5JDIC

Trypanosoma brucei ptr1 in complex with cofactor and inhibitor nmt-h024 (compound 2)
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
266
structure length
239
Chain Sequence
APAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQKTVETQVAELIGTNAIAPFLLTMSFAQRQNLSIVNLCDAMVDQPMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pteridine reductase
publication title Profiling of Flavonol Derivatives for the Development of Antitrypanosomatidic Drugs.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
total genus 91
structure length 239
sequence length 266
ec nomenclature
pdb deposition date 2016-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5jdiC00
3UCXA 3OFSA 3ZHZA 2CZCA 4OO3A 3ZW8A 3U0BA 4A2CA 1NQOA 3QHAA 3UH1A 3AW9A 3E9MA 1QV6A 1ONOA 4FCCA 3HHPA 4ZVVA 4TRRA 1GYPA 3MJCA 1OMOA 5G0SA 5DF1A 2B83A 2IYOA 2B36A 2RH4A 1PJLA 2DTXA 3AY7A 1GUFA 1LSSA 1ZO8A 4RLSA 2EJVA 1NFRA 2I9PA 4C7KA 1CQIA 4R1TA 5C5IA 1T2EA 3HWRA 4MVJG 5HA5A 4K6CA 3T7EA 4GMGA 3WLEA 3OICA 4X54A 3C1OA 3GNTA 3K92A 3ZWMA 2PGJA 2YZ7A 1ISMA 1P0FA 3RU9A 1XEAA 3UF0A 4O6VA 3LLSA 4BIIA 4XWYA 1T2AA 3U49A 4YAGA 4BO4A 2QX7A 3JD4A 3F47A 4UUMA 3W8DA 1EUDA 4IDFA 4CM8B 3AFMA 3OQBA 5TJ9A 4R41A 2DUUA 1KEUA 3JQBC 3LT1A 2C59A 7MDHA 2UDPA 1Q7GA 2H9IA 3DFZA 1JKFA 4Q9NA 1NASA 2EG9A 2OO5A 5JY6A 4ZA2A 1A27A 1EVZA 1CRWG 3ZH2A 3P19A 1AHIA 1WZIA 3ZWAA 3GK3A 3WWZA 4IPTA 3KOUA 4LMRA 4TVOA 5CDYA 1FDUA 3I83A 1PL8A 2VYNA 4WK6A 4O1MA 1U5AA 4RVSA 3GUYA 4Z0PA 5L53A 1MLDA 4P8RA 4WUVA 5CEFA 1MB4A 1PR3A 3KSDO 1KY4A 3FR7A 1C0IA 1W0CA 1BVRA 4G65A 3PYLA 2UUPA 3R1IA 1BW9A 5JNLA 4GWKA 3RBVA 1ZK2A 3SJUA 4BNJA 5ER6A 1Y8RA 4KWHA 2O2YA 2VYVD 3C7DB 1HE5A 4KTTE 1ZZEA 2ZB3A 4MP6A 4OXNA 4PIVA 1H6BA 4DBZA 5JMWA 4BMNA 2OP0A 3ZCXA 4NH4A 3CXRA 1T2CA 1GZ6A 1N7HA 3Q6IA 3H5RA 2ZYAA 1E3WB 4PLGA 5KIAA 4R1SA 2AQKA 4IBOA 1A7AA 4DBVO 3ON5A 1A4IA 1YXMA 1MA0A 4MVJF 1I2BA 1I8TA 1X15A 4BNGA 1GU7A 1GDHA 2HK9A 2Q4BA 4MO2A 2GR9A 3C24A 4DQUA 3W4JA 4CLXA 4BNUA 1DRUA 1FDTA 4MVJE 1X0VA 1DJNA 2DPGA 2QG4A 3AU9A 4IDDA 4IDEA 1K0UA 1N9GB 3ZV5A 3GFGA 5TRTA 1DIBA 1F12A 5JO0A 4E5YA 2PD6A 1XYGA 2GLXA 3KYBA 2HK8A 5KJCA 5F1OA 4FSHA 4DTIA 2F1KA 2C07A 4WCDA 3I9NA 2VUSA 3C1TA 4NK4A 4BO2A 1PR9A 3INGA 1BDMA 4L73A 4OM8A 3WOHA 4DA9A 3MTJA 1ONPA 2W2KA 1C0KA 1VPDA 2D4AA 1GV0A 3H9GA 4LVUA 3VZPA 1PQPA 4AJ1A 3FNGA 5EL0A 4TROA 4QUKA 1K6XA 1NPYA 1Y6JA 1ZSVA 4TRJA 4PFJA 3GGGA 1UZLA 3PJEA 4UUPA 5DCWA 4IXTA 5EESA 5C7OO 1PGJA 3QQPA 4MP3A 1Q2XA 2GDZA 1F17A 2YYYA 4XD2A 4BKUA 3VDRA 2EP7A 1ZMTA 4TRNA 5HRUA 4P38A 5KJ1A 3AI1A 3OEYA 4E5NA 4OIMA 1HT0A 2VWGA 3OIFA 1JVSA 4PLYA 5F1PA 3CPSA 3JTMA 2V6FA 3AM3A 2VHVA 1H94A 1DC5A 1YJ8A 2CMDA 3PFWO 1EFKA 2P2SA 3ANMA 1YQGA 1NPDA 3AY3A 4GBJA 4PG4A 2HMUA 5TC4A 3GGPA 3DHNA 5TQVA 1SC6A 5CHEA 2PKQP 5JDCC 1Z45A 1B8PA 4A26A 3QW2A 1O6ZA 2OL4A 2YUTA 4B4OA 4NBVA 1R37A 4XJTA 3E03A 3OA2A 3ZHYA 3CIFA 4RL6A 4FW8A 5G2OA 2E49A 4FD3A 4ZRMA 5JCJA 4W7IA 1TB4A 2Q1TA 2O7SA 4FGWA 1UUFA 4BKPA 4LISA 4RQUA 1X0XA 4XZ3A 2Y67A 4W6ZA 1B0AA 5JC8A 3OJOA 2H1SA 3MJSA 2IXAA 3L4SO 4RF4A 4WNCA 3WMWA 4BVAA 4E5MA 1ARZA 2C82A 4PLPA 1DXYA 3RBXA 2FPIA 2GO1A 1FDVA 3DR3A 1HDOA 2ZATA 1HEUA 1V3TA 1NQAO 1ZCJA 1NBOA 1ZUD1 4ND1A 2FZEA 4JBHA 1ULSA 3IKVA 3JQBA 4LK3A 3TFQA 1HTBA 3UOGA 3AY6A 3PWSA 3M6IA 3Q2IA 1LDMA 2OP1A 4OJNA 3E18A 3CH6A 1N1EA 1E1NA 3STHA 3OQ6A 2VNAA 1XKQA 1Z75A 1NR7A 3B1KA 1P3DA 3H6KA 2IYPA 4NNJA 3D4NA 4PN3A 1GQ2A 5JDIC 2Q99A 4N5MA 3TL2A 2WYUA 3FPLA 4CQLB 5ADHA 4KQXA 1J5PA 3RKRA 4CLRA 5CPBA 3WLFA 3ICPA 3TL3A 1MXFA 1LRLA 3VH1A 5IG2A 2G82A 2HQ1A 3O26A 1T2FA 2AQIA 4Z6KA 4MPDA 2G76A 3BYZA 1YBMA 2D5CA 2IE0A 2NACA 2VYVA 4XGKA 2O4CA 1PL6A 4CMGA 4HV4A 1YKFA 2P9EA 4N54A 4RCVA 3GFBA 4WEOA 2NU8A 5FWNA 4CR8A 5FI3A 1GCOA 4QQRA 3HSKA 2EIHA 3S2EA 4YR9A 1QMGA 4LN1A 1EVIA 3WJAA 5JBIA 1IPFA 1ADFA 1LSJA 4XEHA 4CJXA 4CLOB 2O3JA 1VJ1A 3CE6A 3PJFA 3RWBA 3PJGA 1I3NA 2BELA 1SB9A 3D5TA 4XJSA 1BTOA 2QZZA 2BF7A 4FJ1A 2PZKA 3OECA 3GHHA 5T8KC 4J0EA 4TKMA 5KTKA 4GX2A 1H2BA 2EW8A 3ENKA 4H7PA 3PZRA 2X1HA 4H16A 3ONFA 1DO8A 3NAQA 2YFHA 4DC0A 3ANLA 4MJLA 1G0OA 4J1QA 1ISHA 4FC7A 3QLJA 1ENPA 2BFAA 4GSKA 2JCYA 1PEDA 1V6AA 2FN7A 3JYOA 1QG6A 2JD1A 4M49A 4JJIA 3H8VA 1U9JA 3DB2A 1PJBA 3AM5A 3GNSA 3GH3A 5GMOA 2EEZA 1U3TA 1W8DA 3U4IA 2FR8A 1B3RA 4E5PA 3W6UA 2J5KA 4WOJA 2BFPA 4GWGA 8LDHA 4JN6B 2X86A 4K28A 4OL9A 1DLJA 1K2WA 1OAAA 1GL3A 3OETA 4WCFC 4J2OA 2FWMX 1PTJA 1NNUA 4LRSB 4IINA 2YFQA 1GPDG 1HKUA 4GGPA 2OORA 5I7VA 2NQTA 3VTZA 5J23A 5EINA 4HFNA 1UR5A 1PGNA 2D2IA 4FFMA 1Y5RA 4RORA 2O23A 3K73O 1C1XB 1R15A 1U8FO 1XDWA 1YB5A 2DFDA 4IMRA 4J9UE 5CFZA 4FPXA 3KSZO 3QWAA 5A4DA 3KSUA 4BO1A 4BO7A 5ITWA 3QVOA 1B8UA 3EVTA 3SLGA 1VSUA 1I32A 3JQ8A 4BNMA 4N18A 4YXFA 3EZYA 3BMNB 1KY5A 5JDCA 4XQGA 4EEZA 3LDHA 3KYDA 3KEOA 2V65A 3ST7A 3JQ6A 4CLEA 1CIVA 3V5NA 1PJ3A 1OBFO 2XAAA 4ONEA 3GQVA 3NGLA 3IKTA 3GAZA 5DCUA 4BO3A 2Q50A 4J7XA 2YQ5A 1WXDA 5GZ3A 1SBYA 4CQMD 1G1AA 3TZ6A 4I8XA 3LLVA 4ZGWA 1VRWA 2PZJA 4L0QA 2B5WA 2GCGA 2X22A 4UVEA 5JMPA 1NP3A 1YL5A 1MUUA 2ZTMA 4K9DA 1MC5A 5EPOA 1RJWA 3GUCA 1HE2A 3NT2A 3ZWYA 2P4QA 5AQ1A 2JFHA 4CPDA 1BWSA 