5JDIC

Trypanosoma brucei ptr1 in complex with cofactor and inhibitor nmt-h024 (compound 2)
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
266
structure length
239
Chain Sequence
b'APAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQKTVETQVAELIGTNAIAPFLLTMSFAQRQNLSIVNLCDAMVDQPMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pteridine reductase
publication title Profiling of Flavonol Derivatives for the Development of Antitrypanosomatidic Drugs.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
total genus 91
structure length 239
sequence length 266
ec nomenclature
pdb deposition date 2016-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5jdiC00
5GZ3A 3ON5A 5JFOA 4Y67A 3ZZNA 2IYOA 1K5HA 3HE3A 4JN6B 5H83A 5T6BA 3UN1A 2VHYA 2CNBA 1VJTA 1QG6A 5A3VA 1AUPA 1T2AA 4CMEC 3EW7A 4R54A 3KZVA 3MJEA 4CM5A 3TOZA 1E5LA 3E48A 1WMAA 1DAOA 3C85A 2AQKA 1JQBA 2WTBA 5L4NA 2RH4A 3ICCA 5CDUA 1HLDA 4BIIA 4GLOA 2Q2VA 4A03A 1MB4A 2FWMX 3ETDA 4ZQGA 5CFZA 2WMDA 3JV7A 1EUDA 2HKIA 3QRWA 4NG5A 4ZRNA 2J5RA 1E3LA 1XR3A 3NTQA 1KVTA 2YQ5A 3NAQA 2I67A 3PFWO 5A9RA 5KOIA 4OOEA 3PWSA 1PJ2A 2C2YA 3UOGA 4DLBA 3VKVA 1K6IA 4UEJA 3H6KA 3DONA 4AJLA 4IUYA 3GPDG 4I8XA 5LCXA 3QV1A 1DPGA 2V6MA 1P45A 3OFSA 3VZRA 4BO6A 4KDEA 4HFNA 5T64A 4CM8A 3RUEA 4JK3A 3T7CA 5JPIA 4CODB 4D0SA 4CR7A 2EKQA 2YDXA 1IE3A 4OL9A 4M89A 2ZCUA 3WR5A 1VM6A 4BQPA 3AM5A 1JWBB 4XB2A 3LLSA 4BNMA 1XLTA 3WJ7A 4ZD6A 1XCBA 5F1KA 3VPGA 4JP3A 2O48X 3OEYA 4LW8A 1ONPA 4UUPA 1MG5A 1YS4A 2B4RO 1P1FA 3VDRA 2AG8A 3UUWA 3FBGA 1NTOA 2CVQA 2B5VA 1DIGA 1DHRA 4RLSA 1KVQA 2V6FA 3OP4A 3S8MA 4CM4A 2ZYGA 2YY7A 4MVJF 1YGYA 2R2GA 3W1VA 3ZWBA 3L9WA 3OH8A 3G3EA 1ISFA 4IZHA 1I01A 3I5MA 1N2SA 1OAAA 2R6JA 3TPCA 1P33A 1J49A 1SEVA 2DTDA 5DOZA 2B37A 3W4IA 3JQDA 3GG9A 1VKNA 4NQZA 4W9NC 4U0JA 2P91A 1X7DA 5TC4A 2RHCA 1BXGB 1XEAA 3BMOA 4IJWA 5FI3A 4AJKA 2CY0A 2IEDA 1U7TA 3OBBA 1NFQA 3DAFA 3MJ4A 4J49A 4GWGA 2J3HA 3CE6A 4ONEA 4L4XA 4CV2A 4BOYA 1RWBA 5JE8A 1Z82A 3IS3A 5A4DA 2HMTA 4BQRA 3K5PA 4BNNA 4TQGA 3GZNB 5JYDA 3UVEA 3I3OA 2RCYA 2GZ2A 3HN2A 4B4VA 3E6AA 1GV1A 2HRBA 4NU5A 2FR1A 2VHXA 3UICA 1H0KA 2WYVA 4CM7A 2BGLA 1VL8A 5TX7A 1HF3A 2WD7A 3JYPA 2JHGA 3PEFA 5H81A 5KJ6A 2WSBA 1ZNQO 1WLYA 2VTDA 1LC3A 3B1KA 2O2SA 3A9WA 1KC1A 3GN1A 3JQFA 4RPGA 2C82A 3AI2A 3LT2A 3LZ6A 3MEQA 2PD6A 1H2HA 2QZZA 3ZNQA 2AQIA 1EZ4A 1PZHA 3SEFA 4CLEA 1XIVA 2W2LD 1D1SA 4AVYA 3ZN2A 1ZK0A 4CMHA 2P9EA 1Y8RB 5L45A 1C0IA 1OI7A 3KYCB 1N1EA 1R6DA 4CMIB 1TT5B 2IODA 4MVJG 4CV3A 2HDHA 5DBIA 1LSUA 3G1UA 3PLNA 4ND3A 2H63A 3HWRA 4DMMA 2I66A 4YEDA 2X86A 5ITWA 1SOWA 3A06A 3WQSB 4IJUA 1JVSA 4MIYA 3BTUA 4NI5A 4B4UA 5I8WA 4R41A 1N5DA 4PCVA 4U6QA 3ROPA 1VC2A 1PJTA 4XRGA 3JD2A 4HKTA 5CDSA 3BMCA 5BSGA 4ZQEA 5CDGA 4WOKA 3RUDA 5JDCA 1VJ1A 1YE3A 3NJ8A 3T4EA 3FN4A 3PDUA 4UVHA 4XX0A 3D3EA 3R6DA 4Q3BA 4PLFA 1WAMA 1I3MA 4MDHA 2VHZA 4BMVA 1C1DA 5L4SA 1A4UA 3E18A 4YJHB 5FFFA 8ADHA 2E82A 3K2BA 1YB1A 1ZFNA 1S7CA 1WPQA 1UXIA 2A9FA 1U8FO 1ZIDA 4E31A 2DQ4A 3W4JA 3U4DA 3MJVA 4AICA 2HK9A 2PFGA 1AHIA 2QRKA 1UH5A 5F5LA 3GEMA 2NU8A 3GMSA 1T2EA 5KKCA 2C54A 5B4UA 4RV9A 4HADA 4FJ1A 3QWBA 1XU9A 3PZBA 2NACA 3LF1A 2X58A 4JQCA 4RPLA 1Q0QA 3VVCA 4UVGA 5KTKA 2DBVO 3DEYX 4XR9A 4A5OA 2IRWA 4MVJA 3RUHA 1GQQA 3RROA 4J7XA 4CMJA 1KEVA 1I2CA 4J91A 1O95A 2HCTA 3E9NA 1LX6A 1BWSA 4NFSA 1H6AA 4CV0A 4DIFA 2IXBA 5EMHA 3ZNPA 1OC4A 3FRJA 2HK8A 1NNUA 2D59A 4Y6RA 5L40A 4E13A 1EUZA 4RVFA 4ALKA 2GN6A 2JD2A 3OF2A 4CLHA 1P1HA 5JCJD 1X7HA 4FC7A 1ISGA 4R5MA 4EEXA 3K31A 3TOXA 4IBOA 3AM3A 3O38A 1UAYA 2B83A 4AJJA 4J43A 1B0AA 1TLTA 1ZSVA 3RBZA 1PZFA 4BNTA 4JCOA 3QHAA 3ZU4A 2CVZA 3I9LA 3PIDA 2QHXA 4OO3A 3WBBA 9LDBA 3KYDB 3WNVA 4IIVA 3BIOA 5EJ2A 5ILOA 1LRJA 3F1LA 1DLJA 3ABIA 1O9BA 1IB6A 2Q1SA 5DNAA 3TSCA 3EYWA 3V1UA 1XA0A 4ZGWA 4WPGA 4LRTB 2DFDA 2R00A 3GDOA 3M1LA 1M67A 2I99A 3MOGA 4XYEA 5TT0A 3HDHA 2HRZA 4NJOA 1WXDA 2NV6A 1V9LA 2Q99A 1T4DA 2DUWA 4M55A 5THQA 3OICA 2I76A 3X2FA 2JD0A 1UAGA 1T1SA 4NK5A 4WNCA 2VT2A 5EESA 1KVSA 4QEDA 1YDEA 1H93A 1ZBQA 3I6IA 3JD3A 1E1MA 4W7IA 2NU7A 4Y8VA 3QVXA 4KTVE 1N7GA 1PEDA 4HX5A 5G4LA 1P0CA 3E1KA 5F21A 4BB5A 2YHIB 4N18A 4EITA 5L51A 1EE9A 2QYTA 3C7CB 4Q9NA 1NX6A 3BMNA 4IJVA 3VH1A 4B3IA 4DIOA 4EI2A 3W4KA 5G2OA 3ZI0A 1NHGA 2O7SA 1BGVA 3RFVA 1Q7CA 3C8MA 4NBWA 3JQEA 4PIVA 1PZEA 2BFAA 2BGKA 3PJFA 4UAGA 4AFNA 3QVOA 2ZKLA 3WJAA 5A9SA 3F46A 1K89A 3G1TA 2J8ZA 3KB6A 2O3SA 2QQ5A 4A27A 4BNHA 2O7QA 1LDYA 1NWCA 2Y1OA 2JCYA 2P4QA 4MP3A 4WLFA 1HRDA 3ROKA 4ND1A 5EINA 1PS8A 3ZHZA 1F06A 4KQWA 2VZ8A 4TMFA 4ZQBA 3RC9A 2PZLA 4RF2A 4WOJA 4HFRA 4CMAA 3ZU3A 4PFJA 3R3SA 1E7MA 1CEQA 4IS2A 2G76A 1EQ2A 1NR1A 5L7WA 4WK6A 5FF9A 5ENDA 5GY7A 5DCYA 1E7YA 1D4FA 1Z6ZA 2YJZA 3RC2A 3M2TA 3WGQA 4XKJA 1N9GB 1UDBA 1TXGA 3MWDB 1WDMA 1ENPA 2X4GA 5A05A 1I5RA 4GVXA 5T57A 4Y6PA 4RGBA 3RSHA 3FSRA 3PVZA 4B7CA 4PVCA 1VLLA 3DWFA 5ER6A 2P68A 1GZ6A 2DM6A 4OYRA 2BH9A 3RWBA 4BO2A 3ZV4A 3ZWCA 3EZYA 2PNFA 4FC6A 3DXFA 3E9MA 5TRTA 1M6WA 3CH6A 3RQSA 1PJSA 3D1LA 4E30A 4HP8A 5JDCC 1PIWA 4PVDA 5TJ9A 4KQXA 1A9YA 4AG3A 5EL0A 1B26A 3LYLA 1H6DA 1UR5A 3B20A 1WZEA 4KWHA 4BGUA 2FR8A 