4I5FA

Crystal structure of ralstonia sp. alcohol dehydrogenase mutant n15g, g37d, r38v, r39s
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
249
structure length
233
Chain Sequence
AYRLLNKTAVITGGGSGIGLATAKRFVAEGAYVFIVDVSRKELEQAAAEIGRNVTAVKADVTKLEDLDRLYAIVREQRGSIDVLFANSGAIEQKTLEEITPEHYDRTFDVNVRGLIFTVQKALPLLRDGGSVILTSSVAGVLGLQAHDTYSAAKAAVRSLARTWTTELKGRSIRVNAVSPGAIDTPAKFAAATPLGRVGRPEELAAAVLFLASDDSSYVAGIELFVDGGLTQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic analysis and structure-guided engineering of NADPH-dependent Ralstonia sp. Alcohol dehydrogenase toward NADH cosubstrate specificity.
pubmed doi rcsb
source organism Ralstonia sp.
molecule tags Oxidoreductase
molecule keywords Alclohol dehydrogenase/short-chain dehydrogenase
total genus 89
structure length 233
sequence length 249
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2012-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4i5fA00
1VLLA 4NJMB 4A03A 1WPQA 4E4YA 3RUDA 2VUSA 1LEHA 3GF4A 4B8ZA 3LQFA 4N7RA 2C59A 3PYLA 4OJNA 1IZ9A 2P2SA 4RLSA 5JDCC 2W90A 2AQHA 2NU7A 5BQFA 4RL6A 4WOKA 2GN6A 4E6PA 2J5QA 3M1LA 2DT5A 5DULA 1EMDA 2OXIA 1E7QA 3KVOA 1XLTA 2O3SA 2LDXA 4MVJA 3NT2A 4RPLA 3IJPA 3OA2A 2EKLA 3VTZA 3ZU2A 2DQ4A 3D0OA 4GWKA 1J6UA 3DHEA 3AI1A 2NSDA 1Z74A 3Q0EA 2O3JA 4GVXA 3K73O 5DBFA 3HB5X 3BMQA 5EQFA 4DUPA 1IOLA 3RUEA 1ZK4A 1YBVA 1YL6A 1UXIA 2WYWA 2VYVD 1V3UA 2XF8A 4CM7A 2AW5A 4XIJA 3FI9A 4AICA 1NXQA 5ICMA 4FOSA 2OOSA 4HP8A 4A0SA 4YAEA 3U4IA 4XYMA 3BMCB 3RU9A 3WQSB 5IXSA 4IJVA 5H83A 4LRTB 1E1MA 1JA9A 4RCVA 3X2EA 3VZSA 4FS3A 1O9BA 4OIMA 2BMAA 2CUKA 3WBFA 3I6QA 3JYOA 1KOLA 2OGUA 1HDOA 1KVRA 1UAGA 2BRUA 3C7DB 4NBRA 1C0PA 3QVOA 4EUFA 4YDRA 3PDUA 3GEGA 2GRAA 1LDBA 3WDSA 2I99A 3B70A 1H9AA 4XYEA 3RFXA 1VPDA 1Q7GA 2YDXA 1G0OA 4IJUA 2AEJA 4L8VA 5BT9A 4BO9A 3MJTA 3I23A 3U4DA 1PL7A 4D43A 3GNTA 1B3RA 1GU7A 2X0IA 2HMUA 1S6YA 2AXQA 4IDFA 3ZWCA 3IJRA 4D79A 1SBYA 2RCYA 2HK9A 3UCFA 1L7DA 4ND5A 2X7HA 4J91A 1LLCA 3HDJA 4BHTA 3FTPA 3VOSA 2PA3A 4HX5A 5TLSA 3Q2KA 3RUCA 2QQ5A 1NP3A 3O8QA 2RHCA 4OQYA 2YQ5A 2WD7A 3LDHA 1N9GB 1PZGA 1R16A 1V35A 4OOFA 4QFDA 4WJZA 4II3A 1LXCA 5THKA 3L77A 3NDRA 4RVFA 3I3OA 4KQXA 4M89A 2Z1NA 2DBRA 2HMVA 1H2BA 3NT4A 1BWSA 5DNAA 3VVBA 4J4TA 3WGYA 3AI2A 4BL5A 4XCVA 1JLLA 5COBA 3OA0A 1E77A 2OMEA 3OIGA 3V5NA 1I5RA 5C3MA 1ZMTA 1OC2A 1YGYA 3JV7A 1YWGO 4R3WA 5KKAA 4BO7A 3FRJA 1JQBA 5IZ4A 3FCOA 5IFLA 4J4BA 5JC8A 3DBRB 2GF2A 3IC5A 3R3JA 2IYOA 4E13A 1GUZA 2NWQA 2O3UA 3GEDA 1PJ3A 4JCOA 3LLVA 3H5AA 9LDTA 2C54A 2C2XA 2EKPA 5GZ1A 4R9SA 4Z3DA 4BS9A 4XJTA 3G49A 2FMUA 4E2XA 1P0CA 3ANMA 3HN2A 3L9XA 4PG8A 4W9NC 1B8VA 1PIWA 2QZZA 2NVBA 4FGWA 1WZIA 3Q9UA 3Q6IA 4RF3A 3VVCA 3ZGYA 4Z0HO 1LUAA 3BMCA 1I33A 1BRMA 5L7WA 1YRLA 2DUUA 3B1FA 3CTMA 1NFRA 2GZ1A 3EDMA 1SCUA 1D7OA 4BNIA 1DEHA 4R16A 2UUOA 3ST7A 4EUHA 1EZ4A 5G0WA 1W6UA 2AE1A 3NUGA 4BO6A 2BELA 1A4UA 2VRBA 3JD2A 1MC4A 2YV2A 4NBTA 1EBUA 2ZTUA 1XYGA 4EITA 3AK4A 3CIFA 3O38A 5H81A 2NACA 3FSRA 1GEEA 3K6JA 2Y1EA 3GC6A 2AA3A 1GR0A 4YXFA 5CHEA 3HSKA 4MVJD 4OKIA 1PZHA 1SB9A 3CEAA 2ZKLA 1O8CA 3I52A 4HWKA 4Z0TA 1MXFA 1UDBA 2WM3A 4TWRA 2D2IA 3WGOA 2IXAA 2YUTA 4L73A 4PG4A 3NGLA 5F1PA 1Y6JA 4Y6PA 1AHIA 1NPDA 1U2DA 2B0JA 1VJ1A 4BV8A 1A7AA 3U49A 4J7CA 5ENVA 3LSYA 1NFQA 1X13A 5TIIA 3AY6A 1QORA 4IDAA 1BVUA 4U5QA 3QP9A 2HKIA 3JQEA 3NX4A 5JPIA 1DHTA 3DHYA 4NJMA 4BGEA 2P68A 4RQTA 4CM4B 3RUFA 5MGBA 1H93A 4A26A 2O3TA 4WGGA 3KB6A 1B16A 1U2GA 1C1XB 4CM9D 1R15A 4WCFA 3RWBA 1K6JA 2YJZA 3VZRA 4XQCA 4JJFA 4UUPA 4WNCA 3INRA 2HMWA 3OSUA 4YRAA 3QSGA 4UVIA 4XRRA 5AXCA 4BNFA 1HT0A 4ZQEA 2X0RA 1UJMA 3C1TA 2Y67A 5DBIA 4JP2A 3KUXA 2CY0A 4UEOA 4Q3DA 3VPSA 4YAGA 5I7SA 3M2TA 4DLLA 5KJCA 3ZNPA 1XQ6A 2OUIA 3GDFA 4UUOA 3FWNA 4Q39A 2WDZA 4BNVA 4FFOA 1Z75A 3I6IA 3PFWO 1QV6A 2VCYA 2Q1WA 4RF4A 1IYZA 1I3MA 1ARZA 1QMGA 4Y8VA 4CMAA 1G6KA 2X5OA 3NRCA 1XELA 4P8RA 2Y93A 3ETEA 3LT4A 4DPMA 2YFQA 1EVJA 4ZU3A 4PN3A 4ND1A 4FC7A 3FBTA 4NI5A 5AOVA 4EI2A 1E7WA 3PFFA 1Q0HA 1PJ4A 2ZB8A 4HBGA 4Z9XA 4HV4A 2DC1A 4LW8A 3LLSA 2W98A 1DC6A 4D3FA 1B2LA 3NTOA 3BAZA 4ZHSA 4CMHA 1DRWA 3OEYA 4IZHA 2OP0A 5T6BA 1LNQA 4WNIA 4U7WA 2ZCVA 3KTDA 4H15A 4E30A 1ONPA 4BUCA 4MDHA 4BMSA 1PX0A 4DBZA 3L6OO 4NK5A 1R0SA 1DLJA 1JDJA 1U4OA 3VH2A 2I3AA 5JNLA 1U9JA 2Q50A 2AG5A 1VRWA 4NG5A 4IQ0A 3MTJA 4J1QA 3DOCA 3JYNA 4R1UA 2GD1O 4OSPA 1V3VA 3H3FA 3LC1O 2JCYA 1Z7EA 3TWOA 4R69A 5FWNA 4JQCA 3JQ7B 2OP1A 4K26A 4BNHA 5F1KA 3GPDG 2JHGA 1LI4A 4BKPA 1EE2A 2A94A 2EEZA 3E9QA 5IDXA 3D7LA 3RUHA 1LLQA 2J3IA 3C3XA 5IJZA 1OC4A 2W2LD 5JY1A 1T25A 1PSDA 1BHSA 2V6BA 1RKXA 2Y1FA 3TDKA 4UVGA 5U1PA 1CWUA 2HUNA 3PLNA 4WASA 3P19A 5TT1A 3WFIA 2UYYA 4I9HA 2XXJA 3C8MA 4LISA 1HLPA 1I0ZA 3DZHA 3P7MA 5TRTA 3RFVA 3IL2A 1CF2O 2PKRA 4BGVA 1JWAB 1E6WA 5IDYA 1TB4A 2OFPA 3NAQA 4IXTA 4J16A 4OSOA 2VUTA 3GG9A 3MWDB 3ZH2A 4B7UA 1B7GO 1SO8A 4R41A 5JFOA 1I2ZA 2BH9A 2AMFA 1KYQA 5HM8A 1LC3A 1XG5A 3WGHA 3WJAA 1VL0A 2YFHA 2IE0A 3IKTA 3A1NA 1LLUA 2NUAA 2YV1A 5BSGA 3F4BA 4MKXA 4PG7A 4OM8A 3WFJA 1U28A 4RJTA 3PRJA 5A5EA 3RC9A 4JXKA 5A03A 5IF3A 2FOIA 4YJGA 2YYYA 1B15A 3W4JA 4ND4A 3WGIA 1ISMA 2DM6A 4KUHA 5KTKA 