5JDIC

Trypanosoma brucei ptr1 in complex with cofactor and inhibitor nmt-h024 (compound 2)
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
266
structure length
239
Chain Sequence
b'APAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQKTVETQVAELIGTNAIAPFLLTMSFAQRQNLSIVNLCDAMVDQPMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pteridine reductase
molecule tags Oxidoreductase
source organism Trypanosoma brucei brucei
publication title Profiling of Flavonol Derivatives for the Development of Antitrypanosomatidic Drugs.
pubmed doi rcsb
total genus 91
structure length 239
sequence length 266
ec nomenclature
pdb deposition date 2016-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5jdiC00
4CQLA 4UVIA 4L4XA 4D3SA 4AJ1A 9LDTA 1GPJA 5JS6A 1C1XB 4P8RA 3I5MA 1SOWA 3VHRA 4DWVA 2XOXA 3O8QA 3R6DA 4GH5A 3GR6A 5DBGA 1I24A 3RUIA 5JDCA 1E5QA 3F4LA 2FMUA 4BKUA 4ZU3A 2HUNA 4B79A 2F1KA 3V8BA 4U6SA 5EJ2A 2QZ9A 4R3NA 3MOIA 1B8PA 3ZWCA 4JROA 5DCWA 1HZZA 3N7UA 1C1DB 4IINA 3JYLA 4IDFA 3JQAB 3L6OO 1LLQA 3RUCA 3OH8A 1E3IA 3CE6A 3G3EA 3PHHA 3I6QA 1UZNA 3AUSA 5ICMA 3GEMA 2NTVA 3L07A 3OP4A 2NU9A 5CEJA 4BUCA 5G4KA 2YQ5A 4CL3A 5KKAA 2IZ1A 3JD3A 1E3SA 4WKGA 4ALNA 5JCJA 3JQBA 4UEKA 3HDQA 3NRCA 3KOUA 1LDMA 3IKTA 1NFQA 2R00C 2POQX 5KJ1A 4XQGA 2HMTA 1WZEA 3BAZA 4KMSA 2C20A 2C29D 3ROMA 2AG8A 4BMVA 1NHWA 3GG2A 2ZYAA 4I5EA 3I6IA 5IXYA 4EJ0A 3VZSA 2NVWA 3OM9A 1MV8A 3QIVA 1XQ6A 4H3VA 3RUHA 2C59A 4E2ZA 1BXGB 3JQGA 1U1IA 2E37A 2P5YA 3H5RA 1G1AA 3LLVA 3QWBA 4XYEA 2CDCA 2GASA 2R00A 3U4CA 9LDBA 1E3WB 1ZXBA 3NTOA 5C3MA 1I8TA 4HFMA 3DFZA 2C2XA 3F47A 5IF3A 4CUKA 2CSUA 3ANNA 3FBTA 1GU7A 1ZMTA 1AGNA 1ULSA 1KEVA 2E48A 3JQ7B 3BYZA 4R1SA 1NBOA 3WGHA 2BF7A 1LRKA 5A1TA 4WCFC 3PDUA 2NU8A 1XELA 4RLSA 3RUAA 3ZHXA 2E6UX 1Y1PA 3JD2A 3VPFA 2GN9A 3ENNA 3KYCB 3GY0A 3I9JA 4ZQFA 2J3IA 4JP2A 4XQEA 4WOJA 3PJDA 3E6AA 1B2LA 1ENPA 2YHIA 2C5AA 4Z6KA 3HDHA 5L51A 1A72A 1GUFA 1S7CA 3CIFA 4ONEA 2Q1UA 4PLHA 3B1FA 2AMFA 3DHNA 3H2SA 4N5MA 3G17A 2J5KA 1P0FA 3LC1O 5IDWA 3DBVO 2A94A 1Y5RA 1P77A 3H7AA 5K9ZA 2OP0A 4WK6A 4YAJA 4MIOA 3BMOB 3PDJA 2O4UX 3MJ4A 4IXWA 3RIHA 4BMNA 3KEQA 3R3JA 4PLCA 1HE4A 4PG5A 3OJLA 1BXZA 2NVUB 3WLFA 2EJWA 1PEDA 1OC2A 3JQ7A 2X9NA 1LDNA 3TN7A 2DTEA 4BL5A 2OXIA 1NHGA 5I7EA 4CR8A 1U3UA 4IDDA 1ZK2A 1LBEA 1V9LA 4L4RA 1T2AA 5EIOA 1F06A 2ZK7A 1B8UA 5KKCA 2PV7A 4XQCA 4DQUA 1N2SA 4M89A 3JYOA 4YAGA 3UHAA 4YPOA 3W6UA 5MGBA 4MPDA 3SLGA 5CFZA 3RFXA 3ZWPA 4MP3A 3LYLA 3VPGA 3L77A 4Y98A 4K28A 2JCYA 1GQ2A 4LW8A 3TOZA 4NI5A 5MDHA 1LJ8A 5TLSA 2X5OA 1KVUA 2Y05A 5HRUA 3D1LA 1YL7A 1YB4A 5KVSA 2HK9A 4MKXA 5B12A 5ENVA 4BVAA 2V7PA 2EV9A 1P3DA 4B3IA 2AEMA 2X22A 3ONFA 1G0NA 4IIVA 1GQQA 4K26A 2BMAA 4NK5A 4OAQA 5BNIA 5DBFA 2VWGA 4QECA 2EP7A 1SO8A 1ID1A 3PIIA 1GFSA 4AJ2A 1IHXA 1KOLA 4BKOA 5BQFA 4FJ1A 4Q3CA 4W7HA 5KVVA 1OC4A 2J6IA 1KY4A 3GFGA 4PG4A 4R1UA 3WSWA 3F5QA 2LDXA 1HLDA 4J6FA 2JFGA 4WOKA 4XDYA 1ZO8A 4LK3A 5ILOA 3BTSA 4K9DA 3AM4A 3OA2A 2QX7A 4HY3A 2VRCD 5F3RA 1DHRA 4HUJA 3GC6A 1PX0A 3EHEA 1WPQA 3PJEA 4OSOA 2D8AA 1L1FA 4NFSA 3X2FA 2VQ3A 2P2SA 1E7QA 1NWCA 1I2BA 1U2GA 3BTOA 1HF3A 4IJVA 1B8VA 2CF5A 2Y1EA 3PYLA 1O89A 4RF2A 2DLDA 1HLPA 1PJBA 1VSVA 1FDSA 3DL2A 4P38A 3TFQA 3TSCA 4YRBA 1HTBA 4DGSA 2PZMA 3RBZA 4GX1A 1ZNQO 1AUPA 2ZCUA 3N58A 1EE2A 3RBXA 2R6JA 3DBRB 3I9OA 3ROPA 3I4CA 5HM8A 1XHLA 1Q0LA 2X0IA 4XJTA 1NAHA 5IXSA 3DAFA 1PU2A 4CLOA 1R12A 3WGQA 3FR7A 3N74A 3OJOA 1Y8RB 1PJQA 1U5CA 4GWKA 2J8ZA 3PLNA 4KDEA 3U4HA 3KLMX 1YGYA 3GNSA 3VVCA 4MDHA 4FFOA 3IIEA 1D4FA 3WIDA 3DFUA 1EE9A 2GDZA 3O26A 5THQA 3TWOA 3K2EA 5L9AA 3BXXA 1M66A 4DA9A 3FNEA 1VL6A 2HCTA 4KDFA 5LC1A 2GO1A 4XB1A 4OXYA 4FJ0A 4PZEA 3IC5A 3ZWNA 1VJ0A 1BG6A 4U0KA 1ZBQA 2IODA 4TVBA 4PLGA 5AOVA 3HADA 4OGWA 4ND4A 4GKBA 3LF2A 4Q3NA 3DR3A 4MO2A 3WNVA 3D7LA 4B3HA 1LLDA 2BFAA 3DZBA 3NDJA 3V2UA 1MFPA 5ER9A 3WSVA 1MB4A 1YVEI 4NG5A 1Q0QA 4Z3DA 4H16A 4IBOA 3CPSA 1H9AA 3CMMA 1P1KA 3SBOA 5A9SA 2GPTA 2Y93A 4DUPA 1R6DA 4I8XA 4CMEA 3LQFA 2O3UA 2Q49A 4OOEA 3S8MA 3AFMA 3WGZA 4F46A 4PG8A 5F5LA 2AEFA 4UAGA 3G1UA 3GZ4A 3OJFA 5B1YA 1DRUA 1V3VA 2DUUA 4WLNA 1IB6A 4J4TA 4R3WA 3VKUA 2DAPA 4CM4B 2DQ4A 3G49A 4AL4A 4BNYA 4ZQGA 5CDGA 3RC2A 4MVJE 4MVJA 2J3HA 4OKIA 1O95A 2GNAA 1BMDA 3NKLA 3NTQA 3ZV4A 3QVWA 4GGOA 2EF1A 5TF4A 2Q4EA 4RVFA 1HYHA 1UDCA 1PL8A 1EBUA 1YS4A 3HNPA 4J2HA 2QW8A 1P33A 4NNJA 2HJSA 1K0UA 4R5HA 4Z3KA 1NPYA 4CM9A 3PJGA 3D3WA 3R1IA 4WUVA 3GHYA 1GADO 2PGDA 4GMGA 2PGLA 3GAZA 5JMPA 4JK3A 2ZTLA 3R3SA 3D4OA 1E7SA 3U09A 5JYDA 3JQEA 3C1AA 5L7WA 3GN2A 4RCVA 2PH5A 2CDBA 1H6DA 5T64A 3WB9A 4BGEA 3NX4A 5G0VA 1U9JA 4BO1A 3E9MA 3AU8A 3DBRA 5I7VA 3GVPA 2C07A 3ICPA 2DBQA 3GRPA 4MVJD 5I8WA 5JO0A 2HU2A 4CLRB 5HS6A 5A5FA 3BMQB 4WPGA 5IZCC 4II3A 3WX0A 3LDHA 3QE3A 1PL6A 1YB1A 1R16A 3VTFA 1X0VA 3OF2A 2JFHA 4PLPA 1DLIA 1X1EA 4WLEA 1UP6A 4R1NA 4DBVO 2FN7A 2Z1MA 3TDKA 1M76A 1ONPA 1QYCA 1YRLA 3JQ8B 3UKOA 4DREA 5KTKA 1TVEA 1X7GA 3CXRA 1B15A 3MJVA 2FP4A 4HFJA 3RKRA 1NNUA 4CMIA 3KYDB 3KM0A 5LCXA 3WQRA 4ILKA 1N8KA 3HQ4O 1PGPA 1KEWA 4P4LA 1PGOA 3RSHA 3EW7A 3BHMA 3GVXA 2FPIA 5DDIP 3EVNA 3CUKA 1YQXA 1K2WA 2V6MA 