4WZ6A

Human cftr aa389-678 (nbd1), deltaf508 with three solubilizing mutations, bound atp
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
283
structure length
258
Chain Sequence
TTEVVMENVTAFWEEGFGELFEKAKQSLLGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRISFCSQNSWIMPGTIKENIIGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSELQNLRPDFSSKLMSFDQFSAERRNSILTETLHRFSLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Atp binding protein
molecule keywords Cystic fibrosis transmembrane conductance regulator
publication title Binding screen for cystic fibrosis transmembrane conductance regulator correctors finds new chemical matter and yields insights into cystic fibrosis therapeutic strategy.
pubmed doi rcsb
source organism Homo sapiens
total genus 90
structure length 258
sequence length 283
ec nomenclature ec 3.6.3.49: Transferred entry: 5.6.1.6.
pdb deposition date 2014-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4wz6A00
1OXXK 2DCUA 1U0HC 4HZIA 4LRWA 3Q5DA 3WHLA 3WRXC 4XH9B 3KKOA 1DG3A 3EC2A 1DS6A 2HUPA 4WVFA 5AJVB 1TEXA 1Q0UA 5H8WA 5FUXA 2YWEA 1ZM3A 4L9WA 4B71A 1J70A 2BMJA 5J4LA 4DSOA 1XFAA 2XITA 3FHOA 3LLUA 4QGGA 3OFND 3U2QA 1N3BA 5LDDC 2P5SA 3RLFA 4A9AA 3SYLA 1YJ5A 2AK2A 4F38A 3QVUA 2IA5A 4PSAA 3BB4A 2QA5A 1U8YA 5IDVA 2QORA 3NC1C 4NYIQ 3AP1A 2XXAA 2GILA 1OV4A 4PPFA 1E99A 4LC0A 4I1VA 1OYWA 2AKYA 2OT3B 2P2LA 3VNVA 3QPVA 1S9HA 1YZUA 1ZD9A 2HLDA 3NKVA 1ZM4A 2MSDB 3RRYA 1BYUA 4R7ZA 1JXOA 3V00A 4NONA 4NP6A 2W6ID 2QT1A 2GHIA 1SVIA 2YOGA 3NVAA 1BKDR 2IXFA 3L2OB 2EVWX 3K09A 3MWLA 2REBA 3MWJA 4ZDWA 1D2NA 1G4UR 1G20E 5UKDA 4UXJA 3NBZC 1GRQA 4DLZA 2GESA 2P6RA 4JVLA 1EWQA 221PA 4GP7A 3EPJA 3DOFA 2ZJ8A 2AWNA 1AS0A 2HYDA 2NO7A 1Y3AA 2CJWB 1XJCA 2ZS9A 2WSSA 3B1VA 4I99A 1UBEA 3EZFA 1WB9A 3JVUA 2V1UA 2N1BA 3DHWC 4Q7KA 4YMVA 1F3OA 2ZUDA 4NCIA 1LW7A 3O8BA 3OIVA 1ZRHA 1WXQA 4ARZB 1EXMA 4Q18A 5JS8A 1JECA 2LWIA 4A0HA 4BFUA 1VG8A 2ODNA 3D3QA 4QL3A 2OHFA 2ZYVX 3EW9A 3FPAA 2O52A 3T1TA 4ZKDA 3CF2A 2QG6A 1Z07A 3IQWA 4D80A 2ANCA 2G6BA 1RKBA 4C0JA 3EA5A 4RD0A 4TZ6A 1OT3A 3EAQA 4LI0A 4B73A 4HUTA 2JLZA 1YKSA 5L3QB 1DAMA 1E1RD 2J5XA 1NBMA 3OEED 2ZSBA 1KDTA 3G5UA 4C4PA 2GXUA 3B1YA 4MUAA 4AKHA 5BYJA 3W6NA 2GXSA 1ZIOA 2ZE7A 4DLSA 3BFKA 4Q1AA 1N6HA 2V7QD 5K8IA 1Q3TA 5HTKA 3UMRA 3A36A 3RSOA 1DAHA 1UEIA 4LHVA 2ATVA 4II7A 3WXMA 1EFHA 4E07A 2YC4C 3VKGA 1MT0A 1N25A 2ODWA 5M04A 1RW4A 1OXVA 2PCJA 4HB2A 3PEUA 1KJYA 2KBFA 3R7WA 3EIQA 3AVQA 1IHUA 3CR8A 4O2LA 3THXB 2Q3HA 2RGBA 2PEZA 4MUBA 1KI6B 3C15C 4P4SB 1DARA 2KI5A 5H70A 1CJVC 4A2PA 3I3SR 4KVGA 1SULA 1W46A 3SOPA 1TNDA 2FOLA 1XNJA 3QI2A 3FWYA 4A2QA 4B76A 1UEJA 4TMKA 4PX9A 3HP1A 2Y8EA 3AKEA 4K8OA 1OFHA 2V6IA 3K70C 4KXFB 2QROA 1G64A 2BCJQ 2MMGA 1GKYA 3RWOA 3VU9A 4D82A 3AGQA 3ZJYA 5CYOA 1ODFA 3MWKA 4Z1MD 4OHYA 1XPUA 4LHXA 1F48A 1OFUX 1IXRC 4AWXA 5CM8B 2MSCB 1WRBA 3GJXC 3ZDQA 2FZLA 2ERYA 5J4YA 2OLKA 1UDWA 3DKPA 4QBHA 1F5NA 1XRJA 1GNPA 1IN6A 1F2UA 1S3SA 5KPJA 1NVWQ 1KK1A 1US8B 2ONJA 1IONA 1Q44A 1CJMA 1LNZA 2BM0A 4N1AA 5GJWC 2F43B 3N5CA 4AYXA 1QVRA 4BFXA 2BIFA 2RH5A 3UKDA 3VFDA 2F1HA 4RCYA 4US1R 1DPFA 2W2TA 4AURA 2OV2A 2OXRA 4UXIA 1Q20A 2CCGA 3P26A 2YKGA 4DB2A 1OXUA 1PZNA 2WJVA 4ASUD 2XJ9A 4BFZA 2FFBA 3QNUA 4GNKA 1E1QD 3U5ZB 2WWXA 1E0KA 3P4YA 5C1BA 3BFVA 2C95A 1LFDB 1NY6A 2FFHA 2ZU6A 1G6HA 2CNWA 3NC0C 1IY2A 4D26A 3EIHA 5TV2A 5KSYA 1KNQA 1UKZA 4IHQA 2EW1A 3PJRA 4HAZA 4Q4HA 4R2IA 3P1JA 2OCAA 5FTKA 4N0EA 5BN4A 1XMIA 3GPLA 1E6CA 2CLCX 3GLIE 1G4AE 1OXSC 5CIWA 1NVVR 2A5YB 4QJ3A 2YC2C 3SYKA 2VH5R 3KFVA 2X2EA 2P65A 3LXXA 1CR2A 4BFYA 3OE7A 1EX6A 1ZU4A 1XEWX 3CIOA 1OSNA 1COWA 3FVQA 4PC7A 4W5WA 4ACAA 2D06A 4M1OA 4MKFA 1M34E 2KBEA 1G5TA 4EPYA 1XTJA 5C46F 4IEIA 3KJEA 1KI2A 3CH5A 1FNNA 3FOZA 4Z54A 2HV8A 5L3QA 3SJZA 4AIIA 2QBYB 2GAAA 2P0EA 1EESA 3IIKA 4JL6A 2AL7A 4ZO4A 4MYTA 2ZE8A 2A5JA 1WE2A 3IO5A 1A7JA 4PHGA 3QXHA 1B0UA 3U4QB 1FX0B 1H8ED 3A8TA 4M1SA 1S9DA 4QJ4A 3RVBA 2GZAA 1W4RA 1VG9B 1G5PA 2GJ8A 4GT1A 5FTMA 4CEHB 3VX3A 5L3VA 1XD2B 2HF8A 4OI4A 3FFAA 2BMFA 4IDOA 2ZYUX 3QPUA 4OI0A 1X86B 2WJIA 2HCBA 5FL3A 1KI6A 3C16C 5SZIA 4P4SA 1ZCBA 2IHYA 5AJWA 2ORIA 2QE7D 4TMVA 1KO1A 2A2ZA 2FPLA 1NIPA 1GAJA 4TYPA 5J4VA 2OSBA 4AYTA 4Q4JB 4JLJA 1P9RA 1RRPA 2QPOA 5DI3B 1GVNB 4QNRA 3CB4A 1AGPA 1JR6A 3SR0A 1Z0IA 2O8EB 2Z83A 5L3RA 2PL3A 4EDHA 4R98A 4V0NA 4Z8YA 1HTWA 4NKRA 1L2TA 2FE4A 1MO5A 4DLXA 1YZKA 2IS6A 4KYIB 5BW8A 3Q7PA 4LV5B 4TYWA 1KKMA 3MJHA 5A5GA 1KYIA 1GRRA 5JEEA 4Q4AA 2WHXA 1X3SA 1US8A 4I81A 2YJTD 4DLRA 4FW9A 4QNMA 5HE8A 4JT2A 1LVGA 2V4ZA 2JLWA 1G6OA 1I2MA 4JVSB 3I61A 4KITB 2IK8A 4UNPA 2ZJZA 4HB4A 3B78A 3H4MA 4P0TA 1IBRA 4JYCA 4D6PA 1S3GA 4BRWA 5ELXA 2H16A 2IYSA 2F9MA 1QG4A 2ZREA 1YVDA 2W83A 3VX4A 2WWHA 4LBZA 2E1RA 2HJVA 4GFDA 4TL7A 3TSWA 4L5BA 4B3GA 4HUQB 2ZI5A 2P67A 3GLHE 3GQBA 2D4HA 3NG1A 2IYTA 2ZAMA 4MYCA 3LWNA 3FHCB 2W2VA 3U3RA 1OW3B 2C5LA 4EAQA 1JEDA 2ORWA 4QC2A 2BWJA 3IO3A 4Q1CA 4F7WA 1M1YE 1XEXA 1G18A 3BAFA 1GSIA 1ZNWA 2ZYTX 4CEIA 4LV6A 4B2PA 1XCGB 4URXR 5P21A 2C8VA 4L8GA 3ZVNA 2JDID 2QENA 2ZSAA 4WA7A 2ZSFA 4M1MA 4TLAA 1ZW6A 2VF7A 3WP0A 5JJLA 5DSZA 1XEWY 2UKDA 5FOVA 1HT1E 4UKDA 2XNDA 