4WZ6A

Human cftr aa389-678 (nbd1), deltaf508 with three solubilizing mutations, bound atp
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
283
structure length
258
Chain Sequence
TTEVVMENVTAFWEEGFGELFEKAKQSLLGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRISFCSQNSWIMPGTIKENIIGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSELQNLRPDFSSKLMSFDQFSAERRNSILTETLHRFSLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Binding screen for cystic fibrosis transmembrane conductance regulator correctors finds new chemical matter and yields insights into cystic fibrosis therapeutic strategy.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Atp binding protein
molecule keywords Cystic fibrosis transmembrane conductance regulator
total genus 90
structure length 258
sequence length 283
ec nomenclature ec 3.6.3.49: Transferred entry: 5.6.1.6.
pdb deposition date 2014-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4wz6A00
2ZE5A 4D0NA 4QOSA 2NPFA 3IPYA 1TEXA 1XXHE 4DDTA 3DHWC 1GAJA 2QAJA 2XSZD 1JBKA 2B7CA 3GLIA 5FUVA 2P6RA 1TU4A 3HWSA 2R8RA 2EU8A 2ZI9A 3TIFA 4S2EA 3PXGA 3SEAA 1QHSA 4DCNA 2ZUDA 3SYLA 4LJ7A 3H0KA 2QAGB 4LHZA 4C2UA 3I1FA 4EPRA 4QJ3A 1G5RA 4DLTA 5DO9A 1G8HA 3GLGB 2F1HA 3TQCA 4C0JA 3R20A 3RNLA 2QU8A 1GRNA 2G0NA 2OCYC 5FBVB 2N46A 4TLAA 3PEYA 4F4IA 3JZMA 3OEEA 1SVIA 1YU9A 2NTYC 1ZU4A 3WNCA 4FINA 3HJNA 2OFOA 2EWVA 1PV4A 3I8XA 4CT4B 5FTMA 1NVXQ 2HUPA 2ZSBA 4DSOA 2EW1A 3U3JA 3I8SA 4HSEA 4A2QA 4XVRA 2ZI7A 1M74A 3NH9A 4FMDF 3QPVA 6Q21A 1II9A 1T91A 4EPTA 3QXHA 2A7QA 3A8TA 2BEJA 4BECA 1L4YA 3QXXA 2OAQ1 2BVNA 4DLSA 4C0AC 1IOZA 5DN6A 4K81B 1UKYA 1XD2A 4PZLA 4RFSA 1DELA 1JR3D 5JRJA 1KZGB 1SGWA 4R71A 4NBSA 5TVKA 4TMKA 5K8IA 4OKSA 4CW7A 1XFAA 4M1WA 3O8BA 2IYYA 4DDVA 4JBYA 1P9NA 5IDVA 1ZC3A 4CDGA 5F2EA 3RRNA 3QBTA 3HPRA 2CVFA 3ZVMA 2HF9A 4PFSA 1IM2A 2V9PA 2QP4A 3EXAA 4UKDA 5B30A 3SBEA 3CX8A 2GEDA 1WDTA 3FVQA 3ADCA 1TMKA 2NPIA 3VX3A 1OFHA 3KX2A 4EPVA 3BB3A 4RSGA 4QRHA 1G3RA 5CDFE 1G20E 4QNMA 3PG5A 2N1BA 1NKTA 1BIFA 3W8NA 1TNDA 1A4RA 4NKRA 2GJ8A 5C18A 1QG2A 1KI4A 1N0WA 3B2EA 3OEED 3VHLB 5KU1A 1S9HA 2QNRA 4NZYA 3A4LA 4TQ9A 2BBTA 1TTTA 3REFA 1AN0A 3ADKA 1M2OB 2BKEA 4FW9A 5FUXA 1CR2A 1JALA 4X8LA 4DIDA 3OAAD 4CGZA 3T15A 1E0KA 3H4MA 3P20A 1I4LD 3I73A 4W5WA 4MYCA 1C9KA 2XSZA 4M9ZA 1X1SA 3PUWA 2WBLC 2PCLA 4GSYA 1J8MF 2CBZA 4D25A 4IVPA 5CIQA 4II7A 3VKWA 1OH7A 4IVRA 2VL7A 5C4MA 2P5TB 4CRWB 2P3SA 4DDUA 2XAUA 1F48A 2RGAA 4R9UC 4NL4H 3LFUA 1KSGA 1CR0A 4ZKEA 5KTYA 2Z43A 4NH0A 4HLCA 3AVQA 3G0HA 1OYWA 2HYDA 3D8BA 3FFBA 1JJ7A 3OHMA 2FH5B 2FSGA 4GOJA 4EFMA 4KBFA 1CP2A 1XEXB 1OJLA 3W90A 1KO7A 3RS3A 3RVBA 3MLEA 2YJTD 1KY2A 1CKEA 1T4GA 1Z63A 2PEYA 3UG7A 3B1YA 4A9AA 3SE0A 2FPMA 1VCOA 5JHGB 2QSZA 2ATXA 5DN6D 1E9FA 4LWZA 2IEZA 2W6JD 3PUVA 2C2HA 1ZP6A 4UNRA 1DO2A 1CJUC 4BFXA 4OHWA 2GTPA 1AQUA 2QY9A 2H57A 3P26A 2ZU0C 4DLYA 1ZJ6A 3Q9LA 1NVVQ 1OHHD 4UNNA 4BWYA 2GXAA 3W6NA 2PLFA 3FMOB 4ZKDA 4LHVA 4KLZA 4MDFA 1QVAA 2I4IA 3QOFA 3VR4A 4URXR 3CX6A 2IHBA 3K9GA 3R8FA 1BO6A 1GKYA 4C0QC 2B92A 2HJGA 1GG2A 3GFPA 2BCGY 3RSLA 3K70D 3G5UA 4JYCA 1ZINA 4JL6A 3SBDA 3ECCA 1CLUA 4AKGA 1NN0A 4AD8A 2W0MA 2DFKB 2IS1A 4NHOA 2CXXA 2GKSA 4DLVA 5CYPA 1RZ3A 3E5HA 3C14C 5BN5A 1VPLA 4JLMA 1QZXA 4C0SA 2ZYTX 2ZS8A 3FHCB 1VG1A 4QJ4A 1ZBDA 2FSHA 2QEQA 2OSBA 2C04A 4Q21A 1RW4A 4RFSB 1W0JD 1Z29A 2FJUA 3PUXA 2IC5A 4N0DA 2JATA 3CO5A 3AUYA 2XXAA 2JJ2D 4NP6A 1GNPA 4UNPA 3P4XA 3THWA 1WBBA 2YVUA 2OLKA 3BOSA 1MOZA 1W2GA 4Q7KA 4QM7A 2O8DB 5SZKB 5GJCA 2AHOA 2O5VA 5DISB 4L9WA 2EFHB 4B2PA 5FOTA 2ZU6A 5FPTA 3GPLA 4IFBA 4NYIR 4PC6A 3EZ7A 5FOUA 5HZHA 1Q3TA 2ZRKA 2HLDA 3PJRA 5KPDA 4C0BA 1JR3E 4I99A 4JLDA 1OHHA 4HAWA 4GI7A 1Q22A 2J1LA 4QBIA 2ZROA 4OL0A 5EZ5A 5DNYB 1AQYA 3CNNA 1F6BA 4N3NA 2R9VA 2HV8A 2A9KA 4TT3A 1EFRA 2VSXA 5FBRB 4B3DA 1PLJA 1MRNA 3SJBA 1L7VC 4MRSA 1FZQA 2CL6X 1IY2A 2XX3A 1OFTA 1J99A 2E9SA 3RSOA 4AY2A 3TW4A 2CNWD 4EPWA 3HU1A 1IXRC 1T5LA 1G3QA 5BW8A 1XMIA 3CWZA 3AVVA 1KDRA 2OBMA 2BM1A 1K5DA 1N2CE 3FPAA 4L9SA 5H70A 4PTLA 3BD9A 2OESA 3U44B 3BWDD 4IEIA 1Z0IA 5HR5A 3GD7A 4I1VA 5JSZB 1DE0A 1XD8A 2RAPA 3VTKA 2HJVA 3QEOA 3CNOA 1V43A 2R2AA 1UBGA 4FMCF 2YNMA 4DLWA 3FFAA 2J7KA 4CF7A 1QG4A 2QQEA 2QP3A 3T1OA 3TSOA 2KWIA 1KI6A 4GMDA 5EE3A 2QGZA 2FU5C 3RAPR 4J0QA 2ZVPX 3WHLA 3ICEA 3BC1A 4L15A 4HLUA 1E98A 2A78A 3AP2A 2P6NA 2VHCA 2LWIA 1FMLA 1Q21A 1VHLA 4P3YA 1D2EA 2XNSA 3QKUA 4Q1FA 1RFLA 3HR7A 4GPTA 3A1TA 4PSVA 5F3WB 2O8FB 3C5CA 1E2JA 1Z2AA 1N6HA 4QHTA 4M0LA 4D26A 3B1XA 1ZRHA 3V4RA 3SR0A 4X8OA 2ZRBA 2B7BA 4OK3A 4TZ6A 2CCJA 4UXHA 1E2IA 4MRVA 1WCV1 5BWMA 3DM9B 1X8KA 2AFHE 2J87A 2A30A 4WZBE 4BRWA 1N5LA 2GXUA 1GRRA 3TUIC 2GAAA 3OFND 3VKGA 5CB8A 3NBZC 3QG1A 1G8PA 4HAZA 1P7CA 1H65A 4NCIA 2L0XA 1YZTA 2OAP1 5KSPA 4LGMA 3KUDA 3FHOA 2KBEA 4FI3C 2GF9A 2D7CA 2JJ1D 3U3KA 1EFHA 3VNUA 1U8YA 2ECKA 2WHXA 2WIBA 2DWQA 3RS0A 4LYHA 1KMQA 2JLXA 4IDHA 1KO5A 3B1WA 4O0MA 2GEUA 2QAGC 3MRSA 2VA8A 1VG9B 1EXMA 3J81k 1GILA 3EZ9A 3ZS9A 4DKXA 3CR8A 2JLRA 3D7MA 821PA 3KZ1E 4WA7A 1S9DA 4OHXA 1XXHA 4TLCA 4DCUA 4KAXA 4OBEA 2RB4A 2ZR9A 3TKLA 1YZGA 5HE9A 5DI9A 4WZAE 2ZI3A 5CK5A 2CL7X 3QJYA 1ZIOA 