5JDIC

Trypanosoma brucei ptr1 in complex with cofactor and inhibitor nmt-h024 (compound 2)
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
266
structure length
239
Chain Sequence
APAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQKTVETQVAELIGTNAIAPFLLTMSFAQRQNLSIVNLCDAMVDQPMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Profiling of Flavonol Derivatives for the Development of Antitrypanosomatidic Drugs.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
molecule keywords Pteridine reductase
total genus 91
structure length 239
sequence length 266
ec nomenclature
pdb deposition date 2016-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5jdiC00
3JQGB 4LSMA 2CDCA 4AG3A 1GUFA 5LCXA 4Y6PA 1DHTA 5TSDA 4J7UA 1C0LA 1KVSA 4EYEA 5I9NA 3JYNA 3PJEA 1GTMA 2ZB3A 2NTJA 4XCVA 3C7DB 1SB8A 3AJRA 1RJWA 1YB1A 3AUSA 2WJPA 2P9GA 3G3EA 3WG9A 1LC0A 4BO0A 1C1XB 2Y68A 4BV8A 3UCEA 4ND5A 1LU9A 4II2A 4PVCA 2IXAA 2NADA 3OQBA 5F1KA 3WFIA 5IDWA 3W4KA 2NSDA 4RF2A 1ZJYA 2I67A 1GADO 4FC7A 4CM9A 5JPIA 3H8VA 2P5YA 4D3FA 1JWBB 4FOOA 1KC1A 3ZHZA 2D5CA 4BNFA 2UUPA 5CPBA 5C3MA 1E1MA 4RPGA 2NNLD 4KUGA 5A5FA 3D3EA 4NK4A 1ZK2A 2DLDA 2I5PO 3RSHA 3KZVA 3JCZA 4P4LA 2I3GA 1A9ZA 1OAAA 1DRUA 1K6IA 2UYYA 4II3A 4BKPA 1PL8A 4J2OA 4E33A 1B14A 1HDGO 1M67A 1XWFA 3LT0A 1LLQA 4CQLB 3FF4A 2AE1A 3CZRA 3WBFA 5U1PA 4MKRA 3L4BC 4GQAA 1H9AA 1TLTA 2YHUA 3ZH2A 3M6IA 4OHUA 4F6LA 3P19A 1IZ9A 4N7RA 1JU9A 3W4JA 1YOVA 3HDYA 3PJGA 4QFDA 4DPKA 3HDQA 1DB3A 2O7QA 1E3IA 4WGGA 4ZQEA 2DC1A 3VDRA 4EUFA 4LK3A 5A4DA 2YYYA 4YRAA 2Z1MA 3ONDA 4E4YA 5ER9A 1YBMA 2E48A 4U8GA 4EJ6A 2E49A 3GN1A 3T7CA 2Z95A 2CUKA 4ESOA 1LRKA 1CF2O 3EYWA 4Q39A 3TNLA 1HKUA 2I99A 4ZJUA 3DOCA 3D5QA 1C0PA 4EITA 3BMNB 3ENNA 1X1TA 2B37A 3ADOA 4BB6A 1T4BA 3CXRA 1ZSNA 3ANNA 5CDTA 3JQBA 4UEOA 1A9YA 3BTUA 3AOGA 2W2KA 1L7DA 5C5IA 1U4OA 4KWHA 2FPIA 2P2SA 1BXGA 3IP1A 1DIHA 1X0XA 1P0FA 2GSDA 3ENKA 2IE0A 5A02A 1N7HA 1QORA 5A9SA 3GRPA 1KVRA 5TT0A 1I24A 3U49A 3KXDA 2R00A 3RD5A 1CEQA 3DDNA 1EUCA 4BMNA 2AHRA 4M49A 1KS9A 4O59O 2ZQZA 4HY3A 4M55A 1U3UA 3ZV4A 3Q2IA 1HYHA 2RHCA 4NU5A 4L76A 3V2HA 3BMCA 2BF7A 4Q9NA 1EVZA 2VUTA 1EFLA 2D4AA 3PWKA 1VJ1A 4WOKA 4BHTA 1NXQA 2JD0A 1E7YA 2DKNA 4ND1A 3SEFA 2DQ4A 1DIGA 5KVCA 1GCOA 4Q3NA 5F5NA 3JYQA 1H6BA 5AXAA 3UUWA 4I9UA 5COQA 4TZKA 2JL1A 3OJFA 1LSJA 5JYEA 1LX6A 1Y8QB 2HQ1A 1VL8A 4GKBA 3VPHA 3NKLA 3PGJA 3RASA 4B4VA 5L53A 3VAZA 4OMUA 1G0NA 3GGGA 3PQEA 3NT2A 3K31A 4Q3CA 1NR1A 2EHDA 4B8WA 3MJ4A 4QFCA 2ZATA 4MDHA 2EGHA 4RZIA 5IDYA 1WZEA 3LSYA 3OHSX 4PN3A 5L7TA 3RC9A 4RVFA 1LLCA 1VLLA 5G4KA 4L4XA 2PZKA 4DLBA 1YGYA 2H9IA 1C14A 1HDCA 2J3IA 1WNTA 3E6AA 3LLSA 2I65A 4TWRA 3I23A 3H7AA 5I8WA 1I3LA 3GOHA 1E92A 4AJEA 4GMGA 4DQVA 4E5MA 2Y0DA 1XR3A 4BIIA 4PG8A 1IL0A 3HN2A 3C24A 4E5YA 3NDJA 4KUHA 1DDOA 2OXIA 4NJMB 5AOVA 4XEHA 4JBIA 1PR9A 1EFKA 1Q2XA 1ZXBA 3L6DA 3NDRA 1PIWA 1P3DA 2QYSA 1VM6A 4FJ2A 1PS8A 5KIAA 1PJ4A 3EAGA 1KIFA 4EUEA 1X15A 3PHJA 2W2KB 2Q50A 4EJMA 5B12A 4OXYA 1PJLA 3ABIA 1U5AA 3WGHA 3FWZA 2PY6A 3I6QA 4XYGA 1U8FO 1X7GA 5JMPA 3TWOA 4BGEA 3OIGA 5TJHA 3ANMA 3RROA 4CJXA 4LW8A 1RKXA 1TT5A 4Q3DA 4QUKA 3ZWWA 4XYEA 3RWBA 1HLPA 3H2SA 3CUKA 3E9MA 1NFRA 3RUDA 4R41A 3B6ZA 1J0XO 2AQHA 2EW8A 4JNKA 2NUAA 4YCAA 5AXCA 3WJ7A 4FPXA 1GFSA 1P1RA 1KY5A 1AUPA 3FNGA 4OGWA 2P9CA 3WJAA 3ZWCA 5JC8A 2GZ1A 3GF4A 3GRKA 3IJRA 1O0SA 3ITKA 3M1AA 4J0EA 3DZGA 3WMXA 4JJIA 1P9LA 3H5RA 2OGUA 5C7IO 5JXWA 2LDBA 5CEFA 2AG8A 4GBJA 3F47A 2VNAA 4FDAA 1IUKA 2JCYA 3OQ6A 3P2OA 2Y05A 5IN5A 4UUMA 2J5QA 1P1IA 4I9NA 4YT2A 5H82A 4O0LA 3DTTA 2C0CA 1Y5MA 4JP3A 1YRLA 2IODA 5BQFA 4D41A 1EDOA 2VYND 2CF6A 2JD2A 4CLOA 2HMUA 2EW2A 4XQGA 2VT3A 2RCYA 4MIOA 5JO9A 5IXSA 1NBOA 1J6UA 4IDFA 4CMBA 2Q1TA 3RBVA 3DL2A 1WWKA 1XGKA 2JAPA 3WXBA 4AVYA 4Y9DA 1F14A 3IP3A 3KTDA 1A27A 2FPGA 1E3JA 4YJDA 3EVTA 3VH4A 2PFGA 3K9QO 4KMSA 4DXHA 4WLFA 3MZ0A 4L4RA 2C7GA 1PZHA 4H7PA 4MINA 4YR9A 2X0IA 1ZUD1 3RUHA 5IG2A 3JYPA 5AQ1A 4TKLA 3Q3CA 1AGNA 4FSHA 3V1TC 3UAGA 3VH3A 2FOIA 4FC6A 3PGXA 1O6ZA 3TQHA 2J6IA 2GZ3A 3NV9A 2Q2QA 4LCEA 3U4CA 3QA9A 1ADGA 5F21A 1SMKA 4E3ZA 2A94A 2W2LA 3SXPA 2VHXA 1ISGA 1GD1O 2F1KA 2FP4A 1TT5B 3GK3A 4XRRA 4YEDA 2OOSA 3PLRA 2X86A 1PEDA 1GZ3A 4NK5A 4OAQA 4CMIB 3KBOA 2EG9A 1AN9A 4BO5A 1XDWA 1AHIA 3GT0A 4NBRA 4PFJA 3L6OO 5L51A 3ZW9A 3DHYA 2PH5A 3E9QA 4A2CA 3JYOA 2QZ9A 2PNFA 1LSUA 3QWHA 1N9GA 3DAGA 4W7HA 4WLUA 4WOJA 1UH5A 3UOGA 1X1EA 5DDIP 1EQ2A 1DLIA 1NHWA 2NQ8A 1T2FA 4IDCA 3KETA 1W8DA 4OIMA 1EQUA 5CPFA 4E5KA 2GYYA 4YPOA 5CDGA 4X54A 2E6UX 4CR6A 1T2DA 1VRWA 3VH1A 3ZCXA 1NYTA 4R1UA 1TT7A 1BDBA 3GG2A 4GI2A 5DN9A 1LSOA 3HNPA 3ST7A 5TS3A 4AL4A 3KEOA 1S7CA 2AA3A 2GN9A 5B4TA 2EKPA 1U7HA 3E1KA 3EDMA 4IS2A 3DHEA 1R15A 1B3BA 3MCVA 5GZ6A 2CMDA 5TLSA 4P38A 1FDUA 4WPGA 4W6ZA 4DQXA 4EI2A 2HRBA 3WSWA 2PD3A 2BI8A 1T24A 1I3MA 3NGLA 2NACA 3GLQA 4DPLA 1J5PA 1XG5A 1P44A 4N54A 4XB2A 4R3WA 1FDWA 2Q1UA 5TQVA 4YDRA 2AW5A 3A4VA 2QX7A 2BGMA 3GNQA 4B3HA 2O3TA 3GMSA 1O5IA 3KYCB 4BNIA 1N8KA 5L3ZA 4Z9XA 4CQMD 2NLOA 4UREA 1LDYA 4R69A 3ZNPA 1QMGA 1P77A 3PIIA 1QYCA 3HDHA 4ZICA 1XU9A 3ZWAA 2BFPA 1K3TA 5A9TA 2BFAA 5ITWA 