2FUG6

Crystal structure of the hydrophilic domain of respiratory complex i from thermus thermophilus
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
161
structure length
144
Chain Sequence
EREGILFTTLEKLVAWGRSNSLWPATFGLACCAIEMMASTDAQADVMIVAGRLSKKMAPVMRRVWEQMPDPKWVISMGACASSGGMFNNYAIVQNVDSVVPVDVYVPGCPPRPEALIYAVMQLQKKVRGQAYNERGERLPPVAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADH-quinone oxidoreductase chain 1
publication title Structure of the hydrophilic domain of respiratory complex I from Thermus thermophilus.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 34
structure length 144
sequence length 161
chains with identical sequence F, O, X
ec nomenclature ec 1.6.99.5: Transferred entry: 1.6.5.11.
pdb deposition date 2006-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
6 PF01058 Oxidored_q6 NADH ubiquinone oxidoreductase, 20 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12280 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2fug600
2FUG6 4HEA6 3IAS6 3I9V6 3IAM6 5LNK6
chains in the Genus database with same CATH superfamily
1KTVA 3H2IA 2H8KA 3HR7A 2JGEA 2DXIA 2OWDA 2QTBA 4IIJF 4XGRA 3SZ3A 2D2IA 2R2AA 1BGXT 1KDTA 1NFRA 2UU9B 2JG3A 5EC8A 3KDAA 2NN3C 1PCXA 1LI5A 1SVKA 3NZEA 4ZO4A 3OICA 1E4VA 4LS3A 3FAZA 1NN1A 4N3NA 5HG0A 1JT2A 1E58A 3DF9A 5IDYA 2V3WA 4CM8B 4PAWA 4O25A 1IVYA 2H2HA 1WTAA 3A6ZA 3CRZA 4KQ1A 3DAFA 4RTSA 4WZAE 4FGZA 2AE2A 1QV7A 1UKCA 2CLEB 5IJAA 4QEKA 3BSYA 4LCEA 3OQ6A 2I71A 4Y7DA 1O3YA 4Q7LA 3RQIA 5T8KA 3ZJTA 4Q15A 3SY8A 5H4GA 1DZ3A 3GUCA 4GT1A 3VU0A 3QKWA 1XZDA 4BBAA 2JJYA 1WDMA 2QB5A 1N2CA 1TUBA 1PJZA 1FS5A 3QA3E 3EQ2A 4GXQA 4QTUB 3M4NA 1HC7A 1YZTA 1P73A 5FR1A 1GJRA 5HCIA 3TNJA 1QH1A 3B9RA 3UV6A 4ZI7A 1AV6A 1U7WA 1GFIA 2GK6A 1VSVA 1JS1X 3INRA 2GZ2A 5DBHX 1EP1B 1E98A 3BL8A 1O6FA 3D6MA 2ZWPA 4MR9A 5F77A 3WTBA 3CZMA 4JOQA 5HCUA 4CQMA 5BMVF 4QYWA 2WKSA 5E95A 4DZTA 1JFFA 1P9WA 1AKUA 1S1CA 2TMYA 1ZY2A 2QTNA 1JN0A 3C3MA 3RSOA 3U7HB 3O1IC 4DCOA 1H2EA 1U9YA 2J7KA 4HK4A 1PZMA 3P32A 1DADA 3OPYI 3AV0B 3LCMA 1C7JA 3C85A 4J1TA 1YZLA 1JKJB 4XTRA 2J9XB 5IKXA 5C32A 3SXUB 4EKGA 2XWPA 4PLGA 5FD8A 3W5IA 3QE9Y 2BSAA 2WF6A 4OU4A 4PC1A 4R0NA 3AKYA 3D7RA 4PG4A 2C61A 4TQAA 4KHPB 1QU2A 5AOVA 2L2QA 3AL2A 4LGVA 4EYEA 1TM4E 1J0DA 3N0XA 4KO4S 1J90A 3AWDA 3FWHA 4J07A 4PYLA 3IEUA 3WRXC 1CQPA 4LJKA 4F11A 4DA9A 3DMRA 4RFSA 4IXTA 3T06B 4ZIRB 1SIUA 1L5VA 2LCFA 4IZOA 3ITDA 1FFAA 2VH1A 2W48A 3OCJA 1WBJB 4GMFA 4I1IA 3SS8A 3W8EA 4Z4QA 4X85A 4BP8A 2IH5A 2QVXX 3QVTA 3DMPA 4BO1A 5AHRA 3VC3A 4C78A 1N75A 1EFTA 1OBVA 2WBLC 1T5IA 3QI7A 4LJRA 2PLWA 3KR2A 1ADBA 3QMVA 2GETA 4YT2A 4YPVA 3TFOA 2OHVA 3RS8A 3S55A 4GOKA 2C4WA 1NFFA 3HB9A 4XUCA 5JY6A 3S3TA 5B3KA 1ZK1A 3OFVA 1KK2A 2AX4A 4TVBA 1WMDA 3HEBA 4FDUA 5KWSA 4EW1A 3SIWA 3F1LA 2VTKA 3SE7A 4H7FA 4R8RA 1BO6A 5EJ8A 1MB4A 5LZ2A 3BQ9A 4JX8A 1EHIA 1WY5A 4JKYA 3WADA 4TSFA 4H15A 5CFPA 1MABB 1OU0A 2KYRA 2WEKA 2ZI4A 3F9IA 3LGXA 4G07A 4NHEA 3R23A 5LB4A 1OTXA 2RBKA 4EKEA 1VLHA 5DMXA 2YIDA 2I80A 2EGHA 3H83A 2EBWA 5EY5B 121PA 3WKDA 1S96A 4JN6B 1IIBA 1HLGA 4IIJA 3ZXUB 1E1RA 2JRCA 3TLKA 4NI5A 2BRUA 3URKA 3PD1A 1NSYA 3GO4A 4BTEA 4IMJB 4NYMQ 3SOPA 1BTOA 4DG8A 1Z5UA 3DZDA 1X1SA 2CSUA 2YCBA 2QVCA 1ZGAA 1BYUA 1GKLA 4JYMA 5HJEA 2NADA 5LQSA 4LYFA 3PP8A 4RKRA 3N2EA 3USES 1AN0A 2ZU6A 1U9IA 4JP2A 5AHXA 5FADA 4WKCA 4ID3A 1VE9A 3TLGB 2J4FA 4L4ZA 1MOQA 1Q0SA 1V8OA 2OCAA 2O7RA 2WSSD 1XNHA 3GCWA 4ZV4A 3A9SA 4IQGA 2DX7A 1UK9A 3J81k 4GR5A 4RY8A 5M3BA 3K6SA 1C5KA 3UAOA 4B1FA 1H2BA 1SM4A 3AETA 4CM4A 2XSZD 3O31A 3JYHA 2EWWA 3TAXA 1LV7A 4X1IA 5ITZB 1E2EA 2QX8A 2BFWA 2HK6A 4BFCA 1JDSA 2OB2A 3EEOA 1PSWA 3G8BA 4WNCA 2ZJZA 5BV0A 1JG3A 4W1SA 2WPNA 3MTBA 1ML4A 3W2GA 2X8JB 3ER9A 3FTNA 3DUFA 1L5RA 1ZK4A 4EYSA 4U2CA 1G4UR 5HBRA 4QGSA 4B0PA 1MX5A 4X7MA 1N2JA 1FTQA 1JHMA 1OWNA 1RYZA 5H83A 4PQEA 1DAKA 1ESZA 1J42A 2CNKA 1IN6A 2E0IA 4MR9B 5AH0A 5ALRA 3RUHA 3D6UA 2VTBA 3G1WA 4DIUA 4Y2RA 2UYQA 1YU6A 3E7PA 5IM4A 4RV9A 2PRIA 1H6BA 4XJXA 2AEEA 4YS6A 4DSAA 3RRJA 3HM2A 3HDQA 4G1FA 2C77A 4CTOA 1SVSA 1OILA 4K5QA 1V8DA 4UMEA 4AMYA 1NU6A 1ZEJA 1ZIXA 2I4LA 3KV3O 1ZL0A 4PAQA 1U7PA 4MMYB 5FULA 1QYRA 2I4IA 1BAPA 2PBFA 2W93A 4F0JA 2X1VA 3MUOA 2C4TA 4BZQA 3ZVRA 5BWOA 2WF9A 3MJCA 3NIWA 4D74A 1RQGA 2EFCB 1I36A 2X22A 4QFDA 1BDBA 4TV8F 4JOBA 5DBEX 3KRTA 1CY7A 2NU7B 3ZW9A 2O8BB 2XGGA 5JQGF 4IHJF 4I1OA 1ICIA 1L7RA 1R7RA 3SLKA 3OEYA 3TZKA 1Q1EA 3EUAA 1JF8A 3IKJA 5F23A 4WDRA 4HDNB 4RF3A 5DOVA 1P18A 1ZOLA 7REQA 1C7RA 4IVQA 4EIWA 1TJPB 3HPRA 4C5CA 2W2OA 1QFJA 4W8OA 2VWPA 1TL7C 2FMFA 3F3YA 3CZ4A 4X44A 3VUFA 4MJXA 1T15A 2AR9A 1SQ0A 2WILA 1FRNA 2QGNA 4YREA 5IXYA 2ZSJA 4MQLA 4RH1A 1S8FA 3CONA 2P6RA 1G0NA 1YKSA 4Z49A 1WUTA 1BDHA 5KBYA 3FFTA 1A7KA 2DKNA 2XKBA 3GFVA 3OLVA 4LXYA 1U8FO 1EVJA 2JEYA 4M8NE 1X86B 5CT6A 1QDUA 2XT6A 3DEJA 2WWIA 1HT1E 4F5YA 1P44A 4MVJE 3QUQA 4RAOA 3U80A 2YY6A 3K16A 2X9QA 4Q3DA 4EB3A 3F6EX 1UC9A 1OY1A 4AJ9A 2M32A 1GTL1 1V11B 3FETA 5D6NA 3RVNA 1XFDA 3QGMA 1KKUA 1R50A 1XPJA 2JNWA 3WWPA 4CKBB 1BEEA 1C9NA 4QXRA 5KQRA 3ETJA 1DVRA 2VTEA 3PDUA 3EOAI 4FUTA 4Y1EA 5JZOA 5KPJA 1EHYA 2AVNA 1Y6JA 1N6PA 1NRIA 