4WZ6A

Human cftr aa389-678 (nbd1), deltaf508 with three solubilizing mutations, bound atp
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
283
structure length
258
Chain Sequence
TTEVVMENVTAFWEEGFGELFEKAKQSLLGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRISFCSQNSWIMPGTIKENIIGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSELQNLRPDFSSKLMSFDQFSAERRNSILTETLHRFSLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cystic fibrosis transmembrane conductance regulator
publication title Binding screen for cystic fibrosis transmembrane conductance regulator correctors finds new chemical matter and yields insights into cystic fibrosis therapeutic strategy.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Atp binding protein
total genus 90
structure length 258
sequence length 283
ec nomenclature ec 3.6.3.49: Transferred entry: 5.6.1.6.
pdb deposition date 2014-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4wz6A00
1JEDA 1DEKA 4ITRC 5AUQA 4OQNA 2C04A 3QE0A 3X1YA 1Q0UA 1MO6A 4TMTA 2GF9A 1DAHA 3VR4A 4B6EA 3K0CC 2JJ8A 3X1ZA 3IILA 4C30A 2CK3D 3KQUA 1ZNZA 3LY5A 1F2UA 4HB0A 1W46A 3DKPA 1JEEA 3L2OB 1CRPA 4I99A 4NBSA 3IKJA 2P6UA 1NMXA 3RVBA 4WA7A 1A5TA 4RZ3A 3E1SA 5K8UA 1RFLA 1U2RA 1QZXA 3U5ZB 1OFUX 4MYHA 4M0LA 3K9LA 3EC2A 3OIUA 3RNLA 2G88A 1ZD8A 2C03A 5FR2A 3FTQA 4HDCA 1T9HA 2BBWA 3PIRA 1E4YA 2BEJA 1E2DA 121PA 2ZR9A 3CH5A 4AWXA 1FOEB 1GRQA 2ZREA 1LB1B 3AF4A 2ZI9A 4OYHA 1XEWY 4UNSA 1XF9A 1XP8A 2IF2A 2W6ID 2DYKA 1SXJA 2IYRA 1Q3HA 2A7QA 2OBLA 3IDQA 1G64A 2BCJQ 1VCIA 2PJZA 4B74A 4IXNA 2GK6A 5IT5A 2CNWA 4KV9A 1KTVA 3MD0A 4IKEA 4RZUA 4Q9LA 2XZOA 5TY0A 5LBIA 4JLMA 3SC3A 2PX3A 2R44A 5DI3B 2P65A 4ZDKA 1CJKC 4PPQA 1T5LA 1KMQA 1OYWA 3CPJB 3K70B 5AUOB 1OKKA 1E32A 3PEVA 2GRJA 2ZSAA 3ND9A 3AF1A 4KYUA 3FMOB 4IDPA 3T5GA 2UZ3A 3WY9A 1QHGA 2GCOB 3BIFA 3SYKA 3ZS8A 5FPTA 1R0XA 5H70A 4NCHA 1NKTA 3B9PA 3WYAA 1P9NA 3KFXA 4KHZA 4BGDA 3A1TA 3O8RA 1DAFA 2FFAA 4IDHA 2VF8A 4Q18A 4UKDA 3NDPA 3TBKA 1OIXA 521PA 4EPVA 1E2FA 5IF9A 5HKKD 1QHSA 3TLXA 5FL7D 4II7A 3SFVA 1AGPA 4D0LB 4OHVA 1KOFA 2ZQ5A 1GITA 4QL3A 5TXGA 2H7VA 2WMNB 5J40A 4C4PA 1G18A 4M1SA 4A2WA 1X86B 3TK1A 3K1JA 3K0SA 1OW3B 3B78A 2ZYTX 3PEYA 1E1RA 2ZR0A 4Q19A 1DPFA 1R2QA 5K8TA 4A2QA 3W6OA 1F2UB 4OQMA 4DLYA 1YQTA 3UMSA 4DLSA 3K0CA 1JALA 1UPTA 2UVQA 3RYTC 4CT5A 4DXAA 1E96A 1UFQA 3WBJA 4DDWA 4Q01A 5IK2D 1QBKC 2YOFA 3EPLA 4DSNA 2JDID 5CIWA 4HZUA 4W5WA 2IS1A 3UG7A 2XXAA 1OF1A 3ZH9B 3UIEA 1YRAA 3A1VA 2YHSA 4QHSA 1R0ZA 3EARA 1NJFA 1N5LA 2V1XA 5ANRB 5BYKA 4LHXA 4S35A 4QNMA 2LKDA 1E2KA 2BM1A 2P6NA 2QY9A 2WOJA 3EA5A 1TF7A 2CK3A 2Z4SA 4LYJA 4WW0A 5C4GB 4EFNA 4BRWA 2ZUCA 1N3BA 2JLZA 2DFKB 3T1TA 3CO5A 2MMGA 1SXJB 4L5BA 1MKYA 4AYXA 1J7KA 5DYIA 1E4VA 2MSEB 2V6IA 4LCBA 4AIIA 2ZI5A 5KO2A 4F91B 2VSFA 3QXCA 4AKEA 3SE0A 1FP7A 1DARA 1EFRD 4HAXA 2BCGY 4AKIA 4UXJA 4DT1B 1P6XA 1AN0A 4BZXA 2ASEA 3ZZ0A 5FPKA 1MT0A 2P0EA 421PA 5HR5A 3LW7A 3TUJC 5EZ5A 3PENA 4TMWA 2O8BB 1JB1A 4CZ2A 2W58A 1KK0A 3GCGA 3SJCA 4DWJA 4KVGA 1G291 2ZSEA 2W6IA 1TU4A 1OIWA 4ZCLA 3I32A 2NO6A 1G3MA 1XEXA 3GLIA 2ZUDA 4HUQA 4YDHB 1IXZA 5C4MA 2VO1A 2CL7X 3W34A 1NF3A 1EX7A 4JBWA 2ERXA 1WRBA 5DISB 1OH6A 4ZO4A 3VMFA 3VX4A 2VPPA 3I3SR 1PV4A 3KKQA 1KAOA 1XWIA 2FSIA 3AF3A 4GBMA 5E4FA 2WIAA 2QTVB 3HU3A 3WNCA 2OG2A 4C0QC 1U94A 2HLDD 4MGIR 2BIFA 2W2XA 1T8TA 4OBEA 3CZQA 1CKEA 2ZRGA 4LYAA 3SJZA 3R8CA 1SGWA 2WWYA 1SVMA 1GILA 1Q12A 4NCNA 4R2HA 3K0AA 1VIYA 2QGZA 3LNCA 3W8RA 1Z0DA 4B2PA 4WZ6A 2IYXA 1R8QA 3F0TA 4AKHA 4PZLA 4LWZA 2PLRA 4QM6A 3U7HB 1NVVQ 3IBYA 1TX4B 2WSSD 1QF9A 2A5JA 2XEXA 4F4IA 5JCZA 4KFTA 5HKKA 4NCKA 3KB1A 5FL7A 2ZE6A 1KI9A 3BB3A 3ETLA 3AVVA 4Q5IA 4QM7A 3HU1A 1KO1A 3MG9A 4HZUB 2ZJAA 1YVDA 2XXAB 3OEED 3BFKA 4XTRA 3BERA 2QNRA 1RRFA 5E7IA 3C4JA 3GJXC 3GJ4A 4DSOA 3QKRA 4RCYA 2IW3A 3LX5A 1XZPA 4B3FX 4PSVA 3K9NA 1UBFA 4KFSA 1Z83A 2XB4A 5HPYB 4POAA 3QNUA 5FTKA 2Z43A 4DSTA 4XVUA 1AK2A 3EZ7A 4GP7A 4Q00A 5IK2A 2KB0A 1J70A 3CF6R 4DLTA 3KL4A 2JDIA 2H1LA 3AQ4A 1N6HA 3A8TA 5DO9A 3AP1A 2YOHA 4RCZA 3U3OA 3QPVA 2N42A 2IC5A 5FH9A 3VFDA 2QAJA 4B75A 1ZU5A 4LJ8A 3OZXA 3OIYA 2GEUA 2OHFA 1Q22A 2FEOA 1G3RA 1XEXB 4JLDA 5CLLA 3GLIB 4HUQB 2F9LA 3IIJA 3NC0C 4BLTA 5LD2C 2PL3A 2FPMA 2QAGC 4R2IA 4DLWA 1TNDA 1GTVA 4YC7A 1EFRA 1KNXA 2HV8A 1BOFA 2VQSA 4BFUA 5FPSA 2GTPA 4MRSA 3UK6A 821PA 2DHRA 3UG6A 4QBHA 1EG7A 4PX9A 2A9KA 2Q0HA 4QOSA 2CJWA 4YONB 4NYMQ 4EDHA 1AQUA 2QM7A 2G83A 4OHZA 4PQFA 4CEIA 3B5JA 3B82A 2GILA 4TMKA 5FTLA 1ELOA 3BWDD 3UXMA 3A6PC 5FI1B 2VP9A 5EP4A 3MJHA 4C0LA 3J81k 1YE8A 2F7SA 2JAQA 2KBEA 4M4SA 3WRXC 3LBHA 5AWFC 4KLZA 1KIMA 3CX6A 1YRBA 3H2YA 3B60A 1FQJA 4UXIA 5SZJA 2Q9BA 5GADl 1S2MA 1R8SA 4C0AC 2HLDA 1ETUA 3AKDA 1NSFA 2EYQA 1NN5A 1G8YA 1KDRA 1ZIOA 2ZU6A 5SZIA 4MA4A 3NH9A 1EESA 2IYTA 1Z07A 2GAOA 2RGGA 3L82B 1GWNA 1MOZA 2PZEA 4X8OA 3TGPA 4WBSA 3HYTA 2LCFA 5KPDA 3U7EB 1US8B 1XBTA 3VQTA 2C9CA 4MH0R 1O87A 2GF0A 3QKRB 3U60B 5J4VA 1A2KC 3AVUA 1M34E 1E0SA 4GL2A 2AFHE 2C96A 1R0WA 2WSSA 3KQKA 2CLSA 1N0WA 3ICEA 2NPIA 1HQCA 4A0HA 2CLCX 2NO9A 2HYIC 4LV8B 3HYRA 2JLWA 2AWOA 2L0XA 2R6GA 1DAEA 1Q20A 4JL5A 1CR0A 1CTQA 4MKFA 1HT2E 5FR1A 2Q3HA 