4ILEA 2OV2A 4RZXA 1OH6A 1OIVA 2O52A 1LV7A 1LW7A 2XNDD 3L8YA 3ZD7A 2BOVA 2WOOA 3W5JA 1J7KA 2FZ4A 3GLFA 1YVDA 1XB2A 1WB9A 4LBYA 1EESA 1ETUA 5L8VA 1KJWA 3IIJA 3EX7C 2DB3A 3PITA 4ON9A 3AVYA 1TX4B 1N6IA 2QT1A 3B9PA 4TTRA 1GL7A 3CWQA 3SC3A 1UEIA 2GESA 4XH9B 4MGYR 2GNOA 2PMKA 1OB5A 3FMFA 2IA5A 1E6CA 1XU4A 5CIWA 3GFTA 2FGKA 3LLUA 3M4YA 5LDDC 2XOKD 5JJKA 3TBKA 2O0KA 1H8ED 4YXWA 3V4FA 4C0HA 2QZ4A 4G5RA 5J40A 4LHWA 4URZR 2X19A 2IYVA 3OZXA 4QBFA 4TL6A 1CJTC 2IYWA 5G3YA 3T1QA 4DRZA 5JWOA 2WJYA 1N6KA 4PPNA 1R0YA 2WKQA 5J5CA 3IBGA 5BN3A 4P0TA 1UADA 3ZZ0A 1Z3IX 1AKEA 2REXB 1VHTA 3ND8A 1UBEA 3LNCA 2R6FA 5EXPA 5EXSA 1FUUA 3EARA 3OESA 3UWKA 4F4JA 1F5NA 1RE0A 1B0UA 5LB4A 1M7GA 1ZUHA 3GLHB 5A5GA 1G9XA 4IEEA 1M6NA 2RGXA 4LV5B 3W34A 5KDDA 4LBWA 5H68A 3B13B 2NZ8A 3BS4A 1NVUQ 2JA1A 2YWFA 3LA6A 1T0JB 4RD3A 3F0TA 1ZNYA 4K8OA 5GADl 1Z0JA 2ZJZA 2A5DA 3DOEA 4Q1BA 4B47A 2AKAB 4E07A 3MJHA 3CF0A 4EFNA 3EPHA 1Z8FA 3EASA 4JJKA 4LZZA 4M4SA 3L0PA 1U0HC 2J45A 3NC0C 1FNMA 1ZW6A 1LFDB 4WZ6A 1NBME 3QEJA 2ZITA 1U8AA 5EP3A 1KAGA 4A0GA 2HEIA 1SKQA 5HTKA 3EPLA 3DPUA 1TUIA 3HU3A 2CLSA 1JQJC 1P5ZB 5FPYA 1TU3A 1M1YE 1U81A 2RH5A 1Z07A 4CEIA 4KFTA 1JPNA 4JBWA 1HUQA 5JWRA 4NDZA 2XXAB 2BJWA 5B2ZA 4ACAA 2RGEA 3W9YA 5CM9C 3R9IA 1G17A 2H7VA 4QGFA 3T5DA 2DR3A 4P4TA 1WA5A 1QBKC 2F6RA 4PAOA 3T61A 3GP8A 5KDLA 4KYUA 4EQ6A 4P32A 2DFLA 2QMUA 3DDCA 1L2TA 2OT3B 3KKMA 3TH5A 4FCWA 2LCFA 4JLPA 5FI1B 4LOAA 4QGHA 2J5XA 1UDWA 1G21E 1VDZA 4ITRC 1GWNA 1PZNA 1Z0AA 4LYJA 1E9AA 5AUNB 1G7RA 4WOPA 1RKBA 4CVNA 1KMHA 2BBWA 4Q9KA 1XD9A 3ICQB 1Z47A 3KXLA 4OK6A 1R7RA 2ZS9A 4OHVA 4KV9A 3WBJA 2MSCB 3NG1A 4NCKA 5JLJA 3WHKA 2D3WA 1EFTA 2ODEA 3KKNA 1E4YA 1O3YA 2VHUA 2VF8A 1G7TA 3THYB 1BYUA 1HYQA 2OLJA 3A1WA 3KKOA 3IPXA 4Q9IA 3TUZC 2WWYA 2QENA 3X1WA 2R6AA 2VP4A 4RD1A 1KKLA 1RIFA 3IQWA 3LX5A 3W5IA 1LY1A 2WJGA 4O2LA 2BMDA 3CKLA 1NLFA 2PJZA 4PQYA 2ZJYA 3CH5A 1KMHB 1D8TA 1VECA 2WZQA 3GJXC 2ZRCA 3TQFA 2Z5FA 4JKYA 4ACBA 3HPQA 3IGFA 3H1TA 2QPAA 4V0OA 2NGRA 1T0HB 3B9QA 1E2DA 4KVAA 5JI2E 4ESHA 1T8UA 1Q3HA 4BFUA 3OIYA 4B6FA 2F55A 1W7AA 3GLFB 5F98A 4B33A 1HQYE 4PQRA 4QKQA 2OXRA 3ZQ6A 5EUQB 2AKYA 3CH4B 2B21A 2KB0A 4DWJA 1ZD1A 4BFTA 1W1WA 4FN5A 3QKRB 4MRNA 4I81A 3GLGA 2WV9A 2V4ZA 1DG1G 5EP2A 2UVQA 4AIIA 4ZDWA 2W00A 3CRQA 4DJTA 4RJLA 5E7JA 5HCIA 3QXJA 1BOFA 1G8FA 1NSFA 2XOKA 3UK6A 4D80A 4XWOA 1M8PA 3AM1A 3K9NA 1S0UA 3JVVA 4TSFA 1EFCA 2ORWA 2X77A 4HAXA 3KQKA 4M8NE 1XDBA 4JMPA 2JEOA 4JBXA 2BMFA 1OYYA 4GBMA 4JLOA 4Q4HA 1IONA 5FOSA 2XTMA 3AF4A 3RS7A 5FH9A 2CK3D 1KJZA 1G7SA 2HXYA 2ZSEA 2PBRA 4AYWA 1R8SA 5B64A 2XNDA 4ZDKA 2RCNA 2H16A 3BIFA 1KDPA 5E7MA 1IY1A 5JBQA 1G19A 1NVVR 2ZSDA 1ZNZA 3AP3A 1NN3A 4P33A 2EFCB 2R6DA 3UANA 3GJ6A 1G3MA 2OBNA 1TQ6A 1NSTA 2OEPA 3WNBA 1P73A 4TWZA 1VYTA 5IF9A 5FOXA 2XZPA 1ODFA 4EQ6B 2ODWA 4JLNA 3WMGA 1NMXA 1OE0A 2OFWA 2FMXA 2GVDC 3CF2A 3ZJYA 1E2QA 4M1MA 1Y63A 1FQJA 4Q4HB 3RWOA 4ZCMA 3PUZA 1MH1A 1XTRA 5GVRA 1XPOA 1A1VA 2AXPA 2ZJOA 3K9HA 4ASUA 4HUTA 2W6ID 4XD7A 5G53C 5EZ6B 4H1VA 2CJWB 5EE9A 5J47A 1WBDA 1YKSA 4PSKA 4ZI2A 3QNUA 2F7SA 5H8WA 2REBA 5FTKA 4A8JA 4M9XA 4M1TA 4MKHA 5IK2D 2CE2X 5JS8A 3THYA 4B3XA 2GETA 4DBLC 2J0QA 3D6TB 1E9BA 2ZRHA 5JSZA 1KDTA 5L3VA 4PQFA 1PLKA 3OEHD 4XSGA 1KYIA 2V6IA 1S1MA 4NPHA 1P2TA 1QHGA 4FMCB 5DHAA 4ASUD 3U60B 1V5WA 4ARZB 5DHFA 4IW3B 2H5EA 1J2JA 2IT1A 2PT5A 2XZLA 2C9OA 2QORA 2F1IA 2ZREA 1TL7C 2OCAA 4IOMA 4A0RA 2IS4A 4R2IA 2O8BA 1DAMA 4GOXA 4MYTA 1ZMXA 4KI0A 2HYIC 4BZPA 3FTQA 2MMCA 4XTCS 5CJPA 5FTJA 5A0FA 1G291 3A1SA 5AUOB 1YZKA 2C96A 5IHPA 2V7QD 2YC2C 4YQFA 4TYQA 4FCVA 3IHLA 1W44A 1WRBA 3CPEA 3A4MA 2IS2A 3CBQA 3BB4A 2FFBA 3ADDA 1SVSA 1IAQA 2BV3A 2ERYA 3MG9A 4PHGA 4LJ5A 4KBGA 5FBQB 1HE8B 3UMSA 2FG5A 4XWAA 2OZEA 2JDID 4F93B 3TR0A 5J4YA 2WM9B 2QMHA 2ODBA 4KFRA 2ORVA 2Q9AA 1E2FA 4V0LA 2YWGA 3I4LA 1KJYA 8OHMA 3PEVA 2V7QA 2ZJBA 3WMEA 1YZLA 3VX4A 4Q01A 4C0KA 1G64A 1BH2A 1FTSA 1EFRD 1RJ9B 5GJWC 3AB3A 5JS7A 4Q48A 1AS3A 1GFIA 2XITA 4DSTA 1J90A 2VHQA 1KI8A 3PUYA 4JVSB 3ZZTA 2LKDA 4U02A 2QE7A 4UNQA 1NY5A 1U94A 4JLKA 3U6KA 1UJ2A 2Z6VA 2IYUA 5H1YA 1B23P 3IKJA 3LBNA 4KODA 2ZRFA 4IFEA 2NIPA 2PMDA 1X6VA 3NEYA 4YDSA 3U3MA 1OF1A 1XRJA 3KKPA 5CK4A 3AKYA 2QI9C 1VYUA 2VP9A 2V3CC 1E1QA 1IBRA 1E32A 3VQTA 3BFXA 2NO1A 2NG1A 1GTVA 1N5KA 3DKPA 3KQLA 3U7FB 5L3QB 2FWRA 5B58C 1HV8A 4Q1AA 2WAXA 1U8ZA 3GJ3A 2QL6A 4CZ2A 4LK2A 1TF7A 3KB1A 3UKDA 3EW9A 1JI0A 1ZM7A 1S3SA 2B8TA 3ONWA 4DUGA 3Q72A 4LV6A 1KK1A 1X86B 2WSSA 3QKSB 3SFVA 1HEIA 1QHXA 2IUUA 5KUTA 1XTQA 4EFLA 4M1SA 4OI1A 1IY0A 2ZE8A 5JFGA 5JRZA 2ZI4A 3THXA 4RD6A 5AJWA 2ZYUX 3TSWA 4JLJA 2QROA 2NZJA 1KHTA 4Q9HA 5JHHB 1KO4A 3WP1B 2SHKA 4A6PA 4DLXA 4DB4A 4GP6A 3ZZUA 1GRQA 3SFZA 1OXSC 1SXJD 1KAOA 1XTSA 2CMKA 3OIVA 2ZTSA 1XF9A 2ZAMA 5TMPA 2HF8A 3SNHA 2F1JA 2NO7A 5DE3A 4HLDA 4Q4AA 3X2SA 1K8RA 4X8MA 2X2FA 3EC1A 2RGCA 3IO5A 3K0FB 3GJ5A 3RC3A 2PL3A 1OKKA 4NCNA 2ZRIA 1RRPA 4CEHB 5FI0B 5JCPA 4M22A 2ANCA 2NOAA 2HCBA 2BC9A 1KSFX 3QSYA 3A58B 4A2WA 2O0JA 2BBOA 4O2RA 1BS1A 4JLBA 2A5JA 1D2NA 2YWEA 4KSBA 2ZXUA 2D7DA 5ELXA 3Q7QA 5L3SA 3BFVA 4NU0A 3O8CA 1CIPA 5L3RA 1MO6A 2ZJAA 2GF0A 3A1UA 3FKSA 2ZRNA 3H86A 1W36C 4LPSA 4IDNA 5KSOA 5C46F 1P62B 