1R4MA 1I32A 4IDDA 1I2BA 3JQ9C 2VOEA 4D43A 4RPKA 3LLVA 4AJIA 4WJZA 3GAZA 1KETA 4M8SA 4MIEA 3W8EA 4BO4A 2GD1O 2O3JA 4MINA 3RKUA 1GUFA 4YWJA 1H9BA 3WSWA 1X14A 3D4NA 4N5LA 1Q7GA 4PN3A 5TQVA 3F4BA 4FN4A 1LDBA 1LSJA 4A10A 5COBA 3ZHXA 2X7HA 5A5FA 3CZRA 1IL0A 5CEFA 4BNKA 1I3KA 3JQGB 3DAGA 2UVDA 5C37A 3DZJA 4L8VA 3ZWMA 2NTNA 2GO1A 2PV7A 3DMTC 4GAEA 4DLLA 1XKQA 5KVSA 3E82A 4DQUA 3INGA 3K6JA 1XWFA 2AG5A 1QYDA 2PGJA 3HADA 2C20A 4K28A 2BFMA 3D3WB 2G17A 1RYEA 3JQAD 3ZW9A 3D5QA 5B1YA 1P1IA 4HV4A 3C24A 1KOLA 3GEDA 1N7HA 3DC2A 1Q2XA 1R16A 2A4KA 1YVEI 2TMGA 5A03A 3B6ZA 1QYXA 4MVJI 5AVOA 4E2WA 1XDWA 5DT9A 3V5NA 1DIAA 4YJGA 1E3JA 1BDMA 4YAGA 3IKVA 1SEPA 2ET6A 3IMFA 3F6YA 3ROMA 1S6YA 3I9NA 4N7RA 5COAA 2EKPA 3R0IA 4GKVA 4TKMA 3WIEA 4FW8A 4J16A 4XYGA 1DO8A 4EUFA 5A04A 3BTOA 1F12A 1OBFO 2BRUA 4L4SA 3FR7A 4NHEA 4Q39A 1I2ZA 3Q0EA 4MKZA 1A27A 3S2GA 5C7LO 1BTOA 1H5QA 1V0JA 3BTSA 4C7JA 1I33A 1YBAA 2NU9A 5BNTA 3WB9A 4IGFA 1E3WB 3V2GA 4A26A 1GZ3A 4PGFA 2R00C 4YYZA 5A3JA 4AJ1A 1DXYA 2EERA 4EUEA 1U8XX 2EG9A 5FYDA 5TS3A 4PLZA 1UJMA 3TN7A 1OOEA 1Y5MA 1LU9A 3ENNA 4MVJM 2DVMA 3OIFA 2W8ZA 2QRJA 3FPCA 1Q7BA 4J9VA 1D7OA 1A7AA 1HEUA 3GFBA 3H5NA 5B12A 4MP8A 3PJEA 4KMSA 3IUPA 3BHJA 2OP1A 3S2EA 1YB4A 2H9IA 3DAPA 4S1VA 3WG9A 4PG8A 4W9NA 3CMMA 1C0LA 4D3FA 1AXEA 1NVGA 4CM6A 1ML3A 2Q4BA 1I24A 2CMDA 5TGDA 4GX5A 2OGUA 3HFGA 2WJPA 4ZRMA 5JAZA 4JIGA 1VPDA 4XQGA 3HB4X 4OAQA 1CF2O 4J4TA 2Y67A 1CWUA 2C5AA 4CL8A 3D4PA 5EN4A 3KYBA 2GERA 1JA9A 1KIFA 4GX0A 2CUKA 3WDSA 1ZJYA 4UVIA 3V2UA 5JCJA 3NEPX 3RKRA 3AFMA 4BGEA 2JHFA 4FGWA 1UXKA 2C7VA 3BTVA 4IPTA 4EGFA 2EW8A 4GKBA 1AE1A 3JQ8B 4CM9A 3I83A 3OJLA 3ONEA 3GA0A 3GT0A 1PGQA 4FFOA 3ZCXA 2FY8A 1FMCA 5IXYA 2VWGA 4R3NA 3DZFA 3Q1LA 2NVUB 3WGIA 2X9GA 4R1NA 1ZUD1 3WGOA 3DOOA 3Q3CA 1YH3A 2NQTA 1UP7A 2FMUA 2POQX 3NUGA 5HBRA 3WTCA 4BNIA 1QMGA 1GCOA 2IZZA 1JWAB 5I7EA 1BXGA 2NNLD 4O5OA 3E9QA 3H3JA 4PLVA 1ZK4A 3FTNA 5L3ZA 1BG6A 4XEHA 1YBMA 2NU6A 2FR0A 3GNQA 2W2KA 1BDBA 4EJ0A 1IYZA 1K3TA 2QW8A 1A72A 2CD9A 1HTBA 1O6ZA 4IDFA 1BRMA 3VTFA 3IAHA 4BMNA 4BL5A 2I3GA 2D8AA 1RPNA 3QWIA 1WVGA 3GZNA 4J4HA 5CEEA 4E5NA 2Y99A 5IXSA 3QLJA 3E5MA 2EV9A 1ONOA 1OZAA 1RM3A 4QQRA 3HN7A 2VZ9A 3LSYA 3RUFA 3A14A 3CTMA 3ZU5A 1E1KA 1WMBA 4WLNA 3OEWA 1NBOA 2B4TO 4FFPA 1UDCA 2DC1A 1K6JA 4R1SA 2X9NA 2HQ1A 1I3NA 4XQ9A 3TFQA 4BNXA 1JLLA 3SLGA 2VOJA 2O50A 2V65A 3ASVA 1V3VA 4JX8A 3F1KA 4HUJA 3WGGA 3L6DA 1HZJA 1NFFA 5LDHA 3GHHA 1I8TA 1X1EA 4GVLA 5EPOA 3OMLA 1HT0A 2NVWA 3U4CA 3GUCA 4YR9A 1TB4A 3RUIA 1OFGA 4E12A 1YJ8A 5C3MA 2IXAA 3KYCA 3DTYA 4DVJA 1J6UA 1TT5A 5ENVA 4GI2A 2O23A 1B2LA 1BMDA 1CETA 4E2ZA 3E8XA 1DSSG 3PP8A 1LDNA 1UXGA 4IDCA 3AU8A 3NT4A 3Q11A 5DZSA 4CQMD 3MZ0A 1E92A 5AXCA 4DBZA 1RM4A 4J1SA 3X2EA 5ITVA 4E33A 4JLWA 5H82A 2AEFA 2Y1CA 2Y1EA 3PPIA 1R15A 4KOAA 4II2A 1XQ1A 5EERA 1EFLA 1QYVA 4ALIA 3NDJA 2Z95A 3GG2A 3R3JA 4WCDA 5T5QA 4NK4A 3ITKA 4FFNA 4OHUA 3P2YA 4W6ZA 4L76A 4R16A 2FPGA 2ZB8A 1MC4A 4FS3A 3H4VA 3TDKA 2E37A 2G1UA 1E77A 5EQDA 3JYOA 5B4TA 1WZIA 3D0OA 3RUAA 4LISA 2PZKA 1BXZA 3H65A 1DAPA 4CPDA 4HNGA 4FR5A 3K9QO 4KDFA 1EK6A 1R4NB 4ND4A 3EUWA 4BKUA 3JYNA 2XXJA 4BNLA 3PK0A 3STHA 2BMAA 3Q9UA 3VKUA 3PIIA 1NXQA 4J7CA 4OXKA 3SJUA 2YFHA 1HSZA 3ZHBA 2VYND 2DBZA 3EVTA 3AWDA 5ILGA 1ZEMA 3CINA 1C0KA 9LDTA 4DPLA 2VZ0A 1GTMA 5IZCA 5DF1A 2NSDA 2UAGA 4LCJA 2D0IA 1VI2A 3ULKA 3OJEA 2BHLA 1C14A 2V7PA 3GRPA 1PX0A 3I9MA 3IQDB 3PWKA 3W8DA 1MX3A 4DREA 4UVEA 3PYLA 2SCUA 1YONA 1CJCA 1ZK3A 5KVVA 4J2OA 4PG4A 5AQ1A 3ZV3A 3H5RA 2YQ4A 3SLKA 3SXPA 3I9JA 1IHYA 2TMDA 4CMKA 5JC8A 1MXFA 3QW2A 4XIYA 4YJDA 4HFJA 4XGIA 4FDAA 2JCXA 2AA3A 5A9TA 1LEHA 3K8ZA 1IPEA 4DA9A 5HWSA 2OUIA 3OJFA 1GEGA 3RU7A 3RC7A 3SJ7A 3RFTA 1DC4A 2HMUA 1EUCA 1H2BA 3KSZO 3QWHA 3TWOA 3FWZA 1R0KA 5JBIA 4LGVA 3GC6A 4S3MA 4RDHA 4D79A 2NTJA 1BW9B 1U9JA 3WGHA 1LRLA 2Q4EA 3GY0A 1J4AA 4ESOA 3KYDA 5CG2A 3ANMA 5F1PA 4JP2A 1O8CA 3RIHA 1KVRA 3U49A 2P9GA 1X13A 2PK3A 2ZJ0A 1P1RA 2OMEA 3GAFA 3ZDFA 1E7SA 2Z1NA 4D3DA 3GVPA 5BR7A 3M6IA 3L6EA 1IPFA 4MO2A 1HDZA 2G82A 2PH3A 5COQA 5IAAA 3OQ6A 3PLRA 1QLHA 3TF5A 3DBHB 5TJHA 1VL0A 2ZCVA 4YA6A 1OC2A 1SOVA 1R0LA 1PJLA 3A1NA 2YV3A 4O6VA 3MJSA 3QVWA 4CJXA 2BLLA 4Y9DA 4CUZA 1O5IA 1JU9A 4OM8A 3LF2A 5KJEA 1W73A 4IS3A 5U1PA 4BGIA 2AQHA 2Q1WA 2ZQYA 3OSUA 3QJ5A 4NH4A 5CAEA 1NAHA 1HDXA 2DTXA 4TVOA 4ALJA 4TRNA 3U9LA 2YHIA 1FDSA 3ENKA 3KEOA 3EVNA 4IQGA 3C1TA 1DB3A 4NMHA 2HLPA 1GCUA 5K6AC 1SNYA 3KBOA 4D45A 2PD4A 4R68A 4Q3NA 4WLOA 3TRIA 4GGPA 3VOSA 3KO8A 4BHTA 1E1NA 1WP4A 5IG2A 2BFOA 3QWAA 5CHEA 5JO9A 1Y6JA 1N1GA 4J90A 5L7YA 4Q3EA 1PWZA 1PU2A 1LDMA 1SCUA 3EZLA 1NHWA 4LSMA 4KWIA 3UCFA 4GLLA 4BNUA 2RAFA 3DHEA 2O3UA 3NX4A 5A5EA 3UGKA 3N7UA 4I5FA 1PR3A 3JQ9A 3GK3A 1D1TA 1UP6A 1WW8A 2H5LA 1QXSA 3L4BA 3IUSA 5HM8A 4ZN6A 2DKNA 4F45A 1GL3A 4MOWA 2BFPA 3D5TA 4HWKA 1A4IA 1LRKA 1N9GA 3KSDO 3PDJA 4NBUA 4RF4A 4P4GA 1GD1O 3NDIA 5KCZA 4WGGA 2BD0A 5LDGA 4E6PA 2YV2A 3HDQA 1LQTA 3B1JA 3GLQA 5DDIP 6ADHA 3NT2A 1ZVMA 4YRDA 2FZEA 3T7EA 2EP5A 3DMTA 4RVHA 1L7EA 1HSOA 4OSOA 3UCXA 3BHMA 4NBVA 5B37A 3WSVA 3CSDA 2JCVA 3DTTA 3V1YA 3FNEA 3EMKA 1JVBA 3JYLA 1VKOA 1NQTA 1M76A 1EVZA 