3A2NA

Crystal structure of dbja (wild type type ii p21)
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
298
structure length
298
Chain Sequence
RRAPVLGSSMAYRETGAQDAPVVLFLHGNPTSSHIWRNILPLVSPVAHCIAPDLIGFGQSGKPDIAYRFFDHVRYLDAFIEQRGVTSAYLVAQDWGTALAFHLAARRPDFVRGLAFMEFIRPMPTWQDFHHTEVAEEQDHAEAARAVFRKFRTPGEGEAMILEANAFVERVLPGGIVRKLGDEEMAPYRTPFPTPESRRPVLAFPRELPIAGEPADVYEALQSAHAALAASSYPKLLFTGEPGALVSPEFAERFAASLTRCALIRLGAGLHYLQEDHADAIGRSVAGWIAGIEAVRPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Haloalkane dehalogenase
publication title Enantioselectivity of haloalkane dehalogenases and its modulation by surface loop engineering
pubmed doi rcsb
source organism Bradyrhizobium japonicum
total genus 107
structure length 298
sequence length 298
chains with identical sequence B, E, F
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2009-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3a2nA00
3K2IA 5ALUA 3VKFA 5ALJA 2XB6A 3N2ZB 4UBLA 2PUJA 4U2FA 2VF2A 2HA0A 1L7QA 2B9VA 1VZ2A 3I1IA 2LIPA 1QIEA 2VATA 3R3YA 3EF3A 4CFSA 5DTJA 3IUQA 2HA2A 4MEBA 2Z3WA 3F67A 1ETHA 3QPCA 3V9AA 4FBLA 4KYVA 1GPLA 3WIOA 4DMFA 2OCKA 4BDSA 3NOXA 4YASA 4HAIA 3QBJA 5AICA 2DHCA 4H7DA 5HF6A 2ZJ7A 4MYDA 5DNUA 1CUYA 2WKWA 4G4IA 1ORWA 5D6OA 1ZD5A 1IZ8A 5ALWA 4B81A 1XQVA 3M81A 1A8SA 3S8YA 2OCIA 2XLCA 3IUMA 4MXDA 4B0OA 4BCBA 5LP1A 1PV1A 3STVA 4BAZA 5BOVA 4LHEA 3VVLA 5HQ3B 1SCIA 4AO8A 1JJBA 3D0KA 1VE7A 4P9NA 2XMQA 2HADA 2H7CA 1D07A 3QITA 5AKEA 4JUIA 3WK5A 2D0DA 1QIKA 3R3VA 4B7ZA 3PUIA 4M0MA 1QIDA 3KWFA 1GGVA 2AJDA 3ESAA 3PF8A 5JAUA 3FVTA 1UOPA 3L1JA 5EIAA 1R3DA 1AKNA 3KSRA 3T4UA 1NU8A 5DWDA 5I8PA 4EUSA 5EGNA 4X00A 3I6YA 3V1LA 1ZI8A 2OAGA 3STYA 2VAVA 1I6WA 3H0CA 3TJMA 4KE6A 7YASA 2QMQA 3FNBA 2I78A 1JU4A 4Y2VA 4FDMA 4LXIA 1W76A 1WM1A 3G0IA 3UUFA 4BP8A 5T4EA 1K63A 1PJAA 1IVYA 3IIIA 1AC5A 4AX4A 2XMCA 2Y6UA 5FOQA 1CUFA 1L7AA 3I1YA 3V1KA 1ZOIA 4CIAA 2HFJA 5AH0A 1M33A 1FJ2A 3FCXA 4H7JA 4OD0A 4X97A 4B83A 1JJIA 1QE3A 2Z5GA 1BRTA 4MYSA 4J03A 4LXHA 5CH5A 4Y2JA 2WUDA 3D5EA 2VAXA 4AMYA 2XUJA 2PX6A 4DMHA 4XX1A 5LLSA 2HFKA 4UHFA 1XZHA 4W63A 2BUCA 2XUKA 5FV4A 4UHEA 1AQLA 4GHWA 1X2BA 1E8DA 1EX9A 2O2GA 2HA6A 3FYUA 2WIJA 2ACEA 3EBLA 4UBKA 2WSLA 2QVBA 5FPPA 3CN9A 4AXBA 3I2JA 1XRNA 2HRQA 1U2EA 1MX9A 4Y2XA 4PV7A 1XLWA 1JKMA 2HM7A 2H7YA 4HXFB 1ZIXA 3R3UA 4H7KA 2XUHA 4L0CA 2DHDA 1WOMA 4B9EA 5JADA 1N5RA 4OB6A 5AKKA 2WM2A 3E1GA 3TRDA 1XQXA 5A71A 4F0JA 5JZ9A 3O4HA 1FSSA 3GBSA 3EQ9A 1X70A 3BJRA 2PSDA 4ZRDA 3DYIA 4X6YA 1DINA 1HLGA 4N8DA 2EEPA 2R11A 1DTEA 2I3DA 3DL4A 5A7HA 2DR0A 2C0QA 4OU4A 3WK6A 4BATA 4QDXA 2XQJA 2ZVDA 1IMJA 4G1FA 4Y2SA 3IUJA 2QTBA 1JT2A 2HIHA 1XZMA 5EFZA 5IVHA 3L1HA 1USWA 3G9ZA 2GYUA 1VKHA 4X92A 3KOOA 2BKLA 3RM3A 1K5PA 4G4JA 1H2XA 3IVMA 2DCMA 3ZLVA 1Q84A 1CQWA 3H18A 3N0TA 2HL6A 1KU6A 3LIIA 2XUPA 4BE9A 3WZLA 3DQZA 3W04A 2ZYHA 1MNQA 1BN7A 3M83A 2WTNA 1CUIA 4B6GA 4EY4A 2H7XA 3E4DA 2RIPA 4E46A 3QM1A 1R1DA 2BUBA 4GBGA 2JGJA 1YB7A 5HF9A 5IVKA 2XQGA 5T4BA 4GECA 1FFDA 2QOEA 3BF8A 1XZJA 1H23A 5AOCA 1CUVA 1Z68A 3QMVA 4J3JA 2GYWA 5A7FA 4UHDA 2XQIA 4HS9A 1XZAA 3UUEA 1EVEA 2Z3ZA 4UPDA 4EZIA 1E66A 4G4GA 1ODSA 3C8DA 4BZWA 3O4GA 4QDOA 3LP5A 1CUDA 3AFIA 4BZZA 2XMRA 4Y2QA 5C8ZA 2XQFA 2WU4A 5CH3A 3STUA 4PSUA 1YR2A 4JNCA 2OG1A 3BIXA 3V1MA 1GPKA 3H1AA 3WWDA 3GUUA 1AUOA 3M3DA 4K6KA 5KREA 2CZQA 6YASA 3DL7A 4UBIA 2GYVA 2DQZA 4G9EA 5ALYA 3ESDA 3OURA 3WK9A 4C88A 4J0CA 4Q82A 4AQDA 3WWOA 2XDWA 1WPRA 2V98A 4OB8A 3PUHA 5AKJA 4PNZA 3F98A 2QUAA 4XJVA 4DIUA 4DNOA 5BWBA 1CUWA 4ZXFA 3AZQA 1QIJA 3LS2A 1OILA 1H2YA 3OG9A 1HKHA 1AURA 2C4HA 4Q05A 2CMFA 5ALRA 5LZ2A 3C70A 1JU3A 2PM8A 1ZD3A 3W9UA 4M0EA 2B61A 3R3WA 5ALLA 3FYUB 2Q0XA 4Y2PA 2VQ6A 2Y2VA 1K8QA 3IBTA 2C0PA 3WJ1A 5JANA 4U2BA 2PUHA 5HK8A 3R0VA 1VZ3A 1SC9A 1GKLA 2X8BA 3R3ZA 3VJKA 4GDMA 2AXEA 3K6KA 1CUUA 3Q0TA 4XIIA 1C4XA 2VT6A 1RYYA 1GQSA 4BRZA 5LZ5A 5LZ9A 1EI9A 5HCUA 4EY5A 5CXXA 4DGQA 3QPAA 2JGKA 4HXGA 1GXSA 3HACA 3C45A 1IZ7A 3WL8A 5AK5A 5AK3A 4PSDA 5AHXA 3WJ2A 5AM0A 1QFSA 2PSHA 1HQDA 5HF5A 4X7BA 1HDEA 4LYEA 3BDVA 4N5HX 2XE4A 5IVIA 1QIFA 1F0PA 1J07A 5BWCA 5EIEA 1O6FA 4H77A 5ALHA 1UKAA 3ESBA 3CCCA 4BC0A 4PQEA 3HLKA 1WB4A 5CTAA 3BDIA 3HRHA 3IULA 2QJWA 1VXRA 1H2ZA 1RWQA 4UBNA 5ALOA 1QIGA 3OTQA 2JGEA 3Q8WA 1CUBA 1GT6A 5HZGA 2O7RA 2HA7A 3HZOA 3YASA 2ZYRA 1S8OA 1WB5A 1YS1X 1L7RA 1HBJA 4O08A 2XUQA 5K5EA 3ANTA 3WWPA 4TPKA 3F97A 4YX9A 4E14A 3WIBA 1XRQA 2JGLA 4AZ3A 5JALA 5AM1A 1J06A 2Y2UA 2CUTA 3ANSA 1GQRA 2X76A 5ALKA 3C6XA 1ZICA 2OAEA 5E4YA 4FLFA 4FKBA 2RHWA 1GZ7A 2QZPA 1Y7IA 3AIKA 3ZI7A 4ZV9A 2QUBA 4W1RA 1BS9A 3R40A 4CCYA 3O4IA 3VJMA 4WCVA 5K3DA 3WA6A 2JEYA 2QR5A 3QH4A 3I6ZA 4FHZA 5CH8A 4LYDA 5JD4A 5ALIA 4H7FA 2BCEA 1CUHA 1QO9A 2WUFA 3AZPA 3O0DA 2IIVA 4GEGA 3WI7A 4KRYA 3IDAA 3DCNA 4UUQA 4J0GA 2RGUA 1EA5A 1EHYA 5E4TA 5J3JA 2J3QA 3OPMA 5JAHA 4AB1A 2J4FA 1XRLA 4X3CA 2QXUA 1QLWA 4UHBA 3VJLA 1OCEA 2FJ0A 3HI4A 3ICWA 4DM7A 1TIBA 3LLCA 1UK7A 1T2NA 5ALZA 5KWJA 2WTMA 1UK8A 2PSEA 3C8HA 3DOIA 4BCDA 4DMKA 5CRIA 1TCAA 5DNWA 4OCZA 5F4ZA 1QTIA 4L3WA 4PW0A 4U2CA 3EQ7A 3GA7A 1DWPA 3IA2A 1AX9A 3QMWA 2H1IA 1YSCA 4B82A 1LPAB 3WYNA 