4TLBA 3U4QA 1AGPA 3UATA 1E2LA 1YQTA 4OI2A 2XGJA 3FE2A 4A4DA 2QTFA 4WVFA 1COWA 3GLHA 3N2EA 2G9NA 1F2TA 3QVUA 5EJEA 4C7OB 2YHSA 2VO1A 4DIEA 3A36A 4IDOA 4RCZA 2CHVA 1KI2A 1YZQA 2O8DA 1GKUB 5CYOA 1UAAA 1CRPA 1JEEA 1EG7A 4US2R 4R2HA 4US1R 1X3SA 2GJSA 1FP6A 4E09A 2ZEJA 4XVQA 1E9SA 1TPZA 3LBHA 2EFGA 1NLZA 2CLCX 3BH7A 1XX6A 4RD4A 5FBLB 3U3RA 2G3YA 3FB4A 4B75A 2IWRA 1W0KD 1NRJB 1YR8A 2GWHA 4ZCIA 1R8QA 3AUXA 4PANA 3ZDQA 4Q1EA 1DEKA 4B48A 4PX9A 4IDPA 1KKMA 3HU2A 4BLSA 3MSXA 4NMMA 4TTQA 2W2VA 3B1VA 5EE5B 1E4VA 1JJVA 2G88A 1S2MA 2KE5A 3FWYA 1E2KA 1R0XA 4TQUS 2WWHA 1DO0A 1U90A 2DFTA 4C2TA 3BORA 4W5JA 3LVRE 4DDWA 3RRZA 3U7HB 1JNYA 1YR7A 2GZAA 4LV8B 5FFMA 2CLDX 3PVSA 2G0TA 5G40A 4HAYA 1FPMA 4A8JC 5L3QA 4F38A 3NDBB 4BLPA 5AWFC 1XMSA 5BYJA 2C99A 2D74A 2FV8A 1O87A 3TRFA 4Q4JA 3ZIAD 3OE7D 5CLQA 4B34A 4B2IA 4XJXA 1SXJA 2QRZA 5TB5A 2V1UA 4L16A 4O3MA 1XCGB 1D6JA 1GP2A 1OXVA 2WJHA 3FMPB 5HE8A 2ZUBA 4DVGA 1NMZA 3MJRA 5KNBA 3EZ6A 4CYMA 4AI6A 2GBLC 2FPKA 1GSIA 4A1FA 1CS4C 4PAQA 2O8EA 3VR2A 4K46A 1AS2A 5G41A 1ZVQA 4LPKA 1NBMA 2VEDA 1Z83A 3FGNA 4LI0A 2FF7A 1A82A 3SYNA 1OIWA 5DYIA 2IX3A 1Q57A 2WWGA 2WSSD 1W36D 4TL7A 3B78A 3ZVRA 1EWRA 2ZE7A 3X1DA 1W46A 2V1XA 3CUEF 4LJ9A 4DUGD 1R6BX 2EFDB 4Q4JB 1LS1A 1U9IA 1D9XA 1XMVA 3RRMA 2QM8A 3EIHA 4DSUA 4YMTA 3RS4A 2Z4SA 3U2QA 2RHDA 3FOZA 3IO3A 1G4AE 1Q1EA 2GK7A 2W0SA 3MD0A 1E79D 1NN1A 2HDNB 2J7PA 1P61B 4IHQA 1BKDR 2A2ZA 3S1AA 2AWNA 1NJGA 1N0VC 2BKUA 3NIBA 5F9FA 4YONB 2NO0A 2WPDD 4BEJA 1E9RA 3KDSE 2K5UA 2IF0A 5FL7D 3AKEA 2IS6A 3DMDA 1IJFA 3IILA 4JLVA 2OCPA 2QA5A 5J4LA 2VP6A 4BRUA 1ANKA 2VP5A 3KJHA 3LDAA 4DXAA 1XMJA 2AXNA 1QHIA 1CJVC 4AWXA 4BE7B 3GEIA 3SHFA 4OI0A 4W9MC 2A5YB 4XOIA 2O0HA 1I2DA 1T5IA 1VTKA 4FMBB 3EG5A 4GT1A 4MKFA 3LAWA 4RCYA 2YOFA 1KZ7B 2Q9BA 5KNCA 3MCAA 3E1SA 2QMEA 4LC0A 5LD2C 3EA5A 3R9WA 1EK0A 4RZ2A 4GNKA 4M1KA 3NH6A 3HYRA 1PUIA 1UFQA 3U44A 2GDJA 2TMKA 3IQXA 1KSJA 4KITB 5KSZA 4CEJA 4OQMA 4LJYA 3QF4B 1RYHA 1E2PA 5K8LA 4UXIA 3GLGE 1CF4A 4QHYA 3SQXA 5JEEA 2DPXA 4BFWA 3U61B 4G5QA 1N6PA 4PHTA 4TMWA 4F92B 4PC1A 4A82A 1TQ2A 1P9WA 2VP0A 4MKGA 1QHNA 3BE4A 4PPGA 4MA4A 5TDHA 1OH5A 5LD2B 1XJCA 1N6NA 5DLQC 4U5XA 5ANRB 3F8TA 5FOVA 1YE8A 1Z2CA 3OEHA 1KI6B 4LUCA 3IUYA 5TXGA 1W49A 1II0A 5BXQC 1ZUNB 1XP8A 3CPHA 3EZ2A 2VF7A 4POAA 4Z8XA 2C95A 1C4OA 2PH1A 5IK2A 1R0WA 3FMIA 1E1RA 1GL6A 5JI3E 4M21A 3RS2A 4A8JB 1Q1BA 4QXAA 1HURA 3A1VA 1JPJA 3C4JA 1LF0A 5EE1A 5JECA 5LBIA 4RZ3A 2OE2A 3GJ4A 2FGJA 2P5SA 5C4GB 1GNRA 4M1YA 5FL3A 2Q3HA 4R7ZA 3CNLA 1K5GA 2AL7A 3GQBA 1CU1A 4HZUA 1HA3A 4IJMA 2WMOB 3L82B 1P6XA 1W2HA 2RKOA 2IHYA 4P31A 4KU4A 3EIEA 1HT1E 2JLZA 1LNZA 2O8CB 1LF5A 3LLMA 3AVXA 2EYQA 2QUZA 5DGXA 5CM8B 5JMTA 2DHRA 5HKKA 2ZUCA 4RY2A 2C9YA 1AS0A 2J0UA 3RHFA 5D3MA 5DYGA 1XBTA 2QRNA 3I5YA 1Z0FA 3GMTA 3D31A 1FW6A 2F1RA 5E7IA 4PC7A 3DOFA 1S8FA 4BPBA 3T1VA 3TMKA 3TVDA 1GL9B 1KNXA 1Z22A 3LXRA 2ANBA 2CL0X 2WKPA 2AFIE 4ZDIA 3N5CA 2FZLA 3Q5EA 3CW2A 3DKVA 4MGKR 1OIXA 3B60A 4BUJA 1QVRA 2H8KA 2CNWA 5JZVA 3W8RA 4XIGS 3I5XA 3G82C 1RC8A 1SKYB 3Q8XB 1D2MA 1R4AA 1LB1B 4HAUA 2IEYA 3KJIA 121PA 2PZEA 3NTUA 4QFMA 3VNVA 4JVNA 2XB2A 2N42A 4Q9JA 2WVJA 1VCNA 2GBLA 2ZYVX 4TT3D 4Q18A 5HZKA 1G3IA 2Z4RA 1SXJB 3K0CA 1E2NA 2YKGA 2NQ2C 4LJ8A 1ZM3A 4LBVA 1KI1A 2Q6TA 5CLLA 4D4LA 3K70C 4Q9LA 3C15C 3U6BA 1Z6XA 1WXQA 4WAUA 3RDPA 3EAQA 3I61A 5JJIA 1MR3F 1NNEA 2UZIR 3D3QA 4L8GA 2MSDB 4UNSA 2ONJA 5KDOA 3ZD6A 3CIOA 1F2UA 4FXPA 1JAIA 1HT2E 2OM2A 3ADBA 4OQNA 4WIAA 1A7JA 2VSOA 3ZVLA 4A6XA 2IYQA 4N1AA 4DCVA 2JGNA 2Q3MA 2JJ2A 4G1UC 5K8TA 1DAEA 4Q02A 1JXMA 1YZNA 5DH9A 1MABA 1UKEA 3BH6A 5EXTA 4Q19A 5KOYA 1W0JA 1DOAA 1Z6AA 3TUJC 1HQCA 1GIAA 2WAYA 1BYIA 1UBFA 1II8A 2ONKA 3L2OB 4OHZA 4KXFB 3TNFA 1Z6TA 1ZUIA 2OHFA 5FL7A 1AZSC 2H17A 3KQNA 2OUKA 2GVZC 2BMJA 1XTIA 1CULC 3QUSA 4PO1A 5J4VA 1G4UR 4HEJA 1E79A 5FPKA 1T9HA 2EYUA 3QBVA 3C7KA 1IJEA 4LSGA 4XWKA 1A5TA 4RKFA 4ZPXA 1DADA 1U0JA 2RMKA 4D81A 2FX3A 2RGNA 1TAGA 2WWWA 1N6LA 3VMFA 5AJXA 2E1RA 4URUR 3B5JA 4HDOB 4LHYA 4EJSA 3NVAA 3CX7A 4JVMA 2OCBA 4NYMR 2IWHA 4LJ4A 2IYXA 4A15A 2KBFA 4GDFA 4HATA 2ZI6A 3KJEA 4DSNA 4NYJQ 1U0LA 2DFNA 3A4NA 3REGA 4NTZA 4IOJA 1I2MA 1WF3A 2H18A 4HZUB 5M04A 2PCJA 1N5JA 3UMRA 1SXJC 4TTPA 2Z83A 4YMWA 4URVR 1ZD9A 3TE6A 3AH8A 2QSYA 1QRAA 2PZFA 2X2EA 1KIMA 4H1UA 2W6JA 4KHZA 1E69A 3DZDA 4LCBA 2ZR7A 2QT0A 2GAOA 3ZH9B 3ZQJA 3VU9A 1RPZA 3QENA 3K70B 3CRVA 4G01B 1W5SA 3O8RA 3PCRB 4AYTA 1G6OA 3O8DA 3T06B 4QGGA 2XTNA 3GLHE 2WTUA 3KFXA 2YOHA 1WE2A 4YMUA 1G8GA 2FSIA 4KJZA 5TV2A 3AGQA 3ZIAA 2FFAA 2QPTA 1VG0B 4M1OA 1P60A 2IYLD 1TQDA 4Z51A 3I3SR 2A5FA 4M2LA 1E0AA 2QN6A 1CJKC 3QF4A 2JLYA 2WOJA 3RRYA 1DVRA 2ZVQX 3BJIC 2GEVA 2ODNA 3K0EA 4MYHA 1SVMA 1VMAA 1NIJA 1IN7A 3QKTA 3HYTA 4G5SA 3PEWA 1XEFA 2NO6A 1NY6A 1CXZA 2V8OA 4MGIR 5FOWA 4MGZR 2KI5A 1LTQA 2ZRDA 4BZQA 2WJVA 2KSQA 1XCMA 2DCUA 4KSCA 5KHOC 2BDTA 4BZXA 3K1JA 5DI3A 3SDZA 3WP0A 1FTNA 3OAAA 3M0EA 4AK9A 3OIWA 4TQAA 3BH0A 1R5OA 1RYFA 2WPDA 1YR9A 1GKIA 1ZD8A 2XTZA 3QKRA 4TLDA 3V9PA 1YZUA 3B82A 2J7PD 2F3TA 1S4QA 4TMZA 2O8BB 3NBFA 1H8EA 1Z5ZA 3WRYC 4YXWD 2B8WA 4JJZA 4WW0A 2GCNA 3X1ZA 1YRAA 2WJIA 1JAHA 1Q12A 1XWIA 1GNQA 2ZRGA 5SZIA 4NYJR 1TQ4A 5SZHB 