4WZ6A

Human cftr aa389-678 (nbd1), deltaf508 with three solubilizing mutations, bound atp
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
283
structure length
258
Chain Sequence
TTEVVMENVTAFWEEGFGELFEKAKQSLLGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRISFCSQNSWIMPGTIKENIIGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSELQNLRPDFSSKLMSFDQFSAERRNSILTETLHRFSLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cystic fibrosis transmembrane conductance regulator
publication title Binding screen for cystic fibrosis transmembrane conductance regulator correctors finds new chemical matter and yields insights into cystic fibrosis therapeutic strategy.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Atp binding protein
total genus 90
structure length 258
sequence length 283
ec nomenclature ec 3.6.3.49: Transferred entry: 5.6.1.6.
pdb deposition date 2014-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4wz6A00
3VR6A 1N0UA 2ZUDA 1BMFA 2WWXA 4JLVA 3BWDD 4AIIA 2OHFA 3LQQA 2CK3A 1KGDA 4G5QA 2FV8A 4EJSC 1CF4A 2UZ3A 4QBGB 4DUGD 2NOAA 1IOZA 2ZTSA 4DCSA 1ZD8A 4RKFA 5KDOA 1LY1A 2ZI9A 1SVLA 3OIYA 3A4NA 5G3ZA 4Q4AB 1SULA 4ZI2A 4URZR 3A36A 3CWQA 1J7KA 1W1WA 3FWYA 3S1AB 1BOFA 1CIPA 3IUYA 2F3TA 1G6HA 4KYUA 2N42A 2ZM5A 3PIRA 3EIHA 2IHBA 4HAXA 3JVUA 4TMTA 2WMNB 1S1MA 2PL3A 2WVJA 3RDPA 3RHFA 3PUYA 1Q22A 4QOSA 4HLQB 2XOKD 3VR5A 3MGCA 3U44B 3P32A 3TQFA 2ZYVX 4B33A 4DB4A 4U00A 5IDVA 4GSYA 2O0KA 2WSSD 1EK0A 1UF9A 3CONA 1JR3E 5KSPA 4CF7A 1ZNXA 4Q19A 3EG5A 3KJGA 3GLGE 3P1JA 4E5UA 1DBSA 2O0JA 1ZVQA 5JWRA 4PQYA 2V1XA 3B1XA 2CLDX 1KSGA 4DDUA 2ZRMA 1OSNA 2FEMA 4IVQA 3BBPA 1R5OA 4OQXA 2BJVA 1U0JA 4Q9JA 3CX7A 3ZIAD 4KBGA 1G5TA 4KFTA 3H2YA 3P27A 3TRFA 3QXSA 1RRCA 1R0XA 1XBTA 2X19A 3AM1A 2QEQA 3LW8A 3Q5DA 2IXGA 5JZVA 3TLXA 4NU0A 2DFKB 3THWB 5L3RA 3W8NA 1WB9A 3DMNA 1NG1A 3NVAA 1NKSA 5JMTA 1IXRC 3VHLB 1J8MF 1II8A 2YVUA 4Q00A 5L3VA 1KO1A 5CLQA 1G7CA 3R9IA 5FBWB 4Q7MB 3KKOA 4NYJR 2FDCA 1VKJA 5JSZA 1X8JA 1X3SA 3QI2A 2RHDA 1MABB 2OAQ1 2F1HA 4N3NA 2YOFA 4TMZA 2XSZD 2ZYUX 2WPDA 4LBWA 1OB5A 2HEIA 1Q44A 4Q66C 3KKQA 3LDAA 2WWIA 4NYJQ 1ZW6A 5SZJA 1G8GA 3DM5A 1XXHA 1KKLA 4DIDA 5DHFA 3PXGA 1NIPA 4KCGA 3KKPA 2XZPA 3RANA 2RGBA 1TU4A 1JNYA 1ESMA 2VF7A 4M1SA 1U98A 3AKDA 2GTPA 4MDFA 3MWLA 5HTKA 2DCUA 2FFQA 5D3MB 1N25A 4LHWA 1US8B 3I32A 4WXRA 3FPAA 3LQRA 2ANCA 3K0AB 4YMUA 3N2EA 4BPBA 3FYHA 1KKMA 721PA 1BYUA 4NDZA 1M7BA 3C5HA 4IFEA 4P31A 2DYKA 3U61B 3NHAA 2QBYA 1PLJA 4W5HA 4ZDWA 1IN7A 1II0A 4LPKA 1XP8A 3C16C 5EXSA 1A2BA 2FN4A 5AK0A 2YYZA 4B48A 2G3YA 2KB0A 1OPXA 1HE1C 3GLIA 4TQ9A 1JAIA 1GRQA 4KODA 4CEIA 1WA5A 4XWKA 4UXHA 1DAEA 5HPYB 1QHHB 3C5CA 2VP5A 3NBXX 2GKSA 4MGIR 1XX6A 1OXVA 4TSFD 3RSOA 5HR5A 3BERA 3UATA 5FL7D 1WDTA 2B8WA 3DMDA 1AS3A 3SYKA 3UANA 4V02A 3B5JA 4BFZA 1X1SA 5FTKA 1AS2A 4Q03A 1K6MA 1U9IC 4X8LA 1QHSA 2BMJA 1Q1EA 2IF2A 3QF4A 1U9IA 1WQ1R 1X86B 2VP6A 4PX9A 5AJWA 2W2TA 3QKUA 4EPYA 1X8KA 2PX0A 1Q57A 3WNDA 1VG8A 3UKDA 1GOTA 1S3GA 3PUVA 4P3YA 2G88A 2BCGY 1XZPA 2ZVQX 2F43B 2WV9A 1DEKA 4A15A 2CE2X 1TQDA 4GMXA 1M8PA 2WOOA 1B0UA 2FE4A 2J59A 4GBMA 4RZ2A 3CZPA 2V9PA 4AD8A 3HDTA 3ND8A 5JS8A 1P3JA 5C4GB 5JWHA 4Q1CA 1JPJA 2OT3B 1XDBA 2OLJA 4TZ6A 3Q7QA 3N70A 5FOWA 2FSGA 3I5XA 1ZP6A 4GOKA 4G5OA 4XSHA 2XOKA 1U90A 4UNRA 4GP7A 4D4JA 1TTTA 5KO2A 4DDWA 2QP9X 3A6PC 3C41J 1XWIA 5A4JA 2WSSA 3OFNA 4HZUA 1NVVR 1W48A 2G83A 2R65A 4PTLA 3IKJA 1KK2A 1UKZA 5FBLB 1R6BX 4P4SB 1N6NA 5IRCD 6Q21A 3KQUA 1EXMA 3CWZA 2JLWA 3CPJB 1NVVQ 3HU1A 3VR3A 3ND9A 2V3CC 2QQEA 1MR3F 3GLHB 2AWNA 4AYWA 3ADKA 3WRXC 3IO3A 1TUEA 2PMKA 1OFHA 1R8SA 1EG7A 5FPSA 3Q72A 2W0SA 3X2SA 4JBYA 2XXAA 2AKAB 2PCLA 1Q1ZA 3ZIAA 1XJQA 4M9QA 1DAIA 3TR0A 4A2PA 3RABA 2R44A 1Q1QA 2Q3MA 4MKIA 2QMEA 1FX0B 5CDFE 3D7MA 4M1TA 1CRPA 2Z83A 4N0EA 4X8OA 2BHRA 1Z2CA 3CRRA 2BKUA 5AUQA 4NYMR 1CU1A 4HEJA 2NGRA 4JIMA 3KJHA 4OQMA 1A5TA 1Z22A 1G8FA 3ETLA 5E4FA 1Z6YA 1N5IA 2ZRLA 2WZQA 2FZLA 1GWNA 2R6DA 3Q85A 2BC9A 3KTAB 4FINA 4B44A 4NYMQ 2A5JA 4LV5B 2XSZA 1KI8A 2PH1A 3IHWA 1ZUNB 4DXAA 2P0EA 1FP6A 5B57C 1GG2A 3AV0B 3F0TA 3GJ4A 1I4LD 1PUJA 2ZS7A 5BW8A 5JBQA 2YC2C 2GESA 4ITRC 3RS2A 4DT1A 5K8LA 3B82A 1S8FA 2FX3A 4PC6A 5K8TA 3ZQJA 5DI3B 5CYPA 4HAZA 1VYVA 4MKFA 5SZIA 2BV3A 1CP2A 3CRVA 2ZI3A 3WBJA 5GJBA 1MKYA 2C2HA 2WJIA 2FFHA 5KOYA 1XJCA 2YKGA 2EWWA 1SVIA 3QEOA 1X6VA 1BO6A 5TY0A 5K8IA 4BASA 1XD9A 1P2TA 4NP6A 3MWYW 1FTSA 2V6JA 5FTLA 1C1YA 1KI9A 4H1UA 3Q8XB 2VL7A 1G18A 2V4ZA 3I72A 3Q9LA 4G01B 3KQNA 1E69A 3ADBA 1FOEB 4G5SA 4GNKA 4HAVA 1ZD1A 4L5BA 3KJIA 1UEIA 1SZPA 3UWKA 2RGNC 3TR5A 4C0KA 5KSYA 5L3SB 4I99A 1CR0A 2RGNA 4QBHA 5H70A 4TSFA 1I4TD 1W0JA 4CEHB 3UG6A 3WP1B 1W36B 5DIFA 3I62A 5FL7A 3IEVA 4IXMA 1RYFA 3ECCA 1CBUA 4MKGA 2FMXA 4IDQA 4QJ3A 3U7HB 3QF7A 1ZIOA 2C95A 3GJ7A 4FWTA 4AI6A 4H1VA 4QJ5A 5ELXA 3MAAC 2GRJA 4MRSA 2P6NA 1XTIA 2DFTA 3ZVRA 2QPTA 3EPHA 3AP1A 2V7QA 4OJKA 2Q9BA 2W58A 1E2IA 1KK0A 2IYWA 3WYFA 2ASEA 3VQTA 2ZR7A 1E2LA 1A82A 3GLFA 2OBNA 1KJZA 1TQ4A 3NDBB 1UBFA 1E0JA 2NO6A 1XCGB 2O8EA 3VR1A 4LCBA 1OH7A 2ZE7A 5HKKD 3W6OA 1J70A 2CDNA 3CR8A 3PEUA 1HA3A 1GVNB 3IIKA 4QHTA 5EXTA 4B43A 2IT1A 2LKDA 1KIMA 