3O4GA 4EGFA 3G2MA 3SIPA 2LKCA 2HF9A 1TZBA 2NZ2A 3SNHA 4B82A 1IHOA 5K0NA 4EHAA 3UPTA 2VJMA 3FUXA 3VA7A 1WP9A 1QHEA 1DOAA 1KK3A 2W6ZA 2ZQ5A 3O0TA 2B5WA 3ESAA 2G09A 4RFLA 5CGZA 3VM6A 3WGJA 3GCZA 3DOCA 3GPLA 4PLCA 3VVLA 4A8JC 3ORYA 3P9YA 3EZFA 1ENYA 2Q3DA 3P8ZA 4N8DA 2BTOA 4H6PA 4AJJA 1ZM3A 1SUCA 4I8DA 3ZGVA 1P9LA 3NG1A 2FFJA 3CW8X 4OKNA 4PCVA 4QJ4A 5DSZA 3DMTA 4RTKA 2UUOA 1E7WA 4BQOA 2WHPA 1KMHA 2NXJA 3HN2A 2KPOA 4HZIA 3ZWAA 5C80A 5LP6F 1DAGA 2FG5A 3AJ9A 3IIKA 4LTMA 3BF7A 2WIBA 3ICEA 1VMIA 5D8DA 5ENZA 1XD9A 4TXHA 1CUXA 3H9GA 4YRZA 5K01A 2G76A 1BDMA 2PZLA 1LPAB 5DCUA 3T3DA 1WXWA 4PG7A 1RCUA 3V1NA 1KRXA 3UJHA 4F4DA 1E2HA 1BSVA 1U8EA 3GEDA 2OO5C 1A1SA 2XDWA 3GFFA 5ALUA 3B2NA 1TLFA 4U2FA 2OAEA 3IRUA 1OX4B 5IK2A 4D9MA 3IRVA 3SMVA 2JF0A 2PIDA 5KWVA 3DUFB 4JXXA 2E89A 1JEOA 1P5RA 3L1KA 1H66A 2QN7A 4I1YA 4PYOA 4UUAA 3MFQA 2PZBA 2XTJA 1BU5A 1O94C 1RQLA 3Q7TA 2QS9A 4CKYA 1EUYA 2XQJA 5JPIA 1JA0A 3OQVA 4EA9A 3IAXA 1YDWA 3KKPA 1TM1E 3OKCA 2PMFA 3GZNA 5CGQB 4Q1CA 3R74A 1JSLA 4MYTA 3WYEA 1FYEA 4HS4A 1BJKA 3AHFA 4JNCA 4EOGA 3RRMA 1A8HA 4XB6B 2PUTA 5NULA 3BD9A 4FFMA 4LHEA 5CFRA 4GDFA 3MSCA 3OHSX 4RHUA 5LBIA 5TVKA 2FG6C 3W2FA 1UFQA 3HUTA 1BWPA 1XEAA 4MYRA 4ROSA 1XMPA 1DIGA 3WA6A 3WRYC 4RIIA 1Q7BA 4FDVA 3W1EA 3AVUA 1XGKA 3PNSA 1ORHA 2GZHA 1N2OA 4S2UA 5A7HA 3JTMA 5FQOA 3DP7A 4HEA6 1U3CA 5F4BA 1CQIB 4JBYA 5GJCA 4OATA 3AVTA 2ID9A 3DW1X 3UQZA 1NUPA 1QB7A 2Q3HA 1JG1A 3E7DA 5CDGA 1V8PA 4I4TF 3FKSD 4LK3A 4XSHA 1B74A 2UAGA 3R3XA 4CQNA 1LRLA 1Z6AA 3ZWNA 4NBRA 3L7KA 2OO3A 3R20A 4J29A 5BOSA 3KZCA 4FMDB 2NYVA 4MIKA 1A88A 2ZBPA 3ADPA 5GJBA 3LI2A 3OIGA 4YJKA 3FB1A 5HIIA 1JIUA 4OHWA 3DBRA 2FPIB 2COEA 3FPBA 3S2EA 2I6QA 4R2HA 1OXKB 1SCUA 3OPNA 3OEEA 5J2UA 3QA9A 4BXOA 1E4EA 2VJDA 4XASA 4DLSA 2F8SA 1Q77A 3HE3A 2Q2NA 5C8XA 1FW8A 1HOXA 1X14A 3UJAA 1UP7A 5AUOB 4R8KA 5FBVB 4UMVA 4DYVA 3LS2A 1SB9A 3AEQB 1ZOOA 3WNDA 4E5SA 1JIQA 1VE1A 4Z51A 1IHDA 3LO5A 2GNOA 3AI2A 3MQ4A 4UAGA 3GZTB 2Z98A 2I3AA 4MVXA 3PC4A 2R7KA 1M83A 4JJGA 5D1NA 3PNVA 4E21A 5GVSA 5MFPA 3EEYA 3OY2A 3CVUA 1X8LA 2YFQA 1R00A 1XJ0A 2B4AA 5HHTA 3W5UA 4MQMA 3RTBA 4PQYA 1KI7A 2PWYA 3F46A 1JNXX 4NKRA 4O2AB 4C7OA 1PJ8A 2OV4A 3W6ZA 1BU8A 1O6GA 5I01A 1RFGE 2ZI9A 3Q6NA 1K2WA 4M4SA 5TPZD 2FB9A 3LK7A 2EGUA 3FR7A 3ZX4A 1QFSA 1JR3A 3K1TA 4XDHA 4CKEB 3L7YA 4S1PA 4UW9A 1JJIA 1N7JA 4OKSA 5LP6A 1Y8QB 3HDGA 3WC4A 4D8XA 3JV7A 4I1SA 3FPCA 2YXBA 3FBTA 1U0EA 2CF5A 1ZS9A 2IU6A 1QRDA 3I9FA 3LY7A 4MB2A 3DTTA 4GC9A 3I6MA 3RVJA 3AKEA 2WTXA 1L5ZA 1KMHB 2WHPB 4W99A 4YP5A 4B35A 1Z0ZA 2H17A 5SICE 3SFZA 3ZU4A 1YA6A 5JNRA 3TW4A 1RLJA 4K6MA 4AY4A 1XZIA 4PW0A 1XELA 3HN6A 5A6SA 2N75A 2D2VA 3WSTA 1HT0A 3RNLA 4RTQA 1X7ZB 5B57C 5TLSA 3AF3A 4EZIA 5ICFA 5TGZA 1UEXC 3GIDA 2H7XA 2E6UX 2DR0A 2F64A 3NYQA 1AG9A 2CFTA 2ZPTX 1GPUA 1W5FA 2A0KA 1Z0IA 4G4IA 4K40A 4ZVUA 1NOIA 2MR6A 1X7YB 2V7QA 3L6CA 3BWYA 3N3AC 1DWPA 4BJ3A 4RM3A 1PS0A 4HEA1 1QFZA 2YJZA 5KJ1A 4BL5A 4MDHA 1XRLA 1C3LA 2JFHA 3VV3A 1GCIA 4Y9UA 3T12A 3EWAA 5YASA 4TUYA 2NZWA 4ZQFA 2B2XA 3H5OA 4AU1A 1V7ZA 3L8FA 4D41A 4HNTA 2QN2A 2D74A 3CB2A 4KQ6A 1GOTA 2J5QA 2OXIA 3DR3A 3HACA 4AVYA 5DSTA 1J8YF 5K99A 3C6XA 2VZ9A 1RRFA 1YB6A 5IBRA 5HRUA 4ILEA 4GKKB 2DFVA 4A10A 2V03A 4W7HA 3A31A 4CR7A 1MIHA 1MJNA 2J07A 3HDVA 1R6BX 3PA6A 3JD0A 4QO7A 2NUAB 2FN8A 2M6LA 3V4PB 3OX2A 4DVGA 5EWMA 2OCDA 2XW6A 4E3ZA 2EBHX 2RHJA 3CMCO 5D1HA 2BGGA 1ZJ6A 1UMCB 2ECPA 3IBTA 1SRRA 1TJNA 3PENA 1IWOA 3PWTA 4O33A 1CHDA 1VGRA 3G59A 4Z4FA 3C8MA 4GX5A 2ATEA 2GO7A 3QXJA 5J58A 1GRCA 4RD3A 2GEUA 1U0GA 1ISGA 1Y6QA 3EQ6A 1IMOA 2XNJA 2MSNA 1PL6A 3H9UA 5AOBA 3TG2A 3SK0A 2FJUA 2CV2A 1L2TA 3ASVA 2Y77A 1ESNA 2YNMA 3AERA 3BICA 4KH0A 4QOHA 4MEJA 5KJ6A 3K2BA 3UY4A 3AKZA 2QUHA 4YCSA 1C4XA 1FP2A 1NKTA 3QEOA 2HPAA 5DIFA 4PYRA 4YV1A 1RKQA 1JR4A 1W73A 2Y2UA 4Y6GB 1T0BA 3TDNA 2DBZA 2NU9A 1F8UA 2IUFA 3A9RA 3G3EA 1U0TA 4Q9NA 4TQ9A 3ZBQA 2CLDX 3L06A 4RK0A 3LBAA 3IMCA 5FUXA 3I45A 3PC6A 1XSEA 1OBFO 2H2GA 4Q6WA 1ZIDA 5FFFA 4F91B 1CLUA 1GPDG 3NFYA 2EYQA 1TFUA 3NKFA 5G2OA 1YTLA 2J3JA 3KOOA 4DQDA 5HJ5A 3IR6A 4QBFA 5BXYA 1GPWB 4XIYA 1PZFA 3BL5A 3JAKA 4BB5A 5B55A 1BXGB 3IBFA 1WSBA 3I9MA 2W9XA 3ZZTA 4JBIA 4PV7A 1KO1A 3WBKA 3N07A 5KYTA 5CB4B 1SCIA 3U37A 2W2MA 3FJ1A 3GLHB 2OGSA 1JDBB 1ZK2A 4N54A 1N7IA 2FF5A 1PDVA 3L8GA 4GM1A 4LBZA 5TEWA 3K72B 5ED0A 3H9QA 4WK4B 4FGSA 4MW6A 3W5BA 5BWMA 3J80A 1U6KA 2BMVA 5ALGA 2XCLA 3T3MB 4NDAA 3FHCB 1USKA 2CXSA 4L74A 3QUAA 4BMPB 5LU9A 5DYTA 3KQHA 3L5KA 1AX9A 1ZM4A 2DH6A 3GJ6A 5CH5A 3UAXA 4EUKA 4FYJA 2FWPA 4XXHA 1DAMA 1Z62A 2IUTA 2B8NA 3CUWA 4BMNA 2WAMA 4IPTA 4A6XA 1OBOA 4ZRNA 1NIJA 1ZX1A 2WWWA 4MEBA 1FMLA 2VNKA 4TKMA 1L4UA 1FUYB 5DYYA 3A6GA 5ALZA 3L49A 4LHYA 3KJQA 5CXSA 3W6OA 3OH8A 5DPMA 3R77A 5LLSA 1E2LA 1LBQA 4F21A 2NO9A 1GSIA 1L5QA 4BC0A 2LTAA 3EDMA 4HDCA 4IJWA 4EG6A 3BRCA 3RSZA 3JQAB 1AUVA 1W581 1ZSYA 2ZRCA 1JHZA 1QYWA 2PT5A 2HPVA 3D5QA 5I51A 3TH5A 4FDAA 2QRVA 2Z30A 4ENWA 3JY6A 2DPHA 5JAUA 5ER9A 1Q83A 3FYHA 4MR7A 2VHWA 3K20A 3MINA 2HBRA 5LKAA 5IBPA 3VU1A 3KT0A 5DX0A 1T9DA 4TVKA 1BFKA 2REBA 2ZROA 2IIBA 2R5WA 3AFMA 1G8PA 1I1OA 3D1LA 3H0EA 5CJ2A 3RNOA 4YCLA 5I7EA 4EG5A 3KQNA 3N2LA 3R3ZA 4RXMA 4RZQA 