2FUG6

Crystal structure of the hydrophilic domain of respiratory complex i from thermus thermophilus
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
161
structure length
144
Chain Sequence
EREGILFTTLEKLVAWGRSNSLWPATFGLACCAIEMMASTDAQADVMIVAGRLSKKMAPVMRRVWEQMPDPKWVISMGACASSGGMFNNYAIVQNVDSVVPVDVYVPGCPPRPEALIYAVMQLQKKVRGQAYNERGERLPPVAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADH-quinone oxidoreductase chain 1
publication title Structure of the hydrophilic domain of respiratory complex I from Thermus thermophilus.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 34
structure length 144
sequence length 161
chains with identical sequence F, O, X
ec nomenclature ec 1.6.99.5: Transferred entry: 1.6.5.11.
pdb deposition date 2006-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
6 PF01058 Oxidored_q6 NADH ubiquinone oxidoreductase, 20 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12280 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2fug600
5LNK6 4HEA6 3IAM6 2FUG6 3IAS6 3I9V6
chains in the Genus database with same CATH superfamily
1KI6A 4QDKA 1HDYA 3KAKA 3R6GA 1DE0A 1H69A 4JYBA 5JD5A 4UNIA 5AQEA 4E5VA 1QV7A 1XP5A 2XR1A 3EQ6A 1KDPA 3ND5A 4JBGA 5G1OA 1FDSA 4DRZA 2Z09A 1A9SA 1KKUA 2QPAA 3R7FA 8OHMA 1KFBB 1XLUA 1Z12A 2Q3JA 4F91B 5AHKA 2IOHA 4CT5A 3T3OA 1KJYA 2CJFA 1J8MF 3ZWAA 1I4DD 2COUA 3NNSA 3KR1A 1SQGA 3ND6A 3UHJA 4BKPA 4ZQBA 3GFQA 1YRHA 2YDXA 3FOZA 3UUWA 1V95A 2BHTA 3EGOA 2DH5A 2GA8A 2JARA 2Q7XA 1YHNA 2Y1DA 3MS4A 4I4TF 4YAGA 3T3MB 4FKZA 1NFQA 5DTIA 2BUAA 3TNLA 4WNIA 5C8DA 3EFOB 4RVSA 4F1WA 2XRFA 2LD4A 3F6EX 4YWJA 4ZK6A 3MPOA 1U98A 4WQMA 1E1KA 5HCNA 3ZZ1A 5I51A 1U0LA 5LIPA 2FPKA 5DOVA 2J41A 4HNHA 4V0SA 2HJVA 4I5EA 5FPKA 2FFJA 4DLVA 4O4LA 1HWYA 3PL1A 4IIJB 5AHWA 4EY7A 4JDPA 3B12A 1D4AA 4JENA 5A4MS 3GRYA 2OHIA 4JVMA 1V8PA 3IVRA 4UNPA 4YRDA 4OIMA 2C4KA 2QM0A 2J7KA 4JJ4A 5FHRA 3GMTA 4TUYB 3VI4B 3VKVA 1ENYA 2JJYA 4BJ3A 4PPYA 4ZO8A 3COWA 4KE6A 3VDXA 1X1DA 4BNJA 4QBIA 3AQ4A 3PGJA 4KNYA 4IV0A 3ICQB 3F4LA 1Z4OA 4R40A 2ONKA 1XLWA 3VBEA 1BRTA 1TEVA 3AEYA 2AFIE 3OTIA 4N3BA 3SLGA 1B93A 1TYCA 2ONYA 1RAAA 4XSGA 1P33A 2HXGA 2ZANA 4YAEA 2GFHA 3C6YA 1L7PA 1NVUQ 1FS4A 1W52X 2QR5A 2GUGA 1EK6A 1Y4ZA 2Z95A 1K5PA 4PHCA 4S35A 4HBZA 2F9MA 2G1JA 2VSOA 3ILSA 4WA7A 4BFXA 3ZXIA 3LH5A 4W5OA 2XMSA 4UTZA 3DEHA 3TOVA 2AX3A 3NANA 4AUNA 5TQ2B 4QGHA 1H1LB 4JP8A 1KOJA 4ZI7B 4QREA 2FUG6 3RROA 3PQ7A 2C7QA 3ZWXA 4QUIA 1Q14A 4DA4A 1BN7A 3P2MA 4LYHA 1Z0AA 3KXDA 1RE0A 4ZQEA 3TOCA 1QHGA 2O59A 4QGBA 4YBRA 2OCAA 4NCBA 3UMJA 2VDWA 3AYZB 1P4HA 1HYQA 5JS7A 5IKXA 3TLAA 4X85A 1MB2A 1TYZA 2B8TA 2ZVDA 4TV9A 4R9SA 5T4EA 1MG5A 1G7TA 5COAA 5EZQA 1OT5A 2WD7B 1ZD1A 1WTCA 4WY5A 9LDBA 2K6GA 5A6VA 4EL5A 1HF3A 4NPCA 1ZOIA 1XZLA 3M3HA 2X3UA 2HSWA 2RCYA 1Q2XA 1VL1A 4GKAA 4I6JA 3I42A 4OHWA 4JU8A 5FR1A 1A77A 1ZXBA 4N0PA 1E5LA 3H1EA 2FW6A 4V2UA 1KYTA 1HZZA 1C9JA 1Y4UA 3D8BA 3LK7A 2GJKA 2R97A 1E94E 2UYOA 3HV2A 3H2SA 3ORSA 2GPTA 2C3YA 1C1YA 1I4WA 3E18A 1PGQA 3KWFA 1G4HA 4G9GA 5FBHA 3JAKA 5EHQA 5B7PA 4DV0B 1ZM2A 2VWHA 1EFCA 4IKEA 1ULZA 4B48A 3BPSA 4J4BA 2A0YA 2OHOA 3GFFA 3SQOA 2M9MA 1E0JA 5DE3A 3RYCB 3EBPA 1GM5A 1P73A 2LWIA 3TR6A 4YX9A 3SJCA 1DOHA 4ZTBA 1YZ3A 4RV5A 4DSOA 5KNLA 5CJJA 3UNXA 1D2GA 1PNQA 3EWNA 5BYBA 3CEHA 3W4IA 3T7KA 4MR9B 4RD3A 2XUOA 3FTQA 3GHYA 1MTOA 1MMFB 2HIGA 4YQYA 5E9AA 5I9MA 2ZXFA 2A92A 2KYRA 5CK4A 3TXXA 4E70A 2O3RA 3V8NA 4F0JA 5ALJA 3LKZA 3W5CA 1VIVA 1IQUA 2F90A 4W5WA 4XW2A 1JHPA 3PXDA 2PD6A 3QF7A 1KP2A 4QYSA 1HDXA 1M8FA 4JI7B 4US0R 1FDOA 2AUTA 1ECBA 2FMTA 3BTOA 2MOKA 5FB3A 3H05A 5LBTA 2IU0A 1YE3A 1E99A 1PNOA 1NA5A 5J58A 1J0BA 4L5YA 5C18A 2KS6A 1W46A 5CDGA 3KZOA 1GFWA 4P4SB 1DXOA 1KEKA 1M9NA 2WWTA 3LAWA 4X3PA 2NWQA 5EJ2A 2WILA 4ZVUA 4CE6A 5KYNA 3THYB 1PJZA 3IQGX 4KUEA 5JH7B 4X7BA 1CF4A 5DBIA 3CNOA 2CZCA 4MR7B 5UKDA 3GCDA 2H2WA 2NNLD 1FP2A 2IPXA 2EIHA 3FRJA 2CMKA 4NFYA 1PJBA 2CUNA 2Q3HA 3ZTTA 3IURA 4OB8A 1G19A 4WBXC 4ATNA 4CKZA 1HFJA 3F8SA 2DFDA 2X6QA 4M6WB 1NLMA 2W6CX 2Q2VA 2XA2A 1R6BX 3NHZA 3OEEA 2GEDA 3R3YA 4BLWA 1UZNA 2ZJ2A 5AM0A 3K73O 1DX4A 1GPAA 1XZGA 1IU9A 1HLGA 2OLJA 2ZB8A 3I58A 3S3TA 5J1SB 2PMKA 2Q9UA 4HN9A 4Y1RA 2PAFA 4YRFA 2ZBDA 3O8LA 4Z1MD 2VG8A 3G5UA 4G97A 4L4UA 1B8PA 2JIBA 1L5QA 5HMLA 3TW8A 1UC9A 4GNRA 1WXGA 2JPDA 3WGTA 3ELDA 4FWIB 1ZITA 2H5IA 1PFVA 4JJ7A 2VDQB 1V4NA 1E1LA 4R1TA 2GXQA 3V3KA 4FB4A 3RUFA 1A2QA 5LNK6 3RCBA 1TEHA 1E61A 3NBFA 3TR0A 4PX9A 3IDZA 3CN9A 1QMGA 2VT3A 3LOUA 1G8SA 1M67A 5DSTA 4C0JA 5I9SA 6YASA 2OO5A 1N1MA 1E92A 1T2CA 2G67A 4XASA 2PLRA 2QV7A 3AL2A 1S9HA 4HS4A 5TMBA 3RLIA 2NSLA 4YP5A 5JC8A 2VEOA 4K6MA 1V5WA 4N0MA 4OHPA 4N76A 2XE7A 1OR8A 1ZLXA 2Q1UA 3OVMA 4WUVA 2P6PA 2R9VA 4TL6A 1COWA 1X1SA 3SC6A 4CG3A 3EXIB 3H5WA 4NL4H 4N65A 3NC0C 2Y6UA 1VKRA 2IS2A 3HY3A 3ET4A 3S70A 2FQXA 3AVQA 4C0SA 2SHKA 3U4IA 1O4VA 2J9RA 1K2VN 1M2JA 2JEZA 1DTSA 1EUDA 3UGTA 1D2MA 1T3LA 3MRSA 3WNBA 1ZH8A 5D6OA 3F78A 4MV4A 4MUNA 3VXKA 4A0SA 3ILYA 3HUTA 1FSSA 3DNMA 3A6DA 1ULSA 1TQ2A 2WG0A 4C30A 3DLTA 3SJZA 4DQXA 1T8PA 2ZKLA 4MVJF 2PPVA 5E95A 4DLLA 5GJBA 4UEWA 3B13B 1C3OB 1R0WA 1QPBA 4TZTA 4AZ3A 2LV8A 4DTCA 