4WZ6A

Human cftr aa389-678 (nbd1), deltaf508 with three solubilizing mutations, bound atp
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
283
structure length
258
Chain Sequence
b'TTEVVMENVTAFWEEGFGELFEKAKQSLLGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRISFCSQNSWIMPGTIKENIIGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSELQNLRPDFSSKLMSFDQFSAERRNSILTETLHRFSLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cystic fibrosis transmembrane conductance regulator
publication title Binding screen for cystic fibrosis transmembrane conductance regulator correctors finds new chemical matter and yields insights into cystic fibrosis therapeutic strategy.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Atp binding protein
total genus 90
structure length 258
sequence length 283
ec nomenclature ec 3.6.3.49: Transferred entry: 5.6.1.6.
pdb deposition date 2014-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4wz6A00
2IYXA 3MWJA 2E87A 4G5SA 1Z3IX 4HAUA 4LGMA 3QUSA 2BMEA 4JYBA 5EE5B 5AJWA 1UFQA 4IXNA 2X2EA 3SDZA 1AS3A 3ICEA 1R4AA 3GEEA 4QGGA 3VQTA 3AP2A 1G20E 4I99A 4A0GA 3GLFA 4EFNA 4NH0A 1ZJ6A 2IXGA 3RSLA 5FUVA 2OE2A 3MWLA 3LNCA 4KI0A 4XSHA 4P32A 4EAQA 3T61A 5K8TA 5AJYA 2J1LA 1TF7A 3UWKA 1JQLB 2J5XA 1ZNZA 4LYFA 2F1IA 3KB1A 3T5DA 2PLFA 5FR1A 2OFXA 4NDZA 2FGKA 5FBQB 3ADDA 3PEYA 1ZD8A 5SZIA 1VCIA 3QEJA 2FSIA 4YC7A 2WWXA 3IQXA 4NONA 2D3WA 4LHWA 3OAAA 4A2PA 1E98A 2FPLA 3GLIB 3CF6R 3DM5A 2XEXA 3P27A 1CIPA 2H5EA 4OI0A 4PC2A 4BFZA 2FWRA 4ZI2A 1G4UR 2PJZA 5KHOC 3DHWC 2GJAA 1QHSA 5GADl 2IYYA 3WXMA 1TEVA 1E9AA 3OAAD 4M1MA 4GI7A 3HR7A 4PXAA 2IYRA 4LY6A 4QHSA 1XD8A 3CF2A 2FPKA 4GZLA 3CM0A 1Y63A 2F43A 2IYQA 3AUXA 3CR8A 3OIWA 3RRMA 1G8PA 4AKEA 4PC3A 1OFIA 5B64A 3KKMA 4QFMA 1KYIA 1CTQA 1GKUB 2CK3A 2GBLA 2DPXA 1NSFA 4LV5B 2GWHA 2VPPA 5EJEA 5HTKA 1CP2A 3BK7A 4NCHA 4B3XA 3VR1A 2VA8A 4LK2A 2WKRA 2H92A 3R20A 1SXJA 1U9IC 3GLGE 1N6HA 2ZSDA 4CEIB 1N6PA 2F1HA 5A5GA 2CK3D 4RZ2A 4B44A 2GJSA 1FZQA 3GLGA 4DIEA 4G5RA 1C9KA 2WJYA 4JBWA 3X1XA 3PENA 4H9GA 2RMKA 4TMXA 3LBNA 2ZR9A 4KBGA 1NI3A 3I5YA 5EP3A 4B3GA 2QAJA 1G5TA 1M6NA 1SXJD 4X8MA 1NN5A 3VAAA 4B75A 1HEIA 4HAXA 1OT3A 1XD2B 5EE1A 3IDQA 4B74A 3C15C 2JEOA 3B85A 2B8TA 2ZJ5A 3NEJA 4IHQA 2AKAB 4XVQA 2MSDB 4RD2A 1AS2A 1W5TA 3RWMB 2FMXA 4D4MA 3EC2A 4UJ3A 2IYWA 2GCOB 1T8UA 3L0IB 3EIHA 3LX5A 4M22A 4QNMA 3UPUA 4PO8A 1CKEA 2R62A 4RY2A 3RWOA 3AF1A 3ZIAA 1GL6A 1G4AE 4DLXA 3MUFA 1WA5A 4F38A 4A6PA 4C0LA 2O52A 3ASYA 2QMEA 4JLVA 4MRNA 1KKMA 1BKDR 3QIAA 2PZEA 4H1VA 1Z5ZA 3CRVA 1EWRA 1ZM7A 2VHTA 1DE0A 3ZIAD 2W0SA 2ZRFA 3KXIA 4KCGA 1E6CA 2RB4A 4OQLA 4AYWA 3HU1A 2GBLC 3DDCA 1L4YA 3QKSA 4BASA 4OHYA 1R0XA 2WJIA 4YMTA 4BFWA 3U60B 1X86B 3NBZC 5JJIA 4MYTA 2KWIA 1T0JB 1DAFA 4L15A 5EP4A 3JZMA 2G1KA 2C78A 1KSHA 1E79A 1MO3A 4GP7A 4GFDA 3W3ZB 4OK5A 3VR6A 1IN6A 2DFKB 3SI7A 4DUGA 1W36B 3K0EA 3L82B 4XTRA 4TYPA 1AZSC 3HPRA 1WDTA 3R8CA 3IO5A 4QHTA 3KQUA 2ZRIA 1ZM2A 4JJKA 1G7SA 5FOVA 2J59A 2ECKA 4XD7A 1PLKA 1OIXA 2VSXA 1J70A 3CIOA 4YMWA 1XJCA 2ZJYA 5FPTA 5KSZA 1GVNB 2LCFA 3FMPB 1E79D 4U5XA 4LHVA 2C98A 3NG1A 4RVCA 1IY2A 1Q1EA 1XTIA 2BMJA 4TL9A 4DUGD 3D6TB 4Q03A 4Q1BA 4DLZA 4HEJA 4YDSA 8OHMA 4XD7D 4DEXA 2O0HA 3QF7A 2QU8A 5M04A 4TYNA 3A8TA 4BQSA 3SFVA 1L8QA 4IDNA 3QBTA 1R7RA 2GEUA 2G6BA 1WQ1R 4R2HA 1DO0A 2JLYA 2FGJA 5HZKA 4V0LA 1G3QA 5EP1A 1EFHA 4B6EA 3K70C 5DI9A 3VR5A 1ZAKA 2VF8A 4HSEA 3FGNA 3K70B 2QT0A 2R9VA 2RCNA 4MRRA 4PAMA 3QXXA 5LB2A 2GXAA 1E2LA 4UXIA 4U7DA 3AEZA 1R5BA 2A78A 1N6LA 2CE7A 2Q3MA 2YKGA 1I4TD 4D81A 3P4XA 3PUXA 3K0FA 2OUKA 4B2LA 4B76A 4DSTA 2EVWX 1U8ZA 3ASZA 4FMBB 1T91A 3WMEA 4QNRA 5JRZA 3KDSE 2IF0A 2NTYC 1NY6A 3PG5A 1VMAA 1P9WA 3B1VA 4GMXA 4MYCA 4DJTA 4CVNA 3SS8A 4WIAA 3T5GA 4MGZR 2QAGA 1R0YA 2O5VA 1OFHA 1E32A 3PCRB 3EIQA 3PUWA 3X1ZA 4DZZA 5KUTA 4ON9A 5FBRB 1UDXA 2NO6A 2GCNA 4U02A 4ZI3A 2ATVA 5DNYB 1WF3A 4RSGA 4BGDA 4KAXA 5JSZA 1M2OB 1YRBA 2W58A 3W5IA 3R8FA 1OB5A 2WOJA 1G41A 3EZ6A 3CR7A 1ESMA 1NG9A 3AVTA 2ZE6A 2QBYA 2Q21A 1ZD1A 2C9YA 1P2SA 4I4LA 4ABYA 2R6CA 2GRJA 2ZU6A 3HU2A 2JJ8A 4ACBA 2AK2A 2J7KA 2OCPA 3BERA 3NWJA 1M1YE 4WVFA 3P20A 3M0EA 1S8FA 1OH8A 3B9QA 3AVVA 4Q18A 3FFAA 1J7KA 2NO9A 4DDUA 1YZLA 5B30A 4TMZA 2J0VA 1D6JA 1E2NA 5FOTA 3SU8A 3QPVA 4MYUA 2WVJA 2CCKA 2FX3A 1FUUA 1IXRC 4RZUA 2MMCA 4ILEA 3SJZA 3B7GA 4Q5IA 4CIDA 2R6GA 4E07A 1D9XA 4G1UC 1GFIA 1T9HA 2Z4SA 1WMSA 3O8DA 1QHNA 3EA0A 3UMRA 5JCPA 1NG1A 2J45A 3L43A 3U6BA 2XTZA 1OE0A 2BJVA 1GKYA 3CW2A 1LW7A 3GJ6A 1KO7A 1PLJA 1U81A 1ZINA 1ZNWA 2P6NA 1LF0A 3QXJA 2FH5B 4XJXA 3VNVA 5JBQA 2DCUA 1XZQA 5FR2A 4C0JA 2YWHA 2ZR0A 2QGZA 3MJRA 1KDRA 1OF1A 2IYLD 4JL8A 1E2QA 3NXSA 5KNCA 2DBYA 1BH2A 4BRWA 4MRSA 3ICQB 4B3DA 1EFCA 3B1ZA 1KDOA 2FG5A 4A2WA 1RVDA 1OIWA 1TAGA 4M1TA 2UVQA 1WE2A 3B60A 3TAHA 3ZD7A 3R9WA 2RGAA 1IM2A 4TLBA 1YZGA 2PX0A 3B1YA 1IXSB 3TIFA 4OQMA 1JAIA 1YU9A 1YZUA 2OFOA 1KJZA 2QPAA 3FMOB 4I1SA 1QHYA 3KFXA 4JLDA 2D06A 5G40A 3SQWA 5EXPA 3AM1A 4CT5A 1BS1A 3K9GA 3SBEA 4C2UA 4LHZA 1VYUA 1VG1A 2GEDA 4BFYA 3G82C 4IEEA 3L8YA 2PMDA 4V0ME 1E1RA 3TBKA 2X8AA 1G19A 2HEIA 4US1R 3NH6A 4AURA 2ONJA 4Q1CA 1AKYA 5JZVA 2BEKA 4OI1A 2IS4A 