5BQXA

Crystal structure of human sting in complex with 3'2'-cgamp
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
185
structure length
178
Chain Sequence
NFNVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDRAGIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPSFSLSQEVLRHLRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Stimulator of interferon genes protein
publication title Molecular basis for the specific recognition of the metazoan cyclic GMP-AMP by the innate immune adaptor protein STING.
pubmed doi rcsb
source organism Homo sapiens
total genus 57
structure length 178
sequence length 185
ec nomenclature
pdb deposition date 2015-05-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5bqxA02
4YP1A 4JC5A 4QXRA 4EF4A 4LOHA 4QXPA 4EMUA 4LOKA 4KSYA 5CFMA 4F5YA 4LOIA 4QXOA 5BQXA 4EMTA 5CFLA 4KBYA 4QXQA 4F9GA 4KC0A 5CFQA 4F5EA 4LOLA 4EF5A 4F5DA 5CFRA 5CFOA 4F5WA 4F9EA 5CFNA 5CFPA 4LOJA
chains in the Genus database with same CATH superfamily
2VAWA 2Q07A 1XHEA 4KR3A 4NDAA 2AZ4A 1XCJA 2WWIA 3CUVA 3PLRA 2C2ZA 4LYHA 4UBLA 5FUXA 4XVUA 1OV6A 2HUPA 5KWJA 5IAKA 3P9ZA 4JT2A 1UJCA 5CDYA 1X3SA 4ZT3A 4YAIA 1IHPA 5DCUA 3V8PA 2BFWA 2B6HA 1IIBA 2QTVA 3MJFA 2W2MA 1I9CA 5AWFC 3RUHA 3U44A 3W6ZA 1NU6A 3B85A 4WTOA 4OQLA 4OPMA 5DO9A 5BYJA 1O5TA 1S3FA 4FPXA 2XV1A 3EAQA 4DUZB 4MJXA 3HCOA 2D4AA 4YVFA 2FCRA 1BVYF 3A4NA 3H8VA 2W83A 3DMTC 3LCMA 4UNPA 7MHTA 5DCLA 2ZCVA 2IP2A 4BECA 2ZYVX 2V0NA 3MINA 5DTQA 2ZJ0A 3PD0A 4HPXB 4WAUA 2C3YA 4B6EA 4OQYA 3RPEA 3S81A 2WK1A 4Z4GA 1I9GA 4OQPA 4ARCA 1OZAA 3QK7A 4JLPA 5DCYA 1NLYA 1UBMS 3A04A 1FU7A 2XUGA 1TM5E 1V9LA 2ZDQA 3MWDA 2Q2WA 2XGGA 4RABA 4V0ME 5KSWB 2BGGA 1Q77A 1O95D 2ECQA 3EXHC 3UF0A 2P0EA 1N8SA 2FDRA 1Y9JA 4JJ4A 4QDTA 3GDHA 3OTWA 4YP0A 4MS1A 1HRDA 1RC1A 4I8DA 1L7AA 1ESZA 4HY3A 4H3SA 3KG2A 1L5RA 4DQKA 2VJMB 5E0OA 4DRYA 2PT7A 4E1VA 2UXDB 2OOKA 5L3RA 2WTAA 1IC6A 3WQBA 2ZRFA 3C3DA 1S2MA 3PEFA 4FJ1A 3C4VA 2RE8A 3PEWA 4MVJD 4EG3A 4NDNE 3ZLUA 3PE3A 2H1LA 2YQ5A 5BNTA 4O4JA 4ESEA 1P17A 4XR9A 4N54A 2Z98A 9ATCA 2ZJFA 4B7CA 4UFPA 1E89A 1Z38A 3ED1A 3UJDA 3SSMA 2EGUA 1T9AA 1PT5A 1Y8RA 3GX1A 4RH1A 2FFBA 1XTRA 2HTFA 2PSFA 4QJIA 2Q4OA 4FQ5A 1NX9A 1J00A 1WB4A 4UJ3A 2FLVA 2QTMA 2WIBA 3JRNA 1HE3A 4ZAVA 1ZNQO 5C8YB 1ABBA 3EVNA 1AD2A 1HFEL 3DHNA 1WF3A 3UGTA 5B7PA 2BGMA 5FLXA 3C4JA 2YDXA 1RXIA 4KFRA 2JKVA 1LJUA 2E82A 4HLUA 3TQIA 3VR3A 3AX6A 5LXTA 1MB0A 2IZ0A 2DHRA 2JFOA 4JXKA 2H17A 1A8PA 1FXWA 2IYLD 3AHJA 2C2YA 2ZSJA 4MX8A 4D9KA 1ZM4A 4FD3A 1JHPA 1LI7A 1BGVA 1NW5A 4HEJA 4LNAA 2J7PA 4UW9A 3SEAA 1AKNA 2R1TA 3EEQA 3AIMA 1GCUA 1OF1A 1ZI6A 1HH4A 4BDSA 2VVTA 5IM4A 1S0UA 2OGUA 1TT5B 4EK9A 2HJSA 3KZXA 2Q28A 4I9NA 4JP5A 4EY3A 4ZJUA 1IVNA 1PS0A 2JLWA 1CE8B 4PFQA 1KYIA 4NE2A 3L04A 1ZCAA 4R1PA 3OU6A 2H1WA 4LWOA 1TCCA 2C83A 1JG1A 3HBJA 5ESRA 3GELA 5FNVA 2JGJA 3K0HA 3ZD8A 4II3A 1YL7A 3ES9A 1TZ2A 3UWKA 4N65A 4NARA 2CE7A 2VDRB 1V71A 3KZ1E 3HDTA 1XU9A 5IAAA 2AN5A 4RLHA 3TNDA 1XU4A 3UGJA 3ZCSA 4CTOA 1P9LA 2A78A 2CUNA 2HIGA 4NNPA 5EGNA 3TQTA 1MVOA 1EG2A 4IG9A 5IHPA 1EBFA 4L3OA 5TC4A 3QXSA 1G5FA 3KBOA 2P3QA 4R1TA 4ZVLA 1KE1A 2OYCA 2ZP1A 4EJ2A 3CRZA 3REQA 1ZNWA 1M2VA 2OB2A 1E9DA 3QE2A 2A88A 2IYYA 2L2QA 2QUBA 1P2UA 2ZVPX 4P4SB 2C04A 2J59A 4TTJA 5I5EA 3KR2A 1X8KA 2L69A 1I7QB 4F1JA 3RRMA 3ROMA 1VKJA 3JXEA 3TRKA 1YUNA 1ZICA 1Z8DA 3A6LA 3IBGA 4P7GA 1A4UA 2O2ZA 2CLLB 4OJMX 2GZSA 1RFGE 1GV0A 1W1IA 4KQFA 1TLFA 4R40A 1MJ5A 4UM7A 5EJFA 1SZJG 3ILVA 4TTIA 3UB4A 4HFMA 4PNZA 4XZ3A 1FFEA 5CX1A 2EF0A 3AEQB 4RMNA 2XMDA 3M33A 4YRJA 1TVCA 2E4VA 3BICA 2HLHA 1N3LA 3BMQB 2P2CA 1GAEO 1NDUA 4JA0A 5D1NA 4TSRA 3L79A 1CY4A 4XYGA 3AL0C 1NLUA 4W5QA 5WRFA 4ZGGA 3A05A 1XFDA 1QH1B 1ZAKA 4NAVA 4L8FA 4ZA2A 2HHHB 2QTAA 1IWOA 2X1VA 1NVVR 1M7BA 1STOA 4TN1A 4V0SA 2QLTA 2ZSKA 4Q19A 4C7KA 2R7NA 1AK1A 3AUSA 3JU3A 3VH4A 1Q5PA 1KJ9A 2GS9A 4KTVE 4MLZA 3OH8A 2XMQA 4P3OA 2O8BB 4NESA 4IJVA 4URVR 4J1QA 4ZT2A 4DV5B 1SU4A 1GVHA 1Y5RA 1U2EA 3DBLB 3DE1X 3H7IA 5SYAA 3ZWBA 4EY8A 4UNIA 5HZHA 1Y6RA 5GVRA 5BW5A 1XRLA 4W1SA 5BW6B 2HDWA 1QYXA 5LP6F 1B0UA 1V8ZA 1NP7A 3FN4A 4ND8B 3WRYC 5MHTA 2KMLA 3E7DA 4UMVA 3UTCA 3EF0A 4CV3A 2CE2X 2NO1A 3FVRA 3QBEA 4RXMA 1PFKA 1LK5A 5EMJA 1VPVA 4NPCA 3RKRA 2NT4A 5AOVA 4NZYA 3QOFA 2OO5C 4M9UA 1B0PA 5JJLA 3DD5A 4I55A 2JKYA 3ZV7A 4AYXA 1UJNA 3Q3CA 1L6RA 1OA1A 2CHUA 3GZ4A 2BV3A 2QX9A 2HW8A 1P75A 2F1RA 4NONA 3VOSA 1JHVA 4D9JA 3MTQA 5JRZA 4BGUA 4DV2B 3L7KA 5F7OA 5AD1A 2EWWA 1ZH0A 4KEAA 2E1PA 4OSPA 5G0WA 4EF4A 3EWNA 3I9LA 3BSWA 2C4TA 1JB9A 1QX3A 1XKLA 3IT0A 1F2TB 4MV6A 3ISVA 5DHFA 3V8VA 1U99A 2ZTLA 1G3UA 1N3BA 1SD2A 3AI3A 2D1QA 3V42A 3F1KA 4E4TA 2B78A 4YJGB 5ABPA 3KM0A 2ZRHA 2B4KA 4LMPA 4LHWA 2ZBPA 3QXXA 3KVYA 4DSZA 4TZKA 4M9RA 1E1NA 2C9ZA 5SV2A 3ZU3A 2FXVA 6CHYA 5LOVA 1XP8A 1ISGA 1HQYE 1ZN9A 5C53B 1NC3A 1UXHA 3O9ZA 3EOZA 1X7DA 2RB5A 1T5TA 3O4HA 3KYIB 2VO1A 2O14A 4MUNA 2VAVA 2Z2IA 3AVOA 3PUZA 5A7GA 2JPDA 1IXKA 3LUAA 1PJLA 5LZ4A 1FIUA 3TR0A 5F3WB 3LZCA 3U1VA 1R74A 4C7MA 5BORA 4AZTA 1Y8AA 1MHPA 3NV9A 5LMCA 3M5WA 1HE2A 3ED5A 4DR7B 3KOUA 1SU8A 4LQLA 4DILA 4RVSA 3N0XA 4QXOA 4DLYA 1SY7A 4NJOA 3RRJA 