 3BMOA 3G2NA 2IOFK 3EXAA 3QYAA 4CV2A 2AB0A 4P2BA 1N6LA 1QK3A 3OIGA 1QKKA 1EZZA 3PHIA 4RTJA 3DBLB 4QOGA 4BO7A 3VPCA 4AURA 1MDFA 1KZ9A 3TSZA 1BHSA 1ULZA 3A14A 1QCYA 4JLMA 5IT5A 1RTKA 1KBOA 4YXWD 3UV3A 5EZYB 2XRZA 1PNVA 3HN2A 3QA3E 2NSYA 2E6KA 1DKQA 1VJCA 3N7AA 2QD1A 2QLNA 4J2TA 5D87A 3H9JA 2YWJA 6REQA 4AMGA 4KQGA 5C8YA 4H6VA 2WMYA 4V02A 3T7JA 4OO3A 2PKWA 3R7LA 3D6UA 4JHXA 3PX3A 1II0A 4G0PA 1XDUA 3AK4A 4OLJA 1Y8AA 2DULA 2D74A 4Y30A 3JQGA 3ADPA 4BQOA 4JVMA 1CT9A 4JQYA 4EO4A 3O0TA 1JFRA 4RD1A 1WSAA 1CCWA 1Z82A 4LJKA 1F38A 4OAOA 3PNVA 4GZLA 2W2PA 1YQQA 5DRTA 4ZI3A 2LKDA 3M33A 3D7NA 1G59A 4G4SO 4Q3OA 4JI7B 4KMOA 1T0BA 3TQQA 2FEOA 1KJJA 1YJBA 1CF2O 4E1AA 4HT3B 4JJGA 3A3KA 3T3MB 3SMQA 3TRDA 2E1PA 1IN8A 5KTTA 1XQ1A 1I4EB 4EB8A 1KH3A 3C3PA 3KVRA 3HNRA 4PSAA 1Q91A 2ZRIA 4HS9A 1YS9A 2H65A 2B3DA 2PXAA 4TTQA 2HSDA 3C1AA 5CEJA 3U4GA 2QL7A 3P2EA 4PRZA 5FL7D 1PQUA 1YRHA 2ERCA 3EVEA 2XMZA 3SIPA 2I1WA 1UOOA 2XB6A 3NOXA 2VSXA 2Q9BA 2QVXX 4DIEA 1DDGA 4ZN6A 3AVQA 4CKEB 4UTRA 5JZOA 4XJSA 2Y67A 4UUNA 2OEPA 3OKPA 4Y2XA 3AUKA 3U17A 2QKYA 5KYWB 3CCCA 5DOVA 3DVLA 4DLPA 1ESCA 3V8RA 4BIMA 1TCVA 3P26A 4YA6A 5A4DA 2AG0A 4QU5A 5DGTA 2B5VA 1GVNB 4JB8A 3DZDA 3CZ9A 4GG1A 1JLLA 2O2YA 4PGAA 4EYSA 4AWXA 5HBGA 2C7RA 4LSWA 5LYJA 3MQ4A 2KW5A 1E1CB 4S1NA 4UVHA 4M60A 5GWXA 3CO0S 1U4SA 4NULA 3TPFA 1L6RA 4TRMA 4Q7JB 3FSJX 2P90A 5BSVA 1XLVA 2DFDA 4JFAA 4WECA 3TXYA 1L1QA 3OM9A 3NUZA 4QUGA 1X7YA 4DDUA 4TLBA 3GLKA 1WMSA 4DIKA 3RRFA 4Y7DA 4HSEA 3TZEA 1G3MA 3RU9A 1NQUA 4MQFB 3A1NA 9MHTA 1RWVA 4M1YA 1DIAA 1F20A 1OBCA 2EW2A 5GV7A 5D6NA 1GUAA 1MABB 2ERXA 3M5DA 4AQ7A 2ISSD 1L3BA 1A77A 1G9SA 4HDAA 4WIAA 4OVKA 4UEKA 1TT7A 1DEAA 2YHIB 3AERA 1CUIA 1J9EA 4MA5A 3R3XA 4I1IA 4LI0A 2GFHA 1DOZA 1TMKA 3P9XA 4L9WA 1IY2A 5C8ZA 2PGJA 3OLYA 1XQXA 1XPUA 1PWEA 2WJWA 3IELA 3K6RA 3PJGA 4BLQA 4C05A 1PLLA 3GJ4A 1H0KA 2XTNA 3BGDA 4CM3A 3D8SA 4NZYA 1CUUA 3W5JA 1EXMA 2CLSA 1QVAA 3GZJA 2P2GA 2J9FB 5B1EA 3FOZA 1H6DA 