4X41A

Crystal structure of protein arginine methyltransferase prmt8
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
311
structure length
311
Chain Sequence
GIHEEMLKDEVRTLTYRNSMYHNKHVFKDKVVLDVGSGTGILSMFAAKAGAKKVFGIECSSISDYSQKIIKANHLDNIITIFKGKVEEVELPVEKVDIIISEWMGYCLFYESMLNTVIFARDKWLKPGGLMFPDRAALYVVAIEDRQYKDFKIHWWENVYGFDMTCIRDVAMKEPLVDIVDPKQVVTNACLIKEVDIYTVKTEELSFTSAFCLQIQRNDYVHALVTYFNIEFTKCHKKMGFSTAPDAPYTHWKQTVFYLEDYLTVRRGEEIYGTISMKPNAKNVRDLDFTVDLDFKGQLCETSVSNDYKMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein arginine N-methyltransferase 8
publication title Protein Arginine Methyltransferase 8: Tetrameric Structure and Protein Substrate Specificity
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 78
structure length 311
sequence length 311
chains with identical sequence B
ec nomenclature ec 2.1.1.319: Type I protein arginine methyltransferase.
pdb deposition date 2014-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06325 PrmA Ribosomal protein L11 methyltransferase (PrmA)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.160.11 Mainly Beta Distorted Sandwich Hnrnp arginine n-methyltransferase1 Hnrnp arginine n-methyltransferase1 4x41A02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4x41A01
4P7JA 1RJEA 1KPIA 3ANXA 4GOMD 5E1OA 4ATNA 3SSOA 2PT9A 4PGGA 3GDHA 4LWPA 4XCXA 2FHPA 1G8AA 1NW5A 4EQZA 1M6EX 2NNWB 4EK9A 2FK7A 1SQGA 3NWEA 1V39A 3FUWA 1VP9A 3LCCA 2OZVA 4H0NA 5M5BA 3D2LA 3TKAA 3SM3A 3I64A 5G02A 2FCAA 2EJTA 3CCFA 3EVDA 5F2OA 5LSAA 4XUDA 4KDCA 4QDJA 1I9GA 4OBXA 4R6XA 2AOVA 1RI2A 2BM8A 3GJYA 4ISCA 1XCJA 2CWWA 1YFLA 3OZSA 4UOEA 4RTPA 1NBHA 2BH2A 3SR4A 5K0CA 4FS8A 4YUZA 5HEKA 1BC5A 2LD4A 3DXXA 2I6GA 3NWBA 4PYLA 3UBTA 1IXKA 3G5TA 3LKZA 5C0OE 3E7PA 3DLCA 1M6YA 2HTEA 3DP7A 3H2BA 5CVJA 3ELUA 3P9NA 4RSRA 5D1HA 5EHIA 4YUXA 2H11A 3R9XB 4A6EA 5FWAA 4P7KA 3S68A 4DM3A 1R6AA 4FSXA 3EMBA 1TPYA 2B9EA 2IBTA 2B3TA 4OA5A 5EKUA 2ONZA 5EMLA 3P8ZA 3UA4A 1AV6A 3BXOA 3TOSA 3HVHA 3HCEA 1D2GA 3VSEA 2ZZNA 3NJRA 1EG2A 2ZLBA 4PNEA 2PX8A 3R0QA 3EVZA 1NW6A 3HA5A 1R8YA 4RVFA 3G88A 5FULA 1N2XA 4GC5A 3UWPA 1G55A 3LDGA 3BKXA 1QZZA 3UZUA 2PSSA 5LQNA 1PJZA 2AVNA 5FA5A 4GEKA 3HP7A 3G7UA 2PGXA 2PLWA 3LHDA 3R24A 2XYQA 3P2EA 5DM2A 3DLIA 2HR1A 3BKWA 3FUVA 1R00A 2P41A 3THSA 4DCGA 5GM2A 3TM4A 3G2MA 2OBFA 3OU6A 4M38A 3F4KA 3A7EA 2OO3A 4IWNA 5ICFA 5DLYA 3SGLA 2P40A 2IGTA 1YZHA 5E8JA 3ELDA 3KPUA 3T7TA 2I62A 5F2NA 3PLAE 2HMYB 2EX4A 2PX5A 3FTDA 3TKYA 5LQAA 4DA4A 3CC8A 4RTOA 3CJRA 1WXWA 3EGIA 3FUTA 4RVDA 4U7PB 3BGVA 3DH0A 2WA2A 3SSNA 3HEMA 5K0EA 3G8BA 2FYTA 4GF5A 1AQIA 1JQ3A 1WS6A 3LKDA 2UYHA 3ER9A 3KPWA 2F8LA 3AY0A 3FZGA 4U7TB 2YXDA 2OKCA 2UYCA 4GBED 1FPQA 2O07A 3HA7A 3AWIA 3MTIA 1Y8CA 2AN5A 5CVEA 2NP7A 1JR4A 3BWCA 3HCFA 1T43A 5EVJA 4KVZA 2P7IA 2IP2A 4PYQA 5DSTA 4MQ4A 5GM1A 1H1DA 3LBFA 1DCTA 3FPFA 4NECA 2P8JA 1KP9A 5DTRA 3SVZA 3KQPA 5EG5A 4HGZA 1I1NA 4AX8A 5DRTA 4YV2A 3UJ6A 4B17A 3R6TA 2N47A 3EEYA 3Q7EA 5K0LA 4AZVA 2ZBPA 1EQAA 3GO4A 5BW5A 5K0GA 2JG3A 3GRZA 4Y2HA 4DKJA 3JWGA 1KXZA 4DZRA 4RTSA 3PFHA 5EHGA 4BLUA 3EVBA 2YXEA 3FUUA 5EZQA 4CKBA 5FCDA 5DM4A 2UYOA 3P9CA 1RJFA 2BR5A 2NXNA 4Z2YA 1OR8A 3KR2A 3UJ8A 5GINE 2IDJA 2EG5A 3KR0A 1QAQA 1VP3A 4X61A 2AOUB 3B3FA 1YUBA 3G2PA 4RTNA 1NKVA 2C7OA 5KVAA 1NW7A 2CKDA 3O7WA 3OU7A 1YFJA 3FTEA 3NVKI 2P3QA 4BP3A 3T7RA 3JWIA 2BM9A 2PX4A 1RJDA 5GP1A 2GB4A 2IH4A 5EEGA 3K0BA 5CD1A 3EVEA 4YV0A 5KYGA 5GIPE 1VLMA 4V0QA 3FYDA 4ER6A 3JWJA 1UFKA 4OBWA 5EZSA 2PJDA 4PONA 2I7CA 3FRHA 4Y30A 4YV1A 4PYIA 4WVLA 2AOTA 4DQ0A 4ER7A 2GLUA 2GPYA 2AOXA 3M33A 5EIFA 4ZTBA 1EAMA 2ZW9A 3MTEA 2GS9A 3HCDA 3BWYA 1RI1A 2V7EA 3GRRA 4OA8A 4AZWA 1XCLA 3QV2A 3O31A 5K03A 3BGIA 5DTMA 3G2QA 3I53A 1EIZA 3I9FA 3LECA 1YF3A 4X41A 2PKWA 2YQZA 3I58A 3B3JA 2AOUA 1RI5A 1SQFA 1XDZA 5DXAA 4HG2A 2AN3A 3EVGA 5HOQA 2ZULA 3KQWA 4RTJA 3PX2A 1R8XA 4L7VA 3M70A 5ICCA 3FRIA 3RIEA 3SMQA 2G8NA 3KPYA 1P1CA 2E5WA 3DUWA 4RTMA 4RVHA 4XUCA 4PCLA 3IEIA 3ME5A 2IBSA 2EJUA 2O57A 3FPEA 5EC8A 2ZZKA 3EVCA 1X1CA 2P35A 2CMHA 1JG2A 2R3SA 1P1BA 4GOND 1O9GA 2O06A 4HRAA 4EVIA 1EJ6A 5K05A 1RI4A 4YMHA 1L3BA 3PX3A 2VDVE 5IH3A 2YTZA 3KPVA 4PWYA 4F84A 3LSTA 4E70A 3MHTA 1KYZA 2NXEA 3LDFA 4CWAA 1X1AA 3FPGA 2NP6A 3TMAA 4FSDA 2G70A 5E1DA 1ZGJA 3OCJA 5KS2A 4HGYA 2Z6UA 5K01A 3NTVA 3VC1A 2QYOA 2OPBA 3DMHA 2ERCA 2ESRA 2CMGA 2C7RA 2V74B 2AVDA 2JHPA 4R6WA 3EVFA 3T0IA 3HNRA 1XDSA 1F38A 4C4AA 3REOA 3B5IA 5E1MA 1L3IA 1M0EA 1VPTA 4QTUB 2HV9A 2KW5A 2QY6A 3OFKA 4G56A 3PFGA 4AZTA 1SKMA 5DRYA 3C3PA 4PGHA 3M6UA 4C08A 2ZBQA 2PXCA 1WG8A 2Z6AA 3KQTA 5FQOA 4WXHA 1SUSA 2IDKA 2ZBRA 5BW4A 2NXCA 1IY9A 2PY6A 3KQMA 2VZ9A 2HWKA 1MHTA 4HTFA 3L8DA 4BP1A 5LQJA 1SVUA 5KQSA 4HH4A 3EGVA 3IHTA 4MIKA 3QOXA 4RTRA 3UJ9A 4R8RA 3IYLW 4KW7A 3DMGA 4PINA 3TLJA 2DULA 4JXJA 1JTEA 4FZVA 1YB2A 5JR3A 3HVJA 1O54A 1JSXA 2P3OA 2ZSUA 5GOZA 3RODA 1X1BA 3GRVA 3GU3A 3EEOA 1QANA 1JG4A 1VIDA 2P1DA 3G2OA 4CTJA 5E2AA 3CJTA 2XBMA 4R8SA 3KQSA 4ER0A 3OE4A 1NW3A 4ER5A 2UYQA 4PYNA 3TFWA 3TRKA 5CIYA 7MHTA 3GIWA 4YMGA 2JHCA 2UZ4A 2PWPA 1ZQ9A 3BZBA 3T7SA 4QDKA 1AF7A 5LR6A 2ONYA 2ZIGA 5EKXA 3U81A 3VYWA 4AUKA 4AZSA 3HCBA 4E2ZA 2AR0A 4C07A 2AN4A 