1MFZA 2PH5A 2BMAA 4U0KA 5LC1A 4AJ2A 1JKIA 5BNTA 1KOLA 3VAZA 4AICA 4QFDA 1XWFA 3A14A 2GN9A 3VPSA 3BHMA 1A7KA 5CDTA 4KP7A 5KJ6A 2GN8A 1HDYA 3KLMX 3F4BA 1I36A 1WMBA 4XR4A 2HO5A 2NLOA 2AE2A 2RH8A 2WEKA 1WDMA 3JQDA 5A05A 4WKGA 3AJRA 4MVJM 5JDIA 4L74A 1UJMA 4R4JA 1GAEO 3GC6A 2GN4A 3PJDA 4IDGA 4R3WA 5JE8A 2OOSA 3GMSA 3CINA 4I5EA 4L8VA 3K30A 4PG6A 4PCVA 2POQX 3LZ6A 1LLDA 1OFGA 1HDXA 5L40A 1R4MA 3PHLA 1LEHA 1QSGA 4DL9A 3DL2A 4Q3NA 2CSUA 3F1LA 3MEQA 3VVCA 3ZWXA 2HU2A 2VN8A 3IP3A 4I5GA 2E82A 2HAEA 4Y6SA 2GERA 4UVHA 3JYLA 4QTZA 1E1KA 3CTMA 1JWAB 2Q2WA 3VKUA 1IYZA 3BAZA 2IEDA 2Y0CA 3DDNA 1UP4A 4BNVA 3WB9A 3DXFA 4BNWA 1E1MA 1D4FA 3ZWWA 1LDGA 1SZJG 3UCEA 2V6BA 4GPD1 1DOHA 3NDJA 1R4NB 5T8KA 1Y9EA 4D3FA 4FIZA 1LDYA 5BSHA 2X9VA 2DVMA 1RPNA 3GEMA 3NTRA 3AWDA 4CUKA 4RF5A 1U2DA 3DBHB 3I4CA 4IZIA 3DOJA 3KTDA 2UVDA 4QT0A 4WASA 4LMPA 1H5QA 1HDCA 3ETDA 1EQ2A 4YJGB 3HDHA 1GFSA 4CMCA 1PZFA 4F46A 2XPCA 4MIYA 2HJRA 4M8SA 4BUCA 3WNVA 4ZJUA 5CDSA 3DZJA 4PLWA 1PWXA 3GNQA 2ZCVA 3NGXA 3ASVA 1YOVB 3NEPX 5HS4A 3FTNA 4CMIB 2HUNA 2GZ1A 3JQAB 5JAQA 1I3MA 4WE3A 1F8GA 4WCFA 4WJZA 5AVOA 4JROA 3CZRA 1WMAA 4OKIA 4CUJA 1BG6A 1LRKA 1HLDA 1Z6ZA 2RHRA 3SXPA 1UDBA 3C85A 1E6EA 5I7EA 3O8QA 2GD1O 3ZNPA 1NHGA 1TEHA 4PZCA 3EGOA 2OHXA 4NJMB 4GX0A 1JLLA 1NAIA 4ALIA 1CJCA 5A02A 2IDZA 5CPFA 5G0WA 1A72A 1U28A 3MWEB 4EJ0A 5IZ4A 3A06A 2FRDA 4YQYA 4PG8A 5BSEA 3ETEA 1J0XO 1PL7A 4NBUA 4OQZA 5K6AC 4N5LA 4PZEA 2WYVA 4D3DA 1BXGB 4IJVA 3F9IA 4B3IA 1E7YA 3WBBA 3IIEA 4YBZA 4AJJA 1EQUA 5H82A 2AXQA 1DC6A 3GZNB 1JWBB 4IQ0A 3RFVA 4TSKA 4G5HA 4EUFA 3FWNA 1YL6A 3GDOA 2D8AA 3HJAA 2P5YA 4YJFA 3ITKA 3RUAA 2DQ4A 1Y1PA 3BMCB 5AXAA 1R66A 1DAPA 3JD1A 4D44A 1SB8A 3CUKA 3A28A 3JYQA 5GZ1A 1EEHA 3JQ7A 3QV1A 4CQMA 3R3JA 3V2HA 4EUEA 1UXKA 4YRBA 1D7OA 4QX6A 1O8CA 5HTOA 2H6EA 1GYRA 4ND3A 1R12A 3KV3O 8ADHA 2XOXA 5TT1A 1HSOA 2PD3A 3GHYA 4RV9A 4BKQA 4QFCA 1AUPA 5A1TA 3ONEA 3SC4A 2GASA 2Z1NA 4HFJA 4IXWA 1E7WA 2Y1GA 1QORA 2O3TA 4E31A 3D3WA 1OOEA 3HB5X 4IQGA 4U5QA 3TZCA 4IIUA 2AEMA 2OBNA 3KB6A 5IFLA 2DBZA 5TNXA 1AXGA 2O2SA 1WDKA 4I5FA 5LCXA 3U4HA 1CEQA 4YAKA 5TSDA 3SEFA 4J0FA 4YVFA 2WYWA 4NU5A 1EUZA 3KO8A 5A03A 4GSLA 3QWFA 3I23A 3PLNA 3LF1A 3TOZA 1DSSG 4TKLA 2Q1SA 1V8BA 5G4KA 3RUEA 1S6YA 3RUHA 3AUUA 4ALMA 4YDRA 3H3FA 3DFUA 4NU6A 1YVEI 3HUDA 1EE9A 4BL5A 1HZZA 4FB5A 4U6SA 2G5CA 4WLEA 4HFMA 2X7HA 4MP8A 3VPGA 3L6EA 1KERA 3F46A 3WJ7A 4BB6A 4KMSA 1ORRA 2Q1WA 2QW8A 2FPPA 4W9NC 3AFNA 1B26A 1V3UA 4TRMA 3B20A 3TPCA 1GZ4A 3HDQA 1X7GA 3T7CA 1BDBA 2X5OA 4WLOA 3TRIA 3ZWNA 1ID1A 4ITUA 5BR7A 4FQ8A 1VLLA 2AG8A 2IODA 2Q2VA 3ZU3A 3HQ4O 1DIRA 3JV7A 3PI7A 2P5UA 3MWDB 5C7IO 3EY4A 4LGVA 1HYHA 4BHTA 4A10A 2VRCD 3IJRA 5T64A 2Q3EA 2FZWA 3N7UA 4B3JA 2PGDA 3D1LA 3OHSX 1JVBA 2W90A 4RZHA 5JC1A 4HY3A 5DZSA 4RPGA 1MGOA 5EQDA 5KJEA 5KKAA 3FWZA 5JAIA 4BNFA 1KETA 2J5QA 1XG5A 4DMMA 4CV3A 1AN9A 4P4GA 2HCTA 1LXCA 4EW6A 2CF5A 4MKXA 5JS6A 3I52A 1RM5A 4EBFA 3ZZNA 1WWKA 1VKOA 4HUJA 4MKRA 4BB5A 3KVOA 1S7CA 1SO8A 4WECA 1EDZA 1YGYA 5C7LO 5AYVA 1MC4A 2XXBA 3AOGA 1BXKA 3WGZA 1HWYA 1Y9AA 1YQDA 1O9BA 1KIFA 2IEBA 3FF4A 3HDJA 4J4TA 4NK5A 4OOEA 3LC1O 3RFXA 3H5NA 1ULUA 3DZBA 5I9LA 5DULA 1H9AA 1HDGO 5ICMA 4P22A 1DHTA 5JLAA 1QYXA 1LTHR 4J7CA 1E3IA 2VZ8A 5T6BA 4ZQHA 2HMVA 3K96A 3BMQA 1NWCA 5JYEA 2JCXA 2PKQO 5ES3A 3RUDA 3S8MA 2GF2A 3JQFC 1BW9B 4Q39A 4CM5A 2C5EA 3DOCA 5U4QA 1DB3A 1NXQA 3ZW9A 1Y8RB 5K6AA 5DCYA 1EZ4A 1IZ9A 2DFVA 4PLVA 2BFMA 3OA0A 2Z5LA 3GVHA 4L75A 3IOYA 4L76A 1HXHA 3EMKA 5A3VA 1LBEA 3QRWA 2G0TA 4BGEA 2X0NA 4U7WA 1LSUA 3VTFA 5BSFA 5I7FA 2J3HA 1DC4A 4J1SA 1N9GA 3G1UA 3ZWBA 4H15A 2I76A 5C37A 3F5SA 1NM5A 2WE7A 4NBWA 2EV9A 2FHSA 1NR1A 2ET6A 2NUAA 3B1JA 3NJ8A 3FTPA 3OJEA 4R68A 3Q1LA 1I24A 1LC0A 4AJNA 2ZQZA 3WGIA 1YWGO 2PKRA 4XRRA 1M2WA 1DIGA 2PZLA 3F5QA 4D7AA 2BFOA 4GQAA 4XRGA 3WICA 4AG3A 2H63A 1IULA 1DC3A 3WTCA 2C0CA 1ML3A 3NYWA 2D1YA 3O03A 4R51A 3TZKA 3DBRA 4XB1A 1T24A 1V9LA 1UXHA 2EERA 2Q2QA 4LSMA 1GPJA 3DAGA 1W6UA 3I1JA 5I8ZA 2QRLA 2JD2A 3ZI0A 1BMDA 1EVJA 1B2LA 4E30A 3L6OO 3K6JA 4WLVA 5L7TA 4INAA 5DOVA 4EUHA 5KJFA 4BQRA 3E9QA 4H3VA 4YJHA 4A73A 4KUGA 2CY0A 4UUNA 3PQDA 4JBIA 4R1UA 3TDKA 1YL7A 1P33A 3H4VA 4FFRA 2VTEA 2W2KB 3E1KA 1U2GA 4M55A 4DLAA 1UH5A 1B15A 3I6IA 4I1IA 3PWKA 3RC1A 2TMDA 1E7QA 3HNPA 2I66A 1I33A 1TI7A 4NQZA 4XGNA 3PZBA 1HETA 1E3LA 1ADGA 4CUZA 1QR6A 4RVGA 3GF4A 4J1NA 1H2HA 1UP6A 5IN5A 2ZCUA 2ZKLA 3OMLA 2A4KA 3UVEA 1P1HA 3BTUA 2Q46A 4B79A 5B1YA 3IUSA 3KHUA 2DBQA 1XELA 5BNIA 3RVDA 1A71A 1D1TA 4W9NA 2NSDA 5EJ2A 1ADBA 2NU9A 3UHAA 4FFLA 3QVXA 5DT9A 2RCYA 2PNFA 2RIRA 2FSSA 3U62A 4OHUA 1Y8QA 1K5HA 3ZDFA 2Z1MA 3BTVA 3FNHA 2CDAA 3IJPA 3GN1A 3DONA 5FFFA 3LQFA 3DAPA 1NHWA 3IS3A 3V8BA 2EWMA 5DOZA 4DVJA 2QYTA 2Y0EA 3JSAA 5COQA 3ABIA 1PJTA 1N7GA 3HFGA 3TOXA 5B37A 5IDWA 1GUYA 4DXHA 2ZQYA 5A06A 2Y1DA 2EGGA 3H9EO 3W4KA 5A3JA 1LUAA 1CERA 3PPIA 3LU1A 2GRAA 1H6CA 1FDSA 3K9QO 1VL0A 5KOIA 3OSUA 1DIAA 3EDMA 3LT4A 3DZKA 3RJ5A 4PZDA 5JSFA 1L1FA 5HBRA 2VT2A 1LQUA 4IDCA 1LQTA 1ZFNA 4RVHA 1KEVA 1NFFA 2PA3A 3BHIA 3LK7A 3NJ4A 4HNGA 1WW8A 3C8MA 3PYMA 2IXBA 3PGJA 3ORFA 3H2ZA 1O5IA 2B35A 4PGFA 1AE1A 4R9SA 