2FUG6

Crystal structure of the hydrophilic domain of respiratory complex i from thermus thermophilus
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
161
structure length
144
Chain Sequence
EREGILFTTLEKLVAWGRSNSLWPATFGLACCAIEMMASTDAQADVMIVAGRLSKKMAPVMRRVWEQMPDPKWVISMGACASSGGMFNNYAIVQNVDSVVPVDVYVPGCPPRPEALIYAVMQLQKKVRGQAYNERGERLPPVAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the hydrophilic domain of respiratory complex I from Thermus thermophilus.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords NADH-quinone oxidoreductase chain 1
total genus 34
structure length 144
sequence length 161
chains with identical sequence F, O, X
ec nomenclature ec 1.6.99.5: Transferred entry: 1.6.5.11.
pdb deposition date 2006-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
6 PF01058 Oxidored_q6 NADH ubiquinone oxidoreductase, 20 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12280 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2fug600
3IAM6 5LNK6 2FUG6 4HEA6 3IAS6 3I9V6
chains in the Genus database with same CATH superfamily
3U37A 1C2TA 5EEHA 3UWMA 4B7ZA 5B1SA 3K4HA 3T4XA 3TSWA 1QQ5A 3DC2A 2OFPA 3PXDA 4MEJA 1JA0A 1GLNA 1R6VA 4RYDA 1HLGA 4JR2A 3K71B 5CVTA 3BCHA 4UATA 4Z54A 1QO0A 2GHQA 5FOSA 1JIKA 1E3SA 2CXPA 4B5LA 4DR7B 1HT0A 2O3UA 5REQA 3R7SA 3QF4B 2WBLC 4AP6A 2XF2A 2XF8A 2QF7A 6REQB 3EPLA 1ZRSA 4W5QA 1TT7A 2IHVA 4QO8A 4AF7A 1NU6A 1V4NA 2REQB 1W25A 2PR2A 4Y30A 3W5IA 4ZYVA 1C1HA 3HZHA 3ZWDA 5BQ5A 1W1UA 3K9LA 2JJ8A 3FCAA 2C2WA 2CE2X 2IEBA 2Q5EA 4FGUA 4EB6B 1WVMA 5CFNA 1M2NA 1XO1A 4OXNA 1ZCZA 4I2NA 4LOIA 4CEHB 5TQ2B 4DA7A 1NAIA 5ALTA 1JE0A 4XDHA 2IODA 3ICOA 4BO8A 3TJZA 5ITSA 4S04A 4DN6A 3WRWA 3FMPB 1C3OB 1DV2A 4GBED 4YLGA 1PK7A 3T1NA 1HFKA 2MYUA 2H2AA 5DHUA 1U3FA 2J5RA 2LUOA 3P9XA 4HAYA 1MIHA 4FCWA 4C05A 1NMSA 3OMXA 1BXKA 1YR1A 2VHXA 1BCRB 3GRFA 4REQA 2B5OA 4Y6LA 2EXXA 3KKZA 4D42A 4YUWA 3ZS9A 4CW7A 1V11B 3ILHA 4GAEA 2ONZA 5LMCA 2OZPA 1BJRE 2HFKA 3T7KA 4YAUA 1PW7A 1FNMA 2C00A 3EZLA 4HNGA 4YFYA 1EUQA 1AB5A 5LQDA 3OJEA 1Z2OX 4W5NA 1XEWX 1L4LA 3CLUC 3B7WA 1JIIA 2D1SA 3NHZA 2ZIWB 2ZJ5A 2DFKB 3TINA 1GCAA 3PP8A 1RMYA 3HDVA 3BRCA 1NKSA 1NI4B 2N3ZA 3EQ7A 4OJMX 2E5WA 5DGXA 5LQKA 4UEWA 2UVPB 2AC2A 5DULA 2ZSJA 2FW7A 2WZQA 4K6CA 3E23A 2VEDA 3C1UA 4TTRA 3ZWBA 2PUHA 3DNMA 2PUGA 4MW5A 3PHCA 1X38A 4BLSA 4AKHA 5JECA 2ZAIA 3AKYA 3MAGA 3NMUF 3FFAA 1SG0A 3HBNA 1L1RA 3D7SA 1FDUA 3WJ2A 3B1KA 1MAUA 2XMSA 3NHWA 2XD9A 5T8KA 1RPAA 3IO3A 5AJUA 3THWA 2AN4A 1PJSA 1TJ5A 4Z4HA 3EULA 2H29A 1BMFD 4R5HA 5HS6A 1K3TA 3ON5A 1FP1D 1BX0A 2FW6A 5EJ2A 3HNRA 2DBZA 3RGGA 4RDIA 4FGJA 2JIPA 1WVGA 2XXJA 4OJKA 4TYYA 2B82A 1JHRA 2Q5CA 5DMXA 3L8ZA 3GDGA 2DG2A 2ID9A 3FNGA 4Z4EA 1IM2A 1DX9A 1R00A 1C4KA 1E5XA 2QUZA 1NLMA 4HK4A 4IGAA 5THXA 1DS6A 1CR1A 2QPAA 4MQ5A 4MRSA 3N0VA 3O74A 1MP0A 5FUBA 4A8JB 4G01B 5K5EA 1D5WA 5CLIA 3U4QB 4G2NA 4Y8VA 4DQLA 1L4HA 2RGNA 4IIFA 2NU7A 4FX5A 4PEVA 1SC6A 1UM9A 1DLJA 4HDNB 4LWOA 2NPOA 1PJ4A 1NPTO 4J2TA 3I73A 5JRZA 4I1PA 2NUPB 2FUG6 2EW8A 2UYCA 5A4FS 4ER5A 3S7ZA 1Z0SA 1IHYA 2EX4A 2YVKA 2QZZA 5IG2A 2JGJA 2O2HA 1Z7WA 3GI1A 3UPUA 5EIBD 1FYVA 3NTOA 1U3VA 5JEDA 4QYTA 3HDTA 2C9DA 4ZI5A 1SQFA 1U8YA 2O2SA 1G18A 1G7CA 1I4TD 2PUVA 3E9NA 5DF1A 5G0UA 1H1LB 5J63A 3KQUA 3SBOA 1IXZA 1X39A 4M9ZA 2NWQA 4BZZA 2JLAA 5MGNA 4GZ6A 2ZWAA 3IJ5A 2BFPA 2A5DA 3L6DA 4M0EA 3T8YA 4DR4B 3JQRA 3QOWA 1CUWA 5HJ2A 1AGPA 1XV5A 3L1UA 5B1HA 4LFBB 1CUEA 3INRA 4YI5A 4H7EA 2P9CA 2IZ0A 2BP7A 2B1JA 1SIUA 4EY3A 5LKRA 5EPEA 3QEMB 4O1HA 5CHEA 1EK2A 1X8JA 4HYTA 4LFAB 1BEZA 3ZU4A 2OHVA 4TM8A 2NU9A 3O3MB 4IUDS 4KTVE 2XBUA 1ZL2A 3B48A 4AMYA 1IHDA 4IIGA 5H70A 2HQRA 1G8AA 1G9XA 4DCSA 1A4XA 1OFIA 1ZJJA 3EA4A 5HZHA 3KE9A 1TGVA 2WSIA 3AFOA 2J31A 2P35A 3F5FA 3N74A 3H1GA 2UYGA 1VSQA 2WUWE 4UTVA 2F1OA 1SC4A 5A3RA 1P1KA 2W8BB 3JSAA 4QTYA 2H4WA 2AK2A 4NZOA 1GJRA 4DBLE 1REQA 2ZCUA 1DC4A 2FPIA 3H18A 3FE2A 3OZ7A 3ZDRA 4YBRA 2YXBA 4REOA 1OXBB 1JHYA 2BZ1A 3AL3A 3RB8A 2B0JA 1FFDA 1Y6ZA 1E94E 2HLPA 2QXYA 2Q3LA 4KXXA 4BKUA 2DM6A 3PHJA 3T4EA 3PNMA 4I5FA 3EUWA 4LHSA 5ALPA 2F43A 5LB2A 4P84A 3V55A 4CNQA 1A5AB 3VO2A 5BQXA 1RRMA 1DRVA 3OUTA 3ZWXA 5H9VA 1C8VB 1UKVY 4JBHA 3PHGA 2IPAB 4YJ2B 3HMQA 4ND4A 5F9FA 4AMZA 3WDMA 1S2OA 1ST2A 3P0FA 4M54A 3BWXA 3UJBA 4E3WA 4EI2A 4ODIA 3GPCA 1FJXA 2ZT8A 2YBEA 1M6YA 4YR9A 3M83A 3OAAA 2J0VA 4V0OA 1CW2B 1QKJA 2EVWX 2O07A 1SB8A 2QLTA 3QLVC 4ZPXA 4QVIA 2XKAA 4HQOA 5FWXB 5GZ1A 2VXOA 5D3MA 1F8FA 1NUQA 1JDSA 1QF9A 2A0YA 3IDOA 3M1YA 1GRRA 5I6DA 2FUG1 1G7TA 1IUNA 1U0SY 2G9UA 3FCSB 2XKKA 4ZV4A 1Z9BA 1IXRC 3LTEA 1CUZA 1LW7A 4R6WA 1ABBA 1Z37A 1G4HA 4JT9A 1A1SA 4PAQA 2Y1XA 4RZHA 3DBRB 2O8VA 4PO3X 4V24A 3TSCA 1Y98A 4KNYA 1JZQA 2BFWA 3Q6MA 3RYTC 2YVQA 2X0FA 3IT1A 3LMKA 1IVSA 2G08A 4UXIA 5FTMA 4JL5A 3TXAA 3PA8A 3WA6A 2RIPA 3TR0A 1C7IA 4DM7A 4BXOA 3A11A 1XZGA 1OWPA 2PD4A 2Y3IA 2GB4A 1H6CA 4N5MA 4TWBA 2K2QB 3GLHA 1IY2A 2ZDHA 4JMPA 3EK2A 3MNFA 3L6RA 3KEQA 4S1NA 2N1BA 4PF1A 3GROA 5J2TB 1XQVA 1KKLA 2H5LA 4I5EA 4YRFA 2J3DA 1AF4A 1GUDA 5CX1B 4KX5A 4ON9A 4HWGA 5J59A 5AVUA 5AH0A 2O52A 2MU1A 4QGFA 3VYUB 2IV3A 3TEFA 4CIXA 2FSGA 5B7QA 5IC4A 1R0RE 4JY7A 