4X41A

Crystal structure of protein arginine methyltransferase prmt8
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
311
structure length
311
Chain Sequence
GIHEEMLKDEVRTLTYRNSMYHNKHVFKDKVVLDVGSGTGILSMFAAKAGAKKVFGIECSSISDYSQKIIKANHLDNIITIFKGKVEEVELPVEKVDIIISEWMGYCLFYESMLNTVIFARDKWLKPGGLMFPDRAALYVVAIEDRQYKDFKIHWWENVYGFDMTCIRDVAMKEPLVDIVDPKQVVTNACLIKEVDIYTVKTEELSFTSAFCLQIQRNDYVHALVTYFNIEFTKCHKKMGFSTAPDAPYTHWKQTVFYLEDYLTVRRGEEIYGTISMKPNAKNVRDLDFTVDLDFKGQLCETSVSNDYKMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein arginine N-methyltransferase 8
publication title Protein Arginine Methyltransferase 8: Tetrameric Structure and Protein Substrate Specificity
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 78
structure length 311
sequence length 311
chains with identical sequence B
ec nomenclature ec 2.1.1.319: Type I protein arginine methyltransferase.
pdb deposition date 2014-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06325 PrmA Ribosomal protein L11 methyltransferase (PrmA)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.160.11 Mainly Beta Distorted Sandwich Hnrnp arginine n-methyltransferase1 Hnrnp arginine n-methyltransferase1 4x41A02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4x41A01
1OR8A 1KYWA 1I1NA 1FPQA 2BM9A 3FUTA 2EJTA 5CIYA 4GOLD 1SQGA 4QDKA 3FTFA 3DMFA 5DM4A 2QRVB 3DMGA 3VC1A 2C7OA 3PFGA 5E1DA 2ZWAA 1P1BA 2G8NA 3JWGA 4E31A 5K0GA 1NE2A 1F38A 3BWBA 1VLMA 5DX0A 3R0QA 1L3BA 1L9KA 1WG8A 2ERCA 5E9WA 3OPNA 5ICEA 1G8SA 5MHTA 2EFJA 2FCAA 1QAOA 3B3FA 1JG2A 3ERCA 3EGEA 3UBTA 3DUWA 5EMLA 3NVMB 1KIAA 1M6YA 4OA8A 5EMMA 2B78A 3NDJA 3LSTA 4R6XA 3TPZA 4RTQA 3PX3A 1KXZA 3IV6A 3GCZA 4PIPA 3G89A 1DUSA 3BGVA 1NT2A 3IYLW 3G8AA 3P97A 2AVNA 2PY6A 5C0OE 3KKZA 4R8RA 2B9EA 2ZFUA 3FPEA 4XUCA 1QAQA 3UA3A 2JHPA 2P3LA 3P2IA 3TMAA 5EQJB 3OE5A 3UA4A 3CJRA 1XTPA 3JWIA 2I62A 5EEGA 5B1SA 4FSDA 1RI5A 5HEKA 2G1PA 1Y8CA 2P7IA 1QZZA 2LD4A 3GNLA 1VL5A 4X61A 3I64A 1EG2A 2VZ9A 1ORIA 3OZTA 5DPMA 1VIDA 1PRYA 3CBGA 4QPNA 1YFLA 2ZCJA 1P39A 2XVAA 1BC5A 2IFTA 3OE4A 4P7KA 5CM2Z 2AN3A 4BP1A 1RJEA 3KR2A 2C7PA 3HVJA 1I4WA 2G72A 3BGDA 5LQRA 5HZMA 4F85A 3OU6A 3HNRA 3REOA 1NW6A 2YVLA 1YF3A 4MIKA 3ME5A 3OZRA 4F86A 2GA9A 1RI1A 2HWKA 3MAGA 2AVDA 3SM3A 4GOOD 2AOWA 4WVLA 1JTFA 2PX4A 5EIWA 3HM2A 1G55A 5CUQA 5ICFA 1D2HA 4RTKA 4P7GA 3P9NA 4GUAA 1JQDA 4PCLA 1N2XA 3E7PA 5K0FA 3ANXA 3HTXA 3CJQA 2P40A 5M5BA 4IWNA 5E1OA 3PX2A 3B3JA 4LWPA 2ZBRA 3KQOA 2PXAA 1T43A 4GC5A 4FGZA 3E23A 2CWWA 4RX1A 2WA2A 1TW2A 4AX8A 2V74B 2PVCA 3TFWA 4BLVA 4YUYA 5GP1A 5EC8A 3PT9A 3UFBA 3BGIA 3EVEA 1RJGA 2QRVA 4PNEA 4P7FA 2WK1A 2ZIFA 3TLJA 3Q87B 2UZ4A 1QYRA 4E2XA 3AY0A 5FUBA 3FPHA 5D1NA 2OXTA 5DT2A 2PX2A 3LGAA 4EKIA 3FPFA 3OU2A 1N7JA 2ZVJA 4OA5A 3KU1A 1M0EA 3M4XA 4C4AA 3THSA 1KR5A 4KWCA 2PV0A 5GIOE 1SUSA 3GO4A 4HSGA 1N7IA 3NTVA 3DULA 3IHTA 3KQVA 4GOND 3UJDA 1YZ3A 3KQYA 4M38A 3ELDA 3EVZA 3HA7A 5EMJA 3DTNA 4HC4A 2XVMA 4K6MA 4DM3A 4DQ0A 3IEIA 1O9HA 2IGTA 3K0BA 3M6WA 1X1AA 5E2BA 3EEYA 4YUWA 5K09A 5LQNA 3WSTA 1I9GA 1VP9A 4MQ4A 5DM1A 2P3QA 1FJXA 1KPIA 5ICCA 5EKUA 5KQSA 1ZQ9A 4BLUA 2XYQA 3UJ7A 2XBMA 2JHAA 1EIZA 1X1BA 2AS0A 4LECA 3HCBA 3LKDA 3LDGA 4GOMD 3TR6A 4YMGA 2B2CA 2GAFA 2YX1A 4HTFA 2FYTA 1RJFA 1SVUA 3MCZA 4P58A 5CVEA 5ERGB 3C6KA 3LBYA 2ONZA 2UYQA 5HIJA 3NWEA 2AOVA 3FYCA 4RVDA 2BR5A 4E30A 2AOTB 5FTWA 2I6GA 3P9IA 4E32A 4EQZA 5K05A 4CTJA 2FK8A 2OKCA 5K01A 1INLA 1KP9A 5K8VA 4KIGA 2AOXA 4RTSA 2HTEA 5FQOA 4RYLA 3GRVA 2OB1A 1JG1A 4Z2YA 2EG5A 1IXKA 1NV9A 1NW7A 3QOWA 4O29A 1VBFA 4PYIA 2QY6A 4XUEA 4ATNA 3GGDA 3P71T 4PONA 4FZVA 5HIIA 3UJBA 2ZZMA 2GS9A 3HP7A 3H2BA 3HCCA 2OZVA 3PTAA 2JH9A 1BKYA 4QTTB 3R6TA 5DX1A 5DM2A 2NXNA 4RTMA 2BH2A 2GPYA 4GEKA 4HG2A 4DA4A 3E05A 3O31A 2Y1XA 4QQNA 4H0NA 3UJCA 3EVDA 1AV6A 1NV8A 1JQEA 5E8JA 3RODA 3BT7A 2AZTA 2UYOA 4CKEA 2P41A 1JQ3A 3I53A 1VE3A 5LQAA 4E2YA 4YUXA 4RTRA 3A25A 3LDFA 4ISCA 5LSAA 9MHTA 3KQWA 3DMHA 5CCBA 1O9GA 2ONYA 5LQCA 4OBWA 2GB4A 5K0EA 1RI2A 2ESRA 2IBTA 2P7HA 3FUWA 4E2WA 4RV9A 3FYDA 3C3PA 5DRTA 2PX8A 4AUKA 3BWYA 3GJYA 3EPPA 2IDKA 3OFKA 2IIPA 1R8XA 2R3SA 3FUUA 5DLYA 3UWPA 5E2AA 3CJTA 4RTPA 4HTFB 1R8YA 3KR1A 2BR4A 5BXYA 4Y30A 3HVHA 5CVVA 1XDUA 4L7VA 1KYZA 3EVAA 5U4XA 5DXJA 2ZTHA 2YR0A 5GM2A 5EZQA 3V8VA 4CWAA 3C6MA 3CGGA 2ZWVA 3LDUA 4MWZA 5ICGA 1XDZA 3MCTA 2PT9A 4DCMA 4CXMA 3DP7A 2G70A 1H1DA 3KQMA 5GWXA 1XJ5A 2HR1A 3BWCA 3P8ZA 4KW7A 3GRYA 5JUWA 3NVKI 4QPPA 4R05A 1G60A 2OY0A 3FTEA 2CL5A 3HEMA 3KPVA 3AXTA 3JWHA 4BP3A 4PWYA 2CKDA 3C0KA 1ZHFA 3I5UA 4PYJA 3FUVA 1HMYA 3I9FA 1F3LA 3SX0A 2AOTA 1R6AA 2ZBPA 3HA5A 5DSXA 5G02A 3F4KA 4OBXA 1FBNA 2VP3A 4FT2A 3A7EA 1X1CA 1FP2A 3G2OA 3UJAA 3THRA 3DXXA 3FPJA 2OPBA 3TM4A 2PSSA 2UYCA 1G38A 3SMQA 2A14A 2E5WA 2JH8A 5T64A 1BOOA 4C08A 3SSNA 1RJDA 3KHKA 5EIFA 5LQKA 2FHPA 3DXZA 1WY7A 3JWJA 1ZG3A 3G2QA 4XCXA 1EJ6A 5HIMA 2IH2A 5HILA 5FULA 2VDVE 3LX6A 4CKBA 3BXOA 4PYNA 1DL5A 2GH1A 2IPXA 4OX9Y 3OZSA 3B3GA 3M6XA 3MGGA 1B42A 3TOSA 1JTEA 3R9XB 1L3IA 4ER6A 4PGGA 2O05A 3M33A 2OYRA 5E9QA 4G56A 2YQZA 3L8DA 1TW3A 2R6ZA 3BUSA 4ER7A 3ORHA 2VDWA 4HGZA 3UJ9A 1ZGAA 2IP2A 1QAMA 3AWIA 4C04A 2HV9A 1D2GA 4PYQA 3S68A 5JR3A 