2X5JO 2Q50A 3CTPA 3RSFA 5KI6A 4AG3A 1QB8A 1KIMA 1OYVA 3OTGA 1J5PA 4NYMQ 5L3QA 2FMHA 3BGOS 3FUUA 4V0ME 4COKA 3DAHA 3I2GA 4ATNA 2Y1WA 2Y71A 2ZIWB 1USVA 1ZGCA 2JC3A 1EPUA 3UWDA 3R7DA 3G9TA 1U90A 1C4WA 2FH5B 1FP7A 2OO5C 2P5YA 3IMKA 4MQMA 1RPAA 5ERGB 2CC2A 3VX3A 4DG8A 5ALRA 2V5AA 1W30A 4M1SA 4O1IA 5FNVA 4AD8A 4X66B 4DAEA 3OPVA 1U98A 4UW9A 3ND8A 3G9UA 4QXAA 5LXTB 2QUBA 1Y9DA 2G9VA 5J43A 1VLLA 3ZIUA 2WA1A 3E0XA 4I3GA 3WLEA 2CJXA 3IPLA 2GJ4A 4XJXA 3W5CA 4FFOA 2A0UA 4CQMB 3L4JA 3OZUA 4X8HA 4XYBA 4C7JA 4YCNA 4GX1A 4A6PA 1WMEA 2BGUA 1O5IA 1GSAA 1RI2A 5DCWA 1WEHA 2DRIA 3TVYA 2ODWA 5EP4A 5F1OA 4KVAA 3NP9A 3WHPA 1XQYA 5J5CA 3CZRA 4RQBA 4QGHA 4EHHA 5TIIA 4NK5A 2Q7XA 1O95A 3JSXA 4L1KA 4O4JB 4B79A 3DBRB 4BEJA 1VLZA 4G0OA 4J0DA 4HBZA 4FMDF 3O1IC 3AKDA 2BEWB 2AQHA 2DSTA 4A2QA 3H18A 1DJPA 1ORIA 2AFVA 3JTMA 4GWGA 5AM0A 2XXAB 1ESNA 2JLZA 1QP0A 4NX2A 2C42A 1Y3BE 3FKSD 3TMAA 3LRTA 5HIMA 2WPDD 1NI4A 2HX1A 4KFSA 2GWRA 2HSGA 3IQHX 4CF4A 1YJQA 3I2JA 1KQPA 2XODA 3K0CC 4G3XA 4R1PA 5J2UA 1GKYA 3VVCA 1YE3A 4QSHA 3R8FA 4BE4A 4G0MA 5K8JB 1CVIA 3GJZA 1WU7A 2GZDA 4RMJA 4CM6A 3GMDA 5KTNA 4WBNF 3LT1A 1FC0A 2IITA 3LDFA 1JDNA 1KRHA 2B78A 3PEUA 4G01B 3I0MA 4BB6A 5JZMA 3GLGA 2FP4B 4LF4B 3CZAA 1G7CA 5JD3A 1VPDA 1WXIA 3DAOA 2FW9A 1PBNA 2C9BA 2OPHA 1JE0A 5JDCA 4QBHA 4BQSA 5B3LA 4YJDA 3ZZNA 2O8VA 3SM3A 3G1UA 4CCYA 1SCQA 1AK9A 4FD3A 3STVA 3UJ6A 2F8TA 1EIWA 1NW9B 4ND6A 3NRCA 4C7MA 1R9GA 2R48A 1VBNA 3M5PA 2ATCA 3DMRA 4BVGA 2XE6A 1KI6B 4LHXA 1WQ4A 2O2JA 1X7WA 2FSFA 4JP3A 3FLEA 4W4TA 4CNQA 1LRKA 5IJ0B 3Q8KA 2QUKA 3UMRA 3R5TA 4MPRA 4FR5A 3MJSA 3GELA 5DXJA 2IUFA 3ANTA 4PXSA 5EIBD 3K9FC 4B5LA 4E2YA 2V65A 1CQXA 1V3TA 2FW0A 1ZONA 1AN9A 1YL7A 1DRKA 2FZWA 2ID7A 1DAIA 2PL1A 3PICA 1X9HA 4NATA 4W5WA 1X1BA 5DHPA 4N0QA 3U3KA 1D8AA 5KNCD 2AD1A 4WV3A 4DDTA 5BMVA 2XCTB 2YV5A 2WWWA 5LWQA 1JB9A 1XN1A 3KKEA 3EZGA 4II2A 1WSWA 4UVGA 1FNNA 4BO8A 4S04A 5EPOA 1DWUA 3LBHA 4AECA 4V0QA 1ZMXA 2B4QA 5E7IA 5TQJA 