2A0XA

Structure of human purine nucleoside phosphorylase h257f mutant
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
282
structure length
282
Chain Sequence
NGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANFEEVLAAGKQAAQKLEQFVSILMASIPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Purine nucleoside phosphorylase
publication title Neighboring group participation in the transition state of human purine nucleoside phosphorylase.
pubmed doi rcsb
source organism Homo sapiens
total genus 84
structure length 282
sequence length 282
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2005-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2a0xA00
1Y1RA 3KUKA 4MCHA 1QE5A 4D98A 4DARA 1ODLA 4JOSA 5F7ZA 5KB3A 1Y1SA 1A9SA 3OOEA 4TTIA 4E1VA 3KVYA 1ZL2A 3O6VA 4K6OA 1Y1QA 1JP7A 3FAZA 1NC3A 2AI1A 4F3CA 1Y1TA 4P54A 1U1FA 2A8YA 1Y6QA 2OXFA 4F2PA 1ULBA 1OVGA 4JWTA 1A9OA 3FNQA 3DPSA 3OZEA 2XRFA 1RXSA 2A0YA 1Z34A 4GKAA 3EUEA 1K27A 4F1WA 4G89A 1JE0A 3KVRA 2ISCA 2QPLA 1RYZA 5IFKA 1RXCA 3D1VA 2AI3A 4TYMA 4DA6A 4RJ2A 1Q1GA 4G8JA 4F3KA 3OF3A 1G2OA 3P0EA 1Z37A 4TXJA 1U1EA 1ECPA 1ZOSA 4F2WA 4YJKA 1A69A 1SJ9A 3GB9A 4DABA 4D8YA 2AI2A 5F78A 1I80A 1SQ6A 2IQ5A 5ETJA 4TXNA 3EUFA 3LA8A 1PR4A 4UC0A 4QEZA 3C74A 5DK6A 1PK7A 3P0FA 1V45E 2BSXA 4M3NA 2H8GA 4YO8A 3DDOA 4R2XA 3LGSA 4D8VA 3NBQA 1PR2A 4LDNA 4D9HA 1JDZA 1T8YA 1V2HE 4G41A 2OECA 1B8OA 1ODJA 4TXHA 1RFGE 3ENZA 3PHCA 1T8RA 1VHWA 4R2WA 1Y6RA 4QASA 4PR3A 1A9RA 4X24A 3UAWA 1YQUA 3NM5A 3OPVA 4BMZA 4MCIA 3KVVA 1V3QE 4LNHA 2RJ3A 3TL6A 4L0MA 3INYA 4WKBA 3E9ZA 1A9PA 1TCUA 1Z5PA 3O4VA 1PWYE 5FAKA 1JYSA 2I8AA 5F7XA 3BGSA 1A9QA 4WKNA 3UT6A 1JDTA 2AC7A 1RCTE 3MB8A 3UAXA 4TS9A 4LNAA 3BL6A 5CYFA 3BSFA 1XE3A 5C80A 3SCZA 2QTTA 4NY1A 1TGYA 4TTJA 1U1GA 1T8SA 4L6IA 4BMYA 1K3FA 1OUMA 1ULAA 4DA0A 2P4SA 4I2VA 1TGVA 4JP5A 2HN9A 1PR6A 1V4NA 4LZWA 2A0XA 5K1ZA 4QATA 5B7GA 1NW4A 4OGLA 2ON6A 3BJEA 3LBAA 1YBFA 2QDKA 3KU4A 1U1DA 1K9SA 3FUCA 5JPCA 4KN5A 4YNBA 1LVUA 2HSWA 5EFOA 5B7NA 4QFBA 2QSUA 3NM4A 5B7QA 4GMHA 4H1TA 5F7JA 1Z33A 4DAEA 4TTAA 1SD1A 1VHJA 1M73E 5CXQA 3UAZA 1PBNA 4M7WA 1FXUA 2B94A 1VFNA 4EARA 3T94A 2OC4A 5EUBA 3FOWA 1T8WA 4TXMA 5EPUA 4LKRA 3F8WA 5CCEA 4L5YA 1NC1A 3ODGA 3K8OE 1TCVA 3MMSA 2HWUA 4GLFA 1LX7A 2PGAA 1CG6A 4FFSA 3OCCA 1PF7E 3ONVA 4EB8A 3K8QA 1YR3A 1JDSA 3PHBE 1PK9A 4R31A 3FB1A 1OU4A 1PR1A 5I3CA 4NSNA 1WTAA 3DF9A 1VMKA 3OZDA 1TD1A 1Z5OA 4L5AA 3EEIA 4OGKA 4NS1A 3UAVA 4U2KA 4DA7A 1JPVA 3IOMA 4TS3A 4ECEA 3U40A 1JDVA 4WKOA 5B7PA 4OF4A 4TXLA 3E0QA 5F77A 4OEHA 3IEXA 3FWPA 4OY3A 1T0UA 4BN0A 1Z5NA 1OV6A 5F76A 3PNPA 1B8NA 1RXUA 1N3IA 1PW7A 3QPBA 1Z38A 1PKEA 1CB0A 3E9RA 1RSZA 4GLJA 3OZBA 5F73A 4WKPA 1SD2A 1PR0A 4QAQA 1C3XA 3DP9A 1U1CA 1JE1A 1YQQA 4QARA 1LV8A 1RR6A 2Q7OE 4M1EA 5IU6A 2A0WA 4BMXA 2I4TA 1OTXA 2QTGA 1Z39A 1PR5A 3DJFA 3UAYA 3NM6B 4IP0A 4PNPA 1OTYA 3OZCA 4DAOA 1RXYA 4WKCA 1ODKA 4DANA 1Z36A 1JDUA 5CYGA 5CXSA 2HRDA 1RT9A 1V41E 2GUWA 4OJTA 3EMVA 1A9TA 4MARA 1YRYE 1ODIA 5F7OA 4YMLA 2OC9A 3PNSA 1V48A 4L5CA 5CCDA 3GGSA 1Z35A 4D8XA 3KHSA 3OOHA 4DA8A
chains in the Genus database with same CATH superfamily
1HURA 1OGIA 1UOPA 4GVXA 3PB3A 3PDJA 1MIHA 5IPFA 1RJGA 2OR3A 4I5IA 5LQDA 1PIWA 1QE5A 2O2DA 3IALA 1E3TA 4GKBA 2JZCA 4CLXA 4EVIA 1RAIA 1COZA 3EX7C 1BWSA 2B34A 2PYZA 3KQNA 3BILA 2SNIE 2Q9CA 4LK2A 5BXQC 5D5PA 3M5CA 6REQB 2PUEA 3QLEA 3NHSA 1RZVA 3I4LA 4JZYA 4CDRA 1KE2A 3ORYA 4YHBA 3FFXA 1L7MA 3Q5GA 2XNCA 4Q4DA 5ELLA 4AXBA 5LQKA 5A05A 5B1EA 4ENTA 3THYA 1Y1QA 4FMCF 1EMDA 3PC4A 3AVTA 3R76A 3CKKA 1GZDA 2X23A 3ODPA 3HZHA 1G5TA 1G2PA 1E32A 1Z6PA 4BMNA 4C1BA 3CUYA 3T7CA 2K2WA 1A9OA 2G5GX 1R6BX 1SELA 3EGDA 4KQXA 4D42A 3RVDA 3QU4A 2A59A 2LCIA 3R0IA 1DB3A 3NONA 2GO7A 1WCWA 3ZLVA 2OFWA 1ESDA 3O73A 2JB9A 2Y0PA 3GEHA 2V7VA 2LUOA 4FDTA 2RONA 3Q4GA 4YFVA 2GTIA 2ZS9A 3R3JA 5L3ZA 3Q3JB 3WLNA 4F1WA 4HK4A 3I6QA 4TLCA 2NACA 1QQTA 1ZA1A 1WCIB 3LOQA 4HMOA 3HC7A 1H4QA 4ESHA 5F3WB 4W82A 2AJLI 3P2IA 5FR2A 2C1XA 3HK2A 3DAFA 3SHFA 2AW5A 1W1WA 3OF3A 3DDHA 5JSYA 2D54A 3HCFA 1Z75A 3T35A 3KPVA 4GEGA 2GXQA 1MJGM 4IWXA 4X1YA 4YMWA 2VHTA 2TS1A 2XCLA 2CD9A 1R9NA 4KAXA 4HKTA 3BZWA 2VTBB 1T36B 3EZYA 1E2MA 5FD8A 2LIVA 2G06A 2Z3WA 3O8CA 2W2LD 2PX8A 1M54A 3AUXA 4KAFA 4HYEA 1FLNA 2CXSA 4IGIA 5DT2A 3UQYS 2QQFA 3BCUA 4MROA 2O06A 4JLJA 3ML1A 3DD1A 1R15A 2WJ4A 3IC5A 2B25A 2CXXA 3A1TA 4QFDA 3AU8A 3JPWA 1KO1A 1RWXA 4D9MA 5ERGB 1A76A 3X1MA 4LVUA 1O77A 2W48A 2WMNB 3WJ2A 3DM9B 1D09A 3GUZA 3FCUB 4M0UA 5FLXA 1KZ6A 3OPYI 3D4NA 4EHJA 2V6IA 3C74A 3ORHA 2HZBA 3O74A 1G21B 4PZ9A 4J9VA 2FOIA 3P9ZA 3UV7A 4RMJA 2ZREA 3PQDA 3KKNA 4JLAA 1YHNA 2R79A 3F3SA 4JQYA 1G64A 4GVPA 2LD4A 3P9IA 1TTHA 1W5SA 3QY9A 3I6IA 1KZYC 3BXPA 4XTCS 4ZVTA 1VECA 2Q0XA 1P3JA 4V02A 4D57A 2EF0A 1TU3A 3TTXA 2HBRA 4BP9A 4Y6LA 2O8BB 5DBIA 1UQRA 3NFYA 1CLEA 4MQEB 1ZUNB 3C3AA 3OMWA 4NYJR 4U9HS 3ZG6A 3R5SA 3TCNA 4KXXA 2PQ0A 4C43A 2IBSA 2PDAA 2Z8ZA 3GJTA 2WVHA 3BJIC 1L9KA 5EIBD 3RGGA 4B33A 4EHIA 4YLGA 4B76A 4XX1A 3DBVO 4D6XA 3DR3A 4E4YA 1DKQA 3INGA 1I0ZA 5E6RA 5AM1A 1R8SA 3LC7O 3ZKAA 3IQEA 2OA0A 4IMJB 4KXLA 5JS2A 5E8RA 1PNOA 