5AKXA 4DRXB 3T12A 5JNWA 3GT0A 1RQLA 1VMEA 2J67A 4MH0R 2PJZA 1DOAA 2I1VB 1XQVA 2H1SA 1G38A 2FSUA 4RVDA 1VCHA 4DY6A 5JJIA 1C41A 2BJHA 4AKSA 3TTTA 5JSQA 5CB6A 4DQDA 3AM4A 1GZ4A 3LLSA 4G26A 4JCOA 1FNMA 3JR3A 1NJGA 4Q9JA 1XLUA 4HRVA 2QE6A 4L15A 2X0IA 4GE3A 3LCRA 4O02B 3T4PA 3ZCTA 4BNTA 3WAGA 2C9BA 4OJNA 5JAIA 3HVRA 4FN4A 1HDGO 2XR1A 3CNBA 4YS6A 3TZEA 4IF4A 1LX6A 2F1OA 2ZS9A 2HXSA 3HKBB 1QO0D 3FTCA 1RRGA 2NXCA 3ESDA 1G5IA 5BV1A 2H00A 1WVIA 4V0LA 3LT4A 1DIBA 2QNIA 1ZK2A 1F8XA 3IR6A 1VSVA 3WQHA 4ENPA 5ERYA 1G6KA 2WJZB 3K0CA 2OCAA 2WTNA 2WZQA 2D54A 4K26A 1Y3AA 3MBIA 4V38A 3RIEA 4C7XA 4J1NA 2IYZA 1N7HA 3OI7A 3WGIA 1T26A 2BMAA 2OXFA 2QTCA 4QGFA 3U7GA 1BAPA 1BYUA 3WWOA 5L3QA 1JDVA 2GBIA 1XTQA 5TQ0B 2C8KA 1ZO8A 5AM5A 1PNQA 1A2KC 2P2DA 2P2SA 2V7BA 5MDHA 3L7DA 1IG3A 4MS3A 4B6JA 1WULS 1W5EA 4MYTA 4DNXA 1T9CA 2G83A 2A4KA 1OD6A 2Z95A 4P32A 4U2BA 2XQVA 4NNOA 5LZ9A 4WSOA 5DN6D 5U1PA 1QZUA 3KQVA 3O9VA 2WIAA 1Q7RA 3LRTA 3TZ6A 5IVIA 2HFJA 3CNOA 1TA9A 1FSPA 2VT2A 2QAGB 1T15A 3V1KA 4XI9A 7REQB 1DNPA 2QG6A 3QF7A 1ATIA 1NN0A 4AY2A 5KVVA 4QXAA 5KTKA 1VZ2A 2O2CA 1C29B 5DHUA 4OK3A 5G1PA 4BS9A 2LD4A 2Z56A 1VPTA 1Z7WA 2K5UA 4PO1A 4XRGA 5BMVF 3GEHA 1Q3KA 3ANSA 1YBFA 3BRSA 2A9FA 3S2FA 3VPAA 3DOUA 2VJKA 4E46A 4GM0A 4EEKA 1O94A 1EXWA 1LLQA 2YHIA 3SYRA 4FDMA 2OHJA 1FP7A 5M5BA 3WI7A 4TN5A 1RXSA 3WP1B 2V9CA 5CPBA 4D56A 1G98A 5SY9A 4ZYWA 2DJ5A 4HSGA 1QH8A 2EFCB 4TZ6A 1CJUC 1KDZA 2OOSA 3BIXA 1X1QA 2FEWB 3L1KA 2H92A 4BMOB 1U6KA 3L1UA 4D4GA 2ZAMA 2ECOA 1XMPA 4HH4A 3HNRA 4AFNA 3SMVA 1PFVA 2M32A 2QX4A 2R4TA 3M6AA 4MJ3A 1JKFA 1QO9A 3GLHE 3NYIA 3H16A 3PC8A 5AVVA 4G0WA 3C5HA 3VI4B 2DOKA 5FPPA 3MTGA 1E94E 2QTVB 3ZHRA 2W7TA 3LCUA 2F3RA 4D80A 1DQSA 3U1TA 4AK9A 4NK5A 1TYAE 4I4IA 4X3CA 5DRYA 1AK9A 3AJEA 3HKEA 5IDVA 5BUSA 1RJFA 3RGWS 5EEHA 2WAMA 4GLJA 1ZOPA 1XVUA 2WHRA 2D8MA 1XJWA 1YS6A 2J8ZA 3MINB 4GOMD 4WECA 2VRNA 1OZFA 3MTDA 4EF5A 2W2TA 4GMFA 2HD4A 1JA0A 1LB1B 1X86B 2VJAA 3MCVA 1G7CA 4NV3A 2VZ9A 5F1PA 1U9IA 2II6A 4LN1A 4KXVA 3BK7A 3NBKA 1N7JA 1N2IA 2PFSA 4P34A 3T3EA 4H7KA 5K6RA 4OBXA 1KJYA 1ODKA 1S3SA 3MWDB 3PQ6A 4UDNA 3OIUA 1Z26A 2VNAA 2J9FA 4MJ7A 1P0IA 4N49A 3RGGA 3EGVA 3TTUA 2NU9A 4EG4A 3IJRA 2D06A 2PN1A 1E20A 3IMGA 4QJ5A 5CIWA 4RMHA 5E4JA 3I01M 5NULA 3WQSB 1WXQA 1QNFA 2ID8A 3FKSD 1MTOA 1PL8A 2CJFA 2EX1A 3FDXA 4H3KB 4J16A 5LL6P 3LIPA 4IWYA 3L7IA 2RGGA 1MRSA 1T0JB 1TJ4A 1UKCA 2EX0A 2QL7A 4WOCA 1NVMB 2PXCA 4C7OA 2ZS7A 1R6TA 2B98A 3KQWA 4HDCA 1LTHR 2RHOA 3DUWA 3VR1A 4EBFA 3GVCA 1SO8A 4E2YA 4Z51A 2X2OA 3JARB 4TOIA 5ALTA 3VO2A 5BYBA 3O1LA 5ALJA 4REQB 2FWNA 2J6BA 3GNSA 3PNPA 2WMOB 1MN6A 2ZDHA 3BTUA 1RABA 5J40A 4IQ8A 3CU5A 2WJPA 2V7VA 1JH8A 3OQOA 3GFQA 1D2GA 3JW8A 2FSVC 4G2NA 2I6SA 4D9NA 3VJMA 1R6VA 2HEIA 3UWMA 2QAGC 3SC2A 5U4XA 1K6MA 2ONYA 3FLBA 1W85B 3Q7SA 5AH0A 1Z8HA 4DQXA 3PJRA 1SXIA 2WZCA 3KUKA 3UG7A 4EYSA 1PZEA 2FFRA 4MP6A 5CXXA 5JAZA 4E09A 2WZBA 4F4FA 3DQPA 5FBKA 3O4FA 1KOFA 4RFVA 4QBGB 4FDTA 2ZKLA 4UATA 1UJ4A 2HF7A 4N03A 4IIBA 3IEIA 1SPXA 2AL7A 5THQA 2PQ2A 4Q03A 3S70A 4D9GA 3T9DA 3H0CA 4NU8X 3HRIA 3KT0A 2VH1A 3AFOA 1SK8A 2O3RA 4Z4QA 1B00A 4JXXA 3ETHA 4OHUA 3DNMA 3PGXA 1RQGA 4GOKA 3GCDA 3GJRA 4J49A 4EWLA 3GT3A 1NBMD 4IHKA 1E9CA 2LWIA 4UAGA 4Y9TA 3DVRX 1DRWA 4UMFA 2ALJA 2XUQA 2W6MA 5LA6B 3AHEA 3IDAA 4C08A 1M72A 1S9HA 5IG2A 2JGIA 2HT6A 1Y82A 3ETEA 4RE6A 1QDLB 2XDYA 3JYPA 3WWPA 5TPZA 1J06A 3QHPA 1VJ0A 1ZU5A 2I54A 3REQB 3KAPA 1SVNA 3WLQA 2J45A 3TSYA 2SHKA 4M55A 3B6EA 2ZBDA 1WKVA 1G2QA 3RC2A 2VWHA 2IPOA 2JLUA 3RTDA 4HWKA 3SM3A 4MA4A 3TCNA 5JD5A 2JHFA 4PW0A 5CT6A 3EMBA 4B3IA 3FWNA 3MN1A 3T0GA 4D3FA 1DAPA 4DE5A 3COJA 2BZSA 3DPIA 1DT5A 1HQKA 3ERCA 4ZCQA 4NR0A 1J0AA 2B69A 3BAZA 1E0DA 1NE7A 1CQWA 4QVGA 4R84A 4WLFA 3VU8A 2B6NA 2AE1A 1DLIA 2RAFA 1CHNA 3AHDA 3GEEA 1AN9A 1LBQA 2AWNA 2VJBA 4GBED 4J1SA 4UHKA 3WKCA 4CFSA 5A4FS 1C3EA 2Q5EA 4AWAA 1HQCA 2GVNA 3MNFA 3ENKA 1W6RA 1I4EB 3GK3A 3NVDA 4H2DA 4UE3S 5K6TA 1UQUA 5LSAA 2PD6A 3AUUA 1V3QE 1KPHA 3JATB 4I4TF 1V6AA 3JVEA 3R77A 1D5WA 2XCIA 1PR2A 3N5KA 1OSNA 5BWNA 2YJZA 1EESA 1HV8A 4FZ5A 4HZUA 1KR5A 4B8YA 1E7WA 2VJCA 1S2LA 2K6GA 1MOQA 1OWLA 2VH5R 1Y4AE 3CNNA 3V33A 1ZVKA 5IJ9A 4KQMA 5EXSA 2YCBA 1HTBA 3H9UA 1QYVA 1V3TA 1IY8A 1SG0A 1VLHA 1T0PA 4FMPA 4NV0A 4Z9FA 5EJ2A 5E6UA 3RU2A 2YRWA 4EGFA 2CBGA 5FA5A 3SCZA 2JASA 3PQ4A 1UXIA 4RFSB 3GQBA 1UJBA 4UEQA 3W1WA 4RK6A 4Y2SA 4B3JA 2HNAA 5D5HA 1NFFA 3EA5A 4HN2A 2GERA 3TR6A 1KK0A 1Z4NA 2Y93A 1ZITA 3IURA 3FPKA 3M5DA 4MVJH 1K6EA 4XUGB 1A50B 3WKBA 1BD4A 4D0LB 4YMVA 1QBGA 3CRMA 1OPXA 3B78A 1E5XA 1PV2A 4WV3A 4UNRA 1WP9A 1F17A 2X4DA 3D7MA 4Y2XA 2OKGA 3JAMA 2OUKA 4I55B 1AS2A 2XLBA 4ZFNA 1M33A 4ZOLA 3B12A 3C0KA 5E4FA 1BWSA 3K71B 1NXXA 3N0VA 3R44A 3TD9A 1LWNA 4FFOA 1B6RA 1Z5NA 2EQ5A 3D6NB 4L7QA 2O19A 1FRZA 2AG1A 1WDTA 2GASA 4WKGA 5KTTA 5I8WA 3OF5A 1SXJE 4HDKA 4JBHA 5AT1A 1BU5A 3DMPA 3QV2A 3CNQS 5DBHX 3Q9NA 4ZAXA 2FPMA 5H82A 3GPDG 1JSRA 3PKIA 3UC9A 3EFOA 2DGDA 3HHPA 3AB3A 4G9BA 2GUWA 5BSMA 1PQWA 1SFRA 1DU4A 3D6HA 3ZU4A 1ZN2A 3NTRA 1PJBA 4C0KA 1POXA 4EKIA 1FLDA 1MG0A 3DGFC 1TX4B 4QDZA 1EX7A 1HNNA 3E6AA 4B4WA 1SB9A 1O6BA 2PSSA 3MQ2A 4RIGA 3CJQA 2VDJA 