5EHZA 1BJTA 1CFZA 1E64A 1JG6A 2FDXA 2HFKA 3K35A 4M86A 4KMMA 4NCIA 3DF7A 4EYKA 1WLYA 3A27A 5FUVA 4TT3D 4IS3A 1JPUA 4DCUA 4EDFA 4CL0A 1H8HA 2Q1YA 5EUBA 3B6MA 4EM6A 1SXJC 1UWCA 2JVKA 2VDMB 4KVAA 3AVVA 1KAEA 2QP3A 3MJVA 5IBRA 1GGFA 4DHEA 3QXJA 1AUOA 1RQLA 1LJLA 3KJZA 2NV6A 4KSCA 5AI8A 3BL5A 5K8IA 5KYXA 2GPAA 2AQIA 5JAZA 3L7NA 4EW2A 1ISPA 4ND8A 4E0BA 4AJ2A 4MDHA 5CUQA 1BCSA 2VDJA 2HPVA 3MJFA 4EOGA 5LQKA 4F93B 2ZRKA 3RU9A 1I5RA 4TS3A 5EZ5A 2XMRA 3DBHB 1BVUA 3WLAA 1O0BA 1MFZA 3K2IA 5LXTA 1J2YA 3E8XA 4IOJA 5EWMA 4DSNA 4EUNA 2Y1WA 2CHVA 4U39A 2IDZA 3IR7A 2V9CA 1W88B 2YMLA 3ITDA 4GKVA 2WVHA 4JIGA 1K7XB 1T25A 1UBTS 3OQIB 3GBVA 4PTYA 3KYIB 3Q7EA 2B7CA 1NFFA 2YJ3A 3K2EA 5KUTA 2VJNA 3HWWA 1UOPA 1N8KA 2V03A 5ARCA 3BB3A 3QI7A 1EJ0A 3HVIA 3CLRC 2FPGA 1RCFA 1HDZA 1L9XA 3DQZA 3LBNA 4OJTA 2NPFA 2F48A 4G1FA 3SEZA 1RLTA 4K3VA 4MYUA 4DCVA 1D2AA 1TM7E 1OFTA 2R7MA 1T5TA 2RK6A 2WFLA 2DZDA 1PJ3A 2ZAIA 4UBKA 2B1JA 4Y6PA 3TRHA 5AK6A 4DNXA 4M9ZA 1UPFA 3QX9A 3CJTA 4LZAA 1VJ1A 2NTEA 3ABIA 3P2YA 3G9UA 2PFSA 4H7FA 3V8BA 1QU2A 2JIRA 3VV2A 2W90A 4FEEA 3LGAA 4Q1FA 2FZWA 3EXEB 2VZ0A 1O5IA 4H7IA 1M6VB 3KK0A 4X61A 1SVLA 1TD9A 1X7DA 3DG9A 3DMDA 3C5HA 3JZFA 3A6PC 1TEXA 2H4XA 1QVVA 5FD8A 4CKWA 4R1LA 1PU2A 2BMDA 1CUVA 3HXOA 3L40A 3KQUA 1KZYC 2QTNA 1T9BA 3L5KA 1Q17A 2GILA 1FRVA 1N4DA 1DG9A 4Y67A 2YYZA 1ILEA 1Y5LA 3PRKE 1ADYA 3F1KA 4OFWA 2C8LA 3W9SA 1H2RS 2AG6A 1XYGA 3QJ5A 4XLZA 1A0OA 1FA9A 1Z63A 3INRA 5G41A 1F2UB 1IMJA 3OHPA 3VU8A 4BO3A 5K0TA 2OY0A 3P2IA 2QJFA 3CX7A 3DUWA 4ND2A 2NSHA 3NQ41 4EX6A 3PICA 4C88A 3RO7A 4F3YA 4EHHA 1R8QA 2FQ1A 2BH9A 1DJMA 4X95A 3UJ3X 3U44B 3M5PA 4GX2A 2NQ2C 2PGJA 3WWPA 5CFRA 3CH4B 4Z0PA 3FHOA 1K27A 3MB8A 4OU5A 1U3CA 2IV7A 2X0EA 3K05A 4EPYA 1ZH4A 4KEAA 4RHXA 5FBRB 3E15A 4DRXB 1ZLYA 1ZVKA 2M2IA 4G1BA 2WTAA 4X20A 4EAAA 1ZD2P 2I65A 3L6UA 4ILEA 2WU4A 1KA9H 3QEJA 4P4UA 1GGJA 2IXAA 3BBPA 4PX5A 1HGXA 3EARA 2GJSA 4GGOA 5J2UF 1HDRA 3F67A 3OEHA 1R9JA 1EB9A 2TYSB 3E1SA 3OZTA 1DKPA 5FOSA 1OTXA 4AN0A 2BR4A 3NM4A 4A1FA 1VG1A 1YZHA 3KOWA 4ZQFA 1SPBS 1S2GA 2BKXA 2JKZA 1LSSA 5EJGA 5J5AA 1ZOOA 2C5SA 3K1AA 1RJ9B 3LPAA 4K8OA 3OP4A 3PR3A 4CF3A 5KYUA 2PX5A 3REQA 3NHBA 2CK3D 4OM7A 3X1KA 4BLSA 3KR9A 4U7TB 1TIPA 3CEPB 1XZQA 3TLGA 3D6NB 3LC0A 3QOWA 4AMUA 2X40A 4S2EA 1T9CA 2CDRA 3VI3B 7GPBA 1OZFA 1RLJA 1PDOA 2E87A 2R66A 3NO4A 1PT6A 3QKSB 4U2EA 3VJMA 3C3BA 5JZVA 1DBPA 2N75A 4YYEA 2CLHB 2R6FA 4IDBA 3RBVA 2A1IA 3RSCA 4E31A 5G40A 2KLHA 3IDFA 2B92A 3KQTA 4FZVA 2ZBVA 4OYYA 4TWRA 3S5UA 5HWSA 4KL8S 2TMYA 2C9MA 1Z74A 4IXWA 4K05A 5HFAA 1QQBA 4JQCA 5AFSA 5BWMA 2PO5A 1BIFA 4UHDA 1G8AA 3PF9A 4O2BB 4E6PA 1SB8A 3DAYA 3QKWA 4RM3A 3AF1A 2C2HA 3CISA 1RYHA 4OBBA 1BCRA 2SKCA 3WK5A 2BFEB 4YI5A 1DV2A 1OLXB 3NP7A 4Q18A 4AKSA 4CMBA 4CEIB 3GEMA 4JUCA 2AN1A 2C04A 2OMKA 3P0HA 1ZH0A 3IJEB 4KVGA 4KQ9A 4PM4A 3WYBA 1ZL0A 4FHDA 4F7WA 4ENPA 3BE8A 1QCCA 4AP6A 4B31A 3WDSA 4EMSA 2B99A 2ECKA 1ZD5A 5CB4A 1K3FA 4TL8A 4YT8A 2WJJA 4ZTZB 2BGUA 2I0FA 2BM9A 3W90A 4DBLC 4J0GA 3ECCA 1QRAA 3BX1A 3BMQB 2GUWA 4YO8A 4C0AC 4QEDA 1OXUA 3ZU3A 4C14A 3L43A 1WUKS 2WTMA 3K9LA 5IAOA 3N8KA 4PAWA 5AO9A 3AUUA 4D56A 1II8A 1E2KA 2CCJA 2O5RA 2YZMA 3E35A 3S6JA 1GTRA 3D3WB 4QUJA 4YRKA 4QOSA 2YMPA 2FK7A 2BWJA 3AEKB 2DU8A 3GG2A 4K9LA 1C41A 2A4KA 1FLDA 2VH2A 3BG5A 3DM9B 4H3SA 1ZA2A 4RZ3A 5A4AA 3GUCA 3IVCA 3OQ6A 2O3UA 4JMPA 3DULA 2A88A 5HXAA 1YIOA 3M89A 3PITA 2BFCB 4B3SB 1VI2A 2IY8A 3O1JC 3T1OA 4JXZA 1KH3A 2ZIWB 3AKCA 2ADMA 5IKMA 5EHGA 3IUMA 4BNGA 5F73A 1BX1A 3VV3A 1LJUA 3ZHXA 1MNQA 4NY1A 2FNAA 4Z5XA 1PR4A 2GYYA 2WZCA 3ASVA 3KOZA 2J3DA 2AC2A 3TPCA 2WU3A 5KO2A 3VC7A 3P2OA 1WPXA 4FYWA 4JYAB 2O8CA 5LOVA 4LXQA 5BQXA 2DFVA 2UZ0A 2YXNA 3ZWQA 3A1TA 2ODNA 3TQFA 4AX8A 4ZMSA 3CW9A 3DL2A 3ZGOA 5IJAA 5BRAA 3IRVA 4H4DA 3LL4A 1Z0DA 4NLLA 1DX9A 1O5OA 1R0ZA 5DHAA 3ZXYA 5M29A 3FZYA 3GPLA 3DD1A 4YUZA 1ENPA 3D43A 3PWZA 3TCKA 1IY2A 1ICEA 2LVBA 4QBTA 5L3QA 1YF3A 2IBTA 2H1VA 1DG3A 3EOAI 3TQCA 3K2BA 3VR6D 2OVBA 1W7AA 1C3JA 3CCFA 4BEBA 3CV3A 1E3MA 3E0XA 3IDAA 3SXJA 5DI9A 2DY0A 1V7ZA 1F4PA 3H04A 4IH4A 3SS7X 2CBZA 3JQGA 1L1RA 3LHSA 3NCHA 4ABTA 4Z53A 3NBUA 3D1VA 3PUWA 2Y1EA 2YJ4A 2JCYA 1G8PA 2ZTMA 5DK4A 2QTFA 3W6OA 2WWIA 2BGKA 3CX6A 4JT2A 3ABSB 4TTAA 4AVYA 1ZOSA 4C1BA 3I83A 4PYNA 1M2FA 2EV9A 4WY8A 4KN6A 2K7FA 3H8VA 4QUBA 4QQFA 3RU2A 4EUKA 4BLRA 2W8BB 3B8HA 3LIPA 3SBOA 4F6RB 1XU4A 4XEHA 3VBCA 4EB6A 1K5DA 3HJHA 3G2KA 3NKLA 1GJRA 4CLOA 3T1NA 4UOEA 3NR2A 1KO5A 2PTGA 3ZNQA 4EZEA 3IO3A 2WJIA 1EFVA 1UKCA 2F43B 4KOEC 3ZEIA 1NUSA 2P3LA 5BYAA 1C8BA 1OYOA 4YJ3F 3FMFA 4MKHA 2IIBA 2O07A 3IPXA 3M81A 3H1TA 1HRKA 3G0IA 3QVOA 2V54A 1MQ8B 1WW3A 3HNOA 4DA6A 3EF3A 5KYYA 2JGJA 2Z3ZA 1WXIA 3KOUA 1LTQA 3T12A 4D8WA 2PRSA 5SICE 5L6MB 3KCQA 1WU7A 2COKA 5C34B 4H31A 1Z6TA 5B64A 1CJVC 3BWMA 4RHFA 5HKOA 2AH5A 2JHFA 2B4AA 1U9CA 2AKAB 3U7HB 1FFGA 1FNDA 1V1MB 1VL8A 2VJLA 1L4MA 3FI0A 3MMPA 2O2IA 2FPPB 2X9NA 3N05A 1KDVA 1PJRA 1Y3CE 3GJSA 3K0EA 1EBBA 2FN7A 3NONA 1FJHA 1X19A 1T2DA 2JGKA 1YVRA 4KRYA 5DNAA 1NURA 3KQVA 1A97A 1T2EA 2QAGB 1KEUA 1GFZA 2QJWA 2M98A 3S29A 1JR3A 2C1EA 2ZRJA 3ZDRA 4BUCA 4OK5A 1RJEA 5JCZA 1JS1X 1Z29A 2OO5C 2VP3A 2XECA 2XQFA 4E13A 1TA0A 