3MB5A 3SGLA 5FHRA 4AZVA 2PWYA 4X41A 2ZIEA 3GDHA 3I58A 4JXJA 4RWZA 2QYOA 5E8RA 1JSZA 2BZGA 3BKWA 5CVDA 5DM0A 5E9JA 3SVZA 1JG3A 1YFJA 3TM5A 2Z6AA 5K0JA 5KQRA 2PT6A 1XCJA 1WXWA 5FQNA 1M6EX 3KPYA 4PCAA 1NW3A 5FA5A 5F2KA 3HVKA 5D1HA 5CD1A 4XUDA 3MQ2A 5F2OA 5EZSA 2PGXA 4KIFA 5K0BA 3LL7A 2NP7A 5P8WA 4RTNA 2PX5A 5DRYA 3OU7A 5F2NA 3NMUF 3G7UA 4FSXA 2Y1WA 3G5LA 3CVOA 4PYKA 5C1IA 3U81A 3KQTA 4AZSA 1YUBA 5BW5A 3B89A 4YMHA 5GINE 2JG3A 3CCFA 2P1DA 1NBIA 3A7DA 4X1OA 4ER5A 5HIKA 2YXDA 4ER3A 3GU3A 1XXLA 2ADMA 5FCDA 5EKXA 1AQJA 4MTLA 3AXSA 2OB2A 3BZBA 3KQSA 3P2EA 4EK9A 1KHHA 5CVUA 4IV8A 4B17A 1SKMA 4AZWA 1RI3A 1R18A 2AR0A 2CMHA 5CCXA 2O0LA 1P1CA 2KW5A 4PYMA 2FK7A 4F84A 4EVIA 3M6VA 4GQBA 2OO3A 1BHJA 4HGYA 5EOVA 3SSMA 3LPMA 1IM8A 3ELWA 5LQUA 1DCTA 2FPOA 3LCUA 3EMDA 3PB3A 3R24A 2ZLBA 2QE6A 4ER0A 5GIPE 1Q0TA 3TKYA 3PLAE 3ELYA 2DULA 5BW4A 5H02A 5DWQA 1Q0SA 1XDSA 2AOUB 8MHTA 4FR0A 5T67A 1KPHA 3FPGA 5E1BA 3UJ8A 3QOXA 1XVAA 4R8SA 3HVIA 1EQAA 3DLCA 4C07A 10MHA 1EJ0A 5HOQA 4EKGA 3T7RA 2OBFA 2DPMA 3NDIA 2IH5A 4CKCA 2ZZNA 3B7PA 4E33A 3LBFA 4GC9A 4IKPA 3OCJA 2PLWA 4DCGA 2NXJA 2PXCA 2ZW9A 4KDCA 4DZRA 5EHGA 4HRAA 5BP7A 5CVJA 1JSXA 4PGHA 2H00A 1SQFA 1WZNA 2YXLA 3FRHA 4FT4A 1XCLA 3QV2A 1R74A 1X1DA 3FUXA 3HCFA 3M6UA 3G2PA 4OQEA 3C3YA 4U7TB 2CMGA 4DKJA 3CKKA 1ZKDA 1UIRA 4YV1A 2IBSA 4HH4A 5EGSA 2NP6A 4RVFA 1MHTA 5EEHA 4M7RA 3LKZA 4BLWA 4LG1A 1SG9A 1O54A 2QM3A 2WA1A 5EPEA 4YUVA 2I7CA 1X19A 3EVGA 2FRXA 1VPTA 2PBFA 3O4FA 5C9ZA 2G71A 5K03A 2Z6UA 4C05A 1L1EA 2HMYB 3HA3A 3LCVB 3NW9A 2H1RA 3DLIA 3EEOA 3GRRA 2XYVA 1RI4A 2IDJA 1P91A 3EVCA 3P2KA 3PFHA 2P3OA 1HNNA 5KS2A 2O07A 3ELUA 3G5TA 4A6EA 2F8LA 3EMBA 4CTKA 5DXAA 3EVFA 3GXOA 4ZTBA 4E70A 5T6BA 5LR6A 3OFJA 3A27A 3KR0A 4QTUB 4MHTA 4FS8A 4WXHA 4RVHA 1D2CA 3GRZA 5EG5A 3KPWA 3MERA 2I9KA 3KPJA 4YV0A 1WS6A 1NW5A 3T0IA 2O57A 4RVGA 2ZBQA 3V97A 1V39A 5EHIA 4IV0A 3NWBA 4UOEA 1VP3A 4RTLA 2C7QA 2EX4A 2GLUA 3VC2A 4E2ZA 3DR5A 1Z3CA 2ORED 3AJDA 4FP9A 4NECA 4X60A 5FA8A 3B5IA 1EAMA 3RIEA 1U2ZA 2VS1A 3K6RA 5E1MA 3A26A 2ZULA 4M37A 3G2MA 4RTJA 1FP1D 1SUIA 4GBED 3LHDA 1QANA 2ZIGA 3MHTA 4AZTA 3G8BA 1NBHA 1ZGJA 4C03A 1WXXA 3GRUA 5DTQA 4X63A 3O7WA 4PINA 2AOUA 4V0RA 1R00A 1TPYA 4PIMA 3UJ6A 4LWOA 3G88A 3KR9A 3D2LA 5FHQA 2YXEA 2NYUA 2YUIA 5FWAA 3R3HA 4GF5A 3HCDA 2IH4A 1G8AA 3BWMA 2UYHA 3PVCA 3MTIA 4BY9E 4EMSA 4QQKA 3FZGA 4DF3A 2P35A 2PWPA 4V0QA 2AN5A 4KVZA 1JG4A 4PYLA 4YV2A 3KQQA 3LCCA 3A4TA 5DTRA 3P9KA 3ER9A 2V7EA 3UZUA 2HNKA 4P7JA 1L3CA 2PXXA 4RSRA 3SSOA 3SXJA 5EVJA 1JR4A 3ER8A 3EGIA 2JJQA 2NNWB 3DH0A 3TKAA 1AQIA 3EGVA 1MJFA 1G6Q1 2ZSUA 4PYOA 3FTCA 5FADA 1PJZA 3SR4A 4DMGA 1YZHA 3KQPA 3P9CA 3PS9A 5DX8A 2H11A 3KPUA 4KDRA 5KVAA 3RW9A 3ID6C 3CC8A 2N47A 2BM8A 3LECA 5K0CA 5IH3A 3E8SA 5LQJA 1VQ1A 1YB2A 3DOUA 2P8JA 2PJDA 4OQDA 4POOA 5DSTA 5K0NA 5DTMA 4Y2HA 1ORHA 5EMKA 1AF7A 1KPGA 2BR3A 3TRKA 3GIWA 3M70A 3T7SA 3Q7EA 5GM1A 3VYWA 3GWZA 5HFJA 4M36A 2O06A 5GOZA 1UWVA 3DXYA 5FWDA 4QVGA 3TQSA 2NXEA 3X0DA 3NJRA 7MHTA 4C06A 2XYRA 5K0LA 3BKXA 4QVKA 2C7RA 1NKVA 4KRGA 2B3TA 2PKWA 2VDUE 4R6WA 1IY9A 2NXCA 3FTDA 2JHCA 5KYGA 2Q41A 2ZZKA 3FRIA 1NW8A 4U7PB 5IKMA 2K4MA 4RTOA 3VSEA 3T7TA 1UFKA 4QDJA 4A6DA 2YTZA 3HCEA 2EJUA 3HCAA 2Z6QA 4YUZA 2B25A 3MTEA 3EVBA 2AN4A
chains in the Genus database with same CATH superfamily
4E4TA 4MKFA 3EPKA 1AIPA 5HMLA 1V5GA 3R3VA 2AL7A 2H4WA 3L7YA 3H9QA 3MBOA 1A4UA 3MS2A 4OI0A 2QRQA 4D6YA 4FHGA 3VXKA 2XNDD 1WDLA 3EXAA 3NG1A 1UM9A 5E1DA 5EE3A 4BNGA 1ZH8A 2GA8A 3U31A 5EN4A 2WJZB 5K2MA 1F38A 3NONA 3T61A 2XQVA 1QR6A 4CLOA 5DLEA 5DN9A 4GRDA 2FZWA 4RS3A 4MWSA 4KBGA 5K8UA 2PZAA 3SDBA 4HQRA 4DYHA 1U2TA 4I1RA 3H1BA 1YXMA 2F3UA 4ARSA 2DM6A 3NDJA 1DBRA 2VP6A 3ZGZA 4G2TA 4R6XA 1FTQA 5EZ6B 4ZI3A 1V7ZA 2C9YA 4IDAA 4YRQA 5CDSA 2B6NA 1E3MA 3GCZA 4QQFA 1T8RA 2VHEA 4EJFA 3K71B 2RIPA 3IHLA 3RKRA 2YRXA 1R5BA 1TYCA 3A2LA 1B74A 2F1IA 1H9BA 1ID1A 3AK4A 3QYFA 3KZXA 4LXIA 3V00A 4Q0MA 3IB6A 3RS0A 4IV5A 4F8JA 1VE9A 1EGVB 5EWLB 1O5TA 1R0CA 5EEGA 1SIOA 2ZYDA 1FVXA 1N6NA 2HWXA 2LBPA 1NUPA 1Y8CA 3N7UA 4RHXA 5C5CA 2BI4A 2CDRA 1GAQA 2DG2A 2ZJYA 1BCSA 1KYIA 1XRNA 4YQYA 3CBGA 1ZICA 2B4RO 2BEJA 4WXYB 4D46A 4WINA 2IWHA 5ES4B 1G59A 1UXGA 4FGUA 4H7PA 3FWNA 4AJLA 3GRKA 2G72A 4KITB 4QWWA 4CUZA 5F5XA 1AK9A 1KZGB 2XUOA 4UTXA 4R2LA 2G6BA 4LWZA 1SHUX 4ACBA 3ITNA 5HS4A 1PWYE 2VQDA 3V9AA 3DOFA 1F8FA 2R6JA 2VPQA 3F97A 1MAVA 2WY2D 2Z4SA 1WMFA 3DUFA 4GOOD 4GX5A 1GU7A 4RA6B 1ITZA 3BGWA 3LOQA 3MRXA 3ESXA 3GYBA 3KQKA 3ZZNA 2PNFA 4BWGA 1N5OX 3EIXA 3LQ4A 4B4OA 1XZNA 4LYHA 3PWKA 3H04A 1G98A 3C3MA 3H5WA 3HTXA 2H29A 2ODNA 4UDOA 3SYLA 3CUVA 3BJRA 3ZNPA 3KQOA 1T4BA 1NMXA 3J81k 3NKVA 3OZAA 1RIIA 4F2WA 3FNEA 4ITUA 1YQQA 2QU7A 4M0EA 1GZHB 2B1IA 3L0DA 2EKLA 2VTEA 3P4UA 1CKEA 5FBRB 3ZU6A 4CFZA 4DGQA 1WXQA 2A1UB 2NU6B 2WJ3A 3I9LA 1K5PA 4IIJB 4MRMB 1HETA 4FLEA 5JEEA 1BU5A 4KUGA 2YJGA 3GI1A 2B4KA 3PGJA 3ESAA 5FJIA 1GTMA 3ETEA 1V1RB 2O2XA 1CR4A 3IKJA 4NX2A 3CUYA 3IP8A 1QRAA 3H9BA 4OA5A 3ZQJA 4GE3A 5L4LA 5AXCA 2AH5A 3P9XA 4FYVA 3JAKB 2GARA 4BNFA 2FPLA 2NOAA 4YP0A 3OM0A 1SZPA 3KQVA 1GPKA 1QDEA 4A2PA 4M38A 1C9NA 1FTYA 1WBJB 3L0OA 2FZCA 1JW9B 2V58A 3PD1A 4IF4A 5IKOA 4H6XA 4JBLA 3T3DA 2PS0A 3U13A 