4NJMB 1N8KA 2OFPA 3KVOA 1BVUA 1KY4A 1RYDA 2EJWA 2JFFA 4J1QA 3UFXA 3KETA 1VSVA 5JMWA 4DUPA 4E5YA 1V3TA 3LC2O 3JQAB 3DZIA 4Z6KA 4J0FA 4TKLA 4Z0TA 3DHYA 4I08A 4BMSA 3G49A 1FDVA 4DQXA 4TRJA 1HKUA 2Y93A 1IOLA 2WE8A 2AEJA 1JDJA 2WYUA 2ZTVA 3TZCA 2HMVA 3IC5A 4NFYA 3ZNNA 4ALNA 4HY3A 2VRCD 3JQGA 4R5HA 2IDZA 2XPCA 3C3XA 2EP7A 3IJRA 4B8WA 4M1QA 4E5PA 4D46A 4JROA 3GUYA 5IZCC 3PHJA 1B8PA 4U0KA 5ICMA 4E5MA 3PGJA 2YV1A 2UV8A 5FEUA 2GZ3A 2FPPA 3T4XA 3VZPA 4CLXA 3D3WA 4BO5A 4DYDA 3MJTA 4KTTE 2VWQA 4R3WA 4LN1A 4XJTA 4LRSB 1YB5A 3K73O 4AJ4A 4H16A 1XGKA 2Y05A 4GH5A 4PLWA 3DZHA 4R1TA 4IMRA 2FHSA 3U09A 4P38A 4HFMA 2PY6A 1Y8QB 3I6QA 1L1FA 5JCXA 5JNLA 4FBGA 3H2ZA 1Y7TA 1MXHA 3K92A 4AJPA 4XQEA 2IEBA 2P5YA 2WD8A 4ALLA 1QRRA 1R37A 4GX1A 1NM5A 1ZEJA 1T2DA 2WD7B 3F9IA 4XA8A 4B79A 4ZICA 1B15A 2G5CA 3FR8A 2O2YA 1EMDA 4BNYA 3WIDA 3QVSA 2YDYA 4R01A 4CLRB 1LLDA 2XF8A 4RZHA 2FSVA 3DFZA 2P9CA 3CEAA 1ZKMA 1P1KA 4ID9A 2FOIA 3KM0A 3ZWPA 1MV8A 3KSUA 1E3WA 2ZTLA 1PZGA 3ZW8A 3AY3A 1UZMA 1CQJA 4H3VA 2NTVA 3ADPA 1ULUA 3NDRA 4ND5A 1EBUA 1KEPA 5AXBA 5FI5A 5I7VA 2DT5A 6LDHA 3H5AA 3TNLA 3ZU2A 1NWHA 3ONFA 4CMCA 4JBHA 3PZRA 2HMSA 2YHUA 4Q3AA 3FF4A 4NZ9A 4BV9A 1QLJA 3OETA 3VPFA 4RL6A 3PTZA 2GLXA 2B5WA 1PJCA 3CIFA 3VPXA 4L74A 1LA2A 1JKJA 1NQ5A 1WDLA 4IXWA 1E5QA 4XRRA 2VQ3A 3BMCB 1W4ZA 2I3AA 5DBGA 2CF6A 1YJQA 1HETA 2LDBA 1Z75A 4RJTA 1Y5RA 1SB9A 3D4OA 3SC6A 3WX0A 1HWYA 1H6BA 1XSEA 3AW9A 3GRKA 4GMGA 1PQPA 1HE4A 2J3JA 4YRAA 1ZW1A 1GQYA 1GDHA 2GN8A 4PRLA 4XDYA 5G0UA 4J4BA 4PRKA 2DAPA 4BNWA 1P0FA 3FBTA 5JLAA 3KRTA 4PG7A 1O94A 3BA1A 1EK5A 4C4OA 2C2XA 5BT9A 2BF7A 3GGPA 3N74A 2DU8A 4DPMA 3VPSA 3QVTA 1X1TA 5G4KA 1I0ZA 1U5AA 1AN9A 2Z1MA 3JD4A 4ZA2A 3VHRA 3EK2A 2GNAA 4XQCA 4XJSA 4GPD1 1ZH8A 1GYPA 1PGJA 2FP4A 2I9PA 2YYYA 2ZYDA 5AXDA 1LSSA 3TJRA 3TZQA 5T67A 2NVUA 3CUKA 1DIRA 4DBVO 4BS9A 1TA4A 4U7WA 2C59A 3AY7A 3L4BC 3F47A 3OHSX 5G0SA 1V35A 2OL4A 5U9CA 1FF9A 1UP4A 4QFDA 2ZQZA 1C1XB 2Q1TA 1MG0A 1GUZA 3TL3A 1ADFA 4G2NA 4U8GA 1PJ3A 4O63O 4AJOA 5C5IA 1F8GA 1NPDA 3MOIA 4F46A 2NLOA 5BNIA 4MKXA 2GRAA 1M2WA 3P5SA 2HO5A 3GHYA 4D7AA 2W2LA 2Z5LA 4CQLB 5I7SA 4CUJA 1Q1NA 3VC7A 2CDCA 5JO0A 1D8AA 3GVCA 2IZ0A 5MGBA 1J0XO 4ITUA 2AQ8A 1P3DA 4QO8A 1L7DA 1HXHA 1I3LA 3GNTA 4P4NA 4CLDA 1M6HA 5HA5A 3SBOA 3VPHA 2GR9A 3H2SA 3V8BA 4CLOB 1IZ9A 4DXHA 5HS6A 1HYHA 1XELA 2JFGA 4CQMB 2ZK7A 2GF2A 4R69A 1NPYA 4YAIA 4G65A 3WQRA 4YJFB 1JKFA 3DZKA 3O9ZA 5K9ZA 1IY8A 4RDIA 1ZXLA 3VZQA 4L9RA 3GF4A 2Q2QA 3NGXA 3AUTA 4NBTA 4QX6A 4LSWA 4MVJH 5I8ZA 4WASA 4O0LA 4JJFA 3O26A 3PQEA 3L07A 1LTHR 2HK7A 2C7GA 3AJRA 3NGLA 4DL9A 5JC1A 1DFIA 1ZMOA 2YZ7A 3O4RA 1ZK2A 4A0SA 4JBIA 3WNQA 3MWEB 3DBRB 2OBNA 2IE0A 3HDJA 5TLSA 2FN7A 1PSDA 2CDBA 3AI3A 4NPCA 4E4YA 2C5EA 1VRWA 2VWPA 4TRMA 3HB5X 3JSAA 4YDRA 4XYBA 4CR6A 4GMFA 3BMQB 2B69A 3AFNA 5TSDA 4IY1A 1MC5A 4WLVA 4BO8A 1DEHA 4NNJA 3H8VA 5JXWA 5DCWA 4EEZA 2I5PO 1U3TA 5MDHA 4D41A 1Z74A 2YUTA 3ZWVA 4J6FA 5L7TA 1KVUA 1YDWA 1EDZA 3F3SA 4Z9YA 1Q0LA 3P19A 5CEJA 2VWHA 2C0CA 1SC6A 3L6OO 1P77A 4BV8A 1ZJZA 4WCFB 4ZQFA 4O59O 1NQOA 3GZ4A 3ZWAA 1B14A 1GZ4A 4DC0A 1C0PA 3WYCA 3GPIA 2NWQA 1VE9A 2Y66A 1R4NA 4LMPA 2W98A 2VRBA 1U4SA 2B4QA 5HTOA 4R4JA 2JKVA 4PLTA 4ILKA 4B4OA 1PJQA 3PQDA 2QRLA 3QA9A 3IP1A 5IDXA 5G0WA 4IGEA 3TZ6A 2EF1A 4CM3A 5JS6A 2OBYA 4JNKA 4EYEA 2F1KA 3PJGA 2P5UA 2PGDA 1AGNA 5J23A 5L4LA 3GDFA 3HNPA 3EAGA 4ZJUA 3I1JA 5BQFA 4MIOA 4N5MA 5JY1A 4JBGA 1R12A 2Y1FA 3I52A 3GVXA 3PWZA 5K0ZA 4GSLA 4C7KA 3PFFA 3RCBA 2ZB7A 3W6UA 1EFKA 1G0OA 5CPFA 3VH3A 2HJRA 5TIIA 1U3UA 2D2IA 2X23A 5BSHA 3HZZA 4WCFC 1NVTA 4OKIA 3GEGA 4N5NA 2XXBA 3NRCA 2OO5A 3F4LA 2VTEA 4LMRA 3GVHA 1R4MB 5GZ1A 1NPTO 4IIUA 4PLCA 1B8UA 5BSFA 4ALMA 2BI7A 1BW9A 1Z45A 4D42A 3BXXA 5K6AA 1YL5A 1DIHA 2O3QA 2X6TA 4GL4A 5EQFA 1G6KA 3OJOA 2RH8A 1QP8A 1X0XA 5GMOA 5IN5A 1A9ZA 1Y81A 2CZCA 2D5CA 3L0DA 3LT0A 1HYGA 2UUOA 3I9KA 4FJ2A 1WWKA 5A02A 1MLDA 3FPLA 5TF4A 4R1UA 1T4BA 4ND2A 4WLEA 3F5QA 3KLMX 3DBHA 3ICPA 3OQBA 4JGBA 3FTPA 1WNTA 1E6UA 3DBLB 3HSKA 1A5ZA 2JFHA 4FGSA 2EXXA 4BKPA 5KVQA 1ZSNA 5LC1A 2E4AA 5JYEA 1DFHA 1HZZA 5I9MA 4OMUA 4YTEA 4PG5A 2RHRA 3PHLA 1Y8RA 1Y1PA 4I5GA 3KLPX 4DWVA 1GPJA 1XQ6A 2WYWA 4CMIA 4UVDA 4P4LA 3Q2KA 1F14A 4PZEA 4FOSA 1C3VA 4YJGB 1MGOA 2DTEA 1LC0A 1NFRA 1HDOA 1XHLA 3DQPA 4PG6A 1DC5A 1YOVB 1UDAA 3KEQA 4Y6SA 4INAA 4B3JA 2VYVD 2ZYAA 2I6TA 1XYGA 4WUVA 2C29D 1WDKA 1NVMB 3JQ7B 4RF3A 4B7UA 3GVIA 2UUPA 3UCEA 2EJVA 1YKFA 5KVCA 2HSDA 3WBFA 4J2HA 3PRJA 1ZO8A 1F8FA 4J1TA 4YAEA 2JAPA 1PQUA 1R66A 4BGVA 1SPXA 4Z9FA 1EEHA 3RJ9A 4BKOA 1DOHA 4R9RA 1E1LA 4NDNE 2GYYA 3D7LA 1ISIA 4X54A 2H1SA 4IQ0A 4XYLA 2NQ8A 3H9UA 4YT8A 1E7RA 3RFXA 3WQQA 4YJHA 3LT1A 3QY9A 1QR6A 3GDGA 4IDEA 1GR0A 4UEKA 3O03A 1GU7A 4DC1A 3LVFO 5IZ4A 1JAXA 5JW6A 2DPGA 1P1JA 3KTDA 3GOHA 1SZJG 1ZZEA 4XB1A 5JAQA 1MUUA 1FDTA 3UHAA 4L0QA 5B4VA 1AXGA 3A4VA 3RUCA 5CG1A 3GGOA 1DIBA 4M49A 1QSGA 1B16A 2C07A 4FSHA 2X9VA 4CL3A 1KY5A 3RI3A 1NAIA 3COSA 1QV6A 1Y9EA 4Z3DA 1ARZA 4F6CA 1YBVA 4NJMA 3M2PA 4ZVVA 2F00A 1NYTA 3DFUA 4HXYA 1HE3A 3IL2A 4CMBA 2JAHA 3PYXA 2Y68A 3KHUA 1DJNA 4L75A 3JQBC 4A2CA 5A1TA 4Y98A 3JQAA 3DOJA 2VN8A 1JKIA 2B0JA 