3OJOA 5KVVA 1YDEA 4WCDA 1UXGA 4IS3A 1YH3A 2H5LA 4MVJE 4RZIA 2ZB4A 4FCCA 4JLWA 5MDHA 3LC2O 3CUKA 2Q45A 3PGXA 4MKRA 4RVHA 3Q1LA 1T2CA 2NNLD 1N92A 3QIVA 1M6HA 4LMPA 3SLGA 5ENDA 5KCZA 5JE8A 4R3NA 1R37A 2EV9A 4QUKA 3HFSA 3JQAA 1F12A 3L6DA 3NGXA 4M54A 3QVWA 2CVZA 2FPIA 2DVMA 5B12A 3WMWA 4YVFA 1JKIA 3PIIA 1ZW1A 4XGNA 4DBVO 4IBOA 3O4RA 2E4AA 3I5MA 5T5QA 3FNGA 1WWKA 2F00A 1P44A 5JDIC 1P1RA 1IZ0A 1MX3A 2GCGA 1VKNA 4LMRA 3RAJA 2Y1GA 1GADO 3IAHA 1E3SA 1N2SA 3JQ8A 4IJKA 1NR1A 3H5RA 4EJ0A 1XDWA 1A9ZA 3BMNB 3JQFA 4CMKA 4FD3A 3RD5A 6ADHA 3UUWA 1KVQA 1JW9B 1LRKA 5DT9A 3ITDA 4TZTA 2EHDA 3OF2A 3DBRA 3QJ5A 3Q2IA 1LX6A 1MGOA 5U4QA 3W4KA 1HSZA 3GRPA 3ZN2A 1T4BA 4F6LA 5JAQA 3W8EA 4GWGA 4K1LA 3E9MA 2XPCA 1ZEMA 4ZJUA 5HS4A 3GH3A 3TPCA 3U62A 3ASUA 4FJ0A 1H5QA 1CQIA 4FBGA 2PNFA 2XXBA 3GHHA 4KUGA 3BHIA 5COQA 4BGUA 3W6ZA 4ALLA 1ONNA 2DBVO 3H3JA 1UZLA 1D1SA 3AOEC 2HK8A 1VSVA 3EC7A 4IDGA 3MJVA 4OL9A 4Y67A 1YL7A 1OZAA 4GGOA 1HYEA 1C3VA 5F3RA 3LT1A 3U9LA 3GA0A 3DAFA 5FYDA 4KTVE 1MB4A 4TQGA 1HEUA 2C7VA 3GPIA 1XKQA 5ITWA 4U6QA 1GCUA 3HADA 4DQXA 3I9OA 4BNGA 5A3VA 2YV3A 3G1UA 5KOIA 4CUKA 3GVPA 3L07A 1E7MA 4D42A 4CLEA 1GTMA 3AUUA 1NQTA 2B4TO 2WE8A 3QWBA 3G79A 3IUSA 4WCFC 4XD2A 4E5MA 1IPEA 1E3LA 2X22A 2QG4A 4BO3A 2AQIA 5CEEA 3BTUA 1JN0A 1BXGB 3QY9A 2OBYA 2FN7A 3JSAA 1DC4A 4AJ2A 2FWMX 3OJ0A 2R00C 4PVDA 3K5PA 2P9GA 2FR1A 2YW9A 1FMCA 4ZVVA 1FDTA 4YTEA 1GYQA 3F5SA 4EGFA 3PJFA 1FJHA 2C82A 4GI2A 3UFXA 3OICA 7MDHA 5I7VA 5JYDA 1Y5RA 3C85A 5JCXA 3SC4A 1FF9A 3HHPA 2CDCA 3PK0A 3CMMA 1I32A 1E7SA 2UUPA 2GERA 4WLEA 3ZWAA 2BHLA 3ZNOA 4CQLB 1GD1O 3GG2A 1MFPA 3JYPA 3VPXA 2V6MA 1X15A 1SEPA 2JAHA 1KC3A 2WSBA 2O3RA 2VT2A 3HUDA 2VRCD 3D3WB 3F5QA 5EQDA 1N5DA 5COAA 4AJNA 5CDTA 2J5KA 2RIRA 5JW6A 1M66A 1PJ2A 3IMFA 2VN8A 4BNMA 4OGWA 4CLOA 4J6FA 1P74A 3U4HA 1SZJG 1GZ6A 5A9SA 3BIOA 7ADHA 5ITVA 4ZRNA 4NNJA 5FF9A 1GY8A 1O94A 4AJPA 5DOZA 5TF4A 3H4VA 3WJ7A 1LDYA 3VPGA 5K0ZA 3H2SA 4D3SA 2VYVA 3HQ4O 5F21A 2NADA 3BTSA 3WB9A 4II2A 2B35A 1O0SA 4Z6KA 3F1LA 4UUMA 3V1UA 3KYDA 4NFSA 1H94A 1KC1A 1RM0A 1NM5A 2H9IA 2PZMA 3TL2A 1OAAA 5L51A 1O5IA 1DFIA 1P1IA 1ISHA 3L0DA 2IDZA 3OBBA 3PDJA 4JK3A 5IZCC 2G82A 5B4TA 2PKQO 4J2OA 1YXMA 3INGA 4I08A 3ZHYA 1ZK2A 2CVQA 2DPGA 2X0NA 3F46A 4WE3A 3ZNNA 4AVYA 3DBHA 1TEHA 4CMBA 4XR9A 4YACA 1Y81A 1Z82A 4ILKA 2XOXA 3KRTA 3AM5A 4FJ2A 2GN4A 1CRWG 1P1FA 4FW8A 3UHAA 4DL9A 1I01A 3DMYA 4YB8A 4R51A 3L4SO 1WMAA 1GAEO 2PZJA 4CMGA 4RPJA 5KVQA 3EVNA 3QW2A 3MJEA 2D5AA 4N54A 1HKUA 3E82A 2IODA 4F46A 1NQOA 1DFGA 2GDZA 4O0LA 1F14A 5CAEA 3PZBA 1LSSA 5KJFA 4HUJA 2UAGA 1E3WA 1NX6A 3I9KA 2C0CA 3HDQA 1ZCJA 3I4FA 1BG6A 1DIBA 2CVOA 4WLVA 3WQRA 2GSDA 3D64A 1ISIA 3GUCA 4MVJM 3PQFA 4L76A 1E5QA 1EDOA 2A35A 1K89A 1L7EA 2P4QA 4I9UA 4CMEC 4PIVA 2FHSA 4HY3A 5ES3A 5JAIA 3OMLA 1R4MA 4EYEA 5L45A 1M67A 4PLVA 4S1VA 1SPXA 2Q4BA 1YO6A 5BSFA 3WX0A 5EL0A 2X5KO 5EIOA 4XB1A 1E7RA 2DPHA 3ZW9A 2R2GA 3WWYA 5C37A 1IUKA 2JD2A 3WIDA 5J23A 1B14A 4UULA 2DKNA 3DXFA 4UAGA 4PZEA 4BNJA 5JMWA 1FDUA 5JO9A 4EUEA 3AOGA 3X2FA 4LGVA 3WBBA 4PLCA 2E82A 1RM4A 3JQCA 1ZSNA 1GUYA 1OBFO 3BTVA 1KVUA 1BSVA 2PGLA 3RUAA 4E5NA 4DRYA 1IHXA 3DZJA 2C07A 1ZSVA 1N1EA 3TZ6A 1PGQA 3VTFA 3FPLA 1C0KA 5AXDA 4OOEA 1MC5A 3KZVA 3T4XA 4GMFA 1E5LA 3VAZA 2HRBA 3H9JA 3S8MA 2BF7A 2C7GA 5EPOA 5LDGA 2CF5A 3QWFA 6LDHA 4CQMA 2FY8A 4BKQA 1NHGA 2PH3A 3JYLA 3ZZNA 3TZKA 3UAGA 4GH5A 4KWHA 1HDRA 3GGGA 4HFMA 5DP2A 1SEVA 2POQX 5JAMA 4OH1A 1UXJA 1R12A 1T2DA 3DFZA 4FIZA 2NVUB 3TF5A 1NFFA 4GX5A 1EK6A 2DTXA 4PG6A 4NBUA 2YDYA 2AEFA 3BMOB 2AEMA 3RKRA 4EDFA 4ZA2A 3F4LA 4PLZA 3EVTA 5BR7A 4YRBA 1U5CA 1AXEA 4AJ4A 4DIBA 1PJLA 1OOEA 4ZICA 3VH3A 4F6CA 3OJFA 5DN9A 1H6AA 1LTHR 4D46A 4M86A 3GVHA 4DPKA 3FHLA 4R68A 3NV9A 1HDZA 2X58A 3AW9A 4INAA 1XCBA 2CZCA 3GVXA 1QG6A 3PWZA 4ND3A 1HDCA 2WD7B 1EDZA 2VQ3A 2ET6A 3O8QB 3K8ZA 3PJEA 2WTBA 1VJ0A 2B4RO 1UR5A 1NHWA 3TSCA 4NPCA 5A4DA 2CD9A 1QYVA 1E1NA 2EP5A 2EW2A 4J3FA 5ICSA 5CDSA 3EUWA 1T2AA 3RKUA 1SAYA 2C20A 5DCWA 2E6UX 4UREA 3GQVA 1MV8A 5EN4A 4U0KA 3WQQA 3AI3A 1M75A 1AN9A 1E3EA 3H65A 5T8KA 4CM9A 3H5NA 2GUGA 1WNTA 4GLLA 4BMNA 1AUPA 3PHJA 4H3VA 1RPNA 3WOHA 3JQ6A 1ML3A 3CXRA 2WYUA 1WMBA 4B4WA 1NPTO 4I5DA 4K6FA 5L40A 3NJ8A 4CMCA 2VHWA 1WZEA 1BXKA 4JIGA 1B3BA 1LA2A 3RI3A 2WE7A 2C5AA 4XYLA 3DL2A 4JNKA 2V65A 1Y5MA 1ZK0A 3ZU4A 3AUAA 4BOYA 5B1YA 4YQYA 2YHUA 1F06A 4OHUA 2X5JO 1UP7A 1WDLA 1EQ2A 2VNSA 1BW9B 3NTRA 3EHEA 3I9JA 2CSUA 4MO2A 4CMIA 4BNZA 5LC1A 2FR8A 5L7TA 1G0NA 4ID9A 3ANNA 4JN6B 1YONA 4MVJF 3ETGA 2ZJ0A 4CUJA 3ONEA 5CDYA 4DWVA 4OMUA 2OL4A 4CM5A 5A1TA 5BNTA 1QP8A 1JTVA 4IDEA 2VZ8A 1UH5A 2Q4EA 2FRDA 4PLHA 5L4LA 3D4OA 4IDCA 4CLRB 4NMHA 3MOGA 4MP3A 3GN2A 5BNFA 3ZWWA 4CV0A 3RBZA 4BB6A 4Q3EA 1PJCA 2VWGA 3NDJA 3R0IA 4GX1A 3DHNA 4IINA 5JC1A 1XIVA 3GGOA 3LC7O 2VTDA 1EVZA 4NBVA 4BNKA 1I3LA 4DXHA 4W6ZA 2X9NA 1A27A 2Q2VA 3KLPX 3ZWPA 1PR3A 1N7GA 2ZTVA 3D5QA 1BMDA 4OO3A 1MP0A 4WLNA 1KEVA 2PY6A 1QV7A 4I5EA 2I6TA 1KEPA 3PXXA 4LVUA 3UH1A 1YOVA 3A9WA 5KWEA 1NWCA 4NFHA 4XEHA 2Y66A 1N9GA 2VHYA 3DAPA 3WG9A 4E32A 5JAZA 3KETA 1X7DA 3FPCA 5EERA 2GYYA 2BD0A 3E48A 2O2YA 2ZQYA 4YQZA 5B4VA 1VE9A 4OXKA 4BNWA 2A92A 4FGSA 4WOJA 4B3HA 