4AU1A 5BMVB 4XTCS 1PT6A 1TM7E 3I8XA 1XXHB 3IDAA 4YCSA 2FEMA 3EY9A 4CNQA 5J23A 3RIGA 3QEKA 2BH9A 1YT5A 2R1TB 4WJLA 3ILYA 1BD4A 1U3FA 4J0GA 2PNJA 1ZQ9A 5EJ4A 5C53B 3K2EA 4WJZA 1IXZA 5AKGA 4DNFA 4KXMA 4LECA 5LBUA 3NB0A 2V5AA 3T5GA 4DJTA 3L6BA 4YMGA 1HE1C 2B2CA 3EASA 3UJPA 4YASA 4HNUA 5COQA 4IMIB 4FUTA 1MAWA 4I08A 4YCMA 1NMYA 4G1EB 2VWPA 4EQZA 3WGZA 1UZNA 3P0JA 3R8XA 4CTJA 5KNCD 2YCLA 1U7DA 4HLUC 1YSCA 2PL1A 4M9CA 3VZBA 2HNAA 3AFOA 5L40A 1LK5A 3RARA 3VKHA 3IUSA 2OB1A 3M82A 3QY0A 1O95C 2V98A 4D0NA 5AVJA 2IRWA 4GYYA 1P3DA 1FDTA 2ZTUA 1DAOA 1JIUA 3QELA 4N5IX 3SHTA 2OLKA 3GAAA 2JA2A 2NSHA 2W42A 2EKZA 3I0MA 4K9NA 2AKYA 4QT0A 4QDUA 4R8LA 4U9HS 5AIAA 4F3YA 2CFSA 2Q1WA 4IWYA 2NO4A 1A9RA 4EZBA 3BRCA 1XDGA 1QFMA 5DM2A 3UJ3X 1M2HA 4OQZA 4FU0A 2V6GA 2OUIA 1UBUS 3DDSA 2Q50A 3ZE1B 4RMNA 1K7YA 1V8FA 2BMEA 2WDPA 3O31A 4CIBA 1CQJB 1WCV1 4RV4A 2QPAA 4BC0A 5M29A 2GLXA 4OKSA 1NPTO 4XWOA 4CKEA 1DKOA 4N6GA 2I91A 1G1MA 2BTQA 4L28A 1C14A 5EP1A 3LW8A 1DELA 3PIIA 4OHOA 1N57A 5HK8A 2UZAA 5B1IA 1Z4NA 4HVAA 4YR9A 1JE1A 4GD3Q 1XMOB 4LYEA 2FWBA 3INNA 4CUKA 3I32A 1BKDR 2QQGA 1HQYE 1UJ2A 2PX8A 3GFSA 3BWYA 3CU5A 5JCPA 3EZ2A 5CDUA 4DRYA 3DZJA 3VKFA 4NHOA 2OT3B 3IT1A 4JB8A 2LCQA 1D6NA 1D04A 2IEIA 2RH5A 3CZQA 3GPCA 3JALA 1WTAA 1KYZA 4LEIA 5DXJA 1P7WA 1CP3A 1E1NA 2RBEA 4MWZA 2IPOA 3DNMA 2WJGA 3Q4GA 4P82A 1LTHR 5BQXA 3LY9A 4JXZA 1FFYA 2R4TA 2FA9A 3STTA 3TOCA 1Y8QB 2V0GA 4HNSA 3OCWA 1BXGB 3PCRB 1NVVQ 4AY5A 2R0QC 5BWCA 4W99A 1NXTA 3KYBA 3OBBA 1H22A 3UC5A 1MG0A 3OPYA 5HX7A 5JNWA 1WBDA 4RW0A 4RIIA 1RW4A 2P1ZA 3EMKA 3UB2A 3TBFA 2DWCA 2VCYA 4R0MA 2OV1A 3I5UA 4LY0A 4C0AC 3TQQA 4QFMA 3SX0A 4DM7A 2NPFA 2Y05A 1LA2A 5TMBA 2H2AA 2J6BA 2Z09A 4MWBA 5JDIC 1R9JA 1Q12A 1HDCA 1T2CA 3GRFA 1JDJA 3T7EA 3AVUA 1K7CA 3EEFA 3Q15C 5I9TA 3GFVA 2R1ZA 3PHGA 1Q7BA 2QUZA 2HT1A 4QYIB 3PXEA 3ZHQA 2VNAA 5GOTA 3WZ2A 1TMOA 2A14A 1N6PA 2C4UA 4R71A 4ESHA 1BOOA 3A04A 1AS0A 1Z88A 3CTPA 5C7IO 4FDUA 1NLUA 1W4AA 4OUDA 3WV5A 4DMUB 2XB2A 1CY0A 1UPBA 3I9KA 4PICA 5MGNA 1R27A 2JFOA 1PR3A 3FCEA 4H9GA 4J3JA 4LJLA 3GA7A 4X8MA 3RK0A 3RKSA 1HYQA 3GDOA 2CNBA 1KNQA 3VR4H 1U3DA 1QRDA 1C7JA 1L7PA 1JPVA 1RBMA 2PX6A 1IFXA 2XJ4A 2ZAYA 1S8OA 3JVIA 3PJEA 3HJCA 1B0UA 4PG5A 1XZ8A 4RCVA 4ZXFA 1UPCA 3ZHZA 3G13A 1JDZA 5I7RA 3N8DA 1N7GA 4NYIR 2HV9A 3GNTA 4YWHA 1IVNA 2D0DA 3CF4A 4H16A 4JBHA 5JR3A 3DM9B 3MB5A 5G2OA 1OREA 4LYYA 5D3MA 2AC2A 1RDFA 4OP3A 2ZXUA 4YRJA 2RGNA 3Q0IA 4PFSA 8LDHA 3LT4A 3MIZA 3P0EA 4OU4A 4YRZA 5LCXA 1TQ4A 3WV4A 1PEAA 2WU4A 1EXNA 1E9CA 1PS8A 1YIOA 4TUYF 4F9TA 1JDSA 3D54D 1XJ0A 2WHPB 3OJEA 2GDJA 3ANNA 3ECSA 3TYXA 1G20A 4OK5A 1IPFA 4CHGA 2JDID 4YMIA 5CFLA 1SK8A 3IOYA 6PFKA 2PZJA 1VLLA 3AERA 4I7EA 4LJAA 4XUDA 1ARZA 1OROA 1QSGA 1S02A 2WV9A 2GHQA 3GELA 3JYNA 3MW8A 3NEAA 1LC3A 1TVCA 5EGNA 3NNNA 4Z0NA 5K3DA 3OU7A 1WTCA 2EATA 2Q1YA 3W5VA 1UBEA 3G5LA 3DMPA 3LUKA 1K5HA 1R0YA 2H1FA 2B98A 2N46A 2V0CA 4W7IA 3QVSA 2DKNA 2JIBA 4KG7A 2JBAA 4M54A 2R11A 2PRKA 2OWEA 4YPVA 5EWJB 3GU3A 4FDTA 1CS4C 4JP3A 2EYQA 1X94A 1AQJA 3GBPA 1J21A 3E61A 3R6GA 4FI3C 3UV6A 4X9XA 1IL0A 4ZQFA 1NRXA 2CVHA 3U49A 3L8ZA 2VQSA 4KQWA 1A8IA 3ELBA 3N75A 3WNDA 3I45A 4PYMA 4DC1A 1ZL2A 1V3VA 3NTQA 5A1TA 2X0IA 5IYZF 4O4JF 1E1QA 1KNXA 3EDOA 3I8OA 2WSBA 1X7ZA 1UEIA 2ATXA 2Y71A 2IY7A 4L75A 4P86A 4D5EA 4BMSA 5CDTA 5JNLA 3A4MA 2AUNA 1JA9A 4JP2A 4MQEA 2QWXA 3STYA 1CRPA 3ZWNA 2O3SA 1KJYA 2I1LA 4YREA 2A1TS 4F6LA 1WETA 4J4TA 2F1HA 1T9KA 3UMFA 1D2AA 4B83A 1PGJA 1T0UA 2GXUA 1QH8B 3D5QA 4R54A 3KJXA 2OBFA 1DC7A 1QWSA 2XNJA 3HB5X 4INPA 4KMRA 3PUVA 3Q5EA 4LBYA 1VMDA 5IN5A 2PX0A 4AKSA 1PX2A 3CWQA 3LBFA 3M1IA 1DCKA 4UDYX 3USCS 4FBLA 4DWJA 2NXJA 2YVQA 1Z73A 1L2TA 1J42A 1YS1X 1SKAA 1MC4A 3A9SA 3RANA 4BZXA 2IW3A 4O3MA 2QMQA 2FFHA 2RHWA 3FRHA 3PYMA 3N2GA 4X45A 3I8SA 1TU4A 2D00A 3RU3A 4MCJA 2WKRA 1TD1A 3OHSX 1SY7A 2Q9BA 3CNQS 2O0MA 3IUNA 4HAWA 4JR2A 4Y9RA 3V8PA 2REOA 5K4HA 4YXWA 2FHSA 1TFUA 2JVKA 1GTJ1 4G97A 3SZOA 4CM1A 1NXOA 4MVJF 1VHWA 2DPXA 4M7RA 1PHRA 2QV7A 3T3GA 3JTMA 2CSUA 4QOHA 1OXVA 4XIGS 1M34E 5HUQA 2GM9A 4FGWA 4B6GA 2PUDA 1T0JB 1N75A 2AN9A 3EQ7A 1XZQA 4IL5A 4Z7QB 4HYTA 5A3SA 4A8JA 5JARA 2FH5B 4XD2A 3THOA 4HDAA 5JAHA 3FGNA 3QLVC 3CPHA 4WLVA 4EHKA 4L3VA 5KQMA 4LQ4A 4FDLA 2H1VA 4LCEA 3ZWDA 4EELA 5L3VA 3PDCA 4CDRA 5JQGB 1K3FA 4KO4S 4RDHA 4RD1A 4DL9A 1C7IA 5A2GA 3IO5A 3I37X 1T9ZA 1Y6GA 2P9EA 2WWYA 5JCXA 5AI0A 1YAJA 2D4HA 1FDVA 1JXOA 2FN7A 1XQ1A 1SD2A 3LF2A 1UMBA 2DFVA 3MN1A 3D3KA 3T0IA 4CKCB 2O5CA 1UP7A 3O95A 1WB9A 2IU6A 4K7JA 3ORFA 4C0QC 4AF8A 2PSDA 4MDYA 4BO8A 5KQLA 5EHIA 5TF4A 1QV7A 3KJNA 3VDXA 4NECA 4CVNA 1JEQA 1VYTA 1YDHA 3L4BA 3MWDB 4IDHA 4J0IA 5IT4A 3S70A 4IMJB 2HHHB 2A5LA 4XVRA 2DWQA 4D8YA 2AHOA 1SHZA 1FP1D 2HIAA 2QG4A 5J5CA 5JBIA 5L7WA 3TX6A 4ZANA 1RRGA 1MF7A 2G8LA 4MKGA 4AZTA 3G8BA 4L73A 4MZDA 5CRIA 4LFAB 3GH1A 2DMRA 2G25A 1SC1A 4EG3A 3I2GA 2CKMA 3GEBA 3W6PA 1MJHA 5JSZB 1VL1A 5HJ7A 3KZNA 2X0EA 2WWHA 2C95A 1G4UR 4NJMA 5DGIA 4OO3A 5JO9A 1JG7A 4DC0A 1PR5A 4DRXA 4WLOA 3KKPA 2WILA 2DTEA 4G4SP 4YFVA 4ZCQA 3H9EO 2D62A 5F12A 4RKQA 1PEKE 3VPXA 1J8DA 4V1CA 3TSOA 1Q7TA 2Z4TA 4O5AA 3GLGE 2PUWA 4L4SA 4P7JA 4TKZA 4JC8A 4DIMA 2JLWA 2BZSA 4LE2A 2ZJ6A 1SOMA 2MINB 4JKOA 2G07A 