1R8SA 4TV9A 2R6R1 3JASB 1Z08A 1H2ZA 4GPEA 4QEKA 5EJ4A 3G2KA 4Q1CA 4UXIA 1FL9A 4YDRA 4EG5A 4ZK2A 4I1VA 5ECDA 1MZPA 1ZHFA 2X2EA 1DKNA 2C84A 2DPXA 2Z56A 3CNBA 3PE4A 2PM8A 4HWSA 4IOKA 4X45A 4ZQFA 3VKWA 2UVPB 5F21A 1ADBA 1Q12A 2ZBPA 4MLPA 4AN4A 2I99A 5K51A 1CB0A 4R8RA 3WLPA 2RJNA 1V7PC 4PXYA 2H5JA 2P79A 1YE8A 1Y63A 3BWXA 4MIEA 4LSGA 4EENA 1M2FA 2R8RA 4YVFA 3RJ5A 1CY8A 2JBHA 3KQVA 4IO0A 2PT6A 2QUJA 5KX5F 1KJIA 4FGZA 5EKDA 1UPTA 4ZYLA 5LZ5A 3T7TA 4ZWNA 1YUNA 3M3HA 2D5LA 1SCJA 1ZD8A 2BV3A 3HCOA 1GLGA 2FQWA 2GO7A 1P7PA 2CL0X 2PT9A 2VAXA 3HH8A 3FGOA 1JZTA 2IA5A 3LXXA 4MB0A 3WXBA 4JENA 4MRPA 1TZMA 1S8AA 2YIJA 3D0KA 1W85A 4EI9A 3ZV3A 1NU6A 2W6ID 3BE8A 1JH8A 1N1EA 2R66A 4FD2A 4CMBA 4W82A 4BQPA 1PWZA 2VRCD 1E32A 2OQ2A 3C6XA 1KI9A 2GAOA 2XZDA 5CLQA 3BKWA 2HQSA 3A31A 2ID4A 1NI5A 4FINA 2PZLA 3H2BA 1P0FA 2ZAOA 1A2QA 2R00C 3C7CB 2KB0A 2FTKE 3EA0A 4OHOA 1BE0A 1WWKA 2Y4OA 4Y9UA 3I5XA 2CHGA 4C2AA 2W6QA 3HCAA 4ZKEA 3TSYA 4GICA 1SCUB 2DWQA 2FPLA 1E1KA 3EXFB 1HDOA 3FI0A 3HVJA 4H15A 2X76A 3L9WA 1HYQA 2XLBA 4X90A 1ZU5A 4AW9A 3QA9A 3LT2A 3P9RA 1MEJA 4C4ZA 1AXRA 3BWBA 3ITKA 2IP1A 2ZYIA 3PQ6A 3SJAA 4QFCA 5T8KC 2YXNA 1UDCA 3MBIA 3RC2A 3WB2A 2AI1A 2UYHA 2IVFA 1Z7BA 2P1RA 2ZAIA 5AVVA 2OB2A 2BJVA 3OC0A 4RENA 1L4UA 3EIHA 4C04A 1EUDA 3SEQA 3N7TA 1K89A 4IDFA 1V26A 4B4VA 5K3OA 1D0IA 2C9OA 1A69A 1QQTA 2BFBB 2H1IA 4G23A 4F2WA 1YVEI 4NCNA 2BBOA 4EKEA 1XU9A 3DV9A 3OAAA 5FUQA 1Q1AA 3PC4A 2XE4A 4BNZA 4D57A 5WRFA 4R6WA 1ENPA 5CR9A 2XQGA 3LHIA 3PEEA 4P3KA 1R0CA 3JQFA 1GUFA 3E48A 3TNJA 5FL3A 1JPVA 4FFWA 3FMVA 2FNAA 3G1WA 1YRQA 2CMDA 4PYOA 1DRVA 1N1DA 5HILA 3SHVA 4C1NA 4GSKA 1QR6A 3HV2A 2O7SA 3UK6A 3TB6A 4D41A 4UBIA 4PF1A 5DI3A 2FFBA 1M8KA 4YT4A 5JAPA 3MFYA 4MAFA 3BMCA 5FV7A 3A9VA 4Y2YA 5HKAA 2PUJA 1H5QA 2YY5A 4LW8A 4Z7NB 3OM8A 3CZMA 4JJ8A 3A6HA 1E7MA 1O8BA 1RXIA 2ENWA 4NPCA 4TL9A 2A0WA 4EK9A 1OAOC 4IIBA 3FM9A 4XX0A 4WINA 2FKAA 2OLJA 4IDDA 2IEYA 4UU1A 1XL0A 1V95A 3JQ8A 1SEVA 2HRCA