4I5FA

Crystal structure of ralstonia sp. alcohol dehydrogenase mutant n15g, g37d, r38v, r39s
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
249
structure length
233
Chain Sequence
AYRLLNKTAVITGGGSGIGLATAKRFVAEGAYVFIVDVSRKELEQAAAEIGRNVTAVKADVTKLEDLDRLYAIVREQRGSIDVLFANSGAIEQKTLEEITPEHYDRTFDVNVRGLIFTVQKALPLLRDGGSVILTSSVAGVLGLQAHDTYSAAKAAVRSLARTWTTELKGRSIRVNAVSPGAIDTPAKFAAATPLGRVGRPEELAAAVLFLASDDSSYVAGIELFVDGGLTQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Alclohol dehydrogenase/short-chain dehydrogenase
publication title Crystallographic analysis and structure-guided engineering of NADPH-dependent Ralstonia sp. Alcohol dehydrogenase toward NADH cosubstrate specificity.
pubmed doi rcsb
source organism Ralstonia sp.
total genus 89
structure length 233
sequence length 249
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2012-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4i5fA00
1GV0A 2IZ0A 4NI5A 1WMAA 3E82A 2X5KO 1SOWA 5JO9A 3JQ7A 1DXYA 2O3SA 1A71A 1T2FA 4XGKA 2R2GA 3TZKA 3B70A 5DCYA 3GNSA 2BF7A 4GWGA 3PPIA 4NFYA 1ULSA 3UW3A 3VPXA 4JROA 3JD1A 3GVHA 2YW9A 4KDEA 1GY8A 3WBBA 3X2FA 1OZAA 2VHYA 3OM9A 1RYEA 1QMGA 4D7AA 2WYVA 3LT0A 4IJKA 1FDTA 3EC7A 1M66A 1UZMA 4DIFA 1NQ5A 1U3WA 3GGOA 1O5IA 2GYYA 2JHGA 3RKUA 1JW9B 1L7DA 4YAGA 1HTBA 2Q1WA 1XELA 4E33A 1HYGA 3AI2A 4FR5A 2CF5A 4IDCA 2V6FA 5TS3A 4UUPA 1I36A 4NR0A 1PGPA 2FRDA 4AJHA 1ISGA 3DEYX 3OSUA 2QYSA 2O4UX 1WAMA 2Q50A 3H3JA 3DONA 1GUYA 2TMDA 4CV2A 1MGOA 4J6FA 1SO8A 3WB9A 5ER6A 3ZU2A 2IZ1A 4JP2A 3O26A 1O0SA 3HJAA 1ISIA 4FPXA 1LLQA 2Y1DA 5JMPA 3K96A 1GYPA 1TVEA 5A3VA 1QXSA 3QWFA 3KSUA 3ZZNA 2HMSA 3D4OA 4DPMA 2C7GA 4NBUA 1LTHR 3G49A 4GMFA 3WSVA 5HS6A 1XQ1A 3H8VA 4CMIB 5K6AC 1DFIA 3L9WA 3GMDA 3WTCA 4L76A 2X9NA 4KUGA 5TT0A 2B83A 2Q46A 3RUEA 4KZPA 1E1LA 4ZQHA 1GAEO 2NV6A 3KLPX 3ZWNA 4NQZA 3HG7A 3LC7O 4HFRA 3CMMA 3ETEA 4RQTA 4IMRA 4DL9A 3COSA 3NTQA 4E6PA 4R1SA 1JKIA 3ROQA 3TL3A 3WDSA 5KVCA 1K6XA 2Y68A 1GR0A 1QRRA 2WJPA 4CPDA 1J49A 5JAQA 4YAJA 1LLCA 2ZTLA 4GH5A 4QTZA 5MDHA 1TA4A 4IDGA 3Q9NA 3TPCA 2WSBA 3KHUA 3VPGA 5JYEA 5COBA 5EN4A 3NX4A 3Q9UA 2GUGA 2EKLA 2Z5LA 3HDYA 4MVJI 4QFDA 3VZPA 4P38A 3QP9A 1I01A 4B4WA 2JAPA 4O59O 4R68A 2A94A 4MVJP 4CM9A 4YJGA 2YV3A 4BNKA 3U5TA 2BGLA 3WGIA 4XQEA 2YY7A 3VC7A 4RO0A 1B0AA 4PG8A 1PQPA 3RU9A 2B4QA 4NDNE 1D7OA 3GT0A 4B79A 3EZYA 4GL4A 3STHA 4CMGA 5CG1A 1PQUA 4L73A 5ADHA 1ZO8A 3GR6A 5JC8A 3PJDA 2YFHA 2FZWA 1WW8A 1LU9A 1U5AA 5LCXA 4RF3A 1GCUA 2IE0A 3F46A 3G3EA 1E6UA 2CZCA 3VTFA 3K30A 4L4RA 2I5PO 5F1PA 1R4NB 2PZMA 2Y05A 3WOHA 1I3LA 2HMUA 4WJZA 3G17A 2EERA 3WJAA 3NJ8A 2NVUA 3PHLA 1F8FA 4ALMA 1IL0A 3KLMX 4RVUA 3ZNPA 3I9NA 3UHAA 1R4MB 5I9NA 5ES3A 3ICPA 2EIHA 4MKXA 4PG7A 1Y9EA 2X6TA 3RUFA 4FDAA 4OOFA 4CLOA 3T7CA 4YAIA 2X1HA 3ETGA 3AI1A 1BGVA 1WDLA 4INAA 4RVGA 5EESA 4RPGA 4I5DA 3ZV5A 3VH4A 3ZWBA 4CM9D 2HU2A 4Q3BA 3QVSA 4R1TA 1P1RA 4BNWA 2FP4A 3OEWA 3FWNA 1I2CA 4IXTA 1ISHA 2R00A 4GPD1 2AEJA 3O8QB 1YE3A 4M1QA 4HXYA 4ALJA 3Q6IA 2O7QA 1UP7A 3FPLA 1GUFA 3GZNB 4GWKA 3PLNA 1LRLA 1VE9A 1ISMA 1HF3A 1T2EA 3CEAA 3GG9A 3DTTA 3Q2KA 5FYDA 1DBVO 4W9NC 3VAZA 2FZEA 5TJHA 4O0LA 4L75A 4WLFA 1N1GA 3E03A 4F6LA 2AMFA 5B37A 5JC1A 5JAZA 2VZ9A 1C0LA 3C7DB 3QRWA 2ZCUA 2DLDA 2OHXA 4CQLA 2NSDA 4MOWA 3W8FA 1T26A 2X5JO 4EJ6A 1P31A 2EJVA 3ANLA 4LN1A 2DVMA 2OP0A 2ZJ0A 4DTIA 2X0RA 3GRPA 4MP8A 2O2YA 1R6DA 2BH9A 3R6DA 1HE4A 1QORA 1NP3A 2BRUA 4TRRA 4Z3KA 2HKIA 1N9GB 2NLOA 2NWQA 2PR2A 4EBFA 1RM5A 3JTMA 3SBOA 2NTJA 3S8MA 2Q1TA 3ABIA 4BNMA 3MEQA 5T8KC 2D59A 1T2AA 3FCOA 4XB2A 4MVJH 4PLFA 2UDPA 4BL5A 4J9UE 2GASA 2J5RA 1EQUA 2ZYDA 4FCCA 4G65A 4GVLA 3ROMA 1I0ZA 4I9NA 1SC6A 1ZMTA 3QVWA 5COQA 3KYCA 4LVCA 5HS4A 1NVTA 3RU7A 1A27A 3BTVA 2PGJA 1T2DA 4LMRA 3E5RA 3UUWA 2IXBA 4U5QA 3P7MA 3W8DA 4RCVA 4Y9DA 1YONA 3MZ0A 4UUMA 4ND3A 3U4DA 4ND1A 4TQGA 1YQGA 3C85A 2DKNA 3WICA 1UJMA 1XWFA 1PGQA 2P2SA 4ID9A 2A92A 3G0OA 3TFQA 5JCXA 4R54A 4ZD6A 2ZIZA 4QFCA 1PZEA 2FWMX 5B1YA 3K8ZA 3IUPA 4MP6A 2DPGA 4CV3A 3K31A 5TX7A 3QY9A 1XR3A 2W2KB 4FFNA 4M8SA 1ADCA 1HYEA 2V65A 5F5LA 5I7VA 1KC1A 1EMDA 3BAZA 1U1IA 1E7WA 1CDOA 1ZSVA 4BKUA 4TRJA 4J1QA 4YQZA 1MA0A 4BO8A 4DYDA 3U09A 3RBZA 4KMSA 4GSLA 1A9ZA 1D1SA 4PVCA 4XQ9A 3M2PA 2QX7A 1BHSA 2GLXA 2X9GA 2NADA 1C3VA 3L6DA 1K89A 3ZHBA 2X4GA 4BGUA 1LDMA 3C7AA 1T1SA 4D41A 2OXIA 3CUKA 4RPLA 5JDIC 1XQ6A 1MV8A 4OAQA 3LYLA 2TMGA 3RFVA 3H2ZA 4S3MA 4YT2A 4IUYA 4IY1A 2OBNA 4NBWA 3OQ6A 4BO1A 3CTMA 3D0OA 4BHTA 3WSWA 1SZJG 1ZJZA 3Q0EA 1PJTA 2X86A 1XDWA 3L4BC 4R41A 3RD5A 5H82A 1ZXBA 2FSVA 4XRRA 4FIZA 3GGPA 1T4BA 5ER9A 3I83A 3K9QO 4HKTA 2J3KA 3M1AA 4Q3DA 1AE1A 1F8GA 4RDIA 4R3NA 1SPXA 1VJ1A 3DFUA 5G0VA 4NFHA 4BKQA 3Q11A 3G1UA 1AN9A 1NPTO 1U3UA 2JCXA 2B35A 2OZPA 2YV1A 2J6IA 2C0CA 3MCVA 1X15A 4L8VA 2OO5A 2UYYA 3TZ6A 5B4VA 1O8CA 2ZB7A 5AXBA 1QLJA 4Y98A 1X14A 2AQHA 4IJUA 3U4CA 5JFOA 3GQVA 1NNUA 1KEPA 4IDEA 4CR7A 1VL6A 2D1YA 2FR1A 2XF8A 5LC1A 2EV9A 6ADHA 4ZQBA 5C5IA 1A7KA 5EINA 3NGXA 3H5AA 4DLAA 4MVJG 4OMUA 3WLEA 3GNTA 2CFCA 1WMBA 3NT5A 1WZEA 1B8PA 3H9EO 4I9HA 4Z9XA 5U4QA 3KUXA 3ANMA 3BMQB 1MFPA 3ZCXA 3H6KA 1X1EA 3H3FA 1YVEI 4EYEA 3PTZA 3WYCA 3O9ZA 