3VPSA 4J1SA 1FJHA 3WWYA 1GYRA 3ZNOA 1GL3A 3QVOA 5U9CA 3NGXA 2RH4A 1HE2A 4XD2A 2V65A 3ZWYA 1R4NB 3MJCA 1ENYA 2BELA 2H9IA 4MVJM 4UULA 2YHIB 3V1UA 4O1MA 5F1KA 4CMAA 4E13A 1YL5A 1XA0A 2A9FA 4XX0A 2FZWA 4BNNA 3K73O 3UICA 2Y0EA 4TRRA 1F12A 2Y0DA 3H3JA 2HJRA 3VKVA 2VUSA 2NWQA 2ZTMA 2RCYA 2DM6A 1D1TA 4ITUA 5JY6A 1WWKA 4BNZA 2W98A 1QORA 4OO3A 3K2BA 2E82A 4GLLA 4IMPA 4DLBA 3GGGA 3GVIA 5EL0A 1HSZA 2NNLD 2HQ1A 3P2YA 1V3TA 2FRDA 3QSGA 1DC6A 5CPFA 3DOJA 4JBGA 4E21A 2Y1CA 4KUEA 4BV9A 3ETDA 4FFPA 1UP7A 1VL0A 3AM5A 4CQMB 3BMNA 1CRWG 4BIIA 2WD7B 4J1NA 3A4VA 1EVJA 4WLOA 1MGOA 4DBZA 3EMKA 4DIFA 4YJFB 1D3AA 5A02A 1LC3A 4MKRA 3D0OA 3G79A 4XB2A 2WJPA 5HA5A 3JYPA 4UVEA 1DJNA 1UXGA 3RC9A 3W1VA 4ZGWA 2QRLA 2O3JA 3CINA 2VWPA 1ZK4A 1HE3A 3QWAA 2BKAA 4NJMB 3WDSA 1PS8A 3H9QA 1P31A 3IAHA 5H83A 2YUTA 3FPCA 1X15A 1EUDA 3I83A 1E1KA 2GCGA 3INTA 4O59O 4CM5A 2IZZA 3UOGA 2PZJA 4FR5A 4YWJA 4C4OA 2J3KA 2QIOA 5A03A 1ONOA 2R2GA 4J4HA 3ZH2A 3WMXA 4B4WA 1UR5A 5JBIA 3K31A 4FGWA 3ZU3A 4EJMA 3DWFA 5A4DA 2GLXA 2X0RA 1P1HA 4GQAA 2O2YA 1SB8A 1L7DA 5EQDA 3ZW8A 4IQ0A 2AW5A 3MOGA 3E1KA 3A1NA 3HDJA 2HMSA 1GEEA 5AXBA 1E6EA 1JDJA 4QXMA 1TT5B 3H9JA 3RAJA 4ROSA 3BMNB 3D5TA 4E32A 3FTNA 4I9HA 1UAYA 2P9GA 3B70A 4P4NA 2B5VA 1MP0A 1UXHA 3QWFA 1T2FA 2V6GA 2X9VA 5GY7A 5G0UA 5ER6A 4YAKA 1DAOA 3U62A 4ZHSA 1L7EA 3C7CB 3KYDA 3Q1LA 1O6ZA 3KTDA 5CEEA 1VLLA 4ALIA 1H5QA 4CM9D 3JD1A 5I7SA 1MX3A 4IZIA 2X6TA 1BSVA 4QQRA 4B8ZA 3BMQA 4D44A 4E6PA 2VHZA 3ST7A 3RKUA 5AXDA 5KJFA 2A35A 4J90A 3DEYX 4LN1A 3COSA 1PS0A 2ET6A 3B20A 1AXGA 4Q39A 1V0JA 3NDRA 5TT0A 2NQTA 4PZCA 1C0LA 2VZ0A 3W4IA 4TVOA 1ZK3A 2PZKA 4TKMA 1CQIA 3GT0A 4EEXA 3QWHA 1QP8A 4AFNA 1DO8A 2GN8A 1ZUD1 3P2OA 2JHGA 3T7EA 3Q9NA 4PLYA 3R0IA 4YVFA 3RD5A 3VOSA 4KQXA 4W9NC 2HAEA 3IL2A 3ONEA 3OJEA 1UUFA 2NLOA 1NTOA 3UAGA 4C7KA 1ZW1A 3MWDB 4ALMA 4BQPA 1YQGA 5T8KC 1NFRA 3PVZA 4BO4A 3S55A 5CEFA 2ZJ1A 1XU9A 5JW6A 2P4HX 5B37A 4BO3A 4AJPA 4IDEA 5JDCC 2QYTA 3ZWAA 4BNTA 1U4SA 3K6JA 2GR9A 5IN5A 1ZJYA 1ULUA 4MP6A 2WD8A 2GERA 2GZ3A 4JXKA 4JBIA 1PQWA 4W4TA 5TJ9A 4PLFA 3PZBA 2ZTUA 4IGEA 3UVEA 3ORFA 1R15A 1SC6A 2NADA 4ND1A 5ADHA 2JCVA 4Y6RA 3DZGA 1JA9A 3GPIA 2OBYA 2VNSA 3QJ5A 5L4LA 2PA3A 1HDCA 3MZ0A 3TF5A 3VPHA 1N1GA 4JCOA 2HO5A 1KEUA 3LT0A 1M6WA 2X23A 1P1JA 3DZJA 2TMGA 2O3TA 3JSAA 5CDUA 3LC2O 2B83A 4J1QA 1DIBA 4QFDA 2B4TO 5F21A 2UAGA 4G81A 1E3EA 4MOWA 2OZPA 3IKVA 3OICA 3GRKA 1A71A 4AVYA 4H7PA 4LMPA 1MG5A 3D64A 1YO6A 4XR9A 3JQ8A 1LDBA 1U28A 3GMSA 1KVTA 4YAIA 1C1DA 1T24A 2QRKA 3VH4A 1W6UA 1EDZA 2CVZA 1EQUA 3M1LA 3V1TC 3SC4A 1BW9B 4OJNA 1LQUA 3WXBA 4BO6A 4E5YA 4ZICA 4R51A 3V2HA 1PIWA 3L9WA 3MCVA 1VI2A 5BSGA 3WLEA 2GD1O 3AM3A 3BMCA 3DAPA 2EXXA 3JQ9A 5EQFA 2GZ1A 4LSMA 1GY8A 1NQ5A 1ORRA 2O7SA 2ZIZA 1JWBB 3JQAA 4XIJA 1LU9A 3KO8A 1PR9A 3ANLA 3V2GA 4BGIA 2C54A 4KQWA 4IQ8A 1UAGA 4BNIA 2PZLA 1FK8A 1T1RA 1PWXA 2OHXA 2OUIA 4S1VA 5TC4A 4ND3A 3Q3CA 3KV3O 4L8VA 1H6BA 4W6ZA 3OEWA 3LK7A 3F3SA 4L74A 3VH1A 3LVFO 4AJEA 5JXWA 3EDMA 4CMCA 4HXYA 4UUOA 1X7DA 2AQ8A 2EHDA 3T4EA 4WCFB 1JAYA 1P1RA 2B4QA 3AOEC 1LRJA 3DOCA 4IPTA 4OQZA 5EPOA 4YT8A 3C1OA 1NP3A 3DZKA 4R1TA 5DCUA 3VZRA 1Y9EA 2IZ0A 1AHHA 3M6IA 3H5NA 4OXNA 5COBA 4E33A 2WYUA 1NAIA 3K96A 7ADHA 2X0JA 4PIVA 3TZHA 1A9YA 4BS9A 4UEOA 3UN1A 1LQTA 2FR1A 3SX2A 5KWEA 1E6UA 4J9UE 2WD7A 3T7CA 4EUFA 2PNFA 5JC8A 1GQYA 4E2XA 4YR9A 3JYQA 1YBVA 3PJFA 3TL2A 1H6AA 4F6LA 2BRUA 2OO5A 4CM6A 3EGOA 1EK6A 3NT4A 2NSDA 3OFSA 4CR7A 4XGNA 1DC3A 1X1TA 2O48X 1F8GA 5A06A 1JAXA 3AFNA 3PRJA 1HDZA 1PGNA 2XF8A 3QVXA 1XKQA 1DC5A 4KTVE 5TQVA 2HK7A 5COQA 2V6FA 3O4RA 1AXEA 1TA4A 3PLRA 3PXXA 1NXQA 2CD9A 1W73A 3LSYA 6ADHA 1MFZA 4XKJA 3QHAA 3WFIA 3W6ZA 1I36A 2DBVO 5F1OA 4BNGA 1Y81A 3AUTA 3AY3A 4R68A 1LSSA 4YT5A 3GMDA 1C0KA 3S2GA 4EUHA 1GZ4A 4CMHA 2DBZA 3FTPA 1GR0A 1IZ0A 1V35A 2G17A 1GZ6A 4WLVA 4YT2A 3D3WB 1Z7BA 1NVGA 5DOVA 4ZVVA 3W8EA 4BNHA 4DTIA 5ES3A 5KNLA 3BHJA 4YJGA 4FDAA 3JQDA 1J0XO 1SMKA 3BHIA 3D5QA 4WNCA 4F3YA 3ITDA 3VZQA 2FPGA 5TNXA 5FI5A 1UXKA 1PJTA 2YV3A 4IQGA 4GSLA 4NH4A 4AJHA 4CM1A 2GF2A 1ISIA 4XGKA 1KEPA 3O03A 1ADGA 1UP4A 5BSFA 4R69A 1EVIA 3UCFA 4JGBA 1DRWA 3T4XA 3FRJA 3GUCA 1FMCA 4E5NA 5IAAA 1UZMA 3KYBA 1SPXA 2OGUA 3E5MA 1EDOA 2WE8A 3GNTA 2BD0A 5HS4A 2Z5LA 3VVBA 1MC4A 2XXJA 3KBOA 4I9UA 2H1SA 2I67A 3E03A 4PGFA 4WLUA 3ROQA 4WJZA 4FSHA 4DMMA 3K8ZA 2IYOA 2NU6A 3FCOA 1YH3A 1QXSA 5JFOA 3AUUA 1K6IA 1NX6A 2BI7A 1HDGO 4DPMA 4AG3A 4WEOA 2I5PO 4CLDA 2OL4A 2ZQZA 1ZXLA 3PGXA 1MUUA 4DLAA 3W4JA 2GUGA 5CDSA 4XGIA 2F00A 5IN4A 5CG1A 4N54A 4N18A 1AHIA 1BTOA 3BA1A 1JKIA 3A9WA 1XWFA 3C1TA 3F6YA 4XIYA 5FEUA 5I9LA 1RJWA 2B5WA 1NPDA 5AVOA 1R0LA 1DLJA 2Y99A 3U49A 1WDMA 4HV4A 2EW8A 4FQ8A 4JJIA 3NV9A 2OOSA 1IHYA 4A5OA 5K6AA 1H9BA 4Q3AA 4J2OA 1DSSG 4RJTA 3INRA 5JAQA 3FN4A 3HN7A 2PGJA 3I52A 1T26A 1NASA 3ABIA 2VOJA 4K6FA 3LT2A 4BGVA 1R66A 1ZEJA 2D59A 4R01A 1FDTA 5EERA 1EQ2A 5I9MA 3DB2A 2I6TA 3WWZA 2FZEA 4J43A 2X1HA 1RPNA 1XEAA 1I3MA 5G4KB 2P9CA 3AJRA 4BV8A 4QUKA 1ADBA 5T8KA 4YBZA 3ZI0A 3SEFA 3IUPA 4K1LA 4DL9A 4ZRMA 1PSDA 5FFFA 2CUKA 4FPXA 1B14A 2FSVA 1WP4A 3PHGA 4P4GA 4LRSB 2VTDA 3ETEA 2ZB3A 5JLAA 3RFVA 4CM8B 1IULA 1KC1A 