5EINA 1ZBQA 4J49A 3S2EA 4M55A 1J5PA 2P9EA 2ZIZA 4IY1A 4QTZA 3SEFA 5U9CA 1OMOA 1ZIDA 3H7AA 3IS3A 3ZV6A 4AJKA 4YAKA 1P1HA 3OEWA 1RM5A 1EFKA 4BO1A 1TVEA 1ENYA 1M6WA 1PU2A 2HAEA 2NTVA 2RAFA 3M6IA 3DMTA 1U3UA 4HFNA 4WPGA 2PGJA 4XYBA 3CMCO 2QX7A 2UVDA 4CUZA 1B8PA 3RC1A 1ADCA 4E33A 3SBOA 3I83A 4D44A 4QSMA 1YDWA 3LVFO 1YJ8A 5CPBA 3TFOA 2HJRA 3E9NA 3MJ4A 4CPDA 1PJBA 4W9NA 4L4SA 5AQ1A 4JJGA 3W1VA 2HDHA 1ISJA 1NYTA 4Y6RA 5L95A 1LQTA 2EF1A 4K28A 3GAFA 4W82A 2B5VA 3L4BC 1YB5A 2SCUA 2PH5A 2EJVA 4BKOA 1KY5A 1U7TA 3S2IA 2JFHA 4CJXA 1R6DA 4IM7A 4QEDA 3WTBA 2ZTMA 2NTJA 2HLPA 3H9UA 2OORA 3PP8A 4HXYA 4YT8A 4Q3NA 5HWSA 8LDHA 1PS9A 5ILGA 2Y99A 4EZBA 3IIEA 3ETDA 2GLXA 3JQAB 5ILOA 1GYRA 1XR3A 3DAGA 4Q3AA 3PZRA 5DP1A 1NVGA 1PEDA 4GAEA 1UZNA 3ROKA 1EVIA 2P9CA 3DC2A 1LSUA 3KV3O 4UVDA 2TMDA 5A05A 1NPYA 3SVTA 1K6XA 1Z73A 2Q2QA 1F17A 2I65A 1TI7A 1HE2A 4XDYA 3TRIA 3UXYA 1YJQA 3RFTA 2EGGA 2VZ9A 3ANLA 4M87A 1P31A 3LT0A 1DIRA 1M2WA 4CR6A 3GZNB 4J1NA 3VDRA 2VOEA 4R54A 4IDDA 3I1JA 3E5MA 4TRMA 1V8BA 2JFGA 1T1RA 4R9RA 2RHRA 4E5PA 3FR8A 3C24A 3WNQA 4K6CA 1P0FA 2O2SA 2W2KA 1PJTA 3RJ5A 4EW6A 2GN9A 4E2ZA 1KY4A 1UDCA 2ZYAA 4PLYA 1YKFA 4AJLA 1KERA 4CR7A 5C7IO 3JQAD 4U6SA 3TFQA 2X4GA 4BVAA 2WEKA 2B69A 1YBMA 2H6EA 2HJSA 2DBQA 3EYWA 4Y98A 2JCXA 1ENPA 4CLDA 4DYVA 3L6EA 1ZXBA 1N1GA 5IDQA 3IP3A 2FZWA 3B6ZA 3PTZA 3BXXA 3FWZA 5A9RA 3GGPA 1ID1A 1DHRA 3ZV5A 2IEBA 3OQBA 1JKFA 1O95A 2Y1OA 4L75A 8ADHA 3T4EA 1XHLA 2ZB3A 1PGOA 5EESA 3DFUA 1HF3A 1K2WA 3PJGA 4PFJA 1JU9A 2NU8A 1EVYA 2E37A 2NVUA 2W2KB 4PZCA 4WK6A 1Y9EA 4ROSA 3R3SA 3EZYA 4NZ9A 4J9VA 1E0DA 5TQVA 4XX0A 2J3HA 3UW3A 1EUZA 1KVSA 4TVBA 4K9DA 3GK3A 1GCOA 3HDYA 1A9YA 2I9PA 5DDIP 1SNYA 3AWDA 1MXHA 3HB4X 4CQMB 4C7KA 2Y0CA 4DQUA 2C5EA 2YQ4A 2NLOA 1C1DB 2QRLA 4CV2A 3BHJA 3QRWA 4CM8A 4YRDA 4RDIA 3GFBA 4CV3A 2FPPA 3BA1A 3ZWYA 2H63A 3ZV4A 5I9LA 2VWHA 5GMOA 1ZFNA 3JQ9A 2GNAA 1I3NA 1QXSA 5G4KB 3HG7A 4XA8A 2YHIB 4TROA 2OZPA 4B4VA 4BNXA 5A06A 4J7XA 2VYNA 3UCEA 3LT2A 4IGFA 4Y9DA 3N74A 3TQHA 1NWHA 4N5MA 3ICPA 2Q3EA 3E5RA 1ZK1A 2D5CA 1SB8A 4GKBA 4TRJA 1F8FA 4PLGA 2QRJA 4Y6SA 4A2CA 5I7FA 4FFNA 1DC3A 3DQPA 2P5YA 1R4NB 2C29D 3I9NA 4R01A 1UAYA 1SOWA 4WLUA 2O48X 4GL4A 4J0FA 3GZ4A 1GEGA 5L4SA 1FDVA 2RH8A 3GZNA 2G0TA 2PK3A 3KYBA 5FI3A 1TXGA 3RQSA 2EGHA 4NU6A 2GPTA 4B79A 4O59O 2JKVA 2Y0DA 4MP6A 3VH4A 1HLDA 2AE2A 1P9LA 5L3ZA 4CM1A 4DIFA 3FR7A 1U1IA 3KSUA 3CE6A 4HFJA 4LRSB 3FD8A 3AFMA 1BXGA 1UUFA 1PJQA 2FSVA 3PYXA 1ENZA 1A7KA 2IXBA 4PRLA 1KS9A 4XDZA 5G4KA 2J3KA 1FXSA 2Q46A 3DBLA 4RGBA 2XAAA 4XYGA 1O89A 4D7AA 1U8XX 2UV8A 3FNHA 5I7EA 3GNQA 4XIYA 5KKCA 4A73A 3RASA 4E21A 3B1JA 1LC0A 2NQTA 3Q11A 3COSA 5TJHA 1VKOA 4N5NA 4AJ1A 4BO0A 1ISGA 3ZCXA 3RC7A 1LRJA 3DOOA 4YT4A 2CMDA 2BFMA 3AJRA 2O4CA 5T64A 3VKUA 1IULA 1EK5A 3D4PA 3PWSA 4AJHA 5A9SB 3U09A 4NR0A 3EZLA 3GMDA 4ONEA 4ZQGA 1E92A 3INTA 1MG0A 3GR6A 4MP8A 4NIMA 5IN4A 1K5HA 1U8FO 1PWZA 2P91A 3GVCA 4ZQFA 3IDSA 2DU8A 4GLOA 4J1TA 3HN7A 4GX0A 4NBWA 1I2CA 1OI7A 5C7LO 3E03A 5TGDA 4GBJA 2I3GA 1LDEA 2DFDA 3H2ZA 3KM0A 3GHYA 1D8AA 4UEKA 2D8AA 2NVWA 3GRKA 5FI5A 4YPOA 1P33A 1TT7A 3NT5A 4E12A 2BLLA 4P4NA 5THQA 3UOGA 2G5CA 3PGJA 5IXYA 4CLRA 1X1TA 3EMKA 4DMMA 4YCAA 3UVEA 1E6EA 2Q1UA 3ENKA 4YA6A 1B8UA 3VH1A 5A5FA 1C14A 2I76A 2PD3A 5JDIA 4UVHA 1QYCA 2B83A 1HETA 1U3VA 4YWJA 2X6TA 1B26A 2HCTA 1PTJA 1J4AA 4BIIA 1W73A 1LU9A 3DONA 4GQAA 3ASVA 3JQFC 3DR3A 2I66A 1DAPA 3HE3A 3MOIA 3SXPA 2PD4A 3OQ1A 3ZWBA 2JD0A 2AHRA 3K92A 1ZKMA 1XQ1A 3NEPX 3M2PA 4DA9A 4A7PA 2WD8A 2VNAA 3KEOA 2OO5A 1VJTA 4CMJA 1CDOA 5KIAA 3BMQB 4FPXA 3ON5A 4LK3A 3IUPA 2QRKA 1P77A 1Y8RB 3AU9A 1NR7A 2E49A 4TKMA 4D0RA 3WGZA 4L74A 4YAJA 4I5GA 3CZMA 2FPGA 3PIDA 1U7HA 4L4RA 4IJWA 3KYCA 2IEDA 1TA4A 1E3IA 1HZJA 1N8KA 2HMTA 3OIDA 3KYCB 5I9NA 1H0KA 3EK2A 4QT0A 1RYDA 2Q49A 4B7XA 5DZSA 4I1IA 4CLXA 4A27A 4JBHA 1N7HA 2OHXA 3LF1A 3ZWNA 3FNFA 1EFLA 2ZB7A 2Z5LA 4R4JA 1W8DA 4MVJG 1R0LA 4EJ6A 1QYDA 1DDOA 1M76A 4B7CA 4ZRMA 3QE3A 1H6CA 3K31A 3WXBA 1KIFA 5GY7A 2D0IA 4LCEA 2TMGA 4AFNA 2EW8A 1HYHA 3DBLB 1ZJYA 1KVTA 1JAXA 3ZWMA 4XGIA 3PQDA 3MJCA 2X86A 3HJAA 3UICA 2ZTLA 3WS7A 1T24A 4RVSA 2HRZA 1BGVA 1Y8QA 1GV1A 1OFGA 3GAZA 3I9LA 4AJIA 5CG1A 4AJJA 4TKLA 2GO1A 4ITUA 1KEWA 2CDBA 4QX6A 1QLJA 5ADHA 4IQGA 5H82A 1YBAA 3U3XA 3ROQA 3WLFA 4AL4A 4H7PA 4J90A 1NVTA 1VC2A 4Q9NA 2JAPA 5F1OA 2ZJ1A 1HL3A 4FDAA 2ILTA 1EBFA 3JD3A 1MLDA 1Y8QB 4MOWA 4YJHA 5JMPA 2QYSA 4WLOA 4ALJA 4B4OA 3QLJA 1VSUA 1A71A 5EJ2A 4DGSA 3FNEA 3UCXA 3AY3A 1BDBA 3MJSA 3AM4A 4YR9A 1HTBA 4KMSA 1YQXA 1X0VA 4FOOA 3HFGA 3TZCA 3ULKA 1U3WA 3MCVA 3JQ7A 4CMIB 4JJIA 4GX2A 1WDMA 1HDGO 4KOAA 4MIOA 1BW9A 3ONDA 4N5LA 4OYRA 3VZQA 4CL3A 5TX7A 4HADA 1H6DA 3Q3CA 1PZFA 4D45A 3V2HA 4X54A 4ESOA 1J49A 1NASA 1XEAA 2PZKA 5I8ZA 3JTMA 3GNSA 1IE3A 3D1LA 3TZQA 1FK8A 3DZGA 4BQRA 2P5UA 3I9MA 1RM3A 1HE4A 3BHMA 2O7QA 3P2YA 3UF0A 5A3JA 2VHXA 5IZCA 2AG8A 1YOVB 2R6JA 3TJRA 1Y1PA 1QRRA 4YT2A 5A9TA 3JQ9C 3WWZA 4NDNE 3ZHBA 4DC0A 4JBGA 3JQGA 1GQ2A 2I67A 5ER6A 5G0TA 2QIOA 4IGEA 4MPDA 5GZ3A 1Q0QA 3S2FA 1QLHA 5C7OO 1KEUA 4ZQBA 1V9LA 3FTNA 4BGIA 1LRLA 1LJ8A 1IPFA 2C2YA 4I9NA 3TOXA 3CSDA 3IQDB 4C7JA 3L9WA 4FJ1A 5L9AA 5L7YA 4DLBA 1DPGA 