4X41A

Crystal structure of protein arginine methyltransferase prmt8
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
311
structure length
311
Chain Sequence
GIHEEMLKDEVRTLTYRNSMYHNKHVFKDKVVLDVGSGTGILSMFAAKAGAKKVFGIECSSISDYSQKIIKANHLDNIITIFKGKVEEVELPVEKVDIIISEWMGYCLFYESMLNTVIFARDKWLKPGGLMFPDRAALYVVAIEDRQYKDFKIHWWENVYGFDMTCIRDVAMKEPLVDIVDPKQVVTNACLIKEVDIYTVKTEELSFTSAFCLQIQRNDYVHALVTYFNIEFTKCHKKMGFSTAPDAPYTHWKQTVFYLEDYLTVRRGEEIYGTISMKPNAKNVRDLDFTVDLDFKGQLCETSVSNDYKMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Protein arginine N-methyltransferase 8
publication title Protein Arginine Methyltransferase 8: Tetrameric Structure and Protein Substrate Specificity
pubmed doi rcsb
source organism Homo sapiens
total genus 78
structure length 311
sequence length 311
chains with identical sequence B
ec nomenclature ec 2.1.1.319: Type I protein arginine methyltransferase.
pdb deposition date 2014-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06325 PrmA Ribosomal protein L11 methyltransferase (PrmA)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.160.11 Mainly Beta Distorted Sandwich Hnrnp arginine n-methyltransferase1 Hnrnp arginine n-methyltransferase1 4x41A02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4x41A01
3GWZA 5DXJA 3AY0A 5BP7A 2EG5A 2PT6A 3A7DA 4WVLA 1G6Q1 4XUDA 2LD4A 4PYLA 1L3IA 4RTKA 1AQIA 5K0FA 3A26A 5DSTA 1JG4A 1VQ1A 2WA1A 3FPJA 3FZGA 2PKWA 3I9FA 4DCMA 5CIYA 2UYQA 3SXJA 3JWHA 1KR5A 4PCLA 3FYCA 2AOTB 1NBIA 1F3LA 1QANA 3EVAA 5EZQA 3LCVB 5ICFA 4YUVA 5K0GA 2XBMA 4BLWA 2P3QA 3EMDA 1ZQ9A 1SQGA 4MIKA 1BOOA 5KQSA 2G72A 4GBED 5GWXA 5FADA 5EQJB 4RTMA 2NXNA 3I58A 2V74B 4PINA 3A27A 3GRVA 3LBYA 1DL5A 5FTWA 2UYOA 1JTFA 4AX8A 4EKIA 1FPQA 3EEOA 4ISCA 2R3SA 4RX1A 3SSMA 3G2MA 2HTEA 3D2LA 4XCXA 3C6KA 2VS1A 2PXCA 3AXTA 1NKVA 3UJAA 3TKYA 5DT2A 2AOXA 4KIGA 4R8RA 4LWPA 3RIEA 4PNEA 5DM2A 3R24A 3TQSA 3B7PA 3NVMB 2JHPA 2ZTHA 3P97A 4AZVA 4DMGA 3FTDA 5BXYA 1G60A 2I62A 5HOQA 5LQAA 3KHKA 3UA3A 1UWVA 4OBWA 1UFKA 5JR3A 4CKBA 1X1BA 3UFBA 2B25A 4V0RA 1FBNA 1M6EX 2FHPA 2YTZA 4OX9Y 4PYJA 1Q0SA 2AOWA 2PX4A 5EG5A 2KW5A 4E30A 3M6UA 4E2XA 3MCZA 2ZW9A 1XDZA 1YF3A 3OU6A 3RODA 2EJTA 2ZFUA 2I6GA 5CVEA 3VYWA 4GUAA 3THSA 5JUWA 1NBHA 3DULA 3GGDA 3VSEA 5K8VA 2EFJA 4NECA 1F38A 2V7EA 5KYGA 4JXJA 4OBXA 4E31A 1QAQA 1XJ5A 3LDUA 2H00A 2NP7A 3KR1A 1FP1D 8MHTA 3SM3A 1H1DA 2AN5A 1NV9A 1NW6A 4E2ZA 3G2QA 1BKYA 3V97A 1Q0TA 1OR8A 3CJTA 1NE2A 3KPVA 5DM4A 5DXAA 2PX5A 1YFJA 5EVJA 4PYMA 2PLWA 4U7TB 2IH2A 2I7CA 2O07A 3GXOA 2CWWA 3G2PA 4FGZA 2BR3A 4V0QA 3FYDA 2PWPA 5LQCA 4E33A 2GA9A 2BH2A 4C06A 2ZBQA 4KDRA 4QTTB 1RI2A 3TM5A 5GIPE 2IBSA 3HCAA 3BWMA 4RVFA 5E1OA 2OZVA 3OZRA 4DM3A 2AOTA 2PXXA 2B9EA 3SSNA 5T64A 5HIKA 3G8BA 2ZIEA 1X1CA 3LECA 2ZWVA 2AOVA 5DPMA 5DTMA 2P7IA 1VL5A 1VBFA 4RTNA 1MJFA 5LR6A 5FULA 4RVDA 2FK8A 3C3PA 5FA8A 1JTEA 4PGGA 4CXMA 3Q87B 3KPWA 1YZ3A 5EEGA 5P8WA 2IP2A 3A4TA 2ORED 3L8DA 3MQ2A 4P7GA 3KQOA 3O31A 3TLJA 2Q41A 5IH3A 1I4WA 3KPUA 3M33A 3OU2A 1KYWA 4HH4A 3T7RA 2G1PA 2G8NA 1G8AA 2P8JA 4K6MA 5FQOA 1X1AA 3FUWA 1WXXA 4RTSA 4PYQA 5E2BA 2AN4A 1SUSA 3FUUA 2ZZMA 3IYLW 3S68A 3ELYA 1TW2A 4QVGA 4FR0A 4LECA 5CUQA 5EOVA 3GRUA 4KWCA 1WY7A 4CWAA 3DOUA 4YV0A 2O06A 2IBTA 3LX6A 1ZG3A 4ZTBA 3UBTA 3FUVA 5GINE 5EIWA 3FTFA 3C6MA 4GQBA 2A14A 2JH9A 1L3CA 1EQAA 4G56A 2NXEA 3PT9A 5K0NA 1KPGA 1INLA 2P7HA 3EGIA 1T43A 3DR5A 3E7PA 4X61A 3G5LA 4PIPA 5E1MA 1EIZA 4EK9A 4RWZA 2YXEA 5G02A 5BW4A 3M4XA 3P2EA 3M6XA 4LG1A 1RI5A 3KU1A 4QQKA 4YMHA 3H2BA 3KKZA 5EKXA 4IKPA 1N7IA 5K0LA 1VP9A 4AZTA 1KHHA 5LQUA 3UA4A 2F8LA 2YXDA 1Z3CA 3T7SA 5HEKA 5GP1A 4UOEA 5EMLA 4DQ0A 1G38A 4MHTA 4CTJA 2XYQA 1KP9A 1KYZA 1QZZA 1R8XA 2QE6A 3C0KA 4GOLD 3T7TA 5CD1A 4M7RA 3ER8A 3CVOA 5C1IA 2CL5A 2K4MA 3GRYA 3IV6A 5E9QA 4RTOA 4PYNA 3PTAA 2IGTA 2VDUE 4KRGA 4YUWA 4FSDA 4XUEA 2HNKA 2OY0A 2P35A 3KPYA 5ICCA 1R00A 5HIJA 1HNNA 3HVIA 4KIFA 4C04A 2IDKA 3GRZA 5FWDA 1XDUA 1P91A 2PGXA 4IV8A 2H11A 3BKWA 1JG1A 3HA5A 5DRTA 2CMHA 4F85A 3O7WA 4C03A 2N47A 3JWIA 5EHIA 4GOOD 1QAMA 4ER5A 5HILA 3PVCA 3P8ZA 5DX8A 3PLAE 1XDSA 3E05A 4E32A 2AOUB 4PYKA 2NXCA 2WK1A 2C7OA 1P1CA 2PSSA 4CKEA 3M70A 2O05A 1P39A 3UJDA 3X0DA 4RTPA 2BM8A 4HTFB 5EHGA 4RTLA 2FYTA 2VZ9A 5F2NA 5K05A 3DXYA 1UIRA 4OA8A 3HCDA 4LWOA 2O0LA 3CC8A 3P9NA 1R74A 1R8YA 3EVEA 3K6RA 1Y8CA 5LQRA 2AN3A 4RTRA 1KXZA 2NP6A 1IXKA 1N2XA 1YB2A 2XVAA 3NWEA 5DLYA 5IKMA 1SQFA 4RVGA 2FRXA 4Z2YA 3HVJA 4GEKA 3E23A 4A6DA 2QRVB 3KQMA 2PX2A 5DWQA 3P2IA 3AXSA 4FSXA 4YUZA 5E1BA 5F2OA 3CJRA 3GNLA 1D2GA 4M38A 4AZSA 3B5IA 2UYCA 4RTJA 5K03A 2PXAA 3KQTA 5D1NA 4PONA 1P1BA 3NTVA 3R9XB 5FWAA 1D2CA 2B3TA 3KR0A 3CBGA 3DUWA 3TMAA 3P9IA 2IPXA 3BGIA 4QDJA 1EG2A 1VP3A 4BY9E 4FS8A 4H0NA 4M36A 3TRKA 1YUBA 2GLUA 2GPYA 2OYRA 3CJQA 3G8AA 3KR9A 3PX2A 4F86A 3FTCA 5BW5A 1NW7A 4PIMA 3NJRA 1RI3A 2ZBRA 3EVDA 3KQQA 3QOWA 4XUCA 4O29A 2HR1A 3AWIA 3ID6C 3LSTA 1PJZA 4P7FA 5DTRA 4QDKA 3I5UA 5EPEA 4CTKA 5MHTA 4GOND 3FUXA 2OXTA 1XCLA 3R0QA 3I64A 5EMJA 3UJCA 3EEYA 1KPHA 5HFJA 2CMGA 1M0EA 1NW3A 4ER6A 1AV6A 2ESRA 3UJ6A 3DLCA 1QYRA 4RYLA 2P3OA 3QV2A 1JQ3A 2ZSUA 4GC5A 4RVHA 1U2ZA 3OE4A 2FK7A 3UJ8A 2BR5A 5K0CA 3OE5A 2B2CA 