1KFEB 4R69A 3PQ4A 2CEAA 4B3GA 1QCZA 3A26A 4CI9A 3U44B 1Z5NA 2B61A 4CLHA 4WCVA 3TOSA 3SVLA 2X3YA 3JPYA 1DPGA 4QGFA 4N5DA 1BKYA 2Z0MA 1CUUA 2GGSA 2YVUA 1XQ9A 4RHYA 1SCQA 2FSVA 3MGBA 6ADHA 3IUMA 3A2KA 2VQ3A 4GKVA 4C7BA 1M2KA 1P9OA 4KV9A 2A9FA 2BI4A 3ESCA 3KTAA 1S2NA 4J94A 4CLDA 1SQ6A 1G21A 2H2WA 1F3LA 4MGEA 2Q2OA 3KR1A 1NYQA 3D2BA 2CL6X 2OQ2A 5ERYA 3T7RA 4AXXA 5TV2A 4LZAA 5DTQA 1S02A 1DMRA 5GY7A 1XMSA 3B9PA 3MCTA 4BOYA 2JGIA 1OXSC 2GRAA 5I8WA 1KI8A 3OQNA 4PX5A 3ESQA 1S2LA 2O2HA 3NW9A 1PZGA 3HCRA 5EI5A 5DN6A 3CLKA 2R68A 1QHFA 3K0SA 3AERB 1NN5A 4O4LF 4GKBA 1BQ4A 3HTXA 3TQIA 5IEJA 3PHBE 3TGPA 4OBWA 3FNGA 1N0WA 1Z2PX 4Q39A 1BDIA 5F1YA 3EGEA 1KKLA 2G72A 3L05A 3IP5A 4CF6A 2G4CA 3AIOA 3LXRA 4KLRA 2PMBA 2XYGA 2AX3A 1EFCA 2Q0HA 4TLDA 4WJKB 1U1DA 4U1RA 2C1EA 2HK9A 5HFJA 3OD1A 2HRZA 1MAAA 3LQKA 5LN1A 821PA 3IA7A 1B15A 3FY4A 1HNZB 2YQZA 1K4MA 1CS4C 4F3YA 1P2BA 2FN3A 2PSEA 5E9WA 2P90A 5H59A 1UP4A 2HIGA 3AUXA 4HDMA 3A05A 13PKA 4DN6A 2ISSD 2R8ZA 3OE1A 4JUAA 3OCZA 4DY6A 1O6BA 2C84A 2JIBA 4DIOA 1KGSA 4ADSG 2PWBA 2QN3A 4KPYA 3URMA 2JB9A 2ASVA 2FEXA 1GQOA 4IIXA 4G9BA 2Y93A 3AP3A 3M4ZA 3NIGB 3PSAA 4QTTB 3GC6A 4IL5A 4RANA 5DTEA 4YJ2B 5GGYA 3ZCPA 1FUIA 1NE7A 4XJVA 4CTKA 1GRQA 2Y9MB 3A6FA 3FR8A 1UBRS 3CLSD 3TQOA 2CF6A 3TINA 1DKUA 2HPHA 3B1ZA 4LRSB 2OESA 4EO9A 1P0CA 3L01A 2GN0A 1EI9A 4MVJH 4CT0A 4OEHA 3EDOA 3KNZA 2AK2A 4QT0A 1Z7BA 3V97A 4ZMBA 2Q2QA 4FE3A 1CVIA 5BNFA 4FW9A 4M7PA 1N5OX 2RC6A 4QGGA 3L8DA 4CMIA 5BSEA 3T41A 1OZAA 3ZH9B 5JJ5A 3RK1A 3CX4A 3L0YA 5T6MA 4Y0AA 1DL5A 3IQIX 4AJKA 1F12A 4WWHA 4O4IB 1Q5PA 3PHCA 4FQ5A 4OUDB 2IX3A 4BNYA 1FPQA 1XK6A 1N7HA 1Q3KA 2WIGA 3BBLA 2ZI7A 1QO0A 1JTVA 4PFJA 4W9MC 4R81A 3VX4A 4TKLA 1Y33E 2X1LA 3VX3A 4UVIA 4IUYA 2WM2A 4LJLA 1T4CA 1IZYA 3AXSA 2DTXA 4B6QA 5JG7A 2FFBA 4E5DA 5LUAA 1LVHA 5AHWA 1GR1A 1K8YB 2L0XA 3HLKA 4FHZA 5E0KB 5CPFA 1QBGA 5JDIA 3OMLA 5EPEA 1T3HA 4NENB 5L3VA 4Q3KA 4I36A 1M0TA 4N3BA 1JQEA 3PPXA 2GILA 2OXEA 3E4DA 2P4QA 5EP2A 5JXJA 3KHKA 4F9TA 4IJ5A 3VKHA 3LXUX 4V2UA 2W2LD 4BTVA 4GPZA 3E61A 3DMFA 2DULA 4GBMA 3F5DA 4LYHA 4NZYA 4TKZA 4XIIA 5ALEA 4ND3A 3CPSA 5FWXA 3ZJUA 2E21A 1KJ8A 2BGRA 5BNTA 1FF9A 3B89A 3B1WA 3N0TA 2W4MA 3S8YA 1Q6ZA 3GGJA 5CX4A 2HCTA 3GAZA 1G7RA 1RPJA 3LIPA 1HRDA 3USZA 1VE5A 1SKUA 1JFLA 4M87A 4UCQA 3UWDA 1P6QA 3V2IA 4EY8A 4DGQA 4QOFA 4ZVMA 4G0VA 2Y1DA 5FXMA 2VRNA 4IGKA 3QOWA 2XDQA 2MSLA 3RHZA 3U62A 1RHQA 2QDKA 3IIIA 4FLFA 3U40A 2C95A 3FVWA 3IHLA 4BU1A 1X19A 5EP3A 1IAQA 4EABA 3N1UA 1QGED 5TVGA 4YAFA 3T3OA 4A7PA 5HKOA 2NG1A 2XYHA 4RZSA 4LHVA 1HL7A 5HZGA 1HEUA 4TXNA 3BFPA 2V45A 1X9GA 4FBLA 5COBA 3JTEA 3RARA 5IF9A 1USIA 1Y81A 1QC5A 5AUQA 3U3ZA 1XVLA 3VNRA 4ZHQA 2J9RA 1NNLA 1XVIA 5FAKA 3EVBA 4AURA 5JSHA 1N1GA 1S7CA 2J6HA 3ESZA 2V7EA 4KQXA 1KC3A 2ZI3A 4CQLB 1W36B 2NUTB 3SCZA 4OOFA 4UE3S 4ARSA 2DC1A 2AFIA 1ODJA 2A84A 3DKKA 1GSAA 3H2KA 2X7XA 4L6AA 3WZLA 4JVSB 3M33A 4XFKA 3UK0A 1XQWA 3KYDB 1CUGA 4MMXB 3S5JA 3KPVA 3NC1C 1NZDA 2ZAOA 4XDGA 5B3LA 1II8A 1VCIA 2I0FA 1A9SA 1HE5A 3DB2A 4WX2B 5H9VA 4E6PA 5DM2A 1EFAA 2EC5A 3BCHA 4JLNA 1ETHA 4OD0A 3HJRA 4P3XA 2FRXA 1MJFA 2ZB4A 3WIUA 2IHUA 3ENNA 3I6BA 3MRSA 4LVNA 2GHIA 4IWNA 4JNKA 2FSFA 4HNUA 2FSSA 1UOQA 1VMAA 1KVQA 2HRRA 1VG0B 2PFGA 2PKEA 3EEQA 3OFNA 1EWTA 1Z6QA 2VNSA 2XUKA 3QVLA 1ESCA 4GKAA 4M36A 4D56A 2O2IA 3KEGA 3VR6H 1WQ4A 4CF5A 1PD1A 4WLUA 3RU3A 3TTVA 3U7QB 2Q6OA 6PFKA 1PD0A 1M2WA 4FDLA 5ESWA 4G01B 5I4IA 4PGGA 1I94B 2DY0A 2UYOA 4QO8A 4E08A 2P78A 1XN1A 5EHGA 3KR0A 1I9GA 1SK9A 3D6VA 4OQFA 4DLPA 1B14A 1V3QE 3DMYA 3BH7A 4A1OA 1FU4A 2W8ZA 2C7PA 4B7UA 1R0YA 1EUZA 1MA0A 3TLZA 4LSMA 1AU9A 1Z6YA 4Z99A 3D0KA 1CF2O 4GU5A 2AFHA 3DC2A 1VLLA 3MTIA 5LQKA 4B2IA 1P61B 3WK6A 3LUBA 3ERCA 2ALJA 4LF5B 1ND5A 1YVEI 3AI7A 3G5MA 2XCRB 1GNQA 1VPDA 1HYHA 4MR8A 4CIDA 3FCOA 3WWCA 1Y9EA 2H2IA 2WIDA 4IJUA 4IKPA 4TLLB 1P7VA 3GUHA 1M2NA 1USWA 2C5AA 3HO1A 1ORRA 1H1LB 2C98A 2D1TA 3C4JA 4AG5A 1G8FA 1V6AA 4W5JA 1MVOA 4DF3A 1N6NA 1GNLA 4PS0A 4QWWA 4B3TB 2QQ0A 4UFPA 5DIZA 1QQTA 2C97A 1A8PA 2A5JA 2FPSA 3K0HA 3LUFA 4DWVA 1Y80A 4UEKA 3NHFA 4P4SB 3RKRA 1SUPA 2AW3A 3FUCA 3PD7A 3M7IA 1EP2B 3ER8A 5T41A 1U94A 4DBVO 3VU9B 4PYJA 2JANA 1EE9A 1D2RA 1G1MA 4YJHB 3GA5A 4E6EA 3JWJA 2ZFUA 4G5RA 2H5IA 3FMVA 3HCEA 3ZU3A 3TRJA 4BNWA 3QP9A 3V7NA 1UDXA 3DEYX 1G5RA 3WLHA 1TQ8A 1CJKC 4NBNA 3STVA 1JX6A 4C7VA 1J24A 1JDPA 1PTJA 1TJ4A 3ESBA 3I32A 2GYWA 2NAFA 3VHXA 1U8XX 5T4HA 4EAQA 2EYUA 3F5FA 1SUBA 3OIWA 4P81A 3T95A 5JCZA 3GRFA 1DHRA 1UBKS 1SPXA 1KOFA 1N3YA 1VG9B 3GRVA 2JKZA 3UWOA 1Y7IA 4REQA 4BVJA 4E46A 4QDOA 2AYZA 2G3YA 1OB2A 4EMTA 3B1JA 3GBPA 2BGIA 4K2AA 4K86A 5AVKA 5GGXA 4AUNA 2DWPA 1RZ3A 3OUUA 3I9V6 4EHDA 3R7BA 3UWSA 2EFEB 2AT1A 3Q6IA 1Q1GA 4G56A 4UBLA 2Q5JA 3O75A 4JFRA 2IPNA 3HYSA 5DSXA 4TLMB 1YI8A 1ZNWA 2QD2A 4G5GA 4XW2A 3DZJA 4AKTA 5BV7A 5IABA 2IGBA 1KI6B 2YOHA 1GUYA 3GT0A 2YN0A 2X13A 3MTDA 4F6LA 2GFHA 1PL8A 1YZUA 2A5DA 2HBZA 1OXMA 3AFHA 3JVIA 2CNOA 3KOWA 4QM6A 1OHHA 1XJWA 2JFGA 1Z6PA 4M88A 3SVZA 4DCSA 2W43A 2OC4A 2G36A 5H68A 2P0YA 2YZNA 4FOPA 4J75A 1K86A 4HLNA 1F60A 2KW5A 2ETXA 5FUWA 1PR6A 5M04A 4EI8A 2R1VB 2FYTA 2I2CA 2YQ4A 1UADA 4EATA 3PUJA 1N4DA 1PZEA 1LPOA 1O5OA 1XXHA 