1PWXA 2O7SA 3VC7A 4UUNA 1HYGA 5A04A 4FFRA 3R1IA 4S3MA 3JQBA 4J43A 2JFFA 3PQEA 3KSDO 4FSHA 3IKVA 5JDCA 1ZO8A 2GZ2A 3OM9A 4U8GA 4BO2A 1Z45A 3GFGA 3H6KA 1QYWA 2EP7A 3DO5A 5T67A 3GY0A 3SLKA 1CJCA 3K2EA 4ZN6A 1Q7CA 3HZZA 2X8LA 3BZUA 1PQWA 4EBFA 3DDNA 3ZV3A 1U4SA 5IN5A 3QWHA 4OKNA 3DBVO 2V7PA 3ROMA 3TNLA 4URFA 1K3TA 4I5FA 3FN4A 2PR2A 3DMTC 1ORRA 5I9MA 4ZQHA 4E31A 1JAYA 4RVUA 3OETA 1NBOA 3HDHA 3CPSA 1R0KA 3CZRA 1ADBA 2ZQZA 1ULSA 3QV1A 1ZH8A 3VPFA 3WIEA 1ZVMA 1V6AA 2FSSA 1TT5B 4R1TA 3U5TA 4BNNA 1XU9A 4L4XA 2G76A 1LLDA 2VYND 2HSDA 4O1MA 1PR9A 3GUYA 4DMLA 4AJEA 5KJ1A 4O6VA 1PQUA 2D1YA 3ONFA 1ADFA 1VI2A 3VDQA 4E5YA 3U0BA 4BNUA 3I4CA 2Y1CA 1YQGA 2BGKA 2CNBA 3OFSA 3KOUA 3G1TA 1NTOA 2O23A 4DTIA 3F1KA 4GMGA 4R1SA 4UVEA 1DJNA 4JP3A 2WYVA 3W6UA 1D1TA 1NQAO 4M8SA 1IL0A 3A28A 4L0QA 3WNVA 5HS6A 1DAOA 4CLHA 3WLEA 5JCJA 1DIGA 2YHIA 1GDHA 1DC5A 3PHHA 3QVSA 1P1KA 2FR0A 3QVTA 3OECA 5DBGA 1DOHA 1W0CA 4RDHA 1UZMA 2PLAA 1UDAA 3NJ4A 3EGOA 4W4TA 1Y7TA 3F3SA 1I36A 4P38A 3C1OA 2W8ZA 1ONOA 1QSGA 4RZHA 3K30A 2PTGA 4PG5A 1D4FA 4XQ9A 5AXAA 5L53A 2VRCA 4RPHA 3VHRA 4LSWA 4QQRA 1QKIA 3ROPA 1LSJA 4FFLA 3RU7A 1YB1A 3W4IA 3WYEA 1FDWA 2VWPA 1X0XA 1UXKA 5I8WA 3UN1A 1HSOA 4PLTA 1C0IA 3PHIA 1AXGA 3ENNA 4YEDA 3DBHB 4F3YA 1P45A 4J1SA 5F5LA 1AGNA 3BTOA 5FEUA 5BSEA 4RPGA 2PKQP 4HNGA 2J3JA 2X0JA 4J0EA 2B37A 3GDGA 4OQZA 2VTEA 5BSHA 3C7AA 3WICA 3AUSA 4QXMA 1GZ3A 1ZZEA 4OXYA 1ZJZA 1CETA 5K9ZA 4DVJA 1E1KA 4IMPA 4E0BA 9LDBA 3RBXA 4KDFA 3OJLA 5ER9A 1GFSA 3OJEA 3E1KA 1HDYA 3GMSA 2JD1A 5TSDA 3E8XA 1HE5A 1YL5A 2NTNA 2WWRA 4IIVA 4G81A 4D41A 5DCUA 3ZW8A 1ISFA 1MG5A 1IY8A 3R6DA 3H9EO 3G17A 4EEZA 3ZHZA 1BTOA 2IZZA 4U0JA 5T8KC 4BNYA 4PGFA 3WYCA 2Y1DA 1GYPA 3M1AA 1Z6ZA 3DTYA 4FR5A 2QW8A 5DF1A 4A5OA 4DYDA 1WVGA 2WJPA 4DREA 1E7YA 1GPDG 4RVDA 1T2EA 1A5ZA 1HDXA 3GT0A 3PJDA 1ADGA 4L9RA 4CM3A 1G1AA 4MIEA 2V6GA 2GZ3A 1LDGA 1ZXLA 4CMEA 4J2HA 5GZ6A 4FB5A 2IZ0A 2D59A 2RBEA 2NV6A 3JQGB 4P22A 4DQVA 3K96A 2ZATA 2B36A 1R4MB 1WXDA 3GOHA 2DFVA 1ZK3A 5L4NA 1B0AA 4AJOA 4W7HA 3QWAA 1I10A 3LU1A 5CEJA 4O63O 1YE3A 3DZBA 4RLHA 3IOYA 4CLOB 2OBNA 4CR8A 5CP8A 2CFCA 2IZ1A 4Q3CA 3PVZA 1YVEI 1P1JA 4XR4A 3UKOA 3OP4A 2JCVA 2PZLA 1DRVA 1DIHA 1NQ5A 3OH8A 4YJFB 5HRUA 3A14A 4NFYA 3D3WA 1A4IA 4XKJA 3F47A 1JWBB 3OHSX 4DC1A 2DUWA 4GGPA 2BKAA 4I8XA 4KTTE 3MEQA 3SJUA 4BO5A 4EJMA 1DXYA 1W4ZA 1E1LA 5KVSA 1Z7BA 2VUUA 3LYLA 5JY6A 2VZ0A 2AQKA 5JLAA 1SC6A 4LSMA 1PS0A 2VWQA 3ZWOA 1T4DA 4TRNA 3E6AA 3O26A 4TVOA 4BNLA 4ALNA 4RF5A 4TMFA 3CH6A 3VPHA 1PZEA 4LVCA 1GPJA 3KHUA 3UGKA 1DRUA 4Q3BA 2LDBA 3S2GA 4PRKA 1EEHA 2H1SA 5DCYA 2J8ZA 4PCVA 5AXBA 4E3ZA 1DO8A 1CEQA 1V0JA 2ZYGA 2D3TA 4P4LA 4W99A 5HTOA 1S7CA 1ULUA 4PZDA 3IP1A 4TZKA 3JQDA 4YJGB 4HKTA 3T7CA 4ALMA 3WGTA 1PGNA 3QHAA 4GKVA 2F1KA 4HFRA 1I3KA 1UP6A 3GVIA 3RCBA 2BGMA 1YB4A 4IDBA 3DTTA 4CODB 2ZK7A 3V2UA 4B4UA 3PHGA 3D5TA 4RO0A 1WLYA 3MZ0A 5G4LA 2PWZA 2Y68A 3ZI0A 3E18A 1MA0A 3KO8A 1E6UA 5CG2A 2GN8A 3SJ7A 4TSKA 4Z9FA 4AG3A 2Z1MA 3PPIA 5TT0A 2Z95A 1PQPA 1DBVO 3GN1A 2QHXA 1DIAA 3QA9A 2B5WA 4JBIA 4YJFA 4XJSA 1H9BA 2FZEA 1LBEA 1EUCA 1K6IA 4KP7A 4XB2A 1YS4A 2BI7A 2HK7A 1XWFA 2EIHA 5JSFA 4YJHB 3C7CB 2BFAA 3HNPA 3HWRA 2E48A 4RF2A 1UP4A 1F0YA 4IIUA 3TL3A 1VM6A 5DOVA 3DB2A 3LK7A 1NNUA 2BI8A 1HRDA 3BMNA 2JHFA 3O9ZA 1XGKA 1Q7BA 1AE1A 3ZNQA 1Y9AA 3JQ8B 2ZCUA 3QWIA 4BO4A 1VL8A 2AQ8A 1T26A 1X14A 2X9VA 5IDWA 3H9QA 3VKVA 3QQPA 4WKGA 3MTGA 2X1HA 4KDEA 4KUEA 2FP4A 3SX2A 1O6ZA 1CYDA 2HU2A 4G5HA 4CQMD 3ABIA 3NYWA 3VZPA 2EKQA 1LDMA 2NU6A 4W7IA 1DB3A 2WMDA 4NJOA 4GSLA 3JD0A 3AFNA 3EW7A 3MWEB 4XQEA 4JROA 1I30A 3NKLA 1KETA 2DAPA 2J5RA 4OXNA 1WW8A 1P3DA 4BMVA 3AOEA 1DFHA 4RVGA 4MVJI 4M49A 4R5HA 3V1YA 1U5AA 3K2BA 4BO8A 1I8TA 4R1NA 3B1KA 4ALKA 2YZ7A 4KWIA 4RQUA 4E2WA 3ITKA 4WLFA 1BDMA 4QO8A 3F9IA 3N7UA 1GZ4A 2X9GA 5JXWA 1WP4A 4MJLA 3S1LA 3P2OA 1PGJA 4YAIA 3OQ6A 4NHEA 1A72A 1UXHA 2EJWA 4QO7A 5BNIA 3RVDA 2DTDA 4WECA 3RROA 4YT5A 2Q2WA 3BYZA 3BMOA 1I24A 1Y8RA 2O50A 1ZMOA 3KLMX 2Q99A 4C4OA 3A4VA 4BKRA 5TS3A 3V8BA 4XQGA 2A4KA 3JYQA 3AY7A 2DTEA 5TNXA 2HMSA 1LDNA 2QZ9A 1DLIA 4P4GA 4IUYA 1L1FA 5JYEA 1FDSA 4BV9A 2D4AA 3W8FA 4NH4A 3ADPA 3ICCA 3KBOA 3N58A 3STHA 4PVCA 1XA0A 4CV1A 4NK4A 3EY4A 4NU5A 3DWFA 3S55A 2P4HX 2G17A 3FBGA 4MIYA 1CERA 1T2FA 3ZDFA 4BB5A 3KSZO 2Q1TA 1RJWA 4WUVA 5G0UA 5KVCA 1H2HA 4XRGA 2I5PO 3RUIA 3ZU3A 3FF4A 2EERA 4J4HA 3GDOA 3RBVA 4WEOA 4CM8B 5A02A 3LF2A 3PI7A 3WSWA 1MUUA 2B4QA 3GEMA 2JL1A 5G0SA 1TLTA 1MFZA 4MINA 4D0SA 4ALIA 1AHHA 3H8VA 4N18A 3AM3A 2VHZA 3DZIA 3T7EA 4CM4A 3PEFA 2ZYDA 1CQJA 3WSVA 4BKUA 4YYZA 3OIFA 4PLWA 1PL8A 3WTCA 4R5MA 2EXXA 1RYEA 4EEXA 2NU9A 1JKJA 2HQ1A 4YJDA 3PWKA 4BNTA 3DEYX 3JD4A 3ZU5A 4XZ3A 2VOJA 3ORFA 4IS2A 2GASA 2Q1SA 1VL6A 3KYDB 4OAQA 3SC6A 2PD6A 1NAHA 3F6YA 3AU8A 3H9GA 5T57A 1EE9A 1I2BA 5HA5A 1TT5A 4CM6A 4RV9A 3D4NA 1GQYA 3V1TC 2RH4A 1NAIA 1DSSG 2Y0EA 3L4BA 1HE3A 5IG2A 2VT3A 3PHLA 5G0VA 3RIHA 4TRRA 1QYXA 3G0OA 2YY7A 2UDPA 4IPTA 1GV0A 3AUTA 4GSKA 1E3WB 5B37A 4Z3KA 4ZGWA 2J6IA 2BGLA 2A9FA 3GLQA 1HWYA 1BXZA 4GPD1 1ENOA 4LCJA 4XWYA 4Z9YA 1J0XO 3K9QO 5TC4A 1GUFA 1WAMA 2PGDA 3EAGA 1SMKA 1V3TA 4IXWA 1ZNQO 2JJYA 5AYVA 2V6FA 1JVSA 1KBZA 1WDKA 