5BN5B 3C87A 1UR5A 3DVAA 1FNNA 4L4UA 2UKDA 3RS2A 4B34A 2RI1A 1ZJYA 4QXPA 4BVEA 5HVNA 3O8CA 3CT6A 2WMDA 1U4SA 2GZ2A 1S3GA 2C3OA 1N2CE 4D3DA 1H2HA 1J8QA 1L7MA 5HTKA 1O4VA 4P0TA 3WOVA 1Y81A 5DHPA 3E5MA 3WL5A 1GVNB 1ETHA 2P2GA 3H05A 3KAPA 4DMCA 1OFUA 8LDHA 1Z62A 3ZLBA 2PH3A 3WYFA 2E4YA 1NJ5A 3FR7A 1H2XA 1X19A 3DA8A 5AJXA 3KOZA 1SVIA 4F56A 4I4TB 3C41J 3PB3A 2BP7B 3O3CA 3M1AA 2BFCB 4R1PA 4IDDA 4ROTA 1CIVA 1N5LA 2QY6A 2H4YA 2WHRA 4Y2QA 5D5PA 4I6JA 4X92A 4ND1A 1KI9A 3ETDA 3HA2A 3QWFA 3EAFA 3Q1KA 3QXGA 3HCWA 2P5UA 4TV8B 3IYLW 3SIWA 1JILA 3EDYA 1Y4SA 4CQJA 2DULA 2ZSIA 3IAM6 5TT1A 3L01A 2ZBEA 2P9BA 3MOSA 5IASA 5LD2C 4J2HA 2OAQ1 2OZLB 3MD0A 2JI7A 1UMDB 2CY0A 4XIFA 4N76A 1D4FA 2AOXA 4DPLA 2FN4A 1RSZA 1JIJA 1OXTA 2SECE 2WAYA 3V48A 1SZPA 5I7RA 1UPCA 3E1GA 4FILA 4R0VA 1T8TA 1ZM4A 3PXEA 1A4IA 1CDEA 5DCLA 3SPXA 1L5RA 4BQRA 3MFQA 4ZHQF 1U3UA 2GVNA 1YB7A 2HK9A 4CLOA 1E60A 1R5JA 1BFUA 1OXVA 3QLEA 1YQWA 4JOCA 1OTYA 3RYHB 2DFTA 3OQVA 4JB3A 5AJTA 1OJ7A 1FEZA 1BX3A 1WXDA 1P5ZB 2CYCA 3KSZO 1ZNXA 2Q2QA 2F4NA 2NYRA 2ZSDA 3N8NA 4FDVA 4P32A 1NYTA 4CU5A 1ZMXA 1U8CB 2FQYA 4EJ6A 1Z7YA 4LGVA 3UXHA 4BVFA 1WHSA 1LI4A 1DDGA 1S1MA 1ULHA 1SD1A 1J5EB 3JYLA 1R37A 5CAEB 4YR7A 1YH3A 3CB2A 4MKXA 2I1LA 3EGVA 1WHTB 3BGIA 5T57A 3WB9A 3KQTA 3CTMA 5FO1A 4EJFA 2G0TA 3ANYB 4G5RA 3G89A 4XM1A 3CRNA 3TX6A 3IX7A 3U0BA 4CRWB 1BWPA 2FUEA 2DCMA 5BVHB 2MTBA 2GZMA 3VBCA 3R9XB 3FWZA 1GPDG 2LR0A 2CGEA 2OHJA 2QAGC 2VDOB 1Q7CA 2RJNA 2ZRKA 3CVXA 1ZEJA 3AIIA 3D0KA 1KO7A 2UDPA 4PYRA 3DDOA 1FQWA 1ZRMA 2BHRA 1DQNA 2FPSA 3MRTA 2ZFUA 5EE3A 4E70A 4YLYA 1WXGA 1FRNA 4A16A 4LKRA 1JLLB 1M67A 1WCWA 1KK3A 4PX2A 3JPWA 1BE1A 3ITEA 4DS3A 3KELA 3LOQA 5B6JA 3LX8A 3F49S 2CLSA 1H2EA 2QG9A 3Q6NA 2W00A 1FLDA 1KJNA 1N5OX 3LBHA 3PEVA 4OCZA 3UTCA 4A91A 1T8YA 421PA 1RPJA 4GNKA 1E5VA 1ZMRA 1UIMA 3BMQB 4NFYA 4P4UA 4A0HA 4OJTA 4B76A 5K0BA 3OQJA 4GICA 1DZ3A 1NLYA 1SA0B 4HWKA 3I32A 3WRYA 3G2NA 4EPVA 4EZIA 4ML3A 4J75A 4IHAA 4CL8A 3JW8A 1U5CA 4EHBA 1KU6A 4O4IB 2VSOA 3W2HA 2LP4Y 3CGGA 4MUMA 3TD2A 1QIFA 4DGSA 2A0XA 2ZWOA 5FQNA 5HZMA 5K45A 1A1VA 3N2LA 2WG1A 1T9AA 3T52A 3K0BA 5E9AA 1KJIA 2OHGA 1Z5PA 3OHMA 1L5NA 5FADA 1LSJA 2Q1WA 1IWOA 3DOEA 4CM9D 2IS6A 3QW2A 3PXBA 1SCNE 1SJ9A 2NNLD 5EE1A 4RK4A 1A82A 3GLIE 5SZJA 3SQWA 2ZBFA 1HTBA 3OT1B 4NICA 3X0DA 2FFRA 4UULA 1Z12A 3FUTA 5FH9A 1R0XA 3ASYA 2FF5A 4IHJA 5BSWA 4QDUA 1K3FA 4FQ8A 2UVQA 4AJJA 2QA5A 5B3KA 2R3SA 5JHGB 4DW8A 3RKUA 2VHUA 1VP9A 3FPLA 1GNRA 4MQFB 1JR6A 2EFCB 2BZ0A 3EIWA 3MWDA 3IUMA 3NVAA 1AA6A 4MA5A 1XQXA 4NYJQ 4QYWA 4QGAA 2GBIA 2OK7A 2C9BA 4HVAA 5BV0A 4M88A 4AIIA 3IEIA 2C4NA 4HTFB 2PXXA 5JYBA 2O8CB 1F4VA 2AL7A 2YW2A 1UK6A 3PLNA 3VJKA 2Q4BA 3TKLA 4K86A 4CEJA 1KC1A 1QFMA 2PNFA 2GEFA 3LQ4A 2P9FA 2YRXA 3JVIA 4GRDA 1H23A 2WI8A 4HSEA 4ZYXA 2QTLA 1Z73A 3H6KA 5CDTA 3NTUA 2DBYA 1T1SA 4JLSA 5CVUA 3UM9A 4NMLA 3IUJA 5T6BA 4M9RA 2V6JA 2I99A 1KEKA 2O0HA 1UP6A 2HHCA 1WQ4A 1X1QA 3VHXA 2YWRA 4GC9A 2V7XA 1B14A 1ULSA 3ETEA 3GVIA 3QEKA 1RVV1 1X1SA 3X1WA 2B7BA 4KPGA 1JEEA 2WJ3A 3EOAI 3QW4B 2VNKA 2CD7A 2FPXA 2NV2B 2J09A 4MQ4A 3LBIA 4JB8A 1DBIA 2XT6A 2GJ4A 5EQFA 6NULA 4XJXA 2HSGA 5CVJA 4CL3A 3EIUA 4AF6A 3HYCA 3I92A 4GXNA 3GA7A 3M6IA 5GM2A 4B4VA 1PJTA 3RBZA 4CQLA 3QM1A 4ZGWA 1IBRA 3DKPA 1TEHA 3L18A 4L15A 2RIRA 5JAOA 1L3BA 2N47A 2YVLA 3LYLA 4WJLA 4C2UA 2HD4A 3FOCA 1PJZA 4U02A 3QYAA 1YBFA 1VI6A 4NCNA 4LISA 4BYGA 2PUTA 3P4YA 1QH9A 3BTVA 2ZB3A 4Y6RA 1VLMA 3PUIA 4F0JA 3KXDA 3MINB 3DJFA 3NU1A 4HXFB 4X1IB 3ZHOA 2AXEA 4MVXA 1ODKA 1KIMA 1PJBA 1RXUA 1UBEA 4IRXA 3UK6A 4BX3A 4A0SA 2R47A 3EB9A 5KTTA 2CVPA 3RIXA 5KCMA 4E5VA 3H7IA 3TH5A 1FRZA 1N6LA 3QIAA 4BE9A 2PJDA 3BKXA 1YV9A 2ZWPA 1SO8A 2BW0A 1LSOA 4LNUA 3AQIA 4KPFC 3PUYA 4DM3A 1TZ2A 2CC2A 1GSIA 1E9CA 3OOSA 1XCPA 5GM1A 5K0GA 4GP7A 4YP9A 1CR0A 1TFUA 1U9CA 3UA3A 1V3QE 1GY8A 4AMUA 5TLSA 4MP8A 3THRA 2EEPA 1DOAA 2H0AA 3PEWA 4YRKA 1PT7A 4R01A 4WOKA 4EFLA 4QFMA 1DSSG 4U7DA 3S2UA 5DW3A 3W9BA 1UBCA 1RI5A 2A7QA 4Z7NB 3GJXC 4XSVA 1L5LA 5CEFA 2ECQA 2FP4A 2L18A 4BOYA 5K8JB 4ABYA 3QV1A 3JTMA 4PNPA 3ZY5A 1IQUA 1OX6A 3HA7A 4HS9A 3VH1A 4Q82A 1GV0A 3SQMA 5DOZA 4O4HA 2Q7XA 1PZEA 3AO0B 4Y0AA 4ZU1X 3F74A 4UTNA 3L0PA 4LYFA 2XBMA 4NKRA 2CCKA 5FOQA 2O7RA 3SK0A 3BUSA 2EP8A 1JKIA 4N54A 4EFDA 1F20A 4BZQA 1RCFA 4PRLA 1XZEA 5I7UA 4OF4A 3BXEA 3K9BA 3QOXA 4KQ1A 3KQKA 1UM9B 2GD0A 1IBCA 4LDAA 4UZEA 3E0XA 4K9LA 4DNXA 2PH7A 1Y34E 3VI3B 4MUHA 1DAFA 1CB7A 3Q9NA 3HBLA 2OM2A 3W2EA 2YJ6A 4MWCA 3BMOA 5EMMA 3WHPA 3CLRD 4QUEA 4ZDWA 2QIPA 3L1HA 2BR3A 3TOZA 3T5BA 1K0FA 1RYFA 3VHXB 3R23A 4BJ6A 2TMGA 3RUEA 1P60A 4IUYA 3GT4A 2BSQA 3KZOA 4D5GA 4MUEA 1NI4A 3HE3A 4QQNA 3ZDQA 3HEAA 1J23A 2PUBA 1EUZA 1XQ9A 4WZ6A 4WBNB 3ORQA 4L3VA 4IOKA 3AEKA 4NECA 1V9CA 1WXIA 2ZYVX 2J85A 5HK8A 5AKYA 2Z2IA 1TL7C 1UZLA 2B8EA 3H9QA 2ZIFA 4KFUA 1ECGA 4N8EA 5DH9A 5MFZA 4ETNA 4I9FA 3LPLA 1IBMB 1LPBB 4ND5A 2G1JA 4RE6A 3EOZA 5EJFA 5TNXA 4EF6A 3OE4A 2BMWA 4M6WA 3WBKA 2VDNB 3UZUA 5I7FA 1HETA 1RRGA 4WCVA 1QTQA 3OE1A 2IIVA 4XX0A 1DHTA 4UNSA 3BWYA 3LL4A 2W11A 4G1BA 2J5XA 4YAFA 5L7WA 3PFWO 7ABPA 3CKLA 2G40A 1MT0A 3L4BC 3AF6A 1VKNA 3OJLA 1W4AA 5TPZA 1YFZA 2BL4A 2FLWA 3PWZA 3LGSA 4P34A 4RIHA 1UFQA 