2I9PA 4AJLA 4MJLA 5TSDA 4J0EA 2NTNA 5JAIA 2X4GA 3PGJA 4YJHA 1RYDA 1WW8A 4OOFA 2BHLA 5EMHA 3GH3A 5T67A 4BNMA 3I9NA 1DOHA 1PGQA 4FS3A 1DHTA 4FC7A 2ZYDA 4GBJA 1SEPA 2X5KO 1GZ3A 1QR6A 3PWKA 2BFPA 1J5PA 4A0SA 2WM3A 4J3FA 4BNKA 2WMDA 4PLZA 1UH5A 4NHEA 1RYEA 1A7AA 4YRDA 2YQ4A 4CQMA 5A9RA 2NV6A 1TT7A 2HDHA 3JTMA 3G0OA 1ZCJA 4ALLA 4GL4A 1J49A 2AQKA 4PRLA 1U7HA 3Q6IA 4L4SA 1M2WA 3KEOA 4BO7A 3JQBC 3I9KA 4URFA 4OHUA 4WCFA 4XA8A 2Y66A 5COAA 4PLVA 4I9NA 2HSDA 3PYXA 4RVGA 2G76A 1JKFA 4Z0PA 4ZRNA 4O63O 3KB6A 4IIUA 4KZPA 3UXYA 1F0YA 4XJSA 4B4OA 1ZFNA 3ZWXA 1X14A 4L73A 1DIRA 1O9BA 1P1IA 1DEHA 3GK3A 1ZH8A 4EI2A 4BNLA 1TI7A 5L7TA 4IDAA 3F1LA 5L7YA 2Q4BA 1SZJG 4BO5A 5A5EA 1E7WA 1DJQA 1Q2XA 1U8XX 2FHSA 4QO7A 3ZHBA 4EZBA 4IS3A 2QZZA 2Q2QA 2VYVD 1I10A 3DDNA 1PTJA 3ZWVA 4FJ2A 1ZKMA 3TQHA 4IXTA 3PEFA 4YRAA 4G2NA 1WXDA 2EKPA 2PK3A 2IEBA 4BNVA 5G0TA 4DC1A 1I2ZA 2B36A 1GD1O 1H93A 5FYDA 1I01A 1M6HA 4CLXA 4E3ZA 2BFOA 1EBFA 3VDRA 3HUDA 8LDHA 1DFHA 2P91A 2VZ8A 1DFGA 3GGPA 4O0LA 4Q3BA 1H0KA 1YBMA 2HRBA 4QO8A 3QLJA 1ZK1A 3C85A 5ITWA 4CV1A 3V1YA 2C5EA 5DP2A 3HDYA 4YCAA 3EZYA 4PVDA 1K5HA 3ZGYA 1NVMB 1BW9A 2UVDA 3WICA 4BHTA 1LX6A 1Q7CA 2XXBA 2IXBA 5DN9A 4CJXA 2W2KA 4WLFA 1GDHA 4XDZA 1ISGA 3CTMA 1M67A 1KY5A 3LZ6A 3E9QA 4EW6A 2V6BA 3GDGA 3AUAA 4GX2A 5DP1A 2D0IA 2J5QA 2O3SA 2YW9A 4TQGA 3NEPX 1C1XA 2FSSA 4XYLA 2VHXA 4I5GA 4NJMA 1U5AA 3OQBA 3TNLA 3D4PA 1CDOA 1Q1NA 4FOOA 1H2BA 2PY6A 4YJDA 1ZMOA 3ROKA 5JC1A 1N5DA 4N7RA 2DPGA 4OQYA 1C0IA 1JQBA 3NJ4A 2HRZA 3U5TA 1I3LA 1VE9A 3Q0EA 5DT9A 1FDUA 1SCUA 3QQPA 1A5ZA 3PI7A 3MTGA 3DBHA 1T1SA 1ISFA 3DO5A 4LVCA 5ITVA 4FW8A 3ZNNA 1NVTA 1XR3A 1O5IA 2HK8A 3KHUA 1FXSA 3RWBA 4E0BA 3TOXA 4NFYA 3LF1A 1Z82A 4A73A 4A10A 3I4FA 4ALKA 1RWBA 1A7KA 2D4AA 1F8FA 4A7PA 1IPFA 3H5AA 1KYQA 4JLWA 3O38A 2WDZA 3OIGA 4WECA 1DXYA 1TEHA 2X9GA 4MIEA 4N5LA 4IGFA 4Q3DA 2GGSA 4M87A 5BNTA 3IUSA 4CL8A 1PJLA 3FWNA 3EZLA 2ZKLA 1KIFA 3DXFA 3JQ6A 4IJUA 4XWYA 3ZWBA 3L6DA 3QVSA 1N9GB 4BNFA 5HTOA 1G0OA 3WBBA 1R0KA 1VKNA 4L76A 4LCEA 4J91A 1AN9A 3LU1A 1UDBA 4PRKA 3VDQA 3WS7A 3H3FA 5KVCA 4INAA 4DRYA 3ZHZA 1CJCA 2PWZA 2YDYA 2EGHA 4D79A 2OP1A 4ZQEA 4M49A 4ZD6A 2WEKA 1MG0A 4W99A 1CIVA 1UZLA 3PPIA 4NBWA 4NK4A 4TWRA 3WMWA 5JMWA 1ZJZA 4B4UA 3PQDA 1MLDA 5J23A 2JD0A 3A28A 3IMFA 4RZHA 5BNFA 1WLYA 4GI2A 1QLHA 1C0PA 2O3RA 2QG4A 2GZ2A 4UUMA 2G0TA 3E5RA 4D42A 3ZNQA 1QYVA 2W4QA 3KUXA 3FPLA 3AY7A 5BSHA 4H15A 3KSUA 1JWAB 3DQPA 4R9RA 1GUYA 4FB5A 5EN4A 4IS2A 3OQ6A 4OXKA 5DF1A 1HETA 4XYBA 3U4DA 4DPLA 1NM5A 1RKXA 3U4IA 4G5HA 4OIMA 4BO0A 3GLQA 4RQTA 1LXCA 3AOGA 4JP3A 4KTTE 1YOVA 3HJAA 4P22A 2DKNA 4YQZA 5IDQA 1BHSA 3ADOA 4BNJA 4CMIB 4YDRA 4DQVA 5AXAA 2B0JA 1U2DA 4BKRA 3GAFA 4IZHA 2PKQO 4FCCA 1ZZEA 5IDXA 3OQ1A 1H6CA 2DTXA 1GPDG 1FF9A 5AQ1A 4ZA2A 3FBGA 3ZW9A 3WJ7A 4L0QA 4M55A 4BMSA 4IY1A 1MXFA 2GN6A 2LDBA 1UXJA 1J6UA 4MP8A 4NBTA 4RVHA 1ZSYA 2VHYA 3HWRA 4MIYA 2VNAA 3RI3A 4F6CA 4CLHA 4DMLA 1SOVA 2D5CA 5L53A 4KP7A 4CM4A 1XG5A 3BTVA 2Q2VA 3H9GA 3HB5X 3GGOA 3ZV5A 1DAPA 1XIVA 4CLOB 3ZV3A 1T25A 4BGUA 4EUEA 2WTBA 1P44A 4CR6A 1TB4A 1Z75A 4UEJA 4YB8A 4NMHA 2EKLA 2VT3A 4DIOA 1YKFA 1MA0A 1YOVB 4GWGA 1B7GO 4LVUA 4WEQA 2G5CA 4E5PA 3C8MA 1LA2A 5ENDA 1R4MB 4FBGA 4RDIA 5G2OA 3RU9A 1YXMA 4ZQHA 4MKZA 3IJPA 5IJZA 2B69A 1W4ZA 4NFHA 2YZ7A 4GVXA 3WGTA 3UW3A 4QX6A 4CODB 4A03A 1Q0HA 3S2IA 5JAZA 4HP8A 3EAGA 3K9QO 4IMRA 1ZK0A 3PHIA 3VH3A 1DB3A 2EW2A 3IP3A 5BSEA 4EGFA 1QV6A 3H6KA 5IFLA 3PFWO 5JY1A 3PIDA 4O6VA 4CMJA 3WYBA 2VN8A 5C7IO 2ZB7A 3E48A 5AYVA 3IDSA 4WCDA 3PP8A 2DVMA 1E3WA 3H9UA 3HZZA 4CQLB 1VL8A 2X8LA 3JD4A 4WNIA 4Z9FA 2Z1NA 1F17A 4NBRA 3HE3A 1EZ4A 3OECA 1YJ8A 4TSKA 3PWSA 4AICA 2CVQA 3F46A 4EBFA 4EYEA 3C3XA 4CM7A 2E4AA 3O8QB 2YDXA 3RUDA 1ENZA 2QHXA 2RIRA 4XEHA 2GN4A 4ID9A 1P9LA 1U8FO 3S2EA 3FSRA 1LEHA 4GVLA 4LCJA 5FI3A 3MJTA 4BO9A 1F14A 2RHRA 1JW9B 1GYPA 4OYRA 4D3DA 4DLLA 4BB5A 2IXAA 2W2LA 1TT5A 4D46A 3SVTA 4U6QA 4DQXA 4UUPA 3F9IA 4D3FA 4UVHA 1PJCA 1Q7BA 3EYWA 1U4OA 2O2SA 5JAMA 3JQFC 1H94A 3GUYA 3V5NA 1UXIA 2DBRA 1KVRA 2VZ9A 5EINA 3S1LA 1ONNA 4L75A 3DMTC 4CM3A 3K92A 4WE3A 4RPLA 5T57A 4RL6A 3LLSA 1LLUA 1E3JA 4S3MA 4YJHB 4BNXA 3DZHA 2PLAA 1E7YA 3GN1A 3OEYA 1BVRA 2D2IA 2FPPA 4JBHA 3UCXA 5B4TA 2DFVA 4NU5A 4DVJA 2RAFA 1WMBA 2VYND 5TJHA 3RUFA 4FC6A 3WTCA 3ASUA 1G6KA 1T2EA 4GGPA 2EG9A 4NZ9A 4BQRA 2AE2A 5U4QA 4E4YA 1Y5MA 3ZWWA 3H4VA 3KETA 5GZ3A 4RO0A 2DUWA 4RVUA 4FOSA 4HX5A 1OMOA 4DYDA 3JD0A 3EY4A 3RC7A 2BGLA 4Y67A 3BTUA 3L4SO 4IJWA 3AI3A 1NQAO 2A92A 2ZB8A 2PD6A 4RPKA 3QRWA 3SXPA 4CMBA 3QW2A 1BGVA 4Z0HO 2NUAA 1E5LA 4Z9YA 1YONA 4OKNA 4RVDA 2H5LA 1OOEA 2NACA 3DTYA 5TS3A 4HFNA 5I7FA 3KYCA 1MC5A 1LC0A 5TGDA 4EEZA 4EJ6A 2Q45A 4C7JA 3E18A 4O5OA 3D3EA 3WGYA 4R9SA 1I5RA 1E1LA 5L3ZA 3WFJA 2B37A 1QYDA 4NR0A 3DBLA 4GSKA 5KOIA 2ILTA 1I30A 1LDYA 4JIGA 3JCZA 4AJOA 2P4QA 1EEHA 1OI7A 1VJ1A 3B1KA 3RJ5A 3FNHA 5BR7A 5I8ZA 2Y1FA 4NDNE 2FR8A 1EVYA 1K6JA 1FDWA 3EC7A 4B7CA 4CLEA 2Q2WA 1WZIA 3RASA 4R54A 3UFXA 4AJKA 1B16A 1B26A 2CVOA 4YYZA 1XGKA 1EVZA 2JJYA 4TRMA 3GG9A 4JQCA 3TFOA 1VJTA 3GEDA 1PZEA 4CQMD 4U7WA 3FR8A 3I9MA 4YQYA 1PJ3A 4YXFA 1LDEA 3L9XA 4HBGA 2YFQA 2QRJA 3IQDB 