4WZ6A

Human cftr aa389-678 (nbd1), deltaf508 with three solubilizing mutations, bound atp
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
283
structure length
258
Chain Sequence
TTEVVMENVTAFWEEGFGELFEKAKQSLLGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRISFCSQNSWIMPGTIKENIIGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSELQNLRPDFSSKLMSFDQFSAERRNSILTETLHRFSLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Binding screen for cystic fibrosis transmembrane conductance regulator correctors finds new chemical matter and yields insights into cystic fibrosis therapeutic strategy.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Atp binding protein
molecule keywords Cystic fibrosis transmembrane conductance regulator
total genus 90
structure length 258
sequence length 283
ec nomenclature ec 3.6.3.49: Transferred entry: 5.6.1.6.
pdb deposition date 2014-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4wz6A00
1X6VA 1RW4A 2HUPA 2QEQA 4NYJR 2D7DA 5CIWA 4XVRA 3QNUA 3TAUA 2GVDC 4TWZA 5LD2B 4CT4B 1G7TA 1CJUC 4Y0VA 5E7IA 2Y8EA 4KXFB 4U5XA 5IT5A 2IC5A 1BMFA 3NH6A 1IXRC 3LV8A 4GOKA 5KNBA 2OESA 5DI3B 1YE8A 2OAP1 4DSUA 1IXSB 2DFNA 3EPJA 1CBUA 1U9IC 2IYTA 2IL1A 1KNQA 3HR7A 3L0SA 1FZQA 1WF3A 5DI3A 5EZ6B 3IEUA 2V9PA 4LJ7A 2P65A 4EIWA 4IEIA 1KYIA 4Q9LA 2A5FA 1WBBA 3NWJA 4UXHA 4NU0A 2IUSA 3O8BA 5F2EA 1Z0KA 1F3OA 2JJ2A 5LDDC 3L0IB 4JSYA 2MMGA 1WCV1 1IJFA 1NL3A 2GEUA 1AKYA 3PVSA 3FB4A 4PO1A 4DKXA 3AM1A 3Q9LA 4Q7LA 5FPTA 4E09A 1PLLA 1XXHE 5CDFE 1W4BA 2ZRKA 3DM9B 3NEJA 4OHWA 1A82A 1N25A 5EE5B 2O8FB 4DCUA 1XF9A 2VSOA 1EK0A 1HQCA 4PFSA 1KDTA 4RSGA 3VR4A 4B3FX 3EAQA 3ZYCA 4HAZA 1G17A 2C98A 3WRYC 1KK0A 1S3GA 1F48A 1Z28A 1G3MA 1ZINA 2P6NA 2IX3A 3OEEA 4F4IA 4QXAA 3LWNA 1XXHB 2XJ4A 3ICEA 3HPQA 1OB2A 1GRNA 2VP2A 2W00A 3B9QA 3ZS8A 2C9CA 2QMHA 1Q21A 2HEIA 4TSFD 4PC7A 1OFHA 2YWEA 3SYLA 1T5LA 5IRCD 2B21A 1Z6GA 3GJ3A 2BCJQ 4IDNA 3OZXA 2R6FA 4RD6A 2GZAA 2P5SA 4KCGA 2VYFA 5B57C 1E2EA 2ZE8A 2O0KA 4ZCMA 3VR5A 4D6PA 1G4UR 3QPUA 3TW4A 3VQTA 2HV8A 2QY9A 2HLDA 1OYYA 1G8FA 4JVMA 1WA5A 5AUOB 1HH4A 3A1VA 2WJGA 3Q5DA 4D0GA 3GJ8A 5GVSA 3GJXC 4OK5A 4L16A 1QVAA 4BEJA 2VQSA 4QFMA 3T1QA 4YDSA 3DO6A 3AQ4A 2CK3A 2C5LA 5J40A 1NLYA 4US0R 3AEZA 3U7HB 1NN3A 3NC1C 1TQ4A 4NCHA 2V4ZA 4PPNA 2HT1A 4MRRA 4PXAA 1KDOA 3GFOA 3U2QA 4CVNA 1UDXA 1GNPA 1WDTA 4KHZA 3TSOA 1F60A 3L0OA 3GLGB 2W2TA 2WSSA 4C0QC 4Z54A 3THOA 3KUDA 3E70C 4PZZA 1E0JA 1Q1EA 3AGPA 5B30A 2P0EA 5EXPA 3R8CA 1WQ1R 2OXRA 3DMDA 3MMPA 4K46A 4TYQA 2YVUA 4KITB 1W5TA 4IXNA 4Q1DA 4TMWA 1NG1A 1P9RA 2AKYA 2IEZA 2Z5FA 4BLPA 4HB0A 2ZRMA 4B35A 1NBMA 2HYIC 4QHTA 4A15A 3P20A 4AK9A 1SVLA 2IYLD 5G41A 1TF2A 3BIFA 4PHHA 3UKDA 1R0YA 4A0RA 4HSEA 3QPVA 1LF0A 2JASA 4OQLA 4HZUA 3M4YA 4IEEA 2IYXA 1YZLA 2EWVA 2GBLA 2ZSBA 4EPWA 4TQUS 5HTKA 1VG1A 2O8EA 5D3MA 3TR0A 2BDTA 1CLUA 4OQFA 2D2EA 2ZRAA 5DISB 2BMDA 1BKDR 5TVKA 1E2HA 1XJCA 821PA 3OE7A 5L3VA 2V7QA 2DR3A 2YWGA 1SXJE 1CJKC 3DEFA 2O8EB 1AGRA 2EU8A 3CX7A 5EUMA 1U99A 4B71A 2ZJ8A 4BLTA 1FNNA 3BWDD 3R9IA 2WPDD 1GWNA 4DDTA 1DAHA 5C1BA 4RKFA 1KKMA 2JJ1A 2DB3A 2XXAA 1N5IA 1YRAA 2IEYA 4IJMA 4M9SA 4QGAA 4YXWA 4EPXA 4OQMA 3SFVA 1XTJA 1KY3A 3L8ZA 4QJ4A 4C0LA 2WWXA 1W47A 5JWOA 2DWQA 4BGDA 3GLHA 2ODEA 2V6JA 5DSZA 1MV5A 3FGNA 1BO6A 4B2LA 4I1VA 2EQBA 2XTZA 3IILA 4KFSA 1QDEA 1IN5A 3SE0A 5HCIA 3T1OA 3A37A 3AF0A 3BH6A 1CR4A 1G19A 5JEDA 5FR1A 3P32A 1JAIA 4ESHA 4LHXA 3SHWA 2AFIE 2FWRA 2ZE7A 2I3BA 1MR3F 3LVQE 1DBSA 1VYVA 1OF1A 2J41A 2ZE6A 3E5HA 1Z6XA 3CM0A 2JJ2D 3KXIA 4NONA 1XD8A 3CF2A 4PC3A 1JXMA 4ZKEA 4G5GA 4FCWA 1JEEA 2HF8A 5TMPA 3OE7D 2GF9A 2GJKA 1GNRA 1KSHA 5GVRA 1OXUA 2VRWA 2CL6X 5E3HA 5JRZA 4G01B 3RC3A 4E22A 1X8LA 1ZM2A 2O0HA 5K8LA 4PX9A 1IY1A 2NZJA 2WSSD 1JXOA 1H8HA 3PITA 1ZD9A 1DTSA 4DDVA 2IYQA 1K6MA 4FCTA 3HU1A 4QJ5A 1ZNZA 1GSIA 1E6CA 2ZI9A 1YR8A 1KO1A 4A0GA 2KB0A 1I4LD 1E2JA 2G0NA 5EUQB 3SNHA 3CH5A 1AQYA 5F98A 4EQ6B 4F38A 1OB5A 2QA5A 2BCGY 4M0LA 1VCNA 2FEOA 2QU8A 4A2PA 1GFIA 2OZEA 3PUYA 3WP1B 4A8JB 5J47A 1XEXA 1GM5A 1II8B 2F43B 1KI1A 5FTLA 2ODWA 3GJ5A 4BASA 5GJBA 4GDFA 1E9FA 1EX6A 3T5GA 4K8OA 4MKGA 2FV8A 1N6OA 5TY0A 1TPZA 1T91A 4Q4HB 1E2LA 3K0SA 5KSYA 3OFND 1Z06A 4M4SA 4DHEA 2J46A 1GKUB 3K9GA 5AWFC 4C30A 1FX0A 4M1SA 3TW8B 2BM1A 2C9OA 5FPSA 4D80A 4IOKA 2ZVQX 3SN6A 5AUNB 1NVVQ 3U3JA 1LB1B 1Z83A 4LV8B 3SHFA 1D5CA 2J9RA 1TAGA 4LHZA 3ZS9A 2WJHA 2ZU0C 1RZ3A 1Z0IA 1VKJA 5HKKD 3GPLA 4FN5A 4UJ3A 3RSOA 3D3QA 4D0NA 5IHPA 1M7BA 4G0NA 2IYVA 3THXB 1P62B 1OH8A 2XITA 1OE0A 2FF7A 2GJ8A 1K5GA 4JLPA 3WMFA 4AWXA 5DIFA 4IDPA 3PEUA 3N2EA 3WYAA 1GL9B 1Z0DA 3LLMA 1E2MA 3RS7A 1J70A 1E32A 4KVGA 2GK7A 4PAOA 1T8UA 1FOEB 2IYYA 1JECA 3KFXA 1K5DA 1DE0A 1QHIA 1GNQA 1YR6A 2NO0A 5DI9A 4A0HA 3GLIE 1XMJA 1MO4A 3KKMA 1HT2E 1YZTA 2PX3A 2RGBA 1E99A 2KBEA 2V55B 1KMHB 3RYTC 2JIZA 3M0EA 2QORA 3B7GA 4NH0A 4QG7A 4IDQA 2VEDA 4JLNA 3SOPA 1JB1A 1P4SA 3L8YA 5KHOC 4LJ5A 1E94E 1ZRHA 1UKZA 2QT1A 5CLQA 2B92A 1EFRD 3NHBA 4NMMA 3QVVA 5C4GB 4DUGA 1OXTA 1OXXK 4BZXA 2ZS8A 4PZYA 2KI5A 3OF5A 3TJZA 1Z08A 3WP0A 3GLGE 3LLUA 1CR2A 3KJEA 1VECA 1SXJB 4PHTA 2XNDA 3GP8A 3MJHA 1YVDA 4WW0A 4F4CA 4F91B 5EXSA 1UKVY 