2YV5A 2XZPA 5E95A 4P4SA 1DELA 1KMHB 1W5SA 4I81A 4EJSA 1E2FA 1XF9A 1Z22A 1M34E 1E1RD 2DWOA 1GUAA 3A36A 4TQUS 3QXCA 2YOGA 5IHPA 2BBTA 4AKHA 2O8CB 1XJ0A 1ZC4A 2WWFA 1Z0KA 1JJ7A 3AB3A 2WIAA 3LO5A 4LBVA 1OSNA 4N1AA 1N6OA 3EWSA 4BLQA 1WCV1 1BYUA 4OJKA 5KPDA 4GZMA 4JJZA 1Q1QA 2ORVA 4ARZA 3WNDA 1Z83A 3WRYC 1TX4B 3CRQA 3E1SA 2FEMA 4E22A 1GTVA 2ZJOA 2OCBA 1CXZA 5HR5A 3N2EA 5HPYB 2JLUA 4DSUA 1T0HB 4XVRA 4LBYA 1QHHA 3IPYA 1EESA 2GNOA 4KXFB 2ZRMA 3OZXA 4UQOA 1E9DA 3GP8A 3THXB 1KI8A 1GNPA 1SHZA 3VNUA 4PSAA 2ZR7A 4B71A 2G88A 4G5GA 3CRRA 3WYGA 4MKIA 4AI6A 2V7QA 4KFSA 1HE8B 1ZCAA 1VYVA 1Z0AA 4GMDA 1T3SA 4BFUA 1NLZA 2QORA 1M7HA 3CB4A 2R6AA 4BLPA 4C0HA 1B0UA 3D7MA 5JJLA 3BWDD 1II0A 2V7QD 1G16A 3FPAA 1E0JA 4EJSC 3HYRA 4W5JA 4LCBA 2J0SA 3LQRA 1Z6GA 4IDQA 1OLOA 5JWOA 3VX4A 5AJVB 3TVDA 2C96A 3C5HA 5J4KA 1DG1G 4P31A 2GF0A 2PH1A 2J0QA 1JPJA 1LS1A 2CLCX 4LOAA 4F4IA 5GVRA 2EW1A 3THWA 2PL3A 4B47A 1XFAA 1T6NA 5DYIA 1ZU5A 4P4TA 4FIDA 2P3SA 4LI0A 1ZNYA 4S2EA 1VG9B 2DR3A 3D31A 2GXUA 1GKIA 3W6NA 1YHNA 4WA7A 3R9XA 4AC9A 5BN3A 3NBYC 4BUJA 3FTQA 5FTMA 2N1BA 1XMIA 3ZD6A 2Z4RA 5KTYA 1N5KA 2O8EB 2QY9A 1NSTA 3WYFA 3IHLA 5AK0A 1YQTA 4LBWA 1CR1A 1Z07A 3IO3A 4Q9JA 4JVNA 4WAUA 1KJWA 4DDTA 3THYA 1SVKA 4JSTA 2D4HA 1W49A 4MA4A 1W2GA 3KFVA 3V4RA 1NNEA 2OAQ1 4XOIA 4GL2A 2O8BA 2JA1A 1GRNA 1RW4A 3GMTA 1XTQA 4M0LA 4AWXA 1KSJA 2XSZA 1OXTA 5E7IA 2FN4A 1MKYA 1TL7C 2QTFA 4PAOA 1BYIA 3CUEF 3RS3A 4URZR 2J7PA 3TNFA 5F9HA 2VO1A 2X19A 4MGKR 4PQFA 3OEHA 5K8LA 1KI6B 2NO7A 1B23P 2V6JA 5EUMA 1NN3A 2E9SA 4EKDA 2ERXA 1QRAA 4RCZA 1D8TA 2XSZD 3K09A 4M1KA 2C95A 1IQPA 4Z54A 1N0VC 4XWAA 2Q6TA 1G21E 2NIPA 4LJ4A 4TMTA 4UKDA 2J7PD 2VHJA 5LD2C 2BCJQ 3OEHD 5AUPB 2HJVA 1PV4A 4RFSB 5FI0B 1QVAA 3OIVA 2IXEA 1LTQA 1OHHA 3GLHE 1NVXQ 1KIMA 1E9BA 3KXKA 1YZNA 4I1OA 4O2RA 5HCNA 3N70A 5BN4A 1RZ3A 1QDEA 3MSXA 2FSGA 2CVHA 3SQXA 1G7TA 2BM1A 2F3RA 2VP4A 4X8OA 3U44B 1GM5A 2F6RA 2FZ4A 2ZREA 3CPEA 3WBJA 3U4QB 1YKSA 1OHHD 2YC2C 1KO5A 3QG1A 4ERNA 3PEUA 3S1AA 1VG0B 4TWZA 2ZXUA 3T1OA 5AR1A 2MSEB 4QKQA 1XCGB 3EZ2A 3IQWA 1Q21A 1O3YA 2QI9C 3U2QA 2PBRA 1P62B 3AKCA 1SHKA 4RJLA 4M9QA 1G7CA 2J9RA 3CLVA 3F3YA 4MUAA 1OJLA 5FPHA 5G53C 3T15A 3RS0A 2KI5A 3DL0A 4II7A 4V03A 3UMFA 4E09A 3CWZA 1FFHA 3EPJA 1E2MA 2GVDC 3QVVA 2OCAA 3U3OA 3GJ4A 2QNRA 4Q9IA 5E3HA 2IF2A 2OBLA 3CNNA 1GNRA 1DARA 3GEHA 3U5ZB 1W4RA 3H86A 4FCVA 2IWHA 2BBOA 3O8BA 3VU9B 2FFAA 4JL6A 3FE2A 2LWIA 1W7AA 1MOZA 3AKYA 3LLMA 5DHAA 4LYAA 4Y0VA 1OKKA 5JHGB 2OESA 1FQJA 3QKUA 4CF7A 4B43A 5FUXA 3O8CA 2HCJB 2ODNA 4FCWA 4FMCB 4QG7A 3KKNA 5SZJA 3TR5A 4PZYA 3W6OA 1UKYA 3TJZA 4K8OA 2OCYC 2Z43A 4Q66C 4D82A 2AFIE 3B78A 4M9XA 3GJ0A 1NBMA 3GLHB 4NCKA 4NCNA 3PFIA 4GT1A 3DM9B 4A0HA 4OQXA 1OKKD 1EFTA 2PZGA 3RLFA 1FMLA 5HE9A 4V0KA 1JPNA 3K0AB 4IVQA 3M6AA 3QE0A 2WPDA 1PUIA 1VHLA 1XB2A 3QXHA 1UM8A 5LB4A 4BLTA 1NBMD 2ZUBA 4AYTA 3NH9A 1AS0A 3GLIA 1AKEA 3TVTA 2HDNB 1GWNA 3W90A 3X1WA 2ZQ5A 3W3AA 1D2EA 3RRZA 3FFBA 4PTLA 3OF5A 1MABB 3FKQA 2WPDD 1KY2A 2VTKA 1NRJB 2I4IA 1RJ9B 3AVOA 2EYQA 1KKLA 5K8IA 3LDAA 4V0OA 1G291 4EPVA 3ND9A 1GZSA 5GJCA 2DHRA 1NN0A 3EZ7A 2FFBA 2FPMA 4RCYA 3WMGA 2EWVA 4R98A 2RGCA 3AF2A 1T3HA 1TU3A 5ANRB 4C0KA 2BKUA 3QENA 3CRMA 2RGGA 2VRWA 1R6BX 3V4FA 4JZKA 5LPNA 1EFUA 2JLWA 3QBVA 4QJ4A 3AQ4A 2ODEA 3IGFA 4E5UA 1ZYUA 1HQYE 3I72A 5DGXA 3AUYA 2ZE8A 2F9LA 4CEIA 2O0JA 1U9IA 1ZBDA 2YOHA 3MLEA 2YZ2A 1CU1A 2G3YA 4NMMA 1IY1A 4KLNA 3TQCA 2C04A 3EC1A 4PHGA 121PA 1ZD9A 5JLJA 1TQ6A 4N0EA 3CX6A 5EE0A 3H0KA 2QGNA 2JIZA 1DEKA 4PPQA 1XD2A 2Q9BA 5EXXA 1YVDA 5L3RA 4B2IA 3ND8A 3QJYA 1RFLA 3GCGA 1JR3E 1ZC3A 4HLDA 2GCOA 3A1VA 1JR3A 1OXXK 4G3XA 2JIZD 2DWQA 4KYUA 1AN0A 1E2GA 3FHOA 3RDPA 4ZIRB 2EU8A 2ZI4A 4QBHA 4QHYA 3IILA 5DHFA 4DCSA 3GPLA 1JR3D 4PZLA 1O87A 1XTKA 2ZRCA 3GJ8A 4W5WA 1EFRA 1Z28A 1T5IA 3WY9A 4L5BA 1P4SA 2QPOA 3NTUA 3K9NA 2JAQA 1W4AA 2OILA 2W6IA 2RGXA 4Q19A 2BEJA 5LBIA 5J5CA 3EA5A 4HAZA 4NKRA 4NE2A 3RRYA 3WBKA 1KAGA 1EFRD 3THOA 1IOZA 2QM8A 5C4MA 4TZ6A 2L0XA 4OHXA 5L8VA 2W6ID 4EPRA 1Q1ZA 3IIJA 4TL6A 4MRPA 3C16C 5B2ZA 3EIEA 2GESA 1P73A 4PO1A 1XPRA 4US0R 1ONBA 4Q4JB 2RAPA 4YMSA 5DO9A 1QHGA 3TMKA 2Q0HA 3A1TA 4U00A 2BM0A 3ZQ6A 3PIRA 2OSBA 5AUOB 5JEEA 4M8NE 3TSZA 1W36D 3SNHA 2N46A 2WWGA 3ZS9A 4LC1A 5KO2A 3UG7A 1CJUC 2WKQA 3E5HA 4QC2A 1E96A 1G6OA 4IEIA 1E0AA 2A7QA 1M8PA 2CDNA 2AL7A 2ZSEA 2FF7A 1NJGA 3ZVNA 4DT1B 2OV2A 4HZUB 2XJ9A 1F5NA 2DY1A 4QGFA 3ZYCA 5H8WA 2G77B 4MYHA 3DKVA 4HAVA 4WZAE 2GK7A 2X2FA 1LY1A 2CBZA 2PMKA 3G5UA 5BN5A 1J2JA 3T06B 2IK8A 3BAFA 4NYJR 1G64A 3IUYA 4ZDJA 2ZRKA 3VTKA 1CEEA 1KTVA 2OLJA 2QG6A 4ACAA 5KNBA 1A2KC 1KAOA 4KHZA 4MGYR 4C3ZA 4NBSA 3BFVA 2WKPA 3IKJA 3K70D 4TN1A 1SKQA 2XX3A 3BH0A 5BQ5A 3LAWA 4PHHA 4AG6A 2XGJA 3NIBA 1G3UA 1N0UA 2AXPA 3L0PA 5J40A 1X6VA 3AVYA 3AF3A 3IHWA 1W36C 4DDVA 3CH5A 3MWYW 4FI3C 2O8FB 1JECA 2WTUA 2EFHB 5IRCD 2FZLA 2BDTA 2WSSA 3TH5A 1TQDA 3LRPA 1FNMA 2BOVA 2I1VB 1KSFX 3B2EA 3W5JA 4CGZA 3KTAB 2OFWA 1DADA 2JLSA 1KNQA 1KZGB 2JJ2A 4TSFA 4C0QC 3SYNA 3RYTC 2F7SA 2LKCA 2C8VA 3AF4A 1AQUA 3AGQA 1S4QA 3Q72A 5DSZA 3NDBB 2WSSD 1GNQA 4TMKA 3BIFA 1JXOA 2JLQA 2MMGA 2YWFA 1IJEA 2A2ZA 1W0JA 1TU4A 1I2DA 2BVNA 2JJ2D 4TSFD 1E2EA 1YR7A 1YRAA 