3TEFA 1IE3A 1V4VA 4H0CA 3NIWA 3ZYCA 3OTOB 1A27A 2EIHA 2B99A 3M8KA 3HR4A 3NHLA 3WKAA 3ZHCA 2H2IA 4WCFB 3SOPA 2ERXA 5ER6A 5BQPA 1JFFB 4Y6RA 1T10A 3GFFA 4CQMD 4DBVO 4MI1A 4M7PA 4EUEA 1M8GA 2GZAA 1GPAA 2RH8A 2W6IA 2YYYA 3DOUA 2IC5A 4FOPA 1QMPA 1Z2CA 1V5FA 1U11A 3GMDA 4IFTA 1ZAKA 2Q3CA 3QXCA 1U0HC 4QGAA 2RHGB 3TRKA 2D0PB 2VJNA 1XA4A 3GNQA 3M5DA 3G8CA 4JDUA 3WXMA 2LRHA 2AIRA 2C2KA 4DJJA 2A0UA 4F5EA 1AQLA 3VHLB 4QVGA 3W7BA 5DULA 2Z8XA 4INJA 4JT4A 5C46F 2LWIA 2VT6A 1FDOA 4Y6SA 2C7RA 1FSZA 3ZWKA 3EXHC 3TQCA 1LFAA 1WZIA 4KXLA 3MSXA 2FF5A 1XQXA 2K4MA 2QZZA 3A1TA 2M2IA 1JR3E 2R1VA 1X42A 2DECA 3OZBA 1WB4A 3ACBA 4ZGWA 3TFQA 3QBVA 3WYDA 2HL6A 4JELA 4LHWA 3EVBA 4K8OA 5AJWA 4FLFA 4ZVNA 5EJMA 5AVUA 5L3QA 3GAZA 1E3WB 2GN2A 5F1KA 2E7ZA 2HA6A 4YAGA 5KTSA 5BSFA 1Q7EA 4NE9A 4QUIA 4R83A 5SYAA 5AVYA 3PG5A 5ALFA 1GL9B 2DBRA 5DYTA 3AILA 5BO5A 3UT6A 1YKFA 2HJGA 4QRHA 4E31A 3E4DA 1V96A 3NYRA 2OHIA 4MB0A 5EZYB 4C7XA 3PNBA 2L2QA 2NLOA 1Z8NA 3KLMX 1A04A 1YZYA 4L6CA 5L6MB 4RVOA 4YJGB 5FTJA 1JIIA 2ZE5A 1XPOA 4QM6A 3S27A 5C1OA 5TLSA 1LTQA 2B5OA 3CW9A 3RF7A 1XMSA 1TRKA 1JG2A 4R1TA 4DBLC 3UBTA 3LQQA 1D0SA 3E58A 4DB2A 1JEDA 4Q7LA 3OWXA 3LSTA 3NTOA 4EY4A 2KHZA 5DV9A 4A6XA 4XX1A 3FZQA 2WF5A 3FR8A 3BK1A 4IJQA 4S1PA 3E9YA 3G8AA 1VRCA 1T1IA 3KSAC 3GBVA 4QREA 2GD6A 3O94A 1L4HA 1XF9A 2ZWPA 3I83A 1XAJA 4ZAFA 2O3RA 3VBEA 4ALIA 5B55A 1RQ2A 1ZSNA 1GUDA 1SA0A 2HHJA 3BIXA 2HZ7A 1YB5A 3GVXA 4MUYA 4OQFA 4RZ2A 1XTPA 2QM0A 4Z1MA 1OSNA 4WTOA 3GVPA 1FSPA 3IQEA 1TM4E 4Q7QA 1NNLA 5LMNB 1QZZA 4BEBA 3DNFA 5CXQA 1F06A 2IYTA 4KFSA 2AQIA 1QO0A 1VIDA 1W9MA 3ODPA 4LPSA 1M74A 2CFCA 1WSWA 2ZJ8A 1ZK2A 5DP1A 4FHDA 5CFNA 1HZZC 2Z2ZA 2Z2YA 1PL6A 1AHPA 3HVJA 5EUQB 3CEPB 2X6RA 3ZD7A 2ZE7A 3ANYB 3FA2A 2DUWA 2WI8A 4QX6A 5DP2A 5FBWB 1WQ3A 3I05A 1GRNA 1R0RE 2V9PA 3DMTA 3JQAB 2D5LA 1VE5A 2ZPTX 3PWZA 5CXSA 5HZGA 1AO0A 5KNDH 3R4CA 1XN4A 5FEMA 3AL0C 5A0FA 2V7WA 2PH7A 4YJ3A 4CCSA 1AKYA 3TVDA 4BJ5A 4GUAA 4P0TA 1TMKA 2D5BA 3TW0A 4IINA 5ALVA 4ND4A 3RTCA 4JJ6A 1XWIA 5C81A 3OZGA 1MAUA 3KYJB 4LNAA 4U7FA 3FGOA 3PTLA 5A4KA 3OQMA 1JT2A 1OBFO 2IHYA 2QN9A 3RS9A 4D0RA 2AI1A 1ZWKA 1A8HA 2WUVA 3B1JA 1VM6A 4DIUA 3TCNA 5I45A 1K3UB 4M0MA 4G09A 1JFLA 2FPGB 3NRCA 4WK2B 5E9AA 5AM5A 4XRRA 5IW8A 2VRBA 1KTVA 4P7FA 4AYWA 5F78A 3TLJA 3Q87B 4IIHA 3ZHVA 1FBTA 2WWFA 4B40A 3AY0A 1VC2A 4ZVSA 4AP6A 1W94A 1DPGA 1TQ8A 5EP4A 1IY2A 4ZJUA 1N7JA 2BHRA 4QAJA 4CGZA 1PSZA 3H5AA 5KMGB 4HS9A 5IAEA 3JCZA 1SC4A 2QRGA 4GRAA 3ILHA 4EHBA 2Y92A 2FSFA 3D8NA 1GRVA 2PFSA 2ZTLA 3TCXB 4DR1B 1PD1A 2RCYA 5EMJA 2X5JO 2O6LA 1USUA 2C2HA 4WJKB 3L1KA 4RXMA 5BN3A 3VNVA 4E94A 1K7XB 1C1DA 2QSUA 4WI1A 4K0RA 2Q5QA 1O0SA 4WQMA 3VHQA 3FM9A 3WMXA 1SR8A 5HF5A 3KAQA 1V9CA 2VPPA 1Q14A 5MN6A 3V2GA 2P3QA 2CVFA 3KSZO 4PGFA 4Q39A 4EITA 1RTTA 5TS2A 2W2VA 5I6DA 5KNBD 1R4NB 3SKXA 3ZHUA 1S2DA 3AL3A 3LKDA 4J43A 2P2YA 5ALZA 4EKYA 4FFDA 1EBUA 1N8TA 4Z1OA 4MYTA 4RM2A 4N7RA 1MO4A 1X7DA 2QR3A 2XH8A 1IEVA 3KOYA 3WRVA 4A0GA 1MMFB 2NVWA 3F9IA 4DCOA 3TUZC 4YQFA 3BOSA 3CNEA 2P9YA 4RABA 4RTSA 1KI7A 3KUDA 1ECJA 5BSVA 4JP8A 1E96A 5FQOA 2QE7A 5IAKA 3ZDAA 4JENA 4EMBA 1F2VA 3ZDXB 2XYGA 1LSJA 3DAHA 4F4HA 2HI0A 1QZTA 3QLJA 4URYR 3A28A 4G5HA 4M88A 2H1IA 2XZLA 2GYWA 1BH6A 2WTNA 3JVUA 3HU3A 2ZZMA 2MIIA 1YJ8A 5EQTA 2Q1TA 3L93A 5F64A 3NAMA 2H9YA 1PNTA 4PV7A 1OPXA 2CW5A 1KAEA 1WKVA 1YOVA 5IFLA 2YHIA 3KG2A 1NDHA 3T5CA 1N6LA 2B82A 5AM1A 3ZC3A 2VKQA 4GIBA 2JGFA 2VDWB 4QQNA 2PZMA 3VJKA 3UXMA 4L5YA 1D4FA 3GRCA 3RYFB 1L4YA 3O3NB 5E4TA 4TLEA 1Q83A 1BXRB 3KXKA 4ARBA 2A67A 1VE3A 4UD6A 3Q7QA 3A4YA 2VKTA 3B1ZA 2G0TA 4BKMA 4ZV4A 3M6FA 1DDIA 1M1UA 3ORYA 4K40A 4QE3A 2O54A 1NP7A 3DMHA 3QA9A 2ONYA 1XZIA 4I6GA 4R9VA 3OY2A 4HGRA 2F55A 4COOA 1LBTA 4JI0B 1B1CA 2NT3A 4ZT7A 1KY3A 3D6UA 3HB4X 4MVWA 3W6ZA 5AVXA 3GJYA 3QHQA 4RE6A 2Q9CA 3V80A 1FYXA 2IIPA 1LZLA 3DZKA 1T36B 4ODIA 5FNVF 3KJIA 5E2AA 2ACKA 2OUKA 4V3BA 5EZQA 2J0QA 1ZK3A 2E49A 3T5DA 3ZDRA 5IANA 1FS6A 4OKIA 3VISA 4E22A 4A8HA 3K70D 4FNOA 1C2TA 5FA6A 3KQMA 5C3MA 1LVHA 3SI7A 4E11A 1YMVA 3CB4A 2UUCB 4BXOB 2O5EA 1U9ZA 4UNIA 3PKZA 3K30A 4U4AA 4YX9A 4EJ0A 5HKLA 3FKSD 2D5AA 2BBOA 3WG9A 3U56A 1QU3A 1EI9A 2E87A 3EHEA 2CKDA 3N74A 2QW8A 5JAIA 1YB4A 3IAM6 3E2IA 2CXHA 3IOEA 3I9FA 3OC6A 2M1ZA 4AXXA 3L7DA 2QUIA 2YMLA 4YDHB 4DM4A 1RLIA 4BNDB 5DASA 2XWQA 4PPNA 6AT1A 3FMOB 3DP9A 3WGGA 1EB9A 1NNI1 1TX4B 2UKDA 3E0XA 2J9GA 2JAWA 5K0TA 3DXXA 2OPBA 2GZ3A 3QRWA 4LTMA 3JARA 5HMMA 3AWDA 1EXVA 3LYLA 4DYVA 1D1TA 4P4NA 5ICMA 2V7PA 5LZ8A 3QQ5A 3U4CA 1M34A 2NO1A 5JC1A 4HZUB 2EF1A 2HXYA 5T4HA 1N0UA 2PWBA 4CMIB 2OXEA 2ZRQA 2Y9MB 3A6LA 4O63O 4C88A 3P26A 3LI2A 1KYTA 2ZYTX 4UMEA 4YCJA 2VPYA 4I1OA 3VZPA 3KQNA 2OAQ1 1L3IA 5SYMA 2HA0A 1CUIA 1GNPA 1EGAA 3D8BA 3M33A 1Y37A 4TRMA 5EMNA 4A82A 4BRWA 1YOBA 1N34B 4AJOA 4IQ4A 2FEWB 2Y1DA 1PYOA 2Y1GA 3ABZA 5LBTA 3U4QB 3SS8A 2FN3A 4UUPA 5B4UA 2JANA 3S8EA 4OJTA 1MQ9A 5B3KA 3ZHTA 5CH8A 2B35A 3M4YA 1KJ9A 5THKA 4N8SA 4W1QA 2QJTA 4P98A 1NKTA 3PUHA 2PSJA 5IK2D 1ULZA 1EVKA 1GKYA 1OXXK 1E59A 3CYFA 3IMGA 4FMDF 4G5XA 4EJSC 1POWA 1JPJA 2WZBA 2HFKA 3PFCA 2ZIXA 4DEXA 4YRIA 4J1TA 1ODSA 3D8RA 1TK3A 2XBLA 4O4HB 4B46A 2WHQA 1I1HA 2OZPA 3FVTA 3MBIA 3RFXA 1CY8A 3GX1A 2DLCX 1DZIA 