3NTQA 2G1UA 4G65A 4GVLA 4KQWA 4FC6A 4YBZA 4JGBA 4E2YA 5B4UA 2DBZA 3ADOA 3KEQA 1EQUA 2VHVA 1C0LA 1X7HA 2PV7A 4H16A 5CPFA 2CDAA 5F5NA 4RPKA 4ZD6A 3P5SA 3JQBC 1X7GA 1R4NA 1U3TA 2W4QA 1ZSYA 4A10A 4B8WA 5KJ6A 1Q0LA 1HXHA 2O3QA 3ZWVA 5JS6A 4Z0PA 4D3DA 3B20A 1LSOA 5EMHA 5CFZA 5JO0A 1XU7A 2Y05A 1QR6A 3RC2A 2X23A 4KZPA 1IB6A 1SOVA 3LZ6A 2DLDA 4B3IA 4RORA 4UEJA 4FFPA 4IQ8A 4B3JA 4MKZA 5CEFA 1E3JA 1X1EA 3NDIA 4G2NA 5KNLA 1LQUA 4IZIA 1XSEA 3TZHA 4HNHA 4NQZA 3PYMA 2NQ8A 4MVJH 3CKYA 5G2OA 1RWBA 1T1SA 4DLAA 1CIVA 2EG9A 4DIOA 2NM0A 4M1QA 1NVMB 1K0UA 4QECA 1Q1NA 2R00A 1PL6A 5JBIA 1C1DA 1D3AA 4FQ8A 1ZEJA 3JD1A 4XGKA 3ZWXA 5FFFA 5CDGA 5CDUA 1Q2XA 1BVRA 4IMRA 2GGSA 4JX8A 3V2GA 3WGGA 3CINA 1PS8A 4CL8A 3A06A 3ZHXA 3W8DA 1GL3A 4E5KA 2PFGA 3U4CA 5HBRA 4PLPA 3G3EA 3WGQA 3KXDA 1H6BA 1IHYA 3DZFA 3Q9NA 3O03A 4J9UE 3DZKA 4F45A 5AVOA 5KJEA 1HZZA 5K6AC 5LCXA 2QYTA 3WMXA 1R66A 4CQLA 3TN7A 1F8GA 1JVBA 1YQDA 3RJ9A 3WYBA 1DJQA 3D3EA 3PLRA 5C5IA 4PLFA 1ZUD1 2W2LA 3JCZA 4O5OA 2GR9A 2HO5A 4QFCA 4ND2A 5JCJD 4WEQA 4FFMA 4BQPA 3WR5A 1PGPA 2O4UX 4FN4A 3TOZA 3RSHA 3C1AA 4DPLA 5K6AA 1EUDA 1GQQA 3DOJA 4LN1A 4WCFB 5LDHA 1C1XA 2IRWA 5IAAA 3QVXA 2IYPA 2CF6A 4J7UA 2EWMA 5TJ9A 4MVJP 2BFOA 2BFPA 1PJSA
chains in the Genus database with same CATH superfamily
2BFFB 2QUHA 4NBKA 4ZAXA 1VLLA 1Q5PA 1BE8A 4ASUA 3HACA 3N2LA 1UPBA 3JAMA 3OCUA 2VUSA 2NG1A 3SDBA 1LEHA 1PFGA 1JHOA 1G60A 1FRQA 3QOWA 4N7RA 4U3JB 4RX1A 4E14A 1SUBA 3AEQB 3LP5A 3AVWA 4DCTA 2ZUFA 1IZ9A 2P2SA 2OCGA 4LZPA 1XKXA 4NU0A 4RLSA 5JDCC 4OI1A 4YDQA 5JQWA 1W87A 1RQNA 1SC3A 4UE2A 3DLPX 4K7JA 3AKZA 1V5EA 2FUKA 2GN6A 2ZAGA 4WOKA 2V6JA 1PEKE 3WVNA 4E6PA 1TD9A 4QTUB 3PUVA 1L8OA 4E1VA 3ZCRA 2EG5A 3KVOA 3QM1A 2O3SA 2EJBA 2D0PB 2JEYA 4O2AA 4QJ4A 1OVGA 4A2QA 3ORRA 3N3AC 1A7UA 3K71B 1S89A 3OA2A 4XASA 3DFKA 3C43A 3T35A 4EGAA 4Y1EA 1M1ZA 1PLJA 2FFJA 3DHEA 5EQJB 3AI1A 3BK7A 2HTEA 4ZO8A 2JGRA 3Q0EA 1SD5A 1SVMA 2YH2A 3FIUA 3GD7A 4O2BF 5BVGA 3MWJA 4UXHA 2FUCA 1F2UA 2QXTA 4NCAA 2ZBPA 3IMKA 2IEIA 1TJ3A 4D4HA 1IOLA 1X1QA 1Z47A 1C30A 1YBVA 1YL6A 1ZK4A 2WYWA 1BDJA 2Q41A 1U5BA 1XKLA 4O1IA 3MBOA 5E1OA 3H4TA 2QR2A 4CM7A 1C3JA 2UYCA 3QFSA 4B4KA 4ER3A 1RAEA 2J4FA 1GNVA 1X8KA 2Q5JA 2XLBA 3C16C 3CNLA 2PMFA 4KLNA 4C43A 1NXQA 5ICMA 5JASA 3NATA 4BFVA 3QKUA 3ETCA 1E2FA 2C94A 3J80A 2SKEA 4HCJA 4XYMA 5IXSA 2GOYA 1U2QA 2I3DA 4AZ3B 1YNSA 1Y5LA 4LRTB 1JA9A 4MR7B 3I8OA 3K4PA 1OX4B 4EG4A 2Y1KA 1N3BA 4CF7A 3VZSA 1XEXB 4FS3A 2GCPA 2HSJA 1AJEA 4UBIA 3ZGVA 4WK0B 3NC0C 4NZYA 1J42A 1XCOA 1GTL1 1G17A 3ANSA 3FCXA 4H27A 1OI3A 5JJCA 2DECA 3FYUB 3F9CA 1C4WA 1QPBA 2R4TA 3QVOA 4RY2A 4X6LA 5EE3A 4DHWA 2CC2A 2WSSA 3PDUA 5J1SB 1Q7GA 3KEGA 1OFUX 3N1UA 3AINA 2V7VA 5C1DA 3AB7A 2JIQA 5BT9A 1Q84A 1TECE 2I7VA 2X2EA 2PHZA 3I23A 3KU1A 1PL7A 3T7TA 5IH3A 3K94A 3TCNA 1B3RA 5DEIA 1Z2PX 3MS4A 1JTEA 1S6YA 3W5VA 2RARA 1CBUA 1RHJA 4JFAA 1RQRA 3C45A 1CDZA 5ELXA 4RV5A 1IQPA 3O8CA 2VQEB 2DR3A 3VRHA 3G9ZA 4KN9S 3UK7A 4L22A 3KHKA 4CFSA 1QKJA 2XD4A 4J91A 1Z5NA 3WYDA 3ES9A 1PDWA 3HDJA 3W5SA 3AWIA 4BHTA 3VOSA 5TLSA 3IEMA 3N87A 3PQ5A 5H1YA 2QQ5A 4EVRA 4HLQB 5AIBA 2GKOA 3L7DA 2WZQA 2V7WA 2IYYA 4OQYA 3HJTA 4BX9A 3I62A 1X7XA 2HJGA 5JRZA 1PZGA 3ET4A 4IV0A 1F9AA 4LNHA 1U2EA 4WJZA 5AKLA 1LXCA 1D04A 2JGKA 2GZAA 4DS3A 3TBFA 3QXJA 2Z1NA 1P9WA 3BCUA 2DBRA 1TEXA 1KP2A 3KTOA 3V1MA 3VTKA 1XPRA 2JFOA 1MNAA 5C1BA 2ONCA 2ST1A 2ZIVB 1JLLA 5COBA 4QGBA 1ZIOA 2QD4A 2QG9A 3E3OA 3LHSA 2ZS9A 3OIGA 1JMVA 1RI2A 2R6HA 3ONVA 3ESAA 1MH9A 4HG2A 3GB9A 5EJGA 1XXHA 5HQ3A 4MEBA 1OC2A 4Y0VA 4WK2B 4R3WA 4BZPA 4BO7A 1F2DA 1QIEA 1DXOA 1YRQA 4HDRB 4D74A 5KU1A 3TG2A 4KPUB 2XUKA 3JASA 4OGLA 3BDIA 4AQ7A 2WICA 1C4OA 1NGSA 3FVRA 3SF0A 3W04A 3R3JA 1TM5E 4AUMA 4KIJA 3ZDAA 4JCOA 1D0VA 3LLVA 1HEYA 1NF3A 1XA4A 2H1CA 3QLEA 4JJZA 4ZOAA 2ZAIA 3EG5A 2C2XA 3CR8A 4KYIB 4MV0A 4XXHA 1G98A 3P9PA 4MHOA 1B6RA 4PX2A 4A16A 3ZZMA 2QRUA 3GH1A 2PKYX 3HMQA 3B8EA 3ANMA 3UF0A 4PG8A 4OI0A 4W9NC 4B0OA 1DI0A 1PIWA 2AJTA 2AUTA 4V39A 3OZAA 3ZGOA 3SXUB 2NVBA 4G0VA 3Q9UA 2R8RA 3G23A 3Q85A 4QULA 3DVAB 3N5KA 1Z8HA 3OM1A 3VVCA 3ZGYA 4DMRA 2H57A 1LUAA 3I01M 3L92A 4PICA 4P33A 1I33A 4QYWA 1BRMA 2G09A 4WA7A 4NC9A 4NV1A 3U13A 1FYXA 3TIGA 4ZJPA 2JFXA 3UHJA 5J4KA 5IYZA 3CVUA 3EDMA 5C4IA 1ZM3A 2Z8YA 2H65A 4BNIA 4LZAA 4R16A 3EPHA 5JV5A 1MU0A 3UUFA 4DANA 1M5RA 4M46A 2YNMA 1CB7A 3LPCA 3NUGA 1PHPA 1JDZA 2YV2A 1EBUA 3ROFA 2B4KA 4HNTA 2IYAA 4ZT3A 5H81A 1W7AA 2WBLC 3FSRA 1GEEA 3NP9A 1Y3CE 3ADBA 2FA9A 2Y1EA 3GC6A 2AA3A 4TXJA 4WV3A 1OIWA 3OBIA 1PSZA 4RHUA 4GR9A 3CF0A 3AHIA 3JW8A 3IDAA 3OO0A 3PA8A 3KZCA 3R09A 3TLGB 2HA5A 3V80A 3I52A 1FVHA 4M6WB 1UDBA 3RBAA 4DDTA 1M8KA 3FSGD 2YUTA 3LBIA 3VJMA 1Z83A 3E5NA 1D2RA 4J0CA 4MMYB 5JIBA 3DL0A 4FIDA 1BD3A 1P9OA 4F11A 5AVUA 5K0GA 5KQSA 1AHIA 1JNXX 1PNQA 1QG0A 1VJ1A 4GPEA 4BZQA 1BQ4A 1VCOA 3U49A 3UFBA 3UWOA 3LSYA 1VHWA 3LYAA 4IJ6A 5TIIA 1X13A 4RHYA 3AY6A 1PV1A 2ECQA 3O93A 4IJQA 1A4RA 4U5QA 4BFXA 1NXPA 1P73A 1XP5A 2P30A 4R8VA 4CFZA 3N0XA 3RS7A 1JAIA 3UW1A 4FFBA 4RQTA 2GRUA 3UAVA 4AX8A 1CR1A 4OQNA 5FHQA 4J0QA 3C5CA 1OYYA 4RK6A 3RS5A 3UT5A 3V46A 2PLWA 4ZYXA 1RLMA 4WGGA 2XNDD 1B16A 2QMQA 3S5UA 3IESA 1OXKB 