5BQXA

Crystal structure of human sting in complex with 3'2'-cgamp
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
185
structure length
178
Chain Sequence
NFNVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDRAGIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPSFSLSQEVLRHLRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Stimulator of interferon genes protein
publication title Molecular basis for the specific recognition of the metazoan cyclic GMP-AMP by the innate immune adaptor protein STING.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 57
structure length 178
sequence length 185
ec nomenclature
pdb deposition date 2015-05-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5bqxA02
4EMUA 4F5EA 4EF4A 4LOHA 4KC0A 4QXPA 4EF5A 4F9GA 5CFMA 4F5WA 4LOLA 4F5DA 5CFNA 5CFPA 4QXRA 4YP1A 4F5YA 4KSYA 5CFQA 4KBYA 4LOIA 4JC5A 4QXQA 4EMTA 5CFOA 4LOJA 5BQXA 5CFLA 5CFRA 4LOKA 4QXOA 4F9EA
chains in the Genus database with same CATH superfamily
3MGBA 4NZZA 4FEEA 4YWHA 3IC5A 2Z83A 3M6XA 3QYAA 4G8CA 2WWRA 3G59A 2IHYA 3GJ5A 4UMDA 2OPHA 2QZ9A 5FJIA 2GLXA 4B7XA 1E1YA 3JASB 1YA8A 3RVQA 4E31A 1TZ2A 2F3RA 4UBJA 2B25A 3DHVA 3QJYA 3QU7A 5MN6A 3LMKA 4X64B 2CNBA 2OD7A 1CUGA 4KFUA 4XJXA 5ECGC 3BRWD 1V7PC 1W88B 5TJHA 3F5QA 3RT7A 3FNQA 4DYHA 1N2JA 2R47A 5GOTA 2MJLA 3O94A 3CZ4A 4BAUA 4IIEA 4CT5A 3WK4A 4LI0A 1GWNA 2DRIA 1YDWA 1F8UA 2I3AA 3DDUA 4EABA 1DGQA 1KFKB 4QLOA 4B79A 2X86A 4C5AA 4MAAA 3HVRA 5C46F 3PTZA 3WGJA 3B51X 4IVPA 2EKQA 4YMTA 2VPPA 4KPYA 1GSHA 3FROA 1HYGA 1T5TA 2BTQB 1BCSA 3QLVA 3OZTA 1LBIA 4RFVA 2CCKA 3CZMA 1NF8A 2A9PA 3V1TC 3W9UA 1UBLS 2OCKA 2VQ3A 1KBQA 5J4LA 1JR4A 1JEYB 1P31A 1WNFA 1XVUA 1J2UA 3CW8X 4BNHA 3F6PA 3QU5A 2V0CA 4JWKA 4PZYA 5KKAA 4D4JA 1V8DA 3U09A 4G1MB 1B8VA 5A71A 2O8CA 1V1RB 3BXFA 8MHTA 2PKQO 2HH9A 2ECPA 2MYNA 3G2LA 3JQ7A 1E98A 4OQNA 3AWIA 3ZW8A 5BN4A 3ZK8A 4Z7QB 3K9BA 3ROEA 1ISHA 1P73A 1YJAA 2XE8A 3W5UA 3CVOA 4YREA 2PV0A 1NXOA 5H0IA 2WUVA 1CIVA 1NQ5A 1OTHA 4Y8VA 5AW5A 4MR7B 4HTFB 2HA7A 4IUDS 3GFQA 4WBNF 2IYPA 3T1OA 3TFWA 4MKHA 5AJYA 3IR6A 3T95A 4QXRA 1R88A 4G0PA 1JG4A 1IHDA 3FPCA 3JY6A 2ZUFA 1WO8A 3RHSA 4B80A 1SIOA 3X3HA 4D8XA 1CX9B 5LWQA 2I6XA 4O59O 3U4QB 1GQQA 5BN3A 1CIJA 2C2ZA 3QBVA 1Y34E 1N8KA 3F9CA 3I8XA 4YALA 1NV8A 2C84A 3FFXA 2IYOA 3FMIA 2BEKA 4WJKB 3GT4A 1R6UA 4G9BA 1M2NA 4U63A 4E7OA 1LB1B 1Q16A 2QR2A 3UT5B 1GGJA 2JASA 2DPYA 2OTCA 5KQSA 2VDRB 5TY0A 4PPNA 1KDVA 2FMHA 3LYAA 3BSSA 2NUPB 1JBQA 3MT9A 4LRXA 4V02A 4ARZA 1CXZA 1Y98A 2QL7A 4LXHA 4X9XA 1SBQA 3JWHA 1W4ZA 1Y4ZA 4K5QA 1IFXA 1Z4JA 2Y0BA 4OUDA 1LTKA 2X0JA 1LSUA 1NKVA 2FHPA 1U5AA 2WZQA 4PAOA 3MTAA 4LX0A 1IG3A 4RVFA 1L7DA 1PFKA 4MKZA 1XVTA 3JSXA 2C59A 4UHDA 2H2GA 4IGAA 3LECA 3TQHA 2CD7A 3BMXA 3BXHA 2BGIA 4IJ6A 3I12A 2JD1A 4XYMA 5EKSA 3SS8A 1YWGO 2H06A 4DV5B 3TRDA 4C05A 2MSCB 3A8TA 2CFOA 2QAGB 2YFYA 3KCQA 4PCUA 5CJPA 4CRWB 3CLRD 2PJZA 4WECA 1LLDA 1K6IA 1RRMA 2FW9A 3F71A 1T5BA 3HY4A 2QBYA 4KV9A 5BSHA 4J0DA 5FOSA 1RPJA 4LNUA 1XJWA 3AT1A 1GN9A 4M1SA 5HBGA 1CZOA 2J5BA 4LGVA 4FIDA 1O96B 2H54A 3BGVA 5DCYA 2K2QB 1B7GO 3JZAA 3G8DA 1E94E 1PR9A 2ZYGA 1XZQA 2C3YA 4N8SA 2XD9A 1ISPA 4PWYA 4HDMA 5FBLB 3KSBC 2NZXA 4UE2A 3PXAA 5KKCA 3C7AA 3T54A 1WY5A 3FUTA 3HA3A 1LK0A 3I9JA 3TL3A 4KWEA 2O8DB 2VP0A 3H42B 3LYUA 2YWXA 1AXEA 1GCOA 4UCWA 2BT4A 3AKYA 1XTSA 2DQSA 1U6KA 2YZ7A 5JLAA 3NFYA 1A1VA 1E0AA 2I4NA 3DBRA 3NAGA 3RTDA 5FV4A 1KI3A 2X9NA 5AVYA 4TRJA 3VZSA 4IPTA 5JAIA 4YDQA 2VDNB 5DTIA 5KWVA 3IOYA 2J30A 1LY1A 4C0SA 2Q5QA 4ZOLF 2ADMA 2QD1A 4X6XA 4BB9A 2R84A 5JNWA 4G0WA 4TMYA 2Z4TA 4DXAA 1M2OA 2RHLA 1E6KA 1YDGA 4GP6A 4MYRA 1H05A 3IS3A 4QFMA 4YVFA 3U40A 3A7DA 4MS3A 2PL1A 4MGHA 3TE7A 1JF8A 3P9CA 3DGEC 4JR0A 1IXSB 4PG4A 4TOIA 2P6NA 4FTWA 2D06A 3W3AH 1WBJB 2QRNA 2HMVA 2IPOA 3G89A 1BCSB 8LDHA 4C29A 2HBQA 4HHEA 3PLRA 1NIPA 3R41A 4TT3D 5DV9A 4V3CA 1TC1A 4X24A 3M1LA 1C0LA 4YP1A 4YAFA 4O5AA 3BRSA 1HG1A 4RTKA 3K2BA 4EQ6A 1MBZA 2IYTA 1RJWA 1TD1A 3AB8A 3UJPA 4ZTZB 4IIJF 4DAEA 3CO0S 3QYFA 4HDRA 4HVCA 2CDCA 2VJMA 4W5OA 3HKBA 4I5GA 1QP0A 2I4MA 2WSSA 1DBRA 2ZUDA 3W3AA 3OZVA 4IJMA 3WIVA 3KS9A 4IS2A 3CRW1 2HV8A 1KEKA 1XZNA 3KFLA 4JC8A 1HQCA 3UAGA 4JYBA 4ZANA 4RQBA 3GUCA 1EWKA 1NTOA 2B92A 2AGVA 2RIRA 3GBPA 3IAM6 4YXWD 4B43A 1FQOA 2JK0A 5HPYB 3GRZA 3PICA 2FDCA 2ZIVB 1E1KA 1UODA 2OYCA 2L17A 5EIWA 3PYLA 1FUKA 1TM7E 4N18A 4EVSA 3H9CA 1CY7A 1R3DA 3L6EA 3RWBA 5LQAA 5BN3B 2JGKA 4MRMA 2OLJA 3AI2A 4N0MA 1L5NA 4NQRA 1YUBA 1K08A 2ZSEA 1V7CA 1WDTA 3HG7A 4OYYA 4DZZA 2C8KA 5LDDC 4ZP1A 4XCVA 3SQDA 2WT9A 5EG5A 1P1FA 1XNHA 3M6FA 4H3SA 3IUJA 4QLAA 5G3YA 3M70A 1RM0A 2H1LA 3W7BA 5GVSA 4P4LA 1XAGA 2J7KA 3ZCRA 3OC0A 2PGLA 3HN2A 3S8YA 1RTKA 4H3KB 2GN1A 1RZVA 3KQYA 3LDFA 3SFZA 2H1IA 5FBKA 1WA5A 4ARZB 3U16A 1Z07A 1KIAA 2H2DA 4DPKA 1P0MA 3ZXXA 4NEHB 5CTAA 4ZI3A 3NRCA 2IPLA 4OUDB 2GBIA 5FBVB 3KSRA 2H0AA 4Y2YA 2ZIGA 2CHUA 2I1QA 5FJJA 2B8JA 1H0SA 2FTKE 2PLNA 3OD1A 3QVSA 2GN0A 5GVRA 3W04A 2WF9A 3OLCX 1SBTA 4FE7A 3K8ZA 2PT7A 2QUAA 1NVMB 4Q37A 2OA0A 1XXHA 2HW8A 2HBRA 3ON5A 2O0KA 4NZYA 3E9CA 4L0CA 1GQYA 3WMGA 1J5XA 2W4IA 1RXUA 1G38A 3L05A 1KSFX 4TM8A 