1N8KA 1R4NA 2DC1A 2UV8A 2P4HX 2VZ0A 3VZRA 4BMNA 2NTNA 1W6UA 3BMOA 4GBJA 1NAIA 4I08A 4UEKA 2YZ7A 2YHUA 4R1UA 1R4MA 4P4LA 1A4UA 4DLBA 3AM4A 3BHIA 3F47A 5BNFA 1H6CA 1XGKA 2PLAA 5T5QA 3BHJA 1SAYA 4ZRMA 2G82A 3AUSA 4I5GA 3LT1A 1IPFA 5G0SA 4PRKA 3JQ9C 1PJSA 4BNUA 4ILKA 1SCUA 2B36A 2HO5A 4JJGA 5LDGA 3KXDA 4W99A 2O23A 4IBOA 2HJSA 3HN7A 3PXXA 4KP7A 4D0RA 3MTGA 2P68A 5EERA 3NAQA 1LQTA 3VDQA 3GAFA 4DYVA 5KTKA 3ULKA 3HE3A 4RVSA 4E13A 4RORA 2WDZA 3TZHA 1LSOA 1P9LA 3QVTA 1H5QA 4BO5A 1H93A 2W2LA 1E1KA 2VWQA 3O8QA 4A2CA 4BO3A 3C1TA 2Q2VA 1C14A 4ZRNA 1ISFA 3GZNA 2AEFA 1Q0LA 4NH4A 4OHUA 1R16A 1DRUA 1QKIA 3S2IA 3ASUA 4WE3A 2O3QA 1DIAA 3ZN2A 5I7EA 1JKJA 1GZ3A 5CDGA 4OSOA 2Q45A 4OKIA 3EVTA 4I1IA 4DBVO 5ICSA 3H4VA 3KM0A 3W4KA 3DAPA 1CEQA 1CJCA 2X0NA 5C7LO 1GQQA 2JJYA 3OJEA 2PWZA 2HSDA 4TZTA 5CPBA 1DLJA 1NVMB 4CV1A 2EKPA 1E7MA 4PZEA 1LDBA 2I65A 1V6AA 3AOEC 4WCFC 1MC4A 4YCAA 3GHHA 1F0YA 2VCYA 1PS0A 1YL6A 3JQFC 2QZ9A 1HT0A 5FI5A 1E3EA 2EW8A 1U8XX 1XCBA 3VDRA 3JD3A 4J1TA 4BV8A 2CUKA 2VRCA 2AG5A 1GADO 2BFAA 4RDHA 4D79A 2PK3A 1DAOA 3NDIA 2WM3A 3KOUA 4GKBA 4DBZA 4H16A 4L4SA 2P5YA 1EUZA 4JJFA 3AM3A 3UAGA 3GH3A 5AOVA 2W2LD 3HB5X 4J0EA 2UAGA 2FHSA 4EGFA 4ZQFA 3WQSB 4HNHA 4PG6A 3BMNA 5C37A 4BNIA 1KVQA 2NTVA 1K6JA 3RJ5A 3F4LA 4NK4A 4BKRA 3GAZA 3H2SA 3GDFA 1P1HA 3WGZA 2JD1A 1YDEA 1P77A 3KV3O 4HP8A 4MVJF 4YQYA 2C29D 3U3XA 2GCGA 2YQ5A 4Q39A 1RJWA 5JMWA 1JDJA 4UUOA 2PH3A 4WLVA 5B12A 3WGOA 1BDMA 1HDXA 1X0XA 3D4NA 4D3SA 3L07A 1GZ4A 4BQRA 1ML3A 2IXAA 4DC1A 3MWDB 3UCXA 3DHYA 5DP2A 1Q1NA 2IYPA 1ZK0A 2O4CA 1S6YA 4AICA 3DZJA 1ONNA 1IB6A 4FD3A 4PLYA 5DN9A 2ZYGA 1P44A 5IZCA 4FQ8A 4ALKA 4B4UA 4CM7A 2VRCD 4U6QA 4DQXA 1HZJA 5AXDA 4LISA 1UP4A 3B1FA 4D45A 2O3JA 3S2FA 4YAKA 5F1OA 1Z73A 4TKLA 5BT9A 1I10A 1U4OA 4H15A 3RC9A 4KTVE 2YUTA 4B3IA 1KC3A 3MJVA 3QQPA 1DEHA 5C7OO 3GDOA 2FPPA 3FWZA 3EYWA 1RM4A 3RCBA 3TL2A 1XG5A 4IQ8A 4YRAA 3LF1A 1TEHA 2XXJA 3JQCA 4XGNA 4BOYA 3PWZA 4N7RA 4FB5A 5HWSA 2FR8A 2ZQZA 3E1KA 4IS2A 2Q3EA 1K0UA 4XGIA 1UZNA 4LMPA 3GY0A 4BNVA 2VYNA 2WMDA 2B37A 5C3MA 1U4SA 5G2OA 2NU8A 2GNAA 2DUUA 1BW9B 3CIFA 3DFZA 4NJMA 2NUAA 4TZKA 4I9UA 4XR9A 2FPGA 2EXXA 1KY4A 2DFDA 4PIVA 3I9MA 4EW6A 5BNTA 1KYQA 5I8ZA 1PQWA 2WYUA 1R66A 2IZZA 3DBLB 1LNQA 2X7HA 4WASA 1ADBA 3SLGA 3VHRA 2RAFA 3DBRA 3OIDA 1AHHA 3OHSX 1NVGA 1ZSYA 2YYYA 3D1LA 2O3RA 3NDJA 4GX2A 2RHRA 4LW8A 4XIYA 4BNZA 4CMEA 1PX0A 1BWSA 3CH6A 1YGYA 4R1NA 3RBXA 4DMMA 4YYZA 2DBVO 1YOVB 1F12A 4K6FA 2VWHA 3CKYA 3RBVA 2J5QA 1LI4A 3OA2A 4NMHA 3KEQA 3AJRA 4L74A 3FTNA 3NRCA 4YJFB 3MJ4A 4R5HA 2NVBA 4DPLA 3KETA 4WCFB 1SB9A 2NACA 4GX1A 3RAJA 1BG6A 1YH3A 2B5WA 1I2BA 2Y0CA 1WWKA 2ZATA 1E7QA 2C2YA 4B4OA 3BMCA 4OOEA 4XYGA 1VLLA 3SX2A 4DUPA 3U9LA 1B3RA 4ND2A 5I8WA 2AQKA 4NK5A 4EUFA 1P74A 1UH5A 1UZLA 1ZVMA 3GN2A 4A73A 4B8ZA 4CMHA 1QV6A 1UR5A 3MJSA 1EVIA 2GZ2A 4JCOA 3I9KA 3ZU4A 2A35A 4C7JA 3NKLA 2QW8A 4FJ1A 2Y1CA 3KO8A 1PS9A 5DCWA 3SLKA 5JAMA 1ZK4A 4QX6A 3GNQA 3RROA 4CR8A 4YR9A 1EE2A 1XU7A 1YJQA 2YHIA 4E5KA 2PZLA 3RUHA 4J0FA 3ZWXA 3ZWWA 2P91A 3ENKA 1HLDA 4JBHA 4J91A 1D1TA 4DIOA 2G5CA 3MTJA 3PDJA 1ZW1A 2IRWA 3DB2A 4BGVA 1BXKA 2ZTMA 3AM5A 4QECA 1Z74A 3TOXA 1JAYA 4PCVA 1EQ2A 4P22A 3GC6A 4F6CA 2Y1FA 4FC6A 1U3VA 2GN8A 4PLGA 1UUFA 2CVQA 2UVDA 3A4VA 4I8XA 3FBGA 5H83A 1NPYA 1PWXA 1XSEA 4O6VA 1GQ2A 2PD4A 3OQ1A 4PLPA 3GF4A 3DHNA 2ZYAA 3R1IA 2OL4A 3AWDA 1NBOA 3T7EA 4RPKA 4TKMA 3QV1A 4E32A 3HQ4O 4Q3EA 2R6JA 2ZB8A 3UF0A 1F17A 4KQWA 4MIYA 1IOLA 4L0QA 1NR1A 4HWKA 3GPIA 2BFMA 3PZBA 3ZNQA 1HRDA 3ZNOA 4AJPA 5IG2A 3DOJA 5JSFA 4MINA 1EVYA 3LU1A 3MJTA 1H6AA 3FI9A 4OIMA 3V2UA 4YVFA 5JXWA 2VNAA 4JX8A 3RVDA 3JQGA 4NBRA 3I9LA 3KEOA 3A28A 1MC5A 3WR5A 3ZV6A 4GLOA 4DGSA 2WD7B 3WTBA 4J43A 1ZKMA 5JLAA 3H9UA 2EW2A 4XA8A 7MDHA 3IJPA 3HUDA 3ROKA 1SBYA 1GCOA 4CLRA 3OICA 5L4LA 4LGVA 4MPDA 1UAGA 3AY3A 3HWRA 3QJ5A 1QV7A 1YQXA 3PQFA 4XYMA 4NHEA 4NPCA 4CUJA 5JDCA 1OC4A 4WCDA 2E4AA 1B16A 4JGBA 3JYPA 4CJXA 4A03A 1TLTA 1QYVA 3EMKA 1NTOA 2EF1A 3HADA 4FN4A 1DJNA 1P33A 4Z0TA 5U9CA 1HSZA 3TRIA 2E82A 1H0KA 5EL0A 3WGGA 1IE3A 1B3BA 1ORRA 3OJFA 4O5OA 5HM8A 4JLWA 2GR9A 1ZIDA 2JL1A 3ITKA 3WLFA 1NQOA 3DC2A 1PGNA 1DIHA 3WIDA 1HDOA 3HZZA 1PL8A 2PTGA 1LLDA 2HMVA 2WE7A 2WYWA 1E3IA 1M6WA 2ZK7A 3EDMA 1UXJA 4FOOA 4R3WA 3KSZO 9LDBA 2PNFA 4F3YA 4NU5A 3UFXA 3ZWPA 2I6TA 2J3JA 2PA3A 1DDOA 3LC2O 1E0DA 4BNJA 2HLPA 2VT2A 2XAAA 4L4XA 5A9TA 4DIBA 4ZJUA 4TRNA 4JBIA 4X54A 4P4GA 1C1DA 1NHGA 4XYEA 5TT1A 3RKRA 3G1TA 5GMOA 4Z9FA 4I5EA 3PZRA 4Q3AA 1GD1O 4AJEA 3O4RA 2B4RO 2P4QA 4FGWA 4FS3A 2F1KA 3V2HA 3FR7A 4II2A 5TGDA 4K28A 4MKZA 1U7TA 3OECA 4MIOA 1N92A 1QYDA 1Y8RB 4JK3A 3CMCO 4BO0A 3GG2A 1V3VA 2AEMA 1DHTA 2ZKLA 1KETA 1Y6JA 4CMJA 2D2IA 5H81A 1PIWA 2GF2A 4WK6A 4FFRA 4YTEA 1LJ8A 4J1SA 4D3FA 5JW6A 3OETA 3I6IA 3ZWYA 4UVDA 3DBLA 1QP8A 2Y66A 5A9SB 1YKFA 2GERA 1PZGA 4H7PA 4D46A 2VT3A 1P1KA 1PR9A 2BFPA 3UVEA 1PJLA 2P5UA 4A7PA 4XRGA 4CQMB 3Q2IA 3Q1LA 3NGLA 1LEHA 4CM4B 1A5ZA 2C5EA 2OBYA 2UUPA 2SCUA 3HB4X 1YWGO 2Z1MA 1R0LA 3JV7A 4OXNA 3C24A 3I52A 5L9AA 2QRJA 5CPFA 3FTPA 2B0JA 3RC2A 3ZWMA 5LDHA 1UDBA 4XYLA 4RLHA 4BO9A 2O50A 4YJFA 4IGFA 1R0SA 3LT4A 1YRLA 4LRTB 1NWCA 1J6UA 1DJQA 