4PZLA 4LZZA 1RKBA 3HCEA 4S1VA 2FOXA 4TLLB 2FWPA 4N3GA 3E5MA 2R1VA 1AHPA 2XUQA 5K6TA 3HCBA 1T0BA 3DKKA 3T5TA 3C4VA 4BN0A 3M83A 1L5FA 4RDHA 2JD2A 2ZPTX 1YR2A 3TSCA 2QSZA 3TIIA 4ZO4A 4MIYA 3FUTA 1QE3A 5DVZA 4U00A 3GFGA 1TZCA 2EFYA 4XCVA 4Q9IA 2IOYA 2XUZA 2A5FA 4XVHA 3OQPA 1KVTA 2XZDA 2YV2A 3BKWA 3ON5A 3OPVA 1EQUA 1XZMA 4TVOA 4IHQA 5DM60 4M46A 1P9NA 2SNIE 4BMNA 4E5PA 2R1TB 1J5PA 4ODIA 2CGEA 2R8BA 4K9PA 2ADOA 3OG9A 5CT5A 4IOLA 4JT9A 1CD5A 3LJKA 1EWQA 4YJKA 2FW9A 1TJ3A 1WL8A 2A1UA 1V16B 2BFBB 2DUUA 3EBLA 2XUKA 1YE5A 4LX8A 2FP3A 3D5TA 4H6WA 1HE2A 1DAGA 5BQ5A 2J0UB 2VJPA 4PQGA 3VKWA 3VSEA 1ZX1A 4FT4A 3QELA 2R2GA 2WPNA 5HBRA 5M34A 4XM2A 4ICIA 1TJ5A 2EJCA 3DGFC 3WWZA 4Q9JA 4I4TA 5CA1B 1R0YA 3GXOA 1N9GB 5EMNA 3WLKX 2BEVA 2NPIA 4FHCA 2ZWOA 2D7DA 1O5TA 2V7WA 3GUHA 1PO7A 3BJIC 1SA0B 4HGQA 3TTTA 4QZVA 5F1KA 4WT7A 1GGMA 1TAGA 2OAGA 2YVAA 4LRQA 4OLHA 3Q87B 5KKNB 2CSXA 2CHEA 4UM7A 4E14A 5KAMA 3JATB 1DS6A 2W2NA 2KSQA 1BN6A 5FLYA 1VMIA 4WK4B 2HD4A 1RM0A 3KT3A 1NBEA 5AMXA 3L0IB 1K9VF 1TMGE 3BM5A 5JANA 2GBGA 1MV5A 3FNBA 4JK3A 1QWSA 2OFFA 1LDYA 3A6GA 3CURA 2Q7OE 1ONBA 1Q83A 2CXSA 3D2CA 5BQFA 4DB2A 2B78A 2P77A 2WJAA 4L0MA 2K4MA 2O2JA 4QU5A 3ZNNA 2BEJA 3HJCA 3P2EA 4ZWNA 3OFJA 4KN8A 1XCBA 3MRVA 4YREA 3UXEA 3G02A 3LQ1A 3IQFA 4OQXA 1TUBB 2LBPA 1SKQA 4PZUA 5TMEA 3ETNA 1X7WB 5E2BA 1V8ZA 4CF5A 4EL0A 1PFUA 1QMPA 3CJRA 4LOAA 3GNQA 5EE9A 2WU8A 4HH3C 2Q5HA 3A32A 1Z75A 4J75A 3KJIA 3CEMA 4HDOB 3U13A 2BGTA 4RWEA 1RMTA 5FTJA 4K5QA 1NBMD 1NV9A 1NZFA 3WS7A 2ISQA 5LZ4A 1WSDA 2CMDA 2ATIA 4MJLA 2JIQA 4NECA 1HK7A 2F6RA 4Q19A 5ERXA 4DYDA 3QLTA 2VWQA 5B2FA 3E4CA 1RZRA 2E4WA 4HS9A 4K2HA 2A0UA 2EC5A 2OESA 2W2MA 4E4RA 1O96B 2GK7A 2QNRA 3BH0A 3PA8A 2XSZD 3QPVA 3VU0A 4KXVA 2QAIA 4QEZA 3L6RA 3MN1A 4UDYX 4B1FA 3ER9A 3WAJA 3DONA 3T7RA 1FP6A 1OMOA 1OD6A 3OM8A 4IWXA 1UBLS 1SULA 2ZYUX 4ZCQA 5EXEA 1A8IA 1VI5A 1J0DA 4LJKA 4BNVA 1A2KC 1JZSA 2BI4A 1AKMA 1RBQA 1ZSNA 3OETA 4L4RA 3USZA 9ABPA 2W58A 4B76A 1ZK4A 2Z9CA 2QJOA 3BUSA 4R8SA 2FI1A 1QS0B 3U9SA 2ANCA 1BS9A 3M1AA 4OV6B 3SFZA 3U56A 1EJBA 3CCCA 3P0EA 4QXRA 1HR0B 1ECLA 1OIXA 2IITA 4HADA 5K3SA 1CS0B 3L7BA 3BREA 4Z4CA 2C3MA 4NMXB 3E48A 1B0AA 3JZDA 3R7NA 2C42A 4RESA 1E3WB 1N0UA 1Q7EA 1A8QA 2OWEA 5LB2A 4PSUA 4QUAA 4D4GA 4X8HA 4EG0A 1PS0A 1PSDA 3K2QA 4JKOA 4O2RA 1GL9B 3K09A 4MGEA 5IKEA 4GKJB 1UXIA 3CM0A 3DDWA 3FDZB 3ZWMA 1S2LA 2HQBA 2JIZD 1Y8QA 2YQZA 3KSMA 4LAFA 4M22A 3SX0A 3MFYA 3IBCA 4QYIB 4KAJA 2QVCA 2ZJFA 3FSRA 4FYMA 4PWYA 4ARSA 1G42A 1NAHA 2OAEA 1HSZA 3H4TA 2ECFA 4H1HA 1GR1A 1NN1A 4JLPA 3PU6A 3QXGA 3GLHA 4J7XA 5GMOA 5C8ZA 4RENA 5K0BA 2WAAA 3SIXA 1KERA 1LQ2A 1N1DA 2C7BA 4Q4LA 3AVUA 1MQAA 4KRGA 4RJJA 2FP4B 2P6UA 1I6KA 2P0AA 4LSGA 3TIGA 5F51A 3K9NA 1QPZA 2W6JA 2YASA 3RRFA 4ER0A 1ANKA 4ARAA 1GSOA 4CM9A 4ECEA 1N4AA 3OJCA 2IGBA 1U3TA 1Z6AA 5ELMA 4IBOA 3CN7A 3V4LA 4M1EA 2B37A 2I3AA 1LPMA 4GI3A 4MIKA 1CHNA 4FW8A 3V1UA 2HPZA 4B47A 5IJ0B 4RMJA 2HT1A 1LPNA 3E9CA 3VO2A 4E21A 3FCOA 3M3PA 3I32A 4Q9LA 3R23A 1U7PA 5FL7A 4DVGA 1LV7A 4A6PA 2O9JA 1S02A 3DZKA 2AXPA 2GBPA 3QUBA 4MPDA 1SZDA 2JIPA 5K1ZA 5JSHA 1ODKA 2MSDB 3PD1A 4AYTA 4LF8B 4MI6A 5PNTA 1JXOA 1BHSA 1WHSB 2P4HX 5E6UA 3IE0A 3OC6A 5EQDA 1JI0A 5U4XA 2C9DA 2ZSBA 5EIWA 4GP6A 5FBKA 2EF1A 3JWHA 1NXSA 1XCOA 4P4TA 3VVMA 2L2QA 4V0KA 1K9SA 2GCOA 2DKNA 5GM1A 4R31A 4U2DA 1Y81A 2HQ1A 3IAM6 3HB9A 3OT1B 1HDEA 3WWYA 4EHJA 1W47A 4ZIRA 3ENZA 4RPJA 3NHPA 2CD7A 2R60A 2ZR8A 4B4VA 1LLQA 2O6HA 4RVOA 3HZRA 1NQOA 4WN9B 1G41A 1J1ZA 1LV8A 1QH1B 2G1UA 4I8DA 4CCAA 3W8NA 2BN4A 1G18A 2AJTA 2ODEA 3GPCA 3RVNA 5HS6A 3I04M 3R6DA 5HF6A 5ALIA 3C8MA 1HKHA 1SOAA 1UMBB 3LHIA 4RAQA 5DHUA 4CKBB 1ZVVA 5L51A 3P0FA 4DCPA 3O8NA 3F3MA 5DGXA 5E2IA 1ZN9A 1UKVY 3IE1A 1FFBA 3PFWO 2CEAA 2ZRDA 1VJRA 1BMDA 3INTA 4JEHA 1VE1A 3RH0A 1SM4A 3T5BA 1CG6A 5FPHA 4ZDKA 4B84A 2W2LA 4F45A 1ZP6A 2NGRA 5DWDA 2IDJA 4Y2GA 4EYEA 1BMFD 5LQJA 3R9WA 5TS3A 2IYLD 1V1RA 2QMOA 1E9AA 4KGZA 3VR0A 4KN5A 2V58A 5AVZA 4MDEA 4L85A 5B1YA 2ZWIA 1N6PA 4R01A 1E5DA 1N75A 1QGDA 5CP8A 5IPFA 3SAJA 4CETA 3BE6A 3VR5H 1LI7A 3DEYX 4A0FA 4X7RA 3TTWA 1P7VA 1F3LA 2H17A 3AFHA 3DBVO 4P33A 3OZBA 3HRIA 3G85A 4YUXA 1JJAA 3AR4A 3LXXA 1W87A 5FUBA 5HQ3B 4EZBA 1WBBA 1PS8A 2IEDA 2Q5QA 1R4NB 3HSKA 1D07A 3PHIA 3ZKWB 5ECGC 2JRLA 5M5BA 3TSYA 2FZKA 3KHTA 4BGVA 1ONNA 1NN3A 1E89A 1PHPA 1WD5A 1KYQA 4UXHA 4LJSA 3AEXA 3C16C 4YCNA 1A27A 1E6MA 2XADA 3ET5A 3LCVB 1UOQA 2WJWA 3AINA 1AQJA 4ZYTA 1G16A 1PZHA 2R2AA 1ONOA 4YJ2F 2CJYA 1OAAA 2A9VA 2VRCD 3QIVA 4MVJA 1IY1A 1QTNA 3AVPA 1RXIA 4KG7A 1JG7A 3RIMA 3DYBA 4W5QA 1GNTA 1ZUNA 3QOFA 2G9UA 4P98A 2BLLA 2W98A 1NQXA 3TJMA 3U26A 2W0MA 3NH9A 1EDDA 1XXHA 1LSOA 1GUBA 1TO6A 4R83A 4WOBA 4MUIA 5JWOA 3FCEA 2OHXA 3BK7A 2EDCA 1EGVB 2J0EA 3OM1A 2Q7DA 3TLJA 4GM0A 4YP9A 1L5ZA 4LE0A 1PZMA 3RAFC 5JHGB 1M8PA 1Z83A 2BFFB 2QQFA 4GD3Q 4KO1S 3LCJA 5J23A 2ZB2A 4Q39A 4MWDA 3AR7A 3MVEA 4MMYB 4P92A 3OE1A 2R6HA 4RC9A 4EW3A 5LYJF 4MPPA 4LHWA 3L8GA 1QGOA 1GYPA 1N2ZA 1ZK0A 1E32A 4A2WA 4DLZA 5KHOC 2OXRA 2I1LA 5EIBC 2E85A 2FPUA 3HB4X 4QNMA 3ZK7A 2OO3A 4RABA 4GMGA 1LX7A 1Z6GA 2CHFA 4MKFA 3UHPA 2OL4A 2J8ZA 3Q7PA 1H4VB 5HOEA 2ONZA 3RAJA 1SCIA 4ZOEA 5EP1A 4LJLA 4XDHA 5JXHA 