2XGMA 5ISMA 1BVYF 2QBYB 2JAQA 2YHAA 2OXRA 4C0HA 4UW9A 4H7KA 4LNUB 4CW7A 1NZFA 4D3FA 1N57A 5BQPA 4HRAA 3FRIA 4N5NA 3VNSA 1AKYA 2JGFA 3NT2A 4H1UA 2FRDA 2JKYA 3GDWA 3OEHD 4FHGA 2IPMA 3LZCA 5K0NA 3KKZA 4R8RA 4HDMB 1KARA 3DLCA 1YGPA 3O0DA 2O3UA 3ICEA 3LFTA 4NDNE 1WRBA 2IPAB 4OMUA 3W05A 3MBIA 4F8EA 2EQ5A 5EHNA 1S5PA 2WPDD 1JT9A 1F7UA 3QW2A 5BYJA 4P0QB 3RRJA 4R1QA 4R9SA 3WAKA 5BSWA 2D0DA 2BHSA 4Q9NA 1IEQA 2IHZA 1ONOA 2GFIA 4QSMA 5E1OA 3DBRB 3HJGA 2PR2A 1U7XA 1P61B 2QV7A 3BA1A 2OMKA 3HU3A 4PAGA 4DMHA 1WSWA 3GHYA 2G0NA 1GZ4A 3ZW7A 5C8DA 1VLVA 1KBZA 3QWHA 5F52A 1Z18A 5JUWA 2HMTA 3V34A 3B9PA 3BICA 1IBRA 2OP0A 3OQPA 3CUEF 5TGDA 2ZB8A 3ZDXB 3M6LA 4FNGA 3PXBA 1QGYA 1LF0A 2GNOA 2YRFA 2ZUWA 3V3TA 3LX6A 1M2OB 1R8XA 2D8MA 1XDZA 2HIMA 1PX0A 4IWYA 4MS3B 1U3UA 1WPRA 5HGXA 2ONCA 2AHOA 4Y1RA 1J06A 1EHCA 1X13A 1ZCBA 5T5QA 2V0GA 5L95A 3ZZNA 1PV2A 5EXSA 2GPAA 1Q11A 2GS9A 3BX1A 3L7OA 1VLJA 3VC3A 2VWQA 1L5MA 1X80A 5CA1F 4DMRA 4R05A 4RJIA 3MA0A 2FWMX 5EWMA 3THSA 2JHPA 3FOAA 3LPLA 1W1UA 3DLIA 1DJMA 5IMBA 4Q6BA 4ZZ0A 3ZWDA 4FZJA 4MZDA 3L04A 4Q9IA 3OTWA 4EQ6B 4HN9A 3BWXA 3HY6A 3SJCA 1UJCA 1YVRA 5DO9A 3H5LA 4HDRB 2VJMB 1TC2A 3HKBB 4D80A 4DIMA 4E46A 3BFXA 3K0FA 3M82A 1VJ5A 2J87A 2WKSA 2J4CA 5GIOE 2OOSA 3HTXA 3C5HA 3ZWOA 4NZ9A 4LWQA 3NJRA 4PNHA 2XODA 2WKWA 3FVWA 3IP6A 4TT8A 2ZRQA 4D4GA 3HUTA 1YC5A 1PDVA 2GCPA 4D6PA 1ZM4A 3PGLA 2IUUA 3DO6A 1U8XX 1CY0A 1PJ2A 3FSRA 4BVAA 3NWJA 2FRVA 2PAAA 3Q5GA 4OIMA 1S01A 2VHEA 4H1WA 4XR4A 3T94A 1AJEA 2Q21A 2Z8YA 1Y0BA 2O0LA 4MRMB 5C18A 4BO5A 4AAYA 1NQXA 4X94A 3TLGA 3ROZA 1Z3CA 3EIFA 5G4LA 4ZCQA 1S89A 3HP1A 4MGKR 3DZJA 1XK7A 3CSUA 4V0OA 1FP2A 1ORWA 3QY0A 5EJ2A 3TQCA 1WKVA 3ZBQA 1PTJA 4ZJZA 1U7PA 1NN3A 5A2GA 2EHJA 1BS1A 1M1ZA 3WL8A 1Q0HA 4RKFA 3ACCA 4DCJA 3UWPA 3R9KA 3RUCA 3ASVA 2QZ4A 1QQAA 3H1EA 5CGZA 3TLMA 3FWPA 1JKIA 2B1RA 1FQJA 3HR4A 4GMKA 5DMHA 5FL7D 1KY3A 5I7AA 3W2IA 4RJKA 4IMIB 3Q5DA 1PEDA 4AQYB 2FGJA 1M2KA 2FUEA 3PF8A 2G06A 1ENYA 1Y81A 4LF9B 3CKKA 5IBCA 1TM5E 1YD7A 3EDCA 4C04A 5EYPA 4Y18A 4CGYA 4Y1GA 1NAHA 4IHQA 2XOEA 4ZQFA 4H77A 4ZJUA 5DBIA 4M9CA 1KQOA 3TKLA 4AB1A 1XXHB 3EZLA 5K03A 1KEPA 3G88A 3KXKA 4Q3AA 1SG9A 2VSQA 1XB2A 5IKEA 1THTA 3AF1A 3NC1C 1ZL0A 4EUNA 3SF0A 1YBVA 4G5FA 2PH5A 5DTJA 4OQPA 1RWVA 1E4YA 1H6CA 4XGNA 5B6JA 1UK8A 4BZXA 2ZYWX 4OJYA 5JFTA 4X93A 2D13A 4WN3A 2CN1A 2JEZA 4H6PA 3M5PA 4MV1A 3KC2A 3EODA 1SZCA 2XT9A 4EJ0A 1G59A 5LU8A 1MRSA 3KQLA 3B3QA 4BNDA 4NXMB 1GGKA 1REQA 5D7NA 2QZSA 3G0BA 3RNLA 1JT2A 2QRGA 1ZJ5A 3QW4B 4HNSA 1GILA 1JPNA 1Q21A 2DG2A 2HCBA 4RAOA 3DAYA 1QHEA 4TZTA 4FMCB 3F6SA 2A14A 3KYJB 5T57A 5A4DA 3R9XA 1XK6A 1CW2B 7AT1A 1T9HA 5FBQB 1FY2A 3OTQA 1A9QA 4LV5B 1FP1D 1QRTA 5CB0A 2APJA 5D8DA 1XN4A 1U8YA 3NYWA 1L5SA 1XYYA 5G2OA 4EJSA 2C97A 1N0IA 5HMLA 3FIUA 1YAJA 1YGYA 2FF7A 4QO8A 1RHMA 3RUDA 4QXPA 1RI2A 2KB0A 3SYTA 4ZZIA 5E38A 2QSJA 3ER9A 3JWPA 4HQFA 2I6FA 1H42A 1NJ5A 2ZFUA 4B47A 2QMYA 2V5VA 1QORA 2CJXA 4OHRA 3KOMA 4F3CA 2LNDA 1J5EB 2Q07A 2Q8PA 1SUCA 3ICVA 2IEIA 1PJ8A 2A0FA 3D4IA 4AZVA 1A97A 3L6OO 4QPPA 1YQDA 3UMGA 2CUKA 1N1DA 4ENUA 1OC2A 3FNEA 2CXPA 3PGKA 2VDVE 2NTEA 3CX8A 2Y1FA 2HFKA 2JLUA 1CY1A 1L4FA 3IX7A 1QVAA 3JD3A 4WSOA 4WZBE 1QQ6A 1X80B 2B2XA 2VYVD 1SFRA 3OJXA 2BSQA 4HXYA 3A9UA 2XV1A 3BD7A 5KHOC 3PUKA 4KAFA 5EWMB 3RVLA 2IU0A 5M34A 3HJFA 3L1IA 4NZPA 1QV9A 2PZ8A 2YWCA 1R66A 2ACWA 2H4HA 2BH2A 1FRVA 2W2VA 1DXYA 4U9IS 1XDBA 1UQRA 1HA3A 1VMIA 1U7HA 4NDAA 2PVPA 3GYBA 4RTRA 4TKZA 2EEZA 2R5WA 3U17A 3VAZA 3K3PA 3FSEA 3UTDA 3ETCA 3AK4A 3EX7C 5J5CA 3FVTA 3K0FB 2I7VA 1Y6GA 5A4KA 2JLSA 4ZVNA 3OEWA 5JXWA 5D7BA 1PRYA 3FBWA 4F4HA 2BAGA 2GCOB 4NABA 3VOSA 1L8OA 4YCBA 5BQOA 3R5SA 3OM8A 2GJ8A 2HF7A 3KE8A 3PR1A 3PX3A 1UKZA 3EGEA 4JGBA 1D0SA 1I3KA 1YK0A 4O8CA 4OL0A 4II3A 3UQZA 4C4TA 4HLQB 1WMFA 3QTLA 3QI7A 4TYPA 3K4PA 1N1MA 4DUYB 1OILA 2C2YA 4DMKA 4GDFA 2BPOA 2BEUA 1MO3A 1MJGA 3FYUC 4QDUA 2OBFA 2YKGA 2YUTA 2I7XA 2NQTA 3F1KA 2C31A 2HIGA 1I80A 3TLGB 2FMFA 1JDUA 1JTEA 5FLYA 1FZQA 3SBXA 4ER0A 2I76A 4ESOA 5AM3A 5BUQA 1XL0A 2WSLA 2XWSA 2C7OA 1ODLA 4YMLA 3DOIA 1IY8A 3D8UA 1TO2E 3O8OA 4DDKA 2ZRPA 4LE0A 4YHBA 4QJBA 5BWLA 3JQBA 2H5EA 1DRVA 5AOCA 1TU3A 2FCAA 5JZSA 4F72A 2P1RA 3QQ5A 4YAGA 4RULA 1YBMA 2EC5A 2W6MA 4MX8A 3MGAA 4UHCA 2D0IA 3P2KA 3MB5A 3TB4A 3CKLA 3LSYA 3GLHA 2A3NA 3JD0A 4MGIR 3H16A 1NOKA 1I4OA 1KDYA 2F9MA 1XEWY 2X4GA 4GKBA 2FRDC 3CLVA 3AKZA 3PPXA 1VG0B 2WYHA 2GBFA 3H8JA 3JZIA 5B55A 1WETA 5EYPB 1JA9A 1DJOA 4MRPA 3QKRA 3ZE2B 3UJAA 1SKYB 4LQDA 1T6NA 1KF0A 5IAAA 1R9MA 2ZJYA 3FHCB 3OMWA 4DWJA 4H59A 1V96A 3OIFA 3MAJA 2MDTA 5AKYA 3B6KA 4CJXA 5H81A 3U31A 2J0VA 1A71A 3P2JA 4BNKA 1WMSA 2GMWA 4MH0R 2MIIA 3L07A 2YQ5A 5IUNC 4U9HS 2P3LA 4C6HA 1LBHA 2TSYB 2YJ3A 5IM4F 4H6VA 5K01A 3LS2A 1OF1A 5HOQA 4BASA 1GHTA 2G07A 3PEVA 4CKYA 1QX3A 2CMDA 4WUTA 1VRVA 2DPLA 4ZVRA 3BE4A 3OHSX 3OPYA 5EN4A 4AYTA 1REQB 2A0YA 2J6HA 4BNDB 4G8BA 4F11A 2ZDHA 4XZ3A 1WXIA 2C4HA 2IT1A 4JFRA 3WSTA 3NDBB 3T34A 2J0SA 2YS7A 2JW5A 1BG6A 3MQ4A 2Q3BA 1V9SA 3LVRE 4EG6A 5BQFA 1JW9B 4CVNA 1THZA 4BWVA 2ECKA 1ACJA 3R9XB 1PGNA 1PT6A 5HW0A 3D6NB 2WJWA 1YE5A 3AI1A 3OX2A 3VNQA 3LT4A 2OORA 2GF2A 4U1RA 1N2CE 