1WULS 4K9SA 3CUUA 5AKEA 1PFVA 4UUMA 5KO2A 2P2LA 3WNZA 2OHGA 4R6WA 5IM5A 1DXYA 1JT9A 1Q21A 5COQA 5DHQA 1N5RA 4RESA 2GPSA 3DT9A 1ECJA 4I7EA 4IQ4A 4TKZA 2W2LA 4TRRA 4Q9HA 5F1KA 3KSUA 1GNQA 1E3JA 4WBXC 1K6JA 4UDYX 1YUNA 2ZZKA 3HI6A 4F45A 1T0IA 2PUWA 5FXMA 3FMFA 4BRUA 2P35A 3THYB 4QULA 4MR9B 4ISCA 1PWYE 3VDXA 1YJ8A 3N0WA 3VVBA 4DWVA 1U7ZA 5FAKA 1K8ZB 2ADFA 2PGLA 1S3GA 2XTAA 3OJLA 2G1UA 1UK7A 3KJGA 2QOEA 2A5FA 4E88A 4RHYA 2Y6VA 4O3FA 3DNFA 2HA6A 3G7NA 3AESA 4Q3CA 1IUNA 3CY6A 4ZCQA 3EGDB 3LQ1A 3HJAA 4A92A 1ZR4A 1FZQA 3ADDA 2IYNA 3AZPA 4WERA 1MU0A 2Q6KA 2F17A 5DDIP 2ZVDA 2IZ5A 3OFVA 3R74A 3ZBTA 3N3BC 3ENVA 1SXGA 3TIXB 1FFEA 2AIRA 1I7LA 2QD3A 1E2BA 3UAXA 2WYOA 4CL3A 3N3AC 3HABA 4Y2RA 2VCEA 1C7IA 3K6JA 2IYWA 5KSZA 3UKDA 4RJTA 1GYQA 1P9RA 5JANA 4ZDKA 3O4GA 2GAOA 3DSRA 3ZZ0A 4LOHA 2G36A 2A35A 3J81k 4QM7A 4CM9D 3LLUA 3NPAA 2ZWPA 5KU1A 1U1GA 1ZICA 1KQFA 4ER0A 2F7SA 1UAYA 3H2GA 2BM8A 3GCWA 1NMYA 1NSFA 4ND1A 4X1YB 4REMA 1I6LA 3AVQA 2R4UA 3C8HA 1KH1A 2BLLA 4WRRA 5FWNA 1N8TA 1V1JA 2ZJFA 1KI6B 1AUOA 2DP4E 2QUZA 4ZPXA 5JO0A 1BS2A 2QX4A 2Y0CA 2H63A 2ZPAA 2ZXEA 4FYKA 3QOYA 4S1OA 2XYRA 2VA9A 4NCJA 4EJMA 1M34A 4EFDA 4XYLA 1P5RA 3K94A 4LZWA 4U6NA 2IU6A 3MTGA 1RRPA 5K0FA 4BQFA 1L5OA 3E61A 5HCNA 3SYKA 3ND9A 4PN7A 5B7GA 1BXGA 3F6EX 4Y2TA 4DVJA 1S9HA 1IBMB 5I9TA 2XXAB 5H82A 4JH0A 5KC8A 3FFWA 4Z0HO 1XQWA 4RHEA 2HBZA 1D2NA 1P1FA 4FKBA 3IP1A 1JKXA 3W77A 1TA0A 1MX1A 2I33A 5KNDD 2IUYA 3C15C 3PEWA 1UWLA 1VI6A 2GM3A 1FLDA 2OKCA 2B61A 1SMKA 5A3JA 4OBXA 3B6IA 1J2TA 4AZ0A 5A0VA 4WZAA 3V8RA 5C1PA 1ENYA 1EM8A 3VR6H 1QTNA 4QQKA 1D3AA 1T6ZA 5ILGA 3CUSA 4IDBA 1YFLA 2HJWA 1IXKA 1WUYA 2D00A 3LYLA 1Z0IA 3FYCA 2AN5A 3DQZA 3ETJA 2IVFA 3IR6A 3GDOA 1JFLA 2BGRA 1TCBA 3IAUA 2L82A 2OCGA 2QN6A 1ODTC 4WA7A 2PRZA 1CJSA 4RNCA 1SD5A 3NR2A 1HM5A 3ZV3A 1V16B 3QU9A 3WTCA 1R50A 2O7SA 3L93A 4M0FA 1JN0A 1WUJS 5E6RB 5I47A 4EI7A 2WTNA 1J0DA 1H3FA 1B6RA 4KG7A 5JXIA 4CM9A 1ZI6A 1TE2A 4PZYA 4KVGA 4ZQCB 1VZ3A 4A2QA 1CR0A 5DRYA 2FEMA 1PN3A 1TF7A 3VHRA 2H1IA 2H92A 4O29A 2BKLA 5AM5A 1WX1A 2GH1A 4ZAZA 3RC1A 3SZRA 4EELA 4A2CA 2V8BA 3AL2A 1EFUA 2WJWA 3AEXA 5C2JB 1XAJA 1NVWQ 3GJ0A 1WB5A 5EUBA 2C07A 4QXAA 2HLNA 4FQ8A 4GZ6A 1GNPA 1R8JA 3NHBA 4JVMA 4K7JA 3AIIA 1PO7A 3ETDA 7AT1A 2QVGA 4RMHA 1NNSA 5DI9A 3B6KA 3I8SA 5LZ4A 1CJBA 3TIGA 1ZGBA 4CM1A 2RHRA 4HS4A 4MWGA 2GT1A 4I4TF 1G8SA 4JEHA 2EWMA 2ZRQA 2C5EA 5CD9A 4OI4A 1I4EB 3EZXA 4RL4A 4AJKA 4C4TA 3KXPA 2V7TA 2FEWB 5D5HA 2YXDA 2M6SA 1EHCA 4EF6A 1EEHA 2JCGA 3GRFA 5KNDA 5FF9A 3IE1A 4IJUA 3OICA 2ZBEA 1JLKA 2PX0A 4ZCPA 1X7GA 1YR7A 3LUCA 1QHGA 4OHWA 1FJXA 2O2XA 4EJSA 5U4QA 1C4WA 1ML4A 1TU0A 4QDXA 1P6UA 1QX4A 1Z5GA 4MYHA 5KYTA 4LK3A 5HFAA 2ZSDA 2A0KA 3TNLA 1F0KA 4K05A 2PRSA 2QORA 1W9MA 4JN6B 4YLEA 2DQSA 3NHLA 3UJ3X 3VU1A 1ZI9A 3DMRA 2SICE 3NZEA 1YL7A 1VOTA 4GPIB 3T0IA 3VM6A 5EVCA 3RM3A 2AX3A 2XDYA 4Y2UA 3A10A 5JI3E 2R97A 3NIFB 3WK4A 4BU0A 3ER8A 2I91A 1YS9A 3W5HA 2C96A 4K26A 2V7EA 3ZV4A 4D0GA 1T5DX 3UNXA 5JSZA 1B2RA 1KY5A 4OGKA 4J1QA 3FG9A 3C1TA 5BR4A 1M34B 4DA4A 4UHEA 3HU2A 2J4DA 4L5BA 4YYZA 3PTAA 2O2CA 3RRFA 2Q3FA 1Z56C 3T4UA 1Z0ZA 4PZUA 5DXAA 3ZOZA 1NE2A 1XZGA 3RLFA 4XDYA 1JDVA 1R9GA 4C0HA 3EBPA 1BXGB 1RAEA 2E89A 3AFOA 4R41A 5KOHA 2ZTUA 4MYUA 5JDCA 1L5YA 4FWTA 4Y2QA 4KQ6A 4M8KA 2CF5A 4GKKB 3D2AA 3IA7A 4KYIB 5AHWA 3DL0A 1TYEB 2A67A 3KJNA 4JC5A 5JMWA 5KDOA 1QFXA 4IHJA 3ZU6A 4FFWA 2DFKB 1G4HA 2GK6A 4B09A 2F4VB 1LI7A 1WOMA 3SG0A 1QQ6A 2CCGA 1JRLA 4HAWA 5REQA 4DLWA 4AZ0B 1PFQA 3HCWA 1WSDA 2B6NA 3H2SA 3H4IA 1K75A 1YASA 3AFGA 5LDDC 2QXYA 1WNTA 3F7NA 4GI1A 1H9AA 1B8NA 5CGQB 1B76A 3U4DA 2ZJ3A 2CNLA 2HW8A 3TOXA 1B1AA 1GPUA 3T7AA 3TCKA 2GD6A 3TIFA 1GVNB 4PRZA 5C4IA 1AXGA 2CKDA 1HTBA 2PH3A 3D31A 1WVIA 2PL9A 5A4KA 1UP4A 4WFKA 2ORED 3CH5A 4GPEA 3RVNA 1M1UA 1U2GA 2Y2UA 3AILA 3HKEB 2WWVD 5M34A 1X92A 3NHWA 3F5DA 4FWBA 2PN1A 3I2HA 3FMPB 4BJ5A 2XUZA 3DA8A 2VWQA 4BO1A 4F6CA 5C0OE 1NRJB 4BQOA 3FUTA 1YQ9A 4JIMA 3A6GA 2FWBA 2FDXA 4QGGA 2GEDA 3SC6A 4MV5A 3IT1A 4I2NA 1HOXA 4PX3A 1CU1A 3CLVA 3UPDA 1JIXA 1ZH8A 2FF5A 4F72A 1QOPB 1C30A 3Q2KA 1MTZA 2FNAA 1NI3A 2Q4BA 5F5NA 2NM0A 3C5HA 1EINA 2G17A 4FMDF 1QH8B 3EE6A 1NYLA 2IHJA 4FMPA 3GARA 3DAHA 1OZFA 1N6IA 1R18A 2WSBA 3EFOA 5FFMA 2HSDA 2I4TA 3EIHA 1KEUA 3A9WA 5T3UA 1KH3A 4BEWA 5ALUA 5E2IA 2I6TA 2IYZA 2PEYA 3HKCB 1AKWA 1FFWA 1UDWA 1MOZA 2JLCA 3TD6A 1CUIA 2GWRA 1U0LA 1CY4A 2BTOA 3NHFA 3TZBA 1K3UB 1RYNA 3ETGA 5JY1A 1AGNA 1W59A 3HFGA 3GLFA 2OCYC 4NJOA 1YOVA 2JFPA 4D44A 1VQ1A 3K32A 4RDXA 4E5MA 1ONNA 2RI1A 4Q9JA 3QPAA 2AG6A 3N6VA 2CN1A 1FDTA 4FXOA 4HGYA 4ZXFA 1ZC4A 3T5BA 1HA3A 4EJSB 3IO5A 4C01A 2NG1A 3G5LA 2BUBA 4EB3A 4QQ8A 2BUCA 2NUAA 1QTQA 5C34B 3AG5A 3JQQA 4LE1A 4RD4A 5K3AA 1KWGA 1LD3A 2JJQA 2O4UX 1NNUA 1DO8A 3N2GB 4NP6A 4L3WA 2CT8A 3ZDCA 1F48A 3OWOA 4DADA 2G5CA 3IBGA 4MA0A 2Q1XA 2DB3A 1FDUA 1RWKA 4P92A 2ZTLA 1K06A 4V38A 5LR6A 3G2NA 3CA8A 4UNNA 5L45A 4BB5A 5EZYA 3BH7A 4PLYA 4R01A 5BNFA 2WHXA 5E0KB 3D4PA 3Q10A 3NHRA 4QBGB 1VBFA 4BVHA 4DQ0A 3LGXA 2YXEA 2AXEA 3EWAA 1IPFA 3P71T 3GFSA 3QXHA 5JQGF 1C3VA 1C7FA 3VYWA 3DLTA 2PSEA 4FOSA 4LF9B 2IE8A 5COBA 1DP4A 5SICE 4V0OA 