2NPIA 2F1RA 1FUKA 1RRGA 3P26A 1GAJA 1NY5A 2W6JA 2C99A 2KB0A 5F9FA 3SEAA 4XVUA 2BV3A 4KSBA 1CJKC 2ODBA 1ELOA 4WW0A 1N5JA 4ZPXA 5AUNB 4C2TA 2BCGY 4TTQA 1UPTA 5CJPA 4ASUA 1JB1A 1W0JD 1FPMA 5J4HA 3LVRE 3K8YA 1R2QA 4OYHA 4JT4A 2W6JD 5E4FA 2D74A 4YLGA 3KKOA 3PUVA 5KDDA 4Q1EA 5J4VA 2HUPA 4ZDIA 3J81k 4JLNA 1OFTA 3VX3A 4PC1A 2C77A 2OBMA 1E4YA 3MJHA 5CIWA 4ASUD 4RD4A 4YMUA 1N5LA 2NQ2C 3EARA 3U3KA 4DHEA 2IHBA 3EZFA 2P0EA 3U3RA 2IXFA 1U0LA 4IOLA 4NYJQ 4LV8B 1KOFA 4L9SA 2VP6A 2CHGA 2JCSA 2GJ9A 3EPHA 3EASA 4DVGA 3ETLA 1JJVA 1ETUA 3WRXC 4F7WA 3K1JA 2FFQA 1CJTC 4RKFA 1OV4A 3JVUA 4DCTA 3LQQA 4EPXA 1OIVA 1PLLA 1CJVC 1UEIA 4LBZA 4V02A 2GDJA 4ZDWA 4HZIA 2WM9B 2Q3FA 2ZSFA 4MRVA 1EWQA 1GSIA 4HUQB 3SBDA 1OW3B 2V4ZA 5HKKA 3QXSA 2EQBA 4JVLA 1KO1A 3DMNA 1E9FA 1OPXA 1W46A 5H68A 4A4DA 2QPTA 1US8B 2REBA 2R6FA 3Q8XB 3Q3JB 1ZMXA 3GFOA 3EAQA 1P2VA 1TMKA 2B7BA 3QQ5A 3WNCA 3GEIA 4Q47A 2J3EA 1UKEA 3FDIA 4FW9A 3WHLA 1EXMA 5HKKD 4JBYA 4D4JA 2R65A 2NZ8A 1XRJA 5BYKA 1ZUHA 3W6PA 3LBHA 2IYTA 1Z0FA 4DCNA 1S9HA 4UNPA 5TV2A 3HU3A 3OEEA 1KI7A 2K5UA 4M1WA 2IS2A 3SC3A 4G5QA 2QMOA 4BZXA 4RD0A 3I5XA 1YJ5A 4BWYA 1OH5A 3EXAA 2WJGA 4URYR 5JJKA 4A8JC 4DCVA 3OHMA 4WXRA 4HATA 4A8JB 4DCUA 3KQHA 3OEED 5AUQA 4C9BA 3ZLJA 1KMHA 1SQ5A 3CPJB 1IJFA 1DBSA 2P65A 1WBDA 2XXAB 1IN4A 1VCMA 4DIDA 2RGEA 3A4NA 4F92B 2GXSA 1DPFA 2PT5A 2P6RA 2O8CA 1DTSA 4XWKA 2WSMA 2XTMA 5JWRA 1YZTA 4RZXA 1E9RA 3W9YA 4HYYA 1LS6A 4QBFA 2H18A 3Q5EA 4DLUA 1W44A 2GETA 2WAXA 2ZVPX 2ZROA 3I8SA 3SHFA 1F2UB 4IFEA 3RS4A 4MDEA 1KSGA 2WJVA 1MR3F 2CE2X 3IIKA 1CR2A 2WBLC 2P5TB 1CLUA 4DLYA 1F2TB 1E1QA 1DS6A 1A82A 2CMKA 3NDPA 4N3NA 5IK2A 4NYMR 1E0SA 1YR8A 4LPKA 4A82A 3TKLA 3AP3A 1KI9A 2XAUA 1GRQA 2XNSA 4LJ5A 1K5DA 1LV7A 1E1QD 1KNXA 2WJHA 4IOMA 3WMFA 3THXA 1Q12A 2ZE5A 5HE8A 1GDDA 4NP6A 1VTKA 1KO4A 1MO4A 2H8KA 3NHAA 4G01B 5GVSA 2FJUA 5IK2D 4DB2A 3REGA 4OI4A 5TVKA 1KDTA 3QPWA 3SJCA 1G17A 1G1MA 4V0MA 2DWPA 2P67A 2H17A 5CIQA 3R9IA 3AVXA 4M9SA 1AZTA 4PHTA 4QXAA 2VHCA 2OM2A 4FMDB 3VHXA 3CH4B 4B35A 4C0SA 1DO2A 1CJMA 1CR4A 4Q7MB 2CXXA 4KLZA 3DMDA 4ZCMA 3TSOA 4R71A 5B57C 3MAAC 1HV8A 2IYZA 4US2R 5KDLA 1I2MA 2MSCB 3BE4A 1DAEA 4JKYA 2EFDB 4GP6A 3CNOA 2LKDA 4B3FX 1VIAA 1G8FA 2YVUA 2W2XA 2YINC 5L3QB 2V1XA 3AF0A 3C7KA 1IN7A 1COWA 3JVVA 4BE7B 3B13B 2GILA 1S3SA 1U8AA 3LW8A 2ZRLA 3L8ZA 4FN5A 5P21A 2XZLA 1NP6A 3N2IA 3PXGA 2NPFA 4KITB 2ZYTX 1ZU4A 2FE4A 3ZZTA 3KQNA 2KBEA 2PT7A 3NBFA 1P5ZB 1QHXA 4Z8XA 4XTCS 2B21A 1NKSA 1COWD 2IC5A 2O8EA 1Z6AA 2R44A 4WOPA 2CL6X 4B48A 3IEUA 5H70A 1W2HA 1P2UA 3UG6A 3UK6A 3NEYA 4DLRA 4QJ3A 5DLQC 2XNDA 4JIMA 4W5HA 5JFGA 2WMNB 4EFLA 1FTSA 1R8QA 1VHTA 2AWNA 5DE3A 2IW3A 2QRNA 1F60A 1ZIPA 2VH5R 4RFVA 2H57A 3GJ7A 4JVSB 2ZS7A 2XNDD 4BZQA 1TQ2A 2VSOA 4J0QA 1KI6A 5K8UA 5HZHA 1EX6A 1ZNXA 4NYMQ 3V00A 4BZPA 1RE0A 2ZJ8A 3PJRA 1E69A 2ATXA 4CZ2A 3WP1B 3PQCA 1X8JA 5FOSA 1PUJA 1HT1E 4CEHB 3A6PC 5FPYA 3C4JA 3ECCA 1FP6A 2ZUCA 3NBXX 4Q9LA 1XMJA 2FFHA 5GJVC 4RFSA 2V8OA 5DISB 3A4MA 3EX7C 4BLRA 4XH9B 2CJWB 3RRNA 1CRQA 1W48A 3CO5A 1PJRA 2WJJA 2ZRJA 1N3BA 1P61B 3B1WA 3EW9A 3I3SR 3X1DA 4L9WA 3PITA 1XEXB 4OHWA 4G5OA 3U44A 3U4QA 521PA 3RS2A 1KI1A 3CX7A 4POAA 2ERYA 1GRRA 3V9PA 4IJMA 4QOSA 4LJ6A 5EQTA 3BB3A 3EWAA 1JALA 1D2NA 2VP0A 2R2AA 1SVMA 4AKGA 2FV8A 5CYOA 1HT2E 5FOWA 5GJWC 1AK2A 2C2HA 3DVLA 3VKWA 5FBVB 1T8TA 2OT3B 3CBQA 2P6UA 5IT5A 4LHYA 3I92A 2V54A 1TUEA 4D4LA 3CZPA 1KO8A 1L4UA 3AP1A 1FX0B 2X77A 3FHTA 1ZM3A 4DRZA 1NVWQ 2RHDA 3GJXC 2TMKA 1KK3A 1SVWA 4LJAA 2HYDA 4D80A 4JYCA 2GXQA 1YR6A 4UXHA 2OEPA 4EPYA 3GJ5A 2F3TA 3SYKA 4BRUA 4DEYA 1OYWA 1G8GA 3GFTA 4GSYA 3VU9A 3HWSA 1ZUIA 2OO7A 2ZIAA 5J4LA 4JLPA 1U90A 4TT3A 2QMHA 3CF0A 4DDWA 1G8HA 2GKSA 2BBSA 4QGHA 4F4CA 5L3SB 2ZRBA 5G3YA 2V3CC 5CJ2A 4EIWA 5L3VA 1IAQA 2HYIC 3CZQA 1G3MA 3TSWA 3UMSA 4CT4B 4TT3D 1QHIA 2AR7A 4OJQA 3GLHA 2JLXA 1KGDA 1CRPA 3DKPA 3LD9A 5A4JA 1XCMA 2ZAMA 5FBLB 4LX0A 5FH9A 2EFCB 3K0AA 3BC1A 1U8YA 3FVQA 4TZ0A 1JXMA 3R7WB 3ONWA 4IDPA 1Z0IA 2WAYA 3VFDA 1TQ4A 2A9KA 5DH9A 4B3BA 1IONA 1Z0DA 4Q4LA 3KX2A 3HDTA 2XITA 2J0UB 1DAHA 3UKDA 5EP2A 1E9EA 1TNDA 4KU4A 1MABA 5JRJA 1DOAA 3JZAA 1PVOA 1UJ2A 2QENA 1T3LA 5KSOA 3P32A 1RJ9A 1U94A 5CM9C 1FOEB 2Z5FA 1P75A 3SE0A 2KSQA 1EX7A 1II8B 1XDBA 1Z08A 5FTKA 1KK0A 4N0DA 4UNNA 3AVQA 2BHRA 3N5CA 1MH1A 2QL6A 1ESNA 2ANBA 2QTHA 1A4RA 2EFGA 2IL1A 3QF4B 4TMVA 4BFTA 1OXVA 5JMTA 3K9HA 3B8HA 2F1JA 2QROA 1Z8FA 1SKYE 4IW3B 1N6IA 3BJIC 4BFSA 1UEJA 3KUCA 3LXRA 1SZPA 4KJZA 1J8YF 2I1QA 4WBSA 1GP2A 5DN6A 2W0MA 2XZOA 4DC9A 4JSYA 3ZS8A 1ANKA 4PX9A 1P9NA 2ZYUX 5HCIA 4NCJA 1UKZA 2WWIA 1R5NA 3QEOA 5CB8A 3ADBA 1VCOA 3PVSA 4O25A 1XJQA 2ANCA 1FQKA 3KJHA 3QKTA 4LUCA 4ZDKA 5DN6D 4AKIA 2IBMA 2NMVA 3AVUA 3KJIA 1HTWA 1Z6XA 2OXCA 3K0SA 1FP7A 4YMVA 2ZI7A 2ZRNA 4JT2A 4UXJA 4IVRA 4L8GA 2JGNA 4HAYA 4KFRA 4Q4HB 3MFYA 4UNRA 3H4MA 1RRCA 4D26A 1XMSA 2Q3HA 2JASA 2ZI9A 5TARA 2CEAA 1U98A 1LB1B 3SJBA 2G0TA 4ZIRA 2BIFA 3U7HB 5EXSA 3EG5A 4CEJB 1ZVQA 1AJEA 1AIPA 3U7EB 1UBFA 4JBXA 4LJ7A 2ZYWX 3RABA 2X1VA 2B6HA 2QSZA 4FMCF 2ONKA 5D3QA 3T1TA 5FOUA 3H1TA 4D0NA 2XTNA 1G6HA 5BXQC 3VMFA 4TYYA 1NN1A 2IEYA 3ADCA 1CR0A 1C4OA 2EWWA 5KPJA 1Q1BA 4GPTA 1S2MA 1Q57A 4QM6A 5JS8A 1PZNA 