5JDIC

Trypanosoma brucei ptr1 in complex with cofactor and inhibitor nmt-h024 (compound 2)
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
266
structure length
239
Chain Sequence
APAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQKTVETQVAELIGTNAIAPFLLTMSFAQRQNLSIVNLCDAMVDQPMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Pteridine reductase
publication title Profiling of Flavonol Derivatives for the Development of Antitrypanosomatidic Drugs.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
total genus 91
structure length 239
sequence length 266
ec nomenclature
pdb deposition date 2016-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5jdiC00
2G1UA 5EN4A 5HS4A 1YBMA 4J2OA 3FRJA 4YDRA 2R00C 3ZU4A 4CMAA 2GN4A 3LT0A 1V0JA 1TT5A 3L9XA 3DDNA 4XR9A 4WK6A 3AUSA 3ZWXA 2XXJA 1RM3A 5BSHA 5EMHA 2IXBA 5KIAA 3WSWA 3QE3A 1AN9A 2EKQA 4XRRA 1V6AA 2HMWA 4MOWA 3L4SO 4CUKA 3ZWWA 4OXNA 4ZD6A 2EEZA 1F8FA 5C37A 4ZGWA 5DT9A 1A4IA 3IL2A 1E3WB 2NM0A 1LSJA 2H1SA 4NK4A 1Q0LA 1MC4A 1XU9A 5ENDA 2DAPA 3PVZA 7MDHA 4MVJA 4RDIA 4ZA2A 4AJKA 2QIOA 2H5LA 4J43A 1LLCA 1PIWA 3F4BA 3IQDB 2AEFA 2BLLA 3OICA 4BO6A 1H6AA 5GZ6A 1EVYA 3JQAD 4QO7A 1XU7A 4LK3A 4WKGA 2ZTLA 5THQA 1P1KA 1M6HA 1I3LA 3K9QO 5TJ9A 5ICMA 4UVIA 5A06A 3O8QB 3GOHA 3QVOA 5T67A 1ZMTA 3D7LA 3BTOA 4F46A 5IXYA 1ZJYA 2V6BA 3H65A 4FOOA 1MA0A 4NDNE 4RF5A 2ZJ1A 3TNLA 1NQOA 3VTZA 1XYGA 3ZWOA 1ZCJA 3RFTA 3V5NA 3HJAA 4ID9A 3OETA 1VKNA 4MIOA 3DAGA 4E5KA 1ISHA 3HWRA 3HE3A 3VDQA 1XCBA 4OOEA 5JMPA 4CMIB 1XWFA 1XQ6A 3NKLA 5L4NA 1ZEJA 3R3JA 3NAQA 1E1NA 4J9VA 4IGEA 3DTTA 3I1JA 1W4ZA 3GZ4A 3QWFA 3WGHA 4YAEA 2RHCA 3E8XA 4JP3A 2HK7A 3DMTC 2I3GA 3D3WB 1M76A 3HN2A 1NR1A 3JD4A 5KTKA 4XGNA 2IEDA 2BGMA 3BMQB 1DO8A 5I8WA 1CIVA 1GCUA 1P1FA 5IZCC 4IIUA 1K89A 1UP7A 1NPTO 4HKTA 2O4CA 3KXDA 2V6GA 3AU8A 3PZRA 4R1TA 2QRJA 4Y67A 1OOEA 1KEUA 3DFUA 4XQGA 5T5QA 1OAAA 1U4OA 4LISA 3VKUA 4ALLA 4IXWA 4U8GA 4IJKA 4DC1A 1J4AA 4I08A 3G3EA 2CDCA 2A35A 1T2FA 3DXFA 1PZHA 3L9WA 4EJ6A 4INAA 2Z5LA 3AM3A 3M1AA 5FYDA 5JDCC 4XCVA 5H83A 4DIFA 1XR3A 1EK6A 4JBHA 5HBRA 2NWQA 2IEBA 3ETEA 4QO8A 3QVXA 2CVQA 1EK5A 1Z74A 1HDOA 3HN7A 5L3ZA 5MGBA 2P4QA 5JSFA 3EGOA 3JQ9A 5CPBA 1P9LA 5A5FA 1DIHA 2PKQP 4PIVA 1I24A 2O48X 2ZCUA 3WMWA 4CM5A 2B0JA 1G0OA 3ETGA 3FI9A 4Z9FA 3C7CB 2GUGA 5CEEA 1JTVA 3K73O 2FHSA 1BVUA 1EBUA 2YQ4A 1BWSA 2NACA 3BMNA 4UEJA 1P3DA 4CMBA 4FCCA 4WOJA 1NM5A 4BMVA 2D59A 3BHJA 1YONA 3QWIA 4GSKA 2NADA 4U5QA 4BV8A 3WGQA 4XDZA 4IJWA 4MIYA 3VZRA 3ZHZA 5AXAA 3JQCA 1B3BA 3D5QA 1VL0A 3HDQA 3RC9A 3VH1A 1YB1A 3NDIA 1E7YA 4HV4A 5L51A 4D44A 3B70A 1OI7A 2PKRA 4MVJG 5T8KC 4B79A 1UUFA 4EEZA 5K6AC 2WM3A 3ZDFA 3K92A 4DC0A 4FR5A 5G0VA 1PX0A 1PSDA 3H9EO 3IIEA 4NBRA 4L76A 2NVWA 3DB2A 4TWRA 5IN4A 4BNGA 2NU7A 3GC6A 4TZTA 3KYBA 2NQTA 1D1SA 1YL5A 3ENNA 4P8RA 3Q9UA 4AJEA 1YS4A 3UGKA 1PGPA 3L0DA 3R1IA 5JCJA 1E6WA 3RD5A 4FFLA 4Y6SA 1MFPA 4WECA 1ZKMA 1QYXA 3ANNA 4Q3EA 2FR1A 4E2ZA 4NH4A 4A27A 3M1LA 5ITVA 5JO0A 2E48A 3BTUA 3AY7A 4LVCA 1K3TA 2NVUB 3WGOA 4OO3A 1GPDG 3B20A 2O4UX 2X5JO 2VUTA 2B37A 4HFMA 5G0UA 3O38A 4S3MA 1U5CA 3TRIA 4BO1A 3F5SA 3CZMA 3GEDA 2ZQZA 2VOJA 4FFRA 4LCJA 4N5NA 4EUEA 1VSVA 4B3HA 2JFGA 3NTRA 3PJDA 3D4PA 1U2GA 1OBFO 2GSDA 3GZNB 4G2NA 1NQ5A 1QYCA 1NAHA 1PJLA 1U7TA 2I66A 4JCOA 1UJMA 2WYUA 1HDGO 3E6AA 4QXMA 4R69A 1HYHA 4YT4A 1E3WA 4U7WA 4R01A 3I23A 4UVHA 1F0YA 3DBRA 1SB8A 2PNFA 4RJTA 2DBZA 3K96A 3IC5A 4BNJA 2RCYA 4D3DA 5F1KA 4L73A 2D4AA 4EUHA 1NFRA 1UXGA 3D5TA 5I9NA 3E03A 4UVEA 4PLYA 4BKPA 4PZDA 4G5HA 2VHVA 1NYTA 4HFJA 1W0CA 3EMKA 1LEHA 4PLWA 5I8ZA 4J90A 5G4LA 5BNFA 4PG8A 4ZICA 2DTDA 3KOUA 3H4VA 3KSUA 3NGXA 2PD6A 1O94A 3DZIA 3L6DA 1PGJA 2P4HX 1EE9A 4BOYA 1C14A 2D1YA 2D3TA 4WLVA 3DC2A 5COBA 5G0TA 4DXHA 1DC6A 1LQUA 2VWGA 1T4BA 3IP1A 1FDSA 1CETA 3EZLA 4CLOB 4J0FA 3LF1A 3QP9A 1HE3A 2EGGA 4FOSA 5L45A 3QW2A 1YE3A 3AJRA 3EW7A 4WNCA 3CH6A 1E92A 1UXHA 1B8VA 1X13A 1JVSA 4J9UE 5G2OA 5EQFA 3HQ4O 4A7PA 2ET6A 3MJSA 1E3LA 1YBAA 4LGVA 5LDGA 3ZWVA 4YAGA 4MVJP 1TA4A 3AI3A 1T4DA 3H6KA 2DQ4A 3C85A 3MZ0A 4I8XA 5EL0A 3FWNA 3ROKA 5CDGA 5JDIA 4FJ1A 3LSYA 2B35A 3ZWPA 3ZW9A 4YT2A 1E3IA 3GPIA 4CQMD 1P77A 3C8MA 4D0SA 1CYDA 1TVEA 3V1YA 3NJ8A 1T1RA 4CM6A 1GCOA 5JCXA 2GR9A 1DDOA 2YV3A 2VZ8A 4RLHA 1SMKA 3RUAA 4J2HA 5U1PA 5CG2A 4Z0HO 2OO5A 3UKOA 4NBTA 5A04A 2AQIA 2O3TA 2R00A 4H15A 4N54A 1KETA 1YOVB 4CMHA 4IQ8A 1C0IA 3I83A 1ID1A 2OL4A 4RVDA 4X54A 4BV9A 2XPCA 3FBTA 3JQ8B 1H9BA 3MJTA 3QA9A 2PH3A 4AJIA 5JAIA 1HZZA 1NFQA 2YQ5A 3PP8A 1MG0A 1QMGA 2WYWA 4J7CA 4DYDA 4WLEA 3INTA 1KVUA 3LT2A 2HMSA 3U3XA 2OP1A 4IBOA 3GLQA 3UXYA 1PWXA 5CDTA 3AOGA 2YHIB 3OMLA 4BVAA 4RPLA 1ZK4A 4K6FA 1JWBB 1ZW1A 4U0JA 3ZNQA 1GUZA 3EK2A 1T2AA 1OC4A 3OBBA 3LLVA 4O5OA 4Q3BA 2FZEA 1RJWA 4NZ9A 4R51A 1OFGA 4FD3A 1D4FA 1YBVA 3W4KA 3DR3A 2A4KA 3AUTA 4TKMA 3VC7A 2PV7A 3ZHYA 3AUAA 4RPJA 5FEUA 1ULSA 1IY8A 3E5RA 3I9MA 1R37A 4D0RA 2X8LA 1LX6A 4L9RA 2OXIA 3WFIA 4QECA 2GD1O 2GN8A 3W8DA 2OBYA 4DA9A 4ROSA 1NPYA 4BNNA 1UR5A 1QP8A 4Y6PA 4WCFB 2F00A 4E21A 3Q2IA 3EYWA 2DFVA 3QVSA 1ZJZA 4DTIA 3FSRA 2W90A 2AE1A 3HFSA 1UXJA 1HZJA 1ISMA 5AXCA 3ADOA 