2KSQA 2H7VA 1G8PA 2IK8A 3BS4A 3EZ2A 1U9IA 2G3YA 3FKQA 3V9PA 3IDQA 2C96A 3GFPA 3RC8A 2CL7X 4FD2A 3AP2A 4GZMA 4HATA 4S2EA 3VHLB 3VR6A 1CR1A 1CJMA 1KO7A 2J0UB 2ZE5A 1A5TA 1ESMA 5E4FA 5HE8A 2DFLA 3O8RA 3KQKA 1KI3A 1DARA 1S1CA 1W4RA 3K0AB 2ONJA 3RVBA 2ORWA 3ASYA 3FMIA 2OHFA 1EXMA 2Z43A 3C5HA 1Z6YA 1KI6A 4W5HA 2CLDX 3PFIA 5G3ZA 4D0LB 4CEJA 3ZQJA 5C18A 2GTPA 3QF4A 2CDNA 2VF8A 1A1VA 2QPOA 3SJAA 4HLQB 1OHHA 2WAYA 3FKSD 4NTZA 5DYIA 1NIPA 2JA1A 1RYFA 1Z2AA 3MGCA 4JLVA 1IN8A 3CUEF 1FFHA 1SVOA 5LBIA 3MRSA 1DG3A 1QG4A 3K53A 1E2QA 4QNMA 2YKGA 1XFAA 1P61B 2E87A 2QG6A 4PQRA 3FMFA 4Q03A 1E9SA 1E98A 3EA0A 1KAOA 3EIEA 3KKPA 4LGMA 2CBZA 4BQSA 3CX6A 2FE4A 2GJAA 1Y3AA 3VNVA 5FI1B 2PT7A 4AG6A 3PR1A 4OHVA 4U7DA 1DOAA 1TU4A 3TAHA 4QM7A 1JAHA 2ZRIA 5J4YA 3U7FB 3HR8A 4CEIB 3ZGXA 3R7WA 3HWSA 1N0VC 5AK0A 2RGXA 1G5TA 2IXGA 4B6FA 1S9DA 1D9ZA 2C03A 3HDTA 3KX2A 2FEMA 5K8TA 3OIUA 3B85A 1MT0A 1N5KA 4X8OA 2BMJA 3IQXA 4IOJA 5BN3A 2F1HA 2WWHA 4HLUA 1EFRA 3C8UA 3BERA 4ARZA 2NO7A 1G64A 1QF9A 3A4LA 1I4DD 1G21E 2P5TB 1VYTA 2GAAA 4RD3A 1AQUA 1AZTA 1KOFA 2XX3A 4KI0A 3KXLA 1JQJC 4EPVA 2ZJOA 3MWJA 1BH2A 3TE6A 5KSZA 4TQAA 3SEAA 1N6IA 5FUVA 3CWQA 3RS0A 2OLKA 5DHAA 1U94A 2WWYA 4MKIA 3L0PA 2R65A 2WICA 1KDRA 3LRPA 2AWOA 3VR1A 2ODBA 2PEZA 2ZSAA 4GT1A 1GG2A 1AK2A 1HY3A 5FTKA 4YDHB 4E07A 4V03A 4PAQA 4B32A 4KVAA 4FMDB 1E9EA 1PLJA 4US1R 1JJVA 1GITA 3B1YA 1F6BA 3C41J 3MJRA 4TQ9A 1ZP6A 4BRUA 1T9HA 2NMVA 2ZEJA 3AP3A 3CRQA 2RB4A 3DMNA 2FMXA 4JLKA 4LYJA 3FHCB 1ZM7A 1ZW6A 2V8OA 4LC0A 1S3SA 1XTKA 1W46A 2NQ2C 2X2EA 3LBHA 3WXMA 2ZTSA 4ASUD 3ZQ6A 1EFCA 1MOZA 2VIIA 4Q21A 3AF4A 2Z4RA 1S9HA 3THWB 4M1OA 1X86B 2IUTA 5FBVB 3QEJA 3SJCA 3TLXA 2WOJA 4Q7KA 1R2QA 3VX4A 1G291 1S1MA 2CVFA 2Q6TA 3K0CA 4IOMA 3CF0A 2HCBA 4V0LA 5D3QA 1NSTA 3LW7A 2P6RA 1HYQA 1OLOA 2F3TA 2R6DA 4NYMR 3ZZUA 1E2NA 5KSOA 3BORA 2CCJA 3KB2A 5JJLA 2JIZD 3MSXA 4NCNA 2CCKA 1R5OA 3A4MA 1RRGA 1X3SA 2FSGA 1LV7A 2NOAA 4HZUB 1O87A 4JYCA 2D7CA 1XTIA 2X1VA 3CNOA 3FHTA 3FVQA 4BFSA 3JVVA 3AVUA 2GEDA 4DCTA 1OIVA 1DELA 4PZLA 4Z8YA 5GJCA 2N46A 2XZLA 3C7KA 2QN6A 3OIYA 3AVVA 2AK2A 4JIMA 2A5GA 4TMKA 3PEYA 3MLEA 2ZSFA 1V5WA 5JFGA 2OAQ1 3AF3A 3X1YA 1X8KA 1FNMA 5FR2A 4G5OA 3MWYW 5G3YA 1XZPA 2ZAOA 1OSNA 1G3RA 4XWOA 1NI3A 1Q1BA 2Z0MA 2JAQA 2NG1A 2WWIA 3A1SA 1EGAA 4JJZA 5F9HA 4BFWA 1EFTA 3AGQA 1E2FA 4IOLA 5FOXA 4Z1MD 1E2IA 2J3EA 2BMEA 3QKRA 4L4UA 4B47A 1S4QA 3O8DA 1H8ED 4XVUA 4C7OB 1UFQA 3I4LA 4Q01A 4Q66C 2VL7A 5FOTA 1FMJA 2EW1A 1R5BA 4M9QA 1S96A 4B74A 1P2TA 2GRJA 4FCVA 4GP6A 3RRYA 4QJ3A 4ZI2A 1R8SA 2JLZA 1VHTA 1XZQA 4KJZA 3TSZA 3WNBA 1E9AA 4QGFA 2XB2A 1QG2A 5KDLA 2PMKA 1KI9A 2D74A 4Q4JB 1G7SA 5JZVA 2BBSA 3LD9A 3S1AA 3KTAB 4JLOA 3TK1A 3U7EB 2CE7A 2YC2C 1MRSA 3AVPA 2CLSA 4OJQA 1R10A 3GJ0A 1L7VC 1T5IA 1XMIA 4HLCA 4HZIA 4RVCA 4UNNA 1NJGA 5FPYA 4EJSA 4W7SA 3EC1A 2G1KA 4MH0R 2QENA 4TMVA 3QBTA 3SJBA 3VU9A 4IVPA 2C9YA 2JLQA 5JJIA 2KWIA 4QBGB 2P2LA 5IK2D 3K70D 1J90A 3I1FA 2AD1A 2ZXUA 2GCOA 3VU9B 3W5JA 3ZVNA 8OHMA 2RH5A 1WE2A 5CK4A 2BC9A 1MKYA 3LW8A 2XTNA 1UKYA 2C77A 5JWRA 3Q7QA 4E5UA 1KI7A 2VBCA 2GZHA 2GCOB 1N6LA 1G20E 3SBEA 1DO2A 2WHXA 2QI9C 1A7JA 4JZKA 4KBFA 3UMRA 2G83A 3GJ7A 1E1QD 4KFTA 3SYNA 4YMWA 2CMKA 1XBTA 3BXZA 3AH8A 4R98A 1J8YF 1ZU4A 3EC2A 3T15A 5FPKA 2BEJA 4RFSB 3UXMA 3W6PA 3FOZA 3A1WA 3N5CA 2J7KA 2W2VA 4FIDA 3IQWA 1T6NA 1CR0A 5IF9A 3K70B 2GWHA 3JZAA 1WB9A 1U0HC 5EJEA 2F1IA 5HZHA 1JPJA 1YZKA 2WWWA 3BFVA 4GMDA 4LJ6A 3U6BA 1JALA 3F5FA 3KKNA 4Q47A 4MGKR 2D62A 1GL7A 4DSNA 3DKPA 1XU4A 1RIFA 1IJEA 2ZI6A 3K9NA 5EP3A 1HQYE 3GEIA 4YXWD 4O3MA 1R8QA 3AKYA 4Q18A 3CX8A 1JR6A 3QKRB 4DRZA 3SR0A 1XRJA 4YC7A 4B2IA 2PEYA 4GOJA 4C7OA 3WNCA 1NY5A 2DY1A 1IHUA 1NLZA 4TT3D 4UNQA 4Z8XA 3SS8A 3L43A 3WY9A 4LHYA 4DLYA 3QG5A 5J5CA 3AUXA 5EE9A 2G6BA 4C0BA 2GZDA 1XNJA 3BOSA 2AR7A 1EG7A 3U4QB 4Q9KA 4U00A 4XH9B 2C78A 3FFBA 5KNDA 3TQFA 4QHSA 4RD1A 3W34A 3P27A 2OCPA 1Z2CA 1RJ9B 4C2TA 5KYKA 5EE0A 3OHMA 2DBYA 3DL0A 2W0MA 3P26A 4QM6A 2FGKA 1A2BA 2GAOA 5L3QB 4JLJA 4A92A 3SQWA 1NMYA 2QMUA 2QROA 2REXB 1VTKA 5FL7D 4Y0AA 4Z1MA 3BH7A 2ZUCA 4LJ9A 2G9NA 2CK3D 4ESVA 5FUXA 2JLVA 1XCMA 2ORVA 4QOSA 1QRAA 3SJZA 5CJPA 2JLWA 2QTHA 4DWJA 5EP2A 5LB2A 2Q9BA 5FI0B 4V0NA 1MO5A 3LX8A 4F7WA 1OKKA 1W0JD 2DHRA 2WKRA 1CS4C 4JLDA 1KO8A 3D31A 4FMCB 1ZC3A 2IXFA 5UKDA 1KZ7B 1RYHA 5G53C 5JCZA 1KZGB 2GBLC 4IVRA 2DWPA 4MKHA 2QM8A 2VHUA 1VYUA 3OESA 1MRNA 2IYWA 1BYUA 4AKEA 2RKOA 2ANCA 1EWRA 5FBQB 1P2UA 5J4LA 2RGEA 3E1SA 2BJWA 2RGNC 2IF2A 1KHTA 2IHYA 1FP6A 2G0TA 5HCNA 2CNWA 1T0HB 4RZUA 3CB4A 2ZRCA 4LJYA 4Z51A 1OIXA 2PH1A 3OIVA 1KSFX 1G18A 3SDZA 4L5BA 1AS2A 4JLMA 4LJ8A 3G5UA 4W5JA 2F6RA 3TSWA 2ZETA 5JRJA 2GDJA 2LKDA 4YQFA 1NVXQ 1YRBA 2J45A 1OW3B 3LQQA 4KU4A 1FX0B 2OBMA 5K8UA 4TSFA 4Q1AA 1T3LA 4PC6A 2GA8A 2JCSA 4HDOB 3U60B 2BOVA 2PBRA 2WJYA 4D81A 1ZJ6A 4Q02A 2ZJYA 4HYYA 2HT6A 2EFDB 3QXCA 5EXXA 3W8RA 3FFAA 1TL7C 2QUZA 1NG9A 3ADCA 4MUAA 5SZJA 5DE3A 1BOFA 4MRPA 2WPDA 1KI6B 2ZM5A 1F2TB 3H1TA 1TADA 3BB3A 621PA 1NKSA 1D9XA 1KDPA 4URZR 1UBGA 3QENA 1KJZA 1X8JA 4KLNA 1BMFD 3ECCA 3QXSA 5G40A 1XMSA 4TTPA 2PCJA 3EZ7A 4JYBA 1MH1A 2OFXA 1XB2A 1BYIA 1FPMA 4BFZA 1GRQA 4I1OA 4RCZA 1GUAA 3X1XA 5L8VA 1Z0JA 