4ZV4A 1FQKA 1G3QA 3GEEA 3PJRA 1G4UR 1NMYA 1Z6AA 4C3ZA 1XEFA 3FHOA 2ZPTX 2DY1A 4JT4A 4TYNA 5EQTA 4HLDA 1ANKA 4QG7A 2R6CA 1G64A 4DLYA 2O8FB 3W6PA 4W9MC 1KJYA 3CF0A 2IC5A 3JVVA 5FPKA 1L2TA 3PEWA 4RFSB 2P2LA 4L9SA 2PMDA 2ZSAA 5JI2E 1TF5A 1G5PA 2IWRA 4JT2A 4Q9IA 1XEXA 1R5NA 2GEDA 2IYRA 3FGNA 4CVNA 1FPMA 2PLFA 3DO6A 5F9HA 1R4AA 2JLRA 1KI3A 2ODBA 1LF5A 1T5LA 4PZYA 3OF5A 3CH4B 2RGAA 1Z0DA 4QHSA 2BWJA 4IHQA 4JLDA 5CJ2A 5FPHA 3B8HA 1NKTA 2P3SA 1E98A 3B1WA 1CJTC 3D31A 4UNQA 3W9YA 3CO5A 3EX7C 2MSDB 3Q3JB 2GJAA 5DHAA 2ZRGA 2BKEA 3T12A 2EW1A 1CRQA 4A0GA 1UBEA 3GLIE 4OQNA 4QBFA 2GVZC 1VCNA 1SXJB 1AA9A 2YWFA 4PSAA 1T4GA 2OSBA 2A5FA 3FHCB 1QHXA 4QNMA 2CL6X 4TL8A 4R9UC 1XEWY 4BRWA 4B76A 5A5GA 4MGYR 1E99A 4M4SA 3UMSA 4RKEA 2ZRDA 1JR6A 1LV7A 4M1WA 1UBCA 1OYWA 4YMVA 1RZ3A 3VKHA 1N2CE 1T0HB 2Z4SA 3QKRA 3EWAA 2R9VA 1M7HA 3SYLA 3TMKA 1AM4D 1KO5A 1RVDA 2D7CA 4TMXA 3EASA 1G21E 2HJVA 4M1OA 4D26A 1ZC3A 3IGFA 4QGAA 3ZJYA 5TDHA 3W5IA 4EUNA 1HT2E 1YZUA 3L2OB 1E2JA 1W2GA 1GTVA 1AIPA 4B6FA 2UVQA 3ZZTA 2GHIA 3GD7A 4UNSA 3B1ZA 2J0VA 2OAP1 2HCBA 3AH8A 4DHEA 3NBFA 4ZCMA 4NE2A 1YRBA 5DGXA 1IONA 1E2MA 3L8ZA 1RRGA 1L8QA 3A8TA 2REBA 3PV0A 4Q7JB 4O3MA 1G4AE 4JMPA 1GL7A 1HT1E 3ZVMA 3HR8A 1TEXA 2DWQA 2IYQA 3BRWD 3BE4A 4L4UA 3LLUA 2GXUA 3MJRA 3K8YA 2PZEA 3GEHA 4AG6A 3SBEA 4M8NE 4A6XA 4I1SA 2HT1A 4NCHA 1M1YE 3DOFA 1YVDA 1BIFA 2EFCB 3DZ8A 1Q21A 1Z28A 3VKGA 4AYXA 5KNBA 2OESA 4D6PA 3VNVA 4ZCIA 3VFDA 3U6KA 1N6HA 2FG5A 4JKYA 3U3OA 5HZKA 2QAGB 3C8UA 2VSXA 4B71A 1KHTA 1OH8A 2P6RA 3AP3A 1W4AA 2XB4A 4AKGA 4GP6A 1EFCA 4AKEA 1CJVC 3QY0A 3K70B 3SDZA 3X1ZA 1Z6TA 4AK9A 3CW2A 4HDOB 2WJJA 1R0YA 3PVSA 2H92A 3X1XA 4D25A 2NO1A 3U3RA 5JJKA 2QRZA 2HV8A 2NPIA 5CB8A 621PA 3EPKA 5HKKA 2Z43A 1DAFA 3QXCA 4ZDIA 3ASYA 2PJRA 3LBIA 1ELOA 2GK6A 2G1KA 4E03A 1OIVA 1ONBA 2ZRPA 2HT6A 2NQ2C 4C9BA 1MH1A 4US2R 2CJWA 2IS1A 5CK5A 3THXA 5AUPB 3VTKA 3MLEA 3PUWA 3PITA 1P5ZB 4ASUD 2FZ4A 5FTNA 2J0UA 3T34A 4MKHA 1R5BA 2YOGA 1IM2A 4URWR 3X1YA 4ZI3A 2AKYA 5H8WA 4ZIRB 3LA6A 1DAMA 4OQFA 3X1DA 1KMHA 1W4CA 2OEPA 4C0BA 1P75A 5LD2C 3ICEA 1OH6A 2W83A 1JEDA 2A5GA 2RGGA 4GOJA 2V54A 3ZD6A 4DB2A 2F9MA 2WBLC 2BMEA 1FW6A 4XVRA 1KI6B 3OAAD 2JGNA 2GCOA 3MWJA 1OT3A 1NJGA 3SN6A 3W8RA 5C46F 4JYBA 2EWVA 2IYZA 2JJ2D 4HATA 5CYOA 5FBRB 4XVUA 3FB4A 4XTRA 2QUZA 1T3HA 2AK3A 2IYXA 1RRPA 2ZREA 5KU1A 3TBKA 5M04A 3IIMA 2WM9B 4FN5A 5FFMA 2HJGA 1NVWQ 1E2EA 2VRWA 1MRNA 1LF0A 4Q4AA 4LUCA 1IHUA 2LWIA 3MCAA 3S1AA 1SQ5A 1XD2A 3K1JA 4YDHB 3OIVA 2YWGA 4RZ3A 3P4XA 2QTFA 3NEYA 1H65A 3TUZC 2JJ1D 4XWAA 2OCYC 3GFTA 4BLSA 1MRSA 4PHGA 2O8CA 2CMKA 2CNWD 3I92A 1KAGA 5KPJA 8OHMA 4Q1BA 1Z06A 3TVDA 4EPWA 1ZAKA 2FOLA 1CKEA 4Q4HA 4URYR 1ZM2A 2QGZA 4YC7A 1H8HA 1N5JA 1GSIA 1ZIPA 4US0R 4DSNA 5ANRB 3LVRE 3NBZC 3AKEA 2QM7A 4L15A 1BYIA 4OBEA 4D80A 3AVYA 4OI2A 1ZCAA 2YNMA 3GLFE 2O8BA 3Q7PA 1DARA 3C7KA 4PAOA 4JBWA 3THYB 2Z6VA 1EX6A 1XCPA 2Z4RA 4Q9HA 2NPFA 1RJ9B 2QU8A 3RNLA 2C9YA 4WA7A 2QNRA 4BFSA 1DADA 4Z8XA 4I81A 5AUOB 4JSTA 5HCIA 4Q1FA 4GRAA 3U6BA 2GJ8A 1G20E 4OI4A 3T61A 1ZM7A 5UKDA 1RPZA 2ZI4A 3V4RA 4C30A 2CHVA 2FJUA 2ORIA 4JVNA 2ZIAA 4MRRA 2TMKA 2ZXUA 4B47A 1NN3A 2ZRKA 2QPAA 2DWPA 3AUYA 5CDFA 5P21A 4FWIB 2H8KA 2GJKA 1OKKD 5CM8B 4D4MA 4QM7A 4I1UA 5CB6A 3VR4A 2V1UA 1E2DA 1WBBA 3OEHD 4D0GA 1XRJA 2IX3A 4G5GA 3W34A 4B2LA 4CGZA 3QQ5A 4JBXA 1ZYUA 1OIXA 3SJAA 4HUTA 4NPHA 5TVKA 2FH5B 3IBGA 4FMBB 1ESNA 4EQ6A 1E4YA 2AXNA 5EP1A 3SJZA 4PAMA 2UKDA 1MABA 2ONKA 2WIAA 1CTQA 1XTJA 2X2EA 4MYHA 3SEAA 421PA 2HYIC 3UMRA 2ZJ8A 4B3CA 2CLCX 4EJSA 1IBRA 4F7WA 4NKRA 4TL7A 1XZQA 4KLNA 2QGNA 1DE0A 3THOA 3DZDA 3UXMA 1U2RA 1HH4A 2AFHE 4YDSA 1UFQA 5FPTA 4I4LA 4TMVA 1UM8A 4FMCF 4G3XA 1WXQA 5D3MA 4LHYA 1NSTA 2OCPA 2WWFA 3GPLA 2N1BA 3C15C 1US8A 4QGFA 1DG3A 4AKIA 4CZ2A 1E9DA 4IDPA 3WYAA 4IEEA 4YONB 3K0AA 4DRZA 4PQFA 3QUSA 3A1UA 3SJBA 3CZQA 1JAHA 1Z0KA 2A2ZA 2GBLC 4LHZA 4RD3A 4EAQA 1IN8A 4G5RA 3BK7A 3IIJA 2GBLA 3PR1A 1Q12A 1AKEA 2ZS8A 4ASUA 2Q0HA 4OK3A 1UPTA 2YINC 4Q48A 5HE8A 2WAYA 2GF9A 3BB1A 3QPVA 4LYAA 2VHCA 4FCVA 5IHPA 3FMFA 1GILA 2D2EA 3NDPA 1NSFA 4PHFA 5DE3A 3W3ZB 3KDSE 4P32A 1Z8FA 1ZINA 4KVGA 2WKRA 2H16A 1Q3HA 1QHHA 3A4LA 2IYYA 1XB2A 1Y63A 3BB4A 3OAAA 5CM9C 2O0HA 3WY9A 2FSFA 5DN6D 1W36D 1SVKA 3O8DA 4BWYA 2JJ2A 2XTMA 2VHTA 1YQTA 3T06B 1HQYE 4S35A 1VYTA 4PO8A 1U94A 4UQOA 3GQBA 2I4IA 4V0KA 2B8TA 4XD7D 2QROA 3MFYA 5E3HA 4RD4A 1SVOA 1P7CA 2FEOA 2B7CA 2IXEA 5AWFC 3V4FA 1TEVA 2W6JD 4DIEA 3DKPA 4FCTA 3B9PA 1OE0A 1KAOA 2QMUA 4O25A 2IYTA 4I1VA 4M9SA 2FNAA 521PA 4PANA 4HLCA 5JHHB 4Q4LA 3HR7A 1KO7A 2NIPA 2JJ1A 4DCVA 1UJ2A 1A1VA 1KJWA 4B34A 5CK4A 4DLZA 2CNWA 2ZJYA 3T35A 2MSEB 3REFA 1QHIA 1G8YA 4HAYA 1VTKA 4MITA 3VAAA 4EFNA 1P73A 5E95A 4C0SA 1IQPA 1G41A 2PLRA 4PR0A 1YZLA 4WW0A 4B6EA 2V8OA 1G16A 1HEIA 2P6UA 3K0FB 1E9SA 1G7RA 3OZXA 3BC1A 3SI7A 3MUFA 3R20A 3W3AA 1T3SA 1YJ5A 3I4LA 3TAUA 1FUKA 2A5DA 4ESVA 2VEDA 3CNLA 2JIZD 3G82C 5FOXA 2JDID 2BMDA 4PZLA 4DKXA 1H8ED 4AWXA 1OV4A 3RWMB 2AL7A 2YV5A 3H84A 1ETUA 2XZOA 1C4OA 1Z47A 3U5ZB 3D3QA 1CR2A 1OKKA 3KQLA 4NCKA 5EUQB 2ODNA 2DB3A 1J99A 4KFUA 2LCFA 2NO7A 1GRRA 4RD1A 1KSFX 1W4RA 2X8AA 3QJYA 4HAUA 2QL6A 1RKBA 2ZE6A 4KV9A 4OKSA 3KQHA 4D2IA 