1EDEA 5LYYA 3O9MA 2PU5A 3VVMA 1YASA 2WHPA 1XKLA 1ACJA 4UBMA 1QZ3A 3NUZA 5A62A 5ALSA 1P0MA 2HU5A 3P2MA 2WQZA 1P0PA 4G8CA 3F8SA 5K3FA 3QZUA 4K6HA 4L9AA 1U4NA 2OQVA 3OM8A 5D3ZA 2RAUA 2XMSA 3FBWA 3W06A 2XMZA 4KE8A 4J0DA 4BAGA 3C6BA 2V96A 3STWA 3MVEA 1LBSA 4AZ0A 2G5PA 4OYYA 3CCBA 3IURA 1LPSA 3KD2A 1UT6A 3WL7A 4WFJA 5EHQA 1JFRA 4C4XA 1AMNA 1EVQA 2J4CA 1ZIYA 4N8SA 1E5TA 1BU8A 1TK3A 1ZJ4A 1C7JA 5C7YA 2PL5A 4X94A 1VA5A 4S0XA 4G5XA 2O7VA 3RARA 3D2CA 3DEAA 3G0CA 3M82A 1BEZA 5EHXA 4P93A 2QXTA 1THTA 2WIGA 4D9JA 1C7IA 2QKYA 4X91A 4QEKA 1G4HA 2YASA 2YXPX 1CUCA 1BROA 3WKCA 1MAAA 4KACA 2PKYX 1W52X 2WFZA 3C5WP 3C6YA 5HFNA 1P0IA 5HKBA 1EB9A 2JIDA 4Y7DA 3WKDA 1CUSA 1QOZA 1HL7A 4EHBA 1SCKA 2EDAA 1XZEA 5D7BA 4F21A 5ALFA 4EA6A 3I2GA 1WB6A 3ICVA 2WILA 4HXEB 3A2NA 4Y9SA 2GZSA 3BL8A 3SWWA 1EDBA 5SYNA 2QS9A 1KU0A 1XROA 1JMYA 5DLPA 3QYJA 3IB3A 2D5LA 5FKJA 3WWCA 3RKSA 1Q83A 1Q0ZA 4WY5A 5CXUA 3O95A 1DT3A 1YA4A 3W2TA 1B41A 4CCYB 2B4KA 2VEOA 5ALTA 4BTVA 4PF1A 1BE0A 5HF8A 2XUIA 2NW6A 2XT0A 4QLAA 2WU3A 3AUKA 3H2JA 3ZPXA 4XVCA 3PFCA 4ITVA 4ZWNA 5AIBA 4FNMA 4UFOA 1ZI9A 5LIPA 3I2FA 4Z49A 5A7GA 2FJPA 5EHNA 3AILA 4RE6A 4MQLA 5AO9A 2AJ8A 5C8XA 2ZYSA 3A6ZA 2PVSA 4WY8A 3H19A 5A2GA 4BBZA 4BCCA 3ED1A 3FSGD 1A7UA 4GXNA 5AOBA 1TKRA 5ALQA 4E15A 1Y37A 4NZZA 1EK2A 4I4CA 4BB0A 2ONCA 4EY6A 2PBLA 2RI6A 2CKMA 5HK9A 5H3HA 4X71A 3WLAA 3KXPA 4CG1A 4DNFA 5I7UA 2HU8A 2ZSIA 3ZLUA 1N8SA 3D7RA 3O4JA 3DNMA 1F8UA 3G7NA 4KE7A 1FFAA 2ACKA 2RHTA 1EINA 4MWSA 2WHPB 5T4FA 3C87A 3WQHA 1CVLA 3D4LA 1VOTA 3KDAA 1UFOA 3L1IA 1XZCA 1ZGBA 4RNCA 3BJMA 3H1BA 5C8VA 1ODCA 2WJ3A 4CG3A 5ALMA 3AZOA 3H04A 3W05A 2XUDA 1XRRA 1QTRA 5K3FB 4K6GA 4QDTA 2JF0A 4BVKA 4B9AA 3I28A 2X5XA 1BN6A 5ALPA 4YPVA 1CPYA 4YK7A 4ZREA 1VXOA 1HPLA 3B3QA 5AK6A 4UFNA 3O9VA 1K4YA 1F6WA 2OGSA 4GI1A 3F9CA 2QRUA 4C4YA 2P8SA 4ZGBA 3HABA 1EB8A 1THGA 4H7IA 4OUKX 4KAFA 2JGFA 1KEZA 4QZVA 5FRDA 3DD5A 4F60A 3G9TA 1ZJ5A 1VA4A 3STXA 2HA4A 5FDFA 5CW2A 3D2BA 4H18A 1EH5A 2I03A 4Y2RA 5FXMA 4IHAA 4IH4A 1NX9A 4I19A 4Y2YA 2YH2A 1LZLA 3C5VA 4K2AA 1E89A 3C6ZA 5JZSA 1JJFA 1W75A 2DHEA 4XWGA 1XZKA 3FSGA 1SCQA 1QJ4A 4Q3OA 5JIBA 3VISA 3H17A 3DS8A 4W9RA 3DDUA 4Q3KA 1YB6A 5AKLA 1QO7A 1XLVA 1MN6A 3BF7A 1LZKA 3CN7A 3WMRA 5AI9A 4BYMA 3K9BA 4QWMA 2WJ4A 4WDQA 5CURA 2JBWA 3G8YA 4C01A 4BDTA 5FPQA 2ORYA 1A8UA 3GFFA 5AI0A 2WFLA 2ECFA 3X3HA 4KR0A 4ARBA 2V97A 2Z8ZA 2OLEA 4H7HA 4UBJA 2GBCA 4GLBA 4Y2TA 5CBKA 1LPBB 2PSJA 2GBGA 3HSSA 5E4JA 1AGYA 2J3DA 2Y1KA 5LZ7A 5YASA 4FFWA 2VSQA 4OB7A 2QT9A 5IKXA 1CUZA 3E3AA 3FLAA 4OSEA 4Q34A 4DTCA 5DJ5A 1GKKA 3B5EA 2VA9A 4A23A 4KEAA 4OU5A 1CUGA 5BV7A 4K5QA 2QJRA 3FVRA 4J0JA 4DYHA 2OQIA 5AKXA 3WL6A 1J2EA 4NS4A 5AM2A 1RP1A 2O2IA 5AM3A 2BGRA 2R8BA 5JD6A 4TGLA 3BIWA 4DNPA 4W1PA 1XLUA 3R41A 4CG2A 3EIOA 4J7AA 2BJHA 4QLOA 2OXEA 2VJCA 2XQKA 5CT9A 4QE3A 1TQHA 4KJXA 4X90A 3D59A 1H2WA 5AM5A 1IUOA 4RE5A 2OCGA 4AN1A 3RK4A 3E0XA 1LPMA 5JATA 2XLBA 4C4ZA 4EY7A 4JYPA 3V1NA 3WA7A 1MJ5A 4ARAA 1UWCA 5K3BA 4N5IX 4DMCA 3VXKA 1CQZA 3H2GA 4DSZA 1F0NA 4Q3LA 1R50A 3G0BA 4MJ3A 1MO2A 2AJBA 1ACLA 1DU4A 1UKBA 5FUMA 3A2MA 2WG1A 3LCRA 2YYSA 3STTA 2WLSA 3GROA 4LXGA 4B80A 1O6GA 5AJHA 1FFCA 4X93A 5HFAA 1XZBA 1UOQA 1XZGA 3PF9A 2OCLA 3ZLTA 1YAJA 1EK1A 4KE9A 4WFIA 1CR6A 5ALVA 4ROTA 1MX5A 2ROQA 1WPXA 2WIDA 3WK4A 4ETWA 1CUJA 1ZI6A 3G9XA 4UHHA 3AIMA 1XZDA 1BEEA 2V9ZA 3HEAA 3WZMA 3FLEA 1H22A 4QNNA 2EDCA 1VJ5A 2ZSHA 4J0IA 4C89A 2W6CX 1CIJA 4MEAA 2DQYA 4RGYA 1XZIA 3DKKA 4HTAA 5AKZA 2BFNA 1XRMA 5LZ8A 1K6EA 3FOBA 4E11A 2DFPA 1MX1A 5ALEA 4BE4A 3D2AA 4KRXA 1G66A 2FX5A 2E3JA 3FAKA 4C6HA 4KAAA 4X95A 3W9BA 1XFDA 3UMJA 2GZRA 1UOOA 2ZJ6A 4U2GA 2O2HA 2CB9A 1TCCA 2C5FA 4BVLA 1MTZA 1SOMA 5CT8A 1CUXA 5AOAA 5A6VA 3BXPA 4I3FA 4J0KA 2PSFA 2I3ZA 2XMGA 2JGIA 3GZJA 1IUNA 1U65A 4H35A 4QDZA 1R88A 3RLIA 3I2IA 4N8EA 1YA8A 2WIKA 1A88A 5DYTA 5AI5A 2VJBA 2OGTA 2CJPA 1IUPA 4G8BA 5EI5A 3T52A 4IQ4A 1YS2X 2G4LA 4HRYA 2JEZA 3OC0A 4OPMA 4X6XA 1XQYA 2WFLB 4G9GA 3JWEA 5AKHA 1CUAA 2CEKA 2XUFA 1GPNA 3NWOA 4B85A 1QIHA 4DNQA 4HRXA 5I9IA 4C87A 2B20A 3SC2A 5ALXA 4MWTA 1OXMA 2VTVA 1DX6A 4BVJA 5LKAA 2XMBA 1QIMA 1DWOA 4H7EA 1E3QA 3WKBA 5FLKA 2G5TA 5C81A 4LKOA 1Q0RA 1P0QA 5K3EA 1DWQA 2PU7A 4AMZA 3LIPA 1LGYA 2WFMA 5AI4A 3SK0A 5D3KA 4EB0A 5ALNA 4QDUA 1ISPA 4MQMA 1TAHA 4RPCA 1UZAA 5AKIA 5SYMA 1G42A 4P92A 3AINA 1AZWA 4BRSA 1LLFA 3QMMA 3WL5A 1N1MA 3ZV7A 3MUOA 1JI3A 4CCWA 3AJAA 5AI6A 3G9UA 2WG0A 4FFVA 1BCSA 5LKRA 3FWHA 3G0GA 3JYHA 4AO6A 4WJLA 1DQYA 4FMPA 1NU6A 1BCRA 3U0VA 4X85A 2WG2A 5CT4A 2VJAA 1SFRA 4BTLA 4M0FA 1LBTA 4IH1A 2PPLA 3HC7A 1ORVA 4IO0A 5ALDA 4EY8A 1UKCA 4W1SA 3DYVA 4FTWA 4JYMA 3PI6A 4FLMA 2CBGA 5JYCA 4GWLA 1YAHA 2QM0A 4AN0A 4J0HA 1DT5A 2BUAA 4LIPD 2XMDA 1W1IA 2ZYIA 5IH7A 2GBIA 3ZWQA 3IUNA 3DJYA 4BP9A 3TEJA 2WIFA 1Y7HA 3G02A 5EHZA 4P08A 4GW3A 4Y2UA 4B84A 3BWXA 1B6GA 2HU7A 2XUAA 1R4ZA 2OPHA 4OYLA 3H2KA 2VJDA 4UBOA 1N5MA 2DSNA 1XRPA 3D3NA 1ZD4A 2HA3A 5JZBA 4UHCA 5T4HA 1ZGCA 5JD5A 2ES4A 3ILSA 3I2KA 4TVKA 4AO7A 3WK7A 4H0CA 5E2IA 1MU0A 1YCDA 4HZGA 3HXKA 3B12A 1DQZA 4EBBA 4A5SA 1PFQA 2HRRA 5LZ4A 4B0PA 3MUNA 4HVTA 4IH9A 3CXUA 1CLEA 1E8NA 1W4LA 4CI9A 1XQWA 5AIAA 2C7BA 4X6UA 