4FGSA 4KNVA 3OHPA 1QZXA 4ZZ3A 1PYDA 4FCWA 2PS3A 4I5EA 4HG2A 5DXAA 3ZV3A 4XLLA 3UKDA 3TCKA 4EJSB 2DJ5A 1N5IA 1H2ZA 4J2HA 5IX8A 1Y37A 2IJGX 5EAIA 4G0OA 1OREA 4N01A 2IHNA 1EGQA 3DVRX 3P52A 4ZDKA 1CPYA 5FPKA 2X13A 3QUBA 1D2CA 2CMGA 2YXDA 2O2YA 4HB4A 2VUUA 3F7NA 4U6SA 3MJFA 3ZQJA 2GM4A 4GZ5A 4LJ4A 1XDGA 1EHIA 2FEPA 2JLQA 5JS2A 4ASUD 4ZQEA 4IL5A 4ETIA 1YS4A 4KFRA 2O0HA 4BMZA 2FVXA 1E64A 4KU4A 2P5TB 4LDZA 3MXOA 5CXXA 5JWHA 4QVIA 3D2AA 2NYAA 4AMBA 2MT9A 1DZ3A 3EEYA 3G8BA 3M9LA 1XMXA 3IPXA 4YRGA 4M1QA 1VPDA 1QFMA 1V39A 2A3RA 2ZE8A 4GNRA 2G9NA 2DBRA 4DLBA 3CLUC 4TRMA 3AR9A 1L1EA 1OWMA 5BMVA 5AW3A 5JALA 1RYMA 3I2HA 3WK6A 1EIZA 2OECA 4Q24A 3AHJA 3A6HA 1KO4A 2V96A 1TGVA 2B2CA 1HDEA 2OCXA 3AERA 5DEIA 4FOPA 1MAWA 2P9EA 1GRNA 3LC2O 3TOXA 2QE7A 4ZHQF 2P90A 3TDKA 3Q3IA 1KQPA 4KQFA 1ML3A 4RA9B 2LZ0A 1TZCA 2ZE7A 1AK2A 3BAZA 3ZHQA 4IXNA 1X9HA 3HJNA 4OA8A 2VHZA 2WYVA 1P3Y1 4B73A 2V58A 3ZOKA 2AXNA 2IX9A 2JGNA 4CZ2A 1M6VA 4NMXB 3K20A 2QR5A 1PJLA 2DWQA 3U7QA 4HDAA 1P72A 1YVEI 2BEUB 2RGGA 3KTDA 3OMLA 4MV3A 2YNMD 2WICA 3CF0A 2V45A 4LXQA 3MTIA 5I4IA 1SA0A 3A6LA 1MUUA 3ROGA 4KREA 1JDBC 1B14A 3D7KA 4DAOA 2ZYHA 3BD6A 4MINA 4DBLE 3O8OB 3F73A 1WQ4A 4UUPA 3NHRA 2GXQA 3OJWA 2ZRLA 4OQMA 2R44A 2W6JA 3TNLA 5FOUA 1Z8NA 1KETA 1DNPA 2VCEA 2GN9A 1YJBA 1D03A 3P45A 2Q6VA 1GEEA 4XQCA 1Q0LA 5DX0A 1GAXA 4EW1A 2XD4A 4PONA 2BCJQ 1DQPA 2ASVA 2IK8A 3QXXA 5IK2D 4RHCA 2RD2A 3I04M 2UVQA 1Z2CA 1ELOA 5CURA 3WLQA 5K5EA 1P9NA 1Z2NX 4BWGA 1GQFA 1X7ZA 3KZNA 3RHZA 1RC0A 3WGMA 5CB6A 1B00A 5K0SA 4LKRA 2J1LA 1QCDA 4G1EB 4MV8A 2GR9A 3UZUA 3NLLA 4MA0A 4EB3A 4F96A 5A4FS 2A7XA 3UB4A 5IAEA 4QQNA 4ROTA 5FOQA 3ICQB 1T8WA 1SHTX 1J49A 1U5BA 1S4QA 1JG3A 3AVTA 3W5AA 4L50A 4LY0A 3K6JA 1MAVA 4AP5A 1BH6A 2PZEA 1NSFA 1JAIA 3AUJB 5REQA 3TZHA 5FD8A 1DJPA 3F9RA 4O6VA 3AUFA 1EVKA 1VB3A 4GMFA 5FA6A 2CNDA 3PHGA 4LVCA 4O08A 3WGLA 2WABA 1IHOA 1NVBA 1YS2X 4OGGA 4HQKA 4MULA 3L1KA 4XW2A 3HO6A 3WDMA 1T5IA 3G0IA 1RXVA 3JYOA 4UJ5A 2C2OA 3RU9A 3OPYB 1ZZEA 3DPIA 4DLPA 2XQVA 2JPDA 2GM9A 3PE4A 2BJHA 4JELA 1C30A 2WSBA 3RHTA 4UHHA 1MTZA 5THQA 2V9PA 2VC2B 4NOKA 1QVRA 5FYQA 3RUIA 1GY8A 5B36A 1BKDR 2EYUA 2GN2A 3PWKA 4P93A 1KE2A 1N2BA 1SU6A 1XPOA 2VPYA 3EB9A 4FU0A 1EYZA 4RM2A 4COKA 5BW6B 3IDQA 1DPFA 1M5TA 2GZHA 2Z3ZA 1UC5B 2ATVA 1ZLYA 2XECA 1JLLA 2PR7A 5DM70 3E70C 5KOIA 1JI3A 2IYRA 1Z9BA 2BCGY 2CYCA 3AYZB 4JUDX 3O4HA 4DC0A 1O0BA 3FNRA 2J45A 4KYIB 4BNZA 1EDZA 4JR2A 3LCRA 3M6VA 1RTTA 3BF7A 1QYCA 4O2RA 4WT7A 2IUSA 3CZCA 1CQWA 3AONB 1NW9B 1TW3A 2GBGA 2ZJ6A 1OBOA 1E7QA 3OBIA 1T43A 1OPXA 1C9NA 4PYIA 5FO0A 4CLDA 2CLFB 2PUVA 4DR4B 5BUCA 1EFVA 5DTEA 3WG9A 3M1IA 3Q9NA 1A7UA 1NQAO 4Q4DA 4YXFA 3T06B 2X22A 1RLIA 3K31A 4UEOA 4I1UA 3TL6A 3L8CA 1VIYA 1QRDA 5DYYA 4D4IA 4YQYA 1VDMA 3QHAA 1XA3A 4L76A 1H69A 2FMUA 3H8WA 1CERA 1D8TA 3M0EA 4YA6A 4DIFA 1F6BA 1APBA 3TMAA 1LI4A 2YOHA 3WJ7A 3NANA 5BMVB 5FTWA 3WGYA 1SVSA 3PIIA 4OBBA 2I3DA 1GPDG 1MOZA 2CWWA 2F1HA 3FPLA 4I55F 5LBTA 3AERB 3TLXA 5HZHA 3O91A 3GGCA 4HK4A 1QB7A 5GY7A 3FSGD 1TF2A 1QCZA 1VGRA 4I1VA 1Y4UA 4PFJA 3RSSA 5AKXA 5LQCA 5IKXA 1BYIA 3IXLA 3KOWA 1VBMA 1ZAYA 3F67A 4X44A 3KJHA 2CKDA 4RW0A 4TX1A 4AJNA 2VOJA 3D4NA 4K2HA 2ZQ5A 2QM0A 4XUGB 3UWKA 4M9SA 2B98A 2DVMA 5D6OA 1XG5A 3WBJA 3ADOA 2NXJA 2YVKA 1M6VB 1WD5A 2QPTA 4AY6A 1BDHA 2GN6A 4HB3A 4TYNA 1JWBB 4LWZA 3U7QB 1N3LA 5CM9C 2OAP1 4KKVA 3K4HA 1D2AA 3L49A 5EKUA 1MH9A 1D5CA 2CNLA 3JYNA 5BURA 1SA0B 1QSGA 3AEZA 3QUSA 2W2LA 1W47A 4BO9A 2GPYA 2VA9A 4L6CA 1E3IA 2CUTA 5ELLA 1PWZA 521PA 4HOYA 3KWJA 5ADHA 3SKVA 3ZJ5A 1Z5ZA 4I8XA 4FIZA 3PFNA 4H31A 5COAA 2Y76A 4Y0NA 2DP4E 1PG5A 3OQHA 4IIDA 4WD3A 3WLMA 3MILA 3EUEA 1U9CA 3OKPA 3KOXA 4YRJA 3TWOA 2XVAA 1XPJA 2A0KA 4EY3A 1XOIA 2R8EA 4DLKA 1H6BA 2AG8A 4DA4A 4C07A 4F93B 1RM5A 1X7ZB 1NR5A 2DBYA 1DQNA 2EFDB 3IE2A 1UAGA 4IHJF 1Z63A 3L41A 2ZCUA 3BEDA 5HUQA 2JIBA 1B43A 5TEWA 1P7PA 2HCTA 2WA2A 2YR0A 3E27A 4Q01A 1U5BB 4WW0A 1W48A 1PBNA 3HZZA 1DJNA 2QTFA 3QG1A 1JHXA 1BXGA 3VO2A 2SKCA 3GP5A 4Q3BA 5HKBA 5REQB 3HDYA 1CULC 1QIJA 1XVVA 3NB0A 4IZOA 4C4OA 5KNCD 1VG1A 2ZS9A 5AICA 1YXMA 2G4LA 5EQDA 1BMFA 4CMAA 2IPXA 1MAHA 4CI0B 1XA4A 2I0FA 3GK3A 4WTOA 4X1OA 2O2IA 2W6ID 3SOPA 4PG6A 4MWGA 4RXMA 2J9XB 2HD4A 4YP6A 3VYWA 5B3KA 1YZQA 1HX7A 1UEIA 4OLHA 2IWHA 2RG1A 4DA0A 3QE0A 3KDPA 1NURA 2QG6A 4PQYA 4F2GA 2PQ6A 1C30B 4K0KB 1OJ7A 1QF9A 4I9GA 2DUMA 4MI9A 3GEHA 3SSOA 4M1WA 3GLIA 3GLKA 4CMEC 3PIRA 5EINA 2DM6A 5FUBA 4XIIA 1CRPA 1WSDA 4L5AA 5DGHA 1WSBA 2HRRA 1JLLB 2NNWB 3BMCB 4MKGA 4O2LA 3SZUA 2WIGA 3JWIA 5DHUA 2Z9BA 1TNDA 2VRBA 3RVOA 1E6LA 1O1YA 2NAFA 3BMQA 3GGJA 3EZGA 3KAPA 5HKLA 5BNFA 1S2LA 2IF0A 2BMJA 5KNBD 1M2EA 1M6NA 1DG3A 2JGEA 4BLSA 1PSZA 1FUUA 1NVUQ 3LQRA 3HJCA 2YJZA 1CF9A 1W4CA 1YNSA 2JARA 1KZ6A 1VRCA 3EG5A 5JD6A 5JRDS 2XXAA 4L08A 4L27A 3DKKA 5T4FA 1EFVB 4MHSA 1VE1A 2WDPA 2AUMA 4TXNA 3KYDA 2FPSA 1SC3A 4UJ3A 5DTMA 1O54A 3RS7A 4QOHA 3VR5D 3V9AA 4KSYA 4R2HA 4EG0A 1VSQA 2ACVA 4G9EA 4J0EA 4JI1B 4BMYA 1Z6XA 5I5GA 3VVLA 1J22A 5DT2A 3O1JC 3SC4A 1YS9A 3PPWA 1E2UA 1K86A 2DWOA 2ZJOA 4ODIA 4QATA 4RVOA 4MWOA 5EJ9A 3EYWA 1JDSA 4O2AA 1H2YA 1QAQA 5CXUA 3VZDA 3ESRA 5DIFA 5DWQA 