2ZB4A 2LDXA 1BDMA 3H4VA 1E7WA 2VN8A 3ZHXA 4XGNA 1A71A 4A73A 2CF5A 1ZK0A 2CFCA 2YFQA 4AJ2A 3ADPA 1H93A 3NGXA 3ZU3A 3DTYA 1Q7GA 5CP8A 3IOYA 1Z7BA 3W6ZA 3GAZA 3VC7A 3JQ8B 1VJTA 1LI4A 3JQGA 3I4FA 4QQRA 4WCDA 4BNJA 1KEUA 3U3XA 5HBRA 1NASA 1L1FA 3D5TA 1E5LA 4E21A 4R68A 1FMCA 4EJ0A 3HFGA 2FR8A 3DBVO 1UUFA 1SAYA 3H9JA 3R1IA 1DIBA 4BO8A 3UCFA 1MFPA 3E5MA 3GDFA 5HWSA 1ZH8A 4EDFA 4NU6A 4EZBA 1M6HA 2UDPA 3OEYA 4CLRB 1LC3A 4YT5A 1Z7EA 3JQ7B 2BMAA 3MOIA 2FR0A 3ICPA 4A26A 1Z74A 3ZU5A 5CHEA 4B7XA 2GRAA 4IS3A 4DREA 1PWZA 2DUWA 4PLGA 2WYWA 3DAPA 1ZO8A 4YQYA 4YACA 4URFA 3O26A 4PG4A 2YZ7A 2G82A 4D3DA 3HADA 3RJ9A 1ZSYA 2Y99A 3G1UA 4WECA 2V6FA 2FWMX 5GMOA 3DONA 4KWIA 1WPQA 2EEZA 1K5HA 4YJFB 3WGGA 4RV9A 4J6FA 1BHSA 1ML3A 4OOFA 5JSFA 4XD2A 5I7FA 4BNUA 2VRBA 2G0TA 4JX8A 4R5MA 3PYLA 2AEFA 2CDBA 3BMQA 3DMYA 2NU7A 3ANLA 3I1JA 3R3JA 5A9SB 1HZZA 5DOVA 3GR6A 4P22A 4YYZA 2BLLA 2GN8A 2GLXA 3OJEA 1S6YA 5KWEA 4DIOA 3MJSA 3DZIA 3W8DA 5H83A 5CG1A 3H6KA 2PGDA 3PWZA 2QRLA 3HWRA 2HU2A 3K2EA 1RM3A 2HAEA 1JQBA 3ONEA 2VZ9A 5DT9A 4R1TA 3UICA 5JY6A 3GN2A 4IIVA 3QWIA 2Y1EA 3TRIA 2WM3A 2DBZA 1FF9A 1ENPA 4BV9A 2C07A 3H3JA 5TC4A 2YUTA 2HMSA 3VTZA 5CAEA 3FR7A 1VKOA 2JKVA 1P45A 1YL6A 4O5OA 3UH1A 4GGOA 4W82A 1ZKMA 4CV1A 3F9IA 2HK8A 4L9RA 1N7GA 2WYVA 5DZSA 1EEHA 4XR9A 3NDIA 4PRKA 5FF9A 4INAA 3CZMA 4RPJA 3P5SA 4H3VA 1QLHA 3NJ8A 5KJ6A 3JQDA 4JN6B 4YVFA 1X14A 1RM4A 5C7LO 3ZNOA 1HWYA 1E1KA 4YJGB 2IZ1A 4FS3A 2DT5A 1NPYA 2Q99A 4NJOA 2Q1SA 3VDQA 1PGOA 3E18A 1LBEA 1ZEMA 3UN1A 1IHXA 3CEAA 5JDIC 1AHHA 5COAA 1QKIA 2I6TA 3HQ4O 1UZNA 4JK3A 3JQEA 3KHUA 1OFGA 3GVXA 4WNCA 3D4NA 1V3TA 3ZHBA 4D46A 2ZKLA 3GZNB 3BHMA 2G17A 1GZ6A 5FWNA 2B5WA 1R4MB 2R00C 2DUUA 2E82A 1GCUA 3BMQB 3HSKA 1EUZA 5LC1A 4FQ8A 4WK6A 4IY1A 4WCFC 2EWMA 3GNSA 4TRMA 1LEHA 2JHGA 4GSLA 1LQTA 3D4OA 1CERA 3ITDA 4IJVA 4RZHA 4BKRA 1UDBA 3ZV3A 4Q3AA 2VHYA 2TMGA 3VZRA 3AK4A 3FPCA 5C7OO 2HJRA 1LDEA 5BNTA 1BVUA 4AJPA 2YFHA 3QIVA 4IINA 2OO5A 4TQGA 3NAQA 4GGPA 4YBZA 1UZMA 4Z0HO 3IIEA 4MKZA 2YV3A 3MJTA 4EEXA 3Q0EA 2J3HA 4MPDA 3RFVA 3PYXA 4B79A 4U0KA 5A5EA 3L77A 2VTEA 4RCVA 4QTZA 3GGPA 2BGKA 1P1FA 4NBWA 4PZEA 3WBBA 1HETA 3VKVA 4LMRA 4EBFA 1R37A 3OIFA 2Y1DA 4M89A 3CMMA 3LK7A 3D64A 2HKIA 4IM7A 4DMMA 1YQDA 3FWNA 1H2HA 3AI3A 5L4NA 4AJKA 1P1JA 2PKRA 3WLEA 4R54A 2RH8A 1MUUA 4ND2A 3ASVA 1LDMA 2PGJA 4E32A 1Z82A 4CLRA 4NIMA 4ALLA 4XDZA 1LLUA 4C7JA 2G1UA 1SNYA 2OUIA 4GAEA 1BMDA 1EVJA 5JY1A 1DIAA 4CM6A 3QHAA 4QO8A 2A4KA 1DC4A 2PGLA 3ROKA 1SO8A 5ICMA 2JFHA 3E9NA 3IAHA 4L0QA 1PTJA 4PZCA 1HDOA 5EN4A 2DAPA 1E7RA 3NT5A 1PQPA 3ZWBA 3GY0A 4FFMA 4NBUA 2VHZA 1J49A 1ADCA 3Q1LA 5A05A 2OFPA 3WS7A 1FDTA 3DBHB 1YKFA 1X0VA 4GLOA 4BL5A 4CODB 1GZ4A 4YAIA 3WYEA 3RFXA 1PJCA 1A7AA 2WMDA 1LXCA 4U6SA 3OH8A 1CIVA 1CDOA 1D3AA 2Z1NA 3QWBA 3QVTA 3I4CA 4WJZA 2Y93A 3GC6A 2VYVD 4IMRA 2DM6A 4WKGA 3F1KA 1JN0A 1ZXLA 5I9LA 1FDVA 5THKA 6LDHA 5A9RA 5K6AC 4E13A 4BGIA 1B8UA 1R4NA 3VH2A 1E7QA 2ZTMA 2VHWA 2GD1O 3OF2A 3S55A 5T8KC 4WUVA 3BHJA 4XX0A 5COBA 4ALKA 5I7VA 1WMBA 1SPXA 4MVJA 4G5HA 1CQJA 2VT2A 1BSVA 3S2IA 3TN7A 4DL9A 4ZQFA 1NNUA 3G17A 1BGVA 1CJCA 2NTVA 4YT4A 1E6EA 4AJHA 1IB6A 1PGPA 3MOGA 4WASA 3Q9NA 5FI5A 1I30A 5J23A 3RJ5A 4BGUA 1SOWA 3V1YA 3EHEA 2Q49A 1BG6A 4CR7A 1IPEA 2OMEA 3E8XA 5EQFA 3PQFA 3S8MA 5T64A 2GN4A 5EQDA 1XQ1A 2WSBA 2OL4A 5EESA 3I3OA 3B70A 4QEDA 4UVDA 5U9CA 5JE8A 3RFTA 4I08A 2XXJA 3KLPX 3OICA 2VUSA 4YAKA 4E2WA 1OC4A 4D44A 3OJ0A 1LTHR 3U4DA 3O4RA 2VWHA 2J8ZA 1ZK3A 2XAAA 3ULKA 3QWFA 3KYBA 3D0OA 3GUCA 4PLVA 2X9GA 6ADHA 5A1TA 3VZQA 4LMPA 3D4PA 1O95A 3GPDG 3W8FA 3QWAA 4FFLA 2FMUA 3AOEA 4DWVA 4PCVA 4F46A 4M86A 3HDJA 4PLTA 4MVJD 5CG2A 5KVVA 3QQPA 1GYQA 2AG5A 2PZMA 3FNEA 4OJNA 3NYWA 1VC2A 4U6QA 5DCWA 2J3KA 4AFNA 1K6JA 1UXJA 4HFRA 3ZN2A 3H9UA 1C1DB 3JQAB 4M8SA 3AU8A 3WQRA 3PDJA 5HS4A 1ISMA 1HSOA 1OMOA 1YQGA 3FSRA 3ICCA 4ALIA 4BNYA 1WZIA 2VWPA 5A04A 3L9XA 3W1VA 4J7XA 4CUJA 2YDXA 5EINA 3JQ6A 3BIOA 3WLFA 2DPGA 3VPSA 1SCUA 3I9JA 3RI3A 3KVOA 1PJTA 1YB4A 1UDCA 3RC2A 1K6XA 3M1LA 2DBVO 1ZZEA 3HFSA 2CVZA 4J90A 5IAAA 3IMFA 1B8VA 4FW8A 3TF5A 4D7AA 4PLCA 1AXGA 3ZI0A 3H9EO 3PZBA 3KSZO 1EBUA 3AWDA 3T7EA 4HUJA 1FK8A 4Z3KA 3BZUA 1ULSA 4GMFA 4DIBA 5LDHA 4HWKA 5FEUA 2UUOA 4NR0A 4JP2A 4W99A 1MG5A 1Y6JA 3V2UA 1B26A 4NNJA 2EJVA 3ZWNA 4CM7A 3NTRA 4IDDA 3PDUA 1DEHA 1R0SA 3DAFA 4GWKA 3LT4A 4RGBA 2DVMA 3DB2A 5C37A 1ISFA 2FRDA 4ZRMA 4CLXA 2NVUA 2EKLA 1RYEA 1TA4A 4Y6RA 1YL5A 1ZEJA 3ZU2A 4CUZA 1P74A 1LUAA 4I5GA 4JLWA 2VRCD 1LDGA 1P33A 5CEJA 2C2XA 4CLDA 4UEKA 4OSPA 3FD8A 5IXYA 3BAZA 1MB4A 3GEGA 3HG7A 3INGA 1E7SA 3P2YA 4FCCA 1B8PA 2PD6A 3V2GA 1BWSA 2X0NA 3PWSA 4FFNA 4YJGA 2D8AA 2AQKA 3GVIA 3CMCO 2Q3EA 2X22A 3H5NA 4J43A 2X5OA 2P4HX 2O48X 5KCZA 1TVEA 3AUTA 4IDEA 4TMFA 3C1AA 2GZ2A 3VZPA 2NU8A 4PLWA 4Z3DA 5LDGA 4K1LA 3PTZA 4M87A 1YL7A 2AMFA 2RIRA 3CTMA 4J16A 4EGFA 1LNQA 1YXMA 1A72A 4FD3A 4I5EA 4Q3EA 4BNXA 1ADBA 1WAMA 4FFPA 4GLLA 4ND4A 1MFZA 8LDHA 3DBRB 1ENYA 3WIEA 5KKCA 1NTOA 4B7UA 1NWHA 1BW9A 2C82A 4P4NA 4XYBA 3BMOB 2BGLA 1H0KA 1SB9A 5DBIA 3W6UA 4BQPA 4R01A 1XIVA 1EK6A 3FTPA 3L6EA 1Y9EA 1U2DA 2NTNA 3QE3A 1TXGA 3PQDA 1O9BA 3PRJA 2PK3A 