2A0XA

Structure of human purine nucleoside phosphorylase h257f mutant
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
282
structure length
282
Chain Sequence
b'NGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANFEEVLAAGKQAAQKLEQFVSILMASIPL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Purine nucleoside phosphorylase
publication title Neighboring group participation in the transition state of human purine nucleoside phosphorylase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 84
structure length 282
sequence length 282
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2005-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2a0xA00
1JDUA 4DA8A 1YQUA 3UAYA 4NS1A 1Z37A 2HWUA 3D1VA 3PNSA 3BJEA 4D8YA 4DA0A 1Z5NA 3PHBE 1ZOSA 1B8OA 4TYMA 3EEIA 1ULBA 2OECA 2ISCA 4D9HA 1JE1A 3EUFA 5CXSA 2ON6A 3ONVA 5KB3A 3GB9A 1ULAA 2I4TA 4OJTA 1Z36A 1A69A 1V41E 4TXMA 1K27A 1TD1A 4WKCA 4LKRA 3UAVA 4TS3A 4GLFA 4MARA 2AI2A 1RT9A 5FAKA 1PR0A 3NM6B 4JOSA 3FB1A 4M3NA 5I3CA 4TTIA 3O6VA 4M7WA 1RXSA 3DJFA 1VHWA 4L0MA 1LX7A 2OC9A 5B7QA 4H1TA 1RXCA 3NM4A 4TXNA 4MCIA 4QFBA 4ECEA 4RJ2A 3MB8A 3LA8A 2QSUA 1Z38A 1T8WA 3PHCA 1U1GA 4OGLA 4QASA 2AI1A 4LDNA 3IOMA 1G2OA 1FXUA 1U1DA 4I2VA 3BL6A 1PW7A 4OY3A 4DAEA 1VHJA 2XRFA 4TXLA 4R31A 1T8YA 3SCZA 1OTXA 4LZWA 5CYFA 1CB0A 4OEHA 5CCEA 1PBNA 1QE5A 2OXFA 2P4SA 1Y1SA 5EPUA 2OC4A 1Y6QA 4F3KA 4TTJA 3UAWA 4KN5A 3FNQA 5C80A 1WTAA 1VMKA 2QDKA 3MMSA 4YMLA 4JWTA 4EARA 3PNPA 5F78A 1OU4A 4DAOA 4GMHA 5IFKA 1JDVA 1ODLA 4M1EA 4G41A 2Q7OE 3OCCA 1Y1TA 4L5CA 1JP7A 2HN9A 4NY1A 4L5YA 5F7XA 1T0UA 3UAXA 3KHSA 3KVVA 3KVRA 1V4NA 1PKEA 1Z5PA 1SD2A 5EUBA 4D8VA 1JE0A 4LNAA 1Z34A 3ODGA 3E9RA 4L6IA 2QTTA 1XE3A 5JPCA 1RYZA 2H8GA 4FFSA 3KVYA 3EUEA 1Y1QA 3OF3A 3UAZA 5F77A 1SQ6A 1OV6A 1PR1A 1NW4A 3UT6A 4QARA 1CG6A 2A8YA 2B94A 5ETJA 1A9TA 1RXUA 2GUWA 5CYGA 3OZCA 5F76A 5K1ZA 1ZL2A 1RXYA 1TGVA 1T8RA 5B7NA 4GLJA 5DK6A 2RJ3A 3FUCA 4DARA 3INYA 5IU6A 4D8XA 4UC0A 3E0QA 5F7ZA 4G89A 1OTYA 1V45E 4BMZA 1T8SA 3DP9A 3FWPA 4WKNA 1VFNA 3IEXA 3GGSA 4MCHA 3T94A 1SD1A 1PR6A 4NSNA 1A9OA 3C74A 4TXHA 4DA6A 2A0YA 1Z33A 4F1WA 1JPVA 1OUMA 4YO8A 4IP0A 1JDTA 1K3FA 1RSZA 1C3XA 4WKOA 3FOWA 1Z39A 1TGYA 3DF9A 1NC1A 1A9QA 3KUKA 1SJ9A 3EMVA 3U40A 2QTGA 4WKPA 1ODKA 1PR5A 1Y1RA 4BN0A 1M73E 1Z35A 1RR6A 1N3IA 4TS9A 3K8OE 4P54A 4PNPA 1V2HE 4DABA 4LNHA 4TXJA 1PR4A 3OOHA 4BMYA 1ODIA 3BSFA 3NM5A 1Y6RA 4F3CA 1A9RA 2IQ5A 1JDSA 4PR3A 2QPLA 3BGSA 3TL6A 1JDZA 3O4VA 3K8QA 1YBFA 4E1VA 1A9PA 4QEZA 3P0EA 5CXQA 1PF7E 4QATA 5EFOA 4JP5A 2AC7A 3OZDA 4U2KA 2HSWA 1V3QE 5B7GA 4OF4A 4X24A 5CCDA 1YQQA 4D98A 1U1EA 3P0FA 3QPBA 4F2PA 5F73A 4EB8A 4OGKA 1V48A 1TCUA 4WKBA 1NC3A 2HRDA 2AI3A 4F2WA 3OZBA 1RFGE 4TTAA 1U1FA 3OOEA 1ECPA 1PWYE 3KU4A 3OPVA 1Z5OA 1A9SA 1JYSA 3DPSA 3LBAA 3NBQA 5B7PA 4L5AA 1RCTE 1LV8A 4K6OA 3ENZA 1TCVA 1U1CA 1YRYE 1Q1GA 3FAZA 2I8AA 3DDOA 1LVUA 4BMXA 2PGAA 1PR2A 4DANA 4G8JA 1I80A 1K9SA 2A0WA 1B8NA 3F8WA 2BSXA 4R2WA 1YR3A 3E9ZA 1PK7A 4YJKA 5F7OA 4DA7A 4YNBA 1PK9A 3LGSA 2A0XA 4GKAA 1OVGA 4R2XA 1ODJA 3OZEA 5F7JA 4QAQA
chains in the Genus database with same CATH superfamily
5KTPA 2BT4A 4EYEA 1D2RA 2V0NA 4S0ZA 3CF4A 4FDMA 4MYDA 3KKQA 3TIIA 1YL6A 2V6IA 5IC5A 5FWYA 3M2TA 4BGEA 3KYBA 3RUIA 2W2LD 4E2ZA 4B3GA 2HLHA 1J8QA 2OP0A 2G04A 4NG5A 3H65A 3FPAA 2X3UA 1HE1C 2ZG6A 3GJTA 5ALDA 1RHJA 1WPGA 3IQWA 1QFYA 2X6QA 3BQMB 4BLPA 4FTWA 4BATA 2OHGA 1RPZA 3FF1A 5EWLB 4H60A 4WUVA 1QORA 4JVNA 4ETMA 7ADHA 1IQ0A 1FX0B 1M2NA 1RWMA 4DR3B 3DDHA 4G0WA 2VT2A 1JA9A 2HA6A 5KTRA 4YAKA 1OFTA 1C8BA 4B75A 1KY2A 3RROA 2VPIA 2ZRBA 3KL2A 5KNBA 3AINA 4FP9A 1F8FA 1EAMA 3NYWA 2ZRIA 1NQAO 3GJYA 5FDFA 1UEIA 4GNKA 1GU0A 4RPGA 5JW6A 3O9MA 2DFPA 2P11A 4KQ6A 5JEEA 2YJ5A 5H3CA 4ARZA 3AU9A 1CR0A 4ZOEA 2JFQA 4AJ4A 1NM5C 2TECE 3PGMA 2GJSA 3L0CA 4MULA 4GLFA 2GEKA 1FP4B 2R8PA 4EUSA 5ICEA 1GGVA 1I01A 2UUPA 5BV1A 2FUG6 3O47A 3PQCA 1Y42X 2Z09A 3WLKX 5B6PA 2XCIA 3CW2A 3S2GA 3UXYA 3WLPA 1TRKA 2PBRA 3GLVA 4D41A 4W5NA 2IHVA 4L8GA 7GPBA 4XWAA 5AQEA 3MMZA 3NM4A 4NCKA 1VKHA 4QFBA 2HNKA 5CX1B 3AF0A 4CEJA 3DEFA 3O9ZA 3JVVA 3TLBA 5JASA 4GMFA 4IJQA 3ZGNA 1XJQA 7AT1A 3R0VA 2V7EA 2FEPA 4JBHA 3REQB 3DMNA 3E2IA 5AESA 1SOUA 1S1MA 3OE1A 1N0HA 2CF6A 3K8ZA 5KYWB 3L0ZA 3QF7A 1AKNA 1VCIA 1KH1A 2XT0A 4IDQA 4H6PA 3Q85A 4WIAA 4MO2A 4RHYA 5LJLA 2P6PA 4AJ2A 2NPFA 4K05A 3OH8A 3E2MA 5BR4A 4Z4IA 4WJLA 3TKYA 1XTZA 1O95A 4RSMA 3TBHA 1QZZA 3BRWA 1ENPA 4GR5A 2H08A 4V0LA 1A2KC 1D0VA 3BM5A 3I39X 5ARCA 5HTOA 2PUGA 4OHWA 2W6JA 2L0XA 2QM3A 2R9VA 3E05A 4D4KA 1TTPB 4I6JA 1KFJB 1EWVA 1N9GB 3H5LA 1XRNA 1ZH4A 2BFCA 3KAPA 1I33A 3D64A 3KR2A 4FR2A 3TLKA 1OX6A 2GZ2A 4CTNA 3DCIA 3S5JA 2OFXA 4KE7A 1Q7EA 1EFTA 1S96A 3KEOA 4F1JA 2Y99A 1N2JA 1P72A 2IYVA 3F5SA 3IALA 3NBZC 4PVCA 4YPFA 1QIMA 1NFFA 3ESQA 5CK5A 1XD2B 1XPUA 1M83A 2OAEA 4P3XA 3RS8A 2UZ3A 1JR3E 3DE6X 5J40A 2IU0A 5TE9A 2KMLA 1LH0A 2NVOA 3M8KA 3EPRA 4PO9A 2X0FA 5TJHA 4A2CA 3BE5A 1OPRA 1P75A 2F00A 4TTJA 1I7PA 1H1LA 2PSHA 1SA0A 2XOEA 1ZIXA 4FUTA 5G0UA 5LB2A 2OBLA 3F96A 3PUXA 5C80A 1EUDB 2ZSKA 3U4QA 5BMVA 3DOIA 5IKXA 1PTJC 2R8OA 2JLAA 4OI2A 