5KVCA 1P44A 2ZJ0A 1Q0QA 2A94A 4CM6A 3B6ZA 3TN7A 4FBGA 3WYBA 4BO0A 4J7UA 3E48A 3QIVA 4BO5A 3AI3A 1SPXA 3GG2A 3GY0A 1ZEJA 5A9TA 4PRKA 4F6LA 1ZXLA 3OH8A 4YAEA 1MV8A 2X4GA 3M1AA 3EC7A 4HFRA 4RPHA 2VCYA 4LVCA 4ZQBA 3QA9A 4HXYA 4BS9A 4CLRB 4XR9A 1P1FA 4WLNA 5LDGA 3A9WA 3OIDA 2EKQA 4IM7A 3JQFA 1U3VA 2HMWA 3RUCA 3WFIA 1GR0A 3C1AA 4RO0A 1DIHA 1DFGA 1DBVO 4PVDA 4B4VA 1WLYA 2AHRA 2BKAA 3H9QA 3GAFA 2OUIA 2WJPA 2CDBA 4OGWA 3FBTA 1PJCA 3GG9A 3ZWOA 4ALLA 1CETA 1E92A 1PJ2A 5F5LA 1X13A 1IY8A 4BNKA 2OMEA 5GY7A 3KLPX 3T4EA 1EK5A 1HYEA 1YE3A 1DAOA 4Y6RA 3LSYA 1QYDA 4YJDA 4XYEA 4DQVA 2Y0DA 1RM0A 3HN2A 2NTVA 1H6AA 5B4UA 3G49A 1VL6A 4KQWA 5AXDA 2YHIA 5ICSA 4J2HA 3ZWCA 4E5KA 4YT8A 2GSDA 4RQTA 1QLJA 1CF2O 2WSBA 3G17A 1FDWA 2LDXA 1QLHA 4JJFA 4L4RA 3WS7A 4B8ZA 4E2YA 4Z3KA 1YONA 5I7SA 3CMCO 3KYCA 1V35A 4PLTA 4Y6PA 3DQPA 4CM4A 3UICA 4D3SA 4HX5A 4JNKA 4GL4A 3JQAD 4GMFA 1Q0HA 4CMKA 3KZVA 1PJSA 4NI5A 3OIGA 1LX6A 2C5AA 2NVUA 1KVSA 4CM9D 3S2GA 3AI2A 3R6DA 4I9UA 5A9SA 1U1IA 3U4DA 1C14A 5CP8A 3AUAA 2ZTLA 4ZU3A 2HSDA 5A5EA 1U7HA 3WSWA 2DC1A 4RJTA 3VH2A 4CL3A 1E1LA 1E6UA 2FPGA 2GN6A 3PHHA 4ND4A 1ZXBA 4M86A 5T5QA 2YDYA 5MGBA 3NTOA 3ENNA 5CDGA 5FEUA 1N5DA 2JJYA 1PSDA 3V2UA 3WXBA 3GA0A 5DN9A 3VC7A 2VHWA 4UREA 4RDHA 4UVDA 3LC7O 1B7GO 2W98A 3CKYA 5G0UA 1BHSA 1MG5A 2V6MA 2I3AA 3WIDA 1LI4A 4NFSA 2IZ0A 3TF5A 1GTMA 4A7PA 2OFPA 2QHXA 3IQDB 2VZ9A 3SJ7A 3VZQA 4LRTB 1ISJA 5L4LA 3CSDA 3ZWPA 4TZTA 5DP2A 4PLCA 2NNLD 4YPOA 3L4BC 1ZK1A 3SLKA 1PU2A 3WGHA 3D3EA 2DPHA 2WD7A 3D0OA 1ZMOA 4Q3AA 4K6FA 4G2NA 4CR6A 1T4BA 4QO8A 4ND5A 3WGTA 2Z95A 4YRDA 1R16A 3RKUA 2ZIZA 1XR3A 4OKNA 3ZU2A 4CMJA 4J43A 2PFGA 2P9GA 3JQ8B 3GRKA 2FR1A 3PYXA 3E5MA 4PVCA 4FFOA 2AW5A 3KYDB 1P1KA 2QRKA 2R00C 4MVJD 4D0RA 1M67A 3D5QA 4Z0TA 5KVQA 3RU7A 3WDSA 2R6JA 4HBGA 2BLLA 4J90A 5DP1A 4DIBA 1NVMB 3RC2A 4LW8A 2A35A 4CV1A 1I10A 5EN4A 3HN7A 1NAHA 4F6CA 4O59O 1I0ZA 3UFXA 1XU7A 3MCVA 3KETA 4N7RA 1VI2A 4J16A 2AG5A 4BO8A 5THQA 3NDRA 5L7YA 1I2CA 4R16A 2HDHA 3JD3A 4E21A 4YEDA 3TWOA 4ZRNA 3WSVA 5BT9A 4F45A 1T4DA 4XGIA 3Q0EA 4DIFA 2PK3A 3MJ4A 1L7EA 5HS6A 2CF6A 2HKIA 5L7WA 1QYVA 3OJLA 1GV1A 5KNLA 3MOGA 3ZNQA 3EVNA 3VPHA 3I9JA 4GVLA 1H93A 2J3KA 4AJLA 4EI2A 4ZICA 3UUWA 1N2SA 4NDNE 1A5ZA 3MJTA 4W99A 2CFCA 1IE3A 3G0OA 1KC1A 1XGKA 4C4OA 1OI7A 2X0JA 2PZMA 4IS3A 4MDHA 1M76A 4EGFA 2NU7A 4XKJA 2BD0A 1JKJA 1PZHA 2Y99A 4BGVA 3DBLA 5L3ZA 5HWSA 1R4MB 1Z82A 1F14A 1PGQA 2P68A 2DLDA 3JQGA 5GZ6A 4YT4A 3W6ZA 1BGVA 3I9OA 3GVPA 3O4RA 1ENYA 2YQ4A 4CV0A 1EE2A 1Z7EA 3WIEA 5U9CA 3BMOA 4O63O 3PK0A 3WFJA 2H5LA 1X14A 1JTVA 2D0IA 3PHIA 5IDXA 4DUPA 2O48X 4DREA 3FRJA 5G0TA 1DLIA 2VHXA 3KM0A 2WWRA 4GGOA 2O50A 3EZLA 3I3OA 5I8WA 1XQ6A 2C20A 2VWHA 3W4IA 3VVBA 2G17A 4JBGA 2O3RA 3JQEA 5L45A 3WWYA 2JCVA 5I9NA 3T4XA 2EXXA 5JY1A 3AUTA 4JJGA 3HZZA 4E3ZA 3L9WA 4DGSA 3DMTC 3WX0A 1EK6A 4NFHA 4RF3A 3GN2A 4CM7A 3K31A 3DOOA 1Z74A 1UXIA 1E7SA 1RKXA 2J6IA 2QZ9A 5JAMA 3BHJA 3B70A 2VWQA 4J4BA 2AMFA 1I30A 4NPCA 3DO5A 1VSVA 1PJQA 3K2EA 1QXSA 4JP3A 4OAQA 3IL2A 1T25A 1IUKA 1TT5A 2J8ZA 3G3EA 1P74A 2DUWA 2WMDA 3COSA 1R0KA 1KEWA 2B4TO 4U0JA 5IN4A 3M2TA 3ZNOA 1H9BA 4JP2A 4OH1A 4WCFB 1GYQA 3F1KA 2QQ5A 1QRRA 3GR6A 1TVEA 4AJKA 2Q49A 3TZQA 4BOYA 3GVCA 4NIMA 1LA2A 4IIVA 1UDCA 4RVDA 3WGOA 4UULA 3WBFA 4Q3CA 3MTGA 1NVTA 3S2FA 5K0ZA 2HMSA 5L95A 1XIVA 3O8QB 4XQEA 3RC7A 4Y8VA 4A03A 2OZPA 1G6KA 3VPFA 1KVTA 5F5NA 4E6PA 1VL8A 3ICCA 3L4BA 1RM4A 1X7DA 2C2YA 3LT2A 4N5NA 5TGDA 1KVUA 1VM6A 2GYYA 3TNLA 2UV8A 3DEYX 3LF2A 4IGFA 2C7VA 5KKCA 2FSVA 1NVGA 1NX6A 3FSRA 4KTVE 3RI3A 2I6TA 4WPGA 5CG1A 3D4PA 3RC9A 3RSHA 1C1DB 1C3VA 3DHYA 4MVJH 4EITA 1C0PA 5BNFA 2O3SA 5CEEA 4E33A 3L6DA 1NQTA 2FP4A 3H5AA 3GEDA 4YYZA 3AUSA 2R00A 2GPTA 4MVJA 3ZHXA 1YS4A 1QV7A 4YJFB 3WNQA 4GI2A 1X1EA 2C54A 3TJRA 1KS9A 3GEGA 1L7DA 1H6DA 3HG7A 3OJFA 2DTDA 4CMAA 2PY6A 4S3MA 4J1TA 5TF4A 1PZGA 3U4CA 6ADHA 1SAYA 2O3UA 2BI8A 2F00A 1CQJA 3JQ7B 2AEJA 4YT2A 1I3KA 1A4UA 2DBVO 3FCOA 3PGXA 4D41A 3EK2A 3DAFA 3OQ1A 5COAA 2YJZA 2VRBA 3IMFA 3X2EA 4A27A 2LDBA 1M6HA 1ZJYA 3E8XA 4IDBA 4WLFA 4BNNA 3DMYA 4DRYA 2HRZA 2B5VA 5IDQA 1HE3A 2QRJA 3VH3A 3NT4A 3D3WB 4DWVA 5KCZA 1FMCA 4J9VA 3EUWA 2PR2A 1XA0A 1LSOA 2ZJ1A 4DPKA 1I2ZA 5L9AA 4R01A 4D42A 3JD0A 4BGIA 4BKOA 3A1NA 2FOIA 5DBFA 2NTNA 5C3MA 2EKLA 3FNEA 1DPGA 3IUPA 4J91A 2ZB7A 4B4WA 2JAPA 3RUIA 2FR0A 4UVGA 4XIYA 1ZK3A 4QECA 4AL4A 3C3XA 3ULKA 5G4KB 4IZHA 3I5MA 3PRJA 1XU9A 3QWHA 4OMUA 3QVSA 1O94A 2O3QA 1RWBA 2Y1EA 3ZV6A 1M6WA 5G0VA 2ZK7A 4D45A 1U3UA 2DAPA 4WLUA 1DFHA 3QSGA 4NG5A 4CM8A 1N1GA 4II2A 4BGUA 4XYGA 4D43A 1R6DA 3LC2O 1P45A 4BMVA 4S1VA 4R54A 4URFA 4BKRA 5JCJD 3U09A 3E82A 1BSVA 3DZIA 3ZNNA 1J49A 3QE3A 5TX7A 4OSPA 4J49A 3JD2A 4TWRA 4AVYA 4FOOA 3GVXA 3HADA 4XIJA 1KEPA 2HLPA 1FF9A 1VJ0A 1ZK0A 3JQ9C 1U7TA 4XA8A 2YY7A 3L9XA 4JIGA 3H9JA 5COBA 3W8FA 4MOWA 1J6UA 3S2IA 3SBOA 4EEXA 2CVZA 4IMPA 4W4TA 1SOWA 4WGGA 3WGGA 5IDYA 5T57A 3B1FA 2VUTA 4E4YA 1KBZA 2DU8A 3N58A 3DMTA 3INTA 5ENDA 4DPLA 4XDYA 3ASUA 5IZCC 1AHHA 3E6AA 4Z0HO 1SOVA 4GLOA 5A04A 5LDHA 4XQ9A 4AFNA 2AE1A 5EERA 1ZEMA 3I9MA 4CODB 7ADHA 3O9ZA 2WM3A 5DBGA 1PS9A 1GZ3A 1RM3A 2XXJA 4Z9XA 