3BKXA 4QTUB 5FA5A 1VIDA 3M6VA 3FRIA 1WS6A 1EJ0A 2GS9A 1IY9A 3E8SA 3EGVA 4R6XA 2IH5A 2XYVA 3SMQA 4QPNA 3VC2A 5EMKA 3OCJA 2H1RA 2PY6A 4OQEA 5GIOE 4DCGA 1ZKDA 4CKCA 2HWKA 1R18A 1L3BA 3LL7A 3OFJA 4HSGA 4R6WA 5EMMA 4EMSA 5M5BA 4DF3A 4POOA 2AOUA 3HEMA 2YVLA 5EKUA 4RSRA 3V8VA 5EIFA 5LQKA 1SUIA 3BWBA 5E9WA 3TKAA 4ER3A 3FUTA 1JSZA 3OZSA 4GC9A 3OPNA 4HTFA 1AF7A 2EX4A 5F2KA 2P41A 3P2KA 5CM2Z 3G5TA 3P9KA 4E2YA 3CKKA 1ORIA 1DCTA 3DTNA 3U81A 3LDFA 5K0JA 3KQSA 3LBFA 3ANXA 4U7PB 4HC4A 1QAOA 2YR0A 5KS2A 3GU3A 3B3FA 1X19A 4FP9A 9MHTA 4C07A 1TW3A 2ZIGA 3PX3A 2O57A 2QRVA 3GO4A 4KW7A 2GH1A 7MHTA 2AR0A 1YZHA 1ZHFA 3DXZA 3KQWA 3P9CA 4IV0A 1O9GA 5LQNA 5CCXA 2PVCA 3GJYA 1NV8A 2ZBPA 3SGLA 1JQEA 1JQDA 2ONYA 3KPJA 4GF5A 5DM1A 5K0BA 2ZZKA 1FP2A 2EJUA 5D1HA 5CVDA 3A25A 3CGGA 1ZGAA 2ZVJA 4HGYA 3QOXA 3DP7A 2PT9A 3NW9A 2OPBA 2ZULA 4WXHA 3R6TA 4E70A 2XVMA 3FPFA 2ONZA 3C3YA 1WG8A 3TOSA 5C9ZA 2DPMA 1AQJA 10MHA 3CCFA 1L9KA 3F4KA 4AUKA 5KQRA 5DSXA 1EAMA 2OKCA 5CVJA 5B1SA 4KDCA 2P1DA 1KPIA 2JHCA 5DTQA 1WZNA 1I1NA 2ADMA 2ZWAA 3BWYA 1X1DA 4IWNA 3MB5A 5GM2A 5LSAA 1R6AA 1RJDA 2BM9A 3KQPA 4HG2A 2C7QA 3DLIA 1TPYA 4FT2A 4RV9A 5T67A 3HCBA 3DH0A 5E8JA 4YUYA 3G2OA 3PS9A 3R3HA 3UZUA 3PFHA 4DA4A 3HCFA 3OU7A 4BP1A 4EVIA 5FCDA 1SVUA 4YV2A 4DZRA 5CCBA 5EEHA 2AVNA 3LGAA 4ER0A 3M6WA 2VP3A 1V39A 3LCCA 4P58A 3ELWA 3IEIA 5K01A 5ERGB 4QPPA 3EMBA 4HRAA 4F84A 1SKMA 3HTXA 2OBFA 3KQYA 3HA7A 3ELUA 1I9GA 2G70A 3ER9A 3WSTA 3LCUA 3NVKI 2JHAA 2ZCJA 2OO3A 3O4FA 1NT2A 3DMHA 4R05A 3EVZA 3FTEA 4A6EA 4AZWA 3LKDA 3DMFA 2ERCA 3BUSA 4BLVA 3UJ9A 2CKDA 2FPOA 2VDVE 5EZSA 5FHQA 1N7JA 2UYHA 2PWYA 3FPGA 2HMYB 2IFTA 3TR6A 3RW9A 1B42A 4EKGA 1XCJA 3FPEA 3B89A 5GM1A 5ICGA 3BT7A 1BHJA 3Q7EA 2IIPA 3FPHA 2Y1XA 3LHDA 1MHTA 2UZ4A 4FT4A 1HMYA 5E8RA 4MWZA 1VLMA 2NNWB 4QVKA 5GOZA 2IH4A 1ZGJA 4E2WA 2YX1A 1JG3A 3PFGA 2C7RA 2PBFA 3DMGA 1NW5A 3ORHA 5FHRA 3TPZA 3ELDA 3PB3A 4M37A 1VPTA 4YMGA 2GAFA 3BGDA 3G7UA 3HNRA 4C4AA 3G89A 2IDJA 2ZZNA 3EVCA 1JSXA 4X63A 3HP7A 1XXLA 3BWCA 4Y30A 3LKZA 5CVVA 4PYOA 3HCEA 2NYUA 3HVHA 3JWJA 3LDGA 5CVUA 1XVAA 5EC8A 3REOA 4B17A 1FJXA 1DUSA 4PGHA 3DXXA 2AZTA 2OB1A 3TM4A 2Z6AA 1PRYA 2G71A 2Z6QA 3G88A 4MQ4A 4X41A 5EGSA 2PJDA 3K0BA 2JG3A 1VE3A 3SSOA 4PYIA 3T0IA 3AJDA 4DKJA 3GIWA 3OZTA 3EVGA 5H02A 4EQZA 1O9HA 2OB2A 1RJFA 5FUBA 2QYOA 3EPPA 4X60A 2HV9A 4KVZA 3EGEA 2ZLBA 1L1EA 1NW8A 3FRHA 3OFKA 2DULA 2I9KA 3BZBA 3MHTA 5HZMA 5DX1A 3ERCA 2YUIA 5DM0A 2JJQA 5HIMA 3UWPA 2VDWA 2E5WA 4ATNA 3GCZA 1RJEA 4HGZA 5K0EA 3SR4A 2Z6UA 4P7JA 3EVBA 2B78A 2QY6A 3ME5A 3I53A 1O54A 3EVFA 3HM2A 4P7KA 1RJGA 2QM3A 3P71T 3UJBA 1G8SA 3TFWA 5E2AA 4OA5A 4PCAA 1IM8A 4FZVA 2PV0A 1YFLA 3IHTA 3NWBA 1RI4A 2AVDA 3JWGA 2Y1WA 1EJ6A 1G55A 1WXWA 4ER7A 4RTQA 2FCAA 5T6BA 4MTLA 3SX0A 3MTEA 3SVZA 1RI1A 3KR2A 2WA2A 1D2HA 2BZGA 3GDHA 3NDIA 2AS0A 3MGGA 3UJ7A 1BC5A 1XTPA 5DRYA 3HA3A 2XYRA 4L7VA 3MERA 3HCCA 4Y2HA 5E1DA 3MCTA 3B3GA 4C05A 1M6YA 5DX0A 2GB4A 3LPMA 2PX8A 3MAGA 3NDJA 5E9JA 4QQNA 3HVKA 4BLUA 3NMUF 3A7EA 1ORHA 2P3LA 2JH8A 2YQZA 1KIAA 2P40A 2BR4A 4PWYA 4GOMD 5C0OE 3GRRA 3BXOA 5U4XA 3KQVA 5ICEA 5LQJA 3MTIA 1JG2A 1JR4A 5KVAA 3B3JA 4C08A 1SG9A 4OQDA 2YXLA 3THRA 4X1OA 3VC1A 4R8SA 4YV1A 4YUXA 2R6ZA 5K09A 5HIIA 2C7PA 3BGVA 2ZIFA 5FQNA 2NXJA 4BP3A
chains in the Genus database with same CATH superfamily
3I3OA 1VECA 1ZK1A 3PYXA 4M1YA 1PR3A 3BDAA 4WKNA 3PXGA 1O6CA 3UHOA 1VJCA 3K2QA 9ATCA 1Q5PA 4BO0A 1V48A 1WQ3A 2O2DA 2J0UA 3VYVA 1L8AA 3HKBA 1ADBA 1Y3AA 2JIRA 3ZW9A 5H8WA 1VKZA 3L1KA 3ZDQA 1V6AA 4LWQA 4KJZA 1AO3A 5G4KA 3LLVA 4MLZA 4OOEA 2ZJZA 3L1UA 3FB1A 1S4MA 4TLMB 3RVMA 2QX9A 3C3KA 4BLWA 4DRYA 1SQGA 5IZ4A 4TXMA 3WGLA 1ZNXA 2IYRA 3TIIA 4DNOA 1JAXA 1JTFA 2B8EA 2Q2OA 3QFHA 1K0UA 4FFPA 3Q7SA 4ZCPA 3EEOA 4LHYA 1WNFA 3MINB 1O57A 3QWBA 2C3UA 5EKTA 4C1NA 1F0KA 2I4IA 1LGYA 3G9ZA 1ZOLA 2WHPB 4EHIA 1ULBA 4RULA 5DI9A 2DFPA 2R97A 4QXAA 3VR4H 4KXUA 1HG1A 1BG6A 1FL9A 2FPKA 1P4HA 3WBKA 1Z35A 3DC2A 4JT9A 3WLAA 1X1BA 2OCBA 4NCKA 3ORYA 3UFBA 4IDOA 3B1YA 4WZ6A 2IXEA 3NONA 4DIOA 5C3MA 3ADBA 3SJUA 2VYCA 4LQDA 4HN2A 3ZWAA 3HUDA 3DL7A 4AO8A 5IU6A 5AK4A 3QXSA 4DA9A 5IAGA 5JZSA 2PX4A 1IZ8A 3OEHA 4V3BA 2Q5EA 3U13A 2HAEA 4ZZ2A 3KLBA 3HZOA 4HOYA 1Z4IA 2HSDA 3QVMA 4K40A 5KHLB 3GVIA 2GRAA 3PWKA 4RZUA 3FPLA 3E6AA 3B12A 3DULA 2BEVB 4F60A 1PZGA 2EFJA 4RGVA 1O1YA 1OWPA 2GT1A 2NGRA 3AQ4A 3LCJA 3Q9LA 3SHOA 1XTZA 3VDNB 4B8YA 5KU1A 1E6CA 2YV4A 1E2PA 1OTXA 4OBXA 1QAQA 5IK2A 3T4PA 1ACLA 1O8BA 4E22A 4RPCA 3NH9A 5JXIA 5KQGA 5K4HA 4E1VA 3H4IA 1EDOA 2C2YA 3H4TA 1OX6A 1VM6A 5I7UA 4CEJA 1WD5A 2JFBA 1Z8NA 1EFCA 2A4MA 3VNUA 4GYYA 3BTVA 3PUWA 5CLIA 5K3CA 3RK0A 5MN5A 1F6WA 2GBFA 1QHHB 5E2AA 3EASA 2ZT8A 1BQ4A 1C3JA 1MG0A 1Z0JA 4IHJA 4KDRA 1RI2A 4QTTB 5LA6B 1JVNA 4J1NA 2XJ9A 4HQ0A 2EYUA 4I5GA 2ZJ3A 5BYJA 5KYXB 5I8WA 2RG1A 4O5OA 3LHKA 2JFHA 4FOTA 5C3UA 1R4MB 4PANA 1ULHA 1UDWA 3G2LA 4YCLA 4ZEVA 1XRPA 2A84A 1BEZA 1K98A 3R7WA 4DN6A 2OWDA 1I3LA 1DI0A 2ZUBA 1TL7C 1VPEA 3MWEB 3ZKWA 1X7YB 3VGPA 1TD1A 4JELA 3HKCB 1BKSB 3K4QA 2ORED 3BSSA 3VO1A 3ZR4B 4ALMA 3O31A 2IWRA 5LYJB 4AZ0A 1AXGA 5TS3A 1Q22A 3RHTA 5AQEA 4QG7A 3RLIA 1HE1C 5CYOA 2G9VA 3SC2B 3FUWA 1VSTA 4D5EA 4FYMA 4PE5B 3BGSA 2GILA 4BQRA 1SUSA 