2H9YA 2K2QB 2XUOA 5ISMA 1FFBA 1FFEA 1G5FA 3GELA 1T4MA 3DLTA 3OOSA 4JEIA 2WUGA 3ESCA 5CT5A 1WCYA 4U2DA 1LPOA 4ZV7A 5IVDA 1WHSA 2WHQA 4WDRA 1ODTC 1CRLA 3A70A 3I6MA 1WHTA 3DKRA 1ZD2P 2GBFA 3DOHA 4QA9A 1CFJA 3C43A 4UFPA 2C5GA 5AKYA 5HKAA 2Z8XA 2IX9A 3EQ8A 4QWWA 4A16A 4KAJA 1X2EA 1E8MA 2AJLI 3PFBA 4V2IA 4DSAA 3WWEA 4FLEA 3VDXA 5HQ3A 2XI4A 3HJUA 5ALGA 1J1IA 5K3AA 1CUEA 5KBYA 5JASA 2AJCA 4W1QA 2XUGA 2WJ6A 3H2IA 5JAOA 1MAHA 4BAUA 4F5ZA 1JMKC 1EDDA 4INZA 2HHAA 1R9NA 2IITA 4Q1VA 2VT7A 1MNAA 4FBMA 1QFMA 3F96A 4NVRA 5FP0A 1XKTA 3PICA 5JARA 4L72A 1UK9A 1VLQA 1UXOA 1A8QA 3WYDA 1CV2A 4JH0A 5CT6A 2HA5A 3KWJA 1UK6A 1LNSA 4NMWA 3JW8A 5DYYA 3NGMA 4PO3X 2FUKA 5AKGA 5JAPA 2C58A 1CEXA 2ZJFA 2OGZA 3HYSA 3PE6A 2WUEA 4G8DA 3PDCA 1EXWA 1TRHA 1XZLA 2WHRA 1QGED 1MT3A 3FYTA 3QVMA 3WKAA 4FWBA 1QIIA 3A2LA 3U1TA 3SX4A 3WK8A 5DTIA 5ESRA 2BGNA 4PSCA 1LPPA 3FLBA 3S2ZA 3QPDA 5K3CA 3V48A 4CIBA 2JGMA 2HDWA 4DLNA 4BC1A 1MPXA 2RONA 1XZFA 1QONA 2Y6VA 4FOLA 5AK4A 5KWIA 5DYWA 5DNVA 3MGAA 2UZ0A 3TGLA 3AIOA 3WKEA 3FYUC 1LPNA 1VE6A 2W22A 3G0DA 1U8EA 1TCBA 3R3XA 3FCYA 1W6RA 5EIHA 4U2EA 1DX4A 4FNGA 5AI8A 3BE8A 2G63A 5CMLA 2BAGA 5AP9A 1R9MA 4WFKA 3H2HA 3I2HA 4ZI5A 5AM4A
chains in the Genus database with same CATH superfamily
3GFOA 4O4IA 3T15A 2AFHE 5LQUA 1OJ7A 2QN3A 3B13B 4H59A 2VRBA 5IJXA 3VKFA 1C7QA 3B6KA 3LI2A 4KMSA 5ALJA 5F1YA 1U0BB 5ILOA 3OMWA 2OCXA 4EJ0A 4RANA 3CH5A 3TZEA 3OHSX 4EJMA 4ZQEA 3RK1A 1LTQA 1YE8A 4G0YA 1L7QA 2XCQA 4IDDA 3ZHSA 2OXFA 4JKOA 3V7YA 3T7TA 5KYKA 4JI5B 2YRFA 1CJUC 4DNXA 3EF3A 1XQ6A 4DCJA 3UENA 2YYZA 2GM3A 2FG5A 4MVWA 4CFSA 1J1UA 1EPUA 3H11A 4MYRA 4RC9A 5DV9A 5FBQB 1JNXX 2AQHA 1MB3A 3BMNA 4N12A 2ZBRA 4XX0B 3W5JA 4P34A 1LUAA 2FOIA 3L7MA 4MEBA 3ZY4A 1WKCA 2QL5A 1T2FA 2IHTA 1N3IA 3A37A 8OHMA 2HMTA 1DXHA 3MJFA 4MKXA 2H0AA 3F67A 2VPPA 4YMSA 1Z6YA 1YBAA 2GA9A 3LUFA 3TW6A 4IJWA 3UC5A 4JLDA 5BQOA 1H8HA 5HHTA 1RYDA 1RVV1 5H83A 2FUNB 3WISA 1XC7A 5J1SB 4OF4A 2RHLA 4DIEA 5GWXA 5A4IS 3C3CA 2DHCA 4RELA 4U8HA 1M2GA 1TQDA 3WC4A 5D5QA 3ME5A 4MJ7A 3V7FA 3CW9A 4WSOA 5KEIA 5ILGA 2RK4A 2HI0A 3IR7A 1Z16A 2Q6VA 4KAXA 4MJXA 4QVGA 4U7TB 3D54D 1N33B 1P1BA 2P3QA 2PRKA 4K86A 4U7FA 4DJDC 2QK4A 1ZUNB 4DCPA 1SVLA 3NOVA 3I5AA 4L76A 3UTCA 1NW8A 3P71T 4K9DA 5EP3A 1E2JA 1M6VB 1I6KA 1J33A 4UMFA 2ZAGA 1A8SA 1E32A 2LBPA 1MUUA 1QAOA 3ZXYA 5D3QA 2XLCA 4EB6A 2AKYA 2I29A 1N8TA 3IUMA 3LFUA 5F1PA 5LP1A 4HDRA 3ANNA 3M6MD 1FTSA 4ZVRA 2P0AA 1ZVVA 2QZ4A 3TUIC 5BOVA 5K8UA 4JLBA 4F6LA 4NFYA 3JTEA 1A71A 1M7BA 4LHEA 2X77A 1NAHA 3C39A 5AW5A 3HCOA 5HQ3B 1E79D 4DEVA 4WKNA 5JCJA 3TQSA 1CE8A 4W4TA 1N92A 4KPEC 5EXXA 3SS7X 1J0EA 1I7DA 3LUDA 4O2AA 4UEQA 2WMDA 4B3TB 1JJBA 1ZAYA 2HGZA 1L5FA 2PSSA 2CXXA 3B1VA 3FNGA 4Q4LA 3N2GA 4PC6A 2FSSA 5J9FA 4E21A 3L0DA 3CKYA 3UJ3X 1WZEA 1RRGA 3KQPA 2WWWA 3L7IA 4ZU3A 1F1BA 1ZA2A 3ASVA 3ASYA 1WV0A 2Q4TA 1D07A 4I9UA 1QP4A 4L51A 1Z0KA 2NQ8A 4JXJA 4N3AA 2R7NA 4R9RA 3AYZB 2IZ5A 1E96A 4JIGA 3DBOB 5GY7A 3SMVA 1PL0A 4E2YA 3I92A 3LL7A 1C3XA 4YRBA 1AZTA 4MLDA 1XTBA 5E9AA 4G63A 5COQA 4YFVA 2D0DA 1W0KD 3Q3IA 3SOZA 3H7AA 1Z0ZA 2I4TA 2WKRA 3D0RA 2JAOA 4QOHA 3FPAA 5TQ2B 4ZC1A 1UPCA 5CCEA 2ECPA 4U63A 2VHTA 4PLGA 1GGVA 1JBKA 1BE6A 2V6JA 5BYBA 4QXQA 2OBXA 5KVVA 4DV6B 3ESAA 4FMDF 2IUTA 3S1LA 2BFOA 2CUKA 4C5BA 3HSKA 4FEEA 3ELWA 3VPBA 3O8NA 1IU9A 5EIAA 1WD7A 4H17A 3FNIA 3SFTA 621PA 3M6WA 5EUMA 1A5TA 3TPCA 2ZM5A 3T4UA 5IYZA 1KH3A 1IMOA 1Z4IA 2HCBA 3PHBE 2HWYA 2PGAA 4MGYR 3RGGA 2FEOA 4B4KA 4Z4CA 5I8PA 1L5LA 5EGNA 5LQSA 4JWTA 4RPGA 2G9NA 3T9EA 1T3HA 3O8LA 3F3YA 2Q6OA 1ZI8A 5JS1A 4ENRA 4YIKA 4BEWA 2DY0A 4LFBB 2IYVA 3FY4A 1G3QA 4PWZA 1SC6A 4UXHA 1E0JA 3L4JA 2VHUA 4GD3Q 2VAVA 5CA0B 2G82A 2QE7A 1OXSC 1RPAA 3EXAA 3CISA 3F78A 3H0CA 4TSKA 3RC7A 4JL6A 3UATA 1PFUA 3UGQA 5IXSA 3UAXA 1MQ8B 2XBLA 3UZUA 3DE6X 5M04A 4CKEB 1ZW6A 1RLJA 1T8WA 1L7NA 4H6XA 2JVKA 3VOTA 2AC7A 1NF8A 3I30X 2FQXA 4DA6A 1GU7A 4Y0AA 1ITZA 1JU4A 2I78A 4Y2VA 1SBYA 3SBXA 1PRYA 2B7BA 2FSVA 1XHFA 3CY6A 3MWGA 5JNLA 4FDMA 3N2YA 3RRYA 3TL2A 1W76A 2QDKA 2Q3MA 3G0IA 1PJRA 1EUQA 2Y1GA 3BGWA 3GDGA 3DP9A 2ID8A 3G2JA 3CB2A 1SKBA 3SM3A 5KS2A 4I5FA 4RHTA 1N2CE 5DHRA 2MYPA 3IDQA 3DHYA 4ZQHA 3DQQA 3H83A 2BV3A 4L95C 5PGMA 2W70A 5KQRA 2WD7A 5TQJA 3VTFA 3OA2A 3WGLA 2IXDA 4R2KA 4ALMA 4AX4A 1LDNA 1VJ1A 2IKQA 2ZXEA 3K9HA 3N8DA 3QBVA 1L8LA 1T9HA 3CIFA 3OSUA 3O3OB 1I0IA 3IHTA 2QSJA 4QVIA 1ECCA 3K92A 5HS4A 3EPKA 3EG9B 2ZYGA 1VIVA 2Y6UA 4KHZA 5DT9A 4RVHA 1R27A 1L7AA 3H5AA 4PLYA 3KX2A 3OD5A 5BQXA 5EL0A 5E1DA 3VDNB 1ZMXA 3N5CA 2NV0A 2HK7A 1YOVA 3PE4A 5CBPB 1U8CB 4ZAXA 2PH3A 1ZRHA 5JISA 1M33A 4DUYB 4KR2A 2R66A 3AK4A 3WMFA 1T15A 3THWB 5BNZA 4F72A 1SPXA 1C0LA 4H7JA 4ETNA 4X97A 3RVJA 3U4IA 4DR6B 1F2DA 4P2BA 4DT1A 3LT5A 2YWXA 2JIPA 3AH8A 1JIIA 3HNOA 2IHVA 4O4HA 5B12A 5MFZA 1GV0A 2D1FA 2E1PA 4E4YA 4QQNA 3V2GA 3K20A 3D5EA 2ETVA 5ER9A 3K94A 2CE7A 4LVNA 4ZOAA 1EFTA 1BFKA 3QWIA 1JQJC 1NBMA 5IC6A 5KKNB 2DXIA 3KVOA 4ITRC 4I3GA 1YRHA 3LYUA 4G37A 5LLSA 4CM8B 4EZBA 3C3XA 3QKWA 1XNRB 4EPVA 1Z34A 3C15C 3SQMA 1OB2A 5T41A 2XOKA 1XZHA 1GA4A 1U04A 2FN7A 3C7CB 3R0JA 4NZMA 2P77A 5FV4A 4UHEA 4LWPA 4LCBA 5D85A 1AQLA 3VR6D 5JVDF 2XD4A 4MQ4A 