5JO9A 5H81A 1K3TA 1E3WA 3L77A 4RVFA 1T1RA 2B4QA 4GAEA 3RAJA 3TQHA 4YAIA 4BMSA 2VNSA 4AJHA 1IL0A 2YHUA 2P9CA 4L4XA 4E13A 1D1SA 4O0LA 3RIHA 2YV1A 4XYBA 3GVIA 4L9RA 1G0NA 4MIEA 1MG0A 1JN0A 4A0SA 2OGUA 5K9ZA 1LDEA 4J4HA 4JQCA 1RYDA 2VHZA 1O0SA 4LCEA 3F4LA 4R5MA 3V1TC 1H0KA 3PFFA 3RUFA 1WNTA 2X0RA 4IJUA 3BMQB 2NVBA 1BRMA 3IDSA 4FR5A 4I9HA 3P7MA 1F8FA 2EF1A 4E0BA 4ESOA 2AQHA 3A4VA 5L4NA 4GLLA 5TS3A 1E0DA 4FJ0A 1LLQA 1D3AA 4IQ8A 2NQ8A 4DYDA 3HE3A 3K2BA 1JDJA 1W4ZA 3MJVA 5FI5A 4E2WA 1E5QA 5A9RA 1Q0LA 1E5LA 3PHJA 3Q11A 1CYDA 1OZAA 3UN1A 3DWFA 3GPDG 3PDUA 4E32A 4YAJA 4YACA 1HRDA 1T1SA 4M87A 1LDBA 4OSOA 1B3BA 1LLCA 4BNYA 1EBUA 3FBGA 3WR5A 5IF3A 4OYRA 1V0JA 3U3XA 4BO9A 2ZYDA 4B4UA 4ALJA 5AXBA 5TT0A 3AOEC 3F3SA 4DLBA 1E3SA 5G4LA 3N74A 3NT5A 4WNIA 1YB4A 5EMHA 4HKTA 5TIIA 3UKOA 1YQXA 1IPEA 5EIOA 2OBYA 3WTBA 2A9FA 3OJ0A 5B12A 4O5OA 1GD1O 2VHYA 5L51A 3PHGA 1ZNQO 2Y1CA 3CEAA 3PXXA 5H83A 2GGSA 4ZD6A 1SCUA 1WP4A 2I67A 2G1UA 3DBRB 4DIOA 3FI9A 1YB1A 4ND2A 1K89A 5ENVA 2Y93A 2YW9A 4U8GA 4XYLA 2X9GA 3WQRA 5IJZA 3P2YA 4FS3A 1E3EA 4FGSA 4QO7A 5BSGA 1XQ1A 5BQFA 3GGOA 1QKIA 3IC5A 3H65A 3H7AA 3FNFA 4YJHB 4R5HA 2PGLA 2C7GA 1YBVA 4MVJP 4DMLA 5CDUA 4E12A 2EJWA 2W2LD 2V6GA 2B37A 4A5OA 2I3GA 4NZ9A 3U9LA 2JHFA 2EKPA 3E9NA 4EZBA 2Y1FA 3NUGA 4IJWA 4I08A 4BNZA 5KVVA 4TQGA 5IXYA 5U1PA 1R0SA 2UYYA 1F06A 3ZGYA 2Q4EA 2YV2A 3KXDA 1MXHA 1KVQA 4GH5A 1RYEA 5AOVA 3GMDA 2VRCA 1UDAA 1K6JA 2CD9A 4M89A 1IHYA 1PQUA 1UAYA 2X9NA 5CAEA 4DPMA 1EMDA 4CMHA 2BRUA 3VPXA 4KDFA 4XYMA 1X1TA 2Y66A 3X2FA 1E6WA 4ID9A 4KZPA 5FF9A 2NVWA 5KWEA 3QY9A 1P0CA 3TSCA 3V2GA 1ZBQA 4CQLA 1DFIA 3W1VA 3JQ9A 1BVUA 2O4UX 5AXCA 1Y8QB 2R2GA 1B16A 1FK8A 3RFTA 1WDLA 1ZJZA 3FR8A 4ILKA 2JFGA 4JX8A 1PIWA 4XX0A 2BHLA 3BTSA 4G81A 4J6FA 4ZQEA 1GY8A 3VHRA 5IZCA 2HMTA 4NJOA 1U5CA 4E2ZA 1PQWA 3ADPA 4YB8A 4HWKA 4KUEA 4WOKA 2J3JA 2PV7A 1U4OA 1Q1NA 3GDGA 1UZMA 3H9UA 4R1NA 4W7HA 1HZJA 4B7UA 1GEGA 3TZHA 3SVTA 2C2XA 4I5DA 5TJHA 4B7XA 1XSEA 3E5RA 1LNQA 4RPLA 4DQXA 3AK4A 4CLOA 1P1RA 1QYWA 4TZKA 1ZSYA 2EW2A 1T2DA 1SMKA 4FOSA 3LYLA 4IJKA 4PG5A 3WQQA 5ER9A 1P1IA 1PGOA 2X23A 1AXEA 1C0LA 1PGPA 3DZFA 2IRWA 1GCUA 3OF2A 3MJEA 3OM9A 4FJ2A 4CLDA 1LDNA 2I65A 1EVYA 2X5JO 1YBAA 4IUYA 4OXYA 4R69A 3DZHA 2VUUA 1U3WA 1ZVMA 1HF3A 1JAYA 4II3A 2A92A 3HFSA 3MZ0A 5F21A 3W8EA 4Q3BA 4CM1A 3EHEA 4GKBA 1A9ZA 3PIDA 3DTYA 1ZW1A 3QJ5A 1J4AA 4W82A 4AJIA 3WG9A 4IY1A 1GQQA 1I3LA 1K6IA 1IZ0A 2NV6A 3SC6A 1JQBA 4AJEA 3DBVO 4UEOA 2AA3A 2X5KO 1ENZA 2BI7A 4FC6A 3S1LA 3JQCA 3ONDA 2Y68A 3UXYA 1IB6A 1EDOA 1V3VA 2JD0A 2PH3A 1DDOA 3BA1A 3FHLA 9LDBA 1MX3A 1HDZA 4P4LA 3L0DA 4YRAA 1I5RA 1LJ8A 1DEHA 1PX0A 3D64A 3QP9A 1HDRA 4EYEA 3RASA 2I5PO 5DNAA 1IOLA 4BNTA 1VE9A 3BXXA 4BV8A 3ZV4A 5A5FA 2Y1OA 2HRBA 3ZWVA 2JAHA 3ITDA 3RCBA 2YHIB 2GZ3A 1U8XX 4XCVA 3AOEA 3I9KA 4ZN6A 4PLHA 5B4TA 3GDFA 1NFQA 4QXMA 3WMXA 1LLUA 3VH4A 1Y5MA 3KYCB 2P91A 3FPCA 4RLHA 5F1KA 4CM4B 3CZMA 3WYEA 4PG7A 1C1XA 2JFFA 2IZZA 2O7QA 4R3NA 3VOSA 3GT0A 4Q3DA 4B7CA 3WGQA 6LDHA 2D5AA 2QYSA 1EFLA 1YH3A 1JW9B 2HK7A 3ETGA 2OXIA 3P2OA 4D46A 2JHGA 4IDAA 2NVUB 5A9SB 4GKVA 3PQFA 3ZN2A 1DHRA 3BMNA 1WVGA 5CG2A 4Z9YA 2W4QA 5KVSA 2YV3A 3DHEA 1HL3A 4UEKA 4ZQGA 3I9LA 4ALKA 4RPKA 4C7JA 3VKVA 4UEJA 3ZU5A 3D4OA 1EUCA 4XDZA 1B14A 2RBEA 1E3JA 1Z7BA 2W2LA 4JCOA 4OQYA 1UXJA 3ROKA 4F3YA 3DC2A 2CDCA 2B0JA 3MOIA 1PZEA 1YDWA 4NBRA 4CL8A 3P5SA 1M66A 2BH9A 2TMGA 1TLTA 3PEFA 5JFOA 4RDIA 4AJ4A 4NHEA 2B69A 1Q7CA 2X8LA 4AJPA 4YTEA 3R0IA 1SEVA 3ROMA 1ZKMA 3WQSB 4EJMA 5JYDA 2ZTUA 2B4RO 1P9LA 1UXGA 4M54A 3O38A 3M1LA 1HLPA 4QSMA 2D3TA 2JKVA 3VZSA 3KEQA 3JYPA 2WD7B 4YCAA 3Q2KA 1W73A 1YDEA 2DBRA 3Q9NA 1EBFA 1TA4A 4UVIA 3AM4A 1I01A 2NTJA 2AEFA 3ZU4A 2DT5A 2NADA 2VTDA 1YO6A 4PLFA 1GADO 1OC4A 4ZHSA 2DM6A 1E7RA 4MINA 3WYCA 2V7PA 2D59A 3ROQA 4ALNA 3DZGA 4FFPA 1AGNA 3KBOA 4EDFA 3PWZA 4CMEC 5TLSA 4K1LA 4LCJA 2EGHA 3PTZA 1OC2A 5EQFA 3NDIA 3R3SA 4FN4A 3I6QA 3RBZA 4BNLA 3C7CB 3FN4A 5ILOA 2E4AA 1WPQA 5T67A 5ILGA 3AU8A 4GX5A 3PDJA 1CWUA 3UGKA 1Q7BA 4WEQA 1KC3A 5I9MA 3GZ4A 1UP7A 3PVZA 2FMUA 2W8ZA 4MVJI 4NBTA 3D7LA 2GZ2A 1NYTA 4NFYA 4NMHA 1NWHA 1ZIDA 2I99A 4MIOA 3S55A 1VKNA 2BGMA 4RVUA 1SNYA 4KUHA 1GEEA 4Z9FA 1YRLA 3RROA 3K5PA 2HJSA 1KYQA 5JW6A 1ZK4A 4M1QA 1GQYA 2CUKA 2RHCA 4BNIA 5B4VA 2RAFA 3SX2A 1XLTA 2WE8A 3QWIA 2FY8A 1WZEA 2Q1UA 1X7HA 2BGKA 2NM0A 2QIOA 1DJQA 1R4NA 2VOJA 3UW3A 2VT3A 3ANNA 1PJ4A 3L07A 2ZB8A 3C7AA 4CMBA 4IGEA 4OXKA 5JAZA 2AQ8A 2X58A 1TT7A 3DBHA 3GRPA 4HP8A 4J3FA 4L4SA 2DTEA 2X6TA 1U4SA 4BV9A 4JXKA 2X0IA 1XHLA 4YJGA 3TFOA 3EYWA 1GUZA 2BGLA 2PD4A 3IP1A 4HNHA 3DBLB 4KWIA 4YQZA 4FDAA 3EW7A 3JQGB 3NX4A 2CNBA 3JCZA 3QVTA 3U5TA 1HSZA 3NRCA 4QEDA 4TMFA 2VZ0A 2XF8A 1YOVA 3ADOA 1DRWA 3BMOB 4CMIA 2PTGA 3LVFO 4RGBA 1B8VA 3PQEA 4ROSA 3M2PA 1E77A 1DRVA 4CR7A 3JQAA 4BQPA 2Y05A 2ZB4A 5DDIP 4D0SA 2WD8A 4Q3EA 2VQ3A 5DBIA 1SEPA 4CM9A 1FJHA 1QYCA 4B8WA 2ILTA 3IAHA 5HM8A 4Y98A 1F0YA 3ZHBA 4EJ6A 3VZRA 1BXZA 1LU9A 3GPIA 3NV9A 4LSWA 2VYND 4XQCA 4I9NA 1R0LA 4CLHA 1A9YA 2DKNA 3HB4X 2J5RA 3LT0A 4NJMA 1D8AA 1PS8A 4JLWA 4DLLA 3OEWA 4CM3A 1PWZA 4K26A 1KVRA 1ADCA 2P4HX 1ZSNA 4CV2A 2C29D 3G1TA 4JGBA 