1HXHA 2XCIA 3K0AA 1T29A 3LL7A 4QFBA 4EHNA 2DC1A 4TS3A 1LRKA 4FSXA 2EWVA 3ZWPA 3CVOA 5A9SB 1Q3TA 5EJ9A 1NJ2A 3S28A 1QGUB 2JI4A 4XPIA 4YAWA 1N5DA 1S3IA 1URPA 2A9QA 4P4LA 2P1DA 2XAUA 1THZA 1LI7A 3L1IA 4FWIB 4NC9A 4UEOA 4X1OA 3X3HA 2XYPA 1K6EA 5LFAA 2VHQA 3LVBA 1NYRA 2Y3IA 3T9BA 3V7YA 4QYMA 2QVGA 2PJUA 3E9MA 4R7ZA 1UFQA 3HGQA 5IRCD 1BWQA 1NLMA 1NRIA 4ZXPA 3EZNA 1N1MA 3RS3A 1GTL1 1IG0A 1RI3A 2ATVA 2AR0A 2CMHA 1YRAA 2HIHA 4PZPA 1E62A 3GLGA 1GFSA 6REQB 2F3TA 1ZJJA 4DCTA 3H1EA 3RAEC 4CEHA 1OILA 4U2BA 5CB4F 2XWSA 1D6SA 3ZNQA 2ZWMA 4LYJA 3AMVA 5K3CA 3R24A 4HUJA 1BVHA 5KUTA 2ZBDA 3EJ6A 4IO0A 4LQDA 1WCYA 1NBWB 4JIMA 2W6JD 4DA9A 4E1AA 5AXAA 1WW8A 4TKVB 3K09A 1Z74A 3V8QA 3ZXXA 1H0KA 4RK4A 4MGIR 2HPVA 5T67A 1YIAA 4ERNA 4Z4EA 3U3ZA 2CFOA 3K1TA 3KUCA 4RENA 4US2R 5KOYA 2OCXA 2O14A 3MELA 4OOFA 4DSAA 1GAJA 2J07A 2OD2A 4NU6A 3DM5A 4JUIA 1T2DA 1YASA 4R2HA 1K9VF 1TAHA 3GB9A 2PQMA 1XQYA 3PR2B 4KDCA 2FLVA 2ZIAA 4BB9A 1B7GO 3OQ1A 4I50A 4M9QA 4CDMA 5KO2A 1W76A 2BGTA 1HT1E 1QYWA 3OZEA 2P91A 2YXLA 1DG1G 3T41A 2BZ0A 5IVDA 1HSOA 1W1WA 2X3UA 1J7KA 2XB6A 2QUJA 3JY6A 5K2OA 1Y6FA 4RANA 2V0NA 1ABFA 4R9RA 1QUFA 3O47A 5B36A 3BDIA 2CNKA 1GAEO 1T4GA 5F3WB 4ALKA 1S4QA 2J0UA 4BAUA 2RE8A 5NLLA 1DP4A 1MXHA 4K9KA 2IU3A 4HDRB 2IWRA 5BR4A 3OTHA 1V7PC 5BSMA 4D45A 3EVGA 2YINC 1KAOA 2XOXA 1S01A 1S8NA 2ZITA 3H2JA 3I72A 3SC2B 1EHIA 4UUBA 3U2QA 4ES6A 4K3UA 1NUUA 5LLTA 3COYA 4ASUD 1R0KA 3K20A 2P3OA 4IVPA 2VJOA 5K51A 1ZQ1A 3BAZA 4EUHA 4QELA 4XYGA 2CB0A 2NO9A 5FBLB 3IHWA 4RPLA 3VKUA 5EYPB 2EX1A 3VU9B 3IBTA 1N8KA 4JJEA 5H68A 1TZKA 2ATIA 2EHJA 5LUBA 3R8CA 2XD4A 1G4HA 2AG6A 4NBNA 3TLEA 4B4VA 4YV0A 4RD3A 1BMFA 4DMKA 1FFGA 2EJVA 2WIBA 1V39A 4I4CA 4HAYA 4MVJG 4TMTA 5HDQA 4Q3BA 3TF5A 2B69A 4FGJA 3HBAA 2QGNA 2QTCA 5IF3A 2PUVA 4B80A 4C0HA 4F56A 5BNTA 2NSJA 4O4LF 3ROFA 2FZ4A 1R0BA 2AW3A 1NR7A 4MJXA 4FOOA 3HHEA 1TJ5A 1I6LA 5E3IA 3AFGA 1W5FA 1WXXA 3QW4B 1Y89A 2BZ1A 4H6WA 3E22A 3PI7A 3EZ9A 2ATCA 2QD3A 1C1YA 2GI4A 4X8OA 3BORA 3OOYA 3OZVA 5JIBA 3GP8A 4KVAA 4UOZA 1NR1A 1JH8A 1QHNA 4IJMA 4XAQA 3STUA 4I3HA 1V48A 2FWJA 1VCMA 1U04A 1YA6A 2R2GA 1PBNA 2VDLB 2HHCA 4C4XA 5KYNA 1Q1ZA 4ABYA 5HKKD 1WB5A 2Y4OA 1EKXA 4AJJA 1P4HA 2RH4A 2H18A 3ND6A 4J0DA 4KTTE 4CR8A 4Z4HA 2AXQA 4LZJA 2AJBA 3VAAA 5U9CA 1E2PA 1YVUA 1GPLA 3MA0A 2QZJA 4Q4HA 1YBMA 3TTYA 3FWPA 1ADBA 1MJFA 1RFGE 2ZSUA 5DVZA 1SFRA 2DWUA 2HJ9A 3OMXA 3GXBA 5DHFA 5FI3A 4AN1A 5CFPA 1G3RA 5L45A 1GFWA 3KOWA 4YO8A 3WQBA 2Q5EA 3KE9A 1UXKA 3N3AC 5BYJA 4BVHA 5I7UA 3QE9Y 3KVRA 1T26A 4R4JA 1FYFA 2C00A 4KI7A 3LPCA 4LY9A 4GQAA 3UC9A 3WMGA 1C4KA 2AFIB 3DCYA 4MIYA 1NHGA 1Y5IA 2HZBA 2CXUA 3K0CC 4JLAA 1GPNA 2EBFX 5GM1A 4LDPA 5HFJA 3DEAA 5A03A 2Q9AA 1TZBA 1TO2E 2FQ1A 3KLBA 1T1RA 2CLEB 2FUCA 2XYRA 4HQOA 4L5BA 4URZR 3E8MA 4DLWA 4ZI7A 1USWA 1TVKA 2VDUE 3DVLA 4JSRA 4R6WA 5FT9A 1E1KA 2J46A 3FVRA 4E5MA 3LF1A 4Z49A 4P32A 1E0DA 4JUDX 1NLZA 2AD1A 1M7BA 5HUHA 1EFUA 4GHWA 4A6DA 1L4LA 2A78A 4YI3A 2Q3BA 1ZISA 3RVJA 2RARA 3HCAA 5LUAA 3IBFA 4J2TA 4PC1A 2VNKA 4GH5A 5IKPA 3S5JA 3HKEA 2FEOA 2JB9A 4X64B 3NKLA 4NATA 1RPAA 1SUCA 4Z6KA 3FTFA 3TBKA 2A7XA 4WA7A 3DFFA 1UFRA 1C0LA 1IOZA 1M6HA 1H65A 2C2GA 3OJXA 3T3HA 5JXIA 2G8NA 2D1FA 2VATA 2C5LA 3A2MA 2IYPA 3JWGA 2GERA 1NE2A 5B7NA 3ROZA 1VRVA 1QDLB 1RM3A 1KO4A 3BXEA 2PKXA 2H3EA 1WG8A 3L4BC 3LZDA 4URWR 3OPNA 3AR7A 1G8HA 2BGJA 3ND5A 1PG2A 3I9MA 3PYLA 3RRXA 1TC2A 4LDNA 4S1VA 1JXAA 5KHAA 3TQHA 3VR6H 2JI7A 4BO5A 2ACVA 5C8VA 3AF3A 4RTQA 4NRDA 2VK2A 2W83A 1K27A 3VR5D 1T4DA 1FX0B 3EEIA 5FO0A 1KSGA 3KE8A 5B12A 1LF0A 5FWXB 4GX1A 1T24A 4KQIA 4O6VA 2Y93A 5MF6A 2Z6VA 2G77B 4R8RA 3RKUA 1CDZA 2ZFUA 4Q3LA 4NBLA 5TNXA 2G40A 5BVGB 5IT0A 1WKBA 2I4MA 1YL7A 4CQLB 1YRHA 1MXFA 1ZLXA 3HFGA 4MKZA 4KKVA 3CVWA 2YDXA 4MRSA 3TNFA 2VHCA 4CV2A 4K9PA 2JKYA 3H6GA 3DVQX 1HE4A 2DFDA 3GCDA 4BLRA 1XRQA 1NY5A 2P7IA 4BQIA 1XKTA 3I64A 4E2FA 1EG2A 1HH4A 3UMVA 4Z9FA 4EUNA 4S2EA 1JKFA 2G3YA 2RAUA 5DF1A 3I1IA 5GONB 4B87A 2ANCA 4Y2SA 4Q66C 3NHFA 4BFZA 3ZQ6A 1C3XA 1CE8B 4ED9A 2BBTA 3HNRA 2GYYA 1KMQA 2QU8A 1Z4LA 3OBIA 2PRSA 2W2OA 1CPYA 4MIKA 4NV1A 4UJ5A 2IQIA 2VOJA 2QMOA 1E9FA 1QM5A 2YS7A 2P69A 3MAGA 1P45A 3CRMA 5DHRA 1P62B 4GR9A 4ZEVA 5IMSA 5KDDA 3K9NA 5HZKA 3CNNA 1O03A 4ESOA 1KJWA 1G3IA 3H11A 1G63A 3DC7A 1PSDA 2V8BA 1JQDA 1TOAA 4AY2A 3WGTA 3BULA 4NE7A 1HQCA 3ANXA 1XZGA 3U7HB 2YZGA 4FYMA 5CIQA 3SMVA 3BD6A 4S0ZA 4LXUA 2QSZA 1LPPA 2ZBRA 1OX4A 4MHSA 3V33A 1TU3A 2H7CA 5LZ7A 5HDBB 3ZI0A 1B15A 2A5FA 2QQEA 1UPFA 4AX8A 4JI3B 1X9IA 4JYBA 4PFJA 3MJSA 1QG0A 2FLWA 3DBOB 3AVOA 4O2RA 1ND5A 1GL3A 1OY1A 2HX1A 4B3XA 1MENA 4FFBB 4BKOA 4JNKA 1KI3A 5HRUA 5DBGA 2YQ5A 4EYGA 1HE8B 4DZTA 3Q7SA 3R5JA 1LB1B 2HJHA 2DUMA 3CVJA 3O75A 3A1FA 4MVXA 1ZJYA 2J3HA 2E4XA 3OO1A 4JLDA 4MX8A 2JCBA 2ZDGA 4KZPA 4TVKA 3PUZA 4ZVLA 4ZALA 1IN4A 1IAQA 1B43A 4L0QA 2LGJA 1XFDA 1GKUB 1XD2B 5GIOE 3PUIA 3PHHA 3QHPA 3F96A 3O2QB 2DUJA 3PGXA 4CLDA 3RC1A 4EA6A 1F3OA 1H05A 2QS9A 3RD5A 1JAXA 1MP0A 3TL6A 5L53A 5K3AA 3VVCA 3H5LA 3DTVA 4OQQA 3TGWA 5EJFA 2VJMB 3C8HA 5CG1A 2O8BA 5GZ3A 4O33A 1EHCA 1JU9A 1KY5A 3CBQA 1MEJA 1D07A 2Q6VA 3NBKA 5LQNA 3KSBC 4FW9A 2YW9A 3JSAA 1E98A 2TECE 1YA4A 3CSSA 1YDGA 2JH3A 2QW1A 3JSXA 4QLOA 3ABIA 3K5HA 