4I5FA

Crystal structure of ralstonia sp. alcohol dehydrogenase mutant n15g, g37d, r38v, r39s
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
249
structure length
233
Chain Sequence
AYRLLNKTAVITGGGSGIGLATAKRFVAEGAYVFIVDVSRKELEQAAAEIGRNVTAVKADVTKLEDLDRLYAIVREQRGSIDVLFANSGAIEQKTLEEITPEHYDRTFDVNVRGLIFTVQKALPLLRDGGSVILTSSVAGVLGLQAHDTYSAAKAAVRSLARTWTTELKGRSIRVNAVSPGAIDTPAKFAAATPLGRVGRPEELAAAVLFLASDDSSYVAGIELFVDGGLTQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alclohol dehydrogenase/short-chain dehydrogenase
publication title Crystallographic analysis and structure-guided engineering of NADPH-dependent Ralstonia sp. Alcohol dehydrogenase toward NADH cosubstrate specificity.
pubmed doi rcsb
source organism Ralstonia sp.
molecule tags Oxidoreductase
total genus 89
structure length 233
sequence length 249
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2012-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4i5fA00
4IGEA 4RF4A 1DIRA 3MTJA 4N5NA 2NM0A 5TQVA 1EE2A 3UH1A 2RH4A 1CJCA 1B26A 3TWOA 2DTDA 3OHSX 1KEVA 1U9JA 4TMFA 3KYCB 5TLSA 1TXGA 1PWXA 1WXDA 4ND5A 2Q3EA 4DVJA 3RSHA 3KYCA 3M1AA 1PGPA 4IPTA 4OAQA 1HLPA 4RCVA 4YAEA 3ZHXA 4B3IA 1B2LA 1Z74A 1ZK1A 2A94A 4E2ZA 3HDQA 4JK3A 4FC7A 3RU9A 1WLYA 3O8QB 4J43A 3OH8A 3VPFA 4K28A 3TQHA 1LLUA 5HS6A 1R66A 4ZA2A 1R0KA 3O8QA 3WLEA 4Q3DA 1B8UA 9LDTA 4XQ9A 2ZQZA 3ASVA 2EV9A 4M54A 4WLUA 2FN7A 4XQGA 5IN4A 2YYYA 3RUHA 4KDEA 2AQHA 3C7DB 4Q3NA 3FTPA 1P1HA 3D5TA 2ZJ0A 3H9QA 1B14A 3OETA 4E30A 4HNGA 5G4KB 5CFZA 4A5OA 1YL7A 4YJFB 4TRNA 1I3KA 3F4LA 2RH8A 4FPXA 1T2CA 5G4KA 1OZAA 4ALMA 2O4UX 3EMKA 3DL2A 3FWNA 1SPXA 1F8GA 5DP1A 1QV7A 4DLBA 5BQFA 3HWRA 2C07A 3LF1A 3O9ZA 3NT5A 4NBUA 1R4MB 4II2A 4G5HA 4CUJA 2WE8A 4ID9A 1LSOA 3VZPA 4XYGA 5IN5A 3FBTA 3ICCA 4CV2A 1SNYA 4AJ2A 1WVGA 5L7YA 3WGYA 4E33A 5A02A 4MOWA 1GPJA 4U8GA 2YV2A 5F1KA 1VJTA 5C37A 5L3ZA 4FFPA 3DMTC 2VYNA 4XQCA 1LBEA 3B1KA 1ZUD1 1RM3A 5AQ1A 5HS4A 1K2WA 4OO3A 4XEHA 1XDWA 3JV7A 2FZEA 4XIJA 4JBIA 3G0OA 4BO6A 3H9JA 1NVTA 1DAOA 1UJMA 4YAJA 5A03A 4RZIA 2PK3A 3LC2O 3LT4A 3NGXA 2POQX 1HDRA 1A27A 3FPCA 3L9WA 5TT1A 1M2WA 2DFDA 3GN2A 5JS6A 2DUUA 2X0IA 2PWZA 4CLRB 1XR3A 2QZZA 3DMTA 3MJ4A 4RVSA 4U7WA 4C4OA 1A4IA 5COAA 1LDGA 3V2HA 3TSCA 4CLRA 4CLXA 1FK8A 1LDBA 2Q1TA 4CL3A 3JD4A 2VOJA 1ZMOA 4FR5A 4FOSA 3H5NA 3K2EA 4CUKA 1ISIA 4I9HA 5JCJA 4AJEA 3GEDA 4OJNA 2B0JA 4FJ0A 4LMPA 3JQ9C 4PLTA 3GDFA 5T67A 3ROQA 3CINA 1GL3A 4WGGA 2XAAA 3BZUA 2J6IA 4BGVA 1NAHA 2X6TA 4OL9A 2O3RA 3VZQA 4EEXA 3E18A 1O5IA 3PJGA 4D7AA 1C1XB 3E6AA 3PHJA 4KWHA 3L6DA 4OXKA 4W7HA 3ORFA 1YOVA 4ALIA 4DREA 3UXYA 2D5CA 1C1XA 1Y8RA 1I33A 4BO0A 3OA0A 3Q2IA 2VWQA 1N5DA 4PGFA 1PEDA 1BGVA 1KEPA 1FDUA 4IDEA 4M86A 3GA0A 4ND3A 4R1TA 2BH9A 3GMDA 1PWZA 5B37A 3ZW9A 2VYVD 2AXQA 3RFXA 4FFNA 2PY6A 3CZMA 1JVBA 3HFSA 4J1QA 1O95A 2IEBA 3G1TA 4QFCA 3OJ0A 2ZTMA 3OF2A 4BNKA 1PJCA 1YL5A 3LDHA 3NDRA 4JBGA 4E12A 1HYEA 3RC9A 3BMNB 4BNGA 2HAEA 4ALNA 4UULA 1SC6A 2DAPA 4MINA 1NPDA 5L4LA 2Q4EA 5CPBA 3PI7A 3BHIA 5TNXA 3G79A 1PZFA 1XG5A 4YR9A 4QFDA 1GFSA 1I30A 4GH5A 4R5MA 5CPFA 4Y6RA 1SOVA 2Q1UA 3RD5A 1PL6A 2JFHA 4NFHA 1QLHA 1J4AA 3U49A 4F3YA 2NVWA 3C1OA 1PJ4A 2HKIA 3S8MA 4IJKA 4R01A 2VRBA 4PLGA 4WEOA 4FN4A 1LX6A 5A05A 2Q2VA 1U8XX 1UZLA 1GYQA 3VAZA 4LCEA 1VJ0A 2Q2WA 4GSLA 4Z9XA 4BUCA 1YBAA 4IXWA 2YHUA 2GASA 1HZZA 1OC4A 4AJ1A 4CR7A 3HQ4O 1B16A 1OFGA 4XCVA 4CMJA 1NBOA 4OXNA 3VHRA 4DBZA 4NPCA 5JMPA 3SC4A 5A9SB 2GUGA 4QUKA 3DBHB 3ZU2A 3ETEA 4UVDA 3TZCA 5JC8A 1DB3A 1HRDA 2AW5A 1IYZA 3NX4A 4UVHA 4DRYA 5A9SA 1LQTA 1O6ZA 3GZNA 2ZQYA 5F5NA 1SO8A 3RBXA 3GVXA 2NV6A 4D3DA 5G0TA 4HFRA 1XSEA 4J6FA 4YEDA 3JYQA 1EFKA 2GZ2A 4PZCA 3TFQA 3CIFA 1ISMA 5KVVA 2E49A 2QYSA 4WLNA 1Q1NA 2JFGA 2Q50A 4DQXA 3D7LA 1WDMA 3V1YA 3PP8A 2B4TO 4YPOA 5TX7A 4JGBA 1H2BA 1U28A 1W4ZA 3JQGB 4NI5A 4XX0A 5L4NA 2VTDA 3HDYA 3K73O 4YRAA 1UXKA 2O3TA 3JQGA 5FF9A 3R6DA 1R4NA 1VRWA 5EPOA 4HY3A 4FC6A 1PR3A 3AK4A 5TJ9A 3FSRA 1ULUA 1X13A 4DLAA 3WTCA 4CM8A 4BO1A 1ORRA 2W90A 3GDOA 2FWMX 4WJZA 4UREA 3D3WA 4A27A 3G3EA 3Q2KA 3HN2A 4DWVA 4DYDA 2V6BA 2WWRA 2P2SA 5LDHA 3QY9A 1UP6A 3R3JA 4LMRA 4RVUA 4YAGA 4W9NC 5IDYA 1Z7EA 4L75A 4YT8A 3UVEA 3EVTA 1GV0A 1C0PA 3UFXA 1KY5A 2YJZA 3GGGA 4NK4A 2XPCA 4OQZA 1E7SA 2E48A 4IM7A 4HXYA 4ND2A 1B3RA 1YB1A 2Y0CA 3ZI0A 1GQ2A 2HK9A 3VKUA 1HSZA 1UXJA 3HHPA 4O6VA 5JDCC 1E3EA 3UGKA 1ZK2A 3W4JA 3DR3A 4GKVA 1TVEA 1LC3A 2PGDA 5KKCA 1GQYA 1VSVA 3GK3A 3U4IA 1F14A 3RUCA 4L8VA 1ZFNA 1U7TA 3HDJA 3X2EA 4FJ1A 4NBWA 4W9NA 1Q7BA 1EK5A 4Q39A 3G49A 1ONNA 3ITKA 1VSUA 3LC1O 3O38A 4RV9A 3AM5A 3ONDA 4KWIA 3Q9UA 3PPIA 1HETA 1X7GA 4L9RA 4GWKA 3CH6A 3WGHA 5JDCA 4BQRA 3Q1LA 3IAHA 3C7CB 4B8WA 2HSDA 4IQGA 2Y0DA 2YZ7A 5BNFA 1JWAB 4NU6A 3H2SA 4W99A 3INRA 2Y1EA 2DQ4A 4ZICA 3RUIA 1PGJA 1DFIA 1T2DA 2O3UA 1DO8A 1CRWG 1HTBA 3PVZA 1EDOA 1Y81A 4ZU3A 4BB6A 4TVOA 3GRPA 1FDTA 3IKTA 1E92A 5JXWA 1TT7A 3LLSA 4PVDA 3PHGA 1I0ZA 1QSGA 1V3VA 3PWSA 4CMCA 3E03A 4L73A 4MIYA 2C82A 2HMUA 1N8KA 2X0RA 3HADA 1P1KA 3JQCA 4MVJM 5TIIA 1LDYA 3JQ6A 3PHLA 3FWZA 1W8DA 1UUFA 2FPIA 4J3FA 4LVCA 3TOZA 2CY0A 1C1DB 5CG1A 2GN4A 4XZ3A 1PQUA 2PGLA 3DQPA 3IC5A 3DXFA 