4AYXA 3B1XA 4FWIB 4DLVA 3UPUA 1YJ5A 2JATA 1KI8A 1E3MA 2R6GA 2WIAA 3ICQB 1PVOA 2R2AA 4GL2A 5EQTA 4DLUA 1R7RA 1TTTA 521PA 3X1ZA 3VKGA 4BFYA 4D2IA 2V1XA 1D2MA 2FPMA 3LY5A 5L3SA 5HZKA 1XPOA 4F4JA 2SHKA 2Z83A 5KDOA 5KPJA 4I1SA 1R5NA 2GESA 1KJYA 1E1RA 1VPLA 1ODFA 4ERNA 4J0QA 2CCGA 2QQEA 2Z4SA 2G1JA 3BB4A 1DAKA 4AURA 2ZREA 4BFTA 3KDSE 3PUXA 5LPNA 1N2CE 3AVQA 4P0TA 5FUWA 4BFVA 2A5YB 3QG1A 3K0EA 1G8GA 4P4TA 4XSHA 2AK3A 5AUPB 2TMKA 3BFXA 4N3NA 3RAPR 2O8CA 2F9LA 2EYUA 2OUKA 4NYMQ 2IS6A 3LVRE 2EWWA 1IONA 1LFDB 4GMXA 1R0WA 4TMTA 3VR3A 2V3CC 1E2KA 1LF5A 3B5JA 1SXJA 4P31A 1PJRA 3NVAA 3EIQA 1NRJB 4LI0A 4LHVA 3MCAA 3B60A 1VIAA 1GTVA 3I3SR 1SQ5A 4ZKDA 2FFQA 2BWJA 4HEJA 4X8LA 1E1RD 3GEEA 2OO7A 4AIIA 1QHGA 4DLXA 4EKDA 3NBZC 4DEXA 5DN6A 4US2R 2W2XA 4UJ5A 3H0KA 1E9CA 1I4TD 3T12A 1UBFA 2P6UA 3PJRA 4TLCA 5HR5A 4MGYR 3WYFA 1G6HA 3W6OA 4NCJA 4DBLC 4Q7JB 3UK6A 1JEDA 2J0QA 1IXZA 4W5WA 3VHXA 4B34A 4LYFA 2FFBA 4M21A 3EG5A 2YOGA 1DEKA 2FH5B 1PZNA 3THYB 1Z8FA 1AJEA 1N6NA 5DHFA 1CRPA 1KK3A 1US8A 1LW7A 1ZIOA 1E0AA 2JLSA 2A3RA 1VCOA 3LH5A 2GCNA 2JLRA 3L82B 1MO3A 2JLUA 1AIPA 3AVXA 4HB3A 5DN6D 5H1YA 3MWKA 1IQPA 3VTKA 4FMCF 4NP6A 5JHGB 4KLZA 4A2QA 2P67A 1OV4A 2QAGB 3KUCA 2F9MA 1G5PA 1QHHA 2QP4A 3TKLA 3TVTA 3LXRA 1E79D 1XP8A 1TUIA 2WWGA 4TLEA 3A1UA 4NCIA 1ZYUA 4GPTA 1Z22A 1Z47A 2CHQA 4TMZA 4MITA 2AWNA 4V0MA 4BLSA 1R6BX 2GJSA 2BBOA 4WOPA 2ZRNA 4E03A 3TUJC 4D4MA 3DVLA 2W6IA 4XJXA 4HUTA 1OPXA 2RGCA 2JLXA 4KFUA 3KJHA 4XSGA 4XVQA 1COWD 5JCPA 4IFBA 2VSXA 4TL9A 4ZDKA 5BW8A 2WMOB 3IHWA 5H8WA 1T3HA 5A5GA 2J59A 3E2IA 4FXPA 4NBSA 3U61B 1JNYA 4JKYA 4PQFA 3AKDA 4ZIRB 1I2DA 1FMLA 3NDBB 2O8CB 4C3ZA 1Z6TA 3QXHA 5JS7A 2I1VB 3PUVA 2R8RA 5FTMA 4JT4A 5B2ZA 1ZNWA 1OT3A 1O3YA 4ZIRA 3HYTA 2NIPA 2ZRBA 5J4HA 1Q3HA 1QZXA 1W2GA 2F7SA 3N2IA 2IWHA 1HV8A 2QSYA 2FNAA 4N0DA 2OBLA 1M2OB 3B6EA 1N6RA 1ZM4A 3BAFA 3I8SA 1VIYA 5AJVB 2VLIA 4B33A 4DEYA 2VH5R 3RRNA 2FA9A 3R8FA 2RAPA 3KJIA 4HUQA 2CLCX 3DOFA 1HE1C 5EZ5A 3WMGA 2WJJA 2XNSA 2PZFA 3IBYA 4Q1CA 4QKQA 2C95A 5CLLA 3FTQA 1VMAA 4LBZA 2N42A 1TUEA 1NN1A 2WZQA 3HU2A 1GILA 1NBME 1OFIA 3FMPB 1IOZA 1OFTA 2FJUA 4TYYA 2QMOA 3CRRA 3P4YA 1NF3A 4OI1A 3KQHA 1IN6A 1DAIA 1NJFA 3THYA 5DYGA 4D4LA 3KL4A 1NNEA 3GLFB 2NTYC 3BC1A 1TX4B 2AD5A 5JSZA 3NBYC 1GL6A 3VKHA 4P3YA 4R7ZA 3GJ4A 4XD7A 3IO5A 2ASEA 3T35A 1G3IA 3CZQA 3VX3A 2AXNA 3CWZA 3K0CC 3KJGA 3VNUA 2QRNA 1OH7A 3U7GA 3BGWA 3D8BA 2V6IA 5L3QA 4O2LA 3GLFE 2QAGA 4PSAA 1OXSC 3ASZA 1U90A 1V43A 4Q4AB 2A30A 3CRMA 4LPSA 4BZQA 2JEOA 2O8FA 2IXEA 1F2UB 2QNRA 3MUFA 5FBWB 3U3RA 2O8BA 1FP7A 5KNCA 2QAJA 5E7MA 3WBKA 4IDOA 4PPFA 1M34E 3P4XA 1G3QA 4II7A 4I99A 3OAAD 4FWTA 2EVWX 2WBLC 4Q00A 2IA5A 4TYNA 2O8BB 5EP4A 1SVMA 1N5LA 4EJSC 3K9LA 1X1RA 3A1TA 3NBXX 1JBKA 1ZAKA 5AUQA 2OLJA 2XJ9A 5TXGA 2EFGA 1SVSA 3WHLA 1H8EA 2EFHB 1UBEA 2GETA 3TNFA 4ZDJA 2QBYA 4TT3A 3I92A 5JEEA 5KU1A 1U2RA 1ZD1A 2DWOA 2PLFA 3CIOA 4KO8A 1YHNA 2JDIA 3NIBA 4ARZB 5BWMA 2QBYB 1TNDA 1D2NA 2IW3A 1U8ZA 2J1LA 4Q9HA 3WNDA 2WIBA 4KFRA 3QXJA 4M1TA 5AR1A 3T1TA 2DPXA 1NVWQ 3C5CA 2IUUA 3F3YA 2O8DA 2MMCA 4R2HA 1NN5A 2VP9A 4NE2A 3SZRA 5CB6A 1TQDA 2FDCA 4YMVA 2IBMA 2RGDA 4IXMA 3UMSA 1KJWA 1ZU5A 3ZIAD 3LFUA 4B3BA 3Q72A 1T0JB 2R6CA 4S35A 2H5EA 2WMNB 1AZSC 2JLYA 1Z0FA 5FTNA 3FPAA 3DZ8A 3B8HA 1M74A 4NCKA 1Q1QA 2OFWA 1N6HA 1KAGA 2WAXA 4JBXA 1ZNYA 1JR3A 4EJSB 4JBYA 4ON9A 4FI3C 1R0ZA 2HF9A 2REOA 3GLFA 4ILEA 5P21A 1HUQA 2GNOA 4JVNA 2BM0A 1GOTA 2A7QA 4AY2A 3ZVMA 1P6XA 2HXYA 3ADBA 4LCBA 4EDHA 4BLRA 5FL3A 3K0FA 1W36D 2GXAA 2G77B 4MA4A 4D26A 2BHRA 2YOFA 3MD0A 2IYRA 1XX6A 2W6JD 4Q9JA 2HJGA 5KDDA 2LWIA 1M8PA 3B1ZA 3KZ1E 3QEOA 1CF4A 1IBRA 3NBFA 3R9XA 1W48A 2JJ1D 4MDEA 1M6NA 3ND9A 4JT2A 4MRNA 1P2VA 1NVUQ 1S2MA 4OI4A 3NEYA 2H8KA 5JS8A 4NDZA 4MYTA 2D4HA 2FPLA 1N5JA 2O0JA 1CULC 4YMTA 3Q7PA 1D2EA 2FPKA 1OIWA 3RS4A 2QT0A 3CH4B 1F5NA 2PZGA 2VHQA 4A6XA 4A82A 5B58C 4M1MA 5IK2A 1OH5A 4NPHA 2RGGA 2GEVA 4M9XA 4ACAA 1FTSA 2WOOA 4I1UA 1N3BA 4Q1FA 4JVLA 3EIHA 3SU8A 3ZJYA 1G16A 4RFSA 1KI4A 2CL0X 1JI0A 2GXQA 5D3MB 4D4JA 3Q5EA 3IIJA 4OKSA 3SI7A 3NHAA 2Q3HA 4B3DA 1W49A 1NSFA 3CF6R 4MGZR 2IS1A 1JR3D 3W9YA 3EX7C 3ZH9B 4PTLA 2HLDD 3AKEA 5IDVA 4RZ3A 1NKTA 3RHFA 5ELXA 3Q85A 5KO2A 1XPRA 3M1IA 2D06A 1RKBA 4PHFA 4LOAA 4U02A 4OL0A 3A4NA 1ELOA 4HDCA 2QQ0A 2X8AA 2QTFA 3FE2A 1W0KD 1MABA 1OXVA 1AKEA 4CT5A 1W36C 3BFKA 5KOYA 1S0UA 1U98A 3PENA 3GLIA 2Q9AA 1RRCA 4DIDA 3K9HA 2BMFA 4JLAA 4IVQA 3CR7A 2CVHA 2AFHE 2OG2A 2ONKA 2VHCA 4UKDA 5E95A 3WMEA 1W36B 1MO6A 1RJ9A 5HE9A 3O8CA 4OHXA 5EXTA 4DLTA 3EZ9A 1Z0AA 2ZVPX 4BFUA 3K8YA 4DVGA 3OEED 3OAAA 5CYOA 1Q57A 4Q4JA 2KE5A 4GI7A 4LBYA 1W44A 2J87A 2RHDA 4LY6A 1QHNA 3RLFA 4C0AC 1LNZA 4RZ2A 4C4PA 3U4QA 2OCBA 3RS3A 1XJQA 1U0JA 3S1AB 2ZU6A 3G82C 2V54A 4OJKA 2AL7A 1L4YA 3LX5A 1ZCBA 4CDGA 5JBQA 4FMDF 4OQNA 3GLGA 1C9KA 3K1JA 3KQUA 1G7CA 4V0KA 1AM4D 1IY2A 3B2EA 2IWRA 4TTQA 2IYSA 1G8HA 2PJZA 2ZI4A 2ZYUX 3PG5A 4DCNA 2X19A 3RS2A 4DB4A 3PUZA 4KODA 2Q0HA 3UG7A 2ZI7A 3ZLJA 3MAAC 1NY6A 3ETLA 4WA7A 3PCRB 1YZGA 5FH9A 1G4AE 2PZEA 3GFTA 3IIMA 3FDIA 2ODNA 1U8YA 3EPLA 5F3WB 1T8TA 2RMKA 3N70A 5BQ5A 4ASUA 3CPJB 4AKHA 3W5IA 1KKLA 3H2YA 1VG0B 4GRAA 4C0KA 2A5JA 5EP1A 2RCNA 4EQ6A 