3JQBA 1IPEA 2BBSA 4JC4A 5AVWA 1WVMA 4NU6A 4OQFA 4ZREA 5EOVA 1NLFA 5KTKA 3ZQ6A 3GGCA 3IEKA 3NRJA 1C8KA 3EXG2 4QELA 2JI6A 4WCVA 4CWAA 2BPOA 3DTYA 4HKTA 4F5DA 2XXAB 4ENTA 1YQ9A 5GINE 1F0NA 4XDZA 1AB5A 3P4XA 4ZRMA 2A14A 2NXEA 1P62B 5MFPA 1GQQA 4A27A 2G08A 2BGRA 4LJ6A 4X61A 1YC5A 2WJJA 3IR5A 4QA9A 3DHYA 3HSSA 3KDPA 4PO9A 1S8AA 1UZNA 5SZIA 1WSAA 2ID9A 2RHHA 2B83A 2VXBA 3A6ZA 4FI3F 4ZC1A 5HF6A 4KPYA 1PT9A 1VG1A 4E5NA 1TJ3A 1I4OA 2IW3A 3BRWA 2WD8A 3VH2A 1X7XB 5HK8A 3OWXA 4B2PA 2NU7A 3T4EA 3BRSA 1WMDA 3R76A 2RGEA 2XWSA 4LNHA 2EGGA 1GCOA 4FCWA 5AOBA 4AY5A 1Z5OA 2YXDA 2FU5C 3HJGA 2JD2A 1U0RA 2REBA 4YALA 4EUKA 1YZUA 2W0MA 1TA4A 4LZLA 3PNSA 3T7TA 3TH5A 3NT4A 2QLJA 2SCUA 4CN9A 5DOVA 3CVOA 2I6UA 2H9IA 4U7WA 3PFCA 4JYBA 5I7OA 3QKTA 4OM8A 1A72A 3EXHC 4ARBA 2VP9A 1QTIA 5L4LA 1COWD 3VR2D 1Y7HA 2OY0A 2XE4A 1ZIXA 3GGPA 3UH1A 4O4JF 1XK6A 2H2DA 3I72A 4FVTA 2WM3A 4GPEA 2IDKA 4QL3A 1Z7EA 3WAGA 2IXFA 2ZR7A 3QBVA 5FFNA 4AN1A 4EFNA 3IPXA 3BKWA 2C95A 4LOIA 4I9FA 5BSWA 1U98A 1N7GA 3OOSA 3TAXA 5CAEA 4IMPA 3WLNA 4CKCB 1RCUA 2V8BA 1XNRB 3JPYA 3FBTA 1FZTA 3QPVA 4NMXB 4E32A 2QG9A 4QWWA 3MEQA 4PWZA 2DHCA 2PYDA 3OCUA 3D4LA 4X6UA 2QJRA 5H5JA 5EJ6A 4OLHA 3ZTTA 3WC4A 4EB0A 3ZIUA 1H2YA 3KELA 4I1VA 4ZCTA 2B61A 1FVOA 4EL5A 2VUIB 4IQ8A 5EHGA 5K05A 2AUTA 2W2MA 2WAOA 4G5RA 3GLTA 5LBTA 2LIPA 3UOWA 5F1YA 1E2HA 3FYUC 3GP3A 3PQ4A 3VJMA 2OMKA 4BKRA 1ZCJA 2HSZA 2VNKA 3KTAA 4XFDA 1IXRC 5B4TA 4TN5A 3E5RA 4PC6A 3M8KA 4I9HA 5HWSA 1V9LA 5H0IA 3R3XA 1BHO1 3PJGA 3CQ9A 3PCTA 3QX8A 1EFHA 2QN2A 2A2ZA 4CR6A 4G1BA 4B9AA 5EUCA 1DKPA 1T5IA 2YWXA 5AR1A 1QORA 3TINA 1R8JA 1GPYA 2OHGA 1NSYA 1YI8A 1RR6A 3PR2B 2R6JA 4LE2A 1U4NA 3OLXA 5EIHA 5IJXA 4Q4AA 2JHFA 3TZBA 3PPYA 3IRUA 2CNWD 3R5FA 1SCDA 3DE5X 5FO1A 4Q9NA 1F2UA 3QVXA 3TD2A 4YMUA 1TA9A 2O1EA 5DKFA 2JIBA 3IURA 3HXMA 1O94A 1PFKA 4Z6KA 1W581 1PNOA 3V8MA 4WXMA 1PT8A 2B8TA 2WD7A 1U8CB 3DR3A 4FFMA 2QM8A 1P29A 2ROQA 1ZH2A 3N28A 8GPBA 1WOYA 3IP8A 2IQ5A 1R6DA 3ISVA 1BS9A 3D6AA 3GT0A 2EFCB 3QKRB 4UCFA 4EKYA 2RAPA 5HKOA 5K2OA 1O4WA 2W2LD 3OKPA 3EDQA 2C7BA 1G5TA 4RYLA 2WF9A 1U2SA 3LV8A 4UZSA 4RVHA 4AMVA 1QC5B 5KNBD 3BJRA 1RBYA 2FK7A 3RASA 4RD6A 2NUPA 4Y2XA 5AUQA 4NK5A 1Q1EA 1VL8A 3TXAA 3MUOA 1DXQA 3T3GA 4B3IA 2FNAA 1BN6A 3AI1A 2YFQA 3FDJA 1ZN8A 4OSEA 4DCGA 4HQNA 1V4NA 5A05A 4HSGA 4XASA 1KU6A 1ZSVA 3BHNA 1REQA 2GN2A 4YMIA 3EF0A 3TOCA 4BMSA 3K20A 4IZOA 5KYTA 3K31A 2AHOA 2YJZA 3A4VA 1XEWX 1QIMA 1CQWA 2YWBA 2Z0MA 1PVDA 1B0PA 1Q0PA 1M2WA 1I24A 5AM5A 4BFTA 3GC6A 1JFLA 3FLMA 4MB2A 5DRTA 1SD5A 2C2OA 3M0EA 3T41A 4AXXA 4B3GA 3DBLB 4YT4A 2QTAA 1OZHA 2I76A 2B2NA 2GXAA 1VBKA 1Z4NA 3ANXA 3QU4A 1Y63A 4I6EA 4MCHA 4E5MA 4M8KA 1O95D 1KDZA 2CT8A 3PVSA 4CKXA 4X54A 3PGMA 2ZIGA 2BEVA 4GLJA 2GRUA 4CZ2A 4MA5A 3SI7A 3B9QA 5M04A 1FNBA 2ZUWA 1O9GA 3VSAA 3MTQA 1PJSA 3KD2A 2IWHA 3VHLB 6ADHA 4KQGA 3CEPB 3OY2A 2EATA 4IUDS 1XNQB 3QVGB 1XL1A 5TV2A 1QR6A 1RPTA 1YOVA 3OPQA 4DS3A 3EISA 4H7IA 1U31A 2GZAA 2Z3ZA 2PQ6A 2YFKA 1JI3A 4JP3A 3F6EX 3EPKA 2ON6A 4IVNA 1CUDA 4Q37A 5FV7A 4C01A 4HGYA 4M9XA 3DP7A 4PSKA 4ZEWA 1PNQA 3H17A 4F2DA 4F96A 5JS2A 1IBRA 5FLEX 3ANTA 4YAJA 1VHDA 5LA6A 4L76A 5C9ZA 2DPMA 2OQVA 5IJ0A 1UFVA 3ZLUA 3GRKA 1EGAA 2EBHX 3TL3A 5FEMA 5HE9A 1GPAA 1LDBA 4IG4A 3UB2A 3A6EA 2I2BA 3BJZA 1OXBB 4EHJA 1DG9A 3VH4A 4PQGA 2QLBA 2W6JA 1WDWB 3PQ8A 4O1MA 2BM9A 4W5JA 2ZTLA 3HRHA 3PEUA 3S1AA 2ODTX 4MRPA 1XRMA 3N3BC 4FT2A 2MJLA 1FMLA 1LI5A 5IM4A 2J4FA 1JHYA 2Q1SA 2FJPA 2XHZA 3UZUA 4I50B 1Z7YA 3ZVKA 1QK3A 5FCDA 3M1AA 5KOYA 5FBRB 4O3MA 1DFIA 2GCPA 4EHHA 1GDTA 2WF5A 3MWYW 2JEOA 3EIHA 2F1OA 4UEKA 1RYEA 2V7QA 2PSDA 3ONVA 1KAMA 4BZPA 1TEHA 3W8DA 3X2SA 1RWVA 1C3EA 4M1KA 4GI5A 5C4IA 2IBMA 4E2FA 3PPXA 3O3NB 1NJ6A 2X15A 2M6KA 4BMDA 4TLLB 3SVLA 2PWYA 4WXEA 2C99A 2WU3A 5CJJA 2CJPA 3W5BA 2CZCA 1TM4E 3FCSB 3KJIA 5I45A 3ZTYA 1A27A 2PTHA 1ZK2A 2IYTA 3FPHA 2HWXA 3L8FA 4LKRA 5HMLA 4F56A 4WBNA 4AWXA 5IKEA 1MHTA 1TNDA 3G2JA 4IBOA 3SBEA 1VSQA 4YRCA 4G0OA 5AW2A 5L95A 2C7RA 3NRCA 5FHRA 3H19A 2ISSD 2C3OA 2ZQZA 4PLPA 1KEWA 3KL4A 5B1IA 5KNBA 5GADl 4I7EA 3RNLA 2YVKA 3OPVA 1KBZA 1CW2B 3DE7X 2Y1CA 1QCDA 1C7FA 1LC3A 3G7UA 3ZWOA 3QPWA 2RGWA 1NDQA 2EJCA 2YRXA 1GVNB 2ES4A 2CFCA 2CLIB 2RBGA 3DBRB 5COQA 5AYVA 3C98A 4X90A 3TTSA 9LDTA 3VPFA 1BFDA 4Y30A 1WD7A 2WNHA 1S9HA 1E8MA 3LDGA 4RENA 1BMFD 1E8DA 2QR5A 2VO1A 4AF6A 2PUGA 3IV9A 4LNUA 2Z5LA 1POXA 1KP3A 1YDGA 4GD3Q 3G85A 1AK2A 3FSRA 3D3QA 4UUNA 5CT4A 5BW6B 5BWNA 2NQ2C 1ZA1A 4C4ZA 2EJVA 3EC2A 1NQWA 4N3BA 5BQ3A 4KQJA 4EY6A 1EE1A 3SSOA 3DZDA 5KOJB 3PHCA 3E82A 4P2GA 2WDPA 3FSGD 4ME6A 4B4VA 2DGDA 2WAMA 4X60A 4P22A 4XAQA 4BNUA 4HVLA 1OKKD 5BQXA 2BMEA 5HF8A 4YACA 6NULA 2ZIWB 2DLNA 2C42A 3HR4A 3REFA 1I2MA 3V8RA 3LXUX 3VRHA 5DX1A 4F7WA 2PS1A 5KO2A 3SP1A 1O03A 4QOFA 3HN2A 1BXZA 3BXEA 3C3AA 4P2BA 2VYFA 3COWA 3GDFA 5KOIA 2ZREA 2Z6UA 1RLTA 2PM8A 2WW8A 3OBBA 4G09A 2V3CC 1K86A 4KXLA 5AKJA 1RYZA 3BH7A 2VDNB 4N0QA 4Y18A 5FOSA 5KCMA 3U40A 3INNA 1NXXA 2FZ4A 2EL9A 1PWYE 4YMWA 3VX3A 4BLSA 4YIHA 1BAPA 3I12A 4FFOA 1TEXA 1E0SA 4FD3A 4ZO4A 3MYRA 5JT1A 1KYVA 2O59A 1YR7A 4WADA 4J4HA 4Y0VA 2XIJA 3LAWA 1IFXA 4OXKA 3GV0A 3MTEA 1RI1A 2HPHA 1YULA 2H31A 3FWYA 4HEHA 4EGSA 4AJEA 4KFRA 3HMQA 3RRMA 5JS8A 