4O33A 3F6PA 4B32A 1GGFA 3HYLA 4DEVA 1VIDA 3U7FB 1KBQA 1OV4A 3CPJB 1QDEA 2O7SA 4EVQA 1HTWA 3RRYA 1AF4A 2OZLB 2OLKA 3GRVA 2ID7A 1Y6QA 4QUEA 4UEOA 2NSJA 4E5UA 2P4UA 1GU7A 1YS7A 3OCUA 1A5AB 2FPUA 2HQOA 3KPYA 2F48A 4MI3A 4OB7A 1Q1AA 3JYLA 1YTLA 3KYCB 1HTTA 3NIFB 4KVZA 5FPTA 1W2HA 1ICIA 4PZEA 1WMBA 1GT6A 2CUKA 3CKKA 3V7FA 2PX2A 1OILA 4R2HA 4US0R 2W6NA 2W2KA 3IIEA 5BWLA 5KX5A 1XWWA 2IIBA 2XTZA 1OGJA 4HWOA 4RVHA 4D0SA 2WWRA 1H2AS 4R3NA 3ZDAA 2R00A 3B6ZA 3U4QA 5EZ6B 3CCFA 4J4BA 2N1MA 3I01A 4BMPB 4FR2A 2A86A 2X19A 1Z0AA 4IEEA 4MVJE 1PZGA 1ORTA 1U1FA 5EE1A 4RIEA 4QHYA 3SJCA 1YGYA 2OCPA 4ANFA 1JIIA 3D0OA 4K9OA 4DM4A 5AUNB 2EKDA 2RK6A 2DFNA 1JG3A 1WXFA 1MDFA 3WLNA 2JD0A 3BDAA 1XEXB 4GBGA 1KIAA 1CDZA 2C5HA 3GJ3A 4LWPA 4O0MA 2EQAA 4LHXA 4E2XA 5BNFA 1KAOA 3T3IA 1QGAA 4RJIA 4LOIA 1M9NA 1O4WA 4INPA 3AG5A 4NC9A 4HGQA 2VJNA 4QFMA 1YJBA 1QYCA 2QZ4A 3WLPA 5EJ7A 5L7WA 4MQMA 3QVSA 1D7AA 3V1TC 2IEZA 1H2WA 1GGKA 1JIQA 2FPSA 2WYOA 3PJDA 3HQ4O 3PSHA 3U17A 5K8CA 1L8AA 3FLAA 4URUR 3BD6A 1LVHA 3IUQA 4EIWA 4ZI7B 2CYAA 2OYRA 4S1PA 3SSNA 1NIPA 1JKJA 2Q2OA 2XGSA 1PHRA 1ISMA 3N7AA 5FWYB 1B4DA 1W4ZA 1PDWA 3H3FA 1P29A 1KAGA 2I6GA 4B3RB 5GZ3A 5TF4A 3QJYA 4RSGA 2BWJA 4DR1B 1ZGGA 3ISJA 2HU5A 4WFIA 3ZVLA 4UULA 2IITA 1JIVA 2QYSA 2X5OA 1WOMA 1FUEA 3Q2IA 4MA0A 3OZEA 3RK1A 2Q5CA 5CH3A 4B75A 4RZUA 4CMHA 5TS3A 2G9VA 2ZUUA 2C99A 3FUVA 2Y76A 2NPIA 4NU6A 2BGLA 2EL9A 1BO6A 5E3IA 2REBA 2V7QD 5ALRA 3S2SA 1GUDA 2F3TA 3L1VA 5CA0F 2QEQA 3NWPA 1VI5A 3L0YA 1IL0A 2IY7A 4QPJC 4DC1A 3DO8A 4W5OA 1KVTA 4MRMA 3OFJA 4FU0A 4KH1A 4AO7A 3WRVA 3SZ3A 1MEOA 3C3CA 1EUZA 3QVXA 2HK7A 5JATA 4E7OA 2BI7A 1Z0UA 2V8OA 3A9TA 2YMMA 4RSHA 5LNK6 2Q6TA 5TPWA 4YMGA 1ZMRA 1W36B 4W7IA 3GLRA 2AFHE 4ERXA 4RF2A 5A4MS 2FKAA 4V0MA 1BRMA 2I8CA 3TXYA 2DE0X 1V2GA 3F78A 4PLTA 2YXEA 4I8XA 4D57A 3ORQA 1MX5A 1IUPA 3MSCA 3PFKA 4CQLA 1EGAA 3BX1A 4PX2A 3BMOA 5CVVA 1XL1A 2BISA 1IAQA 1VL5A 2ZT7A 3OF2A 3PICA 4QXQA 1PG0A 5HG0A 3K5PA 4QLAA 3VYWA 1ODIA 2E18A 2RONA 2RHMA 1SWVA 1AURA 3VU1A 4TMYA 1ZVVA 2FI1A 3EZ9A 1CHDA 2Q50A 3PR3A 3QF4B 5CW1A 4XIGS 5KWIA 3C6MA 3C5EA 2ANCA 4QPPA 3WJ7A 1DAMA 1IPEA 1I33A 1YB6A 3ZGLA 2JBHA 4ZYTA 3QWHA 5L3VA 3U31A 4BX9A 1IOWA 1DO0A 3B2NA 4DNFA 4KODA 4KR6A 1EIWA 2GHIA 2YVKA 4A15A 3QUQA 2XNKA 2BBWA 3B8EA 3A1DA 1IBCA 3Q1KA 4UASA 5E6SA 3WLKX 4PPFA 4DIMA 2FZKA 2IX9A 3LXXA 3GLQA 4CKCA 4NQZA 5K3DA 3FBWA 4KE9A 3K1ZA 3L5KA 5FV7A 4XR4A 2AOTB 4FGWA 3O4GA 4OL9A 2DEUA 5IT9A 5KNCD 1SHZA 1FLVA 1TA0A 3T7AA 3ADCA 4TL9A 1E1CA 2WT8A 2X0RA 1IAVA 4N5IX 1DCTA 1WIWA 2VPIA 4G1BA 4XD7D 5IC6A 4C4PA 1LH0A 1RCTE 3H1EA 2L42A 4PSKA 2FMXA 3WZLA 3ZY2A 4Y1RA 4LI3X 2HOQA 4FOTA 3CZRA 2P3OA 4I1RA 1XLWA 3JVUA 1KEEA 1O6CA 2QLBA 2WVGA 2OZVA 3Q6MA 3CF2A 1R0SA 3RF7A 3T9CA 2ZBUA 4R8SA 3IJPA 4EPXA 3AP2A 3QNWA 4GI2A 4UD6A 4IKOA 3BEDA 4V1CA 3KJNA 1JH9A 3TBKA 2PBLA 5DB4A 1UBHS 2QT0A 4TKVB 3TEJA 2WNSA 5C18A 1EUQA 2H8KA 5ALIA 1QGYA 4UAUA 5M2QA 4HGZA 3TPFA 4TXLA 3VX3A 2ZYAA 2NUAB 3SC2B 4G37A 3T1OA 5CEJA 2P30A 3DAFA 3ZI0A 4H1TA 4HPJB 3VPGA 1V45E 3RC1A 5E1MA 3AF4A 3R5FA 3U5ZB 3V1YA 1FDTA 3E9YA 1XXHB 1UWKA 4MGKR 1KQOA 1U8CB 1ONOA 3QKSB 4Y30A 4AUNA 4CTKA 4S04A 1D6SA 7MDHA 3QOWA 1P1IA 1ZRSA 2Q6OA 5CDUA 2BHSA 1YZLA 4KE8A 1HYBA 5EVJA 5BVGA 1W36C 3FDJA 1LRLA 4UXIA 5KCZA 4QOJA 4P3XA 4WZBB 2JZOA 2YNMD 1VGQA 3OIFA 3ASYA 4JODA 4XSGA 3ZLBA 1KEKA 3NTOA 4UKDA 1EBUA 1D5CA 1V25A 1N6KA 4BP1A 4CMAA 3P9PA 1P74A 5GGXA 3RRZA 5IJZA 3F74A 4CKBA 3E8MA 1DTSA 4XDHA 3SVZA 3CUEF 3RIYA 4URZR 5E2AA 4AM8A 2DKNA 1XZMA 1VYHA 2Z1NA 3B48A 3A1SA 5FULA 2GFQA 3A6HA 4EO4A 5AUQA 1TA4A 1QG4A 4JLDA 4EYGA 5ED4A 4NYIQ 5J4YA 4TYNA 3FKQA 3JWIA 3MTIA 3I0NA 3U26A 3PZRA 4CNBA 2X9VA 2ILTA 3WOHA 1A2OA 3EDOA 3IMCA 1M2OB 3M1IA 1NM5C 3KQTA 3B51X 2O0JA 1JEJA 2QN3A 2V6IA 1BVUA 4Q1CA 3DZDA 3H5LA 5K3FA 4KZPA 1NZDA 3UWDA 2H2AA 1IY2A 2HA2A 3Q3EA 4JI1B 4QYWA 2A9PA 1V96A 4L78A 4L3WA 5DTJA 1PT7A 1U9IC 4FOSA 2XH8A 4R9VA 5DI9A 2NQTA 3D6UA 3H65A 1YIDA 4CMIA 3V8EA 4F2HA 2IHJA 2DR0A 2ZB8A 3NVAA 3W7AA 4B40A 4GWLA 3ZWDA 3DE4X 3ZHXA 3O5AA 4NFSA 1LCIA 1SG9A 2RHHA 3LI2A 4W1PA 3G8BA 1WSAA 3QMMA 4C4RA 2Q1UA 1AA6A 3EXIB 4U7TB 1BQ3A 3F5MA 4R1NA 2ZRNA 3CLHA 3MG9A 2BFDB 4DB2A 4GOND 4J16C 3WLJA 4UZEA 3OZGA 4IS2A 5GM2A 1JDJA 3LT5A 1GZSA 4B35A 4QASA 5KTOA 4F4UA 4W6QA 4D81A 3C6KA 2JLVA 1D2HA 4JA2A 2CBZA 1AKUA 1JT2A 1K66A 1O08A 1UR5A 1FVOA 4D0NA 5JBNA 1PJCA 2C31A 5AICA 4CIWA 5EVCA 2GLUA 1SOVA 3SYKA 3JPYA 1H5UA 3LKDA 1V0JA 2HIHA 2Q5IA 1E8NA 4RVCA 5FX2A 3A6PC 2HLPA 4PAQA 2WFZA 3RVQA 3SVTA 1SUCA 3UBTA 4MARA 1GJRA 1BXGB 4QQRA 2HEGA 4O1MA 3GQBB 2WOOA 1OX6A 1RHQA 3NWOA 2P9BA 1C80A 1Q1NA 1XT6A 4LV6A 2FSPA 5A04A 3FSRA 3CO0S 1YA6A 2D1SA 1JQDA 2G82A 2NN3C 3NAZA 2IOHA 4TUYA 2HV8A 2WUFA 2XODA 1J1UA 1O89A 1VJDA 5HE9A 5JT1A 3ETDA 3IOYA 4G5YA 4OXYA 1ZJ4A 2WV9A 1J25A 3EIFA 3COWA 4EF6A 1SVMA 1YZYA 1Z22A 1Z37A 2PH7A 2I7VA 3A1CA 3DBHA 5EWLA 3V4OA 3ZHVA 4E5PA 2PY6A 4JGBA 5BOSB 1BKDR 3HUFA 3UV3A 3ZDZB 2RH5A 3HU2A 3K0KA 4OHXA 5EQFA 2BGWA 1GRCA 3RJ9A 2WQ7A 2IE8A 3E3LA 5CB4A 1SC4A 5A3JA 4R2XA 2EP5A 4MB2A 3EFOB 1Q11A 3VOTA 2X42A 1NJ1A 1PR3A 3K53A 3WL5A 3IPRA 1CJCA 1F7UA 4R71A 3ZLTA 1FLAA 4DCTA 