3A2NA

Crystal structure of dbja (wild type type ii p21)
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
298
structure length
298
Chain Sequence
b'RRAPVLGSSMAYRETGAQDAPVVLFLHGNPTSSHIWRNILPLVSPVAHCIAPDLIGFGQSGKPDIAYRFFDHVRYLDAFIEQRGVTSAYLVAQDWGTALAFHLAARRPDFVRGLAFMEFIRPMPTWQDFHHTEVAEEQDHAEAARAVFRKFRTPGEGEAMILEANAFVERVLPGGIVRKLGDEEMAPYRTPFPTPESRRPVLAFPRELPIAGEPADVYEALQSAHAALAASSYPKLLFTGEPGALVSPEFAERFAASLTRCALIRLGAGLHYLQEDHADAIGRSVAGWIAGIEAVRPQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Haloalkane dehalogenase
publication title Enantioselectivity of haloalkane dehalogenases and its modulation by surface loop engineering
pubmed doi rcsb
source organism Bradyrhizobium japonicum
molecule tags Hydrolase
total genus 107
structure length 298
sequence length 298
chains with identical sequence B, E, F
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2009-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3a2nA00
2JIDA 1EDDA 1TK3A 5AM0A 4X6YA 2B4KA 3W06A 1IUNA 1D07A 4ZGBA 4UHHA 2WG1A 3UUFA 1CUXA 4JYMA 4X91A 2OG1A 4KAJA 1SCQA 3V9AA 2ZYHA 1KU0A 1ZIYA 4M0FA 4HRXA 3WWDA 4TGLA 5CURA 1CUWA 4UHDA 3KSRA 1R9NA 3STWA 3ED1A 2PBLA 4WFIA 3TRDA 4HXGA 1UOQA 2X8BA 1YCDA 2XMDA 3OPMA 1ZJ4A 3FNBA 4GHWA 2WJ6A 4FNMA 3GZJA 1BRTA 3I2KA 4GI1A 1QO9A 3LLCA 1THTA 3WA7A 3VISA 1MT3A 5ALSA 4J03A 1ODTC 3G7NA 1GQSA 2PKYX 4QLOA 3G9TA 1EB8A 3SK0A 1GZ7A 5C7YA 1XZCA 2XI4A 4Y2UA 4BRZA 4AB1A 2C5GA 2LIPA 2HDWA 2UZ0A 4AO7A 2OGSA 4OB7A 3C6XA 4N8EA 1DWOA 4JUIA 3Q8WA 4W9RA 2OQIA 4AN1A 2ORYA 2VF2A 2BJHA 1DT3A 4BZWA 2QT9A 1K63A 2XMGA 1XQVA 2FJ0A 1FFEA 2XMCA 1R88A 2HA7A 3R3XA 5YASA 2WIGA 1VJ5A 4ZRDA 3AZPA 5C8XA 6YASA 3PFBA 4BCDA 3B12A 3G8YA 4BVJA 4B82A 3PFCA 2DHDA 3I2GA 4B9EA 1XZHA 3ZV7A 1EB9A 1WHSA 3FYTA 5JZ9A 4X92A 4WFJA 1VOTA 1GGVA 3T4UA 3H2GA 4BP9A 4XWGA 1ORWA 4BB0A 2HRQA 2DHCA 5AM4A 1YB7A 3CCCA 2VJDA 1ZI8A 3CCBA 1C7IA 1CQWA 3W9BA 2GYVA 2WU4A 3IVMA 1AX9A 2GYUA 1PV1A 5AIAA 4IH9A 5JAOA 4BAZA 5HZGA 4OD0A 1CUAA 1YAJA 4ROTA 1AZWA 2WG2A 1RWQA 4XVCA 5K3CA 5AM3A 2RAUA 2WG0A 4Y2TA 1DTEA 4EHBA 1XRPA 3D0KA 1JT2A 2QXUA 5A7FA 2VATA 4LXHA 5AKEA 1UFOA 5AIBA 3FSGD 3F9CA 3LIIA 5AKZA 2HFKA 4HXFB 4QDOA 5D3KA 4U2DA 1UZAA 2GZRA 4Z49A 4CCWA 4DYHA 3JWEA 3U1TA 2OPHA 2RIPA 2P8SA 3M83A 2QJRA 4P9NA 3FOBA 2OQVA 4K2AA 3RK4A 2IX9A 1IMJA 4C6HA 3WMRA 5JAUA 4HXEB 3ICVA 2B20A 5AI6A 5BWBA 2V96A 1UKCA 1B41A 1MNAA 3C8DA 2B61A 1BS9A 4J0IA 4MWTA 2IITA 3E1GA 3IUMA 2WHRA 3BJRA 3DOHA 4PQEA 4ZV7A 2OGZA 5ALHA 4AMYA 2O2IA 2OAEA 2BUCA 3DOIA 3A70A 2I03A 1E66A 3ZI7A 4ZXFA 4WY8A 3JYHA 1QJ4A 2XUGA 4WJLA 4CFSA 5LLSA 3DNMA 3OM8A 3STTA 3W9UA 1DWQA 5CBKA 3WK6A 1SCKA 3WWCA 2X5XA 1BN7A 3U0VA 4Y2YA 3VJLA 4DMKA 1E8NA 1X2EA 3R41A 4IH1A 1DU4A 4UBOA 2G4LA 4H7EA 3M82A 2B9VA 4YK7A 4FLFA 4AQDA 5BWCA 1U2EA 3PF9A 4ITVA 3WJ2A 4KE7A 3QPAA 4AX4A 5JD4A 2QOEA 2VJAA 5C8VA 1TCBA 3O9VA 1LPPA 3EQ7A 3QMVA 2BUAA 2Y2VA 2Z5GA 1Y7HA 5K3AA 4CCYA 5AOBA 1LPSA 4Q1VA 2E3JA 3RLIA 5ALXA 4XJVA 2H7XA 3WQHA 5ALGA 2PSJA 5JYCA 1CV2A 2FUKA 1CUGA 2CUTA 4EB0A 5T4EA 2XUFA 3R3VA 1FFCA 5JAPA 4F0JA 3EIOA 1XRMA 3BDIA 5D7BA 5ALWA 3WKCA 4CG3A 3YASA 1VE6A 1W6RA 3O4GA 2OCLA 5FV4A 4G8CA 4Y2SA 2PSFA 3C87A 5E4YA 2EDCA 3QBJA 4QDZA 1QFSA 4BE4A 3AIOA 2XDWA 1CVLA 2YASA 4XX1A 3PUHA 4IQ4A 4GBGA 4BC0A 4Q82A 4LXGA 5A2GA 3RM3A 3HJUA 4OB6A 1A8UA 3ZWQA 5SYNA 2DSNA 3ANSA 1NU8A 4W1RA 2ZYRA 4HRYA 4Q3LA 5AHXA 3WKBA 4E15A 3B3QA 3FVRA 4X93A 1S8OA 1JU3A 4BCBA 3M81A 5AJHA 3K2IA 1KEZA 3HXKA 5AKYA 2ACEA 5CXXA 3DS8A 4G4IA 4WFKA 1EDEA 1N1MA 2XQKA 1O6FA 2OAGA 5J3JA 1UK9A 1QE3A 2HA0A 2I3DA 3VDXA 1XZMA 1WB4A 2EDAA 4E14A 1LGYA 3F98A 3FYUA 4G4JA 5CT9A 1N5RA 2YXPX 5HCUA 1PJAA 4QWWA 3G9XA 1ZD3A 3SX4A 5AI9A 4NZZA 3TEJA 4H7JA 3IA2A 1QIMA 3OURA 5EGNA 2ONCA 2PVSA 4H35A 4G1FA 4JYPA 1LPBB 1ODCA 3OG9A 3O4IA 3QZUA 4EY4A 3K9BA 4P93A 1VXOA 2VSQA 2Y2UA 1ZD2P 1LBSA 1NU6A 4U2FA 4LXIA 4OCZA 4B84A 3IDAA 3QPCA 1VLQA 2HL6A 4Q05A 1E3QA 3F67A 1TAHA 1QLWA 4Y9SA 2WHQA 2XUQA 5D6OA 3DKRA 2GBGA 5EHXA 4QA9A 2GZSA 4PO3X 3LCRA 3VVLA 1BROA 4NMWA 1DX6A 2GBIA 5CRIA 1W52X 2XUKA 4BTVA 4PNZA 2G5TA 3IURA 1BU8A 3GA7A 3WA6A 2XMRA 3AZOA 3MGAA 2HADA 4UBLA 2WFLA 5AM5A 1L7QA 2C7BA 5DTIA 2DR0A 2XQIA 1E8DA 4KJXA 3WK7A 1E8MA 1P0MA 4IHAA 4EZIA 1QOZA 3WL5A 3OTQA 4AN0A 2WUFA 3R3UA 3DLTA 5ALZA 3WZLA 2C4HA 2HA2A 4EY5A 4Y2QA 3H17A 4UBMA 3D2AA 2RHTA 1XLVA 4L0CA 3M3DA 1MU0A 1EVQA 2V98A 1K6EA 2JGIA 5ALMA 1LPNA 5K5EA 1JMYA 3FAKA 1QIKA 4N5IX 3CN9A 2JEYA 1MAAA 4A16A 3G0BA 1DQYA 5FDFA 4MJ3A 2QJWA 4P08A 4DLNA 1G42A 1LPMA 4B0PA 4BDSA 3KWFA 1CUJA 1W1IA 2PL5A 3MVEA 4ARBA 1GQRA 3GUUA 5AO9A 1R9MA 1JFRA 5T4FA 5AM1A 3WL8A 1YAHA 5IVHA 1FSSA 4K6GA 4DNOA 1H23A 3ZLVA 5HQ3A 4UHBA 1GKLA 3GROA 2XUIA 4FOLA 1UOPA 2Q0XA 1IZ7A 1DWPA 4B6GA 4MWSA 5ALYA 1N5MA 1YS1X 1HPLA 2Y6VA 4X94A 3G0GA 4RE6A 3I2IA 1QTIA 3V1MA 1QIHA 4X00A 4BBZA 1GT6A 2JGEA 4MEAA 4X97A 3WI7A 1OXMA 3O95A 3LP5A 4BE9A 5AKHA 2WFZA 3IBTA 3W05A 4UUQA 4OYYA 1IUOA 1QFMA 5ESRA 2VT6A 5LZ9A 4OUKX 3C6ZA 4FTWA 1XRRA 1GPNA 1ZICA 1XZFA 3KWJA 4H0CA 5DNUA 1MPXA 4PW0A 3WYDA 2OXEA 2XUHA 4QWMA 1HLGA 3FSGA 1IZ8A 4J0HA 1YSCA 4RPCA 1CEXA 2VAVA 3WYNA 3DYIA 2ZSHA 1CR6A 4OU4A 