4NNPA 4URYR 2H0AA 1ADBA 2MTBA 3D7LA 5CA1A 2X5XA 3VPGA 3EMDA 4KE8A 5C5DA 1HC7A 5LFAA 1CY0A 4BNDA 4P3KA 5D00A 1XDBA 3IR6A 1JH8A 4DZTA 1SN7A 2JGAA 3CRRA 3JAWB 3PR3A 2YRFA 4FFDA 4HDNB 1OY1A 3KZNA 1ODLA 4HB3A 2H4JA 4M7RA 2E5LB 3MSCA 3PQ7A 3SOZA 5K3OA 3EZYA 3G0GA 5FYDA 3GLIB 4RSHA 1KJNA 4LVCA 5BYKA 1TUGA 4Z3KA 3R3VA 3KHTA 4ID3A 4L5YA 3HKCB 2XUDA 1L7XA 5ALMA 3AVXA 1WV0A 4NV3A 1H8HD 3DR3A 3WTCA 2XQKA 3DKKA 3LXMA 4FE7A 5DBIA 1BD3A 3MD9A 4DLAA 2D74A 4BEVA 1VQ1A 1JGTA 3WJ2A 2IDZA 3SQOA 1ADYA 4GP9A 2C7PA 1TT7A 3NPMA 3JWPA 3QPWA 1XZFA 4GI2A 4IJKA 3ZWCA 1XRPA 3DV0A 8OHMA 1UXIA 4NU6A 4KXMA 3E9RA 1F17A 1KY5A 3ADDA 1CUUA 1RS0A 1XNHA 3L7AA 3P96A 3A9WA 3BXPA 4GPZA 4QLOA 4YJ2B 4U2EA 3VUEA 1N7GA 3G1TA 3JALA 2GM4A 1EFKA 1YZYA 4N39A 4K9RA 1WZUA 4LGCA 5IAKA 3NC0C 4JUBA 1Y81A 2ZWMA 2PAFA 5D3MA 1QYWA 5DV9A 4C30A 2BR5A 4YMTA 5GZ3A 1UBKS 2Z08A 2DFDA 2SHKA 2XBMA 5A02A 4EGJA 3H0EA 4FWIB 2ZUDA 4UTOA 4BRWA 4A8JA 2FPPB 1TEVA 4FYXA 4DNOA 4DQVA 1Q7GA 4YJHA 2OV2A 4HAZA 3SHQA 2YQ5A 3F4BA 3ABRB 3KZCA 3LDAA 2JAOA 4FPXA 3NETA 3UV7A 1NP7A 3H1FA 4PGFA 1F2UA 4K7JA 1L1RA 4G0YA 2QZZA 1LPSA 2F8MA 3CSUA 3A6JA 3D2LA 4C2BA 3IAUA 4ZMSA 1XMQB 3GYBA 3QXXA 5EIHA 2CLFB 5PNTA 4EHIA 3UT6A 5JS6A 3PNBA 1E7YA 3ROQA 1VLMA 4C4RA 1ORIA 4OQ4A 1EUZA 3KQKA 1AT1A 4CMGA 1E8NA 4HH0A 3QPCA 1NMEA 2J08A 2GZDA 2VTKA 2HF9A 2IOYA 5CA1F 1MV8A 2UVQA 4AN1A 1HA3A 5ICMA 1PEYA 2YWGA 3PEYA 2FE1A 5F76A 4OU4A 1D1PA 1YVUA 2PKXA 2WTEA 1G21B 2GHRA 1YU6A 1CS0B 1WLSA 3ELYA 1XZNA 4UCWA 1LVHA 1JF8A 5C8XA 1EWRA 1X8JA 4BQFA 4BY9E 2QPTA 3HU3A 3IRUA 3JQ7A 4KYIB 4NNOA 5HF8A 3WGHA 4GLJA 3UV3A 4CDGA 3LUDA 1RI1A 2QD1A 4ZAXA 3QKSA 1SZCA 4PZAA 3ZCXA 3IHLA 4MIEA 1F51E 1FDUA 2ODAA 4J0IA 4LXTA 3S1AB 4CN8A 2GWHA 1YZQA 1P2UA 3K9CA 1RXEA 2PVCA 2QPOA 1OTYA 5KOIA 1BH6A 3H05A 4BMCA 3KZXA 5K3DA 1MEJA 1VIVA 3LX6A 4RPIA 3PQ4A 2MSDB 2ERCA 1QRRA 1TM7E 1JIIA 2Y77A 2ZYIA 3KUXA 4IQ4A 5IXYA 2PUBA 1I5OA 3G5LA 4J2TA 3FWPA 4XE5A 3AM4A 2HFJA 3KD3A 3NKLA 3CMMA 2IHJA 3OKFA 1A2QA 2J32A 4N0QA 3OIVA 2Q99A 4TS1A 5T6BA 3RJ9A 4A8PA 4BO9A 1RP7A 1TU4A 3OU7A 3LECA 2B1JA 2B0JA 3DZHA 4MUBA 1SEVA 3ECAA 4RLSA 3W2TA 3I2YX 1C2YA 4LHSA 4S0XA 1QVZA 2VP3A 1E20A 3ID6C 2IPMA 3TLMA 4C29A 2IYZA 3UY4A 4F86A 2ZB4A 3CXUA 3NBMA 4YT5A 2FFBA 3AL3A 3GGGA 3JZMA 4UBIA 3TIVA 2GD6A 3ZE1B 3C6KA 2GN0A 1U0BB 2OV4A 3L8YA 3CH6A 3CRMA 4KQ9A 5AP9A 2WWVD 1VPLA 3DOCA 1A50B 5ADUS 3ICOA 3AR4A 2BSAA 1JPVA 1TM4E 2UYHA 4WK2B 2P3LA 3KQLA 2BGLA 1ZH8A 3R7SA 2VHJA 1E2DA 1JKFA 1YBVA 4CKCA 1WR8A 3ZVNA 4ZKEA 4G0UA 4LF6B 1W0KA 3AB8A 3F46A 1CNFA 4Q6WA 4CQMD 1VCOA 1UANA 4ZCRA 5HDBB 2GZAA 4KAJA 4AY6A 1QQ5A 5CB6A 3EX7C 2XUOA 1P5RA 1C9NA 2B7CA 2YWJA 1VPEA 4Y2JA 4J2OA 1K3TA 2P62A 3U13A 1MX1A 2I22A 3FCOA 1NN5A 4TM8A 4EECA 4RC9A 3K1TA 4JR1A 2M1ZA 4Y7CA 4DCCA 1Z3CA 3INNA 1E99A 4BFSA 3E9CA 1NVWQ 1XLUA 3FB4A 3ELWA 1EVKA 1WUJS 1Z39A 3L43A 3MA0A 4OHOA 1DMRA 5JO9A 1T4CA 1ESEA 1CVRA 3DF9A 3K1ZA 3D4OA 3GNQA 3DEHA 1CBUA 1YONA 3JS5A 4GR9A 4ZVNA 1VJRA 3QTTA 3E5MA 1ZSYA 3SXPA 1G16A 3K8YA 5L9AA 1WETA 1VJ1A 4R9NA 4PHTA 2I66A 3P4UA 3O4IA 4EB6A 2G9QA 3E61A 4WBNA 5ALIA 3SLRA 1EP9A 3QKIA 5B2FA 4V39A 3HHEA 3JAKB 4IVNA 1E9FA 2FWRA 3T7IA 1F9EA 1PG0A 3USZA 2Q9CA 3KJNA 1CQXA 1N2ZA 2FFRA 3H4IA 5DNEA 1MLDA 1WW8A 3KT6A 1L5HB 1RR6A 2W58A 3LDFA 5ALHA 5C5CA 2HK9A 1AUPA 1XMVA 3AH8A 3I9KA 1L6IA 4M9ZA 3EXIA 1CEXA 2YHUA 1PFKA 3GN1A 5LBIA 2OHXA 3GIDA 4Q7JB 1VLVA 1PSZA 1EB8A 5TEWA 4CEHB 4NE2A 1T8PA 1OIVA 3DQPA 3UJBA 3MQ2A 1T5LA 1SQSA 3DL4A 1NL3A 4FYYA 4LNHA 3TMYA 2FX3A 1B8UA 4TXJA 4CDMA 3Q7PA 3A58B 2XGJA 4TKUA 1WQ4A 3A1TA 4AMVA 3MWYW 3GJQA 3MIIA 1B00A 4PTLA 2O8DA 4F3CA 3EF0A 1LWNA 1G1MA 1OLUA 1PZMA 2MYNA 1R66A 1UXOA 5FFNA 3D3WB 3O4VA 2X0DA 5JAMA 5DM60 3C7TA 3IV9A 1MP0A 3LXUX 3M5CA 1N2HA 3NBAA 4J3JA 3IOYA 1KSFX 1Z4JA 4RKRA 1HMYA 1WHTB 1IJFA 1MC1A 1UJ5A 3JWEA 4E1VA 2ZOSA 2QIOA 3VSCA 3SDSA 5TPZD 1X94A 1KRWA 2QS9A 3C1UA 1EFDN 3WLFA 1B15A 3X1ZA 1M6WA 4PZYA 4JOCA 2E6KA 4P7FA 5JTUA 3HBLA 2QUKA 3ITNA 3IR5A 4OQQA 1U9YA 1DRKA 5B64A 3NAGA 4J6EA 5LUBA 3WTBA 4U2FA 1CUVA 4J1SA 4LZLA 3H2GA 2C4HA 4UEWA 3DLCA 4JBLA 2DLCX 4KGDA 4N9QA 4WOCA 4FLFA 1APBA 4Q9IA 1B2RA 2YDXA 3GIWA 3N0WA 2UYGA 1ESCA 2XUQA 3OY2A 4ITVA 3GR6A 4OF4A 1OYOA 2BWJA 4ARUA 4LXIA 4F2PA 1CZLA 3FA2A 4W1PA 2TMKA 1E0KA 1EXVA 2IYAA 3R3XA 1P2DA 5CITA 1VKJA 2WFMA 1N2CB 1JKJB 2DSNA 1UMDA 3P9ZA 4M0UA 5KDDA 2AQHA 2BF4A 4PCAA 5EUMA 3RTAA 5CW2A 2OQVA 5EI5A 3UMSA 4C4ZA 3AEKB 1KK2A 3E15A 3LQKA 4QWMA 3EXFA 5IUNC 1YVPA 3AKYA 1MFZA 3UWKA 2PRZA 2Y92A 3F7NA 3ZDXB 2Q4DA 1WXDA 1OWOA 3PEWA 3BD7A 1QAOA 1GTZA 1T9BA 1SZJG 1RQLA 5LM3A 5T8KC 1QDLB 2VHQA 4PZEA 2XEDA 3PCTA 4X65B 1YJCA 3SY8A 3B1XA 4ALNA 3FDZB 1LPPA 4IDEA 1C80A 3MTIA 5ELLA 3HRKA 1PSWA 1XSEA 2WJWA 4DSTA 4IVPA 3RUEA 1R4AA 2YNMA 4G25A 4JR2A 3SZOA 2F9FA 4WV3A 2ZIFA 5E7IA 1T13A 3THOA 2RHGB 3WIVA 5H80A 3GK3A 1KY4A 4CRWB 1RPJA 2XOKD 3D6AA 3QKUA 4K2HA 5CJPA 3RIMA 4A03A 1CY6A 3O83A 3JWHA 2BLNA 5HZMA 521PA 3AUYA 2VAWA 1PZFA 4HDRA 2J3QA 2RC6A 5HUHA 5EP4A 5AUNB 1Q19A 3BCUA 3K9HA 4OXKA 3WKBA 1JIUA 5AVXA 3PL1A 4WZAA 2Y9MB 3SR3A 5FI3A 5CEJA 5ISMA 3NJ8A 1VG9B 2OCDA 1HX7A 2A3RA 1R88A 3C5WP 1QB7A 