1MJFA 4FT2A 4RVGA 3DXZA 3MGGA 5K0JA 3I5UA 5HIJA 2Y1XA 3HVIA 3O4FA 1JG1A 4GUAA 3DOUA 3M6VA 2PV0A 3PTAA 2ZWVA 2PX2A 4GOOD 2Z6QA 2AZTA 3KQVA 4IV0A 4CKEA 2AOTB 5FADA 2ZWAA 5EQJB 3P9IA 2VP3A 5C1IA 5DT2A 1TW2A 4M7RA 5DX8A 2ADMA 3MAGA 4YUVA 1XDUA 4M36A 4YUWA 3AXSA 2H1RA 2FRXA 1FBNA 2YVLA 2EFJA 2FPOA 5EGSA 2PVCA 3P71T 2QM3A 2IPXA 3GRYA 4RWZA 2OXTA 1G8SA 3C0KA 2YR0A 3OU2A 1X1DA 3PVCA 5F2KA 2VDWA 3HCAA 5DX1A 4PCAA 3WSTA 2IH5A 3ERCA 5DM1A 5MHTA 2ZTHA 3EMDA 3ER8A 3LPMA 1P39A 5CVDA 2OY0A 3TPZA 3OE5A 2QRVB 4FR0A 2G72A 2PXAA 2I9KA 5KQRA 1HNNA 1QYRA 1KR5A 3VC2A 3CVOA 3P2IA 4C03A 2XYVA 3ID6C 5FHQA 5HIMA 3SSMA 3TR6A 1JSZA 4FGZA 5ICGA 3HTXA 5CCBA 1RJGA 4IV8A 5FUBA 4YUYA 2JH9A 3G8AA 4XUEA 1Q0TA 2BR4A 3CKKA 3LDUA 5EMKA 4FP9A 4LWOA 2OYRA 4DF3A 5EIWA 3CBGA 3Q87B 3B89A 5ICEA 4X60A 4RTQA 3GXOA 5GIOE 1F3LA 4O29A 2DPMA 2G71A 1ORIA 4PIPA 1KIAA 1NV9A 1WXXA 3M6WA 5T67A 4M37A 1XTPA 2GH1A 4OQDA 4QVKA 4F85A 2ZCJA 3BT7A 2WK1A 3MQ2A 1NV8A 3IV6A 1NW8A 2G1PA 4DMGA 3NDIA 8MHTA 4EMSA 5IKMA 4RYLA 2NXJA 1JTFA 1IM8A 2QRVA 4PIMA 3SXJA 3TM5A 2IFTA 3JWHA 2VDUE 2ZIFA 3KR1A 5DTQA 5LQUA 3MCZA 3OZTA 5DWQA 1KHHA 3A25A 4QPPA 3KQQA 2BZGA 2OB2A 3MCTA 1L3CA 1PRYA 2PT6A 2ZFUA 4HTFB 4C06A 3NMUF 1JQEA 1G38A 2A14A 3LGAA 4PYKA 5EPEA 1ORHA 5CCXA 2P3LA 3EGEA 1NT2A 1XVAA 4KIFA 5EOVA 3LBYA 3CJQA 5HIIA 4KIGA 3BGDA 1KYWA 1BHJA 4QVGA 5K09A 2YX1A 1YZ3A 1D2CA 3NVMB 1VBFA 5BP7A 3GGDA 5P8WA 4QPNA 3UJDA 4E2XA 3KU1A 5E9JA 3V8VA 3A4TA 1WY7A 4IKPA 2B25A 4EKGA 4OX9Y 3NW9A 5FQNA 5CVUA 1N7JA 4E2WA 2YXLA 4KDRA 4E33A 3DMFA 1FP1D 5K0NA 2P7HA 3PB3A 4C04A 1D2HA 2YUIA 3DXYA 1BKYA 5LQCA 5DSXA 3GRUA 5EMJA 3G5LA 2IH2A 1QAMA 1AQJA 1L9KA 4GOLD 5D1NA 4BLVA 4CKCA 4EKIA 2ORED 1QAOA 2PXXA 1G6Q1 2B2CA 1HMYA 3KQOA 4E2YA 1RI3A 3M4XA 2GAFA 4CTKA 4LG1A 2HNKA 1ZKDA 5C9ZA 4PYMA 4MWZA 4X63A 1DUSA 2AOWA 3A27A 5ERGB 4CXMA 3FTFA 5K8VA 3PT9A 5U4XA 5DPMA 3OFJA 4POOA 3M6XA 3BWMA 5E9QA 3TQSA 4ER3A 3BWBA 4C05A 2B78A 1O9HA 3V97A 4RX1A 2Q41A 2ZVJA 3DTNA 1VE3A 1FP2A 1I4WA 3HM2A 4GC9A 5DX0A 1NE2A 4BLWA 3GWZA 4K6MA 1VL5A 2BR3A 3SX0A 3A26A 3KR9A 3P2KA 4P58A 4P7FA 5CUQA 2QE6A 1WZNA 3THRA 3LCVB 1SG9A 4DCMA 3X0DA 4E32A 3MB5A 5FTWA 2K4MA 1U2ZA 1Q0SA 2PBFA 2XYRA 4QTTB 1R18A 5FHRA 1BOOA 4A6DA 2H00A 4X1OA 5FWDA 4RTKA 1INLA 3AJDA 3BUSA 3LCUA 3EPPA 3ORHA 5EEHA 5LQKA 1R74A 3FUXA 3C6KA 3FYCA 5B1SA 1UIRA 1NBIA 1XXLA 3E8SA 3KQYA 3CGGA 3E05A 3RW9A 4F86A 2GA9A 2C7PA 1DL5A 2PWYA 2CL5A 3B3GA 3PS9A 5EMMA 1B42A 4HC4A 2Y1WA 3C3YA 3UJ7A 4KWCA 2VS1A 3A7DA 2OB1A 3ELWA 4QQKA 3MERA 2AS0A 2XVAA 4V0RA 3LL7A 3FPHA 3KKZA 3HA3A 3UJBA 4RTLA 5DM0A 5H02A 3C6MA 3LX6A 1FJXA 3R3HA 2XVMA 1JG3A 3HVKA 1SUIA 3G89A 4R05A 1VQ1A 3P9KA 5JUWA 2C7QA 3EVAA 2O05A 1JQDA 3UJCA 4E30A 2O0LA 5HIKA 5LQRA 3OPNA 3K6RA 1G60A 3GNLA 5FA8A 9MHTA 3GCZA 3QOWA 4P7GA 5T6BA 1ZG3A 2WA1A 2ZZMA 3KHKA 2R6ZA 3FTCA 3NDJA 2JJQA 4RV9A 4LECA 3DULA 2FK8A 3KPJA 1L1EA 3P97A 5HILA 3UFBA 4GQBA 5E8RA 2IIPA 2NYUA 3OZRA 2JH8A 3HCCA 1KPHA 1KPGA 1Z3CA 3UA3A 5T64A 4HSGA 4MTLA 3E23A 5E9WA 5E2BA 5BXYA 1X19A 5DXJA 3UJAA 1N7IA 5CVVA 1ZGAA 2JHAA 4BY9E 4PYOA 5HZMA 4PYJA 3B7PA 4MHTA 1TW3A 1EJ0A 1P91A 2ZIEA 3ELYA 3AXTA 5HFJA 3FPJA 4FT4A 10MHA 1XJ5A 4OQEA 5CM2Z 1ZHFA 5K0BA 4QQNA 4KRGA 5K0FA 5E1BA 5GWXA 4E31A 3DR5A 1UWVA
chains in the Genus database with same CATH superfamily
3FKJA 3K9HA 2D59A 4TM7A 1KPIA 3LYUA 4U00A 5BN3B 3OOYA 3PEYA 4BNFA 1VP9A 4ZTUB 3U13A 3N8HA 1FUYB 3IJRA 3TL3A 5LZ5A 3FFXA 4GPBA 3I5YA 3RSFA 1IMOA 2W6JA 3NWJA 3TKAA 1QTRA 1U7DA 4KAJA 1GUZA 4E1AA 5AW2A 5KMGA 1WU8A 4WW0A 2AN1A 1W88B 4XUDA 3KZXA 3NV9A 4KDCA 2XPCA 1GPBA 4ZCSA 1QHGA 1MO6A 3CEMA 1JFVA 2ZTVA 4P98A 2HA6A 5EWMA 1DWPA 2CWWA 2J9ZB 3E3NA 3AEKA 2NU9A 1U7XA 3QNMA 2QE7A 2W22A 2X40A 1C7ZA 2WU8A 2Y0DA 1SCIA 3SR4A 2QTFA 3HM9A 1EVZA 1Q15A 1VXOA 4ZQHA 3DVRX 3UPDA 3ZGOA 5MF6A 1JQBA 5EE5B 4B73A 4HS9A 4XEUA 4MV4A 4YUXA 3LE8A 3QOYA 3MT9A 4LOLA 2H11A 1W4ZA 4A6EA 1OASA 3WRXA 3PHHA 4DM4A 4QBTA 2B3TA 3S2UA 2ZJ2A 3TNFA 2BW0A 2R7KA 4NONA 1BFKA 1E1KA 4Y7CA 3HCEA 4LVOA 5AJTA 5E2IA 4KQ6A 4W5TA 1ZA2A 1D8AA 4RPKA 5LMNB 1XELA 1L9XA 4BKRA 5A3QA 1M5TA 4FJ1A 4F60A 1G66A 5ALYA 4D97A 2WJAA 5BQFA 1G55A 1K8QA 1VHJA 4L15A 1QZZA 3UZUA 4LHEA 3C3AA 1B16A 3ICPA 3RS9A 5FA5A 1K9SA 2QX7A 4JQYA 2P62A 3ZBQA 5TMDA 3F5MA 3N7TA 3I30X 4FFWA 4AKTA 1T6BY 5F9HA 1WA5A 3G2MA 4PTZA 3MZ0A 3GY0A 3BJZA 5JMOA 3OIGA 1EFLA 4RH0A 1C3OB 5H16A 2QLMA 3Q3CA 1DXYA 1W0KA 2ORWA 3AI7A 1XBTA 4KSYA 3L7AA 2IUFA 2B69A 3GEBA 4OJNA 1Z7YA 2EX4A 4MJXA 1YZFA 1VG9B 1KO5A 2ZS8A 3LXRA 3NAMA 3E5RA 8LDHA 2WA2A 2DETA 4RD0A 1M2FA 1R6DA 1QMGA 3JTEA 4G0QA 4OV6B 2A9KA 2F8LA 1PFYA 4PPGA 3COYA 2WAAA 3AETB 4E7OA 4LSMA 4GBED 5GONB 3L6EA 2GBLA 3HJGA 4Q3BA 5BQOA 3G0BA 5CH3A 1EGHA 3V1YA 5AVTA 1SUBA 1DAHA 1KJYA 3QWIA 2RHDA 3LKVA 2YHBA 2CEAA 4ZOAA 1MKYA 1V11B 4EGAA 2FLVA 2XZPA 2FW0A 3KJQA 1I32A 3V1UA 1MRSA 2CD9A 2DVMA 3S44A 4DR7B 5IWAB 4WN9B 5LA6A 3QVGB 3T94A 3DR3A 5BYAA 1NN0A 1OXTA 2DPGA 3LH5A 3MMZA 5CCEA 1UC8A 1XTZA 1OB5A 1J56A 2H2IA 2HJ9A 1ZQ1A 1BRMA 2PZJA 3NHUA 4L0CA 4ZOLB 2YJNA 5L95A 1YS1X 3JALB 3MRXA 1F48A 5BRAA 3A9TA 1CX9B 1OLUB 2HWXA 1OH6A 1CJVC 2H08A 2QZJA 2B35A 2BM1A 3TTUA 3LUKA 2JIMA 1ZL0A 2HRDA 3EVBA 3GJ6A 3LY9A 4XXHA 