1LDNA 3DP7A 4FILA 4BVBA 4C0KA 3WA7A 1Y7IA 1XP5A 2C5HA 2IUEA 2HJWA 5AI0A 4CCYA 2D6FA 4GEKA 1ZG3A 2M6SA 5GAJA 3S68A 4CG0A 4EOGA 4KR6A 1QF7A 1X7DA 1NJGA 3BZUA 4HH3C 3T5GA 2WVHA 1EWQA 1MG5A 4J6EA 5K8LA 4DQXA 5FUWA 1D6MA 1QO0D 2NYVA 1YA6A 4OJQA 4Q1VA 3ONWA 4BKPA 1E5VA 5ALEA 3OLQA 4L4XA 1CUYA 1CZNA 1D8AA 2QMUA 3A0UA 1JAYA 1QVZA 3A04A 4LXTA 1UMCA 2QMZA 1CY2A 4IV5A 4UBOA 3NVMB 4I1IA 4WLEA 5C53B 1EQUA 4UNSA 2W2OA 3D5TA 3L01A 3T7AA 1Z06A 1MENA 2QSUA 1DDGA 3EW9A 2ZTHA 4KXLA 4W7IA 1JQDA 4KXQA 4YRQA 4DNPA 1CU1A 1ID1A 4ZAYA 4OM7A 4D96A 5DHSA 2QNBA 5AW9A 3SBEA 1QDEA 4HJRA 4YYZA 1ONBA 3G6WA 7MDHA 3HPQA 4TSRA 1W4RA 1Y6ZA 1GVHA 4N5HX 3LAWA 3R3YA 4NP6A 4IRUB 4DV0B 1CS0A 2WU3A 3L7YA 3THRA 5EZYA 2GA8A 3FUUA 3R7AA 2HADA 2JAPA 2FWPA 3D6FA 5E8RA 1FP6A 2HC9A 2VFAA 3VV2A 5H4GA 4R51A 3DOCA 4CF7A 3BTOA 2VJAA 4ZFNA 3M49A 1UIRA 2R8OA 4KMRA 4CL8A 2H8KA 4TVOA 4LS3A 1QRSA 1LLFA 3D8TA 2QGZA 5E2BA 4YAIA 1H2FA 3P8ZA 1BXGB 1M72A 3RT1A 2BGKA 1MEEA 1NUPA 4MTCA 5ICGA 2YUIA 1NZDA 1I01A 5IBPA 4DLLA 4NCIA 1YFLA 1O8BA 3T7KA 2QIOA 2GZ3A 1P6UA 3PNPA 1WPXA 2FE4A 4RTQA 4W1QA 2EKDA 1JHQA 2VHTA 1BTOA 1V8ZA 4ARUA 4UD6A 5JOQA 1QOQB 1XRJA 2ZZNA 4G89A 3UMJA 1ISFA 2O7RA 4PO8A 3GBVA 4F97A 4JJZA 4H0CA 2P9YA 4C5BA 3H5TA 3Q7EA 1K7EB 3KOUA 2ERCA 2AKAB 3HHEA 3PFWO 3QBJA 4UVGA 3UK6A 4DDUA 1AMOA 1PZHA 3DOFA 3OT1A 3W5SA 2E48A 1MT0A 3GLIB 4KR7A 1G98A 4C7MA 4D0LB 5A4AA 1XQWA 2EQAA 4IUBS 4UTNA 1U63A 2PX3A 3DV0A 3I09A 1JBKA 1SUFA 1HDZA 1O5TA 1Y1TA 3DCIA 3PYXA 1JAZA 1WABA 1H4TA 1CKEA 2QL9A 3FPHA 1X42A 1FFBA 4A0HA 4BRUA 3SXUA 4DARA 3A6PC 2BFFA 1G8PA 2HNBA 4ZV7A 4LF5B 4IR7A 3BMQB 4LQCA 2J3IA 2H07A 1GA1A 2OCAA 2WTXA 3HB5X 4MVWA 1S9DA 3JPYA 5DOVA 1XMJA 3D6AA 4RELA 1JEJA 4KWIA 2H00A 3T5PA 1NF3A 2IBSA 3T7RA 2QN6A 4HV4A 1ZUNA 2HX1A 5JQGF 2XXAB 4B34A 3BCRA 3GLFA 1K7YA 1VL6A 4WQMA 3KYDB 3STXA 5IJXA 1I2CA 3BDIA 1YDEA 2PLWA 5H68A 3SIRA 2Y1OA 3UJNA 3KJXA 2Z6VA 1Z7WA 3HP4A 3LHIA 3UHPA 5I8ZA 1MU0A 5K6TA 1W2WB 2QXUA 2F8TA 2ZKIA 3F8WA 2E4VA 4IIXA 3JD2A 3HUDA 3CEAA 4C2UA 3BXGA 4O2AB 3S8MA 2V7PA 3KJNA 1Y9AA 5CT6A 1DJQA 1UM8A 3L4EA 1KH3A 3D64A 4CCYB 5BUZA 1ZRSA 4EHFA 2V3WA 2GF0A 3D2BA 1R64A 4OMDA 4LJSA 5JI2E 4ID3A 4ZHQA 4F84A 3MNFA 4MQLA 4PC2A 5GONA 1NW4A 2IFTA 2N42A 4X7MA 4HQOA 4LJKA 3L7KA 5H16A 5AXAA 5AHOA 3UK2A 1CUBA 4O4JF 4M9XA 1G64A 1LX6A 2FZEA 5T4BA 3IP3A 5IUKC 3KSAC 1SKAA 1YB4A 1UMCB 4MI1A 2HLDD 1BKYA 3BRQA 1GT91 2D5BA 2Y1DA 1QHHA 1UWVA 2VJDA 4EDFA 1E2LA 2WYOA 1OIWA 4QQFA 3VNBA 1NRJB 3MSCA 3L3BA 3PPVA 5ALPA 1SVUA 5KVSA 2CD9A 4CT4B 3Q7SA 3DL0A 3QEJA 4L5BA 4XDYA 3ZY3A 5I8WA 4ZWNA 1U7ZA 4FNAA 4BUJA 2CSXA 3KYBA 2I8LA 3NBZC 1IOVA 1X7WA 5JASA 1C50A 4R2LA 2IXEA 3OKCA 5EZQA 3GZTB 2DT5A 1I94B 1O94C 3MGGA 3TUIC 1P45A 4AN0A 4LPSA 4ER7A 1NIJA 1AC5A 4CCSA 1JEQB 2HCRA 4GLBA 2XJ4A 3BRWA 2XQFA 2PH1A 3WXMA 4M7OA 5JQGB 1IC6A 3A9TA 1UBTS 5D5PA 3GEIA 4IJQA 4GUAA 2XVZA 5FAKA 2ECQA 3NS7A 4NJOA 4NU8X 1E77A 2O19A 3R3UA 2PE5A 3ZK9A 3S99A 3FZQA 2C2MA 3E4DA 3GVPA 4Q9JA 4R6XA 3RLFA 1YMUA 4KQHA 4JL8A 5KX5A 1XJ5A 1S2IA 3TM4A 4X92A 1CZKA 5FI5A 1BYUA 2JFZA 1W94A 2OHVA 1A04A 2C03A 4FYYA 1CR4A 3EGCA 4OFWA 1TMGE 4JLSA 3JCZA 1ZWLA 2O8VA 4JOBA 1BHSA 4CKWA 3DE5X 5KOYA 1K89A 1K68A 2QMOA 1DBIA 3WR5A 2W58A 1U1EA 2BC9A 2Q9BA 2WT4A 1OHHD 3Q7RA 2JLAA 4M49A 4JLVA 4H7JA 4QASA 5CAEA 1CS4C 1FC0A 2DBQA 1M0SA 5ER6A 1U02A 3ND9A 4X1IA 3WWYA 2WD8A 2QRLA 4AECA 3R5KA 4AUKA 1DQRA 4LRYA 1V2GA 1OLXB 3OT1B 4JXJA 1XNQB 5JZOA 2C5LA 3C48A 4Y7DA 2I6GA 2WMYA 2WV7A 4Y2XA 4GLFA 3UT0A 4N41A 3ZCQA 1DC8A 3EFHA 4EAAA 4Z8YA 2FXVA 1GDHA 3G9XA 4MWBA 4A0RA 3FCUB 4EYQA 3JTEA 3RUAA 4EPYA 3P0FA 2DPMA 2IZ1A 1PG0A 2G9QA 2BGUA 1HDXA 2XYRA 3BSFA 3SXUB 8ATCA 2AC2A 2BFFB 3PVCA 2FWIA 3L0SA 3L0ZA 4H7PA 4RWEA 4Z4FA 4H7FA 5DNVA 4CEHA 2EP5A 1JKJA 2OXCA 3C3BA 3IP7A 1SUEA 2VQEB 4FJ1A 3NHKA 1ZUNB 1BDBA 2R8XA 4FLEA 1QNLA 2HSJA 2X9VA 5CCXA 4UPVA 4ITVA 3GLFB 5H3CA 2E5FA 4FEYA 4L9WA 1L2TA 3PQCA 5P21A 1TRHA 3EMDA 4YJ2A 5F2KA 4ESEA 3DFUA 2A2ZA 1F06A 5LBUA 4C08A 3HGQA 4UOQA 4CLEA 2OG2A 1PUJA 5EJ7A 3LFUA 1G7RA 2AJBA 1MC8A 1MOQA 3GQBA 1M10A 1RP1A 3GDOA 1Z26A 3AQIA 3KT8A 5BYBA 2XA1A 2AOTA 1SK9A 2WJJA 3QYJA 4G24A 4WASA 1W0KD 3IKLA 3OCWA 4Q19A 4QODA 4U02A 1Z4OA 2C58A 4HLUA 1MB9A 3QVTA 2O6HA 3KSMA 4O5OA 1X3SA 5DF1A 3UAWA 2Z5VA 4KXUA 3LUGA 4KL8S 4C2AA 2JI9A 4HNHA 2EKLA 1LKZA 1Z56C 4TS9A 2JD0A 3NX4A 2JKZA 2BFDA 3HLYA 4OXRA 5KDOA 1Z83A 3JXEA 5CLQA 4YCLA 3MLEA 3CCFA 3PUXA 5DTQA 4ZHQB 2CXRA 2JH9A 1C7FA 2XYGA 5GONB 1JWLA 4G1FA 1TEHA 3DFZA 4TRNA 2IP2A 1K98A 2WAMA 1YU6A 2IGBA 3HQ4O 4WK2B 4UPDA 5A04A 3RH0A 4IGFA 1BE6A 4HB2A 1JTVA 2JGLA 5ARBA 2QRQA 3L0IB 5LVAA 1QHHB 1C1DA 1VJTA 4WXMA 2W42A 3KKLA 1ADYA 3GPLA 1ZEJA 3MTJA 1DOHA 1XZHA 3NBYC 2A5DA 4E3WA 3GVCA 5EHQA 1AUXA 3BILA 1VIDA 3I4LA 4QBFA 2RHTA 2V6MA 1Y8RA 4R3WA 3QLUC 1MVLA 4K9SA 1X7WB 3O4JA 4MK4A 4E30A 3GRUA 4KMMA 1IEXA 3LX8A 3L7MA 3LPCA 1GGEA 1RPTA 4BZWA 4YT2A 4JJIA 1TT7A 1XRPA 2XNKA 4LVOA 4NRDA 1L7PA 2TMDA 4IIYA 2KX7A 2WF7A 3B89A 2Y93A 3DW1X 3BB4A 4LZWA 1WQ3A 4RTSA 1KZ4A 3ZHZA 4GMHA 1CUJA 1ZXLA 3F74A 4OLFA 4M3NA 1O9BA 2P8JA 5KCMA 1QFXA 3RU7A 2AVDA 2ZSIA 5DLYA 4KQGA 3FLBA 3S2IA 3ST7A 1PFQA 4TV9F 