3B6JA

Wrba from escherichia coli, nadh complex
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
197
structure length
197
Chain Sequence
AKVLVLYYSMYGHIETMARAVAEGASKVDGAEVVVKRVPETMPPQLFEKAGGKTQTAPVATPQELADYDAIIFGTPTRFGNMSGQMRTFLDQTGGLWASGALYGKLASVFSSTGTGGGQEQTITSTWTTLAHHGMVIVPIGYAAQELFDVSQVRGGTPYGATTIAGGDGSRQPSQEELSIARYQGEYVAGLAVKLNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Flavoprotein
molecule keywords Flavoprotein wrbA
publication title Crystal structure of the NADH:quinone oxidoreductase WrbA from Escherichia coli.
pubmed doi rcsb
total genus 67
structure length 197
sequence length 197
chains with identical sequence B
ec nomenclature ec 1.6.5.2: NAD(P)H dehydrogenase (quinone).
pdb deposition date 2007-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03358 FMN_red NADPH-dependent FMN reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3b6jA00
1AKWA 3KLBA 2KQUA 1FLAA 1RCFA 2W5UA 2R96A 1XI2A 2FLVA 2QX9A 3O73A 3F6SA 3B6KA 3ESYA 3OWXA 4FGKA 4QOEA 1XYVA 1OBOA 3TE7A 2HPVA 4QOJA 3ZHOA 2HNBA 3U7RA 3TEMA 1FTGA 1C7FA 2QX8A 1J9EA 5BUCA 4NLLA 3GAMA 1CZRA 4FGLA 2QWXA 3N39C 4U7FA 3FVWA 4YAOA 1OBVA 1AZLA 2BF4A 1FVXA 4R81A 2FX2A 1F4PA 2M6RA 3O2NA 3L9WA 5FA6A 4F8YA 1SG0A 5NULA 2XODA 2WC1A 2AMJA 4QOGA 5LBUA 2BMVA 4YAWA 1AMOA 2MWMA 1B1CA 2V9CA 1CZNA 2FZVA 2MT9A 5EAIA 2R97A 4C76A 1DXOA 1J9ZA 4U7GA 4D02A 2B3DA 2FVXA 3W77A 1BU5A 1WSWA 4BMPB 5FUQA 1QHEA 2MOKA 4FGJA 2XOEA 2Z9DA 2GSWA 5B3LA 1AKRA 3FJOA 1D04A 2QMYA 3NHPA 2QX6A 1CZOA 3GFRA 1AKUA 1CZHA 1CZLA 1RLIA 5LVAA 4LAFA 4YAUA 5TGZA 4PU0A 4ZVMA 3HLYA 1QBGA 3QFRA 2BN4A 3NHFA 3OWHA 2Z98A 4HEQA 1AKQA 4J8PA 3LT5A 3FNIA 5NLLA 1FLVA 3L9XA 1YRHA 1CZKA 2ZKIA 4LA4A 3HR4A 3TZBA 3U7IA 5F4BA 2X2PA 4ZVKA 2Q9UA 3OJWA 2OHIA 1AKVA 1H66A 3OX1A 4GQIA 2BPOA 3S2YA 4QOFA 4Y7CA 3NHKA 4YQEA 1XYYA 4N82A 4ESEA 5A4KA 2RG1A 5FX2A 4QODA 3B6MA 2Z9BA 1I1OA 3K1YA 4H6PA 2ARKA 3KAQA 4HS4A 3R6WA 4QOIA 3FW1A 3W7AA 