3UUWA 4F45A 5L95A 2J3JA 2RH8A 3ONDA 4MVJF 5EESA 3GNQA 1C3VA 4D43A 4ZJUA 2OMEA 3ADPA 2B4RO 5L40A 4D0SA 3RBVA 4M54A 4D7AA 1HL3A 3CZRA 3VC7A 3MWEB 3IJRA 3WYEA 3ZU2A 1NQTA 1U7TA 1Y8QB 3OMLA 3GZNB 3QY9A 5JYEA 1U3TA 2BH9A 2JAPA 3CKYA 4U5QA 1YDEA 1LUAA 1LTHR 1ZSVA 4J49A 3KVOA 4R4JA 4YACA 3X2EA 2WYVA 4JN6B 5U1PA 1P45A 3CEAA 1O8CA 1GTMA 2RBEA 2W2LD 4DYVA 1P0CA 2VUUA 4ND2A 1EFKA 1JLLA 1YB5A 4HWKA 5DBIA 1QV7A 2X58A 3WR5A 1BDBA 4R16A 2ZB4A 4NJOA 3WJAA 3U3XA 3RU7A 2IE0A 3AU9A 4XCVA 4HFRA 2AQHA 1QG6A 3TZ6A 3VTZA 3E8XA 2NTJA 4BO2A 2X7HA 5C37A 2YYYA 1QSGA 1R37A 5AXCA 1HDOA 2X0NA 1Z45A 3DAGA 3DHEA 5H82A 3ZU4A 4TKLA 2ZCVA 1O94A 3BZUA 1DDOA 4AJIA 2VT2A 4D41A 4I5DA 3DMYA 1DC4A 1W8DA 3FHLA 1ISJA 3PYMA 4RLHA 2Q46A 2YY7A 3GA0A 3VPXA 1CETA 4E31A 1SBYA 2C82A 5A3JA 1Z74A 5FF9A 4PLTA 3W4KA 2UUPA 1XSEA 3AW9A 2EWMA 4GX0A 3PK0A 5A9SB 5JO9A 2JAHA 1WAMA 3ENKA 3MEQA 4FFRA 4A27A 4RPJA 3NT2A 3ZU5A 2D3TA 5JCXA 3A14A 3ZN2A 4FFMA 2XPCA 3GDOA 3ULKA 1I33A 2FOIA 4CUZA 1PZHA 4J4BA 2IEDA 2AE1A 3CZMA 5KIAA 4UREA 2IYPA 2JKVA 3RVDA 2NQ8A 4J9VA 2EP5A 2O4CA 4HNHA 3NTRA 3WGIA 1BXGA 2SCUA 1PZGA 1ZIDA 2WSBA 3JQGB 4N5NA 4RGBA 4ESOA 1CQJA 3L6EA 3ZWOA 4B8WA 3QWIA 2VCYA 3JV7A 4GX5A 2UDPA 3GVCA 5T6BA 3GPDG 1PGJA 2YV1A 3RC1A 3OIDA 3DMTA 2RHCA 3WGGA 1LNQA 4IDGA 1YDWA 4I1IA 2W8ZA 2AXQA 1VC2A 4JJGA 4J0FA 5G0SA 3PZRA 2NVBA 2I3AA 5G0WA 3ZHYA 1E77A 2AA3A 2PKRA 1NQOA 1OAAA 3C7AA 1YL6A 3SC6A 4CV3A 1PL7A 2A4KA 4GKVA 1PQUA 3E82A 2DU8A 5TT1A 2FWMX 2Q3EA 5T5QA 1H2HA 4W82A 1X13A 3ZCXA 5F5NA 1DFIA 1HZJA 4BOYA 3BMCB 4I08A 4EDFA 1LLCA 5GZ6A 5KJEA 3GOHA 4PN3A 3OBBA 3ZNPA 4CLRA 4ALJA 4MVJP 3P19A 4ZN6A 3C24A 2GSDA 4TMFA 1E3LA 3DZFA 3H2ZA 1N1EA 3PQFA 2UUOA 1NWHA 3D4NA 4CMEC 4NIMA 4YA6A 5CDTA 1PJ2A 1WMAA 1GUZA 1X7HA 1QLJA 4LGVA 2PH3A 4WASA 4FFLA 5DULA 2NVUA 2Y0CA 1P74A 3BIOA 3JQCA 3NDIA 4PG7A 5A04A 4RPGA 3WOHA 4J7CA 5BT9A 1YWGO 5KJ6A 2PKQP 1LSUA 3PWZA 3MTJA 4J16A 1OZAA 5CP8A 2ZJ0A 4E12A 1LSJA 5THKA 1TXGA 3AOEA 2I66A 2IDZA 4Y9DA 4CM8A 3PTZA 1PQPA 4TROA 4XQ9A 4E5KA 1D8AA 1PR3A 2W2KB 3W8DA 1Z7EA 3NUGA 5KVQA 4E30A 4NQZA 4OL9A 4PCVA 3NYWA 1QKIA 1KVQA 1IYZA 2YFHA 2BLLA 4IM7A 3DOOA 1HT0A 3KXDA 4JNKA 3OJ0A 5DOZA 4LMRA 3UH1A 5B4VA 2C0CA 1WDKA 3ITKA 5FWNA 2CDAA 3GQVA 3SJUA 1CYDA 2C2YA 1Y6JA 1VPDA 4HKTA 1GCUA 1ZVMA 3E9NA 1BRMA 2P9EA 4FIZA 4YJFA 5A9TA 3ETGA 3ZDFA 4YJGB 3ZZNA 3B1JA 4BO8A 1PS9A 4CMKA 1VM6A 3JYNA 1N9GA 1YJQA 1LRLA 1LSOA 4DC0A 3ZV6A 1D7OA 3Q11A 2Q50A 4MINA 4Z0TA 4OH1A 1OFGA 2BGKA 4R5MA 3CH6A 1U3VA 2O23A 3NAQA 2GYYA 2VHWA 4RORA 2QYSA 3Q9UA 2VUTA 1T4DA 2WWRA 4IUYA 1I32A 1EUZA 3BMOA 4GAEA 4K6CA 3U0BA 2Q1TA 5JPIA 1DIHA 3UCEA 5C7OO 3P5SA 2CF6A 1HDYA 5DNAA 2VWQA 1PZFA 3RFTA 2ZTVA 1JN0A 3DTTA 3PQEA 4PLWA 4XYMA 4BNWA 5G4LA 4CV0A 4BNUA 1LDGA 5JDIA 2D5AA 4W9NA 1RM0A 4ZQBA 2DPHA 1T2DA 3I1JA 1XDWA 2CNBA 1E92A 2Y68A 3Q2KA 2NM0A 1HXHA 4BKPA 1ARZA 2CMDA 2GRAA 3Q2IA 4E5MA 1BDMA 3GEGA 1LI4A 1B3RA 1XU7A 1BWSA 2Z95A 2AG5A 4KUGA 4E2YA 1SEVA 4JJFA 3L0DA 4X54A 5L45A 5JDIC 5TX7A 3GHHA 3S2FA 1KETA 2JD2A 2D1YA 1DIAA 3KRTA 4PG6A 2VRBA 3AI2A 5L4NA 3WYCA 4L9RA 5LDGA 1QYWA 1Y8RA 2DFDA 4W7IA 2VYVA 5JSFA 1PJSA 3SJ7A 5IG2A 2JFFA 3F1KA 1P1FA 1IUKA 1E0DA 1Z6ZA 1NFFA 3M2PA 4YTEA 4PFJA 1WDLA 3TL3A 2OBNA 4KUHA 2J5RA 3IS3A 3RCBA 4B7XA 2H6EA 3A06A 2NU7A 1HDRA 2PR2A 2X5JO 4QEDA 4GPD1 4Q9NA 3TJRA 4IDBA 1HE5A 1NYTA 1BXKA 4NBUA 3UGKA 2PD4A 1IZ9A 2Y67A 3UF0A 1YQDA 3LT1A 3TPCA 2VYNA 4J7UA 4HNGA 2HMVA 3STHA 4BB6A 4ND5A 1E7MA 4YT4A 1W0CA 1NR7A 3KSZO 2P68A 5CHEA 1CEQA 1YE3A 3VAZA 1Y7TA 1ML3A 4I5FA 3EK2A 1YBAA 1PJ4A 3FWZA 5F1PA 3QV1A 1V8BA 1VKOA 3RROA 4LRTB 1JVBA 8ADHA 1A27A 4MVJG 3WIEA 4TRJA 4TRNA 3TZQA 1KERA 4M8SA 2EERA 2OORA 4XRRA 4UVDA 2P5UA 3L4BA 4RV9A 1Y8QA 1PWZA 1EUCA 2G82A 3IP1A 4JX8A 3WNQA 2Q1SA 3EUWA 3WTBA 2FY8A 2C7VA 3NGLA 1NPTO 4LSWA 4GLOA 1XQ1A 1R0SA 2EKQA 1ISMA 1HDXA 3HG7A 2VOEA 3FD8A 5HWSA 1WNTA 1ISHA 1BVUA 2E49A 4TZKA 4B3JA 2CFCA 3B6ZA 3RUEA 3CMCO 4KOAA 5A3VA 3GF4A 4B4VA 5L4SA 1VRWA 3L4BC 4AJ4A 2AHRA 2JL1A 2Y1OA 3I9LA 5JNLA 3OSUA 4UVGA 4Z9XA 1KBZA 1RM3A 3ASVA 2TMDA 1OBFO 1WVGA 5DCYA 3JQFA 4RZIA 5KCZA 1RM4A 1Y9AA 4M1QA 4XZ3A 3INGA 3LT4A 4MVJI 1A4UA 2EIHA 1GV1A 4RVSA 3TZKA 3H65A 4PVCA 4E2WA 5GZ1A 3FI9A 5HBRA 4TZTA 4BKQA 2BGMA 4HADA 3DC2A 3PHJA 3HHPA 3CSDA 3ON5A 4QT0A 1TLTA 1T4BA 2X86A 1AE1A 4DPKA 1GYQA 3AI1A 3HB4X 4RPHA 4QTZA 2VHVA 5B4UA 4FD3A 3QP9A 4UUNA 1ZSNA 5K6AC 3RQSA 4D0RA 4NU6A 4Q3EA 4CV2A 5C5IA 1C14A 3ICCA 4IJKA 3TZCA 1Z73A 3M2TA 4RDHA 3FF4A 3JQ9C 2EJVA 3RJ9A 1X0XA 1EMDA 1ZEMA 1N7GA 4AJNA 4Y8VA 5I9NA 4Y6PA 1KS9A 5H81A 5JE8A 2WYWA 1I3KA 3OHSX 3DHYA 5C7LO 1IPEA 5A05A 1I2CA 2PD3A 1IE3A 1XYGA 2C7GA 4U0JA 5TRTA 3KZVA 3HFGA 3I23A 3JQAD 1UDAA 1A4IA 4LISA 2ZQYA 5ILGA 2O7QA 5IZ4A 3VH2A 3GVHA 1E7RA 5IZCA 3W8FA 2BI8A 3PHLA 2W90A 3AWDA 1B0AA 1XLTA 4KWHA 3C7DB 3VZPA 4PZDA 1R4MA 1HRDA 2IRWA 2JCXA 3EVTA 4OMUA 5GMOA 1VSUA 1D1SA 2I3GA 3H8VA 4YAEA 1GV0A 4OM8A 3WQQA 5KJCA 4KWIA 1FDVA 4II2A 1K3TA 2JHFA 2UV8A 2DT5A 1UJMA 4CUJA 3NT5A 3WBFA 1E1NA 1M75A 4A26A 3ZWMA 3M1AA 1KC3A 2YHUA 1HYEA 3DBLB 1R4NA 3DZIA 5CG2A 1HKUA 1CWUA 3IOYA 3GDFA 1MXHA 3QVTA 2AEJA 5DZSA 4RF4A 1B3BA 2ZATA 