3A2NA

Crystal structure of dbja (wild type type ii p21)
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
298
structure length
298
Chain Sequence
RRAPVLGSSMAYRETGAQDAPVVLFLHGNPTSSHIWRNILPLVSPVAHCIAPDLIGFGQSGKPDIAYRFFDHVRYLDAFIEQRGVTSAYLVAQDWGTALAFHLAARRPDFVRGLAFMEFIRPMPTWQDFHHTEVAEEQDHAEAARAVFRKFRTPGEGEAMILEANAFVERVLPGGIVRKLGDEEMAPYRTPFPTPESRRPVLAFPRELPIAGEPADVYEALQSAHAALAASSYPKLLFTGEPGALVSPEFAERFAASLTRCALIRLGAGLHYLQEDHADAIGRSVAGWIAGIEAVRPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Haloalkane dehalogenase
publication title Enantioselectivity of haloalkane dehalogenases and its modulation by surface loop engineering
pubmed doi rcsb
source organism Bradyrhizobium japonicum
molecule tags Hydrolase
total genus 107
structure length 298
sequence length 298
chains with identical sequence B, E, F
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2009-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3a2nA00
5K3AA 4WDRA 1ACLA 1CRLA 5CRIA 5LKAA 1YSCA 4KRYA 2HA2A 1XRNA 1VJ5A 3I6ZA 4OSEA 4DMKA 2XQKA 4MWSA 2X76A 2Y2UA 2VAVA 1JJIA 1ORVA 1MU0A 2XUGA 4J3JA 3V48A 3VJKA 2XMDA 1P0PA 2J3DA 3G8YA 2C0QA 1DT5A 4UHFA 1AC5A 1H23A 1E8NA 2WIKA 1DINA 2ZSHA 2OQIA 2QJWA 2XUOA 3P2MA 1HPLA 4UHEA 5FPQA 1W1IA 2ZYIA 3SWWA 5CH5A 4JYPA 4GW3A 2Q0XA 2FUKA 4QDUA 5DTJA 3EQ7A 1KEZA 5JADA 1VA4A 1GGVA 3PDCA 5DTIA 5KWJA 1PJAA 3WKCA 2XI4A 4MWTA 1MAHA 2V9ZA 3CXUA 2I3DA 4AZ3A 1J2EA 1QIDA 1MN6A 3RK4A 2WU3A 3IVMA 4W9RA 4UBMA 2G5PA 1Y7IA 5HF9A 1ZJ5A 3ED1A 1XKLA 1C7JA 7YASA 3C6BA 3SX4A 3T52A 3V1NA 2CKMA 1KU0A 5C81A 1AUOA 3S2ZA 1AGYA 3EBLA 4NMWA 4ZI5A 1E5TA 4KE7A 1EI9A 3O4IA 3YASA 3G0GA 1EK2A 2VTVA 5FV4A 2GZRA 1E89A 3D2AA 4X92A 1QLWA 4GECA 3VISA 4DM7A 1MAAA 1TIBA 1XZJA 5FUMA 2IX9A 3W9BA 2Z3ZA 3AFIA 5A6VA 2GBIA 4F5ZA 4ARBA 2H9YA 5C7YA 5DYWA 3OG9A 5IVDA 3QPCA 3BF7A 2QJRA 4N5IX 5C8ZA 1UK7A 2OCKA 2WG1A 3FLAA 5AKEA 3WJ1A 5E4JA 5JAHA 3PF9A 2WG0A 2WFLB 2XMGA 1T2NA 2XUHA 3VVMA 4DMHA 4B6GA 2XT0A 3G9UA 5CXUA 5LYYA 3WKEA 5JAPA 5LLSA 3ZLVA 3DL4A 1JJBA 1H22A 4PSCA 3R3UA 2XQJA 3E3AA 5HQ3B 4FBMA 4PV7A 3DS8A 2VJCA 2ORYA 5KREA 2DCMA 5AP9A 2RGUA 2DQYA 3B3QA 3A70A 3Q0TA 5AOCA 3FYUB 3GROA 2OGSA 5AI0A 5A2GA 4DGQA 4BP9A 3HZOA 2OQVA 1A7UA 5I8PA 4Y2PA 1DT3A 5FKJA 4CCYB 1FFAA 3C6ZA 4IH4A 2P8SA 2WIJA 2WTMA 4DMFA 3M83A 5JATA 2XUPA 1N5RA 4J0CA 4ROTA 5LZ8A 3WZLA 2ZVDA 1UKBA 2H7XA 2EEPA 1WB6A 4Q82A 3WK8A 1DWOA 4B7ZA 2JEYA 4FTWA 3WKAA 3QH4A 3QITA 2WJ3A 1CQWA 3CN7A 3W04A 1QFMA 4QDOA 2PX6A 4DNFA 4QNNA 1CUWA 5CXXA 1ODSA 4E14A 2XMBA 3C6YA 4FHZA 3QPAA 1ZIXA 1LLFA 1FJ2A 4QEKA 5AM3A 3AZOA 3R3WA 3D59A 1WCYA 5JD6A 3DNMA 5D6OA 5T4FA 4IQ4A 4BATA 1CFJA 2R8BA 4FLMA 4UBNA 1YAHA 4CCWA 4HTAA 5ALGA 1CUJA 5AO9A 1LZLA 5FDFA 2H7CA 1XLVA 4EY5A 4Y2RA 5BOVA 2WUGA 3AJAA 4X95A 5AM4A 4I19A 5ALKA 3IIIA 3BIWA 3AIOA 1EXWA 2DHDA 4WY5A 5JZSA 1CUIA 1G42A 1K8QA 3K9BA 4UHCA 4RE6A 4Y7DA 4B83A 3O0DA 1AX9A 3O4HA 1GPNA 3ZI7A 3Q8WA 3WQHA 4IHAA 2ONCA 4X6YA 3VDXA 5K3EA 1WM1A 4RNCA 1U4NA 3L1JA 3QM1A 3A2MA 4RPCA 4BC0A 5K3FB 2XQFA 4KRXA 2PSFA 1QIFA 4XIIA 4UBKA 1N8SA 2BKLA 1CV2A 4EB0A 4QE3A 5EIHA 3STVA 2PUHA 2H7YA 1W52X 4C4YA 4C89A 3DL7A 3PICA 3FLEA 2LIPA 2BUCA 3LLCA 4HXEB 1QO9A 4HRXA 3G9XA 1XZDA 2WU4A 5EHQA 3WI7A 4W1RA 4V2IA 2AXEA 5HF8A 4J0DA 1MTZA 3FVTA 3BL8A 2O7VA 1D07A 4MEAA 5CH3A 5HF5A 1THGA 1FFCA 3PUIA 2GZSA 2ACKA 5AKKA 3TJMA 1EVEA 3LS2A 5DYYA 3LCRA 1ODTC 3HI4A 4AZ0A 1XRMA 4ITVA 3HLKA 3D2CA 1AZWA 2XMQA 3QZUA 3V9AA 1OXMA 2PBLA 3CCBA 1F0PA 4ZV9A 4HXFB 4EUSA 2QMQA 2DHCA 1DX6A 1IUOA 4U2GA 4WFJA 1TCBA 1UOPA 1IUPA 5ALDA 4AO7A 4CIBA 2OG1A 4YASA 2BJHA 3VJLA 4UBJA 1K63A 1DWPA 3G0CA 4KACA 3WWEA 4J7AA 3DOIA 1IZ8A 3PFCA 2C58A 1YS1X 1SCQA 3W06A 4FLFA 2ZYSA 3FYTA 3H2GA 4HZGA 4Q1VA 5SYMA 3H2JA 3ICWA 3WWOA 2HU8A 3GUUA 3O4JA 4KJXA 4U2FA 1BN6A 3STWA 3KWJA 3ILSA 5ALZA 2E3JA 3O4GA 5AK4A 2FJPA 5CT5A 3C8HA 1IUNA 3B5EA 1JT2A 3WK4A 3H17A 5EI5A 1UKAA 5AKGA 2RAUA 1GPKA 2HU7A 2C4HA 1Y7HA 2I78A 2HA7A 2CBGA 2HHAA 3ANTA 3KXPA 1XQXA 3KDAA 2OPHA 1X70A 1ZICA 2IIVA 1ACJA 2HRRA 3PI6A 2HDWA 5SYNA 4QWWA 4KAAA 2OCIA 1R50A 1ZGBA 1CUZA 5AKYA 5ALTA 1XZCA 2QXTA 2PSDA 1EDBA 1U65A 3WWDA 5DWDA 1GQSA 4PSUA 3IB3A 4C88A 1CUEA 5CURA 2BUAA 1YA4A 5AI4A 1MNQA 5AM2A 3PF8A 1FFEA 4H7KA 5CT9A 4C87A 1USWA 1U8EA 4HS9A 3C6XA 2Z5GA 5ISMA 4GLBA 1JFRA 2B4KA 4P9NA 2VT7A 1AKNA 3OTQA 1LNSA 4OU5A 2XUIA 4U2EA 4X90A 5J3JA 3AINA 5T4EA 4FMPA 4ZRDA 5LKRA 4G4GA 3CN9A 4LHEA 3I6MA 3B12A 4G9EA 4L3WA 2WTNA 3WL8A 4HAIA 1YB6A 1E8MA 4H7EA 4LXIA 4OPMA 3RKSA 1MX9A 3BF8A 3BJMA 4I3FA 4F21A 3WKBA 4G5XA 1XRQA 4ETWA 4K5QA 5AI5A 2QUBA 5ALJA 4QZVA 5DJ5A 1BEEA 1KU6A 1VOTA 2X5XA 3JYHA 4GI1A 2XUKA 1QIEA 2ZJFA 2JGMA 4AXBA 4AX4A 4QLOA 2HL6A 1G4HA 3W9UA 5ALOA 1BU8A 5AM0A 5HK9A 5E4TA 5ALYA 4Y2JA 4B85A 1MX1A 4F60A 5IVKA 5ALVA 2WFMA 4FKBA 1WB5A 5AIAA 3QYJA 2BGNA 1UT6A 3RM3A 1YA8A 2YXPX 4GBGA 5K3CA 4DTCA 2QS9A 1LPSA 4AO8A 4AO6A 3I28A 3STTA 3DLTA 4H7HA 1UKCA 4OB8A 5AI6A 3STUA 5HFNA 3HABA 2PM8A 3ESBA 1O6FA 3DYVA 4X6UA 2JBWA 3F8SA 1YB7A 2D5LA 5KWIA 4ARAA 2OCLA 3E4DA 2WSLA 1E66A 2Y1KA 4MYSA 3WJ2A 2Y6VA 1EVQA 2DQZA 1GKLA 4BCBA 3GBSA 3OPMA 1XQVA 4BRSA 3VKFA 4YX9A 2DR0A 2V98A 