3QNMA 1Y6JA 5EC8A 1MB0A 2PUBA 1CJUC 2F3QA 4OYLA 2VUUA 4IIFA 2GBLA 3H1AA 4GBJA 4K6HA 4LKRA 3WB9A 3WV5A 4DM7A 1JI3A 1QZ3A 1R18A 2IUEA 2VPIA 2BD0A 2SKEA 4QDJA 4K9KA 1R8SA 1YL5A 1F06A 2P1RA 3AETA 3REOA 3WNDA 3HKDA 1RRKA 4BZWA 1IM2A 2P0YA 4HDKA 1A5ZA 2G88A 3DWEX 4C7JA 4GS5A 4WK2B 1PBNA 1P2DA 4D99A 2YIVX 2RD2A 2QG4A 3AFOA 4P3XA 4P4NA 4RE6A 5KVVA 3F4BA 4A26A 4ARVA 3HN7A 3R3SA 4J07A 5DF1A 1DEOA 4IGKA 3W2IA 3CH5A 4B45A 2QVLA 4F4HA 1J0CA 1DAKA 1EDEA 3SX2A 1VLQA 1E1CB 1ECGA 2FSFA 4P1ZA 4QOFA 4TT8A 1SOWA 4FI3C 3SJBA 4GPEA 3UM9A 1PUJA 3HWX1 2Q3FA 3NDPA 3QBTA 4PLFA 5CCEA 1KEPA 3KTOA 3CX3A 2AVDA 2G28A 3EWSA 5H4GA 2FPIB 1VSTA 4XH9B 1F1BA 3GP3A 4GICA 3FYDA 5DULA 5EGNA 4C87A 2Q0QA 4LIPD 4CFSA 1I4LD 4XLTA 5AUPB 5EINA 1MT3A 1POWA 5JLAA 5KNCH 3M34A 2IIQA 1JE0A 3A1NA 3LE8A 1LX6A 3RFTA 1E2DA 3R1IA 5A3JA 3RIXA 3OWHA 1ECPA 1N2CA 1XUOA 4QELA 2PZAA 3T7JA 2H7XA 5D5PA 4UPEA 1LZKA 4JLKA 2UYHA 5JWHA 4JJIA 1XRMA 3ZNOA 3IBYA 5F35A 3ZLVA 5C1DA 2F62A 4AB1A 3K4HA 2VO1A 3QBDA 1DBRA 1FTNA 5JU6A 4JCCA 5DM70 4YTEA 3AM3A 1LRKA 3W79A 1O95D 5JS6A 2YMQA 3H4MA 1JIXA 2FMXA 1ODJA 1DI0A 1W0KD 3Q0EA 5F98A 4AO6A 1Z7WA 3BRWD 3RAGA 1JSZA 4LJ7A 4MTLA 3RSFA 4OHMA 4DMUB 1CUWA 1QM5A 4TS9A 4ZHQB 5IFLA 3TTVA 3GT7A 5CHEA 3QU7A 3EEBA 3CF2A 1WDWB 3KPWA 4AI6A 2R00A 3RUIA 4QHYA 1I8TA 1EP2B 3WYEA 4P4LA 4KBYA 4M1ZA 4L95C 5B3AA 2PKYX 2VVTA 4HD8A 5FBLB 2J9FB 1F0KA 3TI9A 1BGWA 3BB4A 1X86B 3GEGA 4LX0A 1VPLA 1Z6PA 4ZRMA 3Q3VA 1NJ5A 1P74A 3S40A 4F9TA 2CBGA 3ANXA 3I5YA 4IUBS 4OI4A 2YNMA 2DSTA 4RA6B 5D84A 5KJEA 3IP1A 4AZ0A 2WA1A 4DG5A 4RSMA 2BM1A 5BY2A 4M89A 3NU1A 1JH9A 2B2NA 3B78A 2VP9A 3H75A 2BVNA 1CUYA 2BFDB 1G9TA 3Q5EA 2OFXA 5TEVA 2E3JA 3STUA 3MB5A 3GLGA 1UBMS 3HB0A 2QX9A 3EGDA 3PFFA 2D06A 2NXNA 4B6OA 1DAFA 4QUGA 2C2ZA 3EWAA 5IZ4A 5KTMA 3IT2A 2BKLA 3L46A 5FP0A 3MCZA 1DQYA 2NXWA 4DDUA 2XB2A 2ET6A 2JI8A 4QXPA 2PIDA 2XCRB 3SCZA 2A9FA 2MMCA 3I5UA 2B30A 4QJ4A 4NU8X 3ZTYA 3H0KA 3NPMA 3V33A 2V7UA 1JJIA 1G4AE 1LDMA 1BHJA 3HQ4O 4EFLA 1NUQA 2I67A 2RGDA 1YOVB 3NFYA 2JDIA 1F51E 3PNBA 5LZ7A 1R0RE 5IZCA 1NMSA 1M76A 4GRAA 4Q3EA 4XSHA 2V1UA 4P36A 2J3HA 3K20A 3GP8A 4XPIB 1A5AB 1Z0UA 2Q4OA 4PLHA 2JLYA 1LA2A 3UMCA 2QENA 1AHIA 1PL7A 3WX0A 2FUCA 3R3JA 4HPXB 4RZIA 3DVQX 2WWXA 3AIKA 1E7YA 1VKJA 3QBVA 2PH1A 3TZLA 2YWHA 1SXJD 3N8GA 4BWGA 2OBLA 3MOSA 1XRQA 3M4JA 2DB3A 5AK0A 5IJ9A 4UVGA 5F9FA 2A59A 4YJGA 1OF1A 4C4RA 4FXOA 4P3OA 3KAPA 4QUEA 1TAQA 4H0CA 3V2UA 2FG6C 2YJTD 1AQ6A 3PXBA 3LSYA 3ZXUB 1WW2A 3AM4A 3CZ9A 3K09C 3CPJB 4Q7KA 2CXRA 1YACA 3AY3A 4LGYA 2K5UA 2O4CA 2QRZA 1Y82A 4YMIA 5LD2C 2IHTA 3AG5A 5GIPE 4YS6A 4F84A 1FYVA 1DUIA 1AK1A 3M82A 1KO7A 3X1ZA 3TNFA 1X2EA 4AW9A 2G5CA 4P4GA 5E4TA 2V7BA 4NOMA 2R86A 2XLCA 4OB7A 4UREA 1QQ7A 3ZE6A 4QXAA 4BNIA 4ZYYA 3AY7A 4MJ7A 1H65A 5AM2A 5JATA 5BR1A 3CLRD 4UZFA 1ZBQA 1V11A 1IN4A 1MABA 1K66A 3GCGA 2ZUTA 4UTNA 1YFLA 5KNDD 3KT8A 1XAGA 1Y5MA 1PGPA 1EFPB 3NWJA 3CE9A 4MB0A 3TLYA 1R4ZA 3LOPA 1K06A 5G1PA 2GM9A 4DB4A 4OSEA 1OY1A 1F17A 5JNLA 4I4IA 3I73A 1KE1A 3F5SA 5EERA 5JTTA 3PPXA 2M6LA 1SCUA 2RB5A 4QQRA 1BS1A 4AQDA 4YROA 2VHQA 1QH0A 5KJFA 1S8OA 4RK0A 1OXXK 2QY9A 4MWOA 5A04A 1VGQA 3PG5A 2XRYA 4YAUA 2WLTA 3NVKI 2HMTA 2ZYSA 3I76A 1EBUA 4WJZA 1VIMA 3DT8A 3GZNB 2YYAA 2XCOA 1LK7A 3DPUA 3KQQA 2GO7A 3O7MA 3SWWA 1KC1A 2BW0A 2FPRA 3S7TA 4B09A 3OY2A 2PX3A 3WDMA 5HOQA 3ZI0A 1FU4A 5DNCA 1K4YA 3ZVRA 1RQNA 1EAYA 3RB8A 3AWIA 4ARZA 1XEXA 2FSIA 3NGXA 2KM1A 3V4RA 3CH6A 4KI7A 3RF7A 2XJ4A 1SK8A 3UFXA 1GOTA 1IOLA 1M34A 2R48A 3RYHA 2OHJA 3JRNA 4MAFA 5FT9A 4B8ZA 3PXCX 3IDQA 3QXSA 3MTAA 3B6EA 3O2QB 3BSSA 2BEUA 1EWKA 2R751 1ID8A 2AVNA 3GJXC 2JLSA 2V5UA 3F3SA 2W2XA 2AJCA 3DVRX 1G21B 3CO5A 2QTLA 3T52A 4XVCA 2IZ0A 3H1BA 4DIEA 1ILWA 1IPFA 1EDBA 1P8JA 3A31A 2H1IA 5I8WA 5IARA 3EH1A 3TQRA 1T6NA 4GVLA 4WXRA 2CHQA 1VLHA 4E09A 1I3CA 3W2HA 4O2AA 5FR2A 3IEMA 1D8TA 1RAHA 2NXEA 4MZXA 4RL6A 4DV4B 1V8BA 4OGWA 4BO7A 1T36B 1OZAA 3R44A 4M83A 4AS2A 5F2EA 1NC1A 1P72A 4DT1B 1OBCA 1U7XA 3FM9A 3G9XA 9LDTA 4R71A 3ZU6A 2D5AA 3M2PA 1MB9A 2C2KA 2IYAA 4CUJA 3RREA 1JQKA 1U8YA 2VK4A 5DTMA 5BQPA 3EVBA 1PR0A 1INLA 2OLKA 4K87A 4NHEA 4E7PA 5HDBB 4PC7A 1PN3A 3CR7A 2UYCA 3R7BA 2QUJA 2GK6A 3KXLA 5ICMA 4RD2A 4XQ9A 2C7PA 3SSOA 1L1FA 5F7XA 2QSJA 3A4LA 1DEKA 4HZIA 4KWCA 2GERA 3L6OO 1LNQA 4MYCA 4UBOA 4O4IB 3T3GA 3PUIA 2JLWA 1HYBA 2VHJA 1WM1A 5IVHA 3P1JA 1NM5A 2R62A 2X4GA 1QYCA 4QBGB 3OQVA 3W3AH 2O5EA 4PPNA 1J22A 2AQKA 1GAWA 2V4MA 4I2NA 2OV8A 3CKKA 2VZLA 3Q15C 3KEOA 4OHXA 1C7ZA 2O2EA 3TB4A 4ED9A 1AB5A 2CVFA 4NBSA 4Z0HO 3VTAA 2NV2B 4NE7A 4WNCA 3KUDA 5TPZA 4EA7A 5HUJA 2IL1A 3H2JA 3BD6A 2QT0A 1PQYA 3LY5A 1DIGA 1VECA 2BISA 4P5EA 1XZHA 4F3NA 4JUBA 5BSFA 5L6LB 3FVVA 3OOSA 4IGFA 3A4VA 4CN9A 3FG9A 1GTMA 3V8EA 3U3ZA 1GPJA 1JSXA 2Q2NA 3ACDA 1YQWA 1PZXA 4H3KB 2Z04A 4PO3X 1VCNA 3EGWA 3STHA 2V0GA 3COPA 4LYYA 4EJ0A 2UZ4A 1A76A 5SZHB 1IZ7A 4B85A 5AKXA 5FI1B 3S44A 3MINB 1SGWA 1OXBB 1IPHA 2JS7A 4FPXA 1MJGM 5DRYA 5FNVB 3PDJA 4IEIA 2JEOA 1YB2A 5TQJA 4CR8A 1BE6A 1D2EA 1ZDMA 4AJHA 3E3AA 5KMGB 2PZGA 4G09A 2BGNA 1QAOA 1SUIA 1FUUA 2A67A 1HE1C 2X0FA 1RRVA 4KI0A 3A9VA 1GKLA 5DZSA 5KC8A 3CC8A 3I1YA 1DRWA 3N2NA 1JBKA 4RK1A 5CAEA 1DZ3A 2HL6A 