3B1KA 2VWGA 4QQRA 5HTOA 1UXKA 1C0IA 3TNLA 5JY1A 3C8MA 1NQAO 4BO6A 2D3TA 2VUSA 3LT2A 2NQ8A 2ZCVA 3RUAA 5A3JA 2PD6A 2OORA 3ZU3A 4PZDA 4J1NA 3JD4A 1LC3A 3F4BA 3ZH2A 4GGPA 5L4SA 4BMSA 3N74A 1NR7A 1VJ0A 4IDAA 5KJFA 3U62A 3DQPA 2VNSA 4WNCA 5AXCA 3EUWA 3ONDA 3PQEA 5CEJA 1MP0A 3CZRA 3A14A 1KY5A 3AI3A 1ONOA 2IEDA 1E3JA 2WTBA 3GGGA 3TN7A 1GV1A 3RUCA 4FSHA 3P19A 4M89A 1ADFA 2VN8A 3DZHA 4NZ9A 4BUCA 3KVOA 5IDQA 2AE2A 2O7SA 2VHZA 1M6HA 1UDAA 3DMTA 3ANNA 3GK3A 4MVJM 4AG3A 4JNKA 4Z6KA 1Y81A 1I3KA 1X0VA 2FY8A 2CVZA 1X1TA 1H94A 4BB6A 1ZFNA 4DPKA 4N5NA 3FNEA 3W6UA 4BMVA 4CL3A 3INRA 3CXRA 1I24A 4U6SA 1GDHA 1UDCA 1LXCA 3R3SA 2X0IA 3QVOA 4NNJA 1P3DA 2HUNA 3WQQA 2EHDA 2LDBA 3JYNA 3BYZA 3LSYA 5DBFA 1E92A 2Y0DA 3D4PA 4AFNA 3RFTA 4UVIA 1YDWA 4A27A 4AJ4A 4MDHA 4RJTA 3QLJA 2DTDA 2RH4A 3CSDA 3QE3A 5T64A 2RIRA 1IYZA 5AXAA 1TT5B 3PJGA 6LDHA 2Q4EA 2QRLA 4JJIA 3ADOA 1L1FA 4P8RA 2VWPA 5HBRA 2DBZA 5IJZA 3C1OA 3KBOA 1NX6A 4W4TA 1AGNA 4CMIA 3DDNA 3PDUA 3WYBA 4DC0A 3I5MA 3JYOA 2WD7A 1SEVA 1LDNA 3DZIA 4LSWA 1ENOA 4J90A 4AVYA 4PVDA 2JCVA 3H9QA 4R5MA 2FSSA 4D42A 1GZ6A 4HADA 4N18A 4ALIA 1AUPA 3M6IA 3K5PA 4PLCA 2OOSA 1ZEMA 1ZH8A 4OQYA 3WMXA 1E1NA 1PJQA 2GZ1A 4EI2A 1G6KA 4HV4A 4MIEA 1FDUA 1QR6A 3WYEA 3INTA 3W8EA 3QWIA 3QVXA 1Z45A 4YAEA 4CM8B 1BXGB 4A10A 1H6BA 1VL0A 3JYQA 1BDBA 3ORFA 4CM5A 2GDZA 3JQBA 5CDSA 2GN4A 4M54A 4EITA 2EGHA 4XQCA 4TMFA 4HFMA 3H9GA 3ITDA 3H9JA 4K9DA 1KEWA 5KVQA 3GRKA 1ZEJA 4AJLA 4HUJA 3L9XA 4HFJA 2JKVA 1LSUA 2CMDA 3WMWA 3JQ6A 4W82A 1DFHA 1I3NA 3OH8A 2AG8A 1EEHA 1K6IA 2EP5A 1HE3A 3JSAA 3WX0A 4OKNA 2OP1A 4YJDA 1ISJA 3TWOA 3AU9A 3R0IA 4Q9NA 1FDVA 4U8GA 5CP8A 1O95A 2IODA 3VH3A 3ZWCA 4BV9A 1E3WB 1ZCJA 1XU9A 4OJNA 2LDXA 2Q1UA 3AK4A 3DOCA 3DZBA 3E6AA 4EJ0A 1NWHA 4IDFA 4WOKA 3GPDG 3RC1A 1E7SA 4XEHA 1IHYA 2V6BA 3W6ZA 3KSDO 4QXMA 2ET6A 1DLIA 3FD8A 2RH8A 3FN4A 4IM7A 3CZMA 4JN6B 5TRTA 4CR6A 5A04A 9LDTA 1S7CA 1FXSA 3AUAA 1RKXA 2QRKA 1VI2A 4XDYA 2DQ4A 1YXMA 5IDWA 3A06A 4GAEA 3F1LA 1O9BA 3TF5A 3ZI0A 4BNGA 5L53A 4GSKA 8ADHA 2B69A 2I67A 1DC4A 4G81A 4D44A 4H3VA 3DBHB 4J7XA 3VH1A 2DU8A 1Y8RA 2POQX 4CMCA 2P9CA 5G4KB 5FF9A 4CLDA 2E49A 1E7YA 4IIVA 1P45A 4DXHA 4HNGA 1U8FO 3E9QA 4GQAA 3C1AA 1EVJA 2DAPA 1Q7BA 1NM5A 2PZKA 2Q2QA 2PGLA 5A06A 1NYTA 4FGSA 3C3XA 2HK7A 3PLRA 1CETA 1I30A 4XJTA 4YJHB 4CLHA 2EJWA 2NNLD 4GX5A 4E0BA 1HETA 3BZUA 1U2GA 1ZZEA 2D8AA 1C1XB 2YDXA 2NU6A 4FFLA 4IZHA 4B7CA 4ZGWA 5A9SA 4A0SA 4RPJA 1NXQA 3WFIA 1CERA 2GN6A 2Y67A 1HE2A 4YEDA 3F6YA 4WPGA 4PG5A 4CM4A 3HDJA 2AA3A 3ZNNA 4UREA 1ZUD1 4YACA 2PH5A 3WXBA 4UVGA 1GTMA 2ZTUA 5L3ZA 3DHEA 2HRZA 3OFSA 5ITVA 1ZBQA 4AJ2A 4URFA 5HA5A 5IZ4A 2I76A 2ZB3A 5GZ6A 5BSEA 2Y1EA 1VKOA 2VUUA 4AJ1A 1N9GA 5K6AA 3UXYA 2DT5A 2C20A 4AJIA 4B3HA 4E4YA 1D8AA 2PY6A 3IP3A 1YBMA 1P1JA 4E12A 1W4ZA 3JQAB 2RCYA 2R00C 1E5LA 2EGGA 1VM6A 4BNLA 3NDRA 1AXEA 1R15A 5BNIA 3L6OO 1I2ZA 1JU9A 2NU9A 1GFSA 3PP8A 3V2GA 4GLLA 1NFQA 2D5CA 4DVJA 4YRDA 1T4DA 2VOEA 4ZQEA 3DAGA 4NBVA 1Y7TA 5KVSA 2Z1NA 3PEFA 4WGGA 5A1TA 1SNYA 3TDKA 1GU7A 2NVWA 4TVOA 1J4AA 1X7HA 3IKTA 1KVTA 1FJHA 2UUOA 2I99A 1Q7GA 4KTTE 1EE9A 4ZVVA 1A72A 3ETDA 1DIGA 4IQ0A 2D5AA 3UH1A 1LLUA 1JAXA 1LBEA 4JBGA 2HMTA 3HSKA 4LCEA 5F1KA 4YRBA 4MP3A 2W2KA 1YBAA 5IDXA 1M67A 3ZGYA 2BELA 5L45A 1QYXA 3VZQA 3I1JA 1PJBA 2J3HA 2JD2A 1FMCA 4GMGA 3NYWA 3DO5A 5ENDA 1UP6A 2JFFA 1P0FA 4GGOA 5THKA 4ZN6A 3D5TA 2YDYA 3MJEA 3JQEA 2Q99A 3MOGA 3W4IA 4Y6SA 4DLLA 1ZK2A 4DREA 3FR8A 2GGSA 2EP7A 1I8TA 4OL9A 1V9LA 3WFJA 1DRVA 1LRKA 1FDSA 1TT5A 5ITWA 5I7FA 3OBBA 1PL7A 1DO8A 1UXIA 2X5OA 4OSPA 5KKAA 4BGIA 4DWVA 1RPNA 3L0DA 3WS7A 2JD0A 4DQUA 3KRTA 1EDOA 1BVUA 1DC3A 4ZICA 3GUYA 1FK8A 1TT7A 3AY6A 1JWAB 3I3OA 3FBTA 5CEFA 4ROSA 1EFKA 1EBUA 3H7AA 4IJVA 3SC6A 3QWAA 1VSUA 3IMFA 3VZSA 3PWKA 1HDCA 4E5MA 3ZHXA 4KWIA 3W4JA 1Q2XA 2GRAA 5BSHA 2X9VA 3PYMA 2IYOA 4R51A 2VHVA 2AXQA 4EUEA 2EEZA 2J5KA 4J3FA 4Z3DA 1KOLA 1PZFA 2H5LA 1PSDA 5T67A 1W8DA 4BO7A 3TSCA 2CF6A 3U0BA 3W1VA 4CM6A 5DDIP 4CUZA 2VYVA 1EFLA 1HSOA 4J4HA 4W9NA 5T57A 1T24A 1V8BA 2NVUB 3WQRA 5BR7A 3IJRA 4EEXA 2DPHA 1D3AA 4HY3A 4MVJA 2G0TA 1JTVA 1XA0A 3L4SO 4IQGA 3WGTA 4XZ3A 4WNIA 4BIIA 5AVOA 3FRJA 2AW5A 2C5AA 1DPGA 3AW9A 4FJ2A 4CLOB 2A4KA 4Q3NA 4GVXA 1HWYA 3IUSA 4L9RA 2PFGA 2Y0EA 4J2OA 4G2NA 4QSMA 1WZIA 1HE5A 3E5MA 3ZW8A 1KVRA 1TI7A 1QSGA 2P9EA 1PGOA 5DOZA 1WNTA 2BD0A 1EZ4A 2OFPA 5DCUA 5T8KA 3BMQA 3EGOA 4YDRA 1DFGA 4IMPA 3MWEB 4BO4A 2JHFA 1MXHA 1ID1A 4YA6A 4BVAA 2W4QA 2XPCA 3B6ZA 4XCVA 3RWBA 1B2LA 1W73A 2O3UA 1LDGA 2QYTA 3PHJA 4YB8A 1SMKA 2PZJA 4ZQGA 5A4DA 4Y6RA 3BHMA 4TROA 1VRWA 2AQ8A 4GX0A 5C7IO 3GDGA 3ZU5A 3SXPA 4R69A 3KB6A 3ICCA 3OIGA 4LCJA 4JIGA 3CE6A 2JAHA 2CD9A 2VHXA 3DBHA 3CPSA 5TQVA 4RLSA 2VYVD 3SJUA 4FOSA 8LDHA 3ASVA 3AUUA 5L7TA 4MVJD 1BVRA 3ZHYA 3ROPA 1VL8A 3OQBA 4QT0A 4BNYA 1WXDA 1ENPA 4YJHA 3QSGA 4AJOA 3F5SA 1HDRA 5U1PA 3P5SA 4GI2A 1A7AA 1U28A 3PWSA 2IDZA 1JN0A 1K3TA 1NAHA 2CDAA 3ZW9A 3H5RA 2DFVA 3I23A 3LF2A 5DBIA 5GY7A 1Y1PA 1R37A 3QWBA 3FF4A 2O3TA 4XD2A 2Q2WA 2J3IA 1C0KA 3QIVA 4Y8VA 5J23A 2EWMA 4FFPA 3KYCB 5JNLA 2E48A 3B20A 5KJCA 3EY4A 1KEUA 4EZBA 4E3ZA 2RBEA 3L77A 2I9PA 4WLNA 3H65A 2FR0A 5IAAA 4BO2A 1U9JA 5CEEA 1I32A 