1HZZA 3NRJA 4TM8A 4CQJA 1ZICA 4E09A 1WSAA 1TM4E 1H2ZA 1WXIA 2IYAA 3V00A 5I7OA 2VJLA 1Z75A 2Q6IA 4H7FA 3OOJA 3KR0A 3AETA 3O75A 4QUKA 4R7ZA 4BFYA 5IC6A 2DPXA 3T5MA 3ZCUA 2DF8A 2V9CA 1GOTA 2WWGA 2Y0EA 4C22A 3TGPA 3CW2A 1CZKA 1II8B 2W9XA 5B6PA 2C7OA 1XC7A 1B23P 3JQAB 4EIWA 1KARA 1L4UA 3TZQA 1X1SA 1V11A 1X9IA 4PZYA 1Y7HA 2HCBA 1U7UA 2VH5R 4NBRA 4MGIR 4QXAA 3RROA 1VLMA 3UB2A 2PD3A 3WLFA 4WN9A 1NJ2A 3WLPA 2O0MA 4MQ6A 5DGTA 3ZJTA 5K1ZA 1KMMA 5DGIA 3N6RA 2I7CA 2H1CA 3MMNA 3TXAA 1DIBA 1OILA 3KB6A 2AOTA 4G3XA 4ZOLA 3S8YA 1OKKA 5EIFA 3NX4A 5LYYA 1O97D 3MTEA 2G9QA 3RRNA 3VTZA 1QR6A 1FMFA 3IQIX 3FOFC 1C1HA 2G80A 1W59A 2REOA 3DAYA 4A2PA 4KX3A 3O8OA 3L40A 1EIWA 3FH0A 4XARA 3L7DA 4DRXA 4L85A 2QP3A 4QU5A 4LGMA 2ZB4A 3E4DA 1YR1A 4U2KA 1EGAA 2FN3A 5JCZA 3VA7A 1XDWA 4MQMA 5AM0A 2JK1A 1TVCA 4XVCA 5L51A 3U60B 2XVZA 1ORTA 3AZPA 3JQAA 3QHAA 4FCWA 4D4HA 4DCTA 2QJRA 3OMXA 3SMQA 1TD9A 2PBLA 4DXHA 4I1PA 1R4MA 4MJ7A 4TMTA 3PFKA 1J5XA 4DR4B 2EP8A 4JL6A 2B2NA 5E7QA 3R4CA 3T9DA 4AVYA 4V39A 1U5BB 3GEPA 1YDWA 2VXBA 1DBPA 1O9GA 4X84A 3OCXA 2Q6KA 1Y33E 4EUHA 2OFOA 4Y1GA 4JJFA 4YT4A 3CLSC 3MTAA 3T4UA 3WXBA 2BEVA 2I2CA 3VYRB 3J7AC 1JKFA 4LYEA 2Q27A 4JEHA 2NZ2A 1XPOA 4IXMA 5J4LA 2G70A 3AOGA 2WE7A 3BX1A 3O4RA 4MQ5A 4EY4A 2PH7A 3WGUA 5EP3A 4RMJA 3WLEA 1KK2A 2B5VA 3AEYA 4O4JF 1BE1A 1UZUA 4AY4A 2NU6B 4IZOA 1Z0IA 3F74A 1JYSA 2Y1GA 3E9CA 2H0QA 2C7RA 3U9TA 2DWPA 1PJ4A 4P38A 4EHIA 4CHGA 3LI2A 2A67A 4ENQA 5JDCA 4MYUA 4QXPA 2J3HA 1I3OA 1FQJA 1WCWA 4MV0A 2E1PA 2FGKA 2JJ8A 1M2KA 3AIOA 3HP1A 3M6UA 2X86A 4WI1A 4JHLA 2OAEA 1ZGZA 4PS0A 5F7XA 5MN5A 4CU5A 1JAHA 2ETXA 2Q7OE 1MH1A 2YN4A 4WBNF 3EGVA 2H5EA 2DSTA 2H17A 4C0HA 1BO6A 1ZD3A 4KTTE 4R8RA 5LWHA 4YMTA 2FU5C 2I3GA 1MOPA 2IZ6A 2PL5A 5BT8A 4K9KA 5CM8B 5BSUA 4OUDB 1V7PC 1H4VB 2Z8YA 5F64A 1X38A 3U44A 1PEYA 3GU3A 4RHEA 2P1DA 4NV0A 4BRSA 2GVNA 2BONA 4IO1A 4EUSA 2F1RA 3GFTA 2VPQA 3H0KA 4R8MA 3V4LA 4GOJA 3CB2A 4W1SA 3QEAZ 1UBCA 2C7BA 4E6EA 2QD1A 1NNSA 3BZBA 3I73A 3OKAA 1WMFA 3G9XA 4QDKA 2H3HA 1S8OA 2NACA 4Y2PA 5LR6A 1JSLA 4CNBA 2DBVO 4FYMA 3UYKA 3C5VA 3LQ4A 3N05A 1IOWA 5BUQA 4OXKA 2FJ0A 1UBLS 1FRNA 3UGKA 2H1IA 2CXTA 4LCEA 4ZI3A 1C8LA 1E0JA 3UMSA 5BMOA 4Q19A 4R51A 3GMSA 2YOHA 4UTZA 1I7DA 1GZ6A 4WHMA 5CG1A 4IDBA 3EZLA 4A10A 4N0QA 4DCSA 3ABOB 4KE9A 1DV2A 3NKLA 4OUDA 4HJXA 4M1OA 3QVMA 4PG4A 3Q11A 2YDYA 2IU4A 1URPA 2G82A 3FNBA 3Q10A 4PZ9A 3L0CA 3IP1A 4I19A 5EFZA 3W5UA 1CUBA 3TDMA 4XDHA 4U5XA 5JALA 4O63O 5FI1B 4L4UA 3ESCA 1W93A 1RYHA 2O1XA 4KJXA 5HPYB 1OAKA 4JLBA 2WAOA 4MH0R 1KRWA 1BGXT 1CSEE 2EFDB 5CH8A 4RWZA 1TECE 1CZNA 1PFKA 1W0CA 3HABA 1U2PA 4F5YA 1I4LD 4GSYA 1Z0AA 5F2KA 4BFUA 3SQLA 4BMOB 4EENA 3RHZA 1RJ9B 3HUEA 1K4MA 1IZ8A 2MU1A 4HDQB 1HRKA 1ZD5A 2QYTA 2VRBA 3FPKA 4B4UA 3I4LA 2H2DA 1FDIA 1BROA 2QTRA 2NW6A 3E3AA 4ECEA 5DCUA 1ZAKA 1P81A 2AE2A 3KD2A 3AR2A 1V5IA 5KI6A 2IXFA 3NOXA 1RSZA 2A0KA 2JCVA 4TMZA 5AVSA 2IE0A 1PW7A 1Y1RA 3L7KA 2ENWA 1Y1QA 3IIEA 4Y67A 1CDZA 2A88A 5CLIA 3UF0A 4BX3A 1JU9A 3GYBA 4NF2A 2OV4A 1DTWB 4HAYA 5I45A 4B43A 1ECLA 4JJKA 2Z98A 3SHVA 4NR0A 1S01A 3UMVA 5K2OA 4WX2B 2PMWB 3INRA 1IXSB 1WXDA 1YE5A 3ESYA 1F3LA 1CQWA 2AC4A 1RTTA 3IVCA 3U1VA 4R1NA 4J7XA 1GG5A 1Z8NA 1DKRA 3V7UA 3ICOA 5TQJA 1XQ6A 1RJ9A 3L8YA 2WK1A 2XXAA 4EW2A 3KKEA 3UC5A 3EXHB 1JYEA 1Z68A 2V7QA 5CXXA 3O4GA 1ZNWA 5B1EA 2GBPA 2V7XA 4Q21A 1Q0UA 3SXJA 3G8YA 3KR1A 4OQMA 4R69A 4I5FA 1YC2A 2IYPA 5LB4A 1L3CA 4R4JA 3FFAA 1TM3E 4V0NA 4AQYB 5JS1A 4CT0A 1QGDA 3ZE2B 4Y3UA 2IU0A 4C6SA 4BQRA 4FKMA 4Q9IA 3DTYA 4LXXA 3S29A 5EHXA 2XRMA 1DTWA 3N8DA 4MS3B 4O59O 2XI4A 4UDOA 1Y3HA 1SUDA 3OE7A 4EDHA 4V0ME 4J8PA 1Z4LA 1C1YA 4K3VA 4A8HA 3TI9A 1QORA 1G8MA 1IEVA 4UOQA 3KU1A 3ZS9A 4TUYB 2Q45A 3QHQA 2Q5OA 1DADA 1D9XA 2GFHA 1XD2A 5FPQA 4AG5A 2XTAA 2ZUUA 3KAJA 3N0TA 5L3VA 6ADHA 3SYTA 2YXLA 3AM4A 4RPCA 3U4GA 1NXVA 5IZ4A 5JFGA 2IHTA 3OPYI 1FP1D 2DUUA 3PICA 3RVOA 1CY0A 5KVSA 1HT2E 4J0HA 1WL8A 2GVDC 3AIMA 2QI9F 1E2KA 2IVFA 3GRUA 5AJVB 4A0SA 4D26A 1QAMA 4YJ3F 5BSRA 2MSEB 3PGLA 1T0JB 2AIRA 2DRIA 4EQ6B 4PLVA 4B32A 3CLUC 1QAOA 1PR6A 1YBAA 4QAQA 2A5LA 1CQPA 2AFRA 3CLRD 4EW1A 2GARA 1I8TA 5IEBA 3WYFA 4MS3A 3FZNA 4LY6A 3O6VA 2I2AA 4YP7A 1KYXA 3TPCA 2HF8A 1Y5LA 1ZSNA 3PXBA 3WGHA 1PEKE 2G1KA 1LBTA 4TUYA 1C30B 1K27A 1KEEA 1P4RA 3WNVA 3KUXA 1RWXA 3FI0A 2FZLA 3OOWA 3AHGA 5FTLA 2VRNA 2H9IA 2DUJA 3AI2A 4PO9A 2Z9BA 3GT7A 2R84A 4ND4A 2IW1A 2WI8A 3N75A 5GQSA 4KDEA 5CUQA 2JJ1D 2YV2A 2ZANA 3TRJA 4CBVA 1WZCA 1YFZA 3T1VA 1TCCA 3L07A 3MB5A 1P62B 5M3BA 4EJ0A 2H07A 1LU9A 1U8YA 2I8LA 2K4MA 4QTTB 3BCHA 2NVWA 3JARB 3ZQ4A 3OJWA 1NN1A 1YMVA 4W7HA 2JEZA 4HFJA 4HX2A 4KR7A 4BMXA 1YI8A 4URYR 3AJDA 4MZXA 4QU0A 3I1FA 3LDAA 1LSOA 1EHCA 4MWBA 2VXCA 3ICVA 5ALUA 2HPHA 2XZOA 3N8GA 4KPFC 2VNHA 1ZW1A 2WHEA 2WHXA 1WQ4A 1IEXA 1NN5A 5DYIA 1E0SA 2JEOA 4PAGA 2QQFA 3FOZA 3ZJUA 4V0RA 2PR7A 1VE7A 3I6IA 3RNLA 3QVLA 3H8WA 4QTYA 2OESA 4RK4A 3LSYA 4LF9B 3O2JA 4QFCA 2PU5A 3U6KA 2FPUA 1YVEI 3SQXA 4JFAA 1PZMA 3G89A 5EMHA 1WQ1R 2EEZA 4M6WA 2TMKA 3JARA 6CHYA 5FA8A 5FR1A 2OSBA 2UUPA 1XE3A 3OMLA 4ZCRA 2Z30A 4H7DA 4YHBA 2ICAA 2WA1A 2O23A 4MUMA 4LJ9A 3EY4A 5TSDA 3RIYA 2D7DA 2RHCA 1FXSA 1GAJA 1H65A 2ZCVA 4UHHA 3W3AH 4XDZA 3HL0A 3IAS1 2QD3A 4TLCA 