4XJTA 3GR6A 3ZGYA 1KVUA 4IBOA 4P22A 2CDAA 4LK3A 3WWZA 1RPNA 3I4FA 3PZBA 2BFAA 4NJMB 3FR8A 3DOJA 5L7WA 2P5YA 3QVOA 1S7CA 2LDXA 3SJ7A 4WASA 4XGNA 4RO0A 3UCEA 5CDUA 5KJFA 5JW6A 1V8BA 4RZHA 1X7HA 1T4BA 1BXZA 2XXJA 4BNIA 1NR1A 3KOUA 1ULSA 4Y67A 3WFJA 4EJ0A 1K3TA 2GLXA 4CV3A 3W6UA 1LRLA 3AY7A 1KYQA 4OOEA 5FI3A 2BGKA 2DBQA 1C0LA 4YCAA 4RPLA 1K6JA 1V0JA 3DC2A 5JAIA 3H2ZA 4NDNE 4BKRA 4WKGA 5EQDA 4D43A 1IHXA 3JD2A 4M1QA 1YDEA 5IDXA 2W98A 3R0IA 3H4VA 3F46A 4R3WA 1VL8A 2NADA 4MVJP 3KSDO 3PFWO 4IJWA 4FFLA 3DEYX 3DTTA 1ISJA 4R51A 4ITUA 3EZYA 1UDAA 2GN9A 4MP3A 1E5QA 3WFIA 4KOAA 3K5PA 1Z75A 5DN9A 1K5HA 5IXSA 1Q2XA 3V8BA 1EUZA 3BIOA 1GZ6A 1L7EA 4A0SA 1F8FA 1PL7A 2H5LA 4G65A 4EBFA 4QX6A 3I9MA 3OJOA 4YB8A 3RQSA 3ZWYA 2A92A 2ILTA 2DUWA 2HK7A 5AXCA 3ZV5A 1GZ3A 3PK0A 3V5NA 1BWSA 4AJKA 3BTVA 3PHHA 3UW3A 3PLRA 2AEFA 1PJTA 2IE0A 3HB5X 1Y5RA 4CMKA 3GH3A 4CM7A 3I9LA 1AHHA 4MVJF 2VZ0A 1ZMTA 5GY7A 1BTOA 1E6UA 4WEQA 4DIFA 5AYVA 4DC0A 3DBLB 4CR8A 2DM6A 5IFLA 1DOHA 4XDZA 5F5LA 3DBLA 1YBMA 4ALLA 3RUEA 3M2PA 5AVOA 2X58A 2EKQA 3SLGA 7ADHA 2GDZA 3I1JA 4OQYA 1TB4A 4N5LA 4ILKA 2CMDA 4UAGA 3OIGA 4MVJG 2HMTA 2OP1A 2PZKA 3ON5A 4YBZA 4BKPA 1YQDA 4EJ6A 2AHRA 4CQLB 2EKPA 2Y0EA 1IOLA 1X7DA 3I9JA 1TT5A 4CQLA 1K6XA 1QYCA 2O50A 2RBEA 4H7PA 3VC7A 4KUGA 1F17A 3JTMA 3DAGA 4IZIA 1FF9A 4AICA 3B1JA 4LRTB 3VZRA 2DC1A 3JQFC 1B7GO 3EAGA 3TN7A 4RDHA 5ITWA 3WGIA 1BSVA 1PQWA 2BMAA 4ZQEA 2WE7A 3V2UA 4R16A 3WDSA 1GQQA 1LDEA 3W4IA 4BKUA 3MTGA 2AG5A 1CEQA 2BRUA 5TT0A 5CDYA 3QWIA 5I7SA 1Y5MA 1HYGA 1ZSNA 4B7UA 2IDZA 3QVTA 1Z7BA 2V7PA 4EITA 3IMFA 3AUUA 1DBVO 4HX5A 4MIEA 4IIVA 2VTEA 4YJDA 3EGOA 1IL0A 1D1TA 4BO4A 2GR9A 1H93A 1SB8A 3PYXA 3CZRA 5TSDA 3WB9A 1ZK4A 3HUDA 4HV4A 1DC5A 3F47A 2NU6A 1I2BA 1DFHA 2QRLA 2VRCD 4AJOA 2JHFA 3NUGA 1YB4A 1NX6A 3P5SA 2FP4A 1EFLA 2WD7B 1PZGA 5U9CA 1XHLA 4AJ4A 4TWRA 3ST7A 1BXGB 2JAPA 5EMHA 3KV3O 1U2GA 1HE4A 2WD7A 4MKXA 3WBFA 3GNSA 4FGSA 1LSJA 4IZHA 1HE3A 4HFMA 1BXGA 1D7OA 3FNEA 3C85A 2D1YA 2FZWA 3F4BA 4DPMA 2JL1A 1LQUA 1OOEA 2PH3A 4I5DA 2BELA 2V6GA 2YQ4A 4J0FA 2W2KB 1PJQA 2IXAA 3GPDG 3WXBA 1YVEI 2I66A 1I2ZA 2WTBA 4XRGA 2NNLD 4JP3A 4MVJH 5EIOA 4P38A 2W2KA 4YYZA 1JN0A 4KQXA 2VCYA 1RM4A 2P5UA 2Q99A 4NQZA 3FTNA 4FCCA 1OBFO 3H3FA 5BT9A 3ZWVA 5IJZA 4PG5A 4NFYA 2X9VA 3QWAA 1LTHR 4DMMA 3H7AA 4P8RA 1J0XO 1CQJA 2G0TA 3FNGA 5C5IA 3PYMA 4BNXA 5JO9A 1QR6A 1MG5A 5TF4A 3WSWA 1CIVA 3FI9A 5KJ1A 3CXRA 4JX8A 3N58A 4O1MA 1M75A 3OEYA 1BDBA 3U0BA 2OL4A 4UUNA 4A7PA 5I7FA 4WK6A 2PR2A 2HO5A 1V6AA 1NVMB 2PD6A 1U8FO 2VN8A 2EXXA 3QP9A 4IUYA 4RQTA 4TQGA 4K9DA 5I8ZA 3W6ZA 1LSUA 3ZWMA 4IQ8A 2VHVA 1SEVA 3BMQA 4J7CA 3UOGA 3KSZO 4C7KA 1IZ9A 4CLHA 2OGUA 4ZQFA 3WGTA 4CM9D 1GADO 2G5CA 4MP6A 5JAZA 4R3NA 1ARZA 2I5PO 4Y9DA 4ZRNA 1GV1A 2OHXA 4BNUA 5JMWA 1LUAA 2G82A 1QV6A 3KXDA 3TL2A 2X86A 3ONFA 5FFFA 2YV3A 2B37A 3JYPA 5F3RA 4MDHA 4XGIA 1U3UA 1R6DA 3DZIA 5T6BA 3VPXA 4YT4A 1UAGA 3F1KA 2JCXA 4BNFA 4BKQA 4E13A 3H9GA 5GZ1A 4QT0A 3QWBA 2D2IA 4D46A 1DHTA 2X1HA 4FIZA 1E3WB 2YUTA 4NBVA 5KWEA 3GEMA 1WMAA 1QLJA 4YAIA 1ZIDA 1E3WA 4CR6A 4L74A 4IY1A 1U4SA 4N18A 1RYDA 4DIBA 3ASUA 4BMSA 4E5PA 1LLQA 4E5NA 4OMUA 3B20A 1A71A 4L0QA 1MC5A 1SOWA 3AI1A 2HDHA 2O3QA 3RFTA 4BNYA 4MJLA 4YACA 1E1LA 4YXFA 2X9GA 3PGJA 5L95A 4YAKA 2BD0A 4CPDA 2CD9A 1Z73A 4Z9FA 1ENPA 2BLLA 2D4AA 2GD1O 5H83A 3SC6A 4OKNA 2JHGA 3CTMA 3AUAA 4Z9YA 3DZJA 1GU7A 1PIWA 3NT2A 1HE5A 1JQBA 3LVFO 3ZHZA 3JQ7B 5DCYA 4YDRA 4CLEA 2BFMA 1T2AA 1DC4A 4J16A 4GX1A 3VTFA 1R16A 3INTA 3BMOA 3JQ7A 5IF3A 3LT2A 1ISGA 3ZNOA 2X0JA 4R1SA 3DOOA 3PFFA 3GUCA 3RU7A 5KVCA 4NK5A 2P4QA 2EJWA 1ID1A 3VPHA 3W8EA 3WGQA 3EC7A 1PZHA 4AG3A 3RUFA 2O7SA 3JD1A 3PJDA 2Y68A 1I3NA 2W4QA 3WIEA 1WPQA 3B6ZA 3RJ9A 3ZU5A 4XB2A 3LLVA 4J1SA 4CMIB 2JJYA 4FFOA 3UCFA 5DT9A 1H6DA 3ZWOA 2RAFA 2YQ5A 1Q0LA 3S2GA 3EDMA 4JIGA 4LVUA 1FDSA 4WE3A 4CMIA 4DL9A 5IAAA 1T4DA 3ZH2A 1GCOA 2UAGA 2EW2A 1FDVA 1BHSA 2OXIA 3KUXA 1OI7A 3DBVO 1V9LA 2P9CA 2NLOA 4CQMD 3HZZA 2RCYA 2NU8A 3EZLA 5KIAA 4MKZA 3UUWA 2C59A 3GVIA 4RPGA 3I4CA 1XA0A 4IMPA 1CWUA 3AUTA 1J6UA 4UEJA 1JW9B 3JQEA 4L4RA 3KVOA 2H1SA 1ZVMA 1YOVB 3AUSA 4BO7A 2BGMA 3WMXA 1Y8RB 3E1KA 1B15A 4PLHA 2ZATA 4BV9A 3RIHA 4HUJA 1A7KA 2J5QA 4M87A 5TRTA 2FR0A 1JU9A 2I3GA 5JAQA 3GEGA 2PLAA 1NTOA 4R54A 5B12A 4YTEA 5L51A 4BNMA 5CDTA 2WM3A 3NJ8A 3KM0A 2FR1A 4BO2A 3K30A 4MP8A 2HMWA 2NACA 3WS7A 1PGQA 2Y99A 3QSGA 1HYHA 3EK2A 1WNTA 3Q6IA 1UR5A 4PIVA 4XR4A 4EI2A 1LNQA 1R0LA 4TVBA 1H5QA 4GGPA 1PS9A 4ONEA 5ENVA 3DONA 4R68A 2I65A 2VWHA 4JXKA 4RF5A 3ZNQA 1AGNA 3TPCA 3D5QA 2O3JA 1M66A 2B4QA 3IP1A 4DIOA 5CG2A 4E5YA 4KUEA 1E0DA 3WYCA 4Q9NA 5KNLA 3AFNA 4LGVA 4ZN6A 1Q7CA 3I9KA 4EUHA 3P2OA 3L9XA 2ZB8A 3MOGA 4PLYA 1BVUA 2JD0A 3EHEA 4PLPA 4D3FA 1KIFA 4PN3A 2PKQP 3DTYA 3FNFA 5JAMA 5I9NA 2Q1WA 2FHSA 3AI2A 2UUOA 1E7RA 1GYPA 4WLEA 5ER9A 4B7XA 3LC7O 2NVBA 1IB6A 3ITDA 3X2FA 3GOHA 2X5JO 1JWBB 4C7JA 2A4KA 4CM6A 4WOKA 1N7HA 4Z0TA 4E32A 4I1IA 2C5AA 4Y6SA 4JP2A 1SAYA 3E8XA 5B1YA 3OMLA 5ADHA 4IJVA 4KDFA 5A04A 1MP0A 4JN6B 1BG6A 2Q4BA 2UVDA 4PG4A 5BSHA 5J23A 6LDHA 1K0UA 3OP4A 1ML3A 1U4OA 2NSDA 4RL6A 3FD8A 4FFRA 4KUHA 4IGFA 4PG7A 3TZ6A 2ZYGA 5G0WA 5CEJA 4R9RA 2ZYAA 3DZBA 