2IH5A 1ZINA 1FDVA 3UMRA 3RFVA 4R54A 3GLFE 2VPWA 1WPGA 5EUCA 5FNVB 3TLYA 3HWSA 2Q6TA 3PFGA 5H59A 3TWOA 4IY1A 5DIZA 2V6BA 1CP2A 1NJ1A 2DRIA 3WZ2A 3CYFA 3ZVKA 5KOJB 1OBHA 3JZDA 4UBJA 4ZAVA 1SVOA 1QYCA 3IVAA 2HJHA 1F4LA 1PFUA 1VTKA 2C29D 3OZEA 1KO4A 4XR4A 5K8UA 2FGKA 2GK3A 1A8QA 4RF3A 2VRWA 2IBSA 2O23A 4BKOA 5CT9A 4IDFA 5TQ0A 1HH4A 2RE8A 1Z6QA 3EUEA 3ZDZB 2CLOB 4FJ2A 2ZAGA 3DEKA 2CHQA 1YJ8A 2AKYA 4JXKA 3EGXA 4K2AA 4R1MA 1BNCA 1UUFA 4U0KA 3RAJA 1FP6A 2XJ9A 2ZXUA 1GDTA 1M33A 4L51A 1TO6A 4V1CA 1O3YA 1NE7A 3O4GA 2KLHA 5EGSA 3FYUC 3WLEA 4NH0A 1W94A 1I0LA 3OHPA 4P4LA 3K0HA 1P6QA 4NCIA 4WW0A 4B2PA 1AKWA 1NF9A 2AKAB 1XAJA 3SDSA 1UINA 5EINA 3QBJA 3H6GA 1TFRA 3OBIA 4LGMA 1FFGA 3QUTA 1ABFA 2GI4A 4PAWA 1MQ8B 1TAHA 3S2SA 3Q7QA 2V8BA 3CBGA 2ACKA 4X1OA 2V1UA 5E7QA 3I6BA 1SHUX 1CUYA 4LDRA 1GG2A 4E88A 3IE2A 3E2IA 2D0OB 2HBRA 4MDYA 1XTZA 2QTBA 2I7VA 2EKQA 1E69A 3H3JA 4DUYB 3F78A 4BCCA 1I6LA 2EJUA 3CG0A 3IODA 5ESRA 4BNMA 3AB3A 4ZT6A 3NRCA 3OPQA 5DK6A 5C3UA 5JS8A 4DJJA 1TGYA 4UAGA 2P77A 2XVMA 4FEEA 3G0HA 2B7CA 1NOKA 2O8CA 1WDTA 2WWTA 3DFMA 4UM7A 5DU2A 5LBTA 4AKSA 1NI3A 1OFUX 2ZJZA 1T24A 4EYOA 5B6PA 3LPNA 4WH0A 3ZV4A 4QU8A 5IYZA 1T91A 3WLSA 1WV1A 3PDCA 1GXSA 1I01A 1ZM3A 4Z3KA 5LBUA 2VR1A 4B6QA 5J9FA 3QMMA 4BO9A 3F3MA 5B7GA 4CEIB 3AMVA 1G8MA 1T9CA 1RHKA 3OTQA 5GP1A 4D9MA 1XAGA 4W1QA 3RR2A 3TPFA 2ZI4A 5AUOB 3NXKA 2W6OA 4QOIA 4HPXB 4UVGA 1KL7A 4L6IA 1YSCA 1UIRA 2R87A 1W47A 3H4TA 4FGKA 4EL0A 2QORA 5B3LA 3OU7A 4UJ3A 1IEXA 1KJJA 2ZYGA 4OFBA 2AEEA 4YMGA 5ADWA 2OXEA 2VTDA 3LRXA 4W5JA 3HBMA 1Q57A 1QRDA 1XSEA 1P18A 2MMGA 1SBCA 3KTAA 4K6KA 4QQ8A 1QCDA 3F71A 1II8A 2WRZA 1NHGA 2HMAA 1M1NA 3NHAA 1NNUA 1QPZA 5I9LA 2AXNA 1QX4A 4HZGA 3HSSA 3V8QA 2J1LA 4TTJA 4H60A 5HK9A 3OQIA 4HWSA 2HPHA 3EQ6A 2XA1A 1Y9DA 2YN0A 3ANSA 2MWMA 3V1TC 3HG7A 5JJIA 5AW6A 4J8PA 3NDBB 4GYWA 4RLQA 3WWCA 4WQMA 3UJ7A 2JFPA 4NIMA 2AG0A 2IHKA 3MZ0A 2HO4A 3WMGA 4Q4JB 1OASA 2PX2A 4H6PA 3TZQA 1MOPA 2IOYA 3O9VA 2V7QD 4BX8A 2XXBA 1IZ0A 2UV8A 4EEKA 3QPDA 2B7LA 3WGMA 2VT2A 3IKLA 4NNJA 4RTSA 1KSHA 3UBMA 1Z4PX 4PYMA 3PQ3A 2DHCA 4ZAGA 3S1SA 1N5IA 3EXHA 2AI2A 4KQMA 3QF7A 2NVUA 4CIDA 1XLUA 2VRCD 1YACA 4FUQA 3VU9A 4EP1A 3L7YA 3U9SA 1XN4A 3G59A 3DZHA 1YWGO 3OQ6A 4IEFB 5HJ7A 5K20A 2OK8A 3A28A 2O8BB 4NYIR 3OEWA 4FKZA 2VXYA 4WNAB 1NGSA 3EX7C 1ORIA 1EDEA 2Y1GA 4P35A 4TYWA 2ACVA 2IYRA 2QUJA 2BGNA 2V54A 2WILA 3D6AA 3ZHVA 5BN5A 3HB1A 2WK1A 3KPJA 1WSWA 3HJHA 3R2JA 5AT1A 1FDRA 2ZTHA 3RBAA 4W5TA 3RRMA 1PL0A 3HDHA 2FMIA 4UAJA 1UDBA 1OI4A 3FNHA 2FOIA 4KFSA 1DADA 1I5OA 3JQGB 1CRQA 4CM7A 1YZTA 2E4VA 3IPLA 3JYHA 3WICA 3QKRA 5U9CA 2C4UA 3E18A 1D2AA 4YJ3A 5E3JA 4EGSA 1ACMA 3DQQA 3IVRA 4Q93A 2G7ZA 4B3MB 4LVUA 4A8JC 1KVSA 4G5YA 5FO0A 4WXMA 3R3YA 5IEJA 4IOLA 2W2KA 4XB2A 5ISMA 2R25B 3WNQA 4F6RA 3ZDAA 1E0SA 1EEHA 1AUOA 5J5AA 4HH0A 2YNMD 1Q1GA 2FW1A 4LYAA 2WG0A 3B5IA 3VVCA 4FHFA 4X90A 4NZNA 1W96A 4RLSA 4PXYA 1B43A 1GGJA 3KJIA 1M8JA 3BAFA 4JQCA 2AXPA 3TLKA 3QA3E 5J2UB 3ZGVA 4BV3A 2JAQA 3I2FA 4CQNA 3FTFA 4BO2A 3K72B 1NKVA 3ORSA 4JP5A 4AJLA 1OILA 3PDIA 4HRYA 4X71A 4BCBA 1XXHE 2IY9A 1EIZA 2B34A 4LYHA 5JTTA 1UAGA 2A5FA 2I6XA 3H99A 3R3UA 4F21A 1SKMA 4E30A 4OQPA 3OFJA 3LWNA 2CBZA 3RVRA 3D1JA 5IULC 1Y1KE 1V9SA 1ULZA 3JQAD 4FYJA 2Z56A 4WNYA 3MCUA 1ZA1A 1NFRA 3L0ZA 2XVZA 2UZ3A 1OZHA 2HNAA 3A58B 5ERGB 3SKXA 4Q7QA 1RRCA 3CLVA 4B4WA 2GN8A 1RI2A 1ID8A 1U2EA 4ITRC 4YROA 1ISGA 1XLTC 1KMMA 1IWPB 4NE9A 2PG3A 2ZJYA 3CR7A 5DGHA 5AW9A 1L7AA 4DHWA 3GLTA 1XK6A 2BEKA 1FU7A 3RJZA 5JCOC 4QATA 4Z1MD 3C1TA 2ZWIA 2JLQA 1NIPA 2O50A 3UK7A 1EJ6A 3T5PA 4ZP1A 1V39A 2F8MA 1P72A 1G5FA 3GGSA 1UZUA 5E4JA 1P3DA 3NM6B 2FPIB 1RJFA 4V0QA 4HAOA 3N2IA 2WIAA 1SVSA 2Z1MA 4P4NA 1XVAA 2IYLD 1NJSA 1EFHA 3AHIA 3OC6A 4H0CA 1J49A 5IAEA 3D3WA 3WQHA 4ZK2A 3RQIA 2XZDA 1BA2A 4Q4AB 3ERCA 1BGVA 4MR9A 5C5EA 2PS0A 3HLKA 4I1RA 4Y7DA 1R0CA 4BP1A 5K03A 3LCCA 1P0QA 1DJMA 3D0QA 4EUHA 3B6IA 2PR7A 3DL7A 3FRIA 2JFNA 1XCJA 1BS1A 3IAS6 1QFJA 5E3HA 3CURA 5KPDA 5HQJA 2D6FA 1D7AA 2IHJA 1Y6QA 2JS7A 3WB1A 4X7MA 1YKFA 1VDZA 2FETA 2RAVA 1FS5A 3ZUPA 1HEIA 5FPPA 1ZCJA 3WIDA 4K9NA 5AI5A 1SCIA 2BMDA 2DX7A 1LWOA 4FIDA 3G5UA 3KXIA 2QN2A 3GK3A 1Q7TA 3VTKA 3V9PA 1X7ZB 4PO1A 3SVZA 1PGNA 3K1AA 3GP8A 2CHFA 1P2DA 1D2HA 3G5MA 3LXMA 3S1AA 2O14A 4BAGA 5BSKA 2O1WA 1UKEA 2JD2A 1UWVA 4QSMA 5BR8B 4I46A 1XYGA 5EFZA 5DBOA 2UUOA 3LZDA 3MUNA 5KTKA 5LZ2A 3PFHA 1HLFA 1LC3A 1ZOOA 4FNOA 5ALVA 1EX6A 1S0UA 2FN8A 3AJ9A 3RYCB 3H2ZA 1R64A 1KR5A 3AKEA 2HJWA 3GOQA 4CM4A 4EYSA 1M8GA 4M0MA 1V37A 2HFJA 4DV2B 2QRKA 3BFPA 3CNBA 4RF4A 2W6NA 1CY8A 1LLCA 4P7GA 2Z1DA 4TZ0A 1J97A 1WF6A 3TDMA 4FLFA 1QF6A 4GECA 4RZ2A 4ZOCA 5A3SA 4O4IA 2J4DA 1YS9A 3AUFA 3LS2A 5JCJA 4BATA 1GZSA 2FFQA 3IMFA 1QB8A 1SU4A 4W5HA 2YW9A 1E7SA 5JZBA 4DKJA 3R7BA 5EG5A 4OHZA 1KJYA 1M1XB 2V4ZA 3K0FB 3JYQA 4EX7A 5EQJB 5EIEA 1KYQA 2QTZA 3U3RA 3VVBA 1GU1A 2LKCA 3O8NA 4CLHA 4FUTA 1W88A 1WXHA 4A5OA 2GVZC 4J16A 1U0EA 3DZDA 3OI7A 5GOZA 4G24A 4CI0B 3BKWA 4Q3DA 4KR2A 1G0NA 4DOMA 3A9WA 3MJEA 3EH1A 5AJWA 1J39A 4JROA 2FQXA 4Q05A 4XYGA 3WLOA 2JHCA 1YVDA 3K15A 3C7TA 2H52A 3NUZA 5JAMA 1XRPA 4W8GA 4QYMA 2IU3A 1W581 4PX9A 1QKIA 1CQWA 2GASA 1E8DA 2VHJA 4JU9A 