3A3YA 3NTQA 3PIIA 3Q3JB 4LYGA 5CVDA 1BX3A 2VDUE 1ECJA 3P4UA 5HFNA 3SHOA 2RHWA 3TSOA 2X4DA 1E18A 4C0AC 4LX8A 5JW6A 3JQ7A 5HF9A 5ALPA 1SXJB 1YJXA 4NSNA 1RAHA 2Z6VA 2HJ9A 5I7UA 3F6SA 4ESOA 5KNLA 3DE7X 2AMVA 4D96A 3TO5A 1OQAA 2O8EB 3NIFB 5M2QA 4W8HA 2DQSA 2C9DA 2ESRA 1PU2A 2LDXA 2PLAA 3HO6A 5TXGA 1GN8A 2QI9C 3F7NA 1DPFA 4MVWA 5HGJA 4F8JA 1RIIA 1Y1TA 3DEFA 3PRHA 1PKEA 2Q6VA 4J0JA 3D0RA 3REOA 5DK4A 1NDHA 4AIRA 1DG9A 1OAKA 4LI3X 4H31A 5EXSA 4E12A 4YUWA 4QDZA 3LDGA 4P8RA 1SVUA 3PE3A 1UQRA 4KVAA 2CUNA 4R8VA 1UC5B 5IC4A 4G0WA 2O59A 2GEBA 2ROQA 4ALJA 5KOJA 5LZ8A 3MEQA 4MWEA 2QRKA 4RACA 4YCNA 4CFYA 1BEZA 4HZUA 1LA2A 3DXFA 2OM6A 3FDIA 4DLXA 4JKOA 1C8LA 3HNOA 4BVFA 5DZSA 1QGUB 1SBNE 1T35A 3PXEA 1KYWA 3KUXA 2YXLA 3WBJA 2VP4A 4EF5A 2GN4A 2PUDA 1T8SA 3NUGA 3SC2B 4B6RA 4BMZA 3HNRA 3ZU2A 4U9UA 3WQBA 4EEKA 4UAJA 5DB4A 1G5IA 1PFVA 1UPXA 2H31A 1EFVB 4J3JA 4TMKA 3SSOA 3V1UA 4DA4A 3F78A 4INJA 1CCWA 2NV0A 3OLXA 5K0FA 3CJQA 3GT4A 3HVUA 5K1ZA 4X61A 4KSCA 2AG6A 3GH3A 4FCCA 1E61A 5C18A 4DR3B 4BGUA 1YZFA 1FFSA 2C3MA 3C1AA 3DTVA 4DCCA 1SU6A 1GTSA 2V0GA 1XX6A 4UBNA 3C6ZA 4F60A 3PJRA 3I9V1 4GPEA 4NU8X 5H7XA 2O1XA 3S2GA 3QVOA 5BSRA 3I5AA 4EFLA 2DJIA 2HLDA 4W4TA 3BXZA 4HADA 2QE7D 4YHBA 1U3UA 2AN1A 1KK1A 1QH8A 2C8VA 5IJWA 2H85A 4LQDA 4U5QA 5CBPB 4JI8B 3CVWA 2QJFA 4NPCA 2F3SA 2MTBA 2G0NA 3DHNA 1ORVA 3H1FA 3LP8A 4WGFA 4JVLA 4CLRB 5CA0A 3BMOA 4C4TA 3ECSA 3W5JA 5BV2P 3PI7A 4GI7A 5CDFE 2IHJA 3FPKA 4MAMA 5CNMA 3RIEA 4PANA 2O6LA 1F3OA 2Y1EA 5DM1A 2KQUA 4U63A 2QRUA 1RACA 3TCNA 4OXQA 3V4RA 1E3QA 1W34A 2H0AA 2HC9A 3L92A 3NQ41 3QOXA 5FHRA 1KQ3A 1BWSA 1PJCA 3HRHA 5CLFA 1LPPA 3DAYA 2HDOA 4UEJA 1YA4A 3ASYA 2JLVA 2XVYA 1OFUA 3CCFA 4DLRA 2XAUA 2GPTA 3NM6B 5CM8B 2H2DA 1X2EA 4CL8A 4E1AA 1GLNA 4MVJI 2BCGY 4DPKA 5LXTB 3QRWA 4G0NA 4FE4A 4YMTA 4ML3A 2X6RA 5FL7D 3ADBA 2HHHB 4FYKA 4GL4A 5DRTA 3LLUA 1G5PA 4L3WA 4RH0A 5FHQA 5FI0B 1HG0A 1RQPA 3LZCA 3W5HA 3WB1A 1BRTA 5I4KA 1C30B 4X66B 2EOAA 2POQX 3H84A 1ULZA 4PSVA 1P1JA 4GVPA 1SUEA 2WU4A 3OLWA 3UJBA 2IYSA 1BROA 2QD4A 5KNDD 4I9UA 3RAGA 3QMMA 2WSMA 4IDGA 2R6R1 3P27A 1XMQB 1CXZA 4A23A 1LK5A 1SXGA 1EZ1A 3GNSA 4AMUA 2RKWA 3I8OA 1JW9B 4LF9B 4M8SA 3ZXYA 1VJDA 3NYRA 4F2DA 2A1TR 2C82A 5JJIA 4UAVA 1IM5A 4CV1A 1R4MA 4II7A 1XK7A 3KLOA 4DR1B 3M1LA 4K87A 5H3CA 1K2VN 5JE8A 2WJ4A 3LQ2A 1QZXA 1SVOA 1KNQA 1RWKA 2CKMA 1WKBA 2YN2A 1IB0A 2XRYA 3K5WA 3KQYA 3HMQA 2XODA 1H1DA 2VPXA 1KIMA 3I3OA 3N70A 3RRNA 5HP4A 2P11A 3NMUF 4RJ2A 3KHTA 2OT3B 1RXSA 1F0KA 5E7IA 4G4JA 4CYMA 2FQXA 3TOXA 3KS9A 2ZIEA 4NFSA 3IP3A 1OC2A 3O3NB 2W4IA 4V3CA 3VPSA 2V4ZA 3CZ5A 2IPOA 2J5BA 4RPJA 4V03A 3UCEA 4C3VA 2ZXUA 2W6CX 1M6VB 1NJSA 2OCGA 4ZWNA 1R9MA 2PJRA 2CXPA 2YFHA 1H9CA 1WCXA 1UAYA 5ENDA 1EX6A 2MSWA 3TM4A 2X5JO 2BONA 4WOJA 3I12A 1L5WA 3A25A 3AB7A 3O1LA 3M6FA 1SHZA 3PITA 4K9DA 4Q4HB 2JAUA 3FOWA 3FPLA 4S1VA 4X3PA 5K8CA 3OQMA 2D0IA 2X0RA 3BXPA 1N0VC 2DEUA 4PBSA 5ES3A 2G4LA 1F6DA 3DFZA 3SN6A 3IPXA 1VA5A 2D13A 2H1HA 3S7ZA 3U48A 1LQTA 2PX6A 4KYIB 3GJ8A 1F2UB 4OM8A 2BF7A 1T2EA 4Y2PA 3T4PA 2QKYA 4NE7A 4F4UA 3Q7PA 5IW8A 1M66A 2PUJA 5JFOA 4CEHB 2HF7A 2VHUA 1XKTA 1RRMA 3OJOA 4UHJA 3U5TA 4LF8B 1EJBA 1G5QA 4YAWA 3KQTA 1HTBA 1FMCA 5AOAA 1EHCA 3MWJA 3THYB 4DSUA 3I52A 4X1OA 1IL0A 1SCBA 3JQBC 1I3LA 5GV8A 2UVQA 3NUZA 3WKAA 4B32A 1P0MA 4LOLA 1DXYA 4P0TA 1T6BY 5JBNA 1I24A 4LJ8A 4QUDA 2BKVA 1HH4A 1QUFA 4HLUA 1EBBA 4IVRA 4UU8A 5EHQA 1L5LA 1NRWA 4EKNB 3RREA 3DE5X 1KEUA 1RP7A 3L8YA 4X6LA 3F4LA 4OMUA 2IT1A 3VHRA 4G81A 5D6OA 1GZ5A 4GYJA 4XUEA 5FR2A 4JXKA 4C6SA 1PK7A 4BJ6A 4AKHA 1C9MA 5FBHA 4Q3CA 2O52A 4OQQA 2BFBA 1NVVQ 2WW8A 5CK5A 3V2GA 3A32A 1JDUA 5HDBB 2QBYB 4M53A 2JZCA 2WU0A 2XEXA 2W0SA 3EW9A 1N57A 4UHBA 1JXQA 5FJIA 3K30A 4M0DA 1Z0SA 2BUCA 5EZ5A 3WDKA 1KEZA 2OSVA 4U2KA 1N9GB 3BMXA 4DC9A 3GLFA 3PQCA 4KNVA 3W34A 1I0IA 5KDLA 5BP7A 2XHEA 4PLHA 3GJ3A 4HPJB 4XYLA 5TY0A 5IJ0B 4BPBA 3RVRA 3G13A 1TQ2A 3BL6A 1KZ7B 4K7JA 2JVKA 2O2XA 4B74A 1U98A 4DOMA 2Q28A 2B7LA 1DELA 1J5XA 3OEHD 3PYLA 3AF0A 3ID6C 1V5EA 2VK8A 4OQDA 4HYQA 4BLUA 4D5EA 5BR8B 1C1XA 2FX2A 1U9ZA 4I4NA 2IPLA 1SKYE 4I0WB 2OVBA 3K09A 4IY1A 4ZO6A 3QW2A 5DNDA 3PCXA 1RKUA 3Q88A 3WV4A 3EBLA 1NZFA 2A5LA 1M1NB 1T3TA 2IEGA 3EWNA 2G9ZA 1ZXLA 4Y67A 2C42A 1NMYA 2OCPA 4CMBA 3AUSA 1T4BA 4JI0B 3JQGA 1JHAA 4TMYA 1YDMA 1T36A 1BCSB 2PWZA 3I34X 1MO5A 1AUQA 2Z2IA 2XGJA 3H19A 3ORHA 1L7XA 2XUFA 3E22B 2A14A 1V35A 1TTQB 2DT5A 4DIFA 1KSFX 2A4MA 5G0TA 3OF5A 3H5RA 2QGFA 2X6TA 2ONKA 3LRTA 3PFHA 4H1UA 2QLNA 1VIMA 1KEWA 2GM5A 1Z28A 3CEPB 1Y5RA 4KBFA 3ZGNA 3LC7O 2P9HA 1XPOA 2BEKA 4DBLC 1U2ZA 1RM0A 2D5LA 4MZDA 3BMQB 3R6LA 1O77A 1U7ZA 5KCMA 3WZMA 4EI9A 1NUSA 1M7HA 3TTYA 5M7EA 5AKLA 3L7BA 4EI7A 5IF3A 3MJFA 4FSXA 1G20B 2ZE8A 1UJ6A 4XQ9A 4DZZA 4E7OA 2ISCA 3GEHA 4KAXA 5J5VA 3TCXB 4O29A 3DMHA 3EIOA 1JWAB 4CKWB 3KPUA 3UJCA 1W52X 4UHEA 1CRPA 1MNAA 2XY4A 5KOHB 4MVCA 5D7NA 3LPDA 3Q98A 4PPNA 3BERA 3E9YA 3RUPA 3HGMA 2DFLA 1JI3A 3AW9A 3SX0A 1ZH6A 1M8FA 1BX0A 2A33A 2RB4A 3DL0A 2ACEA 3O26A 3X44A 2WY2D 3A10A 1L7OA 1OV4A 1OROA 4YQZA 2GK4A 3FTPA 2RHTA 4UQPA 3HA2A 3VXKA 1T2DA 3QQ5A 4MUFA 4GX2A 2H1FA 1QBKC 1RXYA 4TYPA 5DYNA 2RGEA 1Q2UA 3K31A 1L1RA 5ESDA 3TLJA 4B3CA 