3NG1A 3CR8A 4RFVA 2R44A 3I73A 3CLVA 5A4JA 2BIFA 2B8TA 2H57A 2YNMA 1SVIA 1ZCAA 2B8WA 4O0MA 3LBIA 4XD7D 4ITRC 5CITA 1D6JA 2ZPTX 3EWAA 5BYKA 2KBFA 3A8TA 3B82A 4WIAA 1KIMA 1JPNA 2IS2A 1E1QA 3QF7A 4A6PA 4A8JA 3X2SA 1W4CA 3R20A 1DAGA 4WZAE 5DGXA 1II8A 3CPEA 5JWHA 1XCPA 3SQXA 2ZRFA 4CYMA 1W2HA 1COWA 5C4MA 4Q4LA 3I32A 4FW9A 4X8MA 2VTKA 1N6KA 2JDID 1NVVR 2LCFA 2XSZD 5AJZA 1P73A 2ZRLA 1G1MA 4HLDA 3DPUA 1E9RA 1AGPA 1VG9B 3QKUA 1EESA 2K5UA 2QAGC 4QGHA 2FX3A 4G5RA 4LK2A 2GILA 2W0SA 4M2LA 2GCPA 1FTNA 5BN4A 5JMTA 3C15C 1SKQA 3O47A 3TUIC 2Q21A 3EARA 4D4KA 2GJ9A 1SULA 3RWOA 3IGFA 4TTRA 2H17A 3BJIC 4Q1EA 3NC0C 3QUSA 2FSFA 1TQ6A 3EWSA 5AJWA 1ZUNB 5LD2C 1RRPA 2ZYTX 3U3MA 1ZUHA 2ZS7A 4LYHA 3KB1A 1YR7A 2NPFA 4AG5A 4H9GA 1UEIA 2OILA 4OQXA 1JR3E 4GZLA 3CW2A 4JS0A 4MRVA 1KI2A 4YLGA 1UF9A 3NDPA 1QHSA 3LA6A 1VDZA 5CM9C 1J8MF 4WZBE 4CW7A 2P3SA 5KTYA 2I1QA 2QGZA 1WBDA 1IN4A 5HPYB 3K09C 4DSTA 1E0KA 4UQOA 2ZJ2A 4EPTA 2BBTA 2IS4A 3GQBA 3VMFA 4DCVA 3IUYA 3QXXA 1SHKA 3CZPA 4Q7MB 2V1UA 4JMPA 4W9MC 4RZXA 1XEWX 2N1BA 3GLHE 4ZDWA 2CE2X 4KYUA 1KMHA 4WBSA 1OYWA 5SZIA 5TB5A 1RPZA 4PPQA 2ATVA 1SGWA 4PO8A 3VFDA 4XOIA 3KXKA 2BKUA 3QE0A 3ZVRA 1SXJD 4URXR 3ZVLA 1S8FA 1XEXB 1OHHD 3AVYA 3LXXA 1QVRA 5FTJA 4BLOA 4GOXA 2O52A 2ZAMA 4LSGA 4DLWA 2ZYWX 3AV0B 1CKEA 2XAUA 1XMVA 3WYGA 4EUNA 4Q4HA 1XPUA 1KY2A 3EA5A 4HUQB 3D6TB 1FUUA 2XNDD 2WTUA 3ZDQA 4ZCIA 1E9DA 3FWYA 5SZKB 3UG6A 2JJ8A 4JL5A 4GFDA 1G41A 1T3SA 4AD8A 4Q19A 4M1YA 3GJ6A 1L4UA 2AX4A 1KSJA 3I61A 4RD2A 2ZQ5A 3WHKA 1US8B 1YU9A 2REBA 1VG8A 3EPHA 3EASA 3QI2A 4I81A 4LX0A 5LB4A 3X1DA 4DLRA 2EFCB 1SKYB 3NTUA 4I4LA 4CRWB 3RANA 3SFZA 2ZI5A 2MSCB 2AHOA 4NYJQ 1Q12A 2FN4A 4LWZA 2ZRJA 3B9PA 4LDJA 4AKIA 2HYDA 3IEVA 5DO9A 2X77A 2FU5C 3PUWA 1XTSA 2ORIA 2XGJA 4LV6A 4MUBA 4DDUA 4D25A 3AF2A 5FFMA 1PUIA 1J2JA 4P33A 4PSVA 2EYQA 1ZD8A 1KK2A 3CO5A 3B78A 2A2ZA 2D3WA 2QE7A 1AS0A 3HJNA 3HYRA 2WWFA 1IN7A 1E79A 4IDHA 2FSHA 1E2PA 1C4OA 4PR0A 4TZ6A 3U3OA 3AF1A 2OXCA 1P3JA 2ZSDA 1FUKA 4WZ6A 2ZR7A 1GKIA 3QOFA 1SVWA 4CGZA 2HDNB 4C0JA 3U44A 4QHYA 1G6OA 1HURA 4TLDA 1KGDA 4LBVA 3QIAA 3LDAA 3CNLA 3T34A 1E96A 3T1VA 5JHHB 3U44B 3IPXA 2YHSA 2H16A 3CBQA 2CNWD 2B6HA 1E2GA 1HTWA 2OBNA 2VF7A 4L8GA 4B3CA 1M7HA 1ZBDA 4F93B 3KKOA 5CIQA 3VR2A 1P7CA 3GMTA 3W8NA 4QRHA 4DXAA 2ZJ5A 4B73A 2A5DA 3OEHA 2C2HA 2XB4A 4R9UC 4MYHA 1CJVC 4V0OA 4CZ2A 3SC3A 4O2RA 1TMKA 5GJWC 4V0ME 1Y63A 4BRWA 2O8DB 3T5DA 1HEIA 1ZUIA 2ZUDA 1KSGA 4MKFA 2IYUA 2J7PA 3K09A 4BWYA 3TMKA 4IRUB 1E4VA 1Z29A 2UVQA 4M1WA 2YOHA 4B2PA 5CDFA 3I8XA 2BBWA 1YZQA 2ZSEA 1OJLA 3H86A 1IAQA 3A6PC 1CIPA 4PQYA 4WXRA 4MGIR 3DKVA 4TL7A 1ZIPA 5ANRB 2H18A 3OFNA 3CPHA 3KQLA 5A0FA 3FHOA 5JSZB 2IHBA 4Q48A 3QPWA 2HXSA 1UKEA 1B23P 3DHWC 2VO1A 3TGPA 1R4AA 3QF4B 1XEFA 4OHZA 4YMSA 3SYKA 1E9BA 3PIRA 3FKSA 1H8HD 1WMSA 4KSBA 4EPRA 3I5XA 3IKJA 1X1SA 4NYIQ 4DLZA 2FFAA 3W3ZB 1XJ0A 3ZZ0A 1QHYA 1FQJA 3NKVA 2RGNA 4C0HA 3A58B 1DADA 1ZMXA 2ZJBA 4PPGA 2QL6A 4DIEA 2GXSA 4UNSA 1L8QA 3THWA 5BXQC 4OYHA 4X8HA 2YWHA 1KO5A 5B64A 3CRVA 2CJWA 3LQRA 4CEHA 1Z3IX 3KFVA 4LJ4A 3ADDA 4TZ0A 2XSZA 1TEXA 4Q4AA 2WJVA 1AS3A 4KYIB 4B75A 4CIDA 4TYWA 3AVTA 4LRWA 4A1FA 1UAAA 3FMOB 3W6NA 2CEAA 1W1WA 3QQ5A 4IKEA 2QSZA 3CNNA 4TL6A 5CM8B 1XTRA 2FFHA 3BH0A 4RD0A 421PA 1II9A 3BD9A 4HAWA 4P4SA 3MFYA 1DO0A 5EE3A 1L2TA 2ZRGA 4DCSA 3V00A 2AN9A 2IYZA 1D8TA 1EWQA 5F9FA 3OIWA 1FW6A 3PEVA 4BPBA 4NKRA 2PT5A 4YONB 2J5XA 2PX0A 1NBMD 2ERXA 2B7CA 5FUYA 5TV2A 4H1VA 1KK1A 3AVOA 3TQCA 1GZSA 2I4IA 2GK6A 3QVUA 4EAQA 3GLIB 1E0SA 1IY0A 4EFLA 1M1YE 2YV5A 3U3KA 4B3XA 2ZR9A 4FMBB 4RKEA 4GP7A 4PC1A 4JSTA 1Q3TA 2ZJZA 3M6AA 2PLRA 1RE0A 4JVSB 1U8AA 4UXJA 1RRFA 2A9KA 1PLKA 2OV2A 3V4RA 3D7MA 4GSYA 1IM2A 4TLAA 2QZ4A 3RNLA 5L3RA 3I72A 5GJVC 3UMFA 3WBJA 2VHTA 1ZM9A 2YZ2A 3GEHA 4IW3B 3PV0A 2RHMA 3QKTA 3KTAA 2PMDA 5TARA 3TVDA 1KTVA 2ZS9A 5CB8A 1JJ7A 5E7JA 1TU3A 2PCLA 4HAYA 1W0KA 2VHJA 4HAVA 2H92A 2FZLA 1Q0UA 4LJAA 4GNKA 3C4JA 3K0FB 1XD2A 1WRBA 4BUJA 4LYAA 4R71A 721PA 2F55A 2QP3A 1ANKA 1WXQA 1NP6A 4XWAA 5AJXA 5FL7A 2BEKA 1OKKD 5FBRB 5H68A 3W90A 1XD2B 2R62A 1CRQA 2CJWB 2C99A 1F2UA 1RC8A 3BRWD 3BK7A 4M8NE 4WAUA 4TN1A 2C8VA 3ZIAA 4BECA 4C2UA 2RGAA 4G5SA 4DB2A 1Q1ZA 4Q9IA 4ZDIA 4ABYA 3VAAA 4XIGS 5AJYA 3RSLA 221PA 2CXXA 1OH6A 1W0JA 1Z63A 1SHZA 2OCAA 2QRZA 1J99A 1P72A 1GAJA 2ZIAA 2IT1A 3IIKA 5TDHA 4G3XA 4GBMA 2MSEB 4D82A 1HE8B 3PEWA 4DT1B 2HJVA 1UPTA 2QM7A 1E69A 1NMZA 3TRFA 1PV4A 4MYUA 4LBWA 5JI3E 4P4UA 1DAMA 1ZM3A 4IHQA 4OK6A 4LV5B 3AUYA 1MABB 4QNRA 2DYKA 4XTRA 3DDCA 2L0XA 2G88A 1G7RA 2W6JA 2VP0A 4HAUA 3RWMB 2XXAB 2ZANA 1YQTA 4OHYA 3I62A 1N0WA 1DAEA 4KSCA 1SXJC 1Q20A 4A36A 1N6PA 3MWLA 3ZZTA 3AVWA 3GCGA 1ZNXA 3EW9A 4RCYA 3I5YA 2YWFA 2VPPA 4DZZA 2AXPA 1W5SA 4L9SA 4ZCLA 2J7PD 2OE2A 2GVZC 5C2JB 3F8TA 2QPAA 4HI0E 4AYTA 2NO1A 2Q9CA 2ZRPA 4Q1BA 2VP4A 3THXA 4C9BA 1Z5ZA 5K8IA 1DAFA 4DLSA 2WM9B 3LO5A 2B7BA 1DS6A 2YJTD 5J4KA 5KPDA 1XEWY 4HB2A 4URVR 4PO9A 4KV9A 4ZPXA 3K70C 2NO9A 5L3SB 5M04A 2XZOA 3ADKA 2IF0A 2Z6VA 1B0UA 3LNCA 5H70A 1BIFA 2W83A 4POAA 5FPHA 5JI2E 1VCMA 1YR9A 2W58A 4MRSA 3J81k 4JLBA 1NMXA 1R0XA 2NO6A 4LPKA 4OBEA 2ANBA 3CKLA 1W7AA 1Q44A 4XTCS 3V4FA 2OFOA 2DFKB 2AKAB 2EFEB 4MYCA 