3AFNA 4RQUA 5JDIA 1MXFA 4KUEA 4E5NA 1LDYA 3GOHA 1WLYA 4RF5A 1V0JA 3WGHA 3EAGA 1PU2A 2X58A 4AJJA 3WWZA 3JQAA 3C7CB 4FFOA 4YT8A 3LDHA 2X8LA 3GMSA 5FWNA 5IN5A 4ALLA 1JWBB 3H5NA 3OJOA 5IDYA 2J8ZA 4J7UA 1Y5RA 5KOIA 2HMWA 1IHXA 5JE8A 3L4BA 2CDCA 2CNBA 1BXZA 4EUHA 3RSHA 1LDEA 2C59A 2P9GA 4MKRA 4WUVA 1K2WA 3INGA 4XWYA 1G1AA 1MG0A 3I6QA 3OP4A 3VH2A 5IXYA 4RPHA 5TF4A 4CMAA 3ST7A 3PJEA 4BQPA 5A05A 3RJ9A 3TJRA 4E30A 1DRWA 2PD3A 3K2EA 4HFNA 2B5VA 1HZZA 1U7HA 5MGBA 5DZSA 4U0JA 3FSRA 3GUCA 3FNHA 4D43A 1P1IA 3ONFA 4JXKA 3Q3CA 5KJ1A 1Z75A 1VSVA 1Z6ZA 4OXKA 4PFJA 3S2EA 2G1UA 4OM8A 1Z7EA 4DRYA 1I5RA 4TRMA 3VOSA 3IOYA 4PLWA 3UOGA 3BIOA 1LRJA 4R16A 2D4AA 1QYCA 1CYDA 1RM3A 3E48A 1H9BA 4UUNA 1OFGA 3NTOA 4RV9A 4IINA 4O63O 5DOVA 1GPJA 1SOVA 2C2XA 5I9MA 1Q0HA 2VZ8A 3ADPA 3PVZA 3JQAD 2G76A 4IPTA 3BA1A 2C7VA 2V6GA 3LC1O 2HJRA 3OIFA 2OGUA 5EIOA 3BTOA 1ZXLA 3GA0A 1AHIA 3IQDB 3IIEA 4N5MA 5CG2A 1PJCA 4KUHA 1EDZA 1OBFO 5THQA 3NV9A 1YB5A 2H63A 2YJZA 4KOAA 4UVEA 3WGYA 3OJLA 3GEGA 3PHGA 3WNQA 3UGKA 4NG5A 4NFSA 3IDSA 2DBQA 4CLEA 5KCZA 3HNPA 3RASA 4BGEA 2X22A 2QHXA 5TSDA 3JCZA 4PLHA 3NT2A 5TIIA 1NPDA 3JQ9A 5L7YA 3RI3A 1LX6A 1GEGA 1OOEA 3I9OA 1LSJA 1HL3A 5JYDA 1EK5A 3I4FA 5K0ZA 4S1VA 3IL2A 4RF4A 2HRBA 1X13A 5K9ZA 2GZ3A 4J4TA 1A4IA 1AXGA 2G17A 5A5EA 2RHCA 2C82A 3T4EA 1T25A 5F3RA 1B7GO 5CDTA 1BW9A 1RYDA 5IZCC 1VJTA 5TC4A 1Y9AA 5B4UA 4OQZA 1DAPA 2BI8A 1Q0QA 4RZIA 1WVGA 3OF2A 3BMOB 2GO1A 2I3GA 2WEKA 2O48X 4IDBA 4R4JA 1B26A 1JA9A 4XQGA 2BKAA 3V5NA 4WLEA 3ON5A 2QZZA 1O94A 2C54A 2CSUA 2CDBA 3DZGA 1XYGA 4TSKA 5JBIA 3I9JA 1PEDA 2PV7A 1YL5A 5I7SA 5JY6A 3LLSA 1GYQA 3VPHA 1Q7CA 4W7IA 4UEOA 4AJNA 4F45A 1YBVA 2HAEA 2Y99A 3PFWO 4FW8A 1JKFA 1YB4A 3LZ6A 3UICA 1YOVA 1E77A 2Q49A 3GHYA 4C4OA 4IXWA 1YL7A 1LC0A 4YT4A 3GVPA 4I5FA 1CQJA 3HHPA 4CLXA 3ZHZA 4ZU3A 1E5QA 2DBRA 2QQ5A 5A03A 5KJ6A 5CFZA 3UCFA 3AOEA 4WCFA 1B8UA 1IY8A 3U4IA 2PGDA 3JQFA 1LSSA 4BS9A 4OXYA 1KIFA 1D4FA 3WJ7A 1PL6A 4RVDA 4B7XA 5KJEA 1NQTA 3PYLA 1ENZA 1YB1A 4HBGA 4AL4A 3PI7A 7ADHA 3PHHA 3MJCA 4J16A 4E2YA 5HRUA 3JD2A 4CMEC 3KTDA 5CDYA 2PKRA 1ZK1A 4BNNA 3FHLA 4U7WA 3U49A 4NU6A 1VC2A 4PLVA 5DT9A 4YT5A 5IF3A 3N7UA 3AUTA 3GZ4A 2ZTVA 5EQFA 3I4CA 3QW2A 4W7HA 5COAA 4Y6PA 2H6EA 1PZHA 1Z7BA 3PGXA 4CM3A 2VTDA 1E3SA 1DB3A 1HYHA 1SEPA 4MO2A 3KZVA 4II3A 2BI7A 3RUDA 1JQBA 3IKVA 1M2WA 4ZA2A 1XHLA 3TZCA 5TNXA 2CY0A 1NASA 3EK2A 5F21A 4IDDA 5BSFA 1MX3A 1MG5A 3VVBA 4B3JA 4YPOA 3V1YA 4XR4A 1X7DA 4NBTA 1VKNA 4E5YA 1J0XO 3EZLA 4EDFA 1XLTA 1L7EA 2F00A 3UCEA 1KEVA 1M76A 1R0KA 1HDZA 3F9IA 1F14A 1YJ8A 3BMNB 1E1MA 1BRMA 1QYWA 3OA0A 4PG4A 3TOZA 1TXGA 5CAEA 1ARZA 4YWJA 1P1FA 2QG4A 4YBZA 2C07A 1DOHA 1XIVA 2E6UX 3NT4A 3K6JA 3A1NA 1HDGO 5JO0A 1EK6A 3IAHA 5G0TA 4KDFA 3O38A 2JCYA 4WLOA 3DZFA 1OI7A 3EHEA 4WEOA 3JQDA 3LQFA 2D0IA 4ITUA 3DTYA 5EMHA 4F46A 2DTEA 2VTEA 3O03A 3JQ8B 4BB5A 5L40A 3DAFA 4J7CA 4TWRA 1PGJA 1H2HA 4OGWA 4RL6A 5EPOA 2OMEA 2HK9A 1I33A 1G0OA 4LRSB 2PKQP 1PS8A 1DIBA 4BKOA 1YO6A 3V8BA 4BNFA 1EUDA 2W98A 3NJ4A 4UEJA 4YXFA 1PR3A 3F1KA 5F5NA 4XJSA 3VPFA 3D3WB 1QLHA 3PYXA 1P0CA 2Q1SA 3FPCA 1U5CA 3WBFA 4UULA 5GZ1A 3AY7A 2FPIA 5FFFA 3VPSA 1N5DA 3CINA 5ILGA 4D0SA 4K6CA 3PFFA 3RIHA 1RM0A 4ONEA 3KYDB 4PGFA 2ZJ1A 3V1TC 3D64A 1NFFA 4WKGA 5DP1A 4G5HA 3TZQA 5IFLA 2HCTA 2YV2A 4RZHA 4IIUA 1T1RA 5JCJA 5JS6A 3LLVA 5L7WA 4NJMB 1NFRA 3D3EA 4FC7A 5TLSA 1O89A 4J49A 4N54A 1OC2A 1RWBA 5JAIA 3DL2A 3OEYA 3TQHA 2W8ZA 1PJ3A 3GVIA 5JDCC 3P2OA 1V3TA 5CHEA 3X2EA 4OH1A 2OUIA 4LVUA 5A5FA 3D7LA 3DBRB 1IPEA 1BSVA 1CWUA 3HFGA 3QHAA 4XYBA 3DBVO 3PK0A 4FBGA 3SEFA 3F3SA 4RVHA 4QEDA 1FDWA 4CM1A 1VPDA 3GVXA 1HXHA 3OJ0A 4B4VA 3NTRA 1PTJA 2X0JA 5KVVA 4PLTA 2IEBA 3HFSA 3NUGA 5KNLA 3VTZA 5BQFA 1GYRA 4PRLA 1R12A 3VKUA 3ZDFA 3L6EA 3DMYA 3BMCB 2GD1O 2HQ1A 3S2GA 3M1LA 3K2BA 3HDQA 3IS3A 2V7PA 4R9SA 3UKOA 2BLLA 1MUUA 4IGEA 4UVHA 1PJ2A 3A9WA 2GSDA 3OMLA 4WLUA 3GFBA 5JCJD 5B4TA 4E31A 1Y8QB 3PRJA 1EUCA 2PKQO 4FFMA 1E7RA 2Y93A 1K5HA 3ZWAA 1N2SA 3PJFA 2ILTA 1IZ0A 1ZNQO 2JFHA 2YQ4A 4PZCA 1OAAA 4CQMA 1GUZA 3JQ7B 4ZHSA 2Z95A 4KQXA 4ALNA 1KERA 3U4HA 1E6EA 4E2XA 1BMDA 2YHIB 5KIAA 3PIDA 2QIOA 3LVFO 1B14A 4XIJA 2WE8A 1CRWG 4NJOA 3D5QA 4BNXA 3JD0A 4Z0HO 2NM0A 4KWHA 1JLLA 1WPQA 4J9VA 1XEAA 4AJKA 5L4NA 1I3MA 3FNFA 1DSSG 4O1MA 5DBGA 3E18A 4Z0PA 4XDZA 4XKJA 4RVFA 4BKPA 3PQDA 1E6WA 5T6BA 3RFXA 4EJMA 5DULA 2VRBA 2H1SA 4CUKA 2HK8A 1PWZA 4UAGA 2EKQA 3GN1A 3N58A 2NU7A 3BTUA 4XX0A 4Y67A 3ZV3A 1U2DA 2VQ3A 4IZIA 4OYRA 4Z9YA 3QWHA 2VUTA 3KYBA 1XKQA 3AOGA 5DF1A 3WG9A 1SB8A 3G79A 1H9AA 2FOIA 3GVCA 1H6DA 1WDKA 3AFMA 5AQ1A 3E8XA 3T4XA 4TVBA 3ZWVA 3DWFA 3PIIA 4IS3A 5JPIA 1E3LA 4DMLA 4CQMD 1OMOA 4D3DA 4XB1A 1ZK3A 5BSGA 4CL8A 2ZB4A 3EW7A 2AQIA 2ZQYA 3HDHA 3DR3A 3JQGB 2VHWA 1F06A 3DXFA 1NHWA 2O2SA 1HDYA 2AHRA 4E2ZA 4JQCA 2H9IA 2GPTA 1YS4A 4DA9A 4E2WA 4E5PA 2I66A 1LA2A 1W0CA 1Y5MA 2BGKA 4HX5A 4A26A 1CQIA 1BTOA 1ENYA 4CLRB 3VVCA 4J4BA 1GQYA 2BHLA 1DIRA 1N1EA 2BGMA 1FF9A 5EJ2A 2Y1GA 2Q4BA 4K26A 4QO7A 2GN9A 3FNGA 3SC4A 4IJWA 5CDUA 4CODB 1ZMOA 4GKVA 1TB4A 1GEEA 3RQSA 2Y1OA 3GLQA 3IP1A 3GFGA 1C0PA 3B1JA 3IC5A 5G0UA 3WNVA 3WWYA 1ONPA 3ONEA 2X23A 4MJLA 1U3TA 1DC5A 5I9LA 4ESOA 