2VSYA 4KE9A 4DCPA 1BHQ1 5FNVF 4ZAXA 3ZW8A 1SR8A 2WJZB 4K9PA 4C7XA 3O47A 1F5SA 3OOYA 4L5YA 5KSPA 1YZQA 4JYAB 3WK5A 4GEKA 4GG1A 4DANA 3EUFA 4O4JA 1H5QA 1E64A 4KHZA 1OZGA 2P27A 2C31A 2EATA 2ZR7A 3C0KA 3HWRA 4R3NA 1JB9A 1KIFA 1L8LA 2IXTA 2RGNA 3CNHA 2X0NA 3HHEA 4HS9A 4LXIA 1UK7A 3HJUA 3KYBA 3N05A 5KDDA 1LSJA 3VKWA 3DO6A 4Y7CA 3PQEA 1UBNA 4YMSA 1W36D 1M2EA 2P6UA 5A4JA 3G85A 1XWIA 2R6AA 3NAMA 2HU8A 1JPJA 4NZZA 1HA3A 1RVDA 2EHJA 3WHPA 1JNYA 4BPRA 4F5DA 1VLQA 1Q7RA 1ZLYA 4WJLA 4P0PB 2QX9A 4MULA 3Q2IA 3GJXC 4GFDA 4CRWB 1A9RA 1Y5LA 2IYPA 3I4FA 4N0MA 4MB6A 1X70A 4ZYWA 1Y3FE 2XPCA 1E1CA 5C7LO 1DT3A 5K8UA 5FX2A 5EIHA 4JHLA 2XYRA 3P9IA 5HBGA 2XT0A 4EY6A 2FP4B 2XWQA 5ALTA 5I8ZA 4ZZ3A 1J07A 1LBSA 2K5UA 4EG7A 5AI0A 1YDFA 1MMFB 1DQYA 1X6VA 4QBTA 4I1UA 1XO1A 5FNZA 4FMPA 3IVXA 3L5OA 3T15A 3TVTA 4WXEA 4CF4A 1Z74A 3X2SA 3OE4A 1YS7A 1O9GA 3CIOA 3HABA 1BX1A 1M74A 1T9AA 2ERCA 2QTCA 3HU3A 4ZZ1A 1NW7A 4QHSA 2H5LA 3IVAA 3EXG2 4LC1A 1F38A 4UM8B 3OUTA 1N5RA 1FMFA 1WZIA 2D7CA 1ISFA 2DOKA 1X1QA 1YB7A 1VPVA 3A9UA 3L04A 3N8GA 4IRXA 4M1ZA 3T3HA 1E9BA 1OFHA 4D3YA 1OLXB 4XX0A 3JQGB 1TCBA 4LDAA 3BDAA 2QY9A 3R7NA 4ER0A 2IH4A 5AJTA 4DCUA 3BF8A 1NXTA 3LX8A 2Y66A 3U81A 1I5OA 3PIRA 4DR5B 1JH9A 3FAKA 2O14A 1T3SA 3UG6A 1B3RA 1XZNA 5DCWA 3ICCA 3IP8A 2VYVA 4UM5A 1Q7EA 5COQA 1JAYA 3L18A 4JJEA 3DEAA 1ZESA 4YRFA 3RHFA 3T7SA 4UOEA 1AMOA 4F3TA 1UAGA 3IA2A 4OVKA 3KZXA 2XXAB 1P5ZB 3W5VA 4FWBA 4L5CA 4BX3A 1CU1A 3MWDA 3MIIA 3EDCA 3M1AA 4GQBA 4IYJA 5GONA 1A4UA 1ULSA 2DAPA 2IZ0A 3IXMA 2Q21A 3BWVA 3OQBA 3RHTA 4FJ0A 1RJ9A 4BGVA 4Z7QB 2RONA 4DR4B 3QBDA 1J0EA 2FDXA 2IE8A 1W6RA 2HAEA 3UAGA 3NEPX 4LWPA 3FNRA 4DB4A 2MSEB 3QEMA 4EW2A 4IVNA 3NKLA 3QWHA 4UMFA 4JSRA 4WKOA 1G19A 1KSGA 5JJCA 3OT1A 3NDPA 2H4HA 4POAA 3IE1A 3Q4GA 3HKDA 5EUCA 1FDVA 5JSQA 4IO0A 1AQ6A 2EKQA 2V1UA 1PYOA 1R4NA 2X0FA 4Q3AA 4XPZA 3Q3CA 5IKEA 3WIDA 1ISRA 2BKXA 2VXYA 1EFPA 1A5TA 1LI4A 1O9BA 1OFTA 5FNVA 2Z4SA 3FVRA 1RDFA 5BYBA 4GMKA 5TJ9A 5CRIA 1SD1A 1VGVA 4JAVC 4TYMA 2XI4A 5CDYA 3N2NA 5KHOC 1J6UA 3W78A 4KPEC 1E92A 1R9GA 5AK3A 1GPKA 1DDOA 2GBIA 3JQ8B 4UULA 5I7AA 1K68A 1QKIA 3SF8A 4BTLA 4N8EA 5KTRA 2NQ2C 3AX6A 4V38A 1M1YA 1ZP6A 2CXOA 3MCZA 2Z83A 3SJAA 1HTTA 3MB5A 4C06A 1GFWA 1URPA 5JS1A 1BN7A 4KTTE 3UJ6A 1PVOA 1NQTA 3OPYB 3RASA 4LXUA 4RYLA 2FDCA 1E6WA 3LP6A 3ITNA 2PUGA 1YQEA 2NYUA 5DM0A 4DZRA 1YZKA 3C3AA 3PGXA 4NBSA 1FFDA 4R1TA 3SBOA 2H9AA 3B48A 2INGX 2NZUG 2WUGA 5HKKA 3ENWA 3F6BX 2MOKA 3AW8A 3UFXB 3OZRA 1F7UA 1AKTA 5EZYF 4ZJYA 5LD2B 2ID4A 4DIBA 4DFDA 1LSUA 4QARA 1QORA 2A9RA 4FJ1A 4CCYB 4EFDA 1C3EA 2Z58A 3KQSA 4OB8A 2DHQA 1ZKDA 2VH5R 1KI3A 3DBHA 1BS2A 1YVDA 3I76A 3R40A 2L69A 5JLJA 4OGKA 1SXJD 4CN9A 5IVDA 2BAGA 3BSFA 4IH1A 2ERXA 4PLFA 1V1JA 5IXJA 1U3WA 1W4AA 1YAJA 3R0VA 4EEZA 2YXEA 2CDBA 2OV3A 4MGYR 6REQA 4ESVA 5ISMA 1FX1A 3BMCA 1Y4ZA 3JZAA 3PXGA 5GZ6A 3ZDYB 4BX0A 4YV2A 4TT8A 1VI5A 2GF2A 5FOWA 3PHHA 3TSZA 1QP7A 2DQYA 1R10A 2QXUA 4IGEA 3ZDAA 2KBEA 5KWIA 1LNZA 2EJWA 5D3MA 5L7TA 2I78A 2QLMA 3JXEA 2BZGA 1Q0QA 2GXAA 2Q6LA 1CX9B 1B73A 2ZOSA 3E05A 2QMYA 4TV9B 4IEFB 3G2QA 5ED4A 1WAMA 5FLXA 2PZKA 1K8QA 1TK3A 1E5QA 1N78A 2XTNA 1IXYA 1OV6A 1V25A 2XNHA 1DTWA 3FF1A 3NHZA 4LY0A 4KXQA 4RC9A 4EYOA 1EFKA 4IEEA 1Z75A 1IK4A 1BS1A 2XTZA 1KDOA 1N8SA 3TQRA 2HRDA 2RHCA 3HCAA 4B3SB 1E7RA 1DXHA 2BFEA 2EZ4A 4OYLA 2R1ZA 3BHMA 3RYFB 2QRHA 2H1IA 3EXFB 4CLOB 2WJAA 4JC4A 1FDIA 1Z8NA 3EODA 1WHTB 2XB8A 2FSGA 3TVYA 2D3WA 4ZD6A 1KORA 1QF6A 4JC0A 3JX9A 1YULA 4MRPA 5LWHA 2ZBFA 3MT8A 4WBNB 3X3HA 4XWOA 3ECAA 5JECA 3CT6A 3RYHB 2A4KA 2V9PA 3KAPA 4YH1A 1ZOSA 3AF4A 4P83A 3ND7A 4AZ0A 5JBQA 1VE3A 1UMBA 2QORA 2Y1OA 4GXRA 1QUEA 2QN8A 3VC2A 4UUPA 2VTBB 4IXNA 1JE1A 3HZRA 3PFFA 1IY0A 1M5TA 4AP5A 3ILXA 2JLZA 3ZS8A 4MRRA 5GMOA 1FDWA 2FZKA 4OHXA 1FA9A 5LQMA 2JIZA 2I4NA 3OT1B 3QKIA 4ZA2A 3M89A 3E35A 4WCDA 2AI1A 1CIPA 2GD6A 1KZ1A 1WZUA 2HW8A 5JC8A 2UV8A 2HSDA 4LPSA 3SYRA 2H54A 3UF0A 1CDDA 1K98A 3FMFA 3FBGA 3MYRA 4O63O 4Q16A 2OKCA 3PJEA 5EXXA 5REQA 3VV2A 5KWJA 1P8AA 3OUZA 3H05A 1S4MA 3M9XA 3WYFA 3P9XA 4EUSA 5AW0A 3U7GA 4CIXA 3KYCB 3TEJA 2R11A 3W06A 4CV0A 1T1RA 4ZOCA 5EE1A 1P33A 2AD1A 4N5LA 3GR6A 3CEMA 1SAYA 2IE0A 3C39A 3LL4A 2GHTA 3BGDA 3CLHA 4C0LA 4E5NA 5B36A 3EJWA 2NU8B 4F2GA 2GESA 1UAAA 5EQJB 3KQLA 4TT3D 4L7VA 2PXHA 5AW2A 3CB4A 1RJGA 3I2HA 3PVSA 2OZLA 1KR2A 4UDYX 4QFCA 1DQZA 2BJVA 4MUBA 4D79A 3MHTA 3TZQA 1ENOA 1T8TA 5B4UA 3KQPA 1E9RA 5ALJA 2C2KA 1AB6A 1G6Q1 3CX3A 4YBRA 5EMNA 3A4YA 5KYUA 2R97A 4MP6A 4RTRA 3UPDA 4NARA 2I8CA 5EFOA 4FM9A 3JSAA 1E2BA 3DCIA 3OTQA 4IDQA 4C87A 2XIJA 2QTHA 2ZI6A 4CMAA 5LZ4A 1IATA 1Z68A 1FVFA 4B4UA 1QTNA 1CK4A 2Q3JA 3PEYA 2V1XA 5CT4A 1LU9A 1XWWA 4CHGA 4F86A 4ZYVA 1ZXXA 4CMEA 1L4MA 2IEZA 3PNPA 2GD2A 1JIKA 2VBFA 2FR0A 2H18A 2I7CA 3QTBA 3QWFA 5HSGA 1Q0ZA 3LBYA 1XDZA 4RSRA 5EZSA 4BO8A 4PPQA 3ZIDA 3RVDA 2JHPA 3GQBA 2XIQA 1BW9A 4RHXA 2GPYA 2NTEA 5A7GA 4KIJA 1NYRA 2ZSFA 3U13A 4WLVA 4E3WA 2F2TA 2FU5C 4P36A 4JIMA 4YTEA 4KQEA 1TFRA 1U04A 4DQUA 5K8JB 1E1LA 2Q5LA 2BHNA 4R51A 2BEWB 3BHIA 3D8TA 3EMKA 3N2ZB 2B2NA 2G82A 2QPAA 3A6EA 3S1AA 2H0RA 3IJPA 1XF1A 4TWJA 1B43A 4QNMA 1DBWA 3WGHA 4NBWA 1W9MA 3ICQB 1TNDA 2I2BA 2XWBF 3ED1A 