4I5GA 3WDSA 2CY0A 2B5VA 3OH8A 2UVDA 3DMTA 4KDEA 1P31A 2VHXA 3CKYA 1VJ1A 1GEEA 2HKIA 2B4TO 3OFSA 1UDAA 5A05A 1BW9B 2O3QA 4DVJA 4YPOA 3I9JA 3Q0EA 4ZQFA 1Q7CA 2D5AA 2C20A 2O7QA 4FQ8A 4PG6A 3FCOA 4FB5A 3I3OA 2HK9A 4GKBA 1YDWA 4Z6KA 4I5FA 1ZO8A 3VAZA 3H8VA 2P5YA 1QYVA 2E6UX 3TSCA 4YT8A 2VWQA 2DBQA 3ANMA 1LDYA 2FOIA 3JV7A 1PQPA 1DHRA 2CVZA 1FF9A 3ZZNA 3TOXA 1BRMA 2HDHA 1A71A 4HFRA 3CUKA 1ZSVA 4BB6A 1M66A 2JD1A 2OUIA 5JDCA 2YW9A 3SEFA 4DUPA 4IDFA 5G4KB 4BB5A 4HX5A 3QSGA 2UAGA 3BIOA 2I99A 4QT0A 5BT9A 1O95A 4D43A 1WLYA 3INRA 4PLHA 3OEYA 2JAPA 4HADA 5AVOA 2HSDA 3LT1A 1LDNA 4CM9D 1NQTA 3KV3O 4WE3A 1KY5A 4WEQA 2BMAA 2GN6A 4J16A 3U9LA 3GH3A 1ZK0A 2GGSA 4NU5A 3R3SA 2HLPA 4GLLA 3AW9A 4IMPA 4BGEA 4D3FA 2DC1A 1QRRA 2G76A 4Q3NA 4LRSB 4CQLB 3JQ9C 3ZU5A 2Y0DA 5L7YA 1QLHA 3OF2A 4R16A 4YYZA 1W6UA 3DONA 2CZCA 2B83A 3KEOA 3GVXA 4CLOA 1DIBA 2OFPA 2Y1GA 3WFJA 1JAYA 3ZHBA 1ADBA 4L4RA 5CEFA 3KM0A 3PDJA 4UREA 3QJ5A 5TNXA 1GZ3A 3KSZO 5K6AA 2C7GA 1ADGA 5KKAA 3TZKA 1T2EA 4RORA 3IP3A 4EI2A 1XKQA 3OJFA 4FIZA 4L8VA 4XQEA 3SJUA 1E7MA 2J3HA 3MWDB 4BNYA 4JJFA 2W2KA 4BKOA 4JJGA 1LDEA 1HE5A 1QORA 2Y66A 1MFZA 4XYGA 2CF5A 2VZ0A 4QFCA 3LC1O 1UP4A 3PLNA 3H5AA 3LQFA 3LZ6A 1F8GA 2WE8A 1QG6A 3K8ZA 4OKIA 1G0NA 2P9EA 3GEGA 3KHUA 3L4BA 4AJ4A 3PFWO 4FC6A 3RUHA 1KVTA 1HE4A 4WLFA 1DIAA 1MLDA 3S2IA 1AXEA 1PZGA 2X86A 2O2SA 3F47A 1JKFA 3JQ8A 4ALMA 2NLOA 2VYVD 3KVOA 2PGDA 1B3RA 2GN9A 4IZHA 1U9JA 4YEDA 2EIHA 3VPSA 5BNTA 5IXSA 4WASA 4YTEA 2Y0CA 1T25A 1SCUA 1O89A 2GO1A 4EUFA 3RUIA 1H6BA 4RVUA 2O2YA 3IS3A 3AFMA 4XA8A 1OC2A 1U28A 4Y98A 1JDJA 4CLRA 3OQ6A 1C1DB 4KQWA 4BNUA 1K6IA 1X7HA 2RIRA 2PKQO 3KZVA 4FDAA 2BFAA 3PFFA 1P1RA 1R4MA 1Y8QB 4MVJE 3RJ5A 4CV0A 5IDXA 2QZ9A 3AUUA 3DAPA 4FW8A 4PZEA 4CLEA 4KTVE 3WQRA 2G82A 5EERA 2JJYA 4Z3KA 2VYND 3N74A 1VJ0A 1XG5A 4YJFB 5I7FA 4OIMA 3JQDA 4IS2A 1IOLA 2HCTA 1YJQA 2VRCA 4CM8B 3CINA 1NBOA 1UAGA 2GZ2A 2POQX 3FBGA 1K0UA 1Z6ZA 1J5PA 1CQIA 1BGVA 3PWSA 1LC0A 4FC7A 3ZNNA 4CV3A 4UAGA 1DLJA 4Z0TA 2YV1A 4C7KA 2WD7B 2QQ5A 4P38A 3OQBA 3NGLA 1B16A 3Q3CA 1F12A 1GQ2A 4IMRA 1M75A 4MP3A 1BXGB 4HXYA 2W8ZA 2O50A 4H3VA 4JJIA 4RLSA 3TL3A 1VL8A 5JNLA 4AICA 2VQ3A 3RBZA 1ZK1A 3SX2A 3I9KA 3CMMA 1K5HA 3HDHA 1R12A 3I9NA 3MEQA 4IPTA 1PJTA 3PIDA 4JGBA 4UUPA 5C7IO 5DCYA 3BMCA 3HFGA 3E9QA 4RGBA 3A06A 4RVSA 3Q9NA 5FI5A 3JQ7B 2GCGA 3OHSX 4BO9A 2C5AA 3P19A 5KVVA 1GL3A 2DBVO 4MINA 2Z1MA 1IL0A 1U3VA 1EDOA 4TRMA 5T6BA 2VRBA 1UAYA 5ER6A 4YJHA 3I9LA 5COQA 2GZ3A 2ZK7A 4UUNA 3OM9A 3BA1A 3HZZA 1B0AA 4MPDA 4XYBA 3WTCA 4I9NA 3UF0A 3PYXA 2PZMA 1XDWA 3KYCA 1VE9A 3GEMA 1CWUA 2AMFA 4CM4B 4GX1A 1PS0A 2UYYA 2Q49A 2WYVA 1Y5MA 2DT5A 4N7RA 3RFVA 2HO5A 4CMKA 1O0SA 1QYDA 4K6CA 2C0CA 1X0XA 4JN6B 3CIFA 1GYPA 1R16A 1SNYA 3WGTA 1GEGA 1SZJG 4C7JA 4AJLA 4D3SA 5G4KA 5JAMA 5IDYA 2G17A 5BSGA 1XGKA 1HRDA 1LLUA 5JMWA 3U4IA 3D4OA 2OHXA 3C1OA 2O3SA 3D4NA 4RO0A 3U62A 4XGIA 4II2A 4DLBA 5A9RA 4M89A 1U2DA 3QRWA 4CMCA 3A4VA 1P33A 1E6EA 1NHWA 4IDEA 4RV9A 4ALJA 2V6MA 2HK8A 1M67A 1MP0A 2CNBA 9LDTA 3H3FA 4NBWA 1RKXA 3ZU2A 1R0SA 3KUXA 4FS3A 3G79A 1LXCA 1Z45A 2Q1UA 4D7AA 4BKUA 1Y8RB 3DBLB 3VTFA 3BTVA 2GYYA 2BI7A 3F3SA 4UEKA 1KVSA 3GGGA 3GG9A 3GY0A 5EPOA 1GFSA 3FNEA 2GRAA 2PD3A 3ULKA 4TMFA 4E5NA 1EFLA 3EZYA 3GHHA 3QWAA 5DOVA 4JK3A 1DSSG 1DB3A 4AFNA 3N58A 3UW3A 4BKRA 4FBGA 4GI2A 3QIVA 4C4OA 1MB4A 4I9UA 4BNHA 1AGNA 3S2EA 3I6QA 1DAOA 3P7MA 3WSVA 3WYBA 5ICSA 1HXHA 2JD2A 2EXXA 2YFQA 1MUUA 3NDJA 3QY9A 5KNLA 1YQDA 4RPHA 2ZB4A 1ADCA 1PL6A 3RUFA 3NUGA 4OJNA 1E7RA 3FNFA 3I5MA 1XLTA 4R3WA 4CV1A 4IGFA 3L77A 1C1XB 2BFOA 1N8KA 3L07A 3WIEA 4OL9A 1WVGA 4WLUA 3RBVA 3QHAA 3EVTA 1TEHA 5TGDA 1JU9A 1EQUA 3SXPA 5GZ3A 1PJ2A 2P2SA 5JYDA 1LTHR 1CF2O 2CDBA 3LF2A 1T26A 3RC2A 2AEMA 3GR6A 5EINA 3I4CA 3RU9A 1WMAA 3C3XA 4IDCA 3OIDA 4R3NA 4K1LA 5IG2A 3PYMA 4HWKA 4MVJD 5FF9A 2ZKLA 2Y99A 2EHDA 3UCFA 1GUFA 1LUAA 1N1EA 3BMOA 3GGOA 5A9SB 1JLLA 2WEKA 1ONOA 1WW8A 2UUPA 4MDHA 2EW8A 3QQPA 3B1FA 1NXQA 3OECA 1H5QA 3HB4X 2W4QA 2PD4A 1GPJA 2W98A 4HBGA 3STHA 4UVGA 4BIIA 4E0BA 3W6UA 4IQGA 5JY1A 3PI7A 1GYQA 1U8FO 4BNWA 4CLXA 2Y1CA 4IUYA 3NT4A 2AQKA 1HEUA 2YV2A 1E7SA 2VUSA 5TF4A 3PJGA 3A9WA 4YRDA 4UVDA 5T64A 3TFOA 4ND3A 2ZYDA 1EDZA 3LC2O 2J8ZA 4NBUA 1PGOA 1QLJA 3DTYA 5DBIA 5A5EA 3I9OA 5AXDA 1DFHA 3GAFA 4TRNA 3VH3A 5JE8A 1UZMA 4KQXA 2JHFA 4YJGB 3ROPA 5KVSA 1JA9A 3H5RA 5JW6A 5G0WA 3OJOA 1J0XO 1NR7A 4XEHA 3WYCA 1NWCA 4G65A 4Z9YA 2ZYAA 4J1TA 1LSOA 3TF5A 2NTVA 2OP0A 4BS9A 2CD9A 1YWGO 1L1FA 1GYRA 1ENYA 4R4JA 1GDHA 5JPIA 4BO3A 1C3VA 4I5EA 1GTMA 2PH5A 2DPGA 2GPTA 1L7EA 2P5UA 4BNLA 4TSKA 4RVGA 1GD1O 3H2ZA 2Q46A 1NVTA 2VCYA 5JXWA 1D7OA 4R54A 3SLGA 2HU2A 4LSMA 5CG1A 3ONFA 2Y93A 1SAYA 2FP4A 3D1LA 4BMSA 3F5QA 3PGJA 1B14A 3Q1LA 4OYRA 1P45A 1IHYA 2DFDA 3L4BC 1G6KA 3QV1A 4KUGA 3G1UA 4XYMA 2LDXA 4FJ0A 1WWKA 3ZHXA 4B4VA 1UZNA 3BTSA 4FFNA 3LLSA 3HDJA 2QZZA 1E1KA 1BMDA 1DFGA 2WSBA 5TS3A 4E5MA 3G1TA 2VTEA 3DZBA 4JP2A 3KEQA 2OOSA 3ONEA 1WP4A 1A4UA 1GZ6A 1N92A 2BI8A 1YKFA 4HP8A 4W7IA 3U5TA 3KO8A 1H6CA 2Y1EA 4LW8A 4YWJA 1SEVA 4GSLA 4K9DA 2P91A 4XIYA 4BO2A 1LI4A 4LN1A 1DRUA 4EYEA 1NFFA 2Q4EA 5K0ZA 1U3UA 3P2OA 1DOHA 3KETA 