2GGSA 1DRVA 1CIVA 1IULA 4BNFA 4DQVA 4IMPA 4BKQA 4DYVA 1QORA 3G79A 3GNSA 4B3HA 2OHXA 4KUHA 3DMYA 2VHWA 4AJNA 3WGYA 3EHEA 1EBFA 4L73A 4BO7A 2GUGA 1DC3A 4YT4A 3ONDA 4YT2A 2XOXA 4K9DA 4QFCA 1B3BA 1LDEA 3AU9A 2GPTA 3OA0A 4M86A 4OQZA 4URFA 4D3SA 5G0VA 1U4OA 8LDHA 5CPBA 3JQCA 2HU2A 5TNXA 2AE2A 4XCVA 1MFZA 4WE3A 4RO0A 4LK3A 4FJ0A 2VHVA 1E0DA 4BO3A 1GV0A 2W2KB 4K6FA 3IDSA 3A28A 4MPDA 1ENZA 1LLQA 2CF5A 2GDZA 2OP0A 3IOYA 3O8QB 4MP6A 4XGNA 3ZV5A 3L9XA 5CDTA 3HG7A 1B8VA 1EVIA 1ZCJA 4XWYA 4YRBA 1KC3A 2CVOA 3S1LA 3NJ4A 3Q6IA 3TQHA 1LLUA 1Y8QA 2XAAA 4J3FA 1U2GA 4TZKA 2BKAA 2B36A 4JXKA 5KNLA 2VT3A 1PGOA 4BO1A 5IDQA 3NV9A 3JQ6A 2IZ1A 2IYPA 4GQAA 3PYMA 3EDMA 4YBZA 3WOHA 3AK4A 3W8FA 1E3IA 1LNQA 4G5HA 2BELA 2J5KA 1E7QA 1LDGA 1YWGO 1YRLA 3LC1O 3NT5A 3IJPA 2Q2WA 3AI1A 4CLRA 1FDWA 1ZMTA 1ZSYA 2HMWA 2J6IA 3WS7A 1PTJA 2FZWA 4W4TA 1ENYA 4XYMA 4B8ZA 1H94A 5KWEA 1MP0A 2ZJ1A 3I4CA 1E3SA 2X0RA 5GZ6A 1GYRA 5IF3A 1KS9A 2VCYA 4RVDA 1Z7EA 1E6WA 1JN0A 2PGLA 3INRA 4CR8A 1CERA 3CXRA 1ID1A 3ZWNA 1GQ2A 2JL1A 5T8KC 2Y1DA 3LQFA 4RQTA 3CPSA 1CQIA 3EY4A 5CDYA 1E6EA 2QYSA 3PGXA 4W82A 2Y0CA 3VTZA 3AUAA 3PHIA 1GYQA 4WECA 4XGKA 4YQZA 1LBEA 3U4IA 1CYDA 1X0VA 2DBQA 4DPKA 4CUKA 1B7GO 1ONNA 1GUYA 1SB8A 2J5QA 4IDBA 1NQAO 4TZTA 3QP9A 4HBGA 2NM0A 3ITDA 3JD1A 4F3YA 4I9NA 2VNAA 2Q3EA 4FFLA 3AOEC 3INTA 1YO6A 4QT0A 2PWZA 2X5OA 4MVJP 2PTGA 2JJYA 2D4AA 2PKRA 2EIHA 4B7XA 3WGZA 4CM8B 1UZNA 3WYEA 3BYZA 1SMKA 1DHTA 5CP8A 4IDGA 2YW9A 3E5RA 1EVYA 4IINA 4AJ2A 5AOVA 1DBVO 3Q2IA 4R51A 4HNHA 3V1TC 3H9JA 4QO7A 3L4SO 3I23A 4UUMA 2UYYA 1HDCA 1J5PA 1LSOA 1FJHA 4JJIA 4E2XA 3WYBA 4TRRA 3UKOA 2J3IA 3OM9A 4OOFA 4UUNA 4AJEA 3RU9A 3C1OA 1ZK1A 2CFCA 1C1XA 1LLCA 3ROQA 4PZCA 3MTJA 3LK7A 4CM4B 3ANNA 2PA3A 1RKXA 2X0NA 1GEEA 3EGOA 5DBFA 1MA0A 1QV7A 1SBYA 2Q50A 5I7FA 1R0SA 3CMCO 4FD3A 5I9LA 2BGMA 3MJCA 4ZQHA 4Z0PA 4MVJE 2Y1GA 2PLAA 1X7GA 5ICSA 4CQLA 1PWXA 4DRYA 5KJCA 1IZ0A 2PD3A 1UXJA 2FPIA 1E3EA 2E6UX 4PLYA 3BMOB 3ST7A 4E32A 3P7MA 3IKTA 3WWYA 1UXHA 2VUUA 5JDIA 2O3TA 4GGOA 3NTRA 5L95A 4WNIA 1ENOA 4Q3CA 4CLOA 4NR0A 2QIOA 1XU7A 3DBVO 1D3AA 3RAJA 4J1NA 4WEOA 3EC7A 2Q45A 4CQMA 4CM9D 2NUAA 1T25A 1QKIA 3VVBA 1DFGA 1PL6A 3S2FA 1MFPA 2VYVA 5F3RA 4ZHSA 4YJFA 4EJ6A 2X0JA 4R9SA 1LXCA 3JTMA 3W6ZA 2GCGA 2ILTA 2EEZA 1RM0A 3FNFA 2EHDA 3DZBA 1F0YA 1YQGA 1ISMA 1JTVA 2FSSA 2J3KA 4I9UA 2AXQA 5C7IO 3CZMA 2O4UX 1W6UA 4YAJA 2OXIA 4RQUA 1FK8A 2Y0EA 1NP3A 2GN9A 1PJBA 1NASA 4IXTA 4DMLA 2ZATA 4DLAA 1HLPA 1V3UA 2OORA 1QYCA 3DBRA 3GMDA 2D5AA 2E48A 3DR3A 1GPDG 1VSUA 5AYVA 3FHLA 4OIMA 2YFQA 3UH1A 3FWNA 3VAZA 4KZPA 2W90A 4A73A 3C7DB 4MKRA 3SX2A 4QECA 3WTBA 2UDPA 3ZGYA 3BMQA 1RJWA 3RASA 1GADO 2VYNA 3JD0A 4RVSA 4YB8A 4W7HA 3NYWA 2VUSA 3B70A 5C7OO 2X1HA 3GFGA 5JAIA 1DC6A 3B1FA 5JAMA 4EZBA 1GAEO 4BKRA 3VH4A 2H6EA 4UREA 3QWFA 1H6CA 2EKLA 1Z73A 3ZV6A 3WMWA 5DOVA 4QUKA 3OJ0A 3RBXA 2QZ9A 4UULA 5AXAA 5HS4A 4LVUA 4DIBA 4WCFA 3PHHA 1DLIA 4BO9A 5IDYA 2WWRA 1P9LA 3S55A 2CSUA 2EGHA 4TVBA 4II3A 3U0BA 3JQFC 2WM3A 3HUDA 1XG5A 2GZ1A 3KV3O 3ETGA 4TWRA 5ES3A 3SC4A 4EW6A 3LC7O 2G0TA 1ISHA 3NKLA 4RPJA 2E49A 4YQYA 1UZLA 2A94A 1C1DB 4TSKA 3AOGA 2X22A 1DDOA 1PR9A 3PHGA 1U2DA 2LDXA 3TZHA 1NR7A 3JQ8A 3OIGA 4P8RA 4GWKA 4Z0HO 1BHSA 1SAYA 3H9EO 4IJKA 1AHHA 1HE2A 5L53A 1A7KA 2PKQP 1PL7A 3LT4A 1TT7A 4O1MA 1TEHA 1CDOA 4YVFA 5TT1A 5JMPA 1DJQA 1KEWA 1UUFA 4FFRA 3TL2A 3DOCA 1CRWG 3M1AA 3WWZA 3PXXA 4GBJA 5G0TA 4YT5A 1P74A 4AL4A 1HE5A 1FDUA 1SO8A 3PJDA 1I30A 5HRUA 2VUTA 1PS9A 2DUUA 2FRDA 4QSMA 4Z9XA 4W99A 3U5TA 3ASUA 5U4QA 2EWMA 5DN9A 1A71A 2X5JO 1RM5A 1Q0HA 2QX7A 2X8LA 2A35A 1U7HA 4BNGA 1T2FA 1G1AA 4FB5A 3U3XA 3KUXA 5JSFA 3BZUA 1YXMA 4CM1A 3HFSA 3WLEA 3QIVA 1ZXBA 4BNVA 4F6LA 1YQXA 1O89A 4LVCA 3H3FA 3DDNA 3ZWOA 4BVAA 4OJNA 1ADGA 4UEOA 3JYQA 2ZB4A 4OH1A 4OSPA 1YL7A 4RLHA 1HDYA 3PQFA 3HQ4O 5F1OA 2NADA 2AMFA 4OQYA 4E3ZA 4QXMA 4B4WA 3ORFA 4IZIA 4I5DA 4CMEA 4LCEA 3ZNOA 3VH2A 2ZIZA 4EDFA 2HAEA 4RORA 3DBLA 2WEKA 2Q49A 2ZTMA 1HDGO 4RCVA 4BNJA 3ZWXA 2AHRA 1EE2A 4PLGA 4EJMA 4XD2A 5F5NA 1EVJA 2D1YA 1PJ4A 4E5KA 3ETEA 4FQ8A 3SVTA 4RF5A 3RD5A 3ZH2A 2B35A 2ZB3A 3AUUA 5KJFA 3JCZA 4JJGA 1ULSA 3WFJA 3OQ1A 3OA2A 4J9UE 3U62A 1TI7A 1IUKA 1IHXA 1HDRA 1I36A 5THKA 1BVRA 1I10A 4I5EA 4ROSA 3WGTA 4FPXA 4KP7A 2GASA 1U28A 4K1LA 1QYWA 4E21A 4H15A 1T1RA 4XR4A 1YOVA 2RBEA 2BI8A 3OECA 3QSGA 4IM7A 1LUAA 2Y0DA 3ZWYA 4BO0A 4DGSA 2EW2A 4PLPA 5JDIC 4I9HA 2D3TA 1K6XA 1VL6A 2VNSA 3ADOA 3HJAA 5BSEA 3JQ7A 7ADHA 1M66A 2X0IA 3L77A 1EQUA 1W8DA 1U3WA 3H9QA 3BMNB 5IJZA 4P22A 1KYQA 2NVBA 3FCOA 4G81A 4K26A 1GFSA 1HL3A 3FI9A 5L9AA 1JW9B 2RIRA 1GY8A 4I1IA 3K96A 3RC1A 1EDOA 5IN4A 1LI4A 3KOUA 2WE7A 3JQBA 1PL8A 5A9SB 1G0NA 5KIAA 3LU1A 4J7UA 2WDZA 5DULA 7MDHA 2O3RA 3DL2A 1BXKA 4WLUA 2Q46A 4XZ3A 1F17A 1B3RA 4NU6A 2I65A 4D0RA 1M75A 4Z3KA 2JD1A 4PZDA 2HUNA 3KXDA 5EIOA 4M54A 1U3VA 4EBFA 2X5KO 1X15A 4YAKA 5DP2A 3C1AA 1P31A 4J0EA 4BNZA 1KBZA 1ADCA 2P2SA 4YCAA 3BAZA 1PQWA 4CV1A 2AW5A 4IDAA 2OZPA 3DO5A 4YACA 1BSVA 3HHPA 3V2HA 2PZMA 4ZU3A 3WFIA 2VRCA 2PZJA 3CKYA 3WICA 3HDYA 1LJ8A 4RPHA 5DCUA 1PGNA 1T26A 4YPOA 4XDZA 1W0CA 2PH5A 2DLDA 3AUSA 4MJLA 1HYEA 1PS0A 3LDHA 4GSKA 