4QUEA 2HTFA 1F2VA 1D3AA 2X3UA 3H86A 4PZUA 4G5HA 5BVHB 4A0FA 4R4JA 2V74B 4YRLA 3GNTA 2HADA 1H0KA 1CY2A 1Q15A 1W48A 4DJ5X 2IXDA 3HR4A 4I3GA 1ARZA 3DZBA 5HF8A 3RLFA 5HTKA 4XKJA 4ASUD 5EN4A 2PXAA 1KEEA 4LF4B 4QVKA 3LPCA 4B7ZA 2BFEB 3DWFA 4H7HA 4YHHB 3G2OA 5G4LA 5FL3A 3QKRB 2PXCA 2WIFA 4YLEA 5JVDA 1YXMA 3S28A 3LUCA 1A5ZA 3BIXA 3ELUA 2BISA 3K1ZA 2YJTD 1PG0A 1NN3A 5CXQA 1O94A 2OFWA 3K35A 4KE8A 5BMVB 1APBA 4C2TA 1WRBA 5LNK6 1W1UA 2W2VA 1OAAA 4GVLA 3KUDA 4G9GA 4MYHA 3ZWKA 5BPFA 1I4OA 4ZEXA 4JB3A 1O0SA 1TKRA 2C7RA 4Y2HA 5T64A 4QBIA 4MDFA 1NVAA 1B93A 1Z16A 5E6UA 3GJ7A 5H80A 3WLFA 2DHEA 3V7UA 3O5AA 4M9QA 1W5BA 4DBZA 4MLPA 3MB8A 4JU8A 4F85A 2NO6A 4N5NA 1OJ7A 3IIJA 2QYOA 5JSKA 3PIDA 1TZKA 2VBIA 1UXHA 1V1RB 2AN4A 2GN1A 2EHDA 4XTCS 4WXYB 5JZMA 1QHSA 5AJYA 4DYHA 1SA0A 4FR0A 1A5AB 1LNSA 1XJCA 2CHQA 3GJTA 3V7FA 5B64A 5BMOA 4Z4EA 5E7MA 1UKZA 3MJRA 2HDNB 1JBEA 4OHCA 2FUG6 2KB0A 2BZ1A 4MA5A 1ZMXA 1B26A 4I7EA 3W6PA 4B6OA 4EVQA 3HJHA 4Y98A 4CU5A 3KYIB 5BR1A 4AMVA 2BP7B 1ZNQO 5EZQA 1RZRA 3OCXA 1L7VC 4YWHA 1YQQA 3O1HB 2CJPA 1E66A 3PLNA 4Q21A 2GAAA 4FYMA 3ZZUA 5BNZA 4QDXA 5EKSA 5G02A 3D5TA 4X54A 4MV0A 4QT4A 1CW2B 1L5GB 5KSYA 5KTTA 5FOQA 4FB5A 3EGXA 4AY2A 2YOFA 2WM3A 1DOZA 1NM5C 2D0DA 4YAUA 3TQHA 2HYIC 1SC6A 1S3SA 1C9KA 3HYNA 4RMGA 5EIAA 4N49A 2CNWA 4BFXA 3PZRA 1MW9X 2PR2A 1Z18A 3BORA 3IQHX 4GR4A 5DBGA 3RWBA 2PSDA 4HX9A 3TMYA 1FY2A 4YALA 3CZRA 5CEEA 2B0JA 4ZFNA 4L07A 1W5EA 1FMTA 2BH9A 5HJ2A 1IAVA 4YRPA 1OXXK 1Z2NX 3QYFA 3EOBI 4PGMA 1EE2A 2AFVA 2YMQA 3ABZA 3FH0A 1JLHA 1JV2B 2LE0A 2ZK7A 1Z3CA 1CIJA 2DM6A 1RQNA 5AI4A 5ECYA 2QLTA 4ARUA 3H2HA 5T3UA 2HT6A 5DX8A 3W2IA 4KDCA 2VDWB 4X0EA 4CDGA 1SFRA 2R5NA 3H4MA 2OKGA 2OHXA 1WXFA 4XZ3A 1NVFA 1KL7A 1TYDE 2GAIA 1WV0A 3KVOA 4L6CA 5CYGA 1TIPA 2ICAA 5A4MS 1EM8B 4C08A 1E3JA 1P2TA 2XWSA 4H60A 2IITA 2W6PA 3PS9A 4DTCA 3N58A 3AHGA 3OLQA 1LLCA 2ADMA 3FTDA 2HF8A 4NG4A 4R1SA 5SYAA 3C87A 2H63A 3GY0A 1THMA 5K6AC 5TRTA 5LNK1 3W9BA 3MM4A 4I9NA 1GPBA 2XDYA 2C7VA 4AJIA 2ZATA 4UREA 2YV4A 4BVLA 3G1TA 3GLHE 2KBFA 1DFGA 1PGOA 1F6WA 2C3UA 3W9UA 3IAM6 1Q91A 4ICIA 3T4UA 3PJDA 3EHEA 3EMDA 4WLEA 5F9HA 1FP1D 2WZCA 4A6PA 3D6NB 2GN6A 2DR3A 2OBLA 2XRMA 4D9CA 1CFZA 1NXSA 3CNQS 5KTOA 4Y9SA 5IVKA 2JGNA 1L3CA 3A3PA 1O95A 4JUFA 1HX7A 1MB2A 3PTAA 2I3ZA 2YWEA 4Q7MB 3C3CA 1DTSA 1FX0A 4ZK2A 4AT1A 3LV8A 1ZVMA 2FUG1 4LKRA 4YDHB 1N6RA 1QYVA 4LNHA 5E2IA 4JYZA 5TIIA 2NNWB 1SG0A 4CTNA 3LKVA 2ACKA 3S99A 2ISQA 2P4SA 2QP9X 3UC9A 1MAUA 4JLJA 1SZJG 1T0HB 1VB5A 3DSRA 3GMSA 2AL7A 3HCCA 2RCNA 1RPZA 2HSJA 3OFSA 3ZWQA 1REQB 3WMXA 3UK6A 2IZ1A 3A06A 1YOVB 3IKMB 4IKEA 4V0OA 4MHSA 3B7WA 2CMKA 3QUCA 3R41A 1P1HA 3PEWA 2RHMA 5AKZA 2J33A 2QTFA 2B4QA 3CZCA 1ADYA 2D1FA 4ZQHA 4IW3B 5I6DA 3H1EA 5BSWA 3AHCA 1N6KA 4KYUA 1QK4A 1N9ZA 1CD5A 1JZTA 1NQXA 4MQFB 1TTTA 4LRUA 4MINA 4G0OA 1TW3A 5AK5A 4QA9A 2RGAA 2ZVJA 3LY9A 3SYKA 2PUFA 1USGA 1IXKA 3DP9A 4H59A 4B31A 4IHJB 1PJBA 3QG5A 3W2EA 3RD5A 3ZR4B 2ZULA 2PGXA 3C5EA 4B3FX 3NHPA 5A5FA 3BJMA 1W87A 1DEHA 3KWLA 1PGJA 2IEAA 1MOPA 1V71A 4MW1A 1GPYA 1KO4A 4C89A 1L5HA 2M6KA 3A1FA 4RE5A 3WGLA 4YLYA 4G1MB 3H9JA 1DRKA 3HADA 3ZE1B 5AJXA 4F7DA 3MF4A 5BSKA 1YHNA 1SOWA 1XU7A 4IMIB 4V0RA 5A3JA 4MRMB 5J63A 2JA2A 3CLTD 3JAWA 3IBCA 3GG2A 2HPZA 1JEYA 4QU5A 1QE3A 3UATA 1E96A 3QX3A 2UUPA 2VZ8A 1YQWA 4V0SA 2VA9A 2VF7A 3GELA 4DMRA 5DNWA 2JJ1D 3LDFA 5K0ZA 1MOZA 3T5DA 5K8LA 3MFYA 4DSZA 1XDUA 4I8IA 1CULC 1KTIA 4N7JA 2ZYVX 1MPTA 1QPBA 2QZJA 2DG2A 1WMSA 3BKXA 4FFDA 1NLUA 4ZVKA 5TMDA 2QAIA 2BFFA 2FZCA 4PRZA 4QXMA 3E9QA 3RFXA 2P2CA 1LCIA 2FR8C 2JJ8A 2PUVA 4JLPA 3SQDA 4GQAA 1A04A 5JYBA 1A95A 4R40A 1ADGA 1CUZA 1OGIA 2F43B 4XWYA 4FC6A 1XDDA 2FW0A 5DF1A 1R5JA 4NCIA 2XBUA 1Q12A 4KB5A 5F7OA 3E70C 1XVUA 3BGVA 1TT5A 2P9YA 3D31A 4Z7OB 3QY0A 2NSDA 4YY3B 2FQYA 3PUWA 4YI3A 2G5PA 3R9XB 1AF7A 1M6WA 4MS4B 4NFHA 1KFBB 3F71A 2G67A 3GVPA 4HTFB 3V5NA 1HDXA 4MPJA 2G8NA 1VKRA 2R62A 4OP3A 3JQEA 1NVWQ 4X20A 3GJZA 5E3HA 1J8QA 2AWNA 2ADOA 2CJFA 2E4UA 4FP9A 2CVZA 3WLJA 4AJOA 5C1OA 2Z6AA 1JSCA 1LTQA 1STOA 1I9CA 2CNNA 2E4WA 5JMOA 1NR7A 2P30A 2XVZA 1ATIA 2MT9A 2YWJA 3PC2A 3KOUA 2ENWA 1QTRA 1VM6A 4L50A 3ZXXA 2AMYA 3TMKA 1T5BA 4CEJB 1IY9A 3ASZA 1JJVA 3TE7A 1GA6A 1PWXA 1MAVA 2C03A 4GSKA 1JB1A 3UB4A 5I7FA 4DV5B 3W3AA 4GZ5A 5L3QB 2XGMA 4IIHA 2GZAA 5JXIA 3ADOA 1YJQA 2CVHA 2RGGA 3AUAA 3NRJA 4KO3S 2HCFA 2WUWE 1GFZA 3QFSA 4RKWA 3TOVA 8OHMA 2ZM5A 1XJQA 1WNTA 2A5GA 4BO3A 5JXHA 3GLGA 4TTAA 1J7JA 1YMQA 1TAQA 2C7BA 3AR4A 4MQ4A 1VJ1A 4ZT3A 5BYJA 5IJ9B 5DWQA 4KR6A 2PZAA 4PR0A 3U1VA 1DC7A 2OY0A 4EA7A 1DC4A 2PUWA 1NBMD 3L7LA 4K0RA 5KB3A 2IQIA 3GLIB 1Y6GA 1KKMA 4QU8A 1G6OA 4JI5B 2R7NA 5TPWB 3ETHA 1J21A 2O4UX 3RJMA 1E3TA 4LBWA 1XTKA 3RAFC 3KJHA 4B5KA 3P0FA 1I4WA 4XM0A 3OHMA 5IJXA 4ARAA 4K05A 3TE6A 3KBBA 2IXBA 1KQPA 2NSHA 2Q6IA 4DWJA 3I8SA 4QLBA 3GCXA 2JKYA 4JJKA 2QAJA 3MMPA 3CRQA 1D6SA 4WEQA 1CHNA 3LO8A 5JI3E 1LY1A 1N92A 3OCVA 3PNYA 3QE4A 4KWEA 4PC6A 4YQFA 5I9NA 3SEZA 5HX7A 1CUDA 3V6LA 1XPUA 3BEOA 4Q1AA 3B36A 1T0JB 2R2GA 2IYXA 1C1DB 1HZZA 2PSSA 4PSDA 3GZ4A 5F1KA 4MHOA 4AFNA 4WXPA 1KETA 2PKQO 3JQFC 4CDNA 5AW1A 3DT9A 5LR6A 4OJYA 1H4TA 2B78A 3ODPA 3NC0C 4IP0A 4QODA 4CG2A 2QTRA 