2JA1A 3BFKA 4JLJA 1G9XA 1KDPA 1RW4A 1SXJD 1HTWA 4KBFA 5DSZA 2O8DA 1NMXA 5JRZA 4C0LA 2IUUA 4QBIA 4TQUS 1S0UA 1OFUX 4CYMA 1F48A 4OI1A 4DUGA 1D5CA 2CCJA 4EPVA 2J7PD 3LVQE 3MRSA 4KI0A 3L82B 2EQBA 2AXPA 3WBKA 1E9AA 1KI7A 4LGMA 1EGAA 1FL9A 1Z0FA 1Q20A 5DI3A 1PV4A 4CEJB 4ILEA 1KDOA 4BRUA 2ZAOA 3LY5A 3TUJC 3QPUA 4F4CA 4M1MA 2ZRAA 2XX3A 3CBQA 3HWSA 3FMOB 5JRJA 1UKEA 2MMCA 3NWJA 4AY2A 2CXXA 5J47A 5IK2D 5JCZA 3ZLJA 4LK2A 3VU9A 1EWRA 5TMPA 1S9HA 4IDOA 3AP2A 1K8RA 4HUQB 3WRYC 2H57A 1U81A 2BDTA 3AF4A 5AJXA 4AURA 1JALA 2HF8A 3QE0A 2R6AA 3QKSA 1ZUHA 4E07A 3NH6A 2F9LA 3SQXA 3KL4A 1ZJ6A 4IOMA 4B32A 3CR7A 2WIBA 1E6CA 4TYPA 3KFXA 2XJ9A 3KB1A 3H0KA 4DSUA 2AN9A 4IW3B 2G77B 5L3SA 2CHQA 3GJ6A 1W36C 1G291 5L3QB 2RCNA 1AN0A 4LJAA 3JZMA 5DN6A 1E79D 5AJYA 2QQ0A 3CF6R 5FTMA 1M2OB 4HYYA 2NZ8A 2D2FA 3R8CA 2NMVA 1FMJA 4ZKEA 4QM6A 3QVUA 1XXHB 1QF9A 4XD7A 1E2NA 1NMZA 3VMFA 4WIAA 1W5TA 1JB1A 1R7RA 4E22A 1J8YF 4DEXA 2RKOA 4IEIA 4B3BA 4OHXA 2C96A 2W6JA 4FCWA 2FA9A 1GKYA 2AK2A 3NC1C 4HB4A 2Q3HA 5KNCA 2ZQ5A 2IUSA 2FPLA 3K0CC 2BEKA 4M0LA 1SVWA 4O2LA 4KITB 1N5KA 3FFBA 4LPSA 1NVXQ 1YZKA 3K0CA 1FTNA 4UXIA 2OE2A 4L8GA 1ZMXA 2BMFA 1NP6A 4NYIR 2GDJA 4UJ5A 2HF9A 2ZANA 4C0JA 4II7A 4JZKA 3RS7A 3ZS8A 4EFLA 3A1SA 3W6NA 4A36A 4NYIQ 2JLXA 3PQCA 1XPRA 4KSCA 4OHVA 1DAGA 2KBEA 2RMKA 2CLSA 2BBSA 4XVQA 4CEIB 3SYNA 5FUXA 2LKCA 4DLVA 2ZJ2A 4RFSA 3DPUA 4A82A 3GJ5A 1TNDA 2ODEA 2E9SA 4IRUB 2JDIA 1H8EA 2QY9A 2JLVA 3HPRA 1A2KC 4ERNA 4FW9A 1ZRHA 3L43A 1QHGA 4Q4JB 4ZO4A 3BFXA 4GMDA 1XF9A 2DWOA 3QF4B 4J0QA 3MG9A 1E1QD 3CRQA 5IF9A 3CM0A 3B7GA 4NHOA 2OCAA 4LYFA 4WBSA 1KMQA 2L0XA 1FNNA 2H7VA 2VP0A 2VO1A 2PCJA 3AKYA 4KFSA 3LBHA 3HP1A 4YMSA 4FMDF 4B3DA 5CLLA 3AGPA 4L9WA 3AF0A 2JATA 2ZSEA 4QL3A 4TYWA 3O8BA 4PPFA 1G8PA 1KZ7B 1SXJC 2R2AA 1YE8A 3NG1A 5C1BA 4Y0AA 2OO7A 2IYLD 4F38A 1Z0IA 1E96A 4URUR 4AKHA 2RGCA 4Q9LA 1N6KA 2ZEJA 4PSVA 3RSLA 2A5YB 3P26A 1CJUC 2AWOA 4PXAA 1G7SA 5J4KA 2B7BA 2GF0A 1UDXA 4HZUB 1N0VC 3BXZA 1T8UA 3DVLA 1VG1A 4KHZA 1OXTA 4YQFA 3RVBA 2J7PA 3LXRA 2OLKA 1XPUA 2OCBA 4QRHA 2ZRNA 5F9FA 3N2IA 1ZNYA 4W5JA 4Q7LA 1A4RA 2DR3A 3EARA 4US1R 3HJNA 2WWHA 2XITA 2ZROA 2ZUBA 4S2EA 1FFHA 5JCPA 1E32A 1XMIA 1T6NA 1T91A 2GEUA 4PPGA 4R71A 1COWD 2XXAB 4BFXA 5IK2A 3FE2A 1KTVA 3DDCA 5EP2A 3BH6A 2G9NA 1TUIA 3P20A 4FXPA 5TARA 4LYHA 3K9GA 5G40A 4K81B 2QP3A 4PQRA 1M6NA 2GCNA 2O52A 1TADA 2W2XA 3WP0A 3X1WA 4KAXA 1SVMA 4BZPA 1QDEA 1P2UA 4CRWB 5KPDA 1WP9A 3U3KA 5JFGA 3GJ0A 1EFHA 1GUAA 4XIGS 5DISB 1I4DD 2IYSA 3T1TA 4JLAA 4XWOA 1S3SA 2VLIA 1BKDR 3CX6A 4KXFB 1BS1A 1F2TA 4PC3A 1E0KA 3GJXC 3B60A 2EFGA 2ZE8A 4M2LA 3FVQA 1P9NA 1E79A 4BFWA 3GLHE 5JEDA 121PA 1EESA 4DLWA 1M7GA 4Y0VA 2GJSA 1YHNA 1DELA 3ZZ0A 1KK1A 2IUTA 2QAGC 3AVTA 1XMJA 2H18A 5DLQC 2QI9C 1AQYA 2I3BA 2QAGA 1GM5A 3RS3A 3HYTA 2GILA 3TUIC 3B1YA 3A1VA 4BQSA 3T1OA 3MJHA 4HDQB 1ZC4A 3UMFA 4PHHA 1KSJA 1RFLA 821PA 3ICQB 2HYDA 2KSQA 1PZNA 3I5YA 1TPZA 3LWNA 1W49A 1J2JA 5DO9A 3UPUA 1Z6XA 1F2UB 1DG1G 4I1OA 1JPNA 4MRVA 1Z0JA 2QSYA 2B6HA 4GT1A 4F4JA 4HSEA 5TV2A 4DLTA 4C7OB 1NIJA 1G19A 2F3RA 1XFAA 2G0TA 5B30A 1L4UA 1G3UA 4QC2A 2XZLA 2Q9AA 3M6AA 4Q5IA 3GJ3A 1SKQA 3LD9A 3J81k 4V0LA 4ZIRA 4RY2A 5LBIA 1NL3A 2C98A 1VYUA 1XNJA 4Z1MD 4OL0A 221PA 4Q21A 1G7TA 5FOVA 1T0JB 4JS0A 3TNFA 4LC1A 3FTQA 4LYJA 2R62A 4LV8B 3IPYA 3GJ8A 3U2QA 5JLJA 1KI6A 5J4YA 3SFZA 3L0PA 1YKSA 2FPKA 3HU2A 5AJVB 1Q1BA 1P2SA 1E1QA 1G3MA 1S96A 2BM1A 2D06A 2J7KA 3K0EA 1TAGA 5SZHB 2GEVA 4TLAA 1N0WA 1PJRA 3M1IA 1NY5A 3AKCA 3QENA 3FHTA 3H4MA 3IEUA 2J0QA 4GDFA 2FPMA 5FBQB 1W5SA 3AVUA 2W2VA 3G5UA 1LTQA 3A1TA 4NTZA 3UWOA 2O8EB 1AZTA 1SKYB 2GXAA 2PT5A 3OHMA 1WBDA 2E1RA 1I2MA 1XMVA 5LB4A 3SQWA 1CLUA 5EUMA 3SE0A 1NBMD 3DKVA 3AVWA 1UBGA 2ECKA 1T3LA 3L8YA 4BLPA 3SS8A 1HUQA 1ZM4A 2FSIA 1E9CA 2WKQA 4BZXA 4DDTA 4NL4H 4OK6A 5FOTA 3R7WB 2A30A 5EXXA 4ZCLA 2NG1A 3E5HA 4PFSA 5DH9A 4RZUA 4OJQA 2P65A 4YMTA 1E2HA 2ZVPX 4ACAA 3BD9A 1XEXB 2CCGA 1EFUA 1NF3A 2OFXA 1IY0A 1KYIA 1NVUQ 3ADDA 3REGA 3THYA 1M74A 2CL0X 3UG7A 2FFAA 1Z5ZA 1GP2A 3B1VA 1COWA 1RJ9A 5JS7A 3PUZA 4LBYA 4MQBA 1Y3AA 2CE7A 5H1YA 3LH5A 3R9WA 4ARZB 1Z0AA 2EFEB 1XTQA 3LBNA 2ZJ5A 4LJ6A 3CB4A 1W47A 2VIIA 3TGPA 3G0HA 1IJFA 3F8TA 5TB5A 2Q6TA 3CX8A 3RS4A 1FNMA 1JQLB 1VCMA 1V43A 3PUXA 2Q9CA 3LX5A 2VH5R 2XTZA 4FMCB 1OF1A 5CJPA 4B3XA 3IPXA 4C0AC 1YU9A 5DNYB 1R0ZA 3QBTA 4UNPA 1G1MA 4LV6A 5BN4A 5GVSA 3KKMA 4K46A 1XCMA 1UEJA 4JLPA 1IN5A 4WZAE 3RC8A 4A8JB 2K5UA 5AJZA 2BVNA 5KSOA 4DLXA 3KZ1E 2J9RA 2ZYTX 3MWKA 3CH5A 1VIAA 1R0WA 2G6BA 5HE9A 5FH9A 2ATXA 3AVPA 3KXIA 1OXSC 1XTSA 5B58C 2ZI7A 1GL9B 4H9GA 3VX3A 3GLGB 2ZJAA 4BFUA 3V9PA 2OFWA 2WOJA 1OXXK 5EZ6B 3QBVA 4P4UA 1DTSA 4MGKR 2E87A 1VCOA 1GNRA 5BXQC 1IN4A 1IY2A 1SXJE 5LB2A 4TTPA 4MA4A 4Q18A 4ZDKA 3AVOA 3FKQA 1FP7A 3BS4A 3V00A 3KUDA 2GZDA 3RRNA 3DEFA 2WWYA 2WTUA 2D7DA 2BBWA 3E2IA 5E7IA 1YZTA 2VSOA 1RC8A 3U44A 2CEAA 4U02A 2NO0A 3TSOA 4PO9A 2G1JA 3BH7A 1KOFA 1E2KA 2REOA 1QRAA 4NCIA 1NN0A 2XAUA 4B75A 1KZGB 5LDDC 2MSCB 4LJ4A 3TJZA 4HB0A 3OEED 3VNUA 2QG6A 4Z1MA 3A37A 1DAKA 4MRPA 4Q7KA 1F5NA 3AUXA 2J3EA 2A9KA 4JLOA 2ZETA 2KWIA 3WMFA 4IFBA 3PENA 2IYUA 1E2GA 2WICA 1CXZA 4JLMA 1XU4A 3AEZA 1UDWA 3EXAA 2X77A 3I61A 