3E1GA 1TCAA 4BDTA 1RWQA 4F0JA 1VZ3A 5LZ7A 4AN0A 4G1FA 4EY7A 1E8DA 3H18A 1BRTA 4EZIA 3UMJA 3OM8A 3F67A 3G9ZA 5ALUA 2HA3A 2XUAA 4BAUA 5DNWA 3AUKA 4H7FA 1TQHA 4LXHA 3U0VA 1X2EA 3AILA 4WFIA 4OYLA 3R0VA 1L7RA 3WZMA 4BYMA 1LPPA 3KOOA 4B81A 4PNZA 2I03A 3MUNA 2AJ8A 4UFOA 2C5FA 1MT3A 1YS2X 4QDTA 1VXOA 3UUEA 4PW0A 3BXPA 5JANA 1CUCA 1MNAA 2VA9A 1BEZA 4G8CA 5LIPA 4P08A 4A16A 2ZYRA 3DEAA 3QPDA 5CMLA 1G66A 3WMRA 1M33A 4AB1A 4OYYA 4X7BA 3IUNA 1UOOA 2O2HA 1H2YA 4HVTA 4KAFA 1XZHA 1T4MA 5FPPA 3V1KA 3D0KA 3ESCA 4UBLA 1GXSA 1FFBA 1XQYA 3FWHA 3MVEA 1F0NA 4FNMA 1ZI9A 3EQ9A 3FCYA 2XE4A 4FFWA 4DLNA 2PL5A 4G9GA 1THTA 1XZAA 3DKKA 2JGKA 3WL7A 3WYDA 4DIUA 2QUAA 2FJ0A 5AJHA 5CTAA 4Y2SA 2QTBA 1YASA 4RGYA 1CUSA 1A88A 4FLEA 2QVBA 1Y37A 3STXA 3D3NA 2RONA 3G7NA 3DCNA 5JIBA 4M0EA 1UK8A 1JU4A 1HBJA 2PU7A 1XRLA 3FYUC 4L72A 1MO2A 3IUQA 4FNGA 3M81A 1JMKC 2RHWA 3FNBA 1DX4A 3SK0A 2HM7A 1E3QA 4DNQA 1CUUA 3G0IA 4WDQA 5EIEA 1EB9A 3ZLTA 5JALA 3WK6A 4H77A 3LIIA 4C4XA 5A71A 2XMRA 1QONA 4BTVA 4G8DA 5JZ9A 4EA6A 5JARA 1BROA 5AIBA 4ZGBA 3FBWA 2WHPA 2OXEA 3LP5A 5EHZA 3IBTA 2EDAA 2GYWA 2WFZA 2RIPA 3EIOA 3EQ8A 1J07A 1TRHA 5DLPA 1DWQA 1QO7A 4AMYA 5IVIA 2WFLA 5ALRA 5IH7A 1JKMA 5KBYA 2WHRA 1VKHA 4QDZA 4G8BA 1BCSA 2WJ4A 1RP1A 1OCEA 3G0BA 4H7IA 3C45A 3R3YA 1K6EA 5IKXA 5EHNA 4BBZA 2RI6A 5HQ3A 4Q34A 5JYCA 1WB4A 1EH5A 3FVRA 5AM5A 4J0JA 4JNCA 2ZSIA 3FOBA 4PSDA 1A8SA 3FSGD 1ODCA 3F9CA 3FYUA 4CI9A 2ECFA 1W76A 4CG1A 3I1IA 1SCIA 1QIMA 5EHXA 4J0HA 4MQMA 5HF6A 2OGTA 5ESRA 2WIFA 5AK5A 3H19A 3IULA 1S8OA 4CCYA 4K2AA 3C8DA 4X71A 3H2HA 4BVKA 2VSQA 3WIOA 1A8QA 3WK9A 4C4ZA 2XLBA 2HA6A 2GYUA 4H18A 5H3HA 2OCGA 4ZXFA 4OUKX 1P0MA 4GEGA 3R3XA 4BE9A 2GYVA 3W05A 3QMVA 2DSNA 1R4ZA 4Y2XA 5AKIA 4ZV7A 1SOMA 4FBLA 2XQIA 5IVHA 4A5SA 4PO3X 4AQDA 2ES4A 3ICVA 4BP8A 4LKOA 1EB8A 1CUBA 5EIAA 3I2FA 6YASA 4L9AA 2PKYX 4KEAA 5AKXA 1UFOA 4AMZA 3DD5A 4NVRA 3WA7A 4FFVA 4J0KA 5DYTA 3WKDA 1LPBB 4Z49A 2ZYHA 1QIIA 1N5MA 1WHTA 3NWOA 2QZPA 2XUQA 4BVJA 1EINA 1ETHA 5ALEA 1P0IA 2RHTA 1CUHA 4UBOA 1Q83A 1QTIA 4OCZA 2OAGA 2AJCA 1CUAA 4N8EA 5AHXA 1UOQA 2HA5A 4BZWA 3U1TA 4DSZA 2OGZA 3C5VA 1Q84A 1XLWA 2JGIA 3CCCA 5LZ4A 2O7RA 4PQEA 3UUFA 2PUJA 1GQRA 1ZD2P 1LPMA 2XMSA 1XZLA 1WPXA 5ALXA 3IURA 1CLEA 1LBSA 3GELA 2NW6A 3LIPA 1N1MA 2WJ6A 3IDAA 4S0XA 1MJ5A 3TGLA 3I2JA 4FDMA 1HKHA 2WILA 3IUJA 1G5FA 1Q0RA 2WIDA 3A6ZA 2HADA 2Z8ZA 3NUZA 1XROA 1BCRA 1TCCA 4UHHA 4DSAA 3RLIA 5YASA 5ALIA 3F97A 1CUVA 1XZGA 2HRQA 1R9MA 5I7UA 5ALWA 1GT6A 4G4IA 5CBKA 3N2ZB 3K2IA 1HL7A 2VQ6A 1WPRA 5HKAA 2OAEA 1UK9A 3I2HA 1TAHA 4RE5A 3KWFA 1CQZA 1CUYA 3JW8A 1R3DA 2HA4A 2VATA 4H7DA 2AJBA 2BFNA 3L1IA 1AQLA 1K4YA 1YAJA 4LYEA 1QFSA 5AI9A 2X8BA 4UBIA 4UFNA 1PV1A 2JF0A 4TVKA 4J0IA 3WK7A 1CUGA 4K6HA 4J0GA 4QA9A 5JD4A 2WHQA 1NU8A 3I2IA 1A8UA 1GKKA 2V97A 3H0CA 4NZZA 4EY6A 3DKRA 3W2TA 3FAKA 1ZD3A 5AKZA 3TEJA 3MUOA 4N8DA 5FP0A 2PPLA 4L0CA 4YK7A 2WLSA 2PSHA 3HACA 3AZQA 3DOHA 2CUTA 1VE6A 4X97A 1XFDA 2J3QA 3D5EA 4J03A 5K3BA 4H7JA 4JYMA 1EHYA 4IH9A 1EDDA 4E46A 1NX9A 5AKJA 5BWBA 2CMFA 4JEIA 2VT6A 3H2IA 3O9MA 3G0DA 4WY8A 2Z8XA 5LZ2A 1K5PA 1XZFA 2QM0A 1F6WA 4C01A 1GZ7A 4BAZA 1NU6A 2GBFA 2JEZA 5JD5A 4TGLA 4EY8A 4BB0A 3GZJA 1U2EA 3I2KA 5A7GA 5FOQA 5AICA 2PSJA 2JIDA 5ALLA 2HFJA 4MQLA 1R1DA 2XDWA 4B0PA 4CG3A 1W75A 1C7IA 2J4FA 3M82A 5HFAA 3ZLUA 1YR2A 1UXOA 2QT9A 4WCVA 2CJPA 4BC1A 2XQGA 5E4YA 1O6GA 5D7BA 5C8VA 2J4CA 1QIJA 2VJAA 3ESDA 2CZQA 4M0FA 5T4HA 3QVMA 3OOSA 2K2QB 5CT6A 4N8SA 2ROQA 3AZPA 4KE6A 2XMZA 2JGFA 4CG2A 3ZWQA 1EX9A 3HJUA 1ZD5A 5HK8A 1W4LA 5LZ5A 3QMMA 1HLGA 4KR0A 3R40A 3O95A 2BGRA 1QOZA 5CH8A 2G63A 3D2BA 1JU3A 5A7HA 1L7AA 1CUFA 4U2DA 2WHPB 3GA7A 4XX1A 3NOXA 4BDSA 3WWPA 4JH0A 1XZKA 5AKLA 3SC2A 3C5WP 5ALFA 1QIHA 1XZEA 4GHWA 4Y2VA 2B20A 4QLAA 3STYA 2HA0A 4K6GA 4Y2YA 1H2WA 4B82A 4H35A 5FLKA 2CB9A 4BCCA 1P0QA 3DYIA 5K5EA 1UK6A 3T4UA 3NGMA 3BIXA 1VXRA 2XMCA 5A7FA 5JAOA 1QJ4A 3BDVA 1EA5A 1LBTA 3WL6A 1VA5A 4PF1A 1F8UA 2H1IA 4B80A 2WIGA 3VJMA 4W1PA 4FOLA 4W63A 3M3DA 4UPDA 1XZBA 3WWCA 3VVLA 3TRDA 4GDMA 4KE9A 1SFRA 3BWXA 4Q3OA 2WUDA 5AKHA 3EF3A 1ZOIA 3DDUA 4W1QA 3VXKA 1MX5A 1EK1A 4EY4A 1ZJ4A 1LGYA 1R9NA 4UHBA 2YASA 4D9JA 5LZ9A 3HXKA 2WQZA 2QKYA 2XUFA 1WOMA 1FFDA 5AK3A 4QWMA 1CUDA 3IA2A 3WK5A 2B9VA 4NS4A 2EDCA 1B41A 4OD0A 2PVSA 3I6YA 4A23A 4Q05A 2I3ZA 2XUJA 5CT4A 3H1BA 3H1AA 1LPNA 2GBCA 3WA6A 3E0XA 3BDIA 5ALPA 2QR5A 1PFQA 1UZAA 4DYHA 1VE7A 1ORWA 2R11A 1IVYA 4B9EA 1FSSA 5ALQA 5E2IA 5JASA 2VAXA 3D7RA 5EGNA 2D0DA 1XKTA 3R41A 1BE0A 2JGJA 2UZ0A 4QDXA 3R3VA 4XVCA 2HIHA 3F98A 1QE3A 1DU4A 2VJBA 1JMYA 4KAJA 1J06A 3R3ZA 2DHEA 1ISPA 4INZA 1X2BA 5A62A 5AOBA 2C7BA 1DTEA 1CUXA 3H04A 3C70A 2BUBA 4X85A 1TKRA 3HSSA 4UHDA 2FX5A 4E11A 5JAUA 4UUQA 2O2IA 4YPVA 4BZZA 5AM1A 2HFKA 3K6KA 2WUEA 3JWEA 4Y2TA 2BAGA 4E15A 1ZGCA 1LPAB 3ZPXA 1CR6A 4BAGA 4MXDA 1QZ3A 3KSRA 1IMJA 1ZI6A 4HRYA 4KE8A 3V1LA 4DMCA 5JZBA 1QTRA 4XWGA 1MPXA 3I1YA 3X3HA 5C8XA 2WUFA 3DJYA 5F4ZA 2Y2VA 4W1SA 1QIKA 2W22A 5AI8A 1L7QA 4HXGA 3AIMA 1QIGA 4B84A 1RYYA 4BE4A 5K3DA 3S8YA 2AJDA 4OB6A 2WM2A 2WG2A 3N0TA 1WHSA 4I4CA 2XLCA 3HRHA 3WL5A 4IH1A 4BRZA 5ALSA 2XB6A 1CPYA 3L1HA 2AJLI 1VZ2A 5EFZA 4Y9SA 1VLQA 2QOEA 3C43A 