3F9RA 5JVDB 3X3HA 5IKXA 1UBMS 4PLWA 4DSTA 4QPCA 4QG3A 4FMPA 5FWXB 4HDKB 2QBYB 2CVQA 2P9GA 3HCCA 1VHWA 5KMGA 3RQSA 2NZYA 3IQFA 2W93A 1G3MA 2DM6A 3WGMA 4JXZA 4Y6LA 3CRVA 5CBKA 4K6HA 1EFDN 2HDOA 1ZM9A 1OVMA 4FBLA 5JH7B 3AKYA 2H06A 5DN9A 1JAHA 1N0HA 2J3JA 2X8BA 5L7WA 4DBLC 1II8A 1OXTA 1TECE 3PDJA 5JV5A 3KBBA 3AX6A 4K9QA 2ZG6A 1EZ1A 4MRNA 3OCCA 2OAP1 4R8SA 3K5PA 3VC1A 4YUXA 1JIJA 3RYFB 1DX6A 2RI0A 2VWQA 2XYGA 2BZSA 3FPJA 5I9MA 3FLEA 5ALSA 3P96A 4B3HA 5KHAA 5K3AA 4TKMA 4Y2QA 5F1PA 1UUFA 3VM6A 4PYLA 4RJKA 1L3IA 3MJSA 1HT0A 2BF4A 1RDFA 3WLMA 5DSTA 4WSOA 1QE0A 2FUG6 3NTLA 4IX1A 3L6DA 4MTCA 5CIYA 3PQ6A 3R41A 2P90A 4IFTA 1UQTA 4G0WA 1WRBA 1DPFA 5FIUA 4BGVA 5KYVA 3R5TA 2NTJA 1WCYA 4MARA 4Y1RB 3UNXA 3C3JA 1FDRA 2AG5A 2P78A 3FWNA 2D74A 4FGKA 5ITVA 3FZQA 4TUYA 2WPNA 2HJ9A 2VSOA 1M2GA 4AJ4A 4CL3A 4XVCA 5JRJA 5LP6A 2IHNA 3WICA 5CP8A 3H99A 3TZEA 1XC7A 3EZNA 5L3ZA 4EYQA 4J0EA 3BFPA 2CXQA 4EGFA 4EFDA 2D2IA 4Q3AA 2AOXA 2PX6A 2RH5A 1OXSC 2P0YA 2ZYHA 1N92A 3VKGA 1PFWA 1V1MA 3A2NA 2PRKA 1MH9A 3Q12A 4JT8A 2ARKA 3VVLA 1UEXC 3KE8A 1KMIY 1BJRE 1N2EA 1UOPA 1ZISA 1YBAA 3IODA 4XWTA 5SY4A 1QX4A 1R0RE 5FL7D 3FWKA 1HQCA 4JLSA 3D6NB 2ZAYA 4HMQA 1TUIA 2XODA 1PW7A 3KXLA 4E30A 4DR1B 1AX9A 2VPWA 1A9ZA 5SZHB 3VA7A 3L49A 3AONB 3KJEA 3SQNA 2CUNA 5F21A 4C7BA 2Z3VA 2ANCA 3ROQA 3I05A 4LTNA 5E38A 4IOJA 3HI6A 2CLSA 5J4HA 1M2JA 2GJ8A 3CN7A 1TKRA 2RC6A 4R1MA 4TRNA 4JXJA 1JIXA 2G0AA 4C4OA 4DY6A 1WZUA 5EJ9A 1AQUA 2RHMA 1DLIA 4XD7D 3RFCA 1VI6A 4KKXB 1E3TA 5EXXA 4EHNA 3MJFA 3QVTA 2IUUA 1JJVA 5AK3A 5E7QA 5DCWA 5ANRB 3N0RA 4OIFA 2EWMA 3KPVA 5AW0A 3TSWA 1KDRA 1Q7BA 2R2GA 4DFDA 1SUBA 5BN1A 5E0KB 1LVGA 4PYMA 1ISSA 2I7CA 3OP1A 1VPWA 3DWIA 3IMCA 3PV0A 4V0QA 2BH2A 3OTWA 5B58C 2F8TA 1KBQA 1TTPB 1K8YB 1FYVA 1M2OA 3I32A 3W04A 2B8NA 2DQZA 4OLFA 2OD7A 3BERA 3BPSA 4GZ3A 4BGUA 4TLEA 3CLRD 4AD8A 1WLSA 4DQUA 3H3FA 4LVNA 4F7DA 3ZZ1A 1ZNYA 3IVGA 1X1CA 4CLOB 4S1OA 2WQ7A 1JJIA 3P52A 5C32A 1EA7A 1VBNA 4IJUA 4B4OA 4HAYA 1IZYA 2EC5A 2IPOA 5AW9A 4RTNA 4JI7B 3M34A 4DDWA 5JECA 1S4QA 2VXOA 1ID1A 4CXMA 5F51A 2OCYC 1CDZA 3GOHA 1LH0A 3FYHA 3L8DA 1N75A 4REQA 4XPIA 3M33A 2YYAA 2HLDA 4E08A 4N41A 8OHMA 4ODIA 2RHTA 1IBKB 2IIBA 4QDUA 1G8AA 2HCJB 2GPBA 4ITRC 2ZJ8A 1G59A 5A4JA 1MABA 3DOEA 1DGQA 4RTSA 2VJQA 1YH3A 2H5JA 3VAYA 3IYLW 3S68A 2XMCA 2YN2A 2H4XA 2GEBA 3AEUB 1Z6XA 1DRKA 3BF7A 4B09A 3PF8A 3T7EA 4FB4A 4KWCA 2PMBA 4WKBA 4YO7A 1EVYA 1WVGA 3LLMA 4K9SA 1K3FA 1ZW6A 2RK4A 4I1UA 1E0KA 3F4LA 4LXXA 3CHYA 1T3HA 1UL1X 2GM5A 3H8SA 5H9VA 4BMXA 3D8TA 1NI4A 3JD1A 4ECAA 1M8GA 2P7HA 4X1YA 4PG5A 3ILVA 4PIPA 2C5GA 1IHYA 4L6IA 1PQUA 3K6JA 4JYCA 4M86A 3RBAA 4LN1A 5DVZA 4TYYA 5KJ1A 2AQIA 1GAWA 4JBLA 2Q7DA 4BUJA 1KQ3A 2GCNA 3DW3X 3T5TA 2XR1A 1DAGA 1Y5RA 3O47A 2WU0A 1IZ7A 4M60A 1W2WB 3CUUA 2EZ4A 1K3TA 1U3DA 3E48A 3KKZA 1T2DA 2QVCA 4XGQA 1C8VB 2GEUA 4LFAB 5DLQC 1RLUA 4UW9A 5HUJA 2YMQA 3E58A 4EY3A 1ZR4A 4KNVA 3ET4A 4ND6A 3X43A 4D45A 4TYWA 2W90A 3PHLA 2PGDA 4NBNA 1DKUA 5CFOA 4FMBB 5CJ2A 1UBSB 2ID4A 2POCA 3L8EA 1SHUX 1SB8A 3I2JA 3MMSA 5AI0A 4KQKA 2CL5A 1Z8HA 5E9QA 1T6ZA 1H22A 1UMCB 2QTLA 3D1JA 3NTUA 4HQFA 3OZXA 4QDXA 3PR3A 5D6NA 3T1VA 2OESA 2UVQA 4KRGA 5DEIA 1CRPA 1O95C 1KOLA 2Z8YM 1F51E 1EK2A 1G98A 1MXFA 3HXKA 3KB2A 1O2DA 3HU2A 3PUJA 4PAGA 4Y2VA 2YICA 3JATA 3ZS8A 3KJQA 1WXDA 2FWMX 4PM4A 1YQGA 1JG1A 5CXQA 3SWWA 2AZDA 2E48A 3GLKA 1LJ8A 4IIYA 4YAOA 3GB9A 2WILA 5BSRA 4ER5A 1KVRA 2ZIVB 3QHPA 4XQ0A 3AFHA 3GT4A 2FEKA 4F4UA 4EPRA 1TLLA 1KH2A 1KZYC 2QYHA 4M9ZA 4GNRA 4DUGA 1A8PA 5JDIC 1MG5A 2YQ4A 4Y67A 1G6HA 1E6MA 1YWGO 3RC2A 4DLLA 5AUOB 2C7OA 4GYJA 1JKJB 4XWKA 3LPLA 1BQ3A 1HSZA 4PZ9A 1JDNA 4TSFA 4URWR 1WB5A 3AUXA 5CIQA 5FPQA 3TZLA 3V5NA 1FFEA 4OA8A 3RLFA 2FSGA 2O0LA 2VZ8A 4AM8A 1HEUA 1E2KA 1GSOA 3WIOA 3AJAA 4CYMA 3OJCA 4F6RB 4ZU6X 4FDMA 4ENUA 4PNPA 1WF3A 1NZFA 4RCZA 3R1IA 2Q0HA 1THGA 5F35A 2HDWA 3IL2A 4ISBA 3AHEA 4Z2YA 2XCQA 4NNOA 1LDYA 3KQMA 5E2BA 1JHVA 3QEKA 4IYRA 1Z74A 3FOAA 1PTJC 1ZNQO 1OX5A 4KVAA 2JAWA 3HUTA 3KSUA 3WB1A 4F45A 3R9XB 4HAXA 2BFEA 2GDJA 2RGXA 2B3TA 4YR9A 3CBGA 2NTEA 7AT1A 4KX5A 1VJ0A 2JVIA 1Q0ZA 5H68A 2QZZA 1DBPA 4MUAA 5JARA 3MGKA 1A7UA 1R2QA 1Z6PA 2P9FA 3K2BA 4FDVA 2HXGA 5KYYA 4DV3B 1Q2XA 3FKSA 4C0QC 5JI2E 5SY9A 4A6XA 3C7TA 2J67A 4Q03A 3IR6A 5BOVA 2CF6A 3LS2A 3ISJA 3UAZA 3AHDA 4CM5A 3K09A 4YCJA 5EPEA 2E5LB 3BG5A 2BN4A 2JZNA 1Y3DE 3RUDA 1WW8A 3DEJA 3HYNA 2DWPA 3QFTA 4B6OA 5BT8A 1FVHA 4CIYA 5IUKC 1C9DB 4PQRA 2A67A 3ZE7A 1YJBA 1T8SA 3QX9A 4QGBA 3L4BC 3TLGB 4QT4A 3Q5GA 4ZO6A 3A6FA 3L0CA 4RKWA 2O8FA 5EP4A 2CXXA 3MJTA 4FYXA 3VR5H 3V33A 5C1PA 4D0SA 5K0CA 1GNSA 2ET6A 4P3PA 2F55A 5FA5A 1VIDA 5D3QA 1WS6A 3WIBA 3RJ9A 3E8SA 2R68A 5I7FA 4IIHA 4DE5A 5EMKA 3AVYA 4NIMA 3HZZA 5B3KA 5ENZA 2Z2YA 3O73A 3T4UA 4K46A 4CMJA 1R18A 1XZBA 2GAIA 3OIGA 5B4VA 1DIBA 2C5AA 3D5EA 1AQ6A 3GJRA 4L5YA 2PTGA 5GOTA 5IN5A 3X1YA 3NBQA 3VBCA 4EG7A 3S8EA 4HAZA 1EK1A 3L6UA 2YC2C 1W1UA 4JOQA 5AOVA 5CYFA 3K9HA 1Q17A 4LWZA 3NHYA 2YYZA 4Y0AA 3RUCA 2CNNA 5NULA 3CKYA 3U19A 5AJZA 4CCWA 2LE0A 5CM2Z 2AW3A 5G40A 1NY5A 2CCJA 2NO7A 1V4VA 3GUZA 1GNQA 3U81A 1XTKA 3N3AC 4M0CA 4MZXA 1QAOA 2EBUA 2P75A 1MBZA 4FP9A 1SZDA 4HZUA 3GN2A 4EJFA 1C2YA 2W2OA 5KJEA 5IK2D 4AKIA 1WU8A 