1D2NA 4HAZA 1V41E 3GT3A 2I2BA 2WVJA 5JCOA 1V6CA 3TLMA 4JKOA 3AP1A 1X70A 3HDQA 2QP9X 5ICSA 3PDUA 2Z95A 1WRBA 2NIPA 1HWYA 3NWPA 4CKEA 1E3JA 2PJUA 5IJ0A 2P2NA 2MYNA 4LIPD 4E2YA 1MB3A 2FW0A 2O3TA 5JG7A 5AVSA 3VYRB 2PMFA 5K01A 5C8VA 4B31A 4U3JB 2PUWA 3AWDA 3E53A 5EXPA 4BV8A 4EA9A 1FFWA 3SCZA 2W42A 1J42A 1EBBA 1QH8B 4YC7A 1W34A 4TSKA 4F4UA 3BWDD 4OUDB 4G0ZA 5IFLA 1E6MA 2Q29A 4X85A 3OJCA 1N2GA 1P44A 3I9V1 4Q9JA 4JJ8A 3LGAA 1YI8A 2OR3A 2YWGA 4RS4A 2D54A 3BGSA 2I22A 3RD5A 4BNKA 1EZ4A 1OBVA 3QJGA 4RAOA 3ESZA 5KQLA 3RUPA 2FEPA 2ZSEA 1STOA 1U6IA 3G85A 3K6KA 4L08A 3GC6A 3RVQA 1Z36A 3M5CA 2IT1A 3QP9A 1ORDA 5L3ZA 4CN8A 2I4MA 1F2TA 1WSBA 4XFJA 3QVKA 4D6YA 2OP0A 2BLLA 3BSWA 3KQPA 2PMBA 2QGZA 4UREA 1Z39A 1K6XA 4LSWA 1ZM9A 3LQYA 3LK6A 5JAUA 4LUCA 2J3JA 1QVWA 1CPYA 2D0IA 1W48A 2ZR9A 1MFPA 1KWKA 1N0VC 4OM7A 3BBPA 3IIJA 4QBGB 4B3CA 2XB9A 3GLFB 3CINA 3E6AA 5EGNA 2XTNA 2PQMA 3H11A 1YKSA 4IYRA 1ZNYA 3LVRE 4RH0A 3NHKA 3KD2A 3O31A 2H11A 4EH1A 4FK8A 3E3OA 4F38A 3KSAC 1PBNA 5IUJC 3ZK9A 3DYBA 1LPNA 3Q3EA 4JR1A 4L22A 2KHZA 1M6EX 3GP3A 1NM5C 1ZH6A 2FPLA 4WA7A 4XIGS 1JS1X 3BA1A 1PEKE 4DG5A 3HFRA 3DUFA 4I55F 5SYNA 4PSKA 4PYIA 5AI9A 2JIQA 1NTRA 1OLOA 4HNTA 3O93A 1AQNA 4QM6A 1S1CA 2O7SA 3OQIB 2ATEA 4RVFA 2Z4TA 4DQUA 2C4WA 2PRYA 4ZU3A 1NM5A 2EARA 1EHCA 3HKBB 3VRHA 5BW5A 3I76A 2P2SA 5G0SA 3RWMB 2ZUWA 3BTOA 4JP8A 5EKXA 1SFRA 1G55A 3FJYA 3KKLA 4CEIA 1QCYA 3EXHB 4FNMA 4MK4A 3URMA 4O4IF 1MO2A 2J32A 2ZITA 4DGQA 1X8KA 2JD0A 2OFOA 3CF2A 3JASA 3JQ6A 3BMCB 1JZSA 4XUGB 5G2OA 1OJLA 1WA5A 4Q21A 3UJDA 3ZHTA 4JBNA 2HHHB 2YVAA 1Y9AA 4XGQA 3LZCA 1T2NA 2X13A 1VLQA 2OLJA 2YHUA 2C94A 2XDYA 3I05A 4FYIA 4GI1A 4RKYA 3ZXIA 2OTCA 2XTZA 1ZYUA 3H4VA 3W05A 3SNHA 4QJIA 1AKUA 3QOFA 1E1NA 5DB4A 1CUJA 2J41A 3EJ6A 1MEJA 2OWDA 4C1NA 1NP6A 5SV2A 4EVQA 1T8UA 4M6WB 4O02B 1TE2A 5JR3A 3R5XA 4URFA 3JZFA 3OLZA 3NT4A 4ID9A 2P6OA 2P9TA 3ROPA 3EXEA 4YJGB 2EKBA 3KU4A 5SY6A 2XMRA 2IPNA 1CXZA 4RETA 1A8UA 4I1OA 4LY3A 1PZFA 5F7ZA 5DGDA 2PE5A 2D1TA 4EHLA 4MV8A 3PDHA 3HKDA 2WF8A 3Q5EA 3R6GA 4MROA 3GPLA 4YH1A 1ADGA 4ZIRA 4JLPA 3WYEA 3HDJA 4DIMA 2JK1A 2FF7A 2VUTA 3N7AA 4Q1BA 4ZCSA 3KLPX 4C01A 5K8IA 4RULA 2Y67A 3NHUA 1BYUA 1E6WA 4MS3A 3KBOA 3FMFA 3A3OA 1ZMOA 4ACAA 2GPBA 1G2QA 4IG9A 2XYHA 4IHQA 4L8VA 3RSGA 1Q22A 3KC2A 2QD4A 4QBKA 4YQFA 2DSNA 2BGJA 1Z3IX 2C4KA 4DR1B 2QU7A 3NFYA 2CHUA 3S2ZA 1XDDA 4JCOA 1JPJA 2AOTB 2BKAA 2PIAA 4L5IA 1B0PA 5TY0A 3UHOA 4BWVA 4B8WA 4AJ2A 3ZDFA 4F45A 4J7CA 4DREA 1IJFA 1OR8A 2DTEA 5IDQA 4N0DA 2O06A 1TO1E 1G5HA 3L8MA 4KLZA 1TI7A 4GYYA 4K9QA 2ANBA 4B7UA 4QZVA 3BH6A 3MVEA 3WHLA 1IXSB 1HRKA 2ZE6A 4FMBB 4L3OA 3RV4A 5C81A 4BBJA 2NMVA 1XZ8A 4ERNA 1RWVA 2FFBA 4FR0A 1OBFO 3GX1A 2FPGA 2RGWA 1N2BA 1G20E 3CR3C 3KYDA 1B6SA 3PGJA 3FTQA 5G53C 4DAEA 1ES9A 3MJVA 2O57A 3QGMA 4JYCA 1T5LA 1CZOA 4XX1A 3I9FA 5EWJB 4W5RA 2CXNA 4QU5A 2SICE 3E2PA 1Y8AA 2WA2A 5LCXA 1KKMA 2NYUA 1XQYA 4IMJB 1U2GA 4DUGA 2FSSA 3F98A 3LXUX 2JFWA 4KR6A 3KQMA 4KI7A 1JU4A 4A7PA 1J9ZA 4DSUA 1FTYA 3AW8A 4QBTA 2G0NA 4MWZA 2WG2A 3C5VA 4BJ5A 4G0XA 4UHJA 5HS4A 1KTIA 2XUPA 5EYPB 1CRZA 4M0FA 1GPBA 1EE2A 2HF2A 5IZCC 4NVRA 1K8XB 4DYVA 2CXQA 3PHIA 4DLRA 3R0IA 2BPOA 2DPYA 3H84A 1HDXA 3BXHA 5AHKA 1ZO8A 4HB3A 3OIFA 1J25A 1RXIA 4JJAA 4HFJA 4LJKA 4R9SA 5D51S 4R7GA 3S2EA 4XVCA 2R65A 2XQKA 2N9UA 2VHQA 2LE0A 3GP5A 4G6ZA 1P2BA 3QNWA 1Z4KA 3DFIA 3QVUA 1QX3A 2A9KA 2G25A 2WWIA 2MINB 3FVRA 4N5HX 4TWZA 6ABPA 2IEYA 1ODTC 2IZZA 1ZX1A 3KYJB 1H8EA 3PBKA 1QZUA 3VZDA 1ZL0A 2AEJA 2PN1A 2BGTA 1XGKA 4BFWA 2JK0A 4F7DA 3MGAA 4PZAA 2NZ2A 2C5BA 2FDRA 1YULA 3QKUA 1QGYA 3T4PA 5JLJA 4F5ZA 4D8WA 1OTHA 2PV0A 3L8EA 2V4MA 4PNEA 1JEOA 1JAIA 5ESDA 3C39A 4P3YA 1YIAA 5L4SA 4BLVA 1NMZA 2WJIA 2WJ4A 3V3KA 3CRMA 1QWSA 4PHHA 1ZIDA 3WL6A 1BXGA 3WK7A 1EWKA 2VJLA 1MX9A 5HKKA 2ZWMA 3AERA 3EVGA 3FUXA 4HPJB 4BGDA 5J47A 2A1IA 3PTZA 2KX7A 5K6RA 4L73A 1DAHA 5EE0A 3NOOA 3ROMA 4B35A 3AW9A 5ITVA 3LPAA 1DOHA 4I50F 4LNUB 4R1QA 2VF8A 3BD7A 2VAVA 3BRWD 3E4DA 5FA8A 3GLIB 4JYZA 4CR7A 1CE8A 3CSUA 1KYXA 3DKIA 3FXAA 3ZW8A 2BFMA 5TPZD 1CEEA 2HY7A 1AKQA 3TJRA 4LZLA 4HGYA 5LJLA 2PM8A 2W2XA 4PQFA 2BEJA 3WB0A 1FTQA 1NBEA 1A3CA 2VAMA 3EEYA 3GDFA 3P0RA 4OP2A 4ENUA 1E63A 3GAZA 5EEGA 4JT2A 5JD5A 4JQYA 3W7AA 3RT7A 1QU2A 1LTHR 1N2JA 2IOHA 3K35A 1S3FA 3R3JA 3K2QA 4ALNA 1IQ0A 5C4MA 1YZFA 3CISA 3WBBA 5C4IA 3DGEC 3TFOA 2R6R1 5IBCA 2ZIZA 1U9ZA 1N3LA 3HDGA 5DK4A 4ALLA 3N6VA 1YTUA 1FP4A 2C1ZA 3N8IA 4B81A 2B9EA 3SQNA 4P31A 4RD3A 4Y2YA 4Z3OA 1W19A 3TNLA 5EHZA 2GHRA 2CYAA 4LECA 3R3ZA 3F1LA 4OQMA 1CU1A 3QTLA 4WZBE 2P5TB 3EVEA 4RKQA 1I2MA 3VH2A 3EGDB 3GIWA 4JVLA 2GEJA 2V7VA 4XSHA 4W1RA 4DNFA 5JSZB 2HLDA 3L04A 2EZ9A 3FFTA 4N5DA 4Q7KA 5E8RA 4MV5A 3LC2O 5DNWA 3ZE7A 1K06A 3DDCA 3UWSA 1J56A 3VYTB 3KOMA 3O0TA 1GUFA 3I53A 3F7MA 3V8NA 1T1GA 2OKCA 3HEMA 4BQFA 4LV5B 3I1FA 3LW7A 1DQYA 2YXNA 4U7HA 3FCEA 3V5NA 1O9HA 1XDWA 3OG9A 4M1WA 2OEPA 1UBRS 5FD8A 2PKQP 2LGJA 1U90A 2GYUA 4X94A 2G70A 5EP1A 1Z6PA 4LGCA 4TV9F 4C14A 4RADA 1N8SA 2Z3WA 1N57A 13PKA 2FEKA 1SMKA 5F7XA 3U5TA 1OGJA 1HMPA 4RKRA 5A4JA 1USUA 3ZLVA 3DCJA 4UUNA 2NADA 1Z74A 5IBRA 3TCNA 1CR6A 2KQUA 2Z4SA 4L5AA 5CLFA 5KKCA 5TQJA 5TQ2A 4RPIA 3ZV3A 4CKCA 