1UWCA 3DQZA 5AH0A 4CIAA 2ACEA 2C0PA 3HC7A 3G9TA 4LIPD 3BE8A 4DNOA 1DQZA 1TK3A 5T4BA 4Y2QA 4M0MA 3WLAA 1YCDA 3WYNA 4CFSA 4FWBA 4Q3KA 4EHBA 3PUHA 4LYDA 1GPLA 1W6RA 2ZJ6A 1IZ7A 5LP1A 2OLEA 5BWCA 4X91A 3I2GA 1C4XA 4Y2UA 1XRRA 5CT8A 3OURA 1ZD4A 4X94A 1DQYA 1OILA 1JI3A 4XJVA 2G5TA 4C6HA 1SCKA 2V96A 2JGLA 4BCDA 2XUDA 2CEKA 1B6GA 4TPKA 4H0CA 3GFFA 5HZGA 4MEBA 5I9IA 5FRDA 3AIKA 5ALMA 4OB7A 4P92A 1BN7A 4OU4A 3KD2A 4U2CA 3G02A 4WJLA 1HDEA 2YH2A 5CW2A 2VJDA 3O9VA 4KYVA 4MJ3A 1I6WA 2PU5A 4GWLA 2DFPA 2HU5A 5K3FA 1SC9A 4BTLA 3RARA 4B0OA 2IITA 4LXGA 5HCUA 4EBBA 4N5HX 2VF2A 2G4LA 5BV7A 5D3KA 1HQDA 2YYSA 1XZIA 3QMWA 4X93A 5FXMA 3ESAA 1Q0ZA 3IUMA 2ZJ7A 1JJFA 4GXNA 2WKWA 1CIJA 4K6KA 2QRUA 3F96A 4BVLA 5HKBA 1EDEA 4X3CA 4JUIA 1ZIYA 2B61A 3V1MA 4ZWNA 4AN1A 3OC0A 5ALNA 4UFPA 1CEXA 5DNUA 3FCXA 1ZI8A 1H2XA 1BS9A 4X6XA 4O08A 3WIBA 2JGEA 3C87A 3PFBA 1R88A 1XRPA 2Y6UA 4MYDA 3H2KA 4IO0A 3A2LA 1CVLA 4U2BA 1QGED 2QXUA 3FSGA 5ALHA 1XQWA 2VEOA 3A2NA 1AURA 3D4LA 3ZV7A 4WFKA 1XLUA 1XZMA 3HYSA 4G4JA 3MGAA 4B9AA 1H2ZA 5DNVA 1J1IA 1AMNA 5AOAA 2PSEA 4Q3LA 3BJRA 2O2GA 2GBGA 1LZKA 2Z3WA 4X00A 1LPOA 3ANSA 3FLBA 3HEAA 2BCEA 4ZREA 4DNPA 2W6CX 2C5GA 3PE6A 4P93A 5AK6A 1Z68A 3QBJA 5D3ZA
chains in the Genus database with same CATH superfamily
5HHTA 4YP7A 1MXFA 3MA0A 4HB2A 4YRFA 1GYRA 1ACLA 3GCWA 3SC2B 1CRLA 2WRZA 2EF1A 3IELA 4N3BA 1T0UA 4UCFA 4YT5A 2HLDD 4CM3A 3HGQA 4O2RA 4DQXA 2YYAA 1W30A 1S9HA 1JNXX 4ZJPA 5KNBD 1Z6GA 4EAQA 2NNWB 3FHTA 3VYVA 4QNMA 5A5FA 3ED5A 5FYQA 3GJ0A 4A6EA 4HUJA 4OSEA 4JQSA 5I7OA 4BFZA 1NBHA 4DW8A 1FX0B 2XQKA 1BX1A 4MWSA 5H7XA 3IKMB 3WGMA 1O2DA 5KTRA 4ZCMA 4KITB 1SXJB 4CMIA 3NC0C 1SU8A 1Z0AA 3MMXA 1UKVY 2A0FA 1H8HA 3ADCA 3VJKA 2OZPA 2XMDA 4GXTA 4NE9A 3TZCA 2VJYA 1RJEA 1D6SA 1FVFA 1J2UA 1O5TA 1V9CA 2C0QA 1DT5A 1FSGA 5BUSA 1I2MA 5CK4A 1RRPA 2XZLA 3KL2A 3HXQA 1QWOA 4QYIB 5IJ9B 4KYIB 1DAMA 5J58A 5H0IA 1NRJB 1BQEA 2CL5A 5GZ3A 1CJMA 4MIYA 3CPHA 3I37X 3IIKA 1GXSB 1U7PA 2JK1A 4ZVKA 1RFGE 2C92A 2WMOB 1NBMA 5BRNA 4WBNA 2QJWA 4D41A 3V8QA 4EYQA 2FKNA 4MWOA 4UHEA 4M9ZA 3TGPA 3W6OA 3PJGA 4NBUA 2R25B 1XA0A 2PKCA 3EZ2A 4YMSA 1U9YA 2G09A 3ZJ4A 2W11A 2GN8A 4NX2A 4BNYA 3AJ8A 1WR8A 2FVXA 2YNMA 3IXQA 3EISA 1VA4A 2WTEA 3EZ9A 3TLZA 1TVKB 3DFMA 3SZMA 3DGFC 1GGVA 4L22A 4U7GA 5DTIA 4M0UA 3V2HA 2O8CA 3VMFA 2NACA 1B8UA 2E21A 1FXSA 1AUXA 1G8JA 3CRW1 3PQ6A 4GM0A 4XD7D 1Q15A 3A6PC 1U6KA 5MFZA 4GR9A 3ZWCA 1RYEA 2WHYA 2Q0QA 1K92A 1LRLA 1XNJA 1OJLA 4G89A 3WLHA 1P91A 3ODGA 2NXCA 3OQ1A 2FGKA 4DFDA 2FQYA 2QW1A 2ZAIA 2EX1A 3J80A 2DRIA 2Y0DA 4GX1A 3CXUA 2P9FA 3ZXSA 4N65A 5F76A 4B4WA 1RJ9A 1QIDA 2Q3EA 5JZVA 3HXLA 2Y4OA 4I8XA 5EXTA 4J0EA 1T5BA 2WU3A 3F5MA 3NORA 2GJAA 2OFWA 1GGFA 3PHCA 4W6ZA 1GZ4A 5FWAA 2W4IA 3TCXB 4CF6A 4W9RA 3IEXA 3K1JA 4KO2S 4X8OA 4GXRA 1Y7IA 3K1ZA 4ND5A 4ZCPA 3SJCA 2INGX 3TZEA 1B23P 3D31A 1IN1A 5BVHA 4WOCA 4IJKA 1RCUA 1GTVA 1VC2A 3NVMB 4QUHA 4IIGA 5HJ2A 1F2TA 3V46A 1ZJ5A 1BOOA 3ED1A 3L6RA 3AXSA 1G18A 4O2AB 3IKLA 3C6BA 4LDQA 1K06A 1VPWA 1SG0A 2R60A 1T0JB 4E33A 4IDOA 3D3KA 3C3AA 4EB3A 3TW4A 1DKOA 3DYBA 4I08A 4R1MA 2CNNA 1L4NA 2X4GA 4EMBA 3Q4GA 5CB0A 4H16A 3A6FA 3PYXA 1JG6A 3GMDA 4KE7A 4E5DA 2Q0SA 3BX1A 3DBHA 1G8KA 3NWBA 3YASA 1JH9A 3JD3A 1EK2A 1Z5ZA 1PAUA 1R66A 2VTVA 3DKPA 3FFAA 4U0KA 5FV4A 5ITWA 3C6KA 3PHIA 1JTVA 1ID8A 2ZVQX 2RHDA 2JHPA 4Q9DA 4DA8A 2NTJA 3FPSA 5IDWA 4YDHB 4C0KA 4DV5B 4XPIA 3JV7A 1OLSA 3BRCA 2WJVA 1QLWA 4DY6A 3VISA 4EA9A 1TJ3A 3DC7A 1R4MA 3JZMA 3N75A 4DHWA 4HH4A 3RTGA 3MPUA 2X7HA 3PB3A 2ZIWB 3MTJA 4KVAA 4LJ5A 3IPXA 4M0CA 5HZMA 3CLUC 3W0LB 4PHFA 4IOJA 2ZJ0A 4KCGA 4QX6A 4XQCA 1M2EA 4YA6A 3DW1X 5DYWA 4DVJA 3QSYA 1DUVG 1EQ2A 2ZGVA 3C8ZA 4UMVA 3U60B 5IVDA 3QPCA 5K05A 2P9EA 1N6NA 1MC5A 4OXIA 3BF7A 1U5AA 2VAMA 1EGQA 1BYUA 5CCXA 2H06A 3ZGVA 3G3EA 3K72B 3ZE1B 3KLMX 3QG5A 4FOTA 4G3XA 3L0IB 4YP6A 2C3YA 4AVYA 1BQ3A 2FK7A 1R6BX 1PT6A 2WG1A 1AS3A 1YHYA 5AKEA 5E4JA 3EZ6A 3R0JA 3N0WA 3P9KA 3Q10A 1ESDA 5C80A 3MT7A 2I4RA 1YFZA 2WU0A 5DW0A 3VH4A 2IS6A 3AEKA 4ZJUA 3MRTA 2R8OA 4IX1A 1NFRA 9LDBA 1RM5A 1R4NB 3DWEX 1Y4AE 1T2NA 4RGQA 5KTNA 4NL4H 3WE7A 3ENVA 4DS3A 3PKZA 2SKCA 5LC1A 1G55A 3MWLA 2IPXA 1HRDA 2M2IA 2Z4RA 4NFYA 3SHTA 1HDIA 2ZUBA 4X61A 3VAYA 3G9UA 3UKDA 5LL6P 4BFUA 1M76A 2D0IA 3PC3A 2M1XA 2QXYA 3UPUA 2QZ4A 1KVTA 2H3EA 2QY6A 3D0OA 2JZOA 3PUZA 4HDQB 3DDZX 4L9RA 2CFIA 3LL4A 3R3UA 4GLFA 4PSCA 2BMAA 4W5QA 1WL8A 4I1IA 4KJZA 5JFGA 5CUQA 1Y6RA 4JGGA 3DWIA 4NU6A 1Z7EA 2V9CA 1NVDA 2ONJA 3LW7A 4WNIA 3RS8A 1Z4JA 2JCBA 3CUEF 3DS8A 5GAJA 1PQWA 1GEEA 2VCYA 2Z2IA 2MHCA 2ORYA 1YA6A 2OSBA 4O4IA 1GZ6A 2FWNA 4P0PB 4BMSA 1V11A 2RGUA 1KFBB 2DQYA 1XF9A 3HVKA 1GGKA 3B3QA 4TZTA 2W8BB 4Y0VA 3RVQA 3D1LA 5FLEX 3SPXA 1CX9B 3A70A 4Q1EA 1PJBA 3FYUB 1DV1A 2OGSA 1X80B 2FFHA 1F4PA 2YMLA 3BSFA 4P35A 2IUSA 1Z5GA 3G49A 5IYZF 2G9NA 5BUZA 4LZOA 2GDJA 4R68A 5I8PA 2F9LA 2RHGB 3VKUA 5CEJA 1NN0A 4WKCA 3N9IA 4MKFA 2KLBA 5JO0A 1RXCA 1M7GA 2PL9A 4L1KA 1QO0D 1NQ5A 4YPFA 4CCYB 3CH7A 2XB8A 2OMEA 4N4AA 3PNMA 4IVRA 2XCIA 3W5VA 4ZZ1A 3OIUA 1K5DA 3PFFA 4HGRA 3SZ3A 3TQRA 4R9VA 5DO9A 1PKXA 2PH3A 3CX3A 2BGJA 1RAEA 1JYSA 2XUPA 1N5RA 4TYWA 4Q01A 3S40A 1JHYA 4RHUA 1YR6A 1HDYA 4MCIA 