4TYYA 1ISSA 1R15A 2FQQA 4O4LB 3VZRA 1DUVG 1NKSA 4JJFA 3D8TA 4YRAA 3KFVA 4UVIA 4BNFA 5KSZA 1HT0A 1I7NA 5K3CA 3B51X 3SMQA 4N8DA 2F8TA 4NOMA 1UJMA 3PFNA 4X3PA 2UUBB 2KWIA 1SCAA 1W9MA 4JP2A 4B6EA 4GMKA 4EY5A 2H7YA 3ZKWB 4NYJR 4UEOA 1T9AA 1FJ2A 1R6BX 3AEYA 4MGZR 5KQGA 2VHCA 4HAXA 4YAGA 4W9RA 4EQZA 5I7SA 2QX8A 1N36B 1KQPA 4DLLA 3D81A 3G8BA 3ZNPA 4D56A 1UMKA 3CWCA 1SXHA 1U1DA 5KB3A 1Z75A 1X9GA 1H5NA 1RAFA 2VCYA 1II0A 4RF4A 5FBZA 4G5QA 3ZYCA 1KH2A 2EFHB 3H2JA 4CMAA 4P0PB 5BMVA 3O7WA 2NYUA 2AI1A 2IZ5A 4PAMA 1CE8B 2I78A 2PSJA 2G5GX 4FHFA 3ZXXA 2AYXA 4P8RA 1Y33E 2EP8A 1OIXA 4DPMA 5C7YA 2D74A 4ZU3A 1JZQA 2F59A 4PN3A 3GAAA 4JB0A 3LPAA 5TS2A 1DX4A 1RXIA 2G40A 4NI5A 2MYNA 3T3GA 2QUZA 4HBGA 4HGQA 3HBMA 5TF0A 1G3UA 5D3QA 3QOYA 4LW8A 3K0CA 1YA8A 2ORVA 3P9ZA 4F5YA 2WWFA 1KYIA 1XTRA 3TLGA 3E3NA 1UIRA 4MPJA 5GWXA 3OEYA 5SY6A 4R8SA 1H2YA 4MKIA 1VJRA 3BE4A 4HLUA 4U7WA 3THSA 2ZCVA 3KTDA 1I9CA 2ABWA 1CZOA 2NO9A 2ODBA 1XVLA 1PX0A 3UB2A 5C1PA 1OB5A 5JD5A 3HR4A 2WAMA 5I5GA 1E1QD 1RJFA 5A4AA 4DV1B 3AIKA 4IQ0A 4EHFA 1HOTA 1QHHB 1SWVA 4QGFA 1EP9A 4MIKA 4R1UA 4OSPA 1V3VA 3H3FA 3PGA1 4KV7A 2JCYA 3PNKA 4YRZA 5JCZA 4N0PA 3ZQ6A 4BZXA 1LI5A 4JQCA 4Y1GA 1KQOA 3JQ7B 3TQTA 4P7BA 5F1KA 1AQNA 3QKIA 3FCSB 3GT3A 3PKJA 5EKSA 4KXWA 3B13B 4TGLA 2PZFA 4B6FA 2QTVB 2O2DA 1EFRA 4D26A 1NYRA 3KJHA 1YVDA 4NQRA 3SVZA 3SXUA 5HW0A 2Q5HA 3MS7A 5I01A 5JTTA 1DWUA 4YCMA 2P8JA 3M3HA 1LLQA 4P35A 1JHPA 1OC4A 2W2LD 4J3JA 4QGGA 3TPZA 4DJEC 1DKQA 3U1VA 1PSDA 1A2KC 3UHOA 1JR4A 2V6BA 2PWBA 3MJFA 3O8RA 1RKXA 5HMMA 2Y1FA 1M2VA 3CR7A 4OK6A 4UVGA 2NUPA 4G1CA 5EIAA 3FM9A 5GGXA 3VU0A 2X5NA 4BN5A 4DB4A 5JSZB 4JITA 3WFJA 1N4DA 3EVZA 3P19A 4HH1A 4YUWA 3EBOA 1JXMA 4I9HA 1QHNA 1M2GA 3UKDA 4HWOA 4Q4JB 1M1YB 1PJ8A 1VJ5A 4HI0E 4AZ0A 3IL2A 1M2JA 3G2IA 5CFMA 1YI8A 5EIHA 2BSQA 1KHTA 2Y27A 2XTJA 3HRHA 5IDYA 4J16A 5LDDC 4K0KB 1WXQA 5HZKA 5C3UA 2OPBA 4AP9A 2EQBA 3MWDB 2QQ0A 5DHUA 1AUOA 5ALGA 3ZH2A 4M8IA 2XI4A 1U2PA 2QTHA 2R1TB 1KE2A 2O2EA 1TW2A 4AM8A 1MRZA 5JFOA 1I2ZA 1ZM7A 3QEMB 1KYQA 2V6IA 4EAQA 4H60A 2JPDA 5HM8A 4YLYA 1WXWA 1XG5A 2XUHA 5C5EA 4YMUA 3UBMA 2IE0A 3FHJA 1FX1A 1D2EA 3ZU6A 3DUFB 4N82A 3E8MA 4JI3B 2F43A 3EGWA 1FYFA 1ONBA 1U8TA 2IUTA 4LEIA 4AIIA 4RJTA 1BWPA 1Q1ZA 4KCGA 1KSHA 2YN4A 2PFSA 1J9ZA 5J9FA 1U2GC 4RHCA 4AULA 5A03A 1W9HA 2OHVA 2Q9CA 3M89A 1O95D 1QB8A 3BX1A 3QVUA 4BDSA 1WKCA 1B15A 1VFPA 5AW3A 5IJWA 4ND4A 1UIMA 2YXDA 5JNVA 1LV8A 1OV4A 3KKLA 2ZANA 3OJOA 4NYJQ 3I05A 3BQMB 4FVTA 4M36A 1SUEA 2GZRA 3D2LA 3IPLA 4NCKA 5AK0A 5TR9A 4URXR 1XNQB 4JLWA 2OCKA 4DDWA 4NCIA 1KI6A 3HCCA 1M2HA 3CUKA 3K0EA 2WB4A 5G3ZA 3C6YA 3SLGA 1FLAA 3GRFA 3QPVA 1A5TA 5HHTA 4E15A 2WF5A 5JE8A 2R6R1 2B82A 4P2BA 4R3NA 1MZPA 3JQAA 1MH1A 1QH9A 1F12A 1SVNA 3C3PA 3QNWA 4YPVA 2FWRA 1TAQA 5JHGB 3U7HB 5ARCA 4U8HA 1JECA 1O8BA 2JJMA 2FVXA 3QXSA 1BKSB 2R8XA 2CVZA 2FPIA 3LH5A 2BHNA 4M1EA 1JAZA 5GM2A 4YVFA 3WMWA 1JKIA 3PIIA 1Y3HA 4XGNA 5CR9A 4IBOA 2GPNA 3HA3A 4HS4A 5J4VA 1V7QA 4G37A 1BS1A 2YWJA 2F00A 3U3KA 2X5XA 3WWOA 2PH7A 4UZEA 1FLVA 2WU1A 2UYHA 2OBLA 2PQ6A 1FXWA 4LMRA 1RZUA 3CGGA 4OJTA 1E3SA 4AZ3A 4C5CA 4C7XA 5I7UA 2ZZMA 4ESEA 1DXHA 2WTNA 5LKAA 3IOBA 3O3OB 3BMNB 2JIOA 3CS3A 3EVGA 2ZRLA 2FG5A 3DAHA 4Q00A 4CMKA 5BNZA 3I37X 2Z8XA 4XWGA 4EJSA 2PUFA 2A84A 1B1AA 1ODFA 3F5MA 5BSVA 2EHDA 2PXXA 3T1OA 4DSOA 2V45A 3NLLA 4EFDA 1EP2B 1KO8A 3W4KA 1T0UA 3FVQA 4GI7A 1OBOA 1R6XA 3V8MA 3WQHA 2R11A 4F6LA 4RMHA 3CNOA 4J8PA 4GWGA 2SKDA 4TPKA 5FPTA 4BBJA 5JCOC 3TL6A 3IUQA 2J5XA 1A8PA 3GH3A 3U62A 4OGKA 3ASUA 2MHCA 4KSCA 3VR2D 1CQIA 2DWQA 4FBGA 2IU6A 2WU8A 3GHHA 5HFNA 5COQA 3CLTD 2XVAA 5HCUA 4ALLA 2DBVO 3DF9A 3G7SA 3H3JA 6REQB 5CLFA 3DEZA 2HIHA 2IH4A 3TINA 1VSVA 3EC7A 4IDGA 3CVJA 4GZ3A 2HGSA 2J0QA 4G25A 2I33A 4GGOA 3KJGA 4ARUA 1C3VA 1TIBA 1PG5A 1CDEA 3GD5A 3IALA 5GONA 2GHRA 1JEJA 3ZE6A 3F2VA 4C2UA 2PS1A 4AW9A 1YCDA 1K08A 2INGX 2R79A 4LTDA 3G1WA 4EPVA 4Z7QB 2J08A 4I4TB 1EVQA 4NZOA 3T3NA 3GPIA 3QYFA 4F93B 3CUUA 4HAOA 4IQ4A 3W77A 1UPCA 1T8YA 5EEHA 5F7JA 1AV6A 3U61B 2CE7A 4CUKA 1Q2UA 3GVPA 3ORQA 1E7MA 1BIFA 3RTBA 2AS0A 3KDAA 2VT7A 4YMWA 1NQTA 2A2ZA 4ZAZA 4WCFC 4ANFA 1XEFA 4BO3A 2AQIA 3BTUA 1JN0A 2DFTA 5JD6A 4ZALA 3TB6A 4ESVA 1DC4A 1SM4A 2FWMX 3R0JA 3OJ0A 1U8YA 2JAUA 1GQRA 2XCOA 4C88A 2R00C 2LIPA 2PUHA 3EGIA 2NUPB 4GW3A 4PVDA 5F73A 3T7SA 3L3BA 5LU8A 2OC9A 2FMFA 1MEJA 4ZVVA 4IMIB 4YTEA 1GYQA 2C5BA 4KE7A 5JSQA 4GI2A 1FJHA 4WCVA 3TEFA 1V5IA 4UTNA 1AKTA 1ULAA 1ZWKA 3OICA 1Y5RA 3BWEA 4M60A 3KR1A 5JCXA 3U7GA 3FOFC 2A5FA 3T9DA 4N0DA 3CMMA 2OA0A 1I32A 2WIKA 3T34A 3CLUC 4B09A 1E7SA 1FTWA 2UUPA 4WXPA 2VF4X 2BHLA 1GD1O 4HEQA 3HXLA 3T9AA 5HRCA 1JT2A 3VPXA 2V6MA 1RFGE 3V8NA 4BX3A 1CSEE 1H8HD 2FETA 2GNOA 1U8AA 2V7GA 1BRTA 1KC3A 4YJ2B 3T5CA 4EI7A 3R44A 4EUSA 2O3RA 2VT2A 1JDNA 1KPHA 4KODA 1WVIA 1PQYA 2BFFA 4LJ7A 5AHXA 5IBPA 4DG5A 4ITRC 4C06A 1O95C 4AJNA 5A3SA 3QKRA 3ELWA 3RS4A 1FMFA 1M1YA 3H19A 4HDSA 5DCLA 4N5HX 5FQOA 5K2OA 2IELA 2VN8A 3IBFA 2JLYA 2YCLA 1FW8A 3MSXA 4H0FA 4DCSA 4TZ6A 1CF4A 5WRFA 4DJJA 4V24A 5D5PA 2DOKA 1GY8A 1O94A 2PX2A 3AFOA 1B6TA 1C3OB 3H4VA 3A9TA 3FDXA 4QXAA 3TR5A 4GQBA 3WJ7A 3R8FA 2WKRA 2QD1A 1GPLA 2I2DA 3H2SA 3KQWA 