1NRIA 4TT3D 4YUZA 4ESHA 2PRJA 1PEAA 1SQ0A 2BFFA 2FTKE 4LV8B 1YFJA 1TTQB 3SMQA 3MGBA 1R6UA 4NU8X 2ZRHA 2VJAA 1I7LA 2YH2A 4MIEA 1O96B 2OC4A 1MH1A 2X7HA 2IXBA 3EVFA 4M53A 3WZLA 3ENNA 2GKGA 3UFXA 1A8IA 1TCUA 1ZUD1 3G2IA 3U60B 3LFUA 4KXYA 5I4CA 4M8KA 4C7OB 2BI7A 1Z2EA 2EFYA 2AHOA 3ANMA 3DNPA 1HG1A 3FIJA 4BFLA 2F55A 4BNFA 3HBAA 4LV6A 4MI9A 4R51A 4BZXA 5EJAA 4ZJPA 3VH3A 1ZGCA 2DSTA 1OHHD 2VNHA 1O0SA 3LYHA 4CFSA 4R1TA 4LPKA 2YFKA 2CMGA 1GVHA 4KAAA 2FRXA 2PRIA 1BW9A 3R24A 1XE3A 2H48A 1MO3A 2VPTA 5DEIA 4EUKA 3FFXA 5EMLA 5CB0A 3D7MA 4AM8A 2F59A 5CNIA 1WXEA 1MZVA 2C88A 1KY4A 1T26A 4HTFA 4PYOA 3MGCA 3CRQA 4WBXC 3KUUA 3U3XA 1JNYA 3V46A 2VDWB 1KI7A 5B37A 3ZHSA 4D02A 4DNQA 4DRXB 5JBNA 1ZD9A 3NNNA 4AD8A 1I4EB 2O05A 2JZNA 3IQHX 4RBNA 3N0TA 3AUSA 1CJVC 1QE5A 1SXPA 3H11B 2Q4EA 2CMKA 2PA0A 3FPGA 4J6FA 3AK4A 1E2GA 2X0RA 3KDSE 5KVQA 5U4QA 3UMBA 4CCAA 1C1XA 3K8QA 3W9SA 4JYMA 4KOAA 1T1JA 1C29B 1NVVQ 1JVSA 4PNHA 5ALSA 4URWR 5FLXA 2AFIA 5KSYA 2O8EB 4HGZA 1QG4A 2Q9CA 3JQBA 3PEYA 4ZC8A 5THQA 3I0MA 4LXQA 4IIYA 3IHKA 3ZGYA 2CL7X 2ZEJA 4YK7A 2HQSA 3KQHA 2Q41A 2EDAA 1FYEA 2CB9A 2PYZA 1U1EA 1JFTA 4I50A 2O2EA 3ZE8A 5UKDA 4AMBA 3IVCA 3ZYZA 1BE0A 1FSGA 2GCIA 3EHEA 3SP1A 3SYTA 1KZGB 4XI9A 5LBIA 1DQRA 2ZIAA 5DCWA 4RH3A 1GUBA 1U3CA 2NVWA 5I01A 1CD5A 1YS1X 1JX6A 2HNBA 2Q6LA 3MMPA 4RZQA 2YOHA 4WKBA 3S2GA 2YIJA 4B32A 2IHNA 4EABA 2CSXA 1NUTA 3GFGA 3Q12A 4JAVC 1YOVA 1NE2A 3HV2A 3SS7X 3C3BA 5BSRA 1XMXA 3DEIA 2QYOA 1NN5A 2B4QA 5L8VA 2ZS9A 4ZKDA 2V97A 2PT5A 3GLQA 1VG1A 4QXMA 2C0QA 3I2HA 5C2JB 4IIJA 1NYLA 3T7AA 3U44B 4NRDA 3ZLJA 1D09A 3QJ5A 4GQIA 3LNCA 3A9RA 1KY5A 3COYA 5U4XA 3BPSA 4KPUA 4WINA 1DGQA 5B1IA 1AUPA 1IYZA 3SF8A 1LXCA 5C3MA 4CHTA 1FJGB 1BFKA 2Z9DA 1FNBA 1I3NA 2C0PA 3ZD8A 2ZPUA 4CKBA 1MG5A 3ENWA 2IF2A 3LYUA 4BLPA 2PX5A 5ARCA 2XLBA 3SVLA 3W77A 2ZUFA 2H4ZA 1LFDB 1Z18A 1KE2A 5JS6A 5JJ5A 5KYKA 4J0CA 2RI6A 4Q48A 1IFXA 3TO5A 3DFUA 3LQ2A 5F33A 3VZQA 2I1WA 3BMQA 3C4QA 4YT2A 9ABPA 3DV2A 5JDCC 3LKBA 3UYKA 3GHYA 1QS0A 4GI3A 4OH7A 5K0LA 1A8HA 2VYNA 10MHA 1NASA 2O5RA 3C8UA 4MYHA 3EA5A 3T3OA 4MUJA 4WXRA 2YKGA 1ZWLA 2RFLA 3NBMA 1KFJB 2JI6A 3S2YA 3SZUA 3K0FA 4BDSA 4W9NC 1TPYA 1BH2A 4DSAA 4XTRA 1T0IA 1U0RA 3T3NA 2XCQA 3HU5A 3GFPA 1MB2A 1UWKA 3OY7A 2CHGA 1HSOA 1LBHA 3DBVO 3GXOA 1PTJC 1DP4A 4CBVA 2PTHA 4OLJA 3LDHA 4TM7A 4Z9XA 4L07A 2DT5A 3TGPA 3R9XA 1D0SA 1DAPA 1W5BA 3LKVA 3TNYA 2QTFA 4KZPA 4Z0NA 1X2EA 3LK7A 3UAZA 3NWJA 3EISA 4D0LB 3KHKA 2CNOA 3LOPA 2R8ZA 2GPAA 3PXAA 3TLCA 3AVXA 1RAHA 3C5CA 2Z1NA 5CNMA 5HKAA 2AC4A 2WLTA 3ACCA 2GHIA 3Q2IA 3CX6A 3GARA 3PWKA 5HOEA 3F46A 3QVSA 1GAWA 4X1YB 1O03A 3VDNB 4AJOA 2FEWB 3F6YA 3ZWQA 4B75A 1UPBA 3TLEA 3FVWA 1M6HA 5HNKA 3VC2A 4IZOA 1ZGAA 1ZI9A 4MQ6A 2ZUUA 4OO3A 5ULLA 2AH5A 2E85A 2G8LA 2A5GA 3IEUA 3KB2A 1B8OA 4Q00A 3JZMA 4OJNA 3NJ4A 5FHRA 5HXAA 1ZSNA 2FJPA 3M6FA 4QUHA 3T94A 3QZUA 4Y9TA 4D46A 5ABPA 5CW1A 2Q49A 2I29A 3X3HA 4MHTA 4URZR 3UXYA 1GUAA 2QT1A 3BICA 1Q17A 1B74A 3PQ2A 2APJA 5AIBA 1BGXT 1L4KA 1XZDA 4M36A 1PVOA 4D2IA 1JQBA 3KKMA 2PYDA 5HP4A 1H4SA 4U4AA 3OX4A 1L5MA 2I3DA 3LBNA 4KGZA 1OIVA 4Q3LA 3ZZUA 5H80A 2ZG6A 4B3HA 3WL7A 3E61A 1YAJA 1OB2A 2E0IA 3KZNA 3GJQA 2MMCA 4O59O 1X0VA 3QBEA 4OK6A 4YO7A 4KIJA 3QLJA 3N07A 3UJ9A 4FYYA 3AF0A 2C4TA 4EGJA 1WB9A 1TQ4A 4E03A 4DDVA 2ZK7A 5EJ4A 2UYHA 1WOYA 3QU7A 3RABA 1WWKA 1XTQA 2QL7A 1SXQA 1QM5A 4MVJI 2AS0A 3CMCO 4KYTA 4UFPA 4A4DA 3MHTA 1X7DA 2XMGA 2GD6A 3EWIA 1E7MA 1JR2A 1PD0A 2QUBA 1WDMA 2Q8NA 4S0XA 4X44A 3TQHA 3LKDA 4CU2A 3IJRA 1VJ1A 2GN6A 3L8FA 3S2FA 2FPMA 1MENA 4FHEA 2ZDQA 1NQ5A 4NEHB 2AB0A 3I2YX 2FK7A 5AHXA 1P9NA 4F4CA 2QQ0A 2CNKA 3AETB 4W99A 4BC0A 2HAEA 4TWAA 2O3SA 4FFMA 1IN7A 2W5UA 2VH1A 3E03A 1QF7A 1QYIA 3BDAA 4GSYA 4R1SA 2OYCA 3SLKA 5MN6A 1FXSA 2W2PA 4GO1A 1OFVA 3DT9A 3I5YA 3F5QA 2Y1LA 1ZC4A 4EG7A 2FWPA 1L5YA 3ORFA 1B8PA 4OXRA 1NFFA 5JATA 1Q3TA 4YREA 3SOPA 2FWMX 3V1YA 4OLBA 2X4DA 4QM7A 4BP3A 4FMDB 5KTMA 2ZWVA 3L4KA 4QODA 1NBAA 3LY9A 3PQDA 1H2ZA 4LN1A 1E8MA 1G4UR 1JR3E 2CDNA 3MHPA 4IJQA 4Y2UA 4UEJA 5ECYA 3P45A 4F1JA 1X15A 5CR9A 5JTUA 5FDFA 1NF3A 2BKEA 2P40A 4OXYA 3P32A 3UAOA 2QM8A 1PJ3A 1L4UA 3D81A 3VR2A 4DTIA 2I55A 1Q0QA 5AESA 4Y1RB 5I47A 3DH0A 3K0SA 2XCOA 2B1QA 4OGLA 2WTNA 5IARA 5JADA 1EMDA 2UZ0A 3KT8A 2YWHA 2CV1A 4HNRA 4JC5A 2H2IA 3G2LA 4XGNA 4CT5A 1PT8A 1K75A 2JW5A 3FCYA 2MIIA 1D4ZA 5ALGA 1UODA 1EWQA 4J3JA 4JJ6A 4NPHA 4QDXA 3OCCA 1MC4A 5KJEA 2L69A 2VNAA 3QKWA 2A3NA 1TU0A 3TZ6A 4YMUA 1H1TA 2DR2A 2Y1WA 2CMFA 2XYRA 5FCDA 2ZUSA 2ZRQA 1XDSA 5IKXA 4TQGA 1FUUA 2RHWA 3WJ1A 3LV8A 3MJRA 5F1OA 4FI3F 4IFBA 4L5JA 2FRDA 1C9JA 3N7UA 1BROA 2FFHA 4NBTA 2O2GA 5K7SA 5DV9A 2EBUA 2XB8A 1N33B 3OPYI 4P4TA 2O19A 5EIAA 4EF5A 4HMQA 3HUDA 4FWIB 3DAYA 5LLTA 4ND6A 4OI0A 4RQUA 1TQHA 1IOWA 4G63A 1VCNA 2B0CA 2C5EA 1L7PA 2GZRA 3RROA 1XALA 2JFGA 2OPBA 2FK8A 4JYBA 4NH4A 3TQSA 3Q7PA 4CM3A 1EXMA 1H4QA 3FHCB 5TIIA 2R97A 4US2R 5HIIA 4HVCA 1U8ZA 2O6HA 3FI9A 2XT0A 4XQ0A 5AW1A 1YOVB 3Q8KA 2PJRA 2HA7A 1XPRA 3EXAA 2AR7A 5K4HA 5AK5A 5FTJA 3RS4A 1ZITA 2BCGY 1XZMA 3MCZA 4DT1B 1I51A 1YQ9A 1SU6A 1WVIA 4FOOA 2WYUA 4FHCA 4IX9A 3QXJA 1W6UA 2LXNA 4R1LA 5B3JA 3F9CA 3HI4A 2G9QA 3B1FA 1XU7A 2JFHA 2VF2A 1QHYA 