1XCMA 5JXHA 4FX2A 2QP3A 5JNTA 5L45A 4OLBA 2PWPA 4MS1A 3FCAA 5EPUA 4L2IB 4QTTB 4MTLA 4PO9A 1V1RA 5A4AA 4QBGB 4GMHA 4NZPA 2EEPA 3IEPA 3NTVA 4Q82A 3ZDDA 2JL1A 2PZKA 5G4LA 1DWOA 3TMYA 2VDWA 2Q5EA 4Q24A 3ROQA 3TSAA 2GUGA 3UAZA 3VSAA 2DBYA 5J2TF 4BNUA 5K4HA 4JR1A 5LYJB 4BFTA 3D1JA 1CQWA 2B3DA 1QFMA 4D3YA 2B4YA 3B9BA 3E2IA 4QNNA 4WA8A 3V4PB 1ZWKA 3ZK7A 5JQGB 3LC0A 1E3EA 1LV8A 1RPJA 4DJFC 4II3A 3WIUA 4AJ1A 4LE2A 1CP2A 4E14A 3X1DA 2B8EA 4EQ6A 4JT8A 2L2QA 4URFA 3EG9B 4DSTA 1YQUA 3N6XA 3FRJA 3NZEA 3THWA 3PE3A 1FJ2A 5FI1B 1ICEA 1XVAA 4F91B 1L4HA 1RM4A 5A3VA 3R3WA 2I6QA 1V8PA 3GB9A 1QYVA 2GEJA 1P5FA 2HT1A 1IVNA 1B42A 2IIPA 4ZICA 3R5JA 2UYHA 2O7NA 3KKLA 2VEDA 3ZXXA 3B1XA 1KEWA 4BATA 4JUBA 4RJJA 4NYIQ 4JVOA 4FLMA 2J0VA 1ULZA 4YMLA 3C4QA 1WMBA 1QQTA 3VR5D 2HT6A 1SUWA 1GARA 1MB3A 1T9KA 2AQIA 4EPRA 4HTAA 3AY3A 1V7CA 4IZ6A 4XUEA 1JDVA 2WOJA 1WMDA 1CJTC 1U0GA 5GGXA 4EW1A 4YAFA 2PYIA 1NBAA 2DXIA 1BD3A 1ZSNA 2CXRA 4GOND 3IGFA 4Q19A 1P7ZA 4WZZA 5IFLA 2GK7A 2ODAA 3B2QA 1ZCZA 3TIVA 4EY5A 2VH5R 1M8GA 4FE3A 5ELXA 1QDEA 3SLGA 2WUWE 2WUGA 4JJ8A 3AJAA 7MDHA 4TTIA 3HO1A 1E6UA 4KUHA 2XKJE 1NHWA 2WJHA 4HOYA 3U3KA 2Q5JA 1H4SA 2OC9A 1NF8A 1E5LA 3G2NA 2IH4A 4GWKA 4IDFA 1X1TA 1YIDA 5EYPB 3RW9A 4EJSC 8GPBA 2BFAA 3A9TA 5J43A 3QU5A 4GFDA 2GBLA 3M2PA 3K4PA 4Z1MA 4LZPA 4JYAB 4RL4A 1E1CB 1E5QA 1KJIA 1KY2A 5GVRA 3ZU4A 4ZI7A 2R47A 1W46A 3ZWKA 4LQ4A 1S3GA 4OQFA 4UHCA 2ONYA 5B3AA 1YZNA 4M99A 4RE6A 3VSEA 4PE5B 4S35A 3OD1A 4JB2A 1VLZA 5KYUB 3WGVA 1CJVC 2VP4A 3OLVA 3FDIA 4L9SA 1OKKA 1JVNA 2IY8A 3B8HA 1XXLA 3AG6A 5CVDA 4FI3F 4CIXA 3ZI7A 2R48A 5EP2A 2PLWA 3WQHA 4X65B 1KORA 1CDOA 1P2BA 1YZUA 4WAUA 3IMKA 4E1VA 4UAJA 5CVCA 3C16C 4ZVOA 3UUWA 5BSFA 3W8EA 3ETNA 1V9SA 4UC0A 3IR5A 3W2FA 3ZUPA 3DLPX 4J90A 2A9PA 3A6GA 2E7ZA 4YYEA 1Z3IX 2Q3LA 5IUNC 1V7PC 3CVXA 2REOA 2VIIA 1HTTA 3CH5A 3RJ5A 4Y8VA 2J9YB 1REQA 1WDMA 4YCCA 1A72A 3NCTA 3PQEA 3TBKA 2X4LA 1XJQA 1OSNA 2DHRA 2ZT5A 2QTVA 1GG5A 2COKA 3AR4A 3G0HA 1CHNA 2PSFA 5F21A 2UZIR 1EWQA 2BRUC 3EFEA 4KQIA 1P75A 3IB6A 1SO8A 1CEEA 4PBTA 4MUNA 2DWPA 3MWGA 1PTJC 5BYAA 3VI4B 1UR5A 2G0TA 3JRXA 4ZV4A 1L7MA 4JB3A 1CVRA 4OXRA 4QIHA 4EB0A 2DUNA 1GN8A 3OLWA 4RY2A 4QE3A 5KOHA 4R3NA 4Q00A 3TZLA 5EIHA 3STVA 2AUNA 1DFIA 2B4AA 2IP4A 2PUHA 2V55B 4QTUB 5G1NA 2EFCB 3F6SA 3ZVRA 4CQLB 5KC9A 1VKRA 1H9BA 3PK0A 5LLDA 1K3FA 1PEKE 2Q29A 4KFCA 1HEIA 5CTJA 2LIPA 3AVOA 3ZHRA 4HXEB 4AULA 1QO9A 4XOUA 4RJTA 2EKDA 3U1VA 1XZDA 2QR3A 1KZ4A 3B9PA 1PWEA 4HG2A 2VXBA 4PY2A 1WMSA 4OA5A 1PR6A 1NIJA 3IE0A 5FPTA 3QLUA 1O57A 4YGYA 3KZXA 2VSXA 2PCLA 3DMFA 3UPDA 3IQGX 4BVBA 1PT5A 1S4QA 2ORWA 3DNFA 5IT9A 3OM9A 4DDWA 1M7HA 1D1SA 1JECA 3NDIA 4RDIA 3I0MA 1M1YA 1XMXA 2YN0A 4ESOA 2QUKA 3EDCA 1OH6A 1I3KA 3N58A 5CH3A 3S7ZA 4QYTA 5BP7A 4GZLA 3KQLA 4YMGA 1T5TA 5D2CA 1FFCA 3QG1A 4LHWA 3MTGA 5ESXA 1K1EA 1VJ1A 1Z4PX 2ACKA 2KM1A 1BRMA 2BR4A 4JOBA 4XYMA 2GHQA 3H2YA 1O97C 4AF8A 4Y30A 3RVKA 1TTPB 4C3UA 2O52A 5E9JA 3LS2A 4BFXA 4RPKA 5C5CA 4L28A 1JQ5A 3HJRA 3HUFA 4ZMBA 1E3MA 1HE1C 4M53A 1ODTC 4AZ0A 1XRMA 3RDPA 1AK9A 1ZH4A 1P4GA 3NUQA 3DR3A 3ND8A 4CFYA 1OAKA 2C42A 3QZUA 1G19A 3C74A 3ETJA 1OXMA 1IZ9A 1E1RA 4RQAA 4DL9A 5CBPB 2GEUA 2F9MA 2HBRA 1F0PA 1FYEA 3FKJA 3EIQA 1USKA 1A77A 2GPWA 2J08A 2QU8A 3LGXA 1T3TA 4HDMA 3R6DA 4G36A 4NBNA 2DHCA 2JC3A 4URWR 3RABA 5B12A 3OFSA 1B0UA 2GM9A 2CHFA 4DLLA 3G9QA 4FZ3A 3VZSA 2YWFA 2P3LA 2OHIA 2PBRA 3WBFA 2GF2A 3EGDB 2R85A 3TPFA 3UJ6A 2GXAA 4LHZA 4FB4A 2QRGA 4GBMA 3EX7C 4FGSA 2TMDA 4CT5A 3I5XA 2BDEA 2O07A 3ECCA 1RXYA 2PT6A 1TCBA 2NYRA 4BQRA 5KSZA 3RODA 3QOWA 1KI7A 4ND6A 1IUPA 3BB1A 4H2DA 4OL0A 4QT0A 3COJA 3NNSA 2QG9A 4KTTE 1PLJA 1QCCA 5CVJA 1K63A 1O96B 2BGKA 1JL3A 1RPTA 1PO7A 2BP7A 3H8VA 5F64A 5AW1A 2ERYA 3HNOA 2BEWB 4J7AA 4JP3A 5ITSA 1L7VC 2FEXA 2B98A 1IZ8A 2CXTA 3IDSA 3CSSA 3FHOA 4OF4A 3PIRA 3VU9B 3OWHA 4LXYA 4DEVA 1DEKA 4G5YA 4LEIA 5FPSA 3AT1A 5TQVA 4D3SA 1FNBA 2I65A 3T06B 2LCQA 1QQ5A 4QTYA 4D82A 3V97A 1LBHA 1Y4UA 3FOAA 3H2GA 5F5LA 3AVVA 4ER5A 4LNAA 4YT4A 1RRCA 3WL3A 4D5GA 1N2IA 1G7RA 5FBHA 1P4AA 3ZD8A 3ICWA 1T4BA 2IPOA 4MRAA 1Z4NA 1Z4KA 1A9PA 5LA6B 4CJXA 4E2YA 4BWGA 4U5QA 4R2KA 4WFQA 4KGVA 4B6EA 1KRXA 3PL5A 1Z5VA 4I1VA 2OBXA 3DEJA 1UWVA 5FWDA 1A5TA 1YCGA 3GRPA 4RXMA 1ECBA 2R3SA 2UZ1A 5BWOA 3ZQUA 1RT9A 1L5LA 2AE1A 5AVTA 2B2NA 3QELB 3U37A 3KWJA 1Y8RA 4R05A 5FNVA 3IX7A 4X3OA 5L7WA 1E96A 3D4IA 4H0NA 3FPCA 4GUAA 1ULAA 1G7SA 2YY7A 3R9XA 4KQHA 5ADVA 3QEMB 4NIMA 4HDNA 1M2JA 4XASA 5SICE 3DMTA 4BNKA 2P35A 5T3UA 5LCXA 2ZRLA 4P4GA 1OX4A 4UDNA 5AK4A 2FJPA 2IV2X 5CT5A 2P2NA 3GRCA 1IUNA 2H1WA 3Q3HA 4DREA 2PFSA 4K2HA 5AW2A 3B5EA 3CF4A 2B0CA 4IDBA 5LXTF 4ZT6A 1G5QA 1OC4A 3PGLA 5KSYA 1HY3A 2O0LA 2QF7A 1UAYA 3W8RA 2EHJA 2IYQA 1W581 3B7WA 3AXTA 4MH0R 4XCQA 4LFAB 5HGJA 1P9RA 2C4HA 4I3GA 2FX2A 5FUXA 1DKPA 1NN5A 2CXOA 4W5NA 3PFKA 4D9GA 2IOFK 3KPUA 1CZLA 2D7CA 2YN4A 4JWTA 4KQXA 3U3XA 4AZ3B 4CLDA 2XCRB 1M1XB 2I1LA 2F59A 2IEAA 1U04A 1NONA 1YDMA 1SB9A 1XQXA 2V0NA 3GGGA 3NOQA 2PS3A 1W2GA 3RTCA 3TOZA 4UPEA 2H2GA 1RLJA 4TXHA 1ACJA 1KFCB 2HRRA 2W6ZA 1CDEA 3PI6A 4HF7A 4ZT7A 5BYBA 2ZJ4A 3Q8LA 2QBYB 2FPOA 4MGZR 1GRVA 1N5JA 1R6AA 1S3SA 2FZVA 2JGDA 4IMPA 