5HILA 4RKWA 2RE8A 1W5TA 4BAUA 3EIFA 1KYVA 3E7WA 3LFUA 4OXQA 2M32A 4F4IA 4L1KA 5BXYA 1R0WA 1HF3A 3MTGA 1XAHA 2IC5A 3H5LA 2JHAA 4M1ZA 4JVLA 3V48A 1DG9A 2RHRA 5CP8A 1R0YA 2EARA 4BEWA 3W3AA 1P91A 3ZZ0A 2CLKB 3TSAA 4K6GA 1SEPA 5FLYA 3B38A 3PWTA 1HEUA 1TEXA 3VAAA 4QJ3A 2QTCA 1LPBB 1XMJA 1OOEA 4XX0B 2O20A 4CR6A 2PUTA 3H8VA 2BL4A 4HRYA 3AX6A 4C0SA 3STWA 2CE2X 4HYYA 3AHIA 3L1KA 4L8VA 3QA9A 4MROA 4XM1A 2FHPA 3S7TA 1HSOA 1NYQA 3QVVA 3BWVA 4FYIA 4MVJH 2DE0X 2FEKA 2ZAMA 3I9NA 2H4WA 3IT2A 4BFWA 4DTIA 3QXCA 4D56A 4U7HA 5IK2A 2ISQA 1U31A 4FZJA 4RVOA 5C81A 3ZDBA 3W90A 1G7SA 3H9JA 1IUKA 1N2CB 4DYVA 3O8QB 3NBYC 1HOTA 3NAGA 4MCJA 4ZVPA 3FBTA 4OHZA 5FO1A 3KSZO 2F9FA 3UMYA 4TTAA 3R44A 1J00A 1OIVA 3A4IA 4A5OA 5IKEA 4DCPA 4YP6A 3ZIAD 3LIIA 5K0CA 2B3DA 3EZFA 2HHAA 5IVIA 5IYZB 2AEEA 1CDEA 2I8AA 1MJGM 3DXXA 3PU6A 3LX5A 4MICA 3PJGA 1BXGB 1IXKA 1Y1TA 3GFRA 4XX0A 5C0OE 4CMGA 5K3EA 1KQ3A 2EKBA 1F4PA 1X74A 4BC0A 4U8HA 2H0RA 2ORIA 4DNPA 3X43A 3DAOA 3GLFE 4DSZA 1E9RA 1EK0A 1KJIA 2FDRA 5G1OA 5CFNA 4EA8A 3NKVA 1TPYA 4X00A 2C4WA 4BZXA 4Z9BA 1RXYA 4A0HA 4CFZA 3UA4A 1Y1SA 1OU0A 1O08A 1DJNA 2OBYA 2OHHA 3QPDA 3EE6A 3ZIUA 2J0QA 1ISIA 3O92A 1CS4C 3TLGB 1RC1A 3LUAA 4L95C 3C85A 4IG9A 3O8QA 2D62A 4F4CA 4QDTA 1WXHA 2PUJA 2PX8A 5ESXA 2D00A 2J5QA 1YU9A 5JH7F 2B98A 1N2BA 4KO3S 1T4BA 4G4GA 2R47A 2Q9CA 1PLJA 1KBOA 2XT0A 3DLHA 2KX7A 3P4XA 1M1XB 1P2GA 5AQEA 1XU7A 3L49A 3OJCA 1U3WA 2Z9DA 3DLIA 3FZYA 2WIGA 1SOWA 2OAP1 3BKWA 4S24A 5ALLA 2PQ0A 1JRLA 5FPHA 2J4FA 2ZDGA 5HXAA 4D9IA 1NBMA 2PDAA 3OZAA 1BXGA 2OO3A 1WCV1 2NAPA 4Q4HB 5CIQA 2C98A 1JFSA 1HYHA 3NIFB 2XJ9A 3HY3A 3QRWA 2D0PB 5H82A 2OWDA 1IN4A 3SLRA 4ONEA 4ICIA 2GPBA 3HKDB 4KXMA 2ZJ1A 1DJQA 2YV1A 1FQKA 3ICWA 2PRZA 4P3XA 2WU4A 4RVDA 2QW8A 2VSFA 3WQQA 3P0HA 1KAEA 4LZLA 2OMEA 1CV2A 2NQ8A 1GFSA 1V7CA 1XMPA 4TS4A 1V2HE 4LHXA 4Q39A 4V0LA 4WDRA 4YA6A 3ICCA 4FMPA 4L57A 3AY0A 3T61A 1CTQA 4MXDA 3HJUA 4PN3A 4XVQA 2R8RA 1QHSA 1J0AA 2F67A 2O07A 3FG9A 4NMMA 2FZKA 1ANKA 4J0QA 4ZYXA 2LKCA 3K71B 2XKJE 1UBEA 5J4HA 5JV5A 2FE4A 2XEXA 3M0EA 4OFXA 4ZVSA 3U5ZB 4P0QB 2NP7A 3IUEA 4KVZA 1CQJB 3DV0B 4PYQA 9LDBA 3RJMA 5IDXA 3L5KA 3ND7A 3ZH9B 1CY6A 4MJ3A 1J07A 3TN7A 5DTRA 3QM1A 1M83A 3BTSA 3I04A 4E11A 2HRZA 3IBFA 3HY4A 2RI0A 1P2VA 4EG1A 1FB5A 3R6TA 2ZS7A 5I7SA 1OX6A 2JG3A 4A27A 5HWSA 1SBHA 1T2AA 2O1SA 3OEEA 4BXOB 3FGNA 2Z1DA 4DKJA 1Z62A 3COSA 5HK8A 5E4FA 1EI9A 3BRWA 3I8SA 5EHGA 3I01M 4DMHA 1ZK2A 1MMFB 2JA1A 3NYIA 4OHKA 1JQAA 4RHXA 1FVFA 1IBCA 3KR2A 2IDJA 2E5FA 4UTPA 1P80A 2WTXA 1Z73A 2OR3A 3A1DA 1KIFA 1U9YA 2AOUB 3IBTA 2AKEA 1V9SA 1E7WA 2F43A 3BZWA 3INTA 1WETA 1EK5A 1GVHA 2XOEA 4ENUA 2PUFA 2HW8A 1KI9A 4J16A 3EVTA 1ZUWA 4QEKA 4TWAA 1US8A 1XL1A 2I2DA 2BM9A 3FF1A 1WJGA 3VC3A 3C43A 3WMGA 1A9XB 3ONWA 4EGQA 1ZXLA 2NM0A 3H5NA 3ZXIA 3QLTA 1MU0A 4IH1A 4GZMA 4D6YA 4YYZA 5CFMA 2I4LA 4ER6A 5A5GA 1EA5A 2LIPA 2X5JO 2HDHA 2YWDA 3M5CA 4Z0TA 5FJIA 4QNNA 2W11A 1RR6A 5TJHA 3RREA 1P3Y1 2ZIAA 3F47A 5EIBD 4BXOA 2GPYA 2LUOA 1D2EA 3DPSA 3JYLA 1H2EA 4I1SA 5EWLB 4UZFA 2QRNA 4DA8A 4BUCA 2P90A 2RBEA 5AOAA 2V7EA 2I6QA 4TSRA 2O5EA 1NVWQ 1GQYA 1XCLA 4LRUA 2BBOA 3MJCA 2XA1A 4K6HA 1BS2A 4CJXA 4KPEC 3F9CA 1E61A 3I5MA 3NHLA 4IR7A 721PA 4LJYA 2AOUA 4CR7A 5BYKA 3RAFC 3EAGA 2VPXA 1CWUA 3JR3A 3R77A 1R50A 1C5KA 2RK3A 5C2JB 3SR3A 1HYQA 2GFQA 2GEVA 1UDCA 5H81A 2VWGA 3U0BA 4TLMB 1WABA 1YA8A 1JFFB 3KPYA 3RH0A 3SEAA 4A91A 2WIKA 3F5FA 4JI5B 3UG6A 5DHQA 3I9JA 4LF7B 5FOUA 3VTAA 2B82A 2HX1A 4PAQA 4HWGA 1N6KA 3D59A 2LCFA 5B1IA 2VCHA 3AZOA 4WKPA 5HR5A 3QW2A 4URZR 5EWLA 3G59A 3ZHVA 4ZI7F 1NASA 3T9EA 1LJ8A 4F84A 1QG6A 3TAHA 5DNWA 4ARUA 4Z1MD 1X1AA 3DPUA 4WUTA 1KY4A 4AYXA 4FSDA 1C7RA 1Y3FE 1QKJA 1N2EA 3QUCA 1BCSB 1OZGA 5IDVA 4M9UA 4N8EA 3RR2A 1GUAA 2QMEA 5AK0A 1SU4A 1GRCA 3S2EA 3IR6A 2VHVA 3ZW7A 5KDOA 1WCYA 2BFCB 1G5TA 4IDGA 2GCOB 3AHCA 3LTEA 2FPWA 4QUIA 1L7BA 3NFRA 4WINA 1JFFA 3RFUA 2VNAA 4R9VA 2D5BA 4IRXA 4K9LA 5KNCH 1TMKA 3ZLUA 3UB3A 2WB2A 5AJZA 4CKWB 2DTEA 2HNBA 2I99A 3GFPA 1MH9A 3GELA 5JFOA 3UMRA 2HHJA 2Z3WA 2HO5A 3ISVA 1P7PA 2RONA 1NDHA 2V7TA 1Z82A 4I9UA 1ESMA 4JWKA 1LBQA 4JXJA 3Q2OA 1JTEA 2IYQA 2L18A 4OMFG 3WGGA 1V48A 3H18A 4ZU3A 2XB9A 2POQX 3HVRA 3E22A 3MILA 3CM0A 3EB9A 1TM1E 4YRGA 5AUOB 4Z4GA 3CF2A 4CDMA 1USIA 5SZJA 1QANA 2HQRA 1WUJS 2BKLA 5E2AA 1VBKA 3LW7A 2I1WA 2Q4OA 2BFCA 2C31A 3BIXA 4LXIA 1K8RA 1C4XA 2VJOA 3UK0A 3ZZMA 4FFPA 4LDQA 3WJ7A 1P8JA 4OPMA 3K05A 5DW3A 2G1UA 2ON6A 3EFOA 1BQEA 2X1HA 4YMGA 1QP4A 1W4RA 2ZBEA 3WHKA 2KBFA 4DDVA 4E4YA 2ZQ5A 3BFJA 1JE0A 3L0PA 3QBVA 4W5WA 4ZQGA 4CKWA 2V55B 4D9JA 3DQZA 3TF5A 3OTHA 3ZDRA 4YCMA 5EQFA 2YN2A 3GUVA 1EM6A 3MCUA 4BE4A 1UBOS 1ZH6A 4R2IA 2I9PA 2GN0A 5IHPA 2JRLA 3K9LA 4JLOA 3ZDZB 5CXUA 1KI6A 1NVEA 2JAPA 4DL9A 4R1MA 4NBSA 3LC1O 4AT1A 4CVNA 4IILA 5JJLA 1JEOA 2DBQA 2G9NA 1JPJA 3KOUA 1BYUA 4J7CA 5JNRA 4IJWA 4GECA 5EJ7A 5KQGA 5THQA 3FLBA 3W5JA 2VH1A 1SQ5A 4KODA 2HD4A 4LBYA 1I2CA 1Z6GA 4OATA 3T95A 1FBNA 1KJ9A 2VRWA 2AK3A 2EFJA 2D2FA 4JP3A 5EP1A 2BMWA 4KSBA 1Z6PA 2Q6TA 3OM8A 3SCZA 1I3MA 2WR8A 4GSLA 3TZLA 4FJ2A 3AV0B 2C2GA 4UM7A 1Y1LA 4PCAA 1ZU4A 1DX4A 4U2BA 4ETWA 4GI5A 1ZH2A 2H65A 5D86A 5CVDA 1XCBA 3EYAA 2IV7A 2O8BB 4FR0A 3PFFA 1GADO 5JTTA 2JGFA 1B7GO 