1GGHA 2YL2A 3RJZA 4DTCA 4TKLA 1AO3A 5BWBA 3HYSA 4BV9A 5CITA 1EIZA 2AG5A 1AH2A 1RKUA 2KYRA 4WRRA 5EXTA 3TW8B 2MSDB 3NHWA 3DT6A 4AL4A 1DEKA 5CCDA 3LO8A 1YC2A 3C6KA 3JQ8B 4TZ6A 2HA4A 3KB6A 2WAMA 3NWEA 1OI7A 2BMAA 3ENVA 4LXXA 5E6RB 4CGYA 2C94A 1HEYA 4GLFA 3JW8A 4AZ0A 4E32A 1G3UA 1XELA 3H86A 5A6SA 3F71A 1A5ZA 2H7VA 2Y76A 1PN3A 5JXWA 3VGJA 4PFQA 1MOZA 1WE2A 2E4ZA 3PE6A 1WXDA 4MQFA 5IJXA 1C3OA 5HNKA 2I0FA 2RI6A 3MMZA 3GEIA 3BTUA 2E82A 5BN5A 4AKIA 1JNXX 1FFHA 4PS1A 2IK8A 2ECQA 4D3FA 4ZZ1A 3EEQA 5K4GA 3O3CA 2BC9A 3QUBA 5MN5A 1LWNA 4QTYA 1ZMOA 2E1PA 1XLTA 3D7NA 4TS1A 3WNVA 1LQTA 1T4CB 2NPOA 1VDMA 4UEWA 3CH5A 4QTTB 2ZI9A 3JWEA 1GCIA 3FOAA 1PCXA 5AW0A 4FEEA 5HKOA 4K3VA 1YL6A 2H0RA 4IUYA 4KODA 5A06A 1XPUA 2R2AA 5BQOA 2GPYA 2CHFA 3U40A 2Q2OA 3CWZA 3GJ8A 4D42A 5KWVA 3HKBA 2H4XA 5FYQA 3UJCA 3VTAA 3JQFC 3EVDA 4MP6A 2VUHB 1CFZA 4QBHA 2XKAA 2B5WA 1WF3A 3N8GA 3PUYA 4WUTA 1QYCA 2A0XA 5LP1A 4IGEA 1JLLA 3R0VA 2X41A 4WOKA 3TBHA 1XHFA 3C6QA 3RUPA 1T6BY 3EQZA 1RLMA 1BCRA 1RKQA 2BDEA 4HTAA 4IDPA 4ON9A 4X1KB 2Q46A 2GB4A 2VSYA 4J0QA 2IKQA 3WSWA 4AF6A 4O0MA 1EX6A 4MRAA 3VNQA 7ABPA 1NP6A 4YAFA 5AVQA 1OQAA 4TQGA 3FUWA 1G7RA 4YRSA 3FYDA 3C3PA 3ETNA 3KKMA 5DRTA 5J3JA 4OHYA 1YJQA 2LKDA 1ZVVA 3SYKA 2JCVA 3MS4A 3VNAA 4OXRA 4WK6A 3O91A 1MPXA 2CEKA 2I6QA 1RRCA 1GQSA 3AQ4A 4JOSA 3SEFA 4DN6A 2A9JA 1CJUC 2BDUA 3NAZA 4A8TA 2ZB7A 4ZT4A 3ZY5A 2VN8A 3T35A 1G8JA 5A4FS 5BWLA 3INGA 4HEJA 2D1RA 5JZMA 3K05A 1PD0A 1BEUB 3LVRE 5FUQA 1LDNA 5JVDF 1U3GA 3N3BC 2NSLA 2P68A 3WFJA 4U6NA 1LGYA 1A1SA 3HEMA 1HRKA 1PYDA 1U2EA 1JGTA 1Z9BA 5CYFA 5DNEA 1EFVB 2ILVA 2IXEA 3C5CA 1EZZA 5AHKA 3RYIB 4CBVA 3FMVA 3K32A 1JEYA 4N48A 3UT5B 2EFGA 3T9CA 2BFCB 5EE0A 4G8DA 3HA5A 4OM7A 4GO1A 2VP3A 3FLAA 5IARA 3GQVA 3F3MA 3AHGA 1WQ4A 2PSSA 1BEEA 3NGLA 2Z5VA 1JQLB 1Z37A 4KHZA 4ZGBA 4BN4A 2Z9DA 5I7EA 2A4MA 4HAUA 1AD2A 4B7UA 1I24A 3TW6A 2BFNA 2JLQA 3M4NA 2P4UA 5ECWA 1ZG3A 3G2QA 5HIMA 5ALIA 5IJ9A 1UADA 4JLUA 3G9UA 4ZOLF 1P3Y1 1ZWLA 1G6HA 2IPXA 3AY7A 3EUAA 4ZMBA 1Q15A 4CLRB 1CFJA 1K66A 2GPJA 1AB6A 3CN9A 1P8JA 5IU6A 1C1XA 1A72A 3RIYA 3UGTA 3ZDFA 3IRVA 4K87A 4BNKA 2BPOA 4F2GA 1NDQA 1ULUA 3HZHA 4CTOA 2EKPA 2GX6A 2R6ZA 3UW1A 1ZJWA 4BX9A 3MIIA 5LVAA 1HF3A 3T3NA 4QLBA 1MVOA 2L42A 4LCJA 4QIHA 3SGLA 5LQDA 1PJTA 3RYCB 3GFTA 4XGQA 2AXNA 1PDVA 3ZDEA 4CV0A 4EKNB 5ELXA 1WUJS 1JVNA 4ZZIA 1RXWA 5E9JA 2XNCA 4F3CA 5CCEA 1YFJA 1TUBB 3FDZB 2TYSB 4FW8A 3UXYA 2C54A 4QQ8A 3WIVA 2VVTA 2PT6A 4BFVA 1YZGA 1SWWA 2P6MA 2XQFA 3NDPA 4N1AA 4X3OA 5BQ5A 4MPPA 1C80A 1ULBA 5KINB 3DEZA 5L3RA 2D1YA 1UZUA 4EYSA 1RQPA 4Y1RA 1E1YA 4BS9A 2NP7A 5FOVA 3HY6A 1L5HA 3WAKA 5F33A 1O0CA 4A36A 5EIEA 2OQIA 2V3CC 2X9GA 1NP3A 3MQFA 2JI9A 2IVFA 2FPPB 4QJIA 5M34A 4PWZA 3VVMA 2CVQA 3C6XA 3DAFA 5LC1A 1JKJA 2VSQA 4UVDA 3PV0A 5EXXA 4N01A 4DPLA 4G1FA 1F12A 3QU5A 4IH4A 1CR6A 4AI6A 3KKNA 1K0FA 1E9BA 3C16C 2VPTA 4RD0A 4RL6A 1K3TA 5GY7A 4AG5A 1AURA 1U8YA 1Y5MA 3F2IA 4EK9A 3RAPR 2YWEA 1P2SA 3EXIB 3FDXA 3QTBA 4J07A 4LS3A 4P7BA 3V2HA 2O0LA 1A9TA 1P1CA 2A86A 1KAHA 4NYMQ 3RG8A 3VYRB 4DLSA 1X80B 4FHZA 1P9NA 1OMOA 2HMTA 5EL0A 4CM3A 4ENQA 5CA1F 4EF6A 1U4OA 5LYJB 1NNEA 3ELWA 4XCQA 2B5VA 4L7QA 4MYDA 3UMSA 4C3UA 3CQ9A 1N5RA 5EAIA 1ENYA 1WSBA 3WAGA 5EHZA 1Q0TA 1T2NA 5JAPA 5AKYA 2DULA 1NZJA 1OU0A 4UQPA 5ESXA 1Z5UA 3DV0A 2CVOA 1TCCA 3BMQB 3GHHA 2FG5A 3JZAA 4LVCA 1EEXB 4XH9B 1N5IA 5A5VA 1CJVC 4Q6BA 1ZM4A 1P74A 4UDNA 4Q82A 4WIAA 2NZXA 4PHFA 4EPXA 5F7JA 10MHA 4EKGA 1QH0A 4UZSA 2ZRLA 2ZDHA 3MFYA 1K4MA 3VO1A 1LI5A 1T6YA 3B82A 2A5JA 1OHHD 2ZRHA 3E3AA 4H1VA 1QVZA 2YV2A 2JDIA 2MSKA 1ESMA 1ZA1A 2O4UX 5EHGA 3TIFA 3JAMA 2O2DA 1PV4A 1N33B 2JW5A 4N12A 1OWMA 1W47A 3L4JA 2QYHA 2GPAA 5K8IA 1KI6A 3QV2A 1R74A 3HCFA 5FOUA 4CNBA 4WMLA 4I1YA 3T7AA 3OP1A 4EF5A 3U3RA 2NU9B 5JLJA 4WAUA 2XOKD 3GUZA 4E6PA 4YV1A 3GLIE 4HH4A 3OF3A 3Q0TA 3HBLA 2HC9A 2BEVA 3F5QA 3NHUA 2O1XA 3BIJA 4G63A 4ZEOA 3V4ZA 4Q4LA 5BUCA 3BE6A 4HDSB 1LTKA 3HJBA 2GJ8A 1UM8A 4G0MA 2GAIA 3O4JA 4Q37A 1UP4A 1ZGCA 1XQ9A 1YS6A 5AXDA 4KQEA 1KO1A 4BV2A 3CLSC 5ENDA 3RHTA 1ZJZA 4P81A 4B45A 1X86B 5EE1A 1RI4A 2GWHA 1P91A 3SR0A 3ZU4A 1ECLA 3ENWA 2DKOA 4B7AA 3HXMA 4B85A 2X7JA 1TMGE 4B81A 1W96A 4UM8B 4W63A 4TPKA 4A6EA 1PZNA 2HXSA 2XF2A 4MKRA 1ECFA 4GVLA 2JAOA 4TSKA 4DQXA 2QAJA 5G0SA 4D41A 1T5IA 3MYYA 4H7IA 4X6LA 2E21A 1XU4A 2C2WA 3DO8A 5EG5A 4F8EA 2GK3A 2ERYA 1IWBB 2H16A 2I9KA 3DNPA 3L06A 4O25A 3NXSA 1KBOA 3RTBA 3V97A 1SUEA 4X71A 1KBQA 5I7AA 1L7QA 2GK6A 4IV0A 4D9EA 3NYIA 1OWLA 4JBWA 3NXKA 3AJDA 3S2YA 1UXIA 4C89A 2IYZA 3AR5A 1GLVA 4G1CA 1GZ4A 3LYHA 3N76A 1NTOA 1PX0A 3ZBPA 4EMTA 1A9QA 2C5AA 5I4KA 3SLRA 5ADVA 1NBHA 5JYEA 1L7VC 4MW1A 5NULA 4LA4A 1J0AA 4PC2A 3INYA 2GCOA 2QJWA 3RSZA 1YRLA 2JLAA 2FWMX 5FFNA 3K09C 2R5FA 2H4JA 4OFXA 3HU2A 3W8EA 2CJWB 3WBFA 2IH4A 2FZVA 4FFRA 5BV7A 4HUQA 3IBGA 1J1ZA 3NWJA 3L4KA 4NL4H 4S1NA 2RAPA 3GNSA 4JEIA 2Q4EA 4KYUA 3RK1A 4KVZA 1JG4A 1NASA 4YV2A 2IXBA 3C5WP 1ZN8A 3T1HB 3IT3A 4RZSA 1V1MB 4AUEA 4JI8B 5BSTA 2VPZA 4ERXA 3D7LA 1PWZA 4EPRA 1L3CA 3JQ9A 4D0GA 2QROA 3TLGA 1WU7A 2HA7A 3VJMA 5CFMA 5E4JA 1OFVA 1MV5A 1WF6A 1JQKA 4G6ZA 2W4IA 3S29A 3EXHB 1G6Q1 3GFRA 3HMQA 3A1NA 3QBDA 4WADA 2B92A 2G17A 2BM1A 4TV8B 2P5SA 3IIKA 5KVAA 3ID6C 