1HE4A 2GNAA 1BXGA 1HYGA 1NTOA 1LC3A 4RPJA 5IAAA 2ZYGA 4UUOA 4GX1A 3RJ9A 1N8KA 1MP0A 1VJTA 3JYNA 4GVXA 3GZNA 4YT5A 2EP5A 4NR0A 1P77A 1Y7TA 5JPIA 1WAMA 1JA9A 1O89A 5JCXA 2NU6A 3INRA 3NTQA 3BMCA 4KDEA 4PLZA 1TT5B 3ZV3A 1NPTO 3GLQA 4P4NA 5CEJA 3F6YA 3KUXA 3VDQA 3I4FA 4E2XA 1ZH8A 3UCFA 3Q9UA 1C1DA 2GUGA 3DTTA 5L4SA 1TXGA 5ITVA 3FD8A 1UAGA 1N92A 3PP8A 3BZUA 2PWZA 4OOFA 3K8ZA 1JU9A 4B3HA 4R9RA 4BNXA 3HDYA 4DYVA 3BTOA 2VWPA 2J3IA 1UZNA 2PLAA 4UAGA 3QWBA 4JK3A 4YA6A 4RF2A 1QP8A 5MDHA 4BNHA 3GOHA 9LDTA 4DC1A 2CVQA 4ZQFA 2UAGA 4IS2A 3WGYA 4Y9DA 2JL1A 3BIOA 3UAGA 1ENOA 1NQ5A 4YWJA 1Z73A 3RD5A 1MFPA 2Q45A 1ISFA 1ISGA 2YDXA 3PIIA 4CQMB 3Q3CA 3QVWA 1P1JA 1CDOA 5JXWA 1P31A 1T26A 1E7MA 4FFNA 4Y67A 2SCUA 3V1YA 3ROPA 2WTBA 4HADA 1IHXA 1Y81A 4BO6A 5IXSA 2E37A 3OBBA 2IZ1A 4AJOA 4CMEA 1M75A 3CMMA 2ZTVA 1PS0A 3G79A 3NKLA 3OP4A 1LRJA 1ISIA 4KOAA 4XB2A 1JAXA 1O95A 1XCBA 5FYDA 3PLRA 3EAGA 3H2SA 4D79A 2NWQA 4RZIA 4U6QA 1YJQA 3RQSA 5F3RA 5THKA 3KRTA 1VC2A 3H3JA 4PRLA 1FXSA 4TVBA 2E6UX 2CVOA 3V1UA 1ONNA 2EHDA 4MKZA 2VOEA 2E48A 2UUOA 2WDZA 4Z3DA
chains in the Genus database with same CATH superfamily
1K66A 3QE2A 4EKNB 1W44A 2OCPA 4Q03A 1Q84A 2ERXA 2O2HA 4ZVKA 3R9XA 3GRUA 2WFLB 3BSYA 3MPUA 4OO3A 3GJ0A 3LQQA 4JI3B 3ZW8A 2WQ7A 3TG8A 1M54A 1QV6A 2H7YA 3GJ6A 5FBWB 2JGDA 4FCCA 3GIWA 1N6LA 3DWIA 4JJ8A 4LYJA 5LKRA 3MWDA 1QGOA 1DV2A 5IBQA 5DF1A 3A9SA 3NHLA 4W7SA 4FYMA 3AY7A 1A8PA 5AHKA 5AM3A 5JI3E 4RLSA 2EJVA 2FQWA 3FOAA 4HXEB 2WSYB 2AOTA 1CQIA 4LXGA 4CFSA 5C5IA 3HWRA 2I9KA 2EGUA 3IJ5A 4MVJG 5JZMA 2JZOA 1CEXA 1KMNA 3AHCA 3EYAA 1FC0A 3HFRA 1Y3IA 3L0ZA 2CFOA 1U31A 3AERA 3K92A 3OICA 4IRUB 4X54A 4AP6A 1V43A 3RU9A 4KN6A 3L02A 2KBEA 2V5VA 4OHKA 2IUUA 2PKYX 1W34A 1FFDA 1NOIA 1XYVA 4BO4A 3S5JA 3JD4A 4FNAA 4HL6A 4R1LA 3RQIA 1NLUA 1W47A 4Q1FA 3JZFA 1MA3A 3CX4A 1BCRA 4PYRA 3AFMA 4ZEXA 1KJZA 2V7QD 1KEUA 2V4ZA 3DYVA 3JQBC 3V4RA 3LT1A 4P82A 2C59A 2UDPA 3GLUA 4ZOLA 2H9IA 5CTJA 1JKFA 4KEAA 3CCFA 4E03A 3QKIA 2EG9A 3R7WB 2DCMA 2ZUTA 3W9YA 4B9EA 1A27A 4C5CA 1CRWG 1UDWA 2OLJA 1AHIA 1P2FA 4TTVA 5HZKA 4GR4A 1HK7A 4PFKA 2GZDA 4IPTA 2P77A 2G0AA 2WJIA 1OXTA 3GUUA 4H7KA 1Y3HA 5L53A 4PX2A 2E4VA 4YCLA 2PR7A 1Y4SA 1MB4A 2YWRA 3KSDO 2IA5A 1JMKC 1L5ZA 4B5KA 4PYJA 1KO1A 2PJUA 3OCXA 3O9MA 1K5DA 5I6DA 1BVRA 1JJ7A 2OZEA 4G65A 4HCJA 1U2PA 3P9RA 3PYLA 3REFA 4MUHA 4GMDA 4GWKA 2Y9MB 4EJSA 2HLNA 1D6MA 1VPEA 4UMVA 5FKJA 4ERXA 1YZLA 3UENA 2GK3A 1NC1A 1VFPA 2O2YA 1DBWA 2IY8A 5F51A 1U3DA 3AR3A 2FMTA 1HE5A 1Q3TA 3B1YA 3H1GA 3NATA 4FSDA 5FUYA 4EY8A 2BYTA 4BN5A 2I33A 4KNWA 2WA1A 1OR8A 1YJ5A 3O93A 5AVQA 1WD7A 1RHUA 3SXUA 4MHTA 4XUGB 5HHTA 4IUCS 3CXRA 2X4LA 1T2CA 3Q0TA 3Q6IA 2V97A 4PLGA 3I04A 3O8CA 1OGJA 3DVSX 2ZRGA 3ANYB 4GU5A 1KZYC 4OJMX 5JAOA 3AVTA 4R1SA 4EO4A 4LDPA 1QZTA 2WA2A 5DEOA 4DIMA 1AHPA 4IOJA 1NI4B 3ON5A 3FUXA 1YXMA 3L0IB 3VAYA 1L4EA 1BA2A 1MRSA 1XZCA 1Z2NX 3ENVA 1JQ3A 1SU7A 2B8EA 4RJKA 3FCEA 4WN9B 1QK5A 1XWIA 3OQNA 1OLXB 1P4AA 4KXLA 4OHPA 3OTQA 1WNFA 3D31A 1N33B 1L4YA 4QUGA 5HFAA 1C80A 4GR5A 5BWLA 4U6NA 4GOXA 4MVJE 3IBCA 2R1TA 1X0VA 1CZRA 2CLCX 4KE8A 4Q7QA 4UDOA 1N9GB 3ZV5A 1ZGGA 2HYIC 3D6AA 4D3ZA 4C20A 1ST2A 1YT5A 3ZG6A 3WB1A 5H80A 3AL2A 5AW2A 5JO0A 4E5YA 2GLXA 3I0MA 3L7DA 4ZYTA 1JQEA 2HK8A 3AHDA 3E7PA 5CR9A 3QU2A 4NOJA 3ZCVA 4DTIA 4EB8A 3GLKA 3ZDCA 3P2IA 5FUMA 2O7VA 1V16B 3LA8A 2XNCA 1P5FA 4TUYF 2GLUA 2EFCB 2HCJB 3TEFA 1V1MB 3CF4G 2UXBB 3COVA 4IO1A 4L73A 2DB3A 4DA9A 1OYWA 2ROQA 1ONPA 3MTJA 3ADBA 5IANA 1GV0A 3H9GA 4AKHA 2B1GA 2NV2B 4MO9A 4OI1A 1T1IA 2ZAMA 1D9XA 2FEWB 1LNSA 1VZ2A 4H0FA 5FTWA 1FSPA 2R96A 5LZ8A 2SKEA 4TRJA 3GLGB 1SWWA 1EU1A 2OORC 4NZMA 4G2TA 4UUPA 4WD3A 1M72A 5DCWA 5EESA 4K3UA 3LHIA 1PGJA 1TMGE 2WNSA 2FXVA 3S1AA 1F17A 5JROA 4BKUA 3VDRA 2IXFA 1ZMTA 3WIUA 1XCMA 1M8PA 1X70A 3NP7A 2O8VA 5KJ1A 3OEYA 5PNTA 4E5NA 2BFBA 3HDGA 4N6GA 2V7WA 4F9FA 1R8YA 2CNDA 2I2CA 3AMVA 4OIMA 1KZHA 3ZJUA 1EXWA 2BFFA 3RVQA 4FR0A 4DSTA 3QKRA 4RD2A 3DOIA 3L5OA 1NXVA 2VHVA 1YJ8A 3PFWO 3OZXA 2OSBA 4GLBA 4K05A 2RBKA 4LY3A 3I1YA 4M0KA 1SQ6A 1YS2X 4F12A 2I4LA 3MRTA 3OAAD 4N7JA 2BR4A 1N2IA 4GBJA 4JI1B 3DG9A 2HMUA 5CVUA 2W70A 4B47A 4BECA 2ZE8A 3COWA 3G1WA 5ALGA 5GTDA 4A8TA 5BUQA 2XE4A 4J0GA 2AFHB 1FPQA 2AUMA 1RXWA 3QW2A 1ZQ9A 4YMIA 3LECA 3BN3A 1GR1A 2BEVB 1ZITA 2GM3A 2OL4A 1C4WA 2YUTA 5H16A 4B4OA 1E98A 4ZT3A 1G5RA 1KYXA 2GKOA 2ID8A 3E03A 1AK2A 5I9SA 3WL4A 1KJQA 4FW8A 5G2OA 4KR0A 4FHCA 3ROFA 2J7KA 4W7IA 1ORVA 4F3RA 5CYGA 4RQUA 4D0NA 1GUDA 1GKLA 5CLQA 2NU9B 2Y67A 3WYAA 3OJOA 4L9AA 2LBPA 2CMKA 2ZZKA 3HL0A 5L3SB 5FB3A 4E51A 2YNMC 2YNMD 4UARA 4WNCA 3WMWA 4D6XA 4E5MA 1DUVG 3CS3A 4JXJA 3Q5GA 1DXYA 2YJNA 2OHVA 3STXA 4ZEVA 2G9UA 3RBXA 2WKQA 2D5LA 3VC2A 1YUBA 2GO1A 3DR3A 4Z86A 2D0DA 3E3MA 1ZCJA 1E58A 1W0JA 1OW3B 2V8BA 3Q41A 3GRCA 1G41A 4RY0A 3WJ2A 1NBWB 3LY5A 4ZVRA 3PWSA 1H2EA 5IABA 2WTNA 3FY4A 3E18A 3CH6A 1T1GA 2D1RA 1N1EA 1Z25A 4LV6A 3STHA 2G36A 1Y42X 2VNAA 1II0A 3DNMA 4GEGA 4YRNA 3H6KA 3IYLW 2IYPA 4LOIA 4NNJA 3OKCA 2IH2A 2BR5A 5H7XA 5J40A 2XVAA 1GQ2A 1X3SA 4WA8A 4FGZA 2CBXA 3I6YA 4J7AA 1H4QA 4IRMA 3RIEA 1QFZA 1HTTA 1M1ZA 1ABEA 2FMIA 3W3AH 5B30A 1L7QA 