2QN7A 1XMJA 4QQFA 5A6SB 2H1VA 3CLSC 4PF1A 3O2QB 4H1HA 4R41A 2V96A 3TM4A 3LP8A 4RJLA 3ROXA 1PWYE 2G9ZA 3L0IB 2H65A 3OPYI 4RZHA 4Z1MD 2ZULA 2ZCJA 4IXNA 1PG5A 2ZYHA 3OJ0A 4JLMA 2FE4A 5KBYA 3A6GA 2JW5A 4LIPD 5FBWB 3OCZA 5KSPA 3DLBA 2OXEA 1H23A 3EC1A 4QODA 1KEWA 3HJTA 2E4AA 1F14A 4HDOB 3NBUA 4BJHB 1T43A 5DTEA 8LDHA 4Z7OB 2QTGA 4AJLA 4DTCA 5E38A 3U40A 5AESA 3QEJA 2FN7A 1AHNA 3UUGA 2FFHA 4BKQA 1J8DA 3V2GA 4LGCA 4BGEA 4R98A 2JJ2D 1PFGA 3CX3A 3WLHA 3CTPA 4MRAA 2ZREA 3LLMA 3P9RA 4FBGA 1RM3A 3P32A 3QYAA 1EAMA 1GRVA 1Q7BA 3IDFA 5CU7A 5C1DA 5KX5B 5EXXA 3LO8A 5HP4A 2XT9A 2HRCA 4Q7KA 2PH3A 4A1OA 3PT9A 3W2EA 2F4NA 3MIIA 5DNCA 1RXUA 1H0SA 2GNAA 4E94A 3U4QB 5AP9A 1CIPA 4RLFA 1Z7YA 3K92A 3P2KA 3REOA 3MJRA 1VJCA 1JKXA 4YC7A 1PYDA 3H9BA 2F3PA 4DSNA 3W5AA 5HKKD 1OT5A 2QZSA 3L7JA 4B76A 1OE0A 1T2NA 3AWIA 2PGDA 1JF8A 4U1RA 3MT7A 2VQFB 4ZDIA 2F62A 4NG5A 3VKUA 3B3FA 1QR2A 3UANA 3LKVA 4IZHA 2AFVA 2QYHA 1SKYB 1ARZA 1KVUA 1VPEA 1YI8A 2FPKA 5EYPA 1OFHA 5FWXA 3DTVD 2WKWA 4BEWA 2C29D 4H7JA 2QT9A 4U4AA 3DFMA 2G8NA 1ZA1A 4HAYA 1GPWB 1JEQB 1S7CA 3SF0A 4H4DA 5AVTA 2Y99A 2YQZA 2ZT5A 1YFLA 3CZAA 2BY4A 4N6NA 1QIEA 4FIDA 2Q5JA 3K9GA 4P3KA 1JDBB 1VE9A 4MV4A 2GUGA 1GO2A 3BCSA 1CRLA 3O84A 1U7ZA 1CQIA 3OLCX 1H05A 2G63A 4K9MA 5AR1A 4EFLA 3IO3A 1AKVA 4O25A 2PUAA 3JQAD 2H9AA 5FI3A 2FA9A 4B6OA 1JIUA 3RWBA 1YQQA 1SU6A 1E5LA 3D7SA 3CCBA 1J4AA 4URWR 5A5VA 4PLHA 2JLCA 1YHYA 4JASB 1SR8A 3D3QA 3OE5A 3GRFA 3VPCA 1NBME 3B1KA 4AT1A 3GRKA 5CEEA 4M8LA 2WG1A 2GBLC 1WWKA 4N5NA 1HGXA 3NFYA 4OGWA 2R25B 1RYDA 3PHHA 4MRMB 4HRXA 5A4AA 1TMOA 4BO4A 3QNMA 2WAXA 1SPBS 3P94A 4WGGA 3IMEA 3NM4A 2IU6A 3MJ4A 3OOSA 3FZNA 1Y37A 3AGPA 4CKEB 4GGPA 2I66A 2D3TA 5T8KA 3DLHA 2ZS8A 4KN5A 3KHSA 4M0LA 4E0BA 5EIWA 4EUSA 4WACA 5HILA 4RHEA 1SULA 1X7ZA 1TM7E 1O54A 2QW1A 3LPAA 4GPIB 4YJ2F 3ZHBA 5BR1A 2JI9A 3U5TA 5KYYA 3G3EA 3NBYC 2ZU0C 4HAWA 4GFDA 4XH9B 1EXDA 1GEEA 2KSQA 1NQ5A 1EEXB 1CEQA 1KOJA 1OI7A 1T9GR 2SKCA 3CURA 3H5IA 4MVJM 4TKUA 4B4DA 1RVV1 5BWOA 3BMCA 7ADHA 3KKKA 4OMFG 1EXMA 1SG6A 2F67A 3EVGA 3I2FA 5ALWA 1DG9A 2R1ZA 1AOXA 2Z5GA 3QKRA 3HMKA 4QNRA 1A9SA 4QJ4A 4X1YA 1E1YA 2A33A 1CVIA 1TQDA 2GJ9A 1UK6A 2IOFA 4WX2B 2JS7A 2QMQA 3HDQA 3HCFA 4FHEA 5EUBA 2PA0A 4RWZA 2OHXA 3KQPA 5C7LO 4YA6A 1OGIA 1Z06A 1E7MA 3OZSA 4DLVA 4F12A 5BXYA 2QXTA 3ABOB 1NVBA 4DS3A 2XZDA 2PXHA 1LPSA 3PXXA 1KJZA 2IS4A 4I1SA 1NUTA 3SICE 2R6CA 2RKBA 4HS4A 1KS9A 4WGFA 4B6RA 1P3JA 4N6GA 1WMAA 4W4TA 3DEKA 2FZLA 3BD9A 2GNPA 2M2IA 4WLOA 1H3FA 2NZYA 4FX5A 3RVJA 3DWEX 4ZI3A 2ACVA 5DGTA 5DZSA 4BWGA 1RYMA 3OT5A 1C9MA 2Y1OA 4HKTA 1DSSG 5DK6A 2APJA 1CQZA 2VSXA 2V0GA 1JG2A 2FEKA 4W82A 3CUSA 2ZTVA 4F9EA 4CM9A 1JQJC 1OXMA 2PGJA 3HDHA 3TRIA 2E85A 1B1AA 2VJLA 1XXLA 2YIVX 1VE6A 1OX4B 4RENA 4XVQA 2V4ZA 3Q8WA 4XFJA 2MTBA 3EVEA 1JDBC 1NY6A 4E5MA 5EKUA 1M75A 1PEAA 3TVYA 4V1CB 4UXHA 5JSZA 3A3YA 5KOJA 2IDKA 1P1HA 2X9LA 1AB6A 1SKBA 2D2IA 2HQSA 1ISHA 1ENPA 3AH8A 3PUIA 4IJ6A 1RKXA 4TT8A 2WJ6A 4U7DA 4WOKA 4GE0A 4JC8A 1NI4A 4Q7EA 1LD3A 1CS0B 1NUSA 1BXKA 2XAUA 2ZE8A 3L7YA 4JQOA 1VE3A 1Z8NA 1WHTB 3STVA 4Y2QA 2RARA 2Z2JA 3DNFA 3HFGA 2E5FA 2XWPA 3MVEA 4O5AA 3V5NA 4MDFA 5A62A 5I7SA 2JIZA 4F4HA 4JVSB 821PA 2SCUB 3VAAA 1IPHA 3C2QA 1OWMA 4GXRA 1ELOA 1E6EA 5F4BA 2CDRA 1E59A 3BWCA 4TS9A 4YQYA 5EC8A 3WFZA 4XTCS 5HGJA 2P27A 5AUOB 4OAQA 1E98A 1R66A 4HGNA 3W79A 3W9SA 2UVPB 2G0NA 2WEKA 2ZPTX 2EW2A 3USZA 3KJQA 1JZQA 3UAWA 3D6VA 2IV3A 5BVGB 1P6QA 3QPWA 2GZ3A 4AKGA 5JCJD 1GNLA 2QRHA 4ARBA 1GZHB 3LXUX 4KIUA 1VQ1A 4P22A 2G25A 3G2HA 3I2JA 2C5LA 3OP4A 4N0EA 3IIIA 1JKMA 1XTTA 5EOVA 4NP6A 3HXKA 5FRDA 3STUA 2DWPA 3N70A 1IY0A 2W0SA 3O1JC 1D7OA 3CF4G 1OHHD 1XV5A 5KQSA 5KYUB 3WGUA 1B23P 1BMTA 1Q14A 3T9BA 4DLXA 2JGMA 3H19A 1F0NA 3NRJA 4R54A 1ML3A 1Q0RA 3U49A 5K99A 1SXGA 3ODPA 4KI7A 2BONA 1SBIA 1RR6A 1KY4A 2RCNA 4DANA 3I3OA 1ZAYA 3V1UA 3L05A 3FPFA 3ME5A 4G1MB 1QG2A 1SVIA 2F9FA 1QIJA 2ADOA 5KC8A 3A32A 2DHQA 1Z4MA 1XK6A 2X7JA 3BN3A 4QT0A 4AJOA 4C0HA 1KE2A 3HDJA 5JADA 1YOBA 3RRFA 2EERA 3FWZA 1RYFA 4RPJA 1Z7BA 4D1YA 3U1BA 5AK6A 5K3FB 3QKIA 1ND5A 1SQFA 1YNOA 4F3KA 2C95A 2NSDA 3N2GA 2OTCA 4PAWA 3HXOA 3FFBA 1UBCA 1CUZA 4C20A 4XYBA 3H8JA 1S8FA 2JAPA 3H13A 3K6KA 1KAEA 1Z2PX 2ZJ3A 1T6ZA 2ZWAA 3VNSA 1GFWA 3VPSA 1RXYA 1RPJA 4ZQHA 1J0BA 2F1IA 1Z25A 3KOOA 3EIXA 3U7JA 5JR3A 3T4EA 5GTDA 2G1PA 5DHAA 3KAKA 4RE5A 1SIBE 4QD3A 2YRFA 2ZSBA 4I50A 2ZYWX 2YY6A 3NIBA 4JGIA 1Y80A 4NYMQ 4TVSA 2XA1A 1SXJA 3GOQA 1AK2A 1PSDA 1YK0A 3DOOA 3O92A 4LZOA 1IN5A 1LLFA 1XDUA 5DW3A 3SIRA 3V4SA 3BGVA 4QULA 3UMSA 5KNCH 2RC6A 1YA4A 2EL7A 2CXRA 1QHHB 1JLMA 1ZGAA 2W00A 4MWBA 3ZOZA 5IYZA 1XZHA 3C3JA 3TOSA 1JFVA 4YMSA 1J99A 4XGIA 4U9HS 1QAQA 1REQB 2IGBA 3OM1A 3O2SB 4LMRA 1T3SA 4PYMA 1QE5A 4MUYA 4R7ZA 4A23A 3I5XA 1S4QA 4TRRA 5DNEA 4JOQA 2MMGA 2Y9MB 4LCBA 4KQKA 2IUSA 2WD8A 4YUWA 1GG5A 4D4JA 3LZ6A 1GFIA 1EVKA 1X15A 1THTA 2YXLA 4OMCA 1SZPA 3PX7A 3L06A 3B3JA 2ZUCA 1YZFA 4PSVA 3D4BA 3FCXA 4TV9A 1NQXA 3FMOB 4JB0A 3PEYA 1AF7A 2W8BA 5GONA 3DQZA 4HNSA 5ED0A 4DZTA 2JANA 3C7CB 1UINA 1M6EX 3PF9A 4HWPA 4KITB 5AVXA 3QQPA 3EZNA 3QENA 1KWKA 1OT3A 3FR8A 1K27A 5JBIA 2ZJAA 4YP7A 3UCXA 1O95A 3MTAA 4ZK2A 