3LECA 1Y6JA 2ONKA 3IGFA 4JLMA 4B3DA 3UUWA 1SCBA 5ED4A 3BMCA 4QOJA 2W0MA 5CLIA 3QVOA 1IEQA 5B3JC 2W6NA 5EMKA 3ZPXA 1IJBA 1TJPB 2C4MA 2FETA 1Y5RA 5FV7A 1E5TA 1ZCJA 5JFTA 3GFPA 5EIAA 1LUAA 2WJHA 1CUCA 3QJGA 3QVGB 3VMFA 5KC8A 3FOZA 4RMIA 2VG8A 4CTNA 4C06A 4RIFA 3LPLA 1CG6A 2ZUFA 4KO8A 3B1XA 4G5FA 2JRCA 4DA6A 1XYYA 3H87A 3T1QA 4BP8A 3L77A 5BV1A 2BMJA 4W7SA 1KOJA 1L4FA 2BRUC 2CV1A 1W8DA 1J4AA 2NTVA 3EF1A 1T5DX 3RTDA 5BYKA 2QR5A 1M6NA 2W37A 5D5QA 1XFAA 1GZSA 2QSYA 4LJ7A 3EZGA 4DV6B 4F3KA 2AN4A 1R3UA 5CA0F 4N0PA 1WXEA 2VHJA 4K88A 4GOLD 4QDKA 2B21A 5IP5A 1UEXC 3H9UA 3A1VA 3LOPA 4OK6A 5ARCA 3DMGA 3O8DA 3RRMA 1PV2A 1I33A 3Q12A 4OSEA 1DJLA 1NJFA 2CXPA 2HREA 3DL2A 4YAKA 1CVRA 3JVDA 1BGXT 1ISPA 1X2BA 1ECCA 1TF5A 1ZH4A 1ML3A 3CLRC 3DW3X 3NPMA 2ERCA 1RPZA 2ZB2A 3OIUA 4OF4A 1CHNA 4GUDA 5KKNB 2Z5LA 3QOYA 4BNXA 1OKKD 3KYCA 4B4DA 1FRZA 3ZXYA 3CZ5A 1E2QA 1SELA 2Z43A 3HXQA 3LQRA 4GOKA 4X97A 4OHVA 5BSHA 4CQMA 5EY5B 5J2TA 3C41J 1HK7A 2FMIA 1YH3A 2Z9BA 5REQB 4RIGA 3K0SA 1A5TA 4I3GA 4RFSA 3IA7A 1XZCA 3P5SA 3JRWA 3P97A 3QA3E 2QX9A 1CUJA 4P54A 3CX6A 5C0OE 3OKPA 3U1TA 4G0OA 2VA8A 1SUPA 2ZUSA 3UGJA 4KIJA 2FSGA 4KMOA 2AKAB 5FRDA 4GZMA 5HIAA 3CJRA 3L9XA 3PHBE 2C84A 4EA7A 4KAXA 4FE4A 2A1TR 3MJ4A 4FSDA 4F38A 2ONJA 1DTEA 2VDKB 3C74A 3QTLA 3T0FA 2E37A 1PRYA 2WUFA 1IRIA 1EYZA 1JSLA 2NUAA 5SY6A 1F6WA 3E15A 2HF7A 3I4FA 4CDGA 2H9AA 4P9NA 2OMKA 3PUXA 4WN9A 4JJZA 1OXBB 4MLDA 5I5EA 1YF3A 4JZKA 4BDTA 1Y6ZA 4EUFA 3DO6A 2NT4A 5CT4A 1IONA 3BCHA 3PJFA 3RJ5A 1S1MA 4MDHA 4N39A 4BJ6A 5KX5B 3IOBA 1GV0A 4AWAA 3LMKA 4YBZA 4X1IA 3W5HA 3ACCA 5FI5A 1HOXA 3AOEC 3AZOA 5CLHA 1U6KA 3F1KA 3IE1A 1NUSA 3R3ZA 1Z16A 1OLXB 1UAAA 4DMMA 1QG2A 2HEIA 1ODCA 2ZRPA 3WLAA 5JHGB 1EP1B 2HM7A 1AXGA 4GG1A 3VYUB 4EI9A 3PITA 1DEXA 4FD3A 2V7BA 3S8MA 2FE4A 4YUYA 3COJA 1AZLA 4ZQIA 2PGDA 3I4CA 3FCUB 3OT1B 5CMLA 3TD2A 5ADHA 2W8BB 1ZUD1 1ZIDA 5G1NA 5A1JA 1OZFA 4EEXA 5IZCA 3CPSA 5JW6A 1XTKA 5FUBA 2YV4A 2UUOA 3WR5A 1HA3A 3T5BA 3QVJA 3LWDA 3O9MA 4QEZA 3OU2A 3WLIA 5HXAA 5L3SB 3KT8A 4JUBA 5C1BA 4RHFA 2NN3C 4A7PA 2C5HA 4HXFB 3REQB 3X1XA 3TDKA 1TGVA 3I28A 4BE7B 1FJHA 4DMHA 4V1CI 4HSGA 3BICA 3BD8A 3K16A 2XTAA 1VGQA 2IPMA 3IPAA 3D3WA 3PL5A 4DDHA 3FLBA 2GESA 4PEVA 2QF7A 1CUVA 1ZGGA 4DMFA 2FP3A 1DAHA 2R7KA 3KTDA 1V5EA 5DTIA 4C6RA 5E2BA 5K09A 4U8HA 3WSTA 2JF0A 4H3SA 2ZEJA 1ZD5A 1XUOA 3FWYA 4IQ8A 1VJRA 3JRXA 2O3TA 3HNOA 2R7MA 4AVYA 2IZ5A 5B5SA 4BLUA 4EIWA 4WNAA 4ZD6A 5EA2A 1U3CA 1X1BA 3PGMA 4BP9A 3VNRA 3OLVA 5EWMA 3VOTA 2R8XA 2R751 2PR2A 4YA6A 1M8KA 1F8XA 2YX1A 3GOQA 3NAQA 3M0EA 1IPHA 1F9EA 2AQ8A 1Y1RA 1R0LA 5DYYA 4UVGA 2F64A 4R69A 4XIJA 1VJTA 3PXCX 3SEQA 4E09A 2FMKA 4TS4A 1JHRA 4Z4FA 3ZXIA 5KYWB 1XEAA 1YZNA 5TY0A 4F4FA 2IZ7A 3DFMA 3GRVA 4RD4A 3HU5A 3VAZA 5IWCA 3QKRA 4FOLA 1SB8A 2JASA 1JG1A 1L7BA 1NFRA 1SKYE 2XDQB 3NEYA 3PC7A 3OTGA 3QFRA 4G65A 4QBIA 1U7HA 4NOMA 1S7CA 1J0EA 1H1LB 3LWBA 4QARA 5TEWA 2KSQA 1NSTA 1RWXA 4CKBB 3L7LA 4IDDA 1AT1A 3BGSA 1Q1BA 1M2VB 5IN4A 3F0TA 5D6OA 1UF9A 4P3XA 5IM4F 3UWKA 1DJMA 2XUPA 5BQ3A 3EZXA 3QBJA 2Q4RA 2ZJ3A 4I4TF 2D3TA 4QPCA 5KTTA 4DA4A 2J45A 3E05A 1QTIA 1CDDA 2D7JA 1GCGA 2P3SA 2CBXA 1Y4AE 2PCLA 4ECAA 1UC9A 3A8TA 3AG6A 1JQ3A 1QH1A 4GLLA 3SJUA 1N2OA 1DEOA 1BSVA 1ELOA 1NLYA 1GNLA 2C42A 3IV9A 4JR0A 1H2BA 3Q1LA 5IC4A 3R0XA 2FI1A 5JCOA 1O96B 4FBMA 3DDNA 1AF4A 4KN6A 4OBWA 1OJLA 4X54A 3QTTA 1PLLA 4JT2A 2QN2A 1W4LA 1ZPDA 3W5BA 2D7DA 2AC4A 1L8OA 3G7NA 2C4KA 3S7TA 4R2MA 1RRVA 3TJZA 4Z9YA 3IPRA 3BYZA 3RB8A 3KR1A 5KHLB 5JWOA 2FMHA 3V6LA 5CVVA 3UMYA 4J6EA 2ZTHA 4EL0A 4C0SA 3AUUA 3FVQA 1E2NA 1M2JA 1PJLA 2AA3A 4TN1A 4XLLA 4BV3A 4R68A 2FUNB 4FXOA 5F76A 3T3EA 3CO0S 4GSKA 1GDTA 5I51A 4YP1A 1AKEA 2Q8NA 5JLAA 2EERA 2MR6A 5L8VA 3C8DA 4RJKA 3W4JA 3P8ZA 1ZRMA 3GRYA 1WWKA 3QWFA 4QNRA 5ALLA 1A96A 3ZDDA 2FRVA 3NOVA 3ZTWA 4PS0A 1GYRA 3AXTA 4J90A 2CF5A 3Q41A 2DRIA 2IJGX 1JILA 4YAOA 1A9YA 4CMJA 2EBHX 2RGGA 3DMNA 3I6ZA 1SU7A 1E61A 1I80A 3P5BA 4IRMA 4WFJA 4XWYA 5TT1A 3S99A 1D0IA 1E0SA 5DSXA 3V1UA 4XGKA 4B7ZA 3QUSA 1FLVA 1R4AA 3G1WA 5B3LA 4UEJA 2JGDB 5KYYB 3AVXA 3ZWYA 1B8OA 1U2QA 4QUAA 2IITA 1K89A 2IIBA 3HWX1 1X77A 4KACA 3GLIA 4FCVA 3UIEA 3IEPA 4PNHA 4D3DA 1BE6A 1Z2DA 3AB7A 2C8KA 5DZSA 5KTYA 5KPJA 3AEZA 3ST7A 2G9ZA 1E3TA 4FIDA 3OH8A 3I52A 1BX0A 2H1HA 3OCZA 4YACA 3DDZX 1U6IA 1ODKA 4L5JA 3I6BA 4EG7A 3CVXA 1DGQA 4ZAZA 3PEFA 2IU4A 2PWZA 4EJSB 2D54A 4CMBA 1CB0A 4FCCA 2WF7A 4MS3B 2P90A 2IF0A 1DBQA 2CE7A 1C30A 3GMSA 4MUXA 1A4XA 4RIEA 1S0UA 5H16A 4OXIA 5BV8A 3T1OA 1W75A 2OYRA 1U7XA 2UVPA 2AI2A 1FRFS 5CD9A 3E70C 2TMDA 1UK6A 3OIFA 2PZFA 4DEYA 3RBVA 1TCAA 1ZGAA 4K6OA 4M6WA 4OIMA 4V02A 1RAAA 1W6UA 4MCIA 3VZSA 1ZW1A 4TLMB 4DIDA 1YD7A 4DSOA 2IP4A 4H15A 5HRAA 4E13A 3OECA 1QB8A 3V8BA 5FEUA 3FFBA 4GM1A 2ZE6A 1IATA 3I58A 4FK8A 5E8RA 3V7UA 3ZY4A 4ND7A 2NQ2C 2EZTA 4JD5A 3TB4A 3TGPA 2FQYA 2OXRA 3FKSA 4WLNA 5JROA 1Q84A 2B94A 3NORA 4MUAA 5FQNA 1B8NA 2OAP1 4MW9A 2CHQA 4LJYA 3OPYB 4MUIA 3IUEA 3R4VA 3QMVA 4Q1FA 3VNSA 3F73A 1NW3A 2YJ6A 3PFNA 1FSGA 4HMQA 5CD1A 2X5NA 3ONVA 5F2OA 4ARZA 3RRBA 2ZR7A 3F7MA 5P8WA 2IUUA 4CPDA 4YAIA 1KMHA 1SIBE 3CNOA 2LP4Y 3KQTA 1EH5A 1XCOA 5L7TA 4YNBA 3RC3A 1TQDA 3SE0A 7GPBA 3I09A 4K9RA 4AM8A 1KKMA 2KJQA 2QTRA 