4ZOQI 1FUIA 4IDEA 3CVOA 3ZDQA 2P9YA 1HA3A 3P2IA 5HIMA 4MJLA 3SS9X 1EE1A 4RFSB 1MZPA 3C45A 4YRPA 3KIPA 3SS8A 1CG6A 5L4LA 4L74A 2CXUA 4R16A 1ZR2A 2ZBDA 3L8MA 5IM5A 3HSSA 5IUKC 2VK2A 4AD8A 3B5EA 1OJLA 4KLZA 4WK2B 4EOGA 1G6KA 2HK8A 2QX6A 4RSHA 2FP4B 2XRZA 3E9NA 1TLLA 2WSSD 4YUAA 2VWHA 3ASYA 5A9SB 1NG9A 4HZGA 3PUWA 3CMMA 2BUCA 1VI2A 3DT6A 3Q0EA 3UPUA 1Q1AA 2CNOA 4KL8S 3ZZNA 3BXGA 5JQGF 2A0WA 1YJQA 3LC0A 1NV8A 2G1PA 1RPNA 1W76A 2I4IA 1L7AA 2ZI7A 4D4LA 2P5UA 1POXA 3E9MA 3T5DA 1IM8A 4C0XA 4ERNA 2JLZA 2V1UA 5FUWA 2O8BA 3B1JA 2A5GA 4J76A 5DTQA 2WU1A 4CLHA 1TRHA 4G5RA 4ODIA 4UMFA 2BZGA 1ZO8A 3MCTA 2ZSDA 4RFSA 5AM3A 1GAQA 1MVOA 4B4VA 4F04A 3CNNA 5AJXA 5B7NA 4MUJA 1KTVA 2AMJA 2P3LA 4JR2A 4KIFA 4R8KA 3N2LA 5I8WA 2Q5LA 3PHBE 5TRTA 3FWZA 1V1RA 3V4FA 3R0VA 4EJ6A 1YZ3A 1MEOA 1GSOA 2FP4A 1H5NA 3OZIA 4QPNA 1E1RA 1TF7A 4UNPA 3GPIA 5CCDA 1X7ZB 4PLGA 2G9VA 3HB7A 3A70A 2ZI9A 1CNEA 2DHEA 3TXYA 3UO8B 2I7XA 5A5FA 5JU6A 1Q7TA 3MWEA 3TNLA 1TD1A 2P7HA 2Q1YA 5FUQA 2GEBA 4MUEA 1GCUA 2YY7A 4OXIA 1TK3A 3NWPA 5HF9A 2Z2KA 4ZZ2A 1VL1A 4AG6A 2FZEA 3CZAA 2WTEA 1Q1NA 4AN1A 2OHVA 5CDYA 1L5ZA 2W43A 1QF6A 1E58A 4U3JA 5H8WA 1EVJA 1XZHA 2FEXA 3EYWA 3PKIA 3UHPA 1SXJD 4RCVA 2HF7A 3ZW8A 2B2CA 5BNWA 5AKYA 2J5KA 1NVVQ 1OGJA 1YCFA 4V1CB 3LT5A 4DDWA 1K6JA 2N9UA 2ALJA 3N2ZB 4PX2A 1QF7A 4B8YA 3I8OA 2QT1A 4NCIA 4B0PA 2PMCA 1JB1A 1P1IA 4JB2A 3A27A 1N6HA 4NKRA 4CXMA 2V7GA 1F6WA 4LDAA 4KWEA 3LT2A 4OJQA 1Q50A 1EFUA 2ZVPX 1X7ZA 3JD4A 1UQUA 4ER3A 1F4VA 3CR3C 4RX1A 1NQAO 3V97A 1V7ZA 4B3TB 1SU8A 1I4WA 1VL8A 1SXJE 2Q2WA 5DX0A 1T2VA 2YYZA 4OHVA 4BLWA 2F3PA 2H29A 2OZPA 1VL5A 2D54A 3P9ZA 4GVXA 4EW3A 5LKAA 2P2CA 5BWNA 4JSRA 1YJ5A 4B6PA 2XVXA 1EUDB 2WD8A 3LCVB 4H0FA 4EEZA 3C97A 4ADSG 2W6IA 4PX9A 5EKDA 2VHXA 3BMOB 3SQMA 2X3YA 4Z4CA 3TSYA 4LTMA 1MJ5A 1A8PA 1DRVA 4MIEA 4Q3LA 1MUUA 4MR7B 1Q95A 5FWDA 4UASA 4CV3A 1A9PA 1UH5A 3V1NA 1PI3A 3WSWA 5KWJA 5LZ2A 3ONVA 3JAKB 3DOEA 3QFHA 2ACWA 3C6KA 2DR2A 1L6RA 3NHPA 1XAGA 4TSFA 2O50A 4IIXA 5DASA 4PHTA 4F86A 2BP7B 2O6LA 4FFNA 2GJ8A 4NARA 5EIAA 2J6HA 5FBRB 5ALJA 4HC4A 3ILSA 3UJ7A 1K3UB 3BSWA 3ESZA 1T34A 1IN7A 2H7YA 1NBOA 2WT9A 4HX5A 3U4CA 3KAQA 1G9SA 1P9LA 1JILA 5CYOA 3Q88A 4RXUA 3B2QA 4HDRA 4ZARA 3R0IA 4IFIA 2Q7DA 1FU8A 3OCZA 3TAXA 4ZALA 2CFCA 3T3EA 3BMOA 3E5HA 1P1RA 1GLNA 3OZVA 2WJVA 3HHEA 2QUBA 3P9KA 4K03A 1X8XA 1XI2A 5CNIA 5B37A 2XMZA 5M34A 1BNCA 2PZEA 2X14A 2NV0A 1IM2A 4OHMA 1VGRA 3GCZA 4MR7A 4E5PA 3P19A 3G9QA 9MHTA 4MGEA 5AM2A 4YV7A 3QPVA 5DLEA 4EL5A 3DSRA 3JAKA 1S4MA 3KHKA 2B5WA 1Z6QA 2FQQA 4RV9A 3UAXA 4DVGA 4Q1AA 3EGDB 3CNHA 4JP8A 1OBHA 2BP7A 2VSNA 3QFTA 3P97A 3OZGA 4US0R 2AMYA 3WAJA 1Y6GA 4BLPA 1S7CA 4U9UA 2BLLA 3RS0A 4BVFA 3AVTA 3W7VA 3L4KA 2IYZA 3IC5A 5B58T 3KNZA 3H3JA 2JFFA 1H8EA 1N7HA 1OY1A 2FMKA 4PYJA 4CODB 1YB6A 2H4YA 1D4FA 1IVYA 3GCDA 4JODA 4MDYA 1NC3A 1L7DA 1NKTA 1L6IA 2QRGA 2WJZB 3BE6A 1PU2A 1V5FA 3G49A 4HDSB 4F9FA 1X7DA 4GX2A 2Q2NA 3R5TA 1Q7RA 1NVAA 2HKIA 4Q93A 2AMVA 3CSSA 5GWXA 5HBGA 2BELA 1JEQB 4ZMSA 2WD9A 4B33A 3BQ9A 1UWVA 2VO1A 2I3BA 3F49S 1I51A 5MGNA 1YXMA 2JGJA 3MCVA 3HWSA 3L18A 2C4HA 1XEFA 3AG5A 3KXDA 2A9RA 3OWOA 5E7IA 4PGGA 4EQZA 2QM0A 1I14A 4G81A 1PDVA 1GPKA 3B78A 1CJSA 4XCXA 1QU2A 2Y4NA 3EGDA 1MV8A 5K3BA 4A8PA 4KQJA 1H2RS 2SCUB 1DEOA 4INAA 2NVUB 2PTHA 5B12A 4C76A 5I7AA 1JQKA 2PMBA 5K0ZA 4MINA 5FLEX 4HMPA 4PQGA 4AO8A 3SIXA 1IBRA 3ZXXA 4LXTA 3HB9A 3RIGA 4BRZA 4MQEB 4GP7A 4TL9A 3WV5A 1O6GA 5EXSA 1OIXA 4DY4A 5DLQC 1BWQA 4HDSA 4GE0A 4IMIB 4QBFA 4FYXA 4ENWA 3WNCA 1SBCA 2OXRA 3ET4A 1XXHE 3Q5EA 1X87A 4PZLA 1W34A 3JD0A 4M0EA 1W5BA 1JEQA 2OLJA 4PYLA 4GOKA 4IJKA 4W7IA 2FN9A 4RGYA 4FFDA 3CO5A 1FJHA 1XDDA 4J7AA 1I2ZA 4LC9A 4OQQA 1Z2PX 3UXHA 3R9XB 1WO8A 3L7NA 4GLLA 4LKRA 5IJXA 5AYVA 1CUEA 1R6AA 1M2WA 3EMBA 4DMFA 2B34A 5EP2A 3HMQA 3DAPA 5K8LA 2FWJA 1WXQA 2C5HA 3GCXA 1E3DA 1M8FA 1KKMA 3F4BA 3GPBA 2SCUA 3OPVA 3LM8A 2JBAA 4G8DA 4XSHA 2ZATA 3DDWA 1H0KA 2NVUA 1D5WA 4I0WB 4C0BA 3NJRA 4RDHA 4B80A 3HYLA 4GGMX 1OUMA 2WRZA 3R0QA 1DAPA 2HCTA 5FULA 2P9BA 4P0TA 5EJFA 1W47A 1A50B 4MQEA 2EZ9A 3K4HA 1GNTA 1Y8QA 5B55A 1DAKA 4KO4S 4ZQCB 1QZUA 2XMDA 4OHFA 4YHHB 1FFHA 4V0SA 3VU0A 4YAOA 1V8OA 1VE9A 3MK31 1QYWA 3D3JA 1Q0RA 1PN3A 3O83A 5CA1B 1G3MA 5IZCA 1B6TA 3FUVA 5E0OA 3T4XA 1N25A 1PGOA 4RO0A 2BGLA 4LRWA 4C01A 4AF7A 5G1NA 1ZJJA 4NAHA 4AU1A 2R6R1 4GRDA 1DJPA 3H1BA 2OO5A 4X1YA 4TL7A 3O7MA 3IS3A 3UB4A 3WB1A 1EFDN 2I62A 5F2NA 3LZDA 4LRYA 1B00A 4QGAA 4URXR 6NULA 5JBNA 2D3TA 2GVZC 3FMPB 1ZM7A 1V3TA 3TTXA 1CVLA 3CJRA 2KQUA 4U63A 3BGVA 5A7FA 4ZAYA 3OOSA 4BMPB 3B8EA 3CF0A 3ZR4B 4YQEA 4CKBB 1E9EA 4D9BA 4DCUA 1G2IA 1JX6A 2VDRB 3KPWA 3LUCA 4RHFA 1H2HA 2QG4A 1Z6ZA 2UYCA 4DIUA 1NY5A 2UYGA 3EWAA 3RVPA 4UTRA 1F8FA 4GPIB 3UFXB 4X1KB 2PQ2A 4LTNA 2G9UA 2BSXA 2C9CA 4EVQA 1JT9A 5JW6A 2A1IA 1C0KA 4CEHB 2FFHA 3I09A 4WJLA 1GRVA 2WB4A 4OLAA 2BE7A 1Q0LA 5KJEA 4MQ4A 2CSUA 4AS1A 4Y1FA 2B92A 4YMLA 1DCTA 4QWMA 4ZO6A 2V7UA 1HDRA 1U0FA 3T5AA 2W42A 4A15A 4YYEA 3L0YA 5EZ5A 5CLFA 3M3PA 3KUCA 4R8VA 4G0MA 1GIAA 5AHOA 2V0CA 5DNDA 2N47A 3ZWPA 4A0RA 1LVUA 3DW1X 3KZOA 3L0SA 3GK3A 4AJ1A 5IBCA 2I87A 4B6GA 4UU0A 4MVJI 5HCUA 1YR6A 3JWGA 3K94A 1TMOA 3DW3X 5EXDA 2EL7A 2XE6A 4INOA 3RBXA 5HQ3B 