2EQBA 2FPKA 3OEEA 2ODWA 2QPAA 1F3OA 5JJIA 3Q7PA 1KK1A 2CCJA 3IPXA 3GFPA 4JSTA 4N1AA 3IUYA 4ILEA 1G6OA 3EWSA 4AD8A 1M2OB 2J0UA 1S4QA 2HYDA 4JLAA 4TLEA 4IFEA 4PC7A 4DBLC 1IY1A 2NZJA 1R5BA 1VPLA 3X1XA 4C2TA 1KO4A 5CDFE 1J8MF 2XNDD 3RDPA 621PA 4B47A 5JJLA 2FEMA 3Q8XB 4B3CA 2B92A 1H8HD 2FV8A 5AUPB 1YZLA 2QAGA 3W5IA 4QJ3A 3DHWC 2Q9CA 5DHAA 1O3YA 3MSXA 1U81A 2PT5A 4Q4LA 3WMGA 2OFOA 2HXSA 4V0ME 1AM4D 2DFLA 3IHWA 4DB2A 3A4MA 1NP6A 2IEYA 1VYVA 2QT0A 2OCAA 3AVWA 4RD1A 4ZDIA 2EW1A 2HCBA 5J4YA 1P72A 1DOAA 4M9SA 2ZI7A 2WWWA 3AV0B 5KNDA 1NG9A 3OAAD 4F4JA 2J1LA 2VHJA 2ZR7A 3MGCA 4E22A 3AP3A 4ERNA 2WPDD 2OAP1 1NVWQ 4HDOB 4JVLA 4PHTA 4JLVA 1LS6A 4QKQA 4N3NA 2V6JA 1NMYA 2WSMA 3TJZA 2I1QA 4PO9A 5FUVA 1E2PA 1X8JA 3LH5A 1GFIA 4D0NA 2JCSA 4HEJA 6Q21A 3ZYCA 1CP2A 1SVLA 1DELA 3VKGA 3W3AA 3OIWA 2BBTA 4LJAA 3VKWA 4D0GA 2RMKA 3X1WA 1QG2A 3DDCA 3QVVA 4AURA 4M21A 5CM8B 2AXPA 3D7MA 3W90A 1AS3A 2GNOA 3I1FA 3ZQ6A 2OO7A 3ASZA 4U02A 1HE1C 2QENA 1MO3A 2F9MA 3KDSE 3VTKA 4QBGB 5J4LA 2E9SA 4JMPA 1NY5A 2QP3A 4LBYA 5DLQC 3W8NA 1KO5A 4TL6A 1OH5A 2QQ0A 2AD5A 1FFHA 2CVFA 2ZE7A 3AB3A 2V4ZA 2W6JD 3AGPA 4IVRA 4XWAA 5DE3A 2F43B 2C5LA 2QQEA 1XX6A 3GJ6A 1E2IA 4MRNA 1HUQA 3GEHA 3KQHA 1FNNA 2WWIA 4RD3A 3A1SA 4PSAA 1RRPA 2J0UB 2PMKA 4IRUB 2R6DA 2VL7A 4YMUA 1XMVA 4F4CA 1CR2A 1P3JA 3SOPA 3M1IA 4B43A 1HTWA 5JEEA 4TT3D 3CPHA 1AKEA 1TL7C 3RS7A 2REXB 1JPNA 1GSIA 3U44A 4QC2A 5LD2B 1X8KA 4HAVA 2O8DA 2QAGB 2A5FA 3I62A 1NVXQ 1NVUQ 5UKDA 3QPUA 2TMKA 4C7OA 2W0SA 2ZI6A 4TLDA 2OXRA 3AEZA 5FBWB 3IO5A 3VR6A 4OHXA 2ORVA 4G5GA 3HPQA 4JT2A 4LBVA 2Z4RA 3QY0A 2FFQA 4H1UA 1NSTA 5FUXA 4EPXA 2XNDA 1SVWA 5EP2A 5G53C 2GXQA 2IS6A 1P5ZB 1G4AE 4LK2A 4ZCIA 1H8HA 1OV4A 5L3RA 4F92B 2ZRDA 2H8KA 3P4YA 5B58C 3FE2A 3RS0A 2GEDA 2C77A 2OFXA 3FHOA 2ZUBA 3FOZA 1S96A 4JLNA 2ZAOA 4IXMA 4NYJQ 2FSHA 2BMDA 3ZQJA 4A6PA 1R7RA 5J4HA 1VKJA 1KI4A 3GJ0A 5C18A 1ZW6A 1RE0A 2ZJYA 4HB4A 4A15A 3A37A 3TR5A 4AC9A 2UKDA 2G6BA 3CBQA 2JJ1D 3CRQA 2VEDA 1UF9A 1VMAA 3OAAA 4V02A 1MO5A 1OXVA 5EP1A 2V3CC 4D4KA 4MITA 4I81A 5FFMA 5LPNA 1T8UA 4PPNA 2EFDB 5AJWA 3CX7A 2WPDA 3FWYA 1A1VA 3D6TB 4HATA 2N1BA 3VHLB 1OFHA 5FOXA 3K9HA 3R9IA 1YZTA 1ONBA 4URUR 3RWOA 4QGGA 4TL8A 5FOTA 1N2CE 1Q44A 4RZXA 4DLUA 4BZQA 2VA8A 1HQYE 2X1VA 3RRMA 3W6NA 4XTCS 4FMBB 2ZSDA 3W5JA 2VH5R 1OT3A 2O8EB 3R7WB 3CONA 1G3UA 2CDNA 3B1WA 1S9HA 5P21A 1R0YA 4JS0A 4B2IA 4BLOA 1ZIPA 3BAFA 4M8NE 4MDFA 2J3EA 1N5IA 1K5DA 2JLQA 5JI2E 3M4YA 2I3BA 3B1VA 3GJ7A 4FCVA 4H1VA 4CRWB 5KHOC 2IWRA 1UKEA 2BHRA 4FMCF 2IK8A 1KAGA 1ZD9A 4GRAA 1TEVA 1XMJA 2NO0A 1GDDA 3NWJA 5L8VA 1WQ1R 2FF7A 4TTQA 4GT1A 2GCNA 4KVAA 3U44B 3THYA 2F3TA 1N6LA 2OZEA 3NC1C 2JASA 4MGKR 3CRMA 1D2NA 3QKTA 1NLZA 5HCNA 4CVNA 3JZAA 2RHDA 4Q1BA 2W6JA 3PUYA 4IOLA 3QOFA 5FPYA 1TTTA 5DN6D 1AS0A 3MWLA 5AJYA 2WZQA 3JVVA 4BEBA 3ZVNA 2I1VB 5AR1A 2J0SA 4GI7A 2B21A 2ZRFA 1E9EA 3I5YA 3R9XA 1ESMA 1XTJA 2OLKA 2QSYA 4DIEA 2VIIA 5CIQA 5KSZA 4TL9A 2ZRKA 2IX3A 1II8B 4V0OA 3A4LA 2J0QA 4XVQA 3CR8A 3P32A 3PUXA 1N6NA 3EXAA 3GD7A 2D2FA 1E2NA 1NNEA 3H0KA 1FMLA 4Q9KA 1CJUC 2OEPA 4S2EA 2BMEA 3QVUA 1XXHE 1U8YA 1PLKA 4KFUA 3AP2A 1WP9A 3V4FA 2BBSA 1ZU4A 4EFMA 4NU0A 4AYTA 3LVQE 5TMPA 2JLRA 2ZSFA 5K8LA 2OILA 4IVPA 1DG3A 4K81B 4US0R 4GP6A 4V0NA 2Q3FA 1W47A 1TF5A 2GZAA 2IXFA 1Q1EA 5HTKA 1HYQA 3U3MA 2ZPTX 3P4XA 1L4YA 2C98A 2GETA 2V1UA 1F6BA 1KI6A 3E2IA 4FI3C 1XFAA 1JJ7A 4YLGA 2JLYA 4W5JA 1E2LA 1IN6A 1SVSA 1G8PA 1BMFA 3O8BA 5CDFA 3MWYW 3K8YA 4JIMA 4NMMA 2IYWA 1GOTA 3BXZA 1TUEA 1M8PA 1RC8A 2JLXA 3X2SA 1G1MA 1RYHA 3LAWA 4L9WA 1SHZA 2MSCB 2JJ1A 5CJ2A 5CB8A 4GOJA 2FU5C 5F9FA 1F60A 2Q9AA 4V0MA 1P2UA 4LV5B 1X8LA 3U2QA 2QMOA 1Q1ZA 1AKYA 1G5TA 1ZNXA 1T5IA 3A4NA 1OFIA 3CX8A 1W36D 4V0KA 1WMSA 4BQSA 3ZD7A 1ZJ6A 1EGAA 4TLAA 2QSZA 1ZRHA 5F2EA 2G9NA 1OPXA 4PC1A 4DLZA 4FWIB 3F8TA 1XDBA 2CHVA 3LVRE 5SZHB 4M1WA 4PZZA 2O0HA 3AVXA 4JYCA 1VG9B 3THYB 1L7VC 2GXUA 3QF4A 4LC0A 4BFZA 1HH4A 4KBFA 3ZVRA 2WAYA 3THWA 2ZITA 1W36C 2HT1A 2BJWA 1E94E 1T0JB 1FZQA 4RKFA 2OBMA 1ZM4A 2P5TB 5EE5B 3C41J 1VECA 1T91A 1JI0A 1ZP6A 1L8QA 4MRPA 4RD6A 1W1WA 2OFWA 2QI9C 3BFVA 3L0PA 3N2IA 4GZMA 1E0AA 1DE0A 2QMEA 5G40A 2GVDC 5JLJA 2MSDB 3MWJA 2FJUA 4RFSA 2ZRCA 2OM2A 4HLUC 1IY2A 2IL1A 5G3ZA 1S9DA 2OXCA 1XTQA 1K6MA 2NOAA 3HDTA 4JBXA 3LXXA 2IYSA 3GMTA 3T5DA 1KSFX 4PANA 2AWNA 4DIDA 1G4UR 3IQWA 5A0FA 1BIFA 1FUUA 1GNRA 2DFTA 2EFGA 2ODEA 3LLUA 3WXMA 1EX6A 4KSCA 1P9WA 4LJ7A 2P3SA 1N25A 2GWHA 3B1ZA 1FW6A 1OHHD 4WAUA 4I1VA 1JECA 4DCUA 3PUVA 4GNKA 4MYUA 4ON9A 2CEAA 2R9VA 4TMXA 4UQOA 3SDZA 2VP5A 4PAMA 1KI6B 1XPRA 4JKYA 1E1QA 5F98A 3MMPA 5EP3A 4FWTA 1UBCA 3NVAA 3PEWA 2QG6A 3IEVA 1Z6XA 1KZGB 5BWMA 3TMKA 2CE7A 1WCV1 3L0SA 4G3XA 1C9KA 4A0RA 1Z06A 1RIFA 3FKSD 3U3KA 1COWD 1W2HA 4TQ9A 2J46A 3FYHA 4Z1MD 1GP2A 2WKQA 4HB2A 4URYR 4PZYA 5SZKB 4BFYA 1W4RA 3EW9A 3OESA 4CF7A 4D4JA 1GUAA 1CULC 2YWHA 3CNOA 4QXAA 1Z6YA 4BFWA 5JWOA 3LO5A 1XPUA 1HV8A 3I8SA 4I1UA 4QBIA 4DLXA 2V9PA 3Q5EA 1CJVC 5DSZA 3QKUA 2P2LA 1AA9A 2FPLA 3QF4B 2B6HA 2E87A 3THWB 1B23P 1MV5A 4FINA 2ZS7A 5B2ZA 4D26A 4X8LA 5JHGB 1U8AA 5FBVB 1ZM2A 3DEFA 2XNSA 2IYYA 1ZBDA 2GZHA 4E5UA 1Z6GA 2ZIAA 1GAJA 5TV2A 1IAQA 4GPTA 1UKYA 5A4JA 2CXXA 1RKBA 3B6EA 