3UPUA 4ZVOA 1O6ZA 1XF1A 4HWSA 1O9HA 1DDIA 1CXZA 2O2GA 4GE0A 2FX2A 5HGJA 1RJGA 3TE7A 4EH1A 3H87A 1P2VA 1RPJA 4FNOA 1SCUA 3EXIA 3DNPA 3KT0A 5D84A 4CUZA 3O2JA 4HPWA 2WSLA 1RACA 2JLRA 2Y0PA 3I01A 3MELA 4ANFA 3W5DA 3ODPA 2VBIA 4L8LA 4M9QA 1L1EA 3DOJA 4FCCA 4NENB 1DEAA 1E2GA 1G8KA 4D98A 4UD6A 2QL9A 1WY5A 2APJA 3MM4A 4M8IA 5SY4A 3ZCRA 2YMMA 2GK7A 1DUSA 1QPBA 1CCWA 3I2JA 3K0FA 3A1NA 1A9QA 4I55B 1ENZA 4BN5A 3ZK9A 4GPTA 1DFGA 1FA9A 2HM7A 4EGAA 4DB4A 3RT1A 4F3YA 5J47A 2PX3A 2I2BA 3EXFB 5FTWA 1DKPA 1U80A 1WOYA 4L9WA 3R3UA 5H5JA 3ZE0B 4H7KA 4WZBB 1GJRA 2LCIA 3PA6A 1KYVA 2H48A 1BXGA 2YXBA 3KLMX 4MLPA 3MWDB 2A92A 3AVVA 4JJZA 1ZLXA 3GYGA 1NBOA 1NW7A 4L0CA 3W79A 2DQKA 4BX0A 1UZUA 1DOZA 1X9GA 2AOUA 5ILQA 2AI2A 4JC0A 4OFXA 4AY3A 2GN0A 1XXHA 2IODA 2PTHA 2UZAA 1SIOA 3QUBA 2Q1UA 4I4IA 1P7PA 4QTTB 4U5QA 2UVPB 3FMIA 1WWKA 1L5QA 3MS2A 2WM2A 1P9OA 2ZAOA 3IGFA 3GUCA 4ND4A 1WMAA 2G67A 4PBRA 2A9JA 1XQXA 1TAUA 1NZDA 1XDUA 2ZTVA 2NUTA 3TBHA 4YAKA 1PJQA 2DH6A 4A5OA 4ADSG 1FSSA 2CSXA 2ZVQX 3B60A 3JALB 2BFFA 4J7XA 2FRXA 1OZHA 1TDJA 1W1WA 1MD9A 3LY8A 1OZAA 4IDQA 4CUJA 3A9SA 1X1DA 4B74A 4DG8A 1NLFA 3GJ0A 3GRRA 2EEPA 2J3MA 1Z5GA 4P98A 2P5TB 5U4QA 3TNDA 5BVGB 1UFQA 2YXEA 3CNEA 3VAZA 5B64A 4AS2A 8LDHA 5JMWA 1YZYA 1ZUWA 4O1IA 3UOAB 3ZJ5A 2A86A 1JDBC 4KIGA 1LC3A 2DR0A 3U3KA 1X92A 3SFVA 5HZMA 3WK6A 1MOSA 2XQJA 4KPYA 3GLHE 5I9NA 2ZVDA 3FGPA 4TTJA 3QUQA 4GP6A 4TZ0A 2VWQA 1WKBA 1DDGA 1COWD 1I3OA 4E5UA 2JI8A 5KNBA 3IUJA 3FJ1A 2QTBA 2RG1A 1SD1A 5LQAA 3NATA 3NUQA 4KKXB 1DKRA 5EMJA 3W4KA 3W6NA 5IWAB 2F8SA 3PGXA 4CLRB 2ZT7A 4X5OA 1XJCA 4IZOA 3DWEX 1QHHA 4LQ4A 4BNVA 3K2EA 2FGJA 3JQCA 3AESB 1USWA 3HYLA 1SMKA 2QL6A 3RIGA 4MCHA 3RYIB 3LBYA 5C32A 3KOOA 4N9QA 4P83A 4Y1RB 3DVSX 4I4TF 5DB4A 3RM3A 3Q12A 2VPXA 5EJ8A 2AQKA 2VUUA 5LDHA 3KZKA 2DCMA 2LTAA 3ERCA 3JSXA 4LQDA 4JX9A 1RJ9A 1U8ZA 4FGLA 4M0LA 3R9XA 3BK1A 3H99A 4FDLA 3NEPX 1UT5A 3ZLVA 3B2EA 3TIGA 3RKRA 3HK2A 1YQQA 3SJZA 4UMEA 4IL5A 4RF3A 1JA1A 4NFSA 1P77A 4KOEC 3NAZA 2YUTA 3H18A 2H52A 4QFMA 3E5MA 3PIDA 3PDJA 13PKA 5CDSA 3QX9A 5JSHA 1KARA 1G9SA 2QTNA 3B3GA 4UVIA 4XD7A 3TQHA 3WYBA 3DQZA 2ZYHA 1CY7A 1MNQA 1RXCA 1CUIA 5JQGF 4B6GA 4LHXA 2VWGA 4EY4A 2FPRA 3E4DA 2RIPA 2YJNA 5JXWA 1T5OA 1EQUA 2V4ZA 4XB1A 4GM1A 4HBGA 3MPOA 4I14A 4TYWA 4PG4A 4C6SA 1CULC 2G1KA 3HKEA 4XH9B 4NJMB 4O3FA 2PX5A 5LP6C 4BB9A 5B55A 1PJTA 1A4XA 4EA7A 3P97A 3D5TA 1U0RA 1Q21A 1MEOA 1ZPDA 2RK6A 2QF7A 1Y42X 2XQGA 4GECA 5HQJA 4UNQA 1Z9BA 4H0NA 2IHBA 4ARCA 3IEUA 1A8HA 1CUVA 1Y3IA 2HXGA 3TAUA 2FEXA 4F9FA 1MMFB 4J3JA 3DGFC 5H3CA 4MROA 4UHDA 5A7FA 2WA1A 3LL4A 1HQKA 1V47A 1XZAA 3ZE8A 1NDUA 1VE1A 2AZDA 3PC6A 4FZVA 5H9VA 2Z3ZA 2J08A 1YS7A 2XNJA 3AFGA 1VG9B 1B1AA 1TGYA 4QASA 5DVZA 4L74A 1U2QA 2PLNA 3KVRA 3MCTA 2FI1A 1FE8A 1ULUA 1QV6A 1S89A 2JGAA 4XI9A 2IEBA 4Z0TA 5ADWA 4BZWA 1Q0QA 4QDOA 2I1QA 1ES9A 4PM4A 4OX9B 2B6HA 3UK2A 3MIZA 4GI7A 4F1KA 1CY6A 5ELXA 1OWPA 3ES9A 4BZZA 5JC8A 5KUTA 2VPWA 2W11A 3M3HA 2JNWA 5A3JA 3DD1A 1TVEA 1R8YA 4X1KB 4XB2A 1G7SA 2P3OA 4KMMA 4G1VA 4WFQA 3N58A 3VR5H 4PRKA 1MDBA 3LX8A 1TNDA 2J4DA 1VHTA 3IPAA 3PJDA 4ZMRA 1EXNA 4S12A 4OXYA 1NP6A 4WCFB 1EFPB 1GPKA 2I22A 1LRJA 4GMHA 3V1MA 4EA9A 2BP7A 4LC9A 5K4HA 3IAFA 2R6HA 3A8TA 3WWDA 1HQCA 3DMTC 4JBWA 4BVFA 4BX3A 3THYA 4WWHA 1MO4A 4L4SA 2ZS9A 4X3OA 4LMPA 2ODPA 2RHHA 4A82A 2CZQA 3W5UA 2FWIA 3P4XA 2AR9A 1G8AA 1OVMA 2AB0A 2JCYA 4JODA 4YP9A 4P82A 3V00A 3U7QB 1SIUA 4G9EA 1Y81A 2X5KO 4IDHA 4UE3S 5ALYA 2GDJA 1PNVA 3ESDA 5EJ7A 4LS3A 5HOQA 1TU4A 4C88A 1Z63A 3HWSA 1YCHA 2YZNA 3MBOA 3MTEA 3NVKI 4BPBA 2WSSD 1IOVA 4OHPA 2V7WA 3T54A 1KH2A 5BMVF 2PMFA 3TQOA 1KI8A 4Z4FA 2EF1A 4V03A 1V41E 5JROA 2OD7A 1WPRA 2EFGA 4HH0A 3I9FA 1H9BA 4E4RA 1GU0A 2P9EA 3L01A 4R8LA 3RLFA 2WQ7A 2BH9A 2JHFA 1U8YA 3KKEA 3OBIA 1Q3TA 2YMPA 3RUHA 4O4IF 2H16A 3QUAA 5CVTA 1PHPA 2W0SA 1VMDA 4QSMA 4ZXFA 3E22B 3AZQA 2VCHA 3EK2A 1L5VA 3E8SA 3PEVA 1QIJA 4S1OA 4W5JA 4ZVLA 2MMCA 4WA7A 3W5BA 4GPZA 1LW6E 4G5FA 3IVXA 5SICE 4TMKA 5KOHA 4AJ2A 1UR5A 2DM6A 4EATA 2QV7A 4EYQA 1DQNA 4ZPXA 1YDFA 2GT1A 2C4HA 1HNZB 2W2LA 4NH4A 5IX8A 2J85A 5BNTA 2IYEA 1N8NA 3C70A 4Y9TA 2DTXA 3INNA 1HFEL 3F3SA 4WASA 5EGSA 1G64A 3Q3CA 2K87A 3BAFA 1JHZA 1P80A 2QJFA 1KQNA 3UFBA 1EWKA 2V9CA 1FSGA 3LDFA 3KAKA 1H93A 3FYUB 1SQFA 3ZE1B 2PYIA 1A82A 5DH9A 1E1RA 1H9CA 3KLPX 3WBBA 2C77A 2I2AA 4Y2PA 4DY6A 2VQ6A 1S0UA 5AW3A 4GG1A 4BX2A 1MV8A 1GY8A 4REQA 3U4QB 2WZQA 5KTTA 5AR1A 2C0PA 1CFZA 5JI3E 3AHHA 1QHNA 2J3IA 2FSUA 3UT6A 3WNDA 4HVAA 3S81A 4U2BA 5HJ5A 4DJTA 3I0NA 4TTQA 5FWDA 2COKA 1O9BA 3A6FA 4GLJA 4NPAA 4EG7A 3VKGA 4B4DA 1QCYA 2HWUA 3U4HA 4W99A 4XPIA 4FMDB 1V1RB 2X8BA 2Z6UA 3ZKWA 3GJTA 4JI2B 4KDRA 1RLIA 4YDQA 4G0UA 4RKWA 1EWTA 2FR1A 3KYCB 5AMXA 1I2BA 4BZQA 5EIBD 3FHOA 1F8YA 2AXEA 4XA8A 3W8DA 1GTRA 1HEUA 4EW3A 4HDMB 1KK0A 3ZE7A 3ZHVA 5I9MA 1OAAA 3Q0TA 4Z9FA 1F2VA 3GLTA 2GCPA 1M6WA 3GJ6A 4Y7CA 1JN0A 1QF7A 2ODWA 1YU9A 2X5OA 1E2KA 4NOJA 4XIIA 5D86A 1C4XA 5BN4A 4KGZA 3QX8A 5HRCA 1RYYA 3JARA 3JY6A 4GLFA 4BRZA 5LZ9A 4GF5A 1PNOA 4LF9B 1WULS 5CXXA 2AEEA 2ZRPA 3LQQA 1SCNE 3G88A 3O3NB 3PR3A 1B0ZA 1E2EA 4X7MA 3ZWAA 4BOYA 1Z2PX 4L75A 4JI0B 1GXSA 3B38A 2NT4A 3DF9A 3ESRA 