3W7VA 3EIEA 4RHUA 2HDNB 3P32A 5E4JA 1U11A 2ZT5A 3SLKA 1CP3A 4QWWA 3JR3A 3VPSA 4H7HA 1K63A 1RE1A 1NVEA 3FIJA 2JFFA 3IOYA 4G4GA 4TV8B 2EG5A 4BBZA 4M21A 4EMUA 4NV3A 4ZT4A 2HBZA 2APJA 1A8PA 1JMYA 4OATA 2W11A 5CNMA 4CR6A 5BUQA 4RTPA 3QEBZ 4F2HA 2H9AA 3G9TA 1M1NA 3NKFA 2HNAA 3FTEA 2EKLA 2PMEA 1UJ2A 3AUJB 5DMXA 2DG2A 4H35A 3GPDG 3N2GB 1X7XB 1Y8RA 4KITB 3GJ8A 4QFBA 4UBMA 2GD2A 4V1CB 5DM0A 1ZNWA 3LECA 4IDEA 2GBLC 2OKCA 3GDWA 5C5CA 2ZWVA 1A9QA 2P62A 5ALGA 2FN9A 5LMZA 3I1FA 3B6JA 3H2BA 1B15A 1NHWA 2VDKB 3CSUA 4OSPA 3UMGA 4ZK2A 5C8YF 2BHLA 1SXJB 4AT1A 1KTVA 3WK7A 1XEWY 3IDSA 1QTRA 1TQ6A 4KVZA 1G8KA 4MPRA 4N4AA 3T34A 4FMCF 3V8MA 3W8EA 5BPFA 3J80A 2I2FA 3AR6A 5REQB 4N82A 3OLYA 3P9CA 4J1TA 2W83A 1GL7A 2INGX 4WFKA 3ZWDA 4YNBA 5DM2A 2IHUA 3L07A 3AUXA 3R9XA 4CRWB 5AW5A 4QFMA 2LCQA 3HA5A 5EIAA 2D1RA 4ANFA 4E3WA 3CLTC 5JZ9A 4OH7A 3LNTA 2LDXA 4R05A 3I1JA 1J56A 4PU0A 4TWIA 1BWQA 4NBUA 1DP4A 1RD4A 4Z8YA 2GOYA 1I0IA 5IKOA 3SLRA 5A3RA 3ZVNA 4QDZA 4B3CA 1WX1A 4JA2A 1M5TA 2DR0A 5F5LA 1WSAA 2VS1A 3BFPA 3FYCA 4JYCA 4WTOA 4OF4A 3MWDA 1EA5A 3GDOA 3KLPX 1ZK1A 5FUMA 1OKKA 3MAGA 4ALJA 3WLNA 4BGUA 5C5IA 8ATCA 1USWA 3SM3A 4JVLA 2X23A 4Q3DA 5FQNA 1CULC 1OCEA 1XDGA 1MVNA 3CRRA 4QHTA 4AMZA 4CM4A 5IYZB 5A05A 2VZEA 4UU1A 4BY9E 1CZHA 2MSLA 1IHPA 4ES6A 4REQB 2HLHA 3NMUF 5TMDA 2FE4A 1EVEA 1EM8B 1PYGA 4QPDA 4YRCA 2H2HA 3GNSA 3PFIA 2A5GA 621PA 4O4HA 1AQNA 5FJJA 3L0DA 4BNYA 3RS4A 4J1SA 4QXQA 3QEMB 1XQXA 3OEED 1WZCA 1OAKA 5IDVA 3GJTA 2FMKA 2HLDA 1XTUA 3DFUA 3P4XA 4G5XA 1P45A 4DEVA 3ONNA 1L5KA 3DHYA 4QSMA 1M1YE 1Z15A 3WTCA 2MSCB 2R00C 1OHHA 2CMGA 1XK7A 2W5UA 4MHSA 4HWGA 4L3OA 3KKKA 2PSFA 5DHQA 4JLNA 1EESA 3GIWA 2KJQA 3OTHA 2XKJE 4AJPA 4DC9A 3SN6A 1I6MA 1TC1A 4MVWA 3O9ZA 2J7PA 3ZIUA 3LD9A 3OZAA 3H19A 1BOOA 1UZUA 3EZYA 4MS1B 5T3UA 3KZ1E 2B8NA 3GVIA 3E2IA 3N07A 4D26A 1KI6B 1THGA 3B1VA 3OICA 4R7TA 2YNMC 2DCUA 1G20A 4MJXA 2NT3A 3H2IA 1GRCA 4JLWA 2Q5LA 2XUFA 3PUYA 1NJFA 4B40A 5EA2A 3TECE 5JBIA 1JWBB 3HB1A 2VQ6A 2ZROA 4KDEA 3PLNA 4MKZA 4L7QA 4BFTA 5B6PA 2TECE 2I6SA 4AQ7A 1RABA 2CCGA 4UFPA 5JNUA 3U2QA 5TVKA 3T3IA 4MI9A 1JB9A 4EKGA 1ZK3A 2HDHA 4D4KA 4PGAA 4EJMA 2HLNA 4I9NA 3WQHA 4PSCA 1T2VA 4JVSB 4UARA 1COWD 3KXPA 3PEEA 1QX3A 1TADA 1V2GA 2D7CA 1SVOA 2ZSIA 3PNQA 4HCJA 4CDNA 4I1SA 1J25A 3CX8A 5K0NA 1XR3A 2FPLA 2B1RA 4WDQA 3S2IA 4FM9A 2AFHA 4TQGA 1L4HA 5B7NA 1QP7A 1BJKA 1Y3FE 1YHZA 3CLKA 3GOHA 2PSJA 3D6AA 4OL9A 4EI9A 2Q27A 1XDWA 1Z7BA 2JGAA 3IPAA 4RELA 5IZCC 2WQ7A 3MHTA 3DV9A 2D2EA 2PNFA 1SU4A 1FY2A 4L0DA 1SZJG 4G01B 4MINA 4N5IX 3ZV3A 4O4LB 4NXMB 3EDMA 4P0TA 5DP2A 4CV2A 1I7PA 1OXVA 4JOQA 3E1GA 1YC5A 3W5SA 4FEAA 1WULS 3KALA 4NP6A 5DP1A 3ZD6A 4G65A 2UU9B 1H8HD 1U7UA 3T5MA 4PZPA 4RMGA 4HXYA 4ZZ1A 4UM9D 5SYAA 4BGIA 2P9EA 3UW1A 3GC6A 2WKSA 4HQOA 1Q7CA 4N8SA 2H0QA 3I3SR 3QE0A 3N6XA 1Z5UA 1CS4C 1DINA 3EJWA 3M6IA 1Q19A 1C7JA 1HM5A 4HRXA 4DGSA 1R8YA 1VFPA 2I7TA 2NN3C 3O8RA 4V0LA 3ECSA 1FLNA 2Z2JA 3ZWNA 2Q0XA 3PPIA 2HA4A 4CJXA 4QT4A 3QJGA 1DKQA 1MD9A 4AJNA 3EASA 3V9PA 4EGCB 3I8XA 3VTKA 4V0RA 3DT6A 3LVRE 4B6RA 3G9ZA 4NOKA 2O2YA 3JWPA 4EJFA 3PJRA 5CR9A 3VPXA 2EBFX 3DV0A 3PFKA 3WIDA 3ZJ5A 3ROXA 4PGMA 1KQOA 3CR3C 4R2IA 1WMBA 3SYRA 4Y9DA 2DUNA 5JIBA 3G2PA 2WP8J 2NQ8A 4R84A 1HEUA 5HIAA 1AXGA 3ZHYA 1IM5A 3Q8WA 3B7PA 3ND8A 2VPWA 2GMWA 4MW0A 2FN3A 3DCNA 2PH3A 3JTMA 3CZAA 2C2GA 4H16A 3H11A 2AZDA 1NBWB 2J3MA 4RNDB 3QFFA 3ZHQA 4YJ2A 2G76A 4KYIB 3AKZA 2CLOB 4RW0A 4ZARA 4AXXA 4MUJA 3QFHA 2JFUA 5D3KA 4NQRA 4B33A 6LDHA 1CYDA 3ISVA 5AKGA 2VDWB 4IF6A 3VNVA 3OLWA 4NJEA 3A04A 2CLDX 3PJEA 5AVWA 1GLNA 3QW2A 4GWKA 1E2IA 4V3BA 1YZFA 3PD0A 4Q1VA 1CY1A 1HG0A 1Y1SA 3WK9A 1MCZA 2YS7A 4JR2A 4DHWA 2RARA 4TYNA 2IT1A 4ZC8A 1NJ8A 3F2VA 1A8SA 1RJGA 4FONA 4TX1A 2MYNA 1X92A 2CUZA 4XFDA 1RXSA 2WJYA 5DN9A 4FHGA 3SFVA 4BVEA 1PWHA 4OPMA 3JWIA 1E7WA 4XCXA 4RTLA 2E5LB 2P91A 5ERGB 1J1IA 3INGA 4LOHA 3SM9A 2BY4A 2GEJA 1T9ZA 2QD1A 3DLAA 3O8BA 4HX9A 1CJBA 5C1PA 1YB5A 1YTLA 2AHRA 4BGDA 2BBSA 2X0DA 4IYJA 5K8VA 3N9IA 4HRYA 4EECA 3JAKB 2GCEA 4L8GA 2J45A 5LYJA 3DFIA 3UAYA 1VRVA 1UBJS 5DFAA 3PKJA 3OZVA 4Y2VA 1P4GA 1U8FO 5FBQB 2E21A 1XKQA 2A5JA 4MUKA 2YN4A 2FVXA 4L74A 1RAEA 3DOEA 3E9QA 1LY1A 2H1HA 1EP1B 4NYJR 4OJYA 3UV3A 3BMCA 5DJ5A 3TS1A 4XX0A 3TX2A 2XQVA 1E8MA 4EPVA 4P31A 2DQYA 1SCKA 4WZBE 3EXFA 1JDBC 1TYAE 3U3OA 3GRPA 5GP1A 1M83A 4M1QA 4RCVA 4YRPA 1FK8A 3RFCA 3VGPA 2Z83A 4NATA 5INTA 3U9LA 4EQZA 1MAHA 1QP0A 4K0KB 3GEDA 2ZAMA 2TS1A 4BQEA 4KXLA 3OEHD 1TLTA 1WRBA 3ER6A 5EJAA 4D02A 1HNXB 3C14C 2AZXA 3WRYA 1DDOA 3HU5A 2H6EA 2P2DA 5IP5A 1Y98A 4ZU1X 4DANA 2WUDA 2BMFA 4J8PA 3SHVA 2P75A 1RXYA 4C07A 1IHOA 3PQ3A 2YQ5A 4BKOA 4EEZA 3I01M 3MCVA 5AOCA 3URKA 1JB1A 3PLAE 4BFLA 3GFBA 3ZD7A 4YUAA 3N5KA 1ZUWA 1XQ9A 1NM5C 4KXYA 4URYR 1N6HA 4EY8A 1W9MA 1V7PC 2AFRA 4PGGA 3WJ1A 1YIAA 1PJQA 2OHVA 5CFPA 1E1NA 1Y0BA 3MWFA 3FBGA 2EFGA 1JXQA 1T24A 2A57A 2NUBA 4TTIA 1E3QA 4XOIA 4Y1FA 2Q6IA 3U7IA 1GXSA 3G7SA 1R6DA 2C5HA 2G77B 2MCFA 2AV6A 2J5QA 4Y1RB 1UH5A 3WGKA 1U0RA 3QSYA 2ZU6A 1YR1A 2YXPX 3JALA 3PC6A 2GAJA 3TW8B 5CDHA 4E2YA 4EKDA 2AD5A 1X39A 1K7FB 1GPWB 2JL1A 4JI5B 1C50A 4RTKA 4CV1A 1RAFA 4DQUA 2YC4C 5LYYA 4I99A 5GONA 5IANA 4KSYA 