1KO7A 1ZMXA 4AI6A 4EPWA 2WTUA 3Q7QA 4RFSB 2QL6A 4GOXA 3QXXA 1XJQA 4G0NA 5CK5A 4FN5A 3AKEA 4RFVA 2XB2A 2O5VA 1P60A 4IW3B 1E0JA 4HLUA 3KJEA 1JXOA 2VHCA 4GZLA 4M9QA 5BXQC 3WRYC 3UPUA 2REBA 5BN4A 3MWKA 1G3QA 2XTZA 5F9HA 4ARZA 4DKXA 4K46A 2PH1A 3H1TA 1QG4A 1U9IC 4Z8YA 1Z5ZA 3BD9A 3VAAA 1AZSC 1MABA 4OQXA 5GJWC 1E2JA 1RYFA 4ESVA 3I4LA 1P73A 3I72A 4L16A 4PPFA 3R20A 4C0HA 3QBVA 2XTMA 4KLNA 4DUGD 5B64A 1UJ2A 5JHHB 1CR1A 4HAZA 4LGMA 2XZPA 5KYKA 2ZRHA 5KPJA 5KSPA 3EPKA 1Z2AA 3DMNA 4Q1CA 5CM9C 2YWGA 4A36A 2IUSA 3HWSA 3GLHE 1OHHA 4FW9A 1RRGA 4XD7D 5BYJA 3UANA 3RHFA 2R6CA 2ERYA 5EXTA 4MQBA 1HEIA 3IBGA 3FFBA 5EE9A 5F3WB 4A0FA 1KI3A 1S8FA 1ZM7A 1YZGA 2D06A 4QJ5A 1P61B 5FOSA 4ZIRA 3BC1A 2FX3A 2IUTA 3T1QA 1KDOA 3NEYA 3NBYC 1OLOA 4QHTA 3FFAA 2ZS8A 4EKDA 2CCKA 2CVHA 2G3YA 3BBPA 2Q3MA 1Z28A 1XXHA 2CLDX 1JPJA 2G77B 2ZJZA 3B85A 3FKSA 4LHZA 1COWA 4PC6A 5JJKA 3QEOA 3EASA 4Z1MA 2XTNA 2ZRAA 2YWFA 2RGDA 1D2EA 2QUZA 5JS7A 1W36B 2GJ9A 1T0HB 4MYTA 4BLQA 2F1RA 2D3WA 4TMVA 1N0UA 1ZNYA 2WAXA 1XTSA 1C4OA 4EPTA 2F1IA 1KDTA 2HDNB 2ZXUA 1BH2A 1H8ED 2EFHB 3NKVA 2JATA 2QGNA 4P4UA 1JBKA 2GCPA 2HUPA 2QZ4A 3F5FA 5BQ5A 1XD2A 5E7JA 3VNVA 1NRJB 2BM0A 2RGCA 1E2MA 4JVSB 1VG1A 2ZRNA 3RS2A 3M6AA 2DWOA 3NEJA 1IHUA 3SBDA 5EQTA 3D31A 4BFXA 2B8WA 4UNRA 1WB9A 4G1UC 4ARZB 4CYMA 2O8FA 3PUZA 4CGZA 4G5SA 4GOKA 4JLBA 4YXWD 1N6IA 4PQYA 3ZZUA 1MABB 1ZUIA 3IEUA 1A4RA 2AXNA 5D3MA 4DZZA 2ZJ5A 2ZM5A 2VBCA 4DCTA 1U9IA 3RWMB 4A2PA 1I2DA 4HLCA 1S3GA 2YINC 4EAQA 4HUTA 3NHAA 3RS5A 3LQRA 4B6FA 1DAMA 1W5SA 4BFTA 1D9XA 1LFDB 3EIEA 3CRVA 1Q1QA 1HE8B 2GHIA 2W83A 1UKVY 1FL9A 3U61B 3K0AB 4IHQA 2FE4A 4LI0A 1QHYA 1KZ7B 1KO8A 4ZKEA 3TQFA 3VR1A 1NN1A 2AL7A 3AVQA 4GMXA 2D74A 2HJVA 2WIBA 4FCWA 3RRNA 3SU8A 4XVRA 2IYLD 4XJXA 1VDZA 4JYBA 2BKEA 1Z0FA 1D8TA 3L8ZA 4KJZA 1DTSA 1ZCAA 4ACBA 1W7AA 1CLUA 1WXQA 3CF2A 1R10A 2WWXA 4AK9A 5C1BA 3ECCA 4DUGA 3WYFA 5JWHA 3PJRA 1HT1E 3LWNA 4E03A 1SZPA 1FX0A 4CDGA 3H4MA 2GK7A 4ZIRB 5JSZA 3S1AA 1IBRA 4IEIA 3OEHD 2ZRIA 4JKIA 4HZIA 4LSGA 4P32A 1CBUA 4NP6A 2ATXA 1WBBA 1JQLB 2NO7A 4NYIR 4XD7A 2X2EA 1XXHB 1KMHA 4LX0A 1YZKA 2DFNA 4W9MC 4OJQA 2B8TA 4MKIA 1U0HC 4Y0VA 3KQLA 1JQJC 1LS1A 2WJVA 3CH4B 2CCGA 4TLBA 4ZCMA 2ZRJA 1KDPA 2JLSA 1BYIA 3CUEF 1KSHA 2J87A 3ZZTA 4B3BA 3I8XA 5EUQB 3EZ9A 4CEJA 1XTRA 1XMSA 3CRW1 1GL7A 1GVNB 3PQCA 3SYLA 3GLGE 1E9AA 4D4MA 2BV3A 2IT1A 1QHIA 5CLQA 4UNPA 1XZQA 4B48A 4LJ5A 3ICQB 4Q1AA 3BS4A 3U3JA 4DHEA 3CF0A 2F1JA 4P31A 2Q6TA 3EWAA 3LW8A 5FBRB 5HE8A 1PLJA 3U6BA 1Z3IX 2W0MA 4NZYA 1RRCA 1GKYA 3B1XA 3OF5A 4QGAA 4TZ6A 4U5XA 1CEEA 1CXZA 4XWKA 3D3QA 1Y3AA 4LZZA 4QFMA 2O8FB 1ZINA 3BK7A 1D9ZA 1N6RA 3CWQA 1JNYA 3DOFA 1VCNA 4JVMA 4UJ3A 2KJQA 4WZAE 3RRYA 1H8EA 2VLIA 5FTMA 2CJWB 2ZE5A 1OH7A 2A5YB 4Y0AA 4B33A 3LBNA 1K8RA 3QF7A 5DNYB 1G20E 2KWIA 5KNBA 4B35A 2BMFA 3K09A 1W49A 2UZIR 4CEIB 4X8MA 3AVYA 2W2TA 3SR0A 3QQ5A 3IHLA 2IYQA 4XOIA 3FB4A 1IOZA 2WKRA 3WNDA 1PLLA 3GJ5A 4EIWA 2EWVA 1G5PA 4YXWA 4D82A 1MRSA 2HXYA 3CWZA 5ELXA 1MH1A 2GESA 3TSOA 4TYWA 1VYTA 3H84A 3AVPA 4DEXA 3QSYA 2G1JA 2F1HA 4DSUA 4HLDA 3RS3A 4MRVA 1FX0B 4JT4A 1B0UA 5GJVC 3RANA 4LHYA 4OK6A 4LRWA 1G17A 5JSZB 3SJBA 1E9CA 4IOJA 4YMVA 3EZ2A 1KMHB 2A30A 1IN8A 5KOYA 221PA 2OT3B 1VG8A 3FKQA 2ORWA 4URWR 1QHXA 2XJ9A 2WHXA 3P1JA 4R71A 1R4AA 1I2MA 1E9RA 3DZ8A 3TAHA 3ZGXA 1Q3TA 4BZPA 4CT4B 1SULA 2RGAA 2R6FA 4TYNA 1UKZA 2YOGA 1XCMA 5JEDA 3TRFA 4A92A 1ZVQA 4NCJA 4MUAA 3OEHA 3NG1A 5E3HA 2WV9A 2AN9A 5JRJA 4F93B 2A5DA 4Q7MB 4NDZA 3N70A 1LV7A 2D7CA 1UDWA 3THXA 3SNHA 4DEYA 1XTKA 3PCRB 4P4SA 2GJSA 1GM5A 4PFSA 1JR3D 4Q7LA 3TVDA 3ZIAD 4O2LA 5TDHA 4TYQA 3GLHA 5KU1A 1G6HA 2WJIA 5K8IA 1M7HA 2IHYA 2IWHA 4EUNA 4M22A 3WP0A 1T4GA 1T6NA 3NBFA 3SZRA 4B76A 3DZDA 3KQNA 3G0HA 1V43A 3VKHA 3WP1B 1P62B 3RS4A 2ZTSA 2X8AA 3BB1A 1M6NA 1ZM3A 3UMFA 2FGKA 1R6BX 5TVKA 2IF0A 3WMEA 4JSYA 1YR9A 4DJTA 1Z8FA 2VHTA 1RPZA 4LPSA 1IQPA 3KJIA 3TE6A 1TUIA 1WDTA 2FFHA 2FSFA 4B32A 2GKSA 4A0GA 2PEYA 5DIFA 1UAAA 1EK0A 2ZRPA 2V54A 4G01B 3R8FA 3EG5A 5JBQA 3KJGA 1G3IA 1M1YE 1G9XA 1NG1A 2F3RA 4DLVA 2IYUA 2C78A 2FG5A 2YJTD 3DL0A 5L3SA 3HR8A 5M04A 3BH7A 2QMUA 3Q5DA 1P9RA 5IDVA 5HZHA 4LBWA 3CPEA 5JWRA 2PBRA 4M2LA 5AUNB 2R2AA 4JZKA 4LJYA 4NCIA 5FBLB 1Z0KA 3QUSA 4NE2A 5FL3A 1PUIA 3B1YA 3UWKA 4URXR 1W0JD 2FH5B 3LD9A 1Z6TA 4Q1EA 3BORA 3O47A 1Z47A 1VG0B 1CU1A 2AK3A 2EWWA 1DAKA 2V55B 4Q4AA 2QP4A 2WWGA 2Z6VA 2QP9X 3BJIC 1LF5A 2C9OA 3PR1A 4C3ZA 2PEZA 3UKDA 5KSOA 3BGWA 2RHMA 3QENA 3SN6A 4ESHA 2O8DB 3BOSA 2GEVA 3IIKA 5J47A 3IPYA 4LHVA 2ONKA 2SHKA 3QXSA 4PAOA 4QBFA 2ORIA 4Q9JA 3PEUA 4TYPA 2O0KA 4TQUS 4A1FA 4A8JC 4C2UA 2G1KA 4KFRA 3TSZA 3THXB 4D4LA 5FBQB 2IS4A 2BJVA 3GJ8A 4LJ6A 2ZJBA 2ZJOA 1E6CA 3T61A 5JZVA 3GLHB 4FCTA 4BASA 4BLSA 5EE1A 1DBSA 1N0VC 2JIZD 4C0JA 4C7OB 1NY6A 3OIVA 1SXJD 1T3LA 1OE0A 2XITA 1VCMA 1GZSA 2KSQA 2EYUA 1TQDA 2H5EA 4M9ZA 4BUJA 3SHWA 2GJ8A 4H9GA 2ZYWX 4TT3A 4W5HA 5IRCD 4YDSA 3L0OA 4GDFA 4CIDA 1P4SA 2JA1A 2VP6A 3ZIAA 5KUTA 1XPOA 5CITA 3I5XA 4PAQA 3TUIC 3VR5A 1Z29A 1NJGA 2GA8A 5JS8A 3NDBB 1M7BA 1OKKD 5AJXA 4KXFB 4QG7A 3MCAA 3HR7A 3T35A 2AKYA 2DB3A 3AKCA 1D6JA 1MRNA 2D2EA 1XJ0A 5AK0A 5KTYA 3EIQA 3GLGA 4ACAA 4NH0A 2FDCA 2ZYVX 1DO2A 2GZDA 