3I6MA 1EINA 3R0VA 3DCNA 4DMCA 2JF0A 1A8SA 4TVKA 3NOXA 2WLSA 4V2IA 4C88A 1U8EA 5LIPA 3ZLTA 1VKHA 5JATA 2VAXA 3FLAA 4X6XA 3RKSA 4S0XA 3VKFA 2VT7A 1XRQA 5LZ2A 5JASA 4EY7A 3EF3A 2H9YA 2I78A 5DYYA 1QIDA 1U4NA 3B5EA 4B85A 2H7YA 4FFWA 3I6YA 1R3DA 1K8QA 1KU6A 3VXKA 2XQFA 1UOOA 3ESCA 4FNGA 3ANTA 1JJIA 4N5HX 4FFVA 4LYEA 4AZ3A 2WHPB 1DQZA 1ZJ5A 4WDQA 1XKLA 4FWBA 5AKXA 1A88A 1XLUA 3VVMA 3C6YA 2IIVA 3FVTA 3D2BA 4HS9A 5FKJA 5KWJA 1P0PA 4W63A 1N8SA 4X7BA 2QVBA 3WZMA 1T4MA 2XB6A 4G5XA 4H18A 1EK2A 3SC2A 2XQGA 1P0IA 5E4JA 5E2IA 3DJYA 2Z3WA 3F97A 3E4DA 5ALRA 2BFNA 2XE4A 5AOAA 3IULA 3KD2A 4P92A 1CUZA 2O7VA 1XZEA 5HKBA 2HRRA 4CCYB 1CUDA 2WIDA 4FBLA 3WKAA 4B80A 4DM7A 5LZ7A 3O4JA 2HM7A 1UK7A 1ZI6A 3HACA 3QITA 1OILA 3ZPXA 4U2CA 4A5SA 2XQJA 2CB9A 3DQZA 1AGYA 2WUDA 3I2HA 2BGNA 1SOMA 5BV7A 1F8UA 3IIIA 3I1YA 3L1JA 3AZQA 2AXEA 3BF7A 2WHPA 1B6GA 1O6GA 2VJCA 5IVKA 5AKLA 3FCXA 2PU7A 2I3ZA 4UHFA 2QXTA 3EQ8A 2W6CX 3STXA 4Q3KA 2DQYA 5FXMA 3DYVA 4PF1A 1I6WA 1VZ3A 4E11A 1C7JA 4L9AA 4BVKA 5I7UA 3PDCA 4EY8A 3IUQA 1JJFA 4UBJA 4FLEA 4I4CA 5ALPA 2PUHA 4JEIA 5CXUA 1UT6A 5HFNA 4H7FA 2Z3ZA 3O9MA 4ZV9A 5DYWA 2WJ4A 4DNFA 1A7UA 1CRLA 4CG2A 4UBIA 1XZKA 4PSUA 2DQZA 2CZQA 1PFQA 3HLKA 2BKLA 3L1HA 3QH4A 1LZKA 4YPVA 2XMSA 2D5LA 5JD5A 4F60A 5AKGA 3FYUB 4GECA 1HBJA 3Q0TA 3BE8A 4TPKA 1ZD5A 2AJDA 3IB3A 3KDAA 2OGTA 1DX4A 1MTZA 3QVMA 1JJBA 4Q3OA 5HF5A 1GPKA 4JNCA 2OLEA 5BOVA 3V1KA 2JEZA 3A2MA 5CMLA 3BIXA 2QR5A 4C4YA 1MAHA 2ECFA 5ALEA 3WL7A 4UFPA 2HU8A 2XMQA 5LZ5A 3E3AA 3BDVA 5DLPA 3A6ZA 2XLBA 1MNQA 5A62A 3H04A 4J7AA 2H1IA 2RONA 3F8SA 3WJ1A 2WFMA 2WUGA 4A23A 5CT8A 2GBCA 3C6BA 3D5EA 4MQLA 3F96A 4DMFA 5FPQA 2BAGA 5HF9A 5ALQA 3RARA 3DEAA 3BWXA 1BCSA 4J0KA 3A2NA 4J0GA 2WFLB 5DYTA 1BCRA 1Q0RA 4OSEA 3H2IA 1Q84A 3ILSA 4KYVA 3D2CA 5CTAA 1MX5A 5EFZA 3C43A 4QLAA 5A7HA 2QS9A 4C89A 3D59A 5AI0A 5ALJA 3UMJA 1XKTA 2QMQA 4CIBA 2HIHA 4RGYA 2V97A 5ALIA 1THGA 5A6VA 4I3FA 4CG1A 2Y1KA 1OCEA 1CLEA 1IVYA 4WY5A 4CI9A 4EUSA 1MX9A 1QTRA 5AH0A 5EIHA 3TJMA 4U2GA 1DINA 1XFDA 4DNQA 1HKHA 4WCVA 3WWPA 2WKWA 1ZGBA 5AKIA 4G9EA 2WTNA 3BJMA 5FRDA 4DGQA 2ZJFA 1CUFA 3D7RA 2Z8ZA 3OC0A 4KAAA 4FKBA 1J1IA 2RGUA 2R8BA 1YR2A 4EA6A 2QTBA 5KBYA 4FBMA 4KE6A 5KREA 2WIJA 4CIAA 3T52A 4M0EA 1LZLA 3HI4A 1FFDA 1ZD4A 2Y6UA 2ZJ7A 4BAGA 2JGMA 3PICA 1YA4A 3ICWA 4BVLA 1QIJA 3VJMA 2PUJA 1F0PA 1XZDA 5HK9A 3AUKA 4C01A 5HQ3B 1UKAA 1ORVA 2HU5A 4PSDA 1X2BA 2JGLA 3WIOA 1CUUA 2K2QB 1LNSA 2H7CA 2VTVA 4LKOA 4W1SA 1XRLA 4DNPA 1GKKA 5EHZA 4OB8A 2ES4A 5K3DA 5DNWA 3H19A 3L1IA 4G9GA 3O0DA 1QIIA 1MN6A 3GFFA 3HRHA 5AK3A 1TQHA 3G0IA 4IH4A 5K3FA 4EBBA 5T4HA 1QO7A 1CUHA 3FLBA 1HL7A 1JKMA 3C5VA 4ETWA 3I28A 1ZIXA 5AI8A 5ALLA 3WK4A 3DD5A 4YX9A 2ZYIA 4OU5A 5EHNA 5D3ZA 3FWHA 1W76A 2WU3A 2ROQA 1VA4A 1AKNA 4J0CA 4J0JA 4Y2XA 2HA6A 5IVIA 5K3BA 4HTAA 4DTCA 4Y2RA 2PPLA 3QM1A 4OYLA 3VJKA 3NGMA 3R3YA 1G5FA 2W22A 2PSHA 2WM2A 3LS2A 1L7AA 4UHCA 3PF8A 2CKMA 4L72A 2QM0A 1YASA 3N2ZB 2XUJA 3EQ9A 1W4LA 2J4CA 2OCGA 2HHAA 4B7ZA 4EY6A 1DT5A 3AILA 4DMHA 2QRUA 5AI4A 2PSEA 3MUOA 4F21A 3G9ZA 1CUCA 3R3ZA 4MQMA 1EXWA 1EH5A 4MYDA 5EIAA 1RP1A 4XIIA 3WK5A 3C45A 4ARAA 3H1BA 2G5PA 4NVRA 1VA5A 3FBWA 4BZZA 4BRSA 1TRHA 1LBTA 3NUZA 1UK6A 5AK5A 5CT6A 1BN6A 5LZ8A 3FLEA 1GXSA 3I2FA 1L7RA 4W1PA 3C70A 4GW3A 1XZBA 1T2NA 4B81A 4K6HA 3UUEA 4HVTA 5EI5A 4AO6A 1EVEA 1J07A 4N8SA 2QUAA 1XQXA 4O08A 3WLAA 1MX1A 4DSAA 5A71A 1CPYA 1F0NA 5IKXA 1WOMA 4X3CA 4K5QA 4PSCA 2DCMA 1H2ZA 1LPOA 4GEGA 4M0MA 1TCCA 1CUSA 1W75A 3G0DA 5ALFA 4ZI5A 3CN7A 3PE6A 1GPLA 7YASA 4BC1A 5AK6A 1P0QA 1X70A 4KEAA 5DWDA 5JD6A 2J3DA 3QPDA 5IH7A 4G4GA 4KE9A 2CEKA 4Q34A 3ESAA 3GELA 3EBLA 1CFJA 4L3WA 4DSZA 1UKBA 4KR0A 1U65A 4UPDA 3D3NA 4BCCA 3STUA 1ZOIA 3R3WA 3R40A 4GWLA 5DTJA 5AK4A 3H2HA 5AKJA 4J3JA 2XLCA 2JGJA 5C8ZA 1EA5A 2V9ZA 5ALTA 2QUBA 1WM1A 3W04A 4J0DA 3ZLUA 1G66A 4YASA 3ESDA 4AXBA 3DDUA 4JH0A 4C4ZA 5SYMA 1QIFA 4G8BA 4BTLA 2FX5A 3O4HA 1H22A 3MUNA 5AP9A 5JAHA 1NX9A 1BE0A 1ETHA 4H7DA 4QNNA 5JARA 4H7KA 5ALNA 4U2BA 2AJ8A 3A2LA 1ACJA 3HABA 4FLMA 2XMBA 3H1AA 1WB5A 2GYWA 4F5ZA 4X6UA 4Y2PA 2O7RA 1VE7A 3IUJA 1CIJA 1QONA 5EHQA 1XROA 1FJ2A 1EX9A 5FOQA 4G8DA 3TGLA 1JMKC 3WL6A 3H2JA 1K4YA 4RNCA 4GXNA 3K6KA 3QMMA 2XUOA 5DNVA 4B0OA 3HYSA 3JW8A 5HF8A 4D9JA 4QZVA 4UFNA 2ZYSA 2VEOA 1Q83A 1SCIA 3STVA 3WWOA 4ZWNA 5AICA 3ESBA 3DL7A 5CH5A 2C5FA 4BYMA 5JALA 5LZ4A 3E0XA 3FYUC 3DKKA 1WPXA 4HAIA 2XUPA 3I6ZA 4AO8A 4BP8A 2WIFA 5ALDA 1H2WA 5C81A 1AMNA 2PM8A 2X76A 1ZI9A 1CUIA 1XLWA 4ZREA 4Y7DA 2WUEA 2C0PA 3QMWA 3V1LA 3PUIA 3HZOA 1F6WA 1ODSA 1VZ2A 5HF6A 1XZAA 4UFOA 5JANA 2WJ3A 1AQLA 3IUNA 2JGKA 4UHEA 3OOSA 3N0TA 3SWWA 3AFIA 4N8DA 1QZ3A 4LHEA 1YB6A 3AJAA 4FDMA 5ISMA 4INZA 3D4LA 1ZGCA 3G02A 1MJ5A 5FLKA 3C5WP 2J3QA 4KRYA 3DL4A 1WPRA 4AMZA 5LYYA 1MO2A 3I2JA 2QKYA 2FJPA 2WIKA 5K3EA 1Q0ZA 1Y37A 5CH3A 2EEPA 5H3HA 1EI9A 1M33A 5LKAA 3C8HA 1WCYA 2RHWA 2OCKA 5JADA 1CUYA 4B9AA 4MXDA 1H2XA 2CJPA 3V48A 2CMFA 2G63A 3X3HA 1XRNA 5A7GA 2ZJ6A 2RI6A 2PU5A 2AJBA 4DIUA 2WILA 3G9UA 1FFAA 4GLBA 1XZJA 3WKEA 5HK8A 2ACKA 2AJLI 2NW6A 4E46A 1XQYA 4W1QA 1QIEA 3I1IA 1EK1A 5AM2A 2CBGA 2DHEA 2ZVDA 1WHTA 5FP0A 1QIGA 3S8YA 5CT4A 2PX6A 5JZSA 2C58A 1USWA 2HA3A 