2DHCA 3EUAA 3PBKA 5AHOA 5DPMA 5EZQA 1NMXA 3MJHA 2VJKA 4B85A 2J09A 4BC1A 2K7ZA 2QTWB 4II2A 2B35A 3FDJA 1AOXA 4D9HA 4NFSA 2JBAA 2K2QB 1OAAA 5AM0A 2IYEA 5IHPA 1U0EA 3P9KA 4N6NA 4EECA 2AWNA 1WHSB 1DFIA 1P1IA 1ISHA 1L5ZA 3D8HA 4I55A 5DVZA 1M1NB 4MRSA 2G82A 3INGA 3DR5A 4I08A 4YIHA 5HIIA 3ZHYA 5B6JA 4C7OA 3I5UA 4AB1A 4OYYA 2RHBA 5HJEA 3DT9A 3EA0A 2QJOA 4DLVA 3ZNNA 4AVYA 2XMSA 2ZTHA 5DTRA 4EYQA 5IVIA 2QAIA 2AN5A 4YACA 4DQKA 4U2GA 4AU1A 1Z82A 1SBCA 4MQ5A 4FW8A 4HRYA 1CVRA 1P1FA 2E5WA 2JCBA 3MLAA 1IN1A 1GAQA 1T1GA 5LPNA 1EFDN 4Y0NA 1WMAA 1GAEO 4O3FA 1XXLA 3EVNA 4YP1A 5HCIA 2PJUA 1TQ6A 2CN1A 1OIVA 2WR8A 2XUAA 1DAHA 1N9KA 4HNSA 4YNBA 3I72A 4OHKA 2IODA 5I4CA 5IC4A 4Z4EA 3NXKA 5CAEA 1LSSA 3ABQB 4HUJA 2ONJA 1W0JD 2YV4A 4FTWA 3AHEA 4GZLA 2F8MA 1E3WA 4U00A 3DQZA 1AA9A 3IURA 3PUWA 3K9FC 1I1HA 2C0CA 3KBBA 3ZR4B 5HPYB 1ZCJA 3ASZA 1DIBA 3E81A 1TYCA 3P9QA 1FFSA 4FFVA 5AKZA 3L84A 1ZOPA 1Z6YA 2ANBA 2G5PA 4A1FA 1GAWA 1MX9A 2C4UA 4L76A 3LX8A 1MB2A 2JIBA 4FS8A 1OXTA 2GTHA 5I3ZA 2C96A 4CL0A 3DE4X 4CMEC 4N6OA 3OCVA 1XAIA 4LFAB 2VXCA 2BONA 1Z0DA 1YFZA 1BFDA 1S9DA 1SN7A 1VCNA 2VBGA 4WL0A 2OZKA 4NE2A 2FHSA 4KXVA 1QBKC 3KALA 4DXDA 3OMLA 4Z3OA 4AYTA 3RSSA 1XHEA 1M67A 3NQ41 4S1VA 1SPXA 4S2UA 2XIJA 4D9KA 3KZKA 3WX0A 5JAOA 4AO8A 2X5KO 3KFLA 5EIOA 2BEJA 2CHEA 4MKHA 3IIKA 4I4CA 1FMTA 1Z6QA 3BAFA 2DPHA 3IRVA 2DKOA 4M6WA 4A9AA 3ENVA 2R2GA 3ZJ4A 1RPTA 3WWYA 2CBZA 5C37A 5FNVF 4IIJB 2JD2A 3WIDA 4UBMA 1RQ7A 1ECFA 1VDMA 4UULA 3CVWA 1LNSA 5BY2A 1C3EA 1F38A 3AJ9A 4UAGA 2NAPA 5EKTA 3O4GA 1VLHA 4BNJA 2QUIA 4FZ5A 2JIZD 4S24A 1JZSA 3AOGA 2ZSAA 4JS0A 4ES6A 4KC0A 1ZSNA 3CSUA 1OBFO 2IOQA 1FUKA 3EWNA 3GLRA 3JZMA 1RR6A 4UDYX 4D9EA 4OGFA 1P8AA 2PGLA 4GGMX 3ZHQA 3MT9A 4MSUA 4DRYA 3LNCA 1JSRA 4YI3A 1NZJA 3NZEA 4QTYA 2NZJA 1BKYA 2JGAA 2V8BA 5DK6A 3VYWA 3FTFA 2C07A 3HUFA 1ZSVA 3KZNA 4P7FA 4C14A 2QRPA 5A4FS 3BE8A 1DOZA 4H3SA 2HREA 4H9GA 2QD5A 4WRRA 5THXA 1C0KA 3TZ6A 1JSCA 2J0VA 3DWEX 4GMFA 2QI9C 2HRBA 3H9JA 4HWTA 4Q4HB 4RKFA 4DNOA 5AJVB 2C7GA 4G5RA 4XIIA 4ABTA 2CF5A 3QWFA 4UE3S 1FCJA 2IXEA 3CYFA 4FD2A 2JGLA 2FY8A 4Z49A 3X43A 4ZRDA 1H3NA 4ZKEA 1QQAA 3P2IA 3ZZNA 2GYVA 1AKWA 1BX1A 2EZUA 4CN9A 3KQYA 4EFMA 4F92B 2NZ2A 4KWHA 5A5VA 1HDRA 3B53X 1IWOA 5DP2A 5LIPA 1SEVA 5DMXA 1GUAA 2POQX 4CEHB 3P0HA 4OH1A 4PW0A 3U3ZA 4ENVA 1O7JA 1R12A 3AR2A 1YQWA 3IERA 4JJ8A 3CJRA 4GX5A 4R1OA 1AY0A 1UPUA 1QKKA 1EK6A 4IR7A 5EY5B 3CJTA 4IO1A 1EJ6A 1NBEA 1JLRA 2YDYA 1A2QA 1T43A 1TYZA 3VO1A 3BMOB 3UTDA 1VI6A 4IKEA 1K9VF 1R5BA 2CXOA 1E66A 3F4LA 4PLZA 4X9XA 2D4HA 3ZTTA 3Q6MA 2ETXA 3N75A 2K87A 3WBKA 4DM7A 2RGDA 4F2PA 1TK9A 4MCHA 1IAQA 1MAWA 3OQOA 5HYVA 1ACLA 4Q7LA 3R0XA 3QVMA 1G63A 3DEHA 3V6MA 4DPKA 4UNRA 4R68A 4QOJA 2AR0A 1PEAA 1QX3A 4TKUB 4DWOA 3H13A 1XRRA 2ZWOA 4PGAA 4DSZA 1XCBA 1QG6A 3GJXC 2XCUA 3ZE2B 421PA 1EDZA 3GFFA 2VQ3A 3W3AD 2ET6A 3OOYA 5AW1A 1RJDA 2C3PA 1NMEA 2B4RO 2ZOSA 2CYCA 3QVKA 3I92A 4JEIA 1PQ4A 4MV4A 3D6FA 3B1YA 4HGRA 1SXJB 2OB1A 1E1NA 5D84A 2WNIA 4LQLA 3KAQA 2VJPA 3DE1X 4JKIA 4L3OA 3S7ZA 3ED1A 2E3JA 2P1ZA 3NBUA 2D06A 2I6QA 3ZZTA 2HC9A 3RKUA 1SAYA 2C20A 2ZULA 2CJPA 4UREA 4WXYB 1LY1A 3GQVA 3F7TA 1K4YA 3IUBA 5EN4A 3UGTA 1N5IA 4OK3A 3K0AB 4M0EA 4U0KA 4ZHQB 4NXNB 4U9HS 4NULA 1E3EA 5I5EA 2XKAA 3CKMA 1MJGA 1WNTA 3H5NA 1DG3A 3LWBA 5EIBC 3RUPA 4BMNA 2GARA 1U7WA 1KSJA 1RPNA 4H3VA 3OEEA 3UWSA 3LXRA 3V1NA 3T61A 1U1GA 3WOHA 3KJFA 1WZ2A 1X9IA 1INLA 4I5DA 4EY7A 3OOHA 1R0XA 1E4OA 1IWPB 1MD9A 1E8NA 3K1ZA 3FNIA 1EA7A 1ETHA 2UYOA 4G0QA 3NEJA 3O2SB 4KKVA 4PQRA 3A2NA 5AKHA 1LA2A 3GA5A 3KXLA 1GSOA 2ID7A 1HMYA 1XEXA 3BXEA 4D9FA 1JHZA 2QJWA 3WWCA 3DL2A 3OIUA 1HNZB 2QZPA 1ZK0A 5B1YA 3AUAA 4I8IA 2YHUA 3CUWA 4DXAA 5KMGA 1R8XA 2XUQA 1WDLA 5DXAA 1NVBA 3Q15C 2OLJA 1YUBA 4Y2PA 3K70D 3I9JA 4MO2A 1SCKA 2BBOA 3PX3A 3WDLA 4JBNA 2PG3A 3L4EA 4BNZA 2D2FA 4PRZA 4Q6WA 4ZCPA 4I4IA 1YONA 2BUBA 3LQRA 4ERXA 1P5FA 1WUIS 3V8RA 1G8HA 3A1SA 3FB1A 5A1TA 4OMUA 5IM4F 4YN3A 4F38A 3AERB 5BNTA 2DLCX 1IRIA 1Z0AA 5DLPA 3TD2A 3RG2A 3SXJA 3VC3A 2XCQA 1JTVA 5FYQA 4CXMA 3AUYA 1LJLA 1CQPA 2Q4EA 2FRDA 2B1RA 3C6QA 3D4OA 1WZCA 3G0IA 5AVWA 5FLKA 2OXFA 2QRVB 4IDNA 4NMHA 2F1RA 3IO3A 1RRKA 1SXGA 4DAOA 1H2WA 4YO7A 3EG9A 1QHGA 5K3OA 2VWGA 2HRQA 2AR9A 3AKDA 3NDJA 4AMVA 4DV5B 1XIVA 1SQ6A 2I1WA 2VTDA 1EVZA 3GGOA 4K6HA 4ARSA 4F04A 1QR2A 1ZESA 1Z0JA 1JDBB 4P7KA 2O8CB 1DVRA 1Z6TA 4UOQA 3IPCA 3N86A 3LDFA 4ILEA 5AK4A 4ZOQI 4BY9E 2XXAB 2H4XA 2GZMA 1AKMA 4HDMB 4INPA 2WIDA 3AEQA 1MP0A 1MAAA 2P2YA 3HU5A 5IH7A 4L85A 2AN3A 4OL0A 2QT9A 2MCFA 4E11A 2OGSA 5ADWA 4ARIA 1JR6A 3AG5A 5EUBA 1IVSA 1NBMA 3Q7EA 1USUA 4ABYA 2FZVA 1YOVA 2X3UA 1WX1A 1QVAA 2O2JA 3A9SA 2BZGA 3A9WA 3BMXA 5ENZA 2VBFA 4Q1BA 3VU1A 4DJDC 4DWWA 2JFNA 3EQ8A 3NYRA 3H2BA 1N9GA 1B42A 3DAPA 1XVVA 3ZJTA 4R81A 3MINB 3KETA 1X7DA 4EYGA 1HKHA 1Z29A 3E48A 3W2FA 5JSKA 4WVLA 2ZQYA 4IW3B 2GEKA 1WEHA 4YRFA 2VZEA 2HCFA 1GZUA 4OXKA 3V32A 4WOJA 4LV6A 1ZBQA 3S2EA 4M55A 4AAYA 1SH7A 3D7RA 1DNPA 2O54A 3OD5A 1TKAA 2RHWA 2C9OA 3O95A 3E7PA 2YJ5A 2PQ0A 1GSIA 1TNDA 3GOQA 4MKGA 4YAKA 5C9ZA 1PI3A 3F6SA 4PHCA 3MB8A 2QX6A 4MRAA 2P2DA 2R86A 3KZMA 4JLSA 2CNWA 1TVEA 1ENYA 1PU2A 2RAFA 2XUIA 3FVVA 4LGMA 3M6IA 