2YWEA 5G3YA 1FPMA 2REOA 3FVQA 1XJCA 4M1TA 4DCVA 4NL4H 2C99A 4ZI2A 1D2MA 2GDJA 2XOKD 3O8DA 2PT7A 2ODNA 4RKEA 1I4DD 4E09A 3T1OA 2QBYA 1SVKA 4BFVA 1FP6A 5B57C 1PVOA 4LDJA 2OBNA 2YC4C 4KCGA 2R62A 3LX8A 2H18A 3MAAC 1ZD1A 3X1DA 1E0KA 2CE2X 2E1RA 4Q4AB 2OCBA 3G82C 2BMJA 2RGBA 2WJGA 4P33A 1S1MA 2YV5A 3GQBA 4HAUA 5FTJA 1KSGA 3PFIA 1E9BA 3AGQA 4NYJR 1G8FA 4YMWA 2ATVA 4YMSA 4YQFA 3UWOA 2N46A 5FOUA 1PJRA 1Q57A 3KXLA 4HYYA 3KUDA 4X8HA 2RGEA 1TMKA 3MRSA 2BWJA 1MR3F 3ND8A 5C46F 3CR7A 3FPAA 1W0JA 2V8OA 2CBZA 4TTPA 2JLVA 1W44A 4GMDA 5L3QA 3CLVA 4GSYA 1E69A 1JAIA 1E99A 3BH0A 3NBZC 4A8JA 3FHCB 4OKSA 3BE4A 1GNPA 3QPWA 3M0EA 4QJ4A 3TQCA 5GJCA 2RB4A 1CR4A 2D62A 5DI9A 4U7DA 4Q7KA 3TIFA 2LKCA 3OFND 4ZKDA 4J0QA 1G21E 4DRZA 2X19A 1VHTA 1XMIA 1UADA 3E70C 1DS6A 2RKOA 3QJYA 5GVSA 3U7GA 4RD2A 2XJ4A 3ADKA 1ODFA 2QU8A 1XRJA 2AD1A 2DR3A 2A78A 4L8GA 3SYNA 4M9XA 5D3QA 1BYUA 2NQ2C 5TARA 1IM2A 2AFIE 3NXSA 1NBME 2JIZA 2AR7A 3LFUA 1LVGA 2QM8A 4DDVA 4TSFD 5DN6A 3GP8A 1G7TA 2BDTA 3ZLJA 4B3DA 4CEHA 4OI4A 1E9FA 1ZYUA 2YNMA 4OQFA 4ZPXA 2Z0MA 3FHTA 1AJEA 1TADA 5CYPA 4DT1A 1V5WA 1KKLA 1S0UA 3GLGB 3OE7D 1X6VA 1TEXA 1R5NA 2F55A 2W00A 4JLKA 4KBGA 2O8BA 2HJGA 4JLJA 3AF2A 2B7BA 3RLFA 3KKMA 4KU4A 2WICA 2AX4A 1Z22A 1NIJA 4JJKA 4CW7A 1KY3A 4FMDF 1G16A 1QVAA 3SEAA 5E95A 2QBYB 2NG1A 1EWRA 2OAQ1 4ZDJA 3T06B 2YKGA 5FOWA 1W4BA 3C16C 1S3SA 1AGRA 1A2BA 1IXRC 4IDQA 4B73A 2QROA 5JCPA 3QXJA 3EIHA 5A5GA 1E2QA 2GXAA 2QRZA 4M1KA 1P2SA 5DHFA 3C7KA 2BKUA 5CJPA 2ZI4A 4JL8A 3TKLA 1G19A 3RSOA 1XU4A 1XCGB 2P5SA 2XOKA 3SI7A 5J4KA 1YU9A 4DDUA 3T34A 4I1SA 1PZNA 3U4QA 3L0IB 1Z6AA 1UBGA 3CM0A 3D8BA 1OJLA 1L2TA 2IBMA 2YVUA 3CRRA 3F3YA 4K8OA 5L3QB 2WOOA 3TW4A 4HLQB 3BB4A 5LB2A 4Q47A 4O0MA 4A8JB 1FNMA 4IDNA 4YMTA 5CB6A 1NLFA 1KI8A 4A6XA 1EFCA 5JMTA 1IY0A 1U8ZA 3V4RA 2DY1A 1T3HA 3G5UA 5TB5A 3LDAA 3MFYA 2ODBA 1L4UA 1M74A 2CHGA 2GXSA 4LHWA 1UEIA 3QIAA 3VR3A 1KI7A 2BBOA 1SVOA 4DCSA 1D5CA 2ZRBA 5BN3A 2J9RA 1OB5A 1SKYE 3DO6A 1YHNA 4P4TA 5IHPA 1RJ9A 4OI0A 3NBXX 2GAAA 1KNQA 1W48A 5CK4A 1EWQA 1X3SA 2B7CA 5CYOA 2X2FA 5EXSA 1LTQA 2RH5A 3GFTA 1QHNA 3LRPA 1LNZA 3BH6A 4BEJA 4XWOA 3OFNA 5EZ6B 1X1SA 3ASYA 4CEHB 3FMPB 3B9QA 2ZRMA 1G41A 4C0SA 1H65A 2IXGA 3C14C 1JJVA 4UJ5A 1K5GA 1S1CA 3K0FA 3VR2A 3SQXA 1YJ5A 3ZJYA 2KE5A 1JXMA 3AVOA 4IOKA 1ZUHA 2DPXA 3EPJA 3PV0A 5FI0B 2ZJ2A 3WHLA 3U6KA 1F2TA 2H17A 1QVRA 2ZETA 1UEJA 4Q4HA 2ANCA 2IHBA 4RZ2A 1J90A 1TQ6A 4TSFA 4DCNA 3JZMA 3K53A 2I4IA 1ZNWA 1WBDA 5L3VA 2XSZD 4OI1A 4OHYA 1Z0IA 1W5TA 4JLPA 5LB4A 3DVLA 1NBMD 1QHHA 1XB2A 3OE7A 4FMCB 4Q9HA 2RGNC 4M1MA 1QRAA 1ANKA 3AUYA 3PVSA 2H16A 2ZJ8A 3A36A 2NGRA 3PG5A 2ZS9A 4LYFA 3C5HA 2J59A 3K9GA 4W7SA 3HPRA 2VRWA 4NYIQ 4WVFA 3RC3A 1U98A 4O2RA 1XNJA 2ZU0C 1GKIA 3GEEA 2O8CA 2WKPA 4PHGA 3KZ1E 4TTRA 2Z83A 3U4QB 3THOA 2J7KA 3RSLA 4DLRA 1BKDR 2FZ4A 4TZ0A 1KSJA 5DH9A 1IONA 2GBLC 4D2IA 3KKNA 2F6RA 2Q21A 2QPOA 3L8YA 2J5XA 3O8CA 3ADBA 4I1OA 4D81A 2P67A 4OQLA 4PC2A 3H86A 2WMOB 3CIOA 3TUZC 2XZLA 2FGJA 4BFSA 1ZUNB 1Y63A 1IN4A 4XSGA 2J0VA 1UM8A 5KDDA 2VSOA 2XGJA 1ESNA 4HB3A 1E79D 1TQ2A 1KKMA 5KSYA 4HSEA 1NKSA 1CRQA 4L15A 1US8A 2XAUA 3N5CA 1CJTC 1F5NA 1KJYA 1RJ9B 2MMCA 3Q3JB 3P26A 8OHMA 4OL0A 1EFTA 1XD9A 3U7FB 3AF0A 1F48A 2O0JA 5JI3E 1NLYA 2BC9A 4P3YA 3WMFA 1GRNA 2X77A 2NPFA 3Q9LA 1HURA 1XEWX 4AYWA 1OXUA 4P0TA 4OJKA 2QE7D 5H68A 3WNBA 4BE7B 1YKSA 4LJ4A 4NTZA 1BO6A 2ZRLA 4RJLA 1X1RA 2K5UA 3FMFA 3K0FB 4MKHA 3UMRA 3GPLA 2WJHA 4BPBA 2A3RA 1KHTA 2AK2A 3K09C 3KB2A 4Z8XA 3V9PA 4DC9A 1KJZA 4LYHA 1F2TB 3AUXA 1ZCBA 4JBYA 2GJAA 4LBZA 3GLFE 4URVR 1J99A 4Q4HB 2IXEA 2PCJA 4A82A 4G5OA 4Q02A 4R7ZA 3P20A 1NMZA 3HU2A 3IGFA 5FPHA 4MGZR 5EUMA 4MRRA 1OIVA 2H57A 2VTKA 3CW2A 2ANBA 3LLMA 3DM9B 4C0KA 2VP4A 1LW7A 3GFOA 1QHHB 2R6AA 4WOPA 4B2LA 3NTUA 4D80A 4MUBA 4ASUD 4L4UA 2AKAB 721PA 3KFVA 2ZANA 1A7JA 2NMVA 2J45A 4MKGA 4Q4JA 2HEIA 2J7PD 2RGNA 3KX2A 5DYGA 3KJHA 1KJWA 1GRRA 1U99A 3C15C 3BRWD 4TN1A 2O8CB 1OYYA 2XSZA 4Z54A 2FA9A 2NO1A 1FMJA 3OHMA 4B34A 1YR7A 5G41A 4EQ6A 1NN3A 1XCPA 1NBMA 1JR3E 1SVIA 1T3SA 3NHBA 3DKVA 2JLUA 5LDDC 2C2HA 2GBLA 1NN0A 2WJYA 4EJSC 2DBYA 1BS1A 2YC2C 5AJVB 4PTLA 3ADCA 4V0LA 2DCUA 3RAPR 1TPZA 3B8HA 4MDEA 1PUJA 3SQWA 3QI2A 1OB2A 1NIPA 3CNNA 2EVWX 4DB4A 4LY6A 1N6KA 4Q21A 3VU9A 2ZVPX 3PUWA 2HF9A 5GVRA 5H1YA 1NVVR 2VP2A 2W2VA 1GNQA 1E9DA 2P6RA 1YR8A 1ZM9A 4Q48A 3W9YA 1GG2A 4RVCA 4Q7JB 3ZD6A 4G5QA 1E3MA 3QBTA 1XD2B 4WXRA 2ZAMA 4IJMA 3A58B 4MGYR 4PO8A 4MYCA 2NZ8A 4M53A 2DWQA 3FDIA 3R9WA 4FMDB 2QT1A 1E79A 5GJBA 4D25A 3QKSA 2R8RA 4Q66C 2D4HA 5D3MB 2F43A 2VHQA 1II9A 4L9SA 2PZFA 3LQQA 1KK2A 3I73A 4KI0A 1G7CA 1ZC4A 4LJ9A 1R5OA 3KXKA 4BWYA 3GJ3A 3QG5A 1GIAA 2QN6A 1J2JA 3C8UA 4V03A 1I4TD 2EU8A 3T12A 1OFTA 1CIPA 3DOEA 2QE7A 4HDQB 4URZR 4JL6A 3TH5A 2FZLA 2FFBA 2IEZA 5DGXA 2ECKA 2OSBA 2RAPA 1II0A 2NIPA 2JJ2D 1EFUA 2QEQA 2V7QD 4KO8A 2IA5A 5FOVA 2PJRA 4DVGA 2BEKA 2ZE8A 2FWRA 5KNCA 3CKLA 4IFBA 4G5RA 4Q4JB 1GL9B 4E07A 4B44A 4FD2A 2Y8EA 1RVDA 2ZSBA 3B13B 1DAIA 2ZEJA 2NTYC 5BN5A 3DPUA 4OHWA 1OSNA 1GL6A 2OCYC 5FTNA 1IXSB 5EE3A 4B71A 4IDOA 3TVTA 3U3RA 1NL3A 3S1AB 4TLCA 3RC8A 1W0KD 1KGDA 4EQ6B 5C2JB 2VYFA 2ZROA 4NYMR 4M1OA 1HY3A 1P75A 2VHUA 4PR0A 4Q1DA 