4CMEA 1RWBA 4E5KA 3GAFA 3E9MA 3F6YA 2P68A 4MKRA 3C1AA 5A3JA 2DKNA 3GZNB 4OM8A 4PG6A 4EW6A 4U6SA 3AJRA 4IINA 4CMHA 1E6WA 2OORA 4ZQHA 3CPSA 1FMCA 3RBVA 4QO7A 3PZRA 1BMDA 4D41A 4LCJA 4N5MA 3OICA 3QWHA 3VH3A 1KBZA 1GEGA 4J4HA 3A1NA 3E82A 4KP7A 4R69A 1UP7A 3C24A 1IHYA 4XKJA 5T8KA 3DHYA 2YW9A 2IYPA 3ICPA 3KBOA 1ZH8A 4Z3KA 1IY8A 5ICMA 3JD3A 5JSFA 3C1TA 1R4NB 4M8SA 2BFOA 4CM1A 4J1NA 1WW8A 2Y1FA 3HJAA 3KYBA 3TJRA 3NTOA 4DLLA 1CERA 2AQKA 4CM8B 3D4OA 4NHEA 1E6EA 3EYWA 4ZD6A 2HLPA 1C0IA 5DCWA 3D3WB 3N74A 1P77A 1SBYA 4B8ZA 1XIVA 3AU8A 3VDRA 4YT2A 5G0UA 2HU2A 1HT0A 1PJLA 3A9WA 1D8AA 1EE9A 1U3WA 3INGA 3SLKA 5BNIA 2O2YA 3QVSA 5A5FA 3ADOA 1DRUA 1E1MA 3ANLA 1PX0A 1V3TA 1N1EA 2IZ1A 3C3XA 3QIVA 4KQWA 4D79A 4AJJA 2R00C 3OJLA 2CSUA 4CM5A 1QXSA 3SEFA 5MGBA 3PHIA 2QX7A 3NRCA 1VE9A 3GNTA 5C7LO 4Q3CA 5ITVA 3ZN2A 2W2LD 4PZDA 1FXSA 3E5MA 4BGEA 4EDFA 2BI8A 2IEDA 1XLTA 3GRKA 1NVGA 3R1IA 1HDZA 1EQUA 3AU9A 4HKTA 3RC2A 1UDCA 1YQGA 1Z82A 1MLDA 5AXBA 3PRJA 1DDOA 3NV9A 4W82A 2EWMA 3FBGA 3D3EA 3KRTA 1IE3A 4PLZA 3IKVA 3QE3A 3O4RA 2PZMA 1QYDA 4UUOA 2AE1A 5EQFA 4Z3DA 2R00A 3L4BC 1MFPA 5CDSA 1ZW1A 4UVIA 2CF5A 2VOEA 3PJFA 4CV1A 3WMWA 5JLAA 1I36A 5C3MA 4RPKA 4XR9A 1K89A 1NHWA 3L4SO 5F1OA 1RM5A 3PDUA 5JBIA 4DPLA 2C29D 2CF6A 2NQTA 5EESA 3TF5A 3ABIA 3MEQA 4Z6KA 1HLDA 3JQAB 3VH2A 3MJTA 3OIFA 2DU8A 3JD0A 4J0EA 1QYWA 2CFCA 4BNHA 1MV8A 4U0JA 3JQAA 4F45A 2UDPA 1A5ZA 4HBGA 4BVAA 1XYGA 3CSDA 1Q7GA 2WMDA 1YWGO 3L4BA 4YJGA 5I8WA 2DBZA 1O89A 3DFUA 1PTJA 2VWGA 1LU9A 2F1KA 2X8LA 4E2WA 5LCXA 4YJHB 1X1TA 2PA3A 5COBA 3F1LA 3CUKA 1P1RA 2EKLA 3ENKA 3ZV6A 1P1IA 1I3MA 4FDAA 1I32A 4YJHA 3ZCXA 1RYEA 4YQYA 3RC1A 3MCVA 1XKQA 1WZEA 2F00A 5KVQA 2RIRA 1H9BA 1ZEMA 3R3SA 3WLFA 1QRRA 4CM3A 3WNQA 2GSDA 4YWJA 5K9ZA 6ADHA 1WDLA 4E31A 1KS9A 1NQOA 1KVSA 1BW9A 1XU7A 2QZ9A 4GMGA 4DA9A 1XU9A 2AMFA 1KVQA 2VQ3A 2VT3A 4GAEA 4BNZA 1EBUA 3PTZA 2ZB7A 5JYDA 3QWFA 4FW8A 5K6AC 4L76A 3L6EA 4FSHA 4RF2A 4AJHA 1ADFA 1XQ1A 4OKIA 4Q3BA 1EVZA 3ZV4A 1O8CA 2DBRA 1H2HA 2DTEA 1ZZEA 3PQFA 1P44A 1UXGA 3FCOA 4BNTA 4LSMA 1DJQA 4MO2A 4BHTA 2HUNA 2UYYA 1ONOA 1KVRA 1I01A 4GLOA 1PQPA 1W0CA 2ZK7A 3AOEA 3RKRA 4AFNA 2C7VA 3PWZA 1YRLA 3HG7A 3DBRB 2PD4A 4HWKA 1ZJZA 1WMBA 4IDCA 1WWKA 3ONEA 2OOSA 1EVYA 1I3LA 1XELA 2G1UA 2B5VA 2HCTA 3E9NA 1EZ4A 4LW8A 2ET6A 4ZJUA 3AOGA 3DBRA 1NQTA 1P33A 2P9EA 4BQPA 3ENNA 1JKFA 3BHMA 5KJCA 4OSPA 1NYTA 1ADBA 5K6AA 4W6ZA 1DIAA 1JVSA 2VRCA 3AWDA 3K8ZA 2OMEA 4IDFA 3WNVA 2O4CA 2X9NA 4RVFA 4DYVA 5IG2A 3FHLA 4XYBA 2NTNA 2YV1A 3U4DA 1GD1O 2DFVA 3QW2A 2RHCA 2IZ0A 4G81A 3NYWA 4M89A 4K26A 5G0VA 2UV8A 2ZTLA 4R1UA 2V6FA 3KSUA 4JQCA 1GDHA 2VUTA 2DPGA 2VNSA 3OQBA 4N7RA 3DDNA 1NQ5A 1LRJA 2VT2A 2Y1DA 4ROSA 3WYEA 5HBRA 5ER6A 5L9AA 5T64A 4Z0HO 1GAEO 3GFBA 1HZJA 3OFSA 3ZWCA 2B83A 1OC2A 1ZSVA 3RUAA 1Y6JA 2IXBA 1P74A 1LRKA 3OJFA 1P0CA 3L07A 4WLFA 5F1PA 3ROMA 2CZCA 1HWYA 1Z6ZA 3AM3A 3PQDA 1PZEA 4KTVE 4CMGA 3ULKA 2VZ8A 1UZNA 4I08A 3OJEA 1MA0A 3W8FA 2IRWA 2A35A 1I10A 2X4GA 2JCVA 5THKA 2X23A 5IDWA 3FPLA 3T4XA 3STHA 2OZPA 1VC2A 2CVOA 3SBOA 3GFGA 4GWGA 4K6FA 3H65A 3P19A 4AVYA 3TRIA 3D0OA 5IXYA 4H15A 4MPDA 3Q9NA 1ZK3A 1F06A 3H5RA 4E21A 1HF3A 2GERA 3K31A 9LDBA 3JYOA 1AN9A 2VNAA 5CAEA 2P4HX 4B4WA 4QSMA 1VLLA 1IPFA 1ZNQO 3DZGA 2C2YA 2D5AA 5A9TA 3ROKA 1GYRA 1ZXBA 3LT1A 1KERA 1QP8A 1KC1A 4XIYA 2PGJA 5FI5A 4CM9A 1TT5B 4FD3A 1UH5A 1ONPA 4OOFA 4RVHA 1WDKA 3ZDFA 3ZW8A 2HMSA 3KB6A 1G0NA 2BKAA 1NR7A 3GLQA 4UEOA 1HSOA 4P4LA 2Z95A 5JE8A 5IDQA 4R4JA 3WGGA 2NWQA 2VZ9A 3OA2A 1FJHA 3VPGA 4BO9A 3HB4X 5EN4A 1ISHA 1DIGA 1ENZA 4PCVA 4WNIA 1ENOA 1L7DA 3P2YA 4QO8A 4WPGA 5DOZA 5ENDA 2BI7A 5I7EA 1Z45A 2Z1NA 5I9LA 2EW8A 3LQFA 4D0RA 1X1EA 4UVGA 3ZZNA 5DBIA 4XWYA 5KCZA 1N7GA 4BOYA 1CF2O 3KO8A 4PZEA 4LSWA 4O59O 1EEHA 4NH4A 4MVJD 3GUYA 3WIDA 4HADA 3IUSA 4BNLA 5COQA 2VWPA 4OSOA 5ILOA 2I6TA 4CLOB 1SMKA 1LC0A 2AQ8A 2E82A 2EHDA 1RM0A 4MIOA 1GPDG 3TNLA 2HMVA 4CLOA 5G2OA 5U4QA 1T2FA 4XA8A 4YT5A 5H81A 1U5AA 1CYDA 2Y05A 3W4KA 4GKBA 1DIBA 5F21A 1XCBA 3M1LA 4OH1A 3ZHBA 3E9QA 4AJNA 1DAPA 4JBHA 4B4VA 1R37A 1U3VA 2PZLA 3UHAA 3IL2A 4W7IA 5TJHA 3TZKA 2I99A 3IIEA 3WR5A 1JAYA 4XB1A 3KLPX 5IZ4A 3UKOA 4ESOA 3OM9A 4GL4A 3WJ7A 4HFNA 1LA2A 1R0SA 4NBTA 1LDMA 4FOOA 2AG8A 3ROPA 4E3ZA 4EGFA 2R2GA 2B4RO 2NTJA 1AXGA 1NASA 4E4YA 1MXFA 3GPIA 3GDGA 3I6IA 4DXHA 5JC1A 4RF3A 3NJ4A 3B70A 4YVFA 5CEEA 5DP2A 3L0DA 1YONA 5EL0A 2J3HA 3NDIA 3EY4A 3BTSA 4OHUA 4OYRA 5GMOA 1D4FA 2D59A 1GY8A 3DB2A 5I9MA 3HSKA 2OUIA 2X5OA 1UDBA 3H3JA 5EJ2A 1NFFA 3Q0EA 3MJEA 4CQMA 3EVNA 4U6QA 3U3XA 4NIMA 4NU5A 3IJRA 3GVCA 4RLHA 4JROA 5K0ZA 1L1FA 4Q3EA 3L6OO 3KEQA 3BMQB 3NTRA 3PEFA 4EEZA 4B3JA 2JD1A 4GQAA 3MWEB 4J91A 1BDMA 1ZXLA 4J7UA 1VJ1A 2JKVA 3NAQA 4B79A 3WQQA 1IULA 2WD8A 5JFOA 3KYDB 4DUPA 4NFSA 1T26A 3OEWA 3GNQA 2SCUA 2FPPA 1BVRA 3KYDA 5L53A 2EIHA 1EK6A 2V6MA 3S55A 5A1TA 2JD2A 1T25A 4A2CA 4D42A 3BTOA 3AY3A 3F5QA 1G1AA 2VYVA 4ND1A 3KZVA 1SB9A 2NUAA 2X22A 1VPDA 1MB4A 3QHAA 2Y1OA 4BNJA 1Y9EA 1MX3A 4CMBA 1N1GA 3UCXA 1T1RA 1D1SA 4GX2A 1B0AA 1YL6A 2GZ3A 4GLLA 4CLDA 1E3SA 3S2EA 1J49A 3GY0A 2AA3A 2O48X 1E3LA 2PZJA 2EGGA 3AFMA 2YY7A 4D45A 5DNAA 1R15A 1QKIA 1M67A 2OFPA 4XJSA 2C7GA 2CDCA 4RJTA 