4RD6A 4KVAA 1GDDA 1RVDA 3ONWA 4CEJB 4QGFA 3ZVMA 4M4SA 1DBSA 2RGXA 1P2SA 5D3QA 4BLPA 2ZXUA 2QBYA 2W58A 3A1TA 4P33A 4YLGA 3HU1A 4JBXA 4A2WA 3EASA 2BV3A 5GVRA 1KJWA 3ND8A 2UZ3A 4TWZA 5EXSA 3B7GA 3U4QA 2NPFA 1J7KA 3PXGA 4AG5A 1JR3A 3OEHA 3IPXA 1FX0A 1TQDA 2ZJ2A 4IVRA 4Q01A 5FOTA 1II9A 2ZRLA 2UVQA 4YXWD 1U94A 4NH0A 2GF0A 1CP2A 1KO5A 1W44A 4QRHA 5FL7A 1ZCAA 3A1SA 3SS8A 5A4JA 3H0KA 5EXTA 4CEHA 4QGHA 2QU8A 5FOWA 2J7PD 1E3MA 3R20A 1IXSB 2G0TA 3TW4A 3H86A 4NCNA 3EG5A 4TL8A 5DH9A 1DEKA 3FGNA 2ZIAA 4QBFA 4Q7MB 2ZI9A 5FR1A 1XXHE 3GEEA 1W2GA 2OM2A 3TVDA 3THWB 5G41A 2B6HA 4NYJQ 3RSLA 5DI3A 1OKKD 3J81k 4M9SA 2WOJA 3GJ3A 4U7DA 2O8EA 4TT3D 4OJKA 1A5TA 4EKDA 2IXEA 2XTZA 4C7OB 1TADA 4XSGA 2H8KA 2FSFA 3O8CA 5BN3A 4TLBA 5KOYA 3JZAA 4FMDB 2Q9AA 2ODBA 1CRPA 2D2FA 2GJSA 2ANBA 3LH5A 3O8DA 4TL6A 3UMSA 4EPVA 5GJBA 4ILEA 1AGRA 3DM5A 1RRCA 3K9LA 1W36C 1OJLA 3X2SA 3UK6A 3MCAA 2ZR7A 2QGZA 3K0FB 2PH1A 5G53C 2LKCA 3QKSA 1HT2E 4RY2A 1R0WA 4DLYA 2ZRAA 721PA 3LBHA 2JJ1D 4EJSB 4A0RA 2FJUA 1KSGA 4NHOA 1JI0A 3IUYA 2XZOA 4RKEA 3CBQA 1OFTA 2JJ2A 3BGWA 3QJYA 2KJQA 5EP4A 1VYTA 3FKSD 4OI1A 4UXHA 3BJIC 3KJIA 3LRPA 3UWOA 5LPNA 4HUQA 5KNCA 4UNNA 4YMUA 2H92A 1K8RA 3GJ7A 1G8HA 4ACBA 5KYKA 3GFOA 4F92B 3Q7QA 1E2FA 3PITA 5C18A 2O8DA 1XXHA 4KJZA 4EPRA 4BFVA 1A2KC 3FTQA 4P3YA 2WWIA 2KB0A 2QY9A 5DYGA 2J0SA 4JLPA 4EFLA 4D25A 2R6CA 3IDQA 3QXCA 1S1MA 2FGKA 2DY1A 4I1OA 4RFSB 1NLZA 3SFZA 2ZPTX 2A7QA 4HAVA 4PO1A 4BLQA 1IJFA 2H18A 3QXJA 1KHTA 3K0AA 1ZYUA 4JVMA 1WP9A 3TKLA 1D2EA 3TSOA 1E2KA 4CEJA 1KOFA 4PR0A 1U8ZA 2FSIA 4WZAE 5KDLA 3QOFA 4RVCA 2P3SA 1SZPA 2XOKD 4WXPA 4E5UA 3OHMA 4ZIRA 5FUVA 1BMFD 2ZI3A 5J5CA 5F9FA 4HEJA 3NIBA 1NSFA 2AHOA 4A92A 1TQ4A 2YV5A 1PLKA 2QZ4A 1G291 1ETUA 1ONBA 2GVDC 2QQEA 1Z06A 4OQXA 5CIQA 5AUQA 3S1AA 4BUJA 2O8CA 4DB4A 2O8FB 1GKUB 2XSZD 2KE5A 1MO6A 4Q9LA 3IBYA 4ITRC 2RHDA 4B34A 4B43A 4Q9HA 2A30A 3GFPA 1GZSA 3GLFE 3EZ7A 1UJ2A 4RD3A 4IOLA 3PFIA 1N6NA 3AV0B 3CNLA 3THWA 1S0UA 1XP8A 1D9XA 3WMEA 5FBWB 1Q12A 3W8RA 5K8LA 4W9MC 4AY2A 2AN9A 3E70C 1K6MA 1H65A 4KU4A 1OHHA 2O0KA 3AH8A 4C7OA 1L4UA 4TYYA 2QI9C 4LUCA 4V0ME 2W6JD 1W0KD 2VSXA 3TUJC 5IT5A 4DBLC 4IVQA 5CK4A 1J90A 2OLJA 4MGYR 3KQKA 2WMNB 3KFXA 4B6EA 1HH4A 3A4NA 3ZD7A 3NH6A 3WNBA 3SN6A 3TQFA 4RD2A 3CO5A 3LXRA 1T5IA 2VIIA 4RJLA 2QUZA 3WNCA 3K0FA 1VPLA 1ZM9A 2JASA 1I4TD 2ZUCA 4TN1A 4LCBA 4ZCLA 4OHVA 4EJSA 3TAUA 3N2EA 1KO4A 4LJ9A 2JIZA 3WYFA 5DN6A 1SXJD 2NMVA 2FGJA 1XD8A 4URWR 1NY5A 1KI1A 2J3EA 3UIEA 4DSNA 4KV9A 4B3FX 3PV0A 2ZU0C 1EFRD 3QPWA 1E4VA 2AK3A 2EWVA 5TY0A 4F91B 3NDBB 1P7CA 2FDCA 2ZJYA 1E2JA 1NSTA 1W1WA 1OLOA 2AR7A 4DT1B 1P4SA 3W6PA 2WKRA 3L0IB 3CF6R 4LJ6A 2ZRIA 4ZI3A 2REOA 4DSUA 1ZM7A 1EWRA 1Q1QA 5AJZA 3V9PA 4L9SA 1Z0JA 3IBGA 1NMZA 4FINA 1S8FA 1NN0A 1UADA 4RFSA 4MDEA 4QXAA 3WHKA 1U9IC 3QVVA 3OFNA 2Z43A 3WYAA 4B32A 2V1XA 4JLDA 4G5SA 1KSFX 3WYGA 3ZVRA 2XEXA 4L4UA 1IN4A 2QGNA 4TQUS 3RYTC 1U9IA 1XZPA 3UG6A 4D2IA 3MMPA 1MOZA 4TLDA 2BHRA 2VP0A 4B47A 2D2EA 2GVZC 1E79A 3W6OA 5FTLA 1GL7A 2YNMA 3A4MA 4AC9A 4LBYA 1AK2A 1IM2A 4CDGA 2F1IA 2OESA 1TAGA 2HXSA 2RB4A 1JQLB 3ZZTA 2BM1A 3ADKA 2W6IA 4MGKR 1TUEA 4DDTA 2N42A 1VCNA 2EFEB 1N5JA 4RFVA 4FN5A 5HPYB 3RS3A 2VP5A 3C14C 2VBCA 1XCPA 4YONB 4XSHA 3ZS8A 4HLQB 3UWKA 1E2MA 3QKRB 1G5RA 2ZJOA 4O25A 4HATA 4B33A 1KSJA 2ZUBA 1G3QA 1Q22A 1EGAA 1MRSA 3KXLA 4XVUA 5FUWA 2ZYWX 3I62A 3CF0A 3RWMB 4DLUA 3PUZA 1YE8A 3BH6A 4HLUC 4XTCS 5CLLA 3TR0A 5FOSA 4AD8A 1NNEA 1NBME 2RCNA 2XNSA 3AF3A 3M6AA 4PTLA 4F4IA 5HE9A 2QN6A 3K09C 2YWFA 2QTVB 4HLUA 4M9XA 1N6PA 2IW3A 1FL9A 1KY2A 3ZQJA 1U98A 3O47A 4OQFA 1M7BA 4D4MA 3EPLA 2R6AA 1RIFA 1NMYA 3BIFA 3C8UA 5AK0A 3OEEA 1W4BA 3HDTA 3QY0A 2QL6A 2F1RA 3CPHA 1Z8FA 1IJEA 4QM6A 2X19A 4MRSA 3B1WA 2B8TA 1IN8A 4G1UC 4X8MA 3ADDA 1YZTA 1PJRA 1GG2A 4A8JB 3GLGB 2W0MA 2RKOA 1P9NA 3I5XA 2CL6X 5CITA 5F9HA 1R6BX 3OZXA 2WICA 2C78A 4EPXA 1F6BA 2F3TA 1VG1A 2IYQA 2QP9X 2WIBA 4IFBA 2OFXA 3G82C 4S35A 3A1UA 521PA 1TUIA 2ZSEA 3B5JA 4BRUA 1BS1A 4A0GA 2O8BA 4URYR 1CF4A 2NTYC 1DELA 1G7CA 2TMKA 2NIPA 2QTFA 3M0EA 3NHBA 1TPZA 1MH1A 1G16A 4EIWA 1FQKA 2HF9A 3UANA 1KDOA 2F6RA 5H68A 3HR8A 4ZDIA 2BBWA 2XJ4A 4BLOA 1KI7A 3SFVA 3VR4A 4DT1A 1KO8A 4O2RA 1ZVQA 3KKPA 4KFRA 5DE3A 3MLEA 4DHEA 3W3AA 1QZXA 2RGCA 1Z08A 3FMOB 4UNQA 3REGA 4Q1DA 4GBMA 4LYHA 2HLDD 1OH5A 1ESNA 2VP2A 1OH8A 2OAP1 2ZANA 3KXIA 3KB2A 1N0UA 1HURA 5SZKB 1XBTA 1W7AA 3QXXA 4Q02A 2NO6A 3MUFA 2OBMA 2J45A 5JJKA 5HCIA 4Q00A 1SVMA 1M8PA 4ABYA 3DKVA 3GFTA 5JI3E 4C2UA 2GCNA 1QBKC 1VG0B 4R2HA 5B57C 4DLWA 3O8RA 1Z63A 2GETA 3EA0A 4K46A 4RD4A 3LFUA 4M22A 4BEJA 1E1QA 1HY3A 2GAOA 1KI8A 2X1VA 4QJ5A 4XVQA 1J99A 2I4IA 4TMTA 3CX6A 4R71A 4F4CA 2NQ2C 1R10A 3VHLB 1QHNA 4WZBE 2NPIA 3QKRA 2O5VA 2C98A 3VMFA 4DIEA 4DC9A 5HKKA 5KSZA 4QM7A 3WP1B 1U0LA 1NMXA 2C9CA 4EQ6B 4HDOB 2NZJA 1D5CA 4QBIA 4PAOA 1KMQA 3B9QA 1E2QA 3TJZA 2EYUA 3GJ8A 3MSXA 1KSHA 5D3MB 3DVLA 3TE6A 2BDTA 3R8FA 1G3MA 4ZV4A 5CYPA 4KBFA 1ESMA 3U6KA 3A1WA 4WZ6A 5B2ZA 2PT7A 3R9XA 1E94E 4L16A 1Z0FA 3U7FB 1NF3A 1KAOA 1XF9A 3WMGA 3WBKA 1YR8A 4B48A 3GEIA 4LPKA 3W34A 4DVGA 4DCTA 3HU2A 2WOOA 5BWMA 4XVRA 3KQHA 3K9NA 821PA 3LLMA 5KUTA 1LV7A 5EE5B 3UMFA 2FSGA 1E0AA 4DCNA 2IYXA 