2N1MA 3NFRA 3N3AC 4Y9UA 3GFQA 3KAPA 1V4BA 5LJLA 4GI5A 3OX3A 2FAXA 4C0WA 3UXHA 4C14A 4PTYA 1C7EA 2OHHA 4YALA 3B6JA 3RPEA 3SVLA 2X2OA 1YOBA 2FZ5A 3EDOA 3B6IA 4PTZA 1OFVA 4OXXA 3F2VA 4Y9RA 1J9GA 1AHNA 1T0IA 3K20A 3G5MA 3NHWA 5LMCA 4ICIA 4LTMA 5EMNA 2QR2A 1VMEA 2F1OA 3UXEA 2A5LA 1YCFA 3NHYA 3ESZA 2D5IA 1X77A 2V5UA 1FLNA 3ESXA 4BMOB 1ZWKA 4XDHA 4DIKA 3NHRA 1QRDA 2M6SA 4H2DA 2QX4A 1J8QA 1JA0A 4M0CA 4C0XA 1SQSA 3NHLA 3NHUA 3EYWA 4LTNA 3NHSA 1FX1A 1DXQA 2Z9CA 1D4AA 1YDGA 5JROA 3OJXA 4N65A 1TIKA 3QFCA 1JA1A 1GG5A 1WSBA 2OHJA 4U7HA 5F51A 1FUEA 4GR9A 1XT6A 3OX2A 5EA2A 1NNI1 4CF6A 3HA2A 5LBTA 5F12A 4DY4A 2FCRA 5LJIA 1YCHA 2FDXA 6NULA 1D03A 3QE2A 3FX2A 4CETA 4LTDA 1AKTA 1YKGA 5LLDA 5B3KA 4YAFA 5ULLA 2MTBA 2OYSA 1T5BA 1CZUA 3N3BC 1BVYF 4S24A 3NHJA 3P0RA 1KBQA 3W79A 4ZVLA 4QOHA 1RLJA 2BZSA 3OVMA 4XDGA 4ZVNA 2HNAA 2Q62A 1H69A 1TLLA 2V5VA 3LCMA 1AG9A 1YCGA 1DX9A 3GFSA 4DILA 3W78A 1E5DA 3KEGA 1KBOA 4FX2A 3NLLA 4N9QA 1ZX1A 1RTTA 4NULA 3ES9A 1QR2A 3F90A 2QMZA 3JSXA 2KLBA 3D7NA 2FOXA 1FLDA 3F6RA 1ZWLA
chains in the Genus database with same CATH superfamily
4JYZA 1AKWA 1RJDA 5E95A 1FUIA 4LBVA 4UEKA 1FLAA 3WGUA 1R16A 1EFTA 1XLWA 2AEJA 4GOOD 4CKBB 2C2WA 1C0LA 3FFBA 5FPTA 3W4IA 4LCJA 3DXFA 4FJ0A 2EBFX 2QVCA 4ZT2A 5L8VA 2EZUA 3ZVNA 2X14A 1G20B 1W5AA 3L0OA 4XPZA 1GGJA 2F3TA 3G8AA 3H5RA 4IKEA 1H2RS 4BRSA 1NNEA 2C3MA 3A25A 1IRXA 2Q9AA 3NTLA 3U44A 5BQOA 3RSFA 1IXKA 4OIFA 1AV7A 3QMVA 3FGOA 4MS1B 4ETIA 1OZ0A 1PBNA 2AL7A 5FADA 4ZVSA 3X1WA 3C4VA 5LNK6 2PE5A 3RC3A 2P90A 1JQ5A 2HNBA 3D8TA 1M1UA 3FBGA 3MMXA 2BFCB 1UBNA 3G7UA 3KKKA 4P08A 3WLSA 1EBUA 1KDVA 1LBEA 4HYEA 1CR2A 1ZGZA 1Y9EA 2LVBA 1I1QB 2I1VB 2QTFA 3EA4A 5EHNA 3RVLA 3IFSA 3TRKA 2Z3ZA 3GI1A 3ZH9B 2AWOA 4I99A 1JEDA 1G3UA 1PE0A 2PMFA 3VZPA 4ENVA 3D3QA 4G9EA 4OBWA 4QYSA 3LOQA 4I4LA 5HKKD 1X2EA 1OBHA 3AEYA 3H2JA 1YRQA 1JEEA 2QIPA 5JI2E 1MW9X 1H8HA 4HXGA 2QWXA 4KDFA 2WRZA 1T3HA 4IM7A 3GT0A 3ABSB 4Y0NA 4C2BA 1LBQA 4JCOA 