4DZRA 4BLUA 1DKUA 2POCA 1TZBA 4IUCS 4OAPA 1HY3A 1O5OA 2CL0X 1RJFA 2G67A 3GFFA 4CKBA 1GDTA 1ZJ4A 5H1YA 4DFDA 1IU9A 2WIFA 4R7TA 4EG3A 1OXSC 3A1SA 4K9NA 4KGZA 3UFXA 2I34A 4NFYA 2VQFB 1NW7A 3O7WA 3R3SA 5CDHA 3HU3A 3SBEA 4UNQA 1OC2A 3HDJA 1EESA 3S40A 4PFJA 3W77A 2VPIA 3CYFA 4KNWA 3D1JA 3DWEX 3K0AB 3NCTA 4GNRA 5KTOA 1CHDA 3K1TA 1B8NA 1VFNA 2PU7A 4L9AA 4CFSA 3GFVA 5F9FA 2ZJ4A 5T3UA 4DQDA 4G89A 3U56A 1BOFA 4DLVA 5BNFA 4C6TA 2FWPA 3QE2A 1EFTA 1EZZA 2VSXA 4G0WA 4NDZA 4GWLA 4CUJA 1KI4A 3NC4A 4DLTA 4J1TC 1A71A 1IMJA 1NP7A 4KC0A 3V1TC 3I8XA 2LGJA 4G5QA 2CHVA 3RHTA 5A71A 2GHQA 4BLRA 3W7BA 1FDSA 3WDLA 1P8AA 1SWWA 2QRHA 3ZQUA 2YQZA 3LO8A 3T3MB 3EXEA 3UMFA 1XNHA 1P61B 1VIVA 1RYBA 1T1IA 1UBMS 5HMLA 1PS0A 1JHUA 2C2HA 2ODTX 1I1OA 2YCLA 3KKNA 3PX2A 4G2TA 3E9YA 1OWPA 4K26A 3ET5A 4X9XA 5D3QA 8OHMA 2ZQZA 2PEYA 1QV9A 4PCLA 2F3QA 2P4HX 2CBXA 2ZE8A 3AW8A 3L43A 3OT1B 3Q7IA 1UMCA 1BDMA 2FSHA 4KQHA 4PSVA 1ZIXA 3K0AA 3P4UA 2NIPA 4J3NA 5M29A 5IG2A 5FX2A 1E64A 1Y4AE 1EB9A 1K86A 1RI4A 1W6UA 4P82A 4TL8A 1P2SA 3QI7A 3NHBA 1W36B 4QUAA 5BW6B 5HVNA 2DM6A 4UD6A 1T9GR 1YMUA 2L69A 3LVBA 1KYZA 1WMDA 3DHVA 4WOBA 4G5GA 3SYLA 1TE2A 4DLZA 3I6QA 4HNTA 4YRKA 1FLNA 5KAPA 5E1DA 1TT7A 4C2BA 3BSFA 5AVVA 3P1JA 3IR5A 5ESDA 1J5PA 5KPDA 4M46A 1IIRA 2QN2A 3B1ZA 3FCSB 1S9HA 2B36A 3VC1A 3VI4B 4F96A 4B5KA 4KFCA 5C51B 1PJQA 2YXNA 3BHJA 1QGUB 1JR3A 2ZS9A 3MLBA 4JOCA 1FFDA 4C4ZA 3N3AC 5AVXA 2C9DA 5JRDS 3I9LA 1X1QA 4FUQA 1L7RA 2QQ5A 1PJTA 2HV9A 2PGLA 2QY6A 1ZIOA 4HAVA 4RGQA 1U1FA 1H9CA 5DRYA 2VAVA 5F7JA 4DQVA 3IKTA 4ZVOA 4BB9A 4D5EA 1RS0A 2VEDA 3LGXA 1GQQA 2RHHA 1LGYA 5FO0A 3QWAA 1NMEA 3M7IA 4W5QA 3KK0A 1FU7A 2PY6A 1LBHA 3KC2A 4O25A 2YJGA 5HKLA 5I7FA 2WTUA 1ABEA 4BP1A 5FUMA 4GSKA 1DRJA 3WGKA 4MHOA 5IM4F 1PEDA 1BMQA 3GRPA 3MUOA 1MB4A 2P3SA 3VR2A 1SCJA 1A77A 4OVKA 5FLKA 5F5NA 1HLFA 2DGDA 2XT6A 3UOGA 1I7LA 4NP6A 2YWFA 4CF3A 1CJCA 2W4IA 1W94A 5LJLA 2AJLI 2IZZA 2NWQA 4NNPA 1MIHA 2WNSA 4Q1DA 3CX3A 4XIFA 1A9SA 1QGUA 4CEJB 1M2HA 1RQ2A 4R8SA 3T1YB 2QOEA 5ABPA 1U0LA 5E7MA 2LIVA 2XHEA 3ODGA 3SNKA 4LYYA 2ZYUX 3PFWO 4TOIA 2PWPA 3ZWQA 1G21B 2W2PA 1ETUA 3ED5A 5ANRB 2XUDA 3NEYA 1AKWA 4JQSA 4LWQA 4BQIA 4F1JA 2ONYA 2PMDA 3CVVA 4OXNA 1A82A 5ICSA 1CY2A 1T2UA 4JVMA 3Q3JB 1WZEA 2VJNA 3L41A 4A03A 4E5NA 4Q47A 4FT2A 4RVGA 1SVMA 4KAXA 5DN6A 4B4KA 3RLFA 2HSEA 1KWKA 2OV2A 1XVUA 3KKMA 2NQTA 3VVMA 2WU0A 1Y80A 2X8BA 4IDCA 2Y2VA 5TV2A 3U4QB 4IV0A 1VE6A 1K6IA 2ACVA 3OBIA 4RDCA 2ZSKA 1NJ6A 2IOFA 3EY9A 4KH0A 3MBOA 4CQNA 1B43A 1PWHA 2RK4A 3AXSA 1N78A 1P0MA 3TPFA 5AW8A 2FRXA 3VYUB 1KS2A 4UARA 1HDOA 4LSZA 3SFTA 2WSIA 3ORRA 2QM3A 5GGXA 3AHFA 3GRYA 1G8SA 4LBZA 4RKEA 4N8DA 2B1IA 4LHVA 4XWOA 2I2WA 4DLUA 3AVPA 3E0XA 3E48A 3ZJ5A 5A3RA 1BZYA 4MP6A 2XQFA 3U62A 2TMGA 5F4BA 3R7NA 4QQRA 1L1FA 2RJOA 1KU0A 2OY0A 4S1TA 3QP9A 4ZT5A 3V4RA 2FPIB 2X0RA 2DBRA 1K5DA 2PXAA 2QTZA 2ZJAA 3JZFA 4HNSA 4TN5A 1J49A 2XUKA 3ADBA 1NX9A 5F7OA 1KEVA 1OWMA 3EGXB 3U4QA 4JQZA 1VLLA 3N59A 4LOJA 2XYVA 4ML3A 2COEA 1WHSB 2VXOA 3AF1A 3PPVA 1BN6A 1EP2B 3DONA 3KT6A 4RDIA 4RF3A 3RUDA 3GLGE 5DP1A 1Z5PA 4E15A 2P6OA 1Z4KA 2FJPA 1XDBA 2XCLA 1F6BA 4AWAA 3NHRA 3TQCA 1KC1A 2RDMA 1LDYA 4MKFA 1S6YA 3SC6A 3WIOA 2J5XA 1BKDR 3A2NA 2CJWB 3LX4A 2BFDB 3PQ5A 5F1PA 4TSKA 3BCRA 3GJRA 4R1OA 2X6QA 1J8YF 1A96A 3AHEA 4IUBS 1ORIA 4GMHA 4JBYA 1NV9A 2KB0A 4N82A 2AH5A 5EJAA 2GH1A 2HA3A 4MLDA 2Y66A 2VDLB 4X94A 1JPNA 5DN6D 5JHGB 2FX5A 3D3EA 3QPUA 1CP2A 1Z7GA 3UMCA 3A1EA 3D7MA 1XA3A 2VJMB 2FPIA 1AMNA 2VYVD 4X8HA 3ACCA 2IFTA 3OLZA 2VDUE 5AKEA 4DHWA 4Q1FA 16PKA 1FYEA 3EGXA 4WH0A 5CURA 2GJAA 3K1JA 5J5CA 1WHSA 1E1QA 1WSWA 2HCFA 4KXVA 3GFQA 4CCWA 4OLHA 1PJBA 2Y92A 3PJEA 4IQFA 2A14A 3LGAA 4NOMA 4PYKA 4URUR 4DIMA 1BWRA 3HKCB 2PMKA 1NQOA 1TPZA 1XVAA 2JANA 2AR7A 3ND9A 4OQFA 2AK2A 3CJQA 5CPBA 1I30A 1WMEA 3WMWA 3ROPA 3L8FA 4HNAB 2O5VA 5DBHX 3FOCA 2BFDA 1PBTA 2OEPA 1CLEA 3IBGA 1PW5A 1FU4A 1ZNYA 5E9JA 1JKIA 4IKPA 2JIQA 2PHZA 4J7UA 1YZQA 3T5BA 5BSVA 2H85A 4TLDA 1L4LA 1FQWA 1R9JA 2VVTA 4DLWA 3AU9A 2VBGA 1SVLA 4GDMA 5FL7A 1W87A 1PEAA 3AQ4A 1ZWKA 4IIHA 1N6LA 1UAYA 1PZHA 1GKYA 4XTRA 3TTTA 2JVIA 3LD9A 4N7MA 4W82A 1FDTA 5E6RB 4W5NA 1DTEA 1DC7A 4IL5A 1E1CA 3UAZA 1NR5A 3KL2A 3SQWA 1FLDA 4N7BA 3TD2A 421PA 4KITB 3HKCA 1XTKA 3BD8A 3SP1A 1WUIS 4CTKA 3C3DA 2HNKA 2X19A 3ECCA 1NNEA 3ANYB 1VZ3A 4CMIB 1QDEA 1XMIA 1QG4A 2QNIA 4Q7EA 1Q57A 1L7MA 4X45A 3WTBA 5K8VA 4NZMA 4MW1A 4UQPA 2GEJA 2FPGA 4KE6A 4W7SA 4POOA 4WZBE 1MXHA 2IP4A 3NHKA 3NS7A 1DBQA 4UZEA 1P75A 1VE3A 1HNZB 4D6PA 5KJCA 2XUOA 5HFNA 3HPRA 3A26A 3ETEA 3KXPA 2OCPA 4NYIR 4DIDA 2YC2C 4X71A 3OKFA 4OK6A 1W581 3IAEA 3WLSA 3EGCA 3ZDFA 3DT9A 5G3YA 3V1MA 4EA9A 4I55B 5E6RA 1GZSA 2G25A 2O1EA 2H2FA 4Q9JA 3P0IA 2RGDA 2R1VB 1J90A 3CKYA 4X1OA 2Q3BA 2HFKA 2CF6A 3B6MA 2WUDA 3DEAA 2Z43A 3ORHA 4MVCA 4YO8A 3C16C 4GPEA 3A3OA 3SDZA 3UV7A 4Z54A 1CY7A 2XECA 1SVKA 3N76A 2OBMA 4CMIA 1RKBA 3PGA1 5KYYB 1DL5A 2WTBA 3U7FB 2OXFA 2CL5A 1JLKA 1EKXA 2JIZD 3TECE 2X5OA 3A7DA 1FFBA 4AC9A 5IFLA 2W71A 2AKAB 1MT3A 3CWCA 4PCUA 3ZU2A 2EGGA 2XDAA 1U8UA 5HQTA 4M1SA 2J5BA 4FYPA 2WOJA 3UJBA 4LXQA 1KMHB 3DBLB 1H42A 3LX6A 4ID3A 2DWUA 2G0AA 5H02A 3A1FA 1Y3AA 1YNSA 2JAOA 5EGNA 2RGNC 1T9CA 1E2BA 2O3TA 2FFJA 