4O6VA 4Q9NA 5B4TA 3HB5X 4YT5A 4YVFA 1I3NA 2VNAA 1HDZA 4EGFA 3JYQA 1O5IA 2IE0A 3C1AA 1S6YA 4AVYA 1Y8RA 1J49A 3BAZA 3ABIA 5FFFA 1DRWA 2HJRA 3K2EA 1VSUA 2HRZA 1AXGA 4L0QA 1Q7BA 3OJEA 1N9GB 3GK3A 1FDWA 4IXTA 4RZHA 3D0OA 3ROMA 1HYEA 2YJZA 4U6SA 2C2YA 2NSDA 4OSOA 3RC1A 2JHGA 1R6DA 3O8QA 4GGOA 2AW5A 5A4DA 5LC1A 3WWYA 1YB4A 2J5KA 4A5OA 4CMEC 3QWBA 1ZK2A 1D1TA 5BR7A 4P4LA 1LDBA 3LVFO 5CFZA 1FJHA 4CM1A 3K5PA 3F6YA 3IDSA 2PR2A 4WCFC 4R68A 3ZWCA 5JCJD 4OOFA 3KB6A 3JQ6A 4CMIA 1VL6A 5HWSA 5L4SA 4NPCA 3U4HA 2FWMX 1DC4A 4E3ZA 3QLJA 2ZATA 4YR9A 2YFHA 4FJ2A 4NJMB 4XX0A 4DGSA 4MP8A 5CPFA 1R66A 2FPPA 1U1IA 4GAEA 1WDKA 3D3WA 4B7XA 4JLWA 3TZHA 1E0DA 2Q2QA 4QEDA 3BMQA 3MJEA 1QV6A 3WQQA 4BHTA 1U5AA 1RYDA 1U7HA 1LDMA 2O3UA 4YB8A 5DCUA 3CXRA 4PG5A 1BTOA 4KDFA 3I52A 1GR0A 3DMYA 1NQAO 2DLDA 1N1GA 3FTNA 4A73A 3ZV3A 2DTXA 2DBRA 3DHYA 1Q2XA 4J3FA 4J4BA 2X0JA 1NAIA 3MWEB 2IRWA 2EKPA 5L40A 2RHRA 2VUUA 1EUDA 3GDFA 3RIHA 3GA0A 3JQGB 1KS9A 3TN7A 2ZQYA 3MTGA 1DXYA 1ZSYA 4J0EA 4PLTA 1PJSA 2OMEA 2A9FA 4D79A 3IKTA 3SC4A 2CDAA 4IQ0A 2X5OA 4CR7A 4QFDA 5DULA 2IODA 4ZQGA 1VRWA 2J5QA 1P1JA 2FZWA 4NFSA 4IDGA 1YDEA 4PZCA 1PWZA 2Q50A 3FPCA 5B12A 4O1MA 4B7CA 3FD8A 1ENPA 1F17A 2PWZA 4B4UA 3N7UA 4RQTA 4F3YA 2PY6A 4E6PA 2NTJA 5DP2A 4IM7A 4J4TA 2E4AA 3VH4A 2X23A 1B8UA 3OJ0A 1NTOA 1O9BA 1PJQA 4P22A 5I9MA 2DVMA 3UOGA 1HT0A 1JW9B 1G1AA 4B3JA 3H3JA 3KSDO 4Q3DA 2GASA 3PEFA 4MJLA 1HWYA 4XZ3A 4YJGA 3UN1A 4BO7A 1P74A 3E48A 4XRGA 3KYDB 4E2YA 1M2WA 3S55A 3C7DB 1DC5A 2ZTUA 1JN0A 4OQZA 2QYTA 1B15A 2VHWA 4RPKA 2Y0EA 2BRUA 4NNJA 5GZ1A 3JD2A 5KVQA 1ISJA 3FPLA 2YYYA 4TVBA 1C0KA 3COSA 3NYWA 1NWHA 3DBVO 5A02A 3U49A 1TLTA 2W2LA 3NT5A 5K9ZA 2AG8A 3OEWA 1YJ8A 2JFFA 4R1UA 3WB9A 4B7UA 1SBYA 2IDZA 4NFHA 5JO9A 3WGGA 4W4TA 3TJRA 3GUCA 1IPEA 2NU9A 2EWMA 3DOCA 2NVUA 4BGUA 3EUWA 5G0SA 4EEXA 2VZ9A 3NRCA 4PFJA 1F06A 1B8PA 3DAFA 3RVDA 1X1EA 2CFCA 3K30A 3F1KA 1T2CA 3H9GA 5A9TA 2OORA 3CE6A 2FR0A 3O9ZA 3T7EA 4AJNA 4ITUA 3W6ZA 3WYEA 1WAMA 4GMGA 5AOVA 3OA2A 1EFKA 2CF6A 3JQAB 3RI3A 5FWNA 2WMDA 1F14A 3GVPA 1ML3A 1LRJA 1U8XX 4CPDA 3HUDA 5IDWA 3GZNA 4UUOA 4U6QA 3AY6A 5CDUA 4EJMA 3SBOA 5BSFA 1GZ4A 1LLDA 3FR7A 3RFXA 4HFNA 3RSHA 4NK5A 4XGKA 4XR4A 1NHGA 1P1IA 5KOIA 2DU8A 2YUTA 4O63O 2R6JA 3RUCA 3WWZA 4FPXA 3WG9A 4A10A 3VH2A 1UXKA 1X0VA 2IZ0A 3H9QA 5HM8A 3PQEA 3NV9A 4MVJH 1HLPA 1N9GA 4GLOA 1Y9AA 3E82A 4GWKA 2B36A 1JVBA 4N5LA 3KBOA 1WZEA 4ND5A 3P5SA 5DCWA 2ZCVA 1TT5B 3M6IA 1A7KA 4PG7A 6LDHA 2JKVA 1O6ZA 2ZTVA 3IOYA 3ASUA 2DKNA 4D42A 5AQ1A 5L7WA 1IUKA 2A94A 4B3IA 2X9NA 3GG2A 3GDGA 2HUNA 3BHMA 1IPFA 2FPGA 4ZRMA 1Q7GA 4QQRA 4MO2A 1EVZA 3RJ9A 4BNZA 3BXXA 5T57A 2BF7A 4B8ZA 2X9VA 4PN3A 2Q3EA 1R15A 3FN4A 3WBBA 3CEAA 3R6DA 3PYLA 1KYQA 2EJWA 4NJMA 3WJAA 1C0LA 4PLFA 4ZRNA 2BHLA 3AI2A 3OQ1A 4M54A 4GKVA 5JC1A 3WS7A 2Q1WA 4TRJA 1MG5A 3WMXA 4BO5A 4TRRA 3DHNA 1PJ3A 3GNTA 4TKLA 2UV8A 3PHLA 5TX7A 4HNGA 3FTPA 1EZ4A 1YL7A 3JD3A 4XJSA 1XIVA 2J6IA 2YDYA 5KCZA 3AK4A 3MCVA 1GADO 5DDIP 3VPFA 4BGIA 1YOVA 1JKJA 3ZWMA 4NIMA 3UFXA 3PGXA 4NI5A 4RPGA 4KUHA 4O59O 3ST7A 2I65A 1YH3A 1P44A 4ZU3A 1ISFA 4FFMA 2BD0A 1I33A 5HRUA 1YO6A 3AOEC 4LRTB 1ZVMA 3WLFA 1CJCA 4BUCA 3R0IA 1TB4A 4MKXA 4PGFA 3OIFA 1DJQA 1LDGA 3B1JA 4GX2A 4UUMA 7ADHA 4ND2A 3PQFA 3RKUA 2DM6A 1YQGA 1LJ8A 2YHIA 4RF3A 2C59A 2DUUA 1LBEA 2PZJA 1PR3A 4GBJA 3TDKA 3WR5A 3JD0A 4B8WA 2D0IA 4FGWA 1S7CA 4LMPA 1QKIA 2EV9A 3WGIA 4WNIA 4XB1A 3RQSA 3BHIA 1ZIDA 1KIFA 3PHIA 5ILGA 4M49A 3AWDA 5THKA 3EC7A 2HMTA 1TT7A 4NR0A 1VI2A 3DOOA 5JBIA 1PS8A 5LDHA 3H7AA 4L75A 3AM5A 3LYLA 4RVHA 5IAAA 4Q3CA 3S2FA 3KRTA 3V2UA 4CMEA 1PU2A 2QW8A 5ADHA 3RCBA 5JYEA 3RASA 3T7CA 3HDYA 4II3A 1FMCA 4J6FA 2ILTA 2AQHA 3MTJA 3C1TA 4WCFA 4KMSA 1I0ZA 3RUDA 3S2GA 5KJFA 2ZB8A 1BG6A 1PGQA 5I7VA 1VPDA 1YRLA 3GFBA 1KVRA 1E3EA 1HLDA 3EVNA 1PJCA 3ICCA 1WNTA 2XXBA 3Q6IA 3DOJA 4LCEA 3H5NA 1KC1A 1GAEO 1B7GO 3S8MA 3TZ6A 2IYPA 2PA3A 1BXZA 3IUPA 4YA6A 3ETDA 4YQZA 3BMNB 4DWVA 3K2BA 2Y67A 4JXKA 1BW9A 4JX8A 2F1KA 1Y5RA 1CDOA 1R0KA 1R4NB 4NJOA 4FN4A 3SLKA 3H2SA 4IZIA 2B4RO 4GMFA 1MC5A 4NQZA 1I10A 3GNSA 2VNSA 4J7XA 4RZIA 4E5PA 2WJPA 1T24A 3DHEA 2CMDA 3E18A 4OKNA 3TL2A 4BQPA 5I7EA 1XQ1A 5A3JA 3H9JA 3RU7A 3F1LA 4J1QA 3FWZA 4NFYA 4TVOA 1AHHA 2RH8A 1KEWA 3PZBA 2I76A 1Z73A 3RKRA 1E7QA 1VJTA 3GFGA 4YXFA 4GH5A 3EDMA 3V8BA 3C7AA 4GX0A 3E9NA 5FI3A 1E1LA 1Y6JA 3DZHA 1QR6A 1FXSA 3KTDA 4BNIA 5U9CA 1UXIA 1V3UA 1ZXBA 4BL5A 4CV2A 1DIRA 2VRCD 4M55A 5TJHA 3BZUA 3E9MA 3UH1A 2X4GA 2TMDA 4DLAA 3G49A 4BQRA 3AFNA 2BELA 4K28A 4XQ9A 3WOHA 2FY8A 1Q0QA 1IE3A 5CHEA 3O26A 1I5RA 4CQLA 5KWEA 3SVTA 1GQQA 3OP4A 1PQWA 1EUCA 1H6DA 1ZUD1 4KTTE 4RF2A 1H94A 5DP1A 4CQMB 4PG4A 5JFOA 3I4FA 4E32A 4ZJUA 1Y81A 2V65A 1HETA 3GHYA 2Q4BA 2D8AA 1LRLA 4NHEA 2OZPA 1GUYA 3EHEA 3GVIA 4Z0PA 2C29D 5HA5A 2Q1TA 2X0NA 4S1VA 2Z1NA 3EAGA 3UCXA 1Z7EA 1IZ9A 3ASVA 4IJVA 1A9YA 2C07A 2GERA 1E5QA 3DBRB 3H9UA 1EVIA 1EUZA 1IB6A 5KVCA 1WDLA 4AJHA 2EERA 1MX3A 2BFMA 5EIOA 3PWKA 1LU9A 2BFPA 1EQ2A 4IINA 3ZWAA 3V2HA 1HSOA 5TRTA 4OM8A 5COAA 3GT0A 4J1NA 1KVQA 4LMRA 4YAIA 4UULA 3HADA 1HDXA 1NVGA 4I5DA 4F6CA 2IYOA 2I6TA 4WUVA 3VPXA 4J7UA 3E1KA 1VLLA 3ONDA 