3ND9A 1NG9A 3GLIB 3SI7A 3I32A 3EA0A 1W5TA 2R6CA 5D3MB 4BFSA 3BAFA 3P32A 1W4AA 2W83A 3U3OA 2IYZA 1DS6A 2IUSA 1UM8A 4BLQA 1XEWX 1ZNXA 3TGPA 2HT1A 2PZGA 1E9CA 1PLLA 2ATVA 3CRW1 1G41A 1UDXA 3QI2A 2GCOB 3TW8B 3IIKA 721PA 1CTQA 1G16A 3SJAA 1P3JA 4TLEA 4ZI3A 2PX3A 1E94E 4ESVA 3OE7A 1E2MA 1ZM2A 1FQKA 3L8ZA 4Q4AB 1SULA 2RHMA 4WXRA 1G18A 1DAGA 4DT1A 5L3SB 1L8QA 3CRMA 2W2TA 4EKDA 3U5ZB 1NL3A 1UKZA 2GZDA 3MWJA 3PENA 3KUCA 5BYKA 1QDEA 4GOKA 1KOFA 2IYTA 4MRPA 2ZRAA 4QJ5A 2P6UA 2WJJA 3DM5A 4C9BA 3WBKA 2R65A 4W5HA 5B57C 1X1RA 2X1VA 4Q1CA 4EJSB 4CEIB 3HDTA 1QHHB 4IVQA 3VU9B 4D2IA 2ZQ5A 1AGRA 1TEVA 4JKIA 4U00A 4MDEA 2IF2A 2AK3A 3NC1C 3W6OA 3TLXA 4DLZA 4CEJB 2Q0HA 1VIYA 2I3BA 4DT1B 2OILA 2BMEA 4FD2A 1W36B 4GZMA 2ZYWX 1T3SA 1KTVA 2D2FA 4TN1A 2IBMA 4IOKA 2QMOA 3WMFA 1DAHA 4EUNA 3QXSA 4YLGA 2FN4A 5KYKA 3DMNA 2PX0A 2DWOA 2OBLA 4P4SB 4HAVA 1NF3A 3Q7PA 1FMJA 2GJ9A 1F60A 3QF7A 1Z28A 5FPHA 1VG8A 2FDCA 1OXTA 2F9MA 2JLWA 2ZR0A 3LXXA 5LB2A 4HI0E 1Q0UA 3Q85A 2GILA 5BN4A 4E03A 1RRCA 4NE2A 1E9EA 2AD1A 2D4HA 4G0NA 2LKCA 1IN6A 2PT7A 1XCPA 4LRWA 3ZGXA 1I4TD 5KNDA 1II8B 2QTHA 3F5FA 1ESMA 5GJBA 2XJ9A 4QNRA 3ASZA 4NONA 1GUAA 4TL8A 2AN9A 3KL4A 3K09C 2V6JA 2V54A 4ERNA 4F91B 2PEZA 4OQFA 2WWFA 3EWSA 2X8AA 5GVSA 1A2BA 4PXAA 3DO6A 4EPXA 4MUBA 3RC8A 1N6OA 2C77A 2VHJA 2FPLA 5CITA 4JSYA 2FFHA 3T35A 4YC7A 4Y0AA 2J0SA 1HTWA 1W4CA 1XTJA 2J41A 3C41J 4BLTA 5TY0A 1LS6A 4BQSA 1T3LA 3IHWA 4D0LB 5KO2A 3EWAA 2DWPA 3WYFA 4PZZA 3LY5A 1KK2A 4IXNA 4OJKA 1UPTA 2HLDD 4Z54A 1ZNWA 1D5CA 2BHRA 2ZETA 3KKQA 2RGDA 3GFOA 2BJVA 2R62A 3AQ4A 2GXSA 421PA 1S96A 1A2KC 3Q3JB 1L4UA 4JT2A 3VR6A 3KTAB 4H9GA 2DY1A 2AK2A 1YRBA 4FCTA 4HB3A 3BGWA 1EX7A 3WYGA 3VHXA 2QBYA 1ZM9A 4GRAA 2ZRLA 4ZO4A 5JEDA 4B74A 4JT4A 4X8HA 1P9RA 4B35A 2IXEA 2QQ0A 1DPFA 1M7HA 2ZI5A 1D9ZA 4PPQA 3GJ8A 4UXJA 1N5IA 4V0NA 5EQTA 2J9RA 2V55B 2W58A 3UXMA 4EAQA 4Q03A 4D0GA 4TZ0A 3R7WB 3PR1A 1US8B 2VBCA 1Z6GA 1CR1A 1G5PA 5EP1A 1WQ1R 1FFHA 1U9IC 3RABA 4Q5IA 1U98A 5D3QA 3THWB 4QBHA 1W48A 1E1QD 1MO3A 5E95A 3THOA 2G77B 4BLRA 2GZHA 1PUJA 3DZ8A 1UF9A 4ZCLA 3UIEA 2I1QA 3NBYC 3L0IB 2VYFA 1E99A 5TARA 1SVWA 3GJ7A 4PPFA 2J46A 4Q7LA 4RD0A 4C3ZA 3FKQA 4RKEA 4JL8A 3FDIA 3KQUA 3WY9A 3CF6R 3IIMA 2JLUA 2XZOA 1GOTA 1F3OA 1P2SA 2ZE6A 2ZRJA 4N0EA 4JSTA 5AK0A 4AKHA 5FPSA 2G1KA 3M1IA 1US8A 1E0SA 2P2LA 1OV4A 2H1LA 3T12A 4ZDJA 4JYBA 3AF3A 4TMVA 5AUQA 1K6MA 5AJZA 2VLIA 1HE1C 4WXPA 3B6EA 221PA 3B1ZA 4PZYA 2R44A 2HXSA 2IYSA 1XTKA 2BEKA 4D82A 4PSAA 1H8HA 5AR1A 2VPPA 4D6PA 2CCKA 4PO8A 2ZIAA 2AWOA 4A2PA 1HH4A 2GXQA 4V02A 1SKYE 4QG7A 1ZYUA 2CJWA 2YYZA 3I92A 2PLRA 3C8UA 4ABYA 5KSYA 1BMFA 5J4KA 2JASA 4AKIA 3L43A 4URWR 1P4SA 3RWMB 2VIIA 1UEJA 2AD5A 4BFVA 4TSFD 4B3FX 3SQWA 3SS8A 4C7OA 4B71A 4KLNA 2C78A 4QHSA 2BWJA 1WMSA 3BK7A 4FWIB 1T3HA 4NCJA 1YR6A 1G8YA 4A0HA 4HLQB 2XJ4A 3IBYA 3ASYA 1VYVA 2EVWX 4Y0VA 1W0KA 4LC1A 3PFIA 1Y3AA 4KVGA 3TAHA 2B6HA 3OF5A 4S35A 2QM7A 3K8YA 4V0MA 4V0KA 1X8JA 4TYNA 3BB1A 2PJRA 4L5BA 4IRUB 5BQ5A 1NLYA 2D2EA 2VH5R 2ZRPA 3BBPA 3B8HA 3KXKA 4YMVA 3K09A 1XZPA 3CRRA 4NYMQ 1MO5A 3CONA 3GLIE 2D06A 3IDQA 4FWTA 2P0EA 2W6IA 4XD7D 4Z1MA 2QP9X 4DZZA 1MO4A 2ZPTX 3RYTC 1E2GA 4P4UA 4AKEA 3IEVA 1N25A 1E3MA 3A37A 3GJ0A 4QBGB 4D4JA 4BEBA 3AVWA 1IN5A 4HLUC 1OFIA 3H84A 2AX4A 2OG2A 4I4LA 2JLSA 3MGCA 3BFKA 1Q44A 4HZIA 1NBMD 3Q5DA 4TYPA 3PV0A 2BBSA 3FKSD 1C1YA 1R5NA 2VP2A 2VSFA 2OFXA 4HB4A 4GZLA 2XB4A 3AVOA 1N3BA 2C5LA 2ZS7A 521PA 1EFUA 2GRJA 1G3UA 1FNNA 3LX8A 1S1CA 3H2YA 3DL0A 4PAMA 3RS5A 2Y8EA 1KK0A 4HUQB 4DCTA 3X1YA 2QBYB 4QGAA 4OYHA 3U7GA 1JR3A 4XVUA 2GJAA 3CLVA 2VQSA 2ZSFA 4KCGA 1J8YF 2H92A 2QGNA 2JLQA 2R6GA 1N6RA 3C16C 1XXHB 5LPNA 3AKDA 1DBSA 4QL3A 4OI4A 3R8CA 2FEMA 1OKKD 3MAAC 3MWYW 3FHTA 1E0JA 4NCHA 4DEXA 4HB2A 2UZ3A 1NVWQ 2VTKA 4MKIA 2I1VB 1KK3A 4ARZA 4OQLA 1KGDA 5GJVC 2P67A 3HP1A 1WP9A 4TYWA 2EQBA 2KJQA 3MFYA 1ZU5A 4OHYA 5FUWA 1XZQA 1SXJE 4B73A 3CR7A 3RLFA 1SVLA 2O8EB 3LQQA 2GCOA 3W6PA 4C30A 4EIWA 1OFUX 4HB0A 4AG6A 1NN5A 4MH0R 2WICA 3EC2A 3K0AA 2C03A 2WWIA 1SQ5A 3P4YA 3QKSA 2BIFA 2Z0MA 2FSFA 3HR8A 5AJVB 1PJRA 2ZRMA 3WYAA 4QM6A 2VRWA 3S1AB 2Q3FA 3KQHA 4KO8A 1JECA 1M7BA 3AVPA 1CRQA 4DLRA 2QAGA 5SZJA 1F2UB 3ETLA 1PVOA 3W3ZB 5AUPB 3NBXX 4KYIB 3THXB 3LW7A 3OIUA 3MUFA 3AP1A 3P1JA 2CHGA 4FMDB 4Z1MD 1CR4A 4B76A 1SVOA 1HY3A 3LWNA 1COWD 3AF0A 3KB2A 3V00A 1IXSB 4B3GA 4LY6A 1P72A 1JR6A 1JB1A 1R5BA 1VIAA 4IDQA 5KPJA 1P2UA 2J59A 3LW8A 2O8FA 1ZM4A 1ZAKA 2J0VA 2GCPA 4LX0A 4A92A 4BASA 4IKEA 1G5TA 5E3HA 4LJAA 4B2LA 4CEHA 5A4JA 3I62A 4M53A 2IYRA 3K9LA 1ELOA 2ZANA 2JCSA 3TK1A 5E4FA 4MITA 4F7WA 4XTRA 3T5GA 3GLFE 2RGGA 4DEYA 1XD2B 3BXZA 1FOEB 2YWHA 3TVTA 1JQLB 1GVNB 4RVCA 1FP7A 4ZIRB 1NP6A 1AZTA 1KY3A 3ZLJA 4Q1DA 2EFEB 5G3ZA 2YZ2A 3LO5A 1N0UA 1XNJA 4Q7JB 2IK8A 1GDDA 2ORIA 1BMFD 4GFDA 3GCGA 1LVGA 4I1SA 2QPOA 3NEJA 4JS0A 1M34E 3U4QB 1E2EA 2F43A 4P4SA 4XSHA 3TJZA 4E5UA 1KNQA 1KSHA 2JDIA 3CZQA 1DARA 3SJCA 1H8HD 3EIQA 1Z06A 4MQBA 3QQ5A 5HCNA 4U7DA 1FX0A 4I1OA 2HCJB 1E96A 4B43A 3U7EB 3AEZA 5J4HA 3R9XA 1AKYA 4DCSA 3BRWD 3SZRA 4HUQA 3SJZA 1ZC4A 2YINC 4HDQB 1FUKA 621PA 3MMPA 1GM5A 1DAIA 4DLUA 1E2HA 5FR2A 4QC2A 3QY0A 1QHYA 4TMTA 1OSNA 3QIAA 3O47A 3UG6A 4Q00A 