3AM4A 2NVUB 1HL3A 1LJ8A 5IN4A 5JW6A 1C0IA 3AM5A 5JCJA 3BHIA 3QP9A 1IULA 4WNIA 2V7PA 2YW9A 5TNXA 3V5NA 5L7YA 3PFFA 3OSUA 4DTIA 1E77A 3WOHA 1MV8A 1BTOA 2PH3A 1PQWA 1WDMA 3VHRA 2D5AA 4BNVA 5TIIA 2HMWA 3TZKA 3C1OA 3ZNQA 3S2EA 4KP7A 2WD7B 1DAPA 3OA2A 1E7MA 3OIDA 1MLDA 1C1DA 3JQAA 4J1SA 5G0SA 4AJJA 1CWUA 2P4QA 1WMAA 3V1UA 4CV3A 2C20A 4PLFA 2FZEA 2PZJA 3TZQA 3WFJA 4BGVA 3BXXA 2Q45A 4RLHA 1XSEA 3O03A 2B83A 4AJNA 4NBVA 1I33A 2YHIA 4JJGA 4DBZA 1Q0QA 4KDEA 5T6BA 5L4SA 1WLYA 4GWGA 4Y6SA 4MOWA 3G1TA 2BKAA 3QLJA 4WCFA 2PR2A 3OFSA 3NJ4A 1Y8RA 1JVSA 3WGTA 2A92A 4OXKA 2C2YA 5CEEA 1WP4A 1DBVO 2OHXA 5KTKA 5EIOA 2FSVA 4BO9A 1PL7A 3PXXA 1ONOA 1EDZA 4F6CA 5ICSA 1GQYA 4HNGA 3SVTA 4EW6A 3GPIA 4FIZA 3QVWA 4JBHA 5TRTA 5BT9A 4GH5A 3JTMA 2Q2WA 3N58A 2WWRA 1V8BA 1WXDA 3DBLA 2EV9A 3RC7A 4E0BA 1EMDA 1Y9AA 1ZK4A 4W9NA 2JCXA 3NTOA 1V6AA 3FPLA 1NM5A 3VPXA 1NAHA 2CNBA 1I3KA 4RVUA 2HK9A 4PLHA 4P8RA 4QX6A 1XYGA 2NVBA 2O4CA 4NHEA 3JQAD 4DLLA 1PX0A 1YS4A 1JW9B 1OC2A 3OP4A 1JWAB 3FBTA 1LA2A 1YWGO 2HO5A 5FFFA 1G6KA 4Q3BA 2C59A 1SEPA 2JJYA 2BD0A 1JAYA 1XCBA 3CE6A 2VTDA 3JYLA 1P1KA 1NP3A 4DBVO 1IOLA 3EUWA 3K2BA 1IPFA 4MP3A 3KEQA 3ETDA 5IFLA 3MJVA 4BKUA 5H81A 4M1QA 3BTVA 4LISA 1OI7A 1V9LA 4GVXA 4FB5A 5T67A 3A28A 3L07A 4E2XA 3GUYA 3IJPA 1R12A 1U7TA 4BOYA 3E03A 4J2HA 3S2GA 4MVJH 1PWXA 3I9NA 5CDYA 4H16A 4I8XA 1VL0A 5I7SA 2GDZA 1Y8QA 3CPSA 2AE2A 3EK2A 3QW2A 4HXYA 1F17A 4CV0A 1R4NB 1H94A 4NBTA 4PVDA 2NU9A 4TZTA 4FFRA 4NZ9A 4DA9A 2VNSA 1F12A 4WLVA 1GYRA 3K8ZA 3TFQA 3U62A 1EZ4A 4CQMB 2J3JA 2Q4BA 2DPHA 3FHLA 3SLGA 3WNVA 2Q1WA 4I5DA 1E0DA 4HP8A 2QHXA 2B4RO 2RH4A 3F5QA 1DXYA 1AE1A 3C1TA 4RQUA 4XIYA 3RVDA 1I5RA 4A7PA 4ZHSA 5CDUA 4GVLA 2R6JA 4IGEA 3B1JA 5ADHA 4L8VA 1XU7A 1CYDA 3MJCA 1LDBA 3QRWA 2X58A 1O8CA 2POQX 1PZGA 1I32A 2C29D 1U3VA 1TI7A 3BYZA 3EMKA 4CUKA 3ETGA 4JQCA 1KY4A 2VOEA 4D3SA 4XYLA 3RUIA 1UXGA 2NQTA 4WE3A 3ROQA 3GVCA 2CDAA 3BTSA 1ZBQA 5THQA 2HJSA 2O2YA 5IDQA 2EERA 3LF1A 3GG9A 3OJLA 1RM0A 3GZ4A 3JQ9C 5JMWA 2JAHA 2AXQA 4D79A 2ZTVA 3HZZA 3GH3A 3CKYA 1YBAA 2DFDA 1QYVA 4CMHA 2PA3A 2B4QA 3Q2KA 1P0CA 5L4LA 4HFNA 2VQ3A 3IDSA 3WIDA 4MP6A 2OP1A 4OYRA 1Q0HA 2X5JO 2V6GA 4W7IA 3SJUA 1YB5A 1XA0A 2O4UX 4W9NC 4RL6A 5I8ZA 4FGWA 4G65A 4AJ4A 4CLEA 1DC5A 2Y0EA 4JIGA 2QRJA 1T2EA 1T26A 4L74A 3KYDA 1Y81A 2E4AA 1DAOA 3GAFA 2WEKA 1KETA 4B4UA 4LVCA 4A10A 5AYVA 1MGOA 4UUPA 2Y1OA 2ZYAA 2C54A 3LLVA 4XJTA 2GNAA 1ENZA 3BMOA 4XB1A 3ZZNA 1PQUA 2J5RA 4J7CA 4J4TA 2B35A 3ROMA 1YJQA 3TDKA 2YQ4A 4LRSB 5G0VA 2IZ0A 4PGFA 2FN7A 3MWDB 4LRTB 3LZ6A 5AVOA 3ZU4A 1E5QA 1W73A 2P68A 3K73O 4XKJA 3E5RA 3OECA 1GEEA 1ZFNA 2D0IA 5DBFA 4TKMA 5TGDA 1PZEA 5JDCC 1UAGA 1QG6A 1E6UA 1GQ2A 3U4IA 5MGBA 5EJ2A 4RF4A 3RU9A 3H3FA 1KBZA 1YO6A 3HUDA 1F0YA 3LU1A 5F1OA 5AXBA 4XGKA 2GN6A 2O3SA 3U4HA 4PG6A 4Y67A 2GGSA 1O94A 3PVZA 4BNHA 3AUUA 4FJ0A 3RUEA 1HTBA 1A7KA 1QRRA 5EMHA 4BO7A 2BHLA 4OH1A 4RVHA 4Z0TA 2ZB7A 4CMIA 2I76A 3AFNA 5BR7A 3DZKA 3HE3A 4U7WA 3H2ZA 1PJSA 3LYLA 4XRGA 3SLKA 4RPHA 1R66A 1H6AA 1ZNQO 3ON5A 4WLEA 1PJ2A 5HTOA 1PL6A 2WD8A 4S1VA 3ZV5A 2AEJA 5TJ9A 1KC3A 1YE3A 2UVDA 3DHNA 2O7SA 4BNMA 1PU2A 4HNHA 4MVJM 1D7OA 4CMEC 4HX5A 3MJEA 4ONEA 5KJCA 4BO3A 1KERA 1C3VA 1L7EA 2O50A 4QO7A 3RUFA 5HM8A 2FPPA 2O3QA 3TJRA 1U1IA 3BA1A 1ID1A 3AU9A 1YDEA 5EPOA 1X7HA 3C7AA 1X13A 1DC6A 1HE5A 4RO0A 4MIYA 2FHSA 3DR3A 1ZMTA 1MC5A 1HYGA 4IXTA 5G0TA 5JCXA 3X2FA 4N5NA 3IQDB 3T4EA 2NWQA 2XOXA 2HMTA 3JSAA 4QXMA 3WTCA 5ES3A 5AXDA 1PSDA 3X2EA 1ZIDA 1Q1NA 3DO5A 3GEMA 3D1LA 3WB9A 4C7KA 3WICA 4M54A 2JFGA 3S1LA 2XPCA 4Z9YA 2UV8A 4BMVA 1MC4A 2IZZA 1T1SA 3S2FA 3H5AA 1MX3A 3PHLA 3PEFA 4ZQHA 4N5LA 3QY9A 2V6MA 4HKTA 4IQ8A 2NM0A 3KV3O 4J1QA 4FN4A 1XQ6A 1GY8A 2X9NA 5ENDA 2VUUA 4D0SA 1D8AA 5DNAA 4MO2A 3EW7A 1TB4A 4YJHB 3WQQA 2OP0A 3EC7A 1IYZA 4PLPA 3SJ7A 3JD4A 2HK7A 4OSOA 4R5HA 4JCOA 3C85A 3PK0A 4GKVA 1XELA 3R6DA 2WTBA 1XEAA 3Q9UA 3PLNA 3FTNA 3EVNA 2V65A 4YJFA 3DOJA 1CQIA 1G1AA 4CPDA 3PJDA 1UAYA 1VJ0A 4J9VA 4RLSA 1U2GA 2JHFA 1NWCA 3GHYA 2CSUA 4YRBA 4MVJF 3OM9A 1LRJA 1UP4A 2EF1A 4C4OA 3GGOA 1G0OA 5JAZA 3F4BA 4PG5A 4CL3A 3IS3A 9LDTA 2JCVA 3KO8A 1PS0A 1HRDA 4ID9A 2SCUA 3VVCA 1DOHA 1PGJA 4CMEA 1I3NA 1PGNA 3DZBA 4R1SA 1BW9B 4B4OA 1SOVA 5G0UA 1HDZA 3TFOA 3DMTC 3JQ9A 1KVTA 3WMWA 4IJKA 1B15A 3OEWA 3TOZA 3OETA 4BNTA 2GR9A 3GMDA 1U4SA 3GVPA 1DJQA 3GEDA 1T25A 2FY8A 1SEVA 2ZJ0A 2PLAA 4GL4A 3OJOA 1U9JA 1NR7A 1X7DA 2QZZA 1HDRA 3FNFA 1VSVA 3KYCA 1DRWA 3LC7O 4F3YA 1Q7CA 2HCTA 2EIHA 2F00A 2YJZA 3L4BA 4AJIA 3WSVA 4WLOA 2DFVA 2BI7A 1UR5A 4YT8A 2ET6A 4J91A 3FN4A 2VYNA 4Z6KA 3IKTA 1N1EA 2X0JA 4D43A 4IXWA 4IUYA 1H9BA 3INTA 4GPD1 1ISHA 4TROA 3UKOA 3MTGA 4NQZA 1NX6A 1V0JA 4U5QA 1QP8A 4UVGA 3ZHYA 1M75A 2ZB8A 3B1KA 1E3SA 3ORFA 5CFZA 1E6WA 3SBOA 5KVQA 4O6VA 1NVGA 3GFBA 3IL2A 3GDGA 1I10A 2GF2A 3I83A 3U5TA 1MP0A 3GA0A 2DTEA 5KNLA 2Y0CA 1I2BA 2RBEA 3AFMA 5EL0A 4W4TA 2YQ5A 2UAGA 3EGOA 5F5LA 4PIVA 1Y8RB 2ZYDA 3QSGA 3UGKA 5F3RA 3H65A 5EERA 1UDAA 1A4UA 3UXYA 3KOUA 4AICA 4MIEA 1Q0LA 2CD9A 5T5QA 5TX7A 3I52A 1HE4A 1NQTA 2AQ8A 1GYPA 1B0AA 4CM4B 5JAMA 1MXFA 4K6CA 4RJTA 1FXSA 1BVRA 4JGBA 4JJFA 2X6TA 1H6CA 4TRNA 1J4AA 1YBVA 4TVBA 