3TH5A 4BLQA 2C04A 4RY2A 2ECKA 3EXAA 1PUJA 1NLFA 4QC2A 1ZC4A 2BVNA 5DLQC 1VHLA 2QP9X 1GP2A 1RFLA 2V7QD 3MG9A 1UADA 3H4MA 2QE7D 4NL4H 3EZ6A 4JL6A 3G0HA 2OT3B 4FINA 1KNXA 3TR5A 3IPYA 5GADl 4QGGA 3PXGA 2CHVA 3AKCA 2QGNA 4AYWA 1TQ2A 1II0A 3ONWA 3L2OB 4DT1A 2VP5A 3QJYA 5CJ2A 4B44A 3TUZC 3CONA 2BV3A 3U6KA 4KBGA 2QPTA 4M53A 3KQNA 1G8YA 4M22A 4B76A 3LBNA 1P5ZB 4B43A 2FZ4A 3T61A 1UJ2A 4NHOA 3UATA 4YMUA 5FOWA 2QTVB 4A9AA 2OSBA 1CU1A 2CHGA 2J0UA 1LS1A 2KJQA 3QY0A 4AKGA 4URWR 2F1RA 3GLHB 2XZPA 3JZMA 2FSIA 3BBPA 3NXSA 1GDDA 4H1UA 3UWKA 4WVFA 2YC4C 4IFEA 4F92B 4M1KA 1P75A 1G9XA 2HCJB 4A0FA 2NZ8A 1GRRA 2UKDA 3IBGA 3A36A 1NN0A 1DG1G 4BEBA 4BE7B 1AA9A 1G5RA 2ATXA 2WJIA 3HPRA 4O25A 5JJKA 5KSPA 2DCUA 2J0VA 1ESNA 4B48A 1GVNB 2PL3A 4UNRA 2XEXA 1QHHB 3AP1A 4L9WA 3ZD7A 3TBKA 121PA 3VKWA 1UBCA 1LS6A 1YKSA 1UDWA 5FOSA 1EFUA 1HT1E 1C1YA 1U0LA 4DDWA 3OEHD 4AC9A 2F1JA 4URUR 1GKYA 1SKYE 1P2SA 2E1RA 3PQCA 4MQBA 3UANA 5JLJA 1M7GA 1AN0A 1EX7A 4OI0A 2R9VA 1CEEA 1DVRA 3NH9A 1ETUA 2A78A 1HA3A 3F0TA 5BN5A 3W3AA 2R6AA 2XTMA 2ZR0A 3DZDA 2OCYC 5EE1A 4BZPA 2YINC 1TF5A 1NIJA 4JJKA 4QBIA 2GF0A 3AB3A 4LC1A 4HLUC 1N0UA 4V02A 1G3UA 4G1UC 1LVGA 1UM8A 1H65A 4PANA 4PC2A 4QBHA 4QL3A 1CP2A 1LY1A 1A2KC 1I2MA 2XOKD 4LUCA 4DUGD 5J4VA 3BE4A 3QSYA 2BKEA 2WVJA 4M9ZA 4TLBA 3RDPA 1P9NA 3TIFA 4DSOA 2F43A 2DFTA 2Q3MA 1EFHA 1CXZA 1P9WA 1BS1A 3ND8A 4RJLA 1ZVQA 1KO4A 2GXUA 4N1AA 1TEVA 3SBDA 4AI6A 1XTQA 5FOUA 3LAWA 3IO3A 4LZZA 4QBFA 4NYIR 2D2FA 3DOEA 3GD7A 4B6EA 4DC9A 2GKSA 1XDBA 4CF7A 2E9SA 3Q3JB 3B1WA 3C14C 4JBWA 1UEJA 2ZRDA 1QHXA 2MSDB 2UZ3A 4WXPA 4EFNA 3ZD6A 4CEJB 2VP6A 1RVDA 4A8JC 3QBVA 4MDFA 2VA8A 4XWKA 3IHLA 1A4RA 2ZROA 1F2TA 3P1JA 4EFMA 4R2IA 4N0EA 4TL8A 1P60A 3JVUA 3K0AA 1JQLB 3T06B 4G5QA 1XD9A 2QMEA 3EZFA 6Q21A 2VSFA 4A4DA 4B3GA 4UNPA 4DJTA 2W6ID 2ZITA 3QKSB 4HDQB 3RS5A 3REGA 5C46F 3RABA 4KAXA 1XWIA 3UWOA 2ZRHA 3C16C 3CRW1 1SVKA 2X2FA 3B1VA 5KUTA 2NPIA 1K8RA 2FOLA 2WV9A 5DNYB 4UXIA 3H84A 3QKSA 5FBLB 1U81A 1Q22A 2YYZA 3R9WA 1QBKC 1XCGB 2WSMA 2UZIR 4OK3A 4OI2A 1OFUX 4ZI3A 2JGNA 1DPFA 1E2DA 5BYJA 5DH9A 2BJVA 2XOKA 4PHGA 2PJRA 4CEHB 2FGJA 3HU3A 3WRXC 5HKKA 3U5ZB 1J7KA 1Z6AA 4C0SA 4HB4A 1Z07A 2Q3FA 3KKQA 2O5VA 3R7WB 2ZJAA 4L15A 4Q5IA 1SZPA 3FYHA 1VCIA 2WKQA 4ACBA 5CK5A 4A2WA 3REFA 1T4GA 1TF7A 2LKCA 2ZI3A 4HAXA 1YZNA 4TMXA 4JKIA 4RD4A 2NGRA 4URYR 1XXHA 5JECA 4P32A 2WKPA 2J0SA 1E4YA 2FG5A 1LTQA 4P4SB 2ZUBA 4EPYA 4CEIA 1FL9A 1W4AA 3HP1A 2F3RA 3UIEA 5CYPA 1KMQA 4BFXA 2OM2A 4JL8A 3X1WA 1WP9A 4LHWA 2GHIA 4ZV4A 4NZYA 2OEPA 1CTQA 2ZYVX 2ERYA 3Q8XB 3BB1A 4PAMA 3EPKA 1GIAA 1YZUA 2H1LA 4K81B 1ONBA 5SZHB 1FQKA 4TYPA 3RRZA 1CJTC 3B13B 5FOVA 3DM5A 4PSKA 4ZO4A 3RRMA
chains in the Genus database with same CATH superfamily
2O2XA 2PGLA 3C3JA 4MR8A 1X6VA 3DOUA 1SCUB 3RIYA 1RW4A 2MYTA 3SX0A 5C32A 2HUPA 3JQAD 3NONA 4YP6A 1RXEA 1SRRA 1U0FA 2P4HX 3IYLW 1WXFA 4NYJR 5G1PA 2DH6A 3CF4G 4YRGA 1E8MA 1BHSA 4A03A 5LD2B 4CT4B 3GLQA 2BH9A 5IT5A 4KXFB 3GJSA 1VI2A 3AESB 5HXAA 4F3KA 3A04A 3LI2A 2EV9A 3NH6A 3OWHA 3RVOA 2O5CA 3R3JA 3SX2A 1IXRC 4GOKA 2ZAGA 5KNBA 3SY8A 3ZDFA 3PGMA 5DI3B 3S8EA 2C5SA 2ZJ1A 3OKCA 4HRYA 4DSUA 1LKZA 1L8XA 3NNDA 1Z4MA 2JAWA 2GT1A 1CBUA 1U9IC 3L0SA 4EG3A 3FWPA 1O6CA 4B6GA 2FEWB 5K51A 4G4SO 4D9CA 3PXCX 1CF2O 1V7CA 1YULA 5AKKA 4PFQA 5DI3A 5EZ6B 5A4IS 3IEUA 2V9PA 4ZVKA 3S8MA 2VHYA 4ALIA 1MB2A 2P79A 1UJ6A 3PYLA 4NEHB 4CMBA 4R68A 2Q29A 2VUSA 1U7DA 1KYIA 1P0PA 4PYQA 3KELA 4B17A 1WBBA 2SNIE 5B7GA 1WSBA 2OZVA 1MV8A 2PYDA 2VPZA 1T8RA 4PIVA 4XARA 4MVWA 5KYWB 3L0IB 2CMFA 4EKIA 3JYPA 1WCV1 1FEZA 3PVSA 2GN6A 1L3IA 2NYAA 4F8EA 3FRHA 3TECE 2H8GA 4Q7LA 5JALA 3E9NA 4E09A 2PZMA 2ECOA 1GPAA 3WIOA 4OHWA 1N25A 5CB4A 3C3CA 3ENWA 1QRUA 1P0FA 3D6FA 1KDTA 2LCIA 4X3OA 4YHHB 4BHTA 3EAQA 2XMQA 3EUEA 2PGNA 3IAM6 4EFKA 4ZCSA 1ZICA 1FXSA 2PX2A 3HI6A 1S3GA 1U0SY 1U7XA 2FEXA 5A04A 2IX3A 2P40A 4J0JA 2Q3JA 1J24A 1EX1A 4AL4A 4QXAA 4BDTA 3B53X 3QUBA 4NCAA 2G1UA 1JQ3A 3P9RA 3GY0A 1Q0QA 4L3OA 5CB4F 3FA2A 1OB2A 1FJXA 1ND5A 2W00A 3B9QA 3ZS8A 4B4VA 1Y1RA 2QMHA 4TUYB 1KZ9A 4G9BA 5M7EA 3ADOA 5BT8A 4EOGA 1V96A 1DLJA 4DMUB 3UQYS 4K05A 4IILA 1BE6A 4CXMA 5DM70 1RI4A 2YWEA 1OXKB 3SYLA 1D0IA 3ZTYA 1MAUA 1R6XA 4IPTA 1SWWA 4JC5A 5FUQA 1FK8A 1XVLA 3OZXA 3FTDA 5JVDF 4CM6A 1BD3A 3A7EA 2IPXA 5B57C 1YZ3A 2ZE8A 5FXMA 3IEIA 1CUHA 1SXHA 3CLUC 1W30A 3EQ2A 4HJRA 1G4UR 4PS1A 5LIRA 2E5LB 3OJWA 1C0PA 1G8SA 4CCAA 5I7HA 1AK9A 2HLDA 2VYNA 1OYYA 5DXFA 4C4OA 3MQFA 4L50A 3S4YA 1WA5A 1XLVA 3ETGA 1Z7EA 3Q5DA 2YFHA 2I1WA 1DQZA 3GJ8A 4HFNA 3KLOA 3E82A 3PQ5A 4OK5A 2JVJA 2VQSA 3LC1O 5GOZA 3WA6A 4R8KA 4YDSA 2FN8A 4OGWA 2C5LA 4JOCA 4ZEOA 2I65A 4IHAA 5J40A 4DM4A 4ZO7A 1YDMA 2FZWA 2EGUA 2ZSKA 3NDRA 4M7RA 3RBVA 4ZU1X 3STXA 2HT1A 4D9KA 2IDZA 1MA0A 2EIXA 1P5JA 3SSMA 2BHSA 4KHZA 3TSOA 3EZGA 3DA8A 1C5KA 5IW8A 3L0OA 4N49A 3WLFA 1TZBA 2O6LA 3JYLA 1ORRA 2WSSA 4RTRA 1SHUX 2IUFA 1MJNA 2JANA 1Z13A 3KUDA 1TT5A 5HUJA 1E0JA 4NV1A 2UVPA 2O8VA 1CVIA 1Z4PX 3AGPA 1T0BA 4NU6A 4DMFA 5B30A 3R8CA 1WQ1R 4ZHQF 1U0OC 2CFIA 2RI0A 3KWFA 3TMAA 1FUEA 4FYPA 5FX2A 1W5TA 1WDKA 3UO8B 2WW8A 4IXNA 2J5RA 1N1GA 4ITVA 3E5NA 3WGZA 1NG1A 1P9RA 3V8PA 2XGOA 2H4ZA 1KEEA 3R75A 3RV3A 