3QNUA 1E2PA 2IUTA 3QPUA 4Z8YA 4AY2A 2IA5A 1TADA 2CHVA 2ODWA 3Q5DA 2GZDA 3WHKA 1SKYB 4A0FA 3QSYA 1RRPA 4X8HA 5UKDA 1I4LD 3U6KA 1G18A 5CDFE 4P4UA 5C2JB 1BOFA 1JNYA 3PUYA 2JLVA 1W1WA 3DOFA 2WWYA 2HLDA 2P2LA 3C14C 1E4VA 3UWOA 2AN9A 1KY3A 5KDOA 3TGPA 3UXMA 3I4LA 3RANA 2ZM5A 4Q4JA 3DOEA 2H7VA 4YDHB 1OXUA 3T1QA 4IOKA 4IDOA 2YOFA 1NF3A 4PPNA 4C7OB 4EQ6B 1KMQA 3HR8A 2HLDD 2OZEA 4QRHA 4URWR 3GLFE 2Q9CA 2A5DA 621PA 1U2RA 2AK3A 3KKQA 4OKSA 5IF9A 1F3OA 3ZQJA 5D3MB 1ODFA 4Z1MA 4DXAA 2C03A 2F9MA 2ZJ2A 4D0GA 4UNSA 4LDJA 3U3JA 3ZZUA 2FNAA 3MMPA 1BIFA 2G83A 1FL9A 4ZCLA 2PEZA 3P4YA 4DT1A 1M7BA 2ZTSA 4HZUA 5SZHB 4DKXA 3VKHA 1FMJA 1DVRA 3IBGA 5JS7A 1YE8A 2QN6A 4ESVA 4A92A 4Z1MD 1NKTA 1YZQA 4I1UA 2QEQA 3QKRB 4MKGA 1BMFA 4QGAA 2HXSA 3KJEA 4HB3A 4Q4AB 1RC8A 3KZ1E 2JLZA 4LC0A 1WBBA 1SULA 3BORA 2ZI6A 4IXMA 4IRUB 1L2TA 3TR0A 3RS5A 5EE3A 4A36A 2QP9X 4Q02A 4IOJA 4F91B 1XPUA 5EZ6B 2W2TA 1BMFD 2V9PA 4NCIA 4PSVA 2VF7A 1QG4A 2Z83A 3ZZ0A 1JQJC 3Q7PA 1TTTA 2WV9A 1N0WA 2ZJAA 3BBPA 1RRFA 2DFNA 1Z06A 5TY0A 4GBMA 1K6MA 3MD0A 3U3MA 2BMFA 1XMVA 1P6XA 5CLQA 1W0KA 2O8FA 1Q22A 2WOOA 3I1FA 5CK5A 3B1XA 6Q21A 2IUUA 3HYTA 3OIUA 1AGPA 1SGWA 2XJ4A 1NMYA 4XIGS 1E2HA 4TTPA 3KTAA 3LX8A 2D7DA 1NMXA 1SXJE 2SHKA 4QBIA 4PSKA 1SVLA 2VP2A 2C9OA 3X1YA 1IY0A 1W0KD 1UBEA 3GLFB 2B7CA 5AJZA 3KKPA 5SZKB 2CCGA 2OLKA 5JWHA 4CYMA 3A37A 2RHMA 4MUBA 2QA5A 1ZM9A 2G9NA 1HH4A 2HV8A 2CLDX 4JLAA 1HQCA 1XWIA 3B6EA 3DEFA 1ZRHA 3BOSA 4Z51A 4R7ZA 1XTRA 4JLKA 3CWQA 2WWWA 1OB2A 2GVZC 2QP3A 4A1FA 3KJGA 721PA 1Z47A 1OH6A 2NG1A 4JKIA 1NLFA 2VL7A 4OBEA 2BC9A 1V43A 1I4DD 3WYAA 4DBLC 2PCJA 3OESA 4O2LA 4B34A 1E2IA 4D2IA 2GZAA 1UBGA 1CF4A 2N42A 3TW8B 4BFXA 1EK0A 4C4PA 1VYTA 3BFKA 1LVGA 4A6XA 2G0NA 4WZ6A 4HDQB 1P72A 3K53A 2HF8A 1H8EA 4P3YA 3A1SA 5EZ5A 2A5GA 4LJYA 2OG2A 1Y3AA 2YWGA 1KK2A 2F43B 5E7MA 5DIFA 4PC6A 4KSCA 3L2OB 4NZYA 2IWRA 4QL3A 1JR6A 1A7JA 2OAP1 3Q7QA 2WZQA 3KUDA 4Q9KA 1RYFA 4DLTA 2XOKA 2GJKA 2AD5A 5ELXA 1N6RA 1U0HC 2Y8EA 5EXTA 5FTJA 1H8ED 2A5YB 3W8NA 2O0KA 3HJNA 1Z0JA 3B82A 2IEZA 4TLEA 3I32A 3LA6A 1FNNA 5EUQB 4TLDA 1SXJC 1UDWA 2D2FA 1SXJB 3KXLA 3GFPA 4B6FA 1Q0UA 1P3JA 1G9XA 2XOKD 2QMUA 1XTSA 4HUQA 4TMWA 4UJ5A 3CX8A 3LWNA 3GLGB 4RD6A 5JI3E 3UATA 3BD9A 1R8SA 4A9AA 1KHTA 1LNZA 1US8A 2ZI5A 3MWKA 2CNWA 4CRWB 2A30A 2GAAA 3GJ3A 4JLMA 3SZRA 1HUQA 1Q20A 3PUZA 2ZS8A 2PZFA 3ZDQA 4O3MA 2HXYA 3VKGA 1DG3A 3FWYA 1OYYA 4TQ9A 5GJBA 3A58B 2ORIA 1R0ZA 4C30A 5F2EA 3O47A 2QT1A 1T4GA 2CNWD 1XZPA 1Z2CA 5JEDA 3FYHA 3GD7A 4Q01A 4GOXA 4Q21A 4RD3A 3H2YA 4BLOA 4HLCA 3RC8A 2ZRHA 3AH8A 1DAKA 4HDOB 1GL7A 4RD1A 4EUNA 4JL5A 1JBKA 2A5FA 2ZSAA 2C9CA 2GF9A 3DO6A 1GILA 1QG2A 1YR9A 4A8JA 1R10A 3EZ9A 3FB4A 3LLUA 4CW7A 4P0TA 2WMOB 1JI0A 1MO6A 4NL4H 4V0NA 3C5CA 1Z6TA 2XXAA 2JLRA 2JJ1A 2ZJZA 4EPWA 2ZITA 1UADA 3TW4A 4HLUA 2IHYA 4NHOA 1NIJA 2RGNA 1ZM4A 1BO6A 2AD1A 1KK1A 1E2KA 3H84A 5KSPA 1XEFA 4B73A 3QKSB 3BS4A 4NPHA 2WWHA 4EFMA 821PA 4EPTA 3ZJYA 5CLLA 4Q7KA 2BWJA 3PEVA 1D9ZA 2JJ1D 3SJAA 1F2UA 1G7RA 2DFLA 1F48A 3WP0A 1G5PA 2IUSA 3KQKA 1VCNA 2VP9A 4PAQA 4LPSA 4TTRA 2QE7A 1F2TA 1E3MA 5CK4A 5CM8B 5FBWB 3EPKA 3VR3A 2PJRA 3RHFA 5KSYA 3SYLA 2I3BA 5FTNA 2G1JA 1P2TA 5KYKA 4KFUA 4DSOA 2HT1A 1H65A 4KFTA 5FUYA 3WNBA 2VBCA 1U0JA 1RPZA 1CS4C 2QE7D 3TQFA 2AHOA 4WZBE 3T34A 1E94E 2HT6A 1OFUX 3KB2A 3LW7A 3OIYA 4DSNA 2VP5A 3AKDA 4Q1AA 1X8KA 1R0WA 2ZU0C 1A5TA 1NL3A 2AWOA 2GHIA 4M2LA 2F55A 1XPOA 1HURA 4URVR 3LY5A 2FEOA 1DAMA 5DI3A 3A4LA 4YQFA 3AVWA 2ORWA 3A1WA 2Q9AA 2RGBA 2ZRGA 4EDHA 3PV0A 1XEWX 2QTVB 3SHWA 1Q44A 4IVPA 4HLUC 4OL0A 3SOPA 2RGNC 3RC3A 1K5GA 2CVFA 3K0FB 4M1SA 4DLWA 3U7GA 1UAAA 4C0BA 1N2CE 2ZJBA 5E7JA 3BXZA 1NMZA 4IKEA 1X3SA 4JLBA 1NJFA 4D4KA 5L3QA 3TLXA 2KJQA 2W2VA 5J4YA 2OBNA 3RVBA 2UZIR 3OE7A 2QAGC 4M1OA 1TUIA 3AGPA 5LDDC 2QAGB 1HY3A 1AM4D 1TF5A 1VKJA 2IS6A 1HA3A 3B9PA 5F3WB 1XNJA 4B33A 5FFMA 5EE9A 3T35A 2IT1A 3FOZA 1KDPA 2Z0MA 4ZV4A 4ZCIA 1WXQA 1A2BA 3SR0A 1YZKA 2BJWA 1J99A 5JSZB 1IBRA 1Z29A 2J46A 3OE7D 4LJ8A 4LRWA 3W34A 2UKDA 1WB9A 1AA9A 4MKFA 4LV6A 4MITA 2QBYB 4TLCA 4URUR 1G5RA 4XSGA 1S1MA 4MKHA 4D6PA 3EPLA 3O8RA 1EGAA 2D2EA 2E1RA 2R6DA 3CONA 3AKEA 3LXXA 4PANA 3TK1A 1KZ7B 1S3GA 4JLJA 4CDGA 1MT0A 2ZPTX 4Q48A 1X8LA 2GTPA 3X2SA 3CKLA 2VSFA 4B3CA 4HUTA 4TYWA 1XTJA 4GOJA 1V5WA 2VQSA 4MQBA 3ZVMA 2EYUA 4JMPA 4HLQB 1C1YA 2IYSA 5BYJA 5DI3B 3E70C 3Q85A 2V55B 4OQNA 4JS0A 2ZUDA 1IHUA 4CEHA 2P5SA 3IPXA 4ZKDA 4LSGA 5FTLA 4NTZA 3A1UA 2ZYVX 2YHSA 4F93B 2ZSBA 4KODA 4KVAA 1J90A 2RKOA 2AFHE 3BH7A 1W4CA 1XCPA 3CRW1 3M4YA 4FCTA 1VECA 4O0MA 1FTNA 2O8DA 2CJWA 5B58C 4K81B 3W8RA 2ZI3A 4YONB 2HCBA 3QVUA 2WHXA 5G41A 5TMPA 1XEXA 2NGRA 4QJ5A 4Q9HA 3LH5A 1JEDA 4OK6A 2CLSA 5C46F 3VR4A 2DYKA 5F98A 2CHQA 5AJXA 4PZZA 5IDVA 2ASEA 4M4SA 2D7CA 4AD8A 4MDFA 1T5LA 3B5JA 3TRFA 5C4GB 4FMDF 4PPFA 1XX6A 4JVMA 1RYHA 4PFSA 1N25A 1P9RA 1VG8A 3LBIA 4L16A 3LFUA 1QVRA 1XD9A 3ZVRA 4PPGA 3IIMA 4Q7JB 3RSOA 1FX0A 4I1VA 1G3IA 3BB1A 3UIEA 1NVUQ 2WIBA 4M21A 4B2PA 2ZETA 4IDHA 3D3QA 3U61B 4OQFA 4JLOA 2GA8A 3DPUA 5FUWA 5KOYA 3I61A 4FWIB 1G8YA 1S0UA 2QRZA 1CBUA 3T1VA 4FD2A 4BEJA 2V1UA 1II9A 3KL4A 2ZRPA 1E2JA 2GAOA 2YWEA 3K0CA 4FINA 2BKEA 4R2IA 2AXNA 4RZ3A 3TUZC 5TB5A 