3I6QA 2EP7A 3VVCA 4F6LA 3MJSA 4BNNA 3QVWA 2QQ5A 2AQIA 1TEHA 3QLJA 4AL4A 3QQPA 2GGSA 5BSGA 4QQRA 4MVJE 4DC1A 1CETA 1GEEA 2WYWA 3K92A 4J9VA 4D3SA 1LJ8A 3LF2A 4BGUA 2QYTA 2PTGA 1YXMA 3H9EO 5KTKA 3JQ8B 4AJLA 3ETGA 1IUKA 3PWKA 3V1TC 1U1IA 3COSA 2Q2QA 4D0SA 1DRWA 3SVTA 2ZB4A 3TZHA 1UZMA 2OP0A 4WCDA 3WX0A 1X15A 3I52A 1Y1PA 4BIIA 1X0VA 3JQ8A 3KEOA 4LN1A 5FYDA 2G76A 3JSAA 3OQ1A 3BMOB 1KC3A 2GYYA 1K6IA 2DVMA 2Y1CA 4YJFA 4J49A 1DPGA 4I5GA 3GAZA 2DTXA 4BO8A 3WOHA 7MDHA 4K1LA 2Y66A 1JA9A 3OSUA 3UAGA 1ISFA 5HA5A 4YA6A 5CP8A 1SEPA 2WEKA 5BNTA 5JCXA 3ZV3A 1Q0QA 1R4MA 5FEUA 2EERA 4E2YA 3GMSA 2GO1A 2C54A 5KJEA 3H8VA 2CVQA 1VL0A 8ADHA 2JCYA 2ZTVA 2CVZA 1GTMA 3ADPA 1F12A 3DHNA 5L45A 2D0IA 5CHEA 4TRJA 3JYLA 1MFZA 3S2FA 1GUFA 3D64A 3NGLA 3TZQA 3H6KA 2OO5A 2FPGA 3BYZA 1ZKMA 5KVSA 2WSBA 1EBFA 5C7OO 4F6CA 5C7IO 1F0YA 3E5RA 3PDJA 2CNBA 3GF4A 3FRJA 2B36A 2ZCUA 3IUPA 5JO0A 1H94A 4IDBA 4BMVA 4TRRA 4J4TA 1MG0A 4TSKA 2UUPA 4X54A 1AXEA 2B5WA 4GGOA 4Y98A 3MOIA 3M2TA 3RCBA 1BRMA 3WBBA 5A3VA 1MUUA 3SX2A 2YHIB 3DZFA 3OBBA 1LLDA 4CODB 2FRDA 5DOVA 4XRRA 3H9UA 1LXCA 1ZJYA 2J3IA 5THQA 3QV1A 4II3A 3DMYA 1VL6A 1H0KA 2NU7A 1O94A 2YHIA 5HTOA 2H63A 4I5FA 1X0XA 3DHEA 2ZJ1A 3LSYA 4J7XA 4TKMA 2W2LA 4NMHA 3WQRA 1EVJA 3LK7A 5GZ3A 3C8MA 4FJ2A 1P1FA 3Q3CA 4J2HA 4WECA 1GZ4A 2WYUA 3I3OA 3PQEA 2R6JA 4TKLA 4UVEA 4M49A 4JCOA 4URFA 1N2SA 5T57A 4OGWA 1NP3A 3OIDA 1UXHA 2ZKLA 3MWDB 3LU1A 4FBGA 4HP8A 4S1VA 4CV0A 1C0KA 1E3IA 1E1KA 2DLDA 1AHIA 4FQ8A 3U09A 5HWSA 4BS9A 3JQBC 4A73A 5IZCC 3GT0A 3RC7A 5LC1A 1PS0A 3DZHA 3JQ9A 3C7AA 4UEKA 1E3JA 1DHRA 4CMAA 4RPHA 4CMEC 4J1TA 4GVLA 4IJUA 1NPTO 1VI2A 4PRLA 1VM6A 4DPKA 4FS3A 5MDHA 4DBVO 1CDOA 1ZSYA 4E0BA 3ZWXA 2I67A 2O2SA 2J8ZA 2AEJA 4L4SA 4R41A 4BKOA 3DOCA 3PGXA 3H5AA 3SXPA 3PIDA 4EZBA 4P4NA 4CL8A 3JQBA 3BMNA 2FY8A 5IZCA 1JDJA 4XYEA 3TL3A 4XYLA 1DXYA 1GUZA 3K96A 2D3TA 5AOVA 5T8KC 2GF2A 3RI3A 1IZ0A 4EUEA 3EW7A 5L40A 1P31A 3I9NA 5CEFA 2J3JA 4XGKA 3I5MA 4WLOA 4XYMA 3Q11A 1LEHA 2C20A 3BHJA 2VHYA 3PYLA 4RPJA 3F3SA 5DULA 2IYOA 1BXKA 3W8DA 4P4GA 1A9YA 1T2EA 1T24A 2VYND 2WJPA 3GHHA 4H16A 1YQXA 5EINA 3VH4A 4RVGA 1E1NA 2GNAA 4GVXA 2QW8A 3CEAA 1HE2A 1QG6A 4BNWA 4PLFA 1GCUA 2NQ8A 2XOXA 3B1FA 4J90A 1GUYA 2CUKA 3DFZA 2O7QA 4ALJA 5KJ6A 2VUSA 2HK8A 1Y9AA 1YB5A 2XF8A 2QRJA 1LI4A 4ND4A 1P0FA 4TZKA 1DLJA 3DBHA 2PKQO 1DJNA 1MGOA 1N9GB 4BO5A 3ZHYA 1U7HA 3G1UA 4UUPA 1DEHA 5EERA 3LYLA 3VKVA 3T7CA 2DT5A 3GGOA 1PJBA 3NDJA 3OECA 1N9GA 1SZJG 3CMCO 3V1UA 4YRBA 1OAAA 5DBFA 1QYXA 4HNHA 2PH5A 3WQSB 3A14A 3FF4A 2EF1A 2EJVA 2NU9A 3VH1A 5ES3A 1HDGO 3VTZA 2WYVA 5TGDA 1AE1A 2VHZA 3LZ6A 1Q0HA 1JKIA 5A4DA 4W4TA 1NFRA 1UAYA 1JKJA 3GC6A 4ZGWA 5JCJD 1I24A 3RASA 1V35A 3QRWA 2B35A 2Q1SA 1M6HA 5FWNA 1A4UA 5KOIA 1PSDA 1QORA 2IZZA 2C2XA 1TI7A 3NTQA 4BO3A 2AEMA 4NNJA 2HJSA 3U62A 3RBZA 1DFGA 1NFQA 4JNKA 1I5RA 2VHXA 1O0SA 3D1LA 3VZSA 5JYEA 3TFOA 3GVPA 4J9UE 2QHXA 3BAZA 5B4TA 1LSSA 4OXYA 2EG9A 3G17A 4Z0PA 1I8TA 1ENYA 2ZYDA 2BGLA 1S6YA 1U3TA 1H6CA 2G17A 1NWHA 4GI2A 4BL5A 3F9IA 4EUFA 3PJEA 3L77A 5DBGA 3HN7A 5DF1A 4CM4B 3K2BA 2E6UX 2X5KO 2ZB3A 4NBRA 4FB5A 2IODA 1QYVA 4RDIA 1A72A 1RKXA 4CM4A 3IDSA 1DLIA 2XXBA 4R1NA 1P1JA 2DPHA 1HXHA 1PJ3A 1H6BA 1PJ2A 4ZQGA 1OMOA 3IP3A 3KETA 4BV8A 1EMDA 2PFGA 1KEUA 1MXHA 1NPYA 1G6KA 2HQ1A 4GSKA 2CDBA 1PU2A 5JNLA 5L7TA 1P9LA 4RVDA 4A03A 2HRBA 1CQIA 1V3UA 3D4NA 1XQ6A 4YJGB 3PXXA 2O23A 1YGYA 3F5SA 4TRMA 1DC3A 5G0SA 1ZK0A 2J5KA 3TOXA 4AJPA 3GG2A 4LRSB 4GX5A 1J5PA 4AJIA 2EGHA 3IS3A 2W8ZA 5DCUA 1E7WA 3HDHA 4JJFA 1TA4A 3GHYA 3MJCA 2FMUA 3OQ6A 1HEUA 1H6AA 3K9QO 3IQDB 1XEAA 3KLMX 4RLSA 4U5QA 3LT0A 1E5LA 1KVTA 1WZIA 3RUDA 4IMRA 4R9SA 5H82A 3AOEC 1JAXA 1BW9B 2FSVA 3E48A 5KKAA 2Q46A 5JDIC 4KZPA 1EQ2A 3UN1A 4BGIA 4G2NA 4E2XA 2QRKA 1UP4A 5JY1A 1YDWA 2GN8A 2GRAA 1EUCA 2YDYA 5DDIP 4INAA 2GZ1A 1C3VA 2I9PA 2HRZA 1PS8A 5ILGA 4QXMA 4D44A 4KMSA 1DIHA 1U2DA 2RHRA 1FDWA 3N7UA 4QEDA 2FOIA 4PVCA 3TDKA 5AXDA 1DSSG 1A9ZA 3ANMA 2BFPA 3EUWA 2PD3A 3JCZA 1DC6A 4MVJA 1YE3A 1VKOA 3WJAA 4WNCA 1B8VA 1GR0A 1XGKA 3KTDA 4TZTA 3WSVA 4DMLA 1C1DA 5JDIA 5GZ6A 5TS3A 4B7CA 2TMGA 2NVUB 3WGOA 5JY6A 1E77A 4U0KA 3VPSA 2Z5LA 1R12A 2YFQA 3V2GA 3ANNA 4NJMA 3GGPA 1AUPA 1ADGA 2NVUA 4WOJA 1NQAO 1EDZA 1M76A 4LISA 4Q3AA 1I2CA 2QIOA 2B69A 3GN1A 3RAJA 3VVBA 1ZEJA 4BMNA 1O9BA 3WG9A 5A9RA 4IDGA 4ZVVA 3UF0A 4OIMA 4DGSA 1NAIA 3AI3A 1QMGA 2BF7A 4BNVA 1YBVA 5CDGA 2LDBA 1B8PA 1PGNA 3D4PA 1KETA 2PNFA 4CJXA 2AE2A 2ZCVA 4IDDA 4PFJA 3RFVA 1KOLA 2GN6A 3MZ0A 4JJGA 2X0NA 1PL8A 2OBYA 1HDXA 2P91A 2NTVA 2VHWA 3AY6A 4RGBA 3RROA 1E7MA 3DWFA 2JAHA 4S3MA 4DQVA 1W6UA 1JTVA 1LLCA 1NXQA 3ZWBA 5JPIA 3JYNA 3T7EA 2I3AA 4H3VA 1RJWA 2I76A 4I9UA 3I9OA 1HDCA 5A06A 3U5TA 1W73A 4JJIA 1YJ8A 2E4AA 4PG8A 3NEPX 4Y6PA 3WWYA 5LDGA 4IXTA 1H9AA 4BB5A 1SCUA 2PKRA 4B3HA 1G0OA 1LDNA 4XDYA 2WDZA 4IS3A 5BR7A 5HM8A 4PLWA 4L4XA 1EVIA 5DZSA 1YH3A 3BMCB 4UUMA 4PLVA 2Q49A 2JFFA 4RORA 1X14A 4ALKA 3RKUA 3WICA 3JQDA 2Q45A 5B4VA 3BTUA 3BMCA 2Z1MA 3ZWPA 5L4SA 1PJSA 2VUUA 4O63O 5B4UA 3CMMA 4GPD1 4WCFC 2FR8A 4GBJA 1HL3A 5U1PA 4IIUA 2PV7A 3JQAD 3PIIA 5I7VA 4I5EA 3ETDA 3HNPA 3O03A 3U9LA 2X7HA 2D8AA 2OBNA 3A4VA 4ZRMA 1PGOA 2Y93A 3RVDA 