2DUJA 4C4YA 3PG5A 3T5TA 3O8BA 4BP8A 2WYOA 2W2LD 3N58A 4FGWA 4KR7A 5TVGA 1DTWB 2OP1A 1VMIA 5LWQA 1SVMA 3OX1A 4PGMA 4M98A 5TDHA 3I5XA 5AVYA 3V42A 5IS2A 3VNUA 3KOUA 4KK3A 4RVCA 4UUMA 4EB6A 2FEXA 3D3QA 1F48A 3I3OA 3TIVA 4DB4A 1HYHA 1P77A 2NXNA 3G1TA 2O7VA 3LIPA 4G84A 5I45A 2OYSA 4FBGA 4FEAA 2FV8A 1YBAA 3MUOA 3R76A 1DCMA 2JRCA 3GGOA 1DBSA 1V4BA 5IT0A 3EDMA 2Y9MB 4TPKA 2QZJA 5TS3A 1GSAA 2WAMA 1KARA 1JR3D 4EG3A 1OAOC 3LHDA 3HCBA 3WFZA 2RHGB 1V71A 1Y8QA 1MX5A 3A37A 4V1CB 1FXWA 1UMBA 3CEHA 1JGTA 3QKSA 1XQ6A 3GWZA 2CV2A 2Y1DA 4N5LA 4LXTA 2QN3A 4JI6B 1OV6A 5IH7A 2ZRIA 1ZVQA 4JL8A 1BKYA 2W90A 4X3PA 4Q1CA 4DMRA 1XQWA 3Q3CA 3R6DA 1PVVA 4U7GA 4NDNE 2WUVA 5JCJD 2VQSA 2GXUA 1XRNA 2WFMA 2WPNA 1E9FA 2C7VA 4O4LA 3LA8A 2QQGA 4QJ4A 2WIGA 4RF2A 3PPVA 4R8RA 5AXBA 3K70D 1Z83A 2D3TA 2VDKB 2JGDB 2C7RA 1RM4A 4OGFA 3EPHA 4XDYA 5HM8A 4LRUA 1G8PA 2XA9A 3ZVRA 1T25A 3R3XA 3I37X 4L5YA 5L53A 4RJ2A 1IN8A 4TLAA 3DHWC 3DM5A 4NV0A 2UVPA 3ZVNA 2H06A 2ZUTA 4CM8B 5EJ8A 1A71A 2QVYX 1PD1A 3FKQA 1QFXA 3COPA 1J9EA 2A9PA 2CFRA 2GZ1A 4KSYA 4DWVA 2Q9AA 2V1XA 1ZKDA 3CVVA 1PLKA 4PLYA 4WLFA 3BCUA 3SGLA 2AD1A 4IS2A 4QPJC 3U1BA 1HUQA 3F3SA 1LLQA 3RARA 1TO2E 2OLKA 1VKRA 4UPVA 3ZQ6A 3FB4A 1PZHA 2XCTB 3HCDA 4ICIA 2VN8A 2H5JA 4L02A 5K4AA 3K1ZA 3KJGA 4G4GA 4DIFA 1SRQA 3FHJA 1EZZA 2VJPA 3OBBA 4Q47A 5DLEA 5EVCA 1XVVA 4F96A 1GTJ1 4CQMD 2PUEA 4X91A 1Z0IA 3M4YA 4UASA 2PWYA 3G2PA 4FZ5A 4FS8A 3TOSA 1NT4A 1KK2A 3FFWA 4P58A 4D92A 4DCUA 4E7OA 2LCIA 1ZJWA 4B7AA 1GL9B 4DA8A 4BBAA 4UC0A 2IITA 3FZQA 4H35A 1TT5A 1YB2A 3SJ7A 2ONYA 4H0FA 1YZUA 4ZOQI 2NU7B 4JJEA 1ND6A 1B76A 1D2CA 1WB4A 2VTEA 3HO1A 1EGVB 1E2EA 1FZQA 121PA 1NW9B 2O20A 2X1MA 4LG1A 4EY6A 3T1HB 4KLCA 1SOAA 3HY6A 4N0MA 4WOBA 4NU6A 1NBME 3L7OA 4TTTS 1T36A 4OVKA 4PBSA 2EJCA 4BLQA 2GXQA 5G1OA 4XQGA 4RJJA 3L7JA 3O7WA 4ZOEA 5MGBA 3W7BA 4POAA 3LDAA 2LRHA 3PXGA 3M8KA 3KOYA 4M8SA 3O2NA 2RDMA 1XVTA 4IZIA 4LK2A 3B70A 4PQRA 1BMTA 1K9VF 1CY7A 2DECA 2YRWA 4NSNA 2DLCX 1QK3A 3ZG6A 4P7FA 2OC9A 3ZV7A 4BN5A 4GM0A 5G3ZA 4JGBA 5LYJB 5JAQA 1WBDA 3AUTA 1KMHA 2VHCA 2GXAA 3LCMA 3THXB 1V7CA 4HDMB 4L27A 3USCS 5M5BA 2GESA 2NU8B 2NUPA 3NBZC 3OZUA 4FDMA 1U28A 3P9NA 2NGRA 3ESXA 1P17A 5AK3A 2AE1A 2ZIEA 3FPKA 3H5VA 1MAHA 3DD5A 3EEFA 3PNQA 1UBOS 2EF0A 2QX8A 3HN2A 1XLVA 5HUHA 3FPJA 3MTEA 3BMOB 3DHNA 3MWGA 3VR4D 3FOZA 3KSDO 2ERXA 3UQZA 3EZXA 2NW6A 2G36A 1BU5A 1U99A 1K7YA 2PL3A 3HCPA 2OCBA 5JNVA 2IGTA 3QVMA 5DNYB 2H59A 2JEYA 3SX0A 5I4BA 1QQAA 4JVMA 1F2DA 1XRLA 5DGTA 4E1VA 4HQ0A 3WR5A 2X0DA 1W93A 1S2IA 2VP0A 1PGPA 1PZNA 4LZOA 2VDWA 1R4NB 4BLUA 4DRXA 2A0FA 1HLDA 3P2YA 4GGMX 1EBFA 1OZGA 1Z6AA 2R6CA 3G9ZA 1QXSA 3KIPA 4F84A 6LDHA 1ZK2A 1SQ6A 3L6OO 5CFLA 5C5CA 3AHJA 3E70C 5CNKA 3S7TA 2X4LA 3RS8A 2WV7A 2C5AA 3Q5DA 2Y05A 4KRFA 2V6FA 2VH2A 1ZBQA 1QCZA 3W78A 4G56A 3GJZA 3H2HA 4MKIA 4WKOA 3L8CA 4OYRA 1GGKA 2C2HA 2VSXA 3U7JA 1KOJA 3FHTA 5D01A 2FPWA 2IEAA 2ROQA 1CY6A 1SC1A 3ID6C 3MWEB 5C34B 2OCYC 1FVHA 5KNBD 3AH8A 1G1MA 4IMIB 2YV4A 3GRRA 3E3MA 3AHFA 5EAIA 5KQRA 1JHPA 1L4GA 5CA1A 4RSHA 3FCXA 4GZLA 3DCNA 1KY2A 4JUIA 1YB5A 3FRHA 4B3FX 4TYMA 4NV3A 5F3RA 3R8FA 3U40A 2ANCA 5CVVA 5AKHA 4IJKA 1SY7A 4C6RA 2YWFA 4GWKA 1GA4A 2REQA 1HYGA 4GXRA 4KGDA 1IBLB 4WCFA 2ISCA 1O6CA 3GD5A 5A4KA 2VP4A 4WZBB 1BD4A 2SCUB 4LTNA 4EHAA 4TLLB 5IHXA 4CDNA 5I4IA 1LEHA 2Q2OA 3S68A 2H1SA 3ADKA 3ACBA 3QBVA 4MVJH 1M34B 2I9PA 5I51A 2QJOA 4ZMRA 3CLKA 1BEEA 2QRJA 4YPFA 4A26A 3PYXA 4WLEA 5D5HA 3KFLA 1CF9A 4GF5A 3M9XA 3AEKB 3OM8A 3LCUA 1C3OA 2G4CA 3WLJA 2H1CA 2NOAA 3G2OA 3UT0A 4XCXA 2A92A 3V4SA 4F8JA 1NSYA 2WF6A 4DFDA 4XE5A 4YMSA 2J9FB 3O84A 3R09A 4HAUA 4Q6WA 4TS9A 5CW2A 2X9QA 4YUYA 5LUAA 5JQGB 4D9GA 1IVYA 1HDEA 1US8A 2HIGA 4NYMR 3KLMX 4IILA 4OLHA 4PLCA 3W3AH 1QV7A 3SSAA 3ZUGA 4UCWA 5AFSA 1KI3A 3EJWA 4NENA 4ZYUA 1P29A 4EW3A 2V6GA 3C15C 3L8DA 4CLDA 2FW8A 3G0BA 3DP7A 2WJVA 1A2QA 1BN7A 2ADMA 1GP2A 2P9JA 4J07A 5IC6A 2O8FA 3OCWA 4AXBA 2ZCVA 3G0GA 4FOSA 3BOSA 4RMHA 1N6HA 2KMLA 3PXCX 2E37A 2MSNA 2QG4A 2IH2A 3HR8A 3PGKA 2VL7A 3VSDA 5ILOA 1J2TA 1ZK4A 2D2IA 1EUCA 2ZGVA 4GKKB 2LCFA 2A9FA 1R4MA 2EC5A 4HQLA 2QN1A 5H3CA 4Z9YA 1JAXA 4BQEA 2PLFA 3M33A 2VPIA 4PN3A 3I3SR 3SHVA 4CIBA 4WERA 3EIHA 1BA3A 4PVCA 1JI0A 3A26A 3ZH2A 1CUSA 1OYYA 4NAVA 4BS9A 3G88A 3HA5A 4A5SA 3GB9A 4BAZA 1IU9A 3K32A 2G77B 2PX6A 1RI1A 1WKBA 4JOSA 2DLNA 1QHSA 2PGLA 1CZKA 2A9VA 1P0FA 1ST3A 1W30A 2PQ6A 3ET4A 3LPDA 3TFQA 3T7DA 3GEHA 5BT9A 2GN1A 1UP7A 1AS2A 1JDNA 4IIVA 1VLVA 2O2IA 4NK5A 3TX2A 4DQXA 2V3CC 3VYWA 3FZYA 5KQGA 1S2DA 3ZD9A 1H22A 5KSWB 1Z68A 5F52A 2DY1A 2WEKA 1YZQA 1PF7E 2PBZA 2XUKA 4YY3B 1UJ4A 2XQGA 4J4HA 3DTTA 1WUJS 2GPNA 1CUBA 4R0MA 1ONSA 3LLSA 4KE7A 4P38A 3DOCA 4X8MA 1HDZA 3EZ2A 5BV8A 2C8LA 3DV9A 3FDIA 5GGXA 4A0FA 3DD1A 2C8KA 4EPRA 3RVMA 4YCMA 4G4IA 4G5HA 3IP8A 4M9SA 3UANA 4BEJA 1TJYA 4B83A 2FR8A 3I2IA 1YVPA 3LQKA 5BVGB 1GR1A 1HEYA 3J81k 3ONVA 1SA0A 1WBJB 3O4VA 3UF0A 5ELXA 2GRAA 3TLGA 1C3EA 4F4DA 4YYEA 1UWLA 3PL5A 4JITA 1TDJA 3SZMA 4EVRA 4DLYA 1TM4E 3S2IA 8AT1A 5LMUB 5A9SB 2JCXA 1T6ZA 1BH6A 1TUIA 1PL7A 1THGA 4CM6A 5I7EA 2C5LA 3D0RA 1T1EA 4K05A 5G1PA 1O95C 3T6KA 3K9FC 1U4NA 5BN4A 2X1VA 4LXUA 2HSJA 3E5HA 1RQPA 1EAYA 3K9QO 