1IIBA 3ICPA 3HPQA 3WC4A 2Q6VA 3ZQKA 2YHBA 3PQ7A 1IHUA 2BC9A 2BGUA 2K2WA 3QTTA 5EAIA 5FWYA 5IG2A 2WB4A 1ZHOA 4YBRA 2VDOB 4JKIA 2GN0A 4V1CI 4LWOA 4Z6KA 4PC2A 5K8IA 1QRDA 1SUFA 2NACA 3BYZA 4XGKA 3K1AA 1D2EA 4BZZA 3LCRA 4MWEA 4GL2A 3UQZA 4TMKA 5AW8A 2QD4A 2QN9A 1FP1D 2AHOA 5HCIA 4N54A 1CDEA 1KDZA 4RCVA 4WEOA 1DOAA 4HEA6 2FSHA 1W9MA 3GLFA 2X9LA 4U5XA 1NE2A 2GILA 2ISQA 3JWHA 4GM4A 2PZGA 4Z9AA 1JJVA 5FI3A 3R9KA 1V2GA 4O2LA 4CL0A 3IURA 3KFVA 2GLTA 5FWDA 3S2EA 1KAEA 4LN1A 3SQLA 2MCFA 4F71A 3AP2A 1O8BA 5JBIA 3E5HA 2BSAA 3I9FA 3TXYA 1J7JA 5E7QA 5JTTA 1GUAA 1YQEA 1VJ1A 2EARA 3HJRA 3NEAA 3SN6A 3E22B 5SYAA 4JI8B 1T6NA 4XFDA 4EARA 3FGNA 4YP7A 4J76A 3VBCA 3D5TA 3IEPA 1USVA 4ZVOA 3SKXA 2X14A 3JR7A 4LQ4A 3ZEAA 3AVWA 1RMYA 1BTOA 2C7BA 4TN5A 5IJ0A 4G0XA 3BORA 4PSAA 1WY5A 3CB4A 4LYYA 2BF7A 1BHQ1 2VI5A 4RXMA 1VE1A 1N0VC 4AQYB 4D9BA 4MW5A 1FTWA 3VGJA 3FRHA 3RR2A 3O1LA 1DWOA 2AZXA 2VP5A 1NSTA 1H2BA 1NRJB 3B5EA 3EBPA 4DCGA 1SU6A 3DOFA 3TZLA 4X97A 5DGTA 1YU9A 1DO8A 2HA0A 4IZ6A 4D9GA 2GXQA 4KOEC 1G0OA 1ISHA 4FC7A 2BFAA 3MPOA 4GSKA 3HBLA 2FN7A 3VNSA 4FE7A 4IXNA 2JGNA 1P2TA 2J46A 4MQEA 5D3QA 4YUYA 4KPUB 4ZKDA 1G7SA 1QDLB 2Y76A 4WFQA 1YFJA 1U9JA 1YI8A 3DB2A 2OO3A 1PJBA 1KH2A 4IIBA 1INLA 2XA1A 2VPQA 2FSGA 4XGRA 5GMOA 4G9EA 1W8DA 4LWQA 4CKCA 2OV6A 3ZY4A 2E4UA 3EEIA 1B3RA 1UINA 1RXSA 3IQWA 3ND7A 1ZGZA 4B3BA 1ZONA 3GQBB 3F74A 4JNCA 4WOJA 5FLEX 3RAGA 1LY1A 1Z29A 2PDAA 3W6UA 3VHLB 4OL9A 1K2WA 1OAAA 1UFKA 2YWXA 2OEPA 3VR5H 2ACWA 2SECE 2IYFA 2ZJ5A 2W6ZA 3FWHA 2YFQA 3DXXA 4BE4A 2O20A 3KWFA 5H4GA 1GPDG 3L43A 2XHEA 4TYMA 1P61B 4BWGA 1U9YA 3BF7A 4YONB 3WMFA 2Q2OA 4RVOA 3S2UA 1H66A 4BLVA 3L7OA 5AJUA 3A6ZA 2FEOA 3GJRA 1JEQB 1U8TA 3USZA 1UR5A 1P4JA 2G04A 2PMFA 4DLUA 2NPIA 4BFTA 1J22A 1KH1A 4X63A 4O08A 4RXTA 1TQ6A 3FOWA 5FI0B 3X1XA 4ZV7A 4DMHA 2JGRA 4OP3A 5BN3A 1ORIA 5I5GA 1U28C 3WZLA 2BHTA 2HJ9A 4IMRA 2FRDC 5D5HA 5KYYB 4CZ2A 2Q5FA 1R6AA 4WK0B 2EDCA 3EVTA 4IHQA 5B64A 1CR1A 1NXSA 4QL3A 2OBLA 4RMNA 5KNBH 2ZBEA 4R6XA 3P96A 1FFYA 3G2PA 2QT1A 3SF0A 1THTA 4YXFA 4L8WB 4EABA 5DGXA 3BMNB 4YDQA 1EJBA 1KY5A 3TLAA 5J2UF 4EEZA 1W36C 1N3IA 3LDHA 5EHIA 1WKVA 2CXQA 4HEHA 3AJEA 3ST7A 5MF6A 1CG6A 1PAUA 3JQ6A 1E1DA 4QLAA 4U9UA 1TOAA 4LYDA 4CLEA 1J1UA 2PE5A 3V5NA 2IKQA 1MB9A 5CNKA 2DEUA 1R5JA 3KR0A 3AWIA 4HB0A 2K5UA 1SM4A 3KEMA 3MCZA 1QGAA 3IHTA 3OUUA 4GVPA 1JEOA 2PRSA 1ZYUA 1JR4A 4J7XA 1OZHA 2FWIA 2W6OA 2YQ5A 4B3SB 1FU4A 4HN9A 5FTJA 3THWA 1XNQB 1CJKC 2JBAB 4Q1EA 4G07A 4I8XA 4P6VF 4ZGWA 4EFMA 2B5WA 2GCGA 3DMHA 4MQFB 3P9PA 4UVEA 1OBOA 1NP3A 4EI9A 3U9SA 1A88A 3DSRA 1XFDA 2ECPA 4FYWA 2CB0A 3ZW7A 2IBTA 1PK9A 5D84A 1MFZA 2PH5A 3RANA 4AJ2A 1NW8A 5MN6A 1SXGA 1G20A 2ZJBA 2RHGB 2QRVA 5BNTA 5FO0A 4I50B 1GL7A 4X71A 1FFXB 4AICA 4QFDA 4IR7A 3T6KA 4XD7D 1A7KA 1TUGA 4JLKA 3BRCA 1TVKB 1OH7A 3OCWA 4UM9B 4OHVA 1S4QA 2GN8A 2WVHA 1HDYA 3KLMX 2XDQB 1T4CA 1NZFA 2AYYA 3N2YA 2HHAA 1PT7A 1CJTC 1WMBA 4B2PA 4KCGA 5DGCA 2HO5A 5H02A 3H1AA 1LW7A 4WKGA 1JHQA 4YREA 2FKAA 3UATA 1ADYA 3N2NA 5BSRA 3LPLA 5LYJB 1IJKA 2GN4A 3LCUA 2P40A 3EXG2 1OYOA 2OUKA 2V98A 4R3WA 2RGXA 4FI3F 3HVIA 4KNYA 4I5EA 3W8RA 2FW1A 4FYKA 1CE8B 4PAMA 4PG6A 1JDPA 1B00A 1C7FA 4J0QA 1Z6GA 3VMFA 4AKEA 1VOTA 121PA 3LZ6A 3VM6A 4C03A 1OFGA 2GWRA 3OCYA 1MVNA 4HDNB 5AM4A 1R4MA 2Q3CA 2QS9A 3MNFA 2OAP1 1NV8A 3NWPA 4EHAA 3IR5A 4Q3NA 3MEQA 1EVEA 1RAIA 1U8CB 3IEKA 3UJCA 3C3PA 3IP3A 3ZWXA 2X5XA 3DM5A 3EQ7A 2HFJA 3QBVA 2HIGA 4UVHA 4QTZA 2FDCA 1C9EA 2PJRA 3KTFA 5ALFA 3QY0A 3CRVA 3QYJA 5BVHB 4LX8A 2CL5A 4WBXC 1U0NA 1IYZA 1QFJA 4WNAA 5AVJA 2IEDA 2D2VA 3EDRA 1V4NA 3THWB 1CULC 2O7NA 3QU7A 2VNKA 3BWBA 2FOLA 2WF9A 3A2LA 4BNWA 4LG1A 4C0SA 4RMIA 1N5LA 1E1MA 3MOSA 4PRZA 2G06A 4WESA 3LUBA 2QYHA 2AWOA 5ADWA 1W0KD 1LDGA 1ZOSA 3CN9A 3IAEA 5FORA 3UCEA 3U7GA 2WMNB 4FDUA 3GW8A 4YRGA 1DOHA 3P2KA 3TTTA 4DR3B 5T8KA 1QLWA 1Y9EA 3LUKA 4A2QA 1RWMA 4MMZB 1MAVA 4FIZA 4GPAA 3PPYA 4UAUA 1OTHA 1N0HA 3T5BA 1Q74A 1F3OA 2VPYA 4LVOA 4MCIA 4CUKA 2GT1A 4Q4JA 1SCQA 1U2DA 4JYPA 2YIDA 2PS9A 2NXWA 3I4CA 1XK6A 3KTDA 1T6YA 4QT0A 4WASA 4YIHA 5JI2E 4LMPA 1QGZA 3TECE 3GP3A 5FWAA 5C1BA 3IOCA 1HDCA 3BH6A 1EQ2A 1XCGB 4RD4A 5JSZB 2X77A 1XPOA 4MB0A 1HMYA 4YJGB 1KO5A 2H17A 2IPAB 1CW2B 2H1HA 4W5QA 2VAMA 3GCDA 3V1LA 4F46A 2YJ5A 4BUCA 1DV1A 1TKAA 2L18A 2YWGA 4PLWA 1FRVA 1RP7A 3GNQA 1X7ZA 1IATA 2C9DA 2ZCVA 3NGXA 4V0RA 1W2HA 3D3NA 1N6HA 1XNJA 2BFEA 3BWCA 3S6JA 1GNQA 1H1LA 1MQAA 9GPBA 4BFVA 5DX0A 2HUNA 5HJ5A 5JJBA 2GZ1A 1N2XA 2CSXA 5F2EA 1I3MA 1S2OA 1JT9A 1VE6A 2HWUA 1VIVA 2R8OA 3PFGA 4RAQA 4OREX 2IX3A 2V96A 5HFJA 3CZRA 4O4LF 3KB8A 4CUJA 4L8LA 2JLCA 4ZOEA 4LJ5A 2OLEA 3DMRA 3J80A 3RV4A 3PFBA 1MNQA 3QU4A 4BBZA 4EATA 1UDBA 3R6TA 4LBWA 4ETWA 1U9CA 3C85A 3NFYA 5DM60 5I7EA 1XZQA 4EPWA 2JFQA 3MBKA 1ZVKA 4F3TA 1NVDA 2G80A 5A02A 2G40A 4TLLB 2WUDA 1YBHA 3RTEA 3MWEB 5IZ4A 1WA5A 2OHHA 3BL5A 3HA3A 4ZI7F 1LF5A 3TRKA 3ZE2B 1IDOA 5BSEA 5IX8A 1N3LA 1J0XO 1R0XA 2QV0A 1SXIA 3EUEA 3K53A 2VL7A 4FTWA 4MEJA 3LGXA 4NBUA 3RHTA 1CQWA 1WETA 4OK6A 3WKDA 2WYVA 4D3DA 1UBEA 4B3GA 2VP3A 3F9IA 4DM7A 1VG8A 3IIEA 3N2ZB 4DQDA 2D1TA 4Z4IA 1DTWB 4NOLA 3STUA 4AKTA 1DC6A 2GEBA 4DCPA 