4I55A 1SZCA 4G8BA 5JDIC 3LX8A 5I4KA 1RDFA 3OPNA 2BRUA 4RMIA 2R1VA 1MOZA 3RV4A 2P2NA 1M2NA 1Z2DA 3O3NB 3U26A 1ZG3A 5J3JA 4XOUA 1ST2A 3RAJA 3KWFA 2R44A 3C6XA 4QOIA 4LJ5A 1VPLA 4CKXA 5LA6F 3KS9A 2HTFA 3OTIA 1RLMA 1X2EA 3DULA 5KYYA 2XF2A 2XNKA 2UZ0A 4PRYA 1D6NA 3RRMA 2XCTB 2HIGA 1ESCA 5E8RA 2ZT6A 2M1ZA 1CKEA 3C24A 3GRAA 3MJHA 4LCBA 2I1VB 4DS3A 3AIKA 1KSFX 2VZ8A 1PAUA 1E3SA 1LC3A 1J09A 3B48A 4RY9A 3A6HA 4PYOA 3CX7A 3UAWA 1U7OA 2ZRLA 1JKJB 3B20A 4RL6A 1U7ZA 2I33A 3P9RA 1KMHA 3VBEA 5KCZA 4EJSA 1OLXB 1Z6YA 2GDZA 2IHKA 1GVNB 1I6WA 3IVXA 2EZUA 3IAHA 3LWNA 4Q4LA 3ZCXA 4CKYA 2YBEA 10MHA 3EDOA 3IP9A 4IFEA 5E1BA 2VKQA 3IQWA 3UAYA 2F8SA 1NVDA 4FDAA 3G9ZA 3MWKA 4E31A 3U4IA 3QLJA 4WRRA 4ZMRA 1H6AA 3PC3A 2WVGA 4I3HA 4BN5A 5ALMA 1CF9A 1F7VA 3ITEA 5B7QA 1FXWA 4IS2A 3ZEIA 1LDMA 5MDHA 4BBPA 4JMPA 2A1TS 2IXEA 4RY0A 5FAXA 2H16A 3WLKX 2QJOA 1ISJA 2P9FA 4UCXA 1JDPA 2QXTA 1SU7A 2ZRCA 1DDIA 4LMRA 3I64A 4E5VA 2EJTA 2AQ8A 1QCZA 3CCFA 4GM1A 1K92A 2FN7A 2FP3A 3FI9A 3R6LA 4P54A 5G41A 4DCOA 3CVXA 2OHIA 4M88A 1UBSB 1DKNA 2QUZA 4N0DA 4QELA 4IIJB 3KQKA 1E2MA 3GJYA 1DEKA 1IN5A 2BM8A 1FS4A 5EESA 2C3UA 4UM9D 4IH4A 1OWOA 4B9AA 3R3ZA 4RETA 3R7FA 1PP4A 2QAIA 2VH2A 4KXWA 5A0TA 1E62A 2C95A 5HEKA 1XWIA 2A0UA 4XYMA 5JOQA 1CJMA 3ZPXA 1CPYA 3OQMA 1RJWA 3ISTA 1TCUA 2P11A 3L0OA 4J91A 5AP9A 5T8KC 5AIBA 5BNIA 1WMSA 2JGDB 1XWFA 5EHIA 1DQYA 2YWCA 4I6JA 2Z2XA 4XB1A 1A7KA 2R2AA 4AKIA 1JFTA 1ZI8A 2F9MA 3OUUA 1RQ7A 5EKTA 1YR8A 4LDRA 3JXEA 2W2KB 2NUAB 4E5KA 1L7EA 1PNQA 3EAFA 3WWDA 8GPBA 1JPUA 4X44A 5CNJA 5JAZA 1F9AA 3TOZA 1QRDA 2JARA 3WDSA 1I3KA 3BRCA 5BQXA 2B5OA 3BKXA 1FFEA 3RK0A 2AVNA 4N0PA 1U2QA 4C3UA 4BL5A 2BF4A 4PLTA 2QPOA 1UJBA 2IUEA 1NVTA 3LHDA 3MJDA 1SK9A 1U2TA 5TR9A 5E7JA 4B85A 1IH8A 3VVCA 2JGMA 4I4TB 4J4TA 2ONJA 4RJLA 3THSA 4FB5A 4F3KA 2X76A 1ML3A 1AE1A 4YY3B 4W5OA 3UC9A 3JQEA 4DMKA 1IEWA 4CIAA 1L4BA 2P9JA 2B7CA 4EFKA 2PLFA 4N18A 4HYTA 3ROGA 3WDKA 2R68A 3UT0A 1IAQA 1ZGCA 1Z56C 4RPHA 1FTYA 1B15A 3PC8A 1LK5A 3KP1A 1I4EB 1C4OA 4RTOA 121PA 1ONSA 1TQ8A 4J2OA 4QYIB 1CRQA 2W2KA 4IIEA 4FGWA 4WFJA 2B8WA 3DL4A 1KZGB 4AICA 5B2FA 4GF5A 3IT3A 2NZWA 3K8QA 3NOQA 2HMAA 1QFZA 4KQEA 4C14A 1Z06A 3H6GA 1JAYA 2OG2A 1T4GA 2OKCA 2YXDA 3C6BA 2GAOA 4EY5A 2AWOA 3PL1A 5JSYA 4KQKA 1EZ4A 4X1IB 5C53B 3RJZA 2ONCA 4PYRA 3UICA 3V3KA 5KU1A 5LC1A 5IFKA 1GSHA 4R40A 3KQLA 4I4TA 1N8TA 1RBQA 4EFDA 5EUCA 5GM1A 3LBFA 2BKVA 4IGFA 3OF2A 3JX9A 3NBAA 1W46A 2PGNA 4YFYA 1RMQA 4TLEA 3M2PA 1KP9A 4B6SA 1ISPA 1NXOA 3GLTA 5EG5A 1WVMA 2AQHA 2H8GA 2FVXA 4BB6A 1VPWA 3AUKA 4U2FA 3UJ6A 5JVDF 4BFTA 3K9FC 1PL6A 2GBIA 3GO4A 2GTIA 3M5PA 1XCOA 3L1JA 4HWKA 4NRDA 4UHDA 2OPHA 3WAGA 3H9CA 3O4HA 4QYIA 3SFZA 4IKEA 2JNWA 2ST1A 4D8YA 4F72A 3L06A 4FE7A 1ZS9A 1JBEA 2WZBA 1NGSA 2ZJBA 2FY8A 2ZYHA 3RV3A 5LBUA 1V6AA 3Q6IA 2WTAA 3PDCA 3H9BA 2H59A 4CTOA 4MMZB 3WOVA 1GFIA 1MW8X 1DFHA 1QO9A 2YMMA 1ADYA 1NZJA 3NANA 2D8MA 4DADA 3BWEA 2GPTA 4MUAA 2QMHA 5CB4A 1KHTA 3TD9A 4BKQA 4DN6A 1U2DC 2X77A 2ZYWX 2XTNA 2XUPA 3V7NA 4CGYA 1H93A 4ROTA 3ZHBA 4WSOA 1XZMA 2VHTA 4XWYA 1J9EA 1EVQA 3DFKA 3WHLA 1P29A 5LBIA 1UAAA 1E2NA 5EIEA 1KZ9A 3C98A 1YQEA 2GS9A 3BTUA 4Q4DA 2R66A 5U4QA 4GKVA 3DAGA 3AHHA 2GTHA 1BYIA 3HLKA 3S0JA 1L5OA 3SQOA 4XYEA 3IL2A 4FYKA 3FJOA 4IXWA 4PSKA 5A5VA 1QYVA 4G36A 4V3BA 4RSMA 3T7EA 3G2QA 4B3XA 4IIDA 3KTOA 1RADA 1S2MA 4IXTA 4N49A 3ILHA 5M04A 2CLDX 1PQ4A 4K9QA 2ZJ6A 5IDYA 1N0IA 3QSYA 4Q9NA 1R8XA 2ZSAA 3CUEF 3IV9A 2FMIA 1M6WA 2X0KA 2GXUA 4KKXB 4B3JA 1HGXA 1NRJB 3F98A 4YBZA 3TRDA 1M34A 3BTOA 1XMSA 5JSZB 4CMCA 3WQSB 3FB1A 4JV5B 2PSEA 2YWHA 3V8QA 5KO2A 5F23A 1DFGA 2Z5LA 4EZEA 1OLOA 2PX3A 3OY7A 4TTQA 3ZC3A 3BJEA 2IYVA 4BQQA 2YVAA 1VG8A 4HKTA 3ROZA 4PPFA 3AR5A 4FGUA 3TZ6A 3LMKA 3R5SA 2D1YA 5CA0B 8ATCA 2O2ZA 2IHYA 2V7WA 3PUXA 3MHTA 1AB5A 1PFVA 2OORA 1NUAA 2B0JA 3BGWA 3TCXB 2ZDHA 1L5MA 1NVXQ 4NBWA 2GK3A 4ALLA 4ETNA 3QGMA 4ARAA 1MXFA 4MP3A 4EAQA 4M60A 1CUFA 1Y63A 3NTVA 2FA9A 5FKJA 1B6RA 3DMHA 3I05A 2VAPA 3BQNB 4G1BA 2H52A 4MYTA 2XTJA 2F64A 3FCAA 3NTRA 1NAHA 3S27A 3PJDA 4DUGD 1TU3A 1RZUA 5AVKA 5BOVA 3EVFA 5D85A 2PIAA 3ZUPA 1VPTA 2RHTA 3IPXA 5B4VA 4P5PA 5HZHA 2VP2A 3BJRA 2ZT8A 3KDAA 5JSZA 4PGHA 2A59A 4CIVA 2EFHB 2X9VA 3KSAC 4JI7B 3PQ4A 5GJVC 3N70A 4C3OB 4DPKA 2Z6AA 4C3ZA 1U4SA 3T9FA 1GPNA 4AP6A 5BW4A 1NXSA 1A9RA 1FMCA 1SVUA 1XQWA 4ZICA 3Q0TA 2I78A 3L93A 5BMVB 5CA0A 2VSQA 4KQXA 4DEVA 4XD2A 5FL3A 4I3FA 2QD2A 3DDSA 3HN2A 1QIEA 3A6KA 1HR0B 1GFWA 2C4NA 1T8UA 2P3OA 5CK5A 3DL2A 1EDEA 1NBWB 2VAXA 3GRVA 4NOJA 3SIPA 1U7HA 3OZXA 4CTJA 1KI3A 5L3QA 4KFUA 1D6MA 1DZ3A 1ZX1A 2V03A 4IXDA 3U3KA 1AHNA 1GRRA 3EEBA 3FHLA 5L7YA 3O1IC 1R0KA 3IOEA 4OHCA 5D5PA 5EP4A 5EXTA 4C4XA 4GX0A 4F45A 1AMOA 7MHTA 3A10A 1TMGE 3D7KA 3T15A 4Y0NA 4Z0PA 5I47A 5DBIA 1OXUA 1T3HA 1AK2A 3KDSE 1BHSA 1BVUA 2QP9X 4WXYB 3OJFA 3TDNA 3CE6A 1SC6A 2AJCA 3PQDA 2H1WA 4IGIA 4AUKA 4CG2A 4QODA 4A73A 2Z8YM 3AB3A 2JLSA 3DXZA 3F7NA 5ED4A 2L82A 2YRFA 1UT5A 1QOZA 2RGNA 4PBRA 3TQSA 4ZK6A 4N39A 3O4FA 3P2YA 1E5DA 2ZRPA 3L6CA 4JLSA 3H1FA 3LG2A 5CLQA 3HACA 3IIMA 4N6OA 2Q50A 2EGUA 5I8ZA 4KN9S 2INGX 4BTLA 5E3IA 5C1BA 4Q15A 4ZEXA 4WXEA 4L5IA 3R0JA 4OB8A 3P9IA 2VT3A 3LWZA 1HYGA 5EQJB 2J9YB 3OPXA 1TW2A 3VKWA 4HL6A 1LEHA 