3AU9A 2KBFA 1N6OA 4Z7OB 1MAAA 4TKMA 4RQAA 5L8VA 3PGKA 4ILKA 1GZVA 5IUKC 4D9MA 4EBFA 4EG6A 1UKBA 5IFKA 5JI2E 3SEFA 5BVGA 1A98A 1TEZA 3LUAA 1EE9A 1KJ9A 4FR0A 4PLTA 1G8YA 4KUHA 1USKA 1FU7A 3B3FA 3HM2A 3ZPXA 2JLZA 1RS0A 3ORFA 2P4QA 2PRJA 1JKXA 3K9GA 4BLQA 3UMYA 1JJFA 1F8XA 2JIOA 2I9PA 3WGQA 4ZVKA 4C7OA 3RKRA 1NV8A 2HK7A 1DWOA 1P1IA 1ATZA 1XP8A 2DXIA 1M1UA 1HQKA 1GQQA 1KYXA 3P9KA 3BORA 5DBFA 4H3HB 2HAEA 3V46A 4CODB 4Q9KA 1UJBA 1PEAA 2HWKA 2PGXA 1XMJA 2JK1A 3DC2A 1I7NA 1EUDB 3JW8A 4KYUA 1S5PA 3ZWVA 1UUFA 3K71B 4NFLA 3AP2A 1OFGA 2HRBA 4PGFA 3T1VA 3KQOA 3UY4A 2Z0MA 5CLQA 2C00A 3FTNA 3H7IA 4QGSA 5H68A 3FWKA 3A2LA 5CBPA 3DDOA 5LU8A 1JIUA 1RWQA 1MOZA 2HA7A 4AZ3B 4CCSA 1JU4A 2EFDB 3R0VA 4HQ0A 1JWAB 2Y0EA 3G82C 4KO3S 5KDDA 5KVSA 1AZTA 3C3PA 5BV1A 2ZBUA 3KB1A 5JCXA 4CQJA 4UM9B 1PNRA 5HHTA 2GDZA 1KFKB 4PQYA 1A9ZA 1T9KA 2XE8A 5KYXB 1D2HA 1Q95A 4J1TC 3GF4A 1NBOA 3FFBA 1IWPB 2LGJA 3L8DA 5G0VA 1YKGA 3BCRA 1JHVA 4I14A 4ND8B 4YA6A 2PEYA 4J91A 3HU3A 5KTOA 1BCSB 5HIJA 2UYQA 4NENA 4WBNA 5JAOA 3EGXA 3JYOA 3R3ZA 4DNPA 1BE8A 3NHUA 3RSQA 3KZVA 4NU6A 3NUZA 2RG7A 5E7MA 5JAMA 1N8NA 1ESZA 4D3ZA 3F7OA 2ZB4A 4RIEA 3B38A 4OQPA 2V3CC 4HNAA 2W70A 3D1LA 5C4IA 1RHKA 1OA0A 2AR7A 4HC4A 4JLOA 5LXTB 4ZDWA 3SVLA 5EWMB 4GEKA 3D2AA 2AMVA 1MO6A 1JNYA 2CLLB 3WYFA 1FFXA 2FQQA 5IBPA 4Z3KA 2Y0DA 1B74A 3AR3A 2QMUA 3ABOB 1XRPA 5JAPA 1I7DA 3ERCA 1JMKC 2P9GA 1SKAA 1AGPA 3CH7A 4G8BA 4IY1A 3IUBA 1PFQA 2CNLA 3LP5A 3GLIA 3UUGA 2FPGB 1XA0A 2RC5A 3LPMA 1NIPA 3I9V6 3MTJA 1WW8A 1HORA 1I1NA 3NDRA 3C7KA 2R6JA 3ORQA 3RBZA 2QMEA 5KIAA 4IJ5A 1U8UA 3UMRA 2KHZA 3PHBE 5AXCA 2GEUA 1UEXC 2QU7A 2WFLB 2PE5A 2AEEA 2NTVA 2XHEA 3IAS6 4JDUA 4WIAA 5L95A 3CLSC 3RNLA 1KRXA 1KJQA 2BAGA 1U2SA 3KEFA 1ZEMA 3HR7A 1TK2A 5E8RA 4M0KA 2DPLA 2GCIA 2OPHA 5LP6F 2GZ2A 5C53B 4J9UE 2BFMA 1Y89A 5CTAA 3K9FC 4OFZA 2I2DA 4OIFA 2CF6A 4LZPA 4GUAA 4RYLA 3RK0A 1O57A 3W05A 5ES4B 5EIBD 2Q46A 2O8NA 2TMGA 2OHHA 3OX1A 4CKWB 3IR6A 2H63A 3OLQA 3QLEA 3AR2A 3WXMA 5EE0A 3VPAA 1W5EA 1XU9A 3M6FA 4WUTA 2HYDA 3H4VA 1D04A 4LK3A 2BE9A 2FSPA 3ANSA 3IHTA 2VAVA 4D3FA 4G86A 4NOLA 4G4JA 1NPYA 4BU0A 1U3FA 5DT2A 5FBWB 2JHPA 4NCKA 3JPWA 2PLFA 5B5SA 5CYPA 3B9BA 3QENA 4ER3A 1T3TA 2O3SA 1Y5NA 4J16A 1UBEA 4YQZA 4HEA6 4TQAA 2O0MA 1R0CA 5A5VA 5HM8A 5JMTA 3TFWA 4RTOA 1ZO8A 2ST1A 3G79A 3N75A 1LK0A 3HDVA 1JR3D 1OFIA 1WXXA 3G1WA 4M9SA 4J94A 3QKUA 5LMUB 2WHXA 3IRUA 3UWDA 2GZSA 1L5OA 3F47A 2X2PA 2V74B 4GUDA 5LWHA 4HSEA 1AQIA 3B5IA 3F5MA 2Q1XA 3JYLA 2H29A 1WNFA 2TRSB 4X20B 3VU9A 5T64A 1X7GA 1YMVA 2BJHA 2CUTA 2NM0A 4Z9AA 3PK0A 5E6RA 4ZT7A 3ZEAA 2D5CA 3TTXA 2I1QA 1ENZA 1ZMOA 4KR6A 4C2BA 2Y67A 2DEUA 1L7OA 2AMJA 1TM1E 4MV8A 7ADHA 1QK4A 2PX8A 4PAGA 3KFLA 1RM5A 3PL5A 5LKRA 2BOVA 2JLCA 1DC4A 1I01A 1RWBA 5K0FA 3DDSA 4G4SP 2PJZA 4HGPA 1NQAO 4BS9A 2RAPA 1XSEA 3PI6A 1I13A 1YFKA 3PD7A 5KYUB 3REQB 1J2EA 1OC4A 4OO3A 2ANBA 1KHTA 1XTQA 3M1IA 2G5TA 3NAGA 2Q0HA 3PUXA 3TLGB 2LKCA 2XUHA 4ZMBA 3ZQ6A 1YDFA 1M10A 3DCJA 3LO5A 3OO0A 3FHTA 1GVNB 3D6TB 2YZ7A 2IPOA 2ZG6A 3K8OE 1P77A 2PEZA 2PG3A 3GJQA 2FG5A 3O2NA 2ZQZA 4MR8A 4DF3A 2X7JA 5HJ5A 1NKVA 2Q3MA 5PGMA 1U5CA 3SR0A 4NDNE 1SZCA 2HMYB 1FMLA 2J59A 5GVSA 4NG4A 1NI3A 1NIJA 2G9VA 2VPYA 3EIUA 4ZCIA 1CY6A 1WMAA 4ZXFA 5K3EA 1VPTA 1WQ1R 3HP7A 1N2HA 1L4GA 1FVHA 1OWMA 3B6KA 1DEAA 1BCRB 4AJOA 1PQPA 4DYHA 3IVAA 1UAAA 2OP1A 2XZLA 2IEBA 4EHIA 2ZSJA 4W7IA 4XYLA 1DRKA 1RYMA 1LU9A 2R6DA 2ZRFA 3BIWA 3KPJA 2NUTA 3T3DA 5DYIA 4KRFA 2B98A 2FF7A 3IA7A 1T9HA 1HT2E 1OH6A 1UMCA 3GD5A 5J5CA 4BO2A 4Q34A 4E08A 2EKQA 4UDNA 4BMSA 4EVIA 5CB4B 3EODA 3GLTA 3MAAC 2O5CA 5ESXA 3CT4A 4HP8A 4IJ6A 1Q0TA 4TZ0A 1JECA 2AI1A 3H17A 1VHWA 4Z3DA 4YR7A 3OHSX 3Q4GA 4EPRA 1JAHA 3NTXA 4IJQA 2Z8YM 2QNBA 2ZIGA 4KO2S 2GBIA 1CE8A 1ORHA 3DW1X 2IXGA 3KTFA 4Y2QA 3S2EA 1JEAA 5H3HA 1PR9A 2EFCB 2QG6A 3WB0A 2QSUA 1II8B 4F9FA 1ZC3A 2H2FA 1Y37A 3VZSA 4MVJP 4NAVA 1Y8CA 2OORA 4D44A 5I4IA 2ID4A 3EZ2A 3VC1A 3PQDA 1D6JA 1X87A 1UIMA 1PR5A 3DOOA 4HXFB 4FCTA 1Y9DA 4Q7QA 2R4UA 3MG9A 4YMLA 4JL8A 4K9RA 3T3NA 2NSYA 1RJFA 1CY4A 2GS9A 2R6CA 3KLMX 1RZRD 3AP1A 2FJPA 3OUZA 1PG2A 1ZI9A 4LJ5A 4O59O 4B32A 5I4BA 1U63A 1VKOA 2OZLA 3HVHA 2RG1A 2DYKA 4YJHA 5EZ6B 4U3JA 1K8XB 3OO1A 3A1SA 1IY8A 4R9VA 2O57A 3IBGA 5CFLA 3PSHA 2CLKB 1P60A 3CZQA 3OCVA 1M8KA 3M5CA 3RRNA 4HAOA 2VJAA 4WXHA 2O8CB 3EZNA 1L4EA 5LOVB 2EZUA 1RXCA 2R8XA 5BN3A 1WPRA 4P83A 1SZPA 3BEOA 3HCRA 4WCVA 2JJ2A 1W59A 1IJFA 2FX3A 5JVDF 3QMWA 2OECA 4TMWA 1R0SA 4MITA 4EHKA 1R4AA 5SV2A 1NXQA 3F6PA 3KLBA 1N1GA 5L3QB 1GAXA 2YV1A 4CU2A 2EBHX 3KJFA 5DHTA 4BTEA 4DG9A 4CEHA 4H6VA 3BIJA 1HL3A 2WBLC 2V98A 1S8NA 1IOVA 2YBDA 1DAMA 3JQGB 3RVKA 2E7ZA 4NCNA 2XE4A 1C4KA 1NVTA 1K92A 3IB6A 4Y2SA 2PK3A 5BV8A 3WRYC 1THMA 1SBTA 3D3EA 4OLJA 4V39A 3SYNA 3CUKA 1U2TA 4DUGA 4OGLA 1VSVA 3S28A 1JEDA 2ZRPA 2WWYA 2IUTA 2WOJA 4UE3S 2AJ8A 1WMEA 4TQ9A 3OPNA 3QE4A 3B7WA 3IVGA 1YZUA 4U5XA 4EB6B 3GOQA 1CF2O 4I36A 4CLOB 1KOFA 4YHBA 3CVXA 1O0CA 2R7KA 3RVRA 1EZ1A 1WNTA 1EFVB 2W6JD 2BFPA 2Q9AA 3CGGA 3Q2OA 4CM9D 1Q21A 2JASA 3EIQA 3KQNA 1KWKA 1TJNA 4MLDA 4ZYLA 2YS6A 4KN9S 4TTPA 4MYTA 2J9YB 2FEKA 1GUYA 1TJPB 3SHTA 3HZOA 4RS3A 4ZAYA 1XCLA 2AR0A 3H2KA 3ONVA 4KOAA 3RTBA 