3U4HA 3FNHA 3PI7A 3NTOA 4OGWA 1JAYA 4K6CA 2ZTUA 4Q3DA 5BNFA 3ZWWA 3DB2A 2A92A 4E0BA 3VDQA 1KERA 3WXBA 1VJ0A 3VZSA 4RZIA 4NFHA 3RJ5A 1YQDA 3K2EA 3WMXA 5ER9A 3I4FA 4N54A 5G4KB 4YXFA 5DP1A 3DHNA 4GX2A 3RBVA 4H7PA 1DRUA 3H7AA 3S2IA 4FCCA 3TFOA 1V6AA 1OMOA 1Y9AA 2AE1A 3AM4A 3BHIA 4OXYA 3UW3A 3FD8A 1ADBA 1KEUA 1O0SA 1U1IA 2CDAA 2O4CA 2P4HX 3FNGA 3IP3A 4WEQA 5A06A 3UXYA 5ADHA 2QG4A 4TROA 3WLFA 3GQVA 1FXSA 4WKGA 3H9GA 4A7PA 2V6GA 3I9OA 3IIEA 4UUOA 3RVDA 2DPHA 2EGGA 1U5CA 4XIJA 1P44A 2OOSA 1K2WA 2HJSA 2Q1UA 1T24A 4FIZA 5IDWA 1H9AA 3ANLA 4BB6A 1N92A 2V6BA 1ISJA 4FFMA 1PGPA 1ORRA 3DZGA 3G17A 3O8QA 1E7WA 2W4QA 2GN4A 3QQPA 3R1IA 4KUEA 2AEMA 4MVJD 4OXNA 3N58A 3P2OA 3GGGA 5T8KA 1T2CA 5IFLA 1K0UA 3QE3A 5I9NA 1TVEA 2GSDA 3GH3A 4KUGA 4RVUA 1DRWA 3GN2A 3TZKA 4CMGA 4PLHA 4BUCA 2PR2A 4AJHA 3AY6A 4OKNA 1Z7BA 3GR6A 3Q9NA 4DTIA 5FWNA 5KJ1A 3UF0A 3D64A 1YL6A 4IQ8A 4U5QA 4EUHA 3MTGA 3E03A 4E2YA 2PKQO 4D44A 4L4RA 3C7AA 3ZHYA 1V8BA 4NIMA 1LQUA 2DBRA 3AOEA 5JY6A 3UAGA 4FOOA 4QTZA 4M87A 3F5SA 3MCVA 3G0OA 2DFVA 3K30A 3OIDA 4RVGA 5KKAA 4NBRA 4U6SA
chains in the Genus database with same CATH superfamily
2H48A 3P5BA 1RXYA 4Q37A 5FEMA 1N6LA 1W19A 2QG6A 4CF4A 2DPXA 4Y67A 4RPIA 1K5HA 2Q41A 3UN1A 4BEWA 3I9V1 4DMCA 3ZJVA 1UPCA 2QTTA 2FOXA 5A3VA 5AKHA 2UYGA 4R54A 3MWJA 1YZUA 1J22A 2K2WA 4X71A 4CM5A 2OWEA 3ER8A 1FDRA 3TSOA 1RAFA 3NEYA 2LIVA 2C2WA 1JQBA 2RKOA 5HCNA 5HFAA 3IR5A 1VGQA 1A4RA 4PIMA 5BN4B 1XUOA 5D3MB 1JHDA 1MT3A 2VKTA 4MUNA 1X70A 3TBKA 2OILA 3GEHA 1HLDA 3GMIA 3JAWA 3EBPA 4TT3D 2ZREA 2P77A 2TECE 2ZE7A 1BU8A 4AZ0B 1RYYA 1X39A 2Q2NA 3GJ4A 5BQ5A 4BWYA 5CFZA 1CP3A 1SQ6A 1KAQA 2HKIA 1RXVA 2J5RA 1E3LA 3PFWO 1KVTA 2YQ5A 2I67A 5JIBA 1PJ2A 1WY5A 4UEJA 3LRXA 4MYRA 5H02A 1B2RA 4AJLA 3TOSA 1K3FA 4ZOQI 3A6HA 4J75A 2GMWA 2C5FA 5E7JA 5EUCA 4I8XA 3LFTA 1ZI8A 3J81A 1EESA 2ZSIA 3DCNA 1QTNA 4NXMB 4MCAA 4K7JA 5IVKA 1CUUA 1XQYA 5T64A 3RUEA 1EGQA 3OZXA 3OLYA 3D9QX 4K88A 4D0SA 3HDTA 3OQJA 4FN5A 5HKBA 5JHHB 4OL9A 1Y7PA 4M89A 1IZZA 2GKGA 2IPMA 1JWBB 5C8YA 4MV4A 1JH9A 2X8BA 2QUBA 4R8RA 3SOPA 3IP7A 2YRXA 4JP3A 2O48X 3CN7A 3TTWA 2MIIA 1I6MA 3HB7A 1SHLA 2BYTA 4HQOA 3I2YX 1NTOA 3HV2A 2B5VA 3BFJA 4UCWA 5T7BA 3FNIA 1GOTA 1DIGA 1DHRA 3JVVA 2V6FA 2WHXA 3M6UA 3S8MA 2DXIA 4CBVA 3K70C 4XE5A 2IHYA 1PF7E 3UIEA 5K0EA 5AUPB 3ZCRA 3DPUA 2W48A 3WO0A 1PCXA 1D2GA 2REQA 3OPYI 5EKUA 3TUZC 5FX2A 3KAPA 3L9WA 3OH8A 1P7VA 3G3EA 2FYTA 4QZVA 3OZSA 3KL4A 1O97C 5GM1A 3OT1A 3UATA 1MEEA 2YY6A 1D6MA 4IZHA 4IOJA 4URXR 2A9PA 3B9QA 4Q1VA 4PCUA 1P0MA 1CUFA 1PT9A 1W2HA 2DSNA 2ZBEA 3WXMA 4R2IA 4RS3A 4NYMR 1J49A 2QAIA 3FJOA 5IULC 2B37A 3PEWA 3JQDA 1WA5A 5BSVA 1MJFA 4P3KA 4DLPA 1X7DA 3JWEA 4PINA 3R5JA 1BXGB 3EZ9A 1PFYA 4AJKA 4QJ4A 3AIIA 2OCGA 2OAGA 2BW0A 1AKEA 3OCUA 2XUQA 1G5QA 1XROA 3SICE 2CNKA 2RH9B 1FJGB 4WX2B 4YP5A 2J9FB 1NFQA 3MJ4A 2LRHA 4RD2A 1BA2A 2J3HA 2NU6B 4ONEA 4ZEXA 3U0VA 1T1JA 1FTYA 1ZKDA 4K9RA 1WX1A 2ZE8A 5KTRA 1OXMA 1XPUA 4BOYA 2X2OA 4J29A 1Z82A 1ZN9A 4DLKA 1EHIA 1G4UR 3E9YA 1CU1A 2R8XA 2D62A 4DCGA 4YUAA 3T06B 3ZDRA 5AW5A 1OFVA 1ZWKA 1N5RA 2AX3A 2NXWA 3UVEA 4ZI7B 1E2BA 2BGGA 3BXOA 2GZ2A 2CMKA 3PPWA 1V16A 3E6AA 4B4VA 2R0QC 3P9CA 4XM1A 5C2JB 4J0IA 2ZTHA 2BGLA 1VL8A 2H7VA 4AMUA 3JQQA 4JSRA 1SJ9A 2GBGA 4C0AC 4C7OB 3JYPA 1M1NB 4CCYA 3CKLA 3PEFA 3WLPA 5H81A 5FL3A 2CT8A 4P4UA 2JEZA 2YUIA 3T95A 4ILEA 1ZNQO 2VTDA 3O3CA 3A9WA 2YZNA 5LIRA 1JLLB 1W36D 1U0EA 2DWCA 1OPXA 2I34A 3UQYS 3N2ZB 3NHLA 2ZOSA 1K98A 2HL6A 5JR3A 2X2FA 2L0XA 5FWYB 3AF1A 4F3CA 4XUEA 5KQPA 3VYWA 3ZNQA 1SUEA 3L7OA 4JOBA 2WG2A 3ENQA 1EFPA 5AK6A 1JEDA 3ZN2A 1PZNA 3VKWA 1YK1A 1A8QA 1ECGA 1HL7A 3BGDA 3K9NA 3N53A 1Y8RB 1XTIA 2X8WA 3EYAA 3NWOA 4K9MA 1OI7A 4UTXA 3WQBA 3CX3A 5AW4A 1D2RA 5GONA 1R6DA 1U7OA 4B5LA 3QVLA 4PO9A 4CMIB 4X9XA 1TT5B 3OLQA 3RYCB 3FVWA 3GRYA 3PLNA 5DBIA 3EIWA 3KCNA 1OHHA 3GCWA 2X86A 4YEDA 3RTEA 5LP1A 4HYQA 3WQSB 2W0SA 4HDRB 5JSZA 1HG0A 3HCPA 3BRSA 1JLSA 3HKDB 4MIYA 3BTUA 4B4UA 1PSWA 1V45E 1X1CA 2CL7X 4LJRA 4ED9A 4PCVA 4AO6A 2G77B 1E2PA 6Q21A 4WD3A 3OCYA 3ROPA 3GLKA 1CRQA 3ANYB 1E32A 3D5EA 4HKTA 4A23A 1KZ1A 3BMCA 5IX8A 5BSGA 3UH0A 4BWFB 1YSCA 3MRXA 2C99A 3PDIA 1NDHA 4GP6A 3RUDA 2J0SA 4US1R 5JDCA 2DUJA 2HCRA 1Y8ZA 3RK1A 4IFBA 3FN4A 1DOAA 2NXEA 2VSOA 3D3EA 1W5FA 1EEXB 1M0WA 5IAJA 3ZOKA 2FUNB 4PLFA 5TY0A 3FCAA 1TTPB 4X91A 3HYNA 4R2JA 3RNLA 4BEJA 4DWWA 2BEVA 4LXQA 4QRIA 1DARA 1C1DA 2R4QA 4I4TF 5L4SA 1W0KA 5FFFA 8ADHA 2E82A 1U0TA 3TEFA 4TYNA 1X3SA 1ZIDA 1V8DA 2IS6A 1UWCA 2Q0XA 1YHZA 5E6RA 4XUCA 4EGJA 1VJRA 4WCVA 3SYTA 2HDNB 1K86A 1KH2A 1SUIA 2PFGA 1WQ4A 3EMBA 1JTFA 1WCWA 3WB1A 1Q0TA 1YVPA 2ORVA 2NU8A 1T2EA 1YTLA 4HQFA 5F33A 3F4KA 1J97A 5CLLA 5CFLA 5B4UA 2JGIA 3K15A 1DX9A 4RV9A 1PDOA 1YFKA 1XU9A 3PZBA 3H5IA 3QWBA 1EGMB 4XPIB 1AQNA 1OU0A 1K7XB 4O2AF 4KGXA 2XKAA 3C6BA 5HK8A 1T6XA 3DEYX 3A6PC 4TV9B 4XR9A 2PU5A 4JOCA 2VHUA 1H69A 3HEAA 1WUKS 2HSEA 4EABA 1A7JA 3RUHA 3TR6A 3TTSA 1EU1A 5DW3A 2WICA 3U6BA 4URWR 4NEQA 3SJCA 1W46A 1KMMA 4AUMA 3JY6A 4HGZA 4J91A 3E9NA 1YZKA 1EI9A 4QXRA 3I1YA 4TMVA 4DLWA 3QVJA 4KR3A 3G2PA 5DHRA 3OM8A 5IH7A 4FDLA 4CV0A 2WVAA 2X4LA 4DIFA 1NC1A 