4PNHA 3LY9A 4S2EA 1NJ5A 2LNDA 1NF9A 3B13B 4L50A 3ZBPA 5CA1A 3SS7X 3AU9A 3QMPA 3RTEA 3QLVA 4NQRA 5AKYA 1W5AA 1D03A 3BK1A 3A32A 1SBZA 4B48A 2YXLA 2HH9A 2QXTA 3F5QA 1GFZA 4CU5A 5D00A 2JLRA 1DTWB 2YIJA 1U65A 2ZYTX 3WWDA 1FL9A 2DTXA 4YUVA 2E5LB 3HWWA 3PV0A 1M2OB 2ZZMA 3IB3A 2J3HA 4LTNA 5G0TA 3E9MA 4C88A 1TZ2A 3GWZA 3NT5A 3O9ZA 3MCUA 5CURA 2TS1A 2BUAA 2AOVA 4AJ2A 1U1DA 1MNQA 2VPIA 3IDOA 3ZY4A 3E5MA 2HSGA 3H0KA 4PYQA 2QL5A 3CGGA 1ZOSA 4M8SA 1ODLA 4ZOCA 4YJHB 3NHLA 4P22A 4C87A 4XRGA 4QU9A 2G4VA 1T2VA 1ZM3A 3A4VA 4JEHA 4RJIA 1KAMA 2ZI6A 4QOEA 1SBYA 2BBTA 1C9NA 3C6XA 2Z5GA 3F90A 1BHO1 3W7AA 1K88A 2AQ8A 4HLQB 1I14A 4MLZA 4HV4A 5CEEA 5IS2A 1E2PA 1U7OA 2I7CA 5B7PA 2C2WA 1Q0QA 5J3JA 3AINA 2IYAA 4HRAA 4A0RA 4FK8A 1M2GA 5CVVA 4M0KA 4OYHA 2BBWA 4J29A 4EPTA 5KQRA 4W5JA 2YWJA 4IIJB 4FJ2A 1EGMB 4YS6A 3PEUA 4BX0A 5JR3A 1Z25A 2E82A 3R6WA 2QAGC 2XHZA 1U8UA 3VH1A 4BN4A 4KRFA 3B12A 1ZXLA 3LCMA 2HBQA 4XUGB 2IPNA 4HPJB 3R2JA 1QRUA 4X66B 3TQCA 4TTPA 7ADHA 3EFOB 3HVHA 1FDSA 1EPUA 3DQQA 2V7BA 4Q02A 2W8ZA 5GJWC 1I3NA 3RYIA 4E1BA 3U09A 4LXIA 1O58A 1YFJA 4OPMA 4G86A 5KJCA 1TLTA 3A10A 3F6PA 4WZBB 2R6JA 3G89A 5A9RA 1UDWA 3UTCA 2FPLA 1GNPA 4G5XA 1MPTA 3P19A 5TT1A 3S99A 4WHMA 4K5QA 3GH3A 4QZVA 1CYEA 1UBEA 4QRDA 5DJ5A 1B1CA 4LNUB 4H1HA 1E9EA 4N3GA 1UIRA 2OO3A 4WT7A 3C98A 4BNNA 1EDZA 1SPBS 1G2QA 2I4IA 3ZXUB 1B15A 3HKDA 1U7TA 4UU0A 4BB5A 1KGDA 1T36A 3RCBA 3ZI0A 2YC4C 3CJTA 2YV3A 1F38A 2HL6A 1C50A 5DBOA 4FONA 1DHRA 4LI3X 3GLGA 3WC4A 1Z08A 4KPYA 4AUMA 5BVGB 3GLHA 1QCYA 1PL6A 4KSBA 1Q6YA 5DH9A 2FUCA 1D2AA 1AGNA 2ZIEA 2XVAA 2ZBFA 3H8JA 3D8HA 2VJMB 3QF7A 1ISSA 5AM0A 3UB2A 3SZUA 5DRYA 4HJRA 2RH4A 5E4TA 1IZ0A 4BLSA 2O6LA 3O7MA 2PWZA 4BV8A 4Y2JA 1XZNA 3BWCA 1AB5A 1MX1A 4QICA 3S2GA 4MYRA 4B85A 5LLTA 1ZK3A 1UC8A 4UNNA 5TEVA 3COWA 4G5GA 2PGNA 3V8BA 1GV0A 1JBQA 2H07A 2BGNA 4DIMA 1ZVQA 4YJKA 1IM5A 2LVBA 2DMRA 2JH3A 4TQUS 3LRTA 3D8SA 2V58A 1UM8A 4GBGA 3FKQA 4N49A 4LX0A 4P5EA 4U63A 4ZT5A 4DTCA 4ZI2A 4V1CA 1GV1A 1SG6A 2X9LA 3K0KA 2PYZA 1LPSA 2J5XA 1ZNYA 1NVMB 1L5HB 4LVUA 1PK8A 2OKGA 1GDTA 2DPGA 3QLJA 4OLAA 2J7KA 3DG9A 2D5IA 4L76A 1WZ2A 1RYFA 2GVNA 1Q0UA 3UQYS 1SXGA 3STTA 1GQQA 1UBGA 3IR6A 3QQPA 1Q0SA 3DEYX 2NMVA 4URVR 4NCKA 3WSTA 2QMOA 4H7HA 4KMRA 1UKCA 2C9DA 3KWLA 5LQDA 3CUYA 4CDRA 4ZODA 5BR7A 3ZZ1A 2CUNA 4RO0A 5DGXA 3NM4A 3HABA 4I99A 2VAPA 1JQEA 4RTQA 3T3GA 2IEYA 3UCEA 3TZHA 2OLJA 4R9NA 5H3LA 5B58T 1AKMA 3C3PA 1OZHA 1GL3A 2FCRA 1EFLA 1XCBA 1ULSA 4UM9B 4N40A 2O14A 4Q7LA 2YWDA 4CEIA 2IW3A 3LDFA 3L7LA 3TEMA 5A4JA 5K0JA 3RYFA 4U7HA 1CF4A 2Y1KA 4MYSA 1AKVA 2OE2A 2Y6VA 1Y80A 3WJ2A 3ZE6A 4XWOA 3VC3A 1KHHA 1ZP6A 1A76A 4Z53A 3ABZA 1D6MA 1GKLA 4BCBA 3RU3A 1M8PA 3OPMA 1G21A 4YRIA 1W85A 3MTAA 2EVWX 3GJ8A 3ML1A 4N6OA 3Q41A 4FMDF 4BFSA 1TCAA 3T5TA 2AKYA 2PLNA 3G79A 3I45A 3EXHA 3KD3A 3QXXA 4DLSA 3W5AA 3DH0A 1E8DA 3C7AA 3WVNA 4LJKA 2E4AA 4NZYA 5HFJA 4I0WB 1BRTA 3T5GA 3PP8A 3UMJA 2YMMA 4Y6SA 4ZVQA 2C2GA 4H6WA 2QVYX 3OE7D 3UHFA 2HA3A 3L6BA 1N1EA 1C9JA 3ZW7A 3CEPB 4BAUA 1UBRS 5BN3A 4LXHA 2PN1A 4PAGA 3TYXA 4DB2A 4WFIA 3TM4A 5B2FA 2RHJA 3RS5A 2G28A 3AEUA 3K8ZA 4Q7KA 3S0JA 1G16A 4GYKA 3R0VA 5IW8A 4Q16A 2OV3A 3TPZA 1FTYA 2IXTA 1A96A 2QT1A 3A6DA 1L5FA 1OLXB 1TPZA 4RETA 4BLUA 5E9WA 2JLAA 2O3TA 4KQMA 2DETA 3FMFA 3CVUA 4PNZA 4Y98A 2VSOA 3JU3A 4JT4A 1NKTA 1RXIA 4HDKB 1NOIA 1VKOA 2YXNA 3DZBA 2J0SA 5LOVF 2DUWA 4Y1EA 4C0LA 1RXUA 4UZSA 3UUEA 4TS1A 5C32A 4NH4A 4TMFA 5HRUA 3LHIA 2FR1A 1P45A 4B32A 4BECA 2X0DA 1XNQB 1APBA 2QJTA 3AUYA 2X22A 4YXWD 1QP4A 5LIPA 4DYVA 4P08A 1PGOA 4V0RA 1TJ4A 2D59A 3QVTA 1MH9A 1RQNA 3QPDA 4GQIA 5CMLA 5AVZA 4S12A 3S70A 4D0GA 1Y7LA 3VU3A 5HILA 3R7LA 3K0AB 1EFUA 2NYVA 5ED4A 3R6LA 5MN5A 1QAQA 1MC4A 4XVRA 3SM9A 3WMRA 3H5AA 1EFTA 2XGOA 4MHSA 4TT3D 1Q50A 2WAXA 3TRKA 3L7JA 3NRJA 1R0WA 4CN8A 2IF0A 2VUTA 5EWMB 1FMTA 3WSWA 1RWOA 4FHFA 4MZXA 4X7BA 4Y1RB 4B4DA 4D3XA 4Y9RA 2NP6A 4MRNA 1JLHA 1E0KA 1ULBA 1UOOA 4C2AA 4J2HA 1DDOA 4L6AA 4WWHA 2RHRA 2YMQA 4UQLA 3LXMA 4TTQA 4X1YB 4JYZA 3UO8B 2GN9A 2OK8A 2F1IA 3EHEA 1RKQA 4UNSA 3BD9A 1F7UA 2VZ8A 5KPJA 2QD2A 1YQTA 3CHYA 1NNEA 4XGNA 3WXBA 1OFHA 3DB2A 1Q0TA 4H6XA 1T4MA 4C1NA 3VKGA 2QX8A 3V1KA 2W6OA 3M4XA 1I7DA 5L51A 3PQ5A 2X5KO 2W2KB 5AQEA 1SD2A 4NZNA 2OBFA 3M34A 4MWCA 3K70C 1YCFA 3UXYA 1TX4B 3IQFA 3OHPA 4WXYB 3G59A 4TKVB 1FFBA 4U5XA 3SIPA 3R8CA 5IM4F 3E6AA 3TZQA 3F3SA 1LDGA 4OHVA 1JLLA 1ZZGA 2A2ZA 3FJOA 1POWA 1ZI9A 2OD9A 2XWPA 4TUYB 3A4NA 5CW1A 5A6SB 2JIZA 1TU4A 4Y9UA 4R1SA 5KVQA 3OP4A 3EWSA 3Q3JB 4R54A 5LUAA 1G41A 2LTAA 3SDZA 5IXSA 3HA2A 4ROSA 1JXQA 4OBEA 3FTPA 3UOGA 1WHSB 4A3SA 2YW9A 5JCOC 2BFEB 4UJ5A 5KYKA 2VLIA 1UZNA 3T3DA 2O5EA 3ZEAA 2F6RA 5HKKA 1KZ7B 2YWRA 3VNSA 5C4IA 4IUBS 1ZW1A 3IVXA 1IN6A 4WBSA 5F7ZA 4IOMA 2FFJA 1PCXA 1E99A 1RACA 2LCIA 3QUAA 4QTXA 1E1MA 1FXWF 2OYCA 3DD1A 4G25A 3WG9A 2Z8YM 5DNDA 5JMOA 3AK4A 3CE9A 1KDPA 1YJ8A 2ZIUB 4I55A 2CVOA 5A5EA 4FLEA 1DIOB 5KJ1A 1SKQA 4CWAA 2G6TA 1X1CA 3MGKA 5T6MA 4YAIA 4ZHSA 1JLKA 3IBFA 1KETA 3HCDA 3QTBA 5D87A 4J3NA 3U3DA 3DCNA 2WV9A 4C4TA 2FOLA 3PHJA 1V0JA 3W5BA 2VRWA 4M0EA 5AUPB 1UK8A 3CO0S 2X0RA 1WDLA 1VKJA 2PU7A 3B1VA 4P4SB 4O2LA 1P1IA 4QUJA 2PKQO 2L17A 3SS9X 