1CQPA 2AK3A 3NC0C 3L1HA 2R8YA 3A0UA 2GI4A 3ZDAA 2X42A 3SQDA 5ICCA 3EXHA 3UQYS 2BKUA 4FFVA 2HBYA 3VDNB 221PA 4QECA 4Z4EA 2D2FA 2WNSA 4J2TA 2W4MA 4IP0A 3FOBA 2XLCA 4C0HA 1HYEA 3PFIA 1OU0A 5EXPA 5HFAA 2LWIA 1CX9B 2GESA 4B74A 2QTBA 4FFBB 3OPQA 1XCJA 2W4IA 4US0R 1CRWG 1U81A 2EWVA 4WUTA 1E79D 4RLQA 1V1MA 4GKAA 1FEZA 2IYUA 1Z88A 2WSBA 3KZMA 1SCUA 3CZ9A 3QLUC 3ZWCA 5GVSA 2ZWMA 1E1DA 2HFJA 3D1JA 4O2BB 3VYRB 3WMXA 2C7QA 2QRPA 3DLIA 4CTNA 1BEUB 4IQ8A 4LQ4A 2HJGA 4TSKA 3T3GA 4H1WA 4LJAA 2PIDA 3DUWA 3PITA 4M1KA 4ZP1A 3TPZA 1RHUA 1C8BA 2CNLA 2FJUA 3HGMA 1CY0A 2FEAA 1RI3A 3PRJA 1SK9A 4NMHA 5IJXA 4PPGA 4I1OA 1OXVA 4H3VA 4HGNA 2FQQA 1MTOA 4HWOA 4QD3A 3A6PC 3NHZA 1NVGA 3RFCA 2BMVA 2NZYA 5CLHA 3RVRA 1IY0A 4RIIA 5E4JA 1PZXA 1QZXA 1XRRA 2H0QA 2KMLA 1J5XA 2J3HA 4JZKA 4K46A 4DMCA 3QBDA 5EP1A 1ETUA 4W6ZA 2MWMA 5LYJA 3T0IA 5DWVA 4EAAA 4ZK2A 5IJZA 1OJ7A 1Z73A 4JYCA 1H5UA 3UJPA 1LTQA 3ULKA 1EX9A 1MX9A 2FZVA 3HV0A 2HBRA 1G6Q1 3CHYA 1COZA 1N2CE 3BQ9A 4WT7A 1BX3A 1OROA 3HKCB 1B7GO 3IUNA 2ZIZA 5IXJA 2CCJA 2PBZA 2C7OA 1FRNA 4EHJA 1K5HA 1U3CA 3ZGLA 5JO0A 1ICEA 4F9EA 4D02A 1ZNWA 2CHGA 1O5OA 3CINA 2JGKA 2V54A 3GB9A 1L5HB 1SXHA 5K01A 1R74A 4KWHA 2PANA 4M0LA 1T4DA 1GVHA 3GLFA 1KJIA 1MIOA 4PRZA 4BUJA 2CEAA 3JD3A 5LQJA 4UBIA 4NWIA 3DOHA 5TSDA 3RTCA 2DCMA 1CR6A 5B3AA 3HLKA 5A0FA 1P1JA 3PJRA 2W48A 5FL7D 3V3TA 3DOFA 1PGJA 5GIPE 5DW0A 2ZM5A 2D5AA 5JZMA 1H23A 3TZCA 1FCJA 5LXTB 2PX8A 1KOJA 4MKGA 4EKYA 1KFCB 4J1NA 4ZMRA 3WAGA 3RADC 4H59A 4F60A 1HQYE 3KEMA 4P8RA 2PH5A 5E6RA 4F9GA 5DNYB 1JB9A 4ND4A 5H83A 3JR7A 1NSTA 1GPJA 2JLUA 5FBWB 1QHFA 4IEEA 3QKUA 2YHUA 2QLNA 3AKDA 3JQ8B 4M60A 4HNHA 3HXTA 1YJAA 2P5TB 4EELA 3TLBA 1VBMA 5KKNB 4TMWA 1FFHA 3E9CA 3HRHA 4FDUA 4HVTA 1XZQA 5CP8A 4BOYA 3VSEA 4CU2A 2FWAA 3KJGA 2VQSA 2JVKA 2ZDGA 3LXUX 4RHEA 3CRQA 3SZGA 1TJ4A 4EEKA 1PZEA 2O3JA 2SCUB 2WKWA 2PQ2A 1CVRA 1NVWQ 1XD8A 5IMBA 1VOTA 1WLYA 4C3UA 5L3SB 4HH1A 4O25A 1XZEA 3QKIA 3I6IA 1NMQA 4PZCA 5IJ9A 