1HEUA 2O50A 3P7MA 3SLKA 1RM5A 2G1UA 2B35A 3F4BA 4NBVA 5ICSA 3FNGA 2H63A 2Y1GA 1DBVO 1GCOA 2I76A 3I3OA 4U8GA 4CPDA 1N92A 1NR1A 2Y1DA 5JCJD 3U9LA 4QSMA 4IDCA 2JD1A 4DIBA 3K5PA 1N7HA 2VTEA 3PFFA 4EITA 1JU9A 6LDHA 2Q99A 3DBHB 5CPBA 2DC1A 2VRCA 3FNFA 5CAEA 2HLPA 2UYYA 1DRVA 2QQ5A 1KVSA 4J1TA 1QMGA 2PTGA 2O3QA 3TRIA 4A2CA 3GFBA 2OFPA 4WGGA 1HSOA 2HKIA 1V6AA 4FN4A 1IOLA 3LC7O 1CF2O 4G65A 1K89A 1XCBA 2DTDA 3HN2A 1JVSA 2PFGA 1T2CA 3AY6A 2BFMA 1DPGA 1GEGA 3OIFA 4R41A 1ENOA 1JKJA 2VWHA 2CZCA 2FR0A 3G1TA 3AK4A 3MJSA 1SNYA 4M86A 1ADCA 2EEZA 3KSDO 3QA9A 1V3UA 1DIGA 4FGSA 3H9EO 3WQSB 1QYXA 4OSPA 4AJJA 1I0ZA 2YJZA 3F5SA 3ANMA 3NJ8A 3KLPX 1K6XA 4FFNA 4CMGA 1CERA 1GAEO 1EFLA 4RF5A 1SAYA 3OA0A 5IDYA 1A9ZA 3O9ZA 4XRGA 1ADFA 4GMFA 4J7XA 1EK5A 2XAAA 5CDYA 1HWYA 3K30A 3DONA 4XR4A 5LDHA 1I3NA 1U3WA 4Y6SA 2WE7A 2HMWA 4XYGA 3OETA 5TIIA 2I99A 4MVJH 2HMUA 2CY0A 2EGGA 3GZNA 3WGOA 1JTVA 4RQUA 5K0ZA 1O0SA 2YV2A 3WG9A 4DXHA 4B7UA 1SB9A 4YEDA 3HSKA 3MJEA 1S6YA 1IL0A 1J4AA 2Q1WA 7MDHA 4NPCA 1IY8A 4QFCA 4D45A 2I65A 1E1MA 1Q7GA 2AQIA 1HYGA 2ZYGA 1QRRA 4RF3A 3HFSA 1E6WA
chains in the Genus database with same CATH superfamily
4LCBA 4UHHA 2F3RA 4EMSA 2UZ3A 4ARBA 2WWXA 1D0SA 5IJXA 4AXBA 4QGBA 5A3QA 5DWQA 1Z25A 4G85A 4AJ1A 4H6XA 3UIEA 5JEDA 2UZ1A 4REOA 4UNQA 3R0JA 2PVCA 5DE3A 1ND5A 3E7DA 4DLKA 3QBJA 3N3BC 1EX7A 2QTVB 4P8RA 4DWVA 1SOWA 4UKDA 4KBGA 2OO5C 2XOXA 2FZGA 5EQJB 1D4OA 5EAIA 3R6DA 4P86A 3ZXUB 3GR6A 1U8AA 2F1HA 1Z0AA 3QLVC 2NZXA 4HDMB 4OQLA 1PLLA 4PSVA 1DBPA 2QMUA 4BKUA 4ZU3A 1XTZA 4EBBA 4IFTA 1JB9A 4ABYA 3EWSA 2F1KA 3DKVA 1YAHA 5FOSA 4N39A 3C5CA 2P5SA 5DH9A 1KDPA 2PO7A 1DIOB 2DMRA 3GLIA 1SHLA 2D0OB 1NRJB 2VNHA 5DCWA 5KWJA 3SHWA 5CBKA 1C1DB 1SKMA 1UK8A 3FYCA 3R77A 4R1LA 1MDFA 2X0KA 2CNNA 1OZHA 3KQUA 1AC5A 1EAMA 5DM0A 5B36A 2QXUA 3GFFA 4R2LA 2XB4A 3AUSA 4LOHA 3QU2A 1SRQA 1CZLA 3ZY4A 2WWWA 3O2JA 1NVBA 3PWTA 4TTAA 3DTVD 4I66A 2M2IA 4AAYA 5CEJA 3QX8A 2YQ5A 2IZ1A 3SQXA 3JD3A 4F2WA 4JI7B 3JXEA 5JCJA 2CNKA 3FIUA 1QGYA 3FNQA 2REXB 2YJ3A 3R3UA 1E1YA 4BY9E 4Q4JA 5JATA 3IKTA 1Y3HA 4AUKA 4H35A 3VR3D 5BQOA 4CDRA 5LQUA 4KMSA 2H92A 3HO6A 4P1ZA 2ZJAA 2X1MA 3U17A 2AG8A 1ZD3A 4PYLA 1RLJA 3ZVKA 3U7HB 3AKYA 2WA2A 1U0EA 1RAEA 2BCGY 3WNZA 1JR6A 4ZYWA 3VZSA 1QZUA 3QVLA 3AV0B 3OM9A 1PLKA 2HLDD 2I4MA 2NO0A 1R6VA 5DTQA 3ZDXB 1II0A 2C59A 4OGLA 3P8ZA 4E2ZA 1BXGB 4G4GA 4PC7A 3LECA 4ZI2A 3ACCA 2E37A 5AM1A 5JAOA 4C20A 4FHFA 4XYEA 4ZARA 4ND6A 2MYPA 3V8MA 4D8XA 2CDCA 4YDQA 2Y1XA 4RFVA 4LZPA 1E3WB 2PDAA 4JT8A 1RIFA 1C1YA 1ZMRA 5C3MA 1D1QA 1K5DA 2Y6VA 5CYGA 4CF7A 2P78A 4TLDA 1NZDA 3FDJA 4E5SA 4CUKA 2CSUA 1I3OA 2AFHB 3AONB 4WBSA 1ULSA 3VC1A 1TZCA 3BYZA 1NKVA 4ZGGA 5J2TA 3P94A 1NBOA 2NG1A 1QGED 4PX3A 5A6SB 4F5DA 2VSOA 1DNPA 3Q12A 4LWZA 4WCFC 5DX8A 1T8UA 3K2IA 4RLSA 4WY2A 4FYVA 2NU8A 4IRXA 3ZHXA 4K2HA 3K94A 5EIBD 1E66A 2OZVA 2GN9A 3ENNA 5E6UA 2ERXA 1UJ6A 3IX7A 4LRXA 1M74A 4OHZA 2HX1A 3U3RA 3BWDD 2J3IA 2R6CA 3HKCA 4JP2A 4YMUA 2CHVA 3OC0A 1Z35A 2OG1A 4JEHA 4P7FA 2XB9A 2DQKA 1NJ6A 3KEGA 4KFRA 5L51A 2B4YA 1GUFA 4MUAA 5JU6A 4Y1GA 1DEKA 1F2VA 1S7CA 3SGLA 3K15A 3PR2B 1ZDMA 3ANSA 3E3MA 4RQAA 3UZUA 5LQAA 4Q7MB 3UOAB 2CNDA 1MRZA 4MQEA 5B1HA 3RG2A 3NBAA 4CKWB 3LC1O 3BF8A 2GN1A 1BMTA 3DBVO 1DXQA 1Y9JA 3GFVA 2P4SA 4ND8B 5FYQA 4DR2B 3U7FB 5BQXA 2A94A 2WWFA 1TZ2A 3DE3X 3LWBA 4Y1RA 4EHAA 2HRCA 4GBGA 4EHHA 2O4UX 4LHYA 2E4WA 2YS7A 3M6MD 3KEQA 4BMNA 3QY0A 4PSAA 1A7JA 2VBFA 4PLCA 2H1HA 4NCAA 4GZLA 1AJEA 2OLEA 4B34A 4P4SA 1EFRA 2NVUB 5C1OA 2EJWA 4CG2A 1PEDA 5IMBA 1DARA 1GDTA 3JQ7A 4RIFA 5E4YA 2BZGA 4UEWA 1E61A 1Z06A 4GXQA 4ZT6A 3TQCA 4JL6A 1NR5A 1NHGA 3ZEIA 3ZCTA 1QPZA 2NAPA 5I7EA 1TA0A 2Q21A 1QQ7A 4IDDA 3FDXA 2XE7A 2QSJA 1LBEA 4URWR 4L4RA 2ZREA 5CK5A 3UV3A 4BMDA 1IWBB 1Y9ZA 4YJ3A 1B8UA 4DUZB 3H1BA 2P3QA 3UHJA 3BL6A 2PV7A 4U2CA 4DQUA 1SXQA 1N2SA 4YAGA 3BRSA 4Q93A 4EHLA 1H8EA 4N8EA 1IDOA 2GZHA 2OQVA 4LW8A 1RC0A 4NI5A 4A91A 1LJ8A 2I7CA 5MDHA 3CVWA 4KR7A 1EE1A 5LLSA 1AH2A 3MERA 4LNHA 2QE7D 3EGXB 3D1LA 4QDOA 1YL7A 4D5EA 3EF0A 5KVSA 1HNNA 2HK9A 4MV3A 4DA0A 5B12A 5ENVA 4BFCA 1N4AA 4BVAA 5IT5A 3IAEA 4QGFA 3IPLA 1TC1A 2CJWB 3KJIA 4KWTA 1K08A 8MHTA 3K09C 4QJ3A 4PZAA 1OH5A 3IKJA 4RCZA 3VNVA 2WV9A 4MKIA 4X94A 1FOEB 5CVVA 2FETA 1GGEA 3JAMA 2F64A 5ERYA 2FEXA 5DBFA 5JD4A 3WL5A 3LGAA 5K03A 3NP9A 2X3FA 1CE8A 2XW6A 4KAJA 4M1ZA 4NE7A 2QN9A 3PIIA 5BN3A 2OA0A 4IUCS 1RE1A 1Z62A 4AX4A 1XYVA 4BKOA 3L8DA 1V5WA 4FJ1A 4QUJA 1R0CA 5BQFA 1TTTA 5F9MA 5A6VA 2J46A 3E05A 1C1HA 1HQCA 5A0TA 5T4BA 2J6IA 2HRQA 2WT8A 1NW9B 4JVSB 4YRLA 4IRMA 2FFBA 2LDXA 3L0YA 4BCBA 3PPXA 1HLDA 4Q1AA 2JFGA 5ALSA 2V4MA 4LK3A 4NV0A 1KTVA 1ZAYA 1L7QA 3BTSA 3L7AA 1SUAA 1B41A 4C07A 3G9XA 2QX7A 3FOAA 1JT2A 4CFYA 2VPXA 3GC6A 3LHFA 1J9EA 4I50B 5MGNA 4N5IX 5AJWA 1L1FA 3R4VA 3X2FA 3MLEA 4EHIA 4DA6A 2P2SA 1E7QA 5DN6A 1NWCA 5I9SA 3T9AA 4IJVA 1HF3A 1Z38A 4HVCA 1QTIA 1MH1A 5EMJA 1O89A 1QHFA 2BGNA 4EPWA 2DLDA 1VSVA 3TSCA 4XTCS 4DE5A 4RCYA 3A32A 4QXOA 1W5AA 1U11A 2FSVC 2PZMA 2IS2A 2DBYA 4GX1A 3CVVA 1ZNQO 2AFRA 3EA5A 5TF0A 4E09A 1COZA 3Q3IA 1EE2A 4OM7A 2DXIA 2PAAA 4L5IA 3ROPA 4F9GA 3DBRB 3E15A 3I9OA 1WCXA 4XJXA 