3KJFA 5DX8A 1Q7BA 2R60A 4RD2A 5IAOA 1P1KA 2C2MA 1QU3A 4G84A 3RRYA 5I5GA 4MV7A 4JJZA 5EJ8A 1ZD1A 4HDKA 5CMLA 2MR6A 4FOSA 4LGYA 4Z9AA 4TWIA 3ZQKA 4B45A 3QE4A 2LPMA 5BPHA 2I67A 2KS6A 1OXXK 4MW7A 1RQRA 1QFYA 1FZTA 4MGYR 2I6UA 2HBYA 2OBNA 2PZLA 3WSTA 4L08A 3RSZA 3CRRA 1LI4A 2GNPA 2P69A 2PUVA 3L04A 3CY6A 1FNSA 3ER8A 3CMCO 1TXGA 3OUZA 1MEEA 3U7RA 3PWKA 3RUIA 5SYNA 2WKRA 1CERA 5CX1B 3GP5A 4PPNA 3WKAA 1C4KA 1IZ7A 1LY1A 3QVOA 4HDCA 5EJ6A 4DQKA 4J3JA 3AUSA 3OEHD 3QJGA 2G17A 3RFTA 1NJSA 1EWQA 1O4WA 3ID6C 5FHQA 2W37A 4I1OA 4E21A 1UT8A 5CITA 4YR7A 1H3EA 3L6OO 1PKEA 2WIBA 3W0LB 1V8ZA 2XZTA 5K6AC 4CF7A 4MLZA 2BR4A 1Q0TA 1A5TA 3GBSA 1NXXA 4H1TA 4I9FA 4XLLA 4NJOA 4BNJA 3ZV4A 2W7TA 2I6TA 2YL2A 2OYRA 1YHNA 1H8HD 2D8AA 1XRQA 1QVVA 3Q87B 3HZZA 3AKZA 4YREA 2DR0A 4IF4A 3JATB 5C8XA 1CJTC 2P79A 4ENPA 2XMQA 3WLMA 1E9FA 1ZC3A 4OQDA 1HKHA 2AG0A 4IKOA 4IIFA 5DZSA 3RK4A 4BWVA 4F85A 1AGPA 2QGNA 2B7BA 1TYAE 3P27A 2YOGA 4L72A 4ZYTA 5DEIA 2W2QA 3ANLA 3MMPA 4RYLA 5IT4A 3NOVA 5AW0A 3WLIA 1AA6A 5CX1A 5KCMA 3PDIB 3TM5A 1LW7A 2R6JA 3KJGA 4DE5A 1GAWA 1YDMA 3OUTA 3ZD6A 4AXXA 5IMBA 2WWRA 2ODAA 3ODPA 5IBRA 3GG9A 2OA0A 4BC1A 1KFEB 1Y5IA 1UXOA 3OIDA 2CLCX 4KR3A 3WJ2A 4GVLA 1DG3A 1ZNQO 4YX9A 1VKZA 5IW8A 2UZIR 3FZEA 1RU3A 2V54A 5LZ8A 2O7RA 2P4QA 5P8WA 1FRQA 4H3VA 1G8YA 2C2WA 3WK8A 4DQXA 4QHYA 3JATA 3QYPA 4R2XA 1V45E 1NR7A 1IAVA 3QITA 1TF5A 4E51A 4J2TA 2G88A 2YXPX 4KDRA 1QP8A 1RCUA 1S3SA 3P9YA 2JVKA 2C00A 5AUNB 4PGMA 3GEDA 3WB2A 3COWA 1D2HA 3NP9A 3FSGD 1OX4B 3SEZA 5BSTA 1QIDA 2GD0A 2QLJA 3I62A 1L9KA 5TVKA 4GOLD 5IANA 4MVJF 3WZLA 4P92A 4ZDWA 4BLVA 4C5CA 3KKLA 1Q91A 1TEVA 4H6PA 5PNTA 1PCXA 2EATA 4FNOA 5C7LO 4KYUA 4AJNA 1OH8A 3PJRA 3KQOA 1XN1A 1M2OB 3E03A 3WADA 3M5DA 5J47A 1XFAA 2JAQA 5J58A 5JRJA 3L5OA 1IATA 3MBKA 4FEYA 3BIJA 1YVUA 3R3WA 1JI0A 1LCIA 5DPMA 4X65B 3M4ZA 4FE4A 1MX1A 4C05A 1DC5A 1SD1A 3D4IA 3TL6A 1NSYA 1ULBA 3OTWA 3DYBA 3DTNA 2M2IA 2NOAA 2XDWA 4QGGA 5LFAA 3OIUA 1KJNA 4R9SA 4BE9A 2O8FA 2Y99A 3QUQA 2NZUG 4IMPA 1N57A 1I7SB 1FSFA 2XQGA 3K16A 6Q21A 4Z53A 2OP1A 4DCMA 1KR2A 3PUZA 5F78A 2QIOA 3UG7A 3OEYA 5LU8A 2XUHA 1DP4A 1T9HA 4LYJA 1BOOA 4WCFB 3EUFA 3KAPA 4BRWA 4CQMD 1SHZA 2WF6A 3R1IA 4OM7A 2VTDA 4EB8A 2AL7A 3I3OA 3GLQA 2CVPA 3U7QB 3TIGA 2FB9A 3G0GA 4JOQA 3FGZA 5CIWA 4U7WA 1K6EA 2VC2B 3KZMA 1NF3A 1AQ6A 1M8KA 2FOLA 1NN3A 2DHCA 2Z4TA 3R6GA 2VS1A 2VSOA 2OB1A 4NU0A 3T3GA 4DRZA 4KZPA 1BXKA 3NU1A 3SE0A 3PQ8A 2EW1A 4YJ2B 3ZU3A 2G08A 1G291 2GEDA 1SOMA 2C03A 3EA5A 5CDGA 1S2GA 2COKA 4R2HA 1TFRA 1YZUA 1IPFA 2IF0A 2OFWA 1MGPA 1WVIA 4PZDA 4G0VA 3E53A 2ZJZA 4U7FA 1SUIA 2CB9A 5HBRA 4CV1A 5JUWA 2C7QA 3EVAA 5KJ6A 3WL7A 1J2TA 2CNLA 4M55A 4WCFA 1Y7PA 3MINB 5TMEA 4LEIA 4RCZA 1OWLA 3U3JA 1Z47A 1D2MA 4HRXA 2ZIZA 1HETA 3U7QA 1M1NB 2IYTA 1N8KA 1X94A 2XUIA 1SJ9A 3Q2KA 1UUFA 5J2TF 5HCNA 3DZHA 4MV6A 4IVQA 4GQBA 1NQWA 2NYUA 1A69A 1X0VA 1Z17A 5B1YA 2K2QB 3OPMA 1E63A 4YFVA 2IBMA 4L8WB 4U2EA 3JR7A 3U1TA 3VU1A 1BRTA 1VGVA 4HAOA 3X2FA 5I4CA 3AINA 1GL7A 4YJ2A 2R86A 1E4OA 2XTMA 4M9XA 3RUAA 3BXPA 1NA5A 1U3CA 4JIGA 5AM1A 1OXVA 2WF9A 4XQGA 2GN6A 4JB8A 1Z35A 1ZHFA 3LZ6A 4FLMA 1LDGA 1J1ZA 1P2BA 4JVOA 5KX5F 3P2OA 1DKPA 4QGBA 3IJ5A 1RMTA 1QRTA 3MINA 4QBKA 4BP8A 1J2EA 1KEWA 1KBQA 4L7QA 4BX0A 2P4SA 5JADA 4C4YA 4D57A 4DHEA 1M1NA 3KO8A 1KVTA 1UP7A 3O3MB 2E2WA 2WM8A 2YIDA 3MT7A 1MQ9A 2ZU6A 3K9BA 2C99A 4HQFA 3P5SA 5AI4A 2VLIA 2Z8ZA 3BFKA 5DDIP 1BS9A 2VUTA 3LU1A 3FFBA 1FCJA 3ZNOA 3SIWA 1AU9A 3JASB 3KT3A 4CUZA 4DABA 4DR1B 3JD3A 3FVWA 4LDJA 2XRFA 3U80A 4B4WA 3M3DA 4TMKA 4UVGA 4OBXA 4R6XA 4I1IA 2XCRB 1RI2A 4HLNA 4QO8A 1SXPA 3ZCTA 3CNBA 1XRMA 3E84A 2Z4SA 4HPWA 4K9PA 1V3UA 3T7DA 2E6KA 3USCS 3TQFA 3V42A 4CM8B 4I4IA 4MUYA 4E5YA 1FS6A 1MDBA 1PX0A 3EW9A 3QPCA 4KO8A 1N7GA 1TF2A 1K7EB 2FSFA 5BVGB 3SM9A 1SM4A 1NM5C 2A0XA 2J09A 1RC0A 2TS1A 2X3FA 4R31A 1D2NA 3MWDB 1QO0D 1BHO1 3E27A 3R5KA 4M98A 1A4IA 3MM4A 4OI4A 4UC0A 2TECE 3QLEA 1OB2A 3DM5A 4Q9HA 5TS3A 4Z8YA 4MVJM 3V5NA 5EJEA 2ODPA 1FPMA 1KE2A 1ZWLA 2R4QA 2XWJI 5HF6A 5JROA 1H2YA 3TOSA 4N7RA 1EBBA 3JASA 3H3XA 4FIZA 3O3OB 4UUOA 1DX6A 1HO3A 2PX0A 3PGMA 2E6UX 3B1KA 3MMSA 2D7CA 1JHVA 2PS3A 2WWTA 3C6ZA 5DM2A 3CUYA 3P2EA 3A1WA 4YDSA 4UM8B 1FFXB 5AOVA 3W8RA 4M0KA 2P41A 3WIBA 4YPOA 1GAXA 3C1AA 4FR5A 1E1LA 1K6XA 4DDHA 1YJBA 5BVGA 1MPTA 1RYFA 2CDRA 4D43A 1XZPA 3EMVA 4QOHA 1BH2A 3BULA 2VQEB 4PNZA 4EI8A 1Z7WA 2DTDA 1XTQA 4EO9A 1ACLA 1UBHS 1TDJA 3BF7A 4FUTA 4S1WA 3WYCA 4ZZIA 3QU2A 3LT1A 5ECYA 3HBJA 4MUKA 3SDBA 4B48A 5LQAA 4DUZB 2N0SA 3L6DA 4W63A 2Q2OA 3DE3X 2OTCA 4P5DA 2BGIA 2QTLA 2ZRFA 4IIBA 3PFCA 2OILA 2XNHA 3TIXB 3OJ0A 13PKA 1KVUA 5A6VA 3SK0A 2C94A 4JY7A 1J97A 1VJDA 1ZINA 2NSJA 2XADA 2ZBUA 3CXRA 3OAAD 1VJRA 1M0SA 2HSWA 3DYIA 3LOQA 2PPLA 3W6ZA 2FWAA 4C0JA 5LQDA 2FH5B 3AM3A 4OL9A 5CW1A 3RB8A 3AM5A 4KLCA 4QBIA 3WK5A 4Z7OB 1TJ4A 3QJYA 1ZVJA 4RM2A 4RVSA 3AY3A 3K0CC 3QXHA 3KYIB 2YNMC 3OICA 4M1EA 1BMFD 3JWPA 4NJEB 5G4KA 1I24A 4DBVO 3AEUB 1VCMA 2DOKA 2IZ0A 3VYTB 4B17A 1RAGA 2G28A 1H6BA 4UXHA 5K0LA 3RJTA 3R2JA 2I65A 1IJKA 2ZI5A 4PG7A 5D8DA 2OMKA 4PR0A 4HDMB 2RHGB 2C1XA 1JXQA 1MAHA 4S2EA 1UFQA 2E4UA 4W6QA 2R8PA 2AG8A 1Z8HA 2FUCA 4ZWNA 2WLTA 3PWSA 4IY1A 5COBA 3TKLA 3UJ8A 2JBWA 1NLYA 5K6AA