3N8IA 1SVIA 3L6RA 1SHLA 2FSVC 1II8A 1FSZA 1D09A 3E1KA 3PP8A 1G3IA 5EWJB 5F3RA 1DRJA 5AKGA 1I80A 5SZHB 3H1TA 1PUIA 1KGDA 2DE0X 1Z9BA 3CUYA 4YO7A 4OLFA 1LBHA 2F8TA 2XUZA 4NJEA 1Y4ZA 3KTAA 5BPFA 4R84A 3O8QA 2D5IA 1I2CA 2BSXA 1OZAA 3D6JA 3QW4B 3AF4A 1KI6A 2CVPA 4PYIA 3DVRX 5J47A 4FHGA 5JD6A 3HJFA 2CYBA 1GGNA 2FPRA 4RZ3A 4M60A 4OQXA 4I8XA 4NCJA 4EY4A 1A5BB 5MGNA 1HLPA 4LJLA 1KDVA 4FB4A 3M7IA 5JCJA 4IFBA 1JHPA 4XX0A 3VR5H 3UBMA 4UDOA 3G8YA 4O2AB 4QT0A 3OD5A 3RS2A 5HHTA 3N76A 3T5TA 1S5PA 1R4NA 1VBFA 2CD9A 4YS6A 3A11A 1ZU4A 4LDZA 3KKPA 2GGSA 3KU1A 1JQLB 3NATA 4XQ9A 1NGSA 2OOKA 4GPD1 2NU9B 1ODJA 1U8YA 3VVMA 2GR9A 2PT5A 3OLWA 3OOWA 3AFIA 1GM5A 2H65A 1BHJA 1CKEA 2G4LA 3FSJX 4FOPA 5FO0A 2XZLA 2WYUA 1N6OA 3C0KA 1NV9A 1QTRA 3D0OA 3Q8XB 4QUKA 2QR5A 3CF6R 4UPVA 3JTEA 1JI0A 3EXHA 3N3AC 4K9DA 2J0EA 3ZW7A 3IP8A 5DKFA 2ZJ2A 2WABA 1IEQA 3GAAA 2UU9B 3A1WA 1QP4A 1U63A 3FVWA 5ENDA 3R7DA 4ES6A 4MW4A 4FI3C 3OFJA 2WB2A 4OLHA 3DMFA 3IKVA 3L9WA 2ZS8A 4E30A 2J3IA 4YV0A 2Q5OA 4TZKA 4FLMA 2Q2NA 1W9HA 4PX5A 4YP5A 1NR1A 4JBXA 5EESA 2PL9A 2QMOA 2R3SA 2Y2UA 3UQYS 3F4LA 1N5MA 2ON6A 3PDCA 4C9BA 3PZBA 3MN1A 1HM5A 2I7XA 5DF1A 1U9JA 2ZRPA 3ZW9A 1LDGA 4OH7A 1UZUA 4PO1A 3AVOA 1QR2A 3JYNA 1N8SA 2PN1A 1NV8A 3UKDA 2NUTB 4KVGA 2ZYAA 3UK2A 1RQNA 1HEUA 1NSFA 2R6HA 2X6RA 4YLGA 4P81A 4TWZA 5K45A 3VTFA 4H1UA 4ENVA 3QW2A 5L95A 4TM7A 5I9NA 4N03A 1QH1B 3DUFB 5EWLA 1RZRD 1NI5A 2ZRMA 1C81A 1VL8A 1KQ3A 3I1YA 1G60A 1NIPA 2O8EB 4OVKA 1FX0A 1VJCA 2Q0QA 1MTZA 3EF3A 4DVJA 2RE8A 1NMYA 2WWFA 1QIDA 3ZKWB 1FZQA 1VG1A 1ND6A 3R6GA 3SXUB 3P19A 4HCJA 4QWWA 4WH0A 3ROGA 3WRXC 4BUZA 1FXWA 1P60A 3S6JA 1WSDA 3A4IA 2AJTA 4AS3A 1TU0A 1SXQA 3CNOA 1JV2B 3V7NA 1SG6A 2QN8A 3MB8A 3NS7A 4LFCB 5BUSA 4DM7A 2ZM5A 2XD9A 3K70D 1SKMA 3UN1A 3A6GA 3NKFA 1ES9A 2B37A 1N5KA 1T3HA 4HWOA 1UOPA 2GNOA 4RFLA 1FP4A 1R3DA 1JLSA 1ZEMA 2JFZA 1W8IA 2WV9A 1G6Q1 2DTEA 3I73A 1R0LA 3ICPA 3G5UA 4RVHA 5DHPA 4YMVA 4RK7A 4HX9A 1SHUX 1K5DA 1ZVQA 1LK0A 2NQ2C 3CLRC 1KIFA 2A3NA 3NOVA 4L4UA 4Z7QB 2E1PA 1FYXA 3BL6A 4EEKA 1WUIS 3FYSA 2H1VA 4TL6A 1CUSA 4JL8A 1AO3A 1PJ8A 3MG9A 3RKUA 4BIMA 1E2KA 1I3KA 1CJMA 1R27A 2EKZA 3LC2O 2G1UA 5CX1A 5AVKA 1RPTA 1E0DA 4MTCA 3TIFA 1N77A 1BMFD 4J16C 3V8PA 3KZVA 2GBIA 2G09A 1GNTA 2F7SA 3ENKA 3FCAA 4QL3A 4BNHA 2CE2X 4YIHA 4KHPB 1ODCA 3CNNA 4NMLA 3WGMA 3B2QA 3RIEA 4PWZA 3REQA 4A0SA 3ESYA 4PZPA 1NDHA 1W5FA 1RIIA 4OEHA 4QYXA 1G3RA 5KYWA 5DULA 1VM6A 5AOBA 5ICGA 3X1WA 5GWXA 5DIFA 1LLQA 3ANLA 4XB6B 2QROA 1FVFA 5LQRA 1LX6A 1GZUA 3GPIA 4N6GA 5EHIA 3AL2A 5I9TA 3ZNNA 3M6IA 3D6UA 1E6EA 1O6CA 1X1CA 1ONNA 3SE7A 2W2MA 3F49S 4EOGA 1UOQA 2F6RA 3EGDB 4AG5A 2Q3HA 2H5IA 4GICA 5BUCA 3K2BA 1Q7BA 1X7XB 4Q3LA 4P22A 3ROTA 3KAJA 4JUIA 3MMSA 5JFOA 1I3NA 2AMJA 1ISMA 2RJNA 4HB0A 1N9GA 1UOEA 2PGJA 4IIEA 4KU4A 3UB3A 1XKTA 3L8CA 4TT8A 3LCCA 5A1TA 3DT9A 4MDHA 5AJUA 1P6XA 1Y3FE 3IULA 3DQQA 4AAYA 1PGOA 3ZNPA 2ZB8A 1H5QA 3HJGA 4LUCA 5CLQA 1MO5A 1FXWF 2QENA 1TZKA 4B9AA 1KH3A 1CQJB 2HO4A 1U31A 2IXBA 2WVJA 3O2SB 4KREA 4BYMA 2O1WA 4MGKR 4M1EA 1QU3A 4LRSB 1Y5RA 4G0ZA 3EC7A 2I1LA 4MYCA 3V8MA 2JLXA 1Q74A 2PT7A 4L5CA 3U26A 4KQMA 1EDBA 4I1OA 4IDDA 3ZWDA 1EUDA 3C6YA 5JH7B 3OC0A 5IRCD 3RRBA 3WRYC 2VAPA 3D7NA 2BKXA 2G5CA 2QUZA 4MQEB 3DFMA 3ZDFA 2HA0A 5AJWA 1DEHA 1HMPA 2Y0PA 4QJ5A 2WF5A 1DIBA 1W46A 2W00A 4BV2A 5TMPA 2HLPA 2IXDA 2MIIA 5JECA 4RHXA 4EFNA 2A1TR 3A3KA 2QLBA 3JAWA 3M33A 4NICA 4HDNA 2VK2A 1CZRA 5AI8A 1ZW6A 2XMQA 1A5TA 1SU8A 1T0IA 2Q1WA 3AEUB 3F7TA 3I1JA 3E7FA 1OXBB 2R8ZA 3GLIA 2P1ZA 1UK9A 4A0QA 1DE0A 1S2GA 3S5UA 3WIBA 4CVNA 4GPAA 5BSGA 2XZOA 3R5SA 1GKYA 3Q98A 1KK1A 1AE1A 5FL3A 2D1TA 4HXEB 1Q83A 3NR2A 4Q12A 1S4QA 1MJGA 1C4XA 1SM4A 2BKEA 3CLTD 1RW4A 2V5UA 5GOZA 2PMFA 3RUHA 2I71A 4M1OA 3ADBA 2I2XB 1QDEA 4LYGA 5EFZA 3UWDA 3H5TA 5TNXA 4L5JA 2ZBEA 3LUAA 3PDHA 4GZ5A 4UBNA 5JAHA 2BRUC 1YC5A 4H7HA 3HCOA 4M1MA 4JB8A 3DXFA 1EINA 1LBIA 3BE4A 3KJGA 2JI8A 4E07A 1TAGA 2FEWB 3D6TB 5C0OE 4YJ2A 2PZEA 4EFDA 1KZGB 1RLOA 3C70A 3D4PA 3GLUA 4FU0A 1IB0A 4IICA 4C0KA 4CF5A 2V74B 3F6YA 3K72B 4V0RA 3VZSA 4YUYA 1FTYA 4NYMR 1UBUS 1JTVA 1E3WB 1XDWA 2ODTX 4H18A 4OK6A 4URWR 4B7CA 1NQ5A 2SECE 5CH3A 1XNGA 4GBGA 5K1ZA 2CV0A 5E38A 2FPPA 3PQFA 3RV4A 3ETHA 4IJ5A 3OUZA 4AJ1A 1JW9B 3CVVA 1WJGA 4W7HA 3A3YA 1ZJ6A 4LXUA 2ERYA 4M8KA 5DXAA 3VJMA 3EJ6A 3I6BA 1N3LA 1PS0A 5HOEA 1F60A 1I1NA 4FC6A 1E3LA 4WESB 5AK3A 1QUEA 3K92A 3MILA 5I5GA 4GBMA 2H17A 1ZX1A 4ZT2A 3NV7A 4DIEA 2V58A 5KQSA 2Z3ZA 3HFRA 3GDOA 3E22B 4YAIA 4BNYA 3JVUA 1NSTA 2R1UA 3QI2A 1K4YA 4CMIB 4OJQA 1AA9A 3CPSA 4LSZA 4GMGA 3PFFA 1OWLA 1T8SA 2AVNA 3K0CA 3UG6A 2LIPA 1VRVA 2BZGA 3W0LB 5KYTA 4QX6A 1G21A 1EBUA 5T3UA 1CS0A 3L7MA 2I6TA 4L8WB 4BTEA 3KD2A 5FT9A 1NUHA 5MFPA 3LHKA 3G2HA 3FWHA 2ORYA 3GRZA 4Q9DA 4L9SA 4X8LA 3OQHA 3TRIA 1FB5A 5FUBA 3RVDA 4GP7A 3AB7A 3PUWA 5TSDA 2KQUA 3S1AA 4ERXA 4TL9A 4P53A 4EHDA 4Z51A 1VG0B 4KFRA 3GCXA 3ZQ4A 1J6UA 5HZGA 2QSYA 5J1SB 4M1SA 4YJFB 2G1JA 1X7DA 4B8YA 3T3NA 1RTKA 1WCV1 3MRSA 5EQTA 1GPKA 1PEDA 1Z33A 1VPTA 2VTDA 2CW5A 2DBRA 3CW8X 3BJMA 4PZZA 4ACAA 1FSSA 2GA8A 2V5AA 3N6RA 5JNUA 2YXPX 1ZR4A 4KR2A 1FQKA 2BJVA 2Y1XA 2R68A 2H1IA 