3SYMA 4XCVA 3EXEB 1L3BA 4RGBA 1IK4A 3A1FA 3GDFA 4AK9A 4CDNA 4WGGA 4R40A 5JAOA 2IYLD 5JFTA 1AKNA 1B8VA 1LQUA 3LPAA 3SBOA 4PHHA 4R8MA 3UKDA 2FWIA 1R0YA 1Y7IA 2PX8A 3VVLA 1Y82A 1LF0A 1UM9A 2JB9A 5LMCA 4DCOA 2IYXA 2EWVA 4EPWA 5AM2A 3H5NA 2L18A 1VG1A 4D99A 1A8SA 3TR0A 1ZXLA 3BIOA 1R12A 1OASA 3X44A 1UXOA 2BDTA 4BY9E 4N4AA 3WRVA 2C7QA 3L8MA 2BMDA 1DWUA 1SUFA 3VYUB 1XJCA 1RCTE 3OE7A 4Q12A 2HIAA 3SHTA 2QLMA 4U1RA 1TUBA 3DEFA 4CV3A 5CXUA 2VK4A 1DC4A 1YRYE 1VLMA 1FNNA 2KQUA 4DDTA 2WPDD 1GWNA 4L4YA 4YIKA 1BROA 4CFYA 3GZNA 4WNYA 2EHDA 4HDSA 1YRAA 2IEYA 3H9BA 4KPUA 4Z4EA 5E2IA 1VB5A 2OCDA 4NE7A 2ZUFA 3ERCA 3OHSX 3GLRA 1KY3A 2B1JA 4XQ0A 4PG8A 4N7JA 3ZX5A 1I7LA 1W1IA 3OMLA 2K2WA 1JGTA 1BO6A 3FGNA 3JWPA 4KSYA 4KEAA 1XKLA 4LGVA 3ITKA 1QV9A 2HJSA 3HKEB 2XYQA 4K3UA 1X0XA 5JO0A 1BXZA 5HCIA 3T1OA 3A37A 4OPMA 3WL5A 3WB0A 1G19A 4D97A 3P32A 1JAIA 3VISA 4ZOQI 2Y1KA 1YFKA 4N41A 2RI1A 2ACKA 2H06A 1EZZA 3D81A 1Y3DE 3R1IA 4GYJA 5L95A 3FYCA 4J4HA 5B3KA 1BXKA 3JVEA 1HG0A 1VYVA 4A6DA 4IJ6A 3DV2A 3LHSA 2WT4A 2JJ2D 3OQ6A 4IXDA 4BNIA 5KKNB 1A8IA 5IAGA 1SUBA 2XMSA 4FDTA 3AHEA 3QYJA 3GZTB 3NHPA 2VKQA 2FPSA 4JQOA 2X7HA 4G84A 4KWHA 5IJAA 3OE7D 1L5ZA 4YRQA 2YW9A 4NMHA 1X92A 3IEXA 1TLTA 3QVTA 5E3HA 4ZHSA 4OMUA 4X66B 4J90A 4WCFB 1X8LA 3E61A 3KQYA 2BHNA 4BKMA 5F7XA 4RPGA 1J22A 5E9QA 3VJLA 1BMDA 1MTOA 2IXTA 2UZ1A 4FLMA 4JP8A 5CG1A 2NZJA 2WSSD 3AG5A 3CFYA 3GLSA 3PITA 3D6AA 3SBXA 4ZJZA 5LXTA 3RFCA 2JHAA 4MV1A 1XAIA 3N75A 5H16A 4DV6B 2ZBPA 2UZ1B 3HU1A 4QVIA 1ZL2A 3CLTC 4MUFA 5CD9A 4A0SA 5LL6P 2DHQA 3PKZA 3M89A 3FWNA 5CU7A 3L4BC 4JBNA 4KR9A 5LXTB 2P7HA 3NCTA 4RDXA 4MVJF 5JSUA 4C7XA 3FW1A 1PU2A 2Y0PA 2G80A 1T2VA 1T5HX 1AQYA 3U16A 3JYNA 1NZJA 1SQGA 3QWBA 4IGIA 3OQIA 4JY7A 3MW8A 4EQ6B 4F38A 1O0BA 1TLLA 5E8RA 1AZLA 4A2PA 1AV6A 1WPGA 3WP1B 2QRPA 2Y0EA 2FR8C 1II8B 3ITEA 2CFTA 2INGX 2ACVA 5FTLA 2C7RA 3GJ5A 1T36A 2G4VA 1IB6A 4YCDA 2ZBRA 4EWLA 2OK7A 4K8OA 3TD6A 2FV8A 2WD7A 5TY0A 1PJ3A 2IP1A 1RM5A 1TPZA 1Y6QA 5AVQA 1E3WA 4BJHB 2A8YA 3PQ6A 4IIJA 5H4GA 1V5GA 1E7RA 3OFND 1WDWB 1Z06A 5I4BA 3Q8KA 2J46A 4HDKA 3LY8A 5AI8A 3F9CA 3TBFA 1XTTA 1A98A 2GX6A 3N1UA 4OQPA 5HIAA 4RV9A 3DDNA 3EVEA 4RJIA 2C9OA 3CSDA 3HEAA 1GLNA 1KR5A 1NRIA 3QQPA 4QQKA 3UXYA 1BRMA 2ZVQX 1PIWA 1Y9ZA 3DF9A 3E1KA 1TTPB 4GI5A 4WE3A 5EJ6A 2E55A 1U2QA 3AOEC 4LK3A 3V4ZA 4Y3UA 1UEXC 1QIFA 2FPIB 2C97A 4OHFA 5I9LA 4RF5A 4G0MA 3ZWOA 3HBFA 1VKJA 1U11A 1A04A 1LRJA 2PAFA 3V3TA 2HMSA 4N8EA 3CLTD 1DCMA 1YCFA 4CU5A 1NBOA 1U7PA 1P62B 2FPIA 2IYVA 2OA0A 3THXB 2HK8A 1QKIA 1XZIA 2FF7A 1ISRA 1OU4A 2GJ8A 2GS9A 5TQVA 1QIEA 5B4UA 4AWXA 3OF2A 5DIFA 3F46A 3OF3A 2IOQA 4IDPA 2WV7A 3N2EA 5LP6F 1IU9A 1OGIA 4OBBA 3PT9A 1GGNA 1OXMA 1W6UA 5FA8A 1Z0DA 2AG1A 1LPMA 3KZXA 4HYQA 2POQX 1J70A 3RS7A 4HX9A 4GECA 5CLFA 2GK7A 1D1PA 2R8XA 2PZLA 2Y3IA 1K5DA 4D3FA 3NT2A 3UJNA 1E6MA 2H48A 4FHCA 1RLMA 2G76A 1XMJA 1NGSA 3KKMA 2YIVX 1HE4A 3OT5A 4LKOA 3FNQA 3LUJA 1KE1A 1E99A 2V55B 3DZCA 1JLHA 1KMHB 3RYTC 2AFHA 4XJSA 3B7GA 4QG7A 3USZA 4I3HA 4K26A 1TB4A 2VEDA 4I1RA 1NBEA 1VHQA 4ZRMA 4JFAA 1P4SA 3MD9A 3FPKA 3MC1A 1EH5A 3FRJA 4JAVC 4LJ5A 4QYMA 5E6UA 2NZWA 2C59A 3A0UA 2R1TB 1ZX1A 4J7XA 1BHJA 2B92A 4UCWA 4UMFA 4GMKA 3F6PA 3LPNA 2XF8A 5GY7A 2HCRA 1NBAA 5C4GB 4V0QA 1XTZA 1OXXK 3CU5A 1X7GA 2HRDA 4K1XA 4E21A 4PZYA 4LRSB 4BUCA 5ALPA 1PR9A 3A2LA 1Z08A 1M2HA 3IOYA 3BMNB 2PMBA 2ZBUA 3C7DB 3R5FA 4PHTA 3KQQA 5HDBB 1OR8A 4JDUA 3OPVA 1O8CA 3RPEA 3GP8A 5J2UB 3RSFA 3DZBA 3O9MA 4F91B 4UHHA 2KSQA 2X8JA 1L5VA 3BMNA 2IK8A 1ZDMA 3EZ2A 2PTGA 3JQ7B 4WNAA 4AW9A 2QXYA 3EYAA 3I5MA 4GGPA 3QBDA 4Z2YA 1V6CA 4S2UA 3LQ1A 4GZMA 4S2EA 3DFKA 5B55A 3RC8A 4CF3A 1ZOIA 3ENVA 2J0UB 1U9JA 1AD2A 4EGQA 2DFLA 2LUOA 4OHRA 4A26A 3KQKA 1KI3A 1DARA 1W4RA 4D92A 4KQMA 1HDZA 1FRVA 4R1SA 1QRTA 4X91A 2CV2A 4PQGA 5CHEA 3KQSA 1LPNA 5NULA 3TIVA 1DKMA 2OHFA 3FMIA 3KEMA 3KEGA 1T6BY 1X70A 2VT2A 5G3ZA 5ALZA 3Q87B 1HYHA 3T7DA 1F5SA 3EIWA 3ZQJA 4EA8A 5C18A 4DR5B 1ETHA 3IHKA 1YU6A 4HQ0A 1KZYC 3FROA 3GJQA 3FKSD 3DO5A 3GYBA 2VRNA 5EZYB 1EE1A 4IWNA 1DWOA 1NONA 2WHYA 5AVVA 4UUMA 1Z2AA 2F00A 1CY4A 4B3TB 3CUEF 3N7TA 1H2XA 5HMMA 1I8TA 4LXXA 1QG4A 3LU1A 3UA4A 3U48A 1E2QA 2ZP1A 3TRHA 3RVNA 2VF5X 3B7WA 1FTQA 2CLFB 3IURA 1J42A 2HMAA 2J6IA 4Z3OA 3UH1A 2XRZA 1AE1A 4DADA 4JB0A 3OQPA 5IZ4A 1E9SA 3L6OO 4G0WA 1N7GA 3KKPA 3P19A 1ZNQO 4G1FA 2CBZA 3G85A 1B6SA 1EGQA 2NT4A 3CX6A 4AF7A 3LT2A 5A1JA 4BQPA 1EM8A 1G98A 5AKIA 4BO2A 3FDJA 1ZGCA 2KPOA 4UEOA 2NZUG 1FBTA 3NOOA 4IIYA 4OHVA 1MDFA 1TU4A 1GUYA 3OZRA 3R5KA 1KWGA 1TKBA 3NHRA 3ZZ1A 2V6GA 4KO2S 4BATA 2H1HA 4MVJI 4B4UA 3QV1A 4UDOA 4LDPA 4A3SA 3Q8LA 1PE0A 1K8XB 1SOAA 3L7JA 4QO8A 1DBPA 1S9DA 3OSUA 1C9YA 3OOSA 3R3XA 1KDYA 3KX2A 4EUKA 4QUEA 2BMJA 3IQXA 2C2WA 1YDFA 4R9NA 2WWHA 1QS0A 3CLRD 2OQVA 1R15A 3BERA 3CZMA 4ARZA 1B93A 2BFNA 2NO7A 2UYHA 4E7OA 1I4DD 3ZY4A 2YY7A 1TIKA 4LECA 1N2EA 4JGBA 3C6QA 1VYTA 3ESYA 3H19A 3K94A 1AQUA 4H6PA 4DTIA 2QX8A 3OMWA 1AZTA 3A14A 1Q0RA 4BBPA 2YIJA 1X80B 3KXLA 5K3OA 2NVBA 3MWJA 3QNMA 2JI6A 1BH2A 4ZREA 2O5RA 4TVSA 2B2XA 5HR5A 4XGKA 4DG5A 4DSAA 2BZGA 5FUVA 1V2HE 3CWQA 1HZZA 4B6RA 4DANA 3RS0A 3R0XA 3DXFA 2OLKA 2DE0X 5DHAA 2DT5A 3TSYA 5JXJA 1YUBA 4MKIA 