5JJIA 4EFMA 1XPOA 1LVGA 3NXSA 1DS6A 1VG9B 4CT4B 2OM2A 4Z54A 1KY2A 3KXLA 1NLFA 3IHLA 4Q01A 5DYGA 3BAFA 1W0KD 4WOPA 3T5DA 2I1QA 1Z2AA 4WVFA 4A2QA 3DL0A 4RFVA 4AG5A 5C4MA 3ZVLA 1P4SA 4C2UA 1M34E 2ZRBA 3THWA 2J5XA 2VQSA 4IVPA 1XTRA 1EFRD 2ZSBA 4EIWA 2QENA 1P2VA 5FUWA 2ATVA 2ZU0C 4XOIA 4OHZA 1E2QA 3NH9A 2R6GA 4NBSA 5FR2A 1E2PA 4DCUA 3THXB 2IS4A 4B35A 5HCNA 3K9HA 4C2TA 1U8YA 5E7MA 2QA5A 1ZM9A 3RRZA 3RLFA 4ACBA 1KI1A 1CULC 4LJ5A 1T8TA 3A4MA 2ORVA 5J4LA 4DDVA 3QVVA 5KSZA 1SHZA 1YZQA 4V0MA 5GJWC 4B3FX 4BLTA 4X8MA 4QFMA 1CR1A 2DFLA 1G6OA 5B2ZA 3FOZA 1E1RD 2OBLA 5LD2B 2VHQA 2A3RA 5CIQA 4M9XA 1U0HC 2BCJQ 2ZAMA 4JYCA 3KFVA 3W5JA 2ZI5A 3ZVNA 2GCOB 1KK3A 3QPWA 4MH0R 4DSTA 3ADCA 4QHYA 3EPLA 1QHYA 2FGJA 5EXPA 5G41A 5BYKA 1TU3A 4KSBA 3H86A 4CT5A 1CS4C 1ZD9A 3QG5A 2QN6A 4HI0E 3EAQA 1NRJB 1EFTA 2C77A 3QSYA 3SHWA 1SHKA 5J4HA 4GL2A 5FOUA 1Z08A 5JJLA 1AQUA 4M53A 1T9HA 1TMKA 3TW8B 1LNZA 2IHYA 4M22A 1F6BA 1P6XA 3U4QB 1XD2B 3CRW1 4LSGA 1JJVA 1DPFA 2OXCA 1QG4A 4YLGA 2YJTD 1DO2A 3KX2A 4N0DA 2GNOA 2R8RA 4JL6A 4GI7A 4TN1A 2O8CB 2ZJZA 5FUVA 2EVWX 3BOSA 4A92A 1ZBDA 2C9CA 2GETA 4LJ7A 5FR1A 2BBOA 3L0SA 4PC2A 1JJ7A 4Q4HB 3GFOA 5JI3E 3OFND 4JL5A 1P61B 4TMWA 2REXB 3EZ2A 2YHSA 2P5SA 2OUKA 4JLNA 1OJLA 4GOXA 5D3QA 1GITA 4K8OA 2O8BB 4O2RA 4DVGA 4KYIB 3SFVA 2F43A 5BN3A 1N6IA 4DC9A 4CEJA 4UJ3A 3P4YA 1U8AA 4A2WA 4LJ8A 4HZIA 4E09A 3KB2A 5BN5A 3O8RA 1AJEA 4HDCA 4LRWA 1JEEA 4WZBE 3N5CA 2F1JA 5GADl 3EZ9A 5FI0B 4MDEA 1MO4A 2ANBA 2IA5A 4HUQA 1GZSA 1XMSA 4ON9A 3CPHA 3IBYA 4TTRA 3O47A 3OEEA 2XTNA 4MUBA 4KLZA 2O5VA 3KUCA 4P4SA 4QGGA 4TL6A 2QT0A 4GZLA 3EZ6A 1VCIA 1DAHA 4DLUA 5E7JA 1ZCBA 3EC1A 4EQ6B 2IXFA 4UNNA 3I8SA 5FBVB 1GIAA 3AGQA 2RB4A 3GLHA 2DHRA 4OYHA 4TLEA 5L3QA 2DFNA 4LZZA 3TSWA 4LHXA 4EJSB 4GFDA 3TKLA 2IS6A 4POAA 3BJIC 5CIWA 2JASA 3LRPA 5A0FA 2H17A 1W0KA 4NMMA 5KYKA 1YR6A 3EIQA 3KKNA 2GAAA 3WMEA 1CR4A 1KI4A 1FX0A 3RWOA 1UKYA 2WAXA 1KO8A 3OEHA 1EFRA 1GNQA 1Z83A 4DLSA 2HUPA 3K09C 1Z29A 3AF1A 1BH2A 1NI3A 3TE6A 4GPTA 3K09A 3KTAA 3TH5A 2GK7A 2VP4A 4OHYA 2KE5A 1MO5A 2JJ8A 1P60A 1FMLA 1DOAA 1QHNA 4RSGA 4EDHA 1HV8A 3K9NA 1W4BA 4UXJA 5SZKB 1KDRA 1K5DA 4XJXA 4DBLC 2AD1A 1R2QA 4FMDB 1UAAA 3BORA 2NZJA 1E1RA 3IO5A 4PAQA 3C14C 2C9OA 4TLDA 4A0FA 1EWQA 2ZRIA 3OESA 4HB2A 2FU5C 5H68A 1E4VA 2RGEA 5BYJA 3SNHA 2D62A 4OK5A 4B2PA 1OW3B 1E0AA 1OFIA 2P67A 1G5RA 1GFIA 1AK2A 1MT0A 1W0JD 2QM8A 3U3JA 1MV5A 4BECA 4JL8A 2CVFA 4V0OA 4NH0A 2XEXA 1R10A 1W46A 2C04A 2C03A 2J87A 2V55B 1IAQA 3ASZA 4LY6A 4BLRA 4C0QC 2KBFA 4Q4JA 2FGKA 1QZXA 3B9QA 2KJQA 2C8VA 3OE7D 4RVCA 2DPXA 3EA5A 3VR2A 1VIYA 2AD5A 2YZ2A 5J4VA 1AGRA 4LJYA 1KO4A 2F55A 2CBZA 2W0MA 4MGZR 2RAPA 3TAHA 1VPLA 2V7QD 2QRNA 5L8VA 2GAOA 4P33A 1G17A 3RRYA 2GCPA 2JCSA 1L7VC 2QSZA 4OQLA 1II8B 4Q1EA 4YXWD 4EKDA 4R98A 1VMAA 3WHLA 2GVDC 1OXUA 2HCJB 5JSZB 4TQAA 3AVVA 3QXXA 3PG5A 4DCNA 4CEHA 1HYQA 1T5IA 4FIDA 4R2IA 4MUAA 4JLBA 2ONJA 1AGPA 2X2FA 3B78A 4R7ZA 2H5EA 1ZUIA 3MMPA 3NKVA 4PZZA 3I73A 2EYQA 3EWSA 2D4HA 5C2JB 1G3RA 1JI0A 4W5WA 2GXSA 4DCTA 4IKEA 3PFIA 4IXNA 4GZMA 3LW7A 5AR1A 2ZR9A 5C18A 2WMOB 3TQCA 4KVAA 3K70D 1WF3A 4B3GA 2A78A 1D2EA 4KFRA 1LFDB 1OYYA 2F6RA 2HLDD 2JLSA 3RS0A 3NHBA 3OIWA 1RE0A 1HY3A 3K0SA 3CLVA 2ZRFA 1NBME 4WZ6A 4BGDA 2R6FA 2VA8A 3GEIA 1I2DA 2VBCA 3PEVA 4Q9KA 2G0NA 1GL6A 4URVR 1OFTA 2EU8A 3B85A 3K53A 3TSZA 4AYTA 2QBYB 1JECA 5GJVC 4F91B 1LS1A 2VP2A 1C9KA 4NZYA 4U7DA 1NY6A 5JWOA 1MO6A 2ERYA 2IF0A 1KNXA 1D9ZA 5B64A 2GA8A 3M4YA 3SR0A 4TYYA 2AX4A 5EJEA 2HDNB 2OV2A 3QEJA 3BGWA 4Q1DA 3GLIB 4V0ME 1YRAA 3H1TA 4XH9B 2VF8A 1JXMA 2RGDA 1TL7C 4D4LA 2O8FA 5JEEA 1MOZA 3UK6A 5BWMA 4B2IA 1U99A 1AS0A 2I1VB 2O8DB 4HB3A 2JIZA 5EE1A 1GDDA 3U60B 4M9ZA 3CRMA 4OHWA 3HYRA 4M1YA 1S4QA 4MYCA 3DHWC 2WSMA 1KSHA 5KHOC 4Q1AA 5EP4A 1KDTA 4JLKA 4XTCS 4EPTA 3TW4A 3AQ4A 3IILA 3SZRA 2W6ID 4TYQA 1JR3D 1LW7A 1XD8A 1YR7A 3CNOA 2BOVA 3KXKA 4O0MA 1X8LA 4LI0A 2JAQA 5G53C 3AF2A 2QT1A 3WXMA 4Q02A 3SOPA 4G0NA 1E9BA 4Z8YA 1QG2A 5F98A 3R8FA 1Z07A 2BEJA 1SXJA 3QNUA 1N5LA 2IW3A 4LJ9A 1F2UA 2EFDB 5EE5B 4JVLA 5KUTA 2ZR0A 3VU9B 3QXJA 1RIFA 1IN6A 1NNEA 3O8CA 4V0NA 1D6JA 2QPOA 2JEOA 2OBMA 1DO0A 2IEZA 1IXSB 1F60A 1ZNZA 1IXZA 3TIFA 2HXSA 3ONWA 4C7OA 3QKSB 4WAUA 1VHTA 2WHXA 4QKQA 2BBTA 4A4DA 1MO3A 3LX8A 4L16A 3JZAA 2IYVA 3NC0C 5J5CA 2XGJA 4IOLA 2AHOA 1WRBA 2QE7D 4QNRA 4LOAA 4A0RA 1NJFA 1UADA 2F1RA 1IY1A 1OHHD 3Q5EA 2B92A 2Y8EA 4LDJA 1NN5A 4P0TA 3SBDA 1V5WA 4WXPA 4LC0A 2YWHA 2IEYA 4CW7A 5FPYA 4ESHA 5G3YA 1JQJC 4TMKA 3F5FA 4RCZA 3E1SA 2RHMA 3OE7A 2ZUCA 4A0HA 3RYTC 4TT3D 2F7SA 4F92B 1E0SA 4ABYA 2ORWA 4NONA 4F93B 2MMGA 3EIEA 1NLYA 1AKYA 1AZSC 1E9RA 5FOSA 1II9A 4YXWA 2ZS9A 1Z6GA 2VSFA 3B2EA 2W00A 3VHXA 3IDQA 2ZU6A 2C5LA 1D8TA 1QVAA 2PX3A 4DLRA 3CUEF 3AVQA 3BH0A 3IQWA 4R2HA 4TLBA 4TL9A 2JLUA 3I3SR 1OIWA 3KJEA 4JJZA 2WJVA 4BZQA 1XTKA 5FUYA 5LPNA 2NO9A 5KTYA 1CJMA 1E94E 5FI1B 1WCV1 4RD0A 1XXHE 3MD0A 4DT1B 1FUUA 3R7WA 4EPXA 4W7SA 4JVSB 1ZU4A 3U7GA 4N1AA 3EC2A 3K70C 1Z63A 1D2NA 1ZNWA 2XJ4A 3C4JA 1ZU5A 4DSOA 3SHFA 2B21A 4B73A 2GZHA 3FKSD 1E3MA 1S1CA 4D81A 2HLDA 2JLZA 2WWWA 2GJ9A 4FD2A 1UKVY 4IJMA 3LXXA 4PPNA 4KU4A 4D0NA 4ZKDA 3UIEA 2QMHA 2ZI6A 3DOEA 2JLYA 4LBZA 4EPRA 