4A15A 3I8XA 4OHVA 1W4BA 4GNKA 4LZZA 2ZAOA 4KV9A 2YYZA 4Q1FA 5H1YA 4Y0AA 3F5FA 1XU4A 4ESHA 3NC1C 2A5JA 5G3ZA 2QQEA 4D0LB 4OHZA 3DZDA 4URXR 4GOKA 5L3SA 2OXRA 3ADKA 3KQLA 3G0HA 1KI3A 2IYVA 3E2IA 2FSHA 4BEBA 1DAGA 4OI2A 3BGWA 3IEVA 3MG9A 2UZ3A 3PR1A 2O8DB 3TUIC 5DYGA 4TQAA 4DLSA 4KYIB 3M1IA 3TAUA 1XP8A 1HE1C 3FHCB 4HB0A 1NIPA 3REFA 3BH6A 4P4SB 1Z63A 1NVVR 1QBKC 4E03A 5TXGA 3R7WA 5FOXA 4EJSB 1QF9A 4BFVA 4BLSA 3NC0C 2D62A 2EFEB 1ZP6A 4W9MC 2CL7X 3ZGXA 5AWFC 2J0UA 2FDCA 3D8BA 2NO1A 2CCJA 1X1RA 3HP1A 4G0NA 2BBWA 4NU0A 2RH5A 3L0SA 4X8LA 2J87A 2JDIA 3HPQA 3TUJC 2GZHA 1QZXA 2R8RA 4ARZB 1KI4A 3UANA 1II8A 1X1SA 1D2MA 1EG7A 4GDFA 2AKYA 5FPSA 1WP9A 1N5IA 1P60A 1VDZA 3MRSA 5JCZA 3QF4A 1Z2AA 1ZIOA 2NO0A 1RKBA 2VYFA 1TEXA 3L0OA 3TE6A 2JDID 5FL7A 3K0CC 1A1VA 3DZ8A 3PEWA 1QHHB 1H8HA 2FOLA 3F0TA 1VIYA 1GG2A 1GIAA 5J47A 1WRBA 1GITA 421PA 4FWTA 3MGCA 1S96A 2YJTD 1ZW6A 1E2DA 221PA 5FL7D 2XB4A 5JHHB 3P1JA 2ZANA 3RNLA 1H8HD 3FKSA 2ZRAA 4AG5A 1M7GA 1KI2A 2JATA 4GRAA 2J41A 1XBTA 4MH0R 4AIIA 5JECA 4HB2A 1K8RA 4A2QA 2IX3A 4BPBA 3BRWD 5TDHA 4L4UA 1W47A 1MV5A 1N6KA 2ZVQX 1N6NA 1VPLA 2YC4C 1XEWY 4ZO4A 5KNDA 3AVPA 3FMIA 2QUZA 1GOTA 4R9UC 3FKSD 1IXZA 1TPZA 3U7FB 3T12A 1KJYA 3F8TA 5LD2B 5A0FA 1Z6YA 1XXHE 1LF5A 3NHBA 2VHQA 4IFBA 1SVOA 4PHFA 1Q3TA 4Q4HA 3SN6A 4AYXA 4BECA 1XXHA 3THWB 4DWJA 3AV0B 1F6BA 2GEVA 2QSYA 2QZ4A 1UF9A 5BW8A 1OH7A 4CEJA 4KO8A 4NYIR 5CYPA 3QY0A 4XWOA 1NVVQ 4C0AC 4YXWA 5CB6A 2DFTA 2XB2A 1JAHA 2V6IA 3BB4A 1DAIA 1M74A 3NKVA 1JEEA 2VIIA 2H1LA 2ZE7A 3C8UA 4ITRC 5FL3A 3LV8A 1G3RA 4M9ZA 1P7CA 1D5CA 4PC7A 3Q9LA 1E0KA 2W83A 4K46A 2KE5A 4LJ9A 1SVIA 3CPHA 4LYJA 4YXWD 3BFXA 3THYB 2PCLA 1ZCBA 1RIFA 2QM7A 5CITA 2HF9A 3K9LA 4MGIR 2O8BB 2ZS9A 4H1UA 2NOAA 3SFZA 2Z6VA 4FXPA 2IS1A 4OK3A 2B8WA 3GQBA 1NLYA 1CULC 3LVQE 4B32A 4UNQA 4KBFA 3OFNA 3FMFA 3QI2A 4AK9A 2PEYA 5C18A 1S9DA 2NZJA 4PO9A 3I73A 1IN5A 3C41J 4W7SA 4Q00A 2WICA 4HI0E 2W00A 4A0RA 1L7VC 3ZVLA 2H16A 3IBYA 1AQYA 1TF2A 3ZH9B 1IN8A 4Q1DA 3K09C 1UKVY 4KVGA 4C7OA 1ZUNB 2REOA 4TYQA 4EQ6A 3NVAA 1J8MF 5BWMA 1U99A 4Q7LA 2PX3A 4HDCA 3CNLA 3OFND 5KU1A 4S35A 4TLAA 5FI1B 3QG5A 3VHLB 4D25A 5D3MA 2GJ8A 1UBCA 1E9CA 1FW6A 1R5OA 4ZKEA 1NBME 1XXHB 4HAWA 4M1YA 3QOFA 4DLVA 1S1CA 1E99A 3RAPR 4PQRA 1MRNA 4M53A 2GCPA 2VEDA 5JI2E 4LWZA 4QM7A 2FA9A 2IYUA 1LFDB 2ZEJA 4HB4A 2KBFA 3QKRA 2QP4A 2B92A 4Q4AA 3GLIE 2AX4A 2FSFA 3S1AB 2VLIA 4TL7A 2HJGA 4LHXA 2A3RA 1AGRA 1SVSA 1MRSA 2OHFA 4F4JA 4PQYA 2C5LA 5FPKA 3I62A 2PLRA 1Q3HA 2DB3A 4DB4A 3VR2A 2VHUA 4NYIQ 4TL8A 1E9SA 1MO5A 4QBGB 2BMDA 4RKEA 4WXPA 4P33A 2QQ0A 2RGDA 2REXB 5CDFA 5C1BA 1OXSC 1GL9B 3RS7A 4PR0A 1HYQA 2CL0X 2ZRDA 2GK6A 2FU5C 3MCAA 2YNMA 4LYHA
chains in the Genus database with same CATH superfamily
3AY7A 1KYZA 1FS6A 2SECE 3PKZA 3HEAA 4MIKA 4PTYA 1AUXA 1VLQA 1B6SA 2E87A 2OHGA 3ZNQA 3E35A 4JJ7A 1QAOA 3QHPA 2RSLA 5EE5B 4N6OA 2RHJA 1IZ8A 2Y0DA 1BXRA 1M2NA 3ROPA 3SYMA 1N5DA 4QD3A 5GWXA 1JKJB 4RWEA 1E3DA 1R4AA 3ZGYA 3VQTA 2Q27A 2VRBA 5FNVF 2VTBA 1VP3A 2WYWA 1XZLA 2IXGA 4R68A 4R2KA 2OE2A 3AR9A 3CB2A 3MWLA 3LNCA 3MTDA 3QV1A 5JPIA 1XOIA 4P32A 4EAQA 5AJYA 2AFIB 1R74A 1TXGA 3DB1A 4YJHB 2A7XA 1ZA2A 5EERA 4E1BA 4AJPA 5AD1A 3IUJA 4KUHA 4A8HA 5ESRA 3DE7X 5JQGA 5FR1A 4MQEB 3V7UA 3ACCA 5M5BA 5IJZA 4MNTA 4EB6A 1N0IA 2CMFA 3HFJA 5KTRA 3ADDA 3AJEA 1VSTA 3IQXA 3PRKE 3PGJA 1SELA 2XUIA 1G8MA 1KFJB 2ZUVA 1LDEA 4NE9A 4EO4A 1H9AA 4DANA 3A6ZA 4RVOA 3ZHZA 4EYKA 1VPDA 5HHTA 1I7QB 1OJ7A 1CIPA 4OI0A 4NK5A 4NARA 3LPAA 2QQFA 1UZMA 3IAS1 5KHOC 3DHWC 3E2PA 1QHSA 5LNK6 1B2RA 2IYYA 3WXMA 1YUBA 1PJ3A 2YS6A 1T9ZA 4GI7A 3HR7A 1P77A 4G1CA 5I9LA 4AMBA 1XU9A 4WUVA 3H87A 3F8WA 2Y2UA 2QRUA 1Y63A 2IYQA 3AUXA 3CM0A 3CR8A 4X1IB 1XP5A 3DEHA 3T7DA 3VYRB 4X20B 4AKEA 2YX1A 5HRUA 2NO4A 4KKXB 4GM0A 1KYTA 3KKMA 4QFMA 5DM1A 1E5TA 5C3UA 4TKVB 3NDRA 4JI8B 5E2IA 1HPLA 2QXYA 5HMMA 1NSFA 4AAYA 2HC9A 3EGXB 4N49A 1CP2A 5KYWB 4AIRA 4EA8A 1RXSA 3V6MA 4MV6A 1WCIB 2VAVA 3DMYA 3DPIA 5COAA 4JYZA 1RYDA 1HEUA 1QSGA 4MYRA 3WGTA 4BBPA 4R6XA 4K88A 2H92A 1I2AA 4QICA 2FHSA 1Z68A 3H99A 2PS0A 3NTQA 1IAVA 1SG9A 2J0EA 2ZSDA 4RPKA 5BUCA 3G0DA 2CK3D 4RZ2A 4PS1A 3H1EA 1FZQA 4WXHA 4KIFA 4YCJA 4BMZA 4G5RA 2WJYA 3X1XA 3CA8A 2GEJA 1UKAA 4H9GA 2Q07A 2RMKA 4FLFA 1NI3A 3BCUA 3WGHA 2FRDA 3GRPA 3HSYA 1M6NA 4FS3A 3WLKX 3VAAA 5E7QA 3X2FA 1S3IA 4LF5B 4PIMA 2BHSA 2DWCA 1BHQ1 3ETEA 4MR9B 3V4ZA 1UCFA 3DL4A 3JQ6A 2ZJ5A 2EBWA 3E4CA 1NUPA 4UHBA 2Q1WA 4RD2A 3RWMB 4D4MA 5A5DA 1DEXA 5EWLB 1U6IA 2E82A 2H2IA 3L0IB 3DA8A 3RVNA 3UPUA 8AT1A 1WW8A 4PO8A 4YB8A 2GNAA 1DIBA 2R62A 4FSXA 4O29A 2WV7A 3DF9A 4DLXA 3ZIAA 5ALXA 1NYQA 4UXIA 2Q29A 1V0JA 1C1HA 3K9BA 3WGLA 4F38A 4P7FA 1SD5A 2WF8A 1ZJZA 2O4CA 4C0LA 1WXWA 1ZR2A 3IFSA 4JLVA 4BQNA 1KKMA 4RGVA 2RB5A 4H1VA 1RLOA 3CRVA 1LA2A 3SIPA 5LWQA 5BQXA 1ZM7A 1C8VB 1FJXA 1SVNA 2G80A 1DE0A 2BR5A 3GJZA 3LKZA 2MR6A 5BXYA 2PKQP 2ZRFA 3M9WA 1LK5A 1R6AA 4ZEXA 4AYWA 3HU1A 5JV5A 4P7JA 1H3FA 4O4LB 2IUYA 4MUKA 3U9TA 1L4YA 1TEHA 5JQGF 3OZFA 1QM5A 4BASA 3GJYA 4YMTA 4WADA 4Z49A 1X86B 3NBZC 3R40A 2JI8A 3U4AA 3HBAA 4MYTA 4WFQA 4DTCA 1DAFA 3IXQA 5EP4A 2Z58A 3GW8A 2Q3EA 1MBZA 4FZJA 2PH5A 1E79A 2ZAGA 2Q7XA 1DTWB 3GXBA 4MYDA 1WCXA 