2WFZA 4H1UA 4LJAA 3M5WA 2EAUA 2KLBA 3EMVA 4EUFA 1YL6A 3GDOA 2QUJA 1B4DA 1M33A 2C2HA 2QTNA 2DFLA 2COEA 3UH0A 1DJMA 2J0VA 1V96A 2VNJA 3BMCB 1NJ8A 3OSZA 5ALYA 2SKDA 4Z4CA 2WJZB 1X1DA 2WF5A 2W0SA 3MWGA 4JEMA 3VOAA 4CT5A 2GRJA 4ZEMA 3QOYA 4RL4A 4UU0A 2QUIA 4MQMA 3T3PB 5GZ1A 4RHCA 2OE2A 1COZA 1W94A 3V2HA 3WLKX 2QRHA 3GJTA 1IJEA 2PZAA 2RONA 4PQFA 5DHAA 1D7OA 2NX2A 3KAQA 2H11A 4JAVC 5HTOA 3EZNA 1W30A 4CIXA 3IA7A 1AS3A 1WE2A 5TT1A 3GHYA 2A9JA 1IIRA 2FW7A 1O4VA 4HN2A 1J8VA 4OQEA 3VR1A 2BP7B 4QFCA 1AUPA 2H9YA 2G72A 4TTSA 3CPEA 3SC4A 2GASA 2Z1NA 4HFJA 3TLGA 4DR4B 3B36A 3DNPA 2NVOA 4PPNA 4QOIA 2PUEA 4E31A 3AP1A 3D3WA 4IMJB 2P6MA 1OOEA 1J1ZA 3AVPA 1EJ0A 4I4NA 4O4HB 4CKWB 5K3OA 3BULA 5DVZA 2AEMA 2JB9A 1MTOA 1X92A 2OBNA 5IFLA 4P3YA 2OXTA 4DA8A 4MI3A 2L82A 3E4CA 3OZ7A 4X1IA 5LCXA 4NOMA 3EB9A 1Z0FA 4P3XA 5AMXA 2Z8XA 4XCQA 4RELA 1ZPDA 3SEFA 2DECA 2IU6A 3A04A 3AF2A 3E70C 1QCDA 4P9NA 1ILEA 2ODTX 1EUZA 3QE4A 3KO8A 4N5IX 3SIWA 2I2XB 3FWKA 4IQFA 3HGQA 4CKXA 4GSLA 2MYUA 1TRHA 3QWFA 3Q7TA 5B55A 1N25A 3BWVA 2LPMA 4I8IA 1QHHB 4HO1X 4EGQA 2O8DB 1GPLA 4TKLA 4UFOA 2Q1SA 1EHIA 3WLPA 4YPFA 5DTMA 4HWSA 4XB6B 4YDRA 3AB3A 1ZG3A 2IPLA 3G2JA 1HZZA 1II9A 4TYPA 2HX1A 1QVVA 2IHJA 3ADKA 1QAMA 3BICA 2Q5LA 5BSKA 4UCQA 2X7HA 3R20A 4MP8A 1WUHS 1W4RA 2DFTA 3DE6X 1Y4UA 3G8DA 1T29A 5C8YB 3F46A 1FYFA 1ORRA 4P5PA 2IYXA 2NYRA 1VA4A 5FX2A 1JR3A 1WXGA 2HJWA 3HXMA 2C4VA 4JLDA 3P1JA 3O4GA 3B20A 3TMAA 3W5HA 1TZBA 1GZ4A 3JARB 1Y3DE 1X7GA 3ORQA 2X5OA 4O8CA 4WLOA 3FMPB 5BW6B 1JTFA 4QJ3A 1ID1A 2AJBA 3NNNA 2WV9A 4LBZA 4FQ8A 1VLLA 5F52A 5ECDA 3RBAA 3R9WA 4DKJA 1SC3A 3OZWA 3ZDZB 1OLUA 1J00A 3D6HA 2ODWA 2A9VA 4A4DA 3QMPA 3HZRA 4WY2A 5EE9A 4BHTA 2AXPA 3RYIA 5AUNB 4G56A 5FNVA 1WW3A 2ZYTX 3MGAA 3CURA 2RK6A 2WWHA 2FZWA 1SRQA 4C30A 5E6RB 2OBXA 1Z3IX 2W90A 1OXVA 4RPGA 3OPYI 3UWPA 1MGOA 5EQDA 4DQ0A 4Q4LA 3K2QA 5JAIA 4K2AA 3WQHA 3M70A 4KAFA 5HIAA 3OEHD 3RVBA 4MWSA 2BE9A 1AN9A 3C4VA 3PDCA 2HCTA 4FDLA 3NBAA 4P4GA 3BXPA 2CF5A 4MKXA 4EW6A 3U3MA 3TE7A 2PSHA 5JTUA 2XOKD 1GAXA 2ZAIA 5JSQA 5KPDA 1QMPA 2HPVA 3ZZNA 3X2SA 1K4YA 1VKOA 1EUDB 3M0EA 4EF4A 2RJOA 5EWMA 3PPWA 4FEAA 3NORA 4XVCA 2ONCA 3OCZA 3RF6A 3K09C 5FL3A 3QVUA 2XXBA 1BXKA 3FYTA 1HWYA 3PA6A 4HQKA 1Y9DA 2X8JB 4KC0A 4M0LA 4MV6A 4AY5A 1KIFA 2F55A 4WJKB 3GARA 4J4TA 2E2WA 1EDDA 2XKBA 4IKOA 5GV8A 1KR5A 3ZDYB 2BGWA 3H5NA 4DDTA 1DKNA 3B60A 3O31A 4OK3A 8OHMA 1HDGO 2Q21A 2OTCA 3A05A 4RSGA 2QX8A 1SQSA 4P98A 3K7EA 4D2IA 3GT4A 2IXTA 2HMVA 4BATA 3R5FA 4BN0A 5JYEA 1NWCA 3TCNA 4ECAA 5TMBA 3RYCB 2O8BB 3G8BA 1J8QA 1SHZA 2HXSA 2PQ0A 3JQFC 5KQGA 3I1FA 2WAMA 3N1UA 3JAKA 5U4QA 4QICA 2DUMA 1NXQA 3B6JA 3C6YA 4BX8A 1Y8RB 5AKEA 3I28A 4YP1A 1SJ9A 1G2QA 4RD1A 5K6AA 1GU1A 4PLVA 1X9GA 4IVPA 2AVNA 3VR4H 1M0TA 1W35A 5EIEA 2V6JA 2ZRBA 4RHTA 3SR3A 1F5SA 3CLUD 2WI8A 1NOKA 4KE7A 3U56A 4L8GA 4N8DA 1QAQA 2X41A 2IWHA 5HYVA 5K3BA 2AR0A 3K5HA 4CNQA 3VTFA 5BSFA 1PFGA 1TPYA 3A4YA 2J3HA 4WZZA 2PRKA 2E5FA 1OX6A 3ZXIA 4KRYA 1T91A 2JGAA 4AT1A 5CCBA 3G1UA 3RC3A 4YK7A 5C37A 5FBRB 5MFZA 4NBWA 4UBMA 2HT6A 3Q7PA 1NR1A 2NUAA 2WSSD 3B1JA 4NDZA 2XVMA 3OJEA 4R68A 4BIIA 2VBFA 2A5DA 4AJNA 1YWGO 3CF2A 1HRKA 1OCEA 2PXXA 1FLDA 1DIGA 1M2WA 3BOSA 4LNUB 4FIDA 3PENA 1HE1C 1BCSA 1VMIA 1AO0A 5JAUA 4TLAA 2RCNA 4UQOA 3F71A 3HM2A 2I4IA 3DHVA 3PNVA 3WTCA 2FCRA 4JCCA 5SY6A 3QYAA 3UXEA 4TYWA 3G85A 2MINA 4BMCA 1KMMA 1J20A 4I3GA 3LUPA 4KYVA 4R9NA 4C3ZA 2VF5X 3MCAA 1RI5A 2OD2A 1T24A 3PC2A 5CLIA 3CR8A 3OKAA 4LSMA 2PH1A 1Z56C 1IJFA 1CS0A 3GCZA 5LD2C 4FLMA 4A8JB 1W6UA 2BSXA 1QNLA 2QRLA 3ACDA 1KDYA 1VLJA 4MX8A 4BVEA 4ZDIA 2JGIA 2H7VA 1EVJA 1OIVA 1OXKB 4HGOA 4XVRA 3ZUPA 4DDMA 5F9MA 5I4BA 4QELA 5JD6A 4HMOA 4EUHA 4RSMA 5DE3A 5DOVA 3FROA 3KKKA 2IIPA 4GT1A 3E9QA 4HDKA 4YJHA 4A73A 3TTVA 5KOHA 1YQQA 1MZVA 4HNUA 4R1UA 2QTWB 1FSFA 1O6BA 3LVBA 5T4EA 3TDKA 3BE6A 4N3BA 3RS4A 4FFRA 4EKEA 2VTEA 1UJBA 2Z43A 3R75A 3E05A 1TD1A 1I4TD 4AB1A 3H0CA 1E18A 3PHBE 1IB0A 4M55A 1B15A 1LBIA 1PZMA 3B3GA 1M34A 2VLBA 3I6IA 4I1IA 4JFRA 3RC1A 1E7QA 1JNYA 2TMDA 3HNPA 1I33A 4NQZA 2OR3A 3QVJA 1S96A 3LZDA 1ZMXA 3PZBA 9ATCA 5K0JA 2Z83A 1EWQA 2GAOA 4N3GA 4OXIA 1NC3A 5E6SB 721PA 1H3EA 4HB2A 1V71A 5DW3A 4MR7A 1GRNA 5IN5A 2NMVA 4F3NA 1GPWB 3SMVA 1F7VA 3C3EA 5AKZA 3UVEA 1R9NA 1K5GA 1P1HA 2Q46A 1MB0A 4RY2A 4AMYA 1WUKS 2DBQA 3KHUA 1JNXX 1XELA 4GP7A 1JG3A 5BNIA 2BGGA 1WL8A 1EM6A 4WSOA 1IEVA 3NHFA 5KYGA 3UHAA 1XLUA 4RUKA 3I62A 4EMBA 1JHUA 1XTKA 2RCYA 3UHJA 3JVDA 1MX9A 4MGEA 3ZD6A 3U62A 3P20A 3BMXA 5KWVA 3LY9A 1JPJA 2BEUA 3DCNA 4EFLA 2XB4A 3EVGA 4I9FA 2Z1MA 3MUNA 2LZ0A 3PXUA 2P5TB 4YRCA 2I29A 1JH8A 1QDEA 2QL7A 2ZANA 3LQFA 5FFFA 3IPCA 4GYWA 3Q88A 4AZVA 1CSEE 2ZUUA 4ZGGA 3QXHA 3VV2A 3FCCA 4DVJA 4QGFA 2OB1A 4CEJA 1NXWA 1I3CA 6NULA 4R8RA 3ABIA 4UM9D 3FGOA 2Z5GA 3WRVA 1C9MA 1RI2A 1K4KA 4QPNA 5JJCA 3OZEA 4KR7A 1FX0B 5A06A 3H9EO 3TQSA 3WBKA 5A3JA 1ZD5A 2DWCA 3R5TA 4YDHB 1IM8A 1H6CA 2GRAA 3RYTC 4MH0R 1AHNA 1VL0A 4ZZ2A 2ANBA 4M21A 1AURA 5KOIA 3D2CA 4GZLA 5GP1A 1DIAA 3ROXA 1G16A 3HRKA 3DZKA 3RJ5A 4RAOA 2FPIB 1MO5A 2HD4A 3WV5A 3DLCA 3AIOA 1WKCA 2XSZD 3H2KA 1J09A 4JQOA 2P79A 2QQEA 1NFFA 1KEZA 4JYMA 2VUHB 