2CDNA 4URYR 1I4DD 2ZJ2A 2OXCA 3W3AA 5DSZA 1CBUA 4IOLA 4DB2A 5EP4A 3VR1A 2G1JA 5CDFA 4HYYA 2ZAOA 3AV0B 3QXCA 2JJ1A 1R10A 4D4MA 5EE0A 3PEUA 1OXXK 2Q21A 2ZSAA 3KJGA 4PO9A 3LVQE 2BCJQ 3K0FA 2ERXA 1UBCA 2QG6A 2CHQA 4YDHB 1QF9A 3NKVA 3LRPA 1MKYA 1P75A 4V0ME 2IL1A 3IEUA 5UKDA 1DTSA 4PC2A 1MV5A 1UKVY 1TF5A 3AGPA 3RANA 2CEAA 2FE4A 2GHIA 4G5GA 4JZKA 3AVTA 1FL9A 3NHBA 1Q1ZA 3SYKA 1TUEA 3LBIA 3TAUA 2Q9CA 5IRCD 1VKJA 3CZPA 1G7CA 2QE7D 2JIZD 4PHFA 1SZPA 1XEXA 3N70A 2GA8A 4E22A 4IXMA 5CJ2A 1NMYA 1DAFA 3E70C 1KO8A 5JWHA 1IQPA 1ZCBA 3LQRA 3T34A 3NWJA 4Q66C 3EPKA 2QTVB 1AA9A 1XPUA 2IXGA 5EXXA 1RJ9A 2VHTA 4EPYA 1F2TB 2REOA 1Z0KA 1XJ0A 2XEXA 3CPJB 3I72A 4CIDA 4LDJA 4B6EA 3K0SA 3VKHA 4TL9A 3MWLA 2C98A 3A6PC 1GITA 3WRXC 1YJ5A 3TR5A 3SHWA 3LV8A 2AR7A 4JLAA 3QPUA 4RZUA 4RFVA 3WNDA 3PQCA 1NJFA 4C0LA 3AKCA 3FYHA 1U2RA 3AF1A 5FTNA 1VCMA 5IT5A 4BLOA 3EZFA 4JIMA 4OQXA 4DC9A 1W4BA 2IW3A 3SN6A 4A36A 1AJEA 3CB4A 3BERA 4ZV4A 2J3EA 4OJQA 4PR0A 3AF2A 4UJ5A 4WBSA 1W4RA 3NHAA 1S3GA 2A5GA 4B3CA 4AYXA 2MMGA 3QG5A 3UMFA 3T1TA 1YHNA 2YV5A 3N2IA 2ZJ8A 4G3XA 1MABB 5EUMA 3VFDA 3QVVA 1TF2A 5FR1A 5AJYA 1XPRA 3ZYCA 2WSMA 1ZIPA 3L0SA 4PHHA 1Z6YA 2JIZA 2WMNB 1IHUA 3M6AA 1DAKA 2G6BA 2IUTA 3K0AB 1VCIA 1KI3A 1P2VA 4V03A 2BM0A 4R98A 1E9DA 4BGDA 4TYYA 4A0FA 4EDHA 2JAQA 1XJQA 2NMVA 3AVUA 3QPWA 1G1MA 1QHHA 1W47A 3OFNA 4C4PA 2NO9A 4LBZA 5HPYB 3NDPA 4UJ3A 4LHXA 4EJSC 1J70A 5JJLA 5P21A 1Q20A 4M9QA 3K53A 2FNAA 3WXMA 3B7GA 1OT3A 4B3BA 4MUAA 2ASEA 5HKKD 4Q7MB 2EWWA 2MSEB 1JEDA 3E2IA 4AC9A 1OXUA 1R2QA 4PC3A 2F9LA 4JL5A 4US0R 5JCZA 1OB2A 4W7SA 2D62A 5FUYA 2YOGA 3GEEA 4M9SA 4Q4LA 1KI7A 2JJ8A 2ZJ5A 3C5HA 5DIFA 1OLOA 2DBYA 2FOLA 5FTLA 3VR3A 4HDCA 1EWQA 3TSZA 1T8TA 1IN8A 1NI3A 3UPUA 1Z0DA 3P27A 1X8LA 4L4UA 4KFSA 1SVKA 1IXZA 2C8VA 2GJKA 2HT6A 3QE0A 4Z8YA 4I1UA 1AM4D 4B44A 1IN4A 3ZS8A 4LYFA 1G6HA 2CVHA 1KDOA 3F3YA 3L0OA 4YMSA 1E1RD 2E87A 5CB6A 3JVUA 2A3RA 3DVLA 3GEHA 4CT5A 3ZVNA 3KXIA 4GMXA 2FFQA 1MRSA 2UKDA 1JXOA 1CJMA 4MYUA 1OH8A 1CEEA 4ZIRA 3VR5A 1RVDA 3K0CC 2CCGA 2CK3A 2OO7A 2RGNC 1OPXA 3PIRA 1ESNA 2FA9A 2F3RA 1DG3A 3CM0A 1Z08A 4OK5A 4RD2A 1Q1QA 1AK2A 1KO1A 3NXSA 3UWOA 3EPJA 2CE7A 3SOPA 1R0ZA 4F4CA 3SU8A 2P65A 1ONBA 2WKRA 1NKSA 4D4KA 4LJ6A 1MT0A 4FIDA 1T6NA 2O8CA 3X1XA 1RRFA 2WIAA 1OW3B 2RGBA 4NYIQ 1GZSA 1NIPA 3KTAA 3MWKA 1FX0B 2C9CA 1SHKA 4G5OA 4JVLA 2WWXA 2ZM5A 4O25A 1AIPA 2FEOA 3JZAA 4Q47A 2YC4C 5DI3B 2GK6A 1EGAA 5FBWB 4UQOA 2F43B 3DEFA 4BFYA 2JLVA 1U99A 5C2JB 4TMXA 1SHZA 3LH5A 4KFUA 4DHEA 3KFVA 5F9HA 5C1BA 1NG1A 2G83A 1TADA 4LYAA 2IXFA 2W2XA 4MRRA 4AG5A 4B32A 3LD9A 4AURA 1RRGA 3B85A 4GP7A 3R7WA 1ZCAA 3VAAA 1KI9A 2J0UB 5K8UA 4BFZA 1EX6A 1XEWY 4GL2A 2DYKA
chains in the Genus database with same CATH superfamily
2ZE5A 1T4CB 2OZLA 2B1GA 4M8LA 1OYVA 4QU5A 4ZC8A 1M5RA 1WW2A 3IPYA 1KFCB 1HSOA 4PYMA 4B46A 5A2GA 1TEXA 1I5OA 2XSZD 4QXRA 3SG0A 3EXFB 4G8JA 5LWQA 2R8RA 1MZVA 4FNOA 4G1FA 4Y2UA 2I2FA 3PXGA 2ZIFA 1RHMA 3FTNA 3N75A 1RWMA 2QUBA 3H0KA 2PRYA 1XLTC 2IIBA 3S7ZA 4QJ3A 3BMOA 1J8FA 5PNTA 2BFBB 3GLGB 5DO9A 4IS3A 5ADWA 2QU8A 2G0NA 5BRJA 4IILA 4Z9FA 3PEYA 1T15A 4MPDA 4W9NC 3JZMA 4F4IA 1YULA 1Y42X 3FZNA 4MVJP 3SKVA 5EIEA 1SVIA 1J0CA 2PXHA 3HCRA 2O54A 1ZU4A 2Q4TA 3FGPA 2C5GA 3EVAA 3WIDA 1FSFA 4ZMBA 1QLHA 4EZEA 5BUQA 1UEXC 1NX6A 2OFOA 3INYA 4JXKA 3WNVA 1J2TA 3I8XA 3O95A 4XJVA 4K40A 3WA6A 1SKMA 1H0RA 1B8UA 4IQGA 2ZSKA 3FOWA 2EG9A 4RA6B 4Y7DA 4JCCA 3TFQA 1XU7A 4EL5A 3VV2A 3ETCA 4XVRA 2CKMA 5FEMA 4DCOA 1PP4A 5DASA 5FIUA 1O97D 1PF7E 4Z2YA 5LZ8A 5GZ3A 1VIDA 2PKQP 1Z2EA 4K6FA 4EPTA 1XVAA 4AYXA 5BMVA 2VNAA 4HRYA 3A8TA 2BEJA 4QEKA 3F1KA 4NBWA 3RAJA 4BECA 1JEQA 2FZGA 2OAQ1 3VR2D 3ET4A 3DFKA 3GJRA 4FILA 2NO5A 4C0AC 1DU4A 1VL8A 4PZLA 2VQEB 5JRJA 2AZMA 2FRDA 3EYWA 5IU6A 1LC0A 1AGXA 2JVKA 2B98A 1Q2UA 4W9RA 4YP1A 2AB0A 4TMKA 4COKA 4AZ0B 4OKSA 1MJGM 1Y6RA 2B1JA 1YVUA 1BFDA 2ADOA 3FYUB 4QYXA 4Z99A 2X8BA 4ZEOA 1NRWA 2AIRA 2QN1A 5EOVA 1KAHA 2QL5A 4MUIA 4C89A 3KM0A 5G4KB 4K03A 1Z17A 3GCWA 2D1YA 3HYLA 3B20A 3WLTA 4GX5A 4M36A 4AY5A 5K09A 2OO5C 2QLTA 2IXBA 4L8YA 2WB2A 3IXMA 3GQVA 3F49S 5TT0A 4N5NA 3KX2A 3JD1A 5ALKA 4ZU1X 1PNRA 1D2GA 4IRXA 4PX2A 1G20E 3PF8A 3PG5A 1DKNA 4Z2AA 5A7HA 3KJZA 1BIFA 3PXXA 1XA3A 1HEUA 1ODTC 1TLLA 3A3NA 3RREA 3MA0A 2WAMA 1QG2A 2XB8A 1N0WA 3B2EA 4LZJA 4R41A 1V6CA 3HKCB 4IV0A 5C3MA 3AUFA 3W5SA 1U1CA 4TQ9A 4AP9A 1V9SA 3T5AA 1OAKA 2HRQA 2TECE 3ADKA 1RI4A 1JE1A 3DAOA 2BKEA 2ZT5A 4D74A 4XOUA 5T41A 3A6ZA 5AKJA 4CN9A 5KMGA 1QF7A 4J0HA 4WL0A 5CFLA 5BWLA 1TM5E 1E0KA 2I7XA 4GQAA 1NMEA 1ZMOA 1R3DA 2R68A 3CNQS 4LN1A 4MYCA 4EYKA 2JD0A 1ZRSA 5DNAA 3UAYA 3JWPA 4TTAA 4J2HA 4GSYA 2MSNA 1LEHA 3V48A 2CBZA 3DMTC 4X1IA 2X6TA 3F2IA 4HRVA 4II7A 3VKWA 1L5YA 5MN4A 3DEHA 2VL7A 1L4BA 4CRWB 4EMBA 3FUVA 2HA2A 3PDCA 3NTOA 3RTGA 4MW7A 5DRYA 1KSGA 4JSRA 4KMSA 1CR0A 1KETA 5KWJA 2O3RA 5KOJB 1D1TA 3MGAA 5FBKA 5A4MS 4DMHA 2Z43A 5FULA 3GBVA 3DV0A 3G23A 1D0VA 4HLCA 3PQEA 3ZH2A 1DBQA 2X5NA 1XAHA 1E3QA 4C7JA 4EFMA 4GOJA 5J9FA 1N9ZA 2NVUA 1CP2A 3SSOA 3M6IA 4S3MA 5DSTA 4WJLA 4A0SA 4GZ3A 4QXPA 1G6KA 4BAUA 1CKEA 4ETWA 3B1YA 1P0IA 1Z4OA 3SE0A 4A9AA 1BHJA 1VCOA 2ATEA 3MC1A 5A3QA 5FFFA 1USUA 4V0SA 5CEEA 5DN6D 