3C74A 2EOAA 1K2VN 3FDIA 4Z3OA 4IFEA 4TKMA 3FNGA 1Q20A 4GQBA 1F51E 2QN2A 3B85A 2P11A 3I1JA 3COJA 2UUCB 2HHHB 3O3MB 3FTFA 5KX5B 1GRVA 2QSYA 1G21E 5IAGA 3DL4A 3PPYA 5D51S 2X0IA 5F1PA 2R9VA 3VYTB 4BX2A 4EGQA 3SQXA 3O8LA 4DCMA 2OM6A 2P41A 4R1LA 5IULC 4RVSA 4TT3A 2JI7A 4PSCA 4CKWB 3NETA 4DV7B 2FSUA 5IKMA 3ESYA 4FOOA 1HURA 1GEGA 1RZ3A 3EG9A 3HJBA 4FR0A 4S12A 1HV8A 3TNYA 2NZ2A 3BGWA 4LXXA 2IUTA 4HWSA 2OCPA 1EFPA 3IESA 4MQBA 4CMIA 2B7LA 2ZDGA 2GZ2A 1TK2A 1AKUA 1JSZA 1MABA 5E4TA 3U37A 2Y1WA 4O4IF 2GH1A 2GOYA 4QWMA 1ZRNA 2NXCA 4KK3A 5IXSA 4B3XA 2WKRA 2GAJA 2OG1A 3JQGA 4F5EA 3RSZA 4FFBA 5C5IA 1EP2B 2Z98A 2PWPA 3IMEA 4YXWA 3VGPA 2WG1A 1DTWB 2ZU6A 3ZC3A 5HX7A 3E48A 3NWBA 1RCUA 3I4CA 3CUUA 3FG9A 4GX5A 3M6WA 1QBGA 1LWOA 5AJWA 1KAEA 5JARA 3E9RA 1BXRA 2C4WA 3GWZA 4ESVA 4MNTA 1XEAA 1XTUA 3CB4A 2VNSA 1JSLA 4G5HA 4PLVA 2HRBA 3B1KA 4GC9A 1JKJB 1XF9A 3EVDA 3Q1LA 1WP4A 3LD9A 3ZWMA 1JRLA 1XLTC 2MYPA 2WILA 4ZT5A 4I99A 4JNKA 1E7WA 5KJFA 4XWWA 4GBGA 1W36C 3T3PB 1R16A 3PS9A 1TYEB 2G77B 3KWLA 4YJ2B 2CB0A 3W2GA 2DUWA 3U1BA 2ATXA 4GRDA 4X1KA 4KFSA 3ANNA 1ECBA 2L82A 2WJGA 4BNWA 1T35A 1X9IA 3BXZA 3L7NA 3GQBB 2GWHA 4FS3A 1YJQA 2Q0XA 4MCAA 1CUUA 3ZK7A 5EL0A 5AD1A 5JROA 2AOTB 3Q4GA 5LU9A 2LXNA 1LZKA 1DG9A 2ZB4A 4NJEA 5HYVA 3HBJA 5LZ8A 4RH1A 1MN6A 2Q8NA 5L3VA 2HMAA 4LBYA 3KKOA 1TTQB 1RWKA 2Z8ZA 4JGGA 2ZI7A 2AN4A 4W5TA 4UD2A 4HL6A 2IIBA 4GI1A 1IVNA 3DMFA 5DULA 3KUUA 1RXWA 4M86A 5D3ZA 5BWOA 1B4DA 2BFDB 4TS1A 4UQLA 4UCQA 3ND8A 5EUMA 1JEDA 4WN9A 1SQ5A 3MTEA 2UUOA 1L8LA 3P0HA 3RSFA 1PQPA 1I13A 4WHMA 1IK6A 2C92A 2PUWA 4UBKA 3DEZA 1DVRA 2REBA 1XYGA 4GG1A 2M1XA 2ZBRA 4EEXA 3IURA 3OEHA 4PYRA 1CJMA 3MQFA 3TOSA 1N9ZA 2ODNA 1ISJA 2BF7A 1PZNA 2OGUA 4X63A 4JR1A 4M98A 1C1HA 3DB1A 3DLPX 3OG9A 3N39C 1AIPA 1C1DB 3VR6D 4KUHA 5LQMA 1ISRA 1KSHA 3FFAA 2Q45A 1E0DA 3LLCA 3LSTA 4MW4A 4R4JA 2WPDA 2Z08A 5I3CA 1XCLA 2R1TA 3N6XA 2H5LA 1RXCA 2OD2A 4XJVA 4AZSA 3DMGA 1Y8RB 4N65A 2WG2A 2H31A 4GM0A 2QR3A 3IPCA 2F17A 1GL9B 3QVWA 2NUAA 5FPHA 1H0KA 1H1TA 4TQ9A 2FV8A 1DO8A 4LRUA 2FW0A 3BKXA 4G63A 1UBEA 2IV7A 1GTVA 5NULA 4HEJA 4F46A 3OLVA 2X6TA 3VH4A 2O8NA 3DBVO 3GUVA 5DB4A 3VBCA 1KEVA 1VBFA 2VBCA 3KO8A 1BMQA 1H8HD 1YZVA 5HMMA 1B93A 4LC0A 4UU7A 3ZNNA 1NF2A 2AV6A 2NSDA 1AURA 2BCEA 5KVAA 3IHTA 2JBHA 2R751 1W73A 3IFSA 4D9MA 5LB2A 4RF5A 4YCMA 3CU5A 1NLFA 1MXFA 1DIBA 3CH7A 4PY2A 4KYUA 4REMA 2B94A 2JI4A 2NZUG 3NV7A 4WOJA 3HCDA 2Q6OA 4WZAA 3WYGA 2GEVA 4K40A 5ALQA 2W83A 3WNZA 2HJRA 2EATA 3WDSA 5ALVA 3VRHA 3EG9B 1L7EA 2UXBB 2CXNA 4KIUA 2HMSA 1XNGA 3PHJA 5H02A 3DXFA 1EFPB 1S02A 3AY7A 4CMIB 4JVOA 2GPWA 3LJKA 3CSDA 3LGAA 5JJKA 3HNOA 3ITDA 4FZ3A 4KNWA 3V8NA 1T29A 1MABB 1W8DA 1C3EA 2QMQA 3TRKA 2VNIA 5DSTA 3PBKA 3PQ5A 1HSOA 1OR8A 3DMRA 1LBQA 3Q8MA 2D1RA 4FFBB 3IOCA 4AMZA 3HGTA 1EMDA 3B38A 1F4VA 2ECFA 4IZIA 1VKRA 4CR6A 2QUJA 4IIGA 1T3TA 1UZNA 1U0GA 2WIBA 3L40A 1T5SA 1T9CA 1QMPA 3HYCA 1BXRB 5L8VA 1JHDA 1Y4AE 2EFYA 2HB6A 3HCEA 4A0GA 1JAXA 1WZNA 2VTEA 3LRPA 5C1PA 5CP8A 1FE8A 3ESXA 3RAGA 1YULA 3SIPA 5HQJA 5A5VA 1F5NA 2YYYA 3DTTA 3NO4A 2CLEB 4R2KA 2BM8A 3E2PA 2E6UX 3HO1A 2H65A 4EPRA 4NFLA 1FBNA 1Z2EA 2V98A 3NRBA 3UYKA 4MUFA 2R11A 3G2KA 3FXAA 5JYEA 4V1CA 5L51A 1RHUA 3NG1A 4NYJQ 3Q2OA 1XQ6A 4FE4A 4IDNA 4BKOA 1MHTA 3HV0A 4X1KB 1FMLA 4XIGS 2PA0A 2JHFA 5K3OA 2CCJA 1NHWA 3K09A 5FL7A 5K0GA 3FOCA 3KHUA 3IIJA 3PQ8A 4JC4A 4U8HA 5FI1B 3X2EA 2QJTA 2OHGA 5C8VA 2Z6AA 2Q50A 3QZUA 1MGOA 1CEYA 4NJEB 1P1KA 1HE5A 2DHCA 3BGOS 3NNNA 3OHMA 4YS6A 2XIJA 4YNBA 5JMPA 3JVIA 3V4FA 2H4XA 3DWEX 1ZD4A 2FR8C 3BHJA 3PUYA 3OO0A 1LBEA 2J07A 2QQEA 2ZSHA 2XMSA 4BLTA 2NXNA 5IT4A 4KAAA 1WOYA 4DIDA 2BTEA 4FQ5A 3ICOA 3KQWA 4R16A 1XMSA 1P4GA 2UAGA 4WN9B 1ISGA 1WHSA 3WBBA 2CDNA 3DC7A 1LK5A 2QQGA 4ZVTA 3COWA 4HZUB 4Q05A 1SC1A 2AQ8A 3QQPA 4U7TB 4F38A 4D79A 1R0CA 3AR4A 4PWZA 2QDKA 3TPCA 4ZGWA 1JIKA 1D2NA 2OZVA 1BC5A 3TSAA 3AF0A 2CUNA 4AJ2A 3S2ZA 5DNDA 4DRZA 3RTGA 3HA5A 2R8ZA 1NR7A 1CR1A 3D8HA 3HU2A 3KCNA 3H2KA 3PEFA 2PQ2A 3HR7A 4UUNA 3B6JA 4R8KA 1M7GA 2CK3D 5ULLA 3OT4A 5EXPA 2DSNA 3KFVA 2JFNA 3TEMA 3TQSA 3EUFA 3LW8A 3ZBTA 2PUGA 1Z17A 2OHXA 3K8OE 3LDAA 4MGEA 4ZAGA 1A2BA 1K1EA 2R1TB 2A5JA 2PYDA 4EPWA 3HU5A 4YRKA 1ZBDA 3WLRA 1ODCA 4KW7A 2XQJA 3MD9A 1ECPA 1RAEA 2KW5A 2B4YA 4DLSA 5DLQC 2FWBA 5HS4A 2I7TA 2NU8A 1Q0QA 5D2CA 1E99A 1CJVC 3CT6A 3NFRA 3TNDA 2NUAB 3JYPA 1UADA 2G9VA 3DE2X 3KOOA 3WYAA 2YV2A 4Z49A 3LQYA 4FYIA 1H3EA 2GASA 4KIJA 3II6X 2QN3A 2I99A 2P6PA 6AT1A 1NP3A 3F6EX 3FDZA 4FSXA 3N0VA 2FW8A 2GCGA 1KDZA 3WLEA 2CLCX 1IE3A 2CLHB 2G6BA 2WA1A 1Z0JA 2PXXA 5G3ZA 1OV4A 5DASA 2GHTA 2JIQA 4RMIA 1JJFA 3EQ2A 1J33A 4FN4A 1QFJA 3WFIA 1UXOA 2R1VA 1QZ3A 2H57A 3L84A 4FFWA 4KYVA 1L4GA 4CXMA 1LPAB 3CF6R 1PQ4A 3P4YA 2ZUUA 2B2NA 1TAQA 1W19A 4WI1A 3LIIA 2AQIA 2VYVA 5K4HA 4GOMD 4LYJA 1LS1A 4B84A 4M7PA 2QUIA 5FYDA 3TRFA 2R6R1 1YE3A 4CODB 3ANSA 1DL5A 4HMOA 2PLRA 2QRHA 4IM7A 2P9JA 4IDQA 3WQQA 1PWEA 5ALKA 3LVQE 3SLGA 3TSOA 4CI9A 1UP4A 3EMKA 2W00A 1XEXA 4P5EA 3M5WA 3STYA 2SCUA 5ALYA 4EYOA 1JHZA 3QI2A 4IEIA 1B8NA 3A1TA 5CFZA 2NP6A 5HCUA 4GPEA 2YW2A 3UGQA 3K1ZA 3QFSA 3MCVA 4AWAA 5JHHB 4N49A 1SBHA 5DW0A 1CHNA 4KDEA 1BN7A 2JIOA 