4R1SA 4ZVVA 3F46A 5B4VA 4E30A 3ZWYA 5ILOA 3IJRA 3LDHA 5JAZA 1LLQA 1JWAB 5A1TA 2NVBA 2Q99A 5F5LA 4D45A 5L7TA 4AJ2A 4CM7A 3W4IA 1KOLA 1I2ZA 3JD1A 1RM4A 2UDPA 4E4YA 4CLHA 5TQVA 1GV0A 4P4NA 3SC6A 5BQFA 3PHGA 4ZQBA 1D8AA 4CMGA 4GX5A 3W1VA 3W8FA 4CLDA 4Q3AA 4HNHA 2YZ7A 3C24A 5ES3A 5JC8A 4Q39A 4AJ1A 4OSPA 3AY3A 4R5MA 1C1DA 3JYNA 1NVMB 3O4RA 4WJZA 1V35A 3PRJA 4W6ZA 1ONNA 3GUYA 2D2IA 3A14A 1Y8QA 4CUZA 1Y1PA 4BNXA 2NQ8A 4ZHSA 1ZBQA 3U09A 1D3AA 4Y8VA 3WJ7A 1EMDA 1PGNA 4BKQA 4OAQA 1M6WA 5IF3A 4JNKA 4XYEA 4YJFA 1I2BA 1ZNQO 4I1IA 4E12A 1KY4A 5AYVA 3TZCA 1N5DA 2EF1A 4CM8A 2JD0A 4EW6A 3IJPA 1A9ZA 2JCXA 3GN2A 5IFLA 2C7VA 4L4SA 1HF3A 4QSMA 2Y05A 1PJ4A 2X0IA 3Q2KA 1L7DA 2WD7A 2RH4A 2X0RA 4D46A 1KEPA 2EP5A 4WCDA 4R41A 1O8CA 3K6JA 1DEHA 3ZCXA 4E31A 1LSUA 1BXGA 4J1SA 4WPGA 1I32A 1RM5A 4MVJM 3HHPA 4DQUA 1YGYA 3IUSA 1LA2A 3GMSA 1X7DA 4BNTA 4YJDA 4EJ0A 1V3TA 3JQ7A 2Q45A 4EBFA 1BDMA 2TMGA 5LCXA 1B2LA 3DEYX 2VTDA 1GQYA 3QWHA 5EQDA 3VHRA 2PK3A 1ZXLA 4CL8A 4RF4A 4ESOA 1PR9A 3FF4A 3ON5A 5L9AA 1VM6A 2A92A 3ROQA 3UCEA 3WNQA 4OXYA 1E6UA 1TI7A 2NUAA 5KKCA 1R4NA 3EY4A 2VN8A 1VKOA 2GDZA 3ZV6A 1T2DA 5C7OO 2Q2VA 3ZW8A 4FGSA 2I3AA 4O0LA 5TC4A 1JQBA 1HDYA 1ISIA 5TIIA 3TPCA 5TSDA 3DBHB 1MXHA 4WLNA 4CM4A 1ZSNA 1V9LA 3PJEA 2IZ1A 3TWOA 1AUPA 3GRKA 4R9RA 3ZU3A 4KOAA 2H9IA 1HTBA 3ANLA 1BDBA 3AOEA 3DL2A 4IIVA 2J3JA 4CR8A 3DZGA 4H7PA 1AHIA 4LVUA 5BSEA 2FPIA 4XWYA 4EDFA 4W82A 1NX6A 1QYWA 4GGPA 3PDUA 5I9LA 2WE7A 3JQFC 4DPLA 4J91A 4TQGA 5DF1A 2XF8A 3MOIA 1YL6A 1P0FA 2HMVA 3INGA 3PLRA 4EZBA 2NNLD 3VPGA 3WX0A 2GZ1A 3MOGA 1U3TA 2AQ8A 4R9SA 1ENOA 1ZH8A 4M8SA 2PZKA 2BGKA 4ZN6A 3VZSA 5IN5A 2R2GA 5H82A 3HG7A 3F9IA 1HSZA 2VWPA 4IS3A 4N5MA 4E13A 4XD2A 1LSSA 2EP7A 3PK0A 1FDVA 1SPXA 2ZTMA 4KWHA 4BO8A 4CQMA 2QG4A 2DUWA 1ZEMA 2X7HA 3RC7A 3TOZA 4CJXA 5C5IA 3DQPA 3G17A 3UHAA 5KJCA 1NNUA 1WDMA 1ZMOA 1EVJA 1ENZA 3DBLA 3VZPA 1RYEA 4JIGA 4PLPA 5HTOA 2CSUA 3NTOA 4YACA 3GDOA 2O23A 1P1HA 2PLAA 2GLXA 4IJUA 2EG9A 3PJFA 5J23A 1Z75A 1SOWA 2B69A 1A72A 4CL3A 1DRVA 4GQAA 4OQYA 4W7HA 5L95A 1K6JA 1SOVA 3ZN2A 1BVRA 1NPDA 2HQ1A 2SCUA 3HNPA 5TT1A 4PRLA 5A03A 4R1NA 2Y1FA 1E3SA 4XIJA 1E3JA 3TZQA 3GVCA 4KWIA 1KEVA 4XQCA 3ORFA 1RPNA 2NU8A 1BSVA 3B6ZA 4GVXA 2PGLA 4MKZA 4MVJI 1UH5A 3NTQA 1N7HA 3DO5A 4DQVA 2G5CA 2AXQA 3ITDA 1AE1A 1Q1NA 5GMOA 3JTMA 3KLMX 4XYLA 2RBEA 1MV8A 4L74A 1PEDA 2UUOA 1C1XA 5DBGA 4URFA 3GNQA 4DPKA 3LK7A 1H2HA 1HKUA 1X14A 2G0TA 1LQTA 3KLPX 4DREA 4EITA 2I9PA 4XB2A 1IYZA 2X58A 2ZJ0A 4OHUA 1H9AA 3LT4A 4BGVA 3PHHA 2WDZA 4LSWA 3PPIA 1XA0A 4JBIA 4DLLA 2HRBA 2W2KB 5F1OA 4KP7A 1E7WA 3GRPA 3T4XA 3VVCA 3VPHA 3V2GA 3FR8A 1FDTA 1CEQA 1MGOA 3DZKA 4E2WA 3A28A 4ZQEA 3PHJA 4ILKA 1DJNA 2B4QA 1LRKA 4G81A 4IDDA 4DBZA 4DQXA 3UUWA 5JLAA 5A9SA 5H81A 4YAJA 1CERA 5CAEA 5IZ4A 3GQVA 1QSGA 2AG5A 3JQBC 2X9GA 3JQEA 2V6FA 4RVFA 1PS9A 3PTZA 1FK8A 3G0OA 1QV7A 4JROA 1IULA 2IZZA 3IAHA 4JBGA 4D41A 5ITWA 2Q1SA 3VZQA 2VWHA 3UAGA 3QVWA 3IMFA 1IHXA 4PRKA 1Y7TA 2J5RA 4TROA 3TFQA 4W9NC 4BO0A 3UVEA 3ZWNA 4CMJA 2JCVA 4KZPA 2O3JA 1SEPA 4IDAA 1KBZA 3L6EA 4WGGA 4B4WA 1XSEA 5AXBA 2VT2A 4HUJA 2P9GA 3PQDA 3NEPX 1C0PA 1TXGA 1PZFA 2YY7A 3BYZA 1PL8A 1HDRA 1HDCA 1DIGA 4XJTA 2B5WA 3QVTA 3ZNPA 4MP6A 3WGYA 4CLRB 1LNQA 1ULUA 1QXSA 1K2WA 1SO8A 3CZRA 1K6XA 1PQUA 4N18A 4BNKA 1R4MB 4Z3DA 1ZFNA 2Q2WA 1WMBA 2GF2A 5DOZA 2WD8A 4B4OA 5JS6A 2EW2A 3O03A 1P0CA 4NG5A 2O3RA 2PTGA 3NT2A 3CSDA 3DZFA 2I5PO 2GNAA 1GU7A 1N2SA 1YXMA 2YDXA 3WXBA 4BNFA 1Z7BA 1ISGA 4MVJF 4CM9A 5C7LO 2E82A 3WTBA 2QRKA 1T1SA 3FHLA 3CPSA 1I30A 3AI1A 3ADPA 5F21A 3W8EA 4W99A 3DBHA 1ARZA 2XAAA 4DIOA 8ADHA 1NASA 1JAXA 9LDBA 1X7GA 3X2EA 2FSVA 1Y9EA 4E2XA 3U4CA 5B4UA 1FDUA 1PJBA 2E49A 2P68A 3ITKA 4J49A 3ZV5A 1A7AA 2RAFA 1U4SA 2PFGA 1DBVO 5EESA 5KJ1A 3I6IA 1WPQA 3RAJA 4FFOA 4YRAA 2DPHA 3DFZA 4A03A 5TT0A 3BMCB 1V8BA 3FNGA 1RWBA 2VOEA 3ZGYA 2ZYGA 4M87A 3WNVA 1H2BA 4HY3A 4AJOA 5IZCA 4FSHA 5B37A 4BNMA 5DNAA 1UZLA 2J3KA 2C54A 4ONEA 3M2TA 4YJHB 1UDBA 3U4DA 3WICA 4IY1A 2J3IA 1WZIA 4ND4A 3NX4A 4CM3A 1UP6A 1DPGA 2VHZA 4WEOA 2FN7A 4IDBA 4DRYA 5DBFA 3KYCB 4QUKA 1YQXA 3GPDG 3ZH2A 4PLZA 4OXKA 4BNVA 4CUJA 3JYOA 5B1YA 4A26A 1I3KA 1UDCA 4QX6A 1X1TA 3WIDA 3Q11A 3HSKA 4OMUA 1W8DA 1I8TA 1U3WA 1YB5A 3MJCA 4DMMA 2I67A 1PL7A 1YVEI 4AJJA 2AA3A 2FRDA 2Z95A 5CP8A 4BMNA 3VOSA 1J6UA 4FFPA 4R5HA 4YCAA 1A27A 3ZWBA 1EBFA 2VYVA 1IZ0A 4KUEA 2V7PA 2X6TA 2YHUA 1I2CA 3WQSB 2W2LD 1RM0A 2OGUA 2HJSA 3M2PA 1HYGA 5L4LA 5I7SA 3VVBA 3TQHA 5EJ2A 3SJ7A 1XHLA 1H0KA 2QHXA 2PGJA 2NU6A 4OH1A 5CDSA 1XEAA 1JKIA 3U0BA 3W4JA 3E5MA 2X1HA 3ZI0A 6ADHA 5JAQA 2QX7A 2Y1DA 1ZZEA 4M86A 2VYNA 2FR8A 1Z82A 3JCZA 5MDHA 1HL3A 2JL1A 3JYLA 5T8KA 2BKAA 3FNHA 3UICA 1W73A 4PLVA 4JQCA 2AHRA 4TZKA 4YBZA 3RROA 4F45A 2BGLA 1H93A 4PCVA 3GVHA 4ZQHA 3MJVA 2FSSA 5DN9A 2E37A 2NV6A 4PVDA 3A1NA 4AG3A 2QYSA 3OIGA 1OZAA 2LDBA 3MJ4A 3JSAA 5A3VA 3GAZA 1X15A 1E77A 4Z9XA 1GV1A 3JQGA 3JQFA 1ADFA 4MKRA 3T4EA 5KJ6A 3CTMA 4GPD1 5JY6A 4GL4A 2EGHA 2JAHA 4K26A 1DAPA 4PLCA 1DFIA 4L4XA 4DBVO 5IDQA 2VT3A 4YQYA 4Y9DA 4PLGA 4A0SA 4DL9A 4Y6RA 1E1MA 2HMUA 3WGZA 1BHSA 5CDYA 4P4GA 3L6OO 1VC2A 3PIIA 5ENVA 2ZB3A 5BNIA 2CUKA 