2Z4RA 3EG9A 4XUGB 1OFVA 1G2IA 4DARA 1RM5A 1VXRA 1LBHA 2LE0A 3T0FA 5KOHB 4HDMA 1GZ7A 3E82A 3U3DA 3A6JA 1XRPA 1JPJA 1NTOA 4AN1A 2ZBPA 4XR9A 3E22B 1N8SA 5AHOA 4S0ZA 4G4IA 4NYIQ 1ZGJA 1SXJC 1YC5A 3JYOA 2BJHA 4IHJB 1VPDA 1BZYA 2I2BA 2LCFA 3EFHA 3FNFA 3VR4H 4CJXA 1G5HA 1CUXA 1KDRA 1PEDA 1DIGA 2EZUA 3BMQA 4FLFA 2WU0A 4IHAA 4KI7A 2IX3A 3O47A 2D2IA 1RQXA 5REQB 4ML3A 2A8YA 2P2NA 3GOQA 1UDXA 4BCCA 1JIIA 2X8JA 4JFAA 4ZOBA 5K6AC 1VYVA 2WTUA 1UZLA 2WIDA 3HDQA 5DFAA 4JWTA 2ZVPX 3RTEA 2K7ZA 1U5AA 3IJEB 2RHJA 3LBHA 821PA 2RGUA 3IULA 3MIIA 3AHIA 3NIDB 1QOZA 4FYJA 5BQPA 2VQFB 3KZMA 2BGUA 4TQ9A 3OCWA 4W9NA 1HMYA 3C0KA 2BM9A 2VK8A 5T7BA 2OHVA 2A0YA 5KINB 5B12A 2EKPA 5HP4A 4D82A 1VIVA 2BFDA 2ACEA 2FUEA 1G5QA 2FRVA 4JJKA 4I6GA 2GTHA 4EP1A 3WIEA 3WLIA 4CWAA 3OE4A 2O2EA 1QK5A 1XMQB 3TBFA 2QVCA 2EU8A 2JI4A 2QYSA 2WKSA 1RLTA 4MDFA 3K96A 5BMOA 5L7WA 4HAIA 2RH9B 1THMA 1SGWA 2P5UA 4GR4A 3EA0A 1NQTA 4M38A 4F3KA 1OH7A 1NVMB 1A88A 1FQKA 4LVNA 3JQ7A 5EMNA 2GARA 1GQSA 4KL8S 5HE9A 1GCGA 4HQFA 2BZSA 1T24A 3B12A 4DLZA 3P0EA 2HHHB 2OQRA 1C30B 2YICA 1KJIA 1LSSA 1ZN2A 1U1EA 2XRZA 1VJGA 4N5HX 4WPGA 5ICMA 2FN8A 2J0VA 3IQIX 5JPIA 3ZGXA 5IT5A 1UPTA 1K8RA 4F85A 5JR3A 3CX7A 2Q8PA 3GA5A 2ZBUA 3EFOB 1YUMA 3ONDA 1VHTA 2X3UA 5KNBD 1PW5A 2IUTA 3STXA 3AIKA 5CT4A 3CINA 2V1UA 3B2EA 5JFGA 4RTOA 3M4JA 1PV1A 3KE8A 3NHUA 1XCGB 3W7BA 3GLFB 2BY4A 3AY7A 4R2HA 1YOVB 4QVIA 4GI3A 3WXMA 1INLA 1DAGA 4JX9A 4N82A 5M2QA 3QFTA 1A1SA 5HA5A 3HBJA 3GRKA 1JQAA 1SUPA 2GNAA 4IJMA 3AR5A 1HYHA 4GOKA 4LAFA 2Q3MA 2IXFA 1PK7A 4PIMA 4UUOA 4UZFA 3QLVC 3PUZA 3DHNA 4MV7A 3SC3A 2XMSA 1I3NA 4JXJA 3PF8A 2H8GA 4JI4B 4U7WA 1AU9A 1E3DA 1E96A 1XF9A 3N70A 5CHEA 4ZHQA 1XIVA 3KXLA 2EKZA 1NMZA 4H0CA 4XB6B 3A6HA 5K2MA 4OI2A 4EB0A 3LGSA 6YASA 1SG9A 4E22A 1B3BA 5HWSA 5EZYB 1BCSA 1VJTA 4N49A 1KERA 4L74A 2OHFA 5KC9A 1HE1C 1W0JD 3CFYA 5AICA 2FSIA 5AUQA 1XVIA 2YJGA 4MKGA 1T8YA 2Q3EA 3Q7RA 4Q12A 5KVCA 3OF5A 1BE1A 4WVFA 1DWUA 4EMUA 3KVOA 1PFKA 2ZXFA 3F6PA 2EIXA 4RZHA 4UARA 4CG0A 2ZYSA 4D4MA 1O95D 1VE5A 4OHRA 4K6GA 3LVRE 4V0NA 1XI2A 4NBTA 1N5KA 4AS2A 1ZS9A 3MJCA 3LYHA 1GXSB 2IYXA 5IVIA 2YJZA 4LRSB 4DMGA 8LDHA 3CR7A 4O4JF 1H9CA 4FYMA 1ICEA 1GRVA 3NAMA 4LF8B 2WM2A 3R3YA 3PC7A 4R1TA 2JH8A 4CDMA 3INYA 4DMCA 5LNK6 1D2AA 3NNSA 2EP7A 4M60A 3BMQB 1ZBQA 2CXOA 3ZLBA 1Z5PA 3JASA 3R7AA 2XW6A 4ZT2A 5KWVA 6AT1A 1LDEA 4ZYZA 1E1KA 3K9HA 2X8JB 3L7IA 4Q9KA 1K66A 4Y2JA 1TF2A 3B38A 4BJ1A 4TV8B 4X3CA 5EGNA 4F3RA 3BK1A 1EE9A 2XOXA 2O6HA 3FPLA 4HZIA 4YRSA 4NCKA 1U3WA 3ADBA 5E7MA 4QGFA 4JKYA 2N3ZA 2ATEA 3LRXA 4Y6GB 4EF5A 2P2ZA 4KWCA 3T5PA 2C4NA 2X1LA 1IG0A 4AN0A 3L4BA 4BVGA 1OFTA 3U4HA 2W90A 1ISGA 2PWAA 4EFMA 4MUEA 2BFDB 1M2KA 2D5IA 1AS2A 2QQEA 4JUIA 1UBCA 4KODA 4A4DA 4E1BA 3KR2A 3USES 5GZ1A 4D96A 1KI3A 1NRXA 1VMDA 3UUGA 2E87A 3TEJA 4G0UA 4N1AA 2QGNA 1X3SA 5FA8A 1KSJA 4YDQA 1KTVA 2DWCA 2IH4A 3F71A 2H18A 5IAEA 2XTMA 1CV2A 4BDTA 2OLEA 3C3MA 1F0YA 4H6WA 5C80A 4IQFA 2IU0A 3R5FA 1UOEA 1W0JA 3JQ7B 3Q5DA 3NTQA 1KORA 3VU3A 4E31A 5HVNA 3MHTA 3MCZA 3VR5D 5JJLA 1J2UA 1GU1A 3BMCB 2NGRA 5DHSA 4Z2YA 4BX2A 1Z4NA 2G1JA 1RWBA 1HFEL 5A9TA 2F6RA 5SZKB 4A7PA 3DZFA 3KUCA 3KZNA 4WWHA 2V58A 1NMEA 2XV1A 4RJIA 5DLQC 1O95A 3ISTA 2PJZA 4M46A 4L15A 1XL1A 3IKMB 2ZUVA 2AF4C 1A0OA 1H0KA 2KM1A 1M83A 5ENDA 2GKGA 3VI3B 4CQLB 4D9NA 4COKA 1GGJA 1N34B 1FC0A 1VYHA 2BGJA 2O48X 4KDEA 3L1JA 2HPAA 2RK4A 4PIPA 3QXCA 2PRKA 1HWYA 4GM0A 4RY2A 2ORYA 1LTQA 2J3QA 4NZZA 5JBNA 5AIAA 4HAZA 1UXHA 4AYXA 2FPWA 1AA6A 4PM4A 2H4FA 3PFWO 2P6PA 1NA5A 2HM7A 2OFPA 4OV6B 1F9AA 4WY5A 4WZBE 1RYFA 1RBMA 2CD7A 3GU3A 3ZLTA 1QCCA 3F74A 3ROZA 2X0EA 5HGJA 3TLGA 2UZ1B 3FY4A 5TS3A 4KO1S 4TKVB 2DBQA 2FMFA 5JT1A 2YX1A 1V2GA 4ZHQB 2ZDHA 4KUEA 4NQRA 4P5EA 1AG9A 1F8YA 2VHEA 3OJCA 1LH0A 3ZHQA 4F12A 4AI6A 4IGFA 2C0PA 4C30A 3EISA 1YZHA 1BCSB 1IHDA 1Z2PX 2VDQB 3HYLA 5B3LA 3CZMA 4DNFA 4KIUA 1WE2A 3M4ZA 1J90A 4BQNA 2GFIA 1E4EA 1V1MA 2G9VA 1NP3A 3B1FA 1VHQA 3CBGA 4GMHA 4TZ0A 2EARA 2YJNA 4TTAA 1AVTA 1N6LA 3JD4A 2BBSA 3CLUD 1QRAA 5IG2A 5A3SA 2BWJA 3VNBA 2R1ZA 3BRQA 3L6BA 2FMIA 4KQ1A 2RH8A 2EX0A 2ZPUA 3JSAA 1UJ4A 1IMOA 2W2OA 3KSRA 1TRKA 1N1DA 3DV2A 4C4OA 4M0EA 3LNTA 4Z4QA 3VR5A 4EY6A 1KI7A 3CRW1 4EQ6A 3RROA 4R68A 4EW1A 1U2QA 3P45A 1I1NA 10MHA 4DNPA 1XRLA 1KO8A 2FP3A 1L5SA 2GX6A 3F8TA 4K86A 3UWSA 2NVUA 4JC8A 3QBJA 4EIWA 5JWOA 3ESZA 2F8LA 3V1MA 4EARA 5AVQA 1TPZA 3P9NA 4XDGA 4ND3A 4P6VF 5FUYA 1GV1A 3GLSA 2CVQA 1DPGA 2Q2QA 4W5QA 1AV7A 3IERA 3L1KA 4RVFA 5FEMA 3SOPA 3JASB 3NDIA 1QORA 1WZEA 2IHYA 4K6KA 4TXMA 1DDIA 5AM2A 1Z18A 1WR8A 4G01B 2ZBGA 2BMFA 3F1LA 4L5YA 5B3AA 4LDZA 3STVA 3L6EA 4HNTA 3H11A 4OI1A 3AJAA 3LQYA 3B5IA 1NC1A 3JWEA 2AUTA 3DZHA 2V03A 2ZU6A 4PEVA 4IOMA 2ZTHA 5G0UA 3W8RA 1NI4A 4J75A 1XTKA 5DLYA 2QRZA 1XD2A 2RGNC 4JI6B 4B2PA 1DX6A 2QVXX 3MCUA 3CVJA 3NH6A 4WASA 5ICFA 2ABWA 2J5KA 3P1JA 3QE2A 1ISIA 4GOJA 1IUOA 3R9WA 2I7XA 3FZYA 4E13A 4K46A 1YA8A 4MJ3A 4OHYA 3C7AA 2G09A 5EC8A 1YDEA 3V1LA 3TE7A 1T6BY 3TI9A 1IZ8A 2VJPA 2DR3A 3NRCA 3WHIA 1VP3A 2COUA 4BVAA 4TYNA 1N5MA 2ZR8A 2B2NA 3R20A 1DWPA 2G1KA 2QIOA 4UBNA 5H4HA 5A04A 4V03A 2PA3A 5ALNA 1QOQB 5DGTA 1SVSA 1T0HB 