3T35A 3THYB 1D8TA 1RFLA 3CWQA 1XMSA 2CJWA 2HCJB 4A8JA 1QHIA 3GLGA 4DEXA 1Z28A 2PJZA 4TMZA 5FPKA 1GOTA 2F9LA 2EU8A 4NL4H 1QHXA 1BO6A 4LHZA 2OE2A 5ANRB 1ZNXA 1MABB 4H9GA 2VHQA 4OK3A 4ARZA 3PEWA 1GL6A 2EYQA 2WKPA 5EE3A 4TSFD 1G8FA 3ICEA 3BE4A 1PLLA 3NBYC 4PHHA 3TMKA 3LBNA 4LJ7A 1FZQA 2JGNA 3QG5A 5TXGA 4C0BA 4FCWA 2GXAA 2QE7A 5DIFA 2DWOA 2VA8A 1OXTA 3BOSA 1IAQA 4JIMA 5IF9A 1CJKC 1X1RA 3AQ4A 1PUJA 1N6IA 1OFIA 2ZRNA 1WBBA 4WXRA 3K70D 4BE7B 1Z22A 1ZC3A 2BKEA 1UBFA 3CR7A 1G7TA 3JVVA 4DXAA 1R7RA 4C9BA 2A5GA 3SDZA 4M21A 3KQLA 1Q3HA 4JS0A 2GCOB 2OAQ1 3RRNA 5DGXA 2VTKA 2C99A 2P5TB 5E4FA 3T1OA 1E9FA 4HB0A 2DWQA 2A5DA 1FFHA 1P72A 2F1JA 5SZHB 2IBMA 1W49A 2ZS7A 3U6BA 1GL9B 2WPDD 2IYRA 3M1IA 1AKYA 2VLIA 3EIEA 3PQCA 2WVJA 3T5DA 2VPPA 1KMHB 4MYUA 2X2FA 3RHFA 4U5XA 4XWOA 1G8GA 1GTVA 1YR9A 3QF7A 3THXA 1E96A 1G41A 1HA3A 1CR0A 1W0JD 2CNWD 4HI0E 2R6FA 5JMTA 1Z6XA 1MO3A 1SKQA 1TU4A 2RGEA 3SE0A 5CB8A 5KNBA 3SI7A 4PPNA 5KSOA 1HUQA 1G7RA 4LJ8A 1FUKA 2WJGA 3CKLA 4FCTA 1DTSA 1W4CA 1JXMA 4WAUA 5HZHA 2NO1A 3C5HA 2ZRFA 4YMWA 1RZ3A 2IEYA 1AQUA 3F0TA 3GCGA 4G5OA 2H7VA 4KI0A 1PV4A 3CRMA 1XZQA 3NEJA 1P3JA 1IY0A 3TQCA 2VHUA 2FMXA 3E2IA 4GRAA 4IXNA 4PQFA 4M2LA 2OCPA 2ZI7A 4EQ6A 5KHOC 1UKVY 5C4MA 4YMSA 1T91A 1AZTA 2BVNA 2SHKA 4KSBA 4N3NA 4D4KA 3A4LA 2IWRA 1N0VC 2XAUA 4RZUA 3FHTA 1JAHA 1KK0A 1RC8A 4HDQB 5BN5A 1EFTA 3P27A 3IIJA 3OAAA 4L15A 1Z2AA 3K1JA 1AS3A 1ZNZA 2F43A 2G83A 2OO7A 4GZMA 3GP8A 2HT6A 2JLUA 3N70A 2QTHA 3DPUA 1UF9A 5CK5A 4G5QA 1E0JA 1CR1A 3FMFA 1JR3E 1ANKA 2I1VB 2JEOA 4JLBA 4LX0A 1LS1A 2O0JA 3Q3JB 2GF9A 2PX0A 1YZQA 1N0WA 4LGMA 3B2EA 3REFA 4M1KA 1UBGA 4QOSA 4GDFA 4Q9KA 2YWHA 2G9NA 1E0SA 4KFUA 4D0GA 1BOFA 1EG7A 4XD7A 4C30A 3THYA 3QBVA 1XJQA 1VHTA 3QEOA 4KFSA 4M1YA 4M1TA 1NN1A 4Z8XA 5EE0A 4V02A 4NYMR 4BFWA 1T3HA 4EFNA 1Z3IX 3T12A 1RE0A 2OXCA 2C9OA 1E69A 1EFCA 1MABA 1R2QA 3B6EA 5J4HA 2WAYA 3GEHA 2J7PA 3VQTA 5FR2A 1KTVA 3AVVA 1NL3A 3KB1A 3SYNA 1G21E 3BFXA 1UKYA 1NLFA 4LV8B 4PC2A 2RGAA 1XTQA 2ERXA 5JHGB 5FOUA 1E2HA 1TQ6A 3NH9A 5LB4A 1TQ2A 3SEAA 1Z6AA 3MJRA 3CUEF 1ZIPA 5JECA 1NJGA 5DHFA 1J8MF 1NRJB 2BCGY 2WAXA 4EPTA 2J46A 3IQXA 4POAA 4M9ZA 4M1WA 4TT3A 2JLSA 2JJ8A 2R8RA 3ASYA 2XB4A 1XTKA 1T3SA 3LVRE 4JVNA 4LYJA 1HE8B 2HYIC 5DHAA 4AKGA 4MQBA 4EUNA 3L0OA 3MFYA 4X8LA 5JS7A 1R5OA 1B23P 5G3YA 2ZRDA 3HWSA 4ZDKA 3KZ1E 4C0QC 1E98A 3WRYC 1DOAA 2PBRA 2VP9A 3SBEA 1LF5A 1UDXA 1XD2A 1H8HD 4GPTA 3BXZA 4W7SA 3HPQA 1SVSA 1IN5A 1L7VC 5JWRA 4IDPA 1TTTA 1AA9A 1XWIA 2KSQA 1KI9A 5IHPA 2RGGA 1QVAA 2B92A 2QAGB 1W5TA 3PUVA 2JJ1A 1Z0KA 1CRQA 2J0UB 2FU5C 4KAXA 4HDCA 4ZCIA 2DBYA 2Z4SA 3NWJA 4Q4JA 1SXJB 4CW7A 2J0QA 3VKWA 4AKIA 3DO6A 4GSYA 1R5BA 2A5FA 4NZYA 4ZCMA 1Q21A 4PQYA 2VHTA 5DYIA 3RC8A 5EUQB 3AF2A 3OF5A 1ZNYA 2D7DA 1X8KA 1FPMA 4LSGA 5F98A 3P32A 3C41J 5CB6A 2L0XA 4NDZA 3K9HA 2GZDA 3L0SA 5DISB 2VP6A 3LW8A 4CYMA 3PG5A 5BXQC 4PO8A 2QSYA 2FNAA 3K0CA 3MAAC 5FFMA 2ZITA 2ASEA 4LZZA 1A82A 4OKSA 2OCYC 3OIYA 2XNDD 3ZLJA 3QG1A 1DE0A 3SBDA 1TMKA 5KO2A 3U44B 2QMEA 2ZSDA 4OJQA 2ZRJA 4Q7LA 621PA 4Q7JB 1YRAA 2VQSA 5B58C 1J2JA 5L3SB 4CIDA 1NVVQ 3FDIA 4JLNA 1DAEA 4XWKA 4FD2A 4DJTA 2WWGA 4X8OA 3H2YA 4JJKA 4EPWA 2OG2A 1JR3D 3AVOA 3WNDA 3ECCA 1KDPA 2IYWA 2FEMA 2J9RA 2GK6A 3AF1A 3I73A 1U0JA 2AFIE 2F3RA 4BFSA 4NMMA 4HZUB 1ZU5A 2ZE5A 2VSFA 2ZJAA 3IEUA 4PXAA 2CK3A 5FL7D 4PSVA 3K9GA 1XPOA 1HQCA 1Z0AA 2YINC 2WM9B 3D7MA 3KL4A 4IEEA 3HJNA 1E2LA 1V5WA 1SHZA 3NBFA 3RAPR 1Z83A 1U8AA 4RCZA 3TVTA 3FKQA 3NXSA 4XOIA 3RS2A 2V3CC 3GJ0A 4BZQA 1E9CA 2IYUA 1OH6A 2DYKA 1KNXA 3CX7A 3EX7C 2XX3A 1E4YA 4NYIR 1XEFA 2W00A 5CM9C 3B8HA 5FH9A 3CRW1 4FXPA 5JRZA 1FW6A 5JWHA 1DAFA 1ZAKA 2IEZA 2FEOA 3AUYA 1W2HA 1Z29A 5EZ5A 5HCNA 6Q21A 3ZVLA 4NPHA 3VR1A 4BECA 3T61A 1XTRA 1AZSC 3AF0A 2H57A 2RGNA 3L43A 1XMJA 4E22A 5KPDA 3IKJA 2EFGA 2QPTA 4Q03A 2BBOA 1N6KA 3Q8XB 4QHYA 4URVR 2YVUA 8OHMA 2ZRBA 1QF9A 3PEVA 2V8OA 3AKDA 4HAUA 3ZIAD 1DADA 2V54A 1FOEB 3M4YA 1E2GA 4NBSA 4F93B 4Y0VA 4LK2A 5F2EA 4P31A 4GOKA 1RRFA 4AI6A 2IHBA 3GD7A 5AWFC 4E03A 4WW0A 2WZQA 5LD2B 1PUIA 2V6JA 4UJ3A 1T4GA 1W0KA 3BK7A 5E7IA 2JA1A 5EXXA 2GTPA 2WJHA 1V43A 2NZ8A 1MRNA 3CH4B 1U2RA 1W36D 4XIGS 4OHXA 3L82B 1SKYB 2IL1A 2JJ2D 3OIUA 4U00A 3A37A 4BFTA 4DCUA 2DPXA 1E32A 1TU3A 4MKGA 4IDNA 4CRWB 4BPBA 5LB2A 4NU0A 2IS4A 2CMKA 4FIDA 3BERA 2FPMA 3WBJA 1KZ7B 2GJKA 3I4LA 2J0UA 1BYIA 3QEJA 2ZEJA 4O0MA 4MYHA 4R9UC 2ZRCA 1SXJA 3GJ6A 3TAHA 2KWIA 2WIAA 2H1LA 3UPUA 3W90A 1IY1A 4G3XA 4ESVA 2FFQA 2OBLA 2WMOB 4RSGA 1QRAA 2R65A 2RAPA 2ZE6A 1EFRA 1KJZA 1R0XA 1P60A 2ZM5A 3TNFA 2NO9A 1IQPA 3KTAB 3MRSA 1GIAA 1SHKA 4KSCA 2GCPA 2JAQA 3NTUA 3QIAA 1BH2A 1ZMXA 4PC3A 4OHWA 1FP6A 1Z0DA 4M9QA 4FMCF 3U7EB 3SZRA 5JCPA 3U44A 3B85A 4LPSA 1AN0A 2Z0MA 4DCSA 4EJSC 4DDVA 3QKTA 1Y63A 3OESA 5L3SA 1HV8A 2NGRA 2BJVA 2G1KA 4C0KA 2ECKA 4DDWA 1X1SA 4Q66C 3QKUA 2BJWA 5FI0B 4CF7A 1AJEA 5DO9A 3BBPA 4V0LA 3U3JA 2BEKA 1M6NA 2W0SA 4HZUA 4GZLA 1UAAA 3BH0A 3F3YA 4LC1A 5G40A 4MRPA 1TL7C 4OK6A 4GOXA 1GP2A 1AS2A 1W5SA 2HJGA 3RRMA 3C7KA 4PSKA 1YR7A 1Q57A 1CKEA 2B21A 4DUGD 3TRFA 3CRVA 4NCHA 4B3XA 2IUSA 2OZEA 3FMPB 2IXGA 2BBSA 3JZMA 5JCZA 1XX6A 3U7HB 3WMFA 4M8NE 2YOHA 1ZINA 2ZI6A 1I4LD 5L8VA 1VYVA 4X8HA 