3ACBA 1E6KA 1NLMA 2DZDA 2VDPB 2J3IA 4ZI7B 5CAEA 3JSXA 1JECA 3LHSA 4XD2A 4Q9AA 4QICA 1YQ9A 4EKYA 3HFJA 5CLIA 4EHBA 2GDJA 4PO1A 1UZMA 3KPJA 3TPFA 4ZAYA 2V98A 4FKMA 4ER6A 1INLA 4I4TB 3IQXA 3LUPA 5SYNA 2J08A 4AJPA 5IZ4A 1J8VA 1MO2A 3G6WA 1PGNA 4O59O 5J43A 1JEJA 1HYEA 5IAEA 4EPRA 1VJ0A 1D04A 1NBOA 2FN7A 2B69A 1XRPA 1ODFA 2PLFA 3QWBA 1GITA 1VMKA 4LMPA 4YDQA 1P75A 2YWBA 4YFVA 4WE3A 2CBZA 5LZ9A 1KQGA 1Q1NA 3JW8A 1Z12A 4AJLA 4G26A 4OHMA 1CR6A 4HXYA 2Q7OE 3V55A 1SCNE 2OMEA 4ECAA 3S1SA 1U8CB 1WMBA 4Y9DA 3NR2A 4Q7EA 2Z3WA 4ERNA 3NHMA 3KUUA 4QUHA 1FLVA 2IYLD 4B45A 3B6KA 4DCTA 4OX9Y 3VYVA 4XVCA 2BCEA 4XIGS 3F98A 2H8GA 2FTKE 1IWBB 3CW9A 3GV0A 5DN9A 2AS0A 2UZ1A 3K71B 1BMFD 1HQKA 2UZ3A 1YCGA 3ABQB 4RTOA 1PT7A 2W11A 3UYKA 4K0KB 3N0VA 2B1RA 2C96A 5I4CA 2F4VB 4CHTA 1BMQA 3L4EA 4XEUA 4M38A 2Y4OA 1CJCA 2IC5A 4FX5A 1P1FA 5EIWA 2ZBGA 2CFOA 2ZS7A 2HLHA 3P9QA 3O7WA 4HVAA 1TT5B 1KQNA 1G9TA 2PPLA 4GWGA 4US2R 1XALA 3GFQA 3NCHA 4F46A 1C7EA 2N9UA 5AJZA 3UWPA 4LF7B 4GMDA 1QYXA 2E2WA 1FTNA 2Q1TA 3NI2A 3P97A 4K3UA 4QXPA 3GUYA 4WFJA 4JSYA 1NVUQ 3C3KA 4TL6A 1SD5A 3VNUA 1YUNA 3VJMA 1U3DA 2JAXA 2RG7A 4LQ4A 4UHDA 4N40A 3K9NA 3ECCA 5EWJB 1OREA 5LA6F 1SUDA 5DTIA 3SLGA 5CVUA 1ZA2A 2AMJA 1E2MA 3NU1A 5CK4A 3VTFA 4KCGA 4LFBB 3AOEC 3S44A 1D8TA 1CUIA 2VF8A 3WX0A 5JJBA 5KUTA 1VJTA 4MS1B 3FYUB 1XNQB 2ZJ4A 4YCCA 2YV1A 4ALIA 2ZXEA 2WKQA 1S2GA 3WL4A 3B52X 1PWHA 3INGA 4Q0MA 4JBWA 2C9CA 3GRAA 3MOIA 3GFGA 1VSUA 3IIMA 3K2QA 4WZAA 3WO1A 4DQ0A 2VZEA 4LHSA 4R05A 4ABYA 5I5EA 4K9KA 1BMTA 5DTJA 1FL9A 3GP5A 2HY7A 3WAKA 3Q0IA 4TN1A 5EHZA 1W0CA 1TA9A 3JQQA 4PZPA 3HN7A 5DM4A 4Q4DA 2VPWA 2B1IA 2A0XA 2QUKA 5BN3A 2WE8A 2P68A 4J0QA 1OXUA 5HQJA 3TB6A 3CPHA 4YMLA 4J6FA 5TQ0A 3THWA 4PNHA 4O2RA 2P2GA 4TL8A 2VHTA 2Z9CA 4YXWD 2ZPAA 2RHGB 2PT9A 3T9CA 3E4CA 4Q00A 3AEUA 4DV1B 2PCLA 3ELYA 4XD7A 3IUPA 2OZVA 4S12A 2J85A 2IOQA 4B6JA 2IHBA 3QE0A 4WZBB 5DOZA 5CJPA 2H1RA 3MZ0A 2EBFX 3U17A 1R8SA 4IDNA 2ZW9A 3GEPA 4N7MA 4MYUA 3VPDA 4B6GA 4EJFA 1E77A 3QH4A 5JY1A 3DNPA 3NEAA 1FDRA 2AKYA 2JBAB 1UFKA 3QVUA 1L6IA 1PT8A 7MHTA 1RBQA 4A0QA 4QRDA 3T6KA 5E1OA 2F48A 4M0KA 5BWLA 5T8KC 1AS2A 2FFQA 5EJ4A 1JAXA 3F3SA 1J8FA 1D6MA 3WLQA 1XDBA 1DBQA 1RYYA 1SQSA 3LNTA 3FLMA 4FQ7A 1HQDA 3UB3A 2WHYA 3EGDB 3ZQ4A 4F9EA 2GN8A 1QLJA 1T5OA 1JHOA 1QCDA 1X1RA 4E13A 2IRWA 1WVIA 1Q1BA 3PRJA 2ONCA 2C07A 4UKDA 1PWZA 4X45A 1CY1A 4Q7KA 3AFOA 4IUCS 3ZLVA 5KTKA 4EARA 3D5EA 2R47A 4P31A 3CISA 2WE7A 1C8VB 4BUZA 2K4MA 3VR1A 2CHGA 8ADHA 3CVJA 4WW0A 5E6SB 5G1OA 1FP4A 3DVSX 1J06A 1DO8A 4J1TC 1FP7A 1QK3A 2EKPA 2VJPA 2XOXA 2YVQA 3QVWA 3VVMA 3ZWWA 2R6FA 4MKFA 1UJ4A 5KYNA 1RSZA 2P1RA 3ND8A 4GX0A 4AMGA 2VWHA 1EBFA 1ST2A 4Z7NB 1BE1A 2GCNA 2GXUA 2AZMA 4NECA 5D2CA 3VU8A 4IFEA 2IJGX 4ZOLF 3G5UA 2VR1A 2TSYB 3RG2A 1NNEA 1I2AA 2ZS8A 1CDEA 2ZTVA 3G1UA 2GEFA 3IDFA 1W96A 1QQ5A 2BIFA 1P7PA 5C7IO 3D2CA 2FW7A 3DHWC 5TNXA 2GYVA 4Q3BA 3COWA 4RVUA 1JDJA 5LYJA 2VSQA 3OAAD 2C88A 1NBWB 1E63A 1UXGA 2Q5OA 2QI9F 1PNQA 3PVCA 5IS2A 2A7QA 4MW2A 1US8B 3IPLA 1XMVA 3ZI0A 1JIXA 3AYZB 2FHSA 5B2FA 1E3DA 3L1VA 1NLFA 1SXJE 3S1LA 3C1OA 3LUAA 4KQGA 2XUAA 1FOEB 4RD2A 3SXPA 1I32A 2AG0A 3PE4A 3KYJB 3RU2A 4N9QA 3TLAA 1E20A 3VNBA 1G8MA 2DY1A 1DS6A 4M60A 2C5EA 2Z4RA 2GAFA 4RPKA 1C0IA 1B16A 1KEKA 1QNFA 4KAAA 4R2XA 1T9BA 2BR4A 2C5LA 3C70A 3K6RA 3Q3HA 3KLPX 3VRHA 4RA9A 1R6AA 2NO4A 1SZDA 4PHHA 1VG1A 1JHRA 2R6GA 2Z5FA 3F6CA 3UNXA 2BEVA 1FVXA 4A6DA 3REQA 2VH2A 1XHFA 1YS4A 3CR7A 1XLTA 3AY3A 1QK5A 1NVGA 2BRUC 1MO3A 2ZCVA 5DBOA 3ML1A 3VMMA 1QGYA 4ZTZB 4B8ZA 2B8JA 4M37A 3THOA 4Q4JA 4R0VA 4D8VA 2AQKA 5BN3B 1WB6A 4JT2A 4ACAA 4C0BA 4B44A 3B8EA 3LKZA 4NY1A 4XYGA 1BJTA 5TSDA 2GJ8A 2AOVA 5F2OA 3RH0A 1UC4B 3NBQA 4JQZA 3DZGA 3FOEC 1GZ3A 4ZI5A 1GZUA 3VO9A 1ADJA 1FMJA 2R6JA 2FY8A 1P60A 1MU0A 4OHVA 1G98A 2G71A 1XCOA 2ZJ8A 3QPUA 1X8XA 1M72A 5GOTA 5B2ZA 3ZTTA 4EGCB 4B2PA 2XYVA 1VXRA 1BKDR 3KWJA 4CF3A 2IUSA 1GGVA 2L19A 3FVTA 2XOKD 4DT1A 4FEAA 5LBUA 3IV9A 2MINA 3PQ5A 3T54A 3VOSA 5IYZF 2J0VA 4P7BA 4GUDA 3ONVA 3RT7A 1L1QA 1DJQA 3BA6A 3AGQA 4Q7JB 2ZJBA 4MEAA 3TW6A 3GUUA 5CM2Z 1CUFA 2YJGA 2VTDA 1K7EB 1NNI1 2H2FA 4NQZA 1A98A 1SULA 1Z17A 5DTRA 3K9FC 1FRFS 3ZWPA 4OJTA 2Z3VA 2EQBA 3DOJA 3E8XA 3GFSA 1YH3A 1NDUA 3VR4D 3ADCA 4QDKA 4DLVA 3SAJA 1R6DA 3P2IA 4DRXB 3JR3A 2B3TA 3SJCA 2EFJA 5DT9A 4O4LB 1H6AA 3EIXA 3FXAA 4X64B 4W1QA 1IBKB 1OYYA 3TNFA 3OTIA 3EXG1 4W82A 4CDMA 2NUBA 2YJNA 1EKXA 5ALQA 3NP9A 2IW1A 2FHPA 5EEGA 3GL9A 4GI3A 4CF7A 5CCXA 1BRMA 1RRPA 4AJ4A 4BB6A 1HWYA 4HXEB 2JFXA 3ASUA 4HWKA 3UJ9A 3OQJA 2ZJYA 3D4OA 3MD9A 3G0GA 2B37A 5A5GA 1EESA 1JHPA 2OMKA 1KERA 2BV3A 1KQOA 2CB0A 4Q19A 4JA2A 4N0PA 1C29B 3OE7A 5ULLA 4C4SA 4GQIA 4CPDA 1I6KA 1P4HA 3U4QB 1CQWA 1D5WA 4UMDA 3L0OA 2GHRA 2GOYA 3OQ1A 4MVJA 4NH4A 1P7CA 3DTYA 1S1MA 4RZ3A 4TMTA 3RS4A 3V2UA 2HCBA 5KTSA 3KKOA 1JLMA 2XB4A 3WBBA 5K3FA 3QPCA 5C5DA 1QRRA 4ZODA 5IU6A 2FZLA 3NHBA 2PMEA 2YWRA 3AIKA 1E2NA 3UCFA 4XUGB 2P41A 4DEYA 4FT2A 1MQSA 3O73A 3QLEA 1U11A 5CA1F 2QMHA 1DIRA 3FZQA 3K7EA 2D5CA 4RMJA 5EE0A 4MVJM 2NW6A 2BBSA 2CYCA 2IY7A 2IEYA 2AXNA 5C8YF 4XDYA 5F73A 5IC6A 1XZGA 2PA0A 1AGNA 3C5HA 2BDEA 1LW6E 1AA6A 3QELA 2B0CA 2F9FA 3H2ZA 4IYRA 2HJRA 1K7CA 