2GZRA 1U2SA 3KKEA 3FJYA 4P7GA 5I3CA 5BSFA 1E2LA 3RARA 2OY0A 4B80A 4RJJA 1D5WA 1CUCA 4L4UA 3IS3A 2VQEB 5DGIA 2C7RA 4OB8A 2QQGA 5J43A 4RPCA 3KZCA 1OH8A 3PITA 4NPAA 1VMKA 3LNCA 3DWIA 3TSYA 3RV4A 3NPMA 4LN1A 5C52B 4QJIA 1QFMA 1SKAA 1Y4SA 1HUQA 2DOKA 4I1RA 5DV9A 1GEEA 1TVCA 2IS2A 2WKQA 3QYAA 3VNSA 4KXFB 2C5BA 4B87A 2JFOA 4WW0A 1R6DA 1SUAA 2A92A 1E3WA 1TTPB 1HNNA 1AX9A 4G0WA 4F46A 3VO8A 2PX3A 2R1UA 4LOIA 3PV0A 1PQYA 2VXBA 4C7OA 1ECFA 5DM70 3ABRB 3T4EA 1UXJA 3NHAA 5ICSA 4MV6A 2C7VA 2BONA 4BKUA 4MB2A 1EU1A 1OROA 4HH0A 3GFGA 2ZE8A 4XGKA 5CK4A 2ZUCA 5CDFA 4LGVA 3ROEA 1OGYA 1LLUA 3Q9SA 5CM9C 3TLGB 2J9GA 2C7GA 1PHPA 3QFSA 4NOKA 1L7XA 3WHPA 2QHXA 4RF3A 1Z68A 4N5DA 3VTFA 2IP2A 4G56A 3WMFA 4C5CA 3LBNA 2D2XA 2IDZA 4RWEA 4DMHA 4EYKA 3IEVA 3FETA 2QMEA 3EIOA 2AXQA 3HB1A 2CVPA 5F76A 1F7UA 3MUEA 5FPTA 4FPXA 4HP8A 4MVYA 1KBOA 4ZYXA 1A5AB 1YRBA 1Z16A 4KNWA 5DH9A 3RRZA 3OSUA 4RANA 1YSCA 3BWEA 4MUFA 2QGZA 4MUBA 2ZYWX 3I5UA 4MVXA 1DARA 5TC4A 3WLTA 1R4NA 5K99A 3K15A 1GFWA 4HDQB 1EA7A 2M1ZA 2XJ9A 3AUYA 3QPBA 1PD1A 2IYRA 3N8GA 5K4HA 1Q16A 1KI9A 3SSAA 4QUGA 3NWOA 1OYWA 1Z83A 3QSYA 3PXGA 3ZE8A 2I7TA 4OAPA 1FK8A 4FD2A 2XZDA 2OK8A 1SO8A 1VA4A 1YGYA 3FB4A 1BQ3A 3E5RA 3O2QB 2E3JA 2OV4A 4NMHA 5KCMA 3SZGA 4EQ6B 3E3AA 3GRUA 4F8EA 1AF7A 3WB1A 3DP9A 4NV0A 4Y98A 4BN4A 1Z0SA 3LHFA 2NVUB 5KYXB 1TI7A 3EQ2A 4OYHA 1VIYA 3FYHA 1BH6A 4ZARA 2A1UA 2OK7A 5DNCA 1EUYA 4RZ2A 4IL5A 5D7NA 3RU9A 1JF8A 1W75A 2IRWA 4I46A 3QKIA 4LDQA 1B8UA 3KR0A 2DBRA 3QUTA 5F5XA 8ADHA 4Y6QA 2QUAA 1GUAA 1YRLA 2I7CA 3H11B 1RXWA 2CMHA 1XEWX 4MI3A 1T6YA 1KZ7B 3VHXA 1P77A 4YC7A 2ZJ1A 3GFOA 4UM9D 1NI4B 3SSOA 2CLHB 1IB6A 4Q24A 1XD2B 4UCWA 4ZVNA 1BA3A 3SWWA 3PWTA 4QDOA 3BC1A 3R1IA 2C9DA 5K5EA 3V34A 2G40A 2FPOA 3U7FB 16PKA 2WUFA 3LO5A 2JI7A 2WINI 5A5FA 1LPOA 4RVUA 1NULA 4U2BA 3T7DA 3ZDFA 3W2IA 1T15A 4YRDA 2ERXA 2QG6A 1GTRA 2ES4A 4MB6A 3R7FA 4BZZA 1XLVA 2IOHA 3CJQA 4GDMA 1EFAA 5GIOE 1C3EA 3UKJA 2D7DA 4GMKA 4BNXA 2HRCA 2VCYA 1IQUA 3UMBA 3MUFA 5M04A 1V41E 3ZTYA 2DTDA 1QG2A 3SZOA 5C8YA 4DC1A 5LMNB 4KMOA 1CDEA 3KOUA 3PSAA 4YRCA 3WQHA 3MT0A 3GRPA 3OEED 1KYVA 1VL5A 1U5CA 4JLSA 1WKBA 3COSA 1JXQA 4FMCB 2RGCA 4IIVA 3EXHC 1RPZA 3QENA 2P3QA 2WIGA 2XX3A 3BZBA 1KVQA 2Z1NA 3GEBA 4Z9YA 1GUZA 3QLJA 2FPGB 2O0LA 4CLRA 4LQLA 3GO4A 1FXWF 3D9QX 3LT4A 4TYQA 5ALXA 2YWGA 4CF5A 4EYSA 3B89A 5K51A 3R7DA 2CMGA 4KDRA 1E3WB 2O1WA 5CT5A 3DOEA 1NMQA 1GR0A 5CHYA 2D3WA 1E7MA 4DN6A 1NBOA 4J29A 3TKYA 1Z6GA 4OHUA 2WHYA 4DLKA 3IPLA 4JBLA 2JHPA 3OOEA 1GGMA 4D4LA 4KO4S 1BVYF 1G5FA 2AMLA 2AA3A 4KRFA 2XUJA 1ZRHA 3SVZA 1ZMXA 3LG2A 2Q4OA 3IP7A 4IDHA 2E4YA 2PUFA 1PZEA 1NDQA 2XE8A 5E4JA 4MJLA 1VJCA 1XPUA 4Q3OA 1QHIA 2DPYA 2C2MA 2ZUBA 3P2OA 3A0RB 1GYRA 1R0YA 3RUCA 3ZCPA 2WV7A 1U0EA 1BVRA 4YMIA 3V48A 4EATA 3RSCA 2BFPA 3MHPA 3HM9A 2P69A 1NKSA 1T9AA 3QG5A 1JSXA 1RRFA 4KPGA 4RGVA 4BV2A 3BEDA 3L9XA 2EJUA 2A78A 1HFJA 1DZIA 3HADA 4YRIA 1FQWA 1OLXB 1D4AA 5BWNA 4ICIA 3BWXA 4MKIA 1LK0A 4K1XA 5T8KA 1R4NB 1XXLA 1DLIA 1FMCA 2XA9A 2Y9PB 3ETHA 4WY8A 5DM4A 5FYQA 2HWWA 4CLEA 3PXCX 4GOXA 2JRCA 1RI4A 3CNBA 4L75A 5D00A 3S1LA 5I7WA 5HX7A 5HXAA 1OBCA 3BORA 2ISCA 2Q6TA 2R8ZA 2Y1DA 4J6FA 1DT5A 3LPNA 4IYRA 4YRJA 4BRWA 4R0MA 5JMOA 5ITVA 1X94A 2Q46A 4HDRB 2YJ5A 3F4KA 3H1BA 1CCWA 3OEEA 5FI0B 1J06A 1IY0A 2NUBA 3GZTB 2BKEA 3UJAA 5JVDB 3ZS9A 3ZYZA 2IF2A 3BH0A 2PS9A 2DHCA 1OH6A 4KLZA 1KEEA 3KALA 3PZBA 2UVDA 5IBCA 2ODBA 1G2OA 2QI9F 5KVVA 3TUZC 3G5TA 1ZGAA 2A1UB 4FGUA 2XD9A 5K8UA 3VZCA 1F8UA 2IYTA 2ZSIA 1SQSA 1HEYA 2GVNA 4MK4A 4DCMA 2D0PB 4HWSA 4LGMA 1SUWA 3R3WA 2YMPA 1Q15A 1UBNA 5CM2Z 4D41A 1H6CA 2BFBB 2EGGA 2DCUA 3EDQA 4D56A 1BKSB 5LYJF 1GZHB 2XEDA 3FR8A 3A4NA 3C7CB 3M6IA 3TUIC 1JA1A 3DFIA 2EAUA 1JLLA 2CLFB 4B2IA 1Y8RA 3HE3A 3B6ZA 4CMBA 2MYTA 2L0XA 1XD9A 1K4MA 2X0KA 1ZEJA 1VL0A 3BTOA 3DGEC 3IUEA 3KKPA 3MBKA 4FEEA 4HXGA 1KK2A 4NBRA 3J81A 5JFTA 3LLMA 3M34A 2IPMA 3OLZA 4CQJA 3CN7A 4IDEA 1ULHA 5JZMA 3M6FA 3U80A 4DCPA 2R62A 1GPKA 3CXUA 3EXIA 3JTEA 4FT4A 1SB8A 3E1SA 4KMSA 2J09A 3TTYA 4P0TA 5JXJA 2AN3A 3DFZA 2H2HA 1YTUA 4DS3A 2W8BB 3PCXA 1RI3A 1TEZA 5DNYB 3QVXA 5IXJA 1QVVA 1LCIA 1C1HA 3MN1A 3K4PA 5AKLA 1L7NA 4B6PA 2QTWB 1T9GR 2V3WA 3D3EA 4L0QA 2PMBA 5IJ0A 2P77A 3W5JA 2WWHA 1JG7A 2C3PA 2ODTX 1VCOA 3QA3E 1LTHR 3U44A 4MVJG 5AO9A 1RU3A 2WNSA 3SEFA 1OXVA 2OILA 5AVTA 1TM2A 2A58A 3MWEA 1JVBA 1B8OA 1PLLA 4ITVA 1PFWA 5AW0A 1KKMA 3ECAA 2NAPA 1RQLA 2D5AA 3JX9A 5HR5A 2BFFA 2RC6A 3VAZA 5A2QA 1OHHD 1XZHA 4WZZA 1Y4UA 1TUBA 4FEAA 3TZLA 4F9GA 1ZG3A 4KGZA 4PR3A 4QU8A 2FW1A 4Z9AA 4QSHA 3OPVA 2BKXA 3TB6A 2PAAA 5H16A 4YGXB 4EY3A 3OZAA 3BRCA 3LC1O 2AEMA 5KWSA 2XXJA 4E6PA 3FTQA 4LNHA 1GRCA 1X7YA 2DFVA 4IKPA 3ANYB 5ADUS 2RHDA 1RADA 4G5HA 4K28A 3GRAA 1SK9A 3OIGA 4FFBA 4P38A 4D5EA 4IYJA 5IC5A 2UZ3A 4UM9B 1JHPA 1G18A 1Y33E 1QHNA 2VXOA 4LC0A 1ZHHA 4N7BA 1SCUA 4CL0A 5FB3A 9ABPA 5JBIA 3UPTA 5CW1A 1CQJB 4WN3A 5IYZF 1I3OA 3EIWA 4NCXA 3QPVA 3HZZA 1I3CA 4YCLA 5AOAA 5LXTF 2HT1A 4KFUA 1B3RA 3FOCA 5ERXA 3I5XA 2ODEA 3DO5A 4OM8A 3T7RA 3DWEX 2YQ5A 1CR4A 1NLYA 5EJFA 3CM0A 3ZX4A 4M4SA 3EJWA 3PEFA 1IIBA 1JQ3A 3MOGA 1T9GS 3S8MA 1AHPA 3Q8XB 1N4AA 4Z53A 2JW5A 