3K9LA 1KY3A 3IQXA 5EP3A 3T5GA 4ARZA 3FFAA 3LLMA 2C99A 1G8HA 1GAJA 4D0LB 1D2MA 1LB1B 2XNDD 3BIFA 4JVMA 4M21A 4PPQA 2WJHA 3A58B 1E2FA 4JSYA 1HQCA 5TXGA 1OB2A 2WWGA 1TF2A 3U7EB 2QTVB 2VPPA 1YZGA 5IT5A 3I1FA 3RRMA 2YC4C 3U7FB 5EE0A 4JKIA 3QKTA 4A8JC 5CITA 5FL3A 1JXOA 4A8JA 1LS6A 2VTKA 2EFHB 2YWEA 4ZDJA 1S2MA 4G1UC 1P9WA 4UKDA 2J41A 1YR9A 2Q21A 3FMPB 3LAWA 2ODWA 3WNBA 2ERXA 3NTUA 2VHUA 2W6IA 3L0OA 4AC9A 1JR3A 4PO1A 1H8HD 5DYIA 2CVHA 3B6EA 2GZAA 5J40A 1N6OA 2VYFA 2EYUA 4YMWA 3GLGA 3GLFB 1SVSA 5FTJA 5KNDA 2J1LA 1O87A 3CF2A 4PC7A 3WNCA 2Q3FA 2P5TB 4NCJA 4HAWA 3D8BA 4LHVA 4NCNA 5AUNB 2RGXA 2IL1A 1N3BA 3HPQA 2PZFA 1P9RA 2V6IA 4BUJA 5F2EA 2KI5A 3ZZUA 4RD2A 2J46A 1W2HA 2OFOA 2ZSFA 2RH5A 3CIOA 2IWHA 2VHJA 2IK8A 5HZHA 3TK1A 1RRFA 3B13B 1FZQA 4TTQA 2UZIR 3QIAA 1XJ0A 1F2TB 2PZGA 1YZNA 2QE7A 2FSHA 2YOHA 4P4TA 4KJZA 3T1QA 1OHHA 4DJTA 3CKLA 2ZRJA 4ZPXA 3SU8A 4BEBA 2D74A 1BMFD 1N6PA 1WMSA 4Q47A 2QZ4A 4BFTA 1XEWX 1GRNA 2WJYA 4TLCA 5EE3A 2NTYC 3RAPR 1E9EA 2H1LA 3QG1A 3LNCA 2CK3D 4FI3C 1TQ6A 4TZ0A 3L0IB 1TF7A 2X1VA 2Z5FA 4TT3A 2D3WA 2IS2A 4XSGA 3GCGA 3RC3A 2N46A 4PC1A 4X8HA 1YR8A 4RZXA 1SGWA 2SHKA 1W44A 5K8UA 3F3YA 4IDHA 2CHGA 2GXQA 2ZE5A 2C78A 2OILA 2ZITA 1S9DA 4KO8A 3KQKA 2A7QA 2JLQA 1GKIA 1DVRA 1GKUB 1N6RA 1OLOA 1Q0UA 1K5GA 1U8ZA 2WKPA 1VHLA 4IDNA 4D4KA 4BFVA 2DBYA 2CCKA 1VECA 2AFIE 1PVOA 2OZEA 3PCRB 3HU3A 3ZD7A 2Z0MA 3WYGA 5DI9A 3QKRB 3D6TB 4QXAA 2PEYA 2ZRHA 2ZJBA 2BIFA 2PEZA 3ZDQA 2ZRCA 3EA0A 3LFUA 4QJ4A 1KI2A 3FKSA 4M1KA 3VX4A 4A1FA 4HLUC 3ZYCA 3T1VA 1ODFA 4V03A 5BQ5A 3T15A 3EZ7A 4HLUA 2BJWA 5EE9A 4PSKA 3U3MA 3WMGA 3ZGXA 3WHKA 2QMOA 2VP9A 1O3YA 4IOKA 3NEJA 1Z3IX 4IVRA 3NIBA 1P72A 1EX7A 4DEYA 4DWJA 2PJZA 1PLKA 3TVTA 4URXR 5GVRA 2ZSDA 2ZYWX 1L4YA 1JBKA 1ZM3A 3FMIA 1FQJA 3CPEA 5KDLA 2AR7A 4C0HA 3MSXA 4TWZA 1F3OA 2XNDA 1A7JA 3LV8A 4RCYA 1CEEA 2GWHA 1KNQA 3EW9A 2HXYA 4BEJA 3A1WA 3DM9B 4CDGA 1PUIA 2QTHA 2WJGA 1R8QA 1PLLA 2BM0A 3LO5A 3SJCA 1N6LA 1VDZA 3OIUA 4B74A 3U4QA 2J45A 2J0SA 3QXHA 4A6PA 4CIDA 3CNNA 1X1RA 4U5XA 3NBYC 3R9XA 2OXRA 3BFVA 2FF7A 3W90A 2ZJOA 5F3WB 4BFYA 2IBMA 4DZZA 4OI0A 2WPDD 1G3IA 4MYTA 2OG2A 4LX0A 3M0EA 4A9AA 4BLOA 1J90A 4C4PA 3QOFA 1Q3TA 1W7AA 1HURA 3AVXA 2FFBA 1NLZA 3GMTA 3PEYA 1QVRA 1GNPA 1IJEA 3EZFA 3FDIA 4LBVA 3I8XA 1WE2A 4IOJA 2FWRA 2CL7X 4QGHA 3AB3A 1TQ2A 4D82A 1SKYE 2QORA 4PHTA 1NG9A 5GJCA 2PBRA 4RJLA 5EZ5A 1D9XA 1NBMA 4MYUA 3SC3A 3ZS9A 2XNSA 4BLQA 3BB3A 4BE7B 3GP8A 1RYHA 2F1IA 2CJWB 3ZQ6A 1B23P 1E9FA 2QP4A 1P62B 1HE8B 1TX4B 3RS5A 3ZH9B 1OH5A 1QBKC 2J0UB 3AF3A 4F4IA 2QAJA 3EPJA 4Z51A 4MRNA 1CJKC 5KDDA 4RD6A 1KMHB 5JHGB 1VG0B 4LWZA 3E70C 4JJKA 1NN1A 3VKWA 3GFPA 1U0LA 3K0FA 2XB2A 5JECA 2PT7A
chains in the Genus database with same CATH superfamily
3VR6A 2ZUDA 1K5HA 4ZGBA 3BWDD 5HOEA 1HYHA 1U8UA 4BO9A 4MJLA 4X91A 3RUIA 2C59A 5FHRA 4DWOA 2X9GA 1S8OA 3EGEA 4ZAZA 2ZIXB 5T8KC 3EZLA 2DTXA 3GVCA 4G5QA 1WKBA 1Z4QA 3NHUA 1MOSA 3IXQA 5T8KA 2UZ4A 1HLGA 2UZ3A 4N5HX 2WJ3A 1D0VA 4DUGD 5C34B 3Q7RA 2ZTSA 2PFKA 4IIYA 3VUEA 1NXSA 3G9ZA 3RYCB 3JPYA 3T5TA 1BMQA 4QPNA 5KDOA 1NOIA 4XB1A 1LY1A 5JADA 4YAGA 3OTHA 1SVLA 3TOSA 1JTVA 3A4NA 2XCOA 3OIYA 3OTGA 4L50A 4Q4AB 3L6DA 3Q7EA 5G3ZA 3I2GA 3RIYA 4ZI2A 3CN9A 4ZMRA 1JH9A 1W1WA 2O06A 1BOFA 2GDZA 1CIPA 2W6QA 3M82A 4XA8A 3G8AA 2OO3A 3H0EA 3KOMA 1JHMA 5B1HA 4EJ2A 1PN3A 4BY9E 2HRRA 4OFZA 5CURA 4MS3B 5KYYB 3EIHA 1YQUA 2IHBA 1R6TA 3LA8A 4HAXA 1DXQA 5FQOA 3FDZB 3RDPA 5CVUA 4LOLA 4KOAA 3PUYA 3DMRA 3PF9A 1P0IA 4KIUA 1CQIA 1NUAA 2XOKD 4MWGA 2JFHA 5MF6A 5DX0A 2GLXA 3DTVA 3TQFA 3KLMX 4DB4A 1D0IA 2XA1A 3R24A 5IDVA 5KEIA 1H5UA 1UF9A 3CONA 2HMTA 4C04A 4Y8VA 4CF7A 5F1OA 4L5CA 3EQ9A 2IW1A 3FYCA 1PCXA 2XUZA 4Q19A 1MA3A 1M1NA 2Y67A 3EXG1 1O6ZA 2R7LA 3KJGA 4LIPD 3RJMA 2J30A 3Q2IA 4I9UA 2XD9A 4E5UA 4PQYA 3H5VA 1L4BA 4XR9A 3VR3D 2OMKA 3AUUA 4CKWA 4OXNA 2EDAA 4PW0A 4YRIA 4RDXA 3RBVA 3P9IA 1XC7A 1LNSA 3AJAA 2I6SA 1Z75A 2W43A 1WZCA 2W8BB 2Q3DA 1R5OA 4IVQA 4WEQA 1Z4MA 2MR6A 3I6MA 3V7WA 3X2FA 1M10A 4DV2B 1RAAA 1JUDA 3BWCA 2WSBA 2R8PA 4Q9JA 1V7CA 1H93A 3CX7A 3ZIAD 3A06A 1G5TA 1J1UA 4KFTA 4A16A 5JARA 2X3UA 1GUBA 3L1IA 2IV2X 3R4CA 1Q91A 4UNIA 4X44A 1GY8A 2EP5A 4M89A 3LW8A 4CM8A 3Q5DA 2IXGA 4NBNA 4RA6A 1TYEB 2P68A 3AQIA 5DDIP 1JFFB 3F3KA 4NU0A 4RPCA 5ABPA 1B6GA 3DMNA 4QOEA 4CR6A 1YCHA 5EXDA 4L8YA 5JMTA 4QZVA 2Y6UA 5FJIA 1SQGA 1ARZA 1GRCA 2RGYA 1J8MF 1II8A 4KRXA 3GRAA 4PO3X 4W8GA 4KL8S 5L3VA 1Q0HA 5BSHA 1C29B 3QOWA 3BK2A 1XGKA 4LN1A 3RUAA 3E9EA 3IA2A 5JSZA 2AI3A 1YZ3A 1K2WA 1MABB 2RHDA 2F1HA 4TKUB 4TMZA 2NSJA 2J3IA 2XSZD 4KE9A 4EHHA 4LBWA 5CG2A 4RE5A 1EUZA 2VWPA 3JCZA 3MUEA 1L5MA 1FTYA 4FGJA 1T3TA 2JIBA 1HL3A 3OBBA 4MS4A 4R69A 1KARA 1ZHFA 1F0NA 5SZJA 4CKBB 1U1EA 1GA4A 1ZMOA 3BTSA 3DM5A 4RC9A 4D0RA 3RS9A 4DIDA 1Z7GA 2PGLA 3O4IA 1IIBA 1NI4B 3U0VA 4CWAA 2XZPA 1N9GB 2VVTA 1RWBA 4GVPA 1JNYA 2VF7A 4FDAA 2O1WA 4M1SA 5AKGA 4N5DA 5FWYB 5T4EA 4J29A 1ADBA 5C1PA 3MWLA 5HTKA 4EEXA 2DCUA 2FFQA 2Y1WA 1Z8NA 1US8B 1T8RA 1DJNA 1P7YA 2B5VA 3FPAA 2CYCA 1P1FA 1RC0A 1U3CA 3K0AB 2SKCA 3N2EA 2OB1A 4PBRA 4UTZA 4YT4A 3GUZA 3ZGNA 4EW1A 2J32A 4UHEA 5BYAA 3WMXA 4NDZA 1M7BA 3T9CA 3P0IA 5JU6A 2DYKA 1ZQ9A 4UVDA 2I9KA 2DXIA 3I09A 