3VR6A 1T3GA 3FRJA 2HK8A 3NGMA 1QO0D 3KAJA 3MRTA 3P71T 4M9XA 2J87A 1HORA 4L2IB 5F2OA 1JZSA 5TQ0A 4RKQA 3RV4A 4RM2A 1NBWB 4DUYB 4MR7A 1P1HA 3UGQA 2YQZA 5ALYA 2A9JA 2XQKA 4D9FA 2J45A 4O4JF 3TLXA 4ND8B 3ECAA 3K31A 3TOXA 3W6OA 4DDMA 3PG5A 3D6TB 2GJ9A 4ISBA 1EUQA 2PSEA 3EN0A 3FIUA 5CA0B 5C3UA 1SVWA 1ZSVA 1T5OA 5IKOA 4JCOA 4OO3A 2JKYA 2GAAA 3KYDB 3MWLA 3O7WA 3C5HA 4KN9S 2OHGA 1E2DA 2F3SA 1Z26A 4YGYA 3VXKA 5DNAA 2G1PA 3AUXA 4WPGA 4ZAGA 2Z8YA 4LRTB 4MI9A 4AKHA 2WWWA 1C8LA 1QH8B 3MOGA 1XTRA 2HRZA 1O3YA 1E2EA 2GS9A 2W58A 3HDHA 3KV1A 2YASA 4MUIA 4QAJA 3R7WB 3VPAA 3HP4A 4Z1OA 3IBFA 1FCJA 1KIAA 2N1MA 1P9OA 3IYLW 3AHFA 3QIAA 5G1OA 4IH9A 3WKEA 3X2FA 2JD0A 4QODA 1RWVA 1QRDA 2VT2A 5EESA 1RLIA 2IOQA 3GFTA 1A9TA 3RVNA 1GT91 2MOKA 4G5YA 2WWTA 1H93A 2IYYA 3AEKA 3RIMA 3I9FA 4TKZA 5EWJB 1IXSB 2HQOA 4FK8A 3TB4A 1NMSA 4O2RA 3BK1A 4I1SA 4L0DA 5CAEB 4G0WA 2X4IA 2QIPA 2VEOA 3RSFA 1U6JA 4N18A 4MQFB 3AEQB 3N8NA 4V0ME 3SM9A 5CT6A 4K9SA 5L51A 4Q9NA 4JB2A 3GJ0A 1NX6A 1JX6A 4XI9A 3VR5D 3W90A 5LQUA 4RESA 1UQUA 1E2MA 4NYIR 3QGMA 4NJEB 3LGAA 1FPMA 1KJWA 1IAVA 5JOQA 1NHGA 4BYGA 3RFVA 1Q7CA 2C5BA 1JFRA 3UKJA 2D2EA 3ILYA 1MB3A 2BGKA 1Z8DA 2H59A 1VSTA 2QPOA 4AFNA 2WAAA 2IU0A 2X1LA 2ZKLA 5FWDA 4YJ2A 2OT3B 2Z30A 1GU0A 1K89A 3Q15C 3G1TA 4RU1A 3KG2A 2WYOA 4EHNA 4DQDA 4UE6A 2O3SA 2H4FA 1HRKA 4JUAA 3GELA 8OHMA 2P4QA 4RD0A 2IEZA 2ZLBA 1NDQA 2GZAA 4LYFA 2PPVA 4DA6A 1HRDA 4G1VA 3FUWA 4RKRA 1PS8A 1I80A 2DH6A 4X1IA 5DM1A 3I34X 4AZWA 4F5DA 1ABBA 1IHPA 1HBJA 2HXYA 1EWTA 3QYPA 4BECA 2XDYA 3BJIC 1XEXA 2PZLA 5CB4B 2HTEA 4HFRA 5LA6A 3ZU3A 1RQ2A 2VL7A 1E7MA 5BN3A 1LPSA 1ZIXA 1R0CA 2BEWA 1G8KA 2ZYHA 1EQ2A 3FW1A 3RKSA 1SCQA 3OQVA 1FDIA 2WZQA 3DZDA 5ENDA 4JOSA 3F6SA 5GY7A 1D4FA 1QNLA 3HJCA 4LWQA 4YFVA 3RC2A 1ZCBA 1WB4A 3AR8A 2FZ4A 4MMZB 1PNRA 4XKJA 4DLXA 4HNVA 3HXKA 3QFSA 3W04A 4DMRA 1Y5NA 2HA4A 1TXGA 2H9YA 1XD2A 2BM1A 3ABQB 1EUYA 1Q50A 1ENPA 2BP7A 4H6PA 1A0OA 3BULA 4M36A 2PT6A 1L4LA 4QDJA 2R79A 4FONA 4NDAA 4JXZA 4L8WB 1T1EA 3UT5A 3RSHA 3FSRA 4B7CA 4C7MA 4CIYA 4PEVA 1KZ6A 4G1BA 4DJTA 1WETA 4NCAA 1X3LA 2QLBA 1U8CB 3ZV4A 1ZNWA 4FC6A 3H86A 1OFTA 3FFTA 4IQ4A 2AKEA 1J7KA 1ZOIA 4RHYA 3VC2A 3TNYA 4Y7CA 2I2DA 3LCMA 1PJSA 1XKLA 3D1LA 1Q1GA 1A9YA 3I6MA 1H6DA 4BGUA 2FR8A 3E1SA 4HBZA 2PSHA 1I2BA 3TGWA 1VBNA 4D43A 1DE0A 1Z16A 3DDOA 5HOQA 1JWLA 3GAZA 2BGJA 5ALLA 5KHAA 2DUMA 1GQRA 2B2XA 4CIBA 3BH0A 1OLXB 1CLEA 1U0LA 4H59A 2H2DA 2O3JA 2V6JA 4BO4A 4WESB 4YWJA 2OBMA 1Y9DA 5IC5A 1DAHA 3LUAA 4F2GA 1OFUA 1U9IC 5CXUA 5EXXA 1MZVA 4PN3A 1NRXA 5TQVA 1PWEA 5KX5A 5EXSA 2K7FA 1BH6A 4MRPA 4RNDB 2AKAB 2QJFA 1VBMA 4O4LB 1YKGA 4X63A 3WK9A 4A10A 5COBA 3TQIA 1JR3E 2X7HA 2Y6VA 1N2BA 3E8MA 3PFNA 3VYTB 4BNKA 4KSCA 3AC0A 4XWTA 1S3GA 3DAGA 3I3SR 4IO1A 4GI1A 1ULTA 4F60A 1BD3A 2XA2A 4UOQA 1N5LA 1YIOA 1QZXA 2CJWA 4GLFA 4RY0A 2R4UA 4DLLA 1NLUA 7AT1A 4MX8A 1KRXA 1NW6A 2IOFK 3INGA 5LXTA 3L8CA 2OV8A 1WSWA 1QYDA 1Z5NA 1GTG1 2FG5A 4MUAA 4OF4A 1ZGAA 2P2LA 5DTIA 3VVLA 3ZDXB 3ZJ5A 2G17A 2YFKA 3KTAB 4IMJB 3USZA 3K1TA 4ABYA 1GO2A 3D5QA 1P1IA 2F17A 2Q6TA 5B1YA 3M4JA 3ZQUA 4HV4A 3C24A 1KOLA 3ZZTA 1XK6A 1R16A 2A4KA 3G0BA 5A03A 3U4GA 5ADWA 5KOJA 3AQ4A 3NR2A 4RA6B 4E2WA 1XDWA 5DT9A 1S96A 4B2IA 4P33A 1I5EA 2BCJQ 2JBAB 2BONA 4NOMA 4KBYA 3W05A 1Y8AA 1YE5A 2DHRA 4AULA 4NONA 3IKVA 4PZUA 5M04A 3K6SA 3KUUA 2IKSA 1KNXA 1CR2A 2EEPA 1AH2A 1JPJA 1I3OA 1T8WA 4WGFA 4MVCA 1JDVA 1QRAA 4GKVA 1QF9A 4EJSB 1Z39A 1YAHA 4LDRA 4RJKA 5A04A 3BTOA 2Q0HA 5C51B 2C4VA 3A70A 3DT6A 1F12A 1PZMA 4HO1X 4O2BB 4XJVA 2OCBA 2H29A 2A1IA 3HCDA 2QJWA 4IYJA 4P36A 2XHZA 2JNWA 2LR0A 4JYCA 2BZ1A 1L5LA 1ZRSA 1MJGA 4QKQA 4YHBA 3AESB 3Q0EA 2YTZA 3BWXA 1A27A 1JSRA 3ESBA 3HLTA 3S2GA 4DLZA 5C7LO 5M34A 4NPAA 4X20B 4H35A 1H5QA 4C7JA 1WZUA 3UV3A 4NDZA 4B5KA 2GXUA 1I33A 1YBAA 2XRYA 2NU9A 3QXJA 5EZSA 1CS0B 4IGFA 1K68A 4A1FA 3LHIA 3G0HA 1F2UB 1GZ3A 2R00C 1WV1A 5F9HA 1B6SA 1QIIA 4YYZA 1N6PA 5A3JA 1DXYA 2EERA 2VJDA 3R5FA 4EUEA 2JLXA 1U8XX 3OG9A 4A0FA 4OQEA 3QW4B 5SYNA 2F64A 4RH0A 4JA2A 4PQYA 1YF3A 1UJMA 1RRKA 3L7AA 1OOEA 2GLUA 3TN7A 1PG0A 3TCXB 4CMJA 4E5SA 2HQSA 4FDUA 1BIFA 5CFRA 4Q4JA 3JASB 2ZR9A 3BKXA 3DHWC 5HW0A 2C9MA 3TJZA 1D7OA 3FPSA 1A7AA 1HEUA 2OLJA 2V7XA 3H5NA 3KPWA 3JAMA 4OFBA 3IUPA 3RYIA 4AUNA 2JLBA 5C8ZA 3S2EA 3AF6A 2H9IA 4PG8A 4WXMA 3C6QA 1IJEA 3Q7RA 1AXEA 2IT1A 1LBSA 1X80B 4P7FA 4BJHB 4CM6A 4GXNA 4I50A 1I24A 4QYWA 2OFFA 3KD2A 2AC2A 2OGUA 4RK6A 3MFYA 4NXNB 5JAZA 2QOEA 1Z4NA 4IWXA 4JIGA 4F06A 3O92A 2PMDA 3ED1A 5AKEA 1QTIA 1SG0A 1CF2O 2I54A 1CWUA 2C5AA 2ORIA 2V9CA 2CNDA 5MF6A 4PN7A 2HRDA 1MQ9A 4UBIA 4F2DA 3IAAA 5AW0A 3V2UA 2C98A 4UVIA 1JIUA 1PT8A 1WB5A 2WF7A 4AS3A 4BGEA 2WWHA 2YX1A 1RXIA 1M1ZA 1X7WB 2ZRFA 3DCIA 4GKBA 1TLFA 1NNI1 3MLEA 4EJ2A 1JTEA 3JQ8B 3I83A 4O5AA 3ONEA 4OXXA 1N2ZA 3KLNA 1KHHA 2H2FA 3GT0A 1ZISA 2NV0A 1M54A 2Q8PA 3D8SA 2Z8YM 3EGXA 3PGVA 2YN0A 5F98A 1SD2A 3DZFA 3PTLA 4KYUA 3T61A 3OZUA 1IIBA 4R1NA 1ZUD1 3LVBA 3WGOA 6ABPA 2RI1A 2NQTA 3Q3CA 3RLFA 4OVKA 2ZJ4A 4F4JA 1U1CA 3TNDA 4QYSA 4BNIA 1D2CA 3GROA 2E21A 1NTRA 1FUYB 5FOWA 4RJIA 3AXSA 3SG0A 3H3JA 1S8AA 3G2JA 2AJ8A 4AYXA 1ZK4A 1R8YA 4V0SA 2AJBA 4DMFA 