1XROA 2YXBA 1GG2A 4EH1A 4HQNA 3L77A 1ISFA 1S89A 2P9CA 1V8DA 3UCEA 2C3OA 5BT9A 4DIEA 2VTKA 1QZTA 5JAIA 1V5IA 3GQVA 5A0TA 4OMCA 3O8LA 4XLLA 4DXDA 2CDBA 1QLWA 1ZNXA 4WXYB 4ITUA 1AHHA 3NG1A 3BBLA 3FKQA 2VF4X 3PEVA 4LOLA 5KDLA 2JGNA 5HCUA 3B7GA 3ILSA 5C32A 2QTTA 4PPGA 1X8LA 1TGYA 1EJ6A 2C8JA 2CZCA 3CKYA 4TTJA 3T1OA 4BATA 4MINA 2FSSA 3V4ZA 1C0IA 1BDHA 1PT7A 4YONB 4YCMA 1TZJA 5ER6A 3GP5A 1IH8A 4RDCA 5IJ9A 1K3FA 3E1GA 4GICA 3HO1A 3T1TA 3QYJA 1S8FA 3ZWQA 1OHHA 1H22A 4HMQA 1ULAA 2J4FA 2OO7A 4I5FA 2B1GA 5FBRB 2O2JA 3AHFA 1USVA 5ARBA 2C97A 2GPNA 3ZBQA 4LFCB 5C8ZA 1W44A 2Q7XA 4H0FA 4IFEA 2G9ZA 4WAUA 1JLLB 5F9HA 1PSWA 1P5FA 3BD8A 2FEKA 2R6AA 3A3PA 1S8NA 3CQ9A 3JD2A 5TS2A 3GMIA 4B47A 4E5UA 1SOMA 4KXMA 1KJNA 2FQWA 2MSEB 2IEAA 2HK8A 1CIPA 3ROTA 3NVMB 2HB6A 1RQ7A 1MNAA 2OUKA 4F4UA 4Z5XA 4LE2A 3NKLA 1YFZA 3FI0A 5HK8A 3KZ1E 2VTVA 2J3DA 2XQKA 4R8MA 4E7OA 2QUHA 4PZAA 4R69A 3HJBA 4M99A 4PGMA 4RSGA 5FWYA 4PSDA 3SI7A 4Q21A 5IWAB 3I5YA 2POCA 2JCXA 3D8HA 4P36A 5JWHA 1K9SA 3FFTA 4G97A 3WDSA 5C7LO 4M1SA 1EFLA 4W7SA 4KN5A 2HFJA 4AJ9A 2CBZA 2VHYA 2H06A 3DZJA 4U0JA 1O0CA 2JLBA 1JHOA 1MHPA 2YV1A 4IRMA 3SLGA 2XMCA 1GFIA 4KEAA 3WA6A 4DV2B 1GZ5A 3LVBA 2NW6A 1UZAA 1RRVA 1CF9A 1JIVA 3OUUA 2HO4A 4MWEA 4RCVA 3PHIA 4M37A 3EVAA 4RA6A 4DAEA 4GO1A 4ER5A 1Q57A 2VJNA 3ROXA 2BFFB 2BM0A 2I99A 3IAEA 4Q34A 5DSZA 4EG8A 2Z5GA 1I4OA 1MJFA 3SBXA 4MW1A 4DMFA 3ZK9A 4JYMA 4KDFA 4BFTA 4KUGA 2CSUA 1ZMBA 3HDTA 4IXMA 1XDGA 2JFWA 5K3EA 1KVTA 1CJCA 1VG9B 3TZEA 5KNCH 2J0SA 4YXWD 3MFYA 4DDTA 2ORIA 3P97A 5BW4A 3HKBB 1JEDA 4DUZB 2VYFA 1X7YB 4D6PA 2M32A 2PSJA 1GAEO 4KYUA 4RIGA 4TL7A 2XEXA 3HCRA 4FFBB 4WEOA 2P67A 5DNDA 4KSBA 1PFUA 4BKOA 4Q39A 5FPSA 3U6BA 3T9CA 2CXUA 3AUAA 3DP7A 4LKRA 5CCEA 4FILA 1AT1A 4YRBA 3E2PA 3A04A 3WO0A 4BLTA 1GZUA 2GZHA 4TTTS 1VIAA 3NKFA 2CLEB 3GZJA 2H7XA 4UCQA 3TLAA 1BMDA 4DWJA 5K03A 4QSMA 4V0ME 4OX9Y 4V24A 1L9XA 2AG1A 4F84A 1JXAA 1XQ9A 3AF5A 3PR2B 3PTLA 3SS9X 3CKLA 2RJOA 2ERYA 5KCZA 1XLUA 2C9ZA 3WR5A 4ZMSA 3ZWDA 2OCKA 4L51A 3QJYA 4RYLA 1GQQA 2B4QA 4INZA 3U9TA 5F3RA 1DV2A 1U11A 2YKGA 1L8XA 5IBQA 1YB1A 4LY0A 4BLUA 5IVKA 1J8FA 1SC4A 2ZR0A 2CJFA 4UCFA 2QTBA 1E1CA 4GPTA 3EEYA 1US8A 4WADA 1JQLB 2A9VA 7GPBA 3C3YA 3D0RA 2G76A 1E18A 4FNOA 4B81A 1NW8A 1WLYA 2R2AA 3FCSB 3H9UA 5JD4A 1C0KA 1AO3A 3BJRA 1X77A 2OESA 3KDSE 1GNLA 4RETA 3OPMA 4JJEA 3TLCA 3DB1A 4YRZA 3I01M 2Q3JA 2OQIA 2YZKA 4ZYYA 2H4ZA 1XB2A 2WWIA 3SBEA 4BDSA 4C6HA 5IJ9B 4FCVA 1OXXK 2O2YA 5C3MA 4FE7A 2IXTA 4W99A 4WLEA 4I14A 1DEAA 4AY5A 3AONB 1UM9A 2H1RA 2JFYA 1H1LA 1VCIA 2FPXA 4GH5A 1Z4LA 3D8NA 2WSSD 3O94A 4R9RA 1K0UA 1XX6A 3UGTA 1J8YF 2BZ1A 2EQ5A 3NEJA 1H2ZA 3THXA 3AVYA 3ZHUA 5T3YA 3OCVA 4YXFA 1CEEA 1AF4A 5AK0A 4HQ6A 4ZVUA 4YXWA 2O1EA 2CXPA 1KHTA 1XMVA 3EEFA 2J1LA 3QH4A 3IOEA 1CUJA 4FBLA 4KV7A 4ROSA 5F1PA 5FA5A 1JDBC 2CDCA 2J6CA 3EARA 3L7DA 5ALSA 3RU2A 4EHDA 4A91A 2A5YB 5AOBA 3A9TA 4BLOA 1T8TA 5FUQA 4IR7A 2EERA 4H3SA 4X63A 3VVLA 4ARAA 2I71A 2DY0A 3RJZA 2H59A 5KJCA 4LFBB 4JY7A 3MIZA 1VDZA 1BYIA 4DIKA 2BGIA 5FWYB 1XTJA 3P2JA 1K6EA 4AT1A 3MLEA 2CSXA 2EKBA 2PWBA 3I6YA 1PDOA 2R86A 3V1KA 1SXJD 1Q91A 2JBAA 4J4HA 4U7TB 5IDVA 4BOYA 3IELA 3L8GA 5ILOA 2FW9A 5D6OA 4CR8A 2P4QA 3D1LA 3B70A 1P60A 2WFAA 2JLWA 3MXOA 3AKCA 5FDFA 4FMDB 4DDHA 2Y8EA 3G0GA 2O8FB 4CTJA 1SC3A 2GYUA 1PW7A 3VR1A 1HETA 3DT8A 2Z95A 4WLNA 2WIAA 2PUHA 3PX7A 1GEGA 4LDPA 1U8ZA 1T5OA 1Y5LA 1GGEA 2FSPA 1OXTA 2K6GA 5AP9A 5HZHA 1VBNA 1TA4A 3GJ5A 1YBAA 3H8WA 4QTUB 1FS6A 4ND8A 3BQ9A 3ZR4B 4KQGA 4DSOA 5CB4F 5FTMA 4QHYA 1EUDA 5ALMA 3HEAA 5F98A 4QICA 3SYRA 1IEVA 3V4OA 5IS2A 1MIOA 2W2KA 1H2XA 4DQXA 3BWYA 3IIKA 4AC9A 4PQYA 1WPGA 3CJRA 1MRSA 2G0NA 4P7KA 4ENWA 3EDOA 2BE7A 2C03A 5LA6B 4U5QA 5CW2A 2XNSA 1P29A 1RHJA 2FUG1 2WSSA 3A37A 3P0IA 4URWR 1UPXA 5LBIA 4B3IA 4YRMA 2O7RA 1PNRA 1J2YA 1SFRA 4P7FA 1E99A 2VJAA 1B16A 3BHNA 4KQMA 4HQOA 4WECA 3DE3X 3GGCA 3GJXC 1KY2A 1JL3A 2D06A 2A0WA 1YZFA 1TUEA 1LW6E 2JAOA 3FCCA 2CL6X 4G9GA 2YNMC 1SVIA 3SNKA 2RAVA 4C4YA 1GFSA 1QHXA 1L4FA 3OJXA 4CMAA 2FZ5A 2VHQA 1PZGA 3K7EA 1LBIA 3F8SA 3CN9A 3KJEA 4XIIA 1QGOA 2W42A 1YHZA 4YV2A 2H4HA 4LXQA 1DO2A 2VPIA 3PQ7A 1YZNA 4IF4A 2NV2B 1W36C 4KRXA 2PRJA 3WNVA 3GGGA 4UBJA 1M8PA 4EUNA 2UYQA 1WMFA 4C3UA 4EKNB 5AXDA 1SXJA 1ST2A 2WLSA 4HH3C 3HEMA 4EPXA 3RS8A 5L7YA 3AERA 2ODQA 2E18A 4O4JA 3GDFA 3OJEA 1A9YA 4GNRA 4OAQA 4O1HA 4E5NA 5CD1A 4TTSA 1S9DA 1T3LA 2GUWA 4WFIA 5A2GA 1DQSA 1LVHA 3G1TA 4XCXA 2PLNA 3F5FA 4KTTE 2WIBA 4KQFA 1XTTA 2P1DA 4KVZA 1GRRA 2IP4A 3VSDA 1MUUA 3ENWA 2D2EA 3LWDA 1RYYA 2ZJOA 1E5LA 3TLJA 3B1JA 5D86A 3KT8A 4UOQA 5IC4A 1P2FA 1XTRA 3GZ4A 5IASA 3TSAA 1H1LB 3DHYA 1FFSA 1O03A 2RAUA 2YOGA 3V8NA 4LVCA 5IK2D 2GR9A 2R1VA 1YIAA 4Z99A 4XYGA 5AI5A 2VDWB 4W8OA 5GIPE 2E85A 3TQQA 2Y0BA 1LDBA 1WD5A 1XVLA 5EPOA 3TBKA 4OB6A 1MJGA 2HK6A 3MNFA 3DDUA 1FU4A 3ZGZA 2BFCA 3S8EA 3EF1A 4N5IX 1U7WA 4JOSA 4OA8A 4ENUA 3VPFA 2FUCA 3ADPA 4BFUA 1RDFA 5C7IO 2HJ9A 4JQCA 3FGOA 2VS1A 1KS2A 5D8DA 1M1NA 1YBVA 2PH5A 4X60A 3MAJA 5B37A 1TK2A 3NXSA 1KETA 3WBJA 5CNJA 3AK4A 1CY2A 1YNOA 3R3XA 1N1EA 4Y0NA 3QHQA 3ACBA 1PJRA 3R4VA 5E3HA 2O8CB 1GHTA 3I9LA 3Q3EA 4UHBA 5KYNA 