1K7YA 3MT0A 4LDAA 4FDTA 1NAIA 5GIOE 1ZM2A 4FSHA 2ACVA 1ZNWA 4ARUA 4E07A 2IK8A 2KE5A 4IVPA 4RA9B 4MV5A 2Z4TA 4FHEA 5IUKC 3U9SA 1DFGA 2PGIA 1XKQA 2QP9X 3P20A 1I4OA 3BBPA 1S8AA 3P26A 3ER9A 3ELBA 2AK2A 1EQUA 2Q2VA 5EUMA 3X0DA 4DNQA 1WKVA 3AQIA 1CR1A 1RVDA 5HS6A 5CFQA 1GL7A 2RB5A 4Q4HA 3AHJA 4WDQA 3MWFA 1MEJA 2ISCA 3LLMA 3AF6A 5IULC 2IUEA 5I7SA 2HSZA 1VE1A 4Z3DA 3ZGOA 1QRRA 3H9QA 3BL5A 1Q1GA 2NUPA 3MB5A 3AI2A 4PCLA 1KO8A 3ACDA 3WK6A 4R1NA 4NS1A 5GGYA 3ZX4A 4EL0A 2UV8A 3I52A 4MVJE 1JJ7A 1Q6ZA 2LWIA 1W5TA 3C97A 3JARA 3N2GB 1GLGA 3MT8A 1XTRA 4HP8A 4NEGA 4C4XA 1JHAA 3A6KA 1IWPB 3ILYA 5G4KA 5K6AA 4NYJR 4GX2A 3S44A 5SZHB 2IHBA 2BF4A 3IL2A 4ZYZA 1OBCA 1T1IA 4G8DA 4IMJB 5F78A 4EA6A 4H1TA 2VWPA 4GQBA 1ZRMA 4TXMA 1TZKA 4HT3B 2A9FA 2C96A 5IK2D 3PCRB 4M9XA 2OXEA 1D2EA 4XR9A 1QFXA 1R5BA 2DQKA 3LG2A 5KDLA 3OTOB 1HMYA 4L5YA 1N0IA 5CX1B 4AS2A 2GYWA 3USCS 2OZEA 1DC5A 4E6EA 3HS3A 1T6YA 3HV0A 3L84A 2O2CA 1SZCA 5EMMA 4PU0A 4GT1A 5DLPA 5DYNA 1Z0DA 2WI8A 2OC4A 3VZQA 1AQJA 1Z0FA 3UXMA 1VHDA 3DB1A 5DNVA 4CQMA 2BFBA 3D3WA 3OFVA 1EIZA 3B6IA 3REQA 4MDEA 1ZX1A 1IJFA 3HVJA 4EDFA 5IH7A 5KBYA 3UOAB 1W96A 2FJUA 4BWYA 4BJ5A 1XI2A 2ZWVA 1T5SA 5AVKA 3EEQA 1QK4A 1VKHA 3L41A 3O91A 4PRYA 4R8SA 4MQ4A 4C1BA 2Q6IA 4TYYA 1VHJA 1OAOC 2C2KA 2WJ4A 2HTFA 1AU9A 4Q3CA 1F8XA 4HN4B 3U7RA 3G0BA 2PWYA 4ZA2A 4H7IA 2H8KA 1DRJA 3NVKI 2GFQA 5EHNA 2JJ2D 3LUAA 3L02A 1JRLA 1XSEA 2BCGY 2OR3A 3AF4A 2QLLA 3T95A 3VFDA 2II6A 5GTDA 1ZMTA 2G72A 3ICOA 5DLDA 1T34A 4LHXA 5DX0A 3FKSD 1SA0A 2WE7A 1HQYE 3GZNA 5KYYA 4DCTA 1E3WA 3MW8A 4E08A 2WYWA 1M0SA 3T41A 4PXAA 3G8AA 3MCTA 3TAHA 1N34B 1A8SA 2W4MA 4DCVA 4F04A 2QW8A 4FFMA 2JJYA 3T9AA 3UT6A 3HKCB 4B44A 4DIKA 5ADUS 3F9CA 3COVA 1L5ZA 4CI9A 2QLBA 2ECFA 4RSRA 1XWWA 2H2DA 2RGDA 3K35A 4LC0A 4CG1A 1QDLB 2P9HA 3ZW8A 5LQAA 1QK5A 1XEXA 3IFSA 1QIMA 2N47A 3EBPA 4MQMA 2ODTX 1B3RA 1V4VA 1B6SA 1GUZA 4Z9XA 1BGWA 2ENUA 3AETB 1S8OA 4H4EA 1YJAA 2NQ2C 2QGFA 4A0QA 5JYDA 4RYDA 3C8DA 3O82A 3L8YA 5CB4B 3ADPA 4D9CA 3IP9A 1TMKA 2OCAA 4XB2A 3HZRA 1OI3A 1P1KA 2HNKA 2FP4B 3E82A 2JI4A 1ZH2A 4TKUB 3R7WB 1K68A 3AKDA 3OOJA 2BGIA 2CFSA 3O1JC 2P3SA 3WK9A 1Y8CA 5FAXA 3UMRA 4FPXA 5KYWB 2HA6A 2GYUA 2MSLA 5BQ3A 2YFHA 2ZS8A 1T8TA 2OCGA 4GSYA 2VR1A 4JC8A 2LDBA 3CZAA 2HPVA 4S1PA 2H0QA 1BWSA 1C1DA 1WUJS 3FX2A 4F97A 2DKNA 2IYNA 2OZLA 2TYSB 4GEGA 1DO2A 3DBRB 4LSMA 2BFFA 3E3MA 1Q1ZA 3L93A 5E6UB 3IVAA 4N3AA 3OZDA 4YRLA 3W05A 4DSNA 1JH8A 4YV7A 2HDHA 2EAUA 4Z7QB 2WY2D 5KNDA 5L9AA 5KYTA 1WQ1R 3LHFA 4UEKA 2A1UB 4PAQA 5K8CA 1N57A 4ENTA 4CV1A 2QX6A 3DEKA 4YV0A 2B82A 2QL7A 3DOUA 5IFKA 3GNTA 4JI8B 4QGSA 4HQ6A 1YH3A 5I5EA 1GQ2A 1HE3A 4XDHA 1VSBA 4AUNA 1KDZA 4B2YA 4D4IA 2PUGA 1T25A 2BGUA 3LP6A 2E37A 4BP8A 3DF9A 5C1IA 1JXAA 2WT9A 5LB4A 4CGYA 1SELA 1VCMA 4QGBA 1Q7TA 1P6XA 2ORED 2J3KA 3T4PA 4AF6A 1YRWA 1ZQ9A 2BOVA 2C2OA 2NSDA 1E64A 2XKAA 4IGFA 5A9SB 5HUQA 3GRZA 5EIAA 2BDUA 4ZIRB 3O4RA 3UTDA 1OREA 1SUIA 1PDOA 4D8UA 3GRKA 3IIMA 4JWKA 1LY1A 4O2BA 4QUIA 2Q99A 1X7GA 3EFBA 1SD1A 3VTAA 4YGXB 1RIFA 4G1UC 1BJKA 4TTAA 4UEOA 4AMZA 4EI7A 2Y0PA 5BYJA 4LN1A 3RV4A 2ZIGA 4NVRA 2I67A 1ZNZA 3WA7A 3LL7A 1DKQA 3RAPR 1F1BA 1E79A 2H9IA 3GJ3A 4HD8A 1LPBB 2GUWA 1MJGM 2ZYAA 3GFVA 1YBFA 1KDYA 4CMEA 3T7TA 1J2YA 1ULTA 3TZ6A 1PL0A 5LBTA 1MB9A 621PA 1U94A 3NWOA 4GLLA 5L3SA 3ZHQA 3HDYA 3BH6A 2AJTA 3AY7A 3AVYA 5C46F 2VP5A 4TROA 1Z28A 5CJ2A 3GEPA 5AW5A 1FVXA 2O54A 2RHTA 3Q1LA 4CV2A 2X86A 2JHFA 5CYGA 2DJIA 3HXTA 4PWYA 3U44B 4NV0A 2PBFA 1MABA 1I24A 1KDOA 4FEGA 1XEWX 4IOLA 1NKVA 2IEGA 3IP1A 2CMGA 1CUAA 2JIMA 3D6JA 4L9WA 2HA5A 4QJBA 4BVGA 2UZ4A 1XL1A 1Z18A 3GLUA 1EXVA 1S96A 3I9V1 3UK6A 3CCCA 3R23A 1LCIA 4G4SO 4E32A 5AVUA 1U7ZA 4XYGA 5DNCA 2UUAB 1C3OB 2DUUA 3QFSA 4P86A 1HSOA 2GOYA 4OI4A 4YVFA 4ZKDA 5H70A 4GPEA 1V41E 4N9QA 1B76A 1CULC 1RADA 1T4CA 5KTOA 2HSJA 5CYOA 4LISA 1KH3A 2ZJ5A 3A0RB 4KMSA 4ZAXA 1QGUA 4JELA 5JY6A 3ASVA 1OTXA 3KLNA 4ZOEA 2F3RA 1SQ5A 4DAEA 1E1YA 2NW6A 3QKSA 3JD2A 2LIVA 3LIPA 1GUFA 2ALJA 4LZAA 1AUPA 2DG2A 1OBFO 5DM60 2BZ0A 2VXYA 3IDAA 5SY9A 3H83A 4EGJA 1U8YA 1M2VA 2VJOA 4X9XA 2FWIA 2ZSEA 3BAFA 3QUSA 2OV6A 4K9QA 3S29A 3V6MA 1E9CA 4GPZA 1K8ZB 4PZAA 5CU7A 4FHDA 3TRJA 5BRAA 3TGLA 3DNPA 3OHSX 4V2UA 4DCMA 2EHDA 3I6IA 5DHRA 2OB2A 1HKHA 2PUVA 2WILA 3IUJA 2TMGA 2X1LA 3JQ8B 4ML3A 3TOVA 1F6DA 2VBFA 1Q0RA 5MGNA 4L4SA 1GD1O 3A3YA 4PLPA 4RVNA 3L4BA 4NEQA 2IC5A 4RIHA 3OA2A 3S28A 4BQIA 2VDKB 3NUZA 2I1VB 1MGOA 3WL8A 1TCCA 4UHHA 4DSAA 3DZIA 4XLTA 1D2NA 3D43A 3MWJA 3TX6A 1KEPA 2PS0A 1P1RA 1CQIB 4YWHA 3JASB 5SZIA 5ALIA 2BI8A 1CUVA 4IGKA 3AEQB 3NRBA 4XARA 5EKSA 1R9MA 4XOIA 1U9IA 3ZQJA 5I7UA 1NT4A 3C5HA 3JAKA 5FADA 3IIJA 2NUTA 2R6R1 5FX2A 4TTVA 4C7OA 5HNKA 3QVUA 4IHQA 5ALWA 5ENDA 2CYCA 3SJZA 1Y9AA 1FU7A 2ICAA 1CT9A 1ZK1A 2J9XB 3KVRA 4PCUA 1V4BA 1ZEJA 1FDRA 1WPRA 3DE1X 1BDBA 4TV8F 3BFVA 1UK9A 2Q45A 2IYYA 3I2HA 1TAHA 1JAZA 4O4LF 2WV7A 2AB0A 3KWFA 3EZFA 4W8OA 4FS8A 2AC4A 5AVSA 2EIXA 2EFGA 4CEJB 3VOSA 2RH9B 1XD2B 2ET6A 1VECA 1ZRHA 1X7YB 2ZAMA 3CWZA 3QENA 3RFVA 4D5EA 3HTXA 3QYAA 4E12A 1C3VA 1S5PA 2FXIA 2XTAA 3MJRA 5TGZA 4CM9A 2FB9A 5I9LA 2XYVA 2GA8A 2XYHA 2YUIA 5A9TA 3L1IA 1BQ4A 1AQLA 4XQEA 3HCPA 1J99A 2VPZA 