4ASUA 2FSGA 2PMDA 4PXAA 3B7GA 4R9UC 3SFZA 2OV2A 5BW8A 4Q03A 3MLEA 3RABA 2J7PA 4GFDA 2C9YA 1TQ4A 5E7MA 1YZNA 2C8VA 2QA5A 4EJSA 2CMKA 1SXJE 1YR6A 1XTIA 1A82A 2GJKA 3VU9B 1U0LA 3Q85A 4PPGA 4C9BA 2FMXA 1G8HA 4CEJB 2YYZA 2QTFA 2PCLA 1RW4A 2OE2A 2CL6X 4UNQA 4R98A 3PXGA 5EJEA 3LA6A 2ZI3A 2ZYUX 5JRZA 1YZUA 4IOMA 3AM1A 4QGFA 4TWZA 1W4CA 3ZVLA 1VTKA 2OLJA 1AZTA 1FTNA 2G0NA 1CJMA 2RCNA 4JVNA 5HE9A 3LBIA 3QKSB 4N0DA 2CL0X 1WF3A 2O8EA 3R7WA 1M7GA 3TNFA 4UXHA 1KYIA 1ZC3A 3BFXA 1Z2CA 4JLOA 3A1UA 4C0BA 3EC1A 1LF0A 1Q1BA 2VF7A 2QORA 3UATA 4FIDA 1DAGA 3EZFA 2PLFA 2IYZA 3QXHA 1G7RA 1G7SA 1XEFA 1Z0AA 3I92A 4JJZA 3VNUA 1E98A 4F38A 1W4AA 1XD8A 2WJJA 2WWHA 1VCOA 3ZS9A 4ZI3A 3K70D 2CHQA 2A2ZA 3JVUA 3QEJA 2IUUA 2O52A 1G8GA 2QRNA 4PC3A 3KXIA 4OK5A 3SHFA 4LV6A 4WXPA 4EPYA 1I4LD 1P2VA 3DMDA 3KUCA 3K0EA 1JR6A 3C5CA 3AVTA 1MO4A 1KY2A 2HT6A 1SKYB 1II8A 1E2HA 2WBLC 3KTAA 5EXXA 3K70C 1OXSC 4RD0A 4IVQA 5JECA 2ZVQX 1DG1G 3TAUA 1DO0A 4LUCA 3L43A 4TL7A 2BVNA 2FOLA 2JJ2A 3T15A 1VYUA 3SS8A 2V7QA 3CZPA 1WE2A 3REFA 3NH6A 2XX3A 2WM9B 4BLRA 3I61A 1AQYA 1OXXK 1BMFD 5EE0A 4WZBE 4UNNA 4BRUA 1VHLA 1W2GA 2FN4A 3ADDA 2DWPA 4HAWA 2FNAA 4EJSB 2WWFA 3EX7C 4D6PA 2OUKA 4A4DA 1IN5A 1U90A 3KKPA 4US1R 4PHHA 1SHKA 4QHYA 2WVJA 3DM5A 1W0KA 3RRZA 3WHKA 4RD4A 3TR0A 4PSKA 4LOAA 1IN7A 1N6OA 1P7CA 3GLFA 4KITB 3EAQA 1P2TA 4NHOA 4KSBA 2QPTA 2EFEB 3AH8A 3KKOA 1Q21A 2AHOA 3VX3A 3FMIA 2C95A 1IJEA 1E2GA 5KDOA 3IIMA 5HZKA 1KI2A 4P4SB 3GLIE 5HCIA 2JGNA 5KDLA 4EPRA 1N5JA 1SQ5A 3QG1A 1KI1A 4AY2A 3W6PA 4PQRA 4M1YA 2QTHA 2YZ2A 2VP0A 5JFGA 4US2R 2IYVA 4XH9B 3EZ6A 3ZVMA 3T1VA 2GVZC 2LWIA 3P27A 1N5KA 3AKYA 3ONWA 2BOVA 4Q9IA 1QDEA 4XSHA 3CB4A 3WBKA 2H92A 1OXTA 1CS4C 1HA3A 2A5GA 4O3MA 1LY1A 1VIAA 2CNWD 4AG5A 1AS2A 3LV8A 1TAGA 1JR3A 3IO3A 2IS2A 1EFHA 4KODA 1TF2A 5J5CA 3FGNA 3WYGA 3LXRA 1SXJC 1OH8A 4HI0E 4QRHA 4OK3A 2D7DA 2J41A 1Z63A 1FTSA 3E5HA 4NONA 3HJNA 3V00A 4XIGS 4N0EA 4EFLA 3SBEA 3A1WA 4Q1FA 4OI2A 1KK3A 3REGA 1UBEA 4QNRA 2QMHA 4TMZA 5AJZA 3N2EA 5H8WA 4FXPA 3VHXA 2HCJB 3KTAB 1DADA 2VSXA 4RY2A 3TSWA 2OESA 1N6PA 3PITA 1ZAKA 1E2EA 1G5RA 1TU3A 4HAYA 3Q72A 1DVRA 5DI3A 3EA0A 3NIBA 1U0JA 5L3SB 4F7WA 1JAHA 4BLPA 4ABYA 3MUFA 4A9AA 4ZDWA 1J8YF 1E9SA 2G0TA 1GKUB 1FQKA 1E1QD 1WA5A 2EFCB 3B2EA 4U00A 4AG6A 1CF4A 3EPHA 2R65A 2JEOA 4TYYA 3HP1A 4KYIB 3GEIA 4WIAA 1AIPA 3IQXA 4ZV4A 1C1YA 2GCOA 1Z0JA 2RGXA 4NKRA 4IEEA 4LPKA 4NPHA 1SKQA 3MJRA 4PO1A 1Z08A 1FUKA 1UDXA 4KAXA 3W3ZB 3ZDQA 4BECA 4PHFA 2ONJA 5B30A 1RZ3A 1YZQA 5FUWA 5FUYA 2OCPA 1E1RD 2KI5A 2HF8A 2KBFA 3TW8B 1IJFA 4I4LA 1NI3A 4B3XA 3GLFB 4O25A 4RSGA 2Z5FA 3CNLA 4LC1A 4B3GA 4DDTA 4Z51A 4QGHA 1EXMA 2PZGA 2PX0A 5EXPA 4TQAA 4AKGA 3SJAA
chains in the Genus database with same CATH superfamily
2XD9A 1DEKA 4OOEA 4YV0A 2GHTA 1GYPA 3QE0A 2N1MA 1XZBA 4UHFA 4YCNA 4XCVA 4YUVA 3FJOA 1DAHA 2RONA 3VR4A 3M3HA 1BMDA 2JJ8A 1JZSA 2GMWA 3IILA 3O2JA 3N6XA 1SMKA 4XRRA 4MYDA 1ZNZA 1F2UA 4HB0A 3ZDFA 1JEEA 2JFPA 1CRPA 3DPIA 4I99A 2BR4A 3IKJA 1WCIB 2VHZA 2UYYA 2WB4A 1NZJA 5KAMA 2HZ7A 2WF8A 4PIVA 4RZQA 1XHFA 4BRSA 1JE1A 1N36B 1NFRA 4X20A 4J16C 4MYHA 3OIUA 1Z3CA 2H1SA 4B0OA 2C03A 1I8TA 3SHQA 3P9RA 2V3WA 3IESA 4P3NA 2BEJA 2I9KA 3CH5A 6CHYA 4EG6A 2PR2A 1GRQA 2ARKA 1LB1B 4V3BA 2ZI9A 4DREA 1Y1SA 4KR2A 1XF9A 1XP8A 4I4CA 4R54A 5BSHA 5CLFA 1IG3A 1RRKA 1XO1A 4OHRA 1SXJA 4MAFA 5FORA 5J5AA 2EBWA 1XI2A 2M1ZA 3BMOB 3R3UA 2VDNB 5TPWA 4ZD6A 3ENWA 1XVVA 2BCJQ 3O38A 5H5JA 2PJZA 3PQ6A 1C0KA 1VB5A 3F9IA 4ZOAA 5F9MA 5K3FA 1EFDN 1JMVA 4KV9A 3VVMA 1RBQA 4WLOA 5JJ5A 3MD0A 3I1IA 4IIJB 4DWOA 2XZOA 5LBIA 4CMJA 3A9UA 1SC9A 3HBLA 2BE9A 2P65A 4WX2B 3WGUA 2BFFA 4C76A 1OY1A 4ZDKA 3ZDCA 4KIWA 3LC7O 1WAMA 3CPJB 4FONA 1I30A 2EWMA 3ND9A 2R6JA 1AUOA 3AF1A 1NI4A 4KYUA 4NMLA 4CCAA 3KV3O 2XNKA 5CMLA 4Q24A 4LDRA 4YXFA 1H9AA 4M38A 5A6SA 3DUFA 3ZS8A 5DWVA 2R68A 3UENA 2F17A 1Q7CA 4QUKA 1T8SA 1F38A 3F6BX 3B9PA 3Q3HA 3PDUA 2Z2JA 4WV3A 1TW3A 5HGXA 3QKIA 4X1YA 5TF4A 4MCHA 5B7NA 5B1HA 3GQBB 4BGDA 1ZN7A 4Q18A 4UBNA 3QU5A 3NDPA 4PAWA 1YQWA 4YJGA 521PA 1HPLA 1U2ZA 3F47A 4MQ5A 5EQFA 1P2FA 1AGPA 3FZYA 1XZCA 2VDOB 1RHKA 3ANYB 4OHVA 1NW4A 5AM1A 1QGAA 2IP1A 4U0JA 5TXGA 4I8XA 5LIPA 1K4MA 2H7VA 3F74A 2WMNB 3E9CA 3Q6IA 1ZKDA 3MWDB 5J40A 2NXJA 5H9WA 5LXTA 5AFSA 4A26A 4A2WA 2CYCA 2J3LA 4EG8A 3U09A 1O6CA 2YRXA 1NR5A 3BIOA 3GDWA 2HA0A 2C7QA 3BGIA 4JCCA 3K0SA 2HK7A 2CL5A 3VUEA 1P1KA 1CY4A 1O7JA 4AJOA 3HU5A 2ZR0A 3OUZA 5J43A 4J75A 4JJFA 3W6OA 4RGQA 3WC4A 3OLXA 4KE7A 1E6EA 4ZAFA 3PWSA 3ZHBA 1VDMA 2ZGVA 2OVBA 2VA9A 3WBJA 4XWGA 3HVIA 4UM5A 4DDWA 2R2GA 5FLXA 5JS2A 3BZWA 3R3ZA 4XJSA 2VHEA 3DBHA 1B6SA 5IJZA 4KQ9A 1YF3A 2IS1A 1BW9A 1W35A 4A8HA 4EFDA 4BUCA 2E3JA 3OE5A 2A14A 4Q16A 3ABSB 2YXPX 3A1VA 2YHSA 4J16A 3ICWA 4UMEA 2JBAB 1LSJA 3UIEA 1HI9A 5ANRB 4DLNA 3DZCA 1RCUA 3VYTB 2QY9A 2BM1A 1UZUA 2Z4SA 4EFNA 4WZBA 4BRWA 2ZUCA 5DNCA 3D2CA 3WBBA 2MMGA 1EFVB 1BGWA 4LWPA 4AYXA 3MOSA 3IVGA 5DYIA 1HZZC 1E4VA 2A0UA 4JJAA 2ZI5A 3D6FA 2EV9A 4PLZA 3Q0TA 1B26A 3RUEA 1VSQA 2QLLA 3TS1A 4WK2B 1RD4A 3N0VA 4D6XA 2JARA 1LSSA 5BT9A 2ASEA 2WFLA 2OD7A 1ACJA 1NUPA 421PA 2CHFA 3GZ4A 4MMYB 3TUJC 3R6WA 5FWDA 4TMWA 2C8KA 1KK0A 3IOMA 4EX6A 4HGYA 5SY6A 2AG1A 