3WGQA 1LUAA 5AYVA 4E21A 4JP3A 1EBFA 1MLDA 4QUKA 3V1UA 1IZ9A 1Z82A 3DMTC 4FJ0A 1ADGA 1HEUA 5G4LA 5GZ3A 2DUWA 4QO8A 1X7GA 4C7KA 4EEZA 3JYLA 3AU8A 4YJGB 1CF2O 3JQ8A 3K73O 5FEUA 2I3AA 2WWRA 4CV0A 3PHIA 1GPDG 5A02A 4LK3A 4WEQA 2BMAA 3GEDA 3E9NA 3LK7A 3E9MA 4W6ZA 5ILOA 1MFZA 2W90A 3RUIA 4OO3A 3SVTA 4B7UA 4CM8A 3D3WA 1BXGA 2WD8A 3BXXA 3GEMA 3PGJA 4Q3CA 4M86A 3QA9A 1T2CA 4BNHA 2JFGA 5L51A 1KBZA 3K92A 4LSMA 4WOJA 1C1DB 3WIEA 1WDMA 5FI3A 3TFOA 3S55A 1ZSNA 3KYDA 5G0WA 4P4NA 1CIVA 1KVSA 3F5QA 2A9FA 1YQDA 2E37A 1KVUA 3R3JA 3UN1A 2VOJA 1LQUA 2FMUA 2DM6A 1DHRA 4R01A 4WECA 4PN3A 3VKVA 5IN4A 2XOXA 2B4TO 1UAYA 1UXHA 4M87A 2EG9A 4DQVA 2NQTA 4N5LA 1JVSA 1JVBA 1B15A 1E3WA 3HN2A 3NEPX 4M49A 3ZV4A 2BFOA 2XXBA 1MB4A 1IUKA 1V35A 4MVJE 1EVZA 3S1LA 5KWEA 5KKCA 1KS9A 4M55A 2FN7A 3DZKA 4BNTA 5ICMA 1QG6A 2CVOA 1WP4A 3JQBC 1B8VA 1O6ZA 3SJ7A 4CMKA 1DC6A 3EVNA 2DTXA 2V6MA 4B8WA 1H2BA 4RF2A 5TJ9A 4U0KA 1ZJYA 3M2TA 4A5OA 1HKUA 4CMBA 2YFQA 3ZWOA 1J5PA 5ENVA 4CQLB 1N7GA 3RC7A 3DOOA 4RGBA 5L95A 3P2YA 1V3UA 4J2HA 5A9RA 5DNAA 3BTSA 5G4KA 1N7HA 5IXSA 1PJ4A 3MOIA 3ENNA 4NIMA 1M75A 1HLPA 4ND4A 5EQDA 4ND5A 2VYND 1ULUA 1IULA 1A9YA 1G0NA 1GL3A 4K1LA 2AE1A 4R9RA 1UXGA 4PLZA 2HDHA 1Y8QA 1C1XA
chains in the Genus database with same CATH superfamily
1D5CA 3G02A 5F51A 4YP7A 5FB3A 2IZ0A 1N2CE 4LDAA 4NI5A 2GKGA 1G20A 3E82A 1UKBA 1SOWA 2J4FA 2JCBA 1Y37A 3DULA 4PYNA 5DKFA 5JEDA 1IXZA 1A71A 1T2FA 1Z4JA 1JAHA 4U9IS 4O5AA 3GNSA 1KI6A 4OHMA 4GWGA 3LP5A 3PPIA 4NFYA 4Q19A 3KSRA 4JROA 2BWJA 1GARA 3JD1A 2DFTA 5J47A 1GY8A 2XIQA 5MFPA 3U81A 1CUAA 4GWLA 3CKMA 3QI2A 2J9FB 3VU8A 1RYEA 3H1FA 1G3QA 2YCLA 3VHXB 1ES9A 1QRAA 2EDCA 3B9RA 1FNNA 1HT3A 4D7AA 1RT9A 2EKBA 4IJKA 3TVDA 3K53A 3W5AA 1G20E 2XMCA 1DUIA 1G3MA 3DBOB 7MHTA 4DA8A 2MYPA 1Z17A 2E4UA 1NM5C 1XEXB 4P84A 4P5PA 4Y9TA 3BRWD 2ENUA 1RPTA 3S28A 2JHGA 2DSNA 5KCMA 3ZI4A 2D5LA 2WINI 1HTBA 3B2NA 4M0FA 4ZCQA 3OF5A 4H35A 2ZWIA 3O1HB 4FR5A 3WK4A 3S8EA 2V6FA 1E63A 2BZSA 3CWQA 2ZJBA 1QDLB 3L6UA 4G8CA 1S02A 5EQTA 4DZZA 3FVTA 3WGNA 4NZOA 1PGPA 3D6FA 2FRDA 3QM1A 1F20A 4ZP1A 4Z4EA 1T5DX 3Q9LA 2II6A 2OPHA 4D3YA 2O4UX 1ZW6A 1XPRA 2EL7A 2ZFUA 1OWOA 1YMUA 5CFOA 2DF8A 2VHUA 3AR8A 1UDXA 4A0QA 4PY2A 4J6FA 1G59A 2IUYA 3V8PA 1YZNA 3MAGA 5ENZA 4X64B 2YX1A 1IXKA 3BE6A 3KQNA 3HJAA 1XZHA 4RUKA 2A2ZA 1O03A 2HADA 1AHPA 4HWRA 3RW9A 4BBAA 5EUCA 1K98A 2G8LA 2VH5R 5AWFC 1RE1A 4O4LF 1Y5IA 3H8VA 2I0FA 3V7NA 2XEDA 5D3KA 4DB2A 4L76A 1L8XA 2Q46A 2W9XA 4X1YA 1S3GA 3EVGA 5DLQC 5EKTA 4D57A 1E2HA 1GAEO 3O1JC 3PXAA 3LCCA 1G3UA 2FSFA 4NQZA 5FA5A 3ZKWA 4F60A 3LC7O 1Y4DE 1BE1A 3JZDA 4G1UC 3ETEA 3EDOA 2F3SA 1PYGA 3AEXA 3SN6A 1VMKA 5I6DA 1LLFA 5SYNA 3ZW7A 3I42A 4KXWA 3ROQA 3TL3A 4I46A 1K6XA 1SIUA 2Y68A 1CK4A 3CUEF 5KNCA 5KX5F 1Q6ZA 2WJPA 2ZJ3A 2PCLA 2ZBDA 3EEYA 4QTTB 3BB4A 5JAQA 1S9DA 4FI3F 4DCSA 4PAGA 4GH5A 4QTZA 5MDHA 1TA4A 2ACEA 1UZUA 3PL1A 4IDGA 4NY1A 3WK6A 1E2JA 5JAUA 2PLFA 3KHUA 3OX4A 4GZ6A 4KV7A 4ARUA 4B3XA 2X41A 3IPXA 5BY2A 1JNYA 3WBKA 3OZVA 4RENA 1N9ZA 2ZJOA 3CJQA 3VDNB 2ZJFA 4P7JA 4QXAA 1I01A 4JJAA 4HS9A 4RS3A 1ZCFA 4A92A 3GDHA 2A94A 1BKSB 2ZSBA 2HEIA 3G9TA 4Y1FA 5J4LA 4CM9A 3EH1A 2BKEA 4BNKA 2BGLA 1T5IA 4IIDA 3R6GA 3E61A 3HY3A 2OCIA 2WAXA 5HTKA 3IPCA 1W0JA 3HYTA 4RO0A 3D3QA 3VC7A 1PQPA 3G1WA 3VR5H 4NDNE 2CXPA 3HFRA 3OURA 2O0HA 1JJVA 3IIMA 4GL4A 3VTAA 5ALGA 1PQUA 4KAXA 4L73A 4RQBA 5HF5A 5ADHA 1ZO8A 5KQRA 3PJDA 5JXJA 2FZWA 1G4AE 1ZMXA 5LCXA 3P9PA 3DZ8A 4P7GA 2GZRA 2HIMA 3I1FA 1KDTA 2QDKA 3PCRB 1R8YA 3Q6NA 4ZOBA 3J81A 1IHUA 3KSBC 2QP4A 1VHDA 1MTZA 4ND7A 2PZMA 2PX3A 3FHCB 3L43A 4HDSA 3ZD7A 4I1SA 1S2NA 2GJSA 2H11A 2HMUA 4K2AA 3FWKA 3C5VA 4FD2A 2BM0A 4MRRA 1JPNA 4WKCA 4YP6A 4TS1A 4MJ7A 4ALMA 4KV9A 3KLMX 1I4LD 4URYR 1KSGA 4C4YA 4HR7A 5ES3A 2Q2OA 3HUFA 4TTAA 3EHDA 1QIKA 5J5AA 2EIHA 4MKXA 1G21A 2C7OA 3SE7A 2PUCA 3TECE 1KO1A 2W2QA 3WLHA 2FFHA 4PINA 5HKKA 3QEBZ 4YAIA 2G77B 1QM5A 3T95A 2BKXA 2EZ9A 3TD9A 5ADWA 2DYKA 3I6MA 2I4IA 1Q50A 4BQQA 4QDUA 5IMSA 1DKUA 3ZCVA 3AI1A 3K16A 4R1NA 1L0BA 4RVGA 3TQOA 3EEQA 1Z0UA 4I2NA 3K71B 3VH4A 2PUGA 3IV7A 5CLIA 4BQSA 3FETA 3NHPA 4R1TA 1W5FA 3OZSA 4BNWA 4INOA 2M2IA 2EZTA 2NU6B 3FWNA 3KDSE 2KX7A 4HZIA 4F7DA 1G21E 2BFEB 3DC7A 4GPD1 4M1QA 4ALJA 5EYPB 3MWEA 4BBZA 5KREA 1RJ9A 1APBA 4AU1A 4GWKA 3GZNB 1LRLA 1ZL0A 2QW0X 1T2EA 5AJUA 2YJNA 3Q2KA 2V7VA 1DBVO 4GZMA 3NO4A 2WUEA 1E6MA 2C9ZA 3DYBA 4DJAA 5TJHA 5SICE 3RSLA 1H0HA 3N1UA 2GO7A 1JKJB 1N1GA 2HWXA 3E03A 1CF9A 3N75A 4BJHB 3MMZA 5EJAA 2Z43A 3GCWA 4RKQA 1S8OA 5FL3A 4UTNA 3VTKA 1GPLA 3BXZA 1EX1A 2ZCUA 4JQYA 3FBWA 2OHXA 4CQLA 2JFQA 3UOWA 2X5JO 3HJTA 1P31A 2GTIA 2OYSA 3GLGB 1RMTA 1W19A 2X0RA 3GRPA 3TE7A 1GCAA 1OWNA 3OZTA 4JBXA 2BH9A 1A9OA 3CF4A 4TRRA 3JR7A 3PUXA 1LVHA 2NLOA 2NWQA 4EHJA 1HLGA 3LKBA 5SY4A 4OK3A 3JTMA 3O4VA 2ILVA 3T0GA 3ZK8A 1FYWA 1UBGA 1ZAKA 1K4YA 3AKDA 3O4IA 1TM7E 3ABIA 3EG9A 2ZYTX 2L19A 4FNAA 3ZE0B 1RXSA 3MEQA 4QGBA 2D59A 1T2AA 4XB2A 4HPWA 3DNMA 5EP2A 3ABZA 1J0DA 2NZ8A 2ON6A 2NSJA 4XXHA 4BL5A 2GASA 2J5RA 4IIJA 4RESA 3U7HB 1EQUA 1J25A 2CJPA 2R8EA 2CJWB 2HPVA 2WIAA 2ZYDA 3AONB 1CUWA 3FAZA 1NSTA 3M81A 1KY3A 2P62A 1I0ZA 3LHSA 1R8QA 2VP5A 4PBRA 1Q83A 