1NVTA 3NX4A 1H6DA 4RF3A 4E12A 1GUZA 3FNHA 2A9FA 3A1NA 3TL3A 1LSSA 4HV4A 1I0ZA 3G49A 5A3JA 4IDGA 1JTVA 3RQSA 5B37A 5GZ1A 2FR1A 4R1NA 4R16A 3BMCB 3WWZA 4IPTA 1T2CA 4QECA 5A3VA 3D7LA 2CZCA 3M2PA 3PHIA 4XQCA 3WYBA 4E30A 1F8FA 2CVOA 3COSA 5IZCA 5G2OA 1KEPA 1ADFA 2R2GA 3C7CB 2DU8A 1V3VA 3JQFA 4IJUA 1WDKA 4PLZA 4DYDA 3VKUA 1KVUA 3OA0A 4FR5A 4RF5A 3FRJA 1DPGA 4R9RA 4UVEA 4E2ZA 5KKAA 1ISJA 5ILGA 2X9VA 4RPLA 4XWYA 3WX0A 5DCYA 1HF3A 1VE9A 3TOXA 2W98A 2A35A 4XQ9A 3NTQA 1YJ8A 1PZFA 1ONPA 4J4HA 3ONFA 4ITUA 2P91A 1LRLA 1DO8A 1JDJA 2BH9A 1BXKA 2IDZA 4K9DA 3W4IA 5B4VA 1NQ5A 4YQZA 4IQ0A 1MXHA 1UXIA 5JYDA 5K6AA 5JDIA 4CM3A 3F6YA 3HJAA 2QIOA 8ADHA 2PZLA 3O38A 4DGSA 3CINA 3QJ5A 3LC2O 1QSGA 3SC6A 4F45A 4CQMA 5DULA 1KOLA 1Z6ZA 2ZJ1A 2ZYGA 3AI2A 3AY3A 5DBGA 1YDWA 4P4GA 5B4UA 4LGVA 4XYMA 4RVSA 3RIHA 3ETEA 4I1IA 5ER6A 4BNZA 3ZNNA 1GAEO 3ASUA 4HBGA 4B3JA 2X8LA 3I5MA 3WQSB 1QV7A 3MWEB 2BFOA 4TSKA 1DFIA 1DSSG 3SX2A 1NHGA 2OBYA 3O8QB 3KSDO 5IF3A 1N9GB 3A06A 1ISIA 4RORA 1PJBA 4PZDA 1K2WA 1PR3A 4DMLA 3HHPA 1HLDA 3TSCA 1Y1PA 3ZWXA 2PD4A 3LC1O 3LF2A 1ARZA 2O2SA 2B36A 4Y98A 1I01A 4LSWA 5TT1A 2HSDA 4BNLA 3TZCA 3U09A 1DFGA 4GX2A 2PKQP 1XLTA 5DOZA 4QT0A 2NU6A 3CIFA 4Z9FA 4B3IA 3IUPA 3I9LA 2JFFA 4I5FA 5A06A 2X0RA 3L9WA 2FZWA 3M2TA 3GDOA 3RUCA 1EBFA 2B4TO 3A9WA 1N1GA 2EKQA 1BXGB 1DC3A 1LQUA 2GO1A 4B8ZA 2WYUA 1EVIA 3IC5A 4AJ1A 3DEYX 4MVJP 1UP6A 4J4BA 3E82A 3H9GA 2ZCUA 2D1YA 1UXKA 4B4WA 4E31A 2EJWA 4OXNA 1UXHA 2C5AA 3RCBA 5KJFA 4RDIA 5FYDA 2Y67A 3PHHA 2DBRA 2BFMA 4UVIA 5DCUA 3ZWMA 5GZ3A 3WGYA 3AUAA 3RBZA 4S3MA 3I9KA 5KJEA 2IYPA 4ZN6A 4CLHA 3DOOA 3NT4A 4DPMA 5JDCA 1JAXA 1HXHA 3PZRA 4CM4A 3WDSA 3B20A 2B5VA 3DFZA 4MP8A 4WCFB 1K0UA 3KUXA 4ALNA 1T4DA 4AJOA 3RAJA 4BKOA 4FOSA 5JAQA 1QYXA 1GQQA 5L45A 1SZJG 5L95A 2Y1CA 1Y7TA 4CMGA 1R0KA 1ENOA 3O9ZA 5I7EA 1BXZA 3JQFC 1C0KA 2JD1A 4R9SA 3JQ8A 2B69A 2YV2A 3WWYA 1YVEI 5F1PA 1HE2A 2GUGA 2EP7A 2VWGA 1NAIA 1VI2A 1UZLA 3KM0A 3JD1A 1HE3A 5KJ1A 4O63O 5HS6A 2WE7A 3K5PA 1U3TA 4G81A 1ORRA 3QV1A 4XDYA 5TF4A 1HT0A 4PRLA 4K28A 3O8QA 5JCJD 2WD7A 3AY6A 4MVJG 2Z5LA 3VTFA 4BO4A 2WE8A 1IHYA 4KTVE 4YTEA 3RC1A 4ZQGA 1CRWG 2EXXA 2TMDA 2V6BA 2VHVA 1OBFO 1N5DA 2ZK7A 1M6WA 1M2WA 2QW8A 3GHHA 2OBNA 1QYDA 2D2IA 4TRJA 3TL2A 3OMLA 2BRUA 3EY4A 3F46A 1E1LA 5HRUA 3P7MA 3LDHA 1CETA 4E5PA 1RPNA 4HADA 4G2NA 3HB5X 3QVOA 3RKRA 4CM1A 2B0JA 2NVWA 1DFHA 1KYQA 4YA6A 2H1SA 3WTBA 4J9UE 1IE3A 2AQIA 4NPCA 2IYOA 4BNWA 1R16A 3VOSA 4DC0A 2ZIZA 1R4MA 4E2YA 2G76A 4MKXA 3B1FA 3U9LA 1I2CA 2X5KO 1P1HA 1GEGA 1UP7A 4A03A 4XZ3A 3EZYA 2WDZA 2ZTLA 4CQLA 1MA0A 3K96A 2DTXA 4KOAA 1GDHA 4LN1A 4CMKA 4BNGA 4ALJA 4E6PA 2GASA 1YONA 4U0JA 4BNKA 3JD0A 1W4ZA 4RQTA 5L7WA 4K26A 3WYCA 7MDHA 1RWBA 1NVMB 4J3FA 4UAGA 3TZHA 5BNFA 3HN7A 3JQBC 3Q11A 3UVEA 1ZVMA 1E3WA 3D3WB 3LQFA 3FI9A 1KVQA 2HDHA 2X23A 4N18A 4A0SA 2YDYA 3CH6A 4QSMA 2W90A 1M76A 3DMTA 5T57A 3G79A 2H63A 1NFQA 3OQ1A 1U3WA 4KZPA 3ZGYA 4UEJA 1GPDG 3DXFA 4XQEA 3R0IA 9LDBA 4D45A 5ILOA 1FJHA 1D4FA 3F1LA 2J5KA 2I9PA 2Q2VA 1WDLA 1GL3A 5K0ZA 3STHA 1Z73A 1PGQA 3VZSA 4ILKA 1A4IA 1K89A 3ROPA 5L9AA 4TRRA 3DC2A 3DBLB 3VPFA 1F8GA 1DLJA 1NQAO 3GFGA 4BB5A 4OQZA 4L75A 3WGZA 5JC1A 3JQ7A 4FGSA 4UULA 4DC1A 3I9OA 4GSKA 2Q4EA 3PPIA 3PYMA 4CM9D 3IUSA 1WVGA 4J1TA 4MVJE 2XF8A 1QV6A 4A27A 1PS9A 2ILTA 4HFJA 2ZTUA 5BSGA 5ITVA 1E3EA 2I3AA 5BNIA 3E48A 3WGIA 5JFOA 3AI1A 1FDSA 1GV1A 3LVFO 1GPJA 2PWZA 2VZ0A 4OKNA 1I8TA 1NQOA 4CMCA 3AOEC 4BVAA 4IZIA 4DRYA 4J49A 4NH4A 3ZV6A 1ZSVA 2AEMA 3WGQA 1PJQA 3FR8A 4FBGA 4KQWA 1E3LA 3ZWVA 2X7HA 2DBQA 2PKQO 3HB4X 4ZRNA 1T1RA 3QVSA 1YQXA 4RDHA 1DIRA 4OKIA 4WEOA 4RVDA 3GZNA 3N74A 3DWFA 2Y1FA 4J1NA 4J0FA 5U4QA 5FI3A 3UCXA 3EZLA 3AY7A 1SC6A 4L73A 4IMPA 3JD2A 1I36A 2OORA 4Y8VA 1W6UA 3DZHA 3IKVA 4WLNA 1Y5RA 2G5CA 2ZQYA 1PJ3A 4IIUA 2O23A 4FFOA 3KYDB 1QLJA 3K30A 1UJMA 1ZJZA 4ALMA 3I9MA 1JKFA 4UVHA 3F3SA 5JLAA 3RKUA 1IZ0A 2YV1A 4NFSA 3R3SA 3RBXA 4BMSA 7ADHA 4CMAA 1GUYA 3KB6A 3NUGA 1EK5A 1EUDA 2H5LA 3H9QA 3PJFA 4GX0A 4ROSA 4ZQBA 1M66A 2GERA 3ZWOA 3KRTA 3L4SO 1ZW1A 3WR5A 1NPDA 4LCJA 3A14A 4PLYA 1VKNA 4XJSA 3K6JA 1HDYA 3PI7A 5HA5A 3QVXA 4JBGA 3SC4A 3GQVA 1MG0A 1I2ZA 2DTDA 5I9MA 4XA8A 1GU7A 1NFFA 4KQXA 4BKQA 2Q46A 4TVOA 3UFXA 3C8MA 1O89A 4ZVVA 1Z75A 2RHRA 4L4SA 4IDBA 3FCOA 3VVBA 4EUHA 2W4QA 5L40A 3LT1A 1D1SA 3PHGA 3PP8A 1U5CA 1E1NA 2BELA 1JVBA 1HZJA 4WEQA 4MJLA 5T8KA 3DZJA 4JROA 1LDNA 2QRKA 2IRWA 5G4LA 5MDHA 1E3WB 4DVJA 3FBGA 1T2AA 1H2BA 3F5SA 5KVSA 4KTTE 1GV0A 2HLPA 4NG5A 4XIJA 2C7VA 1Z45A 2OZPA 3TPCA 4R51A 3F4LA 3ZW8A 2HUNA 2FSSA 3DBHA 3RU7A 2QYTA 2Y66A 4ZA2A 2I66A 4GX1A 3UHAA 3WNQA 3KSUA 5DF1A 2XXBA 4Z0PA 3NRCA 2YY7A 5IJZA 3DFUA 3T4XA 5G0WA 1JKJA 3N7UA 1C1XA 1B3RA 1JA9A 1WW8A 4N5MA 1H5QA 4NJMA 4YWJA 1DRVA 4CM8A 5IZCC 1IY8A 3DBRA 2Y1GA 2YHIB 5CDSA 3K92A 4CL8A 3UW3A 4NDNE 4IZHA 1V35A 2P9EA 4CM5A 5DP2A 1R6DA 3JQCA 1V3UA 4OM8A 2C5EA 3BTOA 1A5ZA 1QR6A 1HDXA 1TEHA 4OQYA 4EEZA 5KOIA 1QYWA 2H6EA 1F06A 1B16A 2E37A 3TZ6A 2O3UA 4LVUA 3WGOA 1OZAA 1OOEA 4E5NA 2VRCA 3INRA 4UUOA 1VL6A 2EP5A 3L0DA 4BO2A 3RUAA 2IEDA 4NMHA 3VPGA 4XR4A 4NFYA 1QXSA 2VWQA 2D3TA 4DQUA 4KDFA 1ZK1A 2O3RA 4CR8A 