5IWAB 2VI5A 2WU8A 2Q5LA 4HSGA 2AFVA 3UK1A 1P19A 1E1MA 1UL1X 1DXYA 1Z4LA 3ASVA 3K3PA 3KR1A 4L1KA 4LCBA 4Q0MA 3VHQA 1RIIA 4QGGA 4U2DA 5FWYA 1NMYA 4FS3A 3BFKA 2WTMA 2PZEA 3FNEA 2PWBA 1ZJ4A 3AXTA 2O8DB 5AK0A 5AW3A 2G06A 2LPMA 4TV9A 5KYNA 4AJ4A 2ZT6A 2OUIA 2WIJA 3BD9A 2WY2D 4YECA 4EQZA 2FSUA 2Q1SA 4GC5A 1LBSA 5H1YA 3CVYA 3D7KA 4RDHA 5H82A 1JHUA 2WWGA 4ZGGA 4EJSA 4KB5A 5LWHA 3MOIA 4RDXA 1TAUA 3M4JA 4EAQA 1PNQA 1Y7HA 1DZIA 3LHSA 2QAJA 2BI8A 1GSOA 2YNMC 3GT0A 1NY5A 1O8CA 1VC2A 1VL0A 1ZUWA 1N5KA 3B20A 1GYRA 3O38A 4MX8A 7REQA 4TTPA 3B13B 4IFEA 4HJXA 3OFNA 1PVDA 1QAMA 3RDPA 5IU6A 1WU7A 1WS6A 3KZKA 1S3IA 2HLDD 1XRSB 5DBGA 3MJSA 1GGNA 4F93B 2FX3A 5AKIA 4AS3A 2AJLI 1CQJB 2C4HA 3HJAA 3L06A 3R3HA 2IPOA 3FLAA 4DJEC 1GKYA 2RC6A 3TRIA 3IPXA 5LQSA 5HPYB 4PCVA 2H92A 3AFIA 1QHXA 1X13A 1BDHA 4DMGA 4RZXA 1BHSA 3EMDA 3D2BA 2RHOA 3M34A 1OVGA 4ZV7A 2SBTA 3DR3A 2HCJB 1KYWA 2AK3A 1BOOA 2BI4A 2Z5FA 2WV9A 2ZAYA 3B9QA 5IKPA 3W4KA 1XEWY 2JLRA 3RU7A 1DEOA 4EI8A 1E5DA 4AJPA 2VBCA 1NLFA 1E1YA 3DUFB 3KTDA 1Y33E 3G2JA 1AQYA 2J9GA 1Q6YA 3N2KA 4Q3NA 4E1BA 4KX3A 3HEBA 4K9MA 4HQKA 1JT9A 4QSHA 2WQZA 4BQIA 3WADA 1DWPA 4OB8A 1FRVA 5F2NA 4MP3A 1Q0TA 3ZK8A 3R5TA 1T6YA 1XVIA 1ZD8A 1L4MA 3NCHA 2OCAA 5K0TA 4QPZA 4CTJA 4R84A 3QXCA 2M6LA 2QAGA 3WK4A 4AMVA 4H15A 5K0EA 2PUAA 3QX8A 5A4DA 2DP4E 5D3KA 3MQ2A 3O6VA 4LYYA 3LRTA 4Y1RA 4JI1B 4JDUA 4MDEA 1ZIPA 1HK7A 5BRNA 1JQ5A 1V5GA 2HH9A 3ZNNA 2ZVPX 3DMPA 4HZUA 4ZVPA 2AYXA 1W0CA 3GGDA 3W06A 4JP2A 2JFFA 3P9YA 3N1UA 1JFFB 3H7AA 1OHHA 1ZGHA 1L7NA 3CZCA 2NT4A 1JA9A 2C3UA 3PPWA 2XUGA 4MKZA 2F9FA 5DYIA 4E94A 5AK6A 1FFHA 3H9EO 1WCIB 2PSFA 3G2KA 2C5HA 4N0QA 2YHBA 3MIZA 5KEIA 3RJ9A 4OP3A 1QIMA 2M32A 4IKOA 4A6PA 4LZPA 5EIBC 2BD0A 4AICA 4C29A 4XASA 1X7XA 3TLAA 3DP9A 3QELB 1M8KA 1E3TA 3PUWA 2IIPA 5DIFA 1HQYE 4F4IA 3NYRA 9LDTA 5L9AA 4F5DA 1B93A 1R4ZA 1W1IA 3F9RA 4YWJA 1X7ZA 1A76A 3A4VA 2NZVG 4KITB 5IDXA 1RQ7A 1WZNA 5I5EA 1UEJA 3C6KA 5DGIA 1C0PA 2JKVA 1KQ3A 1F4PA 2HJGA 2GFHA 2SKEA 4GZ5A 4TQUS 4HEA6 4PO8A 1GQFA 2BCJQ 4X7BA 2VBIA 2Z8XA 4R2MA 4YACA 1TA9A 1E98A 3KB8A 3P9QA 1NNI1 3OT5A 4ILKA 4MMYB 3ELBA 4PCLA 4D7AA 1SD5A 3CBQA 4O2BF 1I1OA 3G13A 3WNBA 4ZYWA 1UMKA 3OUZA 1VJGA 6AT1A 2GLTA 3DFZA 2RGYA 4DLXA 3OP4A 3ZJ4A 4YMLA 2X5JO 4KV9A 2QSUA 2Y68A 3FG9A 3HU3A 1BCSA 4OMUA 5H83A 4R7ZA 3NHBA 4RTPA 3R4CA 4WN9B 3WG9A 2OZLA 1RLIA 5EKDA 4D44A 1FS4A 2ZT5A 3ADOA 3RYIA 1UH5A 3GQVA 3T5AA 4NBVA 2VJBA 1TZCA 2PSEA 3CEMA 3KEMA 4NOMA 2DPMA 2AMYA 1GUYA 2VJMA 3S8EA 2HLHA 3MPOA 1XZAA 1P7CA 2BM1A 1XTSA 4KKXB 3WRXA 5A1JA 3FTEA 4N65A 3V4OA 4AN1A 2OCDA 3VR5H 3REGA 5JDCA 5KAPA 4F9GA 1WCXA 1FE8A 3VI4B 3EDCA 4A92A 3LO8A 3SKVA 1FYDA 1PNOA 2WM8A 4H08A 3D9QX 4ZALA 4BEWA 2PZLA 1GQYA 1OWNA 1GQOA 3PQFA 1CRWG 3E8SA 5K0JA 3QX3A 1P75A 2D5AA 4G65A 2FFJA 1OE0A 1H6AA 2OGWA 2IPLA 1R18A 2QM3A 2F9MA 4S12A 1VKZA 4K6HA 4L0CA 2V0GA 3B1ZA 4WFIA 1KI1A 2GKOA 1Z8NA 3O90A 1F0KA 5AOCA 1GA1A 1R66A 4O4JB 1GZDA 2F3UA 3VQTA 4ZT4A 3DZBA 1DIAA 5F23A 5K3FA 1P39A 1CUAA 4NZYA 1ATIA 4C06A 4XLLA 1C9YA 3CRW1 5C32A 2NSLA 1GYQA 3PJFA 3OF2A 2ZPTX 5ADVA 4XUDA 5BNWA 4FFWA 1K6MA 4U2EA 3DB1A 3N6RA 1OFHA 2HPZA 3PX2A 4LWZA 1NFQA 3ANXA 1JL3A 1VE1A 3IDZA 4UDNA 3F3YA 1FLNA 3CWQA 3TW8B 4KBFA 4EW2A 4EJSC 2WMYA 4FZ3A 4JEIA 4IJUA 1WXFA 4FWTA 3N5KA 2Y4OA 1SXGA 4CMIA 2BEWA 4C4RA 4L85A 3U16A 1FXUA 3ZWOA 3IV9A 4J0QA 2JBAB 4YBZA 3DKVA 2E4XA 5IAGA 3CUTA 1Q6ZA 4MQUA 3RYIB 7YASA 1ZNZA 3SD7A 1KEVA 1UEXC 3RIGA 3Q85A 3D3EA 1W73A 2R8RA 3PSAA 3N0RA 3U1VA 5CLHA 2JAOA 2H63A 2XE7A 1LK0A 1WCIA 2XADA 3QLVA 4TSFA 5F2EA 5B58T 2WIDA 2EGHA 3UENA 1SQ5A 3CN9A 4HWOA 5FPHA 5LM3A 2IVZA 2B8NA 2VWGA 4KR9A 5CFPA 1Q44A 3MF4A 4QICA 4WKCA 4BKRA 3IGFA 4E2FA 4RTLA 3TN7A 4G5OA 2WIFA 5GY7A 3WTCA 1QFZA 1SKBA 4KPUB 4UM8B 3NOVA 2I71A 4YEDA 4ARZB 1W35A 2Q46A 2XMZA 3N39C 1LJLA 1XK7A 4RIEA 2CEKA 3Q87B 4E0BA 5AVQA 3I64A 2GD1O 4KDCA 1SHZA 4C4XA 5JZMA 4S2EA 1GR0A 1DOZA 4U2BA 4EA7A 5BQFA 2X5NA 4OG2A 5KYXA 1Z7EA 2XSZA 3BJRA 4PG4A 3PE4A 1YIOA 2PGDA 2AZMA 3E5NA 3IE1A 1UQUA 1P9LA 4G5QA 2IP2A 4Q4HB 1JLHA 4HDCA 5FEMA 3SDZA 3V8MA 4EM6A 1EXDA 2PCLA 3GJ3A 4LQLA 1I7QB 1JHXA 3ZXSA 1ZVMA 1U7DA 4Z0PA 1DFHA 1WB6A 2A6PA 3TR5A 2VWQA 3Q3GE 3OPVA 5DM0A 3L7IA 2YCLA 4RJKA 4RVSA 1M73E 1O94C 4E22A 1ATZA 1T0PA 4R1OA 1S2LA 2AXQA 2VHTA 4MRAA 3P0IA 5AOVA 1S4MA 1ZW1A 1XKLA 2YICA 4HEHA 4NESA 5C8YA 3SF8B 2MSDB 4B9EA 1FVOA 2BGRA 1MB0A 4XW2A 4YO8A 4EHFA 5EIWA 1I9GA 2OFWA 3PA6A 2MSKA 3DHYA 5LDHA 2XZOA 4MVJF 5T8KC 3TRDA 5LMNB 5IHPA 1RYEA 1JQDA 3EXG1 1Z29A 1WZIA 4HGPA 4J0JA 5EN4A 1YRYE 2XMPA 1NY6A 2K4MA 2GA8A 3DAGA 4H59A 1QQBA 3HNPA 1PQ4A 4LZAA 3U48A 3NNDA 2PZ8A 4YRTA 3TVTA 3TMKA 1PDOA 4KGVA 3DYIA 2QKYA 1JG4A 4TQ9A 4RY8A 5A0VA 3NRBA 3M3PA 3VR1A 4QJ5A 1JDTA 4O63O 4MARA 3SHWA 4HGRA 3AJDA 1VJ5A 1VSBA 1Y6FA 2GK7A 5KHOC 4Z4QA 5JJKA 4F1WA 1SXJC 2XZTA 3GUVA 4AU1A 1XCBA 3TL3A 2IV7A 3ZDXB 1XEXA 3TKYA 5A5DA 3RG2A 3BJZA 2UAGA 1B4DA 3PYLA 1U2TA 3GO4A 4PIVA 4E4YA 2ZSAA 3CWCA 3P1JA 3PXUA 3MAAC 2QVZX 4MUAA 3TBKA 1B42A 1L1FA 2JKZA 4FIZA 5DTJA 1DAKA 1M3SA 2EFDB 2QSYA 3VMMA 1HSZA 1W4BA 4C2AA 2XGJA 3NRJA 4PGGA 1Z17A 3KJQA 1WDLA 3TTTA 1M6VB 1HC7A 2OECA 2PO5A 3PDWA 3FPEA 2GN9A 1JSCA 3LW8A 