4LYDA 4MEBA 1K5PA 4QEKA 4KACA 2AJCA 3WIBA 4KAFA 2WTMA 5LKRA 4FHZA 3CXUA 4NS4A 3FCYA 4AZ0A 5ALVA 3KOOA 5KWIA 3NWOA 1UWCA 5I9IA 2WSLA 4WDRA 1HDEA 3AIMA 4I19A 4BATA 1SFRA 1TCAA 1G4HA 4IO0A 5I8PA 1XQWA 2O2HA 5FUMA 4U2EA 1R4ZA 3H18A 1C4XA 3W2TA 1BEEA 1R50A 2JGFA 2OCIA 1YS2X 2HA4A 4H7IA 2HA5A 2BGRA 1LLFA 4B83A 1JU4A 1XZLA 4QDTA 5FPPA 3WK8A 2D0DA 3WK9A 4FMPA 2PSDA 3QYJA 1EDBA 5K3FB 3BL8A 2BUBA 1VXRA 1XZGA 2XMZA 1TKRA 1Z68A 1CQZA 1UXOA 4X71A 4UBKA 4MYSA 1QGED 5JIBA 1XZIA 1R1DA 2R11A 5HKAA 1WB6A 1YA8A 1Y7IA 2XT0A 5AI5A 2O2GA 1E89A 4UBNA 3HC7A 1AURA 5CH8A 5CW2A 1AC5A 3BF8A 1AUOA 4Y2JA 1CUVA 5ALKA 1ACLA 3HSSA 5E4TA 2JBWA 2Z8XA 2YH2A 3G0CA 1FFBA 4C4XA 4BAUA 2DFPA 4X85A 1SC9A 5CT5A 3WKDA 4QE3A 5LP1A 4K6KA 4C87A 4HZGA 4LIPD 5DJ5A 4Y2VA 5AKKA 1EHYA 2QZPA 2XUDA 2GBFA 3HEAA 3BIWA 5T4BA 2HU7A 1E5TA 1JI3A 1J06A 1HQDA 2VJBA 1UK8A 1CUEA 5ALOA 3AINA 4BDTA 3AIKA 1ISPA 3GBSA 4X95A 4X90A 2ZSIA 2YYSA 1IUPA 4PV7A 2HFJA 3V1NA 4KE8A 3WWEA 3PI6A 1RYYA 5ALUA 2BCEA 2XUAA 5EIEA 3LIPA 4QDXA 5HFAA 4OPMA 4H7HA 3STYA 4QDUA 2WQZA 2C0QA 5F4ZA 3H0CA 2J4FA 2VQ6A 5JZBA 5AOCA 1H2YA 4RE5A 1CUBA 3P2MA 1TIBA 2VA9A 1LPAB 3S2ZA 4KRXA 4H77A 3BXPA 5IVDA 3H2KA 1J2EA 1BEZA 4GDMA 1A8QA 3KXPA
chains in the Genus database with same CATH superfamily
4LGYA 4Q4AA 3AHFA 3BIJA 1ZOLA 3D0OA 3K5HA 1QU3A 4PGAA 4ENVA 3KB6A 2DR2A 1G64A 1ZMRA 3IOCA 5BQPA 2PJZA 1IUNA 1D07A 3L8YA 3OFKA 5IDVA 2AB0A 3LWZA 5AVJA 4ZGBA 2YWBA 5D6NA 2CD7A 2HYDA 2QMEA 4OBWA 1BMTA 4AKIA 4OXKA 1M0WA 1JTVA 4KAJA 5A4IS 1NF3A 4YRPA 4QTYA 5B7PA 5E6SA 4I50B 2PUVA 4C2TA 4N5NA 1ZIYA 5TARA 3L8EA 3MC1A 4FB5A 3E9EA 4NESA 3DAYA 5B64A 1W88B 4HRXA 1QVRA 4YRCA 3TOVA 3VRHA 3JATA 4LWZA 3JR3A 3RIXA 4TGLA 3FKQA 4IUBS 5CURA 5AVKA 1YDFA 4HNHA 2P2YA 4DILA 2R6AA 3SJ7A 1KL7A 3STWA 3ED1A 3QTTA 4C05A 4E3ZA 1G5PA 1Q7CA 3ISJA 5EJIA 2Z2KA 3C4QA 4OHPA 1RLJA 4JSYA 2PBLA 4I4IA 1P31A 3AM1A 3EC1A 4HXGA 5KYNA 1UOQA 3GY0A 1YCDA 1PSZA 1VBMA 1XD8A 3IEMA 1DEKA 5CA0A 4CYMA 5B7GA 3B1WA 5MF6A 2WJ6A 1BRTA 5JSZB 4GI1A 3GUZA 3OFVA 1DC3A 1SXHA 4IZOA 2G9UA 1QO9A 5JG7A 2I4LA 4UXIA 3M1AA 4ARZB 3DT9A 4C0BA 3K73O 3LMKA 4Y6OA 1G9SA 1IK6A 3M70A 4QLOA 2ON6A 4UE6A 5DXAA 1EB8A 1Z4QA 2Q1UA 1AKUA 2VF4X 3KR1A 5C7YA 2XJ9A 2YXEA 3CVOA 4DBVO 1ZHOA 3EWSA 2IZOA 3ZQ4A 1G2QA 2R25B 1KMIY 3Q3CA 1BWSA 3ICPA 1ZVKA 4GMDA 3GRKA 3OE7A 1FNDA 4ZI7F 3OHPA 2C2BA 3IMEA 1E20A 2H4FA 1IWPB 2I7TA 4GM1A 4O2AB 5E1DA 2UZ0A 3M6LA 5DGIA 4HDAA 2P3LA 4GLOA 3PKIA 4TQUS 1B8OA 5EIXA 1R4MA 4OB7A 1YHYA 3V3KA 1J24A 1DWOA 3OC6A 4ZO9A 2GMWA 3AVWA 4ZYZA 1R10A 3ZIAD 4U1RA 3IP6A 2J5BA 2VHJA 4JN6B 4TSRA 2GDJA 1VPWA 1V96A 5AW7A 1MO4A 1EFRA 1B76A 2H59A 1RI1A 2VF2A 4O0MA 3GLHE 4P3OA 4PXSA 2Q7DA 3RIGA 1PFKA 2ZPUA 2BJHA 1CDOA 1UL1X 3FDXA 4YP1A 3WXBA 4YUYA 3IKTA 1UM9A 5JI3E 3QX3A 4XFDA 1IEQA 2FLKA 1V7PC 5B55A 1TC2A 4GPAA 4D82A 2EBUA 4PPGA 1U9YA 1A96A 4R1UA 1XQVA 5HX7A 5CG2A 1CQIB 2GKGA 3CT6A 1L8OA 5C35A 4K9QA 4H60A 1FFEA 1KVTA 3DZ8A 4E5UA 4NK4A 2YJNA 4CETA 3BC1A 3S99A 1D1QA 3RBXA 1R88A 2VDPB 4LKRA 4PZCA 3IUPA 1ORHA 4MW6A 3FBTA 1SVIA 4WX2B 1XVVA 2EFDB 5FJIA 5YASA 3FR8A 4UTZA 1VPLA 4KPFC 2VO1A 1K6MA 1WXXA 3OOJA 1EFUA 1NT2A 1ZUIA 2H0QA 4BNYA 3DLBA 1EA7A 4WN9A 1DO8A 2V54A 3BMOA 4LG1A 3P0RA 5LDDC 2UYCA 1QORA 2WD8A 3CG0A 1O9GA 2AG8A 3D6TB 4R1MA 4CBVA 3G8YA 3DFMA 4KQ1A 5L7TA 3BFPA 4BJHB 3H65A 4HQ6A 3FPEA 3I2GA 4ES6A 2LTAA 3MFQA 4O2LA 4POAA 1PEAA 3ZHOA 5B2EA 7REQA 1XK6A 2CBXA 1T0HB 2Q5LA 1RWXA 3CSDA 1I2DA 2QL7A 5BW6B 5IT9A 1GPAA 2R8PA 3CUVA 2Q7OE 2HNBA 2HIGA 3TIVA 4E5PA 1WIWA 3HKBA 1WHSA 4BKMA 4MGKR 1A97A 3D64A 1LDNA 3DR3A 4ME6A 1JZQA 4WFJA 5AW2A 5JVDF 3GJQA 1N9GB 3PUYA 1VOTA 1GGVA 3GNTA 1H9BA 1QK5A 3HVIA 4WGGA 4XWGA 3FHCB 4HCJA 1RTTA 4YJKA 3VPXA 3AR9A 5HUJA 3N2IA 1IY8A 1M7BA 2Y99A 1NUAA 2DHCA 2ORVA 3RPEA 3EISA 4FI3C 1EZ4A 1SD2A 2ZWPA 3FWKA 4QPCA 1NXPA 5CFQA 1AMOA 1EVIA 1GN8A 5J2UB 3T9FA 8GPBA 5LQDA 3KR0A 3R9WA 5FLYA 1BMFD 1QH8B 3QBTA 4G9BA 2VA8A 1J6UA 2VYCA 2GAJA 3CCBA 2YFQA 1C7IA 2AD5A 4QT4A 4ZMSA 2WNIA 3DEIA 3G59A 2GCOB 1CJBA 2GYVA 5ITZB 3GEIA 3IVMA 2GYUA 5ELMA 2OILA 1IIBA 1E9CA 1PV1A 4L4UA 5IBCA 1MB2A 2AKYA 5TQJA 3ELBA 4Q3CA 1E32A 4G1EB 3RU2A 2QB5A 4R1OA 4DG5A 4IGFA 5JAOA 2IZ7A 2JFPA 3ZGVA 5HZGA 3IKVA 2RK3A 1N0HA 1QC5B 1SOWA 1PEYA 1CB7A 1NURA 1C2TA 2FVXA 3AW8A 4OD0A 4D56A 2J3LA 5JI2E 1PE0A 4G1UC 4ROTA 4V0OA 4HQOA 1E5VA 2I1LA 4GYYA 4C06A 4XVCA 3N2YA 1JT9A 3O3CA 3ETGA 4O4HA 3L8FA 2AOXA 2YIMA 3U7QB 1P9OA 4EG6A 2BBSA 2IJGX 3AGQA 5B37A 2MHCA 4X3PA 2H8GA 1P91A 4XD7A 2WG0A 3IUSA 3OFJA 4FMDB 4KSYA 1TT7A 3K70B 4A36A 1FFHA 3DH0A 1C1DB 1GYQA 1U8AA 5J63A 5JQGF 1GCGA 1NLUA 1UKVY 4GS5A 2BGJA 5KQRA 2P9EA 3RTCA 4EHBA 3R7FA 5KNBD 2P4SA 2V74B 4MPRA 4H3VA 3A05A 1V8PA 4DT1B 5B3JC 5CJ2A 1J0DA 1XMJA 2G9VA 3IB6A 4JLUA 3FSRA 1OASA 3QXJA 4K86A 4RGBA 3RUIA 3DNPA 2ZB4A 2H2IA 3H9BA 2FR8A 4YY3B 4QUKA 4MUMA 1VMKA 3CB2A 5EMLA 2XF2A 4XGIA 3LVFO 5J4LA 3UJHA 5GJBA 3NOQA 3WGLA 5AKZA 1VRVA 1U0LA 2H1HA 2RGNA 3AYZB 4JOBA 3GG9A 1NN3A 3HA2A 3QPWA 4GE0A 2GZRA 2XD4A 3KZVA 4YJ3B 3G2HA 2VT2A 4NFSA 5HEKA 2UV8A 1ZNQO 4Z49A 2JHGA 4Z4GA 3ZVRA 4GUAA 1YGPA 3BT7A 2IV3A 3QNMA 4D9FA 1I7QB 3QVJA 3U1TA 3LCJA 4U0KA 3LUCA 3TWOA 