3MOGA 4TTJA 3ZHOA 3ZEAA 5I9IA 3O9ZA 2F9LA 4FD3A 5KKNB 2PKCA 5K4AA 2Q27A 1AHHA 2PLRA 4I5EA 4MUEA 5E4FA 5P21A 1W7AA 1FFXA 5FI1B 5IH7A 1A7AA 4Z9YA 3WGIA 3FGNA 5KC8A 1ZN8A 3FVQA 4DDTA 1N34B 2HT1A 3OQIA 3V1KA 1RHKA 1GRVA 2DTDA 2SECE 2CMHA 4OMDA 3AU8A 4QNNA 4NJEA 3CW2A 1C9YA 1RYFA 1SC1A 1SUFA 2QYTA 4ND8A 4AF6A 4E7PA 4D0RA 3NNDA 2F1JA 2ZJ5A 2QVYX 2CNLA 2RGRA 1EXDA 1JHVA 4NJMB 4XVQA 3FHOA 3B9QA 3AVXA 1WZ2A 3GCDA 1YR9A 3UUGA 2WD8A 2V9CA 4JBHA 3UWKA 2GPJA 1PQWA 2WKRA 3I2YX 1M2HA 3EVTA 2QR3A 1YE8A 1XEFA 2AYYA 1RP1A 1VE6A 3ENZA 3N7UA 1OD6A 3VZBA 2C1ZA 2WNIA 2YJ4A 4JZYA 3AY0A 4DMHA 3NOQA 1CRWG 3QM1A 1KJIA 4DR2B 3GH1A 1Y1RA 2FMKA 2BTQB 3A1NA 3DBLB 3PQFA 2J1LA 3OBIA 5D3ZA 4UBMA 3SNKA 3RC8A 2B30A 1AHNA 2PO5A 4D4HA 3RIYA 1FZTA 2EWVA 4CKXA 2V7UA 1RI5A 3WDSA 1X15A 4CNQA 5JH7F 1UOEA 2ZWMA 2XMDA 3DM5A 3PE6A 2ZWAA 3DMTC 3PHJA 5G41A 3CS3A 3EXHA 5CLLA 4C05A 5B7GA 3QEBZ 2FJ0A 2HHCA 1V3UA 4L5BA 4OSEA 4FPXA 2P6NA 4V0ME 2CN1A 4GOND 2PFKA 4K6KA 1TAHA 3CWQA 3IJEB 5J4YA 4MMZB 1IQPA 2ZE7A 1WUHS 4QASA 4P3PA 2YV5A 1IVSA 1KGDA 2P3SA 3EUEA 4EQZA 1ZRNA 4U39A 1L4BA 4XOIA 5KJEA 1JG7A 2UVPB 4TVOA 4Y2YA 5JADA 1RT9A 4IZHA 4OQXA 3GEBA 1TUEA 3R7WA 4M8KA 2IKSA 3UGTA 4PHGA 3TGWA 421PA 3BK2A 2CXHA 3UANA 2C99A 5BV1A 4G3XA 4BLWA 3ZXSA 3ILHA 5KMGB 1JQBA 3AFNA 1Z3IX 2QTVB 2PWPA 4LOKA 1JBQA 3BK1A 5EHIA 2ERYA 1XZMA 4FSHA 4US0R 5J40A 3C7DB 2OWEA 3AHHA 3T1QA 2VQ6A 2OCKA 3PTLA 4U7HA 3WKBA 4MX8A 2GF9A 3SKVA 3AFIA 3ZD6A 3F6PA 1GGNA 3MWEA 2VRBA 1J2EA 3MXOA 4X8OA 1XEWY 4YYEA 5TQ2B 2X0JA 4DCJA 1EP3B 2R1UA 2EKZA 3VR6A 3IQDB 1M7GA 3FMGA 3UC5A 1NPTO 1NOJA 1KU6A 1ZVQA 4II2A 5G0VA 3STYA 1GAEO 2WV7A 4X8LA 1GPNA 3ACDA 4YMUA 3C4VA 3DWIA 4OA8A 1TA0A 3C45A 3DVAB 4UNQA 1XMJA 3KAJA 3ZPXA 2HUPA 5C4IA 3GD5A 2IU0A 3QBTA 4ZVRA 1GNPA 2QZPA 1AQUA 4HFRA 2CL0X 3KVRA 4R3UC 3B7PA 2DFDA 4L8YA 4PC7A 4RJLA 4XEHA 5EERA 1ZJWA 2YJ5A 4IFIA 7GPBA 1E62A 2G7ZA 1Z2AA 1U2PA 2X8LA 3GPBA 3MT0A 3R0ZA 4P54A 3VISA 4UAUA 1CPYA 3IB3A 4WERA 6CHYA 1I7QB 3AV3A 3L3BA 3E9NA 4H08A 2WU3A 1XROA 2ZJ0A 1Q1ZA 3DZHA 3VDRA 2JFYA 4PAGA 3I58A 4OBXA 1KA9H 4Y2UA 4LRWA 2I76A 4BX9A 4ZYUA 2IH2A 4BNLA 1HDEA 2QM0A 1PJ3A 1TQ4A 1VHWA 3HCNA 1R0CA 1UH5A 3AJDA 3EIWA 1G8HA 1QIKA 2WHXA 4PX3A 4L22A 7MDHA 4KFSA 1CZUA 2Y0CA 2ZUEA 1AV7A 2FSUA 3FLBA 2D6FA 2HMTA 4KGDA 4ENTA 3LC0A 3F97A 4JJAA 3NP7A 4PSCA 1WSDA 2BEUB 4CR8A 1CR0A 3T1VA 4BQPA 3I4CA 3HUEA 6LDHA 3BRWA 1P72A 1FFXB 1TF2A 2YJ6A 2O5CA 2QSYA 3GK3A 1GGMA 2QQEA 3U2QA 3KDPA 1G20E 4ER7A 1ECCA 3SZRA 2P2SA 3ZZ0A 3GT3A 4AKSA 2CT8A 3QVSA 3BE8A 3QE3A 2IZ7A 2GBPA 2V7PA 4ND8B 2RH9B 4QEZA 1QYCA 4AWAA 4BLQA 5KYXB 3PDCA 3FCCA 4B3DA 2FPKA 1TLTA 3Q85A 5SZHB 1JDBC 3KSZO 4G1CA 4M1MA 3OZWA 1Q22A 2ORVA 2WQZA 1QPGA 1HE4A 1FYDA 4KIGA 4FCTA 1RRGA 4WTOA 3TSAA 1PE0A 5C31A 2VA8A 1SU7A 2BJWA 2ZUBA 3HVRA 3VH4A 5IEBA 3PUYA 2LD4A 2R85A 1NLYA 1M2OA 2VBCA 4WNAA 3H8VA 2H4ZA 1GL3A 1RWVA 5AJUA 1ZCBA 3DCYA 1CNFA 3H5IA 4BNHA 3QPVA 1Q1AA 1X1CA 2WTMA 2J6BA 4IOMA 3RYTC 4EQ6B 3U7FB 3D4PA 2AF3C 1QWOA 3M6UA 4LSZA 4DDWA 3GJQA 1MEOA 3O91A 3O2NA 2I3GA 1JLLA 4GNKA 2QLBA 1ANKA 2Z04A 1NONA 4BNTA 4D5GA 4TROA 2W6ID 2WD7A 3ZJ5A 2YH2A 5JT1A 5AIBA 1P17A 3EXHB 3UJNA 2P40A 3E84A 3LFHA 2PEZA 1R37A 4N5MA 3SDZA 2EV9A 1MD9A 2M98A 3IUSA 3NWOA 4G2TA 4GM4A 4L5IA 4ZCPA 2JFQA 5EE9A 1TZCA 5FPTA 1KWKA 1SCKA 1DAPA 3HDJA 4JI1B 3SBXA 3U9TA 4GUAA 2RAUA 4J4HA 1A50B 1EDZA 5I4BA 1ZCZA 5KX5F 2ASEA 2YY5A 2ZG6A 3IAEA 3ZV4A 4NEHB 3UENA 4A8PA 4O1IA 4RGBA 4WNYA 3L4KA 2Q62A 1DGQA 1U3TA 3SE0A 2WABA 2NQTA 3UUWA 5I3CA 1AZLA 3JASB 4P38A 2CNDA 4Z8YA 3ZVNA 4OHYA 4UZEA 3N2KB 3U09A 3WBFA 2AEMA 4E70A 4PLWA 1GL7A 3JD2A 3KXDA 3INNA 3PHIA 3PWZA 4PHCA 4PLPA 3SIXA 5IUJC 1LF0A 1A97A 1W8IA 5CH8A 5EFZA 3DJYA 2PGNA 3RC7A 4QVIA 2J3QA 3QVJA 2FX5A 1JWLA 1UJ5A 1TU0A 3DOOA 5JSZB 4EBFA 3E6AA 4B48A 5CFOA 3B3JA 4PZ0A 1KDRA 3WDMA 2R8PA 4D81A 3LX5A 2QRGA 4E07A 1LFDB 2F8LA 1JQJC 2QJWA 4I50A 1J2TA 3AXTA 2R60A 2PL1A 2BI7A 4I6GA 3AY6A 2JFVA 3MNFA 4QL3A 3WMRA 1QRSA 2PX8A 3WIVA 2W2QA 1JSRA 3RS0A 4CGZA 2X23A 4TS3A 1PR2A 4IDAA 3PB3A 3SQLA 1XP8A 2GR9A 2QV7A 2ZCUA 3N6XA 4RUKA 4PC3A 3E1GA 4ZALA 3TTWA 3VO1A 3RAPR 1CEXA 3L7OA 5IANA 2YNMC 2FMUA 3FWPA 5L6LB 3B3QA 4MUMA 3IV6A 2E5WA 5LM3A 1J00A 4CIYA 1VP9A 3GFBA 1KRHA 5AICA 1YKFA 2JHGA 3TIVA 4DSTA 2I6UA 1YR2A 1S3GA 2CCJA 1QIMA 2AB0A 5JISA 4OSOA 2Q5QA 4EWLA 3R0JA 5BSUA 1M2FA 2VCYA 2H57A 3DS8A 1V47A 2OK8A 2YIJA 4LHWA 2GH1A 4PLZA 4BRSA 1J09A 3K1AA 5J2TA 1NI4B 1U0JA 2F3UA 2H3HA 3B5IA 4WJZA 4YJ3F 4ZT5A 3V4FA 3D6HA 4Z54A 3DULA 1QM5A 4ZGBA 3OPXA 3PQ6A 2PJUA 3U0VA 1ZD9A 1IUPA 3CA8A 4B81A 2ONYA 1P1KA 1Z36A 3FTQA 2X4GA 4QC2A 1GCGA 1XKXA 3H5TA 2JGFA 5EWLB 3T3IA 1GILA 3BQMB 1CEQA 3SM3A 3ZGYA 5LPNA 2OHJA 5B1YA 1GEEA 3CXUA 4YROA 4K8RB 1JT9A 3MT7A 4W9NA 5JO9A 4YI5A 3P2KA 4INZA 1NUQA 3WAJA 4EGJA 3TUIC 3RVKA 3DOHA 1WB4A 4C6RA 4CL0A 2E1PA 4GMGA 4ZCLA 3U7EB 1ZD3A 5H16A 4A36A 2UKDA 1L4YA 4O4HF 3OVMA 2Q7XA 4RQAA 1AGXA 1Z4LA 2NYRA 4F12A 4YRSA 3SJZA 1FDSA 1ZM7A 2IHKA 1R0ZA 1U4NA 1ZU5A 1WLSA 3D3EA 2OV8A 3W6UA 2E49A 1OWMA 4TKUA 4Z8XA 2ZM6B 4FBGA 2WYVA 4AYWA 1HORA 4KLAA 5AM0A 3WQQA 2XF8A 3P52A 5A4KA 5AESA 1O9HA 5EYPB 2XBMA 2FDRA 2JJ2A 2G70A 3KBOA 5L3SB 5F33A