2R2AA 1JJ7A 2CHQA 3D6TB 3HYRA 3TGPA 1QHSA 3AP2A 4MITA 5EP2A 1OHHD 3AVTA 4BLRA 4V03A 3LDAA 3VHXA 1ZD8A 4DLVA 1CULC 4PO9A 3UXMA 3IHLA 3AVXA 1E9AA 1G1MA 3TH5A 4WOPA 2YZ2A 2OFWA 3LY5A 3Q9LA 5EZ6B 2Q0HA 4S2EA 1SGWA 2JATA 3EWSA 3RANA 3ETLA 1SVOA 1GRNA 3SQXA 1JAIA 1KO7A 1D6JA 4IDHA 3SJAA 1F60A 3VTKA 3VKHA 1NJFA 2OUKA 5C2JB 1P2UA 1E2DA 2PLFA 1II0A 5A0FA 4RZ2A 2J0VA 1L8QA 2AXNA 3KUCA 4AK9A 2D74A 4YQFA 4CVNA 2QEQA 4GI7A 1G17A 2O8FA 1UFQA 2FZ4A 4QBGB 3A1VA 4TL9A 1D9ZA 1NKTA 4KBGA 3R7WB 3AEZA 4D0NA 5GVSA 4MGZR 1T9HA 2WWWA 4IKEA 3ZS9A 2DR3A 4HAWA 4TLCA 4YDHB 3TIFA 4JLOA 4PZLA 2GJ9A 1XDBA 1N5KA 1CU1A 4ERNA 5E3HA 3V4RA 2Q3MA 1MV5A 1IXZA 3LV8A 3CW2A 4FCVA 2CEAA 2PX3A 1X8JA 3CWZA 3PUWA 1DAGA 1XTIA 2VO1A 5FI1B 2OILA 1WQ1R 5IK2D 1CXZA 4JZKA 1S2MA 2J7KA 4I1UA 1DVRA 2B7BA 1E9DA 2IYZA 2QSZA 2HEIA 3VU9B 3PVSA 2AD1A 2EQBA 1NP6A 3KTAA 3SC3A 2GZHA 421PA 4DSTA 3CM0A 1MR3F 3E1SA 2QMUA 2A78A 2RMKA 2XGJA 1E1RA 2J59A 5DI9A 3W5IA 2DFTA 4FWIB 3K70B 4XJXA 3RRZA 1VTKA 5KSPA 4Q5IA 2XZLA 1F2UB 2GWHA 4US0R 5EQTA 2A3RA 3I92A 5EE9A 2CXXA 4PPGA 3BB1A 3VR3A 5CDFA 1FNMA 2V7QA 1E79D 3L8ZA 3KXKA 2JLVA 4V0OA 4LBVA 1GNRA 1HEIA 2NOAA 3BH7A 3K8YA 4MKIA 3ZZ0A 5KDDA 1YZNA 2OEPA 4US2R 1T8TA 2PT5A 3B1ZA 4J0QA 4MH0R 1AM4D 1VMAA 1JB1A 1TF2A 1EFUA 4UJ5A 2WTUA 1P9WA 3LQRA 5HZKA 5F3WB 1FTSA 1W4AA 2Z6VA 3D8BA 3GJ4A 4LOAA 4RZXA 2GEUA 2ZR0A 3RS4A 3EZ9A 3MWYW 1MO4A 4IFEA 4KHZA 2DB3A 1WDTA 4AKEA 1VYUA 1ZP6A 1ZJ6A 4Q4HB 5C4GB 1TF7A 3VR2A 4Z51A 1F2TB 1RRGA 4GOJA 2FWRA 1DG1G 3RS0A 1YQTA 3NDPA 3W8NA 1OIWA 3N2IA 4IRUB 1OYYA 2PZGA 2BOVA 4DLTA 1KDRA 3U3OA 2IF2A 1N5IA 2E87A 4Q4LA 1YZLA 4Z1MA 3DOEA 3GMTA 4Y0AA 1YU9A 2EFCB 3T34A 1KI3A 3SHFA 3I1FA 2Q3FA 1G8YA 2P6UA 3U61B 1GILA 4ZKEA 4TTRA 4JBWA 4UNRA 2RHMA 3ND9A 3ICQB 4B2IA 1N6RA 1LY1A 3P4XA 4URZR 4BASA 4PAQA 3B60A 4AYWA 4JMPA 5EP1A 2PCLA 1E9RA 5FTNA 5TVKA 3T15A 3UATA 1OH7A 3BORA 3DM9B 4JKIA 4G5RA 2REXB 3KJGA 4CT5A 1G3IA 2MMCA 3IHWA 2GKSA 3LA6A 1NIJA 5AJYA 2W2XA 2QMHA 1NN3A 4ASUA 1ZUIA 3GLGE 2WSSD 2DHRA 1T0HB 2HXYA 2PEYA 1OB5A 3FE2A 3AVYA 1VCOA 4TYQA 2Z5FA 3MGCA 4B35A 2AWOA 3BRWD 3CRQA 5DLQC 5JLJA 3IGFA 2EWWA 3CONA 3K0EA 5FOXA 2NO0A 1KK2A 5AUNB 1MKYA 5AJXA 3B1XA 1U99A 2QAJA 3HPRA 3V4FA 2WWYA 1NVUQ 1GM5A 1M7HA 3KX2A 1P6XA 3GLIB 3L0PA 2QM7A 4JLKA 3TLXA 4D4LA 4QG7A 1P2VA 1W47A 5J40A 1NBMD 4DWJA 2WSMA 1T5LA 3KQUA 3VNUA 1J8YF 3QQ5A 2P6NA 3A58B 4TSFA 2IX3A 3KKMA 4V0KA 5FBRB 3TBKA 2ZRMA 4LBWA 4LJYA 3I72A 2H5EA 5K8UA 2FSHA 4IXMA 3KKQA 1EX7A 4B3DA 4LJAA 1N5LA 1U90A 4QHTA 2VSOA 3LX5A 4JL8A 4A8JC 2GBLC 1A4RA 4PZYA 4WBSA 3R9IA 4DRZA 3X1YA 3EXAA 2GJAA 4Q4AB 2AKAB 1R5NA 1RYFA 1K5DA 1E2PA 2GEVA 1XJ0A 4PHTA 1OPXA 1KGDA 3PCRB 2BKUA 2GBLA 1H8EA 1T3LA 2GA8A 4MGIR 2Q21A 4NYJR 3PENA 4B2LA 4JYBA 1NG1A 2WPDA 3QF4B 2GK7A 3TUIC 3CRRA 1DO0A 3KKNA 2CBZA 1XU4A 5EJEA 1O87A 3RC3A 1D2MA 4FI3C 4N0DA 4IOMA 1AKEA 1W0JA 3KDSE 4FMBB 4KODA 1CIPA 3ASZA 1O3YA 3QE0A 4KLZA 4NTZA 4PAMA 3R8CA 5HKKD 1X8LA 2DWPA 4QFMA 2IS2A 2ZETA 1OIVA 4XTRA 2YHSA 3VAAA 4PFSA 1F2TA 2QQ0A 2CLDX 4G01B 1XEXB 2ZRGA 4OK5A 4QGAA 5TB5A 3ZD6A 1LS6A 2B7CA 4LYAA 2QPAA 2CLSA 4CEIB 4XWAA 5KNDA 2IF0A 2IUUA 4TMWA 4GP6A 4DCVA 5FBLB 5HR5A 4B74A 2VHCA 4PQRA 4CZ2A 2I1QA 5TDHA 1NI3A 4BZPA 2OBNA 1HE1C 3PUYA 2BEJA 4G0NA 2FPKA 2VYFA 2XZPA 3CX8A 3CPEA 4KFTA 3AVUA 2ZI4A 2GNOA 5J47A 3KUDA 2D7CA 1LF0A 5B64A 4RKFA 3W5JA 5J4KA 1HYQA 3LBIA 4LJ4A 2Z4RA 4F4JA 3EZ2A 4TTQA 4C0HA 5TMPA 2OFOA 3DMDA 4URUR 1DAIA 1G9XA 5GJVC 4E09A 1G3RA 5CLQA 3AM1A 1VKJA 4IVPA 4A1FA 1WA5A 4OQMA 3RS7A 4GL2A 1QG2A 3DZDA 4OBEA 1ZUHA 2PLRA 3H1TA 2R9VA 1M7GA 5CJPA 2G77B 2OCBA 3GLHB 1QHHB 1AIPA 1JPNA 2YOFA 2UZIR 3OE7D 3RS5A 2I3BA 2BC9A 2ZR9A 1NVXQ 2IT1A 4AG6A 1UBCA 2G0NA 1COWD 1CBUA 3TUZC 3BB3A 3T5GA 4JLAA 5CJ2A 3GLIA 3AB3A 5E7JA 1JBKA 1II8B 4JKYA 3LQQA 5JRJA 5AR1A 3FFBA 4DKXA 3F8TA 2JLRA 2IWHA 5JBQA 5JEDA 5D3MA 1WBDA 1VHLA 2CVFA 2JDIA 1E2IA 1UM8A 3IPYA 4Q1FA 4A0FA 5EE1A 1Z6YA 4PC6A 4UNSA 1IN7A 2V55B 2ZAOA 4W5HA 1TF5A 2E9SA 3VR6A 3FYHA 2ODEA 2QRNA 5GJCA 2D3WA 2B8WA 2QM8A 5FPHA 2AFHE 1ZC4A 4B75A 3U60B 1I4DD 1X6VA 4M0LA 2PZFA 4HLCA 3T1QA 2V9PA 2WBLC 1HQYE 4PHFA 3TR5A 3AVWA 1CJUC 4A4DA 1FUUA 1QDEA 4A82A 1CJTC 4YDSA 1NN5A 2J41A 4YXWA 3EZ6A 1ZM2A 3QKSB 1SVLA 5JWOA 3QF4A 2RGDA 2FF7A 2PMKA 3HR7A 4C0LA 4DZZA 1W36B 1M74A 1H8HA 3AF4A 4H1VA 5FPSA 4WIAA 1JQJC 5FPYA 2VEDA 1FQJA 4I4LA 3IEVA 2DFKB 1PLJA 1DAKA 5FPTA 2X8AA 4G5GA 3DMNA 2AXPA 2XTMA 5FTJA 3B82A 2CDNA 2QNRA 2O8DB 3LO5A 1XXHB 4MRVA 1SQ5A 2C04A 4JLVA 1GFIA 1KY3A 3WY9A 3W9YA 1OKKA 2ZQ5A 5H1YA 2G1JA 3OAAD 1TX4B 5AUPB 2GCOA 3CZQA 2CHGA 2C77A 4CT4B 1YHNA 1N2CE 2CE7A 4HB3A 4BQSA 1KK3A 1GITA 1C4OA 4YC7A 1RJ9B 1S1CA 2BBTA 3K0AB 1JJVA 3F5FA 3PEYA 3GJ5A 4DDUA 1KMHA 2JCSA 4PZZA 1K5GA 1NKSA 4KO8A 1T0JB 1VECA 1A2BA 2JLQA 4JLMA 4Q1EA 4TLEA 1P5ZB 1ZBDA 2XB2A 4ZIRB 4KCGA 1C1YA 4NCKA 1OF1A 4Q21A 2Q9CA 1G8PA 4XD7D 4Q9JA 3TW8B 5LBIA 4CGZA 2ONKA 4TTPA 1GNQA 3I8SA 1QHYA 3S1AB 3FKSA 1R8SA 4H1UA 2FFAA 2O8CB 3I8XA 3K0CC 1T6NA 3SU8A 5FUYA 2GRJA 3SJBA 4U02A 4P4UA 2CCKA 1QHHA 3GLHA 4MA4A 3PUXA 1OIXA 2G88A 2ZRKA 4D81A 1VDZA 2QP3A 1CTQA 2QP4A 1II8A 2ZVPX 3PIRA 2BMEA 3ZZUA 3D31A 4Q9IA 2MSEB 1KI4A 2VHJA 1Z2CA 2CCJA 