5HM8A 2WTMA 3N1UA 5KWSA 1R2QA 4PYRA 5CLHA 4D8YA 5JANA 1JJBA 3Q3VA 4GVPA 4XJTA 3U6BA 1NAHA 2IV3A 4HB0A 2MT9A 1PU2A 4CLOA 2HNKA 3WGQA 5IXSA 3MJHA 1B8OA 3N74A 3P0JA 4MS4B 4OMFG 3OJOA 2Y8EA 4YCMA 4KXMA 4RBNA 3T0FA 3UPDA 1UWKA 3ORSA 4NZOA 4BFZA 1U5CA 1HKHA 1ZD4A 2J8ZA 2GYWA 3QX9A 7MHTA 3U4HA 1G8FA 1VHDA 1NDQA 5JCPA 5EP1A 3U3OA 4QWMA 1JLSA 1ZITA 3GB9A 1YQUA 1D4FA 3WIDA 1G5QA 1SCQA 3O26A 4EO9A 1DL5A 5E6UB 4AF6A 2QTBA 3IUYA 3FNEA 1L5RA 2R1ZA 1VL6A 5H0IA 4F93B 1OXTA 4OA8A 5CD9A 1L4BA 1L5GB 1RRCA 2GO1A 1QUEA 2QL7A 1O94D 3L7MA 2OC4A 4V0OA 4V0QA 2PGOA 3IIIA 4GWLA 4Z4IA 1XQVA 3F2VA 3GCDA 3O4HA 1O97D 1KARA 3NH9A 4C6TA 4XARA 3ED5A 3HYCA 2XODA 3PB3A 2VDJA 1V8DA 1NKTA 1NIPA 3UB4A 5JAUA 2QI9F 5AKZA 3SJAA 2I1WA 4PC6A 4RIEA 3HCWA 1P6XA 1A8PA 3HJCA 4GOKA 1CD5A 3ZHRA 5D85A 2QD5A 2O8BB 3NVMB 1FXWF 4GKBA 2IC5A 3SSOA 4YDHB 1AS2A 4EY5A 4MO2A 4C4XA 2BFAA 3DHVA 5H16A 4EYOA 1MFPA 2VQDA 3QX7A 4TLLB 1U2ZA 3HCFA 1YVEI 4FCWA 4NG5A 4BEJA 4A15A 2PX3A 5HF5A 1VYVA 4FFSA 2GCIA 1HFWA 2VJAA 2XB8A 2GZDA 3SBOA 2WD9A 3NWJA 5IARA 3ZJ4A 4DUPA 2F2TA 3EY9A 1A96A 3D54D 3EDQA 2O3UA 2EZTA 4TT3A 2MSCB 5LP6C 2V9ZA 4MJXA 4YRNA 1VCNA 2V7QD 4JJAA 5FHRA 2AEFA 3OJFA 1TTPB 3GZ4A 3A7EA 3NAMA 2IH5A 3DXYA 4NLLA 4AKHA 1IXKA 4KZKA 1V3VA 2GTHA 4CM4B 2XDAA 3H75A 1W5EA 1I4LD 2F90A 3LFTA 2PYIA 4OY3A 2QTZA 4ZOAA 3JZMA 4MVJA 1OFHA 1SUSA 2J3HA 4GMDA 4D5GA 1XPJA 1O95A 2GNAA 1QHSA 1BXRA 1JR3D 2YNMC 5KTRA 3ZV4A 3AM1A 3GW8A 4MCJA 1AZSC 4JFRA 3DL4A 2Q27A 1MB3A 4DCPA 1YS4A 2QW8A 5CU7A 1R8XA 3IESA 1VPWA 1G3MA 1T3ZA 4Z3KA 4B0OA 1HGXA 2Z30A 3L05A 3PJGA 3SQMA 4GI3A 1Y6QA 3R5SA 1IQPA 2MTBA 3PLAE 1CX9B 1R9NA 3C87A 4M8KA 3BZWA 3K7EA 3R3SA 4MUIA 2G08A 5JYDA 3JQEA 5IWAB 1KU0A 1YR6A 1EWTA 2D0PB 4L85A 1KMHA 2DUMA 3PNMA 1Q74A 3W6PA 3WB9A 5F3WB 1KHTA 3D02A 3AUJB 4RADA 1ZIXA 1IN4A 3LQ4A 3NTLA 4PGGA 1RS0A 1TIPA 5CD1A 3K6SA 1LVGA 1GFWA 1HG1A 4JYAB 1F38A 2F6RA 4HAUA 1BZYA 3HJNA 4HD8A 5I5GA 3RLFA 3KQKA 1YR8A 2QX6A 3QUCA 4MVJD 5I8WA 2IDMA 2HU2A 1EX9A 4FE3A 4QUDA 5HS6A 4OJTA 4H1TA 4WPGA 3LPDA 4FZ5A 3QOWA 4MYHA 5B1SA 4CCAA 4JMPA 5IZCC 3IHTA 1DGQA 1P9WA 1R8JA 2G9QA 2HHLA 3JVEA 1XXLA 4P3OA 4WXHA 1PKXA 2PKEA 4YDSA 3VV3A 1YB1A 1PL6A 1NBME 4DV1B 1JG6A 3E9ZA 1QRSA 1QF7A 4TTIA 1XVAA 3KDAA 2X7JA 1HFJA 3KU1A 2QJFA 3HR8A 1U3CA 4KXNA 4WLEA 3VR2D 2FW1A 3GCZA 4RANA 3TW8B 4X6LA 4NS4A 3O1JC 5HIAA 2Z1MA 2ZAIA 1Y7LA 1KH3A 1RLUA 3F6RA 4QIHA 4US0R 2WOOA 2RJNA 2JKYA 5KTKA 4K9KA 2FZCA 3CXRA 3BWVA 4RMGA 4KIJA 1NNUA 1XQYA 2QSUA 3R44A 3EZFA 3HQ4O 2Z9DA 5C5CA 1KEWA 4EFDA 1DI0A 3DDHA 4XUDA 1LJUA 3EZ7A 3GVXA 1YS7A 4MW5A 2BC9A 3TOVA 2FPIA 3B51X 1U1CA 2PBLA 3I28A 2WNIA 5AW3A 5JXGA 2MSDB 3EVNA 4L3WA 1EVLA 3CUKA 5A5GA 2V6MA 1BD4A 1M54A 5CBPA 1KO4A 4RY8A 3ZNOA 5ESWA 2XTNA 4LRUA 1KMQA 1ITZA 4MV6A 5U9CA 1MN6A 3HKCB 1J24A 3W78A 1HE2A 3CN9A 1P5FA 1WXXA 2V65A 3ECAA 4EFLA 3MJCA 1ENYA 4MLDA 3K5IA 2ALJA 4MVJM 1DT5A 3V1UA 5CT9A 2OPHA 4CMAA 4LHVA 4Q9LA 1YL5A 5K8TA 4IIGA 4WBNF 2EJCA 1RYHA 3QPCA 4KVAA 1KI6A 1ZWLA 5B58C 3MTAA 5BVGB 5M04A 4ZVLA 3K73O 1TFRA 3V7YA 2QTCA 3BSYA 3ZE2B 2VYQA 4OJYA 3ZK7A 3P9ZA 1F12A 3H3JA 3H42B 1MAUA 4B3MB 4LXIA 2NWQA 3WYDA 2YX1A 1CUVA 3DKIA 4AWAA 2DRIA 5EHXA 1T1IA 5CA1B 4JJKA 1UT8A 3EVFA 2LE0A 2CGEA 4MRNA 3K9WA 1NW5A 2FFJA 2PXAA 2W98A 1YI1A 1QORA 2G80A 3R5HA 3K2BA 4KI7A 2HSWA 5BNZA 3UB3A 6CHYA 3IEVA 3CNBA 4F4FA 2W6QA 3BX1A 5EWJA 3P2YA 1U2RA 1USUA 1AB5A 1NW3A 2QZJA 2FRDA 1FYEA 4MJ3A 1XVUA 1DC6A 3ZY3A 5F7OA 4CKBA 2R62A 4ML3A 2PGNA 2IZ7A 4CHTA 3A1FA 5T4EA 2Y1CA 4BV9A 1NRIA 2WF5A 4MWDA 4FFPA 2YVKA 1UP7A 3P26A 4HWGA 4IKOA 4YRGA 3AM5A 2JBHA 2P9QA 3BMNA 4BIIA 2AUMA 2NZ8A 3FKSD 5JAHA 2C99A 3A4VA 4B3FX 4DIEA 4DBZA 2FZ5A 3FJ1A 3AIOA 2C2ZA 1DZIA 1D3AA 3TCXB 4B6GA 2VJBA 1S2MA 3BIFA 4PXAA 4PRYA 1UXGA 3N5CA 2C4UA 4N03A 4E70A 2VATA 4BUZA 1R7RA 3KAKA 3T9CA 1HE3A 1JXMA 1KJJA 3B3QA 1L1RA 1S01A 2BKAA 4NJMB 3FZQA 3GPBA 1C9JA 1PS8A 2WICA 1KP9A 1XRNA 2F1RA 3QLVA 1VLMA 5H83A 3SEQA 5DBHX 4K5QA 3HN6A 3P4XA 5H02A 2BFBB 2IZZA 3KJFA 5BPHA 5LJIA 4HCJA 2ZYIA 4LF7B 2ERYA 5DRTA 4YWJA 4BP9A 1TJ5A 3AEQA 3W5AA 2C7OA 4EI7A 2PUVA 3WMXA 1YMQA 4OQXA 4RMJA 2LRHA 1LPPA 3FPBA 4KQ9A 4IMJB 2HH9A 3DWFA 2QX4A 1L7DA 5EQDA 2IBSA 4RC9A 4B3GA 3RU3A 1HK7A 4D9HA 2XYQA 4IVQA 4Z1MD 4G8DA 2VTBA 2ZI9A 1BE6A 1GEEA 5AXBA 1E6EA 1M1XB 1E0AA 1K66A 3H9JA 2I7TA 2G9VA 3O4FA 2LIVA 3C97A 3K0BA 4BTLA 3LSTA 5FWDA 3P96A 1JWLA 1EIWA 2PGAA 3B70A 4XUEA 3SC3A 2I7VA 1MP0A 2F8LA 2V6GA 3VR6A 4GOJA 5ER6A 5KTNA 4MH0R 5KTMA 2WPNA 3KT6A 4ZHSA 1ZW6A 2AXEA 3OZRA 3C7CB 3Q1LA 4L02A 2GKGA 1FTQA 1R3UA 4YH1A 1OTHA 4J7AA 5CEEA 4ALIA 4I19A 4O0MA 4CM9D 1MX3A 1OHHA 3P9IA 4IO0A 1EGVB 3TXAA 1BSVA 2RGAA 2JAUA 2WHRA 3FOBA 2VDMB 3OLVA 4WXMA 2JI6A 5TQ0B 3VHQA 2E1PA 2OV8A 4LGCA 3AERA 3B60A 2CV1A 3I2YX 2JGJA 1GSAA 4B46A 3DNPA 1J33A 2A35A 4J90A 3KUKA 2F43A 1H1TA 4Q39A 5TT0A 1CZNA 3GBVA 3H18A 3A2NA 3EASA 1U63A 2VZ0A 1E1QD 2AZTA 4IGIA 3UWOA 4JLKA 1DMRA 2NU7B 2J0UA 2PEZA 1T8WA 2IHZA 2J9FA 4AECA 1CJMA 3V7NA 4EEXA 4ER0A 3KL2A 3DVSX 2DH5A 5ALWA 3UWSA 2UU9B 2WSMA 3P2OA 3FYUA 2VPWA 3TLKA 5KYUB 2WC1A 1QAQA 3A9SA 4OB7A 3Q9NA 2PL5A 4TYQA 2KLBA 4YVFA 1KAGA 1KYVA 2VCEA 2VUIB 