2IJGX 2IIQA 4YRNA 3URKA 2A7QA 1U7DA 2ZRCA 5AOCA 3IP8A 5EWMB 1JAZA 2WE8A 3QEJA 2MYUA 3B2QA 4HDKB 4KTVE 4ZZ3A 3N8IA 3DTVD 2BVNA 1Z2EA 5BNWA 1O8CA 1VLHA 5FOQA 2DPGA 3RVSA 5DLDA 3EPJA 3CZAA 1BDMA 1CC1S 4HSGA 4BE7B 1E3IA 3EYWA 2H16A 3QXJA 4H1UA 4WDRA 1VL6A 2WOJA 4DEVA 3TFOA 5IRCD 3JVVA 3H5VA 4RY0A 3ZWYA 4B3MB 1E2KA 1G8AA 1NLZA 2YYSA 2W6QA 1GGNA 5TGZA 2I4LA 1QU2A 1X6VA 4LMAA 13PKA 4N7JA 3KR1A 3LK6A 1WXDA 3IPCA 3TLBA 1MC5A 2NYAA 4DYVA 1KQGA 5T4EA 2OHIA 3MG9A 2P9BA 2IEDA 1KR2A 2K87A 2VOJA 3I6BA 4PCUA 3AOEC 5ITSA 2EVWX 1SHJA 2QUIA 2FPPB 2AN1A 3PRYA 1VL2A 2YVKA 4HAYA 3QE4A 4ND8B 5BRNA 3WFIA 5LKRA 1MGOA 4YJ3B 1E1MA 1EUDB 3RS9A 2X4LA 1J70A 5GMOA 1P1IA 4XX0A 4YAJA 1MIOB 1UDRA 2W2KB 3SR0A 4R1UA 4RU1A 3HJGA 4B2LA 5JROA 2BW0A 3NBXX 4OU5A 4P0QB 3HA2A 3H5RA 5BUQA 1Q0ZA 1TQ2A 2WICA 4MW5A 1RRCA 1SA0A 5E9JA 5IK2A 4DEXA 4ER7A 1PJQA 4NMMA 1A69A 1N6HA 1SUCA 1IY8A 3H0EA 1U8AA 4X94A 4BNFA 1GGKA 1NVTA 2VAMA 1L0BA 2WHPA 2MOKA 2ZCJA 5DOVA 4E14A 3LHSA 1NVGA 2X58A 1T2FA 1XHEA 4HLQB 2X9GA 1PJ3A 2PUJA 3G85A 3WGVA 2QM7A 2R0QC 1HNXB 1FFHA 4N0PA 2VUTA 5EESA 5C1BA 3SF8B 3WA7A 4IIGA 2GASA 1M2OA 1IY9A 2XQIA 1KC1A 3EWIA 2VNIA 3HDYA 4B3TB 5BP7A 4XW2A 2NPFA 2YVAA 1IK6A 2JPDA 1ZINA 1OFUX 2CMKA 2WFLA 3A6LA 1FRFS 4HG2A 4EKYA 1CZNA 3DZ8A 1UDAA 2NQ8A 1USGA 4GZLA 4HB2A 5DSTA 1CK4A 2ZU0C 2ZJBA 3ADKA 4A23A 5C8VA 3F6CA 2L18A 3KXKA 3MTAA 4ZU3A 1UKAA 1MAAA 2G67A 3DTVA 5BQXA 3AERB 2I54A 3FDFA 4O4JB 4TVBA 3C6YA 4R9NA 3HXMA 3TX2A 3PYMA 1OWNA 3U49A 4ND4A 2Q5EA 1OYYA 5BYKA 3WIUA 3PDWA 3TQHA 2XYHA 3BXEA 3PE4A 1QRRA 4HR7A 4YUYA 3SFVA 1MDFA 4AMBA 4HEQA 1IQ0A 4M2LA 3HNRA 4Q4HB 4DHEA 2NV6A 4X6LA 2C9OA 4QJ4A 2BGMA 4MXDA 1E63A 2VSOA 2GBCA 3ILYA 5IZCA 2XT9A 2BBWA 2R1VB 3B82A 4R81A 4JWKA 4U2GA 4UBMA 4HN4B 4GX0A 5JYCA 1Z13A 3PHCA 2WAAA 4OHFA 2B1JA 3RPEA 4QDKA 1OCEA 4NFLA 1K6MA 4MUAA 2ATCA 1YQGA 1DC5A 2YQ4A 2BFCB 3FM9A 4LSWA 3VR5H 5IDWA 3RYCA 1RYBA 4B75A 3COJA 4W1SA 3FUUA 2B4TO 3ANTA 4L4XA 4MAAA 4UVGA 1M9NA 1W49A 1F0NA 5JC1A 1YRAA 2OPBA 2HXYA 2WFZA 3HSKA 4UJ5A 4C7OB 3KQUA 3RG8A 3KHTA 1XXHE 4M9ZA 2NO9A 1CQPA 4N6GA 1OT3A 3P2EA 3DYBA 3E9ZA 4R16A 4RPIA 1MEJA 4N3CA 4RLQA 5H3CA 4TUYB 4PAGA 5E38A 4BO0A 4WBNF 3NWPA 1IAQA 2PZBA 2DECA 3ELUA 1YBHA 1BU8A 2BR3A 2V7XA 3WMWA 4BLQA 4HGZA 1KI1A 3BM5A 4GL2A 3DUFA 3QWIA 3UK0A 4D97A 2W0MA 3WGKA 3ZVMA 2QD1A 3O82A 9LDBA 4AKGA 4ENSA 4O5OA 5DWDA 4NYMQ 3EHEA 3ABSB 3W8DA 4QYWA 1C7QA 1NVAA 1C9YA 1W4ZA 1JZTA 3ZYCA 2NXCA 5DM2A 4HAOA 5EJIA 2OVBA 1NVVR 5CFMA 4EHNA 1K5PA 1N5JA 3VR3D 2AMFA 2RHOA 2CNDA 2O3UA 2I66A 4MWSA 2QPOA 2W43A 4Z0TA 3RTBA 4GBGA 3T3HA 4X6XA 3ZY4A 4MUKA 4S1WA 1MVNA 3U17A 3RT9A 1SHZA 1H5QA 4H7EA 4PLVA 2PANA 1VMAA 3OQIB 2YYYA 3ZHOA 4XX0B 4DSZA 4TVOA 5ICCA 2Q5HA 5IUJC 3QX7A 1B0AA 1CT9A 3LAWA 3C70A 2VHJA 2C2YA 4NH0A 1TZMA 1T8SA 2FLWA 2AEJA 3WQSB 4ABTA 1WM1A 2OBBA 3ID6C 4DXAA 3C8ZA 2QENA 4ALLA 4CM7A 4YMUA 1NUQA 2BR4A 5JJBA 1NJ8A 5TF0A 3ESRA 5CIWA 3H13A 4MMYB 1ZZGA 1KNXA 5EE0A 1V4VA 3VC1A 4DIFA 1GQYA 2JLZA 1CJMA 2C5LA 1X1QA 2WHPB 1ZU5A 1IOZA 2EYQA 3L7BA 4Y2GA 5AYVA 3UFBA 4DEYA 4YAIA 3S2EA 2JCSA 3RUHA 1L5RA 2XYVA 3QFRA 2XF2A 2MT9A 4F3TA 5EJEA 1BOOA 4IJ5A 2DTEA 3RIGA 1WB4A 4YN3A 4KYVA 1M2OB 3ZJUA 5G1PA 5EQFA 3FPEA 1SUSA 1SBCA 3IPAA 4GW3A 3DHWC 4WZAE 2VHCA 5JMPA 5K0EA 4BNJA 1KIAA 5EHGA 2VPQA 1N5OX 4DPKA 4C0KA 1W2WB 1JSCA 3QKWA 2PNJA 3EDMA 5KPDA 4J0DA 5JNVA 1JAYA 3QIVA 4NULA 2XTZA 4M7OA 3VDRA 1JHVA 2R65A 1JKIA 2JFHA 2QMHA 1XA4A 2PMEA 3R0JA 1NRWA 3Q8KA 5ALZA 2WV9A 5AKHA 1D4FA 3ZWCA 2VYVD 2WD8A 1ONBA 4OQPA 2RGBA 3OZWA 3SHVA 4X00A 5BQ3A 1JZSA 4A8HA 5L4SA 3L6RA 4MVJE 2ATIA 1ITZA 2X9LA 2GAAA 1BXRA 2VDMB 4JSTA 3HVKA 1YWGO 2FETA 3VR3A 4F6RA 4DIBA 3JQPA 4PNEA 5K6TA 3II6X 4U39A 2FSVA 3CIFA 1K7FB 3BXOA 2W2QA 3PRJA 1D2EA 1JALA 1X1SA 3QMWA 1C5KA 3GP8A 1E8MA 1R8XA 3ZDQA 4FEYA 1BHO1 3COVA 3JZIA 4WLFA 4TVKA 2R8YA 2BI4A 4PPNA 1M73E 2C8LA 3ZIUA 3B78A 3TCXB 3WLAA 4BO3A 3GMSA 4PPYA 2AR0A 2O7VA 3D6JA 1AHIA 4J3NA 3RYCB 3VQTA 5H9VA 3R44A 1HBJA 3CNQS 4O33A 3U3ZA 1F4VA 1Q95A 4EWLA 1HSOA 5C4MA 3K31A 2LCQA 4AWXA 1SG6A 2OVFA 3HCDA 2ZM6B 5LUBA 2Q6OA 1VFNA 4Q7LA 5DTRA 4JLDA 2FK7A 2IT1A 1TZKA 2O1XA 1F2VA 4C0JA 3ABZA 1HH4A 1QONA 2GN0A 2I7DA 4Z51A 5AOVA 3NCTA 5D3KA 3GBSA 5EMJA 1R4AA 2AF3C 3S0JA 1YACA 1PLKA 5AKXA 3TAUA 3ICVA 4BVKA 2AXPA 3TSCA 1EK2A 4FZ3A 3WRVA 3T15A 4LOKA 1HRDA 4Z6KA 3OHPA 4LOJA 3DUFB 2HWYA 3KRTA 4ON9A 4U7FA 3RT1A 4A9AA 1CS0A 1TMOA 1SHTX 1OT5A 5D6NA 1A3CA 3CEJA 3L7OA 3PC6A 2GA9A 5JEDA 4QLBA 1GILA 2W6ID 2ZIFA 1LX7A 1UQUA 2QLNA 3Q9LA 2OFOA 5EWJA 3T1QA 2RHGB 4MWBA 3ITNA 1YI8A 3LY8A 4DY6A 4EMTA 3AEQA 3CEPB 3HJUA 5BYBA 3SN6A 1MQSA 4OL9A 3VNVA 4JLBA 3MRTA 1E6LA 1XJQA 3O1IC 4R84A 3H9GA 3PD7A 1A7JA 4ZQIA 2KLHA 4G9EA 5TJ9A 2VYVA 1KK3A 1QFSA 4AY4A 4CBVA 2DJIA 4KCGA 2JHCA 4CDGA 1DKPA 5IT0A 5JD5A 1J8MF 2FWIA 4IAOA 4B6SA 5IVHA 1UKBA 2ID4A 1I30A 3BMXA 3LP5A 4P2BA 3G2JA 4NV3A 2QT9A 1EGAA 2ZIWB 4KFCA 4GF5A 4M54A 2Z2JA 5E1DA 3WMXA 4R0NA 3SE0A 5HPYB 1FSSA 2DSTA 4CQMD 2DX7A 5FPYA 1CERA 5C18A 3VVCA 4KWEA 2GJ8A 4HDOB 4YUXA 2QXTA 5CXXA 4GLLA 3IAFA 2GN4A 3Q0EA 1GTL1 1SKMA 1FVOA 1S0UA 3FE2A 4NYJQ 4RXUA 4WGFA 3KOYA 2RH4A 