4ZU3A 2G9ZA 5EJ6A 1K3FA 2KWIA 3EVTA 1N6NA 4KO1S 4PC6A 4Z2YA 5JXIA 5AR1A 3WIBA 5JAQA 1Z74A 3MYRA 2IH2A 1FSZA 4CLXA 5CLJA 1NP6A 4C3UA 1A27A 2EJBA 3INRA 2R6HA 2KYRA 1LQTA 3N86A 1KI1A 4M1KA 4QUHA 3PFCA 1V5IA 1JAHA 4ME6A 4PO9A 4TL9A 1YIDA 4FI3C 2XF8A 3Q0TA 1TA9A 1W9MA 4GWLA 3CVXA 2OCIA 2JNWA 1DIHA 1KPGA 2WJHA 3FY4A 4RPJA 3ELUA 4L4SA 2BVNA 1VL5A 2JK1A 2GPJA 3M6MD 1WOMA 1YZYA 3H2ZA 3JQAD 4YYEA 5A6VA 4J2TA 1JQEA 5GV7A 5TF0A 3I32A 1A8QA 2ZAGA 2EKBA 2E5WA 3SK0A 4C4XA 1G8SA 1NP7A 3EQ6A 1QH1B 3FHTA 1F0YA 1I3OA 2ORYA 4JI8B 1TOAA 2H2HA 4YMSA 4GOND 4M99A 1ZISA 2AN1A 3IL2A 2HHLA 4DM7A 4N5DA 4WBSA 2H2FA 5HZGA 3R3ZA 1I9CA 3DVSX 3P9XA 4Q15A 1L6RA 5I4KA 5GQSA 5K8CA 3N7UA 1J2RA 3G9TA 3UG7A 4QUEA 2ZQYA 3RIXA 3MTDA 3T7IA 4DGSA 2D59A 3LT1A 1IN4A 4NNPA 1Q6YA 2EFJA 1ZOOA 4I2VA 4D0RA 5LD2C 5IF9A 2O2CA 3ZI4A 3VO9A 2PFSA 1WHSB 2W22A 3OZBA 2PUEA 3SHQA 4TV8A 3UG6A 3VDMA 5CG2A 4A1OA 2VHXA 3UICA 3ZY4A 1P1BA 4C4ZA 5JSFA 1N34B 4H08A 1FDOA 3RROA 1EDDA 2P9ZA 3RAJA 2FSVC 4HQ6A 1VJRA 3TW4A 2CF6A 1MO4A 3L1UA 3EDYA 5EIAA 3NTXA 4I4NA 4YQZA 3SVZA 1ZOSA 3LKBA 2XCIA 4GX0A 3VU0A 3HL4A 4B3FX 5KTNA 4S2EA 4DJTA 4JQOA 2G1UA 4JENA 4HDQB 4BBAA 2PRIA 3MAGA 5I47A 2FUNB 2JDID 5KINB 2WSYB 3PQ7A 3OC6A 3PGJA 4R98A 1ZLXA 5A2QA 4V24A 2HTEA 2PO7A 3JZDA 1ABBA 2G70A 2BI8A 4IO0A 2RAUA 3CINA 2NU8B 5J5VA 4UDOA 4DV4B 4DCSA 1LNQA 3TFOA 3J81k 3QX7A 3UA3A 1P1HA 2C88A 1A7AA 1ZH0A 3LLUA 5GP1A 4XE5A 2AI3A 3FDZB 1VPEA 2CC2A 4UQOA 4EB6A 1EJ6A 4CFYA 1J39A 3SJ7A 1DQZA 2EJWA 1OB2A 3HDJA 3K9NA 1XNRB 1NNEA 1UBNA 4ASUA 3O2QB 4RENA 3Q40A 4C7XA 4CR7A 2Y05A 2R1VB 1OFTA 4GKAA 4GMGA 4L51A 1WZEA 2G71A 1X0XA 3ZU5A 1YF3A 3PVZA 3KBOA 1SULA 1WMAA 2AJCA 4PYMA 4D42A 1KYQA 2Q2NA 1EJ2A 5KMGA 3UA4A 4LK3A 1X38A 2DBZA 3LLSA 2PUTA 3NWEA 4NSNA 1FCJA 2FSSA 1NKSA 3BIFA 2Z43A 4QDKA 4GKKB 1VPVA 4TKUA 1NXPA 2F4NA 1SHKA 3HJAA 1C4OA 5ALTA 5IZ4A 3GZ4A 1GPYA 3PGA1 2GDJA 1XEXB 3SFTA 4PFKA 3W6NA 2SCUB 3ZQKA 3DMDA 3RCBA 1QTQA 1AQUA 2BFOA 1N5RA 4R5MA 1DRKA 1XV5A 3VYSB 5KS2A 1N9KA 3K4QA 4YQEA 3DLTA 4Q21A 4XFJA 5KYGA 3HCFA 3M4ZA 4GWKA 3OWHA 4TLCA 3G2QA 3UPUA 2JBAA 3WGNA 4Y2JA 1AS2A 1JL3A 1TVMA 2BSAA 5CEFA 1MT3A 2NIPA 4RVGA 3ADKA 3GNLA 3PTLA 4HAOA 1Z7GA 5T67A 2EBUA 2R7NA 4DMLA 5LXTA 1P29A 3MTQA 1PJZA 1YB2A 3ZHUA 1KQFA 4MV9A 1IVSA 2WJVA 1OXSC 2Z95A 3O92A 2VP6A 2RC5A 1Y9JA 2YNMA 1GO2A 3T3EA 1CUXA 3DLBA 3RAFC 3NBMA 1KI2A 1V3TA 4EATA 4MQ4A 1GA6A 1YUNA 1BD4A 5BQ5A 4EVIA 5FTKA 3AHFA 3ZHRA 4B44A 2G6TA 2PKEA 1B0UA 4HNTA 3MJCA 2VUSA 3A4VA 1LQUA 2RJ3A 3EBOA 3MXTA 1AF7A 3L06A 3ROKA 4Z7OB 2GO1A 2OYSA 2EBWA 5DCUA 1GSOA 2XUQA 3Q3VA 3ZWAA 4DRYA 2NZJA 3GFPA 5EGSA 2G1PA 1Q0PA 2H1FA 4I66A 3RS8A 4YRSA 5A0VA 1WQ1R 1IN6A 1RKBA 3KZKA 4NWIA 5IK2A 2HUNA 3X1KA 4FSHA 1OZHA 2B7BA 3V8RA 5MGNA 2GUGA 1ZH2A 1GCUA 2QAIA 4BNTA 3HJRA 1YKFA 4MUAA 3E23A 4OL9A 5ECYA 4C43A 1ZU4A 3RBVA 1WL8A 4MCJA 4AZ3A 2BGWA 3TSYA 3CTPA 4J07A 1PW7A 1F48A 1L4MA 1LI5A 3P9RA 2RBEA 5EWJB 1B8PA 4QUIA 4CFZA 5IXYA 1SBIA 3OEED 1IQRA 3GXBA 4KGZA 4TV8B 1EXNA 3G1WA 4E13A 3T61A 5J4VA 1IQUA 3B6MA 3EIHA 4D3YA 1KIFA 5AQ1A 3QA9A 5IMSA 3ILVA 3K72B 2PKWA 3QOWA 5EGNA 4DDMA 1MOPA 2FJPA 5G41A 3F2VA 1QFYA 1SN7A 2F1IA 3OFJA 1Y9DA 5GINE 3LUPA 3EWSA 3CVUA 1KVUA 3ZHOA 2Q41A 2OO5A 1CB0A 3T4PA 3OCJA 1Y33E 1Q1NA 1RHRA 2WJPA 4Q12A 1SOVA 4UAJA 4F6LA 3HSKA 5KEIA 1PLLA 4R7TA 4AUMA 5F9FA 4EM6A 3RIMA 4WOCA 5JLJA 3QIAA 4F1WA 4M7RA 5EZ6B 3D81A 1J9ZA 2CKMA 5AKIA 3UWSA 1VJCA 4OHUA 1O0CA 1EXDA 4BEVA 2VSFA 3HLKA 4TSKA 5C3UA 3RFXA 5DBGA 1I2BA 3NJ8A 1SD1A 1RPNA 2UVDA 5A02A 2GX6A 1NBWB 3I9NA 2GWRA 5DRYA 1DFIA 2QVGA 3EOZA 4QUGA 4DZRA 4EF4A 1BO6A 3H6HA 2YY6A 4EB6B 4BZQA 4XA8A 1JILA 4JLJA 2P69A 2IYYA 4ENPA 4MQ5A 4GL4A 3IT3A 2G5CA 1VQ1A 3WQBA 4NS1A 3V00A 4WH0A 3DNFA 1FDRA 3E22A 5BNZA 4WXRA 3E1GA 3TCXB 3PJGA 4YUXA 2O3TA 1XXHE 4M8SA 1N3YA 2CLLB 2D1SA 4K9OA 4AX8A 4E07A 2FPUA 3OZ7A 5KMGB 4O2BA 4X3CA 3FD8A 1KHHA 1N3IA 3W9BA 4ZDIA 1OT5A 2WLTA 1IBLB 3KQQA 2ZBEA 3TD2A 2V7QD 1EGMB 4ZEVA 5EHGA 4BFCA 4P58A 4TKUB 4JI7B 3OCVA 3OA2A 5GGYA 4E08A 1QONA 1T3LA 1R0YA 3EEQA 2RK3A 3DKRA 1CQIA 4YRRA 3FSGA 4FBMA 4ZMBA 1ZH6A 3LO8A 1LDEA 3OOEA 3W1EA 4ZXPA 5GIPE 4CHGA 1BQ4A 4TYWA 1XUOA 3EYAA 3RRYA 4JJFA 1QE3A 4YC7A 1T36A 4FR2A 3NUZA 1U1DA 4DG8A 3Q98A 5KWEA 1UOPA 1PX2A 4BGIA 2QTRA 4L0MA 3NTRA 3BDVA 5DOZA 2JBAB 1NTRA 3OI7A 1G66A 2B1JA 1J7KA 2WKPA 4MRAA 3CEMA 4UXJA 4DSOA 3ZE7A 2ZI4A 4I6EA 1DADA 4P83A 5DHRA 1DUVG 4UM7A 3IKTA 3LA6A 2Q0QA 1VI6A 3AESA 3VNAA 5LXTB 4OB6A 3WGHA 2JVKA 4I1YA 2ZEJA 1BROA 4D81A 3KD3A 3LXXA 5CEEA 1NOJA 4F4JA 3DZ8A 4IEFB 1QGUA 1X39A 4NU6A 5BXQC 5I7EA 4IMJB 1V41E 4WFIA 3TIVA 3GUZA 3BJIC 1ZVJA 3MUOA 1D6JA 1VHJA 3GG9A 1G5PA 1CETA 5TQ2A 2E4AA 2Q28A 5EIHA 4D4MA 3A9CA 1GGMA 1AS0A 1IY1A 2Q62A 2J0UA 2PWYA 3ITNA 1P2SA 5BWBA 3H0KA 4BMVA 2IZ0A 5DWDA 1Z4NA 3CIFA 3DDWA 4YIHA 4LDJA 3O84A 4FD3A 3VPFA 5KNDD 1A4IA 5KYXA 2JFOA 4OEHA 5SZJA 3I05A 2UV8A 1IAVA 4JBYA 1SXJD 4KN8A 4B2LA 8OHMA 5KKNB 3WISA 5IUJC 4L15A 1IY9A 4ZVSA 3T41A 3T7SA 1EPUA 3CF4A 3MTGA 3IOEA 5FNVF 3J80A 3JQRA 3PQFA 4POAA 2B5WA 4UHEA 4RCVA 3AH8A 4OHZA 4CL3A 1JX6A 4EHLA 4HEA1 5CEJA 2FA9A 4AMGA 1ETUA 1SCJA 1FL9A 2Q6TA 4KLRA 4LNAA 