4IP0A 3T95A 3TQTA 4N5MA 4KFSA 1JZQA 1A8UA 1SHKA 4R81A 5EMKA 3M6VA 5I5EA 4PC7A 3KEQA 4MW2A 4XI9A 1OXXK 1G6HA 1V95A 4RENA 1QHEA 3ASVA 4MEJA 1DRVA 2X8JA 3L7IA 2XWJI 4I81A 4X1YB 5HIKA 5ICSA 1KZ1A 2CKMA 4I9FA 4DY6A 1LJLA 1U1IA 4FGSA 4RZXA 2RH9B 5LZ9A 4L0CA 4LQCA 3LKZA 4QIHA 3FUUA 4XR9A 5E4JA 4I19A 2OGWA 5JLJA 1O95C 4ATNA 1L7NA 1V6AA 3ZH2A 4U5QA 3DWGA 2B34A 4EPVA 2C2ZA 3D6MA 4FE4A 5DM70 5E6SB 2PYZA 2FSPA 3CV3A 3Q2KA 3JQ6A 3F74A 4I1RA 2VJQA 2FSGA 1AD2A 3GZJA 4U7FA 1RKBA 4G4GA 3NGXA 1S7CA 4IGFA 1UK8A 1BU5A 1ZESA 4RXMA 5H0IA 2GEJA 2JLRA 2PKQP 2RBGA 5KNBD 3MJVA 1LDNA 1L1QA 5F3DA 3BG5A 2DHRA 3KR9A 3WBBA 2QNRA 1QR6A 4RADA 2QN2A 5H4HA 1GUAA 2C8VA 4S35A 1QE3A 4TS9A 1OXSC 3HO8A 3KOXA 3OQNA 3OOYA 4B2PA 4YP6A 1N1GA 5CHYA 4MB2A 3W4JA 1PNOA 1UC8A 3VJKA 1T9CA 3ESXA 1CWUA 5AI6A 3RYTC 3D3JA 1CUXA 2G83A 2YUIA 2NPOA 1RWVA 1WB6A 2QTLA 4JEHA 3FMOB 4HG2A 5IG2A 4CCSA 5E2AA 5LIRA 4JYZA 3Q2OA 5IULC 2W6OA 3WFZA 1NQOA 2C54A 5LD2C 2EATA 1I1OA 2FQXA 1LDEA 4BMYA 3JAKA 3KPJA 3WMFA 2CMGA 2GPBA 3FTNA 3BJIC 3HA2A 5DBEX 5DNWA 5IDQA 5JFTA 2O8FB 3PKZA 2QTVB 3STHA 4X6LA 3CTMA 1VYUA 1GNRA 4IF6A 1L5HA 3WDLA 2Q3BA 2WKPA 4D25A 2FVYA 2KLHA 1TM1E 3H2HA 5CNKA 4FMCB 3IQHX 4L08A 4L2IB 3Q6MA 5KJ6A 2XCLA 2Y4NA 4M6WB 3V3TA 4EKNB 3B7GA 5LL6P 3FYHA 2DFVA 5CGQB 4CEHA 3WJ1A 2C2KA 2O6LA 1OBCA 2YH2A 3LUCA 1V47A 1UKYA 4BQRA 5HRUA 1ZM4A 2JLBA 4IQ0A 1E4OA 4LHXA 1ADCA 5CPFA 2I9PA 3AJEA 1N6PA 3SS9X 4AXBA 3EOBI 3C3CA 3IMEA 4CGYA 5T7BA 2C8LA 4ZDKA 3VKHA 1FFWA 3HXOA 2D4HA 1TUEA 3U19A 4I6EA 4MWBA 5DK4A 1O95D 4H7DA 2OZKA 1T0JB 4NARA 5DEOA 3O4HA 4S2EA 3TTSA 1F1BA 2Q5QA 3BRWD 3QBEA 1AQNA 3D3WA 4MWZA 4E11A 4B43A 2X9GA 4ALKA 5L3VA 3WGUA 2W6JD 4B5LA 3AZOA 1AOXA 4KEAA 1WHTA 1PG5A 2KPOA 4IILA 1FSGA 3PSHA 1UBCA 4BKMA 2CMKA 1Y4DE 1A71A 5G40A 1JG2A 2F1JA 4W1RA 5ALZA 2CYCA 2IBMA 2IV7A 2B61A 4KW7A 3NDJA 4H16A 1UWKA 4A8JC 2WSBA 1YQGA 3AQ4A 1S1CA 3ENNA 4YCSA 1PL0A 3E3LA 4G09A 5KMGB 2F43B 4BNKA 4KN6A 5BWLA 1UJ4A 3CJTA 1OH6A 4UE6A 3W5BA 1HDOA 4FCWA 2HRRA 4COKA 3BICA 3PHGA 2AW3A 2GDJA 3LBAA 4L5AA 4INJA 1EEHA 1BDJA 3RTDA 1N2CA 1JKJA 1TYBE 1XROA 1WV1A 3VOSA 1RYEA 3WYAA 2JHGA 4ZZ3A 5DSXA 3RK1A 2VNSA 3AEKA 3KXIA 1XA0A 4HWSA 4JX8A 3VA7A 3GLGE 2P9ZA 3AY6A 4L16A 5BN5B 1Y8ZA 3VSAA 2H3HA 4QICA 1YRYE 4G1VA 2GHIA 3TLCA 3QUAA 4DEVA 3CVUA 3KKEA 4KXQA 2FXVA 3AJAA 5C7IO 3V1UA 3OZIA 3Q6NA 2Q21A 2ZTHA 1ECLA 4XX1A 1E1NA 4R2IA 3WLMA 5JMWA 1EJ0A 2BEUB 2EQBA 3FDZA 4IDHA 4QDZA 3BRQA 4ZVRA 6AT1A 1Y6JA 1YB4A 2PX0A 3KYJB 3K9GA 4JYCA 1Z5ZA 4Q3AA 3WO1A 5FTWA 3KEGA 2G1AA 4UTRA 3F8WA 2X3FA 2XECA 4G1BA 4UKDA 2WZDA 1UQRA 7MHTA 3MGBA 2ZRAA 4UHKA 4DCUA 1IRIA 1KXJA 4PYOA 4GECA 1CYDA 3N2LA 4QOGA 5A4MS 1JNXX 1IATA 2VP2A 2IXFA 2WD9A 3GZNB 5IXJA 2D0DA 2IA5A 1VLLA 2L17A 3RC2A 4FGKA 1PK7A 1SOAA 4BQOA 3AR3A 1USVA 2C20A 3UA3A 3LBFA 4BB6A 5LQUA 3OESA 1S3SA 2ZLBA 4JC8A 4MJ7A 4YK7A 3QXSA 4TKMA 3RFUA 3RUDA 4F56A 1XCJA 5K6TA 4HGPA 4ZYUA 1HY3A 1NXVA 1W36B 2BBWA 2AFHB 3VAYA 2C7OA 3JQGB 2A0XA 4DDWA 4UM9B 4ENPA 3WLNA 4TRJA 2WLTA 1R3UA 1DQRA 1V11B 2BEKA 1X80A 2AB0A 2BHLA 1T25A 4IMJB 4DF3A 1QTNA 2VK1A 3K5WA 2GXAA 4E33A 1S7GA 3N9IA 1FMTA 2GOYA 3OZEA 4PQEA 2IHKA 3WJAA 1SCBA 1XMJA 4ZPXA 3VR0A 4CMHA 3ZY6A 2QTRA 1NLYA 2O14A 3P9XA 2V7WA 3BIOA 5J59A 4CQJA 4QGFA 3EJWA 2H51A 4GQIA 4AYWA 1JPNA 1W49A 1V8FA 4YFYA 5JQGF 4O2AA 3T0IA 4Y6RA 1B2LA 5EE0A 1M0TA 1M2WA 2Q6VA 3AEQB 1ULBA 4AQ7A 1QTQA 3BFVA 4OP2A 3KQQA 2RAPA 2ZI3A 3O21A 2PT9A 2VA8A 3MERA 1WDMA 4FGLA 2GKGA 1JE1A 2NU9A 2PLNA 1HOXA 3ZQUA 4WXEA 2HR1A 1QIHA 2PGNA 4GM0A 1GDDA 3HCRA 4DV0B 3MQ4A 5KB3A 2A5DA 4LC9A 2NU7B 3H9CA 1JI3A 4WLFA 4DC0A 1EIWA 2C57A 3K5IA 2QJWA 4KJXA 4C06A 4WCFC 2AVDA 2Z1NA 1TCBA 4S05A 3TSZA 3RTEA 3MCWA 1YR7A 2VDVE 3C8ZA 5KJCA 1IL0A 4N48A 1WB5A 3VR4H 5HE9A 2EW1A 2FPSA 2HB6A 3TCXB 1HZZA 1AB6A 3B60A 4ZOCA 2HXGA 3IJ5A 5BW6B 3S2FA 4UTNA 3JARB 4E5NA 2C9DA 3HEBA 4M7OA 2C2YA 4YQZA 1QTIA 1NONA 2WR8A 5EXTA 2PUFA 2I6UA 1QIIA 4TTIA 2FVXA 2C96A 2HU2A 5TQVA 3J80A 4WEOA 1Z62A 2MYUA 3ZZUA 5A1JA 2YY7A 4YP1A 4JC0A 4UMFA 3WR5A 1MAAA 3N5CA 2OYRA 1VZ3A 4CNQA 3D0QA 5B7QA 2YJ3A 4J9VA 1HWYA 2PQ2A 4LN1A 2QN7A 4I2NA 4ARSA 2R8EA 2QBYB 1UP4A 1AV7A 1HLGA 3P9CA 2Y1DA 4OQEA 1CUBA 3BSSA 2OPHA 1PVOA 1AUOA 3H04A 4BO3A 1T2AA 1QH1A 2I87A 3NP7A 4GIBA 3ZBQA 1GRQA 2XHEA 5FOSA 3HO6A 2O8EA 4MWCA 2EFGA 4AY3A 1C0LA 3CURA 3VKWA 1AUQA 3QMWA 1W0KD 2GQ0A 3IIIA 2F17A 4WI1A 4ZVVA 1IHXA 1JTFA 3B85A 5EJGA 4I9GA 3OX3A 2E48A 1EFPB 3ZKWA 5EN4A 4LDQA 3SXUA 3GRPA 2I4RA 3NORA 4FMBB 2HI0A 2OAQ1 3VH2A 3FOZA 4O2AF 4MYRA 3ZWVA 2XCRB 1DV1A 1JWBB 2ECFA 3H83A 3LAWA 4X93A 1WEHA 5CFRA 3HB9A 4IFEA 2X0IA 5CFMA 4MI1A 4P3OA 3AV3A 1UH5A 4YRBA 2VUTA 4ZAWA 3W7BA 4YRQA 2IS2A 4KMRA 2VJLA 2RONA 1DCFA 1MB4A 2WD8A 2P9BA 3PV0A 1ZGCA 4RZQA 2V7BA 2VPWA 1F1JA 2R6AA 5ENVA 2LBPA 3TL3A 5EIWA 1U7ZA 2R7MA 2PEYA 3LNTA 5HS4A 1RYHA 1C8LA 2O1SA 1RQPA 2IEYA 4B76A 4A2WA 1B3RA 4CL8A 3GPDG 3H87A 2WSSA 3CLKA 2XXAB 5B4TA 3QMMA 3TEJA 3IIEA 2CJFA 1RZUA 1Z16A 1OB5A 2ZS7A 1WTAA 1KE2A 2X1VA 1LSSA 1FLNA 4UEOA 3EPJA 2OK7A 1F0NA 2XR1A 4L1KA 4X94A 3RQSA 1CDOA 1JHXA 5HDQA 3ANYB 4A36A 4JOQA 2J5XA 2DXIA 1AGRA 4GBED 3E03A 2Z2IA 1DXHA 