3ER9A 4RAQA 5FADA 2DFKB 4QSHA 3SI7A 3K0EA 2NZXA 3L82B 1G5FA 2F8SA 1AZSC 1PFUA 3HPRA 4MHOA 4YP6A 1BGWA 3D7KA 3HG7A 4IIBA 3R8CA 3LQ1A 1P2FA 4N3CA 3U3ZA 2EQAA 2FRDC 5ICFA 2ECKA 3I9LA 2VSXA 3CIOA 4GI1A 4H0NA 1A9QA 3GRUA 1ZUWA 3ABZA 5AT1A 5H16A 1X13A 4DNPA 3WFJA 2V45A 3EVFA 4AJNA 5I4IA 2AQ8A 5KNCH 5HTOA 1LRKA 2JARA 1ATIA 4CMBA 1CSEE 1XTIA 2VRNA 3VI4B 3LFTA 3RM3A 8ADHA 3D6TB 4DJ5X 4Q1BA 2BEVA 2GZRA 1EX9A 5IAKA 2PTGA 4DLZA 4YDSA 1ORIA 2W2LD 4G4SP 3UT5B 2JGKA 3U39A 2QU8A 5M04A 2VZ9A 4TX1A 5JW6A 2DP4E 1M2HA 3SFVA 4IDNA 1Y48E 1HDOA 3BICA 3QBTA 4CR6A 1MC5A 3C8ZA 4R2HA 1WQ1R 4TQGA 2JLYA 5HKAA 5HFAA 1WXGA 3L01A 4V0LA 1KE1A 1OI2A 1PS0A 4RHEA 3FVWA 4Q6WA 3K70C 1YQQA 2VF8A 4FLMA 3VR5A 1WDMA 4L27A 3K70B 2QT0A 5BN5B 2RCNA 4MRRA 4PAMA 2PPVA 3OA0A 3P9KA 3QXXA 4MV3A 4J0GA 4U7DA 4BXOA 3DDWA 1H1LB 1ORVA 2CE7A 3L7AA 1I4TD 2OA0A 3RH0A 3HXLA 5BWNA 1O0CA 4B76A 3A04A 3ASZA 3JTMA 1T91A 1FRNA 3CF4A 2CBGA 3FBTA 3KDSE 3HU5A 4YFVA 1XRLA 3H2JA 4GMKA 4NZPA 4NZOA 3B1VA 4MYCA 3H6HA 3L41A 4CVNA 4JUCA 2DBQA 2PANA 2WDZA 3ES9A 2AF3C 2ARKA 3ORQA 1VLZA 3H7IA 1A0OA 3OT5A 1OAAA 2HQRA 4FHGA 4JK3A 2QNIA 4D3YA 4ZYLA 2KS6A 4MWDA 3IT3A 4CKZA 1WHTB 1N1DA 1WNTA 4LQCA 5DMXA 4DW8A 5TQ0A 5BNWA 1YB7A 4QG3A 1WMAA 2ATVA 3HACA 4J0DA 1K86A 3ZXXA 2A84A 1Q95A 4TTVA 4RSGA 4BGDA 2V65A 5JSZA 1YRBA 2D1SA 1DP4A 4LTMA 4C6HA 4BC0A 3VA7A 2CEKA 4NAVA 3CR7A 1O1YA 3QFRA 5B3AA 5DYYA 1ESMA 2IP1A 1NG9A 2QBYA 1RXIA 2YMMA 4H7DA 1H1DA 4ISCA 3S3TA 2BGIA 3KS9A 4GW3A 4HN2A 3G5AA 1TK3A 4Y6SA 5FNVA 1Z16A 4BMSA 3LVBA 3C1OA 5K5EA 2AJDA 5BMVA 2R6CA 2G70A 1TO2E 3EQ2A 1O2DA 2ZU6A 1ZN7A 3X0DA 1LFAA 3Q2IA 4RU1A 2ECFA 4QYWA 2HMAA 3BK1A 3GYGA 3OTQA 3RF7A 4ACBA 3B3FA 3ZCTA 2CVOA 4EKIA 4Y6QA 2B4RO 3MWGA 5GIPE 3SQNA 4WVFA 3IKLA 2HREA 2VN8A 1N2GA 4TMFA 1M1YA 3B8EA 2JJQA 1XVVA 3RC9A 3B9QA 3CLTD 3K1TA 4RKQA 3WLQA 3BMOB 1J7KA 2YS7A 3G8BA 2DH5A 1W4ZA 4D96A 4DDUA 2VDRB 2ZBVA 4BVBA 4TMZA 2CXSA 5KTKA 1BWPA 3S99A 3UH0A 3KB6A 1E2NA 1OLXA 4FN4A 3SU8A 4NG5A 2AX3A 2JGLA 2EW2A 3OBIA 1AA6A 2FX3A 2MMCA 3D81A 4ILEA 3I58A 3B6MA 3PRHA 2AG6A 4DLBA 2BCEA 3LSYA 4AQDA 4TV8A 2X7XA 1YL5A 3BWBA 5KVVA 3SZUA 5KJEA 3N8NA 3ZUGA 1IXYA 1SAYA 4QUJA 1QHNA 4IF6A 4KWEA 3F4BA 1UZAA 3R6GA 3EULA 1HSOA 2JFNA 3UJPA 5IVKA 3DNPA 3WK8A 4B6JA 3RJZA 1LW7A 1PHRA 3BMNB 5C80A 2IYAA 1FYEA 1BE0A 1LF0A 1EDDA 1OU0A 1NWHA 2J3IA 4XJXA 4RKRA 5JBQA 2FI1A 2VDNB 1L5SA 4HNTA 5CMLA 1DEOA 5B37A 5BSRA 3PGMA 1L7MA 4LX8A 3NW9A 4IS2A 1ZVKA 2VC2B 4E7PA 2GM3A 5ALSA 5JPDA 2XA1A 2ZQYA 1Q6ZA 2IYLD 4JL8A 5TPWA 5IH3A 3NXSA 2DBYA 1T3TA 1Q7RA 4BRWA 5K7SA 4L0QA 4PZPA 4XGIA 5BQPA 4RA9B 1H2ZA 1J9EA 1YKFA 3B1ZA 4QXQA 3WK6A 4BMCA 4CV0A 1ISIA 1L6IA 1PGNA 3GGOA 4YRNA 2O6LA 3R9WA 2QTRA 2UVQA 1WE2A 3B60A 3TAHA 4H7IA 3TOSA 3EXG1 4WCVA 1VMEA 1IM2A 1TEZA 1FA9A 5DV9A 2M1XA 4CCSA 2VI5A 2FPIB 3LLSA 3DWFA 4W63A 1M1YB 3T5CA 2Z2JA 1F20A 2OFOA 1YZUA 3KJXA 1KJZA 2J48A 3SQWA 4HEHA 1YK0A 3I37X 2HCTA 2I8AA 4GC5A 4TV9B 4F11A 1KF0A 1MN6A 1I14A 2WD9A 4KGZA 1Z6PA 3AM1A 2ONCA 1BS1A 2H52A 1YA8A 3LT4A 3PI6A 3ZDCA 1DRUA 2O1SA 3GFGA 2W2KA 1VG1A 4WX2B 3P9YA 1PGJA 1E62A 3IBFA 5A02A 1P91A 4AY3A 4BFYA 1VRCA 1WDLA 2MSNA 1HRKA 3L8YA 4TV8B 3B12A 3TBKA 2I6TA 3VKUA 3OA2A 1G19A 4UM9B 2XOXA 2O3RA 3IXLA 2B4AA 4X3OA 3UWPA 4AURA 3ZQ4A 2QIOA 1Z82A 3HJGA 4KTVE 5BMVF 3LO8A 3LPMA 3PFKA 2BGNA 4YN3A 5E95A 3PP8A 4YV7A 3LCCA 4ZO6A 3NGXA 4I81A 5K0SA 2PUVA 5JDCC 1HDGO 2BHTA 1M34E 3BWXA 5FOQA 1MJNA 2DWOA 3L79A 3Q10A 4TQUS 4MV7A 4YWJA 4NRDA 1QNFA 2VTVA 3L7NA 5U4XA 3DVRX 3GMSA 3HI6A 1PSDA 1SUEA 1Z0KA 1JJ7A 1UWKA 2CDRA 1WCV1 3QE3A 1J5XA 2R96A 1IWPB 4OJKA 4UFOA 3MT8A 1L5WA 5T6BA 5BWOA 4E11A 4L6CA 1Z83A 1CVIA 3SWWA 2R6R1 3LCRA 2TMYA 1DJMA 2RHRA 3U4HA 3KU1A 1R27A 4E22A 2VRCA 5KYXB 2A4KA 3KJQA 5AHRA 3PDWA 4ES6A 1PR5A 4IP0A 2RG1A 4HDAA 1QHHA 1V8BA 1EESA 4W5RA 4N12A 4AULA 1L5HB 3SFTA 3WGYA 1GAQA 2REQA 1P1KA 3EXHC 5FWDA 3VNUA 4UUAA 3GH1A 3EXHB 4B71A 1VLLA 2FMIA 2IEIA 3CX3A 3RFUA 5REQA 4YROA 4CM7A 1U8UA 1X94A 5BUSA 3EISA 4R1OA 1SJ9A 5KCMA 1JHMA 2XZTA 1VYVA 2ZFUA 4L4XA 3UFXA 4BFUA 5DHTA 3TNYA 3UENA 1ZGGA 2OZLB 2QORA 1M7HA 3CB4A 4BLPA 2QL7A 4OG2A 3BHIA 3IUNA 1XLVA 4KMRA 3D7MA 1TKBA 4JC0A 5JJLA 2XW6A 3L8EA 2P2DA 4LRQA 1A8PA 1V47A 1II0A 2Y1OA 4P1ZA 4W5JA 4E31A 1EJ0A 4LCBA 1WOYA 1SCAA 2ID9A 5LMUB 1SHLA 5AI8A 5F1OA 3TOXA 1QIDA 2C96A 5J4KA 1TIBA 1XPJA 2GF0A 4F1JA 2J0QA 2CLCX 5CYGA 4F4IA 4YPOA 1GR0A 2ADMA 4LTNA 5GVRA 1CEXA 3E0QA 5IAJA 4EF5A 2AW3A 3FGZA 3U31A 1T6NA 2G4LA 3R3JA 1ZU5A 3HDGA 4P4TA 4QOJA 4RPCA 1ZNYA 4G36A 4MJ7A 2GXUA 3JVDA 3KEGA 4K26A 3W6NA 5AESA 3M6XA 3QUTA 3W4JA 3R9XA 4K3UA 3OCJA 5C34B 5LZ5A 4ARBA 5BN3A 4OX9Y 3ZCQA 3QFCA 3OTOB 3UJ9A 4D02A 1LPPA 5DNDA 5FPPA 1N5KA 3U40A 2O8EB 5GTDA 3OZUA 4ND2A 3W3AH 3SNKA 3WYFA 2E48A 3IHLA 2EW8A 1N77A 4IGAA 2PUJA 4AZSA 5TEVA 3SVZA 5IANA 3TMAA 1NW3A 3CU5A 1KJWA 1H05A 2JCBA 1FDIA 2GWRA 3GCZA 4K6CA 4OXQA 3AY6A 4DDTA 4REQA 2REQB 4KVFA 1W2GA 1WHSB 4C5AA 1K75A 4BV9A 1YRWA 5K2OA 4CN9A 3HKBB 2Q49A 2JA1A 4M46A 4YMIA 5JANA 4AWXA 1KSJA 2XSZA 3GOHA 1TM2A 1T8SA 4XUEA 4XD2A 4RJJA 1ZI8A 3TD9A 3KSBC 3RS3A 3BHMA 3UNXA 1JKFA 2J7PA 2Z2IA 2VH1A 2VO1A 1Y8ZA 3HB9A 1KI6B 2ZT6A 1GU0A 2RIPA 4GXQA 3RRFA 1TU0A 