5JBIA 3LT2A 1HEUA 4ND3A 1ONNA 3NEPX 3KLMX 1DJNA 1EE9A 4JXKA 4O1MA 4R3NA 3ZWPA 5IDXA 5JO0A 4XGIA 4DLAA 4YRDA 1N92A 4BNNA 3DQPA 4BS9A 4HFMA 4BUCA 2QG4A 4H15A 4YXFA 3GVHA 1N2SA 4RPKA 5ENVA 3MEQA 4CLOB 3DZFA 4A5OA 3CSDA 4UUNA 4YAJA 3W8EA 1Q7BA 4NI5A 1W0CA 3JD3A 4KUEA 1GR0A 3JV7A 4DUPA 2HRZA 1U28A 1EVYA 2P5UA 1HSZA 4GX5A 5K9ZA 4OOEA 5DP1A 1NPTO 4IQGA 5JNLA 3AW9A 3BMNA 4IGFA 3V8BA 1P31A 1R0LA 4BQRA 2NV6A 4CM8B 2ZCVA 1HYEA 3U0BA 2HMVA 2X4GA 5G4KB 4CMJA 4DYVA 1LLDA 4R4JA 4CV2A 3ZDFA 4D0RA 4BO6A 2PTGA 4ZGWA 4IBOA 3PFWO 3G0OA 4I9HA 4YB8A 2D59A 2QQ5A 2IEBA 1DHRA 1ZCJA 3PIDA 4IJWA 3D3WA 4IDAA 5A03A 1U8XX 4PG7A 2VCYA 2PV7A 3GNTA 1ULUA 4ZU3A 4MVJI 2O3JA 1D1TA 2VYVA 4FJ1A 1B2LA 1BRMA 3I6IA 1EE2A 1RYDA 4OL9A 4D42A 1VSUA 2IXBA 3UF0A 1JLLA 2GCGA 5BSFA 2VZ8A 3ZWYA 1KEWA 2VOJA 1XKQA 4K6FA 2EGGA 1B7GO 5GY7A 4AJLA 1AXEA 3Q6IA 1JKIA 1SBYA 4DIFA 3MTJA 3OBBA 5B1YA 1KEVA 2CVQA 5JAIA 2RAFA 5BSEA 4RVGA 5IZ4A 4OO3A 4B7CA 1XHLA 2CY0A 3C3XA 3AM3A 1VPDA 4NFHA 4YAEA 4ZD6A 4YAGA 1YOVB 5BSHA 1ZMOA 2X1HA 2GPTA 4YJHA 1RM5A 1YH3A 5JS6A 2W2LD 4BO1A 2W8ZA
chains in the Genus database with same CATH superfamily
2RGUA 4NONA 5EXSA 4HMPA 1GUFA 2EFDB 3WP0A 5FR1A 3Q5DA 4Y6PA 5FOXA 5TSDA 1C0LA 1KVSA 2V7BA 3E61A 1DKOA 1O97D 3MN1A 4EYEA 1S2GA 3SHWA 1RXIA 5K0SA 4Q4AB 4Q48A 3C7DB 1SB8A 3AJRA 5B7GA 5EMMA 4TLEA 2ASVA 4CKEA 1GITA 4LJSA 5JJLA 2P9GA 3I1IA 4KSBA 1KH3A 1NUTA 1RWKA 1IEWA 2BE7A 1TQ6A 1BEEA 5DXJA 2G83A 1DV2A 2WP0A 3KHSA 4R7GA 4BV8A 3ZCTA 1NU6A 2J09A 2UYOA 4GYJA 4ND5A 4II2A 4PVCA 4R2LA 2VNJA 4D9IA 4JJEA 5F1KA 1U28C 5IDWA 2R1VB 4RACA 3W4KA 2NSDA 4WN9B 2LKCA 3OLQA 4KMRA 2C9CA 1BWQA 4GKAA 4H59A 1Q15A 2NZWA 3H8VA 2P5YA 1NQWA 4ZT7A 3SR3A 4MEAA 3FHJA 1JWBB 4LXIA 2A0WA 4FOOA 4H77A 2VNKA 1W96A 2ECFA 3BJIC 3A1EA 4KUGA 2FK7A 3D3EA 4TL7A 4NK4A 3AFHA 1T43A 1ZK2A 3ABZA 1QIEA 2VDWA 3A05A 3IKLA 3KZVA 3K9BA 3A36A 3JCZA 4P4LA 5EZ5A 1SQGA 2FN9A 2CYCA 3FGOA 3AO0B 1KYVA 3FJYA 4JBYA 1PL8A 1W5AA 4U4AA 5E7MA 2O8BB 4D81A 5J1TB 1R9MA 4J2OA 4IUDS 3TH5A 2P9FA 1UBGA 3FTCA 2A5FA 3O8NA 3KWFA 4CKZA 3LT0A 1L3CA 3GCWA 1USVA 3JRWA 4LXHA 5E4JA 5BMVF 3T1OA 2SHKA 3FF4A 4HEJA 1RI4A 3CZRA 2A2ZA 2VEDA 5EE3A 5AJYA 4F3RA 4KDRA 1TLTA 5ALXA 4NATA 1GZSA 4ETNA 1IZ9A 3LQQA 1J8YF 3NI2A 4W8OA 3UAXA 1BEUB 4F9GA 2A3NA 4KREA 1KSGA 2H51A 1W48A 2OAGA 4IIFA 4M22A 3SYMA 3F7TA 1H0HA 1CZRA 3LZDA 4GPZA 2AZ4A 2FX2A 3ONDA 4W1RA 4YIKA 3EXG1 2VJDA 1YBMA 3DLPX 3AL0C 1J1IA 4O2AF 1A8UA 2QZJA 4POAA 1GPH1 4WX2B 2KJQA 2CUKA 2Z95A 3KS9A 2IP1A 5E6RA 3OEEA 3GJXC 1LRKA 3R24A 1CF2O 3HKBA 4LOHA 2H11A 4RMJA 3WK9A 2QJWA 2IXTA 4PZUA 4N76A 3EXFA 4OHBA 2OV2A 4PSCA 1QX4A 2I99A 4TV8A 5KYKA 4JOBA 3EDCA 3PA8A 1NYRA 4YRCA 4AY4A 2FZVA 2IP2A 4WRRA 4PHTA 4WFQA 1OF1A 1A3CA 3HV0A 3CBQA 1GUDA 2CL0X 2IFTA 4UEOA 1PNRA 4HNUA 3TW8A 3AOGA 5AQEA 4DGQA 1U4OA 3TS1A 2B4YA 3IA2A 1KYYA 1QVAA 1OBVA 3Q3VA 4LKOA 4JLVA 1SUBA 1LVGA 5JNWA 3KXIA 5H80A 2ZBQA 1FTSA 3OWXA 1P0FA 2AFRA 2GSDA 1OAOA 3B6EA 3HGTA 2IE0A 2ZRJA 1LS1A 3P96A 2OYSA 4W9MC 5A9SA 1JFRA 2FKAA 2ZBPA 3COPA 3GRPA 2WIFA 1VG9B 4BMPB 1KVRA 2R00A 4KQEA 1CUZA 2X76A 4D1YA 2PU5A 3HDVA 3BK1A 4UUQA 2E21A 2H7XA 2ZQZA 5ELMA 1EP2B 1F8UA 1U3UA 4YI3A 3Q2IA 2FWBA 1VIMA 3AP1A 1KYXA 4ZV7A 1G5PA 4EO9A 3L1UA 4QM6A 3C7KA 3FYHA 5FP0A 5C52B 2PLNA 3WLIA 3B5IA 3PWKA 2FQXA 5AO9A 2YN0A 4WOKA 5ARCA 3CUEF 2MDTA 3JXEA 3K5HA 4FX5A 2GJSA 4U7DA 1L2TA 4QHTA 3PXUA 2C7BA 2P9JA 1E7YA 4OL0A 1DAGA 5JZVA 3DZDA 3MINB 4OYYA 5TS2A 2DQ4A 4Z4CA 5FNVF 1U7ZA 4HYTA 3DLCA 3JYQA 1OROA 2QAJA 3OTQA 1CUFA 4LC9A 1J2RA 4TZKA 3ESCA 4CF4A 4M1YA 4G86A 2EZ8A 3P2EA 2RGCA 2NO1A 4ZT6A 1V11B 5FPQA 4GKBA 5H0IA 3NUQA 3NKLA 3PGJA 3RASA 3VAZA 1BGWA 1E5VA 1DWUA 3PQEA 3NT2A 4JUAA 1TKBA 4MRSA 4PXYA 1TPYA 4Q3CA 1SFRA 2DXIA 4G0UA 1AXRA 1DIOB 3L7YA 5EMJA 2YKGA 4ZTZB 5GVSA 4TYMA 4RZIA 5A0FA 2ZBDA 1WZEA 4PFSA 3G1WA 4L9WA 3RC9A 1N6NA 4I36A 5JAPA 1ZGGA 1FEZA 1LLCA 4E5UA 2V59A 4CBVA 4RETA 2P1RA 2PZKA 3B12A 3RVMA 4DLBA 4B34A 1S8OA 4BX3A 2JEZA 2A0KA 3F3YA 1EJ0A 4ZMBA 1WNTA 1W0KD 3E6AA 3O8OB 1F8XA 3DAHA 3LLSA 1T4MA 2ERXA 1L3BA 5C8YB 4NSNA 1ATIA 3JS5A 2EU8A 1WXFA 1DQZA 3RYIB 2JGMA 4TQAA 2GYWA 4YDHB 1XR3A 5BR8B 4BIIA 4LXGA 5EWLB 4PG8A 4V0MA 1AB5A 2N46A 3UTDA 1H8HA 4N49A 3C24A 3MB5A 4E5YA 5K05A 1XVLA 1ATZA 13PKA 4EATA 2L18A 4EYGA 2PL1A 2Q2OA 3R3ZA 4NULA 1PR9A 1EFKA 4P2BA 4XEHA 3TFWA 2FH5B 5TARA 1PS8A 5KIAA 2AFHB 3G9ZA 2PN1A 2PYZA 3ET5A 4EUEA 1HQKA 3KAKA 1H1DA 4DSOA 2QI9C 5EZQA 1PJLA 1RKUA 4B48A 4Y2RA 1GKUB 1Y4SA 4IKPA 4OREX 2FFAA 3WGHA 3FWZA 4D0LB 4XYGA 2WJWA 2AMLA 5KTYA 5KQGA 1U8FO 1VGRA 4BEVA 1PNOA 1JU3A 4GC5A 2IU3A 4HDKB 1CUEA 1K9VF 4PYIA 1RKXA 1PR5A 4QUKA 4RL4A 3V4SA 1TQ4A 3UJAA 3WLTA 1YV9A 3EZ2A 1G5RA 4A3SA 3CUKA 4I9GA 3IVGA 2Z08A 1E8DA 3B6ZA 4R41A 1Z25A 1R5JA 1GFSA 1EUCB 2FTKE 2AZDA 3WJAA 3QH4A 2P9CA 4K9OA 4OGWA 2PUFA 2P5SA 3EMVA 3GF4A 3IJRA 4J0EA 2A1UA 4AZTA 4JJIA 5JXWA 3VGPA 5REQA 2LDBA 1YAHA 2ZYVX 4Y0VA 4OJTA 2IQ5A 3DPSA 3F47A 2VNAA 4PBTA 2OHJA 4IMJB 3K6SA 4EFKA 2QORA 2QRHA 3L7JA 3MSXA 1SBQA 1L7XA 3OQ6A 3QE2A 4P33A 5IN5A 3U7IA 3OEHD 4ZV4A 3R20A 5BN4A 5DEOA 4I9NA 3ZLJA 5H82A 2BHNA 1A8QA 3FOCA 4JH0A 4G0QA 4EARA 