2YFHA 4YQZA 1UXIA 3RJ5A 4DTIA 2C0CA 2Y67A 1PR9A 3T4EA 4B4OA 1VKNA 4QECA 3GVHA 3IOYA 3DO5A 4WCFB 1WP4A 4HFJA 4WUVA 3NT4A 4O5OA 3IJPA 4NG5A 3U4CA 3O26A 4NJOA 2QG4A 2ZTUA 4J4BA 4QTZA 4WCFA 3ZNPA 1HDOA 3ZWNA 4E5MA 1P3DA 1E7QA 2GPTA 2J3KA 4B4UA 3GZ4A 3QJ5A 3ZNNA 1D3AA 1NWCA 1E7YA 1NNUA 3FR7A 4ZHSA 1DRVA 1YO6A 2EEZA 2EP5A 2J5RA 3S1LA 1NHGA 3GQVA 4FGWA 1TLTA 3AW9A 5A5EA 4PLCA 4GX0A 4M55A 4E6PA 3I23A 4IDAA 2ZIZA 2V65A 8LDHA 3HFGA 3A06A 3CKYA 1EUDA 4WLVA 1M6WA 5HRUA 2A9FA 1Y7TA 3UICA 4IQ0A 4O0LA 1YJQA 1YS4A 3WTBA 4XQEA 3CE6A 1HKUA 1N92A 3HE3A 4MVJI 5BSFA 1HDYA 1ZCJA 3QA9A 4I8XA 4J2OA 4JLWA 5G4LA 4CUZA 2O3SA 3MJVA 5ICSA 4KTTE 3JQFA 3FNHA 4K6CA 3BXXA 1Y8QB 2TMDA 4N54A 4RQUA 5T5QA 4EYEA 1U5CA 1WAMA 4Y8VA 1MC4A 3WYBA 4EJMA 1Y8QA 3ZWWA 4F46A 3DAPA 4XD2A 4YRDA 5BSEA 3WGZA 3NKLA 4NR0A 1ADCA 4A26A 3PLNA 3SJUA 4PRKA 3GG9A 3P7MA 1YKFA 3AM4A 3VDQA 4GMFA 2P9GA 1P45A 3RWBA 2DBVO 4ZQBA 3ZWAA 1NM5A 1JLLA 2Y1GA 1ZO8A 4DQUA 4CQMB 5AXAA 3K6JA 2H9IA 3BA1A 3DZKA 3QVXA 3DAFA 3VOSA 3ZU3A 2E37A 4TROA 3I83A 3FN4A 3M6IA 3U4HA 3W1VA 4NZ9A 4I9NA 1KY4A 4R5HA 5TC4A 1T1SA 4A10A 1XWFA 1A7AA 2C5EA 2GCGA 3A28A 2YDXA 4IS2A 2HJRA 1B3BA 1C14A 2FSSA 3S2IA 3KHUA 1KEWA 3ZU4A 1IPEA 1ZBQA 2BHLA 4FFMA 2H6EA
chains in the Genus database with same CATH superfamily
4IGEA 2W6JA 1P0PA 3C6YA 3LCCA 1DIRA 1N6HA 1VLZA 3MTJA 4V1CA 4RA6B 2QRQA 5KZMB 5J2UF 5TQVA 1G4HA 1RI1A 4FHEA 4GOJA 3WO1A 1M8KA 2RH4A 1CJCA 3LPDA 3UMVA 4YAFA 3JX9A 4RA6A 3OQPA 1NVAA 3OHSX 4NDZA 3BGWA 2PL1A 4WKCA 3FXAA 4KO8A 1SOMA 2RGAA 4L5BA 1TXGA 4QDTA 4F3KA 1ABBA 4EY7A 1DI0A 4YMUA 2ZAIA 4EG8A 1M2EA 2JEZA 3G0DA 1AO0A 1VRCA 1S89A 4R8MA 4TYQA 2DWQA 3T9CA 4BRZA 2QE7A 1UBSB 4IPTA 4RVCA 4RCVA 3ZHXA 1YNSA 3ZW7A 4DDVA 3RSCA 2FW9A 5IYZF 5A4FS 4EF4A 1QQ7A 1Z74A 3T34A 3FKSA 2C2WA 3AYXB 4ZI5A 4K40A 2CK3A 4FGKA 4H6VA 4D6XA 2R8XA 4X61A 3EJWA 5BWNA 3SEZA 3VUFA 4QTYA 3Q98A 1WLYA 1RDFA 1WSAA 1MR3F 2ZT6A 3O8QB 4J43A 4HWGA 5A62A 1R8JA 1RFGE 1LLUA 2HBRA 3L93A 3MLEA 4OH7A 4U2DA 3TUIC 3V55A 3WLEA 3O8QA 4HH4A 2FI1A 3EBOA 2OCGA 5CB4B 1U2EA 4XQ9A 3ASVA 2DHEA 4M54A 3VYRB 3LZCA 4OGGA 1ML4A 3UPUA 1O54A 3MTAA 1Q20A 1KZHA 5CB4A 1U6JA 2GNOA 5F51A 5TVKA 2PUJA 3QUCA 2X2EA 4HB0A 4KDEA 1EHIA 1YU6A 2JGIA 3C1UA 2AQHA 3C3CA 5AM2A 3OZEA 5C4MA 1CUHA 5LP6F 4KPYA 2AD1A 2ZJ0A 3H9QA 4LTMA 5HKBA 4A23A 2ZRKA 3HDTA 3OETA 4YP1A 4E30A 2AMLA 4QELA 4A5OA 1LBSA 1XA4A 4E1AA 4OLFA 2IXTA 3AKCA 3L0OA 4FPXA 1I4WA 3EEYA 1NUTA 3MHPA 4AC9A 3EMKA 4OHZA 5CFMA 4URZR 1LD3A 2XTNA 2VUIB 1F8GA 1YRAA 3GD7A 3SP1A 2XV1A 2ZTHA 2C07A 3EVZA 3HWRA 1SQ0A 2I0FA 3OZGA 4LV8B 2OO5C 3ZD8A 4EPYA 3NT5A 4R40A 1IM2A 1JG1A 1LPNA 2Z43A 3ND6A 4HMOA 4LBVA 5GONB 4CUJA 5JNVA 1C4KA 2ODAA 4ID9A 5EFOA 1LSOA 1OW3B 2R7LA 3CU5A 3D0RA 4FXOA 4TLMB 4RCZA 3DBIA 4LPSA 2X14A 4MQ4A 4N65A 1PVVA 2IPOA 5GONA 3RRMA 1MU0A 5LMZA 4JI5B 3ZHSA 1UODA 4CIAA 2YV2A 1U1DA 1XE3A 4FFPA 1DKRA 3R7LA 2I80A 4F5WA 1RPZA 3CVYA 4JJKA 5FCDA 4NXNB 1T10A 3ZOZA 4BX8A 1FBTA 2GJKA 2R25B 2FZEA 2J5BA 2FRDC 4FUTA 4M0FA 1DBQA 1D0SA 2VPTA 2X1LA 4NTZA 3AEQB 3HJNA 5DTRA 1Q95A 3NTLA 1Z0ZA 4WK0B 3L9WA 5TT1A 2V8BA 1M2WA 2ZAGA 3DUWA 3MS2A 1I6KA 2J41A 2PWZA 3TX2A 4P83A 3MA0A 1A4RA 1FEZA 4MITA 5FD8A 4CLRB 2PAFA 4AKGA 2CLSA 3MQFA 2C8LA 2QZZA 3DMTA 3MJ4A 4U7WA 4C4OA 4KRXA 1A4IA 4L07A 1JXQA 1LDGA 2PO5A 5COAA 5AM5A 1P3JA 4CLRA 3DWEX 2R8PA 4RW0A 3KOZA 2NT4A 2Z5VA 3MS4A 3Q7PA 4OFXA 4OXRA 2IX3A 3H5NA 3K2EA 4L0CA 2H1FA 4HQLA 1TRKA 4HGPA 2MYUA 4LKRA 1W94A 2YWGA 3CLSC 4R6XA 3V46A 3F67A 4F1WA 3GEDA 5F7XA 5IULC 2B0JA 3U3DA 4Y0NA 2Y1LA 2XGJA 1BMFD 3CRRA 2QOEA 4AWAA 2GBIA 3IESA 3V8VA 2EQAA 2V74B 3BZUA 4QOHA 1A9QA 3JALB 2O3RA 4ZGBA 5ITSA 1Y4UA 2JVIA 4LDPA 3EF1A 4PO3X 4E08A 4R31A 1C1XB 3L6DA 4IWNA 3P9CA 3ZLBA 2Q3HA 2PX0A 4GO1A 4W7HA 3W3AD 2NT3A 3ORFA 1YOVA 4DREA 4YHHB 1G5TA 1NI3A 1C1XA 5DV9A 1Y8RA 1I33A 5GQSA 3UAZA 3ZS8A 5LYJB 4FN4A 3K9WA 3ETCA 3N8NA 4AY3A 3PEVA 4PGFA 3QUBA 3W5DA 4IDEA 1FDUA 1GVHA 4PQGA 2HJ9A 2QX4A 5BQ5A 1TFUA 5LYJA 2BCEA 2L69A 2G7MC 4ND3A 1SVOA 2BP7B 4R1TA 4P9NA 1C7ZA 1VPEA 3KSAC 1I1OA 2VYVD 3BQ9A 5FV4A 1W5TA 5BUSA 3LQ4A 3CPJB 1NF3A 4F84A 2BP7A 4QICA 1GDTA 3CZMA 1JVBA 3T1NA 3HFSA 2XUDA 5BPFA 1S2LA 1N4AA 4WFQA 2C97A 2HHLA 1D07A 2I33A 4LBYA 1HMYA 3PNPA 4YO7A 5EVCA 4BNKA 1QWSA 5C4IA 1KAOA 6NULA 2ZQ5A 5FTJA 2X7JA 4JBGA 4E12A 1NJ8A 1TK3A 5AVUA 1HYEA 5ILQA 1DVRA 2HAEA 4ALNA 1SC6A 3PNVA 3GBSA 3K0KA 4HNUA 2NN3C 1IPHA 4ZRDA 4C03A 5L4LA 3ZHVA 2DE0X 2D0OB 2Z6VA 3FOBA 1PZFA 4P58A 1GUAA 1QC5B 1XG5A 3OOHA 2WF6A 4JI4B 4QFDA 4ITVA 1HLFA 5K6RA 4GH5A 1R6XA 4PFSA 4Y6RA 5SY4A 1QGDA 1QC5A 3I04M 4U9UA 1PL6A 3OF5A 3QVLA 1UWLA 4O8CA 1L7AA 1QLHA 2C4HA 1J4AA 3GEEA 2JC3A 4ZOQI 1NC1A 2ZJFA 3C1OA 3BMXA 1VE6A 2AFIB 2IHVA 4U7HA 4UM9D 4E7PA 5FI0B 2I71A 3S8MA 2ERXA 2YJNA 5HZKA 3IP7A 4KQCA 1UCFA 1XRPA 1EXWA 3M9WA 2HQBA 2NSJA 1LVUA 1AC5A 1LX6A 2AFIA 1UZLA 3HB7A 3M6UA 5A05A 2CEKA 2WSSD 3E3MA 4GSLA 3ZQJA 1N3LA 2BFDB 4A6DA 3PLAE 2HGSA 1VPWA 1GRRA 4GYJA 1N6NA 3OCVA 4ZPXA 1CUXA 1HZZA 1NDQA 4EJ2A 1QRTA 3PX7A 3B2NA 3OTHA 2I6GA 2JGEA 2M2IA 3NS7A 2BFDA 5IVKA 1OFUX 1JZQA 2LKDA 4HAYA 4CMJA 3PTLA 1BE6A 2R5FA 1BKSB 1T4CB 2H1LA 2PGXA 3A3PA 3CKLA 4NPCA 