3LC0A 5BRNA 3VC3A 4X66B 4DLSA 3GLFB 5AVZA 3NDBB 1FU7A 2QRKA 3CNBA 1SXJB 4NULA 4ZI5A 3V7WA 1GVHA 2ODQA 3K73O 2WJAA 4MIOA 3PITA 4ZCQA 2Y6VA 3DYBA 4QPCA 1ZXLA 3KALA 2UZ1B 1DO8A 4OBBA 3ZV7A 1TYAE 4JIGA 1GCUA 2AEMA 3AIIA 4POAA 3EGDA 2WSLA 1UJ6A 4OQFA 4TWIA 4WXPA 1Y7PA 2AH5A 5FTKA 4JI2B 4P5EA 1Z0AA 4C6HA 2IU6A 1X7XA 1CIVA 1X38A 4OB6A 3VR6H 3RWMB 5EQJB 4B47A 4YT4A 4IG9A 3KHSA 3ONEA 2I76A 4KODA 3C3KA 2B99A 1V16B 1AHHA 3NKVA 3FHLA 3L9XA 1WOYA 1YZGA 4HSEA 4D8VA 3L7LA 5IPFA 3KX2A 2YASA 5F51A 4JUCA 1JE0A 2GAFA 2CCGA 4LNAA 5D3KA 3IEIA 5D5HA 3TRFA 3UXHA 3C97A 1CQJA 4WXYB 1E3EA 4H6VA 1B23P 4JQZA 4LX8A 5PGMA 4F4DA 5IASA 3VH4A 4L8LA 4YRJA 2HPVA 4CBVA 3NJ4A 3OM8A 2IOFA 2W9XA 1JHQA 1WNFA 3I6YA 3GUZA 3SSMA 1QZXA 3GCZA 4DB4A 4X85A 3LX5A 2EIHA 4LS3A 5IK2D 5JH7A 3EA5A 3HZOA 3K2EA 4DJJA 1M2OB 5LP6B 4MQEA 4FINA 2W5UA 2ZQYA 4UNSA 4RH0A 4XTRA 3ETGA 4Y6LA 4ZOLF 3CF0A 3AT1A 4Y2VA 3Q7RA 1T2CA 1X1DA 1VJDA 1J5EB 4XKJA 3WL3A 1O0SA 4I9UA 2VF2A 1IXYA 2C2BA 1Z7BA 4V02A 1TAUA 3N2GB 5JWRA 4WFJA 1SC3A 2ZUVA 2EGHA 2AZTA 2FMTA 5ALUA 1Z6TA 4CQLB 3PS9A 1OWNA 4BVFA 4JLNA 3AEUA 4MVJE 3ER9A 3QBJA 4KE6A 2H7CA 1N92A 5IKMA 1XL1A 1OH8A 2HC9A 2BPOA 4M55A 4CKZA 3QVXA 3ZU4A 5DASA 1KDYA 1FIUA 1I4LD 1PFQA 1XJCA 4PCUA 2EKLA 4PYJA 3VFDA 2YNMD 4D9FA 1V96A 5CYOA 2QHXA 5A4JA 3KOYA 1J07A 4UUPA 2ZSIA 3ZWAA 4EF5A 1RAGA 3G0BA 1P9NA 5H3HA 4OO3A 2J3KA 2UVDA 3R6LA 3ZBUA 2ZJOA 4ZU6X 4B8ZA 4JJZA 1H8EA 4ZHQF 4B32A 1VECA 2YVAA 3MCZA 2A7XA 3MT8A 1GADO 3W2GA 2FB9A 3RAFC 5B3LA 4KK3A 2ZJ1A 5DNAA 3TW6A 2HW8A 1KPGA 4R1PA 3X1JA 3RT1A 1VLZA 2D62A 2VKTA 2VPXA 3BRCA 1HYHA 2IZ5A 3NP9A 2UYOA 2ONJA 1R6BX 1CR1A 5JXJA 4EITA 5DNDA 3CWCA 1E3WA 2CF5A 4Q6BA 5FOUA 4IZIA 2ZRJA 4NZMA 5CEFA 4N3AA 4LWQA 2OBYA 2J41A 4OXQA 3O4RA 5K0GA 3LY9A 1NXOA 3PC7A 1GJRA 4M86A 4RTKA 5K8JB 2IYYA 3EG9A 3RJTA 5AK5A 4ESEA 2YJGA 1MORA 4RVFA 4QDJA 4MWOA 4D3YA 4WESA 3GEEA 3F9IA 4JYPA 1QNLA 1V35A 4I8IA 1FCJA 3ZY3A 1YB1A 5FPQA 2X2FA 3E22A 1RRPA 5CNIA 3F8TA 3JYHA 4FXPA 5JCJD 5JH7F 1XYYA 4N5NA 4CMIA 3JQBC 5EEGA 4F71A 1K2WA 4FZ3A 3OJXA 2XMRA 3L8GA 2P9TA 1T6NA 3SLGA 2YWBA 5AMXA 1UPTA 5I47A 4DHEA 2H52A 3KB1A 2XYRA 1TE2A 2OCYC 3QVUA 5L6LB 2IKSA 1W88B 1YF3A 2BUAA 3NRJA 4IIBA 1K3FA 2X5NA 4LZPA 5LQAA 1OOEA 5IX8A 5ECGC 2GTPA 4MVJH 4EUNA 4UPDA 3QVOA 3FWKA 4J91A 3K15A 5E6UA 5C34B 5DI9A 4EW6A 1J7JA 1XUOA 3F6BX 3MWDB 4UQPA 5KNDH 1I2AA 2BUCA 1S02A 2LVBA 3QK7A 4R8SA 2YWRA 1EFRD 4N5LA 4QQ8A 3ZQKA 2E85A 4MWGA 4YJFA 1K7SN 3ZHSA 1OI4A 2ZXFA 3Q0EA 2NV0A 4XYMA 3SQXA 2ZUCA 3I9LA 4EG6A 2XWPA 2P9JA 5AVVA 3MTQA 3SF8B 4MRAA 3RC9A 1XPRA 3DMPA 3SQDA 4WW0A 4NYIR 1DC4A 1XDSA 3U0BA 5C8DA 1YQDA 4JXJA 4LJ6A 4CLRB 4NFLA 4Q4HA 1P0QA 1AQYA 4PLVA 4EF6A 5HIMA 3I8SA 2IHTA 4WKPA 1PJQA 1XX6A 3AVQA 4QVGA 4MA4A 3G02A 4MKRA 1RAEA 4WXRA 3UGJA 3P5BA 4NPHA 4QSMA 3GLHB 2Q41A 4OYRA 4P7KA 4RXTA 3R09A 4LJAA 4X1YA 3UT5B 2OENG 3SFTA 4TVBA 1P2BA 5AVUA 3RM3A 4F9TA 5I8WA 1NUAA 4Z0TA 3HYRA 1R6TA 4RHUA 4Y1EA 3RAPR 4JC5A 1M73E 4W5RA 2EJTA 5BQ3A 3BT7A 1JQJC 1A8PA 4XLLA 1PGJA 4FZJA 1BZYA 1C8VB 1AVTA 1IWOA 2PRYA 1ZRNA 4IUDS 4MKFA 1ZK2A 2P27A 5EJIA 2WPDD 4HN4B 1V2HE 3O31A 5E6SA 2GEUA 4B81A 3PX2A 1XQVA 3RIXA 1V7CA 5A06A 3BD9A 4RE6A 3SZMA 2I8CA 1PJZA 1G8GA 1WUKS 3A9UA 1YRHA 4WZZA 3ORHA 4B73A 5A62A 4GKJB 3T3DA 1NMSA 3G59A 1M1ZA 2JAQA 1EQAA 2VEOA 1O6ZA 3QXCA 4WKGA 3WO0A 4JA0A 1B0ZA 4N82A 2J31A 1EWQA 4WOBA 2LV8A 5ERGB 3A6ZA 4WXHA 5KSPA 1PQ4A 3RSHA 4XDYA 3KM0A 4ER0A 2WG0A 1EFUA 2LWIA 4WX2B 2DWCA 2FQ1A 4ESHA 2G1KA 3KSDO 4FR0A 1AKYA 3C3JA 5IVDA 2RFLA 3IDQA 1OASA 3AVVA 4QEZA 2FZLA 1K7CA 1N2OA 2IP4A 3DQZA 1RYMA 3OQ6A 4GL4A 2CSUA 4GOND 3UK0A 3GN2A 4JP5A 3OZDA 4U2KA 4OM7A 1Y34E 2WKWA 3HU2A 1AGPA 4DNQA 1FFBA 2J87A 2A0FA 4P4LA 5IP5A 2ZJYA 4E4RA 3K0AB 3AONB 4LVNA 3V9PA 4S2UA 2O8FA 5CU7A 5JO0A 5CCDA 1UPXA 2CFIA 2QTVA 1ZHOA 1ZIDA 1OTHA 5D3QA 1DWUA 3LY5A 2DJIA 1FLDA 3L7NA 4XSGA 2X2PA 2R44A 1K06A 1CEQA 1TCUA 4XYGA 4L2IA 1E9DA 1U8TA 4C2AA 3KKZA 4JU8A 1G98A 3N0TA 4H1VA 4M6WA 4EFKA 4G5RA 3SQWA 3F2VA 3OFNA 4KQXA 1M1YB 1N1DA 4MUAA 5EXXA 4ZT4A 2PKQO 2TMGA 3GA7A 1WXWA 4I5EA 5CG2A 3STVA 4XWWA 1CZKA 3OZBA 3I3SR 2G77B 4PV7A 3VGJA 3GGJA 1YI8A 3I83A 1H6DA 3RS5A 4G0NA 2WFAA 3WADA 1MT3A 3HB5X 2V0GA 1JEJA 4C3ZA 2OCPA 3A4TA 2PGDA 4RK4A 5EG5A 4DR5B 4MQ6A 2R66A 3FLMA 4OMCA 4CIYA 1EFVB 3LKVA 2QJOA 4GRAA 5AOVA 5FL7A 5ADHA 5LKAA 2WM2A 2XGSA 3A70A 3NBQA 3PEVA 1JBQA 2CZCA 2CL6X 4PF1A 3S70A 3IPAA 1X8XA 2OCLA 1QVRA 3LW7A 5A0FA 1Y8CA 1Q0RA 1E2EA 2X40A 3LG2A 3O93A 2UV8A 4NZOA 5HF5A 4NVRA 1F8UA 1PJCA 3D81A 3L06A 4CL0A 1K5PA 2B7LA 4B17A 4IDAA 1QF9A 2Z3WA 2J1LA 4WNAA 3DHEA 2WHQA 1BE1A 3OCYA 3O90A 3MWEB 4EJ2A 1JSZA 2CDCA 1Q1GA 2NSHA 1UDBA 1VIMA 1MC5A 2QX8A 1PLLA 2Q1UA 4OAQA 1MX3A 1DAIA 5EMHA 1FNCA 3KSMA 2F43A 3R2JA 3BWXA 1Z13A 4X7PA 1EWTA 1PR2A 4LK3A 3P52A 4R2JA 4V2UA 2WE8A 4X20B 4X7MA 1VB3A 2V45A 4NC9A 1M72A 3COWA 4OP3A 5FNVF 4ZJYA 2OGSA 1ZG3A 2QTCA 5BURA 2PX2A 3B3JA 5ALWA 2GZRA 2VXCA 1GGFA 3H9JA 3LZ6A 4G8JA 3KOMA 3NC4A 3OSZA 4IPTA 4XARA 5IVKA 4GQBA 2F1KA 3M4XA 1HNNA 2ZATA 4P36A 1SZDA 3EQ9A 3SIXA 1MO2A 2F1RA 5LU8A 2OR3A 5BN5A 3WZLA 4FX2A 4YH1A 2NUBA 4KLCA 4D5EA 1PZGA 5HIJA 