5K8VA 2JVJA 3UJNA 5FPPA 1SELA 4NV1A 2IZ6A 1HDEA 2YVAA 4KITB 3TBFA 5KB3A 1NR5A 3KJIA 8ABPA 4JLSA 2ZIXA 2JD2A 4KL8S 4O4JF 2EW2A 4C0QC 4LX0A 2P0YA 1IN8A 5DH9A 4AX8A 1GARA 2RCYA 3ET4A 3A1SA 1W4AA 4YV0A 1ZJJA 5JO9A 4D9GA 3JR7A 3NKVA 1QUEA 2QGFA 2W6ID 4QDUA 2M6LA 3B1ZA 1F14A 3IP3A 3KTDA 4LZLA 1OWPA 2B30A 3EVTA 5T3UA 1SVNA 2PFGA 5KDLA 1W88A 4A91A 3JVVA 4GUAA 5FPYA 3S70A 3HJBA 4JITA 3IVAA 1YRBA 4TMZA 4MWSA 3RVKA 5JD6A 2QVGA 1NVUQ 3RUHA 1EQAA 4G26A 3VR5A 4F2HA 1FS4A 3GUHA 4OBWA 5BSWA 1AGNA 1N2XA 4QREA 4X63A 2FOIA 2VPPA 1VBKA 4KXNA 2X9QA 4DB2A 1U65A 3U4CA 2HU5A 1XPJA 2X9LA 3IURA 2G63A 3O1IC 2HA6A 2WZBA 4PC2A 4E3ZA 1CUSA 2DRIA 1RRMA 2VPIA 2W2LA 3RWOA 1Q16A 1ISGA 2F1KA 2VHXA 2FP4A 4OGLA 1TO2E 2X4LA 4ZRDA 4AK9A 1PEDA 4FN5A 1T2UA 2R9VA 4J0HA 4DLUA 2GNOA 4OH7A 3DDCA 3KBOA 1PJAA 4J0DA 1R0YA 4BO5A 1XDWA 2XCLA 3GT0A 3BFKA 3MLEA 5L51A 1U8YA 3NATA 3H11A 4MUJA 4QYSA 4A2CA 4M9XA 1OLOA 1OLSA 3BD9A 4HDNA 4PHGA 3R9XB 2XMPA 5C8VA 1Q12A 4KK4A 1X1EA 2NQ8A 3KETA 2XUAA 3BCUA 1QGUB 2ADMA 5J2TF 3IUYA 4ZP1A 3KR1A 1C7ZA 1ZIXA 5CDGA 3PPVA 2YOGA 1T2DA 2QE7D 3WRYA 4E5DA 1D5CA 5BQ3A 1U8TA 1FNSA 2FUKA 4M53A 4R1UA 1Y8ZA 1TT7A 4IWXA 3P2IA 3UMCA 3ST7A 5HQ3B 3HNPA 3KB1A 4BVFA 2ZPAA 3KEOA 1S7CA 1EWYA 2XE8A 2YMPA 3HY6A 2GN9A 3S5JA 4IS2A 5HIAA 3DHEA 1R15A 5GVRA 1UEXC 2IS6A 2NO6A 2G9ZA 4OB7A 4OLFA 5CX1B 2BIFA 3V1MA 4KHPB 4FYVA 4JT2A 2I4IA 1WKBA 2LGJA 2WSYB 2ZRHA 4LOLA 4W6ZA 2O1SA 5KAMA 2BI8A 2G67A 1DMRA 4CDRA 1ZM2A 2NYUA 2UXDB 4V3CA 2C1ZA 2HJHA 2YNMC 1T13A 1ONBA 1O6GA 2ODBA 3H4TA 4XB2A 3SZUA 1KRWA 1RD4A 3BXPA 5TQVA 1XWWA 1MZPA 6Q21A 4XVCA 1QYRA 3A4VA 3RSGA 2BGMA 4LY9A 3TJMA 2V4UA 5HBGA 3FW1A 2O3TA 4C01A 2FKNA 4G07A 3OCZA 1JUDA 3L0YA 4V2IA 4X60A 3VR6D 2XKKA 3KYCB 2WJZB 4XSGA 1T1EA 3GYGA 1N8KA 3JASB 1X9GA 1FLAA 4B2YA 1KMIY 1NOIA 1C7JA 3MFYA 4UREA 3R8CA 2RE8A 3EIQA 4HDRA 4UCFA 2GJ9A 3MWYW 1H2WA 1WXHA 4YAOA 1DWOA 1NNI1 5FORA 3UM9A 3ZNPA 4F5WA 5EJ6A 3HDHA 2C9YA 4INZA 1EWKA 4N39A 4U2KA 3ZWAA 4B5KA 3SHQA 2YXLA 2D2EA 2JI8A 3FOFC 5A9TA 2BFAA 1DAFA 2NUTB 3EISA 3ZBTA 2HTFA 2FPXA 2VN8A 3ZHXA 4YR7A 2ZBGA 1A71A 2H2WA 1E2DA 2CF5A 2ZUUA 2CFCA 4XIGS 1FVOA 2YFQA 3ADPA 1H93A 3ORRA 3U19A 3IP7A 1DMSA 2GCPA 2JJ1D 3IOYA 3VC7A 3SGLA 4EO4A 4BQSA 1NW8A 4QQRA 5FH9A 5FJJA 5H7XA 4JB0A 2YS6A 1WCIB 5EXXA 4WKNA 2NTEA 4X6XA 1NASA 2JLYA 5CLHA 1FQJA 4FBLA 2YYSA 4X3CA 2H48A 4X64B 1W30A 3DMFA 4D9JA 5HFAA 4RMNA 4MS3B 4BC1A 5K0BA 2WLTA 4EABA 1QGAA 2FR8A 4ZAWA 3M5WA 4LJ5A 3W5AA 3AM1A 1DIBA 3RKSA 3PDIB 3AF5A 3EFHA 4GR5A 4R40A 1DCKA 2R8ZA 3T1HB 5LOVA 2BGGA 3TIFA 4N8SA 1G38A 3E5MA 2QLLA 3K3PA 1ZH8A 4EDFA 1FSGA 5C4MA 2O8EA 5JYBA 2ZRQA 1DELA 2RGDA 2FMFA 2XR1A 2A30A 4KACA 1EX6A 3JQ7B 4TS9A 3LS2A 3C8HA 2ORIA 4YXWD 3I32A 4F71A 3REQB 3ASYA 1PBNA 1YMVA 1K5DA 3EJWA 4IS3A 4FDVA 2WHEA 4DREA 4M1MA 2WYWA 5H5JA 3DAPA 3A6GA 3O26A 4BQQA 1RHMA 4X84A 3RJ9A 5T4FA 4TXMA 3G1UA 2V45A 4LF4B 2YWRA 2EEZA 1WR8A 1KMCA 5A1JA 4DNOA 3EGXA 5JSFA 1BHSA 4FWIB 5I7FA 4BNUA 2VRBA 1JEYB 2AEFA 2CDBA 3DMYA 3R3JA 3ANLA 4F38A 3NH9A 4H1UA 3THXB 1GGHA 2FW6A 4P22A 2IIQA 3AMVA 5BSTA 2GN8A 5DU2A 5MF6A 2W4MA 3C3DA 5LZ8A 2MYPA 3MJSA 3W8DA 3RVOA 2MWMA 3TLZA 4F4FA 5H83A 4R8VA 2PGDA 4GOXA 2HU2A 3HL0A 1JQBA 2Z8ZA 3WK6A 2GFHA 1Q77A 4M8IA 5MN6A 1WHTB 5HP4A 2O7RA 1TF5A 3EDRA 1JQLB 3RSQA 4EA7A 1AZTA 2C4UA 1G5TA 2Y1EA 3HA5A 2DBZA 3ANSA 4HGOA 1ENPA 2FNAA 3KZCA 2HW8A 4Y7CA 4REOA 2E4ZA 2VBCA 1VG0B 1KKLA 1YZLA 2W2OA 4TX1A 1WEHA 3CIOA 4ZFNA 4OXRA 2XMGA 1YFJA 1H3NA 1VKOA 5KTOA 4QHYA 3F67A 1RPZA 1GQFA 1C9YA 2Q9UA 3EODA 2I8LA 3ADKA 3VX4A 4CV1A 2JFVA 3M34A 4K0RA 4B3BA 4UHHA 3GJSA 4HWOA 3DJFA 2OMKA 5DZSA 5HMLA 1C9EA 1XTSA 1M2VA 2QD5A 4L9AA 4NOJA 4INAA 3VR2D 2P5TB 5I8PA 2A7XA 3DCNA 4C20A 1K88A 3TQIA 3JQDA 3JWIA 1H65A 1X9HA 4M3NA 1YHNA 4DY4A 4YVFA 3AVVA 4NJEA 5E3IA 1HWYA 1IVYA 5GM1A 3VJRA 4TTSA 3W3AD 2IZ1A 1NPYA 2GEVA 3QXXA 4Q19A 4DYHA 3GLGE 1QDLB 1ZEMA 2DHRA 1Y3DE 2D2VA 1AHHA 5LDDC 5JCPA 2I6TA 1K7YA 3I05A 4JMPA 4JK3A 4BMZA 1JH9A 1NF8A 2P9QA 3JQEA 3KHUA 3N2GB 2M6SA 4U02A 3LBYA 4WNCA 5ADWA 2F48A 3NAMA 4L4ZA 5SYMA 4AO8A 2H2IA 1SOMA 3R8FA 2G17A 3B7WA 1Y4ZA 4HQNA 2QJRA 5FWNA 5JASA 2PKWA 2WV9A 1SPBS 2R00C 2DUUA 4YONB 1GCUA 2Q9CA 3MCTA 2VYQA 3HSKA 4NENA 3THXA 5LC1A 2JCBA 1YRHA 1PUJA 1WMDA 1YC2A 3QUTA 5C32A 1H2FA 5EIWA 3NLLA 3SHOA 2E4XA 3D4OA 4M2LA 1CERA 3ITDA 4IJVA 1UDBA 3LM8A 3ZDDA 4Q3AA 2AI1A 2EFCB 3LBFA 3CF0A 4I50F 4M0FA 3PFBA 4MQEA 2AJDA 2QTBA 1LDEA 4GEKA 1BVUA 1MOZA 3HBNA 2OZLA 4TQGA 4IINA 3IEXA 4IWNA 5E6RB 2XZLA 2J9ZB 3PITA 2EX0A 4LYAA 2GZDA 2QXTA 2XA9A 2IYNA 3Q0EA 3RAEC 4QA9A 3KELA 2J3HA 4LZPA 1EUDB 2RGBA 5FTMA 4KPYA 4MPDA 3OQVA 3NBAA 4QDXA 4C7XA 4Q47A 4FIDA 1U3FA 4NP6A 5LYJF 3AHEA 1LVUA 1O3YA 2YYAA 3AILA 3CVVA 3U4QA 4YMHA 1QQ7A 1H3EA 1HETA 3VKVA 2IOYA 1Y80A 2Q9BA 1M9NA 3CZAA 4NZOA 4ZOLF 2RK3A 2Y1DA 4IW3B 4M89A 3LK7A 5AW0A 4DMMA 3ZJTA 1YQDA 5JARA 5KYXA 4WTOA 1KO7A 3LUKA 1Z4QA 2XTJA 5EE0A 4YRPA 1P1JA 2BE9A 3WKAA 1NBMD 2L0XA 2PKRA 3IAS1 4KIFA 2F62A 3MELA 2RH8A 5KTRA 1DEXA 3ASVA 3VC3A 5ADUS 1LDMA 4J3JA 4CG0A 1CUWA 4E32A 2GYVA 5KSZA 3EF3A 4CLRA 4NIMA 4LBZA 4XDZA 3WNDA 4ALLA 3L93A 4DQDA 5IANA 1OLXA 1NM5C 