4ZEVA 3SEQA 1XMVA 2FOXA 2R85A 5EIBC 1KO1A 1QTIA 3ETEA 3VNSA 1Y3DE 1T4CA 3EA4A 1MVNA 4UM5A 5CW1A 3NX4A 3WAGA 1IYZA 2BCGY 1Q12A 5FWAA 1Q0TA 4JQYA 2VQDA 2ZQYA 2NZWA 5HJ2A 2H2GA 4EG5A 4NU8X 1RHMA 1UBJS 2J7PA 2GBLA 2Q27A 3QKRA 4EYGA 1P8JA 4UPEA 1E8NA 3EFBA 4XM2A 4X1KB 2XCUA 1EFKA 1YUNA 3B6EA 1BFKA 1S9DA 5KVVA 1PQ4A 3F9RA 1IVYA 2E49A 1IIBA 4X9XA 4X1KA 4BLWA 5ERXA 4GMHA 1VJCA 3IFSA 3HTXA 2OE2A 2JFGA 5KAPA 3D7LA 3V1YA 1P7ZA 4S1PA 5AKHA 3WK9A 3BOSA 2RMKA 5LA6B 3D3KA 3JQGB 4GDMA 4DEXA 4EO7A 1HE1C 3QW4B 1S8OA 3GWZA 3HDYA 1QIJA 2WTXA 3K73O 4TV9B 1RI3A 5DYIA 5GJWC 3ZEIA 2H1OA 4QTXA 5LA6A 3JQGA 1UJ2A 5FF9A 4C0JA 1DKUA 1UBNA 1VRWA 3L1JA 4FC6A 1PR3A 1IC6A 5TJ9A 3V4LA 3CUUA 4J0QA 4KNYA 1YS9A 4LQLA 2QD2A 3BZBA 1FUYB 4HF7A 1C7FA 1ORRA 1SCJA 3D3WA 3I09A 1X8JA 2Y9PB 5AOBA 3I5UA 3SM3A 4DWVA 2RC5A 1KL7A 3BGOS 1CIJA 2VYFA 4EG1A 1MRNA 2E89A 3HLYA 4KGZA 5DTQA 3NPMA 1EX9A 3R3JA 4LMRA 1JSLA 2NZUG 4RVUA 4D25A 2M1ZA 4W9NC 5IDYA 1RSZA 5KPJA 3BG5A 1EP1B 1C0PA 1SVUA 2W6NA 3WK6A 1JLRA 4DWOA 4L15A 2XPCA 5IAJA 3FOZA 3ZTTA 4F04A 2E48A 1JSRA 1YZHA 4FWTA 3H2YA 5I9SA 1ZRMA 1YB1A 1NXSA 2Y0CA 2QKYA 2V3WA 4KPUB 3ZJYA 1RQNA 1CUCA 1R1DA 5FOTA 3RYHB 1UXJA 2OG2A 7REQB 5JDCC 3IAUA 3K2IA 4NXMB 3EGXB 4XGRA 3VJMA 4TTPA 4GMDA 2DRIA 3IR6A 3RYHA 3W4JA 5C53B 1BOFA 1T8PA 7REQA 1TVEA 5HNKA 3P0IA 1SC1A 1VSVA 3SWWA 1ZP6A 2ZSFA 1X38A 1UEJA 3EA0A 4U2CA 1XN4A 3BFJA 1IJBA 3X2EA 2AI2A 2GAFA 4FJ1A 4MLCA 4TL8A 4OEHA 1MEEA 1EK5A 2FSVC 3B2QA 1I4TD 4Q39A 4Y6LA 1VSUA 3PG5A 4K0KB 1NNSA 2XDYA 121PA 4RXTA 3ONDA 1DBSA 1U7UA 2AHOA 3GLRA 4IH9A 3K4QA 4JVLA 4ZAVA 3TH5A 4KX5A 2IBSA 2N1BA 3PPIA 5E6RB 1J39A 3A6EA 4KR7A 3QYAA 2EL9A 3N6XA 3T1OA 4BTEA 1KK3A 1J9EA 1HL7A 3OT5A 1ICIA 5E6RA 3C7CB 4C2UA 1JQ5A 2CXTA 1KI4A 2HD4A 5LJIA 4L8GA 3ZLVA 3EZ2A 1A69A 3OIUA 4TXJA 4M0MA 4UMEA 4EL0A 4NU6A 1T9DA 3FLEA 2Y1EA 3OZSA 2DQ4A 4ZICA 4OK5A 3RUIA 1GNTA 1LFDB 1PGJA 1W87A 1DFIA 1SA0A 1ILWA 1T2DA 1WF6A 3B38A 1A76A 4TL6A 4AO7A 3PCTA 5A6VA 1FZQA 2EKBA 2FE1A 1HURA 1W1IA 4F97A 3OJCA 4EHJA 2B9EA 2P62A 5B58C 2I3BA 1SXQA 1IHOA 3HPRA 3PDIB 1UEXC 3GRPA 2LCQA 4AY2A 1XZ8A 1FDTA 4S05A 3FMOB 9GPBA 4B46A 1HQYE 1TT7A 3LX4A 4PVDA 1I0ZA 1QSGA 1V3VA 5AVZA 2FKAA 1SVIA 3PDIA 1PBNA 2YYZA 4AP5A 5A1JA 3TGLA 3DE5X 4L6AA 4L8YA 2ENUA 2X0RA 4LZNA 1P1KA 5F64A 2ID4A 1G66A 2WJGA 3FYTA 3JQCA 3NDPA 3UJ9A 1FXWA 2B2XA 2ZFUA 3JQ6A 3UMJA 1UUFA 2FPIA 4J3FA 4GLJA 1R3DA 1F6DA 4XI9A 2C0QA 3PGVA 1PQUA 4XZ3A 4HMQA 1A2KC 2EKZA 3DXFA 4LY0A 4XJTA 3ZYCA 4UU0A 1RYMA 3ZGYA 1KVUA 2CDAA 4LK3A 3PZBA 3ZVNA 1EUQA 1J2YA 1K6EA 4NJMB 4A3SA 2O0JA 5AVWA 1T0BA 1R9GA 3W5SA 1A88A 4OBWA 1L5GB 3SJ7A 4UPDA 2I7XA 3CS3A 4DV6B 4DZRA 3O2NA 4OB7A 4XVHA 5ALPA 4O8ZA 4IUCS 5KJFA 4MR9B 1V8BA 4B2LA 1T4BA 1QIEA 2Y77A 4F12A 4BNIA 4D96A 1IWOA 4MR9A 4RDXA 1F51E 4I1SA 2PMBA 4NAUA 2R84A 4Y9SA 2A58A 4HRAA 1JDBB 3BIFA 5CA0F 5FI3A 3A4NA 2O2DA 1BXRB 1W0JD 1P91A 1WMFA 2BGKA 2DBQA 1Z25A 5KYWB 5HZMA 1GKYA 1U3DA 3LLMA 3QA3E 4DF3A 4MHSA 5KYYB 5K0EA 1GITA 3BFPA 1AMOA 1W9MA 2HCRA 4II7A 3DC2A 2VT6A 3GRRA 5J5CA 2QMYA 4OMCA 3DFFA 3H2ZA 2HDNB 2G72A 3L4EA 5JAIA 5KYWA 5E4YA 4LECA 2GBCA 3JD2A 5FAKA 2KI5A 2PXAA 2W98A 3R0IA 3GV0A 1ANKA 2ATVA 1AQUA 3F46A 4R3WA 1VL8A 4E1BA 4EJFA 3NVKI 1YK0A 4MVJP 3PFWO 1R00A 4LZZA 5JSZA 1VJRA 2O2EA 2BDEA 3DTTA 1FYVA 1G16A 2P67A 3OOSA 4RK0A 2IHNA 3T9DA 1UDAA 1B43A 2RONA 5DYTA 2N3ZA 1KE2A 5JRJA 4PYMA 3E22B 3ESBA 2WQ7A 3K9NA 2VA9A 4U39A 5DN9A 4RL4A 5KQPA 1FRNA 1WV0A 4FWBA 1FDRA 1FJ2A 1G7SA 1ZH6A 3OT1B 3BIOA 1GZ6A 3V8BA 4BZQA 4YPOA 3ZXSA 5CD1A 1L7EA 3E22A 5GGXA 4CF6A 1PL7A 2NO9A 1Q1BA 1V95A 3OT1A 4NZYA 4QX6A 3CLTC 2W4MA 3DL7A 1P2VA 3PQ6A 3SJBA 3ZK7A 2HK7A 1HO3A 3BCRA 3ZV5A 3OEHA 1GZ3A 3V5NA 3SE7A 1E1RA 1RRGA 1E4YA 4W1QA 3PC2A 4ZT6A 3EAFA 4WXEA 2XQJA 1A97A 2GHTA 2WA2A 2WJ4A 4EGJA 3HB5X 3PS9A 3O3NB 3GH3A 1VGRA 4RMJA 2P7IA 3HFRA 2BSXA 2GF9A 4H3HB 4MVJF 2GB4A 4QUDA 5GY7A 5HGJA 2CNLA 5KNCA 4CFYA 4YRCA 3OU7A 2C4UA 2XQGA 4QXPA 4IJ6A 2I1LA 5CUQA 1SC3A 4V38A 5IFLA 1QJ4A 4AG5A 5JI2E 1TDJA 4HCJA 3RGWS 3CX6A 1YBMA 1VQ1A 3RUEA 3W79A 4MEBA 4I1YA 1IWPB 2EKQA 4B4KA 7ADHA 2GDZA 2BUBA 3HU1A 4EM6A 4D82A 1Y3CE 3I1JA 3R0JA 4J3JA 1QTNA 4N5LA 4NCBA 1KI9A 4UE2A 1D2AA 3OIGA 2YKGA 2CEAA 2GNPA 1YNOA 2JNWA 4IQFA 2KBEA 2WWYA 3BDAA 3FTEA 3B6JA 2PZKA 4BKPA 3ON5A 4EJ6A 3E53A 4BXOA 4PPNA 1SBTA 4CQLB 2RD2A 2EKPA 1QGUB 521PA 3RIMA 1P4RA 4XSGA 5BMVF 3INYA 1DARA 3WWEA 3MLAA 1NW3A 4CQLA 3RO7A 3P97A 1QGUA 4G5QA 4JP1A 4O2AB 5FR2A 1JIXA 3G8BA 4KUGA 3VC7A 5HZGA 4NBKA 2FOLA 2ZXEA 4JI3B 1LH0A 1NMSA 2OCBA 4IZIA 5DRYA 3STTA 4A0GA 2Y4NA 2HTEA 4EZIA 4BLOA 1IQUA 4O2AA 1FA9A 3M7IA 4QJ4A 1QUFA 1WUIS 4ZVKA 4BCBA 3LPCA 3RE1A 3MG9A 4D9NA 3UV3A 1U8EA 4RDHA 3QEMB 3TRHA 1BSVA 2ZBQA 3V2UA 2WE7A 4RH0A 4ZTUB 2GAOA 4R16A 3L8YA 5IP5A 1EX1A 4KE7A 1J8FA 4HDKB 4X41A 1VE1A 1X1QA 2PRYA 3QEMA 4NBLA 5LIRA 1BX1A 4I36A 1C80A 1ECJA 4CQJA 5BUCA 1RS0A 4TPKA 1T9KA 2FUG1 2GAAA 3PQ2A 4LJRA 5TT0A 4TKVB 3WIOA 5I7SA 2QDXA 2XWSA 5H0IA 4CNQA 1U02A 1YA8A 2JI8A 1IOVA 1KKUA 1ZSNA 4B7UA 4CRWB 1A5SB 1QHIA 3W2FA 4LOIA 3IMFA 1NM5C 1DBVO 1KZ6A 1U7OA 3AUUA 3MWJA 4IIVA 2VTEA 5AD1A 3GT4A 4YJDA 4MARA 3EGOA 4DIUA 4RY9A 1AQLA 2GR9A 2F7SA 1SB8A 