1CEYA 1A69A 4M0FA 1QDLB 3IMGA 4I55A 4K9LA 4GDMA 3VR1A 2B2NA 2WSIA 4KC0A 4MUEA 5HRUA 4F85A 3WG9A 4MUJA 3DBLB 3FCOA 2IJGX 2WC1A 3LP6A 3R5TA 5EGNA 2TS1A 4BEVA 4PM4A 3T5PA 1J97A 2C2YA 4I55B 2G70A 2YMMA 3HN2A 1CRLA 3QEOA 5DNWA 4MS4A 3AZOA 5JMWA 2C84A 4UU1A 1JJVA 3OLXA 3R0ZA 2QB5A 4TQ9A 4E1BA 3FETA 2FZEA 2NMVA 3R5XA 4J94A 3CRQA 2J3JA 2XRMA 3M70A 4CIVA 1ZM7A 3FSGD 2V8OA 3LBHA 2WB4A 1PNVA 2FQXA 2GH1A 2ZTSA 2OYCA 2NTEA 1ML3A 3JQ9A 4KTVE 3UTDA 3AF4A 5I47A 4O4LA 4LZOA 4X63A 4R1OA 2YNMC 3K16A 4WTOA 5DTMA 1A9SA 4OMFG 4BC1A 2FQYA 4CKXA 1SZCA 2FW6A 4M83A 4RIIA 5BR4A 3FG9A 5EEHA 4P3NA 1G291 2Q6TA 5AFSA 4V0LA 5D3QA 2A1UA 1I3CA 4IQ8A 4KN8A 4WUVA 2F3TA 4R3WA 4NYMR 3LQ4A 3ZZUA 1E2NA 1OAKA 3QOYA 1T2AA 3EBPA 4H7FA 2A0KA 4NCNA 1RXCA 4ONEA 5ALGA 1H3EA 2CXRA 3ZDYB 1TI7A 2WTEA 1LV7A 2RONA 2R86A 3O82A 3LECA 5A9TA 4C3OB 1QE3A 3O1LA 2WM8A 1XQXA 3PDHA 4Q3DA 4QEZA 4F5EA 1V5IA 3UMGA 2C9ZA 2XZLA 2C4WA 3C7KA 1E89A 3OIYA 2AK2A 1LXCA 2A5GA 3L6CA 4JIMA 1GADO 5H9WA 2ZSFA 1V5WA 3VUFA 2R8BA 2OAQ1 4QA9A 3URKA 2YY5A 2PPLA 4GW3A 3SQDA 3U3ZA 3VHQA 4NQZA 8ADHA 5FR2A 3Q7SA 1GZ5A 5G3YA 1OSNA 5BNIA 1JEAA 2E4AA 1U3VA 4Q9DA 4H3SA 3UUWA 2VDOB 1EGAA 5CT8A 5KYXA 4JJZA 5C53B 3H2SA 1EFTA 3IP5A 4RHCA 2UYGA 1E2IA 4YROA 5FBZA 3PNKA 1L1FA 4B47A 4YUVA 3PIDA 2PR2A 1QQ7A 5JZ9A 1E3QA 4C7OB 2FZCA 3OPXA 3RC1A 5LOVF 3I4LA 2Q07A 1RM4A 3HBMA 1NSYA 3K0BA 4PG5A 2C7OA 5KJFA 4MTLA 4ARUA 3JQCA 1FMJA 1O57A 2WZCA 1GQOA 1LI4A 1S96A 3HVJA 3I30X 4KZPA 1ACMA 4FCVA 4QQRA 5DNEA 1TAQA 3Q1KA 1R8SA 4JD5A 3OOYA 3UYKA 1QIIA 2SKDA 4CIWA 4KJZA 1F4VA 3NGLA 2UYCA 1WS6A 4XVHA 1NW5A 1VGQA 2OGZA 2XB2A 5EJGA 2D74A 1MW9X 4MYRA 4AMBA 1XLUA 4ZAFA 2JGDB 2YUTA 4X3CA 2BBSA 3E3AA 4GM0A 3UUEA 3T1TA 1EUDB 3NYWA 1A76A 4GE0A 2CE7A 3QX8A 3TK1A 5F76A 3U7EB 1KJNA 3VPHA 1MRSA 5FYQA 1BWPA 2TYSB 3AL3A 3PBKA 5MDHA 3U4MA 3O73A 3LXUX 3BREA 4G07A 2ARKA 3AR8A 1QG0A 3BUSA 3HCEA 4Y6OA 4ZYXA 2NZXA 5BMVA 3GP5A 2Q2QA 4KMSA 1EIWA 4NICA 2GK4A 3TQSA 3PDJA 2A1TS 1P2FA 2DR0A 2V58A 1S6YA 5I7VA 3A1DA 5BMVB 1J90A 3I1FA 5IABA 2IXDA 1K2WA 4GZ5A 4M0PA 4WCDA 1BWQA 5F1PA 8OHMA 4IHJB 2FXIA 1U4OA 1WE2A 5IC6A 1NJ6A 5CK4A 5JVDA 2Z2ZA 3LW8A 2XTNA 1PDOA 2AYYA 2Z8YA 3PRHA 2CB0A 4J76A 3ANYB 4F84A 5KAPA 2GZHA 5KNBD 2IU3A 4BOYA 1N6LA 3SBEA 3G1TA 3TOSA 4GPEA 4B79A 1IXYA 2BFCB 4IL5A 2FUKA 2G83A 4R6XA 5JVDB 3ZI4A 4V1CB 3LC7O 3NPMA 4AM8A 1F0PA 1Z73A 3WI7A 4CNBA 2FMHA 1ZU4A 1U1EA 2BEJA 1SA0B 4V3BA 4RFSB 2G5GX 2AMFA 3UXMA 3W6PA 4GPIB 3N5CA 1CFZA 2J7KA 2W2VA 2FR0A 3D0KA 5IF9A 5AICA 2GWHA 4ETIA 1U0HC 4C0WA 1OLSB 1M6VA 1Q19A 5EJEA 2Z6UA 2Q2VA 3FYUC 3LCVB 5EUCA 1QXSA 2Q49A 3E35A 3OUZA 4DIUA 2EQAA 3H3XA 4MO2A 3RAFC 2WYHA 1DIGA 4FLEA 1N77A 1PZXA 3DHVA 4MGKR 4Q47A 4C4YA 1EGHA 1XU4A 3T7IA 1UMKA 1TYCA 2ZI6A 2I7DA 2GLXA 3K9NA 5EP3A 4YXWD 2UUBB 2B25A 3Q88A 5EHQA 5HUHA 1IFXA 5U4QA 1ORVA 3KT6A 1OC2A 3HRHA 4JI5B 1XDSA 2BLLA 3I64A 2EKBA 3CRZA 1XDWA 3OA0A 2IY8A 4JUBA 4CBVA 3E9ZA 1YSCA 1DRUA 3R3HA 2PGIA 4REQA 3DQQA 3R4CA 1NY5A 4Z8XA 1NLZA 3L43A 5YASA 4JA2A 4KRYA 4MRAA 4OAOA 4DDKA 4CPDA 3S29A 2JIQA 2G6BA 3PVZA 1XNJA 4RVFA 2AR7A 2EX4A 4P98A 5F4BA 4MJLA 4U00A 3T3HA 5JDIC 1Q74A 2C78A 3W9BA 5KNDA 3A2NA 4MEBA 4ZD6A 4ZYUA 4YH1A 3TQFA 2XWBF 4X95A 2H4FA 2QTLA 4TV9F 4WOBA 3KLBA 3LKDA 2OCPA 3WKEA 1SBYA 4YACA 5IVIA 1RJ9B 3RRJA 3WWOA 3MBIA 1NJSA 3C3KA 4LN1A 3SF8B 3P26A 4R8VA 5BSWA 1IE3A 4RPJA 1H2ZA 3WXBA 3DLBA 1A2BA 2GAOA 5BO5A 1NNLA 3E58A 3DAPA 1EEXB 4P4NA 5DB4A 4ZHQA 1VTKA 3REQA 4CMEA 2B7LA 2JJQA 3H83A 3LOQA 4BFCA 1W0CA 1S8AA 3EGIA 5ERYA 1XCLA 4Z1MA 1U63A 2EKPA 4CMIA 1FFGA 2G25A 4LG1A 1USKA 2J3MA 4O2AF 3JWJA 3RBAA 2DJIA 2OHVA 3KSMA 3TAXA 2D0OB 3ZWMA 1XCMA 2JLVA 1GZHB 2ORVA 1QRAA 4QOSA 4EG5A 3BEDA 4ROTA 3IRUA 3MTIA 1EQ2A 2JFUA 5TGZA 4AS3A 3NHUA 4OB7A 4V0NA 4KBYA 1OKKA 2W2PA 1UBNA 1CS4C 1NMSA 1KO8A 3D31A 4FMCB 1D2HA 4TKUA 4C4XA 5K6AC 4BQNA 2IXFA 1SG9A 1RYHA 5AKXA 4TV8B 3OQMA 1BFKA 3KKZA 1ZR4A 4U39A 4JI0B 2DWPA 3LWDA 4DIMA 2ZUUA 2QM8A 3BQNB 1VYUA 3HFSA 1E3SA 1HYEA 4WXEA 1H85A 1PL0A 2RKOA 1YR2A 3LPMA 4ZGBA 1EWRA 1HE5A 1NJ8A 5F7OA 2RGEA 3RSSA 3TFQA 4ZT7A 2HTFA 2IF2A 4YAOA 1MEJA 2IHYA 5COBA 1TE2A 2OSVA 3V7WA 3QEBZ 5K0SA 1T0HB 2DFPA 4JBGA 1UPXA 2EZTA 4RZUA 4L74A 2W8BA 4FOTA 4F2PA 2BHLA 3AHFA 3HCFA 5LUAA 3UMYA 3ZXUB 3SVLA 4JLMA 4W5JA 3G5UA 4Y98A 4EHBA 5JRJA 2O59A 2GDJA 4YQFA 1OAOA 1B8UA 4KU4A 3P9NA 1FX0B 2OBMA 5K8UA 1BD4A 3TGLA 2JCSA 4ZQFA 4X6LA 1ZJ6A 3CQ9A 2N3ZA 2HLHA 4ZXPA 2ZGVA 4MIOA 5EJ7A 5HQTA 5EXXA 2JLZA 3FFAA 2W42A 3N2YA 4D3DA 1NG9A 4RTOA 4B81A 4MUAA 4G9GA 2HFKA 4Y6SA 4HLNA 4GI1A 3T1HB 1BOFA 4MVYA 1V7QA 4XRRA 3FAZA 2JFPA 5C8VA 3QWHA 3R5HA 1KI6B 1F2TB 1KL7A 2NW6A 4DLKA 2XA1A 1SCQA 1M34B 3H1TA 4KHPB 3PNPA 1NKSA 3TEMA 2I2DA 1EVQA 4WX2B 3ZNPA 3QENA 1RLJA 4ABTA 3HLYA 3WL8A 5K0ZA 1VC2A 5G40A 4HNSA 2FRDA 2PCJA 5HP4A 4R9SA 4BO9A 4JYBA 3ET5A 2Y76A 1XB2A 5CVEA 1QH9A 4BFZA 1FPMA 1QVWA 1FTWA 1TEHA 3NIDB 3IUNA 4I1OA 4RCZA 3X1XA 3B1XA 2QNBA 4U9IS 4DLVA 3L8DA 3UPUA 1MCZA 2O1EA 4N5NA 2DY0A 5EFZA 2XPCA 1P5HA 1QAQA 1J2RA 3ELBA 4MPRA 1IBLB 1FU4A 5EQTA 3OT1A 5AO9A 3ISVA 1N2SA 1R7RA 3OJFA 3T5MA 1JA1A 4BFYA 4KPFC 3E8XA 1ZH4A 1JDVA 3LY5A 4I4TF 4LSMA 1RQGA 3B5EA 3F4KA 3OT1B 1HT3A 1KJYA 