5F5NA 1I01A 5F1PA 4F6LA 4U0KA 5HS6A 1DHTA 1WXDA 2EKLA 1I3MA 4QTZA 2DTEA 3RBXA 4E5YA 3RUEA 1ZK3A 4CODB 4DMLA 2IXAA 3PXXA 3LC7O 3S1LA 5L53A 4I9HA 4BO4A 2Y68A 5CEJA 2JCYA 2FMUA 2QRLA 3F4LA 1OMOA 4NU6A 2C5EA 2OBNA 1BXKA 1N7GA 3WLEA 4GWGA 3V1UA 3D64A 4YAKA 5TLSA 3VKVA 2X22A 3KYDA 1B26A 4PVCA 4DIBA 3BMOB 4YRBA 3GF4A 1EE2A 3GGPA 1ORRA 1A5ZA 2WWRA 1DC3A 1KERA 1R0LA 2C2XA 3WBFA 2XOXA 2PZLA 1SC6A 2NTNA 4NBVA 2HAEA 1HE2A 1SB9A 4AL4A 5IJZA 3B1KA 3X2FA 4ALKA 3GN1A 2JFHA 1DLIA 3AM4A 1EEHA 4GVLA 4DYVA 3VDRA 1I36A 5F3RA 5KJEA 4A2CA 3GMDA 3DWFA 4CR6A 1LC3A 4NMHA 1MXFA 4RL6A 3LU1A 1V3VA 4H16A 3ENKA 4WOKA 4MIEA 2VHYA 2EJVA 3P2YA 2X5KO 4ALNA 1GY8A 4E33A 3ZV4A 3OJLA 3OA0A 5DZSA 3PWZA 1E5LA 4XDYA 1CQJA 3K31A 3JYPA 2O7SA 4J4HA 2D5CA 1CRWG 4M1QA 2H6EA 5GY7A 2P9CA 2BH9A 4WLOA 3JQAA 2H63A 3NJ4A 2C82A 4AJPA 5U4QA 4RCVA 3D3EA 4XKJA 4OGWA 4ND1A 5C3MA 4UEOA 1PZEA 1KC3A 1PTJA 1Q0HA 1NP3A 3ZNOA 5JDIC 3DZJA 2WTBA 4RDHA 2Y1OA 3JQBA 1ONPA 5ER9A 4DPMA 4RQUA 3NDRA 1XELA 3IKVA 2AE2A 2AEJA 3RWBA 8LDHA 3CMCO 3ICPA 2CVOA 3OSUA 3AU9A 4ALIA 2ZIZA 2ZB7A 4W9NA 3V1TC
chains in the Genus database with same CATH superfamily
4NLLA 5HS4A 1QZUA 1CUGA 4B44A 3NUZA 2GN4A 3KOOA 2G8LA 3JWGA 2QOEA 4C3UA 3SPXA 5J4KA 2IDMA 1TT5A 1Z7WA 1VB5A 1S4MA 3PNBA 1BJRE 1L4KA 1ORIA 2MCFA 3U1BA 4QOFA 1RM3A 5JNSA 2IXBA 3REOA 3NVAA 3QE3A 1YU6A 3WSWA 4A15A 1M2OB 2EKQA 1GNRA 4XRRA 4OLHA 2BR3A 2Z9DA 3I8SA 5HFNA 4C89A 5ARDA 4CKEB 5IANA 1Y37A 2HCFA 4RHFA 1G59A 1UBMS 4QU0A 1YNSA 5E4JA 1QGUA 1VMAA 2C4UA 2ZP1A 5EUQB 4M9SA 4KEAA 1NYRA 1A4IA 1KF0A 3KG2A 4YMGA 5ALFA 1EGQA 1LSJA 1DL5A 4NK4A 2H00A 2QAGA 1N1MA 3DDHA 1ACLA 1LPMA 2WYOA 4MWZA 1WQ4A 4G41A 4H1HA 2HOQA 2BGRA 2HBZA 4N0PA 2QQGA 3TIGA 4B40A 3Q3VA 1T34A 2AEFA 3OICA 4OQEA 4U1RA 3M6WA 1CRQA 1YS9A 4MQFA 5D2CA 3E70C 1N7JA 2AIRA 2FW7A 3QHPA 5H5JA 1EVYA 2R6HA 3ZWKA 4Z51A 5BWMA 2OFFA 1VBMA 3HM2A 4TOIA 2PAFA 5B7NA 1TAQA 2VT7A 3L4JA 1ZMBA 3L49A 1P1KA 2I9KA 1M6HA 1UC9A 5TJ9A 4Y6GB 3W3AH 5ICMA 3KAQA 1C9YA 2BH2A 4F46A 3D7LA 3BTOA 5FTKA 2V6BA 4P98A 1RBQA 3AETA 1MA0A 4NDNE 4RF5A 2Q7OE 2PGXA 1XYGA 3ZWOA 3L02A 4C4ZA 4X85A 3B38A 2AN1A 4BRZA 8GPBA 1I4OA 1P19A 3HJAA 3HNOA 4G9GA 3AILA 2DPLA 4NC9A 1A7UA 1U90A 2GZDA 3N39C 3OETA 5DGHA 5HF6A 4FWIB 1ISHA 5GJWC 2WHEA 1IEWA 1Q0ZA 1XCBA 3B7WA 4CMIB 1JIJA 3ZNPA 5JCZA 1XQ6A 2QX4A 1JYSA 1RHQA 4L22A 2XRMA 3A27A 3ZWQA 4B3BA 5L4NA 4BBJA 2X9LA 5LU8A 4J9VA 4IGEA 4LYFA 5GV7A 4YUVA 2ZE6A 5LA6B 2R2AA 3WGHA 3I61A 4XI9A 3K0BA 4JB8A 4RGQA 3PNYA 2HK7A 1KGSA 4QU9A 2REXB 1KE2A 2I3GA 4IFIA 1NR1A 4LY9A 3ZLJA 2AR0A 3VGJA 1SHUX 4MK4A 1ZS9A 1LJUA 1VP3A 4LPKA 3RLIA 5AVYA 5IZCC 1BIFA 5CXUA 2B20A 3GIWA 1I7PA 3OZWA 1J9ZA 3ETCA 3GELA 2XA2A 3V4OA 4BTVA 3K15A 4O5AA 1WA5A 3AU8A 3D5EA 3VUEA 2UYQA 3DKIA 4AF6A 2F43A 3DFUA 5E6RB 4NECA 5BWOA 3KYJB 4JVMA 2BCGY 2GJ4A 4KWCA 4RHXA 1GPKA 2A5LA 4WH0A 4QQFA 5AJTA 4KLCA 1U4OA 1ZU4A 6NULA 1EUDB 1IFXA 3NBKA 4U8GA 3RARA 3TLXA 1M6VB 4XFJA 4I08A 3DTVA 4RD0A 4C43A 1JG4A 1U6JA 4Y1RB 5DYGA 5KYUA 4CGZA 1NIJA 4EJ6A 2N9UA 4L5YA 1WIWA 3IKJA 2C3OA 1G4HA 4V1CI 2PU7A 1U3GA 3M1AA 4Z99A 5FI5A 1ZAKA 4XCVA 5H83A 1XR3A 3IXMA 3ESZA 2WAAA 2NWQA 4HTAA 4O4IF 6ABPA 5FPPA 2PV0A 3ETEA 1T13A 3AYZB 2I91A 4HK4A 4EJSC 1DEAA 1Z74A 1WSAA 3KTAA 1M54A 3R6GA 5MGBA 1KIAA 3P2IA 3EGOA 1AKRA 3EIHA 3JQ9A 4M2LA 1P9LA 4P35A 1E99A 1L4YA 4URUR 5CPBA 1KDYA 3R5JA 4F9EA 4RTSA 2ETVA 4UHBA 3QLUC 5IUJC 1I24A 2G83A 2ZCUA 4QPZA 4RE5A 4F97A 1GPH1 4D5GA 1VQ1A 1JBQA 5A2GA 3D2AA 2GUGA 3W5HA 2EL9A 1Z16A 1YT5A 1JTVA 1SG0A 2H9AA 5U4XA 5CCXA 1IZZA 1EH5A 2NXJA 1PUXA 2B34A 3EDYA 1BWSA 4UEJA 4UTOA 3RYFA 5C8DA 1UDRA 5FP0A 3MS7A 1BVYF 1DMSA 4EG3A 5K3OA 4KSYA 1YE8A 2GPYA 1QTIA 1UCFA 2XJ4A 3A31A 3NM5A 2WJYA 4FCCA 3WL3A 4WOJA 3WYDA 4YMHA 2D59A 5CBKA 3CKMA 1G5TA 3BXGA 4U5QA 3IBYA 4YNBA 1Z5NA 4L5IA 4XDZA 4MIYA 3EN0A 4ER6A 3PUXA 3WK6A 2YASA 3ZHZA 5LP1A 2QAJA 4GRIA 3RC9A 3VH1A 1RIIA 1YB1A 3OF3A 2FSIA 4HV4A 1DWQA 4D44A 1N78A 3B70A 2N42A 1NVEA 1OI7A 2CKDA 1UUFA 3NRJA 4GMHA 3CFYA 4OJTA 3HWSA 3ORYA 1AUQA 4DC0A 1IXRC 3OAAD 2CMFA 5G0VA 4J0HA 3S8EA 1PX0A 4G9BA 5JXGA 2X0FA 2YXBA 2I2CA 4TWRA 3M4JA 3CRVA 4H7JA 5BWCA 1ZIYA 2PH7A 4BNGA 4QGHA 2Q6IA 1X86B 4H08A 4TZTA 4ZJZA 3KQKA 4HVLA 2B8NA 3MK31 5F3DA 2P5SA 1LKZA 4LQLA 4F2PA 1VMIA 5DKFA 5E1DA 4JSRA 5JCJA 4HYYA 3QXXA 4FFLA 3DTVD 4QRIA 4PNZA 1MFPA 2HK6A 2PBZA 3I04A 2ZUDA 4WZZA 2TMKA 3X1JA 1JL3A 4Q3EA 1RC1A 4ZPXA 3ZZUA 4A27A 3WQHA 2NU9B 3TLJA 3RS9A 1ZONA 5ITVA 1D4AA 5JO0A 1NOIA 1QDEA 1OFUX 3EF1A 1GKIA 4JR2A 3B20A 3KPWA 3DXYA 5KMGB 4MI9A 2B37A 1K5PA 2CZGA 2DH5A 2YJ3A 3LY9A 3O38A 4IWNA 4S3MA 4XOIA 3LCUA 3TRIA 1P7CA 4BO1A 1FSZA 1EXVA 1XZDA 2GJSA 1QKJA 3PA8A 4MLCA 1DDIA 3F74A 3GEDA 4KXFB 4QYIB 2CV2A 1DJMA 3HL4A 1NULA 4NOMA 2VOJA 3DLAA 3MWFA 3GXOA 5CNJA 1VSVA 4WVFA 1KEEB 3O90A 1K92A 4DY6A 3NTRA 2CBGA 2PZ8A 1FUUA 4CIVA 1DRJA 4LHSA 5E8JA 2GM3A 2MTBA 2C96A 3B85A 4FIDA 4MKIA 3WYNA 2QA5A 2F48A 3TUIC 1KNQA 1NQ5A 3I3SR 5JASA 1HDGO 2I71A 3DGEC 3TEMA 4R01A 1EJ0A 1NMYA 1F0YA 2QNIA 2QENA 2PQ0A 3I23A 3Q87B 4C21A 2QD3A 5F1KA 4EUHA 2QPOA 4GUAA 3SXJA 1AT1A 4U9HS 5I9NA 2G70A 4JP5A 3UJHA 4PLYA 5JI2E 5SYNA 