1C7EA 4NF2A 3ETEA 3CURA 1HZJA 2XMGA 2L17A 2DH6A 3IJPA 3Q7EA 2XKKA 1OYOA 4US2R 4TLBA 2BBOA 1RWNA 1IDN1 1IWPB 4ER6A 2FR8A 5I4IA 1UWCA 2XWBF 5J58A 2I3DA 3AY6A 3T3PB 1C8KA 4A2PA 3EGXA 3IVAA 3RDPA 3X44A 4CCYA 4NZOA 1A5ZA 1J07A 3W2TA 1YL5A 2H11A 3BVPA 3G9XA 2QL5A 2E9SA 4IS3A 5E1BA 4OEHA 1VLZA 3PHGA 3SXPA 3IEXA 3EGOA 1HDGO 4ZEWA 5AW1A 3KVNA 5JZVA 1DBWA 2OGTA 2OV8A 3GRVA 1L4EA 2F64A 2NLOA 3M6WA 1SCBA 2G28A 1FL9A 1MFZA 1OBFO 4YRQA 1E7RA 1K2WA 2YTZA 7ABPA 4HDSA 3UXHA 2D13A 2HCTA 4ALJA 1WETA 2W6IA 3CUWA 1TF5A 5BN4A 2UU9B 1A2OA 2DUMA 3I39X 1BXRB 1XZEA 3H83A 4F6RB 2DPMA 5LBTA 5LYJA 2DYKA 1Y9DA 2G25A 1ZESA 2PU5A 2ZYUX 3L0OA 4RKWA 4V2IA 4WN9B 1A1VA 3K1TA 2WZDA 5H7XA 4EGQA 2CJXA 2GBLC 2VP2A 1SXIA 2P4HX 3F47A 3WLSA 4WLVA 4D7AA 2G4VA 4RD0A 1QYWA 4FFRA 3GHYA 1K5HA 2VHUA 1CB0A 3IX7A 4JS0A 1CE8B 2ZT5A 1U2DA 1USWA 3V2UA 2NO1A 3F7OA 4CETA 5JALA 1ULUA 1UPUA 1UT6A 2YUIA 5CLHA 3AF6A 2D1YA 3N07A 4CLDA 2ILVA 2AOUA 3PUYA 3MQFA 4NG4A 2XT6A 3C45A 3ESYA 2PZ8A 4CQMA 3KSAC 3N0TA 1SBHA 1C3XA 1SRQA 1B42A 5CJ2A 5JYEA 2HRZA 1DXOA 3QXGA 4NBSA 2A9KA 1P31A 1F4LA 3WIDA 4PSKA 3RWBA 4KLRA 5A62A 4INJA 1BE6A 4GOLD 4EEKA 4LG1A 5EHNA 2RARA 4XWWA 3C8MA 3GLFE 1E79D 4HC4A 1ELOA 3H5LA 3F6BX 3KBBA 4I66A 3V97A 1JUDA 1FYFA 3GMDA 2EJWA 3QVSA 2AOTB 3P9YA 5CX1B 3ZCTA 1L1EA 3OWHA 2AH5A 3TOVA 5ABPA 5L6MB 4IILA 4R8LA 3PQ3A 3NH9A 4KFRA 1CS0B 2KE5A 2AFHA 4O2BF 2OQVA 3L7NA 5CA1F 4LYHA 4E6EA 3S2FA 1LLCA 3GH1A 4FLEA 3I4CA 1U02A 3QWBA 2P6UA 4OXIA 4IIEA 1B14A 2MSDB 3BE4A 3U62A 4JJGA 1OAKA 4RQBA 1FNSA 1FRVA 3AJEA 1EX1A 4ES6A 5AI8A 4FZ5A 1X9IA 4QVGA 1W5TA 1PI3A 2PGJA 2NT3A 2Q9AA 3AEQB 3PYLA 3TRDA 2QRKA 3WNDA 1QDUA 421PA 1WSWA 3OZRA 4DG8A 2UVPB 4DCCA 4GP6A 1TCAA 1EPUA 2HH9A 3I1FA 1U2ZA 4NCIA 3ZHTA 3UK1A 1XV5A 1SPBS 4FGWA 4IMRA 4RUKA 4KJXA 4KQCA 3VMMA 1IN6A 4EVRA 4EX7A 4FT2A 3URMA 1UFOA 1JDPA 3MLBA 2W2PA 4HZGA 3GLHA 4QIHA 3M6XA 2UAGA 2O8NA 1GKYA 2V6MA 3BD7A 1E2JA 1V96A 1XKLA 1C1DA 1DEHA 2UYGA 4JR0A 4OHXA 4PC6A 4DB2A 4AF7A 3VISA 2DVMA 2ZR7A 4AZ3B 2ZQ5A 2HMAA 3FTPA 3GV0A 4Y6OA 1Y4ZA 1XQ6A 1WXQA 3MMPA 4JMPA 1OIXA 3RABA 3WMRA 3JATA 1ORDA 2I5PO 2Y1EA 5IYZA 3JQFC 4YDHB 3GGSA 3TPFA 1KARA 3AR9A 2D59A 3MJTA 1GRQA 2CVHA 2QAGA 3CH7A 3FLBA 3OOHA 3QYPA 4MQBA 3EXFA 4N0DA 3NRBA 4YQZA 5JUWA 5EEGA 1Y3AA 1QV7A 2PHZA 2J33A 2GCPA 2QUBA 3A58B 4ZYTA 3PEYA 3L3BA 4HNAA 1Y1RA 2QYHA 3KUKA 2ZS7A 5GJBA 4MCHA 2JGLA 1L4NA 1F2DA 5FWAA 5GONB 1DC3A 3P9CA 4X5OA 2BJWA 2PWZA 1IBRA 1Y1SA 3GLIA 1Z2CA 4CCYB 1IUKA 2HNAA 4FONA 1E79A 1F6DA 1U8TA 5SY4A 4E1VA 4UAJA 5KJEA 4S1NA 4DMUB 4H3KB 3C7KA 1RQNA 1G3UA 3IQXA 2OV2A 4ZOLF 4DDUA 4JODA 1RBYA 3BE6A 3R77A 3UANA 4KNYA 3GUYA 4D02A 1G8MA 3FMVA 3TDNA 3M7IA 1LDYA 2OXFA 2QQ0A 1OZGA 1N78A 2MJLA 4HDSB 4MAFA 4NPCA 4RMIA 4UATA 2PLFA 5BN4B 2X0JA 4HFJA 2P7IA 4ZAYA 3SVLA 2VQ6A 1XRNA 1Q6YA 1T1IA 3S70A 1CUUA 1E9DA 1KFEB 1ZN7A 2VAWA 4G1FA 4RQAA 1PJ8A 4DIUA 1R6TA 4MV9A 5C9ZA 4BQEA 4ZFNA 3LM8A 4J4BA 1UIRA 1LNZA 1X38A 2ZRFA 3HB9A 4JVNA 5CFZA 1UJBA 2FMUA 1E5XA 1Y5NA 2GI4A 3CNHA 3ELWA 4RHCA 4DV4B 3J80A 1RYZA 1XEXA 2DPHA 1DJNA 2QQ5A 3ER9A 3P0RA 2JA2A 2CLOB 4Z4HA 2BL4A 4MWTA 4RJ2A 1B43A 3DOFA 4B7AA 4JCCA 4TL8A 4CQMB 1QYVA 1R9MA 2DJ5A 3HLYA 1NBIA 2XKJE 3C6KA 3HP7A 1P75A 2MYPA 3EW7A 3LUPA 5DF1A 4F91B 2DERA 1TT7A 4XVRA 1QK4A 5C37A 4MYDA 2CV1A 3KSBC 1OB2A 2X2PA 2C59A 4W5JA 3DDZX 2JIBA 2XUDA 3KQQA 5F9MA 2MCFA 3VH3A 4F2HA 1WMAA 3H99A 2PSHA 3JVDA 1XZLA 2HSEA 3JW8A 1MA0A 3UB2A 4TLAA 3ED1A 3AHDA 2VJOA 3OZXA 4LXHA 3M9WA 5JD3A 3TVDA 3FPAA 5KS2A 1H9BA 1J00A 1DDGA 2VK1A 3KKMA 3UWMA 2JIOA 1A77A 4BNHA 2FPSA 4NABA 1KRHA 2ZRIA 2A33A 3T8YA 4RE6A 1AUVA 1NXSA 1YRHA 5AR1A 2ZFUA 5ETJA 4BP8A 4NAUA 1I7NA 4RTPA 1IONA 3GLTA 1U8UA 3VKWA 3PNVA 4B74A 5C5CA 2ZI4A 4OATA 2OTCA 2Z2ZA 1BXKA 2B92A 3T52A 4RS4A 3JY6A 1E1LA 1VRVA 2E4UA 3PX2A 1P5ZB 3RYHA 4AMVA 4TGLA 2IWHA 1V45E 4MYCA 2RKBA 1FSPA 5GAJA 3BCHA 1DXHA 3RSZA 3OZSA 3F7MA 3COWA 5FOSA 4L4ZA 3JRNA 3GHHA 1Z4KA 2FOXA 4CNBA 5CEEA 3IVXA 1I7DA 3FTFA 2DUJA 2XADA 4NDZA 3GLHB 3E9CA 1UXGA 2PM8A 3GR6A 3RFVA 2FZLA 3IAM6 3K1AA 3GBPA 2R25B 4EJ2A 5JE8A 3RRNA 3GCZA 4PYIA 1XAHA 4KIWA 3L1HA 4M89A 3W90A 3WWEA 1JR2A 1PR2A 1Y9AA 2GPJA 4F96A 3JATB 1ZVKA 4LCEA 4AJEA 4F4IA 1B15A 5JFOA 5LDHA 2QN1A 1QF9A 3DHVA 1CUYA 5JNLA 3GLKA 3EVNA 3KCQA 1T26A 5HIJA 1YC2A 2QAGB 5LXTB 2GN8A 4A6PA 1OGJA 3L40A 2V65A 2B5OA 1Y5IA 3QLTA 2RGXA 3EC2A 1T9BA 3ENZA 4JBNA 3AM3A 2F9FA 1L5FA 3MAGA 1IIRA 4HNAB 1XNJA 3UAWA 3OCJA 5DCYA 1WAMA 3BS4A 1N8NA 1I14A 4ZP1A 4AG6A 3QVLA 1I3MA 2HWXA 1RXIA 2ZUEA 4KI0A 4M8LA 4FIDA 1T2VA 3GLIB 3LXMA 4J0FA 5BQ5A 2NZ8A 5LP6B 5TJHA 4KAJA 3U3MA 4L9WA 2C61A 5DGHA 2XMDA 2EZ9A 5I7OA 2ZB2A 3HCOA 4HAUA 3OCZA 4UVDA 3RTDA 1JEOA 1IM2A 1M1XB 1X1CA 4FK8A 1NF9A 2E4VA 4PZ0A 4LYEA 2E1RA 2I67A 2WLTA 4FOTA 1AJEA 5GVRA 2NSYA 3RS7A 1IN4A 1U0SY 2N9UA 2RB5A 4H7DA 4MKHA 4DILA 3CSUA 1E0JA 2BF4A 2ARKA 3I5AA 4GBJA 1ZAKA 2JZOA 4UOZA 1GOTA 3QTBA 2VH2A 2R9VA 4GXNA 5TEWA 3TINA 4DLBA 5IKXA 3WX0A 3CJTA 3UK7A 3ROKA 4TRJA 1WW3A 4LQCA 2OUIA 1I2ZA 2RK3A 4EPRA 5JAHA 1DLJA 2D8MA 1K97A 2ZETA 3CEAA 3FPCA 1A9QA 3PNBA 4JUAA 5D87A 5F4ZA 3UXYA 2IXBA 3BZUA 2ZZNA 1GPDG 2GYVA 4GXQA 