3C7TA 3DNMA 1F0NA 2W6JD 1OQAA 3K8OE 4CCWA 3P9SA 2O48X 4LNUB 1EVIA 1ZP6A 4IUCS 2XYPA 2PBZA 4OHWA 4KXYA 2O1EA 4PBSA 3CURA 3UJAA 4F97A 2CV1A 2ZU0C 4DLYA 1OX4A 3T5BA 2J5KA 2JFYA 2ZAYA 3GFBA 3DE1X 2QXUA 4RHUA 2QIOA 4BWYA 4BDSA 4B0PA 3D8NA 1XRNA 2PLFA 1J09A 2FPPB 5BVGB 3EVBA 2QRJA 2VR1A 4KQKA 1SCUB 3IUPA 3PRKE 3CX6A 1J49A 4C0QC 3AI3A 4H3KB 4MPRA 2HJGA 5K0LA 2BDUA 1XHEA 4EJFA 2DR2A 1U0NA 3G5UA 4JYCA 3P7MA 4N48A 1QNFA 1P29A 3AZPA 5CA1B 1PJCA 2LE0A 4MCJA 2OFFA 1BA2A 1QP7A 3BJZA 3EBOA 1O5IA 5BW6B 3CBGA 3NTVA 3A9WA 3VVMA 4YMLA 4MIEA 3M3PA 4C0SA 2OHIA 3TIIA 3SSMA 1VG1A 1P3Y1 4QJ4A 3T0GA 1RW4A 2G8LA 4IGEA 4RFSB 5AK5A 3K6KA 3REQB 4Y1RB 4G0YA 2IC5A 2EQAA 1EVQA 1RQNA 3NT2A 2QKYA 1KXZA 2Y1WA 3D6MA 4PXYA 2XT9A 5AVKA 1WBBA 3A2KA 2OLKA 3RIEA 4UUQA 1MJNA 3W5DA 1YS4A 2BFAA 2CLFB 4UHCA 4Z4GA 2WAAA 3KYIB 2AHOA 3DO5A 5DISB 1PGPA 3RBXA 1B8VA 4MVYA 3BFPA 2XCUA 4HOYA 4PQGA 4TTJA 5FOTA 1BS2A 3GPLA 5KYWA 2VNSA 1V1RA 2E4UA 3EZ7A 4JFRA 5FOUA 1Q3TA 1Z33A 2ZRKA 1TIKA 4TXHA 2R6R1 3PJRA 3IP6A 5KPDA 3KC2A 5TQVA 1X9GA 2EQ5A 2JARA 3C5WP 1U5CA 1NWCA 1RS0A 1NXPA 1LRLA 3PFGA 4JLDA 4GI7A 4DEVA 3P45A 5B55A 1JFRA 3ZWVA 1AQYA 1UXJA 3H83A 3REQA 4I8IA 4AJOA 5JATA 1F6BA 1U2DC 5FBRB 4GXTA 2A9KA 4XYGA 1OB5A 2NSLA 4NAHA 2VPWA 3COWA 5ADHA 1MRNA 3KZMA 1L7VC 4MRSA 4X1IB 1FZQA 3SJBA 3ZK9A 2YY6A 4BQEA 4MVJI 4CDGA 1IY2A 3CEPB 2AF4C 1L5MA 1SUAA 1E3TA 4XE5A 4AY2A 1PS8A 3O3OB 4EY6A 1X42A 5BW8A 3ESDA 1XMIA 5EIBD 2PV0A 3AB8A 5CJJA 1N2CE 3ZKWB 1RBQA 4PTLA 2C7VA 1UC4B 3WG9A 3O4HA 4FMPA 4QAJA 3BD9A 4N39A 5CCDA 2OESA 4M87A 1RXEA 2HBRA 4I1VA 1DE0A 3SR4A 1XD8A 3C3EA 5F52A 2HJVA 3CNOA 3D1VA 3GU3A 1AO3A 3EH2A 1DMRA 3LZCA 1VL1A 4YP0A 3WDSA 5ALIA 1DC6A 3RU9A 4CF7A 1QG4A 3Q1KA 4HQ6A 3EXEA 3Q11A 1GVHA 2WE8A 3S68A 4Q3DA 3FM9A 3TSOA 2D2VA 1D2RA 1KI6A 4GMDA 4I50A 1DBVO 3OOJA 4QNNA 4J0QA 2MYPA 2ZVPX 3EEBA 3IKLA 4W1RA 3O8LA 1HF3A 3K3PA 3OU7A 4V38A 1FU4A 1ZBQA 4HLUA 1UMDB 4XUEA 1DDGA 6AT1A 3QVKA 1ZFNA 5ADUS 5AVZA 2JBWA 1PYGA 4N3GA 3P0HA 3UQZA 2XCSB 1JT9A 1JH9A 5B1DA 5E3IA 2X9LA 1WLYA 3A1TA 3L4BA 3N8DA 1JLSA 3C5CA 4QHTA 4YCBA 3DOIA 2CDRA 1UT5A 1YCGA 2QVYX 4TKUB 4CCAA 2WINI 2VDPB 4D4HA 4UXHA 2JG3A 4FE3A 2W9XA 3JYPA 3ZW9A 4MRVA 1WCV1 3Q9NA 2HTFA 1ZOIA 4HX2A 3SWWA 1AZWA 1RPNA 2IU4A 2NTJA 4WZBE 4YCSA 1GRRA 2ZYIA 5IEJA 1QJCA 3R44A 3VKGA 4R7GA 2VZ0A 1K27A 3NHYA 3EEFA 5CA1A 1NJ6A 3G6KA 4CM9A 4B6JA 2POQX 1L5VA 3W3AH 1G8SA 1Q7GA 4OREX 4U63A 2R0QC 2KBEA 4KX3A 2PR2A 2D7CA 5AKIA 1EFHA 4Y2HA 2ECKA 4LFAB 2WHXA 3RC2A 2JGDA 4FT4A 1OBCA 3ICCA 4ZHQF 3R75A 1KMQA 2C57A 4IDHA 1WNTA 1JLKA 2QAGC 3MRSA 4M86A 1UK7A 2VA8A 3ZQUA 4HNTA 1VP3A 3D1LA 1RWBA 1U0RA 1NVEA 3C8MA 1GILA 4GG1A 1SCAA 1PHPA 4QUBA 2HHJA 4FFVA 4DKXA 821PA 2XE8A 3M5CA 3GA5A 4PIVA 1AG9A 1GCOA 1M6VA 1WUJS 4OHXA 4TLCA 2CLHB 1AHIA 4KAXA 4JC8A 2VJNA 2HUNA 5GMOA 3SICE 3TKLA 1HDCA 5CX1B 2HMWA 1IUKA 1YZGA 5ER6A 2ZI3A 1E3JA 4QUKA 5CK5A 4G65A 3VZCA 2DVMA 1ZIOA 2OV2A 4KRFA 1LSUA 1KC3A 1VRVA 1KVUA 1LW7A 2NT3A 2HAEA 2QLNA 3GO4A 3GDGA 3IVXA 3L8YA 2FZ4A 5DNCA 3GLFA 3IEKA 3E0XA 4LBYA 4XPIB 4YRFA 1WB9A 4RJKA 1R66A 3LK6A 1DPGA 1KJWA 1NPTO 3AJ8A 3EEIA 4Q39A 4X41A 3TQQA 2FSVA 2JFNA 4H0NA 5DKFA 3ZW8A 2XQIA 2CZQA 2DB3A 2XA2A 5HIMA 2CW5A 2PWAA 1EQUA 3B9PA 4G2TA 4DA8A 3TJRA 1KVSA 3EDCA 5ALSA 2H85A 4TKVA 5KHOC 2QTRA 2FEKA 2GNOA 1Z12A 2PMKA 3WLRA 4E13A 3BAZA 4FR0A 1ZKDA 4RV9A 4U9HS 3CVYA 5CIWA 2FGKA 3LLUA 2VHWA 2ZYRA 1N34B 2BZGA 1KH3A 2JFXA 3M4YA 3VH3A 4DMLA 4C0HA 4YV2A 4DNPA 2QTWB 1QH1A 1J00A 5KREA 2OQVA 3OZXA 1CETA 1IB0A 5LYJF 3AOEA 5G3YA 2PA0A 4FN4A 2WJYA 3NT4A 4PPNA 4MINA 1BE1A 3AESA 4J4HA 5B3KA 4JP5A 4P0TA 5IVHA 1CUYA 1AKEA 1XRSB 1ADJA 1VHTA 2REXB 3GLKA 4YAJA 2QYTA 3CTPA 5EXSA 4HDAA 3OESA 1JU3A 2JIQA 1B0UA 3EPPA 1M7GA 4OATA 5LB4A 3JAWB 3PA8A 4I5DA 4IEEA 3AEKB 1PFWA 2FKAA 2WF5A 5CW1A 4WKGA 3NNDA 3OMLA 3P9ZA 5FA5A 2NZ8A 1G2IA 5FLXA 2HU7A 1OGJA 2IZ7A 3G9TA 4KV7A 4RD3A 3RVPA 2YRWA 5JD4A 4GPAA 4JXXA 1AQ6A 2X86A 2O06A 3SEZA 5KYYB 3D6NB 1RXUA 4G36A 3WS7A 2A5DA 5GGXA 3KEQA 3EPHA 2Z2IA 1F8YA 1Z8FA 1XF1A 4JJKA 4M4SA 3UV7A 3VU0A 1PJ3A 2BELA 3DBLA 1FNMA 2YBEA 3UNXA 2IY8A 3OJOA 5CDTA 1U8AA 4LISA 5BSHA 4U4AA 3ZIUA 3RVKA 2W6PA 2UVPA 1H6DA 1C7JA 1KAGA 3CLSD 1RI3A 3HXLA 1SKQA 4IL5A 4M7OA 3ZCRA 1RWKA 4EVQA 4UBKA 1NBIA 3HU3A 3GX1A 5EYPA 1JQJC 1P5ZB 5FPYA 1JR2A 1R9NA 4BNDB 3T7IA 2YN2A 5K6AA 1QQAA 1NE7A 4ARIA 4DY4A 2XXAB 5JWRA 4NDZA 1N2XA 2I29A 1NI4B 2Q4EA 3KT3A 4IYJA 5B2ZA 3H5LA 2VNHA 1GQQA 2PM8A 4FLMA 5CM9C 1MC1A 3K4HA 1QTQA 4RF3A 4QGFA 4JI4B 1LD3A 2DUWA 1PV2A 2WY2D 1GZVA 4DPMA 1QBKC 2F6RA 1IOVA 3FAZA 5G0WA 4NENB 1XNHA 3PHLA 4EQ6A 2DFLA 4DLLA 1MPXA 3FHJA 2P1ZA 1ULHA 3MQ4A 3KKMA 4H3HB 3HLTA 1Z37A 5F12A 1WPRA 1GEGA 4FCWA 3WL3A 4DL9A 4D7AA 4YVFA 5FI1B 5FXMA 3ZD8A 2J5XA 2QWXA 1NUSA 1ZXBA 1RWWA 1GWNA 3NPMA 1MX9A 4ITRC 3RIGA 4MWSA 2ESRA 4RWZA 1DKMA 4XWGA 3SXUA 5AUNB 4CVNA 1FPQA 4YAUA 5AIBA 1XD9A 5CR9A 5C1DA 4H7DA 3RUHA 5LZ9A 2ISCA 4GKAA 2HOQA 3DLAA 1RXSA 1R7RA 2HU5A 1XZHA 2XVXA 5HCUA 5KTTA 5B1SA 3WBJA 5CDYA 4DIFA 3WHKA 4DV5B 3VU8A 2VHUA 1DWPA 1G7TA 1FS6A 1BYUA 4P7KA 3A1WA 2QX8A 1GPMA 2Y93A 2WWYA 1QGDA 3EZXA 5CGQB 2VHVA 1MAHA 3MSCA 3N8HA 2VP4A 2AN3A 3NTLA 2A1IA 2HMSA 5D5QA 