4F3NA 3D6VA 3LOQA 3NCHA 3EIUA 4G5HA 1Z4MA 1KZHA 4IVNA 1C9MA 2H1VA 5BW5A 2VJLA 4J90A 5BNFA 4LFCB 2CFIA 4PANA 4M99A 2J3QA 4AKGA 2Y2UA 2ZG6A 5I7WA 1WHSB 3AEQB 1NMXA 4HB2A 4A0GA 4CXMA 2HQRA 1QP7A 3IAXA 1C14A 2HM7A 3RSGA 2Q3CA 3EG5A 4WLVA 4COKA 4ZAXA 3DC2A 2VG8A 5G0TA 2FG5A 1FBTA 4FTWA 1LQUA 3UMMA 5IT5A 2VDKB 3LTEA 4NWIA 1FDSA 1CETA 5SY6A 1TM5E 1U5BA 4NZNA 1HE3A 3SR4A 5IP5A 3AJRA 1PNTA 3E15A 2H0RA 3R5XA 4WNCA 2OAQ1 1E92A 1NZJA 5F9HA 1YCHA 1B8VA 1U2SA 3K09C 1YZ3A 4LG1A 4X6LA 4C22A 2DFLA 1TYZA 2OAGA 2ZI7A 1HKHA 1UPAA 3AG6A 4HB4A 4UMVA 5EQFA 4A8JC 5LN1A 4KN8A 1YBAA 4DADA 4ODIA 4MVJP 4WERA 5EL0A 4YAGA 2WI8A 3MZ0A 1XQWA 4MKGA 3FWNA 3IRVA 4FZ3A 2VXYA 4H60A 3HXLA 2C78A 2PSJA 4G1EB 1XU4A 1COWD 3N05A 4NCNA 3ZWPA 3ZW9A 5AP9A 4GKJB 3PFHA 4JOSA 2C31A 4C6TA 4HYQA 1JT2A 4D0SA 4N40A 1KP2A 1KJ9A 2P9TA 3GRRA 4IXMA 3A9UA 3NJ8A 3DNFA 3VRHA 1LK5A 2W6ID 2X19A 4UC0A 5HR5A 1GCOA 4GHWA 4P7FA 1A98A 1DDOA 1UIRA 1HE8B 2YV3A 5TPWB 3OO1A 1LLFA 4PZLA 3K1JA 5F7OA 4DIEA 3RUAA 5EXPA 3CQ9A 1Y3CE 1RCFA 4MWOA 4Z0HO 1KYIA 3H11A 1KI6B 4D4MA 2OO5A 3UKOA 4NBTA 4F2DA 2WNHA 5DHFA 1FFGA 1MABA 3G1WA 3W9BA 4XFDA 1NV9A 4JEUA 4N54A 1KETA 1C0IA 5GM1A 1GQSA 2AOUB 2OD2A 3CBQA 3I83A 4ZEXA 1BEEA 2H52A 2AJ8A 3BKXA 3KVVA 2XPCA 3FBTA 1QUEA 1H9BA 1W2WB 3JQ8B 3MJTA 4FN5A 3DLBA 4FFWA 2BDEA 3C3AA 4PV7A 2VK8A 1DEXA 4M0EA 3QKSA 3FRHA 1G8AA 5JNVA 2W7TA 2HHAA 2Y6VA 1NJGA 1IN8A 1H0RA 3LQ2A 4M1KA 1NONA 1QMGA 1NOJA 1WTAA 2HXSA 4X1YB 5EUMA 4MITA 2OVBA 3L93A 4IILA 3UXYA 1HC7A 4RA6A 1PWXA 3V3TA 3GLIE 1V45E 2JVIA 3AOGA 5FOTA 4RSMA 1U8UA 1KI8A 4BVAA 2RAUA 3C45A 4RPLA 4K6FA 3RNLA 3JWPA 1TADA 1JB9A 2GWRA 4JL5A 2A5FA 1Z29A 4KXUA 2IY8A 2QU7A 1TD1A 4XEUA 3OQMA 3OBBA 1RMQA 1IQUA 4QA9A 4OP1A 3WB1A 4KVFA 3JALB 1RJWA 1SKBA 2ZYIA 1Z2PX 2DE0X 4R51A 3F6CA 4ETIA 5A1JA 4N41A 2QAGC 4URHA 4D25A 2AC2A 4FD3A 4OXIA 1VZ2A 2ORED 3GLGB 3W4KA 3DR3A 4Q4CA 2RHDA 2VDWB 3AUTA 4F9FA 2TMYA 1UOQA 2PV7A 3ZHYA 2HRRA 1W5TA 2ZI6A 2NAFA 3N8KA 3AUAA 3I37X 5FEUA 4K9OA 1ZC3A 3BE6A 3NGMA 4Q05A 4OXXA 3U4QA 1BDHA 5BVHA 3Q7RA 5I3CA 3F7MA 4D0RA 1GVHA 3IILA 1NDUA 2X8LA 3A04A 2OXIA 3SQMA 5GADl 5KCMA 1CJKC 4QECA 4FEEA 1TC1A 1O87A 2ZRKA 5FLYA 1B1AA 1NPYA 4ROSA 1AS3A 2XYQA 4DDMA 3L6BA 4HAZA 1CUDA 3SWWA 1DCTA 2BBWA 1CNFA 2FWJA 3R23A 1JDPA 3U7QA 3Q2IA 2XMZA 3A58B 4NF2A 4OJKA 3EYWA 1Y7LA 5KB3A 4BX0A 9MHTA 3QVSA 1I2DA 5SYAA 1PE0A 2Z6AA 1RAGA 2F1JA 3MTQA 2C2BA 4PYQA 2FW8A 4TS1A 1QZZA 2CJWA 2MT9A 3MLBA 4XSGA 2W90A 2F4VB 4OSEA 4Q9IA 3ZDDA 3LNCA 1FE8A 1HZJA 1UOEA 3ADOA 4BVEA 2CY0A 3HBMA 2HLDA 5CB8A 3MXOA 2UVDA 1PG0A 4L9SA 4LYEA 4OU5A 4S0XA 4AZVA 4DZZA 1AHNA 1P31A 1I7LA 2O20A 2VHXA 4E46A 4HWOA 3TVYA 4LV6A 3GROA 3KC2A 1GEEA 1ZCAA 2HKIA 3AR2A 3BWDD 3OFSA 4L8YA 5EJIA 221PA 2ASEA 2QAIA 2FUG1 2VK4A 1BEUB 2XRZA 2WVAA 1IY1A 2BN4A 2WJIA 3UT0A 4YUWA 3L8MA 3ET4A 4LDNA 4FQ8A 2CHUA 5BMOA 4DLNA 1JIKA 2FGKA 3FCOA 4IV0A 4M9UA 4FU0A 1CY1A 4ZCRA 1MJGM 2HDWA 3PTLA 1M34E 2FRVA 2XVXA 1N5MA 2C4NA 3MYRA 4YIKA 2D62A 2ZIXA 1C4XA 4FI3F 4YT8A 1YBFA 3JV7A 1XKXA 1ILWA 1PQPA 5ULLA 1DHRA 4IHKA 1FF9A 5IT9A 2AF3C 2J4CA 3DUFB 1YS2X 3L0SA 3F7OA 1M66A 1J2UA 2QTAA 2IQ5A 1KQ3A 4NV1A 1JEYA 3L0ZA 5FDFA 2WTNA 4U02A 5BT9A 3F97A 1KH1A 1L5NA 1TM3E 5HFAA 4BFWA 3INRA 4PLHA 5KU7A 4GG1A 3OEYA 2JAPA 4RH0A 5C0OE 4M1MA 3I2FA 5B3JC 1NVXQ 4CM9D 1G5QA 2QL5A 2D74A 2JIOA 3IPAA 2Q4OA 3LC0A 2JI4A 4FMCB 3V46A 2J0SA 2GN6A 4YPVA 2VP0A 3U9LA 3GH3A 1CR1A 1QM5A 4NU5A 5H68A 3R3SA 2Q9BA 4GLLA 4IRMA 5F5XA 4Q9DA 1GLNA 4BGEA 3ZDYB 5ERGB 4D3FA 3EARA 2L18A 4HEA6 3B78A 1QRRA 2G76A 4IJ6A 3UKDA 3NC1C 1WHSA 3JQ9C 3OKCA 2W2OA 3SE7A 2OGSA 3I8OA 3ZDEA 1GPMA 4BWVA 4U7DA 1TOAA 2C3UA 2Y0DA 3BBLA 4PFKA 4DSOA 4QULA 5ABPA 6PFKA 3NVKI 3V9AA 1X7YA 1BKSB 3GJRA 2G4LA 1I6WA 3ENZA 3D7SA 4FR2A 1P7PA 4YYZA 5JWOA 1T5HX 1OGIA 4OHCA 5IM4F 3EDRA 2FWIA 2G36A 1KO4A 2J41A 1QGAA 2Y1GA 4FZ5A 4WIAA 3E5HA 4DSAA 1V41E 4XCQA 3V1LA 2CUZA 3FIUA 3TAUA 1TEVA 3OE7D 2XNKA 1ADGA 5KKAA 3HVHA 1T2EA 3NZEA 1A9XB 4KE7A 4MUKA 3OJFA 3EQ2A 3WISA 4L8VA 3ZY4A 4ZZ3A 3SJUA 1E7MA 2XNDD 1TKCA 1ZQ9A 3I0NA 3KJXA 4BNYA 4ENUA 4JJGA 2PCLA 3AKEA 1LDEA 1R5OA 4MRPA 1RCTE 4LKRA 3C3EA 3IE0A 4TXJA 2QPLA 5G1OA 3RVLA 3FYUA 1W0JD 2PS1A 4IHAA 2OB2A 2CF5A 2DCUA 4C7VA 3NDBB 1OR8A 2VZ0A 1JJFA 4K9SA 3G2QA 3LQFA 2DR0A 3K53A 1YJ5A 2P35A 2YIMA 1ZHOA 1KIMA 1FRZA 1NYLA 2WE8A 4N65A 4ER3A 2PWAA 1WCV1 2JPDA 3NXKA 3KHUA 4FT2A 1IG3A 1N2CE 1NF3A 1Y4DE 1DU4A 1XBTA 2H18A 2QZJA 3L4BA 3NHPA 4FHFA 1KVTA 3PR3A 2VJNA 2G07A 4WLFA 4YC7A 4C4XA 4EVSA 5BWBA 1DQRA 3ZPXA 4E2XA 4U2FA 1WCIB 2FPSA 1R0XA 3OI7A 5DMHA 2J67A 1NW4A 1MLDA 5AKHA 2AOUA 1V48A 1DQNA 4ML3A 2X4IA 4MQ4A 1PZGA 4R2KA 4AUKA 5IKPA 5JPDA 3F47A 4N8EA 2QD1A 3JQ8A 4UU8A 3T8YA 4DR1B 2EAUA 2H4FA 2DPMA 3VISA 3BA6A 2ECQA 4YEDA 4C29A 1P7ZA 4WASA 3HKCB 4RMJA 3VR6D 3C74A 1T25A 2WHXA 3V32A 5KU1A 4EUFA 2A58A 4NJEA 3LP8A 1H6BA 3RUIA 3TGPA 1QR2A 3AFMA 1KRHA 1C7JA 4LOJA 3DCYA 2ADFA 1OC2A 1U28A 2C77A 5ICCA 5KSYA 1JDJA 3EOAI 3OQ6A 1IXYA 3MHPA 1X7HA 2QMUA 2VJAA 4TXMA 1WXQA 4NL4H 3O4GA 1Q21A 2KW5A 3BB3A 3PFFA 5GJCA 4EHIA 5JSHA 2VQFB 3PRHA 4CN8A 3DE4X 3Q4GA 2QZ9A 2RHJA 3ZHRA 4DMGA 1QHHA 2P4UA 1GUAA 