1G291 1I32A 2ZSEA 1HSOA 1YI1A 2XMQA 4EZBA 4QUEA 4CNBA 1FB5A 2KM1A 3OJ0A 3IV7A 1N2CA 3TTVA 2IIVA 2IHTA 1KP2A 1KVSA 1XEXA 2ZBEA 2ZUDA 3EXG1 3JW8A 4RMHA 1IXZA 1KC3A 3K2EA 4YDHB 2YY7A 4QTXA 5L7YA 3G8BA 5F3DA 4ZI5A 3W34A 2PXAA 2RGRA 1WMBA 4OQEA 1NF3A 4BMSA 3E9RA 2G09A 2PE5A 4EB8A 2ERXA 1HFKA 5DISB 5AW0A 4Y6PA 3OT4A 3WK9A 1OLXA 3KCNA 3QA3E 3VMFA 5A5FA 1OH6A 2VPPA 3EIOA 1RT9A 4XB6B 4BO1A 1RWOA 3KKQA 2FSIA 3L3BA 1SIBE 1Z0SA 3PFBA 4RW0A 3HU3A 1J0AA 5E4FA 2OG2A 1N4AA 4MGIR 3H3JA 2BIFA 3GDFA 2VVTA 2W2XA 4B4WA 5KCZA 1M33A 1MIOA 2NZUG 1CKEA 3JQGA 5LZ7A 4CM3A 4O2AB 3R8CA 2XGSA 1Q7RA 1SCBA 4X66B 2GM4A 1T8WA 3RC1A 2EZ4A 1GILA 2QRJA 2Y1GA 1Q12A 4NS4A 4R2HA 1VIYA 3BE5A 3KPYA 3GPIA 5K1ZA 4CUZA 4ZMSA 3GGPA 3LZCA 1CJBA 1R8QA 3KPVA 1X7ZA 4HGNA 1GSAA 2BGUA 3JQDA 3P9NA 1Z68A 3F0TA 4JY7A 3NYQA 2C58A 1O54A 3R3VA 2G5TA 3I28A 2PD4A 1TX4B 4KLCA 4BQFA 4V1CA 1QF9A 2IIQA 4WESA 4H0FA 4F4IA 2PVPA 2O19A 3G9QA 3WLIA 3KB1A 2CW5A 4QYSA 1YRQA 2PU7A 4PS0A 1DEHA 2I2WA 3DLTA 3LC0A 4ALMA 1KO1A 2DUJA 4XQCA 4C05A 2YCLA 3UGTA 3GT3A 4XSVA 1VRCA 4XTRA 3BERA 3SPXA 2QNRA 1A9YA 1UBRS 2D0PB 3GJ4A 3LKBA 3E2PA 1S2NA 3I6IA 4RCYA 3N3AC 2G28A 1X80A 2IW3A 2C8LA 3LX5A 1ODJA 4UTXA 3PHIA 1HLPA 1Z83A 2XB4A 1JWLA 2Z43A 4ER5A 4GKBA 2WWRA 4YBZA 5F52A 3V7WA 4DSTA 4G0VA 5C3UA 3UFXA 3KBBA 4H7JA 1UK7A 4IHJB 4NK5A 2DULA 3EZ7A 4OMFG 2BDUA 2FN3A 1A8HA 1WV0A 1QZZA 9MHTA 5IK2A 4MW2A 2KB0A 4ZEMA 1BRTA 5IC6A 3IE1A 2C1ZA 4LQCA 2EFJA 3AQ4A 3KKLA 5G1NA 1QS0A 4B7XA 5CCDA 1RZVA 2FWJA 4DA8A 1HZZA 8ADHA 2WJPA 4IIEA 1L5OA 2FTKE 1FYVA 5GOTA 3Q4GA 1JU3A 1VOTA 3FPCA 1K0FA 2UXBB 4J9VA 2HBZA 1P77A 1UWVA 2H54A 3OZXA 1XAGA 1J21A 1H2BA 2G9ZA 2NW6A 1ZRNA 2X9VA 5CT5A 2OHFA 1PJSA 4B9AA 2JD2A 1MCZA 1G3RA 2FEOA 3A9SA 4UQPA 4EMSA 3GJSA 1A2QA 1JEYA 1N2HA 2PL3A 3F97A 1I6KA 1QB8A 2GYWA 1TIKA 3MJEA 1DWQA 1KQOA 3IURA 4RHTA 2HV8A 1P74A 3AFNA 4AZ0B 2VQSA 3AM4A 3VNBA 3G7NA 3SKYA 2COEA 2FUKA 3SE7A 3DPSA 3UJ7A 3OJFA 2R5WA 1U6IA 1CDEA 1V8BA 4PX9A 2A9KA 4EENA 4ZK6A 3VKUA 1DC4A 1JEQA 1PL7A 2B35A 2G5CA 2R1VA 3CW8X 4MP8A 3LUJA 2DHDA 2Q4TA 4JQCA 4LZWA 4QJBA 3KQOA 3U40A 4CCYA 4V3CA 3NHFA 4Q3AA 2G83A 4I2VA 1KFCB 3ACBA 1E1MA 1Y34E 3B5JA 4TMKA 2H9AA 1UMCA 2I34A 4FMPA 1ECLA 3D3KA 4N9WA 3KNZA 3WA6A 3BWDD 3UXMA 3A6PC 3TLEA 4D4GA 3MIZA 1UOPA 5F21A 3MJHA 4C0LA 2F7SA 1GTZA 2JAQA 3DVAB 3N6VA 3EMDA 3OZGA 4M4SA 2X8LA 3M4ZA 3LBHA 4WLEA 3WK4A 4BS9A 4KLZA 4D96A 1KIMA 2Z6QA 4UVIA 5DYYA 4J43A 3TE7A 5KTNA 2P2NA 4F85A 5GADl 5L3ZA 5K0EA 3ZPXA 4J0DA 5T3YA 2QOEA 5HFNA 1NP3A 3SM3A 1Q77A 4WXHA 2I7XA 2H63A 4A27A 1TTHA 4BNMA 4ZODA 2YIJA 3RIMA 4U39A 4FU0A 1J5EB 2VCHA 1Z07A 4HRYA 4RMJA 2GAOA 5LWHA 3L82B 2W6CX 4MWGA 4X8OA 4EUSA 1KIAA 2FPGB 3A3PA 3INGA 4H4EA 4K9PA 2C3UA 3GAMA 4GDMA 4UHKA 3ELBA 1IZ7A 3HXQA 4HH0A 1O87A 4JXKA 1WB6A 3AVUA 2GN8A 2W5UA 4XOUA 2G36A 3K35A 3U9SA 5BQ3A 1F14A 3B51X 1NVFA 3JQBC 3GRRA 2C96A 1R0WA 1YJ8A 2OC4A 2WSSA 3NHJA 1SBQA 4P38A 4QBKA 4EGSA 5BVGA 3ICEA 1UJCA 1OWOA 2PVSA 4OSEA 2CLCX 4UM8B 2SCUB 4KOEC 2AWOA 3GAFA 2R6GA 3ZTWA 3S8MA 5CPBA 4ZYXA 2IBSA 1I33A 3NEPX 1DAOA 2G1AA 2FWPA 3HFRA 3TJRA 4DANA 4NK4A 4X62B 1HEUA 1SXQA 1HT2E 3HV0A 2FPKA 3K1AB 3TOZA 3ILSA 2QPAA 3EQ9A 4YCLA 4KIUA 1YC2A 1HT3A 1FXSA 4ZK2A 4WKCA 2ZTUA 2BHSA 4KKXB 2IU0A 5I7AA 1PT5A 4J94A 4JSTA 4N1AA 5GMOA 4YP9A 1N9GA 3STVA 4J2TA 5DCUA 1M2OB 1S4QA 4JLAA 3DFIA 4IFEA 1QKIA 4DBLC 2RK4A 1IY1A 4L0DA 1R5BA 1VPLA 1YK1A 3KVNA 4C2TA 5CDFE 1W9HA 1J8MF 2XNDD 2FUG6 4IO1A 1O2DA 3UUEA 3COJA 3HA7A 2KQUA 4I50F 3ESAA 4PF1A 5H81A 3W1VA 1YRHA 3HA2A 2F4VB 2IXDA 2QQGA 2E18A 4HN2A 4B3CA 1ZK4A 1EXDA 1C9NA 4TRJA 4D3XA 5KVVA 1E8DA 4QJ3A 4ESVA 5DHAA 4UASA 1U81A 2PT5A 4QRDA 3WMGA 4ZEWA 1PNQA 4NSNA 3GRZA 4K3VA 4LKRA 3LY9A 2AZXA 3A4MA 5A7GA 1OAAA 1VYVA 4IGAA 2RCYA 4XGQA 1OI4A 4RD1A 3SSNA 2X2OA 4LNUB 4DBVO 3CSUA 3G0OA 1SA0B 4ZDIA 4Y6LA 5J4YA 1DOHA 1K7EB 1DOAA 3PPWA 4DQLA 4BDSA 3H17A 2WWWA 3QVJA 4BN0A 1TEHA 3LJKA 4IDAA 3E7XA 1KJNA 3ZD9A 2LW7A 2O8VA 2R66A 2VHJA 2V9CA 2PRYA 3MGCA 1N2GA 1TCCA 3QRWA 4ERNA 1C80A 4CNQA 3P0RA 5JTUA 4Z2YA 2RGWA 5AYVA 3BICA 4QTTB 4ZQIA 5C8XA 1V1RA 1NVWQ 4IIUA 1Y5IA 2P4HX 3DBRB 3MTIA 4CF6A 3OT1A 5KTTA 4C06A 3CTMA 1HE2A 3FNHA 2JGLA 1T0UA 3TTTA 3OMWA 3TJZA 5LQSA 3KHKA 4PO9A 1SQ0A 2POQX 3D8SA 3HUEA 3V1KA 3E61A 1GFIA 5MN4A 1XRMA 3H5NA 1MPTA 4OOFA 5DDIP 2QAIA 3ZYCA 4R0MA 5CCEA 2ZIXB 2VSQA 4JNCA 3COPA 1P3DA 2NVUA 3RT7A 2WAOA 3GEGA 5LMZA 1QQBA 1QG2A 4OU4A 3FDFA 2JHAA 4M21A 5CM8B 1JLMA 2L2QA 2QTGA 1T1EA 2C7BA 1FTQA 2BISA 2A57A 2PZAA 2YXBA 2P2GA 3JTEA 5I9TA 2GA9A 2OO7A 3ZQ6A 4I9GA 1GUZA 4HDRA 2PKQO 4DCJA 5AXAA 1B15A 1WPGA 1L5NA 4A16A 1MO3A 1KU0A 1QH8B 4ZXPA 4B3TB 3LX4A 4ZYTA 3D7RA 4FVTA 3ZR4B 2E9SA 4F86A 4JMPA 4MDHA 3L05A 3M9WA 3TZHA 4K5QA 2FHPA 2FOIA 3OZWA 2ZE7A 3AGPA 1TC2A 3K6KA 4KVZA 4UHCA 1Y9EA 3JQ8A 2F43B 2R1TA 2QQEA 5I4KA 2HNKA 2G7MC 5AI0A 2XMRA 3GEHA 3HBFA 3BMNA 1QPBA 5DHUA 2PYIA 3A1SA 4MLDA 4PSAA 4QOIA 4JQZA 4IIXA 4P98A 4PIMA 4P9NA 5T8KC 2HJSA 2RHCA 5JH7A 1NW8A 3DLCA 1CR2A 2LCIA 1JG2A 3FI9A 2ZJ7A 4NAHA 2WSLA 4U6QA 4B43A 1L7XA 5ALGA 2V96A 1AKEA 1TL7C 2ATEA 4PX2A 4QT0A 1GAXA 2REXB 3RADC 3ZV3A 5AHRA 2Q3JA 5FNVF 1SHJA 1S2OA 2QR5A 4NX2A 3C6ZA 5CX4A 3AXTA 5LD2B 