4HX9A 3C45A 5G40A 5AK5A 5CLQA 1GDHA 2R3SA 4PSDA 5AHXA 3WJ2A 5EQJB 3RT7A 3V42A 3BCHA 1W4AA 1V8BA 1HQDA 2G8LA 3G7UA 3OJOA 5KSOA 2Q21A 5EIOA 4IIFA 1W2HA 3QXGA 1L5ZA 4LYEA 1UEXC 5E6RB 3JD2A 3L06A 4QBFA 3TCKA 1DKQA 1P60A 1SKYE 4CF7A 4N5HX 3TR0A 2XE4A 3H5TA 2KBEA 1TO2E 4YJGA 3AHJA 3V5NA 1F0PA 1JIQA 3JQGB 3Q5EA 1RSZA 4MKZA 5BWCA 3HXQA 3U4MA 4ABTA 4H77A 4BQQA 3OPYI 4HLNA 4KGVA 2VNAA 5L3QB 3KUDA 4NQRA 4QARA 1QOPB 1EFVA 5B6PA 1PVOA 1ZU5A 1NLMA 1OTXA 1UKAA 2GN2A 3ESBA 1TKAA 3CCCA 2XDYA 1TW3A 1EGHA 2PAFA 3KT8A 1FX0A 2QGNA 3QA9A 3FCAA 1Q3KA 3FDZB 4GBJA 4HEHA 3SX2A 3RNOA 5HKKA 1CY4A 5FLEX 1EP1B 3CXRA 1ZD8A 3BDIA 3LC2O 3SQNA 1JLLB 2XH8A 5L4SA 1K08A 3ZVNA 5PNTA 3ICQB 4K05A 1YONA 3OAAA 5CFMA 4INJA 4UXJA 1VPTA 2BHRA 3NBKA 3A4YA 3VSAA 5E2BA 4TYMA 1M34A 4AWXA 4XEHA 1RM0A 2RGYA 4BLOA 4C0AC 1XALA 4HF7A 4WA8A 3W5IA 3HM9A 3KJXA 2JGEA 5FADA 3CPSA 5IYZF 4IP0A 3RVLA 2PKCA 3JQAA 1CUBA 3D3QA 3WLIA 5HZGA 3DEIA 1NULA 5C5IA 1KH1A 2ZRAA 5A9SA 1KDOA 4M8LA 3OU7A 1OXUA 1D6JA 2J7PD 2XA2A 2AC2A 1OFUA 2Y77A 3DFMA 3W3AA 4O08A 3NBYC 4AX8A 5I4BA 3HL0A 4AS3A 2FQWA 1WMBA 3LY9A 1ZVJA 5LD2B 3FNFA 4LYHA 4QATA 2QM7A 2W98A 7MDHA 1ONBA 3FZGA 1QH8B 4K6OA 3WRYC 2YUIA 4NDZA 2ONJA 4EUEA 4B7UA 1Y5RA 1Y8RB 5EMMA 1U3VA 4FFMA 3RTEA 1XRQA 1TUEA 4S1TA 3RYTC 3WIBA 2ZSAA 5JALA 4MWDA 1FFYA 4CMKA 2X6TA 1RXYA 3ZWOA 2Y2UA 4P7KA 2RGAA 3HCEA 4FSDA 2FMTA 2CUTA 1D6SA 5JVDB 3WS7A 4C22A 3BHJA 3PQDA 3SVZA 1SZCA 1PI3A 1DTWB 2FN3A 2J48A 2W6JD 5CK5A 2OESA 1ESNA 3HO1A 1NBWB 2VC2B 1Y3HA 5DBGA 4IUBS 4PE5B 2FWPA 4CYMA 3PD0A 3I8XA 4YDRA 3IBFA 3DZKA 5FCDA 4GSLA 3AIKA 4JROA 1QYRA 1YHNA 5EZQA 2AN3A 2BTQA 5AW6A 4FGKA 2ILTA 1CQXA 4Q16A 4ACBA 1SUFA 3L8GA 3PUVA 2IUYA 5AD1A 1GAXA 3TI7A 4DG5A 5IG2A 3TR5A 3QJ5A 3CV3A 1XTKA 1RLMA 5DTMA 4O1MA 2XXJA 3WHPA 1F6DA 5HW0A 4M53A 2ACWA 4QO8A 5DGDA 1I0LA 5K3DA 1N2IA 3TZKA 1A7KA 3N2IA 2GEVA 3RH0A 1ECBA 1PS9A 3I6ZA 4FYHA 4KXVA 4UU7A 4XUGB 4GBED 4QYMA 1J39A 1YULA 1L8XA 4DYVA 2R47A 1XEWY 4WW0A 821PA 1WPQA 2XKAA 1O1YA 2JLAA 1CUHA 2FOXA 3ZD7A 1HE1C 1DEKA 1XZPA 5AI6A 2JJ1A 3O0DA 4MVJF 1X1TA 3FI0A 3HDVA 4MVJD 3DZGA 4K8OA 1XHLA 3PQEA 1RQGA 4JQZA 3GVPA 1WLYA 4Q19A 3TAXA 4A0RA 5IDVA 3LG2A 2A7XA 4BMYA 1OH5A 1PKEA 2P5YA 1UM9A 1WW2A 2H1VA 1T8PA 4J0GA 4WESB 5G0VA 1O4VA 4LHZA 1B93A 1EHYA 3ISVA 1K7YA 4GIBA 5AHWA 4QREA 4YP7A 4R05A 4N6NA 4RHYA 1J1ZA 4BKMA 1YFLA 4BEBA 4OHMA 1UZLA 3PCRB 2J4FA 1XRLA 2QX9A 3L6DA 2C4KA 2QXUA 3VJLA 2VDRB 1ZMTA 3IE2A 4A4DA 1M2JA 1OCEA 2FJ0A 3WOVA 2GKGA 3KZCA 4CRWB 3T7RA 2HK6A 4REMA 2YDXA 3SFZA 1RWMA 2GPJA 4LGCA 5KNLA 3E9YA 3IEMA 1CIVA 2CW5A 1Q1QA 3KB1A 4MWCA 5CFNA 1UJNA 3PQ5A 2PSEA 2CNWA 3Q85A 4OM7A 3CNOA 3CPEA 2VDQB 3B82A 1F9EA 1GTL1 3EJWA 1ULBA 4NHEA 4EKGA 2PT6A 1YRQA 3R23A 4XCXA 4JS0A 1FYDA 1RRVA 5ED0A 4XQGA 1NHWA 3E7WA 3RVPA 4BFUA 2O8BB 1ZRSA 1L5WA 2B34A 1G2IA 1GNQA 5IMBA 1I32A 3N53A 5TDHA 4IDAA 5SZHB 2ZAIA 4C03A 4PW0A 2YFQA 2PT7A 4U2CA 4MP8A 4MVJG 4Q1FA 1IEVA 2B2XA 4NESA 3EQ7A 3VV2A 3SN6A 8AT1A 1LK7A 4B73A 3DEKA 2V7PA 4HDNB 3QMWA 4PYIA 3WJAA 4ZI7F 3FOZA 2H1IA 1YSCA 4IILA 1XL1A 4MUEA 3ZJTA 1P9LA 2RAVA 1QVVA 2JCBA 4C2BA 4RENA 4ZYUA 2CFOA 1BTOA 5F7XA 4I4TB 4ZK2A 1LPAB 3JU3A 1NZFA 2H4WA 3GVIA 2RKWA 3WLRA 2YMLA 1CS0A 4BX9A 5JBNA 2LP4Y 4AKIA 2P1ZA 2O9JA 4OQFA 4RESA 5DTQA 5HDQA 2Q7OE 3CGWA 2VO1A 3LRTA 3VVMA 1Y8CA 5IVPA 1SOAA 2CVFA 5A6SA 3R2JA 1QZ3A 2DHRA 1E9CA 3I3OA 5ALSA 4MUHA 1QYIA 3LH5A 4NAUA 4YREA 4BMOB 3O0TA 2P2DA 3NS7A 4D9GA 1QG6A 5DXFA 2X42A 3D4BA 4F86A 3U7EB 2VDOB 3L7KA 1BS1A 4KPUB 4MUAA 2NZVG 5BT9A 5TMBA 3QZUA 4NECA 3NW9A 2PS9A 1IIBA 4K6HA 5JQGB 1OV6A 1U4NA 1P2SA 4G81A 4TTSA 5AVOA 3OM8A 4L3VA 4K3VA 4BIMA 5G4KA 2I4RA 1MOPA 3LX6A 5GJVC 4U7WA 3OZSA 4UM9D 4JI1B 3ENVA 5JZOA 4LISA 1RU3A 2D54A 3SE0A 2V96A 2XVXA 2EZTA 2ZR9A 3JVDA 4JVSB 3STWA 4YTEA 4JP5A 1ZGHA 5TMDA 3CCBA 5BYKA 3RU2A 2NVUA 5FUQA 2AE2A 2VDNB 3QHQA 5GJWC 3VU0A 3WGGA 5TC4A 4OQNA 2VHJA 3ZHBA 1NFQA 1BMTA 1FJHA 2G09A 2QQ0A 4UAJA 4MV4A 2D5BA 1AMNA 3GF4A 4JR0A 1K4KA 4E08A 3MINB 2PUAA 4QQRA 2SCUA 3QY9A 4ZRMA 1E5TA 1BU8A 2E0IA 2C61A 4LBVA 1H69A 4UZEA 2GBLA 3T61A 1Y6JA 4G97A 3V4LA 1PEAA 1Z25A 3GRFA 2WJPA 5CNKA 3AF3A 3WXBA 4UXIA 2QTGA 4S0XA 1JP7A 4X94A 2IHYA 3SKVA 4G5XA 1FIUA 2WJAA 3QK7A 4E1VA 4JV5B 2D2XA 4H7PA 2UXBB 1Q1BA 1R5NA 2H5LA 2GUGA 3RARA 3ETJA 4RJKA 3D2CA 2R96A 2J9ZB 1N0VC 2E55A 4JI8B 1N8KA 3GMTA 4C3ZA 1R4MB 1HYGA 2LZ0A 3IPCA 2EBHX 3ZVLA 6REQA 2A4KA 1NYQA 4IKPA 3G0CA 2RGWA 3SQOA 3VX4A 3FVQA 1M73E 3QMPA 4JUDX 4BEVA 2QXTA 4QTZA 1F8XA 4FCWA 4EENA 4PHFA 3IBSA 1E77A 4D9JA 1G5QA 2ZRQA 2PD6A 5LLDA 4POAA 3ECCA 1N9ZA 3TVTA 3WKCA 3JATB 4KACA 2ZVPX 2PKYX 2GX6A 1I7PA 1W52X 2G17A 1I4DD 4ZT6A 4H3KB 1RAIA 2R65A 4IJKA 2AD1A 4J2OA 3C6YA 4KWIA 1V2GA 2XYPA 3KKMA 4GI3A 4PX9A 4HAVA 2JIDA 3G2MA 1JHYA 2QW0X 5D5PA 2YYYA 2G07A 4YAOA 1EAYA 4Y7DA 1W5SA 2FW1A 2G9UA 2JG3A 4RTLA 3NC4A 3E84A 5FUWA 2PWYA 3NEYA 5BMVB 2FEPA 2DWQA 2VYVD 4JUAA 1U1IA 1KI6A 1LFDB 2AS0A 1QYCA 2NU9B 2PIDA 4EJ2A 1X39A 4YAWA 4IGEA 5CB4F 5NLLA 4LZWA 2OD2A 3HCPA 1YJBA 4MS4B 3V1YA 1KC3A 4CDGA 5C7LO 4O4IB 2ESRA 4UC0A 2R97A 3KAQA 3D6VA 1T2VA 3Q7PA 4H1VA 4IW3B 2HX1A 1SUAA 1DAOA 1EFLA 2JHAA 2MR5A 4E3WA 3MSCA 4JR2A 1ADFA 