3GFRA 4EKYA 3WLIA 4BNDA 1R0WA 2VYND 1FQJA 4JZKA 2XB6A 3FYHA 1XG5A 2WU0A 2DLCX 3SNHA 4BP8A 2NT3A 3O8OA 4X9XA 4LF8B 2IXEA 4ADSG 4R2WA 1JIQA 1Z0AA 1Z6ZA 4MWCA 1OX5A 2CSXA 1EFVB 4OB8A 1BGVA 1TU3A 5J43A 1KMHB 2WBLC 3RREA 5ITZB 4O2AB 3RFUA 3O1JC 1ZP6A 2JIRA 2YV1A 2QQ5A 2R6AA 4KXMA 3FF1A 3NGLA 1B16A 5DGXA 3EIEA 3D31A 4C2UA 3H4MA 2GTHA 1M75A 4RLSA 2O1XA 3FY4A 2W8ZA 2O50A 3FOFC 4LQCA 1MEOA 1VL8A 4OHPA 4TWBA 2UU9B 3RBZA 3M5DA 3LQKA 3I9KA 3LCVB 4YCJA 1VBFA 3CMMA 3HV2A 1FSPA 5ELMA 4JGBA 3SEAA 3PIDA 3R5TA 1C30B 1YZNA 3BMCA 3E9QA 3HFGA 1NJ8A 1RPJA 3Q9NA 2OAP1 3JQ7B 1RE0A 2FN4A 2GCGA 2B7LA 4PSAA 1DCFA 2DBVO 1OA0A 3PKIA 1G3UA 4ZAZA 4BVBA 1J56A 3TQRA 2WUVA 1P4AA 4ZVPA 3SYKA 1U9IA 3D8TA 4PAOA 5TPZD 4QJ3A 3GRUA 5ER6A 3I9LA 3A25A 3P9PA 5COQA 4QEKA 1BGXT 1P4GA 2GZ3A 2NUAB 2GFQA 3CZCA 5JJ5A 4MPDA 3HEBA 3E61A 1S8FA 4I9NA 3TD9A 2IH2A 1XDWA 2AOTA 5A0VA 1CWUA 1SZPA 3CZ5A 3IT3A 2UYYA 2WYVA 1XN1A 3MA0A 4MNTA 4MPJA 1C80A 2F9LA 2WD9A 2B82A 5TMBA 4MUNA 3IJEB 4K6CA 1XP8A 3DUFA 3QFCA 4N9QA 3CIFA 4E11A 3G88A 3VYSB 2OO5C 3EE6A 2OBMA 2GXQA 1NW7A 1GEGA 3W5AA 4QXPA 4GLBA 5C8VA 2ECFA 1HLGA 3HXQA 3ROXA 5JAMA 4LFBB 5IDYA 3HC7A 4Z3OA 1SU7A 2DWOA 5ALXA 5BYKA 2PVPA 1Q44A 1FFWA 2BHTA 2QV7A 2G08A 4DZTA 1DTSA 4PSUA 3DEJA 2G17A 2HTEA 1ORVA 2PGNA 1TZCA 1XGKA 2F3SA 1EIWA 2HRQA 4PO8A 1C8VB 2OHXA 4KBYA 5E7IA 1TEZA 3D4NA 1RSZA 4PTLA 1DQZA 2BKVA 3OEEA 4KFSA 1U2DA 4O4HF 4F93B 3UK1A 1T6YA 1VLJA 1A9QA 2VAXA 3UWPA 5D86A 4QOHA 2HK8A 4AJHA 3B13B 4DMKA 1KI4A 1M67A 2RIPA 3P4XA 4J0QA 2PX4A 4UNNA 1CZUA 3H3FA 4LZLA 3OJCA 3Q40A 4WKOA 4MO9A 1IJBA 3F5DA 4X1OA 4ZO8A 5DHRA 2PS3A 3ZU2A 3QU5A 4G24A 2EG5A 1PJAA 2Q1UA 2C94A 1IG0A 4X7PA 4INJA 5IAGA 3S68A 4B84A 1LPSA 1JIXA 4DB4A 3PR1A 4GOLD 1E1RA 4G2TA 4C7OB 3HJHA 3SX0A 1A88A 4LYYA 5LNK6 2BI7A 3A2NA 1TAUA 5TGTA 1BD4A 2GN0A 2UVPB 3GG9A 3BWVA 2ALJA 3GYGA 1GFSA 1VDMA 4G0VA 1Z34A 3LPLA 4GPEA 1UMDA 1ZICA 1Z0SA 1HQKA 4ISBA 3WZLA 3ZXIA 4EY4A 1T5OA 2MMGA 2SKCA 2KLHA 4JJZA 2J6BA 2ROQA 4L5BA 2P3SA 2W6PA 3MT0A 3MJDA 4D4LA 4GQIA 3EZYA 1O1YA 1VI6A 1ODCA 4AXBA 1YQTA 4GI2A 1GGVA 3A4IA 2WILA 2F1HA 1MRNA 3HU1A 2YZ2A 3QIVA 5CYGA 1MB4A 2POCA 3FAZA 1JA0A 4FKMA 1I7DA 1JJVA 3I6QA 1ORHA 5ICSA 2NZUG 2AI1A 2JD2A 4BY9E 2EXXA 4B82A 1VZ3A 2AUMA 3G0IA 4G3XA 4NNPA 2LE0A 1ISRA 1PL6A 3L3BA 1OXXK 2FFBA 4IX9A 3NUGA 5CDHA 3LJKA 4JB0A 1N5RA 1WCIA 4OGGA 1T8RA 4D1YA 1PDWA 1QX3A 1ZH6A 3JZMA 1XRMA 3BB4A 4CV1A 3T3DA 1MO2A 4IGFA 3VYTB 4G0WA 5EPEA 1N8KA 1XRQA 4I81A 3W6PA 1WVGA 3RHZA 2XUAA 3NIWA 3R0XA 3V8NA 4RPIA 4DARA 1X7WB 3I2HA 1JU9A 4YP1A 1XPJA 5I5GA 2ZXFA 1PJ2A 2P2SA 2IS2A 4C0HA 3HMKA 3KD2A 1CF2O 2CDBA 5FPKA 1DV2A 2OORC 3LF2A 1J09A 1T26A 3VSBA 3GR6A 4YMTA 5EINA 3IUBA 3RU9A 1D6MA 2E3JA 3K9CA 3EZGA 3OIDA 5SZIA 3D7RA 1JQJC 4EFLA 3PYMA 1E61A 2XMBA 4PBSA 3GL9A 3N2LA 4EX7A 2EWWA 3PNOA 2PWBA 5E9QA 1WRBA 3BMOA 5DEOA 4HRXA 1JLLA 5A9SB 5LOVA 3Q8LA 1ONOA 5KTMA 4B3RB 3LRPA 4UHEA 1A04A 5CAEB 1U9YA 2AJDA 1NXQA 1TPZA 1H8HA 2ZRBA 4RIFA 2W98A 1VG9B 1N33B 2ZS8A 1J8QA 2C7PA 4IQGA 3QIAA 4Y2HA 1G41A 1H2YA 1M8KA 3VC2A 4BGVA 2HGZA 4ER5A 3W6OA 3BXFA 1FW8A 4BNWA 5JD4A 2OEPA 2P3LA 3G5MA 3JTEA 4IUYA 1E7SA 1D1QA 5TF4A 5FBHA 1OVGA 3PJGA 4R1QA 4B7ZA 3NAMA 3IE1A 5ALPA 5JH7A 3TFOA 3OX2A 2P9FA 4O2AA 2DT8A 4PYRA 1PYGA 4FB4A 5CIYA 4KR2A 1MEEA 3CZPA 3KZMA 3K9HA 2IY7A 3H2JA 4FYXA 4X5OA 5EZYB 3S1AA 1DC7A 4H35A 3SVLA 3U4MA 3UJ7A 1L7XA 1JLKA 3I9OA 3IMKA 1T3SA 1XVVA 2NTEA 2Q5HA 1ZOSA 4Z8XA 1LI5A 5IYZB 4S0ZA 3ABQB 4P9NA 3AVVA 2RC5A 5KVSA 4B32A 3AVUA 1PUJA 4O4LB 2DSTA 3H5RA 3CKKA 4N03A 4PM4A 5G0WA 3GLVA 1NR7A 4QTTB 1WVMA 2ZBGA 1VBKA 3TPZA 4P93A 2ZYAA 1QU3A 4J1TA 1LSOA 3G5UA 3NIGB 5KC8A 3ZCRA 4LJKA 3AR4A 3E8SA 4D8XA 1UBGA 5ETJA 3O6VA 3NHYA 1GYRA 1DAKA 4QOJA 3F8SA 1S3GA 3ODPA 3TLGB 1II8B 1GDHA 1SUEA 4ECEA 2A9PA 5JWRA 4BO3A 1C3VA 1GTMA 2DPGA 1OJ7A 2NUPB 3UB3A 4BNLA 1I94B 4KLRA 3VMFA 4M3NA 2ZRJA 1R1DA 3C6MA 4HXGA 4U2EA 3TI9A 2J0UB 5C81A 1EB8A 2PYDA 3KR9A 3L40A 4XARA 1P60A 4QVGA 3CG4A 1DARA 1TO6A 1MX1A 3SKVA 4TYQA 5JXWA 3UJNA 4N76A 5CG1A 3TQTA 5DNCA 1CJTC 4BTEA 1NY6A 2FP4A 3F5QA 4IOLA 1RPAA 3HN6A 2DQKA 2JIBA 2YZNA 3L4BC 1IHYA 3M81A 1X9GA 4JBWA 2E4XA 3ZHXA 2G09A 1UZNA 4OQFA 4MX8A 3LLSA 1CYEA 2DJIA 3KKOA 1YMQA 2Y1XA 3EIFA 3SM9A 5EQJB 2WM2A 3HDTA 3T1TA 4D3YA 1ZIXA 4S12A 1E1KA 4M36A 4E5MA 5CA1F 1XJ5A 2XVMA 4I2VA 3G1TA 4MGHA 1CUYA 1D2AA 5CGZA 2C9YA 3KEQA 1CEEA 4ITVA 5LMNB 1RXYA 1Z47A 1WP4A 1A4UA 3EEFA 3ONEA 5HIMA 3EIOA 3Q2OA 3WWCA 4YUYA 5IX8A 4RLQA 2GVZC 4DCTA 3NH6A 1XRLA 3U5TA 1HA3A 1H6CA 2Y1EA 5JLJA 4K9RA 1L7MA 1GG8A 4YWJA 1W88A 1TQ8A 1LW7A 4K9DA 4E1VA 1E20A 1AO3A 1G64A 1R74A 1F8YA 2JKYA 3CT4A 3TQFA 4E1AA 3A3KA 4F8JA 1DADA 1LI4A 1DRUA 1PK9A 1Z7YA 4D4KA 1GG2A 1VHWA 3AEKB 3IP6A 1DTEA 2Q4EA 5HRCA 2DQZA 2QP4A 2QN9A 1U3UA 3IULA 1DOHA 4O6VA 3CLUC 1I3NA 2VNAA 5TMDA 4BLWA 2RHBA 5FYQA 2EJTA 1O2DA 1ORTA 4N5DA 3G0HA 4AVYA 1N36B 3CX6A 2HJRA 4B6GA 4KO1S 5BYAA 1US8B 2QP9X 5C34B 1Q7BA 3VHLB 1N9GB 2MYNA 1WSDA 3F98A 5G41A 1GA4A 3GV0A 3G2NA 3VPDA 1YS6A 3ELUA 3REQB 3T9BA 4U6SA 3P9QA 3AG5A 1KRWA 5JNTA 3HCRA 1SXGA 2AW5A 5J63A 5LC1A 5ALIA 3U3ZA 3WWYA 2J5KA 4M8NE 4JASB 1F5NA 2H3EA 