3SQOA 1RKQA 4RTJA 1EFHA 3KYCA 5JBNA 2VDJA 5JASA 2AUMA 2RD2A 1VCHA 4L9AA 1L4NA 4DXDA 3V8QA 3W2EA 2PGJA 1YACA 4ZDKA 1T2DA 2ASVA 5FUXA 5L3SA 1F5NA 5LQDA 2AW3A 2J0UB 2WG0A 3W8DA 2AYZA 4D25A 1YONA 2GXAA 1E2UA 4PAQA 2ONYA 3DV9A 4G0QA 3V8VA 3L4JA 2R65A 3DW1X 2DKNA 1XWFA 1KZYC 3C4JA 1FX0B 5K3AA 1T35A 3EVBA 2W2TA 3L8EA 4Z5XA 3L4KA 1PZEA 3CO0S 4MUJA 5PNTA 1DZIA 1G3RA 2DPGA 4DJEC 4YCSA 4BY9E 1U28C 1MO5A 3ZLTA 4M8SA 1ADCA 5F5LA 2HZ7A 2V65A 2YYAA 3DMRA 1ND5A 2WK1A 2AFRA 1U1IA 2RHTA 2OMKA 3REFA 4NZYA 4YQZA 3AQ4A 1GUDA 4MQ5A 1OLXB 1W2HA 1D03A 4YQEA 4K05A 5AUQA 1PZMA 1Z6GA 4C6RA 2F3QA 3M2PA 1ZN9A 5BV7A 2QX7A 5FBVB 1PWHA 4KXYA 1HGXA 1BRTA 2X0KA 2L82A 3OJCA 5K4AA 1RLOA 2X4GA 2Y77A 3IXMA 4BGUA 3DDSA 4E88A 4QSHA 1DWPA 1Z28A 4IWXA 1V41E 4UM9B 5ALPA 3HU3A 5DYTA 1PRYA 1AQ6A 4BUZA 2RK3A 4J75A 5K0SA 3VPCA 2WQZA 1W5SA 2WW8A 4OAQA 1CUSA 3RJMA 3FHTA 1R9MA 4PAWA 1NOJA 3EGDA 3KOWA 4PAMA 3U4AA 3KVVA 1MAUA 3RFVA 1Z2CA 4RAQA 4S3MA 4YT2A 2V7EA 1OW3B 2CL5A 1V45E 1X87A 3CTMA 1N5IA 3D0OA 4JYMA 5FWYB 4PTYA 2WWYA 1Y7PA 2C7PA 4QBKA 1E2PA 4FFDA 3WSWA 4BHTA 4UOQA 1ZJZA 2X86A 3L4BC 1XDWA 2WU1A 4QDTA 1UQUA 8MHTA 4GRIA 1ZXBA 5H82A 3B36A 3QF4A 3G0GA 2FWNA 2P3OA 1T4BA 1SUFA 4UXJA 3TMKA 3AB8A 4Q9LA 4HKTA 1KZ9A 1Y6RA 2H1CA 3DTVD 4YMLA 2HU5A 4WFKA 4EY5A 2FPGB 3NBUA 3UAOA 4V0MA 3TLYA 1DARA 3I6BA 5BP7A 1QPZA 1LJUA 1YSCA 2ZUTA 5CX1B 3D8BA 1H2EA 3A8TA 1JX6A 2BMEA 2C9BA 1JJBA 3G1UA 1WMSA 4QOIA 1U3UA 3NBFA 2YV1A 2VKQA 3O8DA 5J2TA 5C0OE 1IFXA 3Q5GA 1DG1G 1IB0A 1HQYE 1VKHA 4GO1A 4O4HA 3GZJA 5B4VA 1O8CA 1T9CA 2IS6A 3OT1A 4N5IX 3RSQA 1T9ZA 4OV6B 4Y2RA 1QLJA 3TPFA 3EXIA 3U4CA 1UT8A 3GQVA 3HRHA 1NNUA 3NWPA 3M5CA 2YWRA 3JVDA 3PR1A 4LMAA 2H8KA 4WT7A 2EV9A 4NESA 6ADHA 4MYRA 2BGJA 1MHTA 3H5AA 3FDZA 3BQNB 3PKIA 3WLEA 2C2WA 1Z07A 3P5BA 3P4YA 4P4UA 1SC1A 3H9EO 1SCBA 2REXB 4KR0A 1DX4A 4I6JA 3OTQA 1ZS9A 2JNWA 4WXMA 5JY1A 1E4EB 1KI9A 2XCOA 4TTPA 1NXPA 1TM5E 1YVEI 3BFKA 3H3FA 5E7IA 5FA8A 1R4NA 2D0OB 2UV8A 3WYCA 3VZRA 1FYDA 2F1JA 1DU4A 3AETB 13PKA 3KZCA 1X74A 2NXJA 3MTEA 3QFSA 4ENRA 3R7SA 4EDFA 1NW4A 2GK4A 1QMPA 4AJEA 1Z0DA 2YHUA 4RKYA 1R4MA 3IR6A 2FWIA 4BN4A 1C4KA 4S0ZA 3AM4A 3BHIA 5IM4F 1EJ0A 4ATNA 3Q7RA 4TLAA 1XGKA 1IG0A 1DAGA 1YZ3A 2FI1A 3NHRA 4W1RA 5ECDA 5LUBA 3X43A 2IK8A 5J9FA 2H1FA 3I39X 4LWPA 2RGCA 3M8KA 1IPFA 5KNCH 1SRRA 4PRKA 2I7DA 4GI3A 4J76A 4ILKA 4LE2A 3ZXIA 5LKAA 1Z33A 3V3KA 1SCUA 1C9MA 3CNQS 4MJXA 1FS5A 4W99A 3ZHOA 421PA 4D0RA 3GA5A 1U0SY 2P68A 1RQPA 5EERA 1G4HA 3ZDRA 1R4ZA 1GN8A 1GU0A 3AUYA 4OUKX 3GAFA 5CK5A 4ZO7A 3T3GA 3ULKA 3VDQA 3ZY3A 4I7EA 4HDMB 4E13A 2JFPA 4RORA 4JHLA 3VNUA 4K5QA 1LSOA 4BO5A 3RYHA 1H5QA 2A7XA 3LUGA 1Q15A 2O20A 1B74A 1H93A 3CRMA 3DF7A 3FYUC 2WF5A 3O8QA 4HN9A 1GZ5A 1C14A 1PT8A 4ZRNA 1YT5A 2XQIA 4UD6A 4K9RA 4OHUA 3D2AA 3QKSB 1QKIA 3DB1A 3S2IA 4WBSA 4FOLA 4MVCA 4LJ6A 1JYSA 1P7YA 1R5NA 1BYUA 1RWWA 3V7UA 1YA4A 4OG2A 1O94C 5I7EA 1JFFB 1F9AA 2HC9A 2RC5A 2R86A 2VA8A 4CE6A 5CDGA 4H9GA 4RS4A 3IXLA 4NHOA 4Q1VA 3EVTA 2VXCA 1Z6AA 1I4EB 5KHOC 5LIRA 5E6RA 5ICSA 3KM0A 1W30A 3IAM1 1VGVA 4XPIA 1CEQA 1CJCA 1LFDB 4QU0A 3VR4A 4EG3A 1QX3A 2PPVA 2X0NA 4JLJA 4OAPA 3COVA 2W6ID 2R5WA 2JJYA 4KL8S 2FDXA 4AJ9A 4NYIQ 2ZIXB 2PSJA 4TZTA 1HT2E 5K0FA 4TXMA 3KAKA 3P9YA 4WNYA 5DWVA 2P3QA 1E7MA 5IMBA 3CX4A 4MYTA 3TB6A 4WH0A 2B3DA 1XEFA 4HGZA 5JARA 2H2FA 1V6AA 3OTWA 1WXFA 4R71A 1U11A 1OHHA 2H29A 3HEMA 2VCYA 2BMVA 5BQOA 5DN6A 4GYKA 2F9MA 4TL7A 1HT0A 1C3OA 1E3EA 1U8XX 2A9KA 5F3DA 3JD3A 1C1YA 1IOVA 2BFAA 2X2FA 3CLRD 4RDHA 2I6GA 3SC2A 3UB2A 5ECGC 4RD1A 1XD8A 3NDIA 4GKBA 2B99A 4HGNA 4Q9HA 4H0CA 4CI0B 1YZUA 3KE9A 3AKYA 1WCIB 2BCJQ 2E4XA 2HHCA 3GLFB 1FSFA 3NOXA 2B2NA 3TSWA 5FBWB 1TYEB 1U2RA 5GJCA 4BLVA 1X7WB 2HBQA 2VUHB 2BPOA 2W2LD 3HB5X 3N59A 3PGVA 2UAGA 3LHIA 2QSYA 3LNTA 3QU7A 2Y3IA 3KEGA 1BE0A 2VA9A 1VDZA 3GAZA 2CFIA 4YUWA 2Z1DA 4PXYA 5IUKC 2GD0A 2BMWA 2AMVA 3HL0A 1IBRA 1ODJA 1P0QA 1P1HA 3N2KA 3WGZA 4MGEA 1UC9A 4HP8A 3HS3A 2GBCA 3HKBA 1IN5A 4UCQA 4FYWA 1QANA 3DQZA 1ODCA 2FEOA 1BWRA 4PTZA 4UUOA 4QWMA 4UFPA 1SXJB 1BDMA 3MTDA 4C08A 3Q8XB 1YE5A 2MMGA 1B2RA 3UYKA 3QPCA 3D4NA 8ATCA 3V9AA 3L07A 1GZ4A 2G36A 2G71A 2VP0A 1MOQA 1FU4A 1SU4A 3H2GA 3PUHA 4QJIA 3TQCA 1Z6PA 3WWDA 4F0JA 3Q88A 3UAZA 1PJZA 4ID3A 3UCXA 3LUPA 5DEIA 2LPMA 2UZ0A 4U6NA 1ONNA 1IB6A 2NO4A 3DVRX 3NASA 4FGZA 3VR4H 1XZLA 1U0RA 4C88A 3K1JA 1P44A 1J1ZA 3CA8A 4FQ8A 3A0UA 1FQJA 1OREA 2VRCD 4WZBB 2H1OA 1JSXA 4Q0MA 4DQXA 1JHRA 4UEWA 1ZJ5A 4HAZA 1CY2A 2LKDA 5F1OA 2ZGVA 1IWOA 1OCEA 1Z73A 3HA3A 2JZNA 4TKLA 3SMQA 4BPBA 1UK9A 1I10A 4OQNA 2DQZA 3H6GA 2RI6A 1A50B 4DTCA 1DEHA 3PRYA 4CKXA 5C7OO 1P39A 1YQWA 2RONA 1P2GA 3RCBA 1MW9X 2RCNA 4IQ8A 3HM9A 5DM70 4W5RA 4JXXA 3PX7A 3PWZA 1HY3A 3IE2A 3QKIA 4N7RA 2O52A 4L02A 2FR8A 2MR6A 2WUDA 3N8IA 4WHMA 4CM8B 2GEVA 3F73A 1SUEA 2EL9A 1K0UA 3I09A 2ZR8A 1Y1KE 1FNBA 2PZAA 2QKYA 1B73A 2WV9A 3CNNA 3M1IA 2NO0A 2W83A 4FHFA 4S35A 2AMYA 4E15A 3BKWA 2HJHA 2HREA 2FWBA 4MWSA 5IT0A 4RC9A 1IJEA 2PXHA 3D6VA 4NJMA 2NUAA 5KWJA 1A8IA 2DFDA 1JDSA 4Q21A 3GI1A 2PT5A 5LSAA 5I8ZA 4CEJB 2WYUA 2IZZA 3DD5A 4DHEA 3G8CA 1LNQA 4AMBA 4OJYA 3QBVA 1V1MA 1XDUA 2BEVB 2QTWB 3KCNA 4FKMA 1TKRA 3DBRA 5L3RA 1F1BA 