1LDYA 3ORFA 4B6JA 3IXMA 4IQ0A 4J1TA 2BR5A 1JKJA 1TZCA 1ZA1A 2V3CC 1SVOA 3FPFA 4C6RA 1N9GA 3ZCSA 3M5DA 4DG8A 2FMHA 1Y81A 1P3DA 3BFKA 4K2AA 4NYIR 4TMXA 2BEJA 1NVKA 4IIJA 3PXGA 4CKYA 1Z0ZA 3RG8A 1N7IA 3GYGA 2QBYB 4C6HA 2DY0A 1OFUX 3ORYA 1ZDMA 4PC7A 2ATEA 3F7MA 4TQGA 4UOZA 3S40A 2CVZA 3AKCA 2OZPA 2ZCJA 5J2UA 4BNWA 3GDFA 2PXXA 2V7XA 3QFTA 3RSQA 4DL9A 2V96A 1LH0A 1UKCA 3RUFA 3SAJA 5MGBA 1A4IA 2E85A 2VUIB 1MEEA 1KZ1A 2F62A 1B41A 2IOHA 1E92A 3PVCA 3VO8A 4M2LA 2GCOA 1RMTA 4RZSA 3DZBA 4ZDIA 1Z22A 1HH4A 1QV6A 2O5VA 2YN0A 1XMVA 3E9RA 2JGDA 3H87A 5I01A 2Z4TA 3TAUA 4JT8A 3KXIA 3I52A 5GJWC 5H4GA 3LNTA 1MA0A 2WHRA 3ZHUA 3DOHA 4OQPA 4AWXA 4IRMA 5IJZA 1ZHHA 4HB3A 4BNVA 2PTHA 3H11B 4E31A 4KPYA 4ZQCB 2BSXA 4Y1FA 2XYGA 5LUBA 2YDYA 5CA0F 2OAEA 1II8A 3DAPA 3TM5A 3A70A 1PYDA 2VJNA 1PFGA 3IJRA 3K16A 3K9NA 3GDOA 2ZUUA 1WHTB 2VTEA 3AYXB 2PEZA 3I4FA 1TGYA 2YCBA 2Z95A 3L6DA 3SMQA 3T1QA 4H4DA 4ERXA 3BFVA 1R9GA 4K3UA 3IT0A 3ECCA 1IQPA 1O54A 3GX1A 1NBAA 4NBNA 4RACA 2HBRA 3TZQA 4D3XA 1DG3A 4GGPA 5KO2A 2DETA 3RREA 1FFYA 2JFYA 4LTMA 1G8FA 1J4AA 4UAUA 3LI2A 3W9UA 4C4SA 5CUQA 2RGEA 2Y76A 4IRXA 4NICA 4Y9TA 1SCKA 1ODKA 4HGOA 3UH0A 2F55A 1A72A 2QD1A 4CVNA 3U0VA 4Y2YA 4AZ0B 1I2BA 1YDMA 1FU7A 4QUAA 4DT1A 4U5QA 5JZVA 4LXQA 3UBTA 3GWGA 1OFHA 4YT4A 3SGLA 5EINA 3F6PA 3T7CA 3ILHA 4K46A 3R5TA 3I04M 2H65A 3ABRB 1B3BA 2B9VA 3M82A 4NBWA 4RZ2A 4C08A 2V7GA 4ECEA 4EF6A 5J43A 3OLCX 1YR8A 4R3UC 1T4DA 5TJ9A 3CTPA 1Z35A 2I6SA 2R4UA 3OMXA 4L5BA 3RS2A 2G07A 3WJ2A 2FP4B 4RVUA 3ZV6A 4ZMBA 4AX4A 5BSWA 5I9LA 3EGEA 3I9JA 4FZ5A 3UKJA 4F8YA 5ARBA 2FWIA 4ZRMA 4O5OA 3SM9A 4LOAA 4XVUA 3ROMA 5B1EA 4YCSA 3U4MA 4NI5A 4C9BA 3G79A 1RWWA 2HV9A 3O9VA 1RKUA 5GV7A 2B1JA 4P81A 1SVWA 2Y2VA 4DWOA 5IABA 1Y7HA 3DEKA 3BH0A 3ZVLA 1ATIA 1LV7A 3BH7A 4B3MB 1KS2A 1WV1A 2AF4C 5D5HA 1XKQA 3DVQX 4Q1VA 5GINE 2IHJA 1HM5A 4DM4A 4EKDA 2E3JA 4FHFA 4WNIA 4AK9A 2HEGA 4BNFA 4BFLA 4EJ2A 4H9GA 4XJVA 4KXFB 1C9YA 3WQHA 2GPAA 2A2ZA 4ZCSA 3U4CA 1X7XA 5CITA 3HHPA 5KTYA 3LUPA 3PQ6A 2XRYA 2RGXA 3RUCA 3ZLJA 1DBWA 4TMFA 3GGCA 3IAFA 2FUKA 2FW1A 4HYQA 2V5UA 5KDDA 2O0LA 1FL9A 2JEOA 4NIMA 4AJ2A 1Y89A 3CEPB 3RSCA 2FR0A 1PR0A 4L16A 5THXA 3RTAA 1MQAA 3VYRB 2CFCA 3JS5A 2VDNB 1EZ1A 1FFCA 5JAPA 3D8UA 1AK9A 4HQ0A 5FLEX 2QJOA 2O6LA 4WCDA 3EIOA 5C46F 3AF1A 1G6OA 2ZWAA 4RIHA 1D2AA 4CNBA 1XE3A 2HY7A 1K0FA 1RFGE 3BDIA 5D7BA 4KXMA 3WKCA 2KPOA 1EEHA 4IINA 1CW2B 3SQLA 2KJQA 3DO8A 3BD7A 3LHIA 4BUZA 4ZYVA 5TMEA 3ITDA 1L6IA 1FMCA 3GDHA 1HNZB 3RT1A 2XZDA 2D3WA 2X2EA 1Q7EA 3OHSX 5IZCA 4UVHA 1GFSA 1SKUA 1X7YB 4S1PA 3C87A 4C0JA 4HDQB 4KFUA 4N39A 1XA0A 1DSSG 2EDCA 4BNKA 3GFQA 3O8RA 1J8MF 1IM8A 3VO2A 1A3CA 4Q3DA 4YROA 3OQ1A 5FBHA 1QFSA 3OZFA 1RRGA 3V97A 1FY2A 2ZEJA 2VJMB 3AIOA 4BE4A 4KI7A 5DP1A 1ML4A 3JQ9C 3ZTYA 1CVLA 3LQ1A 4JT9A 1JDJA 1AXRA 3OLZA 4GBGA 2BMAA 1Y8RB 3V8EA 2ODBA 3W5CA 3P5BA 1OU4A 2X3FA 3TXAA 5FI3A 1SVUA 4KLNA 4R3WA 3R8XA 3U6BA 1Z38A 2FW8A 4P7BA 2VK2A 5I7FA 4NG4A 3UOGA 4CN8A 5KOIA 4GOMD 3QVGB 3UKOA 3NIDB 3RRMA 5KNBH 1EM8B 4I8XA 1JILA 3ZH2A 2BFCB 1XWFA 3AQ4A 3DOFA 4HRYA 1EE1A 3I92A 3N7UA 1ZCZA 3OCUA 4AJOA 5JTUA 3W8RA 1QQ7A 2GTIA 3BXOA 4RL6A 5CPFA 1B8VA 3FVRA 4M1TA 5BT8A 1T2DA 5JJCA 5L3QB 3A6PC 4QOFA 2FEXA 4EQ6B 2WPDA 2XKJE 1YJXA 3CZPA 1H2EA 3HWSA 4BQOA 2D2IA 5JXGA 5D85A 3V4VB 3ZUGA 4JLBA 4LY9A 1U1CA 4F3NA 3ZJUA 1SULA 3H42B 5H8WA 1M1ZA 5F98A 2ACEA 3ZR4B 4O4HF 1W5FA 1VKRA 2WYHA 3HCAA 2G1UA 5EMMA 1U0NA 4BMCA 1Z34A 1T0UA 1PJBA 3AOGA 4WFKA 5CLIA 3GPDG 4BNDB 2FPIB 4LC1A 5JXJA 1RE1A 1AUPA 5HIIA 3TKAA 3W5SA 3B60A 1MOQA 2E89A 1BS1A 3DM5A 4HN9A 5F5NA 2C7QA 3DGEC 4NJMA 2PS3A 3AEUB 4P36A 4EYQA 4C43A 2UAGA 5J5CA 4F2PA 5BVGB 5J3JA 1A9OA 1BJRE 2VUTA 3LXMA 5JPIA 2HA0A 2I3DA 3JQEA 2DRIA 1XZMA 2P2SA 3A4YA 3KL4A 4HDKB 3FYUA 4M9SA 1L9KA 1OAAA 1OYWA 1Z5OA 4NZOA 1CNMA 1Z63A 3KVYA 5GPBA 1K7YA 4X24A 4YPOA 5HCUA 1E77A 3HCBA 1JV2B 3QJ5A 1FVOA 4AKTA 4XLTA 2P41A 1RWKA 2DAPA 3MK31 4RENA 4BBAA 3SX4A 1MRZA 3QBEA 3PLRA 1AIPA 1YDWA 2C9YA 5T6MA 1XEWY 2ADFA 3SYMA 1Y8ZA 3ABIA 3TSCA 5IAKA 2CXTA 4WESA 1XD2B 3VHXA 1EHIA 1VSTA 2WYIA 4H7JA 4DR7B 1XQ1A 1C3LA 1IM5A 1HDZA 1WZNA 1QIMA 1ZZGA 2HI0A 2ZSUA 1YFJA 1H9CA 2ONCA 3NBFA 3QY9A 2XX3A 2C84A 2CKDA 1FSPA 4LK2A 3QE0A 4ALMA 3G2NA 3WDLA 3ZJYA 2OZLB 3AMVA 1UZMA 221PA 3EOAI 2IL1A 1YR3A 4HFJA 2C4TA 3R1IA 4I9GA 3QVTA 1VLJA 3OG9A 3OTHA 1DFGA 4L1KA 1FTWA 1WXFA 4GE3A 2ETVA 4GMXA 4IIJF 3DT8A 5F77A 3UM9A 2G76A 4C4OA 1PJ4A 2X1HA 1K9SA 1U31A 1TZ2A 4WNYA 2D2VA 4D57A 1SD1A 5ECYA 5IT5A 2QX4A 4KN5A 1IZ9A 3KAPA 4MLPA 1ZD2P 4IJWA 2CHEA 4X8OA 4CG0A 1LBSA 1NU6A 2EARA 1DOZA 3GD7A 3NHLA 5FPSA 3VPGA 4NAUA 3G5MA 4LXIA 5J2UF 3I62A 4YREA 3K4HA 3CA8A 3K0EA 4JWKA 1GG2A 4YAEA 2JVIA 2VJMA 1NYRA 1V48A 2J9ZB 3X43A 4EO9A 3O03A 2ZZNA 3ERCA 2YC4C 1T25A 2HL6A 4LRSB 5TQ2A 4TOIA 2W4QA 3PNOA 3QLVC 1SVKA 4IZHA 4L95C 5A4FS 1V7QA 4F3CA 4B2IA 1QYXA 3I73A 4Q05A 4DV4B 1VC2A 4YQFA 4BJ5A 1KXJA 1PL7A 4S1WA 2XUQA 3B5JA 1E5DA 4Y9SA 2E4YA 4QU8A 5D6OA 1FJHA 2GM5A 3FWZA 3NM6B 4IDOA 4DQLA 4NCAA 4I36A 4E5DA 4KNYA 3GLFA 3VVLA 2RH5A 2QLNA 1GHTA 3LP6A 3PQ3A 3QNUA 4HX5A 2NV0A 3AUXA 3RIMA 4KVZA 4H08A 8ADHA 4TV8B 5L3QA 1ZLXA 3PE3A 5E3IA 3ZZTA 3TRKA 1AHNA 