3D8RA 3FZGA 3WFZA 1D1TA 2RHOA 3G2LA 4UHDA 3AKZA 1T9HA 3QMMA 3QBJA 1C4WA 2XQFA 3K5PA 3C3CA 1P5RA 1NBHA 2PR2A 3AFOA 3LM8A 3SSOA 2ZYSA 4JUFA 5K01A 2WWIA 1KI2A 4OOFA 3B3FA 3KB6A 3JQ6A 1VJ5A 4P4SA 1VL6A 1C7ZA 1KHHA 1T9DA 1HNNA 1X8LA 1MA3A 4PO1A 3G8DA 3N7TA 2MINA 3U4HA 2FWMX 1DC4A 1E6LA 2DJ5A 1E89A 1F5SA 2YVLA 3SM3A 2WAXA 2EGUA 2ZPTX 3B9RA 3KJHA 4H2DA 3KLNA 3NBYC 1FTYA 2WJ3A 4IHJA 4JJ6A 4MP8A 4P32A 4XX0A 4DGSA 1V7CA 3IDZA 4ENSA 2FPPA 1U1IA 2Q8PA 2XUDA 1P75A 1J8YF 1P0QA 1WDKA 2G4VA 3D3WA 1DJPA 4GAEA 3KOYA 4KE6A 3TLCA 4B35A 3ZD7A 3SYRA 4AN1A 3P0EA 4TUYF 3BMQA 3W3AA 4JHXA 3OBIA 5KNDH 1QV6A 5KO2A 1U5AA 5L3SB 1SG6A 2O3UA 2V45A 3B3GA 1U9IC 3CXRA 3LPDA 4DR3B 3CN7A 2QGNA 2QNRA 4W5RA 4YP7A 5CB4B 5KNBA 2RGDA 3OURA 5CD1A 1UK9A 2HA0A 1SOMA 1Q2XA 1QBKC 1W46A 2OHJA 2DKOA 3O4VA 4EY7A 3EYAA 2KWIA 2X0JA 3IHKA 4J4BA 3MWEB 3S29A 5HX7A 3E9EA 3IQXA 1ZH4A 1JKJB 2IRWA 3IAM6 2RHRA 3AJEA 1Z4QA 2FEXA 2OPHA 3RIHA 1V39A 4RULA 1NMZA 1V5IA 2W6QA 2ZFUA 1K98A 3B7GA 3JQGB 3VNUA 7MHTA 4GGMX 5BN5A 1S1MA 3MTGA 4OLAA 1ZSYA 4Q4LA 3STVA 4B09A 4PLTA 3K9FC 4DAEA 1C5KA 1VLMA 2VJQA 4PO9A 3UWSA 4D79A 2K2QB 2BR4A 1Z6GA 5AOAA 4HPJB 4CR7A 1P5FA 3QKUA 3SMVA 2MSKA 3LUPA 4CEIB 5HOEA 3CZQA 3KBBA 2ZUVA 4RJ2A 4MPPA 1XXHB 2J5QA 2V59A 3TBKA 3MGAA 3TXAA 1BS9A 3OFVA 1YDEA 3ND7A 3PFIA 3K5WA 3PS9A 4I4NA 4MUXA 3UENA 3VM6A 3QYPA 4C05A 2GESA 4GMXA 2JCGA 2Q50A 2OCDA 3H8SA 1U3CA 3FD8A 2M98A 2PX3A 4O25A 1F17A 4HS9A 5ERYA 1WPXA 2ATEA 3ZOKA 4RQTA 4C7MA 4F4HA 3AV0B 2FUEA 2QN1A 4JC4A 5IVDA 4F3YA 3H5TA 2PYZA 3OZGA 2NTJA 5DP2A 3EFOA 1Z2NX 2G1JA 4AM8A 4HMQA 3AF0A 3KSBC 4NAHA 5F3WB 2E4AA 1EX9A 3WOVA 2BTQA 1YUBA 3GXBA 1EXDA 4GLJA 3B1WA 1O9BA 4W7SA 1PJQA 1A0OA 4LXGA 4P3KA 5I9MA 3VR5A 1HT0A 4FXOA 4HJXA 4C07A 4MPTA 4NICA 4Q3DA 5EMKA 4LOAA 4WZAA 1QH0A 1P1CA 4YRLA 3E48A 4A3SA 2O54A 3U17A 4TKVB 3PD0A 2R25B 3KDAA 2R3SA 4KR0A 4Z2YA 5SYMA 4QHYA 1NQWA 1V6CA 3C7DB 3JWEA 1DC5A 2YJNA 3P9ZA 3FTFA 4WJKB 2X4LA 4GBGA 4DXAA 1T6XA 2VHWA 3TLGA 2GILA 3NWJA 1D5CA 2Y0EA 4AG6A 1ZR2A 1ISJA 4ARCA 3FPLA 2ODQA 5F33A 1CNEA 4TVBA 3GUZA 3FHOA 5DWVA 3COSA 2C2OA 1NWHA 1TF5A 1OSNA 1S3SA 1XD8A 4HZGA 1TLTA 2H65A 4TT3A 3SZRA 3U49A 2W2LA 3WKDA 1PT9A 1FTGA 3K70B 2VXBA 2AG8A 4R1UA 1YJ8A 2GMWA 3WB9A 4B7UA 1TFUA 3WL5A 4F84A 5K0GA 1SBYA 3OPNA 1G3QA 4OQPA 2AYYA 2J30A 5JO9A 5DRTA 3E35A 2VYCA 3DOCA 4BGUA 4LVOA 1RQNA 4R9NA 3NRCA 2GKGA 2MJLA 4EB3A 2P0YA 3DAFA 3RVDA 5C80A 2Q4RA 2XJ9A 4ZYXA 2XMCA 3M6LA 1CQJB 2YVUA 4PAMA 2YIJA 1IN6A 2ZYUX 2OGTA 3E81A 1L5YA 3H9GA 3CE6A 1QIEA 3JATA 4H0CA 4Y18A 1VYHA 2FR0A 3MM4A 3O9ZA 4AJNA 3LLUA 2HXYA 3EPRA 3GLHB 5AOVA 3WL6A 3UTCA 4AMBA 5K0TA 3JQAB 2ERXA 5LXTF 3RTCA 1F14A 3GVPA 1KZ7B 1G1MA 1LRJA 4FDTA 5ALNA 4RTLA 3BCRA 4XUEA 1JLSA 2QTVB 5ALVA 2P2ZA 1VFPA 3GZNA 1INLA 4U6QA 1FNMA 3AY6A 3DVRX 1OXKB 4KQ1A 4DNQA 5HQ3B 1GAJA 2A9KA 2AMVA 5EXEA 4KRXA 2W00A 2OFOA 3TMYA 2W48A 3RFXA 5IKMA 1N6OA 3QMVA 1P1IA 4EATA 5LMCA 5EJ9A 2YXPX 4RELA 4YV0A 4MQLA 3GLGE 1FSGA 2YUTA 2XE6A 3WWZA 2VSFA 3VR5D 3K0EA 3MMSA 4FPXA 2IELA 4A10A 5F98A 2R6CA 3ME5A 4RHUA 5K20A 4G4SP 5EG5A 3H9QA 1WF6A 2J3MA 4MKFA 3UMSA 1CD5A 4U63A 1JDBB 1PG5A 2H2FA 3A4NA 4MVJH 1W44A 1EVLA 2FZ5A 1N9GA 2WU3A 2VAMA 1EE1A 2NO4A 3LZCA 4GLOA 3HYTA 2XCLA 4JLAA 4QARA 3VX3A 3LL4A 1V8OA 4TMKA 4XJXA 2D4HA 3VTAA 1IOVA 2ZBDA 2DFKB 1JVBA 3FDIA 2O9JA 1UC8A 2VJYA 3IOMA 3KBOA 4LHVA 4N5LA 5DCWA 3C3MA 4BZQA 3PXGA 3CV3A 3IQWA 3M6IA 4LXUA 1A2BA 6LDHA 1O6ZA 2ZTVA 3IOYA 3ASUA 4PBRA 3GWGA 4N8SA 1IUKA 4B3IA 4GPTA 3WDKA 5ISMA 1KXZA 2NSJA 2HNAA 4PF1A 1VCOA 2HUNA 3G2IA 2DB3A 3I1FA 2H1OA 1NE7A 4I6JA 1Q7GA 3CR7A 4QQRA 1NRXA 4MO2A 1EVZA 3OE5A 2R8XA 2FW9A 3UV6A 2FVXA 4G25A 4CIXA 3AX6A 5T57A 1UXOA 1SXQA 1MBZA 3G9QA 3JRXA 2X9VA 1OY1A 4DCMA 1FYVA 2CLFB 3BEDA 3K05A 1WPRA 4RK4A 1SZCA 1TJ3A 3SS9X 4UFOA 3OQ1A 3D6TB 4I4CA 3P71T 2G0NA 4A2WA 3V7NA 1JNYA 1XF1A 1Z5UA 4FUTA 1MO5A 1STOA 1T2NA 1YZFA 3WMXA 4Z4CA 3O1HB 5LVAA 5LD2B 4B6JA 5L3SA 3ZJVA 3HO1A 2OV8A 1J7KA 5KX5B 3DHNA 3WLAA 4TKLA 4C4PA 1VLQA 2UV8A 2XIQA 1WXHA 3OC0A 4WN3A 5IKXA 2J6CA 1YL7A 3JARB 1Q20A 5KHAA 4TZ0A 1THTA 2EZ4A 5KCZA 1BC5A 1DAEA 1K08A 4QM7A 5G53C 3PFBA 3HVJA 3MWEA 4H1VA 4UTRA 2CFTA 1JKJA 3WE7A 3ZWMA 5K4GA 4IW3B 4I50F 4GZ5A 4K5QA 3FPJA 1XL1A 2Q3BA 3T3OA 3O8DA 1JHRA 1MEJA 5AJHA 1YH3A 4WRRA 2QLJA 3G68A 4DLUA 1ISFA 4LYAA 1AQIA 4FFMA 1T8TA 4Q4HB 4RHTA 3ZGOA 2D2EA 2QRVA 1X8XA 1SC1A 1T15A 5DM4A 3TJZA 4PXYA 3OD5A 1UJ2A 1TB4A 1NVAA 4PGFA 3OIFA 1LDGA 2WFMA 3N8HA 1Z12A 7ADHA 4CEIA 2GBLA 4ND2A 2BTEA 1XCGB 3PQFA 2Z2YA 3CVUA 3RKUA 3D3NA 1FUEA 4HO1X 3Q72A 4Z0NA 1LJ8A 2H4ZA 2G88A 2AI3A 1AF7A 4RF3A 2C59A 3ZBUA 1YB6A 4RFSB 5I4BA 3IIIA 4HMOA 2EJBA 5JNUA 1S7CA 3C1UA 4CHTA 3WGIA 3NP7A 3OPQA 3C3PA 5TB5A 3RQSA 3BHIA 4A8HA 1KIFA 3AF3A 3FOAA 4PN7A 4IDOA 1OWNA 3UB4A 4IH9A 3UT5A 1TT7A 1VI2A 1EUYA 2B78A 2OFXA 2PUTA 3CCFA 5I47A 2XOKA 3IUYA 5G40A 4AK9A 1BS1A 4Q47A 3LYLA 4RVHA 4RZQA 5IAAA 3GCZA 1AK1A 1E0JA 3Q9SA 2IOFK 2WMOB 2WA2A 3AP1A 4LYDA 2QW8A 2W83A 1NXWA 2HIMA 5ADHA 1NZFA 3QKRB 4D2IA 4Z4GA 1W76A 3BXHA 3HDYA 4II3A 3NOXA 1FMCA 2HYDA 3T7CA 4ESHA 2A88A 1SVNA 1HV8A 1VCIA 5T7BA 1SOUA 4F3TA 4RTNA 4EYGA 1OFHA