5GADl 3A1WA 4RTSA 1W36B 4R0MA 3F3YA 1YBMA 3C3AA 4EFKA 2D1FA 4FSDA 4IXDA 4DSUA 1Y98A 2QGNA 2CD9A 3BFXA 1YZFA 4IDFA 4G41A 2J3EA 1UIRA 2CJFA 3W7BA 4ND7A 2VZEA 1SUPA 4HVTA 2GAOA 1IOWA 4KWTA 4BL5A 3GZNA 4E5NA 1OXXK 4CDRA 4QYIA 2Y99A 3A11A 3V1NA 4B4KA 3E5MA 4R83A 5JCXA 4N6NA 3N76A 4KQCA 2P6PA 4UMEA 3GEIA 2XKKA 4C22A 2MSNA 3A14A 3CTMA 4MB2A 3ZU5A 3I2GA 1CUHA 4WLNA 5GAJA 3OEWA 3ADKA 4LBYA 2B4TO 2YBDA 1LPPA 2X9NA 2WKWA 3UENA 1I3NA 3SC2B 1QHSA 2GPAA 4XQ9A 3U26A 1I7NA 3VBEA 3X44A 5AW3A 2NO4A 3IURA 4P3XA 3JWIA 1W581 4FXOA 4B35A 4QC2A 3ZQ6A 4XFKA 2O50A 5EVJA 1E59A 4JX8A 3F1KA 3C3CA 1RC0A 4KIFA 1ETUA 1MAAA 2CWDA 1EG2A 3M81A 4HUJA 2FNAA 3ANSA 3WGGA 1RKBA 3QJGA 1NFFA 3N2GB 3SQDA 2IEIA 1CUEA 1X1EA 2C83A 2YXEA 2YXBA 3H8JA 2W8BA 5A3SA 2IYTA 1XMQB 1MOZA 2IQIA 4KQ9A 4M0FA 3H11A 4UBKA 4CKEB 5LZ7A 4WZBA 4EAAA 4YCLA 1W36C 2GTPA 1TAQA 2WMYA 3CLHA 4CHTA 5E38A 1R0YA 1ZVKA 4RHUA 5BN5A 1E2LA 1YJ8A 5LMZA 2IXAA 3KYCA 4MS1A 2I2WA 2IF2A 1J6UA 1JAZA 1CEXA 3PKJA 4N5HX 3H1TA 3JW8A 3LP6A 5FPPA 1N2XA 2CHVA 2FN8A 4JC5A 4YN3A 4E2ZA 2Q6LA 4RJ2A 3WK8A 4NC9A 4EG5A 1J2JA 1N6HA 3AU8A 3NT4A 1N0IA 2J41A 4IDCA 4MUGA 5LP6C 4CQMD 2W6CX 4NZYA 4JFRA 3MZ0A 4N7BA 1E92A 5AXCA 4DBZA 2V0NA 1RM4A 3AP2A 5KYYA 3QPWA 1VYTA 4C0BA 4TLEA 5CLQA 4IIJB 3NC0C 2Y1EA 4ODIA 3U48A 3QNWA 4Q66C 2N9UA 4UQLA 3HB1A 3Q9SA 1XQ1A 2P9TA 4RCYA 2XVMA 5EERA 4XUGB 1MOQA 1YR7A 1EFLA 4B73A 4W5OA 1JAHA 4RTMA 1SUAA 3FFXA 221PA 3GG2A 4WCDA 2MSLA 4OHUA 1XMOB 1UZAA 5HKLA 2B2NA 4M0PA 3K94A 4OHKA 4KFCA 3P2YA 1DQRA 3P2KA 2FPGA 1QPBA 2ZAOA 2ZB8A 4FS3A 4URUR 3H4VA 4R1PA 2C7RA 1KZGB 2PX2A 1H2YA 1W1UA 2G1UA 4WN9B 1CXZA 5EQDA 3TDKA 5JISA 1S01A 3JYOA 4I1PA 1W2WB 4MQ4A 2NPFA 3KQLA 3L7KA 4LISA 4AYWA 3WJ1A 4FINA 2A9VA 2GN0A 1DAPA 3GIDA 3LH5A 4PZLA 5CYPA 4H0CA 3AZQA 2XSZA 3AEYA 2BRUC 4QUHA 3OU7A 4G0NA 4R6WA 3HGMA 4UBLA 3RK4A 3RYFA 4BKUA 3UWSA 2UUAB 3JYNA 4UDXX 1D8TA 4XVUA 1XRQA 2IYFA 1CC1S 2GA9A 4J7CA 1QFJA 1T3ZA 3KFVA 4CU5A 2C5LA 2CVHA 2VYND 2DBZA 4J03A 3AWDA 5ILGA 5KTMA 2QY9A 3IR6A 2AHOA 1T9DA 1C0KA 1YVRA 1NBMA 3NUQA 9LDTA 4DPLA 4X7PA 4Z4CA 4OIFA 2WOJA 2Q5IA 5BNWA 4YLEA 1P7PA 2UAGA 2C2BA 2V9PA 3IIIA 3MJDA 3K3PA 3F6EX 4ER3A 4GPTA 4EHJA 1ND5A 2BHLA 1JHXA 3CB2A 4KI7A 3EODA 2NTEA 4X90A 5AW1A 2R1TA 1YMUA 4ZAZA 3GRPA 1P60A 4CG1A 3E7XA 3H9BA 4PHTA 2G5TA 3W8DA 1FXUA 5EP2A 3D6HA 1QCZA 1WCXA 3MNFA 3O2NA 3RVQA 3SI7A 5BP7A 5AQ1A 1ORDA 1J8VA 2YH2A 1KO8A 4N82A 3RG8A 5CVUA 5IARA 4DLYA 1P91A 1Z6GA 3EA0A 4GXTA 4HSEA 3UG6A 5JC8A 3SDSA 2XB9A 4HFJA 1A9XA 2JLRA 5I8PA 3AHHA 3GXOA 3K8ZA 1L4UA 4DA9A 1H22A 2QT9A 3ER6A 2HH9A 3EQ7A 1Y4UA 3O4GA 4NE7A 5IM4F 3R8FA 4KW7A 1XTPA 3H1GA 2BZGA 2J67A 4UQPA 5KMGA 3LT5A 1H2BA 1KR5A 5G1PA 3NH9A 3KXKA 3TWOA 3P4UA 2NAFA 4TTVA 5JBIA 2OCKA 3IMKA 4LI0A 1L4EA 2V7EA 1REQB 2HU7A 4RDHA 4S3MA 1T9KA 1U0JA 1TFUA 2R9VA 4D79A 3SVZA 4RTNA 3WGHA 1LRLA 1M83A 2YZGA 1MJGM 2I55A 3A9RA 4IGKA 1G20E 4FYKA 4EQZA 2P9GA 2R7LA 1MDFA 2DFPA 2PK3A 3UMCA 1P1RA 4TQUS 1E7SA 3W5UA 2Z1NA 1IEXA 3H42B 4D3DA 4LY6A 1V6SA 2VSQA 4IFIA 3V9PA 3UPTA 5E1DA 3L6EA 3BCHA 1KQOA 5FLYA 4YV0A 2XEDA 3BXHA 3ECSA 3IILA 4MO2A 2BR4A 3UJ7A 1XHEA 3LIPA 1K0FA 1JR3D 2OLEA 3M3HA 4Z8XA 4CKYA 1JEQA 3OQ6A 1QLHA 4DCSA 1X86B 4B80A 5ERYA 1WUJS 3R2JA 4A6DA 2WLSA 3NXKA 1OYWA 1SOVA 3K0FB 1O5IA 1YS6A 1SOUA 2RJNA 4OM8A 1II9A 2KW5A 4WBNB 1YZYA 3PPYA 2Q1WA 1NU6A 4NH4A 1N4DA 5D87A 4IJ5A 8MHTA 4DLSA 2O2IA 1R8QA 3MWFA 4KN6A 5FR2A 3V7WA 4AD8A 1SCJA 3FHJA 4OI2A 4TV8F 4ALJA 2YHIA 4CVNA 3CX6A 4QLBA 1L8LA 1K63A 4ZPXA 2V3CC 2DLCX 2I3BA 4IQGA 2A84A 1TCVA 4IIXA 3CNQS 3HH8A 3QUCA 2ID7A 1MRZA 5DM60 5KYUB 1UL1X 5K6AC 5LN1A 1JZTA 2NP7A 2ZIUB 1YZNA 4Q3NA 3SXUB 3N8KA 4P4SA 4RIGA 3U9SA 3VOSA 2C7OA 4ADSG 1SU4A 2CLDX 2WABA 2DHEA 2IC5A 1YS2X 2H2IA 1QHYA 1QE0A 3VO1A 4QNNA 3FOFC 3ZJTA 4KQGA 2AJLI 1JA1A 3HJFA 4DDHA 3KZMA 3ROFA 2ANBA 1LDMA 1ORIA 2QRPA 3EZLA 3GJSA 4M1EA 4I0WB 2QMZA 3H5WA 3PXAA 5IYZB 1EX6A 4A8JA 2RAFA 4ZDIA 2OVBA 4B2LA 1N78A 1WHSA 4ZVOA 4GSYA 5LMUB 4QUGA 1MPXA 5EEGA 1LTKA 1ABFA 1TJ4A 3N7UA 3PNYA 1PR3A 1U2RA 3GK3A 1UP6A 1F9EA 2QGZA 5A6SB 2H5LA 3KOZA 4H0FA 1JYFA 4DILA 4YCDA 1AK2A 2OSVA 3WWOA 4JT2A 2Q6VA 2RDMA 3OFJA 4L8LA 5KC9A 3OQOA 1W85B 1AKNA 4MOWA 1KARA 1XZAA 1FNCA 4P35A 5K0GA 5BYAA 2GVDC 1M33A 4LXIA 4QOHA 1EE1A 1YC2A 1EUDB 2Q4RA 1LRKA 1N9GA 2QRGA 3ISJA 3ONVA 3LA6A 4G9EA 4EKDA 4W5NA 3LZCA 3QYFA 3NDIA 1ZM2A 3WAGA 5J5AA 2BD0A 1KDTA 5LDGA 2PFKA 1QJCA 2BLNA 3FH0A 3KS9A 2X8AA 4PBSA 3NT2A 4LY0A 2R8PA 1ZVMA 4YRDA 1PK8A 1OKKD 3D6VA 2A58A 1GUDA 3AJEA 3T9BA 5JD3A 3IBGA 3NYIA 2VXCA 1D6NA 1XD9A 3QJYA 4FEGA 4PQRA 3UCXA 3PA8A 5HIKA 4N9WA 2Y4NA 3BHMA 1L8QA 4NBVA 4L8FA 2X19A 1L7VC 2AC7A 5C52B 1GPYA 3MJFA 1Z5WA 1CVIA 1LK7A 3NRJA 3HVKA 4IV8A 4DOMA 2RMKA 1KXJA 2ECQA 3DTTA 4CDNA 4EI9A 5DNCA 1BAPA 4OYYA 3WYGA 4CKXA 3LWNA 4FDTA 1ULAA 1NQTA 1M76A 2YVAA 2ZUBA 4Q12A 3FYCA 2OFPA 1AT1A 4TWJA 4LKOA 1RYDA 1X8KA 1F4LA 2JGLA 3O0TA 3ZE0B 3CUVA 3I2HA 1DADA 2J4DA 1Y34E 1V3TA 2LWIA 3KVRA 4B75A 5A2GA 5CFQA 4LYEA 4RA9A 4M76B 3VI4B 3T1TA 5DMHA 4Z6KA 4J0FA 4HYYA 3PNMA 3ILSA 3PX3A 4I08A 2QMOA 1E1QA 1JDSA 3B89A 2QE7D 3PFIA 3ZEIA 2Z98A 4DS3A 1DUIA 5A6VA 1J24A 2HN9A 