3O4IA 4P7BA 1Y6GA 3U26A 4Z4FA 2FN3A 2YJ3A 2ZAOA 3LUFA 1AE1A 1UFQA 2QD4A 2GK4A 1D4FA 4GW3A 1C1YA 3M1YA 4UMDA 3WYGA 3GNLA 3FMVA 1Y1SA 2NO4A 2X40A 1S2DA 2ZT6A 4NV1A 5C1DA 2FPRA 3LUBA 5H3LA 3HQ4O 3LM8A 3O82A 5JQGF 1ESEA 3Q41A 4IJUA 4KPFC 1T1RA 2NO5A 3WGIA 3KTAA 3AR3A 1AZWA 3F8WA 3KEFA 3VUFA 4ENUA 1BS9A 2QU7A 3NV7A 1VHQA 4G1FA 4GM0A 2F64A 2R7KA 3PIIA 3SC2A 3IOMA 5K09A 2H5IA 1R64A 2AZ4A 3G0DA 5A3JA 1OH7A 1E1QD 4J0DA 4Y0VA 4FYXA 1YK1A 1P0QA 1M76A 1JECA 2MSKA 2XGGA 3EDMA 3HJTA 4LBWA 3HSKA 4ZI5A 9LDTA 2H1CA 1GU0A 1F5NA 1ZRNA 4GICA 2Q5QA 2ZPTX 4C4ZA 5IZ4A 4UC0A 1Y1LA 4UREA 3ZDYB 4JLBA 1FYEA 5SZIA 1QHIA 4QOSA 5IDVA 3OLZA 1U6JA 1YZFA 1NUSA 2WJJA 2H57A 2YASA 3DZIA 5CAEB 4YRAA 1JG4A 4XH9B 4RENA 1JDBC 3LSTA 5JTUA 3IEVA 1UFOA 2HJRA 4NG5A 2PD4A 3MQ2A 5IYZA 2NSHA 4P34A 1P91A 1I1HA 5A7FA 4RV4A 5DIZA 3AY0A 4LUCA 5L3RA 4YNBA 4NABA 2Z57A 2JAUA 4GECA 4I1YA 2ZM6B 1Z47A 4AMZA 1RI1A 4UEJA 1NXVA 3SC4A 3VTKA 3JQ9C 1PFYA 1MMFB 3WWYA 4PSDA 3ERCA 3FW1A 4MWCA 3HI6A 2CVHA 4EKIA 4M3NA 4B3FX 3IAS1 5BSRA 3KFXA 5HIMA 4MS3A 4PC2A 1I7DA 4OI0A 2J3LA 3JTMA 3E35A 2FF5A 4GR5A 1TVCA 4YT4A 3LZCA 2PA0A 4RKRA 1WCIB 3PEEA 2G7MC 2A3NA 3LG2A 3OX3A 1Y1PA 2AJTA 1JQKA 2EJUA 5T3UA 4X45A 3VKFA 5FBRB 2O14A 3CRMA 4D4LA 5A1JA 4GT1A 5BW5A 3HKDB 3LX8A 5EHIA 2B1GA 1WDMA 5LR6A 5KX5F 1E61A 3K09A 3N0VA 3OCUA 4OHZA 2C07A 5G0TA 1KORA 1SCJA 1UBTS 1QHNA 2BBOA 2Q27A 3OJLA 2B1QA 2ZETA 3E9DA 5EE3A 1FXUA 3N7TA 1C7EA 1ODJA 2I2CA 2I1WA 2VR1A 4DXAA 5BMVF 2POQX 3GY0A 1TEZA 2EGUA 2ZP1A 5K3FB 2GMWA 3SE7A 1EVZA 2OLKA 3CWQA 3M4YA 4GYKA 2GD2A 2MINA 1QHXA 1UMKA 5AI5A 2ANBA 2C0CA 1L4EA 5EJ2A 5CA1A 3BK1A 2CLDX 2VSYA 4GVXA 5TQ2A 1Q0UA 2GN1A 2WHXA 4WZAE 4ZOBA 3KIPA 3WYAA 1CF2O 4XYEA 2VQFB 4OAOA 5SYNA 4BBPA 1SKBA 1CJCA 4MWSA 4G07A 3D0QA 2GEBA 3PE3A 2WFLB 4FYHA 1KDRA 3C6MA 4LSZA 3ZKAA 3TB4A 1HEUA 1ISJA 2AUTA 4KMSA 5JSHA 1BAPA 1M74A 1E2KA 2JAWA 3BCHA 3K6RA 4JQOA 1O57A 2WHYA 1U7DA 2JCBA 1ECBA 2I8AA 2FQYA 3P4YA 1E77A 2HPZA 