3CKMA 4P84A 1EFPB 5A5VA 2X9VA 5I3CA 3FBGA 4GWLA 2HWUA 1FBNA 3RKUA 3SZOA 3L1JA 1K68A 3H7AA 2C95A 1BW9A 3IJ5A 4I19A 5A1JA 4XWAA 4TMTA 1RVV1 3R6LA 5BSUA 1QE5A 3JSXA 3LT2A 2Y1KA 4DCPA 3N07A 1Y1QA 4Q4CA 3TLCA 4WBNB 1OCEA 1LTQA 4KGVA 5HBRA 3RS8A 1C9DB 1QPBA 5JYBA 2H4FA 1GY8A 1PR2A 3ER8A 1YZNA 4DQKA 1GDTA 1S8AA 1GARA 5G2OA 4O2RA 3CUUA 1T2NA 2O2CA 4Q3OA 2FSGA 2CVHA 3SQXA 4N5LA 3PXAA 1TO6A 1UK7A 2QWXA 2I4NA 4ZOLB 5EWJB 4EAAA 5B12A 3TBHA 3D8HA 1GCGA 2XUHA 3QVLA 3E7PA 4Y6LA 2C7OA 1KO5A 1GAEO 2QLNA 2VDWA 2XCOA 3HJAA 3V8NA 3SMQA 1TJNA 2QMQA 3BIWA 4HQFA 1HYHA 5AR1A 2ISCA 3LFHA 3LP6A 5ILQA 1XCGB 2GKGA 4XYLA 1CUFA 3IQWA 3N8DA 1Q21A 2F62A 4F12A 4JC4A 1LDYA 2Q0SA 2BFDB 3N05A 2H0AA 3ENNA 3I9JA 5L51A 1JIIA 1YU6A 3QFFA 3CLVA 1DBRA 2GN8A 3C7DB 4XJVA 4DIFA 4BKMA 4V03A 4LQ4A 3KBOA 3DDUA 4TTTS 4L74A 3UMFA 1FFHA 3S4YA 1FBTA 3QVVA 2YN4A 3CY6A 3T5MA 4CLDA 1XZNA 1TZKA 3DV0B 4C5BA 2JC3A 5KSWB 3LC7O 4ARVA 1JKXA 4YJGB 4AO8A 2WA1A 1L4BA 3O75A 1F8FA 2DVMA 2HRDA 4EABA 2BSQA 1W4RA 4GBGA 4Y2RA 2R4UA 3RARA 3MS7A 2AN4A 2IWHA 4BMYA 2P7HA 1ZKMA 2J4FA 2PXCA 4JL6A 4MPRA 1NHWA 1UMDA 1NNI1 2GLUA 2WUEA 1W7AA 4ZEOA 1EUCB 1T9GR 3KE9A 4UBIA 4F85A 2YWDA 1CZLA 2PR7A 1S7CA 1ECLA 1QH0A 1RJGA 2FWIA 5CTAA 5JHGB 2JBAB 3QKUA 4S0XA 2JEZA 2C5FA 4B43A 3I4CA 4MI3A 5ICCA 4CR8A 3V8MA 4FMCB 2ODNA 4FCWA 4QG7A 5ADUS 3TR5A 2W2MA 2UYCA 1TK2A 2GPJA 4ZCTA 5I7OA 1A9XA 3KQYA 1I7DA 4DA6A 3OQNA 1VLVA 1GT91 2G25A 2ODPA 3GLHB 1U02A 1ZG3A 4REOA 2GHTA 3DM9B 4GT1A 3QE2A 5I5GA 4YR7A 2YHBA 3HO1A 3OM8A 2OZPA 2NVUA 2R87A 5HE9A 4V0KA 2C7QA 1SK8A 2Q45A 5H80A 1NT2A 2J5BA 2H9IA 3QVGA 1DKMA 4UOEA 1LSOA 3ZWVA 2IGTA 3AEXA 5DVZA 1NBMD 2ZUBA 4ER5A 3IV6A 4PW0A 4R31A 1AKEA 4F3KA 1GWNA 1YZYA 2P6PA 2XMSA 4IGFA 4F8JA 5ECWA 1JQKA 3JVEA 5AJTA 5D7BA 4V38A 1MABB 2BEWB 4H6PA 3V9AA 5AJHA 2R6JA 1KY2A 2VTKA 2C42A 3DMGA 1FFGA 3ZWKA 2C9ZA 2EYQA 1KKLA 1V1JA 1RQLA 3MLAA 4G5HA 3SSAA 2I6XA 2RK4A 2DHRA 1XVIA 1NN0A 3EZ7A 4W6ZA 3Q7SA 1GLVA 4H08A 1NASA 4GE3A 3IAAA 2DZDA 3DNFA 1NE7A 4RCYA 4ZOEA 5AKIA 2QW8A 4UHJA 3PC8C 3SXPA 1VIDA 3DXYA 3TOVA 4EG6A 4MI1A 5DLDA 4IUDS 5CBPA 5DGTA 2H1FA 2R66A 2BZ1A 2DFPA 3DW3X 3GFFA 3N86A 1CQPA 2Y1GA 3NS7A 1KEWA 3V3TA 4HT3B 3L1VA 2RGGA 3NT5A 1R6BX 4UPDA 1GNVA 1JQ3A 2WTNA 4F3RA 1J33A 2P9HA 4UTPA 2AUTA 5J58A 1OX4B 2AEJA 3KJFA 3LP5A 2CY0A 3HFGA 3JD1A 4QJ4A 5AKZA 3X44A 4W8HA 3UAYA 4Q05A 4AKTA 4AS3A 2D0OB 1SURA 4YAEA 1XKLA 1AVTA 2ZE8A 3D0KA 3H1AA 4G25A 3LNTA 1UT5A 1Q91A 4KK4A 3TQRA 1CU1A 1VJTA 3BK2A 4NMMA 2C04A 3FB1A 3FFWA 3MOIA 1SBIA 4S1WA 121PA 1ZJ5A 4JLSA 4MVCA 1IEXA 1LK0A 4RPLA 1EGMB 1U80A 2EL7A 2V59A 1YR3A 1SXQA 3H0KA 1UPCA 1E8NA 1VMDA 1XRNA 1DEKA 1NUTA 2DBVO 1FXUA 2QGNA 2FR8A 3I34X 1FX1A 4XVHA 5EXXA 3W6ZA 1DXHA 2CUTA 1V11B 5L3RA 2C92A 1RFLA 2PS3A 4HLDA 4UREA 3I9FA 3MWDA 5AM0A 2GCOA 4EI7A 1JR3A 4FOPA 4G2NA 2JIZD 4BNUA 3UOWA 1E1DA 2GEFA 1SU6A 2XVYA 4LZPA 4URHA 4X3PA 4R0VA 1WETA 2NXNA 2HEGA 2EU8A 3GNLA 4QHYA 4DWOA 4X62B 1EWVA 1A9RA 4U63A 3G1WA 2PU7A 3LYUA 4FU0A 1YD7A 3T5PA 4ZEVA 4XQCA 5TPZD 4DCSA 3CNBA 1ZITA 4E12A 4MP8A 2JCXA 5DLEA 5F7XA 1SKMA 1JQ5A 4B81A 2Z1NA 3NTRA 4F9EA 3JV7A 1UJ5A 1Z28A 1U5AA 3WY9A 4L5BA 2A59A 4JXXA 3KDAA 2B99A 3O3CA 4H15A 2JAQA 2P9FA 3C39A 3EWNA 4CV1A 1W4AA 2W6IA 5DW3A 1HO3A 2HA2A 3GA5A 4D74A 3OZVA 2QJWA 5CDSA 3V8PA 3EUEA 3X1KA 5ERYA 2J9XB 1TVCA 4R3WA 3OE4A 4OQDA 1Y34E 3RRYA 2APJA 5DK4A 5I5EA 3THOA 4KMMA 4LVNA 1KJ9A 2JIPA 2WF6A 4OHXA 5L8VA 1Y5NA 2VJQA 4FEEA 4ETNA 1DIRA 3T38A 5DGDA 5EUBA 4IYJA 1ZMTA 3C16C 4JJAA 2EF1A 1EJ6A 3IIIA 3OOWA 2DQSA 1L5KA 1PEYA 1I7LA 2H4HA 5AFSA 1FY2A 4PO1A 4FR5A 1DUIA 4KO3S 2EBHX 4X1KB 1ONBA 2FZKA 3QOWA 4YMSA 1FPQA 2NZ2A 4D42A 2I62A 4J2OA 4QAJA 4DV5B 2FR8C 3AONB 5DRTA 3V2HA 4PGHA 2P7IA 3ZQ6A 3PIRA 1QVZA 2VWHA 3CG0A 4DKJA 4HV4A 3LHIA 3PNMA 4LZAA 3Q3EA 2YHIA 3D4OA 1W6UA 1FTYA 2IVZA 3AW8A 4BCCA 1VCHA 3GLUA 4Y98A 3UOGA 1FJ2A 1QPGA 4LC1A 3I2JA 6ADHA 2IELA 1NXVA 3UG7A 1DG9A 1E1NA 1QG0A 3BGOS 4RGBA 3UYKA 3UK1A 1JUDA 1E96A 4IEIA 5AVQA 5KYTA 1E0AA 1C7QA 3DE0X 2QTBA 4ND8B 4R3NA 2ZSEA 1UDRA 2FF7A 3I6BA 4RK7A 1RBMA 3EGDB 5CXSA 5D5QA 4EUHA 5K4HA 5DEOA 3T9AA 4KREA 3OETA 1J8QA 4AJEA 3MERA 4ITVA 2G77B 3CYFA 3HYLA 4WD3A 2Y6UA 4MYHA 1X3LA 1FSZA 1FDVA 1DQNA 1LU9A 2P4HX 1R9MA 4WZAE 5EHNA 1DWOA 4JXJA 4PF1A 5FUMA 2VJBA 3J7AC 4FGKA 1XMXA 3C4QA 5F3RA 3SIXA 2XKKA 4CKCB 1MAAA 3WWCA 3VUEA 1G64A 3M4ZA 1GCUA 2VBFA 3IUYA 2AOVA 3R7FA 3RSFA 3CVWA 4J0KA 2I0FA 1XZIA 2OLJA 5HFNA 4DQVA 5U1PA 1A2KC 4K6GA 4YCDA 2KM1A 2XWBF 2WKPA 3AEQA 3ZPXA 5IDQA 4IX9A 2A33A 3P2OA 3KEQA 1G3UA 2W98A 3A7EA 3A9VA 3L0PA 3ZQUA 5J40A 1A69A 1IM5A 2BZSA 1X6VA 3CUWA 1NVTA 3L4KA 2XBLA 2RGWA 2LXNA 3IHWA 5KX5B 1I1HA 1ZJJA 1VBFA 4GKAA 1NF8A 2ZIEA 3T9BA 4F21A 2EX0A 4DA7A 1V8FA 2VPWA 3ROXA 1RZRD 1RPAA 3U4CA 2R68A 3LKBA 3OQJA 3RVDA 4J2HA 4JXZA 3BT7A 2YJ3A 5FBHA 3TG8A 3SC2A 2C3YA 4AMUA 3KTAB 3DAOA 2IIVA 2OFWA 4H18A 1T24A 3ORFA 1QH8A 3AFOA 4DQ0A 1TDJA 1KIAA 3P0JA 3E9RA 4JYMA 4TSFA 5IN4A 4LCEA 3RYTC 1ITZA 2LKCA 2C82A 3NJ8A 1D5WA 1M6VB 1VI2A 1J25A 3AGQA 1T4CB 3Q72A 5DSZA 4LMPA 3STWA 2WSSD 4YT4A 4DUZB 5F12A 4J91A 2EZ9A 4A2CA 3O1HB 2X5KO 1PNQA 4OU5A 1QK4A 4G4IA 4FZ5A 4YI5A 3EOZA 4YRFA 2YW9A 2BSXA 5CAEA 