1W1WA 1Y34E 3IEPA 1SNYA 2ZYSA 2GAFA 3T6KA 4CKXA 1EVJA 1M54A 5IVPA 4K1XA 4GRAA 1CU1A 2BKLA 3J81A 4JUIA 3ZY3A 3O93A 4PIMA 2XNHA 5SY6A 1SVMA 2JFHA 2KW5A 3E9NA 3ONNA 3ROKA 5ICMA 1SURA 6PFKA 2BHRA 1HDOA 1AA9A 1JNXX 2DAPA 4AC9A 5AM2A 2JA2A 3NT5A 1PQPA 1JNYA 1NUUA 3ICEA 1M5UA 3FKSA 2VHZA 1Z35A 2ROQA 3WO0A 1M1YB 4HN2A 4QOEA 2GEBA 1KR2A 1VL1A 2QJTA 2W6PA 4KAFA 2OFPA 4ZAVA 1X77A 4G89A 4OV6B 5A05A 4DQKA 4G5YA 3KT6A 5EJEA 1YKFA 3LJKA 3TO5A 4HAIA 2Q7OE 4BL5A 4CODB 4GD3Q 4IG4A 1YTLA 1XV5A 3RFXA 3WYEA 1CZUA 1ORDA 4RHUA 1KY2A 2FSGA 4PY2A 2XX3A 4HWRA 1ICIA 1LXCA 1WCXA 1Z8NA 2QT1A 3NNDA 1L5GB 3TLEA 1RYZA 4AMUA 2Z1NA 1ZYUA 4A2PA 4Y2QA 4WJZA 1Q7TA 2H9YA 4DN6A 1L5SA 3ZTYA 4DEVA 1JN0A 3T7TA 1IBSA 3WGLA 5I9LA 5A9RA 4BN5A 1VRCA 1W59A 3P5BA 1H5UA 1LPBB 3HHEA 4E13A 4BGIA 1X92A 5TDHA 2CLFB 4B8YA 2PZBA 3E1GA 4UD2A 2J3LA 4OJYA 1PT6A 1Y1RA 2GD1O 1NJ8A 2ZTMA 4GLBA 3HCFA 1E98A 4AN0A 1JDUA 1P2UA 4O4LB 1CP2A 1U1FA 4RGQA 2JATA 3FG9A 4WUVA 4X7RA 1FYFA 3BHJA 3CRMA 4XX0A 2QL6A 4A1OA 1H69A 2OGWA 1AQ6A 1RQNA 2L19A 1WMBA 3E4CA 4G5HA 1Q3TA 1CQJA 8AT1A 5ED4A 1Z4NA 2GHRA 4U9UA 2I3BA 2NUBA 1I7NA 5H3LA 3S2IA 3COVA 1I94B 2AK2A 2I34A 3O9VA 4EJSC 2WJYA 1KJJA 4YT4A 1BWRA 2ONCA 3LQ4A 1O97C 5HFNA 2BFFB 1XCPA 4YP1A 3C6MA 3DHWC 1IB6A 5AM4A 2HMAA 4WASA 3M9XA 2C5LA 2XTAA 4REQB 1BA3A 3Q6MA 1M74A 2CV0A 1FVHA 1FCJA 1UBFA 1MAVA 1DO0A 2MHCA 3BQ9A 3E5HA 1S1CA 4M8LA 4UDOA 1BG6A 4KO8A 3CRQA 3F9CA 4V0SA 4WZZA 1QFJA 1ORVA 1IWPB 2HLNA 2OMEA 4F06A 2NUPA 3AUJB 2TYSB 4CGYA 1VGVA 2GN4A 1QAOA 1COWA 2A9VA 3M70A 2CNWA 2OL4A 4IJ5A 4P35A 4AUEA 2VRWA 2GSWA 4UBOA 2DCUA 5U9CA 2ZT6A 4B3SB 1EHYA 2EDAA 3EVBA 2HNBA 1SBNE 2VUSA 3LQRA 3P4XA 1ISSA 1IWBB 2P2DA 2CCGA 3U4DA 4OPMA 1VJ5A 1I7LA 2XUOA 1KI6B 3TRKA 2H0QA 2YC4C 2HFKA 4QXRA 4H7EA 5BUZA 3ULKA 3DHVA 3GJ3A 3KALA 3BORA 4DILA 1X80A 3D0OA 2RJNA 5A1TA 1JB1A 2HNAA 1DOAA 4I4TB 2G0NA 3AYXB 3INYA 4FFLA 2WJ6A 4DWVA 5KNCD 4UNQA 4F46A 2QUHA 4MVJD 5IC4A 3ELUA 5J3JA 4AULA 2J3KA 1V5GA 2JVKA 4HAOA 4NEQA 5EIFA 2FK8A 3C3AA 3C3CA 4M8SA 4B35A 2QRPA 1R0ZA 3O7MA 1P81A 1RZVA 5I48A 3PDJA 3V42A 4TXJA 1T10A 3PUWA 3TR5A 5AT1A 3FSRA 1YQGA 4TWAA 4FHZA 1XE3A 2J6BA 4W5OA 2ZUCA 1FXUA 4J94A 2D2XA 2LVBA 1X8LA 2QQEA 1E8MA 3O84A 1X7WB 4B3RB 4F9EA 1F2VA 5EINA 4RY8A 3BIOA 1TYBE 4CEHB 4HXGA 1GG5A 1KP9A 1UDCA 2PLWA 2RK6A 4IQ4A 2B61A 4E3WA 3EZ9A 1KQOA 1WF6A 3MMSA 1K8XB 4K05A 3LCJA 3KTOA 5BVGB 2ISSD 4FGUA 2H06A 1SBIA 3H9EO 3EEBA 1L7PA 2AOUA 3SMQA 4Q02A 1RPJA 1EP1B 2Z8YA 5K09A 1OTHA 3KSZO 2P67A 4WAUA 3AWDA 1D09A 4TT3D 2IPMA 1Q11A 4IHQA 3WGMA 3SS9X 1QCYA 1NKSA 2RGGA 2C61A 1SVOA 3LX5A 4XE5A 3T7KA 1W5TA 3LHIA 4GMFA 4PYJA 3W8RA 1DKNA 1RPAA 1E9FA 1RJGA 5BSVA 2XCQA 4HWKA 2I1QA 3MAJA 3TE6A 1J8QA 4PEVA 2G3YA 4YO7A 4MUKA 3CEJA 4V0OA 3V2UA 4IH4A 4YMSA 3P20A 5GGXA 4CM7A 5C1OA 4ESEA 1R8QA 3LRTA 2P77A 4QJ5A 3PEEA 3TI9A 3C5WP 3RSSA 5C8XA 5C37A 1ISFA 2NVUA 5D3MB 3GDWA 2WT4A 1F1BA 4PX5A 1FJGB 1XZGA 3IE2A 3ICQB 2I2BA 1KPIA 3GRRA 1LPAB 2H4JA 2OK8A 1LUAA 1KOJA 2QM8A 3AY0A 4QWWA 4TS4A 4WOBA 1ZI6A 3TXYA 2QSUA 3E05A 4I5GA 4X41A 4KODA 3ZHRA 2XTNA 1YJ5A 4E03A 1LDGA 4JASB 3GFVA 1P33A 3RS4A 4RTQA 5EQTA 4D4LA 5LMNB 5BV8A 4RIFA 5LNK6 1BJKA 2ORED 5J4YA 1ZS9A 2ATXA 4N5HX 3T0GA 3HG7A 2ZRDA 1E7SA 3DB1A 3GRZA 3P2YA 5BOSB 1B8PA 4MRMA 2UXBB 1BWSA 2Q3JA 4FFNA 1E2FA 3PUIA 2Q3DA 1KAHA 2WHYA 3O4IA 3CMCO 4HPWA 1YF3A 4J43A 4Q0MA 1CUIA 4P6VF 1Z5ZA 1CQIB 3AUTA 3PQCA 1OX6A 1U8EA 1P9NA 5JPCA 3PFNA 4QPCA 1H4TA 4Q1VA 2CHQA 5EP4A 5A7HA 2V5VA 1K27A 2NU8A 4XVRA 2WWYA 5CYFA 2F1JA 1A5SB 4OP1A 2QZ4A 4TL8A 4MS4A 4EPYA 5ALJA 2XDQA 1EXMA 3GP5A 5P21A 1N6LA 3COJA 3PTZA 4DLSA 4K9LA 4HTFB 4ZCQA 4FD3A 5C1PA 2J4DA 2Y9PB 2YXDA 2A4MA 2OHIA 2YTZA 3ED5A 4I5EA 2YV4A 4R05A 3CZ4A 4FFPA 4W7SA 5ICFA 4BLPA 1N9KA 3DBRB 3TOSA 2VJCA 8LDHA 2JFXA 1FMJA 1XMQB 4COOA 4L5AA 3RV4A 3H5OA 2J9XB 5AK5A 1WB4A 2B1JA 3A7EA 3NONA 1BS9A 3CX6A 2DR3A 2OSBA 5DBIA 1ID8A 4QT4A 3PQ8A 4M0CA 4R01A 2W2QA 4BQPA 1UCFA 4X0EA 2VSQA 3FTPA 4NCJA 3GB9A 3MXTA 5IJAA 2C9MA 5I9BA 3PQDA 4BFUA 2PK3A 4M8NE 4QDJA 3AEXA 3KCQA 4QWMA 4RENA 5JW6A 3R4CA 1FZTA 3CR8A 3VSDA 3RE1A 1TQ8A 2Z6QA 4WNIA 2HU8A 2WSMA 1YVDA 1G8MA 1SVSA 3KDPA 1BE8A 5JJ5A 3KDAA 2YW9A 1M5TA 2G1JA 2LKDA 4R0MA 1U63A 5TMBA 3C5CA 2IE8A 1DTWB 1MV8A 5A4FS 5BV2P 3CVYA 3V4LA 3ZXUB 1EI9A 1TEXA 3MXOA 1QVZA 3PV0A 3AVWA 1P6XA 3ZNQA 2F4VB 4B81A 3LDGA 1NLUA 3ROGA 1K9SA 1PR1A 1RACA 3OA2A 1E7MA 4P36A 1MLDA 1C1DA 1YS7A 2QRVB 5G0SA 3S2YA 2RGNA 1T5HX 4QBIA 4AJJA 4C1NA 4TKVB 4CKBA 1WMAA 1PP4A 1C29B 3SJAA 3TZQA 1WHTA 1YE8A 3BXFA 5KVVA 1CZNA 1WEKA 1J2EA 1EH5A 4RLHA 4JOQA 5E8RA 2X1VA 3O03A 2P6NA 2ANBA 2XVZA 3B48A 1ZN8A 5D85A 4ENUA 2HLHA 3IYLW 4K86A 1K1EA 4GMKA 3EARA 4GWGA 1WSBA 2QAGA 3DYVA 4KB5A 4MOWA 5JLJA 2DWCA 5LQNA 4S12A 3SX4A 2ADFA 4QPJC 1NLZA 3OFSA 5C3UA 4B80A 3NJ4A 4Q9AA 4AW9A 4JSRA 2ZWPA 3SP1A 4ZO4A 2EBHX 2A92A 4OXKA 2C2YA 4O8CA 1WP4A 5BNWA 4J0CA 4A6DA 3BEOA 3DAYA 3EXFB 4HO1X 2O8VA 3IXLA 4Q3KA 4IOLA 3S1AB 1FP4A 3JARB 5ICSA 3GT3A 1GQYA 2W0MA 2ZYHA 4O2AB 1BS1A 1FE8A 4XQ0A 3SVTA 1MRSA 4RXTA 3GPIA 1TD1A 1XQVA 4FIZA 4JBHA 1TJ4A 1J7JA 5BO5A 4UE6A 3UY4A 1M5RA 3ZJVA 1A8HA 1DGQA 2XB8A 1D2NA 