4LF6B 3B38A 4FWTA 1XTSA 1YZNA 2IA5A 1N3YA 2GXQA 3E5MA 1C8KA 3DFUA 4AZ3A 2R4QA 2FJPA 4A5OA 3K1AA 2OV6A 4YRKA 4J0HA 2PX8A 5UKDA 3GHHA 3LW7A 3PX2A 4EHHA 4IV8A 3B6MA 1N32B 3F6RA 4MVJA 1PV1A 4LY0A 3AF6A 1VIYA 2ATVA 1HPLA 3GZTB 4GMHA 1ML4A 4MGZR 4U63A 3W3ZB 2I2AA 3BC1A 3U4CA 2JARA 3DG9A 1NBAA 2X0EA 4RXTA 2PGLA 3PFGA 3W1VA 3UT5A 4QEDA 1K88A 1M6VB 1PJZA 3CE6A 3ESYA 4DN6A 4JX9A 4GLFA 1J97A 4P84A 4DXHA 3FOZA 3JTMA 5LWHA 5KVAA 1E5QA 2C9YA 4QTUB 4H4EA 2OCKA 1R16A 2FMIA 2UXBB 1FU4A 4JLNA 5AO9A 1X92A 5HF8A 4LXHA 5K8TA 4F3YA 1JFFA 3FMVA 3ZQ6A 3K2IA 4Y6RA 2OV1A 3P9NA 4LMBA 1AO0A 4DARA 2M1ZA 3MTBA 4OJQA 2ONZA 2ON6A 4OJKA 2YIMA 3Q7QA 1RXWA 2GDJA 5CCBA 2CJYA 1ECPA 3QEMA 4KAFA 1YI0A 4EA9A 1E2HA 1Y9AA 1KP3A 1R8YA 2IIQA 3C3AA 3N8NA 3QIAA 5L51A 4NCBA 3PENA 4XQ0A 5IVDA 2Z3ZA 4BE9A 1UBOS 2PTHA 4L9AA 4HWRA 4LF4B 2IYSA 3IQIX 4LJ8A 1JIJA 1GYRA 2BN4A 3FH0A 4R6XA 3HJCA 4QNMA 3OC0A 3SZLA 1NBIA 2AMFA 2B83A 4V3CA 4A6XA 1UBKS 2EJCA 1PLLA 2GK6A 2G9RA 3AGQA 1ZR2A 5HMMA 1OREA 3AMVA 1X7WA 4OQZA 3DB1A 4WIAA 1E0KA 3GC6A 2V97A 3IBCA 3UJHA 1PW5A 4J0IA 4LUCA 1NI5A 3G0HA 1JDTA 1KU6A 4O8ZA 2NZUG 3WWEA 2WE7A 2ODWA 3LL4A 2PS3A 3GN2A 4BFVA 5EYPB 4M8SA 5BW4A 3VTFA 4FYYA 1M74A 2HMWA 4C4TA 3P4XA 5JDCA 2HCTA 4DCMA 3TE6A 2AFHA 1MQ8B 4U5QA 1YU6A 2QQ0A 4YP1A 4BPRA 1BDMA 1ZUNB 3PC6A 5D3QA 3SEFA 3A1NA 1RWOA 3E9DA 5DHSA 5EHIA 4AWXA 2QD3A 1W6UA 2Z3WA 1U2PA 5EG5A 1IIRA 2QK4A 1T1GA 1ZPDA 2RHBA 1ZHHA 3S68A 5AKJA 3NKFA 2OWEA 4ALNA 3OOHA 4KDCA 3ORSA 3PCTA 3V7NA 1C3VA 2UZ1A 4XXHA 1T2EA 1B74A 1TIKA 1NHGA 1WNTA 3NU1A 4FE4A 4ZJYA 1MZPA 3GI1A 3GIDA 4XYEA 1IZ8A 2Q3JA 5M3BA 3UWOA 4RMGA 4YI3A 1AXGA 2FU5C 2IIPA 4A8TA 4JEIA 4X3PA 4IIJA 3HEAA 2VF4X 4B3XA 1DQNA 3M6MD 1QWSA 4G4GA 4GPEA 3OURA 2QX8A 3BULA 1Y3HA 4WCFA 3G9UA 3T41A 3KLPX 5AVUA 2R11A 4AI6A 4N0MA 4YI5A 4ZC8A 5TY0A 2E37A 2PBRA 2YL2A 4IZOA 3NH9A 3IPYA 4EENA 1QUEA 3H97A 3T7CA 3QUAA 4YPVA 3UGQA 1S2DA 1BQEA 4EEZA 1ZM7A 4WN9A 2FGJA 2PX3A 4HVLA 2Y1XA 4X8OA 4X97A 5L4NA 1L0BA 4IMJB 2OD7A 3DTYA 1EFRD 1J70A 3FNFA 2GT1A 2P8SA 4HDNA 3A14A 4UBJA 2PRYA 5KYGA 1CVRA 4OJYA 4JR1A 2QUZA 3RS4A 4IGEA 3L8ZA 3U3ZA 3CRQA 9GPBA 1VJRA 3BF7A 4CDNA 5KWEA 2OAQ1 1EINA 1B8NA 4ZOBA 1BMQA 1GAQA 2H2IA 5KJFA 4C04A 4PPGA 1KMHA 1X3LA 2R6DA 2AD1A 1CDEA 3QKRB 4RTLA 1AIPA 4G23A 3RVOA 4AD8A 5F4ZA 4DLZA 5FUMA 5K8VA 3O3MB 1TEZA 3WNQA 1Z0SA 2ZYGA 4AN0A 2XCRB 3LTEA 2ILVA 3COYA 2X5KO 3AVPA 4FVTA 4KFSA 4MTCA 4UBNA 3I73A 5I5GA 3SSAA 3W5JA 4D9BA 2GPYA 2WFMA 3BB4A 2Y3IA 2BMDA 2GHTA 5DHPA 3U81A 4AJJA 3GXOA 2OHIA 4UHFA 3O47A 5KWSA 3E9MA 2WC1A 4PLWA 4F46A 3C3BA 1K9VF 3DCJA 1UT5A 1H93A 2RHDA 3E8SA 2IYVA 4R2JA 5BSUA 2OZKA 4MS4A 2I2WA 1ID8A 2HQRA 4IG4A 5I9SA 4YDQA 1MC4A 5LYJB 2JAUA 4DMFA 3H83A 4X64B 3FDFA 3COVA 4NZOA 2OE2A 5AM0A 4MYRA 2BFBA 4TKLA 1EVJA 4MV0A 3RVDA 3AHHA 3JWGA 6YASA 1ISFA 4IDNA 1DAEA 3KYJB 1U5CA 3JASA 4WKBA 3TIVA 1QOPB 4EW6A 1XEAA 3ABQB 2V6MA 3AUTA 4LNUA 4E2ZA 5AVYA 2VTVA 4BQSA 4DWOA 1JEOA 1ZI8A 2LBPA 3KJIA 4MUJA 5IBPA 1U28A 3QUTA 1EK2A 1XQ6A 2IHKA 3QI7A 2ZSDA 1Z5VA 3CY6A 3MYRA 1Q95A 2YJ4A 3QBDA 4I36A 4JT9A 4R16A 2P9GA 2AS0A 5DV9A 1KMMA 4AMUA 1H3NA 1RIFA 2P79A 3GG9A 3V4FA 4BX8A 5EZQA 3FNBA 1FRQA 3RS9A 3VBEA 5JLJA 2C54A 3SI7A 2PBZA 1UBFA 1FA9A 1GKKA 3AR3A 3ZKAA 3IOEA 3ECCA 3H5VA 2LTAA 2Q46A 1EVLA 3EARA 1JLSA 3PS9A 5EJMA 4CF3A 1C30A 1T9BA 2ECPA 2FPPB 2XYHA 4L5YA 4JI7B 1XAHA 3RAPR 1X9HA 4Y18A 3CSSA 4GYYA 1EHCA 4D8VA 4QXMA 4KDRA 2PMCA 5LBTA 5KSOA 4URYR 1WQ1R 3ESCA 4MB0A 3P5BA 2I3DA 2CUZA 1R7RA 3CRW1 3KQOA 3OQIA 1GL7A 1A72A 1DEXA 4HXYA 5T3YA 3ZQKA 4WNIA 3WA6A 3MCUA 4DIEA 4E30A 1RWMA 1NW7A 2MWMA 1QO0A 4QGAA 4UE2A 3AEZA 5JAOA 2BMEA 3R5SA 2P6RA 4IMIB 1DZIA 3CH6A 1QCZA 3LGSA 3NANA 3H9CA 4B43A 1R5OA 2PT5A 4MV7A 3RAJA 1HC7A 1QVAA 1P5JA 4BYGA 5CCEA 3N2KB 3WC4A 1CFJA 2XXJA 4B3CA 3V1MA 5G53C 1JDZA 2BHRA 3E61A 3HCCA 4G89A 5TGZA 3T5BA 4YMIA 2WV7A 5THKA 1HY3A 3MRVA 2IYUA 4MI9A 5IJXA 1IXZA 1DIAA 5K4AA 4DMGA 2I78A 5BXQC 2QMOA 3PNMA 2W2PA 4WNYA 1XN4A 3FAKA 1QQ5A 2DERA 4JUIA 4W63A 1O0SA 1SC9A 4CTMA 4KNYA 4XX1A 5DGCA 3E03A 1XNRB 4A0SA 2HRDA 4PCVA 2UKDA 4C3VA 2YWEA 2FR1A 4PINA 4L08A 1LVUA 3F5FA 3CONA 2HY7A 2J46A 4D4HA 1NXSA 2WSIA 6AT1A 1K8QA 2DPMA 3MW8A 1KI7A 2RGRA 1L3CA 2JJQA 2BGNA 2ACWA 2ZPUA 1YCDA 2BFCA 2BR5A 2PMKA 4MCAA 5EESA 4RELA 2VHTA 2HBRA 3DHEA 3KXDA 2Z8YA 3N2GB 3OSZA 2WD9A 1QDUA 1J1ZA 2IEAA 4TMFA 1XD8A 4OHRA 4H60A 3CH4B 2I0FA 1GSOA 2DQ4A 1VI2A 1A8HA 1RS0A 1ZIDA 3P2EA 4OTZA 3NI2A 4P3PA 5JASA 2BEVB 3HCWA 1CZHA 3DC7A 1YZQA 1O57A 1P1RA 1V5GA 2Y1KA 5BYKA 4J0FA 1G1MA 3AIOA 2CJPA 2ZE7A 2VJQA 3BAFA 1LFAA 1FNSA 1ENZA 1ZD4A 4QX6A 3VPBA 4CW7A 1I6LA 3UKJA 3FG9A 1NMQA 3I52A 5LCXA 3H5TA 2DLDA 3CE9A 3QSGA 4RY8A 1THZA 3AJRA 4ZPXA 1SXJB 1PCXA 4NABA 1JDSA 3R7SA 3TW8A 3VU3A 1C2TA 5F77A 5GZ1A 5KTYA 3GUZA 3OY7A 3C3EA 3N76A 5ADWA 2B9VA 4FNGA 3ZWXA 3D5EA 4BAZA 4ILKA 3LZDA 5I9NA 5T41A 2QN2A 3PFHA 1Q7GA 3MFYA 4HJRA 5T64A 2Q4EA 1TQ8A 3KB2A 2IZ7A 1RVDA 3L4BA 5G2OA 1KI6B 3EZYA 1Z6XA 2ZBQA 2VP2A 3GJYA 1AN0A 3NYRA 3VOBA 3KSMA 3URMA 3IP6A 1L4YA 4OYRA 3BWDD 1AA9A 1W87A 4MCHA 3T9AA 4JB8A 3CT6A 4M1ZA 2ZJOA 3DE6X 2Z30A 4NBTA 3ZZNA 4AU1A 1K3UB 2PTGA 4RDIA 3KQSA 