3H1AA 3OZIA 3ZTWA 3G1UA 1SU6A 1RQRA 3T1OA 3B1VA 1GUBA 3B8HA 2YIVX 1T6YA 2BFBB 2G6BA 2WJ4A 1QFMA 1Q84A 3NHKA 2GF2A 4BVBA 2AEFA 5CB4F 4D9BA 2C8VA 3KZVA 5AFSA 3R7DA 1A7KA 5I7SA 4PVCA 1I5EA 1SUPA 1PLLA 2NPIA 3BM5A 5T6MA 2EJUA 4WA8A 5CVDA 1AHIA 2XNKA 4W8HA 5KQPA 1L6IA 5JZVA 3W77A 2ZB4A 3HLTA 5SZJA 5AM0A 2HMAA 1ODSA 3SF0A 4RFSA 3WB0A 4WXHA 3AUFA 2A35A 1CQIB 3PTZA 1SCAA 1KMNA 2R2AA 4FR2A 3C1AA 1A4RA 3IERA 1QO7A 3HPRA 3IT1A 3UMGA 3V9AA 3THXA 1JHPA 2NQ8A 3BHJA 5HTOA 2DR2A 1NVVQ 3BHMA 1GA4A 1WL8A 3DYIA 4JUBA 3RREA 5JXWA 2EFDB 1XVVA 1AS2A 3NVAA 3PHGA 4LRWA 4FYJA 4ND3A 4PQYA 1N78A 1I2CA 3MB5A 4YB8A 2ZETA 2YWJA 3TLCA 3ZYCA 1MENA 3HJFA 1XFAA 1YJ5A 4IEEA 1KDTA 4UTZA 5LYYA 4KR2A 4RV9A 3ZLBA 4YUYA 4YY3B 3SVTA 4RQAA 5HGJA 3SEFA 3RYCB 4C3ZA 3VPHA 1HLGA 4FJ0A 1SR8A 3FN4A 1DE0A 3HKDA 4HLUA 3TS1A 3FNEA 4KHPB 2IODA 1Z4JA 4D9NA 1O96B 4LJYA 4JL8A 1N9GB 2AC2A 5B7GA 4QPPA 1L7MA 3M6LA 3W7BA 3RAPR 1DQSA 1ZP6A 4BO8A 2OBLA 121PA 3O93A 4Q66C 3SIXA 8LDHA 5ADHA 3W6PA 3T52A 2X3YA 3UV6A 1G66A 1LLUA 3A1VA 1I4EB 1OAAA 1XCOA 2GN6A 2OO3A 1H1LB 4R05A 1CHNA 3C4QA 3LH5A 4AZWA 1CCWA 3M3HA 4D6YA 1E6UA 2VDVE 3KCQA 3T94A 2LGJA 3ABQB 2IFTA 4H08A 5C35A 2YL2A 4EKGA 3GQBA 1Z4MA 3I28A 3GYBA 2XDQA 1VE6A 4YP0A 2Q3BA 4YCNA 5D3ZA 3ENVA 5ULLA 5LLTA 3G9QA 4UNNA 2CLOB 4D4HA 2NNWB 1YBFA 5BT9A 1G5RA 1MEEA 1ZGJA 2FUNB 5LNK1 5MN6A 2A9JA 3GJXC 1BCSA 521PA 3KSAC 1K66A 2PL5A 3UAXA 1MV5A 1ML3A 1ECFA 1U0GA 4O3FA 4IVQA 2DC1A 2A0YA 3WO1A 1M74A 2HQRA 1ECGA 2DQ4A 2HA2A 2EX1A 2O8EB 3QELA 1KY5A 2IDJA 1P1IA 2ZB8A 1ICIA 2BJHA 1Y33E 4CR7A 4N8EA 3K70D 1E4EB 1R5OA 1XXLA 2XBLA 1JIIA 3K0CC 2XUIA 4R8MA 2JZCA 3HB0A 2C94A 2ZJYA 1QFSA 3OOWA 4LUCA 2K5UA 4OFBA 2QW1A 2UUCB 2AMLA 1FFBA 1ZJ5A 3TQRA 1N5DA 2G25A 4IQFA 1MJ5A 4KB5A 3CN9A 1W5EA 1QSGA 4BJHB 5G3YA 4CCSA 2JZOA 3BWXA 3T0IA 4WFIA 2RGNC 1SFRA 4H16A 1SZPA 1CNEA 4DKJA 2X5OA 1YHZA 5LZ7A 4WTOA 3E03A 1JIVA 1OBCA 3KC2A 1ENYA 5DHPA 5TJ9A 3BBLA 3F3SA 1S3GA 1Z06A 4LDPA 2XH8A 2ZE6A 3VOAA 1EEHA 1FBTA 2QPAA 4N6OA 4F5EA 2I1LA 1KOGA 4N5IX 3L0ZA 5HIMA 3D0KA 4YRSA 5J43A 5JWOA 4PX3A 5CXXA 3K8OE 3FMPB 2QMYA 2OCKA 1BRTA 1L8LA 2PKYX 3VU9B 5GONF 5KKNB 2CXTA 3U7FB 3O94A 2KS6A 1RPZA 2E18A 5E6RB 1PWHA 1SBZA 2WZBA 2FVYA 4Y2SA 5TQJA 2G6TA 3NKFA 4YJHA 4XIJA 3BFVA 1F8XA 3OQIB 1F8UA 1L5HB 1V9SA 2X5JO 4EW1A 3WJ7A 5IABA 1HDIA 2E1PA 1WCIB 1ISGA 3JSXA 4F6RA 5BVHB 1DNPA 3THXB 3IQXA 1SVKA 2B6HA 3OT1B 1YGYA 2FV8A 4IJ5A 3RANA 1Z4PX 1U80A 2A1UA 2PSFA 3QY0A 1C1XB 2IYQA 5DHTA 3S5UA 3V7FA 1R12A 3GLGA 1DAHA 1U1EA 3UV7A 2DZDA 3KNZA 1TYEB 3SJAA 1JSLA 2FPXA 2QU7A 2FPGA 4E46A 4YJFB 1JDUA 3G0BA 1MO3A 4MWTA 4I5EA 1PR2A 1N6IA 1RAFA 1Z2PX 2AEMA 4JCOA 4GKVA 3CLRC 1M6YA 3LPMA 1D9ZA 1Q7RA 1OWLA 4ZOLF 5J58A 1T4DA 4WDRA 1W7AA 1T9GS 1J7KA 2ENUA 4V3CA 4CG1A 1O94D 3L4SO 5C4MA 5L6LB 4H18A 1IXSB 3REQA 3KQVA 4L5CA 5CA0A 3VNVA 1DJMA 1WR8A 1ECCA 2V59A 5DYGA 3SFVA 4KE7A 3EXFA 1UDBA 2PKCA 3ST7A 4ZO7A 4BQNA 1Q3KA 2XKKA 1W88A 1E92A 2QAGB 1C3LA 1NVBA 2EVWX 1C8BA 1YNOA 3QLVC 4INAA 4BP3A 3SC6A 2FPPA 3RARA 1FFSA 2BY4A 4I6GA 5DGIA 5T8KA 3PYLA 3EUEA 5T4FA 5BP7A 2CSXA 1V35A 2O3SA 3PA6A 2CYBA 3KHTA 4OB6A 4CT4B 3UYKA 4DZTA 4FJ2A 1E6LA 4KBFA 3I0MA 4MSUA 1VMDA 4DT1A 3CWZA 3KYCA 3GLUA 3OQHA 2ZTUA 1JECA 3RC3A 2JHGA 1Z2OX 1ZONA 2P6OA 3G3EA 1DKOA 4GMDA 2VK4A 4IKOA 4O4LB 4PCLA 4HLQB 4P3KA 1KMHB 4EHAA 4PXYA 4BJ1A 1DBSA 4KBYA 1BU8A 1TFRA 2ZRKA 4KZKA 4MV5A 5EKDA 3T9BA 3IESA 3EDOA 3R3ZA 3A27A 1JR2A 4C3OB 1SBNE 5A7GA 3Q7IA 4Q00A 5EHNA 4BAGA 3RVSA 4P31A 2F67A 4G89A 3H4VA 5EMHA 721PA 2LPMA 2X2EA 3KUXA 5FI0B 3VYUB 2IP1A 2ZR8A 3IQDB 3BILA 2WZCA 3O1LA 4A8PA 4EABA 1AUQA 1ZC4A 3H18A 4QOHA 5E7IA 1SZCA 3ZHOA 4IIJB 2GWHA 5A7FA 5LMCA 4DMGA 4U6NA 4S05A 1G60A 3SKVA 3NJ8A 4G9EA 4WK2B 1E0AA 5KWVA 1CDOA 2DPGA 4Z5XA 5CEFA 1KVUA 1NX6A 1OYYA 1P7VA 1TT7A 1WX1A 2Y6VA 5F52A 2IYVA 4V0RA 2BRUC 1FFAA 2QK4A 3C8HA 4B47A 1Y8QA 1XCBA 3LSYA 4M8LA 4OLAA 4M46A 3LP5A 1UBJS 3AR2A 1C9YA 2KW5A 4MLCA 1NP3A 2FSVA 2P9YA 1NVAA 1XDZA 2WTEA 3DKIA 5CTAA 3R3SA 2Z9BA 1H2WA 3VO8A 3K0FA 4CFYA 4BX3A 4D8VA 1U63A 2ZFUA 5EYPA 2I6GA 4FEGA 1RWBA 4O25A 1FC0A 4N7JA 1OB2A 1HDXA 1KY3A 2CE7A 3O4GA 4EJSB 5K8VA 4HHEA 1YCHA 3TJZA 2HQ1A 3CG0A 3SYTA 3WL6A 1XMPA 1NSFA 4PF1A 1RYFA 3VPXA 2DHQA 3SQDA 1XZDA 4CMAA 3LC1O 2XB9A 4F4JA 1L0BA 4U2FA 3U2QA 3JS5A 1A5AB 1YIOA 4PC1A 1YV9A 3VMMA 4I1PA 2W6JD 1Q0TA 1DC6A 4S0XA 4TV9B 4WKPA 4IW3B 4E14A 1K6JA 1N1DA 4IM7A 5CDFA 1FCJA 5EVJA 4JQYA 4MO9A 3DMTA 4DCOA 4LHEA 4D9HA 1LS6A 2CWWA 4ZJUA 5IZCA 3DE2X 2YW2A 3L8YA 2JLSA 5FOUA 5KQLA 2R8EA 2YBEA 1DIHA 2B7BA 2CJFA 1DUIA 3THYB 5A6SB 3HCAA 1QPBA 3RVNA 4NF2A 3NGXA 4UTXA 1RXVA 4F6CA 3A9WA 5KYWB 3LYLA 4WOJA 2UXDB 3WKAA 3A4MA 2EEPA 4DW8A 1AKNA 3AEQB 4HGNA 1MD9A 5AOAA 5IWAB 1I3OA 2XWQA 3KE9A 4HQOA 3F2IA 3TNLA 5LR6A 3I2GA 1QVRA 1U3UA 1JJ7A 1HYQA 2HPAA 1WZIA 3KPWA 4N40A 5BV1A 1YZ3A 2OHHA 1D4ZA 4M1QA 1H3FA 4REMA 1MX9A 4KPFC 3VOSA 1L4EA 1VCOA 4YDSA 3PCXA 2XUDA 3MWDA 3OU2A 4HH4A 1JF8A 1QIFA 1WUIS 2G8NA 4FFVA 4A16A 2M9MA 4DJTA 5LVAA 3EQ2A 2Y1EA 1KEPA 3DZ8A 1VPVA 2I6SA 2QT1A 4XOUA 2MWMA 2GZRA 1UAAA 2JW5A 4IDAA 3G8YA 3LPNA 3I8OA 4AMGA 2AJLI 2EFHB 1CYDA 3OJEA 2IV7A 3RVBA 2WTXA 3C3WA 3EZ7A 4J0GA 2AE2A 1WY7A 3SICE 4YT8A 4QUDA 2M6SA 