4MLCA 1IK4A 2HA2A 3M70A 1KE1A 3VYSB 3ZNQA 5IEJA 1PFGA 3A6ZA 2EP8A 3C3XA 2PGIA 4CKYA 4YWHA 1NW5A 5K0CA 2JLQA 1XEXB 1MB0A 1JA0A 2C4MA 1U2PA 4PX9A 3WLEA 5JY6A 4MUHA 4PN3A 1C0PA 2OAEA 2HGZA 1GTZA 3WISA 3PFFA 1X42A 1JXOA 1DFGA 2PXCA 4JA2A 5DYIA 5ULLA 2UDPA 5JJ5A 3Q87B 5JHHB 3LXXA 5AHKA 3ZHBA 3SZUA 3RLIA 4PQEA 1M7BA 4ZEVA 1DAOA 2HUPA 1NT2A 2BMEA 4I99A 4BNNA 2QTRA 4MTLA 4X90A 1G6KA 1WCV1 1X7WB 4D9EA 4EL0A 5CB8A 1LK5A 2FDCA 1ODCA 1SVOA 4ESEA 1NY6A 5CFOA 5T67A 5AVXA 2EW1A 3R6LA 1PSDA 3IUSA 5LB4A 2CWWA 2J5RA 3PQ6A 1MX3A 4A27A 2VPZA 4DR6B 4HPWA 2F2TA 1J6UA 3CO5A 1AXRA 2FJ0A 3JWJA 1U31A 1TLLA 1V25A 2WU1A 5FWXA 3K0AA 1I4LD 1UANA 2WD9A 3H75A 2YQZA 2MR6A 4EKGA 1Y1KE 1XWWA 3EAQA 1ZW6A 3KFVA 3WIVA 1B73A 1PZNA 3F78A 3QF4A 1VKZA 3I9FA 4TWAA 1U8EA 3NHMA 5NLLA 4H16A 2IGTA 5L40A 1CQIA 3PNOA 3IPXA 3TRJA 2CMFA 4C21A 1I6MA 4RPHA 3P7MA 4R3WA 4DBLE 2B2CA 2QW1A 5JZ9A 2QYTA 2P1RA 1CJVC 1UH5A 3RYHB 5CB4A 5KTRA 1THTA 1EBFA 4FDLA 4HEA1 1RS0A 3H4TA 2EL9A 2HJVA 5DE3A 3H6HA 4LMPA 2OGUA 1XLTA 4J0HA 5FA6A 3NBFA 4Q1DA 4DJJA 4CIDA 3CRZA 1QYIA 2WT8A 2Q7DA 1JGTA 5KAPA 1XA3A 1Z47A 3ESXA 2YWBA 5B7NA 1TD9A 1X8JA 3JAKA 4FYIA 3K5IA 3PU6A 1WZ2A 1XMSA 3KYJB 3NWBA 3WLKX 1P0PA 2DULA 4CIYA 3O7MA 4OGGA 3OZ7A 4BVFA 2QVLA 1G6OA 4EENA 1PNVA 3LT0A 3MTDA 2PVCA 4IMIB 4HHEA 4EW6A 1E58A 4K6HA 3MRVA 4RFSA 4WNCA 2VQSA 3H2KA 4OK5A 1I2CA 1ZD2P 2OGZA 2FWAA 4H1TA 4HF7A 1HGXA 1UKVY 3FMOB 2AQIA 2Z58A 4MS4B 2AE2A 4ZT6A 2VYCA 3B1ZA 4JP1A 3RAFC 2V7WA 4MAMA 4MV0A 2X6QA 3UTCA 2QY6A 2E55A 1SKBA 2V5AA 4G2NA 3UAZA 2F1IA 1IZZA 1NBMD 1PDVA 4JLMA 4UDXX 4I55F 4REQB 3RR2A 4D1YA 2YIMA 3F2IA 3BB3A 1O97C 3B36A 1LEHA 3EMDA 3OQBA 1QH9A 4I4CA 3DLPX 1A97A 2FG5A 2PO7A 2YVUA 4L57A 3I61A 2HTFA 3UMFA 1CHNA 3HKDA 4G65A 4UNQA 3TZ6A 1DCTA 3QKUA 1Q74A 5HEKA 1EZ1A 4E5VA 3GVPA 2J9FA 4KXQA 5JCOC 3EOZA 2WKWA 3C1OA 3KPUA 1GN9A 4G23A 2DWPA 3UT5A 4A0SA 3DT6A 2V55B 1P7WA 4YROA 4CLOB 3EPKA 2HLPA 1T5BA 2CHEA 2GKOA 3R7WA 4PLGA 3F8WA 4EA9A 5JS6A 2GZDA 5CVJA 4OQZA 2WTAA 2ZWVA 1T29A 3IHWA 3PBKA 4JI1B 4YMHA 1C1YA 3IE2A 4O08A 2FWMX 3K2IA 1PJ2A 3GY0A 2IUFA 1F2TA 4FI3F 2C82A 3ZWAA 2IWRA 1CZHA 1RP7A 3GWGA 5AVJA 2K4MA 1HQCA 2XUKA 3JCZA 3UW1A 3TNYA 4LHVA 1N2EA 3M1IA 3E4DA 4I9UA 4OPMA 3FJOA 3I9OA 3E7XA 1SG0A 5JSQA 3AUJB 1MRZA 4UCXA 2ZSHA 4XQEA 3BGVA 2ZRGA 1J33A 2IYUA 4M21A 1L5WA 3DLBA 1O89A 2UUBB 4MEAA 2O5VA 4A16A 1PR1A 4MUIA 1EP2B 4C6RA 3AEKA 4TMVA 4AAYA 5JNRA 4JROA 2IOFK 3ETLA 2HSGA 5JU6A 4EHAA 1BYUA 1SH7A 1SQFA 1EWTA 1R3DA 2DPXA 2F59A 3KOXA 4H27A 3E3NA 4OP2A 4E15A 2XD4A 2X5JO 3U48A 3RKSA 2JI6A 4RQTA 3VU8A 2MTBA 4K6FA 1UJMA 2FW0A 2HMUA 4BQPA 1JILA 3GUHA 3R5KA 1DVRA 1P2UA 2XY4A 3TR0A 5DNVA 5TF4A 4UE3S 4JI8B 4P22A 1TJYA 5EP3A 1JNYA 4JT8A 5IDQA 1H8ED 3HJFA 1WNFA 2YRWA 1NBMA 4B32A 3ZE9A 5FWXB 2PMFA 3K0AB 3KS9A 5SZIA 5IAKA 5CDFE 1M0SA 1UWKA 2GILA 4U2KA 1Q83A 4M8IA 4C5BA 4DA7A 5ELXA 4LDJA 4M9QA 4PBRA 5LMZA 2WG0A 3DXFA 3FNEA 1RXVA 5KBYA 3TLEA 1CR6A 1NQAO 1Q1QA 4OF4A 4XXHA 3SQNA 4R1PA 1CQIB 3LLVA 5F64A 4PQRA 2OZPA 3NVKI 3D0QA 1ENZA 5CK5A 2GUGA 3TRKA 3U31A 1WHSA 3I62A 5JJIA 5TQJA 1V5WA 5CB4B 1QXSA 2C3UA 1V6CA 1W19A 2C99A 3A6KA 4XWAA 3AB7A 3AMVA 4EJFA 1KC3A 2Y1KA 3BBPA 2CYBA 1XHLA 2Q4EA 3I92A 4J1SA 4PAMA 4C20A 1IXRC 3PFGA 4CF4A 2J85A 4ZANA 1FPMA 4IXWA 4BFCA 4AZWA 2VQ3A 5MDHA 3JAKB 3USCS 4PYMA 2OBFA 4CM6A 3QX9A 4CM5A 4CV2A 1KDPA 2QRQA 5ALVA 3RUIA 1YK1A 1P80A 1Z5NA 1FP4A 2Y1FA 3KHKA 4JLUA 2H1WA 4YFYA 5ILQA 1UFVA 1X7ZA 4RH3A 4Y7CA 5IH7A 2A88A 5PNTA 2XPCA 4RFSB 3UA3A 1SZJG 5EXDA 3I9NA 5KMGB 5DIFA 2QN2A 1PWEA 5DLEA 1BVHA 4H7FA 3PQ4A 3PCRB 1FPQA 4W5RA 4BNVA 3DZGA 1XZDA 4UDNA 1EFTA 1LDNA 4RQUA 3LQRA 2BGKA 5IKEA 2VATA 2HF9A 4NEQA 1RRMA 5E2BA 4EJ6A 2OYRA 5I8ZA 1ZMRA 3IT2A 2BH9A 4HTFA 3PCTA 4YAKA 4TZTA 2RHTA 4L6CA 2R66A 2YMLA 1PR0A 1KMMA 3AIOA 2YBDA 3NHPA 2X5XA 4GBED 4MJ7A 2J9FB 3AB8A 3ITDA 1UP7A 4FFVA 3T0GA 2EKLA 1QU3A 1KXZA 3AUSA 4AECA 4QARA 3UT5B 4BO9A 1GSIA 3P26A 1H8EA 1LZKA 4BHTA 3SIPA 3OQMA 3IUPA 2WTEA 2KBEA 1FCJA 2WF9A 3R7WB 1DOZA 2Q1UA 3C14C 1WU7A 4DY4A 1EESA 1XEAA 3BD9A 4QG7A 4U7JA 5B58C 1XRQA 5AK3A 4MPRA 2PZEA 5AVKA 4D0NA 4BNLA 1LI5A 4EGCB 4HRXA 2D1SA 4IFIA 4LNUA 3HN6A 2X7JA 2V0NA 1SB9A 1YUBA 4OMFG 4S2EA 5EJAA 2IOFA 2X0FA 4D81A 5JTUA 4QU9A 1V0JA 2H1OA 4YQEA 1U90A 3AJDA 4QWWA 3ICQB 5BSKA 4B71A 2WF8A 4LYYA 9GPBA 1NHGA 2EBWA 2P4EA 2PMWB 2WYWA 2Z5LA 3L8FA 5CITA 4QXRA 3ZWXA 2EIHA 2IYSA 1LFDB 3ZV6A 1U9IA 3FX2A 3OJWA 3ICCA 3GNQA 3AX6A 3D6TB 4NV1A 1Z36A 5E3JA 3U60B 4OHMA 1Y4AE 2YS7A 3E81A 4XYBA 3Q2OA 1V26A 2JI8A 4BAZA 4Q4JA 3E23A 3AEKB 3VHQA 3U4AA 1Q11A 2O6LA 2GSWA 4NU5A 2FVXA 4LF7B 3ECSA 4UPDA 4RACA 2WUWE 1PUJA 2B82A 3NTVA 1YRYE 5F7OA 2H0AA 3M5WA 4LXIA 3R3SA 4QU0A 3OKFA 5CTAA 2GCEA 3E9QA 1G3IA 4GGMX 2ZIEA 1B26A 1IFXA 3BG5A 3ESCA 1Y5RA 4KWHA 4NBWA 2QZ4A 3IUBA 4URZR 3B3FA 1BX1A 1O1YA 4O02B 2BSAA 3NANA 3X1XA 5HUJA 1KNQA 4CV3A 2YZGA 1PLJA 4JB2A 3H9EO 4DA8A 2OD2A 4B44A 1EVJA 4Z7QB 2B1QA 4ZVKA 4N03A 3GEIA 5K3DA 3H6KA 1OFGA 4K8RB 5MGNA 3VBCA 1SIOA 1V6AA 3IEKA 1VDMA 2H2WA 3BIXA 2X1VA 1ODLA 3RQIA 4PGGA 3ZD7A 2VDKB 1NJ2A 3T7JA 1WZCA 2R96A 4K2HA 2DT5A 3OOSA 1L3CA 3KP1A 1U2TA 4R9SA 2VDN