4QA9A 3BTUA 4UBMA 2O8EA 1PUJA 3LCRA 1GCIA 3QE0A 3EZNA 1XP5A 2XVYA 2W7TA 3QUQA 1ECFA 3NASA 1XD2A 4F3CA 3WAJA 1JQ3A 1NUUA 2ZAMA 2I3AA 2Z2KA 1YRLA 1F06A 4NLLA 4US1R 4UBOA 4ZQCB 3VV2A 1DAEA 2X4GA 4KDRA 2HU5A 1P4SA 3C8MA 4HC4A 4NFLA 4Y67A 1PWXA 2QE7D 1PE0A 1SBZA 4F85A 1E7YA 3NO4A 1IULA 4OKNA 1NW5A 3H9CA 4NS4A 1R9GA 3F7TA 4EG8A 4EY4A 2FSVC 3AKZA 5D84A 4JBYA 1RJ9A 5C4GB 1PS9A 3AJ8A 2GWRA 1XI2A 3HL4A 4L78A 4BRZA 4EY7A 4BE7B 1F5SA 1FP7A 2GN2A 4YWHA 5FOTA 1FYWA 3GFFA 3X2FA 1VRWA 3DEJA 3LUKA 5IM4A 4P4SA 2VUHB 4O2RA 1MAWA 3AP2A 4OREX 2PL9A 4HFRA 2G17A 3WKAA 3ABSB 4BUCA 5KB3A 4XRGA 5C51B 3PRKE 1RJWA 5JJLA 2FP4B 3ZIUA 3PFIA 2D59A 1II0A 3DNFA 3GGCA 3THOA 1I5EA 4MQEB 3K2EA 3KWFA 3N2GB 2X2FA 4QNNA 4HADA 1DBQA 4E5NA 3I5UA 2WVAA 5EXSA 3VHRA 1Y8CA 1R9JA 3PHHA 4IIJB 5FLKA 2CUKA 3UCFA 3U44A 5K6TA 1LY1A 1RHJA 2CF5A 3QPBA 1KI2A 2CSUA 2EF1A 2C2ZA 1E2IA 1FMJA 2HQOA 4QDKA 3HP7A 1FU4A 4DCOA 3CLHA 3UV3A 4DV3B 5JNTA 4D82A 2WTAA 3B7PA 3MIIA 3T41A 5EC8A 1OY1A 2OQVA 4X64B 1UKAA 2Q1TA 4LE2A 3MTAA 2V58A 3BS4A 2JIDA 1BYIA 1D07A 1ONPA 1VI5A 3DE1X 1DJQA 1OSNA 4QPDA 1WMAA 2VH5R 2G71A 4KDEA 3ZU6A 2YQ4A 4PG8A 3RVDA 3A0UA 2QVGA 1U7WA 3GMIA 1IH8A 2R79A 2ZTMA 5CGZA 5J1TB 4CCWA 2A5LA 3EUAA 1GTSA 2YCBA 3QMWA 4JFRA 4PLPA 4QT4A 1WUKS 2IKQA 4A3SA 5KWSA 1LLDA 4MRMB 4OFWA 3TK1A 3W8NA 3LWBA 4JMLA 5KX5F 3UA4A 2CWDA 3FNRA 3COJA 2FZCA 5FTWA 2O4UX 2QAIA 3HJBA 3A0RB 2BBTA 3AIOA 3WGNA 4B43A 2R66A 4PBRA 4FHGA 4EPTA 2Q99A 2CK3A 2NVBA 3VOTA 1KYYA 2YZKA 4H1VA 5IBQA 2Q5OA 4EENA 1PO7A 1NXXA 1Z4MA 4CCYA 4Z9FA 1K0UA 3RVBA 3MMSA 3WGZA 3OOEA 1GITA 1X1RA 3L79A 4I14A 5JRJA 4FT2A 4LZNA 3OD5A 4NPAA 4UMVA 3ZCUA 4O1MA 4Y2HA 1GAXA 2GJAA 5HKKD 1JH8A 2V5VA 1KPIA 4KAXA 4RA9A 2WLSA 3CEJA 3R7WB 3DE0X 3FDJA 3OH8A 2FN3A 3MXTA 1DIGA 3LLMA 3KTFA 5HKBA 1N32B 4DE5A 5LDGA 1GM5A 4CUZA 3KJFA 1N3IA 4H7PA 3UCXA 1BXGB 5M7EA 2YJ3A 2ZVQX 1P1IA 3REQB 2HU8A 3RW9A 2CL5A 1G19A 5EVJA 3ROGA 5HZKA 2POCA 4HQFA 1CNEA 1VB3A 3G17A 1K5HA 1YQUA 2VNSA 2YYZA 2X8AA 1SUPA 3HMKA 5EMNA 1KQFA 4BB9A 4CEJB 2HV9A 2FCAA 5LLDA 2Z6AA 4Q4CA 4OB7A 1FF9A 3TSZA 1IONA 4LDZA 4G37A 4Z5XA 4DLWA 5KHLB 4AZVA 1NWHA 2O4CA 3QUAA 5EZSA 4WXPA 3V80A 2ZB4A 2FI1A 4OLFA 4Z3DA 4JUBA 3A6GA 1SBNE 2PT7A 3O4JA 2GEDA 1YL6A 2QN6A 2NUAA 2V7UA 3P2EA 3TMAA 3WLAA 3CRZA 3KWJA 2ZATA 1IPFA 5FRDA 5TVKA 1XDUA 5H4GA 4L5BA 4EG1A 2C5SA 4NEGA 4NX2A 5KJ1A 4ER0A 1PJRA 3KPWA 1B8VA 1YCDA 3KD3A 2R68A 3PFCA 1J1UA 4Y6QA 1D6SA 3ENZA 3M3DA 3GCZA 4QUBA 2BSXA 1UOQA 4DDUA 1OXSC 1HQDA 4CCYB 4IXDA 1MHTA 1I1HA 4ZPJA 4GMFA 3A1NA 4M0PA 1EIWA 4FEGA 4PSAA 4XAQA 2EG9A 3V2GA 2V45A 4G07A 3EXIB 3FNBA 4HNQA 3M6XA 2BKUA 3LF1A 1MJ5A 3TJMA 2HGSA 2JCVA 1XRQA 4XYLA 2PKWA 4X3OA 1AF7A 3DXYA 1P1JA 4NAHA 3TRHA 4IDGA 5KWVA 4EFKA 2IDJA 2RKOA 3HYSA 4LFCB 1R12A 3F2IA 3K0CC 2O7QA 4KE8A 3SKYA 3ET5A 1SXJA 3GOHA 3T38A 1WLSA 4K81B 4ONEA 1D8AA 1IK4A 3M81A 1ML4A 2G1AA 1EDBA 3RRXA 4DNOA 1V1MB 3ZEIA 4TWRA 1P2SA 3V1LA 5L6MB 2PUDA 1IN6A 2V98A 4C4ZA 1GLVA 1K08A 3AJRA 5LQJA 1ZLYA 4DA0A 4I5IA 4KQ6A 4P80A 5TC4A 3WGKA 3RT9A 1U28C 3LDUA 3ZWVA 1ZUNA 2DWOA 1EVZA 1E6LA 3I1YA 1R10A 3C7AA 3CM0A 2NAPA 1DX4A 4INPA 4JQSA 4TS1A 4S1TA 3MWEA 1EP1B 2G5TA 4M7RA 1AZTA 2ZCJA 2PJZA 2A5YB 4X1IA 3OQOA 1CK4A 4B3GA 2BJWA 4H4CA 4Y9DA 4DIKA 4B0OA 3I01M 2W70A 2R6ZA 3L41A 3QFCA 2ZBGA 1I4DD 5B58C 4OXXA 1O9BA 5KNDA 2P0YA 5LU8A 3WXBA 1CBUA 1NQWA 3ONDA 1Q14A 3CQ9A 1KEPA 2FMXA 1H3EA 1RVDA 4CWAA 3GJTA 2EKZA 3PD7A 5JANA 5JU6A 3Q1LA 1UANA 4F5YA 4ALIA 4MLPA 4DDWA 1JG1A 4U7FA 4BE4A 1G5RA 1U8XX 2Z83A 1MPXA 1J0EA 3HNOA 1NG1A 4KRGA 3UT5A 1GTMA 3Q2KA 4LBVA 4OAQA 2GT1A 2YNMA 2X7JA 2O8NA 4PLWA 5JD6A 4XTCS 1HZJA 2ECOA 4YLEA 1H4VB 2ZYHA 2OQIA 5CPFA 5I9TA 4BVLA 1JU3A 1Q7EA 2C20A 4U3JA 4YMVA 3H65A 1COZA 2EWWA 2IYOA 2QE7A 3RSZA 5CG2A 4BEBA 2I4LA 7AT1A 3O2QB 2I91A 1I4OA 1O6GA 1PR1A 2FJUA 1VI2A 1TF2A 1LBEA 3MRVA 4FFOA 4KACA 4E6PA 4NE2A 1GKUB 1FRQA 3ME5A 4MW4A 5HQ3A 5B4TA 3AL2A 3UJNA 1BKSB 3L3BA 1SHLA 4OFXA 3ZWMA 4DJ5X 1NBHA 1U2DA 3LQRA 1T4MA 4L2IA 4WOJA 1WOMA 2R5NA 3DHVA 2PQ2A 3WK5A 5WRFA 2JB9A 4LXYA 3ZC3A 4WK4B 1GPYA 4YUVA 1EX9A 1NBIA 4BFXA 1Z15A 1AZLA 1DTEA 2GM9A 2IGBA 1P8JA 2F1RA 3KVNA 1LBQA 1LZLA 3MFYA 2VDQB 5B12A 2WFAA 3AINA 1DG9A 1Q92A 3T15A 2GLXA 4A15A 4YMHA 1MO4A 2WUFA 3R5FA 1I6MA 3OIVA 4P1ZA 4MCJA 3D54D 4KO2S 4US0R 1ZR4A 1Q21A 2R86A 2XUQA 3D8HA 1DX6A 1TLFA 3IHWA 2R1ZA 4L4YA 5IYZF 3OEHD 1G21E 3HFSA 2FCRA 3JR7A 3KCQA 2PH5A 3QNUA 1YUBA 2PL5A 2IYVA 4H7FA 4J6EA 4TSRA 2HZ7A 3GZ4A 4KR3A 2W6CX 3I23A 3SEFA 3KHSA 1Y3BE 4QDZA 4BFVA 1E20A 3EYWA 4PHTA 1YR2A 2O1XA 2ORVA 3KJNA 4IV8A 3CVWA 3EPJA 5DSXA 1LNQA 1WBBA 2WT4A 4D26A 2Y0EA 3UMGA 2B2XA 1J2JA 3IUQA 3A6JA 2FXIA 3MW8A 2PZKA 3E05A 3JARA 1AB6A 3MJCA 4ZVQA 1G1AA 2JGAA 1PR3A 4IJ6A 4LRTB 5AVXA 1BHQ1 1NYRA 2VYND 1T9GR 3FVTA 4LVOA 1VPDA 3WS7A 5IKEA 4NTZA 5K8CA 1HE4A 1N34B 4ZEMA 4CL2A 1JKJB 3EASA 3GRUA 1XJCA 1QH1A 2C84A 2FMFA 4OQZA 3TLJA 1LS6A 2B4YA 3V7WA 4ZXFA 1AKEA 2VWPA 3JVDA 4QOEA 1SRRA 4IVQA 2DH5A 2HM7A 2H54A 1K92A 2VP6A 4CMIB 3PR1A 4LC0A 5L3RA 2JLUA 1UZAA 4G5FA 1XZKA 4FD3A 2ZKLA 3EMBA 3SR4A 3B9BA 1P7VA 2QTVA 3AILA 5AQ1A 2QS9A 1DCKA 1UJ2A 3OZTA 1W44A 4KOEC 4ZOLA 2ST1A 4UBIA 1GPLA 4E14A 4MUIA