1PAUA 1SAYA 2BZSA 3HEBA 3LV8A 1MPTA 3O94A 1H4TA 1RKXA 4L3OA 3BWYA 4S0ZA 3ZDYB 4MVCA 4BLUA 1KOGA 2O1WA 4E1AA 4BTVA 2A33A 1GNRA 4PNZA 2XNSA 3NGLA 4MS3A 2Z04A 1X7WA 3HJCA 4NAVA 4Q0MA 1L8XA 4TLLB 3ZDRA 1RS0A 1FTYA 3QKSB 3WA6A 4HPJB 4JJIA 4LI0A 1KZ6A 4MW9A 4RO0A 3SJZA 3MGAA 3ETCA 2GPBA 1YBHA 2Y1XA 3DDOA 1C30B 3F0TA 3OEED 3QHAA 4PSVA 5FV7A 2C97A 1FFXB 4GBJA 1J33A 4H7PA 5B7NA 2XDQA 2IPMA 3CPEA 3FCCA 5DHPA 5BR4A 2V4UA 2C7BA 2WI8A 2X0DA 3RYTC 4Z9FA 3SYTA 4I46A 5T67A 1U28A 5GY7A 3C48A 3EFOB 1WY5A 4FEEA 4HDKA 4IDAA 4P3KA 3D4NA 3F78A 4KJXA 3LSYA 4F4CA 3IVXA 4LDPA 5EZYA 1M66A 3PTZA 5KQPA 2COKA 1BOOA 1E8MA 3TLAA 1A9XB 4KPEC 5BUQA 2OG2A 4RQUA 1TPYA 1IVSA 4IHAA 1GZHB 3H4IA 1QOZA 1E1MA 2W2TA 4BZQA 4EZIA 4BNZA 4DQUA 5I51A 1EWQA 2JB9A 2REQB 1GL3A 1HL3A 4FE7A 1W5EA 4JB3A 4AN0A 1Y98A 3O31A 2RJ3A 4MRVA 1TVEA 3VV2A 721PA 1O1YA 1NNUA 1GTL1 1JAYA 2GN6A 3DW1X 1HQCA 4MI6A 2ZI6A 1KARA 1WDMA 1XXHA 4EY5A 4HYYA 4YMSA 5KINB 2ZJ1A 4J7UA 4B3DA 3H17A 3T1HB 3A7DA 1DTWB 3EXFA 3FYSA 4UXHA 4YRFA 2B78A 4BX2A 4EFNA 3GLFE 4C2AA 3ZIAA 5EE0A 1FRQA 4R8VA 5JPCA 2C9CA 4DPKA 3JQ7A 1RQRA 4MV0A 2N0SA 2H4ZA 4MV5A 2OQRA 4EDHA 2CFRA 1YCHA 1RWVA 4KUGA 1UQUA 3QQ5A 4TT3D 3COJA 2IP4A 1QB8A 3AU9A 3EDYA 1VHWA 3E8SA 5BP7A 2IYLD 1JSCA 1P7ZA 3AQIA 3JRWA 3OJWA 3ZZ1A 5I4CA 1HE5A 3QV1A 4X1YA 1I4DD 2R84A 2C3UA 2BDEA 3IPCA 2ZI9A 5GZ3A 2I9KA 1MORA 2FLVA 3KKOA 4UVGA 2QM8A 2EG9A 3WLQA 4AYWA 4EA7A 1H1LA 4LFAB 1RT9A 4ZI2A 1LPNA 2HQOA 2DPLA 3HJFA 3DZIA 4FZJA 3BXXA 2HGSA 2TSYB 2FW0A 1XZQA 5DCUA 1RXIA 5K0GA 1PDVA 1QIKA 4N5IX 4U0JA 5IK2A 2JEYA 3DV0A 4WD3A 3G8AA 3E2IA 3BMXA 1E1YA 1OVMA 2W43A 3K09A 3UGQA 1FSGA 2DG2A 3D3KA 3CX3A 3NBUA 5CGZA 4COKA 1PL6A 5D84A 1DBVO 1G2PA 4G5QA 4KB5A 4RJJA 2I33A 3EZ7A 4MJ3A 4HBZA 5FDFA 1Z25A 3OTIA 1JG7A 1U9CA 2YY6A 4JLPA 4R2XA 1CFZA 1Q19A 3NQ41 3QOYA 2HWUA 2ZCUA 2VDVE 1UEJA 4IV5A 4D74A 2WKRA 3PC7A 2A7QA 2FPWA 1LPMA 3NIFB 4ZN6A 1GL9B 4PICA 4C7OB 1I01A 3KWFA 4TMKA 2I2DA 5DBHX 1KVUA 5B1IA 4YS6A 5CIWA 1C9NA 5KYWA 3R0JA 4ZZ2A 1ZRSA 4NU6A 3HQ4O 5AO9A 1JEDA 3UK0A 3CRVA 2PMBA 1XCBA 3FDJA 4NWIA 5AM1A 5AVTA 4G0UA 4F9GA 1BRMA 3FUXA 5JDIC 1UEXC 4DWJA 4NPCA 1Z8HA 4MUBA 5FHQA 2IEGA 1JG6A 1YQWA 2RHGB 2ZUDA 3O2SB 1HDGO 3NHFA 4HOYA 1VSUA 4O63O 4K6GA 4COOA 2CMDA 3CZAA 3D4IA 3OSZA 5CX1B 5CNJA 1UIRA 1CE8B 1ML3A 1W85B 1KDZA 1B8NA 5HUQA 4EG5A 1TO1E 2BEWA 2Q1YA 3RFFA 3GZTB 2OWDA 2HBQA 4FFRA 1P2TA 3QA3E 5JO9A 5DYGA 1UQRA 2GFHA 1YGYA 3O90A 3WRYA 1KI6B 2J6CA 2EFJA 1WKBA 2C88A 2NU6B 2W90A 2ZAOA 3KYJB 4UHBA 5AJVB 3SSNA 1ZL2A 3MSCA 2QY6A 3L05A 1IN8A 4MAAA 1M1YB 3CKLA 3DMHA 2Q0XA 3L49A 3Q12A 1Y9AA 2X6QA 1ST2A 2MWMA 3F5FA 1MABA 4D0SA 1CWUA 2PGXA 3F9IA 3KYIB 5ALYA 2VPIA 5A1JA 1QG6A 1HPLA 4RPHA 3SNHA 3ZXXA 4KKXB 5EXTA 3WGMA 1DTWA 3GRAA 3HO1A 1DAEA 4MUKA 1WETA 1Z88A 1A5AB 2XQVA 3DBLA 1JI0A 3O47A 1QTIA 2YHIB 3W4IA 5BXQC 4X00A 3K8ZA 3D6VA 3NYIA 4KPGA 3NHSA 4CR7A 4UTOA 3T94A 2IE0A 3KPUA 3N07A 5FA6A 4LZZA 5KMGA 3VC2A 2JGEA 3DTVD 1EFTA 4DJJA 3COZA 1TAQA 4FYYA 4MPDA 5JJKA 3AHIA 3COVA 2KM1A 3LECA 3LP5A 3ESQA 1SQFA 1S8FA 3NXKA 4HDNA 4TXHA 3OPYB 1XVAA 4RQAA 2G40A 1JPUA 1T4BA 2BN4A 2YVKA 1DIAA 4TZTA 4Z9YA 2AOTB 2JCVA 1ESDA 1N0IA 1N6OA 1T1GA 3HP4A 2OBXA 5I9BA 2VT6A 5IKPA 2II6A 5LZ9A 5LYJA 4HT3B 2O4CA 2CLKB 2IW1A 5K03A 5E1BA 5ERGB 3SF8B 1D6NA 621PA 4YAWA 1GPNA 5LR6A 3ES9A 4W7SA 3UAOA 5KNBA 2ZSKA 3K9GA 2HMSA 4RVCA 5LDGA 3V7WA 4LHZA 1CY8A 4XB6B 5DNUA 1W1UA 2HJGA 1L5QA 1U80A 2ZTSA 4WOJA 3T61A 8ABPA 5J2TA 3JAWA 3NVAA 4G4SP 5FNVA 2F9FA 5HVNA 4KQCA 4X7PA 2R68A 1Q2XA 1HLGA 2V6IA 1ZRNA 2H52A 4PE5B 1VIVA 3DZCA 3CM0A 4TT8A 3ZWBA 2NZJA 5JRJA 4RPCA 1L1EA 2VAVA 1DXOA 1TQDA 2D1TA 4HB4A 2QHXA 3WYNA 1YZLA 5HDBB 5K3OA 2QX6A 2PR7A 1B3RA 1NF2A 1WE2A 3GGSA 2A5YB 1VKNA 1VMDA 4LBZA 1FTNA 4MWCA 1MV5A 2HK8A 3HZHA 1EYZA 3UH1A 3KNZA 4ZD6A 4L6CA 4Q3EA 5F2EA 3TH5A 3DCNA 5HUHA 1SQGA 4EX7A 5EFOA 3WQQA 2Y71A 1OLSA 1HMYA 1MRNA 1SUFA 1ZD9A 4JODA 2OE2A 5ER6A 2IIQA 5SZJA 4C88A 4ZEVA 1CU1A 3R7LA 5JYEA 4LDRA 4P3YA 1S2LA 1TXGA 1KMCA 3VPCA 1HE3A 2QENA 1WEHA 4JUDX 4Z4HA 2O2YA 3FLAA 2BELA 4F7WA 3RKSA 3FOCA 1C8VB 5KQLA 3VKFA 1OH7A 2AN4A 2VT7A 5M34A 1VKZA 4EY7A 3N0RA 4MVJH 1FMFA 1CY4A 1K7EB 2J3EA 2LXNA 4WZBA 2YV1A 1U2ZA 2XVZA 3P0EA 4U8GA 3W34A 1EWKA 1ESMA 3OP1A 1JEQB 4LRTB 3KJEA 3ZIUA 4MV3A 1FP2A 2J0SA 3L6CA 2VTBB 4Z9XA 3S29A 3IAS6 5CLLA 3BL6A 3UMGA 3VXKA 1UOOA 3RC7A 4M4SA 4AFNA 3KQSA 2D0PB 4MYRA 4K05A 4EHIA 1CERA 2JAXA 4WKCA 5REQB 4HDSA 3RIEA 1TM1E 1JDUA 4FFVA 4V39A 2PZBA 2W6OA 2BYTA 3JV7A 4RAOA 4GZLA 2WHPB 2HJRA 3D7NA 1DQZA 1PZHA 1SCBA 1ZJ5A 2P69A 2ZTLA 3DKVA 3DULA 3O5AA 4MUJA 1TZJA 5EZYF 2WDPA 3U7JA 1A8PA 4PLWA 3N05A 4FMBB 2YNMC 2WHYA 4FS8A 5DE3A 3RE1A 5AKXA 4NDNE 3LE8A 4MQ6A 2AOTA 2RAFA 3TCNA 4ENQA 2WM8A 3WJ7A 4BX0A 1A88A 3U61B 2EV9A 3OT1B 3AKZA 1ZK2A 4Q24A 1B43A 4G89A 2VDWA 2D1RA 2IIVA 3L93A 2D2FA 1T6BY 1Y34E 3EDQA 1UXHA 2B21A 3GN1A 3RGWS 3RUAA 4C21A 5K4HA 3V32A 3NT4A 2EBWA 2HEIA 3H4TA 1KI2A 2NOAA 3VDMA 5FKJA 2B25A 4TWJA 4LF5B 3ZTWA 4RH0A 1LF5A 1OBHA 2QVBA 2ZYWX 4D9MA 3G49A 3L8DA 1M8FA 1JDBB 2XB6A 4UDXX 1CF4A 3OX2A 3WGGA 4V0KA 1NLFA 3BD6A 3DUFB 4HJXA 1KMHB 4F8JA 4HEHA 3ADCA 1MH9A 2ZYDA 2YJGA 3E81A 5TEVA 