3PPIA 4GC5A 5KKAA 1GUYA 3IH5A 3HM9A 3WV5A 3OT4A 3CMCO 1L5NA 2X1MA 1SUBA 1U9CA 4Q6BA 2FN4A 3PGVA 4EQ6B 4EY6A 4N7MA 3AU9A 2G40A 5KREA 1ZM2A 2VHZA 3GRZA 3S8EA 1MCZA 1QYWA 1W46A 2ERCA 1MENA 2WHEA 4LS3A 1ZKDA 4ESHA 5DXJA 4XPIA 4TLBA 4Q37A 4FDVA 4CM8A 5JO9A 2JIOA 3PQ3A 1H4TA 3LMKA 4KR9A 2Y8EA 1JQKA 2CDNA 2Y6UA 3H2GA 4M36A 4U9UA 1D2AA 2A67A 2IOQA 3G2MA 1I1HA 5AQ1A 3WJ1A 1KARA 1LK7A 3ZPXA 3CLUC 3FYHA 4G0PA 4KQEA 5CTAA 3C7KA 5DI3B 2IH2A 3UK1A 2CN1A 2I4LA 1MW9X 1UPTA 4WESB 4AQ7A 5CXSA 1VHWA 3AFIA 5BMVA 4ND1A 3AFGA 2QN1A 2P1DA 5DCWA 5EE0A 1NLZA 2NO5A 2QQFA 3FKSA 4WXRA 4I6EA 4E51A 4X85A 2FW7A 1LDBA 3O38A 3GDFA 1K8ZB 1GTL1 4C3ZA 4E32A 4X62B 4BN0A 3WYAA 2B5VA 3H5OA 3WBKA 1GT91 1MRZA 2O50A 3CEHA 5EXDA 3UZUA 4LWZA 4BVGA 4EMTA 4JQSA 2BI4A 3ELWA 4TYQA 5B1DA 2A0FA 1HLFA 1INLA 4RV4A 3GPLA 1UOOA 3ANLA 1MGPA 4FYHA 1GTSA 3BE6A 3ELDA 3H18A 3Q87B 4K6MA 3PFCA 2BTQA 5CLQA 2QAIA 4DJJA 1YFJA 3FJYA 3R8CA 3LGXA 3QGMA 4ZAFA 1E7QA 1K2WA 2C4HA 2YWHA 2ZVQX 4L5IA 4WVLA 4Y6QA 3X2FA 4L5CA 4BP9A 4CZ2A 1ZI9A 3LXMA 4RPGA 1JFFB 4BMNA 5KYXA 2Y1CA 3R0IA 1YOVA 3SHFA 2HA7A 1CUJA 4BPBA 4KSYA 3RRNA 3HU5A 4C4AA 2COKA 5EIHA 2VDWA 4PFKA 3C48A 3PWZA 4YASA 3QEMB 3RBXA 2OP0A 4J0QA 4L28A 3NW9A 1QK4A 4F2DA 3NRCA 3EJWA 4DBZA 3OQHA 4X61A 4AX8A 4EYQA 1KMNA 3N2IA 4TRJA 521PA 3ODGA 1B43A 2H4XA 1Q0SA 2REQA 3BBLA 1Y81A 3FI0A 4LYFA 4TKZA 3WGNA 1YJXA 2A84A 4D9MA 4F6RB 1SXJC 1NOKA 2C2XA 2PLWA 4HFRA 4RD2A 3R7WB 3GLIE 4JBGA 2IVFA 1FCJA 4WZAE 1P5RA 2WQZA 4RETA 2VNKA 2JGRA 1NBMA 2X15A 2GZAA 1NNUA 3EDYA 3DFKA 3BRWD 2P9JA 3TF5A 2O0LA 3AUFA 3KWMA 4DMHA 2WUVA 4FFRA 1FTSA 2DH5A 2E7ZA 5BQOA 2EYQA 1PWHA 1J07A 3OJXA 4JJZA 1YVRA 3KXPA 4XYLA 2JAHA 3HYNA 2E48A 3NAGA 5FA8A 5M04A 1T6NA 1GRNA 3JQ7B 5DSXA 3ZI4A 5CNMA 2O59A 5H9VA 4PG8A 4UDXX 4WOBA 3UW1A 2O4CA 5J3JA 1G291 1U98A 5LQSA 2PX0A 2YKGA 4COOA 1GG2A 4EL5A 2R6JA 3U0BA 3X2EA 2DHEA 4X8HA 3LQQA 3LHIA 1RRPA 5KJ6A 1DXQA 3ZD6A 2YCLA 1DIOB 3E70C 2P2NA 3F6CA 4KKXB 4L2IA 1H9BA 2YJNA 1WCYA 2UZAA 3JQPA 4HVAA 1FQOA 2QKYA 4M6WA 4R31A 5ERXA 4N3GA 3TFOA 5B12A 4L6AA 2P9QA 4NJMA 3VTAA 1NRWA 2R7LA 2YS7A 1ORVA 3T1QA 1MAHA 2XRMA 3CEJA 2FZWA 3B6KA 3FYTA 1KIMA 1M1UA 2PPVA 3GLTA 4YREA 3WGZA 3W77A 4TWZA 1VHTA 3K0AA 2R6FA 2CLMB 3ORHA 4MV3A 4HB4A 2FQ1A 2I3GA 1N2OA 4Q1AA 5GJBA 3HWX1 2BE7A 1E32A 4RULA 1ZMBA 3KNZA 3AHFA 4QWMA 3K35A 2RBEA 4PLFA 4OUKX 5D86A 4B9AA 1IATA 3EQ9A 1MOPA 5I47A 4LJRA 4FEAA 1CUEA 2IEBA 4KDFA 5IT5A 3D4IA 2B61A 4JIMA 4DCGA 3UYKA 2WE8A 3DE7X 3CVOA 2YMPA 4JJ6A 4RAOA 1J8FA 2PMWB 4ESOA 4K5QA 3U3RA 5K3AA 3GLGE 1D2MA 1PR5A 4C0WA 3ZNOA 3NIWA 2J5KA 4MQFB 1RYBA 3ZEIA 2AI3A 1RDFA 5KTPA 2DWUA 2QYOA 2GBFA 2WAAA 3WWYA 3C14C 1P9WA 2XNHA 4PXYA 3KZVA 5G02A 1I5EA 1VLJA 1ZRMA 4CM5A 5I7FA 1VIAA 5CAEA 1S2GA 1L6IA 3ZLVA 1Z2EA 1M2KA 2ZB4A 2Z1DA 1SOAA 1X0XA 2CXTA 4LNHA 2PKXA 4MKIA 2IXTA 5DT9A 2IYWA 2B8EA 2V54A 3O7MA 4X1IA 1MKYA 2QE7D 2P9YA 3MB8A 5F2KA 5DEOA 2X3FA 4OGLA 4QGHA 3CB4A 4Q3KA 4X95A 4IGKA 2A5YB 2FDXA 2LE0A 5DW0A 1A9TA 3NALA 2QZPA 1WB6A 1T2VA 3KPWA 4EOGA 3F97A 5DVZA 1PQPA 2H0RA 4U02A 1XKXA 1Q21A 1DV2A 1XNHA 3UVEA 1USUA 2FMTA 3TQCA 3G2QA 5HA5A 4KFUA 5LUBA 2IV7A 2XECA 3BD7A 5IZ4A 1QS0B 4BNLA 2CVFA 3N8KA 3VHLB 1MOZA 1SEPA 3PTLA 4PN7A 3WL7A 1LJLA 1QOZA 4OHPA 5HEKA 3VAZA 1G18A 1EG7A 1K68A 3P71T 3VHQA 5KWVA 1M2WA 3M82A 2WWWA 1A27A 5IN5A 2DFDA 4TYWA 3HVJA 6GPBA 1I5OA 4PHFA 2ADFA 3PXCX 2JLZA 4YWJA 2AGVA 4L07A 1M8KA 4IWNA 4MS4B 1ZIPA 3U3OA 4PV7A 4M0KA 4PYRA 4HWTA 5BNIA 1ZUWA 4BNGA 1Z8FA 1TUIA 3M6VA 3SZGA 4D42A 4NEGA 5B6JA 2O8DB 3L02A 5IJWA 5K0CA 1QRAA 1KMQA 1YC5A 2BFBB 4IXMA 8ADHA 2JKZA 4I4TA 5AHXA 4C14A 1T2CA 4UUQA 1UMKA 3FY4A 3NAQA 9LDTA 2JLBA 3LC1O 4HRYA 5L6LB 4FYWA 3DHWC 5T67A 3LYAA 4KH0A 1UFVA 1V39A 1QHIA 1Z3IX 3LPLA 4Q7LA 3ANXA 4X24A 2E2WA 3G5UA 4XUCA 3ZU6A 5HQ3A 2CFRA 5FPSA 3OZIA 4G5QA 1K08A 5JYCA 4B7UA 1WRBA 1Z88A 4YAEA 1RJGA 2DM6A 5ALEA 3ROEA 3HY4A 3DDNA 3U7RA 5JNRA 5T5QA 4GDMA 1RCUA 1EAYA 2VA9A 1A8UA 4X7PA 1R3UA 1UIRA 1UJ5A 4DW8A 5LQMA 4DMRA 4GMDA 1U8TA 3EQZA 4K88A 4NBKA 4X71A 2VNJA 5LP6B 3W5UA 1Y34E 2RJ3A 4GDFA 2EEPA 1L4MA 5DTMA 4J94A 1D1SA 2GFHA 1B16A 3UUFA 3G02A 3HLKA 4M46A 5H1YA 3ST7A 3VTZA 4YRBA 4OK5A 1YIOA 3A4MA 2UZ0A 2VP5A 1C9DB 4L4RA 5CT5A 4P93A 5H70A 1NJ8A 2WFAA 4OHZA 4CCYB 1DUSA 3VR5A 4I9GA 1JFTA 1QIIA 3CEMA 4UZFA 1RWNA 4TWAA 2MCFA 1ZJYA 4DLLA 2A1UB 1MC5A 2L82A 4M98A 4O4LA 2WWVD 4ZEMA 1O9BA 3NHPA 4DWVA 4F6LA 4LSGA 2IY8A 2K2WA 2H0QA 4WXYB 5FBRB 3BJIC 3IP5A 1A9QA 2J33A 3EWIA 3CVXA 1SXQA 4K3VA 4Z86A 3E3NA 1B3BA 4ZRNA 3EA0A 3HLYA 4YYEA 1RM4A 1TCBA 2QL9A 4ML3A 3HI4A 3R1IA 3IUNA 1Y1SA 2ZVJA 1DP4A 2HNBA 1JAIA 4ZXFA 2TRSB 2PNJA 3R4VA 3DM5A 4PYJA 2CB0A 2VPXA 4INZA 1JQ3A 3PNQA 1W25A 1C8LA 5D6NA 1GPMA 3ZK9A 2BMVA 5JS6A 4MRPA 2ZR9A 2GD2A 3LHDA 1Q50A 4NBLA 2BI8A 4YJKA 4WY2A 5CMLA 4ZVQA 2QGZA 4BLOA 1X80A 3IE1A 1K6XA 1T36A 3SXUB 3PNSA 1FY2A 1L5SA 3KOWA 3BZBA 2XRZA 3TZBA 4UPEA 4OA5A 1CERA 2HRBA 4OU5A 4XEUA 3TE7A 2JCGA 3KPUA 1KQPA 2Q9BA 2K4MA 1FX0A 4MYUA 4V0KA 3EIHA 5FR1A 1HL3A 4BLPA 2JGAA 2ZIGA 4FR0A 3ORYA 2GA8A 4S0XA 3DUFA 2R48A 3PHJA 4U2KA 4PFSA 4LZJA 3DKIA 1ZJWA 1SA0B 4JFRA 1W5BA 1O4VA 2ZROA 3JV7A 2EP8A 