2O1WA 4AICA 4TV9F 2REXB 5EJFA 1Z34A 3ELDA 2O5VA 1K5GA 2ZPAA 4MZDA 3ZVLA 1L7NA 1CIPA 3MYYA 5BNIA 2AEFA 3I01M 3VM6A 1M3SA 4LRTB 4QXQA 4YACA 5TQ2A 5BW4A 1PV1A 4UQOA 3H7AA 1HDXA 1TQ6A 1CETA 4RF3A 3M6VA 1RLIA 2PD4A 1LWOA 1Z35A 3WK7A 4BY9E 3GG9A 2ZUSA 4WCDA 3IQZA 1OXTA 4QAQA 5JD4A 3AHFA 3C1OA 3ABSB 3NEPX 1MFPA 2W0MA 3I2IA 3OPXA 3PHHA 3V4FA 1F7VA 1A8UA 3QXJA 3U26A 4C03A 1A9XB 4IL5A 2PXCA 2OD7A 2DAPA 1OZAA 3H0CA 1Y6GA 4Z7NB 3V8VA 1AM4D 3LUHA 3WBJA 1Y6FA 3HB4X 4LY6A 4NZZA 4EY6A 3FZQA 4IAOA 5FWNA 3KEQA 4F3KA 2XB4A 1JG2A 4RACA 1UMDB 3SQNA 2GRUA 1GDDA 1K08A 1LX6A 1H2FA 1JSZA 3ANLA 3HADA 4RK6A 3W2TA 1CLUA 1D6NA 3VJRA 3JZDA 3D81A 1DBVO 3GLVA 3OCWA 4N8DA 5D84A 3COYA 1W36C 2J31A 1RAFA 3AI1A 4LCBA 1XZPA 1T9HA 1D0SA 1UFVA 1Z2DA 4QUAA 4WZAB 3SYNA 3WB9A 2H31A 2R9VA 4BNDA 2PZAA 4ER0A 2IWHA 1W19A 3DZDA 2WLSA 5CLGA 4Z0NA 3ZU3A 4INPA 1YUNA 4F4DA 2XWJI 4BTEA 4BO5A 2YJZA 2HYDA 3IRVA 1R6DA 4QVGA 4X97A 2ZRPA 2JFNA 1V43A 3CJRA 3HKBA 4D99A 1EG7A 1A95A 1IHXA 3NHZA 1ZR4A 3SF8B 3ZIAA 5BQ5A 4RVHA 1XTBA 4JUCA 1OVGA 4U8HA 2A9KA 3WDSA 1WD7A 3W5DA 4YC7A 4J03A 5K3BA 4OOEA 4H7JA 4WGFA 4LJLA 4L5AA 2LGJA 3TQSA 2VHCA 1DX9A 3HCAA 4NBTA 3QVGA 3PNQA 5DMXA 5AKJA 1EE1A 5C1DA 3TUIC 4OAQA 2UXDB 3SEAA 2VT6A 4AM8A 3H2IA 1GPMA 3G0DA 3WDMA 3N6RA 1S8NA 3ZTYA 1AKQA 3NAZA 3W4JA 4UOEA 1VDMA 1BH6A 4U7WA 1PZNA 1B26A 2WP8J 1H42A 2DE0X 3N28A 1OH7A 1K5PA 5D51S 1QHIA 2QM0A 3CB2A 4MYCA 1NW8A 1Q3TA 1X94A 1AT1A 1PK9A 2JS7A 4FUQA 4R41A 2HZBA 2DH5A 4Z99A 2RGNC 3L8HA 3RS2A 3DE3X 3G0OA 5KTMA 3EHDA 2VYVA 5IT5A 4YRRA 2O4UX 1KZ1A 5JD5A 4TGLA 2CFCA 3C14C 2DSTA 1QLJA 2D74A 1H6AA 3OBBA 1YR9A 4MI6A 4BB0A 1HNXB 2P5SA 1YC2A 4NONA 4NU0A 4ZU6X 4DXDA 5LNK6 1I4DD 3ACBA 1PJ8A 1U0JA 2FPKA 2WIAA 4A1OA 4RJKA 5D7NA 4UTVA 2HMWA 4MQLA 1N9ZA 1DJLA 1JSCA 2G36A 2X7JA 4JP5A 1VFPA 2D06A 3T99A 3D4NA 1PJSA 3W6NA 4M87A 1W75A 1C7IA 2ZR8A 1KTIA 3CLSD 4ID3A 2CLSA 3P9QA 4QEDA 3AUUA 4JUDX 2AX3A 2VS1A 4QGGA 4JVMA 1Z62A 3NYQA 1Y4DE 4MEJA 3ZLUA 1KOFA 4LXUA 3AESA 2H4FA 1ZHOA 1T8WA 3IOMA 5EZ5A 5IJ0B 3FCUB 1UXOA 2QT9A 4G0XA 2BM0A 1CY0A 1T91A 1NJ8A 2EQBA 5I3ZA 1U02A 2BLLA 2V8BA 4NPHA 3TLKA 3IKVA 6REQB 1Z6QA 1P2SA 4CNBA 3KLOA 1A2KC 4BC1A 1YQQA 1O6GA 2WC1A 1YIOA 2ZUUA 1CZOA 3B3AA 5D7BA 1EXMA 2UDPA 2J4CA 2P7IA 1QIJA 5FEUA 3SSAA 2VJAA 2CZQA 2Q2NA 5A5DA 1EFCA 5JROA 4D3ZA 1I5EA 4F3YA 3RRNA 3OOSA 3SHOA 1XMVA 5JI2E 3EW7A 4RKFA 4L73A 4RK4A 2YOFA 3VPHA 1BXRA 1A82A 1QH1A 1MQSA 2B35A 3RANA 5K8VA 4P36A 2QTNA 3NHMA 4IJWA 4ESEA 5L7YA 1NQAO 1RI1A 1EX9A 3ZWQA 3E9NA 1IBRA 4XWAA 3KPVA 2QTTA 3HJUA 1KPIA 3JQGB 4FYIA 1EFPB 3OZRA 3I0NA 4ZOBA 4RA6B 1FNSA 1Z2CA 3ROFA 3T34A 4MV0A 1W4LA 1WKBA 2GN0A 3V4SA 2R2GA 2Q8PA 3ND5A 1HLGA 3DEIA 4YMTA 3PTAA 1XELA 3G68A 2J0QA 3R40A 3O3NB 3MSCA 5CLLA 3SVLA 4MAAA 1T2AA 4DNXA 4K86A 1DC6A 2G63A 1IHDA 4RQTA 3KQTA 4DMRA 4G24A 5LQUA 3ITDA 5JRDS 4GPD1 5A7HA 1TYBE 4RY0A 4AK9A 3WYEA 1IB0A 2WHPB 3QU9A 4XX1A 3NOXA 2OESA 2F1JA 1EM6A 1ZGAA 2QVZX 1T3GA 1Q1EA 3DWGA 3OETA 3QNWA 3LUPA 4C4AA 2YBEA 2CZGA 1OY1A 2GFIA 3U61B 3SC2A 2XA2A 2P62A 2VSFA 3C5WP 2I0FA 1QIHA 1TVEA 3O0TA 3R5SA 4GHWA 4Y2VA 3VQTA 1E20A 3HV2A 5I7AA 4QLAA 5K0SA 1E62A 4B3RB 3R0ZA 4K6GA 1DQRA 2OV1A 3ADKA 4R6XA 4FR2A 5I7VA 2B69A 1TZJA 1VL2A 2ZTLA 3SD7A 5EKXA 4BCCA 3EPLA 3LX6A 3RC8A 2GEDA 2CHEA 1QYXA 3MPOA 5J2TB 1FX0A 4I9UA 3DYIA 1WV0A 4BMYA 3D7KA 5K5EA 3MTDA 2A0KA 2FR8C 3OJOA 2XMCA 1P73A 4ZCLA 5A7FA 3O75A 4L27A 3E2PA 4AY3A 3VHQA 1Q2XA 1H1TA 2EX4A 1RYBA 1OI4A 4QBHA 1GFWA 2P27A 3GUZA 1KMNA 5JSZB 2VQFB 4ZAYA 2ASVA 3GMIA 4LVNA 4WKBA 1GL9B 4LQDA 2O1XA 4IWXA 1HLPA 5G02A 5JS1A 3GFSA 3LSYA 2NZWA 2JFGA 1NX6A 1VA5A 1NRXA 4PF1A 2ZSDA 4BNXA 4QYIA 5IJ9A 2V7UA 4RAQA 2J48A 3DZHA 4B17A 1JF8A 5E0OA 3ORSA 4IDHA 2J59A 1RXWA 3CLTC 4IGIA 4IJVA 1WTCA 2REQA 4CUKA 2GXQA 3V5NA 4PZLA 2E6KA 1O89A 4IHJF 4C6RA 2YHIB 2Z43A 3CLSC 2BEVB 1ISHA 3D6HA 5F7JA 2E18A 4GMXA 1MOPA 1YVDA 4GX5A 4KQKA 2QMYA 4UPDA 3ZGNA 1L4BA 1H05A 1XLTC 2YWEA 4TRMA 2ZAYA 3RHTA 3Q7EA 4D8WA 2I6FA 3TRDA 1EFKA 1CJBA 4I4TA 4UOQA 5BSHA 3DZJA 3OCZA 4OHBA 4PLZA 1ST3A 1DELA 3HR7A 2WUDA 3LTEA 3BZWA 4LF5B 2CLKB 4FT2A 2C5EA 5JS7A 3VXKA 3PSAA 4JBNA 3UJDA 4G5HA 3GBPA 1NA5A 1IE3A 4RPHA 4CL0A 2XA1A 4YMWA 1ZJ4A 4A1FA 4EG8A 4RS4A 2Y1GA 1MA3A 5I51A 2VH1A 3Q2IA 4RPLA 3K6SA 1XIVA 3DZFA 4Q0MA 2IXFA 5F3DA 3LAWA 2PZ8A 2QKYA 5HMLA 4ZVMA 2BHNA 2XUFA 1ZH8A 1WOMA 2MINB 1CIVA 3OAAD 4E13A 1BE6A 5EUCA 3H87A 1XN4A 3IXLA 4F3RA 1CNFA 2VWQA 4HFRA 4ND8A 2F64A 4AY5A 3T9DA 1CUDA 1V5EA 2NOAA 3WK5A 1G5IA 2QW0X 2H5JA 2AXPA 4A7PA 3NW9A 2ANBA 1OLUB 1ZJZA 2J6HA 4PG5A 1NW7A 4MMYB 1JVSA 1P2DA 1G8AA 1E6MA 1Z17A 3EVZA 3RSLA 6PFKA 4EJSB 4GOKA 4A0GA 1YACA 1VJTA 2I6SA 4BP3A 2N1BA 1LVUA 1M8FA 1HQKA 2ECOA 3HP4A 3I6YA 4J1TA 4L6IA 4NOMA 4TN5A 4UAGA 5E7JA 2V54A 2H52A 4Q5IA 4KN8A 3LT5A 3IQHX 3TW8B 4AP9A 1NW9B 5CT4A 4UMEA 3H1BA 4UTOA 2W93A 3KJHA 3H1AA 2O8EB 4ARVA 1QQ6A 1BMTA 4BGIA 3CQ9A 3E0XA 3L8FA 1MJHA 1S0UA 3DE2X 3EAGA 2B37A 3N8IA 4GR4A 5LR6A 1T43A 3BTOA 1J39A 5ALPA 4F3CA 5BNWA 1JQLB 4R8RA 4NMLA 1VE7A 2FZWA 2JAXA 4P7GA 1LDNA 4NDZA 3EOAI 1IVYA 1G5HA 3THRA 1DMRA 5EAIA 4KL8S 5KQSA 4O59O 2E55A 4LZJA 5ALQA 2D2FA 2IYXA 3B7GA 5E2IA 3X1YA 3D6TB 1NLMA 