3ZD6A 4UBMA 2YYYA 3D1LA 3FDXA 2IPOA 2O3RA 3L8CA 1AM4D 4GX2A 4LW8A 4XIYA 3AERB 3ZX4A 4BNZA 4CMEA 1BWSA 3QX7A 4EG8A 1QH9A 1MABA 3CH6A 3OMXA 1KZHA 4DMMA 1BFUA 3W34A 1WZ2A 4Q4HA 1YOVB 3DEHA 3IPYA 4LHSA 4M0DA 4V0RA 1Z08A 4ERXA 2GPNA 3CKYA 1RCUA 4FHZA 4YI5A 2F8SA 2JGNA 4XJXA 1CVIA 5D8DA 4DA6A 4L74A 3FTNA 2GAFA 1L4UA 3M6LA 4I4LA 3L5KA 4R5HA 4H4CA 2PZBA 3EDYA 3MBOA 4JYBA 4WCFB 4KCGA 4GX1A 5JG7A 2XCIA 3RAJA 2Y0CA 3B6EA 1W36B 4AZ3B 4QVKA 4XWTA 1WUYA 1U8EA 1UPXA 4M9ZA 2P1RA 2NSLA 4DUPA 4ENWA 3TCNA 1HYBA 2I1WA 3TEJA 4PCAA 5KWVA 2EKDA 5HFNA 1Y8CA 1EXDA 1P74A 1CVLA 2I62A 1JHXA 1L1EA 3EFOA 2BSQA 4RTNA 1ZVMA 2IXFA 3A4YA 2OYCA 1RXIA 4U7PB 3W7AA 3COWA 1STOA 1QV6A 2VT7A 2B2CA 1I14A 2OCYC 2JA2A 4F21A 1KWKA 1XYVA 3L7YA 1RYNA 3N3BC 5G3ZA 3IUYA 3KO8A 4PZ0A 5DCWA 3CEHA 1ZU5A 1O87A 2D13A 2GBLC 2H48A 3RROA 2WMYA 4YR9A 1MNAA 1XNJA 3ZXUB 1ZI8A 3WP0A 1PTJC 2GARA 4FIDA 2O5EA 3ZWXA 2JHPA 2P91A 3O8OB 1NY5A 2A0FA 3MCWA 3WK9A 1LZLA 4DIOA 3MTJA 3PDJA 2EARA 1MVOA 1XCPA 1YC2A 4W1SA 2ZR9A 1RHKA 3AM5A 4DJDC 1PFUA 3CW9A 3LO8A 1PK7A 1AMOA 2YXBA 3S27A 2B8WA 4F6CA 4YXWD 2D2VA 4YCJA 1LF0A 2ID4A 4C14A 4IQFA 4XFKA 1M8FA 3PCXA 4PLGA 2CVQA 4YI3A 3A4VA 3RYFB 4E03A 3FBGA 5K4GA 1XZAA 1XSEA 4FEAA 5FUMA 4BEJA 4O6VA 1P4RA 2P4EA 1XDZA 1XZEA 4PLPA 1N3BA 1HNZB 2ZYAA 3DT9A 3GT3A 2OL4A 3R1IA 4OYYA 2FE4A 4BATA 1Y42X 3T7EA 2AVDA 2X6QA 4TKMA 4YRIA 1RU3A 2BFFB 3T38A 1M5UA 3N2EA 3IUQA 4NYMR 3AR3A 2ZB8A 4TT8A 1K4KA 2QTTA 1TQ6A 4LPSA 4MIYA 2Q6LA 4O4IA 4B3GA 4AO7A 1AJEA 2HF7A 2ODQA 3PZBA 3DWGA 3X3HA 1HRDA 3TW8B 1M2JA 1A2OA 3KZOA 3FPKA 2VTBA 1N32B 1YS7A 4UUBA 4W5HA 3Q7TA 2A9VA 1TJYA 2FZ5A 2XWQA 3KAQA 4FE4A 4CIVA 3MJTA 5FKJA 1H6AA 4G01B 5I8PA 2GM9A 3R3WA 4KO2S 1BQEA 1G63A 5A5GA 5HKBA 2J0SA 1CX9B 1UF9A 1VPVA 1H4SA 2P6MA 3A6DA 5JXWA 5FIUA 1V7QA 2VJDA 3GUZA 3PNBA 2C3OA 1TUBA 3QMVA 3RVDA 1SCAA 4H2DA 1A8UA 3C3DA 4NBRA 1F6DA 2H2IA 1YB6A 2VF4X 4DGSA 2WD7B 2VSQA 3BL5A 3RHZA 1TMOA 4HH0A 1M8PA 1XRNA 3D6NB 1LI5A 1MJFA 1RTKA 3H9UA 2EW2A 3I45A 1FXWA 3A2NA 3C6KA 1YZYA 2XCQA 1N2HA 1Z0ZA 1DQYA 3QBTA 2JIZD 3OICA 5L4LA 4QGFA 3RFFA 1HM5A 1NRJB 1UAGA 4YO8A 4LV6A 5IKMA 3NFRA 5KNBD 2A3NA 4DEXA 3OEEA 2DLCX 1ZNWA 4KLRA 5JDCA 3MELA 1NW6A 3KDPA 1OC4A 1S2OA 1ZIXA 4WCDA 1ZJJA 5AVSA 5DYIA 5EIBD 4LF5B 3EA0A 4JGBA 3JYPA 4D9HA 3HKEA 4K9SA 3BH0A 1G5RA 3GEIA 4X1KA 2WVGA 1NTOA 3OU2A 3F78A 1M6YA 1CFJA 2RHOA 4QXRA 4NH0A 4R0VA 5LQSA 4HDCA 5EIEA 1DJNA 1P33A 1PBNA 5K3FB 4Z0TA 3WA7A 1HSZA 2QR5A 2GPAA 2E82A 4E7OA 1YNSA 5EL0A 1IE3A 2VJMB 2Y6VA 3A1EA 3A6GA 4L5CA 4OA5A 4BIMA 5HM8A 1Z5GA 4Z7QB 1ZIDA 2JL1A 3C4QA 1O96A 5EIHA 2NUBA 5LMNB 4G5RA 3L8GA 2AUNA 5FUQA 3MWDA 1EFVA 1E3DA 3BOSA 4MR8A 4EFMA 1DIHA 4UM7A 2UXBB 3HZZA 1PL8A 4EF4A 5D5PA 1G38A 3HXTA 4X8LA 2HMVA 2BFCA 2IZ5A 3SJZA 1N2GA 5IS2A 2ZUVA 3AR2A 3L8HA 5JPCA 3NPAA 1YVDA 2PV0A 3H05A 4F7WA 2P78A 5DLEA 1IUPA 1SXIA 2EFDB 1OV6A 2W2NA 3BREA 4D26A 2BHTA 2I6TA 3A7DA 3BBLA 5BV1A 4WBNF 1E0DA 3N8GA 3WKBA 4C2BA 4PNEA 3QOFA 3MMPA 4E1BA 1MB2A 1B6SA 2O57A 3NIDB 4YCLA 2BGWA 5K0CA 5JD6A 3ANYB 1FZQA 4JVSB 2V3CC 3B5EA 3OUUA 1NATA 3PGA1 5TT1A 4P81A 4LBZA 2PUEA 4AWBA 2RJOA 3F96A 4WVFA 3RSGA 2PH1A 5CVTA 1ORIA 5B3JC 1NBAA 1GD1O 4TL8A 2P9ZA 3W2FA 3BF7A 1MD9A 3NAMA 1Y80A 3PNPA 5AI6A 2COEA 5GPBA 3V2HA 3GRAA 1PR1A 4RA9A 3WC4A 4EB3A 3E8SA 4EY4A 4ZI2A 3U7RA 5TGDA 3TKYA 4K28A 4BVJA 4F11A 5BRJA 2I8AA 4N3GA 4BU1A 4AQ7A 4MIOA 1QYDA 3KQVA 1EAYA 1YR1A 2HHHB 4CWAA 2IDJA 4HQOA 3WKAA 1DC7A 5EHQA 4Z8XA 1DHTA 1R3DA 2ZKLA 1YMQA 1D2MA 1ZITA 1UQRA 1LPMA 3KV1A 2D2IA 2CD7A 5TVGA 4LV8B 4BAGA 1JI3A 1PIWA 1ZINA 4NWIA 3SZLA 1DJMA 3KJFA 2P11A 3VGPA 3O8BA 4KIGA 2VBIA 2G6BA 1M34E 3KPWA 3OETA 1M5TA 3I6IA 4OLFA 4PYQA 3M6FA 4UVDA 5ERGB 1EEXB 1Z2PX 2OZEA 3DBLA 2ZXEA 1LBTA 2R4QA 2WWXA 4GI7A 4BQOA 4YRMA 5B7QA 2VAPA 2IP4A 3HP1A 4RA6B 4Z4GA 4RKFA 3DKKA 1FPQA 1KXJA 1N5LA 2O5VA 3DF9A 3LL4A 2BTQA 3UMFA 1P1KA 2D7JA 4KK3A 2UZ4A 1PSWA 2BFPA 2PBFA 4KXNA 1L5WA 3BRCA 3FOAA 3RGGA 2XCSB 2SCUA 3OOSA 1YWGO 2ZVJA 1R0LA 2PUVA 3JV7A 4OXNA 4JOBA 1USWA 4WIAA 1ECPA 4WADA 1UDBA 5IDVA 3ZZUA 3CRNA 1E2FA 2ZT8A 3G7SA 3LI2A 5J4KA 1K6MA 1DE0A 2O5RA 4ENSA 1E4OA 1WPGA 3RRNA 3X1KA 4XPZA 1Z39A 2EFYA 5HDBB 4PIMA 4JQOA 3EB9A 1XRSB 4UBKA 1NQAO 2Q1YA 3L49A 5HCUA 2F2TA 1HFEL 4QBFA 3RRJA 5EVCA 3KL4A 1TNDA 2VUSA 1BYIA 2NQ8A 5CVUA 3RUAA 1Q5PA 4V0QA 2ZRQA 4XWKA 1U1DA 1WSBA 1TJ4A 4W7SA 3AJ8A 4G6ZA 2M98A 3ZCQA 3TK1A 4ZI7F 1LC3A 3F4BA 5JANA 3PRHA 5L4SA 1NR7A 3KX2A 3KZXA 1IY0A 2W2OA 5KJFA 4RJ2A 4F06A 4AG5A 4C5BA 4X20A 3BEDA 2VNSA 2F3TA 4WNCA 5AXCA 5GM1A 3EUWA 4XASA 4BAUA 1AKRA 3GV0A 1A69A 4DVGA 3MN1A 1PFKA 1MP0A 3JVUA 3U44B 1HQDA 2OV6A 4NZNA 4R8KA 1KE1A 1KY5A 3KQWA 4JSYA 1AD2A 5ES4B 3OT4A 4V39A 3HCFA 1K5PA 3A7EA 3GZTB 4WUTA 5I7OA 4KVAA 2FRVA 2IEDA 4HL6A 4ZRMA 4FFBB 4RHEA 2FUKA 1E8DA 2OAP1 3IVCA 3M3HA 4O2LA 1FTGA 2FN3A 5IU6A 3OQNA 4UBJA 4B44A 3HXMA 2XQKA 2J46A 1XJWA 3B78A 1X38A 2QZPA 2R1TB 3T15A 2FW8A 1NR5A 1ADFA 2A84A 3Q85A 4FHCA 1ZGAA 3DE2X 4KWEA 4BEBA 5F1YA 3TIVA 4LFBB 2O7RA 2O7SA 2V9ZA 2VHZA 1M6HA 3ANNA 5HZGA 4AG3A 1OXBB 1XEXA 4OHXA 1SXHA 2E3JA 2J9ZB 3MB5A 3UUFA 4ISBA 2ONZA 1ZFNA 2MSDB 2C4KA 3QIAA 4YBRA 4H3HB 3ZLVA 4CL3A 1CQIB 