3HB0A 2H7CA 3FR8A 1W5EA 4RA6B 3I2GA 3RJ5A 4P9NA 1Y8QA 3B9BA 1T6BY 1JHMA 2NSJA 3H9GA 4UE3S 2YIJA 4ZVMA 2CZCA 1A9SA 1PEKE 3JRWA 4AJHA 2FQ1A 5KNCA 2IX3A 4QBTA 1VPTA 1EVZA 3SE7A 3VM6A 3HCOA 1H8ED 3FWZA 1Z5GA 4MIYA 3VO1A 3G68A 4QPZA 1XZBA 1I5EA 3TTWA 3UC9A 2E18A 2NO7A 2Q49A 3Q1KA 3ITEA 4W7SA 5U1PA 2W6IA 1V3QE 2VYNA 4GQAA 5CH8A 1SBCA 5ALLA 2PXCA 2BBWA 5BUSA 2O5RA 3FI0A 2QX8A 3CS3A 3LBAA 3AXSA 3HGMA 3TQOA 1E2IA 3FPBA 3ONVA 4IWNA 5KNBH 3WWCA 2GAAA 2HWKA 4QDOA 3ZUGA 4B7ZA 3X1JA 2PJRA 4TN1A 3PVSA 3EARA 1ST2A 4G8JA 1OX4A 1PFWA 3A3OA 3WGUA 5CNJA 3L1VA 2ZYUX 5C7IO 2G72A 2FLWA 1M1YA 1E3EA 4K3UA 3HJUA 3L7BA 2FSGA 3B12A 4BUCA 1P0CA 1WTCA 4F1KA 2NSYA 2Z8YM 2PUJA 5ALMA 2CSUA 3D8BA 2AJ8A 4ZODA 1AO0A 2XITA 2GSWA 2NGRA 4W6QA 4KRYA 2OO3A 3DWGA 4Q3OA 5CLHA 1Q0UA 3VR5H 5GM2A 5IH3A 1A4UA 1W87A 5AKHA 4IOMA 4HVAA 5BRAA 5KNBA 5LWHA 3WSVA 3PHBE 1A95A 4GIBA 1XZEA 2Z4RA 13PKA 2AQHA 2XLCA 2WI8A 1RYYA 1TRKA 2J09A 4Y9TA 5ALIA 3R8FA 3CE6A 1U9JA 4JB0A 1M2WA 2B9VA 4D82A 2J85A 3E22B 3U1VA 4E5KA 1HEUA 1FP7A 4L02A 2X58A 3LP8A 4JI2B 1SKYE 3VR5A 4FEGA 1CVIA 3QXJA 5E1DA 2WWGA 4NI5A 4JEMA 4JITA 1VLHA 1AXGA 1K06A 4CLOA 4ETWA 2ZREA 1ADCA 2RK6A 1U9IA 2X77A 3AINA 3EXHA 1K27A 3GRAA 3GY0A 4KQIA 4KQEA 4L8VA 3LK6A 2G83A 1CFZA 1XRLA 2GJSA 1DRWA 4PLGA 1CQIB 1L7XA 4Q16A 1H4QA 2IV2X 1ZKMA 2BTOA 2XTNA 5JQWA 4A0SA 4CGZA 2G3YA 4LMAA 1H1DA 1UBJS 5DNUA 3ECAA 1T36B 3AZPA 2DAPA 1DFHA 4IIBA 4H1HA 5EJGA 5J3JA 2HI0A 3MRTA 4U7JA 5FTMA 1QO0A 3OZWA 4OX9B 3FFBA 1ENPA 2C2XA 2GTIA 2PHZA 4FHCA 2W7TA 2QTLA 3AHHA 4Q1FA 3ZYZA 4X6LA 3AVWA 1G291 1NQVA 4J3JA 5AVVA 3TTXA 3RVDA 4JSTA 1CD5A 3AESB 1J2EA 4LBWA 2J9ZB 3GGDA 1FUEA 4A03A 2VXCA 3JTMA 4DLVA 1NJ2A 5EE0A 1ZK0A 5SV2A 4F9EA 2KQUA 5FORA 1FTWA 3A4TA 5JAUA 1QGUB 1ZC3A 4IVRA 1G3RA 2OL4A 4YCCA 3UMMA 5DHTA 1CJBA 1PFVA 1YH3A 1FNNA 3OVMA 4JP5A 4CM1A 3DD1A 3KJIA 1CUCA 2XA2A 4DY4A 3JV7A 3LYHA 3NHYA 1H9BA 1JE0A 3GLTA 3OOHA 3ZLJA 5TQ2B 4YRAA 4LOAA 1K6JA 2CHQA 3WNBA 4D8UA 3KKKA 1HZZC 1T1EA 2QROA 4I9HA 2J0UB 4JUIA 3WIUA 1N6IA 4ARBA 4ERXA 5IT5A 2R7AA 2REQA 3TD6A 3DL2A 2GBLC 1CF2O 3E81A 5JS7A 5E1BA 2OXIA 1TGYA 1B73A 2OSBA 2VHVA 4RD1A 3TVYA 5KYXB 3BG5A 3BWEA 2V54A 3GA5A 2QVXX 3FTQA 3N87A 4MWDA 2OT3B 5HK9A 2RH8A 5FPQA 4FDTA 2J67A 2X42A 1N6OA 1YZTA 1ADJA 2WHPA 1KDTA 1OLSA 3P97A 4N5LA 2B4KA 2FZ4A 4LHWA 3L9WA 1ZICA 1J42A 4HAVA 2Z1DA 2EWVA 2GM5A 3JVVA 4BFLA 3DR3A 1P4AA 5CU7A 1F6DA 1VRWA 3BS4A 3G3EA 2LTAA 5A7FA 4AN4A 4DN6A 1Y6RA 1Y8QB 2VVTA 5DU2A 4AJ9A 4RSHA 4P32A 1YT5A 1IU9A 2YFKA 1SUIA 1A76A 5H7XA 4ZK2A 3E5RA 3E7PA 4UHBA 4UUOA 1AF4A 3DZDA 5J1TB 1KAQA 1Q1BA 2V6JA 3TZQA 2XCUA 1DI0A 1OROA 1ZI8A 1Y3BE 5EHIA 4AIRA 1KYVA 4JUAA 4IMPA 5BSFA 4OYRA 1QIDA 3JARA 4INPA 5BSEA 1NMXA 1M8KA 1RKXA 1KC1A 2YMLA 4AQ7A 4TLMB 4N7BA 2JIMA 1FW8A 3ZDZB 3G1TA 4CF3A 1Q50A 3D0RA 3RVJA 4X91A 1OX4B 2V7UA 2IL1A 4PGGA 1K8YB 1R50A 3LP5A 2INGX 1Y82A 3ZX4A 1UXIA 1V16B 1M1YB 1RLOA 2V7TA 4JYMA 2XNHA 5KWIA 3D31A 2YC4C 2ZSUA 4IRXA 4E5SA 4EW6A 1JJVA 3TYXA 2QX7A 2W90A 5JSYA 4JDUA 3KXIA 4MUEA 5LSAA 5CXSA 4KJXA 3VR0A 3IA7A 4E21A 5AVRA 4Q7EA 3C2QA 3CUYA 1K92A 4XWGA 4IP0A 3SX0A 5CDUA 2AEEA 2I3BA 3JALA 2B4TO 3K6KA 5IF3A 1Y1KE 4FFRA 5CDSA 4GPAA 1RHQA 4PC7A 1E3DA 3MF4A 4FYHA 2QLJA 3GLHE 4HAYA 1RI3A 2Z2JA 2GERA 3H19A 3IDAA 1JFVA 2C96A 2IIQA 1M54A 1EK1A 2JCSA 1Y7PA 1YQQA 3A28A 2RCYA 1YJCA 2ST1A 2VPWA 3E3OA 3N2YA 3SYNA 4DG5A 2G8NA 4DLWA 2NWQA 4C0XA 1HY3A 3AFMA 4G8DA 3UMBA 4UNRA 3OX1A 4BMCA 1TZBA 3OTHA 4EPXA 3A9SA 2QYSA 3LWNA 4A10A 2XRZA 1KP9A 1W25A 4JOSA 2QK4A 2O7NA 3HXQA 4IHKA 3CWQA 4A8JA 1P7VA 4MCHA 3D7LA 5IPFA 1KO5A 4AY2A 4CLOB 1OWLA 5J2TF 1M8PA 4R2IA 3EXHB 1N2OA 2ZBQA 1Z0FA 5COBA 1G5QA 1QH8A 3T9AA 4QU9A 2ZW9A 4N6NA 3OJOA 3H6KA 3R2JA 4HI0E 5C8YA 3NVDA 3OF3A 1T8YA 4GHWA 3BA6A 4JVMA 4PRKA 5JS6A 2AKEA 4JMPA 4IX9A 1XCBA 1H9CA 2WPNA 4L2IA 1YRLA 2OHFA 3ITKA 2ZJ8A 3N0TA 4CMJA 3BQ9A 4XEUA 3W6OA 2OAQ1 2OFWA 2O1WA 4KVZA 2Z6UA 2BGLA 2PRKA 5BR7A 3DYVA 3S2FA 1RJFA 4PZPA 3ZV4A 1CF4A 5ED0A 4JS0A 1WR8A 4OGKA 4GGOA 1IZ0A 2XNSA 1YTLA 3IAS1 3K1AA 4H4EA 3WLLA 4A0QA 4AC9A 5FWAA 2FH5B 4DC1A 4AUEA 1YZGA 1WUJS 3RKSA 1K8QA 2HLDA 1CUZA 5D3QA 1J70A 1JE1A 3AU8A 3M34A 3NHMA 4U0JA 3SLRA 1U99A 4DRXA 4JEIA 5BR4A 3MHPA 4X95A 4BMDA 3HXMA 2H1HA 5LA6F 1X1RA 2AJLI 2QTNA 4P92A 4US2R 3CW9A 4EHKA 1O77A 3KAKA 1NT2A 3WWPA 2WE7A 1HXHA 2POQX 3UGTA 2QPAA 5JYBA 1KI7A 5CW1A 2REQB 5F73A 2G25A 4C4AA 3HKDA 3WV4A 1E0JA 4UAGA 1YKGA 2RGBA 3LXUX 4ER6A 4RVUA 5FI3A 3KT6A 4ZYVA 4P4GA 4JBHA 1L4NA 1VGQA 1Z5PA 2YJ6A 3C70A 3G5MA 2C9ZA 3LI2A 2NUTA 4BKMA 3CFYA 1M83A 4FWIB 5EQFA 3V8QA 5EJ8A 1JXMA 2X7JA 2XLBA 3GJ6A 2WHPB 1OLSB 5TVGA 2GYUA 2VF4X 5CD1A 1O4WA 2PMWB 4YONB 1VKOA 2FPGA 2VXYA 4R0VA 3W5CA 3ANYB 3KBBA 1XHEA 3GG2A 1RW4A 3DVLA 5HIKA 1PUIA 1A50B 2P2YA 5ALWA 2P4HX 1F1BA 1MKYA 2KHZA 1O6BA 5EMHA 1RYZA 4MO9A 3CTMA 1ZJYA 1UPXA 2ZYSA 5EUCA 4Y98A 3K5IA 3EPKA 4TTJA 1DKQA 2X2OA 1YQWA 1EM6A 3ORRA 3I04A 4K9LA 3PSHA 3C3JA 2OKGA 2I1VB 3TIIA 1HT1E 2ZYDA 4PVCA 3EC7A 3TOVA 3G9UA 2KLHA 2DUUA 1X9GA 4ANFA 5AW0A 1P0QA 2D3WA 3NHWA 4LJYA 3RFVA 1HUQA 3L4BA 3R4VA 4YRCA 5HRUA 1MMFB 1K7XB 1C9JA 1OHHA 2GFQA 2ZJ4A 2ZWAA 1KRHA 1NVVQ 3JARB 