2XCQA 3WNCA 3NJ4A 2G4VA 1WW8A 1P7YA 1XTUA 4GICA 4E1BA 1HM5A 3PGJA 4R2WA 3H2ZA 1O5IA 1GG5A 3GRRA 3UTDA 1DO2A 3IDOA 2HR1A 2VK4A 3SICE 2A94A 4IIEA 4JU9A 3WYBA 4J7UA 1IHPA 4AUMA 4DRZA 3QIVA 1W88B 5BV0A 2O7RA 1NXXA 1YNSA 4IGIA 1ZEJA 1JVNA 3FPEA 1RWNA 1ZXLA 4OBXA 3D6NB 4PRKA 4YAEA 3FKSD 3TW0A 4B6FA 5MN5A 1EFCA 1TE2A 1TMYA 2CE2X 3C3AA 4HFRA 4LVCA 3MG9A 1D6SA 3QA9A 1C7EA 2O0HA 4BS9A 1HNWB 3RYHA 2ZPUA 4XR9A 4Z5XA 1WY7A 4YJ2A 4KRXA 4A2PA 2NSYA 3I5AA 4WLNA 5LDGA 2A1UB 3WLNA 1GL9B 1OFTA 2ZWOA 3OZSA 4J0DA 1BDJA 3EXFA 5REQB 1SXJA 1U3VA 2HMWA 4QNMA 3WFIA 4LK2A 5B6JA 3IE1A 4JB8A 4RO0A 1O57A 1K08A 4GZ5A 1DBVO 2FW0A 4B4VA 2E0IA 4XWOA 3H9QA 3UPDA 4MMXB 4YMVA 3NMUF 3AKYA 4MKGA 1M1UA 1KWKA 3UAOA 4C3OB 4KN5A 2CDBA 3LY7A 1HFKA 1HORA 2QZ4A 2QM8A 3MLAA 2VK8A 1KAGA 3GG9A 3ZWOA 4ZI2A 1WULS 1KP3A 1GXSB 2PCJA 4RK1A 3SDBA 5I3ZA 1LPAB 1SUEA 1NQVA 1MH9A 1VDZA 2QTGA 4XYEA 1Z22A 1M7GA 5G3YA 4BCCA 1E5VA 1K7XB 2I03A 1U94A 3PQ8A 4HK4A 2NTVA 3RWMB 3R6WA 3ZZ1A 1GT91 1VL6A 3U80A 1SUWA 1TVMA 2BCEA 2HQOA 1XTSA 2YHIA 4FOLA 1H4TA 3S68A 3ZWCA 1QV9A 1AKQA 2GSDA 3HU5A 1U3FA 1CUZA 1QLJA 3NKVA 3PEEA 5EE5B 1FDWA 1JI0A 1OILA 4ARAA 4E2YA 3E58A 1BA3A 2FE4A 1YONA 3UT5A 5ICGA 3MT7A 2P3SA 4PLTA 4F5DA 4I14A 3DQPA 4O4JF 1WO8A 2IF2A 2F9LA 2QNBA 5HZHA 4JVSB 4UD2A 3T35A 3EF1A 1CUHA 3C74A 1NMYA 3M5DA 1RPAA 4GL4A 3DEFA 4WZBA 3ZLTA 5B3JC 1Z0SA 2QT0A 2VTKA 3KZVA 2OSVA 3OKPA 1M5UA 2QM0A 1SZDA 4L2IB 3BCRA 3OIGA 4LOKA 3D1JA 2C5AA 2NVUA 2I55A 2MT9A 3EWNA 3OE5A 3S2GA 1ISPA 3AI2A 2DZDA 1G5PA 3A8TA 2BKVA 2W7TA 3GUVA 2YV4A 2W93A 1M8FA 3IDZA 5IBPA 1C14A 4B6QA 2YXLA 1FMJA 1DS6A 1L9KA 1TYAE 4ZU3A 4JSTA 1OH6A 3GPLA 3Q8XB 2XGSA 1ILWA 1U7HA 4LXQA 3CV3A 2CUNA 2QD1A 4MB2A 2JI8A 3I5YA 2GVDC 3IMEA 1J06A 4AXXA 3VH2A 2IYYA 2WSMA 3CXUA 5JQGB 1SXPA 3RVMA 2FPGA 3H2HA 3KNZA 1TYBE 2CUZA 2DBYA 1JA1A 2PJZA 4MUMA 2GO7A 2I7CA 3WYFA 5CDGA 5FEUA 5KYXB 4YQFA 3BZWA 2NZXA 3GA0A 2RSLA 4CIBA 4B3MB 2QRZA 4N0QA 1BHSA 3WLAA 3UPUA 1QZXA 2D5BA 1CPYA 1GTMA 4AY2A 2QHXA 3VZQA 2C84A 1L8AA 4MJ3A 1ISJA 2QVBA 2WNHA 1DDGA 1LV8A 5JSYA 4E7PA 3CSDA 3ZWPA 1O0BA 4FM9A 1FIUA 4PLCA 2NNLD 4Y7DA 1ESMA 3VRHA 1G9SA 4WFJA 1NF2A 1T8WA 3C4JA 2I8AA 2QAGB 4GLJA 3WGHA 3WLLA 1M2OA 1O77A 4UZEA 5AKIA 2WD7A 3A3YA 1RBYA 1CDDA 1ZMOA 3D0OA 1G6HA 4K6FA 4CR6A 2CN1A 3LQ2A 1NBMD 2Z95A 4RE6A 2OCDA 4UW9A 4YRDA 5BN5B 2WJAA 3MK31 4OKNA 1KNQA 4KLAA 1CY4A 4PO8A 4CMJA 4J43A 3SHVA 2P9GA 3A6HA 1DP4A 1U99A 3JQ8B 1M1YA 3IEUA 2FR1A 4FZ5A 2ADOA 3KQHA 1K8RA 2EU8A 2MR5A 1HC7A 3PNPA 4OCZA 4WA7A 3V4VB 4EF6A 3E5MA 4YV2A 4TKUB 4PVCA 2HADA 4UBLA 3I12A 1Y3AA 4WRRA 3A6JA 5JNWA 4AS3A 4HSEA 4KLCA 5B1SA 4ENWA 5KVQA 2VH2A 3RU7A 2R6JA 1NYQA 4JASB 1JJIA 3LOPA 3RC2A 4LW8A 4HGNA 1DNPA 1KJ9A 2G08A 2A35A 4CV1A 4LF7B 2J5XA 3INYA 4F6CA 2FXIA 1GPKA 2AK2A 3N39C 3UFXA 1RIIA 2QVZX 3MCVA 4FMCB 2HYDA 4TV8A 1VI2A 2AG5A 4KITB 4WBSA 3U1VA 5THQA 3NDRA 3TH5A 5EHXA 4RHYA 1Z2OX 3QLVC 3MYRA 4HQ0A 4XTRA 2DPMA 2G70A 4B76A 1M2VB 5F5XA 3TWOA 2VSFA 5KTSA 1N0UA 1XVIA 4HRAA 3U17A 4N12A 2VPZA 5IEBA 4C6TA 1O95D 4XPIB 2VSQA 4MA0A 3E2PA 1TEVA 4KJZA 4HWRA 4N76A 1FYXA 1GGJA 3SYLA 1GV1A 1OWMA 2BVNA 3QH4A 3QX8A 4NVRA 1HY3A 521PA 1R3DA 3JZAA 3MOGA 5ALIA 3VPHA 3KG2A 2Y1WA 4OB8A 1YNOA 8ABPA 3IQHX 1M0SA 2YS7A 1E6CA 1Z68A 2RHBA 2WFAA 5E3IA 4AJLA 3VKFA 4NCNA 2DWQA 3PCXA 4FWBA 2CHFA 3B6KA 4G1BA 4TVKA 4KFTA 4V3BA 4URXR 2DY0A 1KC1A 3G0OA 3PXDA 4P3PA 3EY9A 2XUAA 5FYQA 4F6RB 1OX5A 2C9ZA 3RK4A 4KR2A 4LDQA 1VSTA 4IS3A 2HV8A 3VMMA 1L5OA 3JXEA 4XKJA 2BD0A 2J1LA 4CFYA 3FFAA 1D4ZA 3CZAA 4IQ4A 3HR4A 4CKEB 1U90A 3DBLA 1G2PA 2CFSA 2XMQA 5HWSA 1DG3A 2P68A 1JDBB 2ZI5A 4NU0A 4UXJA 1ZOPA 4C4PA 5NULA 1BGVA 2Q3FA 3O4RA 1ENYA 1JFSA 1Z7EA 5IDVA 1I5OA 4DRXA 1IY9A 1C41A 5BYKA 4G1EB 3WFJA 2O5RA 2HA5A 1Y1SA 4UNIA 4YPVA 2AI3A 1JTVA 5FOQA 2WYOA 2BTEA 1Z08A 2FRVA 3Q9SA 1M6EX 2WIAA 2JCSA 4DREA 3LX8A 5G0TA 3HM9A 2JEYA 2A86A 2WWRA 5F4ZA 4GE3A 4PQGA 1UOPA 2A9QA 2HRRA 4B0OA 1C8VB 4PIMA 1TO2E 1N7JA 1DAMA 3HJGA 1ZD4A 4P93A 821PA 1E1CA 4UE3S 1XTTA 5DGDA 3JQEA 3REOA 5IJAA 1Z5GA 4F84A 3QX3A 1CR0A 1YZFA 1NIPA 2FQXA 3A4TA 4RJIA 5AW9A 4GRDA 2PGNA 5JY1A 1O9HA 1FP6A 3PNKA 4JS0A 1TIKA 3HZZA 4E3ZA 4CTOA 5I7HA 3SJAA 4QKQA 2P62A 1P7ZA 3U4QB 1FFCA 3I2KA 4BAGA 2QD5A 1RRCA 3D9QX 1A9XA 4KFCA 4S04A 3GJZA 2WU8A 1VHLA 4P81A 5KSPA 1ZN7A 2VJPA 4CG0A 5FNZA 1YB6A 3UV6A 2G1PA 1S0UA 2AMFA 3CUVA 1I30A 4C0JA 1CRPA 2AUTA 1P6QA 1GQFA 3GLHB 4CF3A 3GLIB 1SD2A 2AJ8A 7GPBA 2M6KA 1G7TA 1ZGJA 2ODAA 1VYTA 4RX1A 1T25A 1CP3A 5BOVA 1Y6FA 3V97A 4ES6A 3VJKA 3EN0A 1IU9A 1E2GA 1TT5A 4F85A 5C1OA 3HYLA 2WZQA 4ZWNA 2Y4OA 4ARVA 2WMDA 5AR1A 1XZ8A 3COSA 1R0KA 2P1DA 2VDUE 3TSAA 1H9BA 4OH1A 4WCFB 1KJNA 4DLWA 3H87A 1GYQA 1XMJA 2L42A 3F1KA 2QQ5A 1TVEA 4OLHA 2Q49A 5KYVA 4CI0B 1TPZA 3PRYA 4NIMA 5ALUA 3SBEA 3HA7A 1BYUA 3KDSE 4XUDA 5FTMA 3S2FA 3VSEA 3OZRA 2JFWA 4TVSA 1XIVA 3O8QB 4KREA 1XCJA 3Q8LA 3RC7A 4MI9A 1Z8NA 2JLQA 2R4TA 5BQPA 2J9GA 1U7XA 4PM4A 1UT8A 1L5KA 3FVVA 2O19A 1JLLB 3AEUB 3ICCA 5D3MA 5G53C 3O8NA 5KZMB 1XZBA 1KVUA 3TNLA 2ODBA 5ELXA 2UV8A 1AKNA 1RHMA 3DEYX 3GUZA 3L0SA 4BCDA 5KKCA 1ID8A 5BSUA 1VP3A 2FSVA 4FZVA 1NX6A 4IXMA 4WMLA 3T61A