4P08A 5D5HA 5SZKB 2FW0A 3LUJA 4DR1B 2WU4A 3E81A 4HWRA 4IIBA 2NPFA 1AMNA 4W9NC 3RVMA 3KP1A 5LZ2A 2VL7A 3UAGA 4EA6A 2OT3B 3MWDB 1LW7A 1SC1A 2JIZD 2O0KA 4PO3X 4WA8A 1NFRA 5AH0A 1FLNA 3PVZA 1AGRA 2JIOA 1NDHA 4NZPA 3V32A 5CEFA 1RPZA 3QOFA 1Z68A 4RZQA 1D8TA 4BO3A 1PFUA 4AJPA 4WBNB 3IPAA 2O7NA 3D2LA 1U4SA 3G85A 3IKMB 5FPYA 2GR9A 3TD2A 1FB5A 4F60A 1Q2UA 2BMVA 4YP9A 1RYMA 4B9EA 2Q28A 5F2EA 3I2IA 4ZVRA 3TVDA 5TJ9A 2QR5A 4ZEWA 2GWHA 4NXNB 1ZLYA 3VO1A 1NUSA 2ZTUA 4UUQA 5DBEX 1R15A 2NUBA 3B9RA 3DQZA 1SHZA 1KPGA 2PZEA 2Q2OA 1GZHB 5TEVA 2JCVA 2PT5A 4EB0A 2LR0A 2ZYSA 1U80A 3CT4A 1JA9A 3EFOB 4G07A 1RBMA 4F84A 3DH0A 2IELA 3H5IA 5DLQC 1DOAA 4M9RA 5ICFA 2FN8A 1A1VA 5LQMA 5L4LA 4DOMA 2PA3A 1HDCA 3FOWA 2B7LA 2CBXA 5BWMA 1YVPA 3OCVA 3PXCX 4JLMA 4IQFA 3G5AA 4HYEA 4OVKA 3CH4B 3ONNA 4RPIA 1T3SA 2A5JA 4GI5A 2RHMA 2IOFK 3RVNA 5K7SA 2ZJ3A 3ZW7A 2HXGA 1CUIA 4BVJA 5A5VA 3EQZA 2IU0A 1WTCA 5CDUA 3W3AH 4AIRA 4F2HA 4Y2VA 4ESVA 3A4LA 4G81A 821PA 2Y1WA 1E3EA 1JFFB 1Z6XA 5CJ2A 1O96A 1CZUA 3IKVA 3IBFA 3OUZA 5JNUA 5F9FA 3TKAA 4D3ZA 3QKSA 1MG5A 4IRUB 4MCHA 3SJZA 1T4CB 2V5UA 4XR9A 2J4CA 5JRJA 3T0IA 1PNOA 4YAIA 2RD2A 3U56A 1T24A 3SKYA 2FPMA 1TM4E 3C6XA 4FHCA 5JSQA 1EDZA 4QNMA 1R74A 3CSUA 1BO6A 2NUPA 3M1LA 3DD5A 3V1TC 4IV0A 5H1YA 1OAKA 4RD0A 5J43A 3A1CA 3LGSA 2PT6A 2XJ4A 3ZC3A 2QUBA 2R1TA 4GI1A 3H87A 4R51A 4E5YA 4URHA 1X74A 3PGMA 1X1DA 2W2OA 3MCVA 1VI2A 3WK7A 3LMKA 1AZLA 2WILA 3WLEA 2VYFA 1IQRA 2GD1O 3AM3A 3ZBTA 2FQXA 3HL0A 2GZ1A 3SZOA 1GQSA 1LBQA 2WAXA 2ZRDA 4LSMA 1ZC4A 1OH8A 2ZBPA 2ZIZA 3H17A 3OLZA 4O2AF 1LU9A 3KO8A 4MV0A 5CIWA 5JHGB 4BGIA 2C54A 3F74A 5TB5A 3SC2A 4UTPA 1SQ6A 1P19A 1FK8A 2BEVB 2X2FA 3C8ZA 2OUIA 3DBOB 2LIPA 4K87A 2WUGA 3IEIA 3Q3CA 4C7BA 2VTBB 4KXLA 1O96B 1YBHA 4QYSA 1B93A 1I1OA 2WF8A 3KJEA 1J70A 4L8VA 4W6ZA 1JG7A 1K63A 2G5PA 3OEWA 4J2TA 3VH1A 3ZX4A 4M8LA 3H6GA 4H3HB 4AZVA 1DKMA 1M0TA 1RYBA 2J7PA 2PX8A 2QNBA 3EDMA 4X24A 5DLYA 1CFJA 1DV1A 5KYUA 3T3OA 2AQ8A 5CR9A 1CR1A 4ZXPA 1MORA 2GEKA 3AOEC 4OF4A 4OQZA 5EPOA 2F1IA 3VNQA 3A4MA 1MOPA 3C1OA 3VZRA 4E33A 4A5SA 2J3LA 3C3MA 1ZHHA 2H59A 1VGQA 2G4CA 4F92B 4KPFC 1TCBA 4L3OA 3K96A 2VDUE 2X0JA 3QVUA 5LZ5A 5SZJA 3PVCA 4ZCRA 9MHTA 4RAOA 1OB5A 4UEOA 3A1EA 1EP1B 2VXBA 2RGCA 4ASUD 1PFKA 5E1MA 3ZGXA 3T7CA 1UC9A 1GAQA 3OT1A 2H2GA 4Y9TA 1XRLA 4I2NA 2VJQA 5FL3A 2ES4A 3N0VA 1G9TA 2V1UA 3I58A 4QOEA 1PNVA 3PA6A 2A3NA 3D3QA 5HFJA 4HVLA 1VHTA 1YBVA 1ZJ5A 4ZCQA 2G8NA 2OO5A 4P54A 4C2AA 1TKRA 3B5JA 2FOLA 3FDFA 3OT4A 3I5XA 4D2IA 1W9HA 2XNCA 1YTUA 1W19A 4B48A 4XGNA 1RYYA 1EXNA 1MGPA 1NYLA 4Q1FA 4YS6A 2OFWA 4JHLA 2O48X 3VJLA 1JAXA 3PRJA 3FMGA 2YYAA 5CBPB 1NI5A 1X1CA 5AVSA 1X39A 5IEJA 1UZAA 5KTYA 1XKQA 1YJBA 3E4CA 3CF4A 3FCXA 2GCEA 3B2NA 3OCCA 2V6FA 4V0NA 1TA4A 4KK3A 1IJFA 4PC2A 4W8GA 1CNMA 1CW2B 1MZPA 3EBPA 5ALGA 1IIBA 3AH8A 3MIIA 3A2KA 3RRNA 3RVJA 4RM3A 1I36A 1U3GA 5CXUA 1UKYA 5F1OA 3QKRA 1AQIA 1PR5A 4IWNA 3LVRE 3ITNA 4KFSA 2WTNA 4N0QA 2ZRKA 2CBZA 5F2KA 4X3OA 3PEYA 3OLYA 1IRXA 2P2YA 1FSFA 1KO7A 1PSWA 1GZ4A 1S2IA 2CEKA 3S2GA 5LVAA 1JILA 2R4TA 3JQQA 1QU2A 1WO8A 1CP2A 1U4NA 1V7ZA 3DLCA 4WXYB 4Y2HA 5JMOA 1NZJA 1IZ0A 1V35A 4OLAA 1GZ6A 2QP9X 3OZWA 2ECFA 2ZSFA 1IN7A 4B9AA 5IVKA 1M2VA 5HUHA 5KYYB 4MW1A 1S2NA 1IOZA 5DOVA 2ZWVA 2CK3A 3W8EA 5AKLA 5BV0A 3SZMA 4ZTUB 4NY1A 2VJOA 4Z53A 4N7MA 3CV3A 3STUA 5D3KA 2RGWA 2ZUEA 2P6OA 1AQJA 1A98A 3JQDA 4PS0A 5JNVA 1SMKA 3M89A 4WNCA 2EP8A 4JLAA 3SF8B 4RVCA 3L8EA 1RR6A 5SYMA 2OCAA 5FI5A 2ZBFA 2ZULA 3OQIA 1OCEA 1TZKA 4K6MA 1RW4A 2B6NA 5REQA 3WDMA 3RVSA 4IKPA 1KGDA 3UPUA 1RHQA 2ZT8A 4Q82A 1GL7A 4UHEA 2AFIA 3IUMA 1ISIA 3M7IA 1LK5A 1KEPA 4N12A 3R3HA 5DGIA 2HT6A 3KPWA 2WTEA 5BYKA 2Z58A 3UCFA 1NBAA 1DRWA 1PR2A 1RQRA 4JGBA 5CVTA 1XRRA 3T95A 1V2GA 2MYTA 5FA6A 4OTZA 4YR7A 1JSRA 1AUOA 1YZKA 2LCIA 4YV1A 2OGUA 3FAZA 4UTZA 3LQ1A 1L6RA 3E5MA 3EXAA 4JJ8A 2WE8A 1M34A 5D7BA 5AKKA 3WLAA 4DRZA 4HWTA 1Z88A 3N8DA 3IQFA 4KX5A 2H1SA 4JDUA 3ROQA 4PGFA 5HOEA 3CB4A 3OTQA 3H2GA 1PD0A 2IYOA 1KQFA 4RETA 3LCUA 3FCOA 3IDOA 2QE7A 2ADMA 1TFUA 3GI1A 3GAAA 4O2BA 4S12A 4PPQA 1CRPA 3VOBA 5K3DA 4ZCMA 3TNJA 4AG3A 1SQSA 1T10A 3KEMA 1E8DA 3E5NA 3MWYW 3RH0A 4CLDA 8AT1A 2O7RA 3R5JA 2IY9A 2ZQZA 1ZXLA 2WIJA 3PGXA 3CWQA 3OEHD 4QPDA 4R0NA 1LBIA 2AX3A 2F00A 2G0AA 3OZDA 4XGIA 1O0BA 1X42A 4QOJA 5K8LA 3DMFA 1UINA 1WSWA 3BCRA 2XYRA 3BIXA 3R40A 4DC9A 5LYYA 1EX1A 1VECA 5JSZB 4NNPA 3C1TA 3ZXXA 2B5WA 1PKEA 5AVOA 5C8YB 1ZVKA 3M6XA 3KJHA 4CDGA 5E8RA 1OTXA 3VR1A 4MROA 4HV4A 3U49A 4R40A 1BD3A 1SQ0A 5HE9A 1QAMA 1Q5PA 1QFXA 1TAGA 1WVIA 3NV9A 3QFFA 1IHYA 4IIDA 5JXIA 2OCKA 1GVNB 1H9BA 3I0NA 3EHDA 1P75A 3GJ4A 3I4LA 4NARA 4RJTA 1ND6A 1ONSA 3AGPA 3B13B 2AC7A 3INRA 2IEAA 3CLRD 5FV4A 2PE5A 4MPJA 1UIRA 1Z7WA 3I52A 4DXDA 2R7AA 2AI2A 2W48A 4QFBA 4Z4GA 4XX0B 5ALRA 1JKMA 1NASA 3A11A 3ABIA 4JJ4A 4PBRA 3REGA 3TVTA 4K6FA 2ONKA 5BO5A 5BUSA 1QIHA 3O83A 3L7OA 3Q7IA 3OEEA 4JV5B 2M32A 1ZEJA 2FCAA 2R5NA 2WWGA 4R01A 3GRVA 1QFSA 2JGRA 4KQMA 1EQ2A 1QK3A 1XHEA 2YWCA 3JZDA 4FYMA 4KXQA 3WWZA 2FZEA 2WI8A 4FEEA 1RPNA 4BIMA 1QZTA 2XWJI 3DZCA 4PHTA 3AJRA 4BV8A 1XEWX 2JJ1A 4QUKA 5DHAA 5T8KA 4QOHA 3UHFA 3W2IA 3IUPA 2A0FA 1VCOA 