2QN8A 3BGDA 4HYYA 1NUAA 1VECA 2IXFA 3A3YA 4GKBA 5AXBA 1W85B 1TM3E 5B2FA 3IX7A 3PHBE 2BFWA 4G4SO 5DYGA 2CFOA 4Z9BA 3Q11A 3KAKA 4ICIA 3I30X 1ZGHA 3KB8A 1YE8A 1T0PA 4QPCA 1C1XB 1WR8A 2HJSA 2FK8A 3ND8A 2C98A 3YASA 4DY6A 3S81A 1VCNA 4TMKA 3ZU6A 1GM5A 2PKQO 2ODQA 2VJMA 4EYQA 5LMZA 1Z2NX 2J59A 2WD7A 2XKBA 3ORYA 4J29A 4OBXA 1K75A 3GQBB 1T3SA 3HSYA 4N0QA 2QQGA 3TQIA 1SKYB 3FPFA 3P96A 4ER6A 1E3MA 4IFBA 5KYXB 1L8OA 3WVNA 4UD2A 2OBYA 4XWTA 5ALMA 2YV5A 1U90A 2H4JA 1HZJA 2YMMA 1DXYA 1ZWKA 4EDFA 4H3SA 4XDHA 5JXJA 1QMGA 1ZL2A 3D4OA 5J2TA 5C1IA 5FUXA 4TV8F 3UJ6A 3ZPXA 4JJ8A 4MUEA 4RM2A 4DRZA 1J8MF 5CIWA 3CM0A 4NKRA 1KBZA 1UT5A 1WDTA 5JECA 3DM9B 2JJQA 3TOCA 2ZRMA 3I1FA 2EX1A 3RYTC 5JASA 4KI7A 3EAFA 3HPRA 4N5LA 2P7IA 3RARA 5DX8A 1U4OA 1TM5E 2C4NA 3QPDA 2RK6A 1E79A 3WIOA 3REOA 4KK4A 1H1TA 2PT5A 4JYMA 4B46A 4HADA 3U7EB 1ONNA 5LQNA 4FX5A 1M6YA 1PHPA 2B36A 1FYDA 3UMJA 1R3UA 2TYSB 3RRFA 5C5DA 3H6HA 2ZIGA 1PEAA 2IXGA 4KDEA 4BKQA 2AJCA 2J9XB 4IDQA 1ZD3A 1QPBA 3CEPB 3LHSA 1YDGA 3QWAA 5KCZA 2XD4A 3PUYA 5F7JA 4AIIA 3PFBA 1JP7A 4BNJA 2AUMA 4JYAB 5J40A 3BMNA 1WXXA 5LMNB 2X8WA 2PLNA 2Q8NA 2V7VA 3PXXA 4EM6A 4EVIA 1F48A 2QDXA 3QU2A 4Q9NA 5HCUA 4A92A 5JH7B 1YQDA 2I9PA 5IT0A 4YLYA 1AU9A 3FH0A 4FN5A 3OICA 4AD8A 1PGQA 5IASA 4KVZA 3FCYA 3B20A 1YS1X 2JGAA 1QLJA 4OHVA 1GTMA 4H7FA 3MS4A 1ONOA 4PXAA 2QN9A 3OIGA 4G4SP 4RZHA 2QOEA 3GP3A 2PGLA 2AHRA 3A1WA 3DL2A 2MSWA 3DEYX 3PF8A 3QOFA 1L5WA 1R0ZA 3UA3A 4JR1A 2VN8A 3FVTA 1OD6A 5EZSA 2BFDB 1NN1A 1DC4A 1RT9A 4OUDB 5FTKA 3WNVA 1E9DA 1W73A 2OSVA 4KVFA 5EN4A 4DJEC 1MNAA 3O1HB 4PAMA 3CEMA 4BZZA 2E18A 3CW2A 1ND6A 3HS3A 3I5AA 1OA1A 2XVZA 4QDJA 3ZJ4A 4BBZA 2XMPA 1J0AA 2PGOA 1WUIS 4KN6A 4PAWA 1OVMA 1Y7TA 5CNIA 3ND9A 4PLYA 2V9PA 1T5DX 4A82A 2UZ0A 1SBIA 4ZEXA 1R0BA 1TA9A 4AY2A 4GKKB 1K2WA 3OE5A 4AIRA 2PKXA 3I53A 1WDLA 5FTMA 3KSRA 3P0RA 1FFEA 1W6UA 1WEKA 2C2MA 1U0LA 1DFIA 2GAIA 2JFZA 3CBGA 3EOBI 1DXHA 3Q4GA 1MAVA 4HI0E 2IF0A 5F1YA 4ARUA 5CR9A 1FBTA 