4TKUB 2BVNA 1P9LA 4K2HA 1YRAA 3FUTA 1ZOOA 2NO5A 4GO1A 3HB5X 4GOND 3SEAA 3FUCA 4KSBA 3T7IA 1W25A 2ODBA 3OH8A 4TKLA 3LDFA 3IVGA 5DXFA 3P5SA 4B5KA 4Z53A 3AL0C 1XV5A 3A6LA 5CJPA 4EW3A 1JB1A 1BJRE 1W0JD 3GAFA 3LVRE 3OFJA 1E1MA 2AH5A 4MQUA 3FSGD 1RWQA 4GD3Q 1R2QA 4OYHA 1TCCA 2W6JD 1BEUB 4LJLA 3KKOA 3Q1LA 5KDDA 4JB0A 5J4VA 5B6JA 3J81k 3VX3A 5FKJA 4CKWA 4WGGA 4PC1A 1EVYA 2OBMA 2OCLA 4DM7A 1RJWA 3MJHA 3TECE 1JEQB 2VBIA 4OLBA 2V03A 3B9BA 3FI0A 3I83A 5KJFA 5IJ9A 1C1DB 1M2FA 1N5LA 3H83A 3EARA 4DHEA 5HS4A 2P68A 3MMSA 3EVDA 2Q6IA 3PVZA 2QRPA 3UK7A 4LV8B 2VP6A 2WPNA 1F8UA 3EASA 4WLOA 2WB2A 3WRXC 4F7WA 1ETUA 1LJLA 1O95A 2VCYA 4KQIA 3TIVA 1LZKA 4GNRA 2XYHA 1EDEA 1GJRA 1HFEL 5P8WA 1X7ZB 1YJCA 4GMFA 2VHVA 1N2JA 3DR5A 1OIVA 4RTNA 2G9ZA 4ECEA 1CJVC 3PCTA 2GBCA 3LLVA 1WWKA 5D87A 4NWIA 2I9PA 1T3ZA 1T8WA 5HKKA 4INAA 4J9UE 4QUHA 4JVLA 1KO1A 3DMNA 4RL6A 3D8NA 1RPJA 2PX8A 1NNUA 1NW9B 3A1CA 3HRIA 3KB8A 3IJPA 4TXNA 2JI9A 2HHCA 1ZMXA 1FJGB 1A88A 1NXTA 7REQB 3GEIA 3FDIA 2P6OA 2QYTA 1NXPA 1PU2A 3TX6A 4MLDA 4OA5A 4R51A 4D4JA 1ST2A 2YY5A 1BD4A 1U28C 3BGSA 1UP4A 2CKMA 3LBHA 1Z0FA 1YQDA 5FRDA 1OYOA 3UTCA 3WLMA 4DCNA 2B2CA 1XWWA 5TV2A 4DR4B 4PFJA 3OEEA 3N74A 2OHOA 2JHFA 3C3WA 3Q2OA 3GP8A 4MEBA 3G0OA 3EVGA 3K9CA 3AWIA 5ENVA 5EQDA 3SC3A 4KFCA 2IS2A 3J80A 1QC5B 3DAHA 2OYSA 1F2DA 1P8AA 3GT7A 1DKRA 4EHLA 1AHHA 5ALTA 1VIMA 2DF8A 3QLVA 1XDZA 4BBJA 3AKZA 1QP4A 3G9ZA 3GEBA 2X4GA 4DCVA 1NYLA 1XTTA 4K05A 4KGDA 5HJ2A 3OWHA 3ROKA 5AUQA 2OXIA 4C9BA 2QRLA 5FFNA 1YGPA 3NAMA 1MV8A 3NIDB 3SKVA 1IJFA 3AI7A 1DBSA 2P65A 3TMYA 5L45A 1VCMA 1VKOA 2QYSA 2VATA 1QB7A 1O95C 3QUQA 1DPFA 2P6RA 1PJTA 1ZZEA 4KXMA 3E05A 2O8CA 4RVNA 3NWPA 4C6SA 5JWRA 1BMDA 4M37A 1AKRA 4RZXA 1E9RA 1LS6A 2H18A 3DFKA 4WI1A 2BY4A 3Q5EA 4DLUA 1W44A 4OB8A 1KZHA 2GETA 2WAXA 3ONNA 4KPGA 3M1YA 1OBCA 3I8SA 1NDQA 3TO5A 2PSFA 1QYDA 1S5PA 1MR3F 2RAUA 3IIKA 4NPAA 4P58A 5TT1A 3KLNA 3KCQA 4AY6A 1IZ0A 3TL3A 3WRYA 4O4HA 5LLTA 2JIQA 1DS6A 4KRGA 5FLYA 5GM2A 2N0SA 3G2OA 3RWBA 2JFYA 2C9BA 4CR7A 1W73A 3OCWA 5IDYA 4HGOA 3M33A 1DQRA 3Q5GA 3DMTC 1XVTA 1D2RA 1P39A 5IK2A 1HDRA 1YOVB 1E0SA 5EN4A 3AP3A 1GRQA 1DC5A 3M3HA 5TGDA 3PSHA 3K6SB 3VV2A 3THXA 3LXMA 2I87A 1U2QA 3CE6A 1VE5A 2NVOA 4Y2XA 4AUMA 2CSXA 1EP2B 2YVQA 3B2QA 3WKEA 3EBLA 2I76A 4MRAA 2V7EA 5HE8A 1E3EA 3KHKA 3A4YA 1QH1A 1G5HA 1RQGA 2GN2A 3E9CA 3VU1A 1KO4A 1QYVA 2ZBPA 4G01B 1GPUA 3BE6A 1GZDA 3H65A 1GPNA 2DLDA 4DILA 2X8LA 2XRZA 2YZMA 2H4YA 1EKXA 1WABA 1EM8A 3Q15C 4G9GA 4P38A 2ODTX 2H17A 1CUYA 4V0MA 5CIQA 5ESWA 3R9IA 4QXAA 4C0SA 3CUTA 4DCOA 2RHOA 3ILSA 1JP7A 1CJMA 3QUCA 4KX5A 4N7JA 4O1IA 2CXXA 1ST3A 3DZFA 5HK8A 1ZBQA 1DKUA 5C5IA 4R71A 5HVNA 5IT4A 1H6AA 3DE1X 3E23A 2IYZA 3Q98A 1GPKA 3CURA 3UCEA 3BE4A 2XQJA 4F72A 3FY4A 5JZBA 4U3JA 1EFVA 1JIVA 4GP6A 4UTXA 1WKCA 4ZTUB 2LKDA 1NDHA 2KHZA 3A9CA 4DMFA 3QU2A 5FYQA 1H3EA 1DUVG 4HBZA 2V1XA 3C7KA 1IN7A 3JVVA 4I8DA 2P4UA 4ZT6A 2GILA 1S3SA 4FPXA 4IDGA 3RK4A 2EF0A 4YTEA 5JH7B 3IB3A 2P2ZA 2POCA 2UVPB 2VFAA 3N2IA 4X6YA 2NPFA 3PXGA 4ZYUA 2ZYTX 4MICA 3FPLA 1SU7A 1C0EA 3NBFA 1QHXA 1KARA 4G1VA 2VJOA 3ILVA 1J49A 1OUMA 5E38A 3ZHSA 2ZTMA 1COWD 2IC5A 3GOQA 1JDBC 5CLIA 2CL6X 1F0PA 1JDBB 4X95A 3FLMA 5L4NA 2FDXA 3OZGA 1W2HA 3UG6A 4Z2AA 3NEYA 1ILEA 4XZ3A 4DLRA 2RH8A 4QJ3A 2H63A 4JIMA 1MOQA 4BNDA 3O0DA 7AT1A 3WTCA 1ULSA 3CISA 4TRRA 1R8QA 1VHTA 5DE3A 3EVCA 4UPVA 3STVA 3QYAA 5ICEA 5IZCA 1QIKA 1VA4A 3N6VA 1QK5A 2H57A 1YB6A 3TKYA 3T9EA 1GG8A 1QYIA 1NJ5A 4NENB 4CKBB 3BTUA 2PYZA 1TQ2A 1X1EA 3LS2A 2Y76A 1PSZA 1TTTA 2GASA 4L5JA 4HTAA 3WIUA 1A5ZA 3V00A 4DR1B 2ZJ8A 3H13A 5LQCA 1X14A 2BGMA 2H5IA 4RTKA 2J5QA 1X8JA 3PQCA 1TLFA 1E3QA 2HFJA 3A6PC 4O4HF 5FPYA 4FFPA 1K9SA 3HCRA 1PEDA 1A9YA 3NBXX 4TWAA 3RYIA 5KKCA 4ML3A 1X1TA 1XMJA 1YVUA 1WSWA 1I1NA 4G1EB 3HCEA 1PVDA 1SKUA 5KJ6A 3MHPA 1VL5A 1YFKA 4EW6A 4GAEA 3UW1A 3A4MA 4KH0A 4KQ2A 3RRNA 1CRQA 4R0MA 4AICA 2NV0A 1JFSA 4KPFC 1WY7A 1P0MA 2BFBA 3WIEA 1EGVB 3R7AA 4HX2A 2MOKA 2GT1A 4QPCA 3BQNB 3EFOB 3PE3A 4FGUA 4OHWA 1Y7IA 1VHWA 1T4MA 3GCXA 3P0FA 1GQSA 6PFKA 3RS2A 4F4DA 3GGDA 1PT9A 5ICSA 2G4VA 5TS2A 2VAXA 1OWLA 4POAA 5C37A 2JD2A 4ZGWA 2VPQA 3BDIA 3CKKA 2X2OA 2I4RA 2VH2A 2VP0A 1Y6GA 1SVMA 1SBZA 4LCJA 1HT2E 4XJTA 5JATA 2OCDA 2FF5A 2MYPA 3W5VA 2A0FA 4YRCA 3RKRA 4Y6GB 3ZE7A 1NV8A 2QYOA 3UXHA 3JR3A 3CBQA 3ZY6A 2P6UA 5K3EA 3F5QA 5IT5A 4LHYA 2ZDHA 1MB9A 3OP1A 3PFWO 3FDZB 3FHTA 3CZPA 3DVAB 4LSMA 4EG1A 5CFRA 1SRRA 3GJXC 3BWVA 4OPMA 3S2YA 1YDEA 4FYWA 1SVWA 4LJAA 4IAOA 4E21A 4PRKA 4D80A 1M67A 3VGPA 5IKPA 1YR6A 4UXHA 2OEPA 1JHAA 1CY0A 2Y1CA 5TC4A 3NNNA 5F7JA 3ESCA 4GSYA 4WT7A 4MKRA 1GTZA 1E59A 1PL8A 2H54A 3OJFA 4B4VA 1KJQA 4DDWA 5H9VA 2GKSA 2IKQA 2GYYA 2P78A 3OWOA 2BBSA 1JJAA 3NR2A 4JB8A 1G21A 1WVIA 2G07A 3D1VA 3EVZA 2V3CC 3ANNA 1CQIA 4G0ZA 2FQXA 5EHQA 3DDSA 4BV2A 4EIWA 4YCMA 4R1UA 2H4WA 3TSWA 5BRAA 1E7MA 1OZHA 5LP6C 4CT4B 4TT3D 1KP3A 3EEBA 5LP6B 1FJHA 2FK8A 3LUAA 3DTVA 3ZBUA 3DKPA 3IALA 3LD9A 1O77A 4MWEA 3B6IA 1MHPA 5DTEA 4ZJUA 1BMQA 4MARA 4DUPA 2XAAA 4LX0A 5FH9A 2PA0A 2R4QA 3BC1A 2XUOA 2WZDA 3FVQA 5ER6A 5FEUA 1YS4A 2VQ3A 5EMNA 2R1ZA 1W76A 2E21A 4YAJA 4LF8B 2WDPA 2BTQB 3VRHA 1WPQA 3H4TA 4DLPA 3GGCA 1H85A 2JANA