5TSDA 3CZRA 1DO2A 3T0FA 5AVVA 1ZK4A 1N5OX 2FEXA 3HUDA 5JHGB 3FUWA 2LXNA 4LCBA 4WFJA 4B1FA 5EUCA 1KMCA 3MGCA 2JCGA 5B1IA 3B36A 4EWLA 2VRCD 4C21A 1JDUA 1EXMA 3NUGA 5DK6A 3IQFA 4I4LA 4ZVMA 1NT2A 4Y2GA 5DEIA 5KU7A 2QX9A 2CFOA 2WD7B 5DNWA 3JZAA 2LIVA 3JU3A 4AJ4A 2G8LA 1GO2A 2JIPA 4BX2A 5BORA 1L5FA 4ADSG 4K9QA 1R8XA 1U2GA 1UMBB 1JLLB 1OROA 2WD7A 3C3WA 4FGSA 4IV8A 4UBNA 3TOCA 4F1KA 4HFMA 2R60A 5K8IA 4P53A 1EFTA 1EDDA 1R0RE 1R0ZA 5BQOA 2FW0A 1D7OA 1QANA 1UMBA 2ESRA 3VAAA 3U16A 2OGTA 4DPMA 1IM8A 2JL1A 3MJRA 5K1ZA 4YRMA 3W5JA 3ZJUA 1TECE 4CG0A 2PH3A 4DQKA 1U0HC 2C9CA 4DR1B 4C0LA 4J0FA 2IXAA 5I47A 3GPDG 1YVEI 2E7ZA 3DVAB 2WTBA 3CKKA 4B5KA 2YFYA 3B85A 4MVJH 4WOCA 4P38A 5BXQC 4YRJA 1KP2A 2A1IA 3AGPA 4KQXA 4B5LA 1Q92A 1RM4A 2CNWA 1ID8A 3KQUA 2ZIEA 4E3WA 4NQZA 3E9DA 3FTNA 4UU7A 4EEKA 5MN6A 3EH1A 4P98A 4I81A 4CKWA 1W30A 2WKSA 4NFYA 2X9VA 3QWAA 3UA4A 1LTHR 3IBTA 1GP2A 2B1QA 3QUTA 4KRGA 4DMMA 4P8RA 1S4QA 1GG5A 2PSHA 3I45A 4BNXA 5CYOA 2D7JA 5ELXA 1FY2A 1VIYA 3MF4A 5JEEA 4URVR 4IIJF 1SVLA 5KJ1A 4XVRA 1FFXA 1FB5A 4JX8A 3DO6A 4EA7A 3LA8A 2A33A 3CR7A 3SQNA 1M75A 1YD7A 3OEYA 2PL5A 4E5UA 2AMVA 2WTUA 3WVNA 4W5NA 3ZX5A 4BN0A 3QPCA 2QTAA 2HO5A 1ESZA 1NVMB 5INTA 1U8FO 4RQTA 5I8ZA 3T38A 2FZCA 1C5KA 3N8DA 4KMMA 3RHSA 1SD1A 2C96A 1CUUA 3Q0IA 2D8MA 3BMQA 4G25A 2GYVA 2NAFA 3QIAA 1A82A 3FZYA 4JR2A 4RZ2A 5FA5A 3T8YA 3QXXA 4B34A 3D6NB 1Z17A 1X3LA 1IN6A 2IV3A 4EQ6B 3GJYA 2OGUA 4BC0A 5LKAA 4MP6A 1O1YA 4J0GA 4CEJB 3V8QA 4Y9DA 4BNUA 3RF7A 2Y6VA 3ZWDA 1RYHA 2OFXA 4HEQA 1LUAA 2V6IA 3ONFA 3PQCA 2L82A 2IU0A 1GPAA 4GM4A 4IO1A 1IM5A 3KVNA 1ZNWA 2ZT5A 3CHYA 3CNNA 4TQUS 3MFQA 4J29A 1TAGA 1CY0A 5HFAA 5K3EA 1UAGA 3LQ2A 4U00A 2JCXA 2AD5A 2W6IA 3H9GA 4JT8A 5GZ1A 1NX9A 1C3OB 3G2HA 1ZD2P 2ZIUB 3QWBA 3QX8A 1C8BA 1Z6YA 4JBLA 4PHHA 1GRVA 2X1HA 2JEYA 2XMSA 3VDXA 4BTLA 2YUTA 1II8B 1SXJB 3RYIA 5CB0A 3EOZA 3CF0A 3IBYA 1KYVA 1C3OA 3E70C 4PTLA 2Z6AA 3GDHA 5ANRB 3CKMA 3UJNA 3GRUA 1YVPA 1II8A 3CUEF 1AV7A 1MPXA 2IZ7A 4INZA 1WQ3A 1VBMA 1WW3A 3QEOA 4IY1A 4N18A 4JYPA 3ASUA 1L7BA 2FUG6 4Q9IA 5FIUA 4BMSA 5HQ3B 4QU0A 4E5PA 4LY9A 4OMUA 2LPMA 1PR2A 1MC5A 1EGQA 1V7CA 3RFTA 4EMSA 2BSQA 5KKNB 4BFZA 2HA6A 2BMWA 3I9V1 2PA0A 4MJLA 3UUFA 5LQRA 5CDHA 4F60A 4YXFA 2X9GA 3ECCA 1YJBA 4YAKA 5DHUA 3TLKA 4F9GA 3HGQA 2CD9A 1OWLA 4NU0A 2V7UA 1Z73A 4XCQA 1M74A 1E2DA 1KZ4A 4ZOLF 2BLLA 2VSYA 3TMYA 1RQLA 5G41A 3LQ1A 3ZZTA 1XTBA 3LVBA 4OQDA 5IXJA 2P2GA 1JDZA 3CTMA 1JEEA 3AUAA 4JJEA 2XKJE 3RSSA 3CJRA 3FVWA 3DZJA 1K3UB 4Z9YA 5FNVF 3TYXA 5B2EA 2ABWA 1CZUA 1I5EA 3TXXA 3JQRA 1NKSA 2OB1A 3KDSE 5CH3A 3ZHZA 3NTUA 2E2WA 3KKQA 4ZPJA 4CLEA 5KQGA 4CL2A 1PV4A 1QGOA 1CXZA 1R16A 3BMOA 4MS3B 1I6WA 3WLOA 3HK2A 3P9QA 1ISGA 1ZN8A 2X0JA 4R1SA 2KBFA 5FOVA 2NIPA 4YALA 5KNDA 3OPMA 4MS3A 4RJLA 3W8EA 3WGQA 1LB1B 3EC7A 1IHDA 3MJFA 3NTXA 2MYNA 2O7SA 3O2SB 5FTLA 3BGVA 3PXAA 1UF9A 4IHJB 4DA4A 1S3IA 2W4QA 1Z0UA 3BXPA 4MMYB 4XM1A 5H9WA 1WPQA 4K9PA 3RJ9A 3ZU5A 2FEWB 4EPVA 1Y1SA 4J1SA 5FUWA 1J56A 2BHNA 3QUQA 4L6IA 2JJYA 5HKLA 2HHCA 3UCFA 2ZBDA 1KQPA 3O82A 4I50F 3T15A 3MRSA 1H6DA 2O8CA 5KC9A 1R5NA 3EDMA 4JIGA 1FDSA 1WHSA 2C9YA 1M1UA 4WE3A 4DL9A 4RD4A 1YT5A 5B6IA 1CEEA 1T4DA 3ZH2A 3OAAD 1BWPA 4YJ3B 5AI6A 3QPBA 1OWPA 4NCXA 1ULAA 1V8FA 1V2GA 1WZCA 3IMEA 3KUXA 2F3QA 1U2QA 1EFHA 4YJ3A 3HZZA 2RCYA 4QPNA 3EZLA 4BVJA 5DBOA 5KIAA 3LGAA 5EAIA 1EFVB 3TZLA 4PX9A 1NLMA 2BPOA 3DDZX 3O93A 2CL7X 2XB8A 5CVUA 2OA0A 5F98A 3I4CA 1J33A 1FLAA 2LIPA 4IMPA 1J6UA 3IDAA 4UEJA 5AJVB 4FZJA 1XZQA 3SZRA 1NXXA 3VR1A 2PT6A 1O95C 3KVOA 4M36A 3AH8A 4OXQA 2GJ8A 3ZIAD 2HA4A 2BGMA 4J0CA 5K0LA 4PGAA 1GNSA 4PLHA 2ZATA 2BONA 4BV9A 2R7NA 1A7KA 2D4HA 1NW8A 2J5QA 4M87A 4PNZA 5AJWA 5TRTA 4BBJA 4D8XA 3GAMA 4DQLA 3AKEA 1NTOA 2A5YB 2AGVA 4P4SA 3MYYA 5B12A 3SJZA 4YTEA 3K6SB 2JFVA 3P96A 3Q9SA 5CDTA 3NM6B 4BO2A 1IUOA 3DKPA 2YOFA 5KHAA 3HGTA 3K30A 4MP8A 2HMWA 4LNHA 4TL7A 3K70B 2C2ZA 1HX7A 3K6SA 1PGQA 2B78A 3CR3C 1B23P 1SG9A 1HYHA 1PEKE 4UBKA 1ULTA 2WHPB 4EI2A 4YRIA 3N6RA 2RKOA 3X43A 3K1YA 1W59A 1UINA 2WHPA 3C6KA 5ENVA 4Z4FA 4IAOA 2QE7D 2Q0HA 3S2ZA 2ZGVA 2VWHA 1V41E 4JUCA 5JQGF 4N76A 1AKMA 1GPUA 2O3JA 4Z8YA 3N59A 4KUEA 2R7AA 3AFNA 3DUFB 4I1OA 2ZE7A 1L5KA 3ZG6A 2CK3D 2II6A 3I9KA 4FDMA 3W1WA 3P2OA 2IYFA 3LPLA 2ZB8A 4AO6A 3MOGA 5CJPA 1S5PA 1M2OA 3DUFA 1U2SA 4V0ME 4ISCA 4X84A 1RMYA 4PN3A 1KIFA 2C4VA 2PKQP 3CCCA 1H66A 1KWKA 1V37A 3R9XB 4CEIA 4DCMA 2FHSA 1J7KA 3A4YA 3AI2A 3IQEA 4IO0A 4RFLA 4JC8A 3NUZA 1X39A 3VU0A 2GCEA 3QV2A 4D8WA 3P9XA 5AR1A 1QE5A 2FEAA 1VJ5A 3GOHA 4RWZA 1CUBA 1JWBB 2EU8A 5B3AA 2A4KA 2BKXA 2PL9A 2CHUA 3AF5A 2RAPA 3I9V6 4GPEA 4WCVA 4YRFA 2OORC 3D6JA 4I1IA 2C5AA 2EZTA 2RGEA 3LUPA 4KDCA 2OV8A 4YCDA 2HPAA 2HSEA 1FP7A 2UVQA 1YULA 1GAJA 2ZYIA 4IJVA 1SXHA 4JENA 4JIMA 3DTVD 1ZJ6A 2R47A 2IVFA 2YRWA 2BY4A 4LYYA 1QO9A 3EVDA 5H02A 5J23A 2JK0A 3AKYA 3N2NA 4NCAA 1OU4A 4FFRA 3MT8A 2IHTA 4TYWA 3GCGA 4MW7A 1RP7A 4EATA 5IM5A 5G0WA 2VJOA 4KW7A 5FORA 2ZYAA 1GN9A 2R6GA 1UIMA 4P5DA 3E9MA 2AZMA 3PE3A 4HAUA 2P68A 3PA6A 5FA8A 1E0JA 4IYJA 1IEXA 2RGCA 3GZNB 4KIWA 3SQXA 2ZRAA 3R24A 3CURA 1RPAA 3FYUA 1VMEA 4CMHA 1CZNA 1E6WA 4ZQHA 1GPNA 3D2LA 5DFAA 4PPYA 1V8OA 1X2EA 4QO7A 