4D43A 1I7DA 1W52X 2QPTA 3ET4A 4GD3Q 4Q1FA 2V7QA 3K9FC 2BELA 1EWQA 4L4YA 2HAEA 4C4XA 4GLBA 5EMNA 3RADC 2EJVA 2QRVB 1TIBA 1NF9A 5CH8A 3RW9A 2VT7A 1E3MA 1U4SA 4R2IA 4DSOA 1SCBA 5B3JC 3N07A 1W19A 1QRUA 4ZCTA 4IXDA 4ZDWA 1Z39A 2Q1SA 2Q1TA 4RGQA 4MV5A 1A7UA 2A9VA 4PHTA 5KVSA 2WLTA 4LHEA 2BM1A 4FFWA 1OTXA 4PY2A 4US1R 1XDBA 1DKUA 1KY5A 3SJ7A 1JN0A 4Z0HO 4C0SA 3IJEB 4RA6B 2HWXA 1HR0B 1UFRA 4FS8A 2HMYB 1EUCB 3GF4A 2HBYA 1G7SA 4XEHA 3EEYA 3T3HA 1MORA 1H4VB 1U2DC 1JMVA 3Q3JB 4RGYA 1N2JA 2GCOB 1TZBA 3S27A 3EZLA 2ZRIA 2ZAIA 1E0AA 4CE6A 4NCAA 5LP6C 4UQPA 4O2BF 1JLLB 4CWAA 1D07A 3A0RB 3CZQA 4Q4DA 4GYKA 4AP9A 2O0MA 5J4KA 4PC1A 1JHRA 3GFSA 4L57A 3T7KA 4PU0A 4X7BA 1Y6FA 5FR2A 1CF9A 2DFTA 3H2ZA 4JN6B 4S0ZA 3WG9A 5JZ9A 1MB4A 2FTKE 2Q4BA 2XZTA 4OQEA 1ADJA 1E3JA 2KB0A 1BCRA 3BWBA 3NPMA 4RDHA 3ZIAA 5NLLA 2I8AA 1TM1E 1EA5A 1YRLA 5IKMA 3A11A 4ENWA 1DC8A 3WGQA 1FVXA 4L5JA 4QLBA 1R5BA 3GB9A 4CM8B 5JQGA 3GGOA 4LGYA 3RYFA 3EY9A 3K4HA 2ISQA 2NTJA 2WINI 3U3XA 2QM8A 3EGDA 3WB9A 3HXMA 3S2EA 3AONB 2JIPA 1GG8A 2B37A 1NQVA 5DX1A 1IEVA 3FWPA 4NAHA 1LW6E 1V8FA 4K9RA 4LX0A 4NPAA 4TS3A 3ZUGA 4C2BA 3IL2A 2X5NA 1KFBB 3HJNA 3OCWA 1QQAA 4HO1X 2JLYA 1TTTA 1XPOA 4XD7A 1A82A 2KQUA 3C3PA 3C97A 4H6XA 2IOFK 2RH9B 4ZKEA 2R47A 5BMVB 3EPRA 4XCVA 4CV2A 1Z6AA 4DCOA 2P3SA 2QUJA 4MRVA 1RNLA 3NEYA 1KORA 1I0ZA 3D6FA 5TR9A 1FS5A 4IR7A 1C7QA 2AFIB 3KIPA 4V39A 3WS7A 3ILXA 2VAXA 1UFOA 1EFDN 3DV9A 1YMUA 2VEOA 2JJMA 3IOMA 2C5FA 4HNGA 4GI5A 2JA2A 2D6FA 1EFPB 3CKYA 2G88A 2V7WA 2WDZA 3HMQA 1RYYA 1VYUA 2FX3A 3ORRA 3OIYA 4HHEA 5F1KA 1BS9A 3SC3A 1K4KA 1GLNA 1NN3A 2NXJA 1YQXA 4I9FA 4AS2A 5DYGA 4CMKA 1AKRA 3JVIA 3GAMA 1ZRNA 1D8TA 1KEVA 2P65A 1T10A 1O77A 4JHXA 1OU0A 1G7TA 3O91A 1K5PA 1RU3A 3LRXA 4PZ0A 1XKTA 1IN4A 1KO8A 3OQVA 4MSUA 3LVRE 3QELB 2C84A 2X6TA 3KZMA 3TFWA 3A6DA 2FQYA 3IP3A 3OX3A 1UDRA 3PQFA 3MS4A 2OGTA 4RKEA 4AIRA 2VDWB 1SUDA 1ZC3A 2DKFA 2WKSA 4DEYA 4CF5A 4IJKA 1JMYA 1D09A 1QE3A 4NBUA 4QYIB 2PMDA 4O59O 1DO8A 5KOHA 2BM0A 4ZVSA 1PJ2A 2CF6A 2JI8A 2RH4A 1CD5A 1DJNA 4ALLA 4HLNA 4B3FX 2IKSA 1T24A 4ND4A 4UU1A 1OVGA 1W0JA 4JJKA 5EHGA 4Z4IA 2ZIZA 2XQJA 4DNQA 3OM9A 3QTBA 2F9LA 4PCUA 1W47A 2I29A 1VPDA 2X8WA 3QM1A 4HDMB 4X6LA 1TL7C 2YNMA 3KOYA 3MRSA 4L1KA 5ALOA 3WYFA 1KC1A 1VLLA 1XZIA 3F7MA 3MJSA 4QTYA 4QGSA 3CVJA 1Q0QA 4UJ5A 4X9XA 3P7MA 3ONWA 3L4BC 3K8OE 4PVCA 1FP1D 5FTKA 1M1XB 3QU5A 4C6RA 3SDZA 5F52A 3VNBA 2QLMA 2LPMA 4BX0A 2VDOB 2C20A 3QKTA 5F5LA 1NV9A 2XITA 5AVRA 4W9MC 1P4SA 2GJAA 5H59A 2I67A 1NRXA 4DXDA 1KZ1A 4ZO7A 4XUEA 5ADVA 4C2TA 2OBMA 3SQMA 4EY4A 2OQVA 2A0XA 1Z47A 2CFCA 1AC5A 3BXGA 3MELA 2LRHA 3L8YA 4BASA 4UTRA 2Y6VA 4B6SA 4LKOA 3ZVMA 3D31A 3EAGA 4EGSA 2JH8A 3K5HA 3SK0A 1MIHA 4L2IB 1A8IA 2IRWA 2O0KA 4L0CA 3THWB 4BFCA 3AV3A 3EYAA 4PLVA 1MB2A 2YZ2A 3Q9SA 4PX5A 3RQSA 4NJMB 1X1SA 3CBQA 4AMZA 4KWEA 3WL6A 1YR2A 2WG0A 4B3SB 1Z9BA 4B9EA 3S4YA 3NP9A 2BKVA 1B2LA 2MSCB 3H17A 1X1DA 4XD2A 5CURA 2HGZA 4FFBA 3I09A 1UAGA 1EFTA 3VR3D 3X1DA 1LA2A 1DTEA 1RQXA 1IJBA 1Z36A 1DIHA 2BR3A 1B0AA 2RC5A 3AKEA 1A4XA 4LTDA 3CCCA 2NTNA 4N18A 1LC0A 5ILQA 2QTBA 2J7PD 4RD6A 4AKEA 4WW0A 4QPDA 1IRIA 3H5WA 3RT7A 5HW0A 4EJSA 3GJXC 4W5HA 1ODLA 1KH1A 1JA9A 3N58A 2J48A 3DULA 4J91A 2JIMA 3H9QA 3ABSB 4CEHB 2HSZA 3K73O 3GARA 4UU8A 5FAKA 2H9YA 2H4HA 1J0CA 4KVGA 3P52A 4XOUA 4YRPA 2FZEA 1UPXA 3BH6A 2C97A 5DSZA 3QVOA 3RRXA 5CAEB 5C3MA 3RI3A 3IQWA 3P9KA 2BFMA 2XMSA 4QM6A 2HMAA 1N2HA 1ZH6A 1SJ9A 2RGEA 4GM4A 1ZM9A 4LGVA 4X1IB 5DTRA 4KYIB 2IC5A 1WXEA 5JCOA 1QGUB 2XRFA 1UXOA 1C8BA 1ORRA 2Q3CA 5TX7A 3TEMA 2R1UA 3L6RA 7REQA 5IUJC 4DREA 1EP9A 3C16C 1P62B 3ZQJA 3R9XA 3ZIUA 2AI2A 3FSEA 5FFMA 2AQIA 2GNOA 2WTUA 4NK4A 2XD4A 2FB9A 4QG7A 4QQNA 1D1TA 1U63A 2QTRA 1YGPA 2I6QA 3B20A 3ZHSA 2F43B 2JVJA 2Z4TA 4LSMA 4X20A 2PXXA 3FUTA 1G2OA 2PWZA 3R9KA 5LKAA 3AOGA 3T3GA 2FSFA 4PRZA 4DV3B 1MHTA 2G17A 4RYLA 2EBHX 3RT9A 3FNGA 2VPPA 4RBNA 3FDIA 2AEJA 2ZRDA 3HXQA 1ZJJA 4I1IA 2ZAOA 2EWMA 4FOLA 1CYEA 3JQBA 3LFHA 3OFVA 4LQDA 1UBJS 4OFXA 4YH1A 4KR7A 1PD1A 4U6NA 1X42A 3ZW7A 1GQRA 3VO1A 4UTZA 3OOJA 4J75A 4KV7A 1XZCA 4C03A 1KNQA 1NUAA 4G41A 2AFRA 5I3ZA 4PHGA 2PX6A 2KJQA 2VHJA 2ZQZA 3EVBA 2H4YA 3VPHA 2H1HA 4DDUA 5BV2P 1LWOA 1YKGA 5T4FA 3ROKA 3WLEA 3M3DA 3FXAA 4I0WB 3B9BA 5B2EA 3AY7A 2BFAA 2NU7B 3MFQA 3GA0A 2JFQA 3NHKA 3QI2A 3OOYA 4I4TB 4EUNA 1Y7HA 2ASEA 4OOFA 3FCYA 3FCUB 1QP0A 2X0FA 2BZ1A 4E2WA 1QRTA 5A7HA 1L8QA 1Q20A 3WIUA 3A26A 1VOTA 3D6AA 1XZQA 3FDZB 3LUHA 3LQ1A 1DC3A 2CSUA 4G5SA 2ZSHA 4BVLA 3D2BA 2FOLA 4OXXA 4UFOA 4HXFB 4TV8F 2VQSA 1R6AA 1T9HA 1CJKC 1EFUA 1LDMA 1WX1A 5H68A 1HURA 1BE8A 1DQZA 2YVQA 4WEOA 2X8JA 1XZEA 1CULC 3QXGA 4W9NA 5CP8A 4D3XA 4PNEA 4HZIA 4DHEA 4C6SA 4MVYA 1JALA 3IEVA 1EXNA 3AKDA 1JQ5A 2C2KA 3X1MA 1XZPA 1O8CA 3LBYA 5C8VA 4CEJB 4X44A 2H2FA 5DK4A 3ZTYA 1TLLA 1JG6A 1DBVO 2C4MA 2PGIA 4IH4A 4U6SA 4AICA 1PTJA 3NDBB 2MMCA 1WTAA 1BMDA 2PAFA 4YXFA 3W5VA 4WUVA 3NASA 4YMUA 2J85A 5JU6A 1K6JA 5CVEA 1JDUA 4YMTA 4EY7A 3ESAA 3ZHTA 4DCPA 4BEBA 1U0NA 1U65A 4C05A 4R2MA 1J0EA 1U3FA 4N4AA 5FV4A 3D2LA 2GN9A 5ALKA 3FNEA 4IM7A 4AF7A 1ZBDA 4X7MA 3B53X 4EG5A 3ZY6A 1ULUA 2NTEA 1EMDA 1N5OX 5AW5A 2NSYA 5IJ0A 3RSFA 