2XAAA 3IQWA 4XYBA 3PXCX 2FHPA 2A0UA 3W5IA 1PQPA 3EGDB 3T7DA 1IBLB 3QP9A 4OX9B 4LKOA 1TK9A 4M1ZA 2BMDA 1XVVA 3MBKA 1JQKA 3VI3B 5DULA 3RSGA 2PJZA 1O6GA 1ITZA 3MTEA 4QLBA 3CH5A 1T34A 1KMHB 2TS1A 1VECA 2WZQA 4KW7A 5IEBA 2ZRCA 3H1AA 3VOBA 5AKLA 3ME5A 5F3DA 3TQFA 2Z5FA 3DP7A 2W22A 4Q7EA 2Z08A 1ADYA 3MZ0A 3KK0A 1XRPA 3PBKA 2ENWA 3B36A 5FUMA 2BKAA 3F8WA 2NUTB 4ZQHA 4IUYA 4FYVA 3Q8WA 4UAVA 3OBBA 2I4LA 1KYZA 3BFJA 4BTVA 5L6MB 5B7QA 3DOCA 5F98A 3ONDA 4OJTA 1WHSB 4PQRA 3A6FA 5AM5A 2RHWA 4QKQA 2R4QA 2PT6A 5C8YA 4MR9A 5E1DA 4H35A 1Y1QA 4MRNA 4I81A 2BAGA 2X5XA 2WV9A 1DV1A 2ZPAA 4EVIA 1GPAA 1J7JA 5LC1A 1GTG1 1H3FA 1CDZA 1L8XA 2PUJA 1OU0A 2QT9A 2WHEA 3CRQA 1Z4PX 3L06A 3F47A 3I01M 1EGHA 3G0CA 4HWOA 4WADA 4B8WA 2O14A 3QXJA 4WINA 3JQQA 4BZWA 1UKBA 3H5IA 4WCFB 5ALRA 1IIRA 4F9EA 1SD2A 2Q1XA 1JRLA 3E9CA 1NSFA 2XOKA 1NU6A 2W37A 4J2TA 2KLBA 3SXJA 1BU5A 3T7CA 2XE4A 4L3OA 3HB7A 4QDJA 3HKEB 5E3JA 2X77A 1VE3A 2HA3A 4HAXA 4XDHA 2A7XA 4PYIA 3UW3A 4R4JA 4WBNA 3EULA 2ZT6A 3IAUA 2OTCA 4JLOA 4IV8A 3SS9X 3DBLB 4Q4HA 5CCBA 4R1UA 4XX0B 4KSYA 5FOSA 4KIGA 2OA0A 1OWMA 1YB1A 3DLTA 2KLHA 4PLWA 1GADO 2PMBA 2N0SA 5EIBC 5B64A 5KVAA 2QZZA 3OOSA 5C53B 4B7XA 1R15A 2EGUA 2AMLA 1PGQA 3GT3A 5B1YA 3C6ZA 1GNVA 3AEUA 3JRXA 4R8KA 3D6AA 1G19A 5AMXA 3S2UA 2M98A 1KS2A 2ZSDA 3GZJA 3WGHA 2ES4A 1IK6A 2ZATA 3IAFA 2JH8A 3ANMA 2HIMA 3UANA 4WKPA 3WJ7A 2V7TA 2IPNA 4DABA 3N0XA 4KXMA 5IDWA 1RLOA 4UPDA 2P2CA 4X3OA 1HR0B 1VYTA 2IVFA 5DWQA 1DGQA 1JSCA 1QAQA 2XZPA 3FSEA 3GGJA 3EFHA 3JAKA 3LVBA 1TJ5A 4OQEA 3WMGA 4KOAA 5F1OA 1Y0BA 4Z49A 2GVDC 2QUAA 1MAAA 2ZDHA 1B41A 3ANTA 4MW9A 4M1MA 3QFFA 4DQKA 3RWOA 1BQ4A 5ADVA 3EBLA 4ZGGA 5CCEA 3IMFA 2ZBVA 4BNHA 3KQTA 4DRYA 3I42A 4Q9NA 2FZWA 3H9UA 1UJ5A 1N2ZA 2C1EA 3A11A 5G53C 1QH8B 3IP5A 4MVJD 1YKSA 2AV6A 2R8YA 3OTIA 4PSKA 4DMKA 4ZI2A 4UHEA 4KXLA 3AEUB 3QNUA 5DNVA 4AO8A 1BA3A 4XQ0A 4A8JA 4M9XA 4G0UA 3IHTA 3PZBA 1E6EA 2B69A 4J03A 4B7CA 1Q84A 1SVUA 4B3XA 2GETA 2QW0X 5CGZA 5F64A 3D6TB 1YV9A 3OFSA 3CUYA 1E7SA 2Q3CA 1JQ5A 2YFKA 3DUWA 3PHIA 2OD2A 4IS2A 5JALA 4B4VA 5CYFA 1ULBA 5L3VA 5IH3A 3ITDA 2V6IA 2XMPA 4O4LF 3CW9A 4NPHA 1V8FA 2BUAA 5D8DA 4QOFA 3I28A 2X23A 4ARZB 1ZL0A 4AJJA 2RAFA 3TLBA 1HL3A 1UP6A 2ZTLA 1BN7A 2RKBA 4A0RA 2ZREA 4IOMA 1TL7C 2O8BA 1AXGA 3HEAA 3V1NA 1ZMXA 1QMGA 2JFUA 4AMYA 2ABWA 3KQYA 4BZPA 3FTQA 3L07A 5A5FA 4Y2GA 1EEHA 3NONA 4XTCS 5A0FA 1E2BA 2P91A 3GFSA 1G291 3JALA 2GKOA 3A1SA 3PJDA 3UHOA 1YZKA 1B8OA 1MVNA 3VR6D 3ENWA 5AUOB 3VYUB 5IHPA 5K3BA 4GU5A 3LQ2A 4ZMSA 3BDAA 4FCVA 3EGEA 2DKOA 3A4MA 5M5BA 2QLFA 2WJZB 2IS2A 3HLYA 1P19A 1SVSA 3PJFA 4PSCA 4H17A 3P97A 4J0EA 4KUGA 3RUFA 3ZNNA 2ERYA 5CB4A 2D5BA 4ZZ1A 1LDYA 2JDID 4F93B 3HUEA 4ZEWA 4MV1A 2QMHA 5FFNA 4ENPA 3LM8A 4H59A 2ECQA 1E2FA 3TXXA 1K63A 3JQ6A 1ZEMA 2YWGA 4LAFA 1QCDA 4MWOA 4JLWA 2I34A 2XR1A 1GFSA 4GVLA 4B84A 1YZLA 5IULC 1PL7A 3MB5A 1G64A 1NW9B 1VBKA 1BH2A 1FE8A 1PAUA 2YFQA 1DKPA 4K87A 1YKFA 5TR9A 1JFTA 4OBWA 7REQA 3FCUB 3INNA 3MD9A 4JOQA 5KTOA 4Q48A 1AS3A 1CB7A 1XL0A 1S7GA 2REQA 4J90A 3NU1A 5JCOA 2JCXA 4JVSB 5CVEA 2QE7A 1FFGA 1CEQA 4HPXB 4JLKA 4LMPA 4U3JB 2Z6VA 3MM4A 5EMKA 3EE6A 3IXQA 2R1VA 1R0RE 1KAMA 2PMDA 3U3MA 3AEQA 1CIVA 4IX9A 1XTZA 5HRCA 4PWYA 4DV6B 3EVFA 3AKYA 1IU9A 2R97A 2V3CC 3NFYA 1IBRA 3SX4A 4KQEA 2NO1A 4GSKA 1GTVA 2PKCA 3U7FB 3E9EA 6REQB 1XAGA 1VJ5A 2HZ7A 1C3XA 3GF4A 4HN4B 5DTJA 1PZGA 3LX4A 1PIWA 2WAXA 3KTFA 4H3SA 3ZNPA 3UXHA 1U8ZA 4YP6A 1VRWA 3KVRA 1V5IA 1YRHA 3S0JA 3ZU2A 3AHJA 4QDKA 1ZM7A 1GSHA 4F6RA 3KBOA 4DARA 3Q72A 2GN4A 1L4NA 1X86B 2GYVA 1E4EB 3WSVA 2ZUEA 3T7SA 1I0IA 3QX3A 2CXHA 1OC4A 2VQ6A 1V1RB 1PG2A 1P9OA 4FEGA 4NS4A 4Q6BA 1O5TA 4MW2A 3GZ4A 4WJKB 1P0MA 1ZDMA 2QQ5A 5HIIA 5HF6A 1TM2A 4ARVA 1XTQA 1VXRA 4P98A 2VAXA 3A28A 3DDHA 3JPWA 4UARA 2ZFUA 1IY0A 4UHJA 4OI1A 1L7QA 2CUZA 4FSDA 3ZBQA 1Y1SA 4WKCA 5DM2A 2HIAA 3U9TA 3C5EA 2QF7A 2PGDA 3AERB 4F96A 2ZYUX 1TAHA 3EIOA 3I9MA 3HUFA 3BMCA 1KHTA 1NUPA 2UYGA 4A6PA 2SHKA 4TGLA 4Y67A 1GRQA 1HOTA 2RJOA 3N8KA 4G4SP 4X94A 1OXSC 5AHOA 1W581 1ND5A 3M6FA 1DJMA 3UAVA 3OTGA 1S2LA 5GOTA 2ZVDA 3IH5A 4BP8A 4DF3A 2HF8A 3SNHA 4WK4B 3PDUA 1A5BB 2C2MA 4IP0A 4EGSA 3X2SA 4JKOA 1SB9A 2YWJA 3CG0A 5I45A 2V4UA 4X8MA 1RYBA 2VNJA 4EMSA 1H05A 1J8DA 3WRXA 4F2GA 2HV9A 2J48A 4ITVA 1CX9B 4IKOA 1PEYA 1W88A 1UJMA 2RHBA 2PL3A 2FWAA 2VNKA 3K9QO 2FK7A 4QFCA 2ZRIA 1ATIA 1G66A 1RRPA 2D3TA 2Y1CA 1SCUA 4WE3A 3P9CA 3WGIA 1CUHA 4RVSA 1KEVA 2BC9A 4TWJA 1PRYA 3JRWA 4JD5A 2RGWA 5JIBA 4O2RA 2IYNA 2DUUA 3F7NA 5SZKB 5CURA 2ZXUA 2XDWA 5ELXA 2EAUA 3Q7QA 2H2DA 5L3SA 3BFVA 4NU0A 4GYYA 2XQKA 2M6SA 4DXDA 3B70A 2FW1A 1MFPA 1NONA 2F64A 3FCOA 3HKCA 4QQNA 3O8CA 1MO6A 1QIEA 4FQ8A 5BR1A 3RAFC 4N41A 4OGFA 3RAGA 3FKSA 3H86A 1V4BA 1WCXA 3FAKA 4PVDA 4AQDA 1J56A 2FDXA 2V3WA 4LPSA 2OXIA 4C07A 5C46F 1P62B 3U4QA 3VPSA 2RHHA 3UZUA 1JA1A 1EK2A 2PUHA 2WP0A 2ILVA 2VXCA 3FNGA 1QQ5A 3GEDA 4OI2A 2QTFA 1NOKA 1A3CA 1LTKA 2GX6A 1T6YA 2M1ZA 2P1DA 4M9CA 3QVUA 3F3KA 1U1DA 4OXYA 3I83A 4U7JA 4OGGA 5LKRA 2CHVA 2WJ3A 5LUAA 2O8DA 4EJ6A 5CA0F 1JEEA 3PPXA 4F85A 3CTMA 1N2HA 1X3SA 3CT6A 1VPTA 3LBHA 2Z04A 3RV3A 1XTVA 1XX6A 1U7OA 2QIPA 4BCDA 5FUBA 3VNBA 4FKMA 1SBHA 5DDIP 3JYLA 4U9IS 3WK4A 5I7EA 