2QR2A 3AERB 1BMDA 2H48A 3BIJA 2MINB 4N5MA 3VO1A 3OICA 3VH3A 1G8FA 4KFSA 4Q7QA 1YBFA 3A1NA 2XA1A 4KP7A 4R69A 4KMOA 1XAGA 1UP7A 4O4LB 2MINA 4I0WB 2ZJ3A 2CNDA 1G5HA 3C24A 1NP7A 1Z4OA 1GILA 3KWFA 3MD0A 3MWLA 5IJAA 3VR5A 4B84A 3OOEA 2YW9A 4K0RA 4KBFA 2IYPA 3DXXA 1ZH8A 1RQ7A 3IVCA 3Q41A 4DA7A 1XTQA 4A92A 1ZWKA 4H1UA 1L4GA 2X9QA 4HWRA 1ODFA 4ENPA 1PT5A 4FOTA 1MKYA 4ZU6X 1ZOOA 1QAQA 2Y1FA 3KYBA 4MI1A 3UEOA 5GIOE 5JVDA 3EDOA 4Z54A 4FMDB 1A9OA 2I03A 2YWHA 3IVMA 3ILXA 4ZD6A 3V00A 1WKCA 1C0IA 2QAJA 2WNIA 1BJKA 1NVBA 4WZAE 5CNKA 1ZIXA 4CFSA 4QRDA 4EPTA 1SBYA 2R4UA 2ACWA 1JKXA 1AV6A 1SD5A 3C3DA 3KVRA 1O96B 3M83A 4AJ9A 3HBNA 2HU2A 4D5GA 1GLVA 3CRW1 4KLAA 1W5AA 4K3VA 3WDMA 2YXPX 2Q7OE 4HXGA 2ZYVX 4WHMA 3HBLA 1FFBA 1O96A 1U3WA 2Q6KA 3SLKA 5A5FA 1ZRHA 4LHZA 4AKIA 1UK6A 3ANLA 1PX0A 3RC8A 1V3TA 1G20B 1N1EA 3ZBQA 2V98A 3MILA 4JL6A 4P5EA 4Q7MB 1T36B 4Z2AA 3K15A 2WHRA 4CM5A 2YRXA 4HX2A 5MGBA 3HYRA 1G20A 1NZDA 3PHIA 3NRCA 3SN6A 3UM9A 1VE9A 1NYRA 4LNUA 1ULBA 5ECWA 3PC3A 2W2LD 3CN9A 2LRHA 3IUYA 4I4TA 3N3BC 4LJ6A 4M0EA 3ZN2A 4A0FA 4BGEA 5I6DA 2INGX 4KAFA 4RESA 3DQQA 2E5FA 4G07A 4KFUA 1SQGA 2VDNB 4HKTA 3RC2A 2QPOA 3KR2A 3V4VB 4DMKA 2P2NA 4CTOA 2FE4A 2OY0A 5BRAA 3PPYA 4BQFA 1YQQA 1NKTA 2KS6A 5DGXA 3N5CA 4QQNA 5E6UB 5LXTA 1KDTA 1NMZA 3UMYA 2Y0PA 5H8WA 3ISJA 1IE3A 1M34B 3ANTA 3BGSA 2P6PA 3I73A 3O4RA 2FLVA 3QOYA 2PZMA 5E6UA 2D5IA 5FR1A 4UUOA 2NYRA 3WLJA 2HJHA 3K6KA 3L4BC 5AKXA 1M34A 3P9ZA 1QR2A 1BJRE 1MVOA 1PTJC 2P8JA 4G36A 1JAHA 4CV1A 1Y5LA 3PHBE 5C4GB 5C3MA 3RVBA 5I9TA 2AG1A 5ALYA 4BLUA 1K08A 1OLSB 4DPLA 3B5JA 2CF6A 3DEJA 3M0EA 4HDRA 4LC9A 3TF5A 3ABIA 4Z6KA 1SN7A 4Q7JB 1OBOA 3OIFA 2VDKB 5EUQB 4J0EA 4MW4A 3ZHUA 8OHMA 1VL2A 1FE8A 2OENG 1E99A 4LXHA 5HK8A 1YCHA 2L19A 4G4JA 4BYGA 4YS6A 3TXYA 3CSDA 4URHA 2J6HA 3KTAB 2WMDA 3NCTA 2DEUA 1XNQB 5ICCA 3U40A 1PT6A 1YWGO 4UNNA 1EWRA 1C41A 4GU5A 5I8WA 1N0WA 2AN4A 1LPMA 5T4FA 3HVJA 4YRRA 4J0HA 1Q1QA 1NC3A 3MTEA 1JXMA 1NUUA 3B9BA 3I5YA 2VNIA 4YJHB 1XDGA 1WE2A 3QBTA 1OI2A 4XIIA 5C8ZA 2IH2A 2Q3FA 3V8RA 2PBRA 1K97A 2IUSA 4YJHA 3A58B 5H4HA 1J8YF 2FXIA 2HX1A 4WBXC 1XKQA 3A3OA 4OK3A 1WZEA 4XARA 5KVQA 4B6QA 4KRFA 3M3DA 1CDDA 2C9OA 3U48A 3WLFA 3IAS1 3D6MA 2QN9A 1QRRA 5BQ3A 1ZGHA 4HZUB 2CWDA 3TUJC 5K9ZA 1WDLA 1W0KA 3AL0C 3GIWA 1NQOA 2GI4A 4ISBA 4UD6A 4BP1A 2QR5A 2QA5A 4HZUA 3KL2A 4NBNA 1P39A 4DV4B 1LS6A 1EBUA 3KT6A 2XXAA 5JYDA 4BAGA 1MZPA 2O0KA 2QN3A 3QEJA 4L76A 4ID3A 3R74A 5T4HA 4RF2A 1YGPA 2F3RA 1XJCA 4ZVRA 3HU3A 1V4VA 4YUYA 2Q5HA 2RHWA 1EVZA 1AA6A 1Y1QA 1O8CA 1REQB 1SUWA 2DBRA 2DTEA 2HLHA 2J7PD 3IB6A 5F2NA 1A5AB 3L7MA 3FCOA 1DE0A 2XHZA 3PICA 4BNTA 1OXVA 4JL5A 4HVCA 2UYYA 4LF8B 1I01A 1REQA 4RIGA 5HDQA 2OZLB 1JALA 4C0SA 2ANBA 1NJ1A 2C7VA 4XPZA 2HRCA 5ALZA 1YRLA 3HG7A 1MW9X 2PD4A 5ALLA 1JG4A 2C42A 1WWKA 1CR4A 1E5VA 2OZLA 2G1UA 2MYTA 1EZ4A 4K86A 2IUFA 3O8DA 3OE7A 1QZZA 1P33A 5HIAA 2BZ1A 1VB3A 1WDWB 5K6AA 2Q8PA 4W6ZA 3AWDA 2R5NA 2JI7A 3IIKA 1ESDA 4IDFA 2CDNA 3WNVA 3E8SA 5L8VA 4M1YA 3T1HB 4TV8B 5I7WA 4QGAA 1JHDA 2BR4A 1TYEB 4RVFA 4QWMA 5AHRA 4F4CA 4FFWA 4K6MA 2QTLA 5IG2A 3FHLA 1RXUA 1U04A 3LUKA 3WYGA 1J9ZA 4RKEA 3ZQUA 4G81A 1CG6A 4M89A 1Q3HA 4F4JA 2D1TA 3EOBI 4HDNA 3T54A 3NM4A 3THSA 2YV5A 5EXTA 5HP4A 1P7VA 3HB9A 3M4JA 4JQCA 1N7IA 3D8BA 4HVAA 1YUMA 4N7RA 4R1MA 3HV2A 4WWHA 5JSKA 1CVIA 2XJ4A 3ECSA 3IV7A 4RPIA 3LBHA 1YA6A 2VT2A 4DM3A 2DBYA 3PFCA 1F4PA 2X6QA 5HBRA 2X3FA 3WJ1A 3K0CC 5ER6A 2H4WA 4Z0HO 3QNWA 4IDOA 3ZCVA 1GAXA 1HK7A 1HZJA 2QU8A 2REQB 1JIVA 1OC2A 1Y6JA 1LRKA 2HWYA 2JAUA 3NBKA 1KDPA 3L07A 1AZWA 3ROMA 5FPTA 5EJGA 1HWYA 4ZJYA 2X15A 5C5DA 1GRNA 4ZYZA 2REQA 3VI4B 4KTVE 1L1RA 4QE3A 3ULKA 2R79A 2VZ8A 4H35A 1Z3IX 4G4SO 1TQDA 4UZSA 1I10A 1PYGA 4CI0B 2X23A 3FPLA 4WKNA 4YCJA 3STHA 3W0LB 1P1CA 4XEUA 5C51B 2CVOA 3SBOA 3GFGA 3N8HA 4ZI3A 5KVAA 2OHOA 3COPA 4O4HB 3TRIA 2ZJYA 3S28A 1F3LA 4F8JA 1TK9A 4FYHA 5IXYA 5M04A 5CCEA 2YY6A 4OGLA 1B76A 4Z9AA 3H2GA 4R6WA 4X8HA 5FV7A 4E21A 2XTJA 3PV0A 4YCMA 1HF3A 3WQHA 3OHMA 9LDBA 1I14A 3JYOA 3SFZA 2VNAA 3LUHA 1YHZA 4B4WA 3CVUA 1TEXA 1VLLA 1ZNQO 7YASA 1CIPA 3JZMA 3U44A 1AH2A 1Q0SA 1QP8A 5IH3A 3DZ8A 1MB3A 5JSYA 2QP4A 2VDOB 4CM9A 3GGJA 2PX4A 4TT8A 3A10A 2D2EA 4WOPA 3HJTA 1TRHA 3TGPA 3BICA 4DFDA 3ZW8A 1ABFA 3E7XA 4BN4A 4CKXA 2EF0A 3AZOA 2I7VA 4HGNA 4P4LA 2FN3A 3GXOA 4Y2VA 1AGYA 1J8QA 1GXSB 4JLJA 4R4JA 1CZLA 3KUKA 3IAS6 1RYYA 2VZ9A 2XYRA 2H4JA 5DHFA 1SJ9A 3UXHA 3A1UA 2WMOB 2WOJA 3CNHA 4IIHA 4UJ5A 2DY1A 3STXA 1GXSA 1MORA 4H59A 1VYVA 3NNSA 2VAWA 2ZUUA 1DMRA 2AK3A 2O1WA 2R8YA 2RK6A 4IIFA 3DDUA 1NBME 1ENZA 4PCVA 1YKSA 3S4YA 1L7DA 3P2YA 2F3UA 4N39A 4QO8A 4WPGA 5DOZA 2BI7A 5ENDA 4MW9A 1Z45A 3U7JA 4EX7A 5K0GA 4X90A 2EW8A 2G9NA 3SZ3A 1HQCA 1MN6A 4KQKA 4UVGA 3QY0A 4NICA 5DBIA 2CFSA 4BOYA 1CF2O 3KXIA 3KO8A 3WLRA 2RHDA 3QE4A 4MTCA 4P34A 3REFA 3ZX4A 2VH2A 1KY3A 3FE2A 3WIDA 5KNBD 4NCIA 3DAOA 3T5TA 4MGZR 2AXEA 1QVVA 4BFVA 2W70A 3WLPA 4F7WA 5J2UB 2WG1A 4IX1A 5KCMA 5KDLA 3URKA 1GGMA 1EGMB 1SMKA 2NU6B 2E82A 3SIXA 1OGJA 2RBGA 2HMVA 2HXSA 1DNPA 3FTQA 2WFAA 5J2UA 4M7WA 1U2TA 2CLFB 1VLJA 2H2IA 3ESRA 4P7JA 5BRNA 4XA8A 3T3OA 4F11A 4RA9A 2QQ0A 2X0FA 1GRQA 1WP9A 3QXGA 3R77A 3GARA 4AG6A