2XVMA 3ROPA 5E0KB 3VH2A 4BMDA 2REXB 5E2IA 2CE2X 2CVPA 2WTAA 3OJXA 7ABPA 4QFCA 2FUCA 3BM5A 3T15A 5AOAA 4KMOA 2DF8A 2P2LA 3DOJA 2BFFB 4S24A 3DLHA 1C3OA 4F4IA 2OFWA 1Q92A 4JWTA 3CURA 4INOA 4IW3B 4E2XA 1R5JA 4GPD1 2QM3A 4LE1A 4O4IB 4B75A 3HXTA 1DKQA 1PT7A 3NXSA 2X19A 1X3SA 2CN1A 2VCHA 3E7FA 1QH0A 1PS9A 3OU2A 3Q1KA 5A02A 5IASA 2FEOA 3SXUA 2PH5A 1U8UA 3E1KA 3D8RA 1CUDA 4P84A 3ZWNA 4BBJA 4CCYB 1Z33A 4DMLA 2DGDA 4FBLA 3L0ZA 4B6EA 4PRZA 5HS6A 4H1UA 1NJ2A 1XTQA 3BGIA 2VHQA 2CLHB 3E7PA 3O4JA 3QUBA 5DBEX 3OLYA 2HM7A 5GJVC 2D2XA 4FHEA 3RS9A 3UTCA 4A92A 2V0NA 3GW8A 4OQFA 1OILA 2FHPA 4A5SA 3H5RA 3T3EA 2GZ1A 2VZEA 3DQZA 4EQZA 2P4EA 1TJ5A 4V0LA 1HZZA 1CC1S 4AC9A 2PCJA 2OSBA 4HWPA 3JU3A 4K7JA 2P79A 2XB8A 4I4TF 2ZYAA 2L19A 1FLAA 4XPIB 5FJJA 2Q0SA 3S81A 1I4OA 4HLDA 3DZDA 4D4IA 2VTBA 2HF2A 3GP3A 1OZGA 3HXLA 4AJHA 1J0EA 3CRNA 3UGTA 3D81A 4JFRA 5CYOA 3L0SA 4UAJA 4BRWA 3AM5A 1YR9A 3AZQA 2NLOA 3R77A 4F06A 4P3XA 2C94A 1T29A 4KQWA 5REQA 1PQ4A 4TKMA 4TRJA 4N40A 4U7TB 1G5QA 3BF7A 4YCCA 1XYGA 3LPDA 4I55A 2LGJA 2WHPA 3KYDB 1O6GA 2VJCA 3FVQA 4CMBA 2VWQA 3FOWA 1RXVA 1JBQA 4EMUA 5AKLA 3WLSA 1E1RD 1GYPA 3W5VA 5B6IA 1FNCA 2XOEA 1THMA 3FCXA 1F6BA 2GHIA 1U6KA 2I3ZA 2QXTA 3RK1A 5I48A 4JI3B 4MDFA 1XCLA 4ZICA 4YAOA 3STXA 1JHAA 1U7HA 4R9SA 3GCGA 3U44B 3VNUA 2A86A 2Q07A 3L0IB 1FDTA 5H3LA 3FTCA 4GPEA 1EVJA 1LBIA 4PF1A 4J4TA 1IDOA 3OZRA 5IN5A 1X1BA 2MYTA 3MWYW 4QSMA 5AXBA 1PG2A 2W4MA 3G6WA 3PP8A 4PZLA 4L9AA 4BVKA 2QVGA 3TZBA 1I24A 1KZ4A 4EY8A 2FZ4A 2BDTA 4LF7B 1Z15A 3U81A 3VU9B 2ZVQX 4CQLB 4PZYA 4BWVA 1ZL0A 3N7AA 5EUBA 4JEIA 1PWXA 5SY6A 2QX8A 5G0VA 3SHWA 1LLDA 4C4AA 2DFVA 2D5AA 3O9MA 3BQ9A 4BO7A 4ZV9A 3AJ9A 3U39A 1JIUA 5IF9A 2WJ4A 3BRWD 1QR2A 1DIBA 4IIUA 3OZAA 1FPQA 1LK7A 1A7UA 2OHHA 3WG9A 1ZK4A 1LY1A 1CRLA 5DTQA 3UQZA 4UBIA 2EBHX 2PL1A 3S3TA 5BVHB 2XKKA 4JP3A 4K3VA 3U3JA 1IIRA 2Q3EA 3MPUA 5LYJF 3EBOA 1PFQA 1KF0A 1L5KA 1ZGJA 1M8JA 1ADCA 1NLYA 1PJLA 3HLKA 2P4HX 4MOWA 5AJTA 3B20A 3L1HA 2IHUA 1PBNA 2UVQA 1KQOA 1NTOA 3GRPA 1N1EA 1TD9A 1W46A 2ZSEA 1LZKA 3D31A 4YPVA 3KETA 1Z08A 4TSKA 5H59A 2IPAB 1FSFA 3A9RA 1Z56C 1MJGM 5J2TF 5JW6A 4OUDA 4CEIB 1D7OA 1NVUQ 3NR2A 3Q9LA 5FNVF 1NBME 5AKGA 4MUFA 2ST1A 1M75A 3ILYA 3OUUA 2V4ZA 2RHJA 2F4VB 4LY0A 3ASUA 5FWYB 4GECA 5JS8A 3VZDA 1ZD5A 2HHJA 2AKEA 2AN9A 1KHTA 2R2GA 4UDNA 3H75A 4WEOA 4YRSA 5AVWA 2O8EA 1MO6A 3QUQA 2FH5B 3QVMA 1NX6A 2J5RA 3P2OA 4Q3OA 1OWNA 4LHVA 1NLMA 1EFVB 5KPDA 5HF5A 5JROA 1LX6A 1W49A 2C4WA 1GZ3A 2CBZA 2VUSA 2LKCA 1V45E 5G1OA 4BVHA 4CV3A 4IHQA 4TRNA 4NEQA 3S44A 1V11A 1LQUA 3HB5X 4JNCA 4KFCA 3DV9A 4ID3A 4DR5B 1FF9A 3Q10A 3X2FA 2HCJB 4DY6A 3A2MA 2PNFA 3ZE6A 1X80A 1QKIA 2QRHA 4C7JA 2QP3A 2BFBB 4HVLA 2FFJA 4LCBA 2BV3A 2WV7A 4PCAA 3FUWA 4MR8B 4PEVA 1L3IA 5ALEA 3VU0A 1Y6QA 2GCIA 3WL7A 3WP1B 4A5OA 5E3JA 4BMXA 2XMQA 5LZ5A 4E6EA 4UFPA 4OJTA 1T6NA 3BDVA 1RWPA 4GZ5A 4XJSA 3A6ZA 4YRLA 1NOJA 4JLJA 4MZXA 5K0JA 3ETNA 1OD6A 2QD4A 4UMDA 4X8LA 4KDEA 4ETNA 3ACBA 4D4GA 4KO4S 2IUTA 1MNQA 2B1GA 1DRJA 4CUZA 2RHBA 3RSFA 4TRRA 2AHRA 1BYIA 2H4XA 1PLLA 2V7TA 3B7PA 1G5HA 3B85A 3L0DA 1UMKA 4P2BA 1QZXA 4K9NA 2WE8A 3ADKA 1QGOA 1ZC3A 4FX5A 2QSJA 3WICA 2CLSA 2ZIXA 4OHRA 5JBIA 3LOPA 3P9SA 4YN3A 1Z6ZA 3Q3JB 2YWDA 1VL8A 3B1KA 2VHYA 4FN4A 3QUCA 5EPUA 1CLUA 1K8ZB 1V43A 5J59A 4CM8B 4EVQA 1I2AA 1LXCA 3I6IA 2ZBQA 4UCFA 1WXIA 1RLMA 2CGEA 1U3DA 1E7QA 1T4GA 2OV3A 2BAGA 5FPQA 3OEEA 4IKEA 3DEAA 3WIDA 4DQXA 4YAUA 1D2NA 2PBZA 2UUBB 2N47A 3BWXA 3GJSA 3Q7PA 4TZ6A 4PYOA 3SDSA 5DSZA 2AK3A 3I12A 3ETEA 2ZU6A 1N57A 4B7CA 3SEQA 2KMLA 4R8SA 3PNKA 4O8CA 4YDSA 1H05A 1IXKA 3AFGA 1H8HD 4E2YA 2W8BA 4KREA 2IY8A 3GAFA 4CLDA 2OUKA 3QWBA 2YOHA 4EX6A 3IALA 4OL9A 3FTFA 1P2DA 1Q84A 1DEOA 4FOOA 4IGEA 5ECDA 5KWVA 5CHEA 1NJ6A 2I6QA 4OXQA 4L73A 4P0PB 1A4UA 4JVNA 4KYVA 3JZIA 2BJVA 1C29B 2JBAA 2Q3DA 2VJLA 4JV5B 2AFHB 4I9FA 2DBQA 1JAHA 3HYCA 3C43A 1NAHA 2VL7A 1Z5GA 2YVUA 3ZV4A 4CIWA 2K6GA 3QFFA 2IH4A 1ULTA 1DXHA 1ADFA 5EIBD 1Y5IA 1KQGA 5EWJB 2FOLA 2VHUA 3DLPX 3HDJA 5WRFA 1IULA 5C37A 3W5BA 1VHDA 4OHXA 2XBMA 3AB7A 4IXTA 3NBAA 1DRWA 4X9XA 3IVAA 4EF5A 1QHYA 4JT2A 5CG1A 1E4OA 1KYYA 1RZUA 3T8YA 2H3HA 3EGCA 4TT3A 2L82A 4NCKA 3T7TA 1IVYA 4J6EA 1T1IA 4CI9A 1MC5A 3SF0A 1MX9A 2ZB8A 3NJ8A 2WOOA 1M0SA 2WYOA 5EIHA 5LA6A 3TJMA 1PCXA 1NC1A 4MVXA 3SPXA 5BUZA 1N6PA 3QXXA 3JQAD 1JLMA 1J49A 3Q7EA 2BE9A 2ZBPA 3RTDA 4IS2A 4DNQA 2JLUA 2BBTA 4D02A 4ADSG 1E3WB 4WK4B 4D79A 2UYHA 1HKHA 1KY2A 2YN4A 4WCVA 4GMGA 3GLSA 1QAMA 2CDNA 4N3NA 1JLLB 4LNUB 3BG5A 2B6NA 3EX7C 1HLDA 5AVOA 2F3SA 4WJKB 5SY4A 2OZKA 1KKUA 2J67A 3JTEA 3DHWC 1VL5A 3ZWDA 1IHXA 5AXAA 3KQVA 2BTQB 4LZOA 2PX8A 1SQ0A 3BJMA 4WECA 4PCLA 4MVJE 3B6JA 3THYB 2P9TA 2ZJFA 2C7RA 2WAMA 3EIWA 4QBGB 5KEIA 2Z8ZA 3JZMA 3Q5GA 1XU4A 4L5YA 4LJ5A 3HN7A 1Y4SA 5LOVA 2F8TA 3IHLA 3VHLB 5EIWA 3QX9A 4DZRA 1HORA 2ATCA 2CVQA 4OLHA 3O9ZA 4I55F 5KQGA 1Z0IA 3O74A 1EX1A 4FKBA 2RGUA 2IBTA 1BU5A 4K1XA 3UW3A 3CWCA 4IKOA 1O5OA 3NBZC 4JJ4A 3K1JA 1W35A 1IVNA 1TTHA 1PJQA 1NIJA 3N8DA 4ZVRA 2OMKA 2Q2NA 3AL3A 4F6RA 3CE9A 3KPJA 1H1TA 4GXRA 3V80A 2YJTD 5KREA 4LISA 4B46A 3MBKA 3EVBA 2EQ5A 4M0EA 1P77A 1E9BA 1LZLA 3CU5A 2D7JA 3TM4A 1X1SA 1ZD4A 2Y6UA 3EEYA 1Q7RA 