3NEYA 4MKHA 3ZQ6A 2WJJA 4B3BA 5FBQB 3DEFA 2C96A 1VCIA 3DDCA 4LY6A 2JLXA 2VRWA 2YYZA 2DFLA 3NBXX 3OIWA 4PANA 1FMJA 1GKIA 3Q85A 4A15A 3K53A 4M53A 1R0ZA 2VP4A 3W3ZB 2CHVA 2Q6TA 1WF3A 3OEHD 1M2OB 3EWAA 3CNNA 2IYYA 4TZ0A 1YZGA 4ESHA 3UG7A 2HDNB 2IS1A 3QSYA 4B6FA 3ZIAA 4I1SA 5DNYB 2R44A 1JNYA 4TQAA 1XD9A 2XOKA 3B9PA 1E9BA 1BMFA 1XB2A 1P2TA 2K5UA 3EC1A 3X1WA 3X1ZA 3ZYCA 5FBVB 4TQ9A 3RABA 1KAGA 2EFHB 3U7GA 2R6DA 3Q5EA 3SNHA 4KYUA 1NLYA 4HAYA 1Q1ZA 1P62B 2Q9BA 2RGNC 1RPZA 1Z5ZA 3AUXA 4O3MA 3EARA 1IOZA 1Q1EA 1C9KA 5K8TA 3K0SA 1FP7A 1ELOA 4HSEA 3G0HA 1SXJE 2XSZA 1LTQA 2QMOA 3VR5A 4BZXA 1DO2A 4PC1A 5TARA 3AP3A 4OI2A 3HYTA 2ZRHA 3QENA 1SVWA 4MDFA 2R6GA 1BIFA 3MG9A 5EUMA 4BGDA 4C3ZA 2ZJ5A 1W48A 1KZGB 3GLFB 2PMDA 1EK0A 5KU1A 4BWYA 4TMXA 5E95A 3SJCA 2AX4A 1WCV1 2LCFA 2H17A 1G7SA 3E5HA 2WJYA 2FG5A 4FMCB 3T06B 1L4YA 3KJHA 4DIDA 1N6OA 3ZGXA 1XPRA 1E9SA 2A9KA 5JHHB 1U81A 4HAXA 4GMDA 4IJMA 1CLUA 5JSZB 1TEVA 1AQYA 2QT0A 2BMDA 2D62A 1P73A 2O0HA 2CL0X 2W6JA 4LHWA 4Q1BA 3LW7A 3EPHA 3BWDD 2PZEA 4K81B 1VIYA 3BD9A 4ZPXA 2FA9A 1QHGA 1N6LA 4D4JA 1RJ9A 5GADl 4C2TA 4FMDF 5JZVA 4C0SA 4JJZA 2YWGA 3LAWA 1Z6GA 4HYYA 4OQNA 3X1XA 5G3ZA 3AGPA 2QAGC 2CK3D 2ZRPA 2CL7X 1R0YA 1SXJC 3ADCA 1PVOA 3SHWA 1JEEA 4BLSA 4JL5A 4MRRA 2QAGA 2QRZA 3IIMA 3RNLA 3THOA 4IW3B 2J1LA 4FWTA 2C2HA 3CLVA 4LJ5A 4OL0A 3H84A 2AD5A 3C5CA 4UQOA 4YMTA 4GMXA 2ZS8A 1XTSA 1I2DA 2VF8A 3AVPA 3HU3A 3PR1A 4BLTA 4IDQA 4ZDJA 121PA 3L8YA 4JSTA 3BS4A 1E2NA 3LVQE 2GEDA 2WWFA 3EPKA 1SVKA 1Z6TA 3CPJB 1FMLA 1NG9A 5AUOB 3IILA 4DUGA 1G19A 3T1VA 3RDPA 3MD0A 1CR4A 4NE2A 3U3MA 4RD1A 4PPQA 1P61B 1KIMA 5EP3A 3ZH9B 4B3CA 2ATXA 4P32A 4NYMQ 5B30A 2DFNA 2XXAB 3DL0A 3LNCA 2ORVA 3QBTA 2HT1A 2GDJA 4QHSA 2WKQA 3R9WA 2LKDA 4IOJA 3CZPA 3NHAA 4P4TA 5EXPA 4Q47A 2CE2X 2VL7A 1XMVA 5JI2E 1R4AA 1S96A 3ADBA 1KKLA 3SQWA 2CVHA 3CNOA 2FN4A 4Q48A 5SZJA 2C9YA 1ZUNB 2XTNA 2F7SA 3LX8A 1GWNA 4BEBA 1XCMA 1VCMA 4W5JA 4EFMA 1SKYE 3KQNA 2J87A 4OHZA 3TK1A 2F55A 2GXQA 1YRBA 4KLNA 2ZJBA 4RZ3A 2C03A 2G3YA 4LHYA 3TSZA 2JLYA 1S4QA 4DEYA 1A1VA 1ZD1A 2EFDB 1YR6A 2IYVA 1OB2A 1CS4C 4A6PA 4IOKA 2WV9A 4NCJA 5KDOA 3LD9A 3Q72A 2ZVQX 3A6PC 4TYNA 2R62A 2O8BB 2FH5B 5KTYA 4LDJA 3GLFA 1E2EA 1OE0A 3FMIA 1JALA 5E7MA 2N46A 1CEEA 4JSYA 4LWZA 3BC1A 3X1DA 5LD2C 2FX3A 3QXSA 2IC5A 1LB1B 4OYHA 3I5YA 1G3UA 2PJRA 4A36A 4D0LB 4B44A 4C0AC 3FB4A 5IK2A 2IUTA 4JT4A 4MRNA 5BYKA 1VIAA 2ZTSA 1T8UA 3DZ8A 4ZI2A 1FTNA 1UKEA 5JSZA 2X77A 4V0MA 5CDFE 1P75A 1Z47A 1WMSA 3C4JA 3B13B 5JFGA 1E9EA 4A6XA 4JBYA 3U3KA 1GUAA 4Q19A 2NG1A 3AKYA 2JIZD 5DN6D 2ZROA 4ON9A 2FV8A 4HLDA 3QUSA 1R8QA 3AKCA 3I32A 2IYLD 1RYHA 5IRCD 5BQ5A 4OQLA 4LYFA 4QKQA 5JJIA 3P20A 1JPJA 1Q1BA 1UPTA
chains in the Genus database with same CATH superfamily
3HO8A 1S2NA 2ZB2A 1CC1S 4CM5A 3TMYA 4FBLA 3ZWBA 3RJ5A 4YAUA 3AIKA 3KP1A 1U0HC 4ZVKA 2G40A 4DJFC 3Q11A 1OPRA 5ENVA 3KKOA 1N8NA 1ZN9A 3JD3A 4JQOA 1H6AA 1P5RA 1V37A 3KZOA 1UQUA 3IAHA 3Q0TA 3AL0C 4PHCA 2F9FA 1AH2A 3B5IA 1X0XA 3N8IA 3ORRA 5FUXA 3UQZA 5TPWB 2Q46A 3ORFA 4BPRA 1RPTA 3WKBA 4QLBA 3L0DA 2QZSA 2BMJA 3LP6A 5DCYA 2BT4A 1W76A 3SZGA 3V4LA 3T3PB 1OU0A 1JILA 1H5NA 4Q6BA 4QGGA 1SO8A 4AUNA 4UFOA 3U2QA 3I28A 1TYCA 3W2HA 3QVUA 2XMDA 4F1WA 2PAFA 2ZWAA 2DSNA 1ECPA 4ZRNA 1U8YA 4X94A 2I4RA 3TL6A 3B3QA 1A9XB 4LC0A 3KYCB 1WLYA 4I1VA 1CNEA 1L0BA 2AFVA 2AKYA 4J91A 3I6YA 1ZD9A 1IMJA 2FETA 2HLDA 5L8VA 3FYUA 1J0XO 4RSMA 3WQHA 5E38A 5AI9A 3RRYA 1QU2A 2OV3A 1T4MA 1PDVA 3OX1A 3PNQA 2FMKA 4EO4A 2W6ID 2ATEA 3RRMA 1YASA 2GWRA 3MWLA 5U1PA 2GPJA 2JKVA 3IAEA 5GP1A 1O9BA 1HLGA 3AEQA 3IBFA 4FHZA 3NBZC 2BFCB 1R9MA 3D64A 5AI8A 4YASA 3THSA 4BB9A 3SZ3A 4DBZA 1T8WA 5ALEA 2I9PA 1GPAA 2C8LA 3LCCA 4YBRA 5EIFA 1EWQA 1UP6A 2A9PA 2HIAA 1AS0A 2HYDA 2NO7A 4KPYA 3ZCUA 1V8ZA 4BC1A 2HSGA 2PV0A 5AVRA 2CJWB 2G36A 4CR6A 1KE2A 1XT6A 4TSKA 3QHPA 1PS8A 4KTVE 4OQEA 4ZXPA 4I99A 2JGDB 1TO6A 4J3JA 4R54A 1J1IA 4KQ6A 3I2FA 1T1IA 1DQNA 1UPBA 3OZSA 1EKXA 5JAQA 3VNVA 4WXHA 2I2CA 5F23A 1LK0A 5JZ9A 2I9KA 2QM3A 4ZYZA 2CJYA 4DAEA 5A9SA 1UWLA 4IJKA 3EW9A 1I2BA 2O52A 3T1TA 2DPGA 2ILTA 3CF2A 4GPIB 3DLIA 5K8CA 2PUFA 4HWSA 5BV1A 2O3TA 3CKKA 2HAEA 2MINA 3AWDA 2L17A 2GOYA 4BNLA 4B73A 5LXTF 3ZKWB 4EA7A 1AA6A 2JLZA 4H1TA 4NFHA 1YKSA 2J5XA 3NHRA 1NBMA 5CG1A 1PJ8A 3G5UA 4PZ9A 1WW2A 2MCFA 4C4PA 2XQKA 1PGJA 1YL6A 1RAFA 5L6MB 1PQPA 2J3JA 4E1BA 1YBFA 2GXSA 2GSDA 2ZE7A 3ZCPA 2RAUA 1N6HA 3H75A 4PBTA 1SURA 2PWPA 3GDOA 5HTKA 1RQRA 1IPHA 4LQLA 5B55A 4INOA 1UEIA 4LHVA 1ONNA 1ZI8A 4V0SA 2CLFB 2YIMA 5JNRA 2VDVE 2R8XA 5KYVA 4B7AA 4MYRA 1QIFA 3PJDA 4E07A 1N25A 4UVDA 4RUKA 1ZRMA 5JSYA 3TEFA 4HNVA 4LZPA 4BV8A 2FEKA 2D8AA 3PEUA 4HB2A 4M0DA 1THTA 1NTOA 4FGLA 5CP8A 1QYWA 1MNQA 8ATCA 3P0HA 4KLRA 4ENRA 1NE7A 1VJ5A 4JUCA 4O2LA 3T5MA 3THXB 4WLOA 5LP6A 3GWZA 3GPCA 1J49A 1GO2A 3N5KA 2C4HA 3C15C 3G85A 2D1TA 2PSSA 2EIHA 2VDJA 2VK4A 3HBFA 3I6MA 4B6SA 5HNKA 1ZI9A 2BKLA 2E4YA 3I9JA 1IDN1 1TKAA 5T41A 3TNDA 2B61A 3ANTA 3SM3A 1C41A 1XVVA 3Q10A 1IUNA 4TMKA 4PX9A 5DNUA 2Y8EA 2HJRA 3NDJA 1RCFA 2YYYA 2V6IA 4KXFB 2QROA 1G64A 1XCOA 2BCJQ 1VHDA 2MMGA 2NXJA 4R0VA 4BNMA 4D82A 1S2GA 5DNCA 4QICA 4WFIA 2Q5JA 3E9ZA 1N4DA 3D5EA 3TSYA 4Z1MD 1XPUA 3ILSA 5LUBA 