3TAXA 3TUJC 3W78A 1QPZA 4F8JA 1Y6JA 3KQMA 4GBJA 4E6PA 3QYJA 2Q7OE 2XB4A 3DLCA 1TE2A 1U0BB 2HA3A 1L5HA 3IILA 4XOIA 1OBHA 3PXEA 1SUEA 2CB9A 3CNEA 5K03A 3FRHA 1KXZA 4PG6A 1QC5A 1KY3A 4B2IA 4V3BA 1BDBA 1WW8A 2Y1LA 4JP1A 2W6CX 4POAA 4Q4HB 4WXHA 1UFQA 3VNAA 3ZKWB 2WF7A 3I6ZA 3ZU2A 1CUUA 1VSQA 2PQ0A 4CT0A 4EA7A 1CRPA 2Y2UA 3KL2A 3F5QA 2HF8A 4TLCA 3V7UA 2QTLA 2W2VA 1GA4A 3MUFA 2PG3A 2YDYA 3ZNNA 4W8HA 4RD3A 5D3MA 2VJPA 4CMEA 2ENWA 2QR3A 3IVRA 3LWNA 5EWJA 5FTNA 3NHYA 2B4QA 3QMWA 4UUNA 4ZVUA 1FX0B 1ZXLA 2PWBA 4PZDA 2EARA 3RNOA 3HJBA 2ATCA 1YL5A 4HDSA 4OHWA 5CH5A 3VVCA 2C4VA 3WMRA 3WNZA 2AZMA 1XGKA 2H11A 1G4HA 2TSYB 1Y6ZA 4FW8A 1DBWA 4XQ9A 3D4PA 1XEWX 3EGOA 1E2PA 1I3MA 1ZGBA 3Q1LA 4OQNA 2C2WA 3BOSA 1UBRS 4ZYZA 3J7TA 2OBYA 3OZDA 2G7MC 4O2LA 1VG0B 4BKOA 1NRJB 2CLIB 3PGKA 3VC1A 4YAGA 5F35A 3TSWA 3GNQA 5CFPA 1CUAA 1LY1A 3G8YA 3QMPA 4F71A 3N6VA 2Q6IA 4A8JA 4DKJA 4E03A 1H42A 3E35A 3GO4A 3ZV4A 2A14A 2R96A 3FCAA 2G3YA 1DHTA 2OY0A 2QI9F 3FOCA 4NY1A 4ZJZA 1HDEA 4LFBB 4J4HA 4GC9A 1BRTA 3DF9A 2ZZMA 3E23A 3OZXA 4PG5A 4C22A 1SXPA 4UCXA 4RC9A 4YPOA 1R4MA 1Q3TA 1I4WA 1K86A 3FVVA 4M89A 1P7PA 1CQPA 1RLMA 2PL5A 1AUVA 3IVAA 3BG5A 2AXPA 2LXNA 3S2YA 2RGNA 4QOFA 1NDHA 4U7WA 1D9XA 4QFDA 2UZ4A 1XQ1A 3ZY4A 4HLQB 4U00A 1E77A 2W2LD 3SZMA 2FSHA 3LPNA 1E9SA 3CFYA 1RAEA 1GQSA 2A0UA 2H54A 1PZMA 1RBMA 2GPBA 4A8HA 1QRSA 2O3JA 1YCHA 4OYLA 5TMDA 1T1IA 1DKNA 2MYTA 2VL7A 4MKFA 1VPWA 3ZE9A 3QW2A 1FRNA 5DX8A 2QJFA 4KK3A 4HYTA 4N01A 4CM7A 3OIVA 13PKA 3M7IA 1OLXA 4HH3C 4QFBA 2DCUA 3UUEA 1RBYA 2Q0QA 3EISA 4MGIR 2GF2A 1CQJA 5LYYA 4QVIA 3DBIA 1IBSA 1T0HB 4O4IF 3HYSA 3BCHA 4CDRA 5ALQA 1BA2A 4JLWA 2FF7A 2G1KA 2QXYA 3D6TB 4AULA 5ES4B 4CM4A 4MDHA 1GQYA 2QENA 4OM7A 5JQGB 3QVTA 1CTQA 3JQ8A 1Y9EA 3RSLA 2AMYA 2TMGA 3H2SA 4FHZA 4Q3OA 1NW6A 1W29A 4Y67A 1PO7A 1GUAA 4LOJA 1L7EA 1MAUA 3KLBA 2GJ4A 3FHLA 4M0MA 3K8ZA 5DTIA 1PKXA 4AJ4A 4BB9A 2UAGA 5CA0B 3KQLA 3EC7A 4MR9B 4B44A 5BN5A 4FCVA 2PYZA 1N34B 4GUAA 5TIIA 2GARA 3UWPA 5KIAA 4FZVA 3KJZA 1GZ5A 3X1JA 1JWBB 1RPNA 3NDIA 4I3FA 4RZSA 4DCUA 1RHUA 2CHEA 3OEWA 5EQDA 1U0HC 1NIJA 1N5JA 5K09A 4Z5XA 3VPXA 4JI4B 1N2CB 1NW4A 1L4HA 1QHFA 4FGUA 2SKEA 2XE4A 5FADA 2EFYA 1AGNA 3EVTA 2V59A 5A4IS 3KT8A 4FZ3A 3GFGA 3PQCA 4I3GA 4RD0A 1G4UR 4WZAA 1W36D 3WK7A 4AJEA 1MX9A 2H5LA 3NNNA 4Z7QB 4TL6A 1AQLA 1UDXA 2FJ0A 2MSWA 4ATNA 4ZHSA 1P4JA 1ZMOA 1WUHS 3GHYA 2OPHA 5B55A 5K8UA 4JY7A 4RTRA 4IHJF 4WNAA 2ZKIA 1OH6A 1SBNE 1ZW6A 3QFRA 3CJRA 3RDPA 1NQUA 1GAJA 2PRKA 2VS1A 2ZZKA 3G1UA 3G2JA 3IPCA 4IGAA 1B6GA 3DD1A 4YT5A 1GNTA 4YCNA 4I5FA 4LJYA 5KNBD 2QL6A 3KTAA 3A0UA 4NYJQ 1P72A 3SHOA 3UK2A 2FWJA 1OXVA 4URFA 3VDRA 2VJOA 3G9XA 5EIBC 4J0DA 4D4IA 1RXVA 2FX5A 3KUUA 3DGEC 1PUIA 3NR2A 3TTVA 2G1UA 4YLGA 3FPJA 1SHKA 5CG2A 5AM4A 5HQJA 3CISA 4UHJA 3DZ8A 2NTYC 3V4ZA 5CG1A 4G4IA 1JB1A 1CS4C 1W44A 2AV6A 3HVKA 4PANA 2L17A 4XFDA 2BBTA 1KFKB 1CB0A 1P9NA 3FBGA 3TJMA 1L7PA 5H5JA 4B09A 2XDQB 3IBSA 2WYUA 1GTMA 4UHDA 3W9BA 3M6FA 3UFBA 3AEXA 4MWSA 4JWKA 2UYOA 3B36A 4QHTA 3DMNA 5JCJA 3A6EA 3BGDA 1U81A 4K9QA 5FH9A 5IDQA 3HDVA 4TX1A 4EUKA 3S44A 4H1WA 3RVMA 3ZLJA 3ER8A 4IQFA 3U16A 2YY5A 3ZJUA 1RI5A 1DZ3A 5K4GA 5IEJA 3K9BA 1UEXC 1JQBA 2XUKA 2W6OA 3ENVA 4R68A 2AC2A 1P7CA 1UC9A 2OCXA 3A4YA 3AR5A 3C1TA 3WNDA 2LW7A 1ZHFA 1FL9A 2XEXA 3EHDA 5ALNA 3RSSA 1GGVA 2DC1A 3EFEA 3ZE0B 2O2HA 5TQ2B 1FTGA 2O06A 2YV1A 3D3WB 1KVSA 1Q1ZA 1DQRA 5IT4A 3GLGA 3SN6A 3PHGA 1L5GB 6REQB 5LVAA 1ZMXA 2A9RA 1G8FA 1KI9A 3E9QA 1QR6A 3ADBA 1JPNA 2Q21A 1X7XA 1HLPA 3HXPA 4MW1A 3TG2A 1SKAA 4CHTA 4V1CI 4TRMA 4BKRA 2QR5A 5L8VA 4BQNA 1TKCA 1SH7A 2CXUA 2VPWA 5ESWA 4CN9A 2YYSA 2XQIA 5CT4A 2H7XA 4MMYB 1ZQ1A 1F06A 4P33A 3WL3A 3ZGVA 2P4QA 4TMWA 1DJLA 2AJBA 5FAXA 1XZNA 1L2TA 2AR7A 2X2FA 4KRXA 1PN3A 3SS7X 1GXSB 1ZM3A 2GQ0A 1JT9A 4OA8A 1QMGA 2ACEA 4MAFA 3ITKA 2BH2A 4FJ2A 1MFZA 1VECA 3EPLA 2FN9A 4Y1GA 3RLFA 3IQDB 4XARA 1VL1A 2PCLA 1BIFA 1LPAB 2A1IA 5IANA 5JS2A 2CDAA 3K8QA 1XF1A 3WSTA 3ZWWA 1J22A 4B71A 4XSHA 3UMJA 5EKDA 2B1IA 3HA2A 1ADFA 1LDGA 2FN3A 4Q1VA 1KF0A 1P7VA 2Z9BA 1ACLA 3EBPA 2MYNA 2MYUA 3KR1A 3TD6A 3KYDB 2W22A 1EE2A 4BJ3A 1JE0A 1RAFA 1S3GA 2BFEB 3UXMA 1EBBA 1NJ5A 1PT9A 5KYWA 1T2AA 4HTFB 1P2TA 2B25A 3Q8XB 1FDOA 3K09C 1K5HA 2X7HA 3HUTA 1J09A 3A2KA 3MUOA 1QFXA 3PJEA 3TLZA 4GNKA 4RKYA 3W4IA 4G3XA 2GPJA 4GO1A 1G60A 1GNVA 1I4OA 1ZGZA 3CLSD 3H11B 4KLRA 4N3AA 2O57A 2WWXA 2HYIC 5ILGA 2VRBA 1QHGA 2W4IA 2V3CC 2XGMA 5FI5A 3C43A 1AUPA 3CIFA 3GMSA 2Y1DA 2C57A 3VR0A 2V6JA 4JI2B 1K89A 2Z8ZA 4Q4LA 1TB4A 4W7SA 4X20B 3KLNA 5B64A 3PBKA 5A1TA 1JA1A 2ZYRA 2DQSA 2R9VA 3QITA 4JT4A 2OV2A 1FYFA 1V7CA 2FG6C 2IHZA 1CB7A 2HBQA 1KWGA 2J1LA 1JX6A 4EZEA 4BV2A 2YC4C 2WU0A 4JVLA 3BA1A 3HCEA 5EJGA 5C8YF 4BRUA 1PT6A 3T15A 1J2UA 1P5FA 4RK1A 3SFZA 4DCCA 3LYUA 1QLHA 2QNBA 3PYMA 4RDCA 2RK4A 3ROTA 1UWLA 3G1TA 2NO4A 4F1KA 4KNWA 3ELYA 3O8OA 3E0XA 3CVUA 1TUBB 3LUPA 4M0EA 2UYQA 2ZWPA 3V4PB 4ASUD 4KXXA 5TEVA 2HA5A 4DZRA 1DBIA 4KR2A 1ZL0A 4UCWA 3KOMA 2VP4A 4MO2A 4QBKA 5FTWA 4AROA 5F3DA 2VDLB 2VOJA 4GKKB 2RGYA 2AIRA 4ZCRA 4PTZA 5F73A 2E4ZA 2JK1A 3WLRA 4Q1BA 5C5CA 5KQPA 3VVMA 1T0BA 3JAWA 4M37A 4PYKA 4AZ0A 5G4KB 2P9FA 2K87A 1D0IA