4JSTA 4RQBA 2JGMA 1AOXA 2WTXA 3I34X 2EJTA 3IA7A 1U7WA 2C2ZA 4BVLA 3IRVA 3RO7A 4H3HB 4LC0A 5KKAA 1QIJA 2PUJA 3VU8A 4OJYA 4RJ2A 4JB8A 2H11A 1CVIA 2YXLA 1U7ZA 3MT0A 1KSHA 2NSHA 3AUKA 2BSQA 5HQ3B 1C80A 1O0CA 4R5HA 4BNDA 3BEOA 1XCGB 4PSDA 3OPQA 3OZGA 4R31A 1ULBA 1QPBA 3IBCA 4TL6A 3WIOA 1UFKA 4IJ6A 1RQPA 1B6SA 1XVTA 3P1JA 1LNSA 1TM3E 3JWHA 2HCRA 2VTVA 3B7WA 1U2PA 3F1LA 4P6VF 4Q5IA 4W1SA 2ZZKA 1XG5A 3B1YA 4MV7A 1RM5A 3WP0A 4WL0A 3D1JA 1FDSA 4XGQA 3KZCA 3HXOA 4RQTA 3DTVA 1BG6A 4OB8A 4Q4LA 1LQTA 3RJZA 3TEFA 5IC4A 1GRQA 5AHOA 3SDZA 3IT3A 3AFHA 1BFDA 1C81A 2PQ0A 3IR6A 3MRSA 1Y6FA 1ADJA 1XMQB 2ZBGA 3KOZA 4YNBA 1JFSA 1BVYF 2C7PA 1N8TA 2GXSA 1IHDA 3DZKA 3IAEA 4ILKA 3T06B 4DSUA 1K75A 2A1UA 2FZCA 3PX2A 3THRA 4QPNA 1CJVC 1MENA 1FMJA 5AK3A 3ZNPA 4Y1RB 2R66A 2XTMA 1PRYA 1ZWLA 2FK7A 2AK2A 3G0IA 4EBBA 1ZNYA 4REOA 1TT5A 1CR2A 2ECPA 3J7TA 4RDHA 1H0SA 1XC7A 2R6DA 3UAWA 3B2QA 4E5VA 1HL7A 4FGWA 3S6JA 1J8YF 4Q48A 4J16A 1SZDA 4GPZA 1KP2A 4MO2A 4O5AA 5IC5A 1R8XA 4AG6A 3I3OA 1STOA 5AI8A 1RYDA 4Z1OA 3DD5A 4YX9A 1P4GA 4BY9E 1I5EA 1DOAA 2OKGA 4R6XA 4EKEA 4DS3A 5EHNA 5IHXA 3FWHA 4RA6B 1R4NA 1W76A 3W7BA 3SQNA 3Q6MA 2EP5A 2AFHE 5E8RA 3NOOA 3WBFA 4J0JA 3JALB 3GJZA 4DCJA 4CF4A 3OIFA 5K3BA 4KVAA 3GRYA 4I0WB 3QW4B 4DTCA 2VJPA 5JS6A 4P83A 4LHWA 2F8MA 1NTRA 2JGRA 2A59A 1VGQA 2UKDA 1P5ZB 4QQFA 3VJKA 4OYLA 4ER7A 2Z8YA 2OR3A 4OBEA 5LXTA 1PHRA 1YA6A 4BNUA 1I7DA 1UAAA 5LN1A 5KI6A 3K5PA 4YRAA 1WPQA 2BGKA 4NV3A 4D26A 1OV4A 3LS2A 4P4NA 3U9LA 1L7AA 4EQ6A 1FX0B 4DADA 1SM4A 4L72A 4B74A 3M0EA 3TE6A 1YASA 2FR8C 2JFOA 4GI7A 1SZPA 1XF9A 1IPFA 4HNQA 5KCMA 4F45A 2GHQA 4G24A 3SSOA 4ZDJA 5BN3A 1W4LA 3E6AA 1OF1A 4XSHA 1VI5A 5JSKA 2RGNC 3CPHA 3QKIA 5DGDA 3SQWA 1YBMA 4PPQA 4B7ZA 4EY6A 3P19A 2FSFA 4M1OA 4BB6A 3WISA 2RMKA 2Q6OA 1DT5A 2FYTA 2Y1FA 5KX5B 3E22B 5DH9A 2Z4SA 4C04A 2PSEA 1T9AA 4JXKA 1P80A 1EFCA 1BMQA 2OV8A 3WLOA 4J1TC 1EXWA 3KZXA 4AKEA 2FPGA 3RSGA 3B8HA 4UDOA 3UT0A 4CKEA 3RHTA 2GF9A 2PUFA 4CQMD 1L4MA 1ABEA 1VA5A 2C4NA 2PHZA 3E0QA 1RCTE 3EIHA 4G67A 3L3BA 1PQPA 2B8EA 1USUA 3L82B 5FHRA 5HFJA 2GCEA 1LB1B 1SC4A 1O7JA 5TPWB 1RAIA 2VS1A 5H68A 1XU9A 4RS3A 1A95A 4L5JA 1HXHA 4NOJA 5D51S 3M6MD 4UMEA 1W2HA 1UK6A 5A5DA 2RGGA 1GUBA 5CT6A 2DFLA 2VDLB 4UEKA 1DKPA 3JCZA 3RSOA 2RGAA 4CEHA 3C5CA 3T9AA 3GMTA 4ITUA 1L3BA 4XIJA 5LZ8A 1N3YA 4A6PA 2E4AA 2X0IA 1JH8A 3AEYA 1I7PA 1T36B 3ZKWA 2XCQA 4Y2GA 3EDMA 4JJ8A 2BR4A 3C70A 3QLUA 4GW3A 5JNWA 1T2NA 4NU0A 4E4YA 3PRKE 4KCGA 4Q9DA 3SKYA 2JFNA 3DG9A 3OX4A 3EVGA 3UUEA 5EI5A 2P2GA 2BEVA 3BB3A 1EVEA 4MTLA 3HFSA 4BX8A 1J07A 1WXWA 3Q5DA 4N8SA 3KALA 2QUAA 2HJHA 1YZUA 2H5EA 2IUFA 2XV1A 2O8DB 3ZCVA 5JSZA 4ZEOA 3AHDA 4YO8A 3H2ZA 2ZRKA 2CUZA 1GIAA 3WLAA 2PX4A 2XHEA 1T9BA 3K9WA 5AK0A 3SN6A 2JFGA 1SG0A 3HPQA 1FTQA 4FYPA 4L4ZA 1IRIA 1MDBA 1UANA 1M5RA 5JY6A 1CPYA 1O97D 2F6RA 2RG7A 2XD9A 4QAQA 4YCNA 4GM0A 4MGYR 1XTBA 2IRWA 3BZUA 4L8FA 4DMUB 5EE5B 4M1YA 1FEZA 1ZCFA 4IIEA 4KODA 3D4OA 5LA6F 2GCPA 4I08A 4I81A 3M3PA 2WD7A 1NKTA 2QTVB 3G23A 2ONJA 3AUFA 5ALFA 4HX2A 1AKYA 4FDTA 4ZI5A 4EB8A 3CN7A 3WHPA 3IMKA 1EFHA 3BGSA 3KT8A 2GN0A 1ZQ1A 3GT4A 1N4AA 4I9UA 2AMLA 1X70A 2FQWA 3V6LA 5FH9A 4AI6A 4KK3A 2PUAA 3W5HA 1T5OA 2CXPA 2X9LA 2Y68A 2A5FA 1NATA 3ECAA 2GAOA 2QNIA 4Y2HA 1AZTA 2D1SA 4BVAA 2XGMA 3EGIA 5HOQA 1XEFA 3F9RA 2AXQA 2C61A 3P9ZA 1CS4C 2RBKA 3GQBB 3HL0A 4CFZA 5L4NA 5L45A 4JDPA 3TK1A 1GG5A 3U62A 1RAGA 1NIPA 2J3KA 3E22A 3G7SA 1ZCJA 3CNLA 4JC0A 4L3WA 5H9VA 1UKBA 1XPOA 3JQ8B 1IN1A 4UPDA 4JI4B 2PKWA 2H00A 3GGGA 1UFRA 3L02A 1HO3A 4BCCA 5LOVF 2WWYA 1CDEA 3F5DA 4XWAA 3AVTA 2OBFA 5A05A 3F7NA 1WXQA 4B32A 3LSTA 4Q9IA 3KV3O 4ZDWA 1VE3A 1Y6GA 4RV5A 1JRLA 1M5TA 4RF2A 5DTJA 3TQSA 5AK4A 3DWFA 1PGNA 4G07A 1WAMA 4XQGA 1T34A 4RHFA 5AKJA 3R7DA 3VUFA 4BS9A 1DC4A 4J3JA 5B3KA 2BJWA 3OPYI 1M2KA 5HWSA 5C8ZA 5BPHA 4GL2A 1X1TA 2PQMA 4K6MA 2UUAB 5ALTA 1RZ3A 1SRQA 1WM1A 4KGVA 1OW3B 3TG8A 1K5HA 1A9ZA 1RYZA 1SCDA 1VIAA 2G71A 3GJTA 2NXWA 3O1JC 2NSDA 5BWCA 2IEBA 3ZLUA 4FWIB 3LW8A 3UB4A 2NO6A 4BJ3A 2A5LA 5CBPB 4YQEA 3C3CA 1E1RA 1XI2A 2OCAA 3OZWA 2AMYA 4C4ZA 4M7PA 4XUEA 1NBIA 1OGIA 5SYMA 3VAAA 2G7MC 3LTEA 4I7EA 1UC5B 1GFWA 1K7FB 1BXGA 1VPDA 4G8BA 5I7EA 4BTLA 1F9EA 3O38A 1W2GA 3PHIA 1RXYA 3LX6A 4IDFA 2WWRA 3ZOZA 1ISRA 4JCOA 2QY9A 4LFCB 3LL4A 4HEJA 1BEUB 3HDYA 2G8LA 3HJAA 2IIBA 3DO5A 2GA8A 3IEXA 4H7DA 4DABA 4EHLA 3AU8A 3N2GB 3OEWA 3PWZA 1GDHA 2Q2WA 3BHNA 1W8IA 3NTLA 3QP9A 4LRQA 3REOA 3TUJC 3IPLA 4U2BA 4CLOB 2F1KA 3ELYA 2XITA 3E35A 4QRDA 3K0FA 2QRJA 4AWAA 2AUMA 3DE5X 3MILA 3MQFA 5IZCC 2ONKA 1PWYE 3MWKA 1UDXA 3OU7A 4RK1A 1MP0A 2IHTA 4FLMA 3MIZA 4YGXB 2LDBA 4EB6B 3ZYCA 3O4FA 4E13A 1K88A 1SXGA 2C77A 3ND6A 1JR3E 3R6GA 3K30A 1FZTA 4M9UA 4UD6A 2NXJA 3RJ9A 4DB2A 4F5ZA 3T3DA 1C9MA 4OI4A 2FSVA 2DQKA 2FCAA 2QVCA 3LC7O 4DHEA 2OFXA 1HDRA 2WMDA 4EATA 5JEDA 4WZAA 1NNEA 5CVUA 1B16A 3DQPA 1PLKA 1TFUA 1BWQA 1CIJA 1J0XO 1KP9A 1QONA 2QTVA 3KOYA 3O2QB 5EHQA 2AOUB 5BNFA 4BVGA 1XROA 1YZNA 4YAIA 4D92A 1FJ2A 3U2QA 4XW2A 3AESB 4G8DA 1G3UA 2X4LA 1F0YA 3PGLA 3RVRA 2PGLA 3D7LA 3ISVA 5LFAA 1X1QA 3FOAA 4RAQA 1PQYA 4IAOA 4QKQA 1MFZA 1V7ZA 3UN1A 5DNVA 3UT5B 3MYYA 1DHTA 2ZQ5A 1E1DA 3IAHA 2ZRMA 1TYCA 