4UEOA 4EKYA 1NPTO 2GZSA 5JSQA 2B4RO 3AFHA 3TLGB 1EDBA 1ULZA 3SE7A 5SYNA 4DA9A 1P7VA 1SVUA 4BFZA 1XROA 3GAZA 3CRNA 3OKPA 1SQ6A 1OPRA 3P2JA 3Q88A 4LECA 5DLPA 4E70A 3RADC 3NNNA 1AF7A 1KVSA 1FNMA 2BC9A 2H63A 3QYJA 4JBGA 3T7AA 2D5LA 5BR1A 2YDYA 3ZD9A 3FFTA 1Z38A 5ADUS 4NHOA 4ZDKA 4TZ6A 1Q83A 3M9XA 1BOOA 4GMKA 4JJ8A 5B30A 3ORRA 3TF5A 3SJCA 3DP7A 3O8OA 1BYIA 5CXUA 5KHLB 2CHQA 2D7CA 1JA9A 3MAAC 4C07A 4CCWA 1Q22A 2NO1A 1MT0A 3O95A 4JBHA 1GTSA 4HNVA 2PD4A 2XUZA 3RWBA 2ZJ2A 3RABA 1HDCA 2ARKA 3W2TA 5KTNA 2ODEA 1FTQA 3VSDA 4UU1A 5EJEA 3TSAA 1CDZA 2JATA 3KJEA 5DN6A 2Q1SA 2B4KA 1B42A 2G6TA 3KM0A 4UHJA 3FTPA 4KXUA 1IXYA 5EWJA 2YS7A 3REOA 3DO5A 4PF1A 5EKSA 5HF8A 4PIVA 2NTEA 4CMBA 4P3NA 2P6MA 4XGIA 4HDQB 2FZ5A 5ELLA 2OV2A 4QLAA 3ZDRA 5K2OA 1FBTA 2IDJA 2IWRA 2WU3A 3AUKA 3U3XA 3ZPXA 5IAGA 2PQMA 3QEKA 3IT2A 3DCYA 2M1XA 1W73A 2WNSA 4FE3A 3VBCA 1IHOA 3VU9B 2Q62A 3DGEC 4ITVA 4YV1A 5AIBA 1NKSA 4FNMA 3CRMA 2FDCA 2C92A 3D3JA 4AAYA 4YAIA 1P9RA 1M67A 1OV4A 5B2FA 4GDFA 1J8DA 1Z28A 3EW9A 1G20B 3OZFA 4JR1A 1AA9A 2I6UA 3AILA 3INYA 3R75A 3RTDA 5ARBA 2PZKA 2WEKA 3LQYA 5AO9A 6CHYA 2FKAA 1RXIA 3BRWD 1DC7A 1UANA 3N0XA 1IG3A 5ICGA 4W6QA 5EUQB 5HJ2A 2OUIA 4OGKA 1V39A 3NBXX 5DWVA 1V7QA 1RE0A 2PVSA 2DAPA 3H19A 1U7OA 3H4MA 4LZZA 4A27A 1LU9A 1R5BA 2OCBA 1TZKA 1U2PA 3ED1A 7REQA 2C7OA 2IYSA 3IR6A 4NZPA 1OLSA 2A9QA 2J41A 2ZTMA 3N7AA 2JFQA 3C1AA 3M5PA 4NK5A 4D3XA 3OTWA 4YI3A 2I7VA 2Z2JA 5IK2D 1KOGA 1TKRA 5ALQA 3UJ6A 4MI3A 2ISSD 1S8NA 3L2OB 2MT9A 4NZZA 4TLMB 5H59A 2AVNA 4MS1B 4MRVA 1RVDA 3DFUA 4U0KA 4WKCA 4XR4A 3VH1A 1U8AA 4D4LA 4LZAA 1WUYA 2EW1A 5M5BA 1A9ZA 2HMYB 4JC5A 4DDWA 5HK9A 4OATA 3RG8A 5H3HA 2CFSA 3ZDDA 4X71A 3AHEA 4NZ9A 1U0TA 3HB0A 1W4CA 2PUGA 2ZP1A 1BMFA 4NCAA 3OJCA 3IAM6 4Q47A 2DQ4A 2DT8A 4Y6OA 1YI1A 1R0ZA 3M2PA 4IWYA 4L7VA 1YQXA 3EZFA 1RC1A 4JA0A 3HYCA 2WR8A 1AKMA 1U2RA 3VVCA 3P94A 5B58C 1I9GA 4DPLA 4DKJA 1C30A 3K31A 2CXNA 2QAJA 3NNDA 3TUJC 4LPSA 2CUZA 2IIQA 4MWSA 2G83A 3OZ7A 4D9HA 3QXJA 3C87A 3BT7A 1KHHA 1CVLA 3DBVO 3V34A 5J4HA 1J42A 1XDZA 3U09A 1QHSA 2LXNA 4ZP1A 1IB0A 4RNCA 1ZGBA 2OXIA 1RAEA 3K0SA 2WD8A 4X1IA 3H1BA 5B4TA 1ODCA 2WJ3A 4MQBA 1WXEA 3UJAA 3GLGB 1J8YF 1FDUA 2CK3A 2Q5OA 2XUDA 3ISJA 2R1UA 4YJFA 4EI8A 3QPWA 5K3FB 1PR0A 3M1LA 2PYDA 2ZIZA 3I9LA 4K6GA 2HJSA 3TX2A 1AK2A 4URFA 1CERA 3BSYA 4BVKA 1F12A 4B9AA 3I28A 1NBIA 2R5WA 3V4FA 5K8VA 2QX6A 4TLDA 4CDMA 4I5DA 4XRGA 1D09A 2B92A 2GHIA 4HLDA 4OBBA 4EVSA 1WUJS 2R1TB 1CPYA 4YPVA 1FOEB 2OECA 3CPHA 4JELA 2O8FA 1Y5NA 2MYTA 2DWOA 2H17A 4RZHA 6LDHA 3B3QA 5AVSA 1BHQ1 2HDNB 2V7BA 3U7IA 5BV8A 1RRKA 2FR8A 1ST3A 2CDAA 3MFYA 3PKZA 4UFNA 2QVXX 2HK8A 3EEOA 4LZLA 1ISMA 4DQVA 3ANXA 3FUTA 4TLLB 3CRRA 3OCYA 1S9HA 1Z4JA 3RYFB 3AQ4A 2HC9A 2PUWA 2AVDA 3LW7A 3LQ4A 4MRRA 2B2CA 3CG4A 4JN6B 1MC4A 4QX6A 4C4YA 5IABA 1QP0A 3LXRA 3HBJA 5TVKA 5IM5A 5G0TA 1KVUA 1JQ5A 4OUKX 1OX6A 2Q49A 4YRTA 3C3DA 3LUPA 3OZRA 5IJ0A 1TLFA 5ENDA 4HEQA 4JIMA 4E5MA 1MEEA 1RYEA 2NUAA 6ADHA 1N2CA 4CXMA 2OCAA 1MOZA 1NOIA 4F60A 4J1TC 3BM5A 1NJ6A 1Z56C 4LX8A 4CKZA 4ZVUA 1P33A 1D5CA 1U8XX 1V4VA 3OT1A 2WIBA 4CIWA 1VL6A 1VL8A 3A36A 3IOYA 5A4AA 1YBMA 5AVTA 1RKUA 3L1KA 4Y9UA 1NX9A 3EPRA 1YUMA 4LY0A 2NP6A 2DF8A 1YB2A 3OWHA 2YH2A 3QELB 4MV9A 4G0NA 5E9WA 3SEFA 3PGMA 2FLVA 5IDQA 2Z4SA 3H3FA 4QKQA 3GQBA 3WLFA 1H4VB 4CGZA 2C84A 4FFLA 1PW7A 4OGWA 2ZWVA 3UUGA 3DTNA 4ZEXA 1W75A 1HE5A 3R7FA 1C3VA 3BORA 4D0LB 2R68A 3PNPA 2FH5B 5CPBA 2X9GA 4UD2A 4DR2B 2NZXA 3O94A 4O63O 2Z30A 3FSGA 2OFFA 1NJGA 4Q3OA 1PNQA 3ZHTA 2YRXA 4W9RA 3LHSA 4BGIA 1FS5A 1C2TA 1BG6A 2UUCB 2JFNA 3D8HA 1UCFA 4AQYB 3ADBA 1MN6A 4RF2A 3BF7A 3MA0A 3WDKA 2FG7C 3HO6A 2VTDA 5F12A 3GD7A 3R77A 4KLZA 2GCOA 1VTKA 3RSLA 2AFIB 4A9AA 4IJVA 1IN7A 2EVWX 3AEQA 5JHHB 3U56A 2ZR7A 5LP6F 1EGAA 1V43A 4QWMA 3LSYA 4JMLA 5CVUA 2B69A 4MUNA 2QTAA 2ICAA 2PKXA 1ZCAA 4EA8A 1QGAA 1XVVA 2VT2A 4WDQA 3AVYA 2Y0CA 4RZQA 4RX1A 4Y6RA 2ORYA 4A0QA 4DN6A 1WUTA 2Y93A 3TG2A 1CKEA 4Y6LA 1E3WB 4ZI7B 2YKGA 3SNHA 1J0XO 2KI5A 2JI6A 2O07A 2EF0A 3CJTA 2WFLA 3PEEA 4I5GA 5IANA 4G3XA 1U7ZA 3SZMA 2WWXA 2GD1O 4R0MA 1DEXA 3EZ7A 4KR0A 1U2GA 3GOHA 1XG5A 3QP9A 4ARBA 2V97A 1Q1AA 3JZFA 5HUQA 3HRIA 2JLVA 1QF6A 5GP1A 3CSDA 5DCYA 2OLEA 4FNAA 5BO5A 2FCAA 1Y6ZA 3ML1A 3DL0A 4WNCA 3TOSA 2DUWA 3CG0A 1GNSA 2BFWA 5TPZA 1QU2A 5K0LA 4RA6A 1WW8A 1KS9A 3WO1A 2GBGA 4LV8B 3VPFA 3P9ZA 4DFDA 2X0RA 3KTDA 2PBRA 5CEEA 4YRDA 3EZ6A 4NYJR 1KEPA 4F3TA 3MCWA 3BHNA 3A6HA 4H3HB 4H6WA 1TTHA 4K9KA 4QDJA 2BI8A 1TZMA 2XZTA 3JS5A 2AG5A 1CZOA 2WVJA 3B36A 3NP9A 4OIMA 5CCXA 4OB7A 2B4YA 3L7YA 2C9DA 2QMZA 2QVLA 4AJPA 1WXHA 4AJEA 1W85B 1SBIA 2F64A 1HG0A 3QLVC 4YJ3A 1NN5A 5DMHA 4HGPA 3H05A 3I9OA 3ONEA 2EX1A 1WETA 4WAUA 2AZXA 1W47A 3B5EA 1XCPA 4HRVA 2X0EA 2Y76A 3TPFA 3VKVA 4DC0A 3U16A 2IA5A 3Q8KA 1KSFX 1GSIA 1KRWA 3BFPA 1CUGA 1OFTA 3H97A 1BOFA 1M75A 5IEJA 2JD1A 1U0JA 1TIPA 1Y1KE 2QJRA 3IERA 1NN0A 3T1NA 1PSWA 3MCVA 3WL6A 4OI0A 2ALJA 3OUZA 1F0KA 1RP1A 1TYBE 1E9EA 1HLPA 2LRHA 2O2IA 5E7IA 3SXPA 2R8BA 3DZHA 2JHGA 1ZYUA 3ADPA 3CX3A 4P2GA 3JVUA 1ONSA 4W1PA 4E7OA 3H8WA 4CN8A 3EZLA 2H29A 3H5OA 1BZYA 3I9NA 1IBCA 1JKXA 3T7JA 2OXEA 2D13A 3BH6A 4YBRA 5CP8A 1P8AA 4NF2A 4DUGD 