4XASA 3I62A 3ZOKA 1KL7A 2FKNA 3QPUA 2XMZA 2QN3A 2OCKA 4O5AA 2W0SA 2QTCA 2ZI6A 4EJ2A 1VPEA 3ZV7A 3FBTA 1ODCA 2ORVA 3A28A 5B4TA 3T0IA 3HPQA 3IKVA 2UYQA 3VC7A 3P2JA 2W9XA 3QY0A 3DZIA 4UZFA 4EM6A 4IKOA 5E1OA 3UOWA 2V74B 1QCZA 5CNMA 3NOQA 4E51A 4GDFA 4D9IA 1G4AE 4P86A 5H0IA 4DJAA 2H8KA 2JZOA 1Z18A 2GM3A 3FE2A 1REQA 1NFFA 1JHQA 3GMSA 3P4YA 4IH9A 3STUA 4H0CA 2ZUBA 2FDRA 4MHTA 1S96A 1RKXA 3PBKA 4KPEC 3WWDA 4L5IA 4Q12A 4MP6A 2BMDA 1R3DA 4CDMA 3ZQJA 4E30A 1VPVA 1SVNA 3BTVA 1NVEA 1A9ZA 3R6TA 1KI4A 1TLLA 3MJDA 1ZW6A 5HIJA 1RE0A 2GD6A 1SOWA 3K8ZA 3LOQA 4HB4A 2G07A 4OXQA 4PIPA 4AC9A 4ARCA 4X64B 1FTGA 1UUFA 1Y6RA 3CBQA 3L1HA 2C2KA 3OAAA 2UZ1B 3R6LA 1OXVA 4MZXA 4OQZA 4JUFA 1F8YA 5FTWA 2PX4A 1G55A 4YJFA 3RFUA 1GZ5A 2QRHA 3ZC3A 4FUTA 5FCDA 4ZMBA 1JLHA 1OBVA 3KWLA 3LFTA 4JJIA 1JBEA 1CY6A 2QUBA 4U2GA 5FOXA 1YZTA 2AUTA 2CDAA 3RWOA 4IINA 5LA6B 4IZHA 1GZ3A 2JFUA 4QGGA 3I0ZA 3MW8A 1YB7A 4H31A 4BX2A 3RJ9A 2A0KA 1Q44A 4PYIA 4PLCA 3NV7A 4DLUA 5GV8A 1SCKA 4BZQA 4YJ2B 2ZWAA 1HQYE 2WVGA 2XAAA 3B52X 2AEFA 3RRMA 5K0BA 5J2TA 1C0EA 4ENTA 5I8WA 5IULC 1QANA 2VH5R 1OT3A 1VE9A 4H3SA 2DXIA 3K9QO 1VE5A 3INNA 4ZAYA 1S9HA 1R0YA 2IV2X 4JS0A 4N4AA 1O94D 4BLOA 1U5AA 3UEOA 4D79A 3BAFA 3JQ7A 4EY3A 3E3OA 1ZOLA 4MDFA 4CTJA 2VUUA 1K5DA 4RS3A 3IOEA 5JG7A 3RAJA 3M4YA 4X5OA 4CRWB 1O77A 3KLPX 1TUBB 5IG2A 5CXSA 5CDSA 1BQ3A 2CN1A 4RL6A 1TEVA 4GMGA 1DX4A 1GDDA 2ZBRA 4H27A 3GIWA 3OIDA 1BOOA 5T8KA 1ATZA 1KY5A 3W9SA 3LKVA 4BX8A 4OX9B 3THYA 3CQ9A 2JASA 2O8DB 1QOZA 4PYRA 6GPBA 3FWHA 5EFZA 5FBHA 4OIFA 2W6JA 4DNQA 2W2KB 5KYWB 5ISMA 1M6WA 1AS0A 1FLDA 2GO1A 4G81A 4YV2A 2NV6A 3ZVNA 1O5TA 4RENA 4GI7A 2O07A 4QVGA 4XIFA 2C4NA 1UZNA 3R9XA 2RIPA 2DQ4A 2ZFUA 3UICA 1GR1A 2RJ3A 4W8HA 1S8AA 2VIIA 4N5MA 2ZWMA 5CIQA 1CZNA 1RTKA 2DWUA 2GZRA 2PZ8A 3CBGA 4OHKA 3KVRA 3O83A 5FJIA 2CUTA 1M2VB 1E1KA 4PYNA 5LQCA 2G08A 2J0QA 2QTRA 1LTHR 1X42A 1BD3A 2VYVD 3CA8A 3CR8A 1O0CA 4CF5A 2CF5A 4WERA 3E6AA 5C9ZA 3H0KA 2BMAA 2NLOA 4M1EA 1G59A 2I33A 4D02A 4O4HB 1U8YA 1E5QA 5CVJA 3AP2A 1WP9A 4WBNF 2BBSA 1ZU4A 4D43A 5AKXA 1RYZA 3K31A 2RBGA 4H7FA 2OCDA 3ZIDA 3BXEA 4K81B 1LLDA 3G1TA 5C37A 3DOIA 1CHDA 1Z37A 4YACA 3FYUC 1W47A 1TF5A 4D41A 1PD0A 2PZJA 3DE3X 4BQEA 4ETWA 4ZI7B 3C3YA 2C5BA 4H16A 4JKOA 1BCRA 1Z2DA 1GV0A 4O2BB 2H1RA 5HTKA 5BR4A 4Z4GA 4MUXA 4LWOA 2DVMA 1QC5A 4B87A 2C98A 2IOFK 5DCWA 4CKCB 3E2IA 2WM8A 4OUKX 4NI5A 5ESXA 1XFAA 3VPFA 3P9YA 1FFCA 2JLYA 4QFCA 1MUUA 3ZN2A 3MWYW 1ULTA 4NMMA 3DEJA 2DM6A 1BX0A 1M67A 4Y2RA 5G0UA 3S7TA 2PKQP 1FA9A 3L1KA 3VI3B 1GZ7A 3HBNA 4C4XA 2QX8A 1RC8A 1FS4A 1RYHA 2NZWA 2P3OA 3LAWA 4P93A 3WWOA 4LN1A 2H4WA 2P2SA 3KOWA 3K9BA 4MI3A 5LU8A 5CJ2A 3FPBA 4GOJA 5AVVA 5F9FA 5IKXA 3ZK9A 5A6VA 4KQFA 4V0MA 1VE3A 3ZWDA 4AW9A 2BFEA 1X8LA 3M4NA 1G20A 2QMOA 1Q1ZA 1ZNXA 1XMPA 3OE1A 3EXIA 1PW7A 4EJ6A 1XZLA 1BDIA 1U5BB 4BQSA 1WMSA 1ZJ6A 1FJ2A 3ZJUA 3E9MA 5F2EA 3R0JA 4PC1A 1S7GA 1DSSG 1K27A 3DTVD 3V1LA 3F8TA 4D74A 4O4JB 1CCWA 3EOZA 4U5QA 5LJIA 2CHVA 5JISA 4M1WA 1BXGB 2FAXA 2FR0A 1P4GA 4MVJH 3AVXA 4XPIA 5JUWA 4S3MA 1HH4A 4INZA 2WAYA 3MYYA 1VE6A 4QUBA 1W36C 2HT1A 3N75A 4PE5B 4Z3KA 4RKFA 3RWBA 1VIVA 1C41A 3DDWA 4LOIA 5JZ9A 4KPGA 3B1KA 5E8RA 5K3SA 5JMOA 4F2GA 1K4KA 2QF7A 5BNIA 2I4MA 3N2IA 4N5NA 1E0AA 4OP1A 1CFZA 4ZOLA 2PSJA 1J00A 4W1QA 5JLJA 2MSDB 3VDNB 1BN7A 3RAEC 2R79A 2DF8A 3C3DA 1EK1A 4B85A 2D0OB 1TVCA 2R8PA 2N3ZA 1IY2A 2IL1A 2AFHB 4HLUC 2CNKA 1VA4A 3BZUA 6NULA 2VQDA 2ZKIA 3AETB 1K6MA 1FE8A 2NOAA 3AJ9A 3QLUA 1WB4A 3FA2A 1VLLA 2KHZA 4GXQA 4JBXA 4YRDA 4DCMA 3AY3A 3L4JA 4PANA 1GNLA 1S4MA 1X7YA 3DBLB 3L5OA 2ZXEA 4YMLA 1THZA 3LUFA 3GUYA 3W4KA 3V34A 3G5AA 5A0FA 1LX6A 2DFTA 3LLUA 3WQBA 3PKJA 3U1TA 4GPZA 3DL7A 2AC7A 2ZPUA 1P80A 3AESA 1Z74A 1ORDA 3B1ZA 3EOAI 4BJ5A 2Q5HA 3FNBA 4AJIA 4YCDA 4BN5A 1JECA 1FW6A 2N47A 4DCUA 3R0ZA 4MYUA 4L5AA 1C29B 3O8OA 5AM5A 2CEAA 3FYUA 4ZQGA 1QYCA 5CDUA 2VP5A 4PAMA 3OJWA 1S2GA 5CPFA 3FY4A 1IHDA 2AE2A 4P2GA 4KN5A 5ALXA 2J9GA 3SQNA 1XMQB 3K32A 3MQ4A 2PUEA 1CHNA 4Z0TA 4LYEA 2XUQA 3AX6A 3MQ2A 4L85A 3H9UA 2O2EA 2YWCA 4IQ0A 4R5HA 1Z6XA 3VXKA 3LC1O 3JRXA 2P6PA 3TMKA 2CE7A 4HQFA 1WCV1 4A0RA 3I2GA 4G1VA 3ITEA 3VOTA 3ESRA 1XNQB 1JG7A 2JIOA 3WGMA 4OB7A 4V39A 5EYPA 2X41A 3EW9A 4D57A 4CF7A 2WB2A 3I6MA 3CUTA 4KQXA 1RXIA 2ZUEA 3DOJA 1GUAA 4NU8X 2E4ZA 3ANSA 2AYYA 3R7FA 3E48A 3G23A 3KYBA 3OECA 4C2BA 4ROTA 5JWOA 1JFTA 2YDYA 1ORRA 4I1UA 5GGYA 3T9DA 3T7EA 4EYGA 2QTZA 2V9PA 4DLXA 1CJVC 2G70A 3QKUA 3B3JA 1NLUA 3E3LA 3LE8A 4N3GA 3RVRA 4YHBA 3UT5A 1DL5A 1B23P 3CKYA 2VTEA 2P5UA 2B34A 4FINA 2ZS7A 3A70A 1W73A 1N2IA 3ELDA 4UBKA 5B2ZA 5JHGB 2HA7A 2OOSA 2GBCA 1LGYA 3BGOS 3DEFA 2IYYA 1XN1A 4JITA 4ZJYA 5LIRA 1ZBDA 3P2EA 4MW1A 2H2DA 1Z6GA 2HTFA 3KT0A 4Q3KA 1CZKA 3KLBA 4FLMA 3LLCA 1R6AA 4GPTA 5TV2A 1V9LA 2ZM6B 1QYVA 2HAEA 1WUHS 3B6EA 7MHTA 5AVWA 3DG9A 2WTUA 1VMKA 4PVCA 4RFSB 5ER6A 1D7OA 2QL6A 4GOXA 1HLFA 4G56A 4MVWA 3O8NA 2GAJA 4FYMA 1SFRA 2XB2A 1KIFA 3SIXA 2O5VA 1P60A 1A9QA 2V7UA 2BEVA 2BDEA 4WCDA 4HLUA 4JOBA 5KYYB 2VHCA 1ZAYA 5ALRA 1NQUA 3UPUA 1DX9A 3KO8A 4OHOA 5BN4A 3TFOA 3MWKA 1TMOA 2ECQA 4BBJA 3ZUPA 4BWFB 1SC4A 4QARA 2BMVA 4NV0A 4G9BA 4P82A 1RXSA 4ZN6A 4WMLA 5A02A 3Q3VA 3ICPA 3H1TA 3UXEA 