3IAM6 4BX3A 5K09A 4KLAA 4TLEA 2B8JA 2ZYSA 1ISMA 5AXDA 1QFZA 4LSGA 1ZR2A 1AB5A 3RH0A 1HT2E 3E70C 3K2EA 3WHIA 4AG5A 3UWSA 1ZUNA 4GOOD 3BMQA 4OHFA 4ZJYA 1RAEA 5KQSA 3ZW8A 2GRUA 1Y4UA 4BECA 3VTKA 3W3AH 2CNNA 2P1ZA 3ESBA 3DMPA 4LJLA 4M9XA 1XNQB 1I36A 5IAJA 3GARA 2C57A 4ZAVA 1VJ0A 4MA5A 4P3PA 4F71A 2NXNA 3QIVA 3N59A 2KS6A 5SY9A 3D6MA 2E21A 3LGSA 3CLKA 5LXTF 3FYUC 2OLJA 2BFPA 4ZFNA 4HAIA 4FQ5A 2BF7A 5IHPA 4HTFA 3CRW1 4KWEA 5HSGA 3I6ZA 1FW8A 3W2GA 1TIPA 4AO8A 1AKRA 1VFNA 1DJOA 2CV2A 1T26A 4IUCS 4OMDA 5FX2A 1FOEB 1JKFA 3R3HA 4MW1A 4UTRA 4LF9B 2ZULA 4ZJZA 3VR3D 3D7MA 3PEVA 4RKWA 1PS8A 1AMNA 2PM8A 5IF3A 2X76A 3UJBA 1SUDA 3ROEA 4RLHA 3TFQA 1ZI9A 3EODA 1XLWA 5EIFA 3RC3A 4EHHA 1QFXA 1NONA 3E18A 1P8AA 1U3WA 1KAOA 2WUEA 2QNRA 1JLRA 3QMWA 3B3JA 4WZ6A 3MHPA 4BKQA 1P6XA 1MVLA 1XF1A 2G9RA 1R0XA 2OB1A 3CLTD 4MUNA 4R8LA 3IL2A 1G8PA 1P2GA 2M32A 3PIIA 4WXMA 3U49A 1DC7A 4EEKA 4FR2A 3A0RB 5EZ6B 1GEEA 1T3SA 1JYSA 4FNAA 2RJNA 4XQCA 3TPZA 5AUOB 1N2GA 2QYHA 1DC8A 3BE4A 3G2PA 4KSCA 4CTKA 2AWOA 3WNVA 4PG8A 3PXCX 3SZOA 4HUQB 3HDQA 3EZLA 4R2JA 3OIUA 4W99A 3OF3A 2PMEA 4YB8A 4QGAA 4B09A 5KYKA 4AF8A 4RZXA 2RH4A 3G02A 1H5NA 4BXOB 2BFEA 2PZ8A 1GL7A 2CL7X 5DTRA 3ZHSA 3KQKA 1I3CA 3AEQB 1ECBA 2QTCA 3VH4A 3E03A 2QM7A 2WKSA 3C5WP 2CLEB 3DEHA 5LMZA 1GO2A 1A5TA 2CCJA 3P97A 4RGVA 1OZHA 3PQ2A 3U40A 1Q77A 1TTTA 2I5PO 3R5FA 3USES 4A8JB 4DLSA 2B1IA 1N1DA 2ZE6A 5LYYA 4A3SA 2VDKB 4W7IA 2RKOA 4IIHA 5IFKA 5BUCA 2JLZA 1BCSB 1H8HA 3QEJA 1WJGA 3LM8A 2PZFA 5B6PA 2PT5A 4QGHA 3KD3A 5D1HA 4A0RA 4DCTA 5IJXA 2QKYA 4WLEA 1GNQA 5F2OA 3RVLA 1Z6AA 4UARA 2BI7A 3DAOA 2J0UB 2PZJA 2IVZA 3NGXA 2Q1XA 3HB1A 3PTAA 2RE8A 1BCRB 3MD9A 4RIIA 2FJPA 2WIKA 4BQFA 2CFTA 5K3EA 1Q0ZA 1OAOA 4G0NA 1BE1A 1PL8A 3H83A 2X0NA 5H3HA 5I7RA 5P8WA 1TK9A 3ZWWA 3QWFA 4D9EA 3AEKB 1J0CA 1M33A 3GRCA 3R7WA 5BQFA 2JI9A 2Y8EA 4FT4A 5IDQA 3KXKA 3QEKA 3HJNA 4QXOA 1WZ2A 5F9FA 5TLSA 5IAOA 4ZKEA 2E4ZA 1U28C 1WCYA 2B5WA 3B1FA 1B4DA 3AERB 3FMFA 1SHTX 4FFOA 2GTPA 2OYRA 3ZHCA 4Y18A 2ESRA 3NTXA 4RF4A 3VPAA 3ETHA 4YP7A 1H2XA 2CJPA 3WYBA 4OMUA 3VV3A 2G63A 1XK7A 4ZC8A 2CC2A 2XT9A 3X3HA 3UJNA 3OM0A 3HXPA 2B7CA 3JAKB 1L1FA 1HX7A 4C0QC 2C96A 5A7GA 3C24A 3ZWKA 1PD0A 3JQAA 1PF7E 1V41E 3EGOA 3GMIA 4GUDA 4YCAA 3ZD6A 2OGUA 3UWMA 4Q7KA 4DR1B 2VF5X 5D5PA 4BNLA 4NU8X 1RBYA 5DW3A 1OT3A 4QTUB 1NWCA 4OQYA 2YV4A 4P5PA 2WILA 3G9UA 4KH1A 4CDRA 2Q6LA 5BSGA 1GFIA 5EYPA 1YTLA 1NRWA 2Q8NA 1Y5MA 2BCJQ 3EGDA 3HU3A 4KU4A 2O4UX 4KQGA 5HK8A 1NF8A 3TZHA 1C0IA 1SKBA 4DUPA 4B7AA 2OD9A 2ACKA 1NOKA 2AJLI 1Y3DE 3BGDA 1I5OA 1QHEA 2XECA 1I7LA 3GOHA 4ACBA 3E3NA 2O6HA 1VB3A 3A4MA 4PZPA 1Q3TA 4EUHA 2CCKA 3B6ZA 2O52A 2PXHA 2A8YA 1YI8A 2QTTA 3I1IA 1VIMA 4MV1A 4RKYA 2CBGA 4NONA 4WXYB 3BB4A 1U8YA 3F47A 1UKYA 2ILVA 4GLLA 4I1IA 2R6JA 3OBBA 4PYKA 1SBYA 4ZPXA 4YRDA 2FPSA 1GRNA 1RDFA 2XWBF 3P94A 5FP0A 3U1BA 3WWZA 1GTSA 1F2VA 2I2WA 2QPLA 1GWNA 1SOAA 4N9QA 1COWD 2IT1A 3OIVA 4Y30A 5JZMA 1QIGA 3S8YA 4KR3A 1UP7A 2MSWA 4RX1A 3VDRA 1XTKA 3K09C 5ECGC 1USWA 4MVJI 3RHZA 1Q6YA 1GZ6A 1C7EA 4FMCB 1T2VA 4LYDA 5KAPA 1M6VB 1K5PA 4D3SA 3EZFA 5HE8A 4KACA 3D7KA 3TKYA 3QBDA 4K03A 1KTIA 1W8DA 3UCFA 3CXUA 2NYRA 1PZGA 5I7WA 3KELA 1OX4B 3VYWA 4S1NA 4RD0A 5DBIA 1BX1A 5A9SB 3BTUA 1KFCB 1TKBA 4QPZA 1Q17A 2ID4A 2LPMA 5I9IA 1XD9A 1E61A 3MT7A 5EXPA 2O2SA 3D4PA 3OKPA 2I6GA 3N3AC 3DV2A 2WFAA 4GD3Q 3UGKA 3RSSA 2ZWIA 3VDNB 3C0KA 3PD0A 1OZAA 1Y3HA 2JVKA 4HKTA 1RKQA 4WDRA 4ZVVA 2O7NA 4G5GA 3TFOA 3WNDA 3S1AA 3P0IA 1RHMA 5B3AA 5LB4A 2QN7A 3CPSA 4HMOA 4P82A 1KEUA 4UM7A 2BFDA 4O02B 3TJZA 2JIMA 1N2ZA 1TM4E 3GDGA 5FUXA 1IOWA 3ON5A 3F4LA 3I5AA 5KOJA 3ER6A 4HN4B 4B47A 3TE7A 4CL2A 4XWKA 5M5BA 3EPHA 1RYBA 2PXAA 1Z4JA 3BHMA 4ND6A 4U2EA 1CT9A 5LU8A 3MRXA 4LJ9A 1GA4A 1R4ZA 1CR1A 2JZOA 4H6PA 4ZJUA 4D0GA 3WRYC 3I5XA 3HY4A 4NJEB 3WGYA 2PZGA 3VX3A 4XUDA 1Z83A 2P75A 4EWLA 1DO2A 1NDHA 2PRKA 2EW2A 3G2QA 4YJFA 5AWFC 3UC5A 4MWGA 3W4JA 1RMYA 4EHFA 2GN1A 2I7XA 4OHZA 3TIXB 1WCXA 3K6SB 4HX9A 4RD4A 3PC4A 2LBPA 5NLLA 1EVLA 4JB2A 4NPHA 4LJSA 2VCEA 1LLFA 1NPDA 3G85A 4UUNA 3EIFA 2IYEA 4B83A 1QP7A 2IUSA 3MAAC 1CTQA 4ED9A 5FTMA 4K9OA 1SXPA 3N8NA 4HMPA 4LJ6A 3EZNA 5FWXA 1IG0A 2JPDA 3EGVA 2IS4A 3IVCA 3PPVA 4MQFA 4S2EA 3BL8A 2BUBA 5J58A 3K0CA 1U1DA 1V5IA 1XZGA 4M55A 3DF7A 2FX3A 5LBUA 1TKRA 3TBKA 5KU1A 3A26A 1UXOA 3PWSA 3OTWA 1SN7A 3GFTA 4N47A 1ID8A 4JASB 2BLNA 4UBKA 1BVHA 2H2HA 1X8LA 2D59A 1C1YA 2DH6A 3NCTA 5IBQA 1PSDA 1YRWA 3WLHA 5JR3A 4KO1S 1E2UA 4U39A 3LA6A 1IHOA 3EF0A 4PIVA 4LECA 5AW9A 2BMFA 1YA8A 5AI5A 1Y7IA 1FYVA 1LSJA 5I7VA 4I5GA 5KC8A 1M6YA 1RJ9A 1W7AA 3LNCA 4UBNA 2I7VA 4LWPA 3HC7A 3VBCA 4RVDA 5CW2A 2R8EA 5AD1A 4RH3A 4RF5A 4FE3A 1G38A 1Z39A 3H5OA 4MR9A 5KSZA 1M6VA 1Z6YA 3ZXUB 1G291 2J46A 2X6RA 3K31A 3ET4A 2ZUVA 1E2IA 3LKDA 1UFQA 1H4VB 2HD4A 2JBHA 3L79A 4L2IA 3L7DA 1G5TA 2YH2A 3G0CA 1T1JA 3IE2A 1ZOSA 2TECE 3UYLA 5FWNA 5AOVA 1Z07A 1QFJA 3K94A 2DFPA 3CBQA 4X85A 1KDTA 5TF4A 5M7EA 5FO1A 3GGPA 5B3LA 1AA6A 1IBMB 1PBTA 1QQBA 5DMHA 2P78A 3REGA 1IB0A 3PNBA 2G1PA 1XLTA 3KQUA 2IC5A 1KA9H 2IW3A 2VP9A 3TLJA 2IS6A 1G55A 4UNQA 2E49A 3KVOA 4XEUA 2Y93A 2IU6A 2W5UA 2QE7D 4YPFA 3T7IA 3KLPX 3EXG2 2QMUA 2X22A 4C6SA 2WB4A