3JU3A 4J6EA 2Z9CA 4CKBB 1I24A 4GXNA 4NTZA 4U6SA 4AG6A 1GDHA 1Z6YA 3C8ZA 4HAIA 3LQ4A 4KQFA 4N3NA 3SYLA 4P2GA 1QGUB 3SYTA 4BFSA 1CNMA 4FYYA 2IY7A 4YRSA 3WRXA 3LSYA 4PHTA 4MQ6A 1K7XB 4HBZA 5FEUA 4QHTA 3IRUA 4IMIB 4UPDA 2DRIA 2WSSD 5JD3A 4A27A 3N5CA 2H65A 3WO0A 1PN3A 4AJ4A 4H7HA 4MDHA 621PA 2NZUG 3AVYA 3KC2A 2DTDA 3CSDA 2XVYA 3PUWA 2WKWA 2RIRA 5AXAA 1ZVVA 1XPUA 4EAQA 2XUPA 2Z5VA 5JSKA 1AH2A 4LSGA 2EF0A 3S44A 2ADFA 3ADOA 3HYRA 4JYPA 4M0LA 5AR1A 1XAHA 2VWPA 5F12A 1CUDA 4Q24A 2F3PA 4W4TA 2WPDD 1LB1B 2I1VB 2PYDA 1I1OA 2P3SA 5AUOB 3PDUA 4UBOA 4LZWA 3V46A 3WLSA 1E2QA 3FPBA 1G6HA 2DR3A 3ZTWA 2ZM5A 3WYAA 1CRPA 2DWQA 3DYVA 5AKXA 3CCFA 4OP3A 4J90A 1RBYA 2H85A 2FN9A 2B61A 5SZHB 1I1NA 3WV5A 1KMHA 3KT3A 3OQOA 4HADA 3NI2A 1AUPA 2GFIA 3II6X 3CSSA 3E27A 1VIYA 3TTUA 5KQLA 3M6IA 4PLCA 3HKCA 1GFWA 4MA4A 5AHOA 4QVIA 1ZEMA 1E1NA 3DVQX 3M33A 1NF3A 4KZKA 4TS3A 2MTBA 2DHRA 2YNMD 4MAFA 4LJYA 1U0LA 1SD1A 3CF6R 5EWLB 4X62B 2UU9B 4MK4A 3QWIA 2UVPB 1Z45A 3MJHA 1AO3A 2Q5FA 1FRFS 2FGKA 4TUYB 1VL0A 3ORFA 4AN0A 2VDPB 3ZY2A 2GDZA 1E69A 1ZM9A 2KPOA 2VKTA 1KI2A 3DKPA 5JCOC 3LFUA 4X1IB 3Q5DA 3EEIA 3GLSA 5H3HA 1UBOS 1QBKC 1JHZA 1Z25A 3MVEA 4BKMA 3O94A 5E6SB 3H9JA 4K9DA 4FZJA 4OU4A 1Q22A 3GRKA 3V4SA 4LHEA 4JA2A 4HUJA 1RZ3A 3L9XA 3K9HA 4HFJA 4Q1FA 2XSZA 2GLTA 5EUBA 4CKZA 5KTSA 2UVQA 2XTNA 1QH8B 2O2XA 1CTQA 1DFHA 1I3NA 1YS1X 2OM2A 3ESAA 3JQ6A 4G97A 4KQ6A 1EEHA 3SR3A 4F84A 1S8NA 5FBQB 4WZAB 1V2GA 4D96A 3JAWB 3JSAA 2M1ZA 2R8BA 4RVOA 2SHKA 5JXGA 1Z2OX 1UZAA 4S1PA 4YJDA 4MQLA 4AXBA 5IK2D 5J1TB 1FC0A 1L7NA 1B4DA 3EGEA 4O2AA 2HUPA 1UBMS 1G7TA 1RXWA 1XU9A 4X85A 2LDXA 3RVMA 3E6AA 1VPEA 3GRVA 3WP1B 3U6BA 5A6SA 4O8ZA 5LWQA 3TNDA 3RC1A 1U7XA 3GPDG 3W2HA 2PT6A 5CB0A 1RMYA 3LQ1A 3GYGA 5DNCA 4TZ0A 2R4TA 2C5SA 1XP5A 1IHYA 5E95A 2V6BA 3W8NA 3U39A 3KSDO 2Y92A 5TRTA 2ET6A 2OV3A 4IM7A 4LYAA 3CZMA 1U2EA 1SA0A 3V6MA 3AUAA 4QAJA 1RKXA 2QRKA 1VI2A 1OZHA 1T8SA 1YXMA 1PEAA 2W6CX 4F9TA 4GAEA 2C9OA 3F1LA 4GECA 4M9XA 3B6JA 3EDRA 3TF5A 1U94A 2HHAA 2OHHA 4UJ5A 1ZP6A 2XKKA 3QEAZ 4KR3A 5L53A 3O3MB 1BU8A 2ZVPX 8ADHA 2GCNA 5IJWA 2WB2A 2NX2A 4HZUB 2F62A 1IPHA 1DC4A 4G1FA 5EP4A 3O4GA 1HFWA 4KE7A 1FUIA 3DBHB 3G5UA 5KMGB 1Y8RA 2POQX 2X2EA 3LOPA 4GOXA 3ROFA 3EFHA 5FF9A 4F04A 2E49A 2ZYRA 2X3UA 5HG0A 4IIVA 5EEHA 4AT1A 3W6OA 3EMBA 5AW2A 1U8FO 3K8OE 1OR8A 1MPXA 3CS3A 4GQAA 1M2OB 2H08A 4LYGA 2Z56A 3E5HA 1REQA 4NU8X 4ZDWA 1ESDA 1NYTA 2C8KA 1SY7A 4RJJA 1RHMA 4CLHA 4HXFB 2EJWA 3PU6A 1KQ3A 2XJ4A 4GX5A 1HETA 5JECA 4IZHA 1C1XB 1ZOLA 2NU6A 2X19A 3LZDA 4A0SA 4OL0A 1NXQA 5AVJA 2WILA 1KDOA 1E9BA 4J3JA 2BFEA 3KQKA 1RVV1 1GIAA 1OKKD 1VGRA 2EFJA 2YHBA 4OB6A 2OD2A 4YEDA 4ZRDA 5EYPA 1O95D 3ROEA 5BSKA 2ZS7A 2W70A 4DBLC 2DXIA 4UU1A 3EC2A 3FGPA 4PG5A 2J09A 3HDJA 2BISA 3QOXA 5CYFA 2YIMA 4IVQA 4YN3A 1DXOA 5HUQA 3VVMA 1N5MA 1RAGA 1JG2A 1TD1A 4DE5A 1W59A 1ZUD1 2AC7A 1KRXA 3WXBA 3BWYA 4IRMA 4MYHA 3UJ8A 4FINA 4A6DA 1KH2A 3LTEA 1T8UA 1ZOPA 3P2MA 3BL8A 4RMGA 1XKLA 1XQXA 5AOCA 4BVLA 1B0PA 1HX7A 3GLGA 5ALTA 3I5AA 3LQ2A 5AVWA 1VXOA 3CWCA 5HA5A 2ECPA 5IZ4A 1K7YA 5HF6A 2CC2A 1L4LA 3N0XA 4M0CA 3PS9A 5BR1A 2XVAA 2HIHA 1JKXA 2XMQA 3CSUA 3QUQA 4WFIA 3E1SA 2TECE 2RG1A 1HDIA 2Y0BA 3L8DA 4TTTS 1LVUA 1PFQA 5A4IS 3FPFA 1CBUA 1VB5A 1YBMA 3JASB 3MXTA 1QVWA 4OHVA 4HB3A 3SHFA 3JQAB 4L85A 3KBBA 4G56A 4C0KA 3VYRB 2IYEA 2WIGA 1P61B 1KJNA 4ZVKA 1RCTE 3NDRA 4BNLA 2IY9A 3M83A 3KSAC 4UXIA 3GLGE 2XMBA 3ICWA 1R15A 1ZPDA 4I4TB 4GG1A 4IUCS 2CJWA 2I80A 3ZOKA 1ISRA 3C15C 1KE2A 2XNDD 1JU9A 1ZCBA 1K06A 1BA2A 1GFSA 4WINA 1RIIA 3VOAA 1WPRA 3UMMA 2D5CA 4UKDA 4LXTA 1TUGA 2VAWA 4YRDA 2AXNA 3JQQA 3DAGA 2J0UA 1PHRA 2Z1NA 4K0RA 1R6XA 2TS1A 1NN5A 1L8LA 1SNYA 1XNHA 2GN0A 3KJEA 3KU4A 1Q0SA 4ZQIA 2NUPA 3D6JA 4TVOA 2JIPA 2YZNA 1J4AA 3BH7A 3BWDD 2R1VB 3OFVA 1FX0A 2XA9A 4HLDA 3HJBA 2UUOA 3CZ5A 3LY5A 3THRA 4HUQA 1NNLA 2R2AA 4AM8A 4IQ0A 3ETDA 1DAHA 1DIGA 3G2KA 4MCJA 4Y1EA 5TQ2B 3SQDA 3SXJA 1LLUA 3TZLA 2FKNA 1JAXA 4K9KA 3BG5A 4LDNA 4OHFA 2D54A 4QEKA 4ZI3A 5EJ7A 2C5GA 2ZWVA 5F1KA 5HRAA 4MP3A 3PC3A 1OY1A 4MR9A 4BJ3A 4N4AA 3I1JA 1PJBA 2J3HA 2JFNA 3GT4A 4RGVA 1FMCA 4YCCA 1NY6A 3PC6A 5B3KA 4TZ6A 4K0KB 4HB0A 5ENDA 2I4OA 3IDFA 1R0WA 1Y33E 4R6XA 1P0FA 4AMZA 5THKA 4UBNA 1QZXA 1V4NA 2FX5A 2YDYA 3D5TA 5DV9A 3JQEA 2O2GA 2YWFA 3MOGA 4WN3A 3VC1A 4J2TA 4Y6SA 4DLLA 2YN4A 5CJJA 2GGSA 3ZDBA 4A1FA 4MULA 2EP7A 1I8TA 2X7XA 4OL9A 4XOIA 5DCLA 1NNSA 1LRKA 3FCAA 1TT5A 5LQAA 3D3KA 3OBBA 1XMQB 1E2KA 4RBNA 5JAPA 1AKVA 1Y1TA 2X5OA 2RHWA 1QTIA 3DYIA 1RHJA 1RPNA 4HD8A 3S6JA 3PJRA 3JWGA 1QFZA 1K75A 4B6JA 5BN1A 3V1KA 7YASA 3ITEA 3KRTA 1EDOA 4RK5A 3VSAA 2H3HA 1G9SA 1FK8A 1PNOA 2ZSJA 3SK0A 1EVEA 3QFCA 3I3OA 1N5RA 2G1JA 2JJ8A 1XT6A 2CLIB 2XDYA 2ZJ6A 1DTEA 4ML3A 3OOYA 5FWYA 3H7AA 3I0ZA 1H2XA 1ZX1A 4RTSA 2QSZA 4IJVA 2REOA 1GG8A 3QWAA 1PI3A 3AB7A 2JZOA 4E5MA 3ZHXA 4KWIA 3WRXC 2WU3A 3LX8A 4AROA 3ILXA 2E4ZA 5B7PA 2IX3A 3H4IA 1NJSA 2XRFA 1O57A 2XI4A 1OB5A 2XADA 4LC0A 3KOOA 2A5DA 3B82A 3S40A 3KJNA 4LWZA 3WNDA 4Z3DA 3T41A 4EPVA 4ON9A 4LMBA 5IKPA 2ZRBA 2XB4A 3LPLA 4IEIA 5DDIP 1MIOA 1VP3A 2VYVA 4CM6A 1FLDA 1HSOA 2VJYA 4K9OA 4MUHA 2NVUB 1T24A 1V8BA 3TD2A 3WQRA 5IH3A 4L5BA 1C2YA 4LKOA