2HK6A 4ZVLA 3UH0A 1ODFA 1SU6A 2NVOA 4BKPA 2AE2A 1XU7A 3AI7A 3NTXA 4J0QA 3WLIA 2GBFA 4LA4A 1CZLA 1XQYA 2I2AA 4AURA 1Z15A 2QN3A 5CH3A 3KDSE 3PUXA 4S1WA 5LPNA 4HT3B 1G9TA 5AW0A 2A5YB 3QG1A 3V6LA 1K4MA 1BS9A 1CQPA 1G8GA 4P4TA 1JG7A 1S2OA 3VMMA 4GLLA 4Y2XA 3VA7A 4MS1A 1HQKA 2P4UA 4PIPA 1WQ4A 2YXDA 2JGMA 4DRXA 2PZKA 1YZFA 2C8LA 3JQ8B 3QV2A 2XZDA 4N3NA 2F9LA 2EYUA 4NYMQ 5JS2A 5ILGA 2EWWA 1QPGA 1BGWA 1Y8RA 4N18A 1NF8A 1EUCA 2ZBDA 3RWBA 3DPSA 5EHIA 4EHFA 2PVCA 4YCBA 4DRXB 4Q3NA 5BNWA 3JD2A 3EIQA 3KKEA 3Q6NA 4XDYA 3QH4A 1KRXA 1Y8RB 4KX5A 4MGEA 5BW6B 1VIAA 4LZJA 3I3SR 1SQ5A 1KYQA 1YDGA 2BWJA 4X8LA 3WMWA 4F97A 3GEEA 4H3HB 4ZKDA 1H5NA 2QUHA 2H1OA 2FPWA 1DTWB 1W94A 4EKDA 2HEGA 3NBZC 1T3GA 1JKJA 2GYUA 3N74A 1Y5MA 3BILA 1NXWA 2B6NA 3VTFA 3CVXA 2HJRA 2TSYB 2W2XA 3MWDB 3ZUPA 2V5UA 3HCNA 3N0XA 1I4TD 1Q0HA 3TCKA 1WLSA 1Z7GA 4TLCA 1VBFA 1Q7CA 1G6HA 1XJWA 1ZS9A 3HKBB 3W6OA 2GPBA 3NHZA 1M0TA 3QU2A 2OXTA 5D00A 6NULA 5L7WA 4NENA 3SJUA 1IXZA 4W5WA 4JLWA 3TTTA 4AP5A 3EG5A 1RP1A 2YOGA 2G4CA 1W9HA 2QV7A 2XTAA 4R1UA 4YAJA 1PZNA 4C7MA 3OZCA 4GU5A 2QRGA 5LQRA 2LIPA 3KD2A 5D51S 4B5LA 4XFDA 1P3DA 2B9EA 3ZK8A 2GGSA 4DSZA 1D1QA 2P5YA 4UPDA 3LH5A 3L82B 5HJ2A 2JLUA 1AIPA 3AVXA 2R1VA 3PC7A 5DN6D 1R3UA 2WD8A 4FBMA 4HDRA 4MINA 5H1YA 1FRFS 1RS0A 1CDZA 3HMQA 4INZA 3KYJB 1NURA 4NJMB 1BMQA 5JHGB 3DUFB 3R6TA 4BL5A 2NN3C 4DREA 8LDHA 1ZUNA 4PEVA 1Z0ZA 2P67A 2R1VB 1OV4A 2QAGB 2D2VA 5I3CA 1QHHA 2VH1A 2TMYA 4AN1A 3LXRA 4YRSA 4TLEA 1TKRA 5HJEA 2CYCA 3T6KA 1VKRA 1Z22A 2EJCA 3EN0A 5HIMA 5LCXA 1PR6A 3GUCA 3NUZA 3QVGB 3R4VA 4XXHA 1R6BX 3M1AA 2HBRA 4KN5A 3HXLA 1PFGA 4BO1A 3TUJC 2Y1XA 4FKMA 5LYJA 2EX1A 4TROA 4XPIB 2CZGA 1YAJA 2JLXA 1CUGA 1BDHA 4BJ3A 1RHJA 3U4HA 2YHBA 2BFPA 2Q62A 1Y6JA 3OQBA 2NNLD 4QREA 4AZ0B 5JCPA 2AR9A 3RVPA 2BFFA 4TL9A 5IDXA 3L18A 1U4SA 5LKRA 2EGHA 4PNPA 3GUHA 1INLA 1QM5A 3OH8A 1X74A 4FMPA 4FXPA 1TC1A 1JNYA 3WLNA 4DCMA 4JKYA 4K9MA 3A32A 3LT0A 4ZIRB 4MV5A 4IGEA 2NUTA 3PDIA 2WSYB 1E1LA 4MPDA 4AMZA 1AY0A 3QXHA 5JS7A 3PUVA 2R8RA 4AZWA 4YRAA 3U1TA 3WWDA 3ZLTA 1KAQA 1GGVA 2B3DA 5T4FA 3GG9A 4ZIRA 3E9YA 2ZRBA 1K7EB 2K2QB 2NUTB 1RDFA 2J9FA 3PKJA 1TTHA 3TRIA 4BNDA 1W2GA 4WKPA 4ZQCB 1KARA 3CWCA 3RS8A 5DNAA 4K9RA 1JQKA 3CUTA 1M2OB 5HBGA 1P19A 2P91A 1N6RA 1PDVA 3ADPA 3I8SA 3NOXA 1QKKA 1QGUB 5TT1A 4ZRDA 3AL0C 1QFSA 3UOWA 4DY4A 3WWYA 2B0CA 4B33A 5JSYA 5FQOA 1W5FA 5LBUA 2VP3A 4YP5A 4NY1A 3VUEA 1KF0A 2FA9A 3PQ4A 4HBGA 4HUQA 3EBLA 3U39A 3Q3EA 2CLCX 3NUGA 1HE1C 4EBFA 3WMGA 2WJJA 2XNSA 1TXGA 1AOXA 2PZFA 2YJGA 3P2JA 4GRIA 1Y7PA 2QLFA 4FR2A 2I71A 2D1TA 3PX3A 1NU6A 3C0KA 5CLLA 4YUWA 3OE1A 2F48A 3CE6A 1NN1A 1GILA 1GKLA 3ZU4A 4D8XA 3FMPB 1OFTA 1ZI9A 3V8QA 4E5KA 1DJMA 3CRRA 2RE8A 3KQHA 5LMZA 1IN6A 1KORA 1Q91A 1CE8B 3KL4A 3NS7A 4P3OA 1GZ7A 5JPIA 4ZCTA 4C01A 4YJ2B 1TX4B 3HWRA 5JCXA 3GLFB 3ZDAA 3VOAA 1JMVA 4P3YA 1GA4A 1N2GA 4EHIA 3IO5A 1WPXA 2JAXA 4KP7A 1VJGA 4LXTA 4H4DA 3BCSA 3UFXA 3T35A 5FI5A 2HKIA 3W4JA 2GRAA 1AH2A 2AXNA 3K35A 5JFOA 4M0MA 2JF0A 4L02A 3U7GA 1ODKA 1U3WA 3BGWA 4UEWA 4Y7CA 5L3QA 1BEEA 1RJDA 2WJ4A 3QU5A 4KPGA 3SM3A 1EVYA 4R9VA 3RARA 4PSAA 4GD3Q 5GQSA 5LZ8A 3USES 4MQEB 3OE5A 3CRMA 3NAZA 3G88A 4HTAA 4FYIA 1ECFA 1W36B 3D0OA 1T1JA 4L3VA 2JEOA 1EYZA 2EW8A 5DULA 2IXEA 3MUFA 3OCJA 5FBWB 3U3RA 3VYRB 3H97A 1RM3A 1FP7A 2BUAA 2RI6A 2V8BA 4B80A 4KXQA 4MUMA 4F2DA 5DYYA 1GYQA 1AQJA 4DRYA 2XUZA 3HBNA 2RHBA 4WLVA 3TZCA 2GCGA 3NP9A 4L6IA 4PRYA 2HWUA 1BH6A 2WA1A 4W5NA 3QVOA 4CTKA 3WK8A 3M5WA 3UOGA 4NOJA 3STHA 3R3SA 3WHLA 5CG2A 1VKOA 4ZDJA 1IN1A 2O2CA 1ZD2P 3I92A 4JX9A 4JH0A 1U2RA 5KU1A 2WPNA 3FZEA 4EG4A 1ZD1A 3MZ0A 5CNMA 3IAM1 3PHLA 4BJ5A 3VR6H 4AUNA 1OH6A 4BO7A 3G0BA 5E2BA 1QZ3A 3SDBA 1O6BA 3ZE7A 3G79A 4ECEA 5BWMA 3ECAA 2HR1A 1CZNA 3OPYI 3A3PA 3I04A 3VBCA 1LPPA 3R6GA 2QVLA 2QY6A 2G40A 1PW7A 3ZE0B 3PJGA 3BL6A 4CM4B 4KFRA 4M1TA 3WGLA 4IAOA 2IUUA 1WV0A 3F3YA 1FYXA 4Q1VA 1IZZA 1NN5A 3V48A 4QOJA 3SZRA 4FPXA 4M9RA 5TQ2B 5JXIA 5DK6A 3MHTA 4DLLA 1B00A 4MHSA 2D54A 5BQ3A 1KJJA 1WZNA 5DGDA 1KJWA 1ZU5A 3ZIAD 1BAPA 4CM8A 4DV1B 5KOIA 3EIOA 5KTPA 1IJKA 2PA3A 2R6CA 4S35A 4RF2A 5FLKA 1XSEA 4LNAA 4ZJPA 2EEZA 4FILA 3VJMA 5ITVA 2WMNB 3PC8C 4M38A 5EPOA 3PQ3A 1LRKA 4RTNA 3IAS6 5B7NA 4MKZA 5DJ5A 5CVCA 1QH8A 3KJZA 1A9ZA 4CFZA 3MS4A 2OFWA 1QNFA 4NCKA 4A5SA 1MN6A 3B7PA 4TSKA 2WKSA 1MEOA 3AWDA 2L42A 1A9RA 4FEGA 2P0AA 3AF5A 3IMKA 3IUBA 4F3YA 2AG8A 4TKMA 5ECDA 3OJXA 4JBYA 2OORC 5DMHA 1JHPA 2XECA 1JUDA 3NALA 2WTXA 1GOTA 2A7QA 1I1OA 1MXFA 2OCLA 1SCIA 4E08A 6ADHA 3ADBA 4AY2A 1YJBA 3ICCA 5FL3A 3K0FA 1W36D 3DE3X 5BVGA 2WSLA 3KOWA 2C2OA 3WLJA 4YMGA 4D26A 4MA4A 3JTMA 2IYRA 1DI0A 1ULZA 2W6JD 2HJGA 2PZAA 5KDDA 4A23A 1HF3A 2VXBA 1EHIA 3UAZA 2Q1UA 2BR4A 3NXKA 2W2LA 2Y66A 1ZMRA 3BTSA 3CEPB 3GT3A 2BJHA 1RAEA 2FE1A 2NTJA 1CUYA 1IBRA 2WJWA 3BXOA 3E7WA 3NBFA 2HZBA 4OFWA 1HR0B 1XYYA 1SFRA 3I8OA 3ND9A 4R41A 2XVAA 4UTNA 1PD1A 1WP4A 3PF8A 4MRNA 1IZ7A 1DJLA 3O3MB 1X94A 3KR0A 2VJCA 4MYTA 3AUAA 2O0JA 4PTZA 4YS6A 1QIDA 1TAHA 2DC1A 4ROSA 2FCRA 1L4GA 4O59O 2FPKA 5AI4A 4YMTA 5JDCA 3TRKA 2J6CA 3ZHVA 4PLCA 3RS4A 2RK4A 3UN1A 3NIGB 1OWLA 3UK2A 1OYVA 4G8BA 5IK2A 2B0JA 2OCXA 3JXEA 1FNSA 4FJ2A 1YNOA 3S28A 1AXRA 2GEVA