1JILA 2CL0X 1ZN9A 1H94A 4TWZA 5LMNB 1Z34A 4PY2A 4FTWA 1Y5MA 3HGMA 4ZI7A 4QASA 4GL4A 5BV8A 3PXAA 3KKLA 3PG5A 4BNYA 3B2NA 3EGIA 4G81A 2JJ1A 5AM2A 3AL0C 3UO8B 3GQVA 2WWXA 2JFPA 4ND8A 3L2OB 4EK9A 1ISMA 1FFDA 3L43A 3P0EA 2OD2A 4G2NA 3WG9A 4EKDA 5JNVA 1Q0RA 4BUCA 3UUEA 2ZKLA 4KRXA 4QLOA 2EV9A 4WNAB 4TMYA 5I7EA 1CK4A 2EXXA 4EGJA 3FB4A 3G5AA 3KB6A 3UOGA 3O95A 4ED9A 3A05A 3HV0A 4G01B 1VHTA 4GR4A 3AR8A 1PQYA 4PNHA 1U5AA 1E63A 2N75A 5HDQA 4BE7B 1JHRA 3MT0A 4IX9A 2N0SA 3O91A 5JCOA 2OENG 3C0KA 1QZZA 3OFNA 4GOLD 1Y89A 1E96A 1GRQA 1VTKA 2PSHA 4FE7A 2VN8A 4RLHA 1GDHA 2FF7A 3IBYA 3QM1A 4K05A 3ER8A 3R75A 5FRDA 1DC5A 1AGPA 3HY3A 2VJAA 3PTAA 1E2EA 1SIUA 2G1JA 2VDUE 3JW8A 4URXR 1C5KA 2OKGA 1BMDA 3A14A 3HBNA 3PNMA 4PBSA 1MAAA 2R4UA 4BNLA 4DY4A 2DBYA 4JJAA 4Q18A 1L5GB 3Q4GA 3NHFA 5E6RA 1LVHA 1RNLA 3HO6A 1M6VA 3OIVA 5LFAA 2YV1A 4UUOA 4G25A 1A7JA 4ZOCA 4F85A 3MBIA 3F90A 4C03A 4DDTA 3OQIA 4HDOB 2JAPA 4I14A 2CXSA 5B2ZA 1GPJA 2VSNA 3OJOA 4PYKA 3C16C 4S2UA 3TUZC 1KEEB 2QW8A 4QRDA 4DLZA 4U2BA 2I87A 3FPCA 3X0DA 4H9GA 5E3HA 2YWFA 4I9UA 5L3SB 3VR1A 1NVXQ 4L73A 4QBHA 1TGYA 1UIRA 2VDLB 4LWOA 3ACDA 3ICCA 4IG9A 1SQ5A 4IJQA 4V0ME 4COOA 1R0CA 2G06A 2IYLD 3AW9A 4CIWA 1VBMA 3PC3A 3CISA 1TZKA 1FS5A 2VPXA 3A9CA 5IKMA 1EP9A 1II0A 1LWOA 4GEKA 2PVSA 1U0HC 3IELA 2ECPA 4D4JA 3A1WA 4N49A 2A1IA 2DBZA 4H7KA 5BWOA 4QAQA 3TTVA 3RIGA 4CLHA 4DLWA 5B1EA 1D3AA 1X8KA 3OZDA 3HGQA 4WZBA 5ENDA 1ACJA 2ZTMA 3ENNA 3ZDAA 1SQ6A 1W8IA 1M54A 1T3ZA 4EUNA 5JJKA 4BO5A 1F20A 3JQBC 1Y1LA 4BB9A 2ZBUA 1K92A 2W6MA 1NHWA 3AMVA 3L6EA 4UNSA 3T15A 4NTZA 3WRWA 4BY9E 3OZUA 3O3MB 4C88A 3WYBA 9GPBA 1BFKA 3E70C 1HV8A 3H2JA 1XPOA 4PZCA 1NLZA 4JI3B 1N5OX 1EUCB 1CUGA 2BP7A 1KFBB 1IN5A 4KXNA 3ID6C 3SIWA 3BEOA 3EBOA 4PAQA 3KQLA 1KMHA 1SY7A 2OXTA 3TLKA 3C41J 5ECWA 2DTEA 3BB4A 6PFKA 1ZS9A 2GEDA 1WDMA 4MIYA 4ER6A 3FDIA 3OD1A 2QPLA 1N7HA 4BWGA 4DAEA 1UOQA 4GC5A 3D3WA 1U2ZA 4JS0A 5BYKA 1PQ4A 1ZJJA 2AMJA 3LO8A 3QBTA 2ZWOA 4AP5A 4JQSA 1R0LA 2OCDA 4NWIA 4XWYA 5FBLB 5HJ7A 3PEWA 1T4BA 5JAQA 1KYYA 2BI8A 3QVSA 4PZYA 1QOQB 2UVDA 1KARA 4GHWA 4NH0A 1I14A 5ALIA 3MMPA 4Z7NB 2DJIA 5GIOE 3VMFA 1T9GR 1PZEA 4NSNA 4WCFA 5U1PA 3OG9A 3KWFA 4IIJA 3G2NA 4KACA 5FBQB 2W4QA 3IMEA 5IC4A 4Y2TA 1EI9A 4R2KA 3K70C 3SQWA 3B1FA 1Y4ZA 1RWNA 1P4GA 1U9ZA 2HA3A 4Q1FA 5CK5A 1QRTA 4M99A 3OZSA 1VDMA 4HTFA 3OKCA 2JI9A 4ZV9A 2NW6A 3SEQA 2CV2A 1NMZA 2XCOA 3ZC3A 3S5JA 2W4IA 4PSUA 1J8DA 3LP6A 3L0OA 1HF3A 4FMCB 2OZLA 5LD2C 5BSMA 3T5CA 3GL9A 2R1TB 2XNSA 3A58B 1IUPA 1SQ0A 3S2ZA 3UPUA 4NAHA 5GGYA 4NU5A 4EB6A 1ODCA 1FUUA 2ZP1A 1QRUA 1UEIA 3H5WA 2EWVA 4A2CA 3O4HA 1U7PA 4ACBA 3OOEA 4BU0A 1JH9A 4IV0A 3OKAA 1DBRA 1L1RA 1ZJYA 3C5EA 1YS2X 4JASB 3TEFA 4FGLA 4FNAA 3FMIA 5D5PA 5DM1A 3DZCA 5EZYF 1SBQA 3RNOA 2H1VA 5B6IA 1SHJA 1F12A 2O7NA 4DCCA 1AKMA 2D2XA 3Q3GE 5AIBA 4KAFA 1O6ZA 3AG6A 3FFTA 1EK5A 3DZIA 5BO5A 1UAGA 2ZVJA 1XNGA 4IIBA 1GRVA 4ZPXA 4A0HA 4TYPA 2QQEA 2IQIA 2MDTA 3NW9A 2HRCA 5JD5A 1JP7A 3I2YX 2VR1A 2ATCA 2ZI6A 3R6TA 3SBOA 3W05A 4DG9A 4TZTA 3E3LA 4ZQBA 2VQ6A 1OGJA 5L3RA 3KWMA 4EF4A 2XTZA 3H2SA 4QT0A 3W7VA 3G0GA 4OK6A 1PL8A 4W5NA 2P1DA 1JMKC 4UUQA 1PJAA 3RVOA 3HDVA 3KIPA 4IZ6A 2C8KA 1PS0A 3JVDA 4ZCLA 3AYXB 4B46A 3KZNA 4MK4A 2C7QA 1WO8A 5MGBA 2DWCA 4L9AA 2HLDD 5BSFA 3O2SB 2H3EA 3RUEA 1AKYA 2XXBA 4GI7A 2ZSBA 1KJQA 4F91B 1O94C 2BMDA 5IWCA 3JARB 3R3UA 4ZV4A 4NXMB 5I9SA 1XMQB 3ZDFA 1U99A 3NTXA 1MZPA 1GTMA 3PJFA 1E3DA 4N3NA 3BE8A 2C1ZA 2OE2A 2WMYA 2O6LA 2WYUA 3Q40A 1Z0IA 4WW0A 5DP2A 3T38A 4PRYA 1C81A 4OH7A 4RLQA 1RXIA 5K8JB 4F9GA 2G09A 1NU6A 4YV7A 3MLAA 1RWOA 3V8PA 3UGJA 4X6XA 2HOQA 4UHFA 1QVZA 2GYVA 1HKUA 1WPQA 1EK0A 2H2WA 4IXWA 4FOPA 4U8HA 1UKYA 3MTJA 4A8JA 1XT6A 2GYWA 3PC8A 3JRNA 1P74A 3CUYA 4IS3A 1OPRA 5C5IA 3AUAA 1ZVKA 2AG8A 2B3DA 1M0TA 4BKMA 2BSAA 3LRTA 1MR3F 1T29A 3MB8A 1AGYA 4OHOA 4PN3A 2VHUA 3PBKA 2XNDA 4EO4A 3L0IB 2Z4TA 3AFGA 1FW6A 5B53A 2W7TA 2IZ5A 3PQ2A 4DNPA 2JEZA 3AOEA 2EZ8A 3GUHA 1U5BB 1Z47A 1KMQA 1ZI8A 2ZIAA 3BGDA 3H42B 4HWTA 4L51A 4RQTA 5BSKA 4RELA 2TYSB 4OGFA 3R9KA 1VYTA 1EWRA 1M0SA 1KK3A 1P1JA 4FFBA 4MW6A 5KBYA 3REOA 2BEUB 4LXQA 2IYAA 1ESZA 1N2JA 2YZ7A 4F3NA 3LUGA 4HGOA 1Z7WA 3LW8A 5JNTA 2PH7A 3GJZA 3OH8A 4UD6A 2Z6QA 1TJ4A 1XZQA 1DOZA 4NENA 2X8WA 2PYZA 3C1TA 4O4HA 3OZTA 1V6CA 1E5LA 2C97A 5H02A 4ZYVA 2YFHA 1JS1X 1TUGA 4IUCS 3NANA 5ECGC 4JFRA 4PPQA 1CB0A 3UK2A 1XJCA 2CDCA 4RJIA 4B75A 1F17A 1AKWA 3WL3A 1KMCA 2EQBA 2JB9A 1LBEA 1Q74A 2IYXA 4LZZA 5JQGB 3I0ZA 4DUGD 4LW8A 4JB2A 3R7NA 1U1IA 1T24A 1ESMA 3A6KA 3GCZA 1GFWA 1E9FA 1H4VB 1Q44A 1VGRA 1VSVA 1Z5NA 2PLRA 4HGZA 4OUDB 4TSFD 5BSUA 1A76A 1BNCA 1ILEA 1GT6A 5LB4A 4P7KA 4XDHA 4IDQA 3IAM6 3FAZA 4MUBA 1CUEA 1D7OA 2O0KA 3GI1A 2HJVA 3O83A 4XWOA 3EXIB 4PCAA 3BHIA 1JHOA 2BVNA 2JARA 3MGCA 3AESB 2OCXA 4OHBA 4PG8A 4YHHB 2AVDA 3PXUA 2NNLD 3WYDA 3U4HA 2E89A 3L04A 3AERA 2IELA 3WLKX 2GERA 4HATA 1M2KA 3UV3A 3B6ZA 3ROFA 3PNBA 3D4IA 3FMFA 3GRFA 4TL7A 5DYIA 2FPIB 4M2LA 2AYXA 4LZJA 2WA2A 4JC5A 2JGAA 4CL8A 5J2UF 1DOAA 2AS0A 2Q5CA 4FBMA 1N34B 5PGMA 1XTPA 2EX0A 5HF5A 2Q6VA 2FOIA 2X9NA 4EPYA 2X8JA 2W98A 3TECE 1OX4B 4YXWA 4CI0B 2GK7A 1T0HB 2W8BA 3BE6A 1E6EA 3G82C 3QW4B 5EIAA 5JSKA 5C8VA 4C9BA 3OQNA 4CLRB 2HUPA 2YASA 3L18A 