4ZYTA 5BSFA 3ESBA 2DPGA 4GYJA 4KNVA 3EDYA 3GPBA 4CGZA 5J4YA 2UVPB 4UMVA 3OLCX 3EPHA 3NU1A 1FYDA 2ZAOA 3EOZA 2Q29A 4FMCF 3SI7A 1T9GS 4FNGA 4D79A 4D26A 4NEQA 5AHWA 3LGSA 2Y1OA 3Q3VA 4FT2A 5GGXA 3WL8A 1I4EB 1TQHA 3NPAA 4KLNA 4RLHA 5CB4B 9ATCA 3T35A 3ZOZA 5LC1A 2YXLA 2ZSJA 2CNNA 4NFHA 3ICEA 1X3LA 5ITWA 2ECKA 1KF0A 1T35A 4R5MA 4RY9A 4UTZA 3SOPA 3TRKA 3ESCA 3EHDA 3AXTA 3OHMA 2ZVPX 2W8BA 4LK2A 1V7PC 1WW2A 4INAA 4RWZA 3GZNA 1FFAA 4ZZ2A 4DZZA 4NS1A 4ZQBA 2XDQB 2GAIA 3G8DA 1C9YA 3N8KA 4R8MA 1HYQA 2X8AA 4TQ9A 4X1IA 1ZM7A 3LXRA 4KO8A 5EXPA 1YCGA 3H2BA 1HURA 1L7VC 4TRNA 5K3FB 1YFLA 2H0QA 4R01A 5G1OA 3THRA 2AFHA 1ULZA 1ZOSA 4IS3A 4C7OB 221PA 5IAOA 3JQGA 1N8TA 3EIWA 4GEGA 4KHZA 2Z0MA 4CMKA 1V11A 2DWPA 1AM4D 3GFTA 4OIMA 4MW9A 2O50A 5H5JA 1LJUA 1ZVJA 3V1NA 5K8CA 1HFJA 5JPDA 3L84A 4KXNA 3W4KA 2P2LA 2ZB2A 3PI6A 3ZDEA 3CKLA 2YOFA 3OP4A 5KTTA 2Q2WA 4Y67A 2QKYA 1W94A 1MX9A 1R9NA 3NT4A 1NVVQ 2JCYA 3SX2A 1VKRA 3FCCA 4FXOA 4HQLA 3W3ZB 3LQYA 5BORA 2I4TA 1MDFA 4LHEA 1L5KA 2GX6A 3OZRA 4NJOA 3TG8A 1RADA 4P7JA 4HQRA 1JLHA 4MWSA 2RBKA 3EVEA 3RS0A 1VHTA 4BWVA 2Q9BA 2ZUEA 3AEQA 1Z6YA 4J94A 3RFVA 1KHHA 1S2MA 2DULA 3FB1A 3NWJA 4LF5B 1PLJA 4WY2A 2GUGA 3WY9A 1VTKA 4R7GA 4Q03A 1N5RA 1EK6A 4Q4AB 5KOYA 1VIAA 3DJFA 4FDUA 1KJJA 3ET4A 4HK4A 5BXYA 1SUEA 4M22A 1D8AA 3HRHA 3KG2A 4FFBB 2ZUUA 2NU7A 3AUSA 3C45A 4WHMA 3UA4A 1FLVA 1P4RA 3CBGA 3E6AA 4LXHA 5HX7A 3EBLA 721PA 3OPQA 2OM6A 3H0CA 4GBJA 4PPFA 1Y6FA 2PBFA 3TDKA 5HPYB 4OFBA 3V2GA 2PL5A 4BOYA 2IGTA 1IBCA 5B2EA 3SVTA 2DAPA 1A9XB 2R84A 4O29A 3YASA 3HO1A 3ZHXA 3UJDA 1G3MA 4B0OA 4LDNA 2B0CA 4ENQA 4F0JA 5DRTA 1NX6A 5D8DA 2X8BA 4QUJA 3TECE 3LNCA 1ZJ5A 5DSTA 1D6JA 1T4GA 3K30A 5L4SA 1XN4A 3WGLA 1FYEA 3E7XA 4JP8A 2FR1A 3HL4A 3TGWA 1D0SA 3LRTA 3J81k 4A1FA 4LE2A 3SBDA 3E4CA 3K1AA 3GRYA 2ZPTX 1KL7A 2GK7A 2DC1A 3M81A 1YGPA 3QUQA 3VO2A 5KBYA 4YRZA 3HDJA 1R8QA 1TCAA 3X43A 4IBOA 3LT1A 2Q5EA 1E2UA 2H8KA 1JFLA 1LY1A 3FMPB 5A9SB 3U7FB 1CB0A 2C1ZA 1VSBA 1R8SA 2XSZA 3FUVA 4HBGA 1B93A 2D5LA 2RB5A 2QG6A 4R51A 4K9PA 3FCEA 2M2IA 4EUEA 4ZFNA 2F62A 3EMKA 4IM7A 2JIZD 4EKIA 4TTVA 1Z8NA 4D8UA 4Z4CA 4YR9A 5FHRA 1EFPA 5DO9A 3UW1A 4WFIA 2J09A 2UUCB 1UMCB 2AL7A 4PRKA 1QUFA 1M6EX 3WMXA 5KCZA 1Y6QA 3GQVA 2W37A 3IQEA 4PY2A 3BHIA 2WF9A 4G2TA 3QIAA 2CMDA 3EPPA 4HF7A 4LXYA 5EC8A 5CH8A 2D0IA 4LJ4A 3VSBA 1VMEA 4AMGA 1PUXA 4BQIA 2PX5A 3MJFA 3JQRA 3I8OA 4L5BA 1ZOOA 2GFQA 4ENSA 2VL7A 4J90A 1SKYB 1HQKA 5H16A 2E4ZA 3TUZC 2XKBA 4YHBA 4F5DA 4HRXA 5JSZB 3AHFA 4E5DA 1RQGA 4WA7A 3HFSA 4E5UA 3BCRA 1XTTA 2WF6A 4PG7A 4JDPA 1G3QA 2GN1A 3DHWC 3KPWA 4UHBA 4HUJA 3G9QA 3T34A 2EJWA 3OCCA 3WYNA 2ZTLA 3H5NA 4D4IA 2XXAA 3VDRA 4K3UA 1JP7A 2FN8A 2XMGA 1FTNA 1AS0A 1T3LA 3LFUA 3IE1A 3HHPA 3VNAA 4LJRA 3GH3A 3EQ2A 3C6XA 4PIVA 4MGEA 1PRYA 3RFFA 2V6JA 4Z6KA 3BIXA 1SCIA 2QT0A 4KVAA 1HDCA 2WD7B 3KFLA 1DC8A 2RG7A 4NATA 5AI0A 3P2MA 4D7AA 3P8ZA 3GLFA 1BG6A 3EVFA 2GAJA 1J2YA 4UFPA 2SCUB 3IVMA 1KDZA 2OQ2A 1SXJA 4TVOA 2GCOB 3INRA 1NE7A 3WK5A 1YUNA 1BMQA 2ILTA 1PCXA 3ANXA 3D59A 4O2RA 3ZY2A 2P35A 2UZ1A 1SIUA 3GRRA 1RE0A 1OJ7A 2M6KA 2B5WA 1OWPA 2NLOA 5LYJB 2BTQB 1ML4A 4B71A 4NX2A 4ZCIA 2C59A 2PE5A 1J06A 2Y1KA 1HEYA 3EBOA 4KKXB 4MW7A 3SE0A 1BCSB 3ZU5A 4EHAA 3WAJA 3DLBA 4XEHA 5CDSA 4EIWA 4WJKB 4AWXA 2FDCA 1V16A 2XWBF 1SVSA 3FNIA 3A1EA 5GM2A 2VHWA 4GR4A 2NM0A 4FCTA 3RGWS 1XZIA 5KI6A 1JIXA 1H2HA 1YJQA 5TQ2A 2H2GA 1X2BA 2VYND 4B3CA 4ND8B 5FFFA 3B1ZA 4ZVPA 1DIAA 1H22A 2A8YA 3IAM6 3QLUA 4FVTA 4JH0A 5ERXA 2QTWB 3WYBA 2EF0A 1C30B 1OFIA 3DS8A 3QWFA 5KNDD 2BYTA 1QOZA 3DO8A 3LS2A 1M2OA 4QVKA 3VJLA 5LP6A 3EIUA 2FMFA 4PC6A 2FRDC 1AQJA 2FFHA 1RJEA 2VKQA 3LH5A 1IM2A 1ZM9A 3T7SA 4FFVA 1MRSA 1JVNA 3W2IA 5L4NA 3D1JA 3D6NB 4LZNA 4WLEA 1FFHA 4RULA 5JZVA 1FC0A 3S55A 3DWEX 3JASB 2QEQA 5HGXA 1NTOA 1P5JA 2RGDA 3OO1A 4AKSA 1L7AA 1WVIA 1GVNB 2G0NA 2A0KA 4CQLA 1M3SA 1UWVA 2IYEA 3E0QA 3F98A 2JW5A 3OWXA 3RR2A 2CJPA 4X1OA 4BZZA 2BH9A 1F7UA 4KCGA 2IY9A 3C5CA 5C3UA 3TR5A 1GXSB 4DM3A 3V4RA 4P3NA 4JLDA 2R4UA 3E84A 2GEDA 4IDBA 4HAVA 4WERA 4E31A 4WKNA 6LDHA 3B3FA 3OJCA 3NMUF 4G5GA 1IY0A 2VFAA 4RAOA 4XIGS 1RFLA 3OOSA 3HXTA 4G5FA 3Q3CA 4G0MA 3SKYA 3ZXSA 4YDQA 1ENYA 1FJHA 2WINI 1BW9B 4HGQA 4JLPA 4K0KB 1HKUA 4PG5A 1V3UA 1BXKA 2IH2A 1G8SA 3F6SA 3CB4A 1NATA 3B5EA 4A91A 1R6XA 3IUQA 4IWNA 4NAVA 1ID1A 4IDFA 2AZMA 3DMTC 5DLEA 3JD3A 4WINA 3IPRA 4LWOA 5JS8A 3MT7A 3Q3IA 4PAMA 4C7KA 4DA6A 3HY3A 3QYAA 2QW0X 4HJXA 1Q57A 5FXMA 1SGWA 4PPQA 2XUPA 4KMMA 1W48A 1E1YA 1BCRB 4QQFA 3CW9A 4RV4A 5K6AA 5SZJA 1GTL1 3TFOA 1NYTA 1YUMA 2J0UB 4NBSA 1Q7RA 4XIIA 3L2OB 1U81A 1Q1AA 1UFQA 4PLZA 5JNVA 4PBTA 5HCUA 3P26A 3UMRA 3WIOA 2R79A 3BH6A 5JANA 1LKZA 3ZVRA 1MGOA 4BP8A 5AIBA 2NVWA 2RHJA 2Q6LA 3LIPA 1L5MA 1GILA 2QV7A 4IR7A 2EOAA 3Q8KA 1OILA 1P0MA 3RH0A 2EHDA 5A4IS 1JIJA 3AFHA 5G1PA 1UWCA 5A5FA 1NPDA 3BZBA 1O6BA 3BMQA 3LVRE 4ZIRB 1UEXC 5CEEA 1J1ZA 3K0BA 3JX9A 3QU5A 2GJ4A 2PZKA 1OI3A 2OCAA 3IVXA 2WRZA 4DWWA 5EMLA 3ACBA 1DDIA 1GQQA 2HSEA 3KWLA 4GFDA 3T1TA 3VRHA 1Z0UA 3BUSA 3JQFC 2PJUA 3CNLA 4DJ5X 4TQAA 1W88A 1XLVA 3MJCA 2J5RA 3N58A 4IXNA 4HWGA 5FUVA 5FJJA 1T2NA 4PO3X 2QMQA 1C41A 1NDUA 4J1TA 