1LQUA 4NSNA 3LPCA 4BQPA 1UWKA 5KYYB 3AVTA 5BO5A 5ALVA 3C1OA 2D7JA 3L1JA 5FL7D 4AURA 1DFIA 2YHAA 4HGOA 2RIRA 1H4QA 5ALPA 1UBOS 4FBLA 8MHTA 1EEXB 2IXDA 1W5AA 4GXNA 4H7EA 2PJDA 4Q6WA 1IJKA 4WLNA 1CUGA 2CLMB 1NN0A 2JHCA 4X8OA 3A7EA 3RK1A 1DEXA 1RKVA 5EUQB 1W4AA 5C1IA 3PPYA 3ZHVA 1SCJA 1BE0A 1Z07A 2DWQA 4D8XA 3RADC 4L76A 4OQEA 5CG2A 5HK8A 1IN1A 1PWEA 1C9NA 1EXWA 1P1FA 3SDSA 3OEWA 4WZ6A 5CX1A 3VX3A 1ZCAA 1XRSB 4DSZA 4TMVA 1UPBA 1YL6A 5AKLA 1U31A 4U9UA 1DPGA 2AXNA 3MBIA 3OHMA 2NZUG 1M2OA 3EWIA 9ATCA 2OR3A 4P81A 1JQBA 2YXBA 1IUKA 2PQ2A 2H52A 3L93A 3LZCA 3B1XA 4YUWA 1JPNA 3DOHA 3CUWA 2EKPA 3KEQA 2AB0A 1G5TA 2R1VB 2UKDA 2B9VA 4ITRC 4M0EA 4KBGA 4DA8A 1QJCA 1QUEA 3GWGA 3H0CA 4CEJA 3GYGA 1HUQA 1NKTA 1XIVA 3DDZX 1QZUA 1KSFX 2WMDA 1RCUA 2C99A 1QNFA 1XCGB 4B35A 1TVKA 3JVIA 2H92A 1OLSA 3FZNA 2ZJ5A 4IG9A 4GP7A 4R8LA 5F7OA 3EQ7A 3U4GA 4CNQA 2QTAA 4TLAA 1OZHA 1MPXA 1PLJA 2W2LD 3FJ1A 3UK1A 4E88A 5KQLA 1PVOA 2AIRA 2QOEA 1WVGA 2VA8A 4A5SA 4FDTA 5I7RA 3WTBA 2FE1A 1UMKA 2G63A 1T6BY 4RUKA 3GUYA 3GO4A 4XGKA 3EXHA 4LRXA 5F1OA 5CIQA 3BULA 2OZPA 3FN4A 2QP4A 2EZTA 2WM9B 3IQIX 4CIDA 2AQ8A 2ZTLA 2A1UB 2QLTA 2O8VA 2NO5A 1F4LA 2UDPA 2TSYB 3DTYA 5FO1A 4UVHA 3R7SA 3DWGA 4MRAA 1GR0A 5JYEA 3D5QA 3IULA 5JECA 3CTPA 1HL7A 1X94A 1DUSA 3QELB 5F7ZA 3H97A 1JDTA 3FTCA 2PGLA 3OLXA 1KJNA 4I4TB 4RSHA 3CZMA 1RHJA 5AI4A 2BEVB 1CNMA 2BP7A 3GA7A 4WKGA 1LCIA 1KARA 1YVEI 1AKEA 1E79A 3V2IA 1JW9B 1PWYE 2Z1NA 1RBMA 3L5OA 5AWFC 3SDZA 1XMQB 4WOPA 2RHJA 5IN4A 2HCFA 1ZXLA 2Y1XA 2REXB 3UAOA 1TFRA 4H18A 5COQA 1GILA 1RFLA 3F9IA 4AIIA 1NW9B 5KINB 5KOHA 4MVJD 2D5IA 4X44A 3PFHA 3UPTA 1FP7A 1FYWA 3QQPA 4KLAA 4EVSA 4LFBB 4I19A 1E0AA 3E70C 4YLYA 3ZHTA 1KAOA 1JAXA 4X8LA 3SS9X 3M6WA 3CVVA 2GDJA 1J5EB 2C7RA 2J9ZB 1ND6A 2JBAA 4KV9A 1BDHA 2D4AA 1B41A 2IHBA 4EHAA 5JQGA 1J23A 4Q02A 5ES3A 5EIXA 4M38A 4F92B 2VUSA 3FPLA 1V3UA 2P6OA 2ZYGA 4OOFA 5KSYA 2PM8A 3MMNA 4RIGA 4X1IA 3DTVA 4IQ4A 3UENA 3INYA 1RI2A 3N0VA 3A2MA 4OI0A 1RLUA 3VHXA 3EX7C 5T41A 2PV0A 4OK6A 4RXUA 5GOZA 2AKEA 2ZQ5A 1EP3B 3GVCA 1E6LA 1VLZA 3FKQA 4GOXA 5ALNA 3UCFA 3K6SA 3G5AA 3QU2A 4K6FA 4BN5A 3BHJA 2ZRAA 2PWBA 2UZ1A 3GFPA 3OPQA 2HSGA 4E51A 3TZEA 1AF7A 4Q15A 4F8EA 2RONA 1VJCA 1WTAA 2JJ1A 2WSYB 1QYVA 1HFEL 2F7SA 4INAA 3QPUA 1GCIA 5TLSA 1IG0A 4AY4A 1CEXA 2HU2A 1YL7A 2YWFA 5B55A 2HB6A 1H93A 1I51A 4WFQA 4Q37A 1P0IA 3DO6A 1VSBA 4BUJA 4MV0A 1IWBB 2F8MA 4JT8A 2FFHA 3THSA 3P9ZA 1TU4A 4GSYA 2QQ5A 1SEPA 2UZAA 2VT6A 3GCZA 3JQAA 1LPSA 2ZT8A 2NXCA 3PQ2A 3GLQA 3IOCA 3UYLA 4CVNA 1IJBA 1EWYA 1E4YA 1MZVA 2LIVA 4J16C 4L07A 5D3ZA 3S27A 1MA0A 1YULA 3ZGXA 3HABA 1TUEA 1ZN8A 1EFTA 1L7AA 1WABA 3IAEA 3UWSA 4BLUA 4GBED 5JFGA 2QL5A 1NLYA 4BWYA 3MERA 4UC0A 1T3SA 2QD5A 4KXFB 3GUVA 4R3UC 4AJEA 5DWVA 1CPYA 2ID8A 1AO3A 5BNFA 1RDFA 4OHCA 1UKYA 2VSYA 3FVTA 4K9DA 5DYWA 1G6HA 4GYKA 4BATA 4LXUA 5DNYB 2JHAA 3AC0A 3LDFA 3X1YA 5JE8A 4DPLA 3AESA 3T9BA 1IZZA 4TRJA 1OX5A 5JCPA 1JDZA 1IZYA 1U0GA 4EB0A 1Z6XA 1EDOA 2C0CA 1I80A 3DBLA 1NI5A 1DXQA 1V39A 1ATIA 2VF2A 3CLTD 1V71A 3ME5A 3OFNA 3OIWA 2C07A 4PGHA 1EFLA 3E4DA 3SOZA 5LD2B 1Y8QB 2IHJA 1BFUA 4I1OA 4X8MA 3HR4A 3BFXA 5IC5A 4W5NA 3TSZA 3K0FA 1P29A 4OJKA 1XOIA 2Z57A 3B52X 1N7JA 2VDPB 4MUAA 3ZVKA 4II2A 4IDCA 4O29A 3GLHB 4B3HA 1KQ3A 3NTVA 3QWAA 4IFBA 3U3DA 2QN1A 1Z8NA 4EJ6A 1H85A 3MAJA 3K0SA 4ENTA 1U6IA 1WUIS 4WMLA 4MRMA 1GGEA 4XJXA 4PINA 2B36A 3L01A 4MQMA 2HV8A 2FUG1 5EEHA 4FOLA 4BV9A 4MWGA 3RRBA 5KSWB 2AJDA 1QHHA 2DPMA 2Q4DA 3TIVA 3MRXA 4QDXA 1OVMA 2QN6A 2XRMA 5EG5A 3TQHA 1X6VA 2R5FA 2B5WA 1TZBA 4YCAA 4CN8A 2KW5A 2Y0PA 4O1HA 3DHWC 2SKDA 5EQFA 3GBSA 2C4NA 3AHIA 5ADWA 2YHIA 5K03A 2ZI3A 2UXCB 3MYRA 1V8OA 1I2ZA 2M1XA 3E2PA 4YRLA 5FUXA 5H70A 4ZKDA 5FEMA 2XMGA 3GGGA 5CT4A 4E12A 5AW4A 5KOIA 4JA0A 3BHMA 4P7FA 4J9VA 4UCWA 3THXA 5E6UB 4U7JA 2MIIA 1PSZA 4D46A 1VI6A 2DWOA 2OBXA 1ZJ5A 4R3WA 1FBNA 3HYSA 3MWGA 2GCOB 3D54D 4CI0B 2X0JA 2RKWA 3ZK9A 4C2AA 4CF6A 4EH1A 1E8DA 1EA7A 2E48A 5DV9A 1GPLA 2DWCA 2H8KA 4MQEA 4ZIRB 4AD8A 4AJJA 2AFIA 3H65A 2PS0A 2Q5FA 2NVBA 5CXSA 2YNMD 5TGZA 1C7IA 1V3QE 3DZFA 2O1WA 3P9YA 3DPSA 3BB1A 4YRRA 1AZSC 1BWRA 3HZZA 3EEFA 2JKVA 3IQWA 4ZCLA 1IDOA 4HVAA 1DHTA 2V6GA 1CRQA 1QDLB 2F59A 3PFNA 5FPTA 2C97A 2IZ7A 3KBOA 2OORC 4PHHA 1LBQA 2BFOA 1FDRA 2HZBA 4U4AA 3VUEA 2HH9A 4PN3A 1LI4A 2QDXA 3IUSA 3GJ6A 4N9WA 3K31A 3W6UA 3MWJA 5ECDA 4LXIA 4G84A 2O2SA 2Q21A 4PIMA 4FQ8A 5AKHA 3D59A 4UM8B 3BQ9A 1XD9A 3PDIA 5FA8A 1VL5A 6ADHA 3PYXA 1AKYA 4AUMA 3DWIA 4RMNA 1V1RB 2QZJA 4FGLA 2H51A 1G8HA 1MX3A 2IYXA 1U9ZA 2AA3A 2QZ9A 5DDIP 5C4MA 5BR7A 2WJHA 4ZPJA 1AM4D 1TCCA 5EWLA 2JDID 3I04A 3ESRA 4UHEA 3BKXA 1TM4E 2PIAA 3C3DA 1UOOA 1X77A 4OXIA 2H5EA 4UAJA 3WLQA 3ZV7A 2IIPA 3D2LA 3ENWA 2A78A 4UTVA 4C7KA 4QJ3A 7MDHA 3U5TA 5HFNA 2EWWA 1LLDA 2RHCA 4YP1A 1KNQA 3U7EB 2KMLA 3AM5A 4F9GA 5ULLA 3SICE 4JXKA 4PC3A 2H5JA 1JHQA 3BWDD 3GGOA 4GPAA 1QV9A 1VHLA 2HU7A 4PFKA 2ZBQA 3TTSA 2QX8A 1M33A 3SMVA 1I2MA 2A94A 1XK6A 1E2HA 3IP8A 4XE5A 3UN1A 4U6QA 4MQBA 1JIQA 1DQRA 2DT8A 3D1JA 3H5OA 4JBWA 4GOMD 5TQVA 1BDJA 2FJUA 6PFKA 2HV9A 3GLKA 1JVSA 4WRRA 5JSUA 1HT3A 1FEZA 1RWOA 4HPWA 2GAAA 2OFPA 1ZUNB 4D4IA 4EFMA 2OQRA 2DLCX 1ZJZA 3FA2A 1T8YA 3ABRB 4M1KA 