3FKSD 4BASA 5DNVA 4DIEA 4F5WA 5TVGA 3NMUF 1IBLB 1M8FA 3IOCA 1NN1A 3LKVA 4U7HA 1XMJA 1QHNA 3TQIA 5LQJA 4X1KA 2XOEA 1KQFA 2G9UA 4MICA 4ZIRA 3IA2A 1LPNA 1JEQA 3BJMA 2G0NA 2DUNA 1E94E 2WM8A 4TTPA 4Z2AA 5HIIA 3JQ7A 3EIFA 4GLBA 5HS6A 1X7ZB 2AX3A 4TXNA 1QKJA 1WCXA 1F4LA 2H1HA 3AY0A 4X0EA 4MGYR 4OYLA 4OHZA 5C8YB 4B3SB 5LCXA 2AZXA 1JEAA 4LBYA 3R3VA 1W8DA 3PQ7A 3T5BA 4D42A 1NKSA 3AM1A 2C1EA 2VOJA 2Z1MA 3F96A 3ML1A 1NOIA 3L7AA 1CRZA 1NATA 1ZUNA 4BIMA 1GTL1 3AU9A 3DAOA 1S6YA 3NV7A 1LPAB 1PNVA 3GJ6A 4IYJA 4DR2B 1B8OA 1ISIA 2YJTD 4RVUA 4FFRA 4CMIB 1OI4A 2UVPA 2EZTA 1BWPA 2NYRA 1J97A 3E15A 5EXPA 3LBYA 5J4LA 1KIFA 4YC7A 1WMAA 2X23A 4I3HA 4EKIA 1UJBA 3KWJA 1BXRA 1ZIDA 3EEBA 4YP9A 2OO7A 3AHJA 2VS1A 3ZQJA 3ZE2B 1M34A 2ONKA 1TM1E 1D03A 1YZLA 1JFFB 2B30A 2FW9A 2Z6VA 3GY0A 3I0NA 1WSDA 2PH5A 6CHYA 1Z5GA 3AC0A 3Q11A 3I1FA 3H9CA 4INJA 5EA2A 3P97A 3ZBTA 1X7WB 4NESA 1SXHA 3TBHA 1E2UA 4CNBA 3V34A 2L18A 4ID9A 4MJ3A 4DCTA 3I2FA 1OREA 5I9NA 5F98A 3D7NA 2XQJA 3TQTA 5JZOA 4ALKA 3LQ4A 1ZCZA 1N8SA 4IJWA 4R84A 3ANNA 3ZV5A 2HSWA 1XKQA 3DMRA 3ADOA 3SZUA 5EIEA 1JJFA 2DG2A 2J9FB 1VGQA 5BY2A 5B55A 1YIAA 4I5DA 4TYNA 2C7GA 1XWWA 3LYHA 4DLKA 2GYYA 5JCJA 4CI9A 5KEIA 1VIAA 3PHBE 3W78A 4DQKA 1U2DA 3NBMA 1HDGO 1LC0A 4FFWA 1JPJA 1U1GA 3SC3A 4Y1GA 1O6FA 5A62A 3H0EA 3P45A 1NG9A 2Y2VA 4IXDA 4UATA 1IZ0A 1GNVA 4MW1A 4NQZA 2JLVA 3E61A 3FRJA 3MCVA 1XTUA 2O2XA 1H1DA 2PJZA 1WQ1R 2DUUA 1Z2DA 5HA5A 4MGIR 1HQYE 1SA0A 1OR8A 3MC1A 2OCGA 1JALA 1Q1BA 3COVA 3LVFO 4ZT6A 4ZZ1A 2RD2A 5DXAA 4DMCA 4KLNA 4BNHA 3GXOA 3QXCA 2GEFA 5LJIA 1VKHA 1KC1A 1SCNE 3T3PB 4CDNA 1MO4A 5B7QA 3HABA 1NYRA 3AHCA 4YR7A 1V16A 2M1XA 3OZCA 4E5VA 1Z45A 2AOTA 4XA8A 1NNEA 4NG5A 5I51A 1HTWA 2X9VA 4V24A 3RH0A 2VDOB 1W49A 3O8CA 2ILTA 1Q3HA 1VSBA 2XVYA 1CRWG 1GGFA 2VWPA 1U3GA 3NCHA 1QBGA 1Z2EA 4D25A 3RIHA 4D0GA 3RU9A 2YIJA 1Z7BA 3K1JA 4QPDA 2I7VA 4LX8A 5F7OA 1JB9A 4PGGA 5D3MA 2CYCA 2UAGA 4L2IB 2YIDA 3LT5A 5BN4A 4P7GA 2OT3B 3OIYA 1WW3A 3F47A 2FN9A 4DUYB 1DQZA 1PT6A 4CKEB 3W2FA 1TCUA 2GCGA 2GJ9A 2R4TA 5FQOA 2NLOA 3MXOA 4HT3B 2WEKA 5FKJA 1XTSA 1EB9A 5B3LA 1WXXA 6Q21A 2IVZA 4PYQA 4RMIA 5EIOA 4Q0MA 3FUUA 1CJBA 4RV4A 5A5FA 2WTUA 3BGOS 4QJBA 3OT5A 5AM4A 1L7RA 2OHFA 3TPFA 5HPYB 1USIA 2CXHA 5FBZA 5TQ0B 5LP6C 5EXSA 4HVCA 4HRXA 3FX2A 4QGHA 2P9ZA 5FPPA 1GZ6A 1NP6A 3F6BX 4JKOA 3PUVA 1P7ZA 4IDNA 4AKHA 4D8YA 3MJHA 3KS9A 1UDAA 5BW4A 3P9RA 3NI2A 4A03A 4AMYA 1TAHA 3AIIA 1KVQA 4E11A 3KU1A 4TWRA 2I54A 4LRXA 4NS1A 3GFVA 3FKQA 1IJKA 4K28A 2F1HA 1Q6YA 2F3RA 1PGNA 4Z0PA 1BOFA 2DETA 2Q1TA 3BBPA 1RWQA 3L77A 4OMFG 2QL5A 3T7SA 3O8NA 4TS9A 4DADA 1VC2A 3DYBA 4JODA 2GTHA 4URZR 1H85A 4K5QA 4TMKA 3BMXA 1RRFA 2VJMB 4J0HA 4DIUA 2ZJOA 1BVHA 2REQA 1AQNA 4P81A 2XF2A 3L7MA 3WFJA 5BXQC 3ESXA 3ROKA 4MRMA 2I66A 5FLXA 3C74A 3GRZA 2YV5A 1QP8A 2CLDX 1KVTA 2WAYA 3ADKA 1P7PA 2RHGB 3F5QA 4I4CA 4OI2A 1AG9A 3HA5A 4Z4QA 4RGYA 2N47A 2II6A 3U4QA 2C3YA 4GSKA 2VJBA 3AESA 1QAMA 3LOQA 3QWFA 1Q15A 1LV8A 2V8OA 3HL0A 1LSOA 4HDSB 1ZJWA 4R8LA 1Z5VA 1J2YA 3N7UA 4GP7A 4QFBA 5CM9C 2F3PA 2D3WA 5CX1A 5LQSA 4F6LA 4C7XA 2J08A 1W2GA 2PXHA 3OJLA 1JKMA 3GH3A 1RZRA 2QVGA 2HIAA 2P2YA 3TSYA 4ZALA 4WACA 1GZSA 4V2IA 4RTLA 5HFAA 5F2NA 1TF5A 3DONA 3TSOA 4BB5A 1Z39A 3D8BA 1US8A 5DCYA 4ZXFA 5FWYA 4AS1A 2IUTA 1GTRA 1SCKA 4WOBA 1KXZA 1WBJB 2R11A 4HNSA 4CLRA 1A95A 4KYUA 1R9NA 3QP9A 2FRXA 1UR5A 5E4JA 1PL7A 4D41A 1MVOA 3PE3A 4Y2YA 4NJOA 4NNPA 2I71A 3AXSA 2QD4A 3QKSB 4ZANA 1N57A 2O2JA 4Q7EA 3TD9A 1TA0A 3IE0A 3N86A 5ICSA 4RTJA 1K7SN 4FINA 4IVRA 4PONA 3NTVA 3K8QA 4HI0E 3N8KA 1D2CA 3KR0A 1F5NA 3LT4A 4M83A 2Z09A 2QD1A 3CRRA 1X7ZA 2R6GA 3RCBA 1ELOA 2OBYA 3UTCA 3WAJA 5IASA 4RSHA 1HTBA 2JIPA 1V3TA 2Q29A 2XMBA 3AUJB 3BGWA 1ZM3A 1MB3A 1C50A 2NM0A 2Y9PB 4GGMX 4L02A 3C5VA 2IRWA 4PRKA 3QSYA 4LNAA 5KWIA 3KQQA 2VQSA 1E9RA 2Y3IA 3MAJA 2EQ5A 1JW9B 1RKXA 4XUCA 1AK1A 3DBOB 4LHWA 4A1OA 1DC8A 3IP7A 5J2TB 4JLMA 1W19A 2BJVA 4X92A 1P4JA 5EMJA 2Y27A 3A70A 1DCKA 1B6TA 3OTIA 4RPLA 4CF3A 1AUOA 3AEYA 2ESRA 1I5RA 2CVZA 1ODIA 2YH2A 3I61A 3PVZA 3RYCA 3V4RA 1JEYB 3QVWA 1PE0A 5JAZA 1ZVJA 3K9BA 4BAZA 1VMAA 2QG4A 2H1FA 2QU8A 2Q6OA 4L6CA 4JVOA 1NN0A 1Y3CE 3IDSA 1AZLA 1K1EA 1XU7A 3HBLA 1YVDA 1IY9A 1MPTA 4F2GA 1K88A 1XZAA 2WBLC 3LQKA 3O1HB 1T5OA 3K7EA 3PLRA 3X2EA 2RI6A 4W6ZA 3HGTA 5REQA 3OCXA 4LSMA 3W5VA 2O8DA 1K6EA 4R6WA 1J42A 1KERA 3KB1A 4RE6A 1R5NA 4WESA 4J0KA 4O1HA 1CQXA 4WRRA 2JATA 4IGEA 1N5KA 3OE1A 3BWBA 1KDVA 3WOVA 1XTJA 2V7GA 4ZYXA 1NRIA 2IPMA 3QQ5A 3NP9A 1FK8A 4GC9A 3PNYA 3TSCA 2WP0A 3THWA 3VZBA 3P2KA 4LDNA 1BX1A 5L9AA 3P0JA 5BYAA 4JP2A 2W58A 1E5QA 1TVKB 3TLXA 4PZEA 2OORC 3IEVA 2ECFA 1TKBA 3NT5A 3C1OA 4V2UA 3FIJA 2A5FA 2YR0A 3DFZA 4K3UA 3ZLTA 4TRRA 5JNWA 1BS1A 5FPSA 1QZ3A 2PUHA 1JDSA 3U49A 3V6MA 1PBTA 3A28A 3R3JA 1FNCA 1XEAA 5FTKA 5FOWA 1PN3A 3NHRA 3UGTA 1OGIA 3DOJA 5CCXA 1UPBA 1GTZA 1UFQA 3CH5A 4MEJA 3GJYA 4MYTA 3KQNA 3O9VA 4XVHA 2A0FA 4JR0A 4C2TA 1RZVA 3G7SA 1MTZA 2PX0A 2HEIA 3AR4A 4GM0A 4UTOA 2NWQA 1WZ2A 3OWOA 1VLVA 2FPMA 3A25A 4KWTA 4D92A 3DVLA 3EY9A 1CQJB 1X7HA 2RGBA 5CW2A 2Q45A 3D6JA 5I4IA 5JNLA 3LHFA 5ALNA 4RM2A 2VHZA 3QA3E 1IJFA 4BV8A 3ILYA 2FAXA 3ZN2A 3ZJ4A 4NMMA 3EEQA 2H08A 2D8MA 5T4BA 2GBPA 3EBPA 4TL8A 5EJFA 