1U9IC 4TRRA 1UBKS 4DNOA 4UDYX 5LN1A 2OQ2A 3HZHA 2B20A 1LVUA 5KYVA 4A3SA 4PCLA 5GJWC 2P9TA 3TQIA 3PP8A 1Q91A 3FB1A 4P7KA 3RTGA 3ZHZA 1FNSA 2F3SA 3I4LA 4XFDA 1WNFA 1Z7BA 2D54A 2OKGA 3OCXA 1R0CA 3I72A 3BQ9A 4MLCA 4ZCSA 1YZHA 3R20A 4C0HA 4MQ6A 4W1SA 1EFPB 4DMRA 2XTMA 5B64A 4IUDS 3H6GA 5DOZA 3B9BA 3JYLA 1CR1A 3QJ5A 3UM9A 4HAZA 3UPDA 2XT6A 3LL4A 5HP4A 1CB7A 2BAGA 2JHPA 1UCFA 2F00A 2YJNA 3PI7A 5DTEA 1SQ6A 2W2PA 5KPJA 2PYDA 4XUDA 3RVLA 3TM5A 4EG3A 3TAXA 1QCCA 1L9KA 4W63A 5CM9C 5JATA 3FUCA 3N0TA 1L7RA 3AR8A 3EC7A 5JSQA 1NMQA 4KR6A 2IUSA 4ES6A 5AKYA 2ZP1A 2WD7A 3HFGA 4FW9A 3RHFA 3BYZA 1YAJA 3BCHA 3GWZA 3R7NA 1XJWA 2ERYA 4RGYA 4BP8A 4RPLA 5EXTA 2EBFX 4MQBA 1HEIA 1M2FA 2OMEA 2XYQA 1S8FA 4A0QA 2HBYA 2QG9A 3FJ1A 3W77A 4LOJA 3ROQA 1ZX1A 1PSWA 3JTMA 5LQNA 2Y1KA 2FX3A 4KN8A 1YU6A 5AVSA 5IAEA 4F84A 3KQMA 4BY9E 1EEXB 4EJFA 2HLNA 1C2TA 1VC2A 3JD2A 4EKDA 2YY5A 4TN5A 3OKFA 2CCKA 2CVHA 2WF6A 3D4IA 3R0QA 1R6XA 1XXHA 1Z28A 4TXLA 4G37A 2ZJZA 4YK7A 4HL6A 3TMAA 3WWEA 2CFCA 4PC6A 5JSHA 1H2XA 2J32A 3FNRA 1NVGA 3UUFA 1EM6A 5H3CA 2ZRAA 4BVGA 3P9ZA 2D1QA 1TTQB 5K8JB 1E6LA 1E60A 1PJ3A 4MYTA 2PGXA 3HCPA 3AR2A 1OZ0A 2Z2YA 3TB4A 3F6RA 1A04A 2ZTLA 4FPXA 1TEZA 4OL9A 1MQSA 2J3MA 1N0UA 1ZNYA 2IPOA 4MWTA 4R1TA 4TMVA 1DO8A 4G4IA 4BNGA 2YRWA 5CBKA 1ZJ5A 1L4KA 1KDTA 1PP4A 1ZN9A 2HDNB 3HUFA 2YW2A 4MYRA 1DBPA 1H8ED 4KDRA 1P6QA 1P1JA 4RA6B 2CZGA 5BNWA 3IUNA 1LBIA 3M9XA 1O6GA 1E4EA 4KQ6A 2DPYA 4H6XA 3RS2A 1JHXA 1A7AA 2ET6A 4JVSB 1W6UA 2DWOA 2I6FA 3MINA 1O96B 4AJLA 3SBDA 1R4MB 1M66A 3AINA 1P0FA 3N1UA 2H4ZA 3II6X 1P1FA 4KQEA 1T15A 3DEYX 4GUDA 4QU5A 1GPWB 1SQSA 5HMLA 4ARZB 4CYMA 5BWOA 3UCFA 1YVPA 2AOTA 4E31A 4D9CA 3QVMA 4QAJA 4N5DA 1IDOA 1CF2O 3OU7A 2QY6A 4JLBA 3G0BA 4CGZA 3P0FA 2Q5IA 5A2QA 1MABB 4Z4EA 2XCQA 4DZZA 4Z6KA 2ZJ5A 3TCXB 3FTEA 3VR4H 2C9DA 4RVUA 1U9IA 1I2DA 4C4ZA 4IH4A 2MU1A 1UBLS 2ZYIA 5TPZA 1D0SA 3RS5A 4HV4A 5GZ1A 4LJLA 1ISHA 2A4MA 1PK7A 1PT6A 2FW7A 2RG7A 3V4PB 3WV4A 1IK4A 1HE8B 4P83A 2Q29A 4NEGA 3DONA 4K9NA 5KYGA 4Z1MD 1UKVY 2VBFA 4HNSA 3U61B 1B93A 3K0AB 5HWSA 1QHYA 3VR1A 1KO8A 1P3Y1 5IKMA 5CFRA 6ADHA 5F3RA 5B1EA 1TYZA 2W8ZA 3OVMA 2V6BA 3OFKA 4FCWA 2Y71A 3PXAA 3SHOA 5BSWA 1A7KA 3DV2A 1FEZA 1VDZA 3L8ZA 1D8TA 2O59A 2VT6A 1DXOA 4NABA 3FPGA 2VTBB 3O0TA 1RHUA 1GO2A 2EGUA 3ETEA 1MX5A 5EMNA 4AK9A 8GPBA 1ES9A 3E9EA 1P4RA 3PJRA 2JGMA 3HB4X 3QTTA 2VZ0A 1ZFNA 3MBIA 3JXEA 1P7ZA 2Z3WA 1SBNE 1J2UA 1EGHA 2GK7A 3AQIA 3GELA 3H4MA 4JGIA 3WSVA 4IILA 5JSZA 4IEIA 2NSLA 3KTFA 2XR1A 1V4NA 3R7SA 4BQNA 2C4KA 1YCGA 5DK6A 1KYWA 4C22A 5HUHA 3M1LA 4HZIA 1FSZA 4KQMA 1WIWA 2JEYA 3JATA 3DW1X 4U9IS 1JQLB 4NYIR 2MYUA 1S8OA 2X2EA 1N1EA 2IXAA 1KMHA 4XD7A 1W76A 3ESYA 2WYHA 5EZYA 2IIPA 5BV1A 1YZKA 1PT7A 1P8JA 4Y9UA 5K05A 2IU6A 4OJQA 1U0HC 1EDZA 3F8SA 4EJMA 4GLOA 4IHAA 5D6OA 2FR1A 4EKGA 1KDPA 4DLAA 1FDRA 3EZ9A 3HHPA 3L7JA 1W96A 1VPWA 1GL7A 2AOUB 3T3EA 4EO7A 1N5RA 2XEDA 3GLGE 1U31A 2O2GA 3IT3A 4D4MA 9LDTA 3TEJA 4ND7A 1KBZA 2IT1A 2GPNA 4B48A 4E33A 1QZUA 2G82A 2ZWPA 4Q1AA 5C1IA 3CF0A 4YRAA 1DJPA 1NXWA 3EWAA 1Z3IX 4NZYA 1TECE 3WNQA 3ZI7A 1CJCA 4DAEA 2GERA 3OF5A 1GV1A 4H4CA 1CX9B 4KGZA 4WUTA 4G9GA 1KAEA 3D3QA 4FFPA 3MXOA 1BNCA 4I55B 4L8WB 5LP6C 2O8FB 3AJAA 5I8ZA 3DZHA 2UXDB 1LNSA 3I2HA 4C7KA 1JNYA 1X92A 1VCNA 2KMLA 3S2IA 1FY2A 2P9GA 1TKBA 4JVMA 3HCEA 2KJQA 4LECA 4RK4A 4UJ3A 3TLGA 4ZO7A 4CDNA 1M72A 5I7WA 5JO0A 2EDCA 3KETA 2MR5A 4GM4A 2AJBA 3Q9UA 1X0VA 3LBNA 1K8RA 3WDMA 3EDRA 1AQIA 2KWIA 3L6EA 2QD4A 1XLWA 1OXBB 2UZIR 5FWAA 1WD7A 3EXHB 4X8MA 1Y89A 3HSSA 4LHSA 1VL8A 2P0AA 3BCUA 2VBGA 3FB4A 1K08A 1XTBA 1M6VA 2HNBA 2WKRA 2Y2VA 3VO1A 3WNDA 3X1KA 2EWVA 3SAJA 3DMYA 1G5PA 4DIBA 3OD5A 1UXOA 1T35A 4WCFB 3AEKA 1Q95A 3L4KA 4DIKA 2R0QC 3L06A 2YASA 5EIHA 4TYWA 4GF5A 2VNSA 3OQBA 4M1ZA 4IJ5A 2JFWA 3AVPA 4J7UA 4DEXA 3FYDA 3W6ZA 2F1HA 4KB5A 1V9CA 1C9YA 1X7XB 5IVKA 4R84A 1CRZA 3QEMB 2IZZA 2I6UA 3CLRC 1FX0B 2Y6UA 4JT4A 2P9HA 3UK7A 5H3HA 3RANA 1ZK2A 4FYKA 4J0IA 3BN3A 4BJ3A 1I80A 1SXIA 1G17A 3JQRA 4UTNA 2CD9A 1WWKA 2XMSA 1K8XB 3EDYA 2CKDA 1DCFA 4IOJA 2R7KA 1WEHA 2WJ4A 5AM4A 4BBAA 2JA2A 5GY7A 3EZ2A 2A30A 3I39X 5KOYA 2OT3B 4G4GA 4MVJG 5I3ZA 4GX1A 4URWR 4LJKA 4JGBA 2BFOA 4EF4A 2ZZKA 3K92A 4NRDA 5EEGA 2RGAA 4YRCA 3WRWA 5DTIA 4G1CA 5FA5A 3WJ7A 4F6RB 1QO7A 1R0SA 1RWWA 4TYNA 1ZCJA 2Z30A 2YOGA 3HCFA 5ES4B 2HO5A 3TRFA 4EECA 3ZBQA 4A92A 3DTTA 1YQ9A 5AXBA 4F9TA 5K0JA 1TRHA 3L93A 4NEHB 3AR7A 4B6RA 2A7XA 2HRQA 3NG1A 1I7SB 1WTCA 1YZVA 2BGKA 2B94A 2A5DA 5C34B 4BNKA 3JZDA 10MHA 3CNHA 3S2ZA 1XDDA 1XQWA 1CUIA 1UDWA 4DEYA 1AKMA 4KR3A 2KS6A 2GJSA 1OC2A 3KPUA 4PAGA 1QO9A 1PZMA 2SICE 2O0LA 4GYKA 4QYWA 5AI6A 1QG6A 4BVLA 4JEMA 7GPBA 3H1EA 1W85A 3TQOA 4REOA 2DFDA 1J4AA 1ZJ4A 1PEYA 1WLSA 3GLHA 4OQQA 1ZGHA 1H1TA 1A97A 1SUPA 2CFTA 3HEBA 4HZGA 4Y67A 5LP1A 1GU7A 4EUNA 1CQJB 3FTPA 5LP6A 5KOIA 3N8NA 2PUGA 2GZSA 3EBLA 5DLDA 4D9EA 3HM9A 1T6NA 3VVBA 3T5AA 1C8LA 1D2CA 4JP8A 2XT9A 3KQNA 2X6TA 3J7TA 5BMVF 4WRRA 5P8WA 4R2XA 1TM5E 1XLVA 3PHBE 4YCAA 2ZTSA 1JTFA 4J6FA 2MJLA 3R44A 5TMEA 3LWBA 2JIQA 4IXDA 3A0RB 4NJEB 3W5CA 1IHYA 1V7ZA 3MCVA 2IF0A 4BXOB 3BGVA 1R74A 2WP0A 4QXMA 2ZZNA 5TNXA 5C7YA 4EMBA 3RR2A 3DNMA 5DGHA 5JANA 2VHTA 3AHHA