5TF0A 3S2ZA 3MIZA 4ERNA 1DAEA 2H3HA 3E9DA 1EMDA 1N4DA 2COEA 1ZK4A 2EFHB 1GGFA 1NNLA 2JCXA 1YB6A 3NTOA 3OIVA 1AUOA 1DQPA 3FPLA 1NM5A 3VPXA 5K8CA 1EFCA 1NAHA 4C6TB 1EG2A 3FDIA 1C7EA 3QUSA 2BMEA 1XYGA 3PUKA 4Q5IA 4EKEA 1U0BB 1R00A 3SCZA 1OC2A 1JW9B 4UEWA 3LGSA 1FL9A 1JWAB 3TCKA 2PM8A 5C9ZA 1K66A 3Q15C 4MROA 4X66B 2FHPA 5ESRA 4PXSA 5BRJA 5LWHA 2C59A 1SEPA 1AO3A 2JJYA 2BD0A 2VDMB 4L2IB 3O6VA 4D6YA 2YX1A 2NZXA 4PNPA 1AUVA 1UKYA 1XCBA 3CE6A 4BJ3A 1B73A 2XNDD 4BTEA 2GVZC 3OPNA 4DBVO 1V1RB 1G21E 1SKBA 1IPFA 1YOBA 4I6GA 2OO5C 3ETDA 1OV6A 4UTZA 4LISA 1PYOA 1V9LA 4PAWA 1JB9A 4N0MA 1OX4B 1WUYA 2O2EA 3A28A 3L07A 4E2XA 4EPVA 3GUYA 5D86A 2XUQA 3IJPA 3PVSA 2MINB 3SXUB 2WYHA 4Y2SA 1Z0AA 1ZIOA 3K15A 4K8OA 5ALHA 4MVJH 2QG9A 3P9PA 3QLUA 1PWXA 3L1KA 4ARBA 4KPEC 4I8XA 3R6LA 2GDZA 4PO3X 1RSZA 2C8VA 4O4HF 1BU5A 3TVTA 1R4NB 2ZVPX 4YREA 1VLVA 3C8ZA 1WBBA 3SHVA 3FJ1A 4OYHA 3BXOA 4PVDA 1WE2A 3DUFA 5CX1A 1GGEA 2A14A 4UKDA 5HNKA 3D7SA 3NEYA 1AGPA 2Z0MA 2R8OA 1IOWA 4KO3S 1NDUA 5EXEA 3YASA 5FWXA 4ASUA 4FFRA 2EFEB 1JYSA 1E6MA 4IEEA 1V8ZA 2F7SA 4LF6B 4N0DA 3TCNA 4CQMB 2AG6A 5KMGA 2NSHA 1Z2PX 1DRKA 2MSNA 5GV7A 3O90A 5FLKA 3FHLA 1HDIA 2XUDA 4MA0A 1P6QA 2Q1WA 2QHXA 3RVDA 1CFJA 4XLLA 1JLMA 3C1TA 3CEPB 3O8OA 2R44A 3QBVA 4NENB 2ZJ6A 4S2UA 1GGJA 1Y63A 1YIOA 2QX6A 3CB4A 5EXTA 3V00A 3ZJ5A 4MDEA 2ST1A 1JFFA 1XD2A 5ADHA 1G66A 1NGSA 4EQ6B 1CYDA 2GZHA 1LDBA 3A4MA 2ERCA 4C0LA 1E2HA 3ILXA 1P4RA 3WKEA 3GBVA 2IUSA 5KYNA 2POQX 2HF9A 1G4AE 3EMKA 3SSOA 3LA6A 4BJHB 1O95C 4MQEB 5HPYB 5CTJA 4JQCA 1KY4A 5FULA 2MSCB 4D3SA 1FXWA 2FMXA 3CT6A 2H65A 5DK6A 1P73A 3TRFA 1R9JA 4ENVA 3OFND 2VP6A 5KSOA 5DE3A 3M1YA 1ZBQA 1QQ6A 3ADCA 2FE4A 4FMCF 2IXFA 3G2JA 1Z62A 4MQUA 1IFXA 3OJLA 5IDQA 4DIKA 3JQ9C 5FQNA 2Y3IA 5C1BA 1QHFA 1GTVA 2JAHA 1XN4A 1IMJA 3S7TA 3KKQA 3HU5A 4RJLA 3GH3A 1SKQA 4AKHA 4AY3A 3WL8A 5F35A 2DFDA 4F2PA 2FPGB 1QYVA 1YZHA 4RKFA 2PA3A 2O9JA 2V7QD 2B4QA 4M1OA 4R8RA 3WRVA 4ZHQA 3UMSA 4CKWA 5EFZA 3VNUA 3DZ8A 2VQ3A 3IDSA 3RTGA 3L41A 4MP6A 2XNSA 1UODA 4LHXA 4OYRA 1YSCA 2X5JO 2AUNA 5JCOA 3QLVA 4NEGA 1QB8A 3R6TA 5CA0A 4MDFA 3P2JA 2P41A 3R0JA 3UATA 1VKJA 3WLPA 4RL6A 2PL9A 5I8ZA 3ADDA 4UU8A 4P9NA 3IE1A 4JIGA 2Y0EA 1Y82A 1NJFA 5DGCA 4DMFA 3FOAA 1T2EA 1ZX1A 4TMVA 1L5HB 2ZRFA 1Y81A 4EPRA 1WXXA 1MIHA 1DAOA 3QU9A 1OA0A 1Q44A 2PMWB 4RKWA 1VYTA 2J41A 2IUFA 4RSHA 4XVQA 1W25A 3GGSA 1EVLA 3PFGA 4RFLA 5D01A 5HFJA 2B1IA 1JXAA 1PYDA 2FPPB 3DQQA 3TSWA 1XVIA 1ENZA 3BMOA 4HN9A 3FM9A 1Z4IA 2GB4A 4H27A 4GU5A 5KNDA 3KBBA 4KSCA 3GLRA 5BW6B 1G3QA 2HPZA 2NGRA 4BCCA 3TDKA 2E1RA 2YQ4A 2P6OA 2GJ8A 1MDFA 1C8BA 3KVRA 4KN6A 5FDFA 1JFFB 1XD2B 2HADA 3HP1A 2QENA 1BFKA 1Z5UA 3ZKWA 4GOND 5AVOA 4YP7A 2YWFA 2AT1A 1ILEA 2P68A 2PRSA 4FFSA 3OECA 1GEEA 3HJUA 1AKVA 4KEAA 4TMYA 2GPNA 1RZUA 3CF4G 4XSHA 5K3AA 1RU3A 4UNRA 1DEAA 2D0IA 2YFKA 4WZAA 5DBFA 5FHQA 3UKJA 4CVNA 1CUJA 1HA3A 3QF4A 1UAGA 2Q5HA 5DGDA 5L3SA 2FSHA 4IO0A 4L8GA 1QG6A 4XUDA 1EJ2A 5FKJA 3U4IA 5MGBA 1QZTA 1QC5A 3LUJA 4LTMA 4RF4A 3HVUA 4Y1RA 2IKQA 3A25A 3DOIA 5J40A 3R3VA 4F8JA 3HUDA 1YO6A 5ADVA 4ZYYA 1TUGA 5F1OA 1EE1A 3ANYB 3W8NA 2F6RA 2JC3A 2O3SA 3AR3A 3T0FA 3GLGB 2HX1A 4OLJA 5BWCA 2O6LA 1O94A 3RF7A 5DBOA 5EMHA 3VSCA 1FYDA 3IILA 4BO7A 2BHLA 2VQDA 1WDTA 3OOEA 5TQ0B 4RVHA 1J42A 4EG1A 1PV1A 4JL8A 3IHTA 5BWMA 2I76A 3E2IA 4M9UA 4MLPA 3AFNA 3JYHA 3K1YA 4XGRA 4U7WA 2AN3A 1OIVA 2Q6IA 5DK4A 5EJGA 1VJCA 2I7VA 3N8GA 5ALKA 1QP0A 3BXEA 3I8XA 1OGYA 2FMKA 4XM1A 1HBJA 2WD8A 3ENZA 4UNIA 2QPLA 5LKAA 2BUBA 2GT1A 2UVDA 1D0VA 3BWXA 4LHYA 3SBXA 1XJWA 1PU2A 2RHMA 2O8FB 3W7VA 2EEPA 1VHQA 3KZOA 4MVJM 1XTZA 4N4AA 4RNDB 5LYJA 3FFTA 4MYUA 4PYNA 3OE4A 3EXG2 3AEKA 2AJTA 3KAQA 3MJEA 4DRXA 2VL7A 1JG7A 5A3SA 1DO2A 2B1QA 1ULHA 3B7GA 4TKUA 1I4TD 1JEAA 2IOHA 1YT5A 2O3QA 4IVNA 2IYTA 1U1IA 3BA1A 1T6YA 1P9WA 3AU9A 2AZTA 2XSZD 5H68A 5FYQA 1G5IA 1M8KA 1HK7A 3OIWA 5FTJA 1X13A 1SVWA 3QY0A 4N48A 1DC6A 1N5RA 4MIYA 1MIOA 1Y7LA 4LYEA 3DR3A 3P9YA 1WXGA 3A1UA 1NKVA 1MC5A 1S3SA 2JASA 3DL7A 2ZS8A 4G37A 4HL6A 1GAJA 4F6RB 5JCXA 2DMRA 3SFVA 5A5VA 3J7AC 3T4EA 2F3RA 4KIJA 1FP1D 1WU8A 2JJ2D 2XMBA 4JP1A 1NX9A 2XOXA 3EGEA 3JSAA 4FNGA 3LUHA 4JMLA 4XAQA 3WTCA 1VMEA 5AXDA 4TM8A 3VU0A 1M33A 5JI3E 3X2EA 1OFTA 2X41A 2WKSA 3EA4A 3EEYA 4C7KA 4G5SA 3KPJA 4OHWA 5GONA 2AOTA 2QL5A 1WULS 3LNCA 5AW8A 2RAVA 5EJ4A 1GRVA 3HVIA 5K3FA 3RHTA 1POWA 2XPCA 4COKA 2CT8A 1E2NA 4I6JA 1A04A 1E61A 1JSCA 2IYSA 1MX3A 3FDJA 1TVCA 2RHTA 3PHLA 4ZQHA 3ZCRA 4G41A 1NLYA 1L8OA 1V39A 1WF3A 4EA6A 2YICA 3KV3O 1KDOA 4V0ME 3WIUA 2ODPA 3T5DA 5HK9A 1M6NA 2KB0A 2FXIA 1C5KA 4LAFA 4QBHA 5DNAA 1JJIA 2VAPA 3DGEC 3MHPA 2BDUA 4UTVA 4MVYA 1L7MA 2IWRA 4FGLA 1PFQA 2CXTA 2OP0A 5IH3A 2WAAA 1IYZA 3EC7A 1H23A 2NUTA 4BFXA 1M1NB 1XZ8A 1DG1G 3D1JA 3PK0A 4GKVA 3E9CA 3OU6A 3ZQ4A 4NS1A 1JHPA 1V8FA 1T9HA 1UOOA 3QBTA 3R3UA 4GKJB 1XHEA 2X8WA 4KGXA 2HWXA 3ORQA 2V65A 4YJFA 3DOJA 4OSEA 4HDSA 5CR9A 5L3QB 2PSFA 1UAYA 1GT91 4J9VA 2HEGA 4LYDA 4PNHA 3VPCA 1Z5WA 2W00A 2CCKA 1DTSA 3NHFA 5M2QA 4LGMA 1A0OA 2C1XA 2G04A 3ZIUA 4FYJA 4INPA 1VFNA 3OTHA 2ZIAA 5J2TB 1YVUA 2HA2A 3GGOA 4RA6A 3OZDA 2CLMB 1UQRA 2XYPA 2WZQA 1XL0A 2D62A 1P7PA