1YR8A 5IUNC 4MRMB 1MU0A 2Q4OA 2CMFA 3NHFA 1V8BA 3RRJA 1Y3DE 1VZ2A 4Q1EA 4KH1A 3EFBA 5KQSA 1OUMA 4B48A 1XMQB 4IDPA 5A0VA 4NESA 3CZ9A 1ADCA 3IE0A 4P34A 4RSMA 4NMMA 4TTQA 3JXEA 3B1VA 3U0VA 1JJVA 4DIOA 2B1RA 5AICA 2KE5A 1XC7A 3OCVA 3BCRA 2P9YA 4GNRA 4TQUS 4CKXA 3QLVA 1ORWA 1U3UA 1Z4NA 1CUIA 2DT8A 3LHFA 1M2NA 4HFMA 4S12A 2DFTA 1POWA 2X13A 3P94A 4CR7A 3KUKA 3LVRE 1ND6A 3LC7O 1G0NA 1VCHA 4WFQA 3CB2A 1UOOA 2EL7A 1BG6A 4RC9A 4G5HA 1P1IA 5E9AA 1PDOA 3KQQA 4W7IA 1E6KA 4A8JC 4GLOA 1CY4A 3ICOA 4JQSA 4XYLA 3TLJA 5IWAB 1HI9A 2FV8A 3DEJA 5KCMA 4L0DA 3TRFA 5IZCA 5MGBA 3OE7D 1TYCA 1FFCA 5LN1A 2QSUA 1ZH8A 4YWJA 4KXQA 1OR8A 2Y1LA 4YN3A 2BKVA 2NW6A 4O3MA 1TCUA 2PMWB 3GT0A 4MA0A 3FMPB 1L0BA 3KR9A 3AQIA 2CJXA 4GMFA 5KNBA 3HB5X 2FQXA 2ZLBA 4FHEA 2GBLC 4NQRA 2FPKA 1GSIA 2XMBA 2EDCA 3EOBI 3HE3A 4A1FA 4I36A 4PAQA 2FPOA 4X1YA 2O8EA 1OA1A 1AS2A 1X3LA 1U7HA 5TQ2A 2I1LA 2VEDA 3A4IA 3UBTA 3WYCA 3EUFA 2H4XA 1DIBA 3FGNA 1FSSA 1QANA 2UZ0A 2Z2YA 4LI0A 5BRNA 1F0YA 2IY9A 2D0PB 3KVYA 1GZ4A 2OECA 2EARA 5DYIA 1N4AA 3MT7A 5K8VA 1BWRA 3QVLA 1K06A 5DN9A 1N2JA 2GUGA 3P9YA 4BVJA 4JJ6A 2VATA 5CFZA 2UYCA 5ALYA 4EL0A 1OT5A 1T5TA 1ZSVA 1U9IA 4OM8A 3KKZA 1XMVA 1T29A 4ICIA 4C5BA 2H5JA 2QM8A 5A04A 4DMUB 3U4CA 4MUJA 2P75A 2IY7A 2IU0A 4YMTA 2RHDA 1LK7A 1FRNA 2QLMA 5IUJC 4YQEA 4ZD6A 1PR9A 5HWSA 2O2JA 3IO3A 3CLTC 2W0SA 3VSBA 1NBHA 1NN1A 2HDNB 3E9ZA 4F4FA 4X1YB 2G8NA 2A9FA 2EDAA 2JH9A 5BWOA 3N1UA 1D6NA 4FM9A 4YCJA 5DM1A 3D7KA 4FUQA 4YONB 2VF4X 5FTWA 5F9FA 3FYUA 1E9RA 1UBJS 4NMHA 2IF0A 4EGQA 1C8VB 2DPGA 2PH7A 3DMDA 1T8RA 3HJGA 3IAS1 4JLVA 1ACJA 1YT5A 1GTJ1 3R3WA 4KQ9A 5A9TA 5J4LA 2CJPA 2VP6A 2J33A 1R6DA 2HA0A 1X38A 3ZX4A 3O4FA 3KLMX 4OXXA 4XXHA 1V35A 1ISSA 3EDOA 4PSDA 4XZ3A 2P78A 5A9SB 4MTCA 5H3HA 2AXNA 3BSWA 3JPYA 4BE7B 3GEIA 4KX5A 3WLKX 2BZSA 4KQCA 4Q34A 2XUJA 2A5YB 2BRUA 2O0HA 2W6ZA 1VTKA 2ZUVA 4KNVA 4XOIA 3KT8A 5DV9A 2OV1A 1SFRA 4GT1A 3LAWA 4RCYA 1KZ7B 3B89A 4XDZA 3IP8A 1O96A 5TJ9A 3WB0A 3R9WA 1UQTA 3FD8A 2TMGA 3USZA 1L7OA 4J1TA 1DFIA 3A3OA 3ZKWA 2ZQYA 4YAEA 1HETA 5JNLA 3D5EA 1LVHA 3U44A 1A5AB 1MB4A 1FTGA 3IQXA 4HH1A 2PAFA 1OZ0A 2C07A 4LJYA 2FW9A 4OQMA 4UUOA 5CFPA 1E6MA 4KRYA 4JT9A 4TQGA 1N33B 2FWBA 3CZCA 3CUTA 1CF4A 2SKCA 4D9IA 2R4UA 3AERA 3ZK7A 4KQFA 1PSDA 4DIMA 1LH0A 4RM2A 4Z1OA 3GDWA 5AVSA 2OD9A 1Q91A 3GR6A 5DGHA 5EHXA 3KD2A 5LQRA 1UMDA 3EXG1 3R0IA 3CNEA 3O8OA 1D4OA 2ZTVA 3HHEA 3BE4A 4PPGA 4H6VA 4MA4A 4I50F 3RUCA 1C41A 1KQPA 3G8CA 4HJRA 3NYQA 4DKJA 2PUDA 2XBLA 1TZBA 2W42A 2ZIEA 5KKAA 5EN4A 4U5XA 5ANRB 3F8TA 5FOVA 1DUVG 1YE8A 4JGIA 1Z2CA 3N58A 4K0RA 3S81A 1BHSA 5JXIA 1IUPA 1HMPA 1ZONA 2BP7B 1X7ZB 1G2OA 4L95C 5DRTA 3UYKA 1I0LA 1RYEA 2JCVA 2YZGA 4HUQB 3U37A 3UCFA 2AXEA 5BXQC 1L7DA 3C8ZA 3CPHA 3EZ2A 2C95A 4Z9XA 3LDGA 4EH1A 3DC2A 2AVDA 2PD6A 3DCYA 4YUXA 2R1TB 3CH7A 1E1RA 1GL6A 5EJ8A 3EHDA 4M21A 3E0QA 5E4YA 1Z39A 4F72A 1NDUA 3C85A 1EZ1A 3FZGA 4KE8A 4LK3A 4WFIA 1JPJA 5BVHA 5FI3A 4C6RA 1ODIA 4CKCA 4RZ3A 2GPSA 2OE2A 4NZOA 4N01A 2PU5A 2P5SA 2VPYA 3H05A 5EKUA 1AO0A 4LNUA 2FRXA 2XWJI 4NY1A 1T24A 3E5NA 4R7ZA 3RFXA 1K5GA 3INGA 3FSGA 4KN8A 5CA1F 5K0FA 4HZUA 1JHXA 4IF4A 3I9NA 3BCHA 4OLAA 3RIXA 4KU4A 4O5OA 1QAOA 5TX7A 1AMUA 2O8CB 1YNOA 4UPVA 3V80A 1LF5A 1LQUA 2X9VA 3AVXA 1QIIA 4UM9D 1NW8A 3NB0A 4ZHQA 1NI4A 4PICA 2DHRA 3NATA 1J2RA 1TC2A 1Y7LA 4BO4A 4HBGA 1D4ZA 2F3PA 2J0UA 3OP4A 2Z98A 1XE3A 3SZ3A 3I5YA 3L18A 2OZLB 1DZIA 4N0PA 1P7WA 3GMTA 3RF7A 3ZE9A 4NENA 4JI5B 2QTLA 4CKCB 3VC1A 3AOGA 5E7IA 4NU6A 2WU3A 1FFDA 1GTMA 5T4FA 2QMZA 2ZJ4A 1S8FA 4EECA 2G04A 5D84A 3MWEB 1SRQA 2J0EA 4C7KA 4ZU6X 1GL9B 4D3FA 5CB4B 3ZDZB 1Z22A 2W2KB 1A76A 1CDEA 3C8HA 2CL0X 3KYJB 3LXRA 3PXEA 2JGFA 4FI3F 2GB4A 4RLSA 4U6QA 1GTRA 1AKVA 4BUJA 2AH5A 5G0TA 2MSKA 2YJ5A 2F1KA 4XIGS 1V3VA 1U7UA 1D2MA 1R4AA 4HAUA 3ZCTA 1NATA 2IEYA 3IAM6 3KJIA 3PGXA 121PA 4BBZA 4CTJA 2DQKA 3NTUA 1VE1A 4RV4A 2Z6QA 1P81A 4JVNA 2QDKA 3VNVA 3EN0A 5GPBA 3ZCSA 4GW3A 4Q9JA 1KFEB 2WVJA 4TT3D 3DEKA 4Q18A 8ABPA 1C0PA 1WF6A 4CKWA 5HZKA 3I2IA 3K0CA 3L7NA 3GOHA 4YEDA 2YKGA 5G02A 2F17A 2IBSA 1FVOA 1G8KA 4EUHA 1ZM3A 4BO0A 2I8LA 1PZFA 4LBVA 5BNTA 3O31A 5CPBA 1HPLA 3IOMA 2QV0A 3D3WA 2HMAA 5FWXB 1LI5A 3ZJVA 1WXQA 1M1UA 1CHDA 3RDPA 3IOYA 1V25A 3I61A 3T7JA 1BXKA 1SCQA 4L8GA 5L7WA 2ONJA 4LY3A 4C7VA 3NNSA 3NAZA 4CG0A 4ZVOA 1F2UA 3F9RA 4UNIA 1JAIA 3ADBA 5THXA 1XRLA 2VSOA 1ULAA 3E7PA 2II6A 4ZOLA 4DPKA 3P4UA 2Q3MA 3HGQA 3K0HA 4BEWA 1N3YA 1M2WA 5IMSA 3E9YA 3R0JA 1JXMA 1Z7GA 4IXWA 4Q02A 5HJEA 1WCYA 2WSYB 2F2TA 1UKEA 4PRYA 3VGJA 1OGIA 4ME6A 3ZOKA 1J6UA 5EXTA 1CZNA 4IMPA 4NE9A 3MN1A 1CVRA 4Q19A 4Y9TA 4P0QB 3ML1A 2JBAA 4D97A 5AM0A 1C8KA 4PZDA 1E5XA 3SVZA 3MCVA 5CVTA 3TUJC 1GIAA 2Q3DA 3L2OB 3TNFA 2Z3WA 5CEJA 1Y8AA 2ECFA 4RZIA 1NM5C 5C31A 3VDRA 3WO1A 4QPDA 4E7PA 1NF2A 5BSUA 2OUKA 2EWMA 4EYQA 2PSSA 3TN7A 4HNRA 1XTIA 2QX9A 3GFFA 1PW5A 1T3GA 4M8KA 4PW0A 3CZRA 4RELA 5IJAA 3M8KA 3Q9SA 5T67A 1G4UR 1TM3E 3OZSA 3RGWS 1OTXA 1T9HA 3PVCA 5ED0A 2FB9A 4N54A 1H5NA 5H82A 5FPKA 4G23A 5GWXA 4MHSA 2E5LB 4I9NA 3DQPA 1IDOA 4IJWA 1U0JA 2IZZA 3I01A 1HLDA 1QDLB 2RGNA 1TAGA 4AROA 3QLUC 4PIMA 5CD9A 1M6HA 4CIWA 2E1RA 3QWFA 4MPPA 2OHHA 4URUR 5D2CA 3OCWA 4LHYA 4Q4DA 4UTZA