3IURA 2QBYA 1IN7A 1M8GA 4LPKA 3F1LA 4JOBA 1NRIA 1RAEA 1JIQA 1DQRA 5EXSA 2J5BA 2PYDA 2ROQA 1ND6A 1P3DA 4OLBA 2YYZA 4QUHA 2FSSA 2G3YA 2QLNA 3MQ4A 3FMGA 4MXDA 4TQ9A 4GXTA 3SC4A 1VKZA 2OBBA 4K1LA 5A05A 3OO1A 4JUDX 4QGSA 1Y7TA 1FK8A 4LECA 4CEIA 5EJ5A 1NE7A 2KLHA 1SMKA 3S8YA 3C5CA 3PFFA 3R6DA 3ZGLA 2GKSA 4S3MA 4LXYA 3RSOA 3TEJA 3DEIA 5J2UA 3RSQA 4AMYA 2HHLA 3AR8A 3CNBA 3UATA 4AZ3B 2PYIA 2VAWA 3P94A 4V02A 2RAVA 2OAEA 4BFZA 5CD1A 2G67A 1WZEA 3GQBB 4Q03A 4RPKA 2IYAA 4C22A 2BMJA 4JB2A 3QF4A 4J0EA 1X86B 2VP6A 4LXXA 1QK3A 1VLVA 1USKA 3PJEA 4C6HA 1CQXA 1EDDA 1X8KA 1Q57A 1A0OA 3CE9A 3WNDA 4Y6PA 2PA3A 4ZPJA 1WG8A 1XYVA 2BCGY 2WLSA 3QHPA 2F43B 5BN3B 1DEKA 1CQWA 4PZUA 1TQDA 3JATA 1M8PA 2WOOA 4NJEA 5ERGB 3U37A 2FE4A 3ETNA 4XDZA 4RZ2A 1H0RA 1U8FO 2GUWA 2V9PA 3ND8A 2X8JB 5JS8A 5E2AA 5C4GB 3JZFA 4WCDA 1QO0A 1V48A 1XDBA 2OLJA 3B6IA 2VK2A 4I9FA 5ELMA 4F2HA 1TM5E 4BYMA 4ZFNA 3AETA 3CV3A 3FR8A 4TTAA 1JEAA 1I5OA 4GQIA 4GOKA 3C39A 4G5OA 4RMIA 2XOKA 1U90A 3NBAA 1ECJA 5IYZF 3RIMA 4GP7A 3TE7A 1Y3DE 4FIZA 4UNRA 1TTTA 2XUHA 1FJHA 2XOXA 2X0RA 2BZSA 5HUJA 1HT0A 1RXYA 1XRNA 4HZUA 4ZOEA 3O2NA 3PNMA 3B51X 1P4JA 2QN9A 4M9UA 5K45A 2VYND 3E7XA 3IVGA 3IKJA 4K86A 3DBIA 1B2LA 1UKZA 1MDBA 3D4PA 5FBLB 4G2TA 4QDJA 1N6NA 4FYIA 4BVKA 4YAIA 2CVOA 4P3NA 1FP4A 1EXMA 1VXRA 3NIWA 2IY7A 1NVVQ 1K7CA 3CPJB 3ND9A 3VR3A 1BCRB 1KU6A 2HEGA 6LDHA 4YJ2A 2FVYA 1MR3F 4AYWA 3G2KA 1MU0A 2VKTA 1FB5A 2QTWB 4DXHA 2HIAA 5I4KA 3NUQA 4EY4A 1R1DA 2YBEA 3L7BA 1R8SA 3OSZA 3NALA 5AW9A 2XXAA 2XKBA 3QBDA 1YZVA 4CE6A 1LPPA 3ZIAA 4BMVA 4A2PA 1VRVA 5F7JA 1Q1QA 2O8CB 2BKXA 3H1AA 4GKJB 2XNHA 2IU6A 1ZD3A 2QMEA 2CN1A 3R5XA 4E31A 2QXTA 3JWIA 1JXQA 2Z83A 4N0EA 4CKEB 2BHRA 3IRUA 3C85A 1IXKA 4OMFG 3CRRA 1CUCA 3K35A 5TC4A 5KTNA 4JIMA 3TB6A 4L5JA 1A5TA 4NR0A 3DEJA 1IOLA 3Q9SA 3VTZA 2BUBA 5E4FA 5LQMA 1Z6YA 5IFKA 2YWBA 2ZRLA 3NWPA 1YQQA 3WHIA 4KV7A 1ZZEA 2R6DA 2ZIFA 3AR7A 3DE0X 3KKKA 2CFSA 2CXTA 4LW8A 3P9XA 4YCNA 2A5JA 1O58A 4JU8A 2XSZA 1QAMA 1KI8A 2PH1A 4NMLA 5G2OA 1JIXA 1ZUNB 2HH9A 3CPSA 3UWDA 4F6LA 2E0IA 4LA4A 3QFSA 1I2ZA 4UM8B 2P0EA 4I5FA 4RW0A 3VM6A 1MNQA 4TZTA 1SC4A 3IBSA 1T8PA 3KLNA 4RVFA 4DBZA 3P2KA 1Y4SA 4F6CA 1HDIA 1I4LD 1BS2A 1DIHA 1M2HA 1N2CB 1PUJA 3FRIA 2YC2C 1V1RA 4K1XA 3UMVA 1DT5A 3MJSA 3WSVA 5K8LA 3LCRA 3P96A 4PV7A 5K8TA 1A7KA 1O89A 3IQFA 4OU4A 4RK1A 5DI3B 4BV2A 1T3GA 3FNHA 5AOAA 1U4SA 2BV3A 5SZIA 3WIUA 2PGAA 1T6XA 1VJCA 2HOQA 3CCCA 3DOOA 2FFHA 4BIMA 1EUQA 4K9LA 5GJBA 3F7MA 5BURA 3ESXA 1X7ZB 3T38A 1SVIA 4QEZA 2J6CA 2XMBA 2RH4A 3QEOA 5LUBA 4D9BA 4LVCA 5A02A 5TY0A 4QQFA 3W1EA 1QR6A 1VM6A 4FFWA 4BASA 5BW6B 2A88A 4OHBA 4OGKA 2Q2WA 3IMFA 3MWYW 2HHHB 2MR5A 3SZGA 3VDNB 4BB9A 1C1YA 1Z7YA 1NU6A 1QP8A 3L02A 4G89A 1GNSA 5DB4A 4TKVB 2LD4A 4TTSA 2AEMA 3I72A 3C3PA 3NTLA 3EJ6A 3DA8A 3L18A 1E69A 2B0JA 4XEHA 3T9FA 3ADBA 1TVKB 4G5SA 2OD9A 5BNZA 4YJ3B 1A4XA 3H9EO 3KJIA 1KJJA 3EF1A 1C5KA 5I48A 3PLAE 2MOKA 4G09A 5KQLA 1H1LB 2RGNC 1ESEA 2QTVA 4NCXA 1K7XB 1W76A 3QZUA 5ALOA 3S3TA 3BMXA 3WDLA 4C0KA 1CR0A 2RGNA 1ISJA 1I4TD 4GMHA 3I58A 3GIDA 3F74A 3RF6A 1W36B 2XMQA 4IH9A 5MGNA 3IEVA 2JAPA 4DW8A 1RYFA 3ECCA 1LBQA 3ORHA 9ABPA 5ITZA 1RXEA 3LYUA 5H4HA 3IC5A 3OHPA 2OQIA 4ZT4A 2X0NA 3WE7A 1ZIOA 1L8LA 4AI6A 4ZOBA 3H99A 5KNBD 4QJ5A 5JBIA 4UCQA 7ADHA 3PL5A 4Y9UA 2VXYA 4QAJA 3KSAC 2VTVA 1C9YA 3EPHA 4HS4A 4C7KA 2V7QA 4PSCA 4ETIA 1HSZA 1VB3A 1E2IA 2G4LA 3O8OA 3RKUA 4TMYA 1U65A 1E2LA 3JWJA 5ALQA 3QOXA 1E1YA 5G0WA 3GLFA 2DFPA 1ZIDA 5IZCA 1A9PA 2Q5JA 2NO6A 4K3UA 2GI4A 3IOEA 5C52B 1RS0A 2O8EA 3A27A 3VR1A 1O96B 3JZDA 4LCBA 1Q14A 5DX1A 1T6ZA 5HKKD 1NE2A 1W96A 2FPRA 2O4UX 1HA3A 1J9ZA 3I2JA 3F9IA 1YIDA 5EXTA 3WTCA 2F8SA 3FVVA 3C1OA 4MB0A 1OX5A 2FCAA 2LCQA 3IERA 5JTTA 2C3YA 3UYKA 2QUAA 1YBVA 2LV8A 2YJ5A 3T54A 4RF2A 1B8UA 1G4UR 1TCUA 4JEMA 1Z6AA 4RZHA 3VSCA 1U0OC 3K9CA 3LZCA 2DC1A 1PEYA 1PS9A 3I37X 4G4SO 2VYNA 3ZJYA 2DY1A 1YQDA 4HLDA 2POQX 1A9QA 4YAUA 1KQFA 1G64A 2UUCB 1ONOA 1ESCA 4Q6WA 4CM7A 4EGJA 1J22A 1QIHA 2Z5GA 1YJCA 3FCEA 3GUCA 4HL6A 4QWMA 4RFSB 5JI2E 3ZBQA 3DDSA 2IYRA 1R5NA 3DFMA 4LSMA 3UCFA 4CVNA 5KTMA 1AY0A 2AR9A 1R6XA 4M0MA 1RWPA 2JLRA 3LK7A 4ZWNA 3ZH2A 4YHHB 1I3MA 1J24A 2UVPA 3R5JA 4QPPA 5AW2A 4B5LA 1HZZA 4QECA 4AUKA 2Z8XA 4D9GA 2O5CA 3OC0A 1FRNA 4MR8B 1PG5A 3F71A 3MTIA 3ZXUB 4BMOB 4DLNA 4IG9A 4OA8A 1Z0DA 4QHSA 3N74A 4JLDA 4R9VA 4DJDC 4UNQA 1E98A 2QRGA 1CJTC 2G7ZA 3EVGA 3KVYA 4C2BA 4PYJA 1GPBA 5LWHA 3DP9A 3HVUA 1FP2A 4G81A 4CETA 2Q5EA 4K28A 3WQHA 3U19A 1V37A 3T12A 4G1VA 4A0GA 3ROEA 3GLIE 2EEPA 3Q9UA 4AMGA 1WXEA 2C0CA 1EIWA 1IUOA 4GWGA 2P41A 2X4LA 5CGZA 1RM5A 2GVZC 1SXJB 1NJ6A 1J56A 4XX0A 2SCUB 1L3BA 2YVQA 1X9IA 3OPQA 4Q37A 3K2EA 4GPEA 5EEHA 4NATA 2W70A 5J2UF 4G25A 2CL6X 3DUFB 4R40A 5CXUA 1J2RA 4PWYA 4UTNA 4IDEA 4J49A 4ENTA 1TLFA 3LTNC 4B76A 4B7AA 3HKCA 5IUKC 3TRDA 3UMSA 4RKEA 3U4GA 5B3JC 2B1JA 3K3PA 4MUGA 1RZ3A 5B3JA 5K4HA 3WWCA 3W2HA 2Z4SA 3H13A 1DTWA 3HVJA 2R9VA 3UQYS 1VP3A 1ZH2A 2JF0A 2ODQA 3EQ6A 3IULA 4KI7A 3EISA 4UBKA 1AM4D 1JN0A 1KO5A 3SYLA 3EASA 3ZZMA 3I04M 1G21E 1KYZA 2B2XA 2C9MA 2QVGA 1PSWA 1N57A 3T9DA 4RO0A 4RHXA 4QGAA 3W5IA 5BSFA 2VQEB 1KVQA 4G9GA 5C1OA 4BO6A 4K9DA 4DV3B 3B3FA 3GD7A 4MW7A 