3HUEA 4K1LA 2DX7A 4G0YA 4D4JA 4A0GA 4FOPA 4I6JA 2XZTA 1GVHA 1WP4A 2R66A 2FPOA 3PHGA 1PG5A 4GLBA 3O0DA 4US2R 1K68A 4QWWA 4REMA 4LZJA 5J5AA 1G21E 5JLAA 2ZB3A 3HKBA 1Q7RA 1G8PA 3RFVA 4N41A 1ODKA 4KBYA 2O1SA 4CM8B 1IULA 2Z5GA 1C50A 3M33A 4MWZA 1KC1A 4OU4A 5BWBA 1PYGA 2Z8ZA 2X40A 4PX9A 2R7NA 3SS7X 1BROA 2ANBA 2W0MA 5DTRA 5TSDA 3D31A 3FXAA 2FV8A 1QDEA 4D0LB 4XFDA 3ZJUA 1YB6A 3AVXA 2R8PA 4ZU6X 4E07A 1CG6A 4L8FA 4V2IA 2P8JA 3GJXC 3ERCA 3H0EA 5T67A 4BNMA 1T2UA 2QYOA 4BAUA 1JA0A 2PZGA 4GBJA 4ZAYA 4WNAB 1FRQA 3L8GA 2BFPA 2GJ9A 3CBQA 2IOHA 3FTEA 3X3HA 3R7AA 3S1AB 3M4YA 3F5MA 2BZSA 4CTJA 4F8YA 2HTFA 4NHEA 4YQEA 4YRDA 3F49S 4CQMA 2W6OA 4X92A 5A9RA 1TT7A 2GBGA 2HDHA 2VAVA 2I2WA 3EODA 2JHPA 4KDRA 2ECKA 1J49A 4H1WA 4B6OA 1SOAA 2ZIWB 1PT6A 1S8AA 3KEOA 5D1NA 2MCFA 1N3BA 3BZBA 1ORTA 4YGYA 1QGDA 3FLEA 3JQBC 3L82B 4BQEA 3TVYA 3HFRA 3K20A 3T3EA 3IQXA 4LHSA 1XD8A 4PLVA 1YT5A 4WOCA 2CCJA 3B2EA 3BWCA 3TR0A 3U9SA 1JKFA 2B2NA 4DDVA 1ZI9A 4ZRNA 4O63O 1VIYA 4B4OA 4KZPA 3UXYA 1F60A 4XW2A 5DNVA 4DMRA 1RWKA 4ENRA 1X14A 3GD5A 3R41A 1DIRA 4J1TC 4FILA 1DEHA 4J16C 1ZH8A 1XTVA 1QGZA 4ABTA 3CPEA 4H7KA 1SK9A 3UATA 3B38A 1SHTX 1Q1QA 1TI7A 4IICA 5I3CA 3R7WA 1QVRA 1I13A 2HTEA 2R8YA 3E3LA 3FX2A 4IDAA 5E2AA 1JECA 5L7YA 2IHVA 3MTBA 3WGKA 4BO5A 2PQ0A 5BR1A 1CT9A 2FN9A 4MW2A 1E7WA 1G66A 4OL0A 3DPUA 1U8XX 1BQEA 4Z5XA 1I10A 5EJEA 4P6VF 1TIBA 1PTJA 2A4MA 1Q3TA 2KBEA 1VIMA 3ZWVA 2OSBA 4HR7A 3TQHA 1DZ3A 3PEFA 2H1OA 4KXYA 1LBTA 1Z29A 1UBEA 2PM8A 2V7QA 1RCFA 1U5BA 4DC1A 1H93A 2OHJA 1I01A 2BMFA 1M7GA 1L9XA 2OAEA 4CLXA 2Z04A 2BFOA 1EBFA 1DX6A 3LGXA 1TW3A 1L6IA 3QV2A 1RZVA 4HEQA 1T2NA 5KNDA 2BFCB 5AM4A 3Q41A 4QO8A 2GZMA 3FM9A 4EGQA 2L0XA 3TB6A 2GM4A 1ZK1A 3C85A 4L0DA 4BFUA 3N70A 3R74A 1E4OA 3DKPA 2WSSA 1G60A 3L4EA 5D7NA 4CV1A 5JRDS 2ZR7A 1VRCA 4N4AA 4LI0A 4X6YA 3EDYA 1N2EA 4MUMA 2HQBA 2TYSB 3EZYA 1I4OA 4OFBA 4PVDA 3MC1A 4XIGS 1CQZA 1B4DA 2JCGA 4OXXA 1U8YA 4DV2B 1O6FA 4PX2A 2IXBA 2Q4RA 4PAOA 4QATA 5DN9A 2BM8A 2W2KA 1Z0DA 3V6MA 4F5EA 5HDQA 1J2JA 2EARA 3RS7A 1S3GA 4HZUA 4DSOA 2QMEA 5IANA 2RAVA 5FBZA 1PDWA 3Q3EA 3G23A 3P2MA 5BQ3A 5CW2A 5GJCA 2FMTA 1IN8A 1KY5A 1G8YA 1ZOOA 1I7DA 2Y1KA 3DXXA 1E1QA 3KDSE 1IMJA 4OLJA 4EW6A 4O3MA 2OKCA 3GDGA 5GV8A 2J5QA 4WJLA 2O3SA 5ECDA 1C9KA 2OGTA 3NEPX 4ZZ2A 1TTHA 2AK2A 4S0ZA 2NYRA 4XYLA 2Z5FA 4IG9A 3T7JA 2OUKA 2ZRNA 3TNLA 4MZXA 4NS1A 1U3FA 4OXIA 5AK6A 3OAAA 2FW9A 3UUGA 2PQ6A 4N7RA 2DPGA 2QYHA 3VOAA 3K35A 3DW3X 3JALB 1IY0A 3OZIA 4FUQA 1J0BA 1X7WB 1EFDN 2BUBA 3H97A 3FE2A 1VPTA 1MQSA 1SCUA 2BJWA 4NTZA 2VF5X 1SXJB 1C7ZA 2D0DA 1W8IA 1AMUA 3PI7A 2M6LA 4RTNA 2YJNA 4ZJZA 5CLIA 3WA7A 2FWPA 4JUIA 3IPRA 2COKA 1JLRA 1NF3A 1NYQA 4I3HA 1DV2A 3VO8A 1JFRA 5I4KA 3A9RA 1NXOA 3OQNA 3FSGD 2ZB2A 4X85A 3KQLA 2C8VA 3PR3A 4C4YA 4PYJA 1KYQA 1V8FA 4U7GA 4WECA 1TEHA 2YMPA 4HJRA 4RMNA 1Q84A 1O4WA 2OCGA 4HN4B 5LL6P 2IPXA 1MB2A 3KDPA 4M87A 4AD8A 1SC3A 3HRIA 3THOA 1PJLA 2ECPA 2R6FA 4F2GA 4QLBA 1JH9A 5CTJA 1JH8A 3M5DA 3ORHA 2PWBA 4D6YA 3DP9A 3DXFA 1R5JA 1W96A 2BEUB 5L3SB 4N40A 2IQ5A 3QVSA 4Y6GB 2DSTA 5DSZA 3SNKA 2ORVA 3UKJA 4BCDA 1QO9A 4D98A 1XMVA 2LP4Y 3KKKA 2R86A 1IK4A 1L5HB 2PSDA 2J85A 1G4UR 2KSQA 2J41A 4TM8A 4M1KA 4WKPA 1RQ2A 5FO1A 5HF6A 3CX3A 3VDQA 3WS7A 3OTIA 3KZMA 4CFSA 5KVCA 4LF5B 3IERA 1F9EA 4OHBA 4DRYA 2RKOA 2BR4A 1CJCA 1XX6A 2KHZA 1G21B 2Q4TA 4JLVA 1GNPA 2AK3A 4PBSA 2XLBA 2O9JA 1TEZA 1CUHA 2A1IA 3HUTA 1JSZA 2MSKA 1SQGA 2IOYA 1FMLA 3CEMA 4GICA 3PQDA 1QGAA 5J23A 4W5RA 3A28A 3TIFA 1UJ4A 3IMFA 4JI5B 2QT1A 5IMSA 1JDBB 4HB3A 3U0VA 4GI2A 1UT6A 1X86B 1C0PA 1VE5A 2O3RA 2Q0HA 2Q0QA 2QDXA 2QG4A 3E5RA 3EIUA 2IPMA 3FSGA 3OLWA 2O59A 1C41A 2W4QA 4Q3LA 2XUJA 3AY7A 2GESA 4V38A 3KSUA 3AGQA 3MCZA 2P9HA 3JAWA 3ELDA 5AUOB 2ZR8A 4E11A 3OQ6A 3OURA 4TLAA 5DF1A 5DXJA 3GJQA 1QGOA 4DNPA 4BO0A 3GLQA 4H59A 3IT2A 1QNLA 2MYNA 4JP3A 5THXA 5H4GA 1U2QA 3OT5A 4YDRA 1KYIA 2B0JA 4BKRA 3QEJA 3R9IA 2FTKE 3GAFA 4IZHA 3UV6A 1YIAA 5CM2Z 1ZZEA 2EZUA 4G1BA 4PGAA 2M1ZA 4B3TB 4IHQA 3PCTA 1FF9A 1T0JB 4FSDA 4B82A 4ZA2A 1C4WA 3D6MA 2VLIA 3ZE1B 2VJKA 5CFNA 6AT1A 2QMOA 1V95A 2XD9A 5CFLA 4M55A 5FOXA 4BLQA 3N8IA 3SF0A 3W90A 3MUNA 4PZ0A 1T1EA 5INTA 3GYBA 3C6YA 1KO5A 3QEOA 3CLVA 1Q0PA 4MP8A 4RVHA 5E1OA 1F20A 3IHKA 1FLDA 2VHYA 4HWOA 1GTZA 3TFWA 4E15A 1C9DB 4ND7A 1DAHA 3DPIA 4M7PA 3RI3A 4F6CA 1U7DA 3HYSA 4DMLA 2O5CA 4O2AB 1JI0A 4JQOA 4YECA 2OORC 4HDNA 4CM4A 3HB5X 4HDRB 5KNDD 3GGOA 1YZUA 4RK7A 3B6MA 4H6VA 1E96A 4QA9A 3TQIA 2PUBA 3MPUA 1V9CA 1T25A 4FIDA 3CE9A 4WW0A 4OCZA 4WI1A 2XCSB 3OQPA 4UEJA 3A6GA 4DR4B 2PIDA 4MUJA 4AF7A 1GHTA 3ZY2A 1XXHA 2XOKD 2PUCA 4MYRA 1TUIA 1B7GO 2J30A 4PR3A 4MR8A 2G5CA 4E5PA 4JI2B 1LA2A 1R4MB 1RAAA 1Y5NA 3AX6A 5ALQA 2VDKB 1NNLA 3LBIA 3O21A 3DFMA 4NESA 4NPHA 1EPUA 4RDIA 5G2OA 4UE6A 3C8DA 2I4IA 3HLKA 3WLLA 1W4ZA 3HJTA 1T9AA 1UK6A 1G5TA 4DCVA 3HPQA 1QF6A 5LBTA 1RQXA 3UW3A 2HA6A 3EMBA 3B1WA 4C1NA 2O20A 1TTQB 3E61A 2FEKA 2ZE8A 4H18A 4QTUB 5K1ZA 3S2IA 3WFZA 5I7OA 4H4EA 3ID6C 4HP8A 3QXCA 5LYJB 1OY1A 3KSRA 2XDQA 3O2QB 2EW2A 1PJRA 1BHJA 1DTWA 2WF7A 3B2QA 3IP3A 3L7NA 4Q9HA 4X7RA 3UA3A 4EF5A 4EGFA 4W6QA 5K6TA 1QV6A 2V3WA 3OZEA 2E21A 4CMJA 1TGV