1G9TA 2MSCB 4HH0A 3N39C 5EINA 1NOKA 2I71A 3TNLA 4AL4A 5CEEA 4TXMA 3RROA 4QODA 2OLKA 2WKSA 4X60A 1P6UA 3K05A 3R5KA 1O6ZA 1US8B 2H4YA 4KUGA 2ZBPA 3OJFA 2JIMA 1IONA 4H17A 3TGWA 5LQAA 2PZBA 1YRQA 5GJWC 3N5CA 3S99A 2OCLA 1H2WA 4M46A 4MEJA 4DG8A 3GEDA 1I4WA 2F1HA 3SHQA 1W87A 4RCYA 3LYHA 4US1R 4DMFA 2QMZA 2NWQA 4AS3A 3P2KA 2OXRA 4UXIA 4AURA 1Q20A 2CCGA 3P26A 4I1RA 5ERGB 5LIRA 1PZNA 4G86A 4S1WA 1H4SA 2XJ9A 3IC5A 3WL5A 3ZHUA 3QNUA 2AB0A 1PL6A 4H1HA 4ZVLA 3P4YA 1VKRA 2MJLA 2ZATA 4G0ZA 1TEZA 3K30A 2FX2A 3FJOA 5HK8A 1NY6A 5GTDA 4KB5A 3ND5A 1A7UA 1FLDA 1ZD4A 3EF3A 5TV2A 5KSYA 3ZXSA 3GQBB 1ZOSA 1RACA 2WEKA 3L8EA 2BFFA 2IXBA 1WHTB 4NAVA 4TKVB 4Q4HA 4R2IA 4RDHA 1Z2PX 3P1JA 2JK0A 2OCAA 4MUXA 5FTKA 3EEBA 1P8AA 2RSLA 3U7JA 3ETEA 3W7VA 4AJ1A 4DOMA 4DHWA 2R97A 1AK1A 1QF6A 2PNJA 2VDWB 1ZN8A 1JDBB 1VP3A 5M2QA 2A5YB 3G1TA 4V2UA 4LFCB 3FCXA 4HC4A 4NCBA 2GA9A 4E30A 4WDRA 1R16A 2X2EA 3L1KA 4INAA 4MTCA 3AJ8A 4QUIA 3DZKA 3KWMA 4N40A 2H1FA 3O0TA 4IDDA 4AU1A 4IFTA 1E6MA 2BGGA 3CIOA 3PL5A 4W5TA 3V8NA 1NF9A 3FVQA 1E2UA 4JSRA 4MKFA 1M34E 4WPGA 1M6VB 3KJEA 3CH5A 1FNNA 1XWFA 1JHXA 5ESXA 3CZMA 3L84A 3OI7A 5L3QA 4B8WA 3SJZA 4CKWB 4L9RA 2E0IA 4MHOA 4FB5A 2Y0EA 3HUDA 2QBYB 3R6TA 3IIKA 3LDGA 1O97D 1WX1A 2AIRA 4Z7OB 1WEKA 3VV3A 4NEHB 2FEPA 3LUCA 3QYAA 1WE2A 3MJSA 2JGLA 3S44A 4B6RA 3V4ZA 3P5SA 1FX0B 1M5TA 3R5XA 1H8ED 3AOGA 4YJ3F 1AUQA 3FPHA 1E6LA 2Y9PB 2VCYA 2CB0A 3KZXA 3O4IA 4M1SA 4UCWA 4DA0A 4YHHB 3C74A 5J58A 1TIKA 2Y2UA 4EUHA 2BRUC 3HVUA 3QPDA 4H7DA 4DM4A 1ZMOA 3Q3IA 5KTNA 4MVYA 3BM5A 3EXIA 1XD2B 1H2ZA 1CUCA 5LMCA 2BMFA 4IDOA 1AO0A 3M5PA 3DEKA 3QPUA 2WA2A 4OI0A 2WYIA 1X86B 2FPIB 4O2BA 3C16C 1W19A 2JEYA 5AJWA 4AQ7A 3MPUA 3DUWA 1E5TA 1KO1A 2A2ZA 3NORA 5F52A 2A59A 2FPLA 4TYPA 5F7JA 3FVVA 5J4VA 2PWBA 3HNPA 1QS0A 4JLJA 3D1VA 1MP0A 1I80A 1RRPA 1NT4A 3C3MA 3G8DA 2HWUA 1GVNB 4QNRA 1OZAA 1AVTA 2FTKE 1MAHA 3OLZA 3FPBA 2MR5A 3G9ZA 4FCCA 3PKJA 2XEDA 3QP9A 4L75A 4V0NA 1M34A 4U2EA 1DI0A 3PRKE 4ZJPA 5KX5A 4EATA 4G1FA 3QWHA 2I7DA 4M0PA 4NKRA 4CUKA 1L2TA 1ZD5A 2LGJA 4PZ0A 3C1UA 2PIDA 1MO5A 4TKLA 1P33A 4NPAA 2IS6A 4JC5A 4LV5B 4WECA 4NAHA 1KKMA 3LFTA 4RS3A 1Y1QA 4RVNA 1GRRA 3A2KA 1ORHA 4YPFA 3OQMA 2VRBA 4I81A 5LQSA 2NXNA 5B7QA 1RT9A 2YJTD 5JU6A 1FMFA 1C9DB 1XQ9A 1JFFA 4JEHA 5AXBA 1LVGA 3AY0A 2JLWA 1YIDA 3O4VA 4TGLA 3HB0A 3AOEC 1JSXA 4NJEB 3PBKA 1VHWA 2CXNA 1N75A 2HJ9A 4Z49A 4UNPA 2ZJZA 5HJ2A 1YDEA 4H7IA 1IBRA 4JYCA 4P0TA 1S3FA 4D6PA 3SYMA 5ELXA 5C8ZA 1MJHA 2H16A 2WD8A 3FD8A 5KYUA 4R8RA 2YRXA 5EVJA 3ZU5A 4JI8B 4IKOA 2W83A 3DEZA 2E1RA 3BCHA 4XWGA 2QX4A 2UUBB 1NA5A 4QJIA 3LOQA 4G1CA 5AK5A 3NG1A 3TEJA 3W5SA 4EY4A 2QB5A 2ZAMA 3DFIA 3ZCVA 2W2VA 3U3RA 2O5EA 1H2FA 4QC2A 1UZUA 3M6UA 1TCVA 4GL4A 4UEOA 4Q1CA 3SC4A 2NM0A 1E7QA 2J07A 2DFPA 3KOZA 1JR4A 3BAFA 3BGDA 4K9PA 4MCAA 2WLTA 2GYYA 4IWNA 5A6SB 2NTEA 2ZYTX 3O4GA 1U63A 3DAPA 4LV6A 5GM2A 1A9RA 4G0MA 5P21A 4EI7A 5TMEA 2C8VA 3ENKA 1QGZA 3ZVNA 3TZLA 4KR9A 3PB3A 1Z2NX 2GPAA 1JQKA 2FQXA 3QOYA 3FTNA 4ZC1A 5KCZA 1WUTA 2CJFA 1NTRA 1KJNA 5ITZA 5KAMA 1U8CB 5HDQA 1ZW6A 2B6NA 3GZNB 1M1NA 1X92A 2FE1A 4IJUA 1U2PA 2AEEA 1NT2A 5DSZA 5BVGB 3WZMA 3IL2A 4XQGA 4RD6A 4FKMA 1IATA 1YONA 2PS0A 3DEHA 4GWKA 3GUZA 2JANA 2VSNA 3WYNA 5JATA 4JGBA 4V1CA 1AGNA 3BXFA 3OM8A 4LYYA 5C34B 1P2SA 1Y7TA 2ZXUA 2VKTA 3HB9A 4JBXA 4QPJC 2HJHA 4MSUA 3C39A 4P0PB 3AL3A 2HK9A 4QQ8A 4QYIA 1Y6JA 5EHQA 4ADSG 2Z1NA 4Y1GA 3AYXB 5EXSA 1JA9A 4BGIA 3PXGA 2AUNA 4IVRA 5FOTA 5A4KA 4LC9A 1YACA 3WL8A 1UINA 2UVQA 2ZRLA 1U94A 2ZFUA 3CZRA 2PX5A 3SE7A 1KO5A 1W44A 4PYRA 4QRHA 1SVUA 3SS8A 5IPFA 5FRDA 3H0KA 1W6UA 5EXTA 4CEHA 5FDFA 3LZ6A 3L6CA 4URFA 3OFVA 4H4CA 1SUDA 2WABA 3GL9A 1P5HA 5LCXA 3NBMA 4ZTUB 1A9OA 3TNJA 2LVBA 2IIPA 3WJAA 2B4TO 2DR2A 2SECE 3QZUA 1YS6A 4NCNA 2R85A 3I9FA 2X0KA 1B74A 2R84A 2ZIAA 4J43A 4QBFA 1QOPB 1L4NA 3A4YA 3ILVA 5EPEA 4H4EA 1RXSA 5BMOA 1XXHE 2X8BA 1QV6A 3GEEA 4N8SA 4RJJA 5GY7A 3SSAA 3LUHA 3A9TA 4TZTA 3WTCA 5HS6A 2CV1A 3E7PA 1G21A 3KEFA 5ER6A 2GT1A 3V34A 4LW8A 1KQPA 1YR2A 2SICE 1XK6A 3ZQ4A 2IXEA 4L6CA 1C30A 1VOTA 1A2OA 2CBGA 3KQWA 3O8CA 3JCZA 1DIGA 1TKBA 3M1AA 5DWVA 4BDSA 4XDGA 1I32A 1U9CA 5EZQA 1V7CA 4OIFA 2RKBA 5DM0A 4ZFNA 4G9EA 3NYIA 3K9QO 3OMWA 2ZDQA 4X3PA 1FP4B 3M49A 1Z7EA 1GGHA 4CNBA 1WXEA 1MRZA 1OC2A 2VJNA 3E2MA 4TLLB 3O8DA 4EPVA 1VGQA 5IVHA 3HFSA 1VJCA 5I9MA 5NULA 5A2GA 1RTTA 1IU9A 1YDGA 4I3HA 3ESBA 1E18A 3MCAA 4FMPA 1LTHR 4L6IA 2QGZA 3K0FB 4EVRA 3JX9A 4K9MA 4M87A 4QASA 1V41E 1R0WA 4DLYA 2ZRAA 4NXNB 3HS3A 4F2WA 5E8RA 1HE4A 2O7SA 3CN7A 3CZ9A 3L8FA 2XZOA 2H7XA 4F5YA 3VKUA 2EKQA 5EP4A 3FKSD 2E4WA 1EVKA 1UK6A 4K0KB 3BJIC 4TTTS 2VDMB 5IKOA 2F59A 1RAEA 2CNKA 1Q7BA 3CEAA 3A1FA 5TRTA 3HFRA 5DNDA 4FHDA 4GYJA 4UNNA 1K3TA 1KY4A 1CRZA 1OBCA 1ZH4A 2I87A 4X7MA 2PUAA 3FX2A 1I5EA 1YZYA 4ACBA 3GFOA 3MS2A 4N65A 4F92B 2AR0A 2YYAA 1SC4A 2HBZA 1XXHA 3UBMA 2QN7A 1TUBB 4BFVA 4B8YA 4F84A 5A2QA 1KYYA 1EZZA 4E6PA 4DLBA 2WWIA 4DR3B 1BMQA 1POWA 2WINI 1GADO 1M3SA 2KB0A 3FUVA 4JLSA 2J0SA 4EFLA 1EA7A 3INNA 3R5JA 4IGKA 4M8SA 1ZR2A 1N32B 3L0CA 3SFZA 3ZDRA 2ZPTX 4K9KA 2RHLA 4HAVA 4PO1A 3OLVA 4L8VA 1K3FA 1CIJA 4IL5A 3RUHA 1WUKS 2HA4A 3C7CB 1ZYUA 4JVMA 4G0PA 3OOEA 3D2LA 4CEJA 