5HKLA 4WUVA 5HSGA 5JCPA 4PYLA 1KFBB 3F6PA 4QE3A 1TQHA 1JEDA 1H3NA 4GGOA 5DDIP 4CKBB 1LLUA 1V25A 5IWCA 4J1QA 2X4GA 1J2UA 5CYOA 3PDUA 3Q4GA 1GUBA 3RSFA 4NSNA 3D59A 4INPA 4R1QA 4DZZA 3TGPA 3R9XB 5AM5A 4GOXA 2ZB7A 2J30A 3PPWA 4RE5A 1EESA 2MSLA 5CVVA 4RLQA 2DFNA 2NZJA 2IV3A 2AE1A 3E0XA 1E1DA 4LFCB 2EKBA 1RPZA 5JATA 4C4ZA 3B89A 5KSZA 4LSZA 1GZSA 4CL0A 1L4UA 4GNKA 1FJXA 3IP5A 5F5NA 4I99A 5A5FA 1O96A 1K92A 3WICA 3L7CA 4PIPA 2JJQA 3K72B 2CVPA 2HWXA 3DT8A 4LEIA 5K1ZA 4BNIA 4D6PA 1K0UA 4FYKA 4LQCA 2XYVA 5K3BA 2Y1CA 3T1VA 1Z06A 1T91A 2HCFA 5BUQA 4W6ZA 2DUUA 3JQ9C 4IHKA 1AA6A 1ODJA 1AKVA 1QQ6A 3MRVA 4DTIA 3OP4A 5EZ5A 1L2TA 1JPNA 1JWBB 1SWVA 3W6ZA 2CL6X 3AO0B 2P0EA 3L0YA 1Q0UA 1RXEA 4JY7A 3D9QX 4P35A 3IE0A 2B30A 3GRKA 4G2TA 2O1EA 2ZRHA 1H4TA 3RIEA 4RVCA 4ZIRB 1HEYA 4Z9BA 1QTNA 1R6AA 1F5NA 2PL9A 4J0FA 1NMQA 1PQUA 1PT8A 2VNSA 3EOAI 5CB4B 5HCIA 1PJBA 5BSKA 3M2TA 3KQNA 2Q5EA 3A3YA 3FWYA 3KSDO 4HGQA 1NSYA 3AVXA 1FFCA 5HFAA 1ZH4A 1W96A 3A9UA 1JPJA 3PUZA 1PGPA 4XVQA 4DS3A 3B9RA 1UOQA 3ZBTA 1XZGA 2GM4A 3PF9A 2ZT5A 1H2BA 1YAJA 4QU9A 1PFYA 4KG7A 4R2JA 5L3SB 3NHUA 1EK1A 1N2EA 2N1MA 1QVAA 5J2TA 2RI0A 3KTAA 3O38A 2QQ5A 1WPXA 2G9RA 3FKSA 1DXYA 1RQ2A 3VO8A 5IJZA 2WINI 2PDAA 5KCMA 2E4UA 3CKMA 2ZAYA 3T7EA 5K3SA 3U60B 3AIMA 3KKKA 4MR7A 4OMCA 1J21A 2FETA 1ZK0A 2UAGA 5LB2A 4I50F 5I3CA 4KC0A 1UAYA 5I48A 4Q9HA 1TPZA 5HRAA 4NKRA 4Q6BA 1V1JA 1GGFA 3VPDA 2XCRB 5C35A 3CKKA 3GDOA 2EDCA 4HI0E 5HCNA 1JVNA 2ZSHA 1Y7TA 4FXOA 3X1ZA 8ADHA 1EFRA 1NONA 5GVSA 1Z4NA 5CM8B 5HIJA 1DQSA 5H16A 1NQVA 1SXJE 1P4GA 3N87A 4MEAA 5DNEA 4DANA 2OHIA 4N7MA 3M0EA 2XW6A 3R7SA 1I1QB 3TDNA 1MCZA 4RGYA 3UGJA 4CM9D 4WACA 4R7TA 4LWZA 4LE1A 5A0VA 2ZQYA 1F14A 1RKQA 1BEUB 5M34A 3PVSA 2EKDA 1FNCA 4R81A 2YJGA 1XRMA 3RVDA 1O3YA 3UTDA 4PC7A 5LZ8A 4DW8A 2QG4A 4CV2A 2EERA 5JV5A 4ARIA 3HN2A 2DFPA 1E6CA 1H65A 2EARA 2PLRA 2R79A 1GIAA 4OYRA 3S2IA 3UMFA 4JITA 3A10A 3KCQA 3CWCA 5TX7A 1OI7A 1F06A 3HMQA 4RYLA 3VGJA 2WWTA 5EVCA 2YN2A 2BLNA 1HRKA 1TK2A 1JTEA 4BU1A 1PG0A 2MMGA 3W9SA 1AUQA 2XSZD 1UKYA 2X1MA 1G6KA 3I9JA 4J1TA 4KAAA 3RANA 3THOA 3W9BA 4JJAA 4PG8A 1E99A 5HX7A 2P91A 4GYWA 4PAWA 3RTCA 2ZJ6A 3FSJX 4BV2A 3D4OA 4CIVA 3LPNA 1BO6A 1YE5A 1TCCA 3BB3A 1RWKA 3FPSA 4DXDA 4ZT2A 3GLKA 5AOAA 4A0HA 2ONKA 5LXTF 4MDEA 4I3FA 2XOEA 1KFCB 4RAOA 3ELBA 4EHIA 4NCNA 1P4JA 3E3NA 2EIXA 3L84A 1TZCA 2Y3IA 4CLOA 1OA1A 2O2ZA 3SLKA 2PSFA 2I3ZA 1P61B 3DQPA 3E9DA 1VPDA 1S6YA 2QTHA 3LPDA 4U4AA 5DHPA 2IX3A 2EZ8A 1LK0A 4D81A 121PA 2YC2C 3I2IA 4AMUA 3W1WA 2YVAA 5FHQA 1DJLA 4F7WA 5T8KA 4R2MA 4EKNB 3G8CA 3THXA 1RMQA 1UMBB 3D6UA 4YIHA 2IEZA 4AWBA 2JRCA 2O7SA 1W46A 1JR4A 2HQBA 2PT5A 3R4VA 4MKIA 5DGXA 3SI7A 1YC2A 1QHGA 3ZDXB 2WNHA 1OYOA 1MXFA 2XNDD 2XIQA 3NIBA 3TJRA 1HYQA 3VC2A 1U1FA 1V6SA 2BSAA 4YMTA 2V55B 2IYPA 4DREA 4W5QA 2Z4TA 2OMKA 2DLCX 3DMYA 4OI4A 1DE0A 1TZ2A 1DAFA 2OHJA 1XMOB 1C9EA 1U3FA 1Y34E 2FSFA 3AF0A 4EGSA 4OPMA 3NHWA 4NG5A 1XQYA 1BD3A 1UXHA 1EGVB 3UPDA 3ITKA 2JIBA 2A0UA 1D03A 3HKCB 3PXBA 3NVAA 4JGGA 2G3YA 2VXYA 3PNYA 3TQFA 3PFWO 3OO1A 4HH3C 1PWHA 2AF3C 2IP1A 4HV4A 1P8JA 4BGVA 2P3SA 1GPNA 3C5CA 1QIHA 4W82A 2X9LA 2V7XA 3FUVA 3C3WA 2BZ0A 5JSUA 4G5OA 4IDNA 3UBTA 4C87A 5LDDC 5BN4B 3SR4A 2HLHA 1M2VB 3Q3HA 4MO9A 2HW8A 4NIMA 3RWOA 2H8KA 3GCGA 3CLRD 3EQZA 2YNMA 3HADA 5LSAA 2GVZC 2VTVA 3KVYA 3R9KA 5AW1A 2AEJA 4YRQA 1MC1A 2KJQA 3B2QA 2DULA 3P26A 4FINA 4L5YA 4M87A 4IWXA 1BDBA 1GNTA 1T9DA 3H9EO 3KL2A 4MZDA 5DOZA 5LKAA 2BEUB 3AETA 3ZQ6A 2XMBA 2V3VA 1JAHA 4EPXA 3WKBA 4FE4A 2AMYA 1DJPA 5FLKA 1XTSA 3AJDA 3UANA 3EMKA 4JOQA 2NUPB 1GUYA 3LX4A 5D3MB 1U0SY 3CEHA 3PB3A 3KKZA 3N8NA 3SR3A 3ZZ1A 4ND6A 4QBTA 1DWQA 4E5PA 4FILA 1Q74A 2Z1MA 4HQRA 4RSRA 4BO2A 2YN0A 1IOLA 4EMSA 4EG5A 3ZY2A 3NYQA 3GO4A 5CB6A 2GOYA 3OU2A 4GYKA 4WK2B 5JPIA 3QLVA 2G1PA 2VF4X 4TUYA 3UHOA 4AMBA 3SYNA 3CF4G 4M4SA 2PV0A 4EB0A 5L3ZA 4F8EA 2GNPA 3R8CA 1JDBB 1PUXA 2E4XA 2X8LA 5JZMA 1GDTA 3OCZA 1XDGA 4MQMA 1TAHA 4RPCA 4WBNA 1KZYC 4QODA 3JD0A 1HYHA 3NHFA 4NCBA 4XGQA 4ESHA 2VEDA 3NNSA 2VKQA 4HQLA 4ZO7A 4JT8A 4BVBA 5LL6P 1M1YE 1N7IA 1L3IA 2Q9CA 5KOIA 2JLUA 1RCTE 5T6MA 2YJ6A 4BRSA 1ZBQA 2VRCA 4B6JA 3SF8B 5FBKA 2ZRFA 1H85A 1DVRA 2F1HA 1JHMA 2W6MA 5CLJA 1U94A 4QGAA 1QRRA 4IXTA 2BT4A 1ISRA 4KSYA 3U17A 4PR3A 4EYSA 5KTRA 4A15A 3OZBA 1JI3A 4B3SB 1ZCFA 2C9OA 3I58A 5TXGA 3BXOA 1K66A 1ZOPA 3O31A 1PEDA 4L4YA 4LI0A 5G3YA 4YJHB 3I01M 2W6ID 1UBKS 2D1RA 1K7FB 1GGMA 1TEVA 3IBYA 4M0PA 1GZ6A 2AXQA 5EJGA 4GX0A 1N0HA 1X7XA 3NAMA 3T9AA 4YCMA 5KTKA 3EZ9A 3AEUA 2WQ6A 2AW3A 2O8NA 1LDGA 2XX3A 3JYHA 2WYUA 3KJQA 3LAWA 3DHWC 2EXXA 4MLCA 2OHHA 1X87A 3N2NA 5DBEX 4YRMA 3E8XA 1RS0A 3JVEA 3NH9A 5DLEA 3OQBA 1A0OA 2QNBA 1JF8A 2A7QA 4FMPA 4F6RA 3RVMA 1Y0BA 3RC8A 1U9IC 3WLJA 2GPNA 2C1EA 3WYEA 5LQKA 4JP1A 5K4GA 3F71A 4YDSA 4KZPA 4KN5A 4RJLA 1Z45A 1IYZA 1VRWA 5CT4A 1NRXA 3U9SA 2MIIA 4KR7A 5THKA 1JSCA 3R3JA 1JHQA 5MF6A 5ENVA 1NKVA 3A3NA 3L5KA 2X8JB 4MCIA 4D5GA 3ICPA 3THSA 4TV8F 4WGGA 3QF7A 4D8TA 3O47A 1LBTA 2PPLA 4BBAA 3UIEA 1DP4A 2GB4A 5ALDA 3WAGA 2PNJA 1GCIA 2G4CA 4NONA 1PEYA 5LP6B 4OQMA 3FOEC 2C5EA 3BD9A 3IE1A 4U3JB 3C7TA 5CDGA 3G1UA 4JYMA 2XYHA 2MSKA 3ZWKA 4JLNA 1W29A 1Y3BE 