4G86A 1KH3A 4QRIA 3B1ZA 4M46A 2DWCA 2YUIA 3IT3A 4GQAA 3AEUA 5B12A 2E89A 1EH5A 3EOZA 2R6R1 3G23A 2HN9A 3AIIA 3NBFA 4GWLA 2WNHA 4ZCMA 3HXMA 5IT4A 1JV2B 4NE2A 1PV2A 3DTNA 1GPKA 5DGXA 1IONA 1E2MA 3A28A 3L8ZA 1LH0A 5ICFA 1QP7A 4GR5A 2OWEA 5DM4A 2BGGA 3D6UA 4R68A 3H42B 4JMPA 1T25A 5TGDA 1COZA 5TMEA 4B8ZA 1V9LA 3VR4D 5GZ1A 3BE4A 3DW3X 3MCTA 4L4UA 2ZBDA 3O38A 2CV1A 4KQWA 4YJ2F 2GXUA 1Y37A 3HKBA 1NXWA 3MJRA 3PT5A 2ZVDA 4HDRA 4YASA 4M8NE 1U04A 3FGZA 4OQZA 3HKEB 1MHPA 4I1SA 4O63O 2C0PA 3ONVA 1C4WA 4R5MA 2Y1KA 4KE8A 3DOFA 4PFJA 1WSAA 3DZ8A 1Q21A 1Z28A 1Q5PA 3BTVA 4OJTA 4KX3A 5KNBA 2A8YA 3DC2A 3VNVA 4BLWA 5AKXA 2IEBA 1GVHA 1ZVJA 5LP1A 5FIUA 2IIQA 5HZKA 4DV7B 1OH8A 2VSXA 5KMGA 1KHTA 3Q0IA 4UVGA 3R75A 2Q2OA 4GP6A 1G2IA 1XTBA 1PZMA 4HG2A 2X6RA 1J21A 4MVWA 1RQ7A 3CW2A 4UC0A 5IKPA 2WJJA 2AZ4A 4ECEA 2B1QA 3MBOA 2PNJA 2PMWB 4OEHA 3VSDA 3X1XA 1SXPA 1N77A 5JJKA 2QRZA 4LDAA 1ZK4A 1I80A 2F59A 5K99A 5AW0A 5KOIA 3O9ZA 5HKKA 5L7TA 1JR2A 2UZ1A 3QXCA 2CL5A 2EGHA 2PJRA 3LBIA 4Y3UA 2V45A 3NVMB 2PX8A 5CVTA 5B6PA 1N8KA 3K15A 2DQZA 1F2DA 3BA1A 4EGSA 2NU9A 5CK5A 3MGKA 1NQ5A 1N5OX 4I8IA 1MV8A 1FVHA 3NDIA 4ZVPA 5AUPB 4ZVLA 1XMPA 3A2NA 3VTKA 4CCAA 1QVWA 2PV0A 5I7FA 1RYZA 3T34A 3CXUA 1CEQA 2YOGA 1IM2A 4RJIA 3X1YA 3T7CA 1YS2X 5JFTA 2AKYA 3PUHA 4IILA 1DAMA 2AIRA 1LQTA 1KMHA 4NPAA 3X1DA 5HS4A 5ICMA 5KWJA 1GAXA 3OC6A 2CVQA 1CETA 3ICEA 5B37A 4P4GA 1DRJA 4H7EA 4BNFA 2RGGA 2X4IA 3TL2A 2F9MA 1AMUA 1WSDA 4ND6A 1FFYA 3FX2A 2BMEA 3GFGA 1ID8A 2FZEA 4XVRA 1KI6B 1PJCA 2ETXA 1LWOA 4EHAA 5JS6A 2G9QA 3L7YA 3PK0A 4RK7A 1NJGA 1FU8A 1NHWA 4JYBA 1UBUS 2C29D 2EWVA 2J9YB 3E35A 4BNIA 1ZEJA 3BFPA 3Q3VA 5CYOA 1VJGA 5AVTA 2I6FA 4QOFA 3W2TA 4U4AA 1GGJA 2IYXA 3UAYA 4F9EA 5K0CA 1LUAA 3C8HA 5HQTA 4EYEA 4RS4A 3TSYA 2XUFA 5FFMA 1L8OA 4GC5A 3D8SA 4Q9NA 4EG3A 3IJ5A 4DDKA 4J0DA 4JJ4A 3AG6A 4LUCA 4TOIA 5IBPA 1IHUA 3MCAA 1QGUA 3PKJA 3V33A 2PUFA 1CDEA 1LLQA 5JSFA 4KGXA 3OIVA 4PSDA 4ZVVA 3SAJA 4OFBA 1UK6A 3AWIA 5AM3A 1Y80A 2DLNA 2GOYA 2JJ1D 2ZJFA 2OCYC 3NNSA 3LF2A 1RLUA 2XQVA 2JGAA 2G9UA 4ZYZA 5ALZA 2O8CA 2CMKA 2CNWD 2CMFA 2OHOA 3HK2A 3OUZA 1AN9A 3U3DA 1KAGA 4ZVNA 3LF1A 1C3EA 1HR0B 4Z9YA 4Q1BA 1W35A 3RODA 3WWEA 1Z06A 2GBPA 2PUVA 3AOEC 5KIAA 1QRDA 1ZAKA 2JIRA 3GEPA 5DW3A 3UGQA 4WNAB 2REQB 2QX7A 3TSAA 2QGZA 1RXVA 4BO3A 1KEWA 1WXHA 5I7UA 3E9DA 2YQ5A 4W7IA 5FWAA 3BF8A 2V58A 3LLSA 2GX6A 4UMVA 3WIDA 4L15A 1R66A 4BKUA 1R64A 4HWRA 2C5AA 4NZZA 4OI2A 1ZCAA 3FNFA 3W3AD 3WK7A 3ZYZA 3WB0A 2QYSA 4JA2A 4Z6KA 2I3GA 3THYB 3WR5A 5I9NA 4TV8B 3DBVO 4K03A 5JQWA 2I7CA 4OGLA 2GPYA 4QUBA 4MX8A 4WA7A 1XWFA 4BFSA 2AJDA 1T8SA 2HHJA 1DKUA 4I81A 4L74A 4OL9A 4Q1FA 1GUZA 5EWMA 5HCIA 2X76A 5H9WA 3DT8A 5JJ5A 3T99A 1NDUA 3L4EA 1P31A 2XWBF 1V35A 1RPZA 1YS1X 3WGOA 4C30A 1GZUA 1OWOA 1OILA 2HK6A 2QTNA 2FJUA 2HMYB 3NWBA 3ZU3A 3CLKA 3WDMA 1B1CA 2ZRKA 4OMCA 2A7XA 2PT6A 2QPAA 2B61A 2Q3LA 4LY9A 4UUMA 5P21A 4KR9A 2FQQA 1P7ZA 2JH8A 3OLQA 1YKFA 3GF4A 4I1UA 2VRBA 3UY4A 3VR4A 5CMLA 1C7RA 1UDAA 1X7WB 1S8NA 2QN1A 4LWPA 4Y30A 5IAJA 4OV6B 1GSAA 4Z2YA 4E2WA 2V1UA 3KQOA 5EIWA 4CL8A 1USIA 3FI9A 5BVGA 1Y5NA 3N2KA 2ALJA 5TVKA 3UTCA 1E5QA 1AD2A 2IPNA 5LIPA 2FH5B 3IBGA 4FMBB 4NXMB 3OETA 1GQOA 3I2YX 3R77A 1E4YA 3PXXA 3SJZA 2PVPA 2J6IA 3BWVA 2Z2KA 3D7RA 2WIAA 3DL4A 3EEBA 3L04A 2QJOA 2HYIC 421PA 5GP1A 3UMRA 2ZJ8A 2Q4DA 5CB4A 4BVGA 4MROA 3BGDA 3URMA 4AM8A 1YS9A 3I2HA 3TTVA 1GRVA 1XZQA 2BFPA 4UD6A 5D1NA 2RGWA 1DE0A 4D56A 2BFEA 3DZDA 3PNKA 1MO2A 3A32A 3KYCB 3F3MA 5FPTA 4I4LA 1RWNA 3OTQA 4S1PA 4TMVA 3TNDA 5CNJA 2YZMA 2O2YA 7REQA 1C9EA 1XZCA 1NAIA 2PRZA 3ZDAA 5D3MA 1NSTA 1PTKA 1QJ4A 4B3HA 4G0QA 4E5PA 1N9ZA 4I19A 3C3XA 1DG3A 2CMGA 3BMOA 3EMVA 3AHGA 4GQBA 3ZHTA 4IEEA 1ECGA 4DR7B 4U7FA 1TEZA 3B3QA 3CEHA 2JGMA 1M76A 3QUSA 3IUSA 4OSOA 2D6FA 3N6VA 2PKEA 1JAHA 4KDCA 3D7NA 3TLJA 2ARKA 3KTOA 4TVSA 3BSYA 4G5RA 4OLFA 4CN8A 2BHNA 2YW9A 1AKEA 5JVDA 2FG6C 4R8MA 1O5TA 4W1PA 2Q0HA 4MICA 5D01A 3PD1A 1HWYA 3I2KA 3RSFA 2P40A 4Q48A 3CEAA 4BMCA 4F4UA 2JD1A 2WAYA 4L07A 5DBIA 2C2XA 3VPSA 4EF4A 4J75A 4Y2YA 2YJZA 4IIUA 2AMJA 3GH3A 1V6CA 5J43A 1BA3A 2WKRA 3HDHA 3QEBZ 1R0RE 3NC4A 3OZCA 1NP7A 2Q4BA 4E21A 1KVSA 1XB2A 2VEOA 3BB4A 4D9EA 2O0HA 3GL9A 1QIEA 3DR3A 3T4XA 3WY9A 3KOWA 4NFLA 1ZGAA 4BB6A 3O8DA 3RIEA 4BWYA 3OCYA 3KDAA 2XTMA 1W34A 2QLTA 3MELA 4G0PA 3ZKWA 4S35A 2NZXA 2HO4A 2I4IA 1P3Y1 3H5RA 4ODIA 2NT3A 3MFYA 1HM5A 3Q0EA 5EJFA 2XUPA 3WQSB 3W5BA 2E4YA 4EMSA 5EQDA 3QHAA 2FMHA 1R8XA 4M38A 2ZQZA 4RL4A 3V4FA 4URHA 4RTSA 1JG3A 2WTBA 4V0QA 2QD5A 5DBFA 4MQFB 4AO8A 2BTQA 2QMUA 4O25A 4X6YA 4EX6A 4M9SA 6REQA 3BIOA 2HWUA 4HLCA 2YUTA 2FWPA 2J6BA 2NQTA 3N8NA 1JDBC 3I05A 5J5VA 2EX0A 3BHNA 1KEZA 3FPBA 2BGWA 3Q98A 3KE9A 3D8TA 1E1KA 2FUG6 2JJ1A 4RYDA 1AKVA 1A1VA 1Z62A 2BDUA 2OO5C 5JYDA 4JN6B 5CK4A 1V4VA 2CNWA 2ZJYA 3T35A 2OO5A 1PK7A 3REFA 2A57A 3R09A 5KYVA 1G8YA 2Z9BA 3TLGA 1PWYE 1KORA 5E95A 1SUCA 2PLRA 4WW0A 3ZW8A 3GX1A 3J7AC 3VU8A 2VAMA 4PCLA 2V8OA 2AC7A 2PM8A 5JXJA 5KKAA 4FSDA 3UZUA 2QZZA 5KYWA 3DE5X 4MHSA 4ZD6A 3W3AA 1SRRA 4N7BA 1T3SA 4OIMA 3WZMA 2YYAA 1E8DA 1VE6A 4BEWA 2ZCUA 3U17A 1SZDA 2IXBA 3K4QA 2EFYA 3REQB 3C3JA 3CNLA 3V8PA 5T57A 3A4TA 4DKXA 1Q77A 1VSBA 2IXTA 1DRWA 