4FKBA 2H06A 2X7XA 5AQEA 1ECLA 2RCNA 2RI0A 4Q4CA 4R7GA 5B57C 4Q3OA 3T3OA 2WE8A 3V8PA 1FU7A 2IYXA 5LM3A 3E22A 4YJ3A 2VJYA 5F73A 4EGCB 2IJGX 5JBNA 3MCUA 3JQGA 3DD1A 3OOSA 1RFGE 1YMVA 2XQIA 1BD4A 3WLKX 4HGQA 2EP7A 4X24A 1RP7A 1KDVA 3TW8B 4B8WA 1JEEA 5LFAA 2C5GA 3BS4A 4MNTA 4P4TA 5TXGA 2C84A 3WWDA 4D46A 3WAKA 2BTEA 4HAXA 3FKSD 4QPZA 1GTRA 4EA6A 2QTAA 2GZ3A 2WTNA 1X38A 4HNSA 1UT5A 3K2IA 3PR1A 4BO5A 2CXPA 4DYDA 4M37A 1WBBA 3SDBA 2BKLA 4JWTA 1L8XA 5CXQA 3WGUA 5EIXA 4AQ7A 4XJTA 4MHOA 4NCNA 2P30A 4GECA 3E2MA 2Y05A 4FMDF 1VZ3A 5DHQA 3I5UA 1H4SA 1D1QA 4MRMB 3C41J 2FHSA 4IMRA 4J8PA 4MYHA 4QOIA 5IJXA 3U40A 4CKCB 1KPGA 5HRCA 4HFMA 4LC0A 3I6QA 5IUNC 1QG2A 1TZMA 3L1KA 3H2ZA 1Y7TA 1NQVA 1MENA 4RHTA 5HXAA 4O33A 4XQEA 4HJRA 2P5YA 5EHQA 4OJQA 1Y1RA 4ALLA 4XA8A 1ZEJA 4RM3A 2WFZA 1KP3A 2WIFA 1B15A 4JJEA 2FK7A 3TAUA 4E4RA 4P31A 3VUEA 2O2YA 1N77A 2UU9B 3QK7A 2B92A 4RZUA 3OKAA 3FTCA 1UBRS 3ZHSA 4UU8A 4TLBA 5F9FA 4R01A 3U7JA 3UMSA 4RZHA 2FI1A 2XF8A 3FI0A 4RFLA 4D57A 2FFHA 3QKRA 1OI4A 1E6CA 4JLSA 1P1KA 2WINI 3ZWPA 3DEIA 3L7LA 4KQHA 2FLWA 4DSOA 1E3WA 1L1EA 2K87A 4KGZA 2PS0A 2O5CA 2QVCA 3HWSA 1E1YA 1CQJA 1Y8CA 1ZH4A 3KVYA 3HP7A 2NTVA 4KMMA 3ADPA 1ULBA 1Z25A 4ND5A 3OMXA 1KEPA 1WHTA 1PYDA 2D2FA 4O3MA 2A14A 5FI5A 1G66A 2ZT6A 3CRQA 3MHPA 1UEIA 2PWBA 4XH9B 1YCHA 2O8BA 4OY3A 4PRYA 1IMJA 2ZM5A 3ET4A 3DYBA 4KI0A 4D82A 3LMKA 3PZRA 3P9ZA 2C2ZA 2GK6A 3PBKA 3PB3A 4M1OA 4MW4A 2GRJA 4QQFA 5AOBA 3SZOA 2XZDA 3O2JA 3OETA 3RVRA 4JI1B 5KVAA 1WXXA 1PJCA 3K4PA 2I7VA 3LX6A 5I7AA 1J0CA 3U7EB 1TEVA 1U2EA 4L74A 4AIIA 1SUDA 1DWUA 1DAGA 4MYCA 4L1KA 4QUIA 2BDUA 2CF6A 4D1YA 1YJQA 3INYA 2LDBA 1L5KA 4DJAA 2GJAA 1SB9A 3D4OA 4KN5A 3E9DA 5FUQA 1H6BA 1XSEA 4W5WA 5JWHA 4EG6A 4Y2UA 5MN4A 1MB9A 4GMGA 1U7WA 3QZUA 4TTRA 1P39A 2FP3A 5HZHA 3L4KA 3HA2A 2Z43A 4XDYA 4PRLA 4DSAA 2I2FA 1PTJC 2I29A 2ZRKA 1MJNA 1XYYA 4PRKA 3FBTA 4TZ6A 4QU8A 4C0KA 4PG7A 3IV6A 1RWXA 1YA8A 2C2XA 1D2NA 3GGPA 3KZKA 3N74A 4C43A 3OM1A 2YIMA 3U4AA 1WCYA 2KYRA 3GGJA 4ZTUB 4FHZA 1U5AA 3VHRA 1H2AS 2H2WA 2GNAA 4HMOA 4XQCA 2AOXA 5TJ9A 1ZH8A 1GYPA 2FP4A 3QUTA 4L50A 4AWBA 4F4DA 1LSSA 3L4JA 1OVMA 2IBSA 2ZIWB 4RW0A 2DFLA 3MTBA 4HMPA 1DG3A 2LZ0A 3GLGE 4JXJA 1OWLA 1F5NA 3WIVA 4BS9A 5AW6A 1SXJE 3G5TA 3ZR4B 5K8UA 2ZDQA 3F47A 3OHSX 3N6RA 3O4FA 5G0SA 4ZCIA 5GIOE 1H3EA 2ZQZA 3DFKA 3M1YA 1W49A 5AMXA 1GUZA 3SD7A 3DYVA 1UXOA 4BAGA 1PJ3A 4LPSA 4WXPA 1P29A 2ZAGA 3G2QA 5EXEA 1T5TA 4JA0A 3OHPA 3N0WA 5G02A 4AMYA 5C5IA 3S27A 1JFSA 1P9NA 1F8GA 3DEZA 1V11A 3BIJA 2NLOA 1SPBS 4H31A 2YKGA 2PWAA 2ZJYA 1QAMA 1YKSA 2HO5A 3CJRA 3FTQA 3IQZA 1QZUA 2VPTA 2VSXA 2Z5LA 4WNYA 5CJJA 4S12A 3L0SA 3WISA 3EPHA 4OMCA 2QAGB 4W5JA 1D8AA 4M7PA 3WZLA 2IZ0A 2NSHA 1J0XO 2O6LA 5E3IA 4ITUA 1XAGA 2XZTA 1BHJA 2AQ8A 4QO8A 1PLJA 4KXUA 1MCZA 1NYRA 2Z83A 3PF8A 4B31A 5LL6P 5HA5A 2M98A 3VPHA 2Q6OA 4B44A 4S05A 3V8BA 2FHPA 2G40A 3KR0A 3LQ4A 4WN3A 2X0EA 1RD4A 1MO2A 5FBKA 1XELA 2JFGA 2XMSA 3KCQA 4CQMB 1E5VA 1L5MA 2GF2A 4R69A 1S8FA 2XDQA 3DL0A 4MUKA 1GLVA 2Q9AA 2NUAB 4G65A 3MF4A 4M2LA 4WZAA 4E46A 4YP0A 2TRSB 3RTGA 2ZPTX 3B1ZA 1OILA 2AZDA 1SVIA 1IY8A 2B61A 3RHSA 3MWGA 1ZXLA 1R8JA 3VZQA 3KVVA 3AUTA 4NBTA 3EC2A 3WL3A 4LSWA 4MW5A 2YWRA 1XLVA 2OD7A 2NYUA 4JLNA 3O26A 1Z0DA 2JH9A 1LTHR 3LCVB 1ECBA 4QM6A 1POWA 2ATEA 4KAAA 4XQ0A 2J0QA 1DFIA 1ZMOA 2C7BA 1QCDA 1XNHA 3T7KA 5KTTA 2QAGC 3FPBA 3DEFA 4DLVA 3AUKA 4Q24A 2OBNA 4DCVA 3WA6A 2FN7A 1PSDA 4G63A 5AW7A 4NPCA 3ZCVA 4E4YA 1DO0A 2ZI7A 1JFFA 4TUYF 4K40A 3FDFA 2R6CA 3AINA 3R6GA 3ZWDA 4UTVA 1GGKA 2AYYA 2EOAA 3AFOA 2EKBA 4XYBA 4DJFC 1WUIS 3O91A 3CZCA 3OQPA 1U0OC 3KOMA 4IY1A 1XZEA 3PUHA 4WLVA 3TMKA 3M83A 1Z4LA 2E4VA 4E3WA 4ZEOA 1DEHA 5CGQB 4BO8A 2MCFA 1TM7E 4GNRA 2I5PO 4HB3A 1Y42X 5DCWA 5MDHA 1PG2A 2CE2X 2JFOA 4D41A 4NZOA 5F7ZA 4ZYWA 5L7TA 1J2TA 1KVUA 4LYGA 5ELLA 4Y2HA 4YALA 1SG9A 4Z9YA 4Z53A 1I4OA 2CKMA 2COUA 1FX0B 4V3CA 4N8EA 2XYHA 3F78A 3VOAA 1SC6A 3SR4A 4PZPA 1NJ1A 3TPFA 2R4TA 1QGZA 2E7ZA 5B2ZA 1MX9A 3VR4A 1YDHA 1GZ4A 4DC0A 2EFYA 1GA4A 4HEJA 2NWQA 1R4NA 3HUTA 3WO1A 4LMPA 4H27A 2IUUA 1N2OA 1Q11A 4MH0R 1UBMS 2VRBA 4GG1A 1LNSA 4DQ0A 4P53A 4TVSA 5HTOA 4PLTA 3KYJB 3IAM1 2UUCB 4F5EA 1FLNA 4B4OA 3PQDA 1CCWA 1GTVA 2QRLA 2G07A 3QA9A 4QOGA 1NF3A 1G3RA 3M33A 2Q5EA 5IDXA 2QD4A 1L5NA 5JD6A 4IL5A 5BV8A 2BY4A 4HB0A 4EX6A 2EBUA 3A6JA 5LDDC 4MPPA 1G17A 4EYEA 5JEEA 2D6FA 3PJGA 3R44A 3KJGA 2O2XA 1MHTA 5B6PA 1I9GA 2IUYA 3EDOA 1Q21A 1W88A 2B1GA 2A1UA 5J23A 5L4LA 3C14C 3EAGA 2AOTB 3E8SA 4JUCA 5FWXA 5JH7A 3VISA 3BGSA 4PX5A 3O8BA 1A5SB 1DAFA 3HU5A 5GJCA 3IHLA 5AESA 3I52A 5K0ZA 4Q1DA 3OPMA 1H2FA 2XF2A 3PFFA 1UDXA 5IW8A 3LBHA 4EKIA 3VH3A 1N36B 5J2TF 4INOA 3CX8A 2VF4X 3W1EA 5B7PA 1KI4A 3PQ8A 2D2IA 5AI8A 4OHZA 1G5FA 4QUDA 5BSHA 4KKXB 4V0NA 2PL9A 3IA7A 5LMCA 2DHCA 3QOYA 4L6CA 3RSZA 1SQ0A 4OKIA 5CVJA 1B42A 4RXTA 3PXUA 4CETA 4AX8A 4D3YA 1N3IA 1ZD5A 4LRQA 3NRCA 3R9IA 5KS2A 5CHYA 4KO8A 5IKMA 2OBLA 3AFHA 3EISA 4I3GA 3I6YA 3ETNA 4HWPA 5AKXA 2F8LA 2VTEA 5HTKA 1W0KD 2BFWA 1OYYA 2Q5FA 3GVHA 3AETA 4BMDA 1NPTO 5AM3A 1FE8A 4LGYA 2F55A 2IHBA 1BW9A 3C98A 3CR7A 4D42A 3BXXA 2IGTA 4MWCA 1Z12A 1XRJA 3N28A 1NBAA 3PRHA 4CF6