4E7OA 5EIBC 3MGAA 5T67A 2BE7A 3ZPXA 4ENTA 1JKXA 1XG5A 1CDZA 4W8GA 3S2YA 2B8EA 5KDLA 4ZO7A 2P3SA 2G70A 1UJMA 1TRKA 3BWBA 3EIFA 1YFJA 3TKYA 1RM4A 5ENDA 1KVSA 2YXDA 4WXPA 3WKAA 4ZIRA 2QRVB 1L5HA 4PYNA 4OQQA 1EFKA 3NAGA 4HR7A 1GGKA 1PR2A 3TW8A 1NI5A 3L9XA 4DBLE 2CF5A 4MP6A 1TQ4A 2YV5A 1KYXA 1UZMA 2HHJA 1C2YA 1ETUA 3STTA 1M54A 3S1AA 5CNMA 5J4YA 2J5BA 5AUQA 4BUJA 1U7HA 4RXUA 1L7RA 3A4TA 3A3KA 3HKEA 2Z5GA 4LXTA 3T5PA 5IC4A 4R81A 5KYYA 2O8FB 1YRHA 3LVFO 3IBYA 1TM2A 3HZZA 4UHDA 1LVUA 4OXYA 4B34A 4NG5A 2ZT8A 1W85B 3WK5A 4B43A 1VXOA 3HQ4O 2DR0A 3L41A 2A30A 3S40A 3W79A 1NASA 1ODLA 3SX0A 1ZA1A 1AKRA 3EZYA 2IDZA 2Q27A 4WCFB 4XM2A 4A8TA 4BB5A 3GLFE 3K0BA 3P9SA 5CXXA 3EZ7A 1JVSA 1IC6A 4YACA 1PS0A 1Y4DE 4Y6LA 5DLEA 2WT9A 4X63A 4EF4A 2K6GA 5CPFA 3U4CA 4KO4S 4DCPA 1TYDE 2OMKA 3VSBA 4EKYA 1D9XA 1OFVA 1LQUA 3STWA 3WMEA 5CT6A 2GHTA 2I66A 1ZUWA 2AN9A 2EZ8A 2QJRA 4AY2A 1FFWA 1JVBA 4AUMA 2Q49A 1GTJ1 3IAS1 4LUCA 3REQB 4V0ME 3QNWA 3VYUB 2HMUA 2OTCA 3HA2A 4RX1A 1EM8B 4P98A 3MMNA 1SAYA 2DHEA 1VDMA 2OKGA 1HE5A 4LNHA 3TUJC 2HPVA 2OVBA 4MGYR 4B81A 2A9FA 1EVZA 3EUWA 2WMNB 3KFXA 4XUEA 3OHPA 1HH4A 2EGHA 3H2GA 1JDVA 3T38A 3A6EA 3ZD7A 4N3GA 2C3OA 2IHVA 3C70A 3SN6A 4BP3A 3JARA 4FZ5A 4K87A 3WLOA 3A9WA 3LXRA 4IMIB 4JCOA 2C3PA 4RHYA 3TSAA 2CNDA 1B7GO 3DBRB 4U6SA 1KOJA 5HRCA 4ND3A 4EJSA 1XLWA 3N2EA 2YRFA 3RUIA 2BFBA 2JIZA 1QPZA 3H2KA 1XD8A 1E58A 2J3EA 2IU6A 2P2SA 2C4UA 1RABA 1V6CA 1NSYA 3PC4A 1PV1A 5KJFA 5FOQA 4DSNA 1X70A 4BCBA 5D85A 1YC2A 2P11A 5ICMA 1ZR4A 3JAKA 2SKDA 4PTZA 2Q3CA 4KRFA 3PLRA 4L1KA 1E4VA 1WZUA 4NBLA 4F91B 5JSQA 3FJYA 4BEVA 1SU8A 3WO0A 5LQNA 4PTYA 4L28A 1W93A 3TZKA 4ANFA 4U2CA 5A0VA 2DQZA 2TMGA 4BIMA 2P30A 4FDLA 3H3XA 4KNVA 4NS1A 3E18A 3LTNC 2EEZA 3PDIA 3TINA 4MIYA 3UYKA 1I1HA 4DSUA 4PGAA 5FA6A 3M6LA 2GRAA 1NMZA 3KELA 4FINA 3BD6A 1S8FA 3Q3CA 4MDEA 1Q0SA 4II2A 1OREA 1QE3A 3KT0A 3PUIA 4N0PA 4OAQA 4QXAA 3WHKA 1WPGA 4D4KA 3VVCA 4ZAXA 4C4RA 4KQCA 4RTNA 1NXSA 4HXGA 4RF5A 2QAIA 1JDJA 1QQ7A 1T0UA 4CDMA 1Y8CA 1QR6A 2FJ0A 3UAZA 4ZTZB 1JTVA 1WUYA 1BFKA 5EWMA 1HSOA 2HI0A 2J9GA 2NUBA 3BUSA 2M6RA 4D2IA 4EYOA 3RFXA 1B8NA 1SPXA 2VP0A 2OCDA 2BGKA 2Z1DA 1D7AA 2GVZC 1YSCA 2DCMA 2P9FA 3JQ7A 2YNMA 3A4MA 3KTOA 1GT91 4LNUA 5I9BA 3IP5A 4CDGA 2F1IA 4XLTA 2OESA 2AJ8A 2EEPA 4LF5B 1RYZA 1R0SA 2AF4C 2QXTA 1GUBA 3D3JA 4OA5A 1L5NA 4MI6A 3C45A 2QUKA 4ZZ0A 4K1LA 3NOQA 4Y2JA 5EGSA 1N5JA 4RFVA 4ZQIA 5HPYB 3PDHA 3RS3A 5KTSA 3C14C 1XCPA 4YONB 2W4MA 4HLQB 3OSUA 3QKRB 5ILGA 2QTZA 1H1TA 3GOHA 1W9HA 2PA0A 2XKAA 4N9WA 3URKA 3HABA 1Y3BE 2P2GA 4OMCA 4P3OA 4B33A 1JHYA 5HS4A 2XKJE 5K2MA 5JMWA 1PGOA 5HQJA 1EGAA 2ZWPA 3IEXA 4XRRA 4U63A 4WOKA 1RWPA 3RWMB 4DLUA 1WAMA 4OU5A 1SY7A 5IANA 4C3UA 4CV3A 5CLLA 4MKRA 5FOSA 2QQGA 1NNEA 1Q7EA 3D3EA 4EX7A 3HJRA 2IU0A 2R4UA 4PTLA 1OTYA 1ST3A 4GLFA 2G9UA 4MVJG 5AM0A 5HE9A 4CN9A 4XAQA 2YWFA 4ZQBA 2CLIB 4XVHA 5CMLA 5JJ5A 3R9XB 1N6PA 2IW3A 4M36A 1NXWA 2YZGA 3WMXA 3M4XA 1U98A 3AR7A 3QI7A 5DKFA 5DMHA 4M54A 1Y6QA 4HPXB 4RY9A 3EPLA 1EAYA 4FQ7A 1UBMS 5CLGA 3C8UA 4FC6A 4WADA 4RKRA 4DG5A 3KEGA 5IEBA 5EJFA 5CYGA 1IG3A 3EAGA 4EY5A 3W5DA 1W4BA 2EX4A 2VYNA 1SN7A 3MIIA 4IUBS 2F1RA 4E5KA 2P0AA 3G89A 4EITA 5AKEA 1IN8A 1HKUA 2ZYRA 2YQ4A 3ASUA 4FFSA 4KO2S 4LA4A 4X8MA 3RIXA 1GG2A 4M99A 3GLGB 2W0MA 1UXGA 1E8NA 2FUG6 4HBZA 5CITA 1NXOA 3GFFA 1DC3A 5HZGA 5H16A 1M8JA 3OZXA 5COBA 1X80A 2DM6A 3CX3A 3HCDA 3AHEA 3I6QA 2F3TA 3LLSA 3BRWA 2QP9X 1I1NA 3F3SA 1X39A 3FDXA 3A1UA 4CV0A 1WEHA 2ZSEA 3R75A 5JDIC 1O9HA 3W9BA 2I62A 3KZNA 1MW8X 1DKQA 1IXYA 2NIPA 1MPTA 3FPCA 2ZPUA 3U7FB 1GEGA 3BRCA 1FTWA 4JX8A 3ABOB 3W6ZA 1M5RA 1KVTA 3H1GA 3KSMA 5H68A 4N49A 3RKUA 4P5EA 3TOSA 4ZDIA 4HEA1 4X6LA 2XJ4A 2F17A 3KAJA 3SFVA 3EVGA 1EVQA 2A1IA 3E84A 1M33A 3KKPA 2GBCA 5L4NA 1WZEA 5DHQA 2CXTA 1Q7TA 1K6JA 4O2AB 4LXQA 3G1WA 3J7TA 1JU3A 1Z08A 2PL5A 3SCZA 3HO1A 3STUA 3D6NB 4RABA 1P1RA 1V8OA 4LYHA 2YN0A 4MLPA 4LVUA 5CYFA 3F98A 2APJA 5DASA 1OH8A 2ZANA 2I3DA 3KB2A 3JQDA 1W7AA 3QXXA 5CCXA 5CD1A 1ICEA 1T5DX 5DHRA 3OOWA 5HCIA 1BRMA 1L7PA 3IYLW 2I2WA 4P1ZA 3I5AA 2QN3A 1SVMA 3LPCA 4Q00A 3HXPA 9LDBA 1J5PA 2FZ5A 3UAYA 4Q3DA 4ABYA 4ER7A 1RZRA 2A9OA 3QLJA 3EQ6A 1JDUA 2BCEA 5K8JB 5I8ZA 1QBKC 4G4SP 1NDQA 4R2HA 3FPSA 4ZICA 2H52A 5AKXA 4ZEVA 4K46A 2VHWA 1PG2A 3WJ2A 1D6SA 5J2UB 4PRYA 4EZEA 3RJZA 4R0MA 2O3QA 4FUQA 1E1QA 1EJBA 4G81A 2XGMA 1ONSA 5C81A 4XVQA 2NQ2C 1GDTA 4WX2B 1XSEA 4V1CI 2IXTA 4ALIA 3DMPA 2HLNA 5ALRA 2NPIA 2OBYA 4ESEA 3DOUA 5ADWA 2Y1EA 4R51A 2N0SA 3AHFA 4DIEA 5KSZA 2AI2A 3DNPA 4QM7A 3W2IA 1GTSA 1MXFA 4GYYA 2FW0A 3FCYA 3G2OA 3L5KA 1GSHA 2ZBFA 1GUZA 2NO5A 4DYVA 3TXXA 1R1DA 1F51E 1GL3A 4ZVUA 1VKOA 1BS9A 2C2YA 4QBIA 1C9MA 1QQ5A 4S24A 3ZTTA 4BVHA 1KEPA 3TJZA 5T3UA 4HCJA 2PFKA 3GJ8A 1RLUA 3IKMB 3R6DA 4KKVA 2F62A 2JCYA 4JJFA 1CRLA 1A9XA 3IESA 3NETA 3TE6A 4BX9A 3AILA 4EECA 3KYCA 5IH7A 1GPNA 3HJGA 4PN7A 1G3MA 4IIYA 1FU8A 2YWRA 4NE7A 4QTXA 1H2YA 2XB6A 4EG4A 3Q2OA 4EY6A 5ITZB 1RAIA 3CMMA 2XV1A 1EQ2A 5B2ZA 4CLRB 1E5DA 1E94E 2XUIA 2CUNA 1KP9A 1UOPA 1Z0FA 3P2OA 1NF3A 3WMGA 1BXRA 5A71A 1L5OA 1Z73A 1UJ5A 2Q7OE 3ROPA 4PR3A 3WBKA 4CT0A 3CRNA 3UV6A 4DVGA 2RH9B 3QVLA 4DKJA 4DCTA 4WESB 1LBEA 1T2EA 1H5QA 2PDAA 1LQTA 