4HVLA 2X2EA 4RZ3A 3EEOA 1H66A 2JBWA 3FOFC 2F8LA 1LS6A 4AKTA 1XELA 3PQ6A 2ZI9A 4FKZA 3DP9A 1C3VA 3OCZA 2ZANA 1PVDA 5BSUA 5C32A 4XGRA 4FUQA 1UPFA 2VHYA 2AUTA 3ESCA 1I1HA 4NZNA 2QLTA 3GQVA 3T1HB 5IASA 3BEOA 1COWD 4MUJA 1X94A 2QY6A 2VRCD 4DJAA 2BFEA 3RRFA 2IDMA 4NBWA 1E1RD 1WVMA 1TJ3A 1WZUA 2X1MA 1Z4IA 4J1TA 3C7CB 3O0TA 3EZXA 1VMAA 5MF6A 3ZCXA 4DWWA 5DLPA 1USWA 3JALB 1I6KA 2IZZA 5K3CA 3RR2A 1EVYA 3U7IA 2WR8A 3X1XA 4BRWA 3T38A 3UHAA 2PBZA 3EQ9A 3WLJA 4RZIA 1BU5A 1KR2A 2GAOA 4Y7CA 3ZHSA 4C1NA 1MV8A 1NBAA 4X3PA 5J4KA 4YR9A 5LYJA 3S1AA 1XZFA 1AM4D 5DEOA 2O05A 1WZIA 2ONKA 4MPJA 5DYTA 3TDNA 4YRBA 3CRMA 2H4ZA 4JJ8A 2UUAB 1LU9A 1ZJ4A 3I3OA 4A8JB 5EJMA 4LFCB 5JCJD 5CB4A 5CNKA 3TBFA 1P75A 5F4BA 1KYWA 1DHTA 1W0KA 2P6UA 4Q18A 1T24A 4P5PA 3D0QA 3N8DA 1PGQA 3QELB 2JS7A 1O6GA 2O2JA 4AQDA 5C8YB 1NJFA 3N3BC 2ACKA 5LB4A 1QTIA 1SVLA 4JLPA 4MVJF 1FFGA 2NQ2C 2XUDA 4L2IB 5DBHX 2R0QC 4E4TA 3ZPXA 3L7JA 1TUBA 4OFXA 3WNQA 5DN6D 4NBRA 2FW7A 3UBTA 1J25A 1A4XA 1R0KA 1N7JA 1KY4A 1XEWX 3A1FA 1K3TA 1I3MA 3PEYA 1VKJA 2J6CA 4F4FA 3WWDA 1CUVA 1U0RA 1ISSA 4RJ2A 4Z53A 4LDNA 2E0IA 3K1AB 1NN5A 2BGRA 4TXLA 4NULA 3T7DA 3B1YA 1XZDA 1NRIA 1WUKS 4RMGA 5ADWA 1ZVQA 5LZ2A 3VBEA 1UJ2A 4IXDA 3VQTA 4DRXB 2RARA 2YXBA 3MMXA 3AI7A 1GG2A 3H3FA 3T9DA 4DREA 3N8GA 2VAMA 3OJ0A 1C7EA 1MH1A 2NM0A 1OFUA 2VPZA 4MPRA 3GUUA 1VJ1A 2H3EA 2WFZA 5CT8A 3PNMA 4GKJB 3AJAA 1TKAA 2QTVA 1I4EB 5DNYB 1K7CA 1DHRA 2K6GA 3AFGA 3DHYA 3WWZA 3ZQUA 4C3VA 4RS3A 3QRWA 4KXXA 1I6LA 2POCA 4NMMA 1IZ7A 1GJRA 3RKUA 3VPHA 5JS8A 5JYDA 5KDLA 2BMEA 1R0LA 1ACLA 5AQEA 2NVUA 1NYTA 3ETEA 4L3WA 2WIFA 4LWOA 4U2EA 2Z2YA 3UB3A 3UVEA 1E6EA 4C14A 4IAOA 5FDFA 2NUTB 2H1WA 3RSOA 2CVFA 4MAMA 4BX9A 1CJUC 1Z6TA 3RIGA 4E88A 1G3MA 5KYTA 3AM1A 1QF6A 4RTOA 3TI7A 4KPGA 4I9FA 3T4UA 1GR0A 4G25A 5E1MA 5AK5A 1PJCA 2FPGB 1Q3HA 1UJMA 2IS1A 1YS7A 4F21A 4C4PA 2X0RA 1NPYA 4UASA 4BCDA 3KDSE 3VVMA 1OAOA 3P2MA 5DYGA 1V43A 4X3OA 4EKNB 4ZYZA 1S1CA 3LUDA 2G80A 1C9DB 1AQIA 2HJSA 1BEZA 3K0AA 2FWJA 4CDNA 1MQ8B 3KJFA 3X0DA 3SE0A 4L75A 3LOUA 1LEHA 3AM4A 1G8MA 4FJ0A 2YIMA 2XNDD 3KP1A 2FDRA 1R7RA 4RKRA 3LUHA 3STTA 4Z3KA 3GMSA 4ALMA 4XJSA 1E2QA 1EK6A 3S55A 5AKGA 4UVIA 3W8RA 2CT8A 4RIIA 4RYDA 1GPKA 5IT0A 4LEIA 3GJ0A 3ESQA 2IRWA 2OMEA 3QHQA 4LK2A 4L5YA 4NESA 4DW8A 1QHNA 4XVRA 2M2IA 1IWOA 2EX0A 2ZJ3A 2OB1A 3C87A 4PFQA 1WWKA 4J91A 4LJ5A 2L18A 3CRNA 1TT5A 2GD2A 2PMFA 4LF4B 1K9VF 1Q14A 1SY7A 4KH1A 5CFMA 2A4MA 1K3UB 2WQ6A 4N5MA 1LVGA 4RETA 4YCJA 4LDAA 2XF2A 4KO2S 2I33A 3OQOA 1RT9A 2M32A 1OW3B 1CUHA 2BFEB 2BGNA 2I65A 2PX2A 1SOAA 3KE9A 3TLBA 4D99A 4LIPD 3A1DA 3Q15C 4GS5A 3ONFA 2QUHA 3IHLA 3ZLBA 3BK1A 4PLTA 5CM8B 3I5XA 1GLNA 4NG4A 1V5GA 5JO0A 2R2GA 1UWCA 2C9CA 3HNRA 1TEVA 5JVDF 3N2KA 4UM9D 6GPBA 1YO6A 5IHXA 1NLYA 4UVHA 4QU0A 4UAUA 5E2AA 3M6AA 3LTNC 4MITA 5HF6A 1PR3A 2H4FA 3GD7A 5EIBC 3CZ5A 1E63A 1KVRA 4R2WA 4NAVA 1GPWB 3GRFA 3S1AB 4H35A 5LYJB 4IH1A 3Q88A 1N2IA 5C4GB 3G0OA 3SSMA 4N3CA 5P8WA 1MG0A 5TT1A 1K8XB 1DBQA 1WMEA 1QTNA 3JD1A 5ILQA 2NUBA 2ROQA 2EW1A 1U1CA 4JCOA 1ZGCA 2RI1A 1E2BA 5CB4B 1TDJA 3ORFA 4MUYA 4ZO8A 3WLPA 3U0VA 2RCNA 5JMWA 1B42A 4J7XA 4TTAA 4WE3A 4YDHB 4BQFA 2Y92A 4YMUA 4ZJYA 5SY6A 1Q12A 2QLLA 1VL1A 4F3TA 3KZ1E 1PN3A 3NXSA 4HPXB 3L5OA 3KXPA 1QK3A 1KS9A 3Q3CA 2X5XA 4BY9E 2Q29A 3PHIA 3WZMA 1TUBB 3PHLA 3G7NA 1Y3CE 2AMFA 2JZOA 4HX5A 1DRJA 1OIXA 2JIZD 1TA0A 3VR6H 2CLKB 1VIMA 1C9YA 3EIUA 4I19A 5IC6A 3A26A 4OXKA 3UT6A 4UUAA 1K7FB 3KYCA 4N4AA 3ZY2A 1NUTA 4M1ZA 2JAHA 2PAFA 2RHHA 2WEKA 3B1VA 3P32A 4Q6WA 1EVLA 2E4WA 4QTZA 3GLIE 4JBNA 2JLWA 3ROTA 2UZ3A 1QCYA 2B35A 2ZJ5A 5IDXA 4GRAA 4V0NA 2HQOA 2OZPA 1SK8A 3MB8A 3WNDA 1CR0A 4UTVA 3HSSA 3FIJA 4U00A 2ZUTA 3ZZMA 5LIPA 3VR6A 1U90A 1QHXA 5EVCA 3FVQA 5AM0A 1DAIA 1AKWA 1EUZA 1K97A 3CJQA 5JE8A 1Q7RA 4TUYA 4PCLA 2C98A 1DLIA 3N74A 3GD5A 3O4VA 4K05A 3RIYA 4G5QA 2ZAOA 1T13A 4YJKA 3ZWBA 1XR3A 5KYYB 3OECA 4MW6A 1IN8A 1N1EA 3WGVA 3GU3A 3DHEA 3W5JA 3LC0A 2NVUB 4OLAA 4WCVA 1TF7A 3JQ8A 5AW6A 2YWHA 4K7JA 3V97A 5CRIA 5HM6A 4UNPA 1FRQA 3W5IA 1JIVA 2BFBA 3H4MA 2Y3IA 3G7UA 3MT7A 4LECA 5JDIA 3HRKA 3IPRA 4D4LA 4US1R 2NN3C 1FQKA 4HT3B 5HTOA 4F6RA 2BEWA 1H8HA 2V7VA 2JH8A 1H5QA 2QD2A 3WTCA 1Z36A 1QGED 1P2BA 1DKOA 2O06A 4J4HA 1E9SA 3DW3X 1CYEA 4PAQA 1Z15A 3WHLA 5IT9A 4B7CA 3UMCA 2ZJ1A 3FWHA 5JBNA 1NVGA 3BCUA 1C8VB 4F45A 1HYQA 1UQUA 2CFIA 2OBNA 4ZCIA 1CDZA 1WBBA 1ATIA 1QTRA 1SQGA 3A1UA 2IY7A 2C3UA 3GEGA 3K0AB 3DTNA 2JFPA 3FUWA 1OI4A 2WB4A 3IEMA 4L74A 4IVNA 3E61A 4H7IA 2Q3MA 1EDOA 4PV7A 4MAFA 3T5AA 3DONA 4S0ZA 4J1TC 2IU4A 3P0EA 5HF5A 4C7JA 5DHPA 3JQFC 2YWDA 1PJ4A 1UMBA 1TTHA 1NUUA 1GZSA 3X44A 4EK9A 1UM9A 4M8LA 5JC1A 4O33A 2EL7A 1GRQA 4FYKA 3LCUA 2VT7A 3BREA 2GDZA 1ZNWA 2GEFA 4UMFA 2C00A 3DHWC 4FYJA 3N8NA 2ZRHA 1OWNA 3SNKA 4ENQA 1KDOA 1TT5B 5B2FA 1SAYA 4FOSA 3HA2A 5FX2A 1XWIA 4FPXA 3GELA 3IXQA 2OOKA 2MSLA 2W93A 3ACBA 3QPWA 2JFFA 4I2NA 1KZ9A 3A2LA 4R2JA 1Z3IX 2FFRA 3R3VA 1W5BA 3KQPA 4MW2A 3BFVA 1IRXA 4C30A 3HPRA 3GLSA 2QG9A 1MP0A 4BEJA 4IVQA 4FHZA 3Q7TA 3BD8A 1QLHA 5FEUA 3GAAA 1X1AA 1GLVA 2Z58A 1ESNA 2JGIA 2O3SA 4QOFA 2JFWA 2A1UA 3KWFA 3AJEA 4GZ3A 4LSGA 3TRIA 3VI4B 3N2KB 2PUFA 5BV2P 1RBMA