5JJBA 4XXHA 1A7JA 2A9PA 2BGMA 2PKRA 2Z5GA 3N59A 3QVWA 3RVMA 2GEFA 3X1WA 1XXHB 1NF2A 3HO8A 5I8PA 1VE9A 2PY6A 2CNWA 4IO1A 4WZAE 5C46F 1CV2A 5TJHA 4Z4FA 3ZOZA 2F1KA 5C4GB 3KHSA 1O6GA 4LYGA 3FPAA 4M1YA 4GZLA 3RV4A 5ALDA 1K98A 1UM8A 4KLZA 5I7EA 4CIXA 5FA6A 3JZAA 3SK0A 3T3EA 5KQSA 3EB9A 4MWBA 4WINA 4WE3A 3UT6A 1A4UA 2ZPAA 2JVIA 5FCDA 4EUSA 4R9RA 3HCFA 1RRPA 2HA3A 1H0RA 2RHHA 1L6RA 1P61B 3DA8A 5IAAA 4FYXA 1MH9A 4BNZA 5KEIA 4QAQA 3EC2A 4WKCA 1MAUA 1UK6A 2CFOA 1IY0A 3H87A 5L3RA 2VNKA 4AZVA 3T3PB 3ZZMA 3HXTA 4BKQA 2DR2A 1Z5VA 1TTTA 1GV0A 4G5HA 2QJTA 3N2LA 3H7AA 3WKCA 3HJBA 1QH9A 2FPWA 2Y1CA 4NZPA 3Q11A 3U61B 4CEIA 2D00A 2V97A 3PCTA 1AURA 3DMNA 3WWOA 4C6SA 1LD3A 5HILA 3CINA 1IN8A 1XJWA 2NUPA 1TW2A 4P86A 2GLXA 2JAXA 4B6GA 5DNVA 3SYTA 1PV2A 3GQVA 2GPJA 4PF1A 4XD7A 5BR8B 4EKEA 2P6NA 1GPMA 1JL3A 3HUDA 4IXDA 3A4NA 3TCXB 1BYIA 1DQZA 1OU0A 4L08A 3Q40A 3ZY5A 1G38A 2IH2A 1XQ6A 1YS6A 4MH0R 2G5GX 4PLCA 1BDBA 3G17A 3AETB 3M8KA 5A5DA 4BFSA 3GHHA 2GCGA 3HKDB 1QO0A 3PRHA 4HDKB 1F6DA 3X2EA 3ZUGA 5EL0A 1BHO1 4FTWA 2E89A 1SG0A 1U0FA 5F3DA 1XMVA 4HFRA 1DPFA 4PQFA 5FPPA 1R9GA 3TNJA 1IHYA 4RVCA 5CHYA 4MEAA 1KEVA 3J81k 2AL7A 3KSZO 2OXCA 3SJUA 2VZ8A 3MIZA 5DTRA 4ZICA 2LP4Y 1RRGA 1GGKA 3K92A 3EK2A 4LF5B 2FR1A 4I7EA 3V7UA 2QPOA 4KQ2A 2FMUA 1C1XA 4GHWA 1AG9A 1ULTA 1YJXA 2PT5A 2PDAA 2F3TA 4RU1A 3TW6A 3QU9A 2OFOA 1U3VA 4EMBA 3EGIA 3RU7A 1LI5A 5JDCA 1AXEA 2DFPA 3OKAA 3TJZA 2GZRA 2X1VA 5ESRA 2IC5A 3WC4A 4C7MA 1QZXA 1V47A 2X5XA 1T10A 2OV3A 5AM1A 1YZYA 2X3YA 1KJJA 1KS2A 4XVQA 4LMBA 3PEUA 3ZWOA 2PKQP 3NEJA 1U2GC 1UADA 2FEPA 3EXHC 2BFNA 2XTJA 3O3OB 1XRRA 3KVVA 3PSAA 4ND6A 2V3WA 5EKSA 1XPUA 4X94A 1WXEA 2NU7A 2O5VA 1N2CB 4LN1A 4IIHA 3L8EA 1LB1B 4PZZA 2ZRQA 3CUUA 1PTKA 5JV5A 2FUEA 1JHMA 4PO8A 4AFNA 5KTPA 2VF8A 1UDWA 2ZCUA 5FTMA 4BDTA 3AWDA 4FQ7A 2Q5EA 1FUEA 4I9UA 2CXUA 1YMQA 3KC2A 4RACA 2H16A 5BP7A 1XFAA 3Q7TA 3O26A 4ZZ0A 1X8KA 5FFFA 4RHCA 1ZCFA 1BXZA 4GI1A 4J4HA 4CMIA 2EW1A 1F9EA 3RTCA 3VAZA 3ZU4A 4BNWA 1YOBA 1HLPA 1HKUA 4W4TA 1NQVA 3R3UA 4YXFA 1UAYA 5TPZD 3W5HA 4LRWA 5FUWA 1Q1BA 1YFZA 2GKOA 3FOCA 4UNRA 1M0SA 2BHSA 1BGVA 2CDCA 2PH5A 2PZBA 3R77A 1Q0UA 3T99A 3NWBA 1MX5A 1VLVA 2IU4A 3CKLA 3OM9A 3WZMA 1E9SA 4LI3X 4BBAA 2C2XA 3ZWPA 2DUMA 2XDWA 3V32A 4EEKA 3IBFA 2JLVA 3GRVA 2N9UA 5AK5A 4ITVA 2P3QA 1P44A 1EJ2A 1UF9A 1W76A 3FZQA 3K5WA 5J1TB 3L1IA 1R7RA 1SBYA 2O2HA 4J3FA 5DX0A 3WL7A 4AZ0B 1OLOA 3L8HA 4HLDA 1ISMA 1AKWA 2YWJA 4KIWA 2EJVA 1LS6A 3WGZA 1IBKB 4YDRA 1LLUA 3H9CA 2EKDA 2CF5A 3LYUA 5IC6A 1VJGA 1ZD9A 3RVLA 4BWVA 2VK2A 3GT3A 2GVNA 4H59A 2XNHA 3OOHA 2WNHA 3Q5DA 3UJ9A 3GLGB 3R4CA 1KQGA 3A1EA 4F71A 1AGRA 3EGDB 3PCRB 2QVXX 3HTXA 5TS2A 3I4FA 3O4VA 4WLFA 5BPHA 3V4OA 4HRAA 3AM1A 4DBVO 3TKLA 2Q4EA 4UCFA 1ZI8A 2WDZA 3QF4A 4C3OB 5K0LA 4DQLA 1MB3A 4DVJA 3MS7A 2P1DA 1LQTA 1ZQ1A 3LQYA 4C20A 1E4OA 2NADA 1ESDA 4UMFA 3DVAA 5KNBH 3QHAA 4TTJA 1A9YA 5L4NA 1Z26A 3I52A 1RYZA 1U7OA 4FYPA 3OJFA 2ZB7A 5F7JA 3RS7A 3QE2A 1O87A 4K46A 3FROA 1UBNA 1OIVA 4RK7A 1AMNA 5FOQA 1OSNA 3C7CB 2OA0A 3VOTA 5DT9A 2UVDA 2FDRA 2VDUE 3D5EA 2BTQA 2O0JA 4ZEOA 1H9CA 2Y0BA 2WG1A 3IVXA 3CRMA 3RRJA 2XODA 4AJ9A 4KTTE 4EZIA 4KKXB 1IBLB 3G8DA 3CF6R 4UU0A 1GT6A 1QLHA 1X9HA 4A16A 3KT6A 3JWGA 3C8DA 1QU3A 5JROA 2QLMA 2XYPA 5AW9A 5KWSA 1EU1A 4DA0A 4EKYA 2ZJBA 2I54A 2HXSA 2PZMA 5IJ9B 1PCXA 4YJGB 4B9AA 4G85A 2G71A 3MEQA 1P6XA 4IGIA 3ZBQA 3NT5A 5MFPA 2O8BA 1DSSG 1EHIA 3D7MA 3S2GA 2X8AA 4LTMA 4RV9A 2ONJA 1ZUIA 2HJ9A 1KORA 2C8KA 1E1MA 2YFHA 3QVVA 3VA7A 4A1OA 1FMJA 5FOTA 5JS2A 3KOYA 1BVYF 1JEQA 3FR8A 2QVYX 4I55A 4X3OA 3P19A 3KQMA 4MARA 1CR4A 1M66A 3AB3A 3NHYA 4V0NA 5DNWA 5EYPA 3VNQA 2HCBA 3ST7A 4LDAA 3OU2A 3SS8A 3WLFA 2XOKA 3AUFA 1L8QA 4HNVA 5JRDS 4BRWA 3MLBA 1NUPA 4LWOA 5AJVB 3D7LA 1WY7A 4GEGA 1V11B 1MABB 1OKKD 1RR6A 1WB6A 2M6KA 4NEQA 1DXYA 3GV0A 2X41A 1YBFA 4PTLA 2X0NA 5AM4A 1Y5RA 5FF9A 5TT0A 3FRHA 5HKLA 3S1SA 3ZHOA 2XVZA 3ZD9A 4G0OA 3CLSD 1NT2A 5KYWA 1GD1O 3MLAA 2XTZA 1EIZA 5CLGA 1SCUB 2WVGA 2G72A 3KEGA 4MP3A 4AC9A 1BWPA 1JQLB 1UEIA 3P9XA 1QGYA 3EVDA 1EFUA 3VH3A 5BV2P 4I3HA 4OTZA 1UK7A 4P2BA 2FMIA 3H5AA 3ZQ4A 3EUAA 4POAA 5DSZA 4A0RA 1KIAA 2HLDD 5HMMA 4PG7A 1D5CA 3W5JA 4O08A 5FBVB 4BMXA 2XWQA 3RNOA 3L0YA 4RWZA 1RQRA 1J07A 3HKCA 3I0ZA 4M1OA 1OHHD 4ZREA 3PXAA 5CD1A 4BTVA 3AUAA 5I8ZA 2EERA 3JU3A 4BRSA 3A7DA 1XEXB 4ARZB 1U2ZA 1HETA 2QXUA 4HNTA 3ZV5A 4BMCA 5JNWA 3UFXB 4LZOA 5CFQA 1M34B 2J7PD 3RYHB 3FTFA 3IBTA 2IYUA 2V1XA 4JB8A 3IFSA 1EH5A 3KDSE 5IUNC 1WP4A 2I2WA 3EVGA 3HNRA 4PSKA 4YN3A 1GLVA 2BEUB 4KH1A 2G9NA 2PWYA 3TKYA 1SBZA 4NJMA 1PG0A 1QYDA 3DBIA 4R41A 1U8TA 4LJ6A 5G0UA 3SFTA 1OI2A 3EZLA 2DWPA 4M9RA 5DRTA 5JS8A 1T4GA 3NDIA 2Y27A 3WL3A 1D0SA 1EVLA 4A27A 3V6LA 1JDBB 3EEOA 1V4VA 4HDNA 4O2AB 4ZRDA 3J81A 2NYUA 3E7PA 1E5TA 2G17A 3RRXA 4E15A 3VSAA 4OQ4A 1OBOA 3TW0A 2NG1A 1M1XB 1O1YA 3KRTA 4M8SA 3WK6A 2L18A 2QLBA 5JJIA 2QTCA 1H2EA 3ZDXB 3DE0X 3VYSB 1WDKA 3F97A 1BC5A 4JP2A 1D2CA 4KJXA 3G6KA 3PHJA 3JQCA 2RBGA 5D3MA 4G41A 5FI3A 4MWEA 2H1WA 3NYWA 4OBXA 4I5GA 4KQCA 5K51A 1X8XA 5GZ6A 4PPGA 4V3CA 3ZE2B 5C8XA 2PMFA 1MHTA 3HFRA 4L0CA 1G3QA 3AIMA 2H08A 4CV3A 4ZAGA 3DLHA 1G1AA 4JIMA 3C4QA 5HA5A 2CN1A 1XMOB 1XF9A