2WOOA 2NU9A 2VK2A 4XVRA 4IHJB 1T5TA 5MFZA 3D43A 1H6BA 3K9NA 3Q87B 4KIFA 1JIQA 1LV7A 2WUFA 1AKQA 3UMFA 1DO8A 3L4EA 4RQUA 4GGPA 4R2JA 1H69A 4PFKA 3MWFA 4Z9BA 4DCNA 5IFKA 1A98A 1NQUA 4FU0A 4FTWA 3B9RA 1RFLA 3CWQA 1XMSA 2CJWA 4IS2A 4KQMA 4MUMA 1FVFA 2DTDA 4TRRA 2G9QA 1HORA 4FFMA 4TMZA 3HCRA 4C88A 2A1TR 2FK8A 2P9YA 2Q8NA 1QHXA 1BO6A 3ONNA 2OE2A 4AROA 4BJHB 4DDHA 5ANRB 4IJVA 4ARAA 4IIFA 3VKHA 2WKPA 3AHIA 5CBPA 1N1MA 9MHTA 1YL5A 2PJDA 4JB3A 4DNOA 2E21A 4KN8A 4QQKA 3BKXA 1DMSA 5BSFA 3VO9A 4U7TB 1NC1A 1J22A 1FZQA 3GXOA 2JGNA 2Y99A 4NENA 2GBFA 4ZODA 2PGNA 3CZ5A 3KIPA 4UTZA 3TJRA 3WIBA 3R3WA 1GKKA 4BYMA 3BOSA 4E1VA 4JIMA 3L02A 3VKVA 2DF8A 1PUJA 2OK7A 2ZRNA 1V4NA 2IZZA 3H11A 1Q1NA 2GD0A 4WXRA 1HDIA 4BE7B 1ZC3A 2GFQA 1ABEA 3GVXA 5E3JA 1R7RA 4DXAA 4I9FA 5CDSA 2QU7A 4FIZA 1HEUA 4I9GA 1J8DA 2B94A 2GCOB 2V0GA 1A95A 3IMFA 2P5TB 5E4FA 4JD5A 1P1JA 3RR2A 1PYOA 4WNAA 2SCUB 2QD5A 5LQDA 1DBIA 4JR1A 1W49A 3U6BA 2FG7C 3M1IA 3DBLB 3QOWA 1T6XA 2OZLB 4XYGA 1Z6QA 4LOHA 3O2SB 3ESZA 4ZJYA 1KC1A 1FFEA 3PQCA 1G9SA 3T5DA 4MYUA 4NQRA 1JLRA 1U3FA 3CUTA 4PPYA 4EHFA 4U5XA 1YR9A 1P0CA 3THXA 1ONOA 1MG0A 1CR0A 1CRWG 2C2OA 4LGVA 4RH3A 1TFUA 2IV7A 2PD4A 2QK4A 1Z6XA 2YV3A 1DIRA 2BAGA 2RGEA 3HEAA 1TD9A 4PX2A 4ENUA 4HVCA 1KMMA 5F2NA 4YRKA 3OOSA 3WB9A 5KNBA 1SKMA 1QCDA 3TRJA 1NUTA 2HK7A 5DTQA 3OKFA 2XXAB 1EGQA 3OKCA 4FNMA 1NVAA 1DKPA 1Y33E 1BWPA 3N6RA 5D6NA 2WJGA 3QFTA 3MTQA 1DTSA 4WAUA 1EESA 1N2BA 1YA8A 2NO1A 4G63A 4NCXA 3O1JC 2IEYA 1RPNA 2O50A 5IZCC 5BMVB 1AQUA 2LXNA 1N1GA 1O0CA 1D09A 4QO7A 2I6SA 2I6UA 4KI0A 1PV4A 3CRMA 1LRJA 3AESA 1NHGA 4KPUA 3UNXA 4EJ6A 3TQCA 1AOXA 4GRAA 1VLVA 4QNNA 1YF3A 2ZI7A 1QHFA 3ET5A 3HRIA 4IIJB 4NARA 4OMFG 2QVGA 4KMOA 4UDNA 3T8YA 4A1OA 1E1MA 1QMPA 5C4MA 1JI3A 3LXMA 4N3NA 4AY6A 1F12A 1JJIA 5A7FA 1ORDA 4JC8A 1HOXA 3WQQA 1RC8A 3IDFA 4CM1A 1EFTA 4HNAA 3IIJA 3OCYA 4CM9D 4ER3A 5BV8A 1Y89A 1YQ9A 1FDOA 2ZLBA 3D0KA 4YAEA 4A23A 4H7KA 2OO7A 1U8XX 5CUQA 4F86A 1VPVA 2GSWA 3KJQA 3N2LA 1IXKA 3EPRA 4BJ5A 1R4NB 2QTHA 1UF9A 2FLWA 5CK5A 5AKZA 2CKMA 4G5QA 5G0VA 1Q0RA 1OAKA 2AOWA 1ANKA 3USZA 2I1VB 5KVAA 2BHSA 1OBOA 2AMJA 4A0QA 4BWFB 1UODA 4M1ZA 2HRCA 4KR3A 1Z4LA 2O0JA 5JCJD 2GF9A 3UHAA 2PGIA 2A8YA 3GYBA 3REFA 1F7UA 2QE6A 1VFPA 2K2QB 4QOSA 5DGDA 4MA5A 4RMGA 1UQTA 4V0RA 5D86A 1IBKB 2G9NA 2W6ZA 2JRLA 4KFUA 4DCOA 4B4VA 3SC2A 3ZY3A 4TKVA 2PVCA 4KQJA 3QEOA 3IDAA 4CM4B 5GINE 1X7GA 2Z6AA 1T8YA 5CG2A 3ZV3A 2VDWA 4BFWA 4EFNA 4ZAFA 1Z3IX 4B4UA 4Y2SA 4REQB 3V2IA 1IIRA 2Q1UA 3VYRB 3ADBA 1XV5A 2HL6A 3P2JA 1MABA 1R2QA 4IILA 5J4HA 2PH3A 4QAJA 1P81A 2DUWA 1J5EB 2QT9A 3JPWA 5DM2A 3A11A 4RS4A 3TLMA 4BQRA 4HP8A 3RVSA 4UUAA 4CG0A 2AXEA 2FQQA 2JI7A 3JQRA 4I3GA 3R74A 4N12A 5JNTA 4H3VA 4CTOA 1WXHA 1J00A 1MDBA 1P2BA 2RGAA 3KVVA 1U6IA 3P9KA 4KE6A 4JQYA 4YAWA 5CAEB 1Y8RA 5JHGB 2D59A 4F71A 3BF7A 1E2HA 1GFSA 2RK3A 2XE4A 1DEOA 2B1JA 2PIAA 2QLFA 4ZXFA 2OXIA 2WNSA 3SEAA 4BATA 4CKWA 3DAGA 4N8DA 1SKAA 2HPHA 3A6GA 4MWGA 1WSDA 1IH8A 1Z2DA 4M89A 5KKAA 5SY4A 3UCXA 2PD6A 3EIXA 4RPJA 5BV0A 3EFHA 2EBHX 3C7DB 5HXAA 1IOLA 1DWPA 4TT3A 4DCMA 2R8RA 1KP3A 2XB4A 1XTKA 1T3SA 3F4LA 3I1IA 4QATA 4XOUA 4EB8A 5DHAA 4DLLA 1NVFA 1GA4A 2AEJA 2DECA 4E5NA 4EUNA 4KNYA 2HGZA 2Z8YA 1T4DA 4YB8A 1OX4B 5JS7A 1RCTE 1V45E 1ZSVA 2A9QA 5EERA 3T9BA 3A9CA 1MQAA 1EJ2A 1K7XB 3HXLA 3OBBA 4FX5A 5DRYA 1KRWA 3SBEA 3DDUA 1SCDA 1XZIA 2P90A 1KR5A 1SR8A 3QU5A 1L1QA 1XD2A 5DHPA 3F96A 4GPTA 2WJAA 3ED1A 1JW9B 3HPQA 4WGFA 4WY8A 1IN5A 1L7VC 3FI9A 2Q5LA 3N86A 3NC4A 1RWBA 3BEOA 2OGWA 4BO3A 5IWAB 5LDHA 1C0PA 4FS3A 2KSQA 1V7PC 2AEFA 4PZEA 5IHPA 2B92A 2VNAA 4K26A 3H65A 4HOYA 3OY2A 5K0CA 1MJGA 2QL9A 3MUNA 4AO8A 1VL1A 4HDCA 2DBYA 2GN6A 4BAGA 4FKZA 2AC7A 1C4KA 2IYOA 4OJTA 3OPXA 3AKZA 4JJ6A 5AYVA 3AEKB 5DYIA 5KVSA 5EUQB 2QWXA 4AFNA 2VN8A 1IFXA 1IQ0A 4LSGA 2Y92A 2JFZA 2L0XA 3L0SA 1EVEA 5K0NA 4FLEA 1B73A 3B12A 4JXKA 1AGXA 2WU0A 2UUOA 4CLEA 4N48A 1V8DA 3K0CA 3VO2A 3MAAC 1EYZA 4MW0A 4X00A 3PX7A 2AOTB 1XAGA 3SBDA 1DE0A 5HQ3A 4DR6B 3O8QB 3OT4A 1NULA 4OJQA 4Q7LA 2MT9A 621PA 5FJJA 3MMXA 5EIEA 1RPJA 5JD5A 1J2JA 4JLNA 4LF8B 4L57A 2HDHA 4NJEA 4QUJA 3RIHA 3A0UA 4DJTA 4X8OA 1VIVA 3SEFA 2VPZA 5BYAA 4BLVA 3BRSA 4FN4A 6LDHA 3LA8A 5HFAA 4EPWA 4YV1A 1HNNA 3ECCA 1E8MA 2V4MA 4R05A 3AF1A 2Z98A 1U0JA 4P7GA 2GPBA 5BSEA 3RFCA 4NMMA 1A04A 3GF4A 4KWIA 4PXAA 5FL7D 2CK3A 2VNKA 2IP4A 1HQCA 1Z0AA 3KL4A 3TQRA 3ZI4A 1HRDA 2CVQA 2FK7A 1V5WA 1SHZA 3BMCB 3A06A 3NBFA 2XDAA 3RFFA 1Z83A 1U8AA 5KJ6A 3TVTA 3NXKA 4Z53A 1EIZA 3RC9A 4JDUA 1R8YA 1T3GA 1SHLA 5A02A 3RS2A 4MB0A 4BZQA 1IZ8A 1E9CA 2G07A 1S2DA 3ZGNA 5EJ8A 4EKGA 4QPNA 1V8FA 1E4YA 1V5EA 2W70A 3VKFA 4E32A 2WTXA 2HQBA 5CM9C 3A3PA 3K35A 4R2LA 1BEZA 4Z9YA 5JWHA 5BR7A 4M1EA 1DJLA 1DRKA 1Z29A 4GLJA 3T7IA 4BBAA 4WXYB 5ARCA 2O2YA 3OWHA 5T6BA 1N2ZA 3SBXA 3VR1A 1BD3A 1DP4A 1UMDB 1AZSC 5U4QA 3AF0A 2VUHB 1QQ6A 2WTEA 1PEKE 5CTJA 4CIXA 2C00A 3L43A 4TUYB 2ETXA 4FT2A 4WK4B 4HDMB 1MQSA 2QPTA 4JR0A 1DKNA 2GEKA 1TLFA 3GMIA 3VHXB 3Q8XB 4URVR 4Z5XA 3HXMA 1JKFA 4PLYA 1D2HA 3G2PA 3PEVA 3SF8A 3DZCA 2FPRA 2UDPA 1AQIA 1Z39A 4UZFA 4ZVNA 1ZZGA 4HYEA 1FOEB 3R5HA 1VPDA 3M4YA 2FZWA 3ZU6A 3ZCSA 1G59A 5A04A 4LK2A 3UT0A 3Q7RA 3F8SA 1E66A