1H8ED 4QDKA 5KQMA 1QOQB 4EW6A 2VF2A 4OM7A 4Y1EA 4KQ2A 4BJ1A 2GHTA 1P74A 2FJ0A 3AW9A 3S5UA 2XZOA 3SHQA 3BIWA 2OZLB 4YLEA 5ALXA 3JQ8B 5JAQA 3D3QA 2PH7A 5BR7A 2R8EA 5CDHA 5ESWA 3H87A 2VSQA 1ZH4A 1BQ3A 1LBEA 4N6GA 4NCKA 4OHPA 5H5JA 5KNCH 2ODNA 1G8MA 1J99A 4DV6B 4OX9B 4GRDA 2BFDB 3T7DA 2YWCA 2AUMA 4TPKA 4A8TA 2QL6A 1QCCA 1RKBA 2TYSB 2Z8YM 4M0FA 4KTTE 4MVJP 4OKSA 3E4DA 1Q7EA 3ORYA 4JLJA 3TBHA 5ADHA 1LFAA 1PJBA 3LOPA 3NEAA 4PRLA 5DVZA 4ZVSA 5KJ1A 4BQEA 2VH2A 3V48A 1Y8CA 1CQIB 2IPLA 2J5KA 3GXOA 4BGUA 4QBIA 4TQUS 2NVBA 1OFUX 3DAHA 1OLXA 4NS1A 4OI1A 2GZMA 5DHQA 2V74B 4OUDA 4HWKA 3D02A 4XXHA 3KZVA 1TLLA 2H0AA 2PFGA 1KH1A 3AIMA 4M0EA 3UHAA 2IOFA 3LVQE 1K8ZB 3WO1A 2LIPA 2JB9A 2EQBA 1Y7LA 1AF7A 3HHEA 2PGDA 2P6MA 2W2KB 1Z0FA 1FL9A 1YVRA 1HOTA 1Q20A 3OZFA 4LGMA 4RLFA 1PV4A 3BXXA 3LQ2A 4YRDA 4LFAB 3AT1A 4HLNA 3S27A 3UMYA 2J09A 2ZAOA 4MPRA 3LY5A 3MTDA 3WGZA 2GAJA 3NLLA 3U7QA 4F4CA 4CT0A 3S29A 2AN4A 3R6WA 3DT6A 3HO1A 1T9BA 5BN5B 1UKEA 3KC2A 3NWJA 5FBHA 4IWYA 4W5OA 3OZIA 2BF7A 2CXXA 5E3JA 5AKHA 1C3OB 2WT4A 2H4JA 1UMBA 3UK1A 3VU9A 4MWOA 1F1JA 2X0JA 5M3BA 4C3UA 4DM4A 1EWRA 5JATA 1S9HA 4IDOA 4QOJA 5LKRA 5IF3A 3AF4A 1SZCA 2NU6B 3DWGA 3QE0A 1V5IA 4J2HA 3QKSA 1L5ZA 4N3AA 4E07A 1KVRA 3LFTA 1KBQA 2R86A 3GVHA 3NH6A 4IIBA 2VJMA 4J1SA 4C4YA 3KL4A 1ZJ6A 3VO1A 3ESYA 1NZDA 1H9AA 4JBNA 3IJRA 4TYPA 1I4WA 4BNZA 2PR7A 5JCOC 5A6VA 2IV3A 3TWOA 2B34A 4ID3A 5ECWA 5JCOA 4DF3A 3K9FC 4INPA 3MGAA 1KFJB 2JIQA 2H1VA 2H9YA 1AN0A 4LJAA 4EO7A 3O93A 2QQ0A 4YAJA 4G0VA 4HYYA 2H31A 2PXCA 2NMVA 1FMJA 5DEOA 1WTAA 3L6UA 4ZKEA 4QM6A 3GRRA 1X77A 1IBLB 3ZUPA 3WYNA 4FDMA 2ZJ4A 1QOZA 2KS6A 2ZT5A 3PFKA 2ZGVA 1M0SA 3A3NA 1WDLA 4FFBA 3TL6A 3WGKA 4E22A 4WKGA 4LSWA 2WTXA 2RKOA 3NTRA 1WMAA 2B8NA 2FMFA 4XUDA 3IAUA 5DXFA 4BB5A 1T1SA 1JKJB 3LQ4A 2FA9A 1YV9A 2DF8A 4MWTA 2UU9B 3UUFA 1R6VA 1XA0A 3T4UA 2Q3HA 5HJ2A 2XMZA 2ZQ5A 3RSGA 5HGJA 1NNUA 5JNWA 3SQLA 1SVWA 2XAAA 3C3AA 2F3QA 3FFBA 2X15A 3JVDA 3CJQA 3SLKA 1L5QA 3KUKA 5IG2A 2KW5A 5F5LA 2TMDA 4V1CB 1DXHA 4FZJA 1UXHA 4YAOA 3PDHA 4Q1VA 1P1KA 3HN6A 4II7A 4WKPA 3VC3A 2ADMA 5CB4F 3R23A 4EFLA 1TYAE 5I9SA 5KQGA 2VJQA 4R2LA 1CY4A 1BXGA 1KP9A 2AR0A 2BEUA 1BAPA 3G8YA 3OLCX 1WHSB 3V97A 2H08A 2OSVA 4OHVA 1FNCA 3HG7A 2YJ6A 4PNZA 4POOA 4CEIB 2H5JA 5JRDS 3DFUA 3AWDA 1NSYA 4EQZA 4GX0A 1H1TA 2A0KA 3JARA 4QPJC 2JI6A 3LZDA 3JYLA 2ODEA 4HAIA 5ESXA 5BUQA 1H8EA 3EHDA 1P5HA 1Y7HA 3JY6A 1NR1A 4E12A 4ERNA 3ENKA 3CZ9A 1ZRHA 2HA0A 5HGXA 3IEMA 4Q4JB 3DV9A 3GP5A 4GMDA 1EHCA 2VWQA 1XF9A 1U6JA 2DWOA 2Y0CA 3QF4B 4L57A 4LMPA 1E1QD 4HX9A 3CRQA 3DFKA 1WDKA 4MVJI 5IF9A 5JVDF 3B7GA 3ZHUA 2VDJA 2XIQA 4RKRA 3U9LA 1ZR4A 4RF3A 2L0XA 3WLSA 2H7VA 3AKYA 4KFSA 5JTUA 3OZEA 3JATB 3H2KA 1ZH8A 3GT7A 4BVAA 2IIVA 3HGQA 4L9WA 3AF0A 4OFWA 3STHA 3RT1A 2F62A 4P1ZA 5C1BA 4BTEA 1YE8A 3E0QA 4N4AA 1VE5A 2OO7A 1K6EA 4OP2A 4S0XA 3H17A 1ZICA 3B53X 4AKIA 4NDNE 3MM4A 3GNQA 1W2WB 1UQRA 5AW3A 4HQLA 3K1TA 4U9IS 4Q4CA 4YACA 1N6KA 2ZEJA 4PSVA 4UHCA 1BHJA 1AOXA 3HB1A 3ILSA 3MJTA 5EZYB 1G7SA 2EZ4A 4FS8A 3DOCA 2H4FA 4R3UC 1B4DA 4V24A 1Z0UA 4FYJA 4HZUB 3RB8A 3ZCXA 4ES6A 3DCYA 3BXZA 1T8UA 3LT1A 5T4FA 2V4MA 1QS0B 3BMQB 4S1VA 2OLKA 4F3RA 1AO0A 2WQ6A 4E14A 4R9SA 1DKRA 3TMYA 5F9FA 3N2IA 4G5XA 3MB5A 2DR3A 4L3VA 4KNVA 5DX8A 5JXGA 2BGMA 3HP7A 1CJBA 1NXOA 3PSAA 1CVLA 2WTNA 2XLCA 3A3KA 2WZBA 5JCPA 4ZEOA 5DK6A 1JDVA 5D84A 3R3ZA 4XB2A 2RK3A 4KLRA 2P6PA 1VRCA 1T6NA 2GEUA 3RJ5A 3VYUB 1CWUA 4R71A 2XXAB 1NU8A 4UVHA 3FE2A 4XRRA 1KTVA 5BWCA 1KA9H 4IWNA 2NV2B 1X94A 2LRHA 4LCEA 2AT1A 5JR3A 1BH6A 4LYHA 5G40A 4K81B 3MTGA 2QP3A 2BUAA 2GCNA 2FG7C 2W2XA 1OC2A 3WP0A 3X1WA 2G9ZA 1UPBA 4MVXA 4BZPA 4RIGA 3UMMA 1PL8A 2XDYA 3GJ0A 1EFHA 1GUAA 1U6KA 4REMA 2A1IA 1C8KA 2G71A 5DISB 4GXNA 2HPZA 1TZKA 1YK0A 4MVJD 3KZXA 3SM9A 4XWOA 1MUUA 2CD9A 4ZK2A 1SBTA 5JDCC 4I9NA 4RJ2A 2O5EA 3PNVA 5JC1A 3B60A 1U3FA 4AS3A 5JDCA 1VHJA 3NGXA 1WCIA 2YXBA 4M2LA 5LQSA 3WLAA 3LPAA 3GLHE 2OZKA 2XUQA 1ML4A 3R5SA 4EUSA 4IIXA 1M7GA 2XMDA 3LY7A 4Y0VA 5BMVA 3COJA 1B00A 4ZU6X 1OZ0A 1YHNA 1DELA 4DUZB 3RHZA 4DGQA 3LHIA 1TUBB 3JPWA 2IUTA 9ATCA 2EERA 3AVTA 1MJGM 1U3VA 2EKZA 2BEVA 3L1JA 4FONA 4FT2A 1BWSA 3TJRA 4N49A 3HYTA 2X5JO 3TUIC 3B1YA 1XRLA 3CF4G 1SD5A 1GYQA 4HDQB 2DUUA 4OXYA 1ZC4A 2ZB4A 1YBHA 4PHHA 4Y18A 1RFLA 3SQOA 3IB6A 1UT5A 3GEDA 2E21A 3PFCA 1SXIA 3RRJA 4PLTA 4BXOA 2PBZA 3U4AA 2O50A 1W0CA 5CT4A 2H2DA 3AL0C 1Z6XA 5SY4A 2B4AA 1DG1G 4DREA 3PC4A 1UJMA 1UMCB 1E3JA 1IH8A 3DD1A 4JA0A 4KQKA 2MDTA 2G5TA 2GNPA 2HSDA 2ZBVA 1H4TA 1RP1A 3NONA 5HRCA 4AX8A 3GW8A 2F3RA 5B30A 5ALYA 3ZEIA 4DPKA 1UXJA 4X7RA 1CUIA 5P8WA 1QYIA 3L41A 3QEMB 2OC4A 1ZN7A 2OENG 2CKMA 1JYFA 1BTOA 2C20A 3LD9A 1GFSA 1PX2A 4L51A 1FYFA 1Q0PA 3DBRA 1KAHA 2XGGA 3PX3A 2ZTUA 3H6HA 4ALLA 4RY2A 2UUAB 1V1MB 1AZLA 1YC2A 3O92A 3OJXA 3ZGVA 5I9TA 2D8AA 1XNJA 2NVUB 1SA0A 4UAVA 2WWTA 2V6FA 3FD8A 4Q21A 4JXZA 5JJCA 1TIBA 3OPXA 4JS0A 2IY9A 2A59A 1UXKA 5FJJA 5ITZB 5JLJA 3RVNA 1Y1LA 4LJSA 3SFZA 2D1TA 3R0IA 4N65A 3QY9A 1Q1BA 1E1QA 1G3MA 4JSRA 2NZUG 1V95A 1RPTA 2JA2A 5BV8A 2CNLA 2H2IA 3D6MA 3F8WA 5DASA 1RQXA 5JD3A 4QD3A 5HEKA 5SZHB 3NMUF 3SZ3A 3RROA 4PNHA 3M1IA 2Q41A 3G1WA 1GD1O 3AKCA 3LYHA 3OMXA 3O8OB 3UPDA