2VAXA 3ANMA 4RTOA 5FOSA 2D0DA 2YMPA 4IIHA 4HH0A 3R41A 4NG4A 2Y1XA 3JAWB 1RPAA 1VHTA 4R8KA 3VR6A 4C0HA 1RAIA 2W7TA 3DV0B 5LSAA 1VPTA 1K3UB 1M7BA 3JQBA 4PQYA 2JLBA 3DFIA 4I9NA 4A0HA 2ZRMA 3D5TA 5JH7F 4XVCA 1SKAA 1WHTB 2UXBB 3LQ2A 3H1TA 2B3TA 2RIRA 2C4KA 2VJBA 2FEKA 5BW5A 1S2IA 4FM9A 3SIWA 1R0LA 1DOZA 3QU2A 2DHEA 2XF8A 1GAJA 3FGZA 2VOJA 1SD5A 3UYKA 5DGCA 1X2BA 1R10A 1C8KA 2BSAA 5A62A 4K87A 3T7AA 1DC7A 2VWGA 4P4UA 1NXTA 2D0OB 4JNKA 5AJZA 2C77A 3U6BA 1A5AB 3FTDA 2AG1A 3OCXA 4GOOD 2RH8A 2YZ2A 3TB4A 1E63A 1ZGGA 1W9HA 2JLUA 2GAFA 4XDYA 1ATZA 2GAOA 3AFNA 3C70A 2XVMA 4BZQA 1FB5A 2HGZA 2AZXA 1NZJA 1DPFA 4M38A 3MD9A 1AHPA 3T52A 4CDNA 1J22A 4ZDWA 4DBVO 3O83A 3OX4A 5AHKA 4UXIA 5F73A 1OGJA 2DLDA 5AXAA 4RVSA 4ZEOA 4DDHA 1US8B 4M6WB 5B2EA 5ENZA 6AT1A 3L0SA 3SX2A 1UBCA 3IV6A 3F7OA 4FC7A 3BMOA 5EQFA 3MC1A 1DWUA 4UHJA 2P7HA 3A1FA 1A0OA 1JW9B 4LA4A 1ZOOA 5JPCA 1Y8QA 1TC2A 5JNSA 3RIHA 4AJPA 3VO1A 1J1ZA 4XQGA 2JZCA 3WHIA 1I6KA 1NMEA 3N2KB 2HAEA 1PUIA 1NC1A 1NMZA 4G8JA 2BAGA 2BEJA 2ECPA 2CVPA 3C3KA 4OUDB 3PXAA 3AEXA 4U6NA 2FW9A 2H54A 1WX1A 1MFZA 2YYZA 4R1OA 1SAYA 4HWKA 4YLEA 4DY4A 2AR0A 2VH2A 1JHOA 2G25A 2WU1A 3UHAA 5IT4A 1X80A 3B36A 3HO8A 4A10A 4EX7A 2WP0A 4F84A 5JDCA 3ONVA 1G8FA 2X8JA 3FWPA 2H29A 3JWJA 4HRYA 4DR4B 3G13A 2YXEA 4DMCA 3HB0A 1KSGA 3ZIDA 2PLFA 1QTRA 3ITNA 1NW3A 4XWGA 1N2XA 3MWDA 2VTKA 1YBAA 3BXHA 3VX3A 2ETXA 4K6FA 3X3HA 5C8XA 1P9OA 4OQ4A 2VDMB 1QIKA 5E6SB 2W22A 4UQPA 2V7QD 4PZZA 4F1KA 1F06A 5BOSA 1D4FA 5IJZA 3Q6NA 5AK0A 5G3ZA 1W8IA 4HXGA 1EVIA 3PUVA 1FLAA 1RYYA 5H9WA 1E1NA 4MUKA 2QMHA 1XRJA 4IDPA 4GYJA 5HM8A 4MUAA 2ISQA 2YJ4A 4ZCRA 4BJHB 1UJ6A 2WM2A 2R7NA 3B6ZA 1SXHA 3NFRA 4OB6A 4G0YA 4DCUA 5CFNA 5FCDA 4L2IA 2FEOA 1EX6A 5B6PA 1MQAA 4Q1FA 5EMHA 1FDTA 2ZW9A 1JE0A 2X2PA 2AFHB 1EUDB 1P61B 2ORVA 3QQ5A 1FU4A 4GZ6A 1Z74A 2XCLA 4YP9A 5C2JB 4GL4A 3ILVA 3UA3A 2PE5A 1CPYA 1H8EA 1L2TA 3DDWA 4CLEA 1ARZA 2H1RA 4ZDIA 5BN4B 2AJLI 2Q5OA 1IPEA 2P2DA 3C0KA 1Y82A 2JFQA 2PG3A 4NRDA 4EG3A 2HDOA 1DTSA 1KJZA 1OZ0A 1GQFA 1TAGA 3A27A 3GGPA 3R20A 4XTCS 4B33A 1YJ5A 1XAJA 1UWCA 1C0LA 2EJTA 1XXHB 2LXNA 3F3YA 3J7TA 3QW2A 3RPEA 4EG0A 2P9ZA 4LDNA 5DHFA 3EOBI 2IXEA 4GBJA 2QSUA 3VPXA 2OQRA 3I3OA 1XMSA 3UH0A 2PGLA 3RFXA 1H3FA 1QHGA 4JI0B 4L51A 5IBCA 3EUFA 4AJHA 1A5ZA 4AWBA 2X3FA 3G9TA 1IC6A 4TLBA 5TGDA 3K9HA 4LS3A 1U80A 1P2UA 1CY6A 1YVEI 3S2IA 4YQYA 4HNVA 1IBKB 2BHLA 2D1YA 3M9LA 1SHUX 4XJSA 4EGSA 3FMGA 5T4BA 2MOKA 3FDXA 3WLAA 1ABBA 4ALNA 3HSYA 1TJNA 4ODIA 4CFSA 1NBMD 1SIOA 4FWBA 4G1MB 4OATA 4Q3KA 5IC4A 2NZ8A 2C2ZA 2WUVA 1UMCA 1XG5A 1OUMA 3FNFA 5GM1A 4EHBA 1GPLA 5K8UA 2VHUA 2ZJ6A 1XCPA 3W8NA 3MILA 3TIFA 2VHEA 2QYSA 3WJAA 4AT1A 5LXTB 4PLVA 1UJNA 4JOCA 1MB4A 1Q0HA 2EKQA 2YNMD 4EG7A 5KOIA 2GPAA 1QH8B 2IE8A 4X91A 2WD8A 4YCMA 2D2VA 3HBFA 4MP3A 5CR9A 3RADC 1EM8B 2ZB3A 3BGWA 4DGSA 2EERA 1ZK4A 4Y2UA 1XR3A 2FSHA 2XNJA 4FE7A 4X20A 2VLBA 1RAAA 1WV1A 2C59A 4X94A 3OQIB 1Q19A 3O8DA 4RXTA 1JI3A 3AHCA 4DIBA 1O94D 3LBHA 5IF9A 4PG6A 5E8JA 4RGBA 3GCXA 2J07A 2KBEA 1Q2UA 4RCYA 1B8PA 4R1UA 4KODA 2JCSA 2C5AA 1L3IA 4ZGWA 1GY8A 3AB7A 1B6GA 3I04M 4HQLA 4JY7A 4TPKA 3U5TA 1NG1A 4PCAA 4R1QA 5JCJD 4AQ7A 3GFFA 2NQ8A 2HB6A 2FRDC 2OECA 1G63A 2EW8A 3JQ7B 2NU8B 2PGDA 4OJKA 4KPEC 1QC5B 1E2KA 3GIDA 3GLFE 3DLBA 1KZHA 1PR5A 5CDTA 2J8ZA 4OGKA 1T10A 3GQVA 4NJOA 4YR7A 3GPLA 3AIKA 1WZIA 3RRBA 1FRVA 4F8JA 4HGNA 2QZZA 1BXZA 2BIFA 3G2PA 5L6MB 4I4IA 4ZMRA 2GK6A 5B3LA 5EQJB 3KD2A 4U2CA 4Z51A 3G02A 3QA9A 3HZHA 1RWXA 3OZXA 3NWPA 1LUAA 4LJYA 1C0PA 4JI6B 2VJDA 4CODB 2BZGA 1PR9A 1W0CA 3WX0A 3ROKA 4GWLA 3RSCA 3ZDAA 4DPLA 2DFPA 2JFBA 1XK6A 3KJGA 4LOAA 3TOXA 3IXMA 3TLAA 3L7MA 3P0JA 4Q1BA 1FUUA 4YCBA 1L8LA 1XF1A 2VXCA 3QEJA 5CNMA 3CVYA 1ZM4A 2Q8NA 4NYMR 3E8MA 1L5GB 3TNLA 1QFZA 2ERCA 1SBCA 5HCUA 4WK6A 1OPRA 3RNLA 4AKSA 2YV2A 5I45A 5I8WA 4Q1CA 1TEZA 3L0CA 2B8WA 4M2LA 3W9SA 3DHVA 5D3KA 1SCUB 1WTAA 2YYSA 3D8NA 4XVHA 1XZIA 1X15A 2BGTA 2EU8A 1TAQA 3GRFA 2VAWA 4P7JA 5BYKA 4V0SA 3IERA 4HX2A 1XRSB 4Z4FA 4NMMA 5FXMA 2AK3A 3RVRA 2R8YA 1W4RA 4RZSA 3DMDA 5KU7A 3LLVA 3IH5A 4YMVA 2O8DA 5HIAA 3LMKA 2Y3IA 2W6JD 4RU1A 4HVCA 4CQLA 2QJOA 2NZVG 3P5SA 1N2CE 1Z36A 3RVBA 1UQUA 4TL8A 4HDOB 4YUYA 2C8LA 2EBFX 1Z4OA 2PQ2A 2QRUA 3ENNA 5DHSA 3AVXA 1EDEA 1X7WB 2REBA 1ZIYA 4MYHA 1WSBA 1MH1A 3VSDA 4MGYR 4YP0A 1KARA 2RI0A 4I8IA 4W5HA 1YR3A 2GO1A 4W9NA 4ND2A 4BLTA 1XTUA 1ZMXA 3H11B 2QAGB 3IE2A 4MR9B 4G07A 4AN1A 3P45A 2JA1A 1RWBA 3TL2A 1CEXA 4UFPA 2W2VA 2WD7B 3FCXA 3CIFA 3TLGB 1H2XA 5EHIA 3D4OA 1RBQA 3H6HA 4QJ3A 4JLUA 3DEZA 4KNVA 1R8YA 3LBNA 4M8LA 2O8NA 3PDIB 4WVLA 3M6XA 4K6MA 4WBNF 2HRDA 5J2UF 2IS2A 5JYEA 2F1RA 1M1ZA 1N1DA 2YNMC 3TR5A 1CY7A 2EIHA 2Y6UA 2YHAA 3C3EA 1L5YA 3ZJUA 1P7YA 2GQ0A 1ZUIA 5ALHA 4PYNA 2QTWB 1AURA 1JHZA 4K8OA 2XYGA 1O6BA 4P84A 1LQTA 2RHCA 3Q8KA 5DCWA 1NNLA 3HYSA 2MSNA 2M98A 3DPIA 4M83A 2G5CA 4A73A 4X1KA 2AHOA 4MWZA 1H2ZA 1CS4C 4JXZA 2IXGA 2Z5LA 1TIPA 3F6RA 4EW2A 1J1IA 1RM3A 4X1IB 5HR5A 3KDPA 5E7IA 2EXXA 2F8LA 4GP9A 1AMNA 1E6EA 2DR2A 2RHLA 2PSEA 1RHJA 5DYIA 4DHEA 1SVWA 1UDCA 2GZ3A 4IW3B 1EVZA 3OIGA 4E4YA 1G3UA 1SIBE 3PEVA 4I5GA 2QQFA 4MGIR 3UCXA 4F6LA 5C5DA 3FUCA 1HMPA 1P5JA 1KA9H 3AP1A 3CKMA