5LA6B 3CC8A 5TY0A 2X15A 3TX6A 3EARA 2DSNA 4HFNA 4HLUC 1VE7A 1G5FA 4GE0A 4RNCA 5JZVA 3TXXA 3QFHA 3SBOA 2PZBA 3DPUA 2PUBA 4QSMA 3KB8A 3T94A 1H05A 3RADC 221PA 2HJRA 1TQ8A 3EZNA 3TOCA 3VC1A 4XW2A 2KSQA 3MJ4A 4G1MB 3W05A 3EF1A 3NO4A 2M6SA 2NXCA 1PV2A 3KHTA 2ZXUA 2F6RA 4QLAA 1P7YA 4E70A 4QQKA 3W1VA 1BFUA 3LJKA 2IP2A 3L7LA 1SQFA 2Z3ZA 1EB8A 2ZSIA 3LZDA 4YPFA 1X1BA 2EF1A 3L4BC 1WKVA 3ND5A 4N03A 3LLUA 4Q02A 4FLFA 3S2IA 2Q3DA 4EJ2A 2RHLA 4QEDA 1T5BA 4W1PA 4GICA 2HLPA 2BMDA 4YT8A 1IUPA 1XZFA 8LDHA 1GZDA 4JVLA 3QUAA 5JZ9A 4EZBA 3F7OA 1V7CA 4NCXA 2X2PA 5AOBA 5ILOA 3TAXA 3WWZA 5B64A 4HHEA 3M5DA 4IRMA 1S2DA 4B6PA 2GPSA 1RRPA 2UZIR 3N07A 4MO9A 2WTMA 4RVNA 3USCS 4QFBA 2C2BA 3EC1A 3AJAA 4Q1AA 1PEDA 3A7EA 4GAEA 1UZNA 5EFZA 4TKUA 1GA4A 2TMDA 4UHFA 3HABA 4B3MB 1Z73A 2CXHA 2I65A 3DMRA 2HF9A 1TI7A 1HE2A 2QTNA 4Q4AB 4L8YA 3HL0A 3LO8A 4MWDA 1SVKA 1YJXA 4RESA 1A4XA 5D87A 1J5XA 1RVV1 4LF7B 3UXYA 1YJQA 2RAPA 4RFLA 1QZZA 1VLZA 2VZ9A 2FRDC 3GUZA 3KQQA 1NW9B 1MO4A 1P31A 1TM1E 4JUIA 4E1AA 1SVSA 3GZNB 1L7BA 3LGXA 3LXMA 2GVDC 1E2NA 5B3KA 2VTKA 4IDDA 4C0AC 3DD1A 1I7LA 2BLNA 3I1JA 2YOFA 4GNRA 2A1IA 1UBFA 4GP7A 3CU5A 4NEHB 1ZD8A 4AS3A 3ZGLA 1V8BA 1L2TA 1OLOA 2JFGA 3OZTA 3VDMA 2JIRA 4E5PA 3PA6A 2ZRBA 4LC9A 2ID4A 4D8YA 1P0FA 2W2KA 2VSYA 3KU4A 1XQWA 4G5OA 1YK0A 1A5AB 1FRVA 2D13A 3KSRA 2R5NA 4DKJA 1F7UA 2XGGA 3IAAA 4HNUA 1NI4A 3CT4A 2MOKA 3U56A 4U6SA 2B69A 1S4QA 4FONA 1YBMA 2O52A 1YZYA 3SP1A 3Q12A 4JEUA 1LBHA 2REXB 2LRHA 1O77A 3H16A 3KELA 3VUEA 2JEZA 3L6EA 1FSSA 2BSXA 4PZPA 5CK5A 4IIYA 1XTZA 2VAVA 3KR9A 1ID1A 3TTSA 3UA3A 4H31A 1JZTA 3ZV5A 1B41A 1K8ZB 2Y1OA 4L75A 2H1VA 1WCXA 4M76B 1QNLA 4YCCA 2D6FA 1K68A 2FFRA 2ZYRA 2YRWA 1DKLA 1HF3A 3N0VA 4KQIA 3R3UA 4PFJA 4C0LA 5BRJA 2E37A 1SIBE 1UQUA 5FI0B 4ZT7A 2LCQA 1Y9ZA 4PZCA 5IBCA 1GPUA 4MWSA 1Y9EA 4ROSA 3EZYA 1PD0A 2WSSD 4Z9BA 1E0DA 3RJMA 2O59A 3SC2A 2H3EA 4RZQA 2EZ4A 1O6BA 2VJCA 1H22A 4K9DA 4S1PA 3EN0A 4IF4A 1HMPA 3HDYA 3AWDA 2BISA 4KXXA 4MW2A 2R4UA 2NYAA 1NRWA 1KZGB 3B85A 3CEJA 3HXTA 3T3DA 4DQUA 2A5JA 1SXIA 4JLAA 1L4HA 1H0SA 1UBKS 2C5EA 2O0MA 2YQ4A 3ENQA 3GFRA 1SD2A 3UEOA 1XEWX 4I1UA 3PDHA 4B34A 1ABEA 2DBYA 4YRDA 2QMOA 2QR3A 4YJ2F 1SXJE 1DX6A 2JGIA 4MV6A 4MCIA 1U0JA 2FPPA 4ZJYA 3ABSB 3BA1A 4XOIA 3SD7A 5J58A 5I9LA 1M5TA 1TO6A 2XEXA 3BJEA 4P3NA 1XUOA 3GBPA 4OJQA 2PUDA 2LBPA 4B3TB 1GITA 2GNAA 3GZJA 1C9JA 1Q92A 3DH0A 3JZDA 3W6NA 4PCLA 1ND6A 2YHIB 4BEVA 2R87A 2OZPA 3BSSA 4TROA 3SHWA 3LQYA 4EW2A 1XT6A 1YQQA 2XYHA 1NWHA 2R8ZA 2GCOB 4L6CA 3R3VA 1G42A 1Y89A 3ICPA 3U7RA 1GPWB 2Q3EA 4RD6A 2FEWB 3IR5A 1ZK1A 3PE4A 2D5CA 1SB8A 4PO1A 5KYWA 4PLGA 2R25B 1L5FA 1KBQA 1GCIA 5I7FA 1X42A 3PVCA 1FRNA 3QBJA 3TW0A 4K5QA 1JDBC 4LJ5A 4TTQA 4QU9A 4B6SA 1DX9A 3I9NA 2C29D 3ICVA 4WZAB 2GJ8A 5CURA 3U16A 1HNXB 4NZMA 4WLUA 2F8SA 4GL4A 4J0FA 5AOAA 3C3BA 4KYTA 3H99A 1EWKA 1WB4A 2CVHA 2ZE6A 4XUDA 3SNKA 1ZI9A 2P7HA 4EZIA 2O8FA 3KYBA 3A2LA 2GPTA 4MZDA 4EF5A 1ZLYA 4O59O 4RWEA 3LCRA 1DBPA 4EEKA 1YULA 2W8BA 4XUCA 3INYA 2E4XA 5L3ZA 1Z7GA 2VF5X 3UWDA 3ZY6A 4HFJA 4W9MC 4Q3KA 1DBRA 4LRSB 5H70A 1VLJA 1H23A 5ULLA 1JEDA 3DM9B 1UUFA 1PJQA 2FSVA 3PYXA 4G9EA 5JFTA 2EGUA 3CUTA 4FDTA 2IXBA 2XMCA 4KWCA 4OH7A 3UMJA 2MR6A 1WCWA 3DNPA 3FNRA 5G4KA 2J3KA 1UBTS 2P9TA 1F0NA 1QK5A 2XAAA 1XZIA 2DFPA 4G67A 3MQ4A 4XYGA 5CNMA 3FNHA 3IDZA 3GNQA 4D7AA 1TQHA 3IILA 1NJSA 4DLXA 1GPMA 1AUXA 2VJDA 4F21A 3CX7A 3EE6A 3B1JA 1F8XA 2F7SA 1VKJA 1OGIA 2PZEA 2C03A 1T9GR 3HB1A 4IXNA 3DMGA 4FSDA 5D5HA 2J0EA 5I8PA 2X8WA 1VKOA 1RFLA 2GETA 3FDZB 1L7QA 3A6ZA 2X8JB 3RC7A 2RI0A 3DOOA 4YT4A 3AJRA 3MD0A 1YA6A 2SCUB 3H04A 4IILA 4Q4DA 3GMDA 1OH5A 1A7JA 1JBKA 4O4IA 5SV2A 1E92A 1R6TA 2CFRA 2HMYB 6NULA 4WZZA 4NIMA 2ZITA 3S1AB 1K66A 4IIEA 1WF6A 3NG1A 2WAAA 1K5HA 3VU9A 1PWZA 2ZBRA 2PT6A 2EVWX 4ZQFA 2NU9B 1TTTA 1ZCBA 2TMYA 1FNMA 3PICA 5EMNA 1T1EA 1JBEA 1PDVA 3QIAA 4E08A 3RVSA 4ZVOA 2B21A 4GX0A 1CJVC 4X7BA 5F4BA 5M5BA 1NXWA 1OI7A 3E03A 4QU5A 2ZJ5A 3KM0A 5EXPA 4LX8A 2W0SA 2D8AA 2J07A 1CF9A 1SA0B 5EFOA 1Q0UA 5JSYA 1I7PA 3NBAA 4FK8A 1TT7A 3DLBA 2XB8A 3T7RA 1VLQA 3EGVA 4OJMX 4QWWA 1KARA 4CLRA 3O75A 4BFYA 4WNYA 1N6HA 5J63A 5KDLA 1PUXA 2WOJA 2GJ9A 4FDLA 3ENKA 3FUUA 4DRXA 3KKMA 5A5FA 1MAHA 1YHYA 2I76A 2VDRB 2VP5A 4PV7A 4TXLA 4C6HA 2AVNA 3QPUA 1QYCA 2A9VA 4QSHA 4TVKA 3QXGA 3HXMA 1BN6A 3LG2A 2AKEA 1WHTA 1JFSA 3H1TA 4JGGA 1FMLA 3ZIAA 1JPVA 3BBPA 2Y2UA 4YO8A 4DCNA 1LU9A 1KZ9A 3E7WA 1PZMA 3L7YA 3OWOA 3PC2A 3V4ZA 1Y3DE 3FJYA 3IAS6 4MTCA 1UKVY 4HVTA 4HGYA 2JLVA 3QU5A 2PD4A 3OQ1A 3OD1A 2JD0A 2E4ZA 2HMAA 2QRGA 1QO0A 2XRFA 3DE0X 1ZKMA 5ED0A 5FL3A 4UNPA 4C22A 3CURA 1Z2CA 1M6EX 4I50A 5A5GA 3VOAA 2VNAA 1R6UA 3KEOA 3R5SA 2A57A 3AEKA 5LKRA 3BMQB 4FPXA 1YRBA 2H1RA 3NAGA 4LK3A 3PGVA 3DQQA 3RIEA 3PC3A 3C98A 3MWGA 1JG1A 5TPWB 5KO2A 3G8AA 2CMFA 1PLLA 2E49A 3T0IA 2UU9B 3O2NA 4L74A 1X77A 3FUXA 3HLYA 3DZ8A 1Y0BA 4K0RA 2YC2C 4DTCA 2VK4A 4AY6A 1U31A 1XAJA 1JQEA 1U7HA 1OGJA 3KYCA 2B92A 4LZLA 4IV5A 1E3IA 3OIDA 4LWZA 4JMLA 4LTMA 5HDBB 3OCJA 4DDMA 5DN6D 3H18A 3P2JA 4OUKX 5DZSA 5IPFA 2DF8A 4EKDA 4GYYA 1SHZA 1DJPA 1UJ6A 2XWPA 1T6BY 3A9CA 3MINA 4MW5A 2OHXA 4IGKA 3O31A 3LF1A 3S6JA 3ZWNA 1LW6E 1NUTA 2X2FA 3HYNA