4FLMA 4QYIB 4HX5A 2XEDA 3CX7A 4IRUB 2CUNA 2MINA 5JFOA 2X5NA 5KYXB 2VOEA 5WRFA 3E1KA 3TLAA 1CB7A 1REQA 3B6EA 1O7JA 1MQ9A 2P41A 1YAHA 2QM0A 2E49A 3DKVA 5DXJA 4GQAA 2WOOA 2X14A 2NXNA 2XECA 1XPUA 4NU0A 2BUAA 2PWAA 5FLXA 4P31A 2BEWA 4MA5A 2OFPA 1I4OA 1RYZA 3DV0B 4R2XA 2CBZA 5E3IA 2ZYIA 4BNZA 2O0KA 2X23A 5HJ7A 3NQ41 4JASB 5LWHA 2DTDA 3HU1A 3PXEA 3VKUA 3QVWA 1GPMA 3G2IA 1TM7E 1JLSA 4PO9A 2HJ9A 4NBNA 1RP7A 3RHFA 1FTYA 3O4RA 2KW5A 3DXFA 5IH3A 3VYSB 1SU8A 1JVBA 3R6WA 2CV0A 3G02A 3SXUA 3FTNA 4IQ0A 4LYFA 4Z9AA 1FRZA 2VDPB 1W88A 1FYFA 2H5IA 3BFXA 2JIMA 3EFEA 1NVUQ 4GW3A 4MW4A 4P22A 4B84A 5KNDH 1J90A 5D8DA 4TMWA 5F1OA 1FDSA 5IC5A 1QK3A 3VGPA 3GA0A 2A6PA 2JRLA 3AVOA 2EW2A 2HU7A 3H2BA 1FP2A 4CEIA 4PQFA 1PAUA 4OYLA 3FCOA 1VE5A 2E1RA 3UKJA 3RREA 4E12A 4RJ2A 2NYUA 4P86A 4XARA 3RGWS 5CW1A 2CLLB 1ZD4A 1D1QA 3GT7A 5LMZA 4TQAA 4UNRA 1AGNA 2MSWA 2FDXA 1ISSA 2V9PA 3FXAA 4L1KA 4TYQA 1S9DA 4E6PA 2ZWIA 4AYXA 4LF8B 4WKPA 5JZBA 1T8UA 4UHCA 3L7OA 3VM6A 2IUSA 4KITB 3ZVMA 5T4HA 3UWSA 3RI3A 2JVIA 2FZCA 3CHYA 1J97A 3GT3A 4QBHA 1QAQA 4RA9B 3ILSA 4LWQA 1ZWKA 5EWLA 4DF3A 2HLDA 3K6SB 3BUSA 4G4SO 3NP7A 3F49S 1QP8A 4QYXA 5E0KB 4CV0A 1F5SA 4OP2A 1G41A 3OE4A 2GJ9A 4ZQCB 2PZGA 1PFQA 2HRRA 5EXDA 4E7PA 4GZ5A 2H11A 2Q7DA 2G36A 3BE4A 3MUNA 4WL0A 4ZQGA 1JDTA 4TV9A 2QW1A 5D7NA 4B3IA 3FPFA 4KXNA 4MQEA 2QWXA 3CXUA 5F3RA 5KINB 6Q21A 4BQEA 4NBRA 1XD2B 2ZWPA 3GCWA 4HNAA 4K9LA 2HSEA 3D6JA 4ALLA 3TSWA 4HMQA 5M7EA 3NDBB 4WLFA 4RD4A 4IDOA 1Y6FA 1A9SA 2J6BA 4WJZA 4GXQA 2WJHA 4P4SA 2AYZA 1BH2A 2AXPA 3FR8A 3NDJA 2C7BA 4HMPA 3QNUA 4XDHA 4OFBA 1IPFA 1NA5A 3PE3A 4RKYA 1Z0UA 3BWCA 4FDAA 4ZDIA 2J45A 1FFBA 3ZD6A 4N0MA 5F73A 2ZUTA 3Q41A 3MWEA 4JMPA 2ZIWB 1JALA 2AOVA 2C3OA 1EBUA 3IKJA 4WLVA 4KCGA 3KJFA 4JEIA 2PS3A 2CCGA 3ESCA 1EVIA 2VQDA 4TT3D 4UU0A 1G0NA 1BS2A 4WVFA 2OBNA 3L0IB 5CT5A 1WCYA 4U2DA 2DETA 5EJAA 5KDOA 1RKBA 2H4ZA 4B4OA 4YJ3F 3IJEB 2ZU0C 3NT4A 4M49A 4O2BF 3DDSA 1VCOA 2PQ0A 1WHSA 3NGXA 3T5MA 3U3JA 5A03A 4BP3A 4BO7A 1IZZA 4FFBA 2W83A 4OQEA 4WDRA 1K2VN 1QPGA 1IJFA 3MT7A 4B17A 1SH7A 3SX0A 2BJVA 4E5SA 1WHTA 3GVXA 3C3MA 3W8EA 2OAP1 1XCJA 3LF1A 2GBFA 3WIDA 4AF8A 4YP0A 1ZHFA 2RCNA 4QA9A 5B1HA 1CFJA 1SA0A 4F8YA 4M98A 1JLRA 4E32A 4I6EA 2C5GA 4N41A 1T2CA 1R4NB 3NHSA 1XMJA 3TPZA 1PD0A 1XTJA 4P4TA 3EQ8A 4LVOA 4A16A 4B32A 4F12A 2NYRA 1E8MA 1ZQ1A 3LKDA 3PNVA 5DN9A 3TMAA 3NFYA 1C9NA 1CR0A 2QYHA 3NRBA 2FPIA 3EVAA 2J7KA 3PFBA 4JFRA 4RFSB 2YIDA 1XELA 1USIA 5EERA 5EUCA 4RPIA 3OQIB 3UOWA 4L6CA 3WV4A 4KWCA 1QVZA 1NBEA 1FFSA 2WZDA 3WP1B 2N0SA 2JBHA 4M1KA 3U40A 3F6RA 3ZNQA 1KQFA 1I3CA 1J1IA 4I50B 3I0ZA 4RD3A 4PGHA 3FUWA 1CUEA 4EKEA 2JLZA 1GZ3A 1KAEA 4B47A 3I61A 4KJZA 3T95A 1ICEA 1JUDA 3KEQA 2R7KA 5JASA 5C31A 5KBYA 3GGDA 4W1QA 2XUGA 4AJJA 3CF6R 4JSYA 1JRLA 1U3DA 3CLSD 2R1VB 1MAHA 1Z4LA 2QTMA 2ZXFA 3L04A 4URZR 1JB1A 3VZPA 1M0WA 1NDQA 1TU0A 2RHGB 4J7CA 4XLTA 5DM1A 4F5ZA 5D1HA 3ZK7A 1Q1ZA 1DLJA 4ED9A 1DIAA 5DHFA 3M34A 1G19A 1XTRA 4PAOA 3TE6A 1NVWQ 1R9NA 2C9BA 3A6PC 2GF2A 3R20A 2P9TA 4EP1A 1JFSA 2QYSA 4RMHA 5DGHA 3H1FA 4PCAA 3ZHUA 1IQ0A 3QKSA 4D3SA 3L4KA 3F96A 3NKVA 1F20A 1C2YA 3A6KA 1T1JA 3QRWA 2AMVA 4V24A 3PQ8A 3ZGVA 5KPDA 1FLDA 2DBRA 3HI6A 3BEOA 3JQBC 4NVRA 2ZDQA 2FMHA 3LQ1A 4HDOB 4B6SA 2PX8A 4DR1B 1NXPA 4YJ2F 2Q41A 4C0BA 5I9LA 1Q2XA 1M10A 2B21A 2B99A 1XP8A 2EFYA 3AKDA 3HUDA 3V6LA 2GPTA 1CQIB 4ZZ2A 3C8UA 5JARA 4DDKA 3UG6A 4B6PA 4LMRA 1VLQA 4TS4A 4EG8A 1N34B 1L5HA 3E82A 3Q8MA 2VDVE 1GPJA 2GVDC 3E4CA 3WYDA 1CV2A 3K1JA 1OYWA 2NTNA 2Z57A 3FUXA 1E4OA 4QAJA 4U2KA 4YP5A 5LXTB 1ND6A 3V7WA 2A1TS 3KWJA 1UK6A 3BD8A 3CUKA 1LNSA 3EF0A 4U00A 1BCRB 5SY9A 1VKRA 3LK7A 5EYPB 1X80B 1SCAA 1ABFA 3NGMA 4K9NA 1UBFA 1EJ0A 3PENA 3U6BA 2JHPA 2EJWA 3EB9A 3JQDA 4CKCB 1IEXA 2AFHB 2CNNA 3W5VA 2JS7A 2GZHA 2I6FA 4RHUA 5CFRA 4DCVA 1FQOA 4DRXB 4OUDA 4MQ6A 4A8HA 5L95A 3HE3A 4G8DA 4CR8A 4UCWA 2VH2A 2B4AA 2Q5LA 4LVCA 5FQNA 2H2DA 1FVOA 1MVOA 2V1XA 3W9YA 1EXWA 2OORA 3BGSA 3TQQA 2I76A 1HDYA 1QGED 3SIRA 1U28A 3ET5A 1HURA 1OF1A 3CNBA 5MGNA 2XVZA 1VDZA 4Q93A 3SSNA 2RJOA 2FP4B 4ZXPA 1SHLA 2B1RA 1QIIA 3A2LA 4BRWA 2JB9A 1PUIA 3DEJA 5F4BA 3T3NA 2AI3A 1MO5A 5AW9A 3PQCA 5DHQA 1TPYA 4DM4A 3RWMB 5JSZA 3LYAA 4MHOA 2A1UB 3ADCA 1LFAA 3E9NA 4QUHA 5CAEB 5CYGA 2BL4A 4CIBA 1UBGA 2HO4A 1OYYA 1GPYA 1KMCA 3G5TA 3GIWA 3TLBA 2P7IA 2QAIA 1PTKA 3HHPA 2WYHA 1GCGA 1EIWA 3GUHA 3FOFC 3HZHA 2AV6A 4MV1A 3TMKA 3AR9A 1OU0A 5IBCA 1GYPA 4CM4B 4OJYA 1D0IA 1C1HA 4D99A 2Q2VA 3D7SA 3OZXA 4ND8A 1IIRA 4RVDA 4F2PA 5FX2A 5L4LA 1J25A 2C3PA 1X1RA 3D8TA 4FOLA 2YZ7A 1AVTA 2GZDA 3I9V6 4NDAA 3OZDA 1U1GA 3ZHOA 4DMUB 1HH4A 2IYOA 5D87A 1TA0A 1U9CA 5BR7A 1HT0A 2EHJA 1BVYF 5CPFA 3OQJA 3NTXA 4QPCA 4TYNA 3AJEA 1E9RA 1TT5A 3ZEIA 4ALIA 2P4UA 2FW0A 2UZ0A 1R16A 5FYQA 2YIJA 1H8EA 1QGZA 5LVAA 3C48A 1J8QA 2HNAA 2ZJAA 3K96A 3WKEA 4HNTA 1ZMBA 3L5OA 3IAHA 2Z58A 5HWSA 4P6VF 3TIIA 2JI7A 1S2LA 1P18A 1VE6A 3O8QA 4M1ZA 4Q9AA 1O5IA 3G0DA 3K4PA 1AKTA 1U8EA 1UJ4A 3LOPA 3R3XA 5E7JA 4U9HS 1XAGA 3FCYA 1TI7A 1CYEA 1F2TA 3PYLA 1CY1A 3BE8A 4D9IA 2G63A 2GZMA 1SHZA 5BSUA 1KDZA 1ENPA 4D8WA 1NW6A 4EYGA 3FHTA 5E1OA 3SJAA 2P79A 3H5WA 2I67A 4P4GA 1JEYB 2VDKB 4I1SA 4RXMA 5DOVA 1KSG