5DHPA 2PRZA 5HIKA 1RZRD 2IE8A 3EYWA 5EERA 2WYHA 2G9UA 3SHWA 4ZVOA 4DCUA 4DFDA 3GLQA 3LZCA 3JYHA 3KWFA 3ZWQA 3A3KA 1H9CA 1OGYA 2Z8YA 3HP4A 1CUEA 1SIWA 5CCXA 1DMSA 4PQFA 4YGXB 4FYWA 5DI3A 4Z0HO 4YALA 3U4MA 2C5GA 2O3UA 3BL6A 5EOVA 1Z8FA 3PC2A 3LC0A 1FFAA 2Z95A 2ZYWX 3LCUA 3DKRA 4REQA 2Z5GA 3IAS6 3WY9A 3F8TA 1KFCB 2ZLBA 2NIPA 4ER0A 3G82C 1YNSA 1MO5A 2AT1A 3U61B 3WB2A 2Q3EA 3FNFA 3JZDA 5EXSA 4B5LA 2XQJA 3RDPA 1YE8A 1YUNA 5AOVA 1YK0A 5CW1A 1DX4A 3RRJA 3F1LA 4IIJF 3SPXA 3WLSA 4D9KA 5JJCA 5IXYA 1N9GA 4D4IA 5E38A 3WNQA 2VDQB 3DDOA 3DLCA 1RP1A 1Y98A 3E3OA 3I2JA 2LUOA 4YP5A 4M7WA 5D3MB 5IK2A 4WA8A 5LXTF 4EB8A 1VJ0A 5KPDA 1OBOA 4GNRA 2RGUA 3R9XA 2ZT7A 2L69A 3CPJB 3NKFA 5ITZA 2PKCA 1SXQA 2IUYA 5JSYA 4IZOA 3N2LA 5BNIA 3G1UA 5AI6A 3EN0A 4YRMA 2WKQA 1NVVR 3NT4A 1VECA 1PBTA 3DHNA 4GQIA 1Z0FA 4M89A 5DLDA 4UBMA 2B9VA 1TEZA 5TR9A 1NUHA 5BMVF 1T8WA 4IWXA 2QW0X 3BBPA 4MMZB 3V4OA 1DRUA 4NBKA 4XI9A 3LPNA 4AMUA 3GRAA 1BJRE 1HLGA 3Q5GA 2IKSA 3GDGA 1CEYA 1SG9A 3G59A 3NYWA 5JJIA 4PSUA 3NVDA 2A5GA 2I7CA 4UMFA 2FRXA 3E7DA 3UJHA 2HQSA 2RH9B 3LC2O 4TUYB 3PQEA 4F4DA 4XA8A 1RE1A 2K2QB 3NIBA 3R5TA 2POQX 4DR6B 4PSAA 1ISGA 3IKMB 3TLBA 4DCSA 3U60B 4NZOA 1QNFA 3M6MD 3HKCA 5KS2A 1B3BA 4JBNA 2FVYA 2R8PA 2NSDA 3G5TA 3QF7A 4CTKA 3EMBA 2GM3A 5KDLA 4BBJA 1KZ6A 1BOFA 4J16A 4KH0A 3NUGA 3HWRA 1EM6A 2FDRA 2F9MA 2NVUB 1U6JA 2WLSA 3GRZA 4RVHA 2PQ0A 1J2EA 1FLNA 1PJ4A 1ZRHA 2PFGA 1X74A 3KPJA 4FEAA 2IV7A 4MQEB 4TYMA 5J4LA 4RVCA 3WJ7A 3W9YA 2GZHA 4LYGA 5JH7A 2Z2IA 4E1BA 1KO5A 4UOEA 2CDBA 4DDMA 1EIWA 1I1OA 4U2GA 2JGKA 3D0KA 2ABWA 3U4GA 3EMVA 1W36D 4X60A 1RACA 2FEXA 2WMYA 1U2ZA 4EM6A 3CE6A 1MO2A 3L1UA 1VBMA 2X15A 1MIOB 2N75A 5COAA 4K2HA 4EJ6A 3DOIA 3ZY2A 4EENA 2RI1A 4RADA 5IYZB 4O4JB 1J9EA 3V8EA 1T2VA 2FR8C 1OZAA 4KNYA 1Y42X 2IA5A 2FX3A 4M0UA 1WXIA 3QFCA 4M9XA 4OQLA 4US1R 3UJ6A 5KNCH 3B8HA 3C8MA 5BR7A 3DBRA 1SOVA 1EK6A 5G0TA 3ADCA 5AM3A 1HDEA 2B8TA 5BOVA 4KUHA 3Q10A 1L5SA 1NZDA 3HO8A 4NQRA 4WOPA 3VPDA 3VSDA 3CTMA 1PTJA 2RFLA 2DBVO 4YIKA 2O3QA 5EE5B 4H60A 1IBRA 1NSYA 3BFPA 3C7KA 4KFTA 3P9KA 4GZLA 1AVTA 3PIRA 4PHCA 2PH5A 3UN1A 4URVR 3NETA 3K9WA 3FFXA 2JIMA 4PF1A 3TVYA 1JR4A 1R0ZA 1MB9A 2OEPA 5TQ0B 1JR6A 4HQ6A 1HE2A 2I54A 3IXMA 1MOPA 2ZRCA 4ICIA 4JJ7A 4OMFG 4PYOA 1L8XA 3KQPA 4NWIA 4OHXA 1F2UB 1HRDA 1S4MA 3B78A 3ES9A 3HR8A 2G9RA 5DBFA 3ZWVA 5KWSA 3HACA 3BMOB 1EQUA 4IEEA 4P4SA 4HNGA 1SC3A 1KJIA 1BYIA 2J3JA 1M0SA 4FYYA 1AQ6A 4MW6A 1XLVA 3PYXA 5DTMA 3SWWA 2VTVA 4GMHA 4N4AA 4C1NA 2J3MA 3GJZA 1VI6A 1FMJA 1YKSA 3S2EA 4BLOA 4DUGD 1JDPA 2ZE8A 1J70A 5AHXA 3DAOA 1GXSB 1UOPA 1E6CA 3CZRA 5K0LA 4J03A 2BFMA 5AW7A 1H2WA 1PW7A 4PGMA 2HK6A 4MITA 5HQ3A 2ON6A 3UUGA 2JHCA 1FXUA 3ECCA 4OJMX 5F4BA 4EARA 3GFGA 1JHUA 4F06A 4COKA 3VSEA 1IOLA 1NF2A 1GDHA 1UFKA 4FMCF 1Z2PX 5FUYA 3UHAA 2YTZA 1IHUA 3T9EA 2BWJA 4KV7A 4DCPA 4BFXA 1UDBA 3U81A 3JQQA 1KYXA 5EFOA 2GLTA 4EG5A 2UUBB 1N0HA 1BWRA 4X1YA 3AF5A 2JLBA 5DNVA 2CXXA 1FE8A 1E4EA 1SQGA 4BNZA 3C4JA 4QOEA 1E32A 1U28C 3DZDA 5DM4A 1QHHB 2C9ZA 3CRRA 5HKKA 1L5MA 8AT1A 4FJ2A 4DA7A 1I3OA 3PFGA 3OX4A 5LZ9A 4C6TA 2EFDB 2GEFA 1PGNA 3CIOA 1QP7A 2QRHA 1O5IA 2R8OA 1L3BA 2UXDB 1P5JA 3KP1A 1GNSA 3BBLA 1H66A 1R64A 3O82A 3I9NA 2XMPA 4RE5A 4Q4JB 2VJDA 1EK2A 2H06A 2IZOA 4UCXA 5AHRA 4WNYA 4IRUB 1ISRA 1KIAA 2DHDA 1EUZA 2XVXA 3DBVO 3MLBA 3LQ2A 1NXVA 1W9HA 4ZCMA 3L0SA 3AR2A 2ZJ0A 3RSFA 2PEYA 4CUJA 5IX8A 4BNHA 3LHIA 1DUSA 1NT2A 3IYLW 1ZD8A 2OHXA 2AXPA 3R7SA 9ATCA 2CY0A 2C9BA 1ZVKA 3FYTA 3FIUA 1YVEI 1RYZA 3QIAA 3QYJA 3P2IA 4BN0A 5A5FA 4DTIA 4CODB 6ABPA 4YR7A 1V37A 4X3PA 3ZJVA 2QYTA 4I5DA 2XKJE 2CXOA 1RI5A 3DHYA 4M0KA 4ZI5A 5A02A 2LD4A 4YRFA 3I1YA 2I4RA 5DU2A 2MSCB 2HJRA 1Z4OA 2RI0A 4NCBA 1VE1A 1YQDA 5IJ0B 5BNZA 3E5MA 4EWLA 3F4BA 4EP1A 3EGCA 3W5UA 5HZMA 4GDMA 2ZYAA 1E99A 2R1VB 3OU6A 1JQJC 5EPOA 4F85A 2FUG1 3O8NA 3D3EA 4WNCA 1HYBA 2PMFA 1W2WB 2YZ7A 2AVDA 3PCTA 1VE6A 3ICVA 4MQLA 3WC4A 4C01A 4M98A 3ZGXA 3E5RA 4RKEA 3DB2A 1HMPA 1YWGO 1FUIA 2D1QA 1FY2A 1TA4A 2YJNA 3P9YA 3PXDA 1W52X 4G4SO 1G55A 1EUDA 4DIEA 5KQPA 1DAMA 1A77A 2HCTA 4A16A 4GICA 4PCLA 4GR5A 4NAUA 4UE2A 5FBQB 3FSGA 4DY6A 3E7PA 1EUQA 4P0QB 3VA7A 3V1YA 4Q02A 2D4AA 3AF2A 4P93A 3ZBUA 1YZQA 2NQTA 1WMBA 4G5YA 4DVJA 3WGIA 5DHQA 4BGEA 1YVPA 2DQZA 3AEKB 4PG7A 3H2IA 3OKAA 4NZPA 3WK4A 2RK4A 4KE9A 4BNLA 5AW8A 1R8JA 1V6SA 2QPTA 4AAYA 4PX2A 3ETDA 1EDDA 2GN8A 2OL4A 4AJKA 4ENPA 3AHDA 5J40A 2AMYA 2HFJA 4E6EA 2I6TA 3ZE6A 4PXAA 1IMJA 2PX2A 4Q3DA 2IYRA 4D96A 1XZEA 4K6FA 1T8PA 1RHRA 3Q2OA 1OBHA 4LE0A 4TVSA 4BQPA 2UZIR 1ZUNA 4A2WA 1AKVA 2EWWA 3A1DA 3GPDG 4S04A 4UVHA 3WYGA 2PMBA 3UUEA 1RQLA 2QN8A 2ORVA 1E2EA 1K06A 1M54A 2X19A 4DM3A 4IAOA 5DHSA 2NO7A 3MS7A 4CQNA 4ZK6A 1R9GA 1H4SA 4F3TA 3HGMA 1ENPA 1IJKA 1S9HA 2AMJA 4HBGA 4TM7A 4ZO4A 3W1EA 8ATCA 2NU8B 4LOHA 4IDNA 1KPIA 3OJFA 2AMVA 3GGOA 1OI3A 3N86A 4AJ4A 4R9NA 4C4YA 2RKWA 3L3BA 4S1TA 4F21A 5JADA 2HMAA 3SQXA 2CNWD 2W0SA 2GPTA 3PJRA 5CXXA 1YZFA 1P18A 2EGGA 2W2NA 2BMFA 1TJ4A 2H1SA 2O1EA 2G5GX 4J1NA 1CP2A 4J0HA 2C04A 1I0LA 4UBLA 1KSJA 4EGJA 2FYTA 4CIXA 4DMRA 2G82A 2DOKA 1N2SA 4DBZA 2AYYA 3M1LA 3LBYA 5HIJA 1P7VA 1P81A 1VHQA 2GD2A 4NVRA 5FPQA 1A9XB 1GUBA 3FNQA 4ISBA 3IULA 2FZGA 1MUUA 3ZY3A 1M8JA 5K01A