2OFOA 2O2ZA 3ITEA 1ODKA 1PJ2A 1UPBA 1WA5A 3SZRA 5CG1A 1RLTA 4FDVA 1U6JA 4YRNA 1PNRA 1ULTA 2ZETA 1KJYA 3MWDA 3BB1A 3QTBA 1S2LA 2B4RO 2O3UA 3LLSA 4YCDA 2P6MA 5L45A 1L2TA 4DB2A 5LBTA 4LOIA 3I9NA 4Z3DA 4BFYA 4MGZR 5E3HA 4JLVA 5I7VA 2DHCA 1XC7A 3SF8A 4JP3A 2E6UX 1X7WB 2I1QA 1E77A 1SG9A 2GM3A 2RSLA 1M8PA 2VSYA 3G0IA 4KVFA 4P54A 1QHNA 3E9DA 4IHKA 1IJKA 2YBEA 1NA5A 1Z2CA 4M54A 2OD7A 3UCXA 1P1IA 2VAVA 2ORIA 2VP6A 2YRWA 5AJYA 1Z45A 3NTXA 4FNAA 1DG3A 3FDJA 2WU4A 4N8EA 2OHVA 2P2SA 2PS0A 1U2GA 2H1CA 3MCUA 4NONA 4DPLA 2B4QA 2C42A 3LBYA 4QPDA 3HV0A 2H9YA 4G23A 1QAMA 4LRWA 4NBWA 3UT5A 4YX9A 1XF1A 3KFXA 3NM5A 1A9RA 1D9ZA 2ZSUA 3NFYA 3PNLA 4KL8S 4MV1A 3VZCA 1JDSA 2WUFA 4QBIA 4BB5A 3TL6A 3X2FA 3QWHA 4XVQA 2ONKA 4TUYF 4O8CA 2C95A 3LUGA 3QKRB 1KWGA 1EP1B 1TJNA 2YVKA 2YYSA 1DT3A 1X86B 2JATA 1XWFA 3GG9A 3L1IA 3UOWA 1OF1A 5GY7A 4I4TB 4M98A 3WG9A 2WWYA 1NUPA 3EGVA 1X92A 4KH0A 4QTYA 3HXQA 2ZJ0A 3ZJ5A 2QN9A 4W6ZA 3M1YA 3K9LA 2AC7A 2O0JA 1NW9B 2QG9A 1G7TA 1SUAA 4H2DA 2XAUA 3O84A 4LI0A 2IOHA 5U4QA 5BQFA 2PM8A 4WZBB 3T6KA 1WDTA 3CKKA 5F9HA 2BDTA 5FEUA 4TMFA 1HI9A 1C7RA 2JCXA 4F9GA 2F1HA 3QOXA 1BWSA 1YQQA 5EP3A 2P0EA 1BWRA 2ZEJA 3AUKA 3FN4A 4OGWA 4P4GA 5F73A 2I67A 4EO4A 5EJ7A 1VOTA 3AILA 4JR0A 4OXYA 4CDNA 1QGYA 4MS1B 4DR1B 2R1VB 4E32A 4UUNA 1NC3A 3O3CA 4DRYA 2AI3A 2YZKA 1G8HA 4EH1A 5FCDA 3T5GA 1JDNA 3G2NA 3ASZA 1K0FA 2P8SA 3H8VA 4G1FA 2H9AA 3DSRA 5CT9A 4BB0A 1DAHA 1H3NA 3U60B 2N75A 3SZUA 1L7OA 4DCGA 1P3JA 3OHPA 2ZYHA 2I4IA 1W85B 4K6HA 4ND3A 4PZ0A 5IVPA 3AOEA 3QELB 4GWGA 3JWGA 3K0AA 1JYSA 4G1CA 2WSSD 2ADMA 4IJMA 2HV9A 4MW5A 3SHWA 3D02A 1OBHA 4YP9A 3AZPA 3WHKA 6YASA 1I9GA 1V8DA 3KVOA 3O1LA 2GJ9A 2NZJA 3F8SA 4H6XA 1GZ5A 3TJRA 3ZOKA 3H1AA 1RCTE 4BUCA 8AT1A 1LF0A 2FFQA 1RD4A 3HNOA 3LT5A 5B2ZA 2GZSA 1ACMA 4FMPA 2O52A 2ID7A 2R6CA 2AUMA 1SCDA 3EZ7A 3LWZA 3N75A 4PTZA 4YAFA 5DP2A 1NP3A 1M1YA 1Z28A 2D3TA 5DI3B 4MKIA 4N41A 3TSCA 2I80A 4N12A 4NYJQ 1U1CA 3CU5A 1J23A 1FW6A 3EY9A 4L5IA 1TA4A 3UJ6A 2A9OA 1ULSA 1IXSB 1WZNA 3GQBB 3LQ2A 2J45A 4CLHA 3DOOA 3BL8A 4GQAA 4K26A 3L6CA 5CCXA 3ND8A 1F7VA 2VPPA 3JXEA 2PY6A 5C1IA 2D4AA 2VDNB 3R9IA 4B45A 1JSXA 3NTQA 2Q5IA 4Q1BA 1P77A 1O5OA 4DNXA 1A96A 2ZYSA 1XK6A 3TS1A 4RAQA 2WZBA 4QULA 1WPXA 1W5EA 1AC5A 1NVFA 3RC1A 3DE5X 2B9EA 2CHFA 3GFRA 3V4OA 3V2UA 3V1MA 3TOVA 4RMIA 4HFRA 4IIGA 2R97A 3RVJA 1UBEA 1NZDA 1RMTA 3T0GA 3UT0A 1PZEA 3GFFA 2DFLA 4MVJF 1FEZA 1O97D 1M33A 2BM9A 2FMUA 3MWEA 3NHPA 4WK6A 5K0NA 5JRJA 3L8DA 4ZTZB 3CHYA 4JEMA 3MWGA 1KEKA 3BK2A 4IH4A 1QCCA 2FP4B 4R6WA 3WRWA 5F7OA 4QHTA 2BM8A 3OCVA 4X20A 1PU2A 1NXSA 2VSNA 1T1JA 4PYLA 4KAFA 1FUUA 2GJAA 2LTAA 4IO0A 1SVMA 4QSHA 2Q2QA 4Z99A 2QTHA 4M1TA 3R20A 1M66A 2AYZA 3DVSX 3HG7A 4YCAA 1ZYUA 3H4VA 2ZU0C 5GGYA 4M9QA 1U9ZA 2Z8YM 2G72A 2IYOA 2XJ9A 4YRLA 4ISCA 3A3OA 3IBFA 1J00A 3IUEA 4DPMA 1Q91A 3R0QA 2FZ4A 4OHVA 1VPWA 1V25A 3I30X 5K01A 4Y2TA 2OB1A 3R7LA 3I52A 4LJ5A 1JB9A 3ADPA 1UK7A 4ME6A 1D2GA 1K08A 2BJHA 4ZMRA 3F4KA 4XIFA 2IV2X 2UVPA 3UUWA 5BSMA 3UENA 1DLIA 1UFRA 1W25A 4LI3X 5CB4A 2HM7A 4W4TA 2IOQA 1IBSA 2JJ1A 9MHTA 2IW3A 2GM9A 2PZAA 2JB9A 3UWOA 4BMVA 5KQLA 1NBEA 4EKDA 1GA4A 1E7RA 2C92A 7MDHA 5UKDA 4C88A 5A7FA 1RTTA 2EC5A 1ESDA 1NF9A 3A6PC 1KPIA 1Z8HA 4Q3OA 1J2EA 1R9JA 1WUYA 1NYRA 3FPBA 4KV7A 1H8ED 1CUFA 1Y5NA 3E8SA 3VVCA 2XDQA 3VV3A 3DAYA 2BCEA 3H8SA 3WWOA 4DM4A 3HJUA 1XZCA 3IE0A 2HX1A 3LX8A 3OOJA 4NMWA 2CY0A 1A69A 3IS3A 2A5FA 3IAXA 2QT9A 4N65A 5K3FA 3IVGA 4ZARA 1UFVA 4HAIA 1HBJA 4C7OA 3QVLA 4FWBA 2HIAA 2VHEA 3HBMA 1A1VA 1T5BA 1TZ2A 1ZCFA 3DNMA 3OCXA 2AHRA 2B30A 1E9VA 3Q0TA 2O2YA 4KJZA 2W2OA 1O9GA 2ZTSA 5B36A 3DVQX 3OZAA 3VTAA 1HT0A 4KPEC 1SQ0A 3KDAA 1JA0A 1C9JA 2IYFA 3UFBA 1YKGA 2V9CA 3DZGA 4UZFA 4RK5A 3PUIA 2DZDA 4H1TA 5L4LA 4H59A 1BGXT 1KR5A 4PZLA 2C3MA 1ECCA 2C58A 2G40A 2O0HA 4TVKA 1EUYA 3AUJB 4BQNA 5DGHA 2QL5A 3CX7A 2OT3B 2F3RA 4DSAA 4MW6A 5FX2A 5L53A 1LS6A 4YWJA 2WTNA 1XTJA 1Z38A 4YVFA 2AXNA 5JNTA 2C3UA 3RYCB 4YAUA 3CR3C 1WMEA 2MJLA 3P27A 4EZEA 5ITVA 1KP3A 4B3RB 2RH8A 4K2AA 3ZZ1A 2OAP1 3F67A 4KC0A 3RVNA 3TCKA 1NG9A 2P9EA 4J7UA 1XNJA 3D7RA 4GH5A 4OM8A 5E3JA 5F5XA 3TIGA 1FQWA 2OSBA 2H48A 1D4ZA 2XNDA 4Q4AA 4CUJA 2YZGA 3OFVA 1EVEA 2FG7C 4I2VA 4IIVA 3E35A 4FFBA 4Q82A 3K0HA 3JYOA 4M1ZA 3X0DA 4CV3A 1AA6A 3BKXA 3ZCRA 1VHJA 4P80A 3EVCA 2K2QB 2P6UA 3U4CA 3CX3A 2C4NA 4E1BA 2R65A 4NDAA 5CB4F 2XNKA 4ITUA 4R31A 1EEXB 3AETB 5JJ5A 1ZJZA 1JVSA 2XZTA 3AFOA 4V0QA 5KC9A 3ORQA 1A9XA 4YUVA 1ZW1A 4RF4A 2H1LA 5EE5B 4EX6A 3WGOA 1N34B 5IFLA 4PRZA 5C46F 1WULS 1U2ZA 4MEBA 4DSOA 3ZBTA 3KIPA 4DC1A 2J30A 3M3HA 1DFHA 2HA5A 3WWZA 1C4KA 2A1UB 3AR9A 4N0PA 1ZM2A 3FTCA 4E4YA 3OMLA 1DL5A 3ZY5A 3IHWA 4L95C 3T5CA 4L8YA 1X6VA 3WV4A 1OPXA 2ZBGA 2HMSA 4HN9A 4BFWA 1PQWA 3ZIUA 2X41A 1E0AA 4MO9A 1ATZA 4E09A 1LLDA 1E2MA 2X4GA 3BCSA 1F06A 3D1LA 2L2QA 2PH7A 1VE9A 3IUSA 3F97A 2IK8A 1ZD1A 4D56A 3IAS6 1TAHA 2C5HA 3JQAB 2XE4A 1HTBA 3OTQA 5A9SA 4RDXA 4GMKA 2AXQA 5DFAA 1KQNA 4PQFA 2ZQZA 2ZZNA 1DQSA 1E60A 4TLLB 3VR3A 3SF0A 2ZAGA 2OV8A 4EARA 5K8VA 2EG5A 2JJ2A 4QJ4A 4UHEA 2BSQA 5IZCA 3DJYA 3PQ5A 2N3ZA 2C9CA 4HZGA 1KO7A 2VT3A 4G9GA 3V46A 5ILOA 3PR1A 2N1BA 2GEVA 