4DR4B 1LSUA 3I52A 1C8LA 2QN3A 1TO6A 1Q83A 4F38A 4GPD1 4QYIB 5GM2A 5LOVB 1HUQA 3ZV7A 5TMEA 1P73A 4EL0A 1AIPA 1IONA 2WRZA 3LA6A 3U26A 4MUHA 3LTNC 2RJOA 2I0FA 3R3HA 1B3RA 3GZNA 3NNDA 1LNSA 1TM5E 2A58A 3AUYA 4D7AA 1OV4A 2QOEA 4ZVNA 5AKXA 1OFTA 1GN8A 1TFUA 2GPWA 4X8MA 2RG7A 4XLLA 3P94A 1Y37A 2DX7A 3UWOA 4YRMA 5A5VA 4XIYA 5K5EA 2C2XA 3LCCA 1C4WA 1VE7A 2QLLA 2YZGA 3IUEA 3KQYA 3JVEA 1B41A 2F3QA 3WKBA 2XCLA 2ZCJA 3ONWA 3B70A 4WNCA 2G63A 5A06A 3PTLA 3EC7A 3BUSA 4JLAA 2JJ1D 3TQHA 3PQCA 4M53A 1Y9JA 2VATA 3WKEA 1Y4UA 3WQQA 1B42A 1G1MA 4DWJA 3DF7A 3K0AA 4BNDB 3WKDA 3L40A 2R84A 2WSSA 4PZDA 3KT6A 5KPDA 1H9CA 1AS3A 3E5NA 3KO8A 4XRGA 4NFYA 1XE3A 1T1GA 1N5IA 3FHCB 4LBWA 1J5PA 1E7SA 2OCPA 2R85A 3E9QA 3WVNA 3UHFA 3W6OA 2Q5QA 4D3FA 3RE1A 1YZGA 4HEJA 3HBJA 4QO8A 1W5TA 2VPZA 4O0LA 2NYAA 3SQMA 3WB9A 4RA6B 4K9MA 1GPMA 1QQ7A 5CDSA 3OFND 1XBTA 3OJXA 1JSXA 2QT9A 4RY9A 3P0RA 1J0DA 1JA1A 5EEHA 2XXJA 3M2PA 3VPCA 3CEHA 2YJNA 3CCCA 1IVSA 1T3GA 2VJMA 2XNJA 3EVNA 1E2FA 2AZTA 1P9OA 3NM4A 4JSRA 2MSWA 3AVUA 1X8LA 1NDUA 5DCUA 4D4IA 1I6KA 4MW7A 1ABEA 2F62A 3WHPA 1Y9DA 2R6FA 2Z2KA 2MINA 4KR7A 1ZOSA 1ORRA 1EFTA 3QHQA 3FNRA 4LV8B 4BMVA 4C89A 4D9JA 3AU8A 5HM6A 2XLCA 3WYCA 1C7ZA 4BMYA 1QIIA 2GZ3A 2XEXA 1Q1ZA 2PZ8A 3KQUA 1W30A 1L6RA 3MJCA 3QLJA 4OFWA 1BS2A 3C8MA 1CNMA 3V2GA 2I9KA 5KHOC 3BMQA 5HJEA 1MW8X 4KQ1A 4BMNA 3ERCA 1PZNA 4UD2A 2R65A 3WTBA 2QVBA 2Y05A 1TT5B 3EODA 4MEAA 4C30A 2CNDA 5KOHB 4PG7A 3AUUA 2NAFA 4NOLA 4U5QA 1NVVR 3WQRA 3UQYS 4QFCA 4TRJA 2ZXEA 2V6MA 1LPPA 1X74A 4B4DA 2JA2A 4EUEA 2I67A 4AURA 1F6DA 1LF0A 1WPGA 3FIUA 3TFWA 3OIFA 3GEPA 1T2CA 2QQGA 1E2NA 4OA5A 1IM8A 2P68A 1HL7A 2XE7A 3ON5A 4U2KA 3RU7A 1VMKA 1YVRA 2HMUA 3UF0A 4F12A 4O59O 4Y6SA 3ORSA 2CBGA 3N2YA 4NZMA 1EJ6A 1WP9A 2Q46A 1WP4A 4Z0TA 1YNSA 4WLVA 2WIDA 2ZYWX 4AP9A 3UT5A 5LQDA 4K9LA 1QWOA 1A5ZA 2ECQA 3RS4A 5C80A 1AO0A 4YAWA 1EB8A 1P5HA 4HLUC 5F9FA 2J9ZB 3RVQA 1ZL2A 3MVEA 3LUDA 4G0XA 2J6HA 5CIWA 3FJ1A 4Z99A 4BNGA 4JQCA 3TGWA 3CMCO 2JIQA 4CG0A 3CNQS 1IOVA 1CY6A 1L4KA 2DFNA 3C8UA 3H5IA 5E1DA 5HK9A 5DX0A 1POWA 3PDUA 4G24A 4AJNA 1UC8A 4J76A 4JC8A 1QP4A 1KK1A 2NACA 1M8PA 3AFNA 1YB5A 4L8LA 3TVTA 3EGDB 1QS0B 2VQ3A 2I7TA 3LIIA 1NNI1 5K3FB 1CR4A 1LDGA 1F7VA 1EX9A 2EIXA 2RHCA 2KLHA 2IS4A 2OSBA 1XLTC 2O7RA 2R6R1 2FCRA 5EQTA 3UWDA 4CKZA 2RDMA 3OQMA 2VXYA 2BEJA 4A91A 4YV1A 3W3AA 4Q1BA 3WGOA 3CZMA 4JQOA 4PFJA 3D0OA 5DI3A 4Z54A 4AJHA 3W5SA 2C82A 3IHWA 1GSHA 4XDGA 2GF9A 1C1YA 3EW7A 2FZLA 4UEJA 4UU8A 3L7LA 1PQWA 5EWMA 3MRVA 4XX0A 5K8IA 1I3NA 3JQ8B 4C0LA 4IH1A 4MAAA 1VQ1A 2WA1A 1M1YB 4HDRB 4M1OA 3G9TA 4LJSA 4Q4HA 1MB9A 1P9RA 1JMVA 4M8IA 1PR5A 4AQYB 4YMVA 2LZ0A 3N8NA 1PJ3A 4KPUB 4TMVA 3OF2A 1NBIA 2O0MA 4CIVA 2BL4A 3CX3A 1GU1A 4LZWA 5ALEA 1ZQ9A 5DEOA 4MIKA 3X1WA 1FU4A 1BW9A 1RPNA 4KO4S 5IM5A 1EUDA 4CT0A 1KO1A 4B80A 2XQVA 4JU8A 4L6AA 4EH1A 1AGXA 1JQBA 2WVJA 2RAFA 1QMGA 1PEKE 2HXSA 2OILA 2YDYA 2D4HA 2AJ8A 2IXGA 4XM1A 3RVDA 3FXAA 4IF6A 3TRJA 2D1QA 2CHQA 4NBSA 1LRJA 4UCQA 1UDXA 4FW8A 1TKAA 1IM2A 3C6BA 1TVKA 1W5SA 4GXNA 1OMOA 1KEZA 2QTVB 3BD8A 4RFLA 4RMJA 3W5DA 1XJWA 1X14A 4RPHA 4DIKA 2I62A 2DRIA 2OHVA 2XWBF 4CEIB 1RYYA 1AQYA 1NGSA 2QA5A 3T0GA 2ETXA 1P7CA 1U3VA 2KI5A 3A9UA 3GT7A 4HBGA 2FMXA 1SVMA 1YGPA 2FFQA 4IQ4A 4DSAA 4CV0A 3K0HA 4DMHA 3M4ZA 1W4RA 2YXNA 3PR1A 1JZTA 2HTFA 4Y9SA 3PK0A 2ZW9A 1EP2B 3ABZA 1YSCA 3N05A 4IIEA 3OX3A 3RODA 3O8DA 3PGXA 1NBMA 1JFSA 1XTTA 4GUAA 5ALHA 3RV4A 5JUWA 2WMDA 5F33A 5EWJA 2N1BA 1PK8A 2OV3A 2CXRA 3ZCRA 1N2HA 1W0JA 3D2AA 1F38A 2J9RA 2ILVA 1ZRMA 1UZUA 4O6VA 2FP4A 4Q6BA 3PZBA 2OM2A 4BL5A 3TBFA 2CJWB 2QUZA 2BGTA 3B1XA 3E22B 3N2NA 1GLGA 4H7HA 1G4UR 2BTOA 2HRQA 2C3PA 4PC7A 3FH0A 2QV0A 5H81A 4FIDA 4JR2A 3WWOA 1JDZA 1ABBA 2C03A 1QONA 3VAZA 1B0AA 3I45A 2HCBA 1QTRA 1QRDA 1KO8A 1VCNA 2EDCA 5FFMA 4LQ4A 5AVOA 3RTDA 3T61A 1VJRA 3U7RA 4BE9A 2GA9A 3WHLA 5C2JB 4EUSA 1ULZA 1PT5A 1PJBA 2JBAA 3DBHA 4LEIA 2OZVA 2H1OA 2QP3A 3DE1X 4U7GA 2QVXX 1YI0A 5HZKA 3LFHA 3H9EO 4WI1A 4Y9TA 4D4MA 1FDSA 2DUJA 5CR9A 3E8XA 3WMFA 4WNIA 5D86A 3NX4A 4IFIA 3GMIA 3JD0A 4B44A 1YZNA 1KRXA 3W3ZB 2B4KA 2G36A 5DH9A 4MVJA 5T8KC 3W79A 3DO5A 3IXMA 2DQKA 4KU4A 3RTAA 4GMGA 1GPNA 2W6PA 2ZS8A 1W52X 2BKAA 3A4TA 2V3VA 3KSDO 5EWLB 2ECOA 1T9CA 1I4WA 4KQMA 2OBXA 2PNFA 3ND6A 1NXPA 1U8ZA 3WAKA 4B6FA 4FCVA 4Z53A 5LPNA 4DQVA 2XNDD 2ODAA 1EINA 3NXKA 3LC0A 1YA8A 1CDEA 3OAAA 3EEIA 4KN9S 2UYYA 5FJJA 4A2WA 2O5EA 1ZICA 3ZZNA 4FR0A 5CUQA 5ETJA 2KSQA 4NMWA 2C2ZA 4H7EA 5AICA 4BVKA 3OO0A 4FGWA 2QLFA 5DYWA 2PUEA 3R7FA 3RSQA 4XEUA 3CNLA 5LBIA 1PL0A 4IIGA 1H2FA 4I99A 1JKIA 3H5LA 4DCNA 3ESRA 1IM5A 1T4CB 3CPJB 3DR5A 2YBDA 4ID3A 1XQWA 4XJSA 2XUFA 2C5LA 2W6IA 4MZDA 4HDNB 3BQMB 3RAFC 2IOYA 4I5IA 2DHEA 4NJMB 3DWFA 2A1TR 4HNRA 3GJ7A 1ATIA 5KSWB 1IDN1 4D9EA 1ZPDA 4DC9A 3OCWA 2OV2A 2O1SA 3S6JA 4YMHA 1E9SA 1T2UA 5IJZA 2DPYA 3EA5A 2XD9A 3WLFA 1KZ7B 2Y68A 5LQUA 2GKOA 2ZYIA 4WKCA 2WG0A 4D0RA 4EARA 4YX9A 1H5UA 3GELA 3N59A 4L5IA 1BGXT 2VHVA 4R9RA 1E2QA 4WQMA 4HDMB 1G20A 2QB5A 1B8PA 4UJ5A 3SK0A 1G38A 4Z4IA 4PO1A 4GX2A 3B6JA 4EG6A 4LC1A 2D0DA 1IVNA 2L82A 3GP5A 1E6KA 3NYIA 4PC2A 1ZD2P 4LSZA 2A7QA 3L7CA 3S0JA 4NCAA 4KXMA 4JFAA 4F3TA 4RCVA 1LVUA 4HGRA 5ES3A 4PBRA 2P2SA 2QTCA 2J6CA 2F