1HDGO 2JFFA 3AY3A 3LTNC 1DQPA 2HYIC 4GL2A 1JDVA 3BXFA 1UMCA 1Q21A 2AN3A 1VFPA 3U48A 3KB2A 2VDPB 4RJLA 3KZKA 4ND2A 3OVMA 2QMUA 2XCTB 4HAUA 4NBRA 4E6EA 1T0UA 2G3YA 4PFJA 3TXAA 3DOJA 3UMBA 2KHZA 2BV3A 3BH0A 1Q44A 5BVGA 5CDFE 4GP6A 2AOWA 2VDQB 5E7QA 1EG7A 4ZV4A 1M2KA 4WLOA 2IZOA 4N01A 4Y6QA 5CDGA 1XZPA 1XQYA 4LJ8A 1VBKA 3TQHA 2VHUA 1VPVA 2ZSFA 5HA5A 2ADFA 4C22A 1DLJA 3JYLA 3KQHA 4JUFA 3RUFA 4W9NC 3C8UA 2HV8A 1NVAA 2NZUG 3AR6A 3V8QA 4CMAA 3B6KA 4BGDA 2HU5A 2H00A 1XPOA 2C97A 2VC2B 4B4OA 4BGUA 1KK3A 4L02A 1EIZA 4IUYA 4G8BA 2X0NA 1PS9A 2YJ6A 1LBQA 4XQCA 2ZR7A 1QK5A 4D80A 3QU7A 4OAPA 1GRVA 2EX4A 3EUEA 1KAGA 1Y8RB 2HQ1A 3LP5A 5TVKA 1YDHA 2VJBA 1EZ1A 3TE6A 2G6TA 2WD7A 2YWFA 4EVSA 3HCWA 3ADCA 2OG2A 1ONBA 1V3VA 5I4CA 5IN5A 2QJRA 1OLSB 4M9UA 1FZTA 2SCUA 1XWWA 4OI1A 1JDBB 3AX6A 3C5EA 2GCOA 4P33A 2W70A 5LZ8A 2W22A 2ARKA 2DUMA 1GZDA 2VDRB 5CA0B 1E94E 4XGKA 1RM5A 4AK9A 1AS2A 3WLRA 3DDSA 4JBIA 4UBJA 2CWWA 5LYJA 5IYZB 2EDCA 1XALA 2BTQA 3KQTA 2B78A 5LBUA 3ZQJA 3IVRA 4L3OA 1DBIA 4JLBA 4WE3A 1DKMA 1P1CA 1QJCA 3N3BC 3N87A 1Q17A 4JP2A 1BCSA 4TTTS 3IAM1 3CLSC 3EG5A 3RSCA 1X7GA 2WTAA 5ER6A 1NXWA 1FU8A 2FOLA 3QG1A 4MJ3A 4RX1A 3RC3A 1W9MA 2LKDA 4UMDA 3ZGZA 2ZWPA 3QA3E 3OZFA 4G3XA 4DREA 4WGFA 1K86A 1WMDA 2B92A 1XTUA 3E7WA 3NCTA 3VDMA 5IVIA 1R64A 1JIVA 1TLTA 1C7FA 2RJ3A 2X6TA 2CBXA 2V55B 3EVZA 3I5UA 1KEVA 3KOZA 4PIMA 1JAYA 4YBRA 1N9ZA 2A88A 3R5JA 4I55B 2CCJA 3G2OA 4GRIA 3L0OA 3T4EA 1B42A 1D1SA 3USCS 3V8EA 4ND8A 5MHTA 2Y1LA 1HNZB 5AVWA 1PQPA 3ROXA 1W47A 4EW2A 1C30A 4TV9F 3UMYA 4QHYA 2HAEA 2C9ZA 4RE5A 3GZTB 1NVBA 1UBFA 1E92A 1RZVA 3GEMA 3RODA 1E2LA 1LPNA 2Q07A 3GGSA 1AS3A 4NLLA 4NZNA 3LW8A 4HNRA 3M3PA 3IELA 3T94A 3C7KA 1KC3A 2C03A 1RVDA 3VTKA 1P5HA 1JMVA 3JASA 4N76A 2CUNA 4ND5A 4AG3A 5BW5A 2R87A 2G0TA 3DFIA 3E48A 1J9ZA 2VWQA 1H2ZA 3TZEA 1A9OA 1B6SA 3GH1A 3PE6A 5FORA 4L4YA 2VJAA 4PNHA 1W29A 4DUPA 4PYNA 1Z4IA 2G17A 4P7GA 5CLLA 3WI7A 4BVBA 1XTPA 1Y3HA 4C7JA 1GXSA 4DMRA 1L3BA 3NHFA 1OUMA 3F3KA 2VF7A 4AKGA 3KLOA 1XVAA 3G6WA 4W8OA 5DNUA 2DUWA 4N8SA 4TTRA 1JDTA 2QZ9A 1Z6GA 2YZNA 2AQKA 2Z98A 3M6MD 4HNQA 2PXCA 2Y4OA 3PT9A 2Z83A 2PKRA 4QOSA 3VQTA 4YRIA 1BW9A 4FBLA 5FLXA 2JNWA 3RVBA 2NTVA 6ABPA 2NP6A 1DIGA 3I6IA 1YJXA 3U1VA 1JEYB 4JVMA 5LYJF 5DGIA 4S12A 5T4HA 4IF4A 2PS9A 4YROA 1PGQA 4DW8A 4B4KA 4EDHA 2V1UA 1TGYA 3DH0A 1BA3A 2BMEA 1BCRA 2OZVA 2QX6A 3ABOB 1SVWA 1A9QA 3IV6A 2BEWB 1W36D 1KVQA 3QFSA 5TF4A 2J0UA 2WG1A 2XODA 4IEEA 3ZQ6A 1YO6A 4MP3A 4TGLA 3RI3A 4B84A 5JMTA 1TO2E 1L9XA 1J2JA 2QRNA 1IZ7A 1KS2A 2QF7A 2R2AA 1EVJA 2KM1A 1D03A 3K3PA 4IXWA 4QPNA 4ZALA 3WKCA 3KDPA 5C32A 2Y27A 4J9UE 2FZCA 2HGSA 3AESA 2G9VA 1QMGA 3BJZA 4MPTA 4K9SA 1J9GA 5A4AA 4Q7EA 2BKAA 2I3GA 3OO0A 4Z54A 3I1IA 4DEYA 3PFHA 4ZIRA 5LNK6 3EQZA 3ABSB 4HB2A 2VHZA 5BSUA 3F9CA 3ZI7A 3D3NA 3IKJA 4A0FA 3L8ZA 3PQ2A 3V42A 1QK3A 2M98A 3RREA 4NWIA 1GZVA 2VIIA 2J9RA 2JEOA 4UOZA 1KYXA 2OLKA 4R1SA 3BD8A 4II2A 4MUHA 2X1HA 4GKBA 1JXQA 4OV6B 5F1KA 4QGGA 1THGA 4ZT3A 3IJPA 2YY6A 4JLWA 2ZRNA 1K7FB 4FFNA 2HHAA 1HL3A 1VC2A 3R6DA 4DLXA 1RRMA 1VSUA 2AFRA 3B8HA 5BSEA 1U28C 3AJ9A 3NALA 4GS5A 1BROA 3PQEA 5H1YA 3ELUA 3H5OA 4N0DA 4INZA 1DXQA 5FPKA 4PR3A 2P8JA 1C7QA 1J09A 2H2AA 1VL1A 1M75A 2BFAA 4C5BA 2WIDA 3GJ7A 3TLYA 4RMGA 5A3RA 2RBEA 2I34A 4RMJA 1X7WA 4HWPA 3KSAC 3TO5A 2X1LA 2Q0SA 4EF4A 4C04A 4ZVOA 5TV2A 3SYKA 1A9PA 5CFZA 3TG2A 1I7DA 2IOFK 4LAFA 1KI8A 1FTWA 1UINA 2EP7A 3CFYA 1YDGA 3SMVA 2Z9CA 1FP1D 2PZGA 4JL6A 2GZ1A 3NT5A 2N47A 4QATA 5EFOA 4KBFA 1MXFA 1XQ1A 4P86A 5FUWA 1JA1A 1NJ1A 4KDEA 3W9YA 1NHWA 3I23A 1OROA 5EEHA 4R68A 4QO8A 5LYYA 1UBHS 1U9CA 3DHNA 3HJRA 2W6NA 2Z9DA 3NHUA 1P2TA 4GKKB 4F5EA 3A3NA 4YV1A 1GR1A 1TQDA 4XFKA 4KMSA 2VTVA 1D2HA 3QE3A 4MKGA 1V48A 2XXJA 3QKRA 1Z83A 2C2XA 3DXZA 1LUAA 1M34E 5IAAA 1M54A 2EZUA 3QIVA 5LB4A 3EZ2A 4I4TA 1V7QA 2XSZD 3DNPA 3OA0A 4URHA 4RFSB 2Q5LA 1D1QA 4AJJA 4I14A 3TKLA 5AW4A 2VXOA 2V3WA 1CK4A 4XDHA 3EW7A 2A9KA 4WFQA 4WZBA 2ZXEA 4QGSA 1EE9A 2FWIA 5AM2A 3Q12A 3TMAA 1WVGA 3LP8A 4BKOA 4U0KA 5KIAA 1E7SA 3GT4A 3BX1A 2CK3A 1DAGA 1E2QA 2XH8A 3FH0A 3OEEA 2C8KA 3MBOA 3QLUC 1R8YA 4MS1A 3RT9A 2R1VA 2GPNA 2RMKA 2YJZA 3PD0A 2BFFB 3VDNB 2WKRA 4ZV9A 1TYEB 1NKTA 4HNUA 1R0CA 1PYGA 3W7AA 3MWKA 1SNYA 5C4GB 1E1MA 2R25B 4L76A 2WWGA 3HDHA 1MB3A 3C8DA 1BJTA 3R74A 3O4GA 2G8LA 3VKFA 4MAFA 1W85A 1SUBA 2Z57A 3ND7A 4D42A 4AP9A 4BDTA 3VSDA 3SVLA 1VDZA 3QELA 4HR7A 5SYAA 5J2UB 1S3FA 2J85A 4O4LB 1PBTA 1TC1A 4Q15A 4B4DA 2JZOA 3FTPA 1NN3A 1OA0A 2WKQA 5C8VA 1YRAA 3LCUA 4OTZA 4X45A 5H3LA 1QH8B 3ROZA 1VSVA 4BLWA 4R2KA 5CA0F 1ABBA 4W5TA 1RKQA 3PC8A 4HNTA 2AF3C 2PFSA 1Q84A 3GVXA 3S7TA 4N3GA 5GONA 4HC4A 2GETA 4FMDB 1IYZA 3CXRA 1NOJA 2B83A 3H7IA 5DI3A 1E62A 3WSWA 5K0EA 1FJXA 4CZ2A 1OB2A 4DLRA 5BNFA 1UAGA 1KGSA 2QGFA 2QW8A 4F6LA 1TVCA 3G5TA 3X1MA 4G5QA 1X0VA 2FSHA 2YJ4A 3ER6A 4DDUA 2BJWA 5EJ4A 3BCHA 1JKXA 1SXJD 3GQBA 3G2JA 4PX9A 1FFXB 1I0IA 1LEHA 1EJBA 3TOZA 3AHEA 5BWMA 1ZONA 2OV6A 4PN7A 2ZWAA 1CU1A 3WOVA 1JR4A 4JI3B 5BQOA 2MSKA 1I2DA 2REQB 4PSVA 3STXA 3BTOA 2CXRA 1PK9A 3LY7A 4U2DA 5BN3B 1HTTA 3QSYA 1H0KA 1OC2A 2XIJA 4RS3A 5ABPA 3PXDA 4I4TF 4QXPA 4BVJA 1RMY