4XQCA 3D0OA 4AMUA 1RWNA 3G8DA 2ZJ3A 4H1UA 3AESB 1E4YA 5EKDA 3U16A 3P4UA 2PV7A 2Q7DA 1Z5OA 4QPNA 1D8AA 1TF5A 1P9WA 2XVAA 3GLKA 1MO5A 1VM6A 1Z4KA 4OHXA 5ALNA 5HSGA 3HA3A 3OBIA 3OZTA 3P26A 2HA4A 4N5MA 3UW1A 4CMBA 1YQTA 3X1XA 1KJYA 4WDRA 3CRZA 2P2YA 2ZJ4A 3F96A 4JASB 2V5VA 2PO5A 1WQ3A 1ILEA 5ALWA 1I4WA 3MAJA 2OCBA 3FNHA 3OEED 4BC1A 3HWRA 3K9QO 3N74A 1C9JA 2W58A 4LHEA 4KSBA 5AM3A 2QM7A 2RC5A 2W93A 3KLPX 1W34A 2BGTA 4TMFA 1GGKA 1TJ3A 2B5WA 2GF0A 1PUJA 1T8WA 1TYAE 3DVQX 3F1KA 3ILSA 4PY2A 2PFSA 3FCXA 5AJZA 5H7XA 1ZR4A 4ETMA 4PX5A 4TZTA 2PDAA 3SX4A 3IIEA 2WKPA 1F14A 4YDSA 5E3IA 5KOJB 3JASA 1EVEA 4LHXA 3LSYA 1W94A 3V46A 4BCDA 4DV4B 3G2KA 3TCNA 5JD5A 2WZBA 3BGSA 4INAA 4I46A 3UHAA 1KZHA 1YH3A 2XYHA 4FBLA 4TLMB 2QPLA 4B32A 4ZT6A 1SXJA 1CUWA 4FCWA 1IXSB 1OMOA 3F6BX 3FSGD 5LA6F 1QIJA 3PEVA 4YACA 3VSDA 3PUKA 5E8JA 1L4NA 4D26A 4PYLA 2B7CA 4GZ3A 2KLHA 3PVZA 3ZWMA 3NKFA 3R3XA 1TYEB 3QYAA 2FW7A 4I36A 3W04A 3GJQA 3O73A 2DQKA 2C95A 2F7SA 3CX8A 2XHEA 3DF7A 4ZYTA 2W6OA 1QB8A 4U7JA 1X1TA 3JAMA 4KXVA 3FTQA 3RT1A 3C4QA 2QXTA 4RWZA 2O8VA 2X2EA 1IY2A 3CRVA 4GOMD 1QNFA 5EGNA 4LJ9A 1KYQA 5TPWB 3ABIA 3LUAA 2NOAA 3STTA 3SXUB 4EO4A 5G40A 4BEBA 4BNVA 3N8DA 1TMYA 4DNPA 5I4CA 4OGLA 2QDKA 1B0ZA 4B6QA 4ES6A 1KMHB 5C52B 1ZCZA 3GA7A 3IB3A 3GJ6A 1E59A 1JMYA 1ZLXA 1FNDA 2VDVE 2Q5CA 2WNIA 1P0FA 3BHMA 5LMUB 4DG5A 1Y63A 2RJOA 2VYFA 1O6ZA 2MMCA 3IR7A 4H3KB 4FYJA 5IP5A 4UEOA 3ZS8A 5AW3A 4DUZB 3IODA 1UK9A 4KXFB 3BDIA 2G09A 1Z5UA 4JFRA 3IHTA 5AP9A 1Q6YA 3KYIB 4I55A 1NVFA 3INNA 3IDSA 4RM3A 3UF0A 3X1YA 5BR4A 1XZJA 1PL0A 5DEIA 4B6FA 2JRCA 2O6LA 3I62A 4LXGA 3EN0A 2UKDA 1GAEO 3TQQA 3P9PA 3WKAA 3ZUPA 3TI9A 3H65A 1RDFA 4G5HA 3VSAA 2BFEA 2DYKA 1EGAA 3SY8A 1DPFA 2BEJA 3JQRA 2QTZA 2XAAA 2ZJZA 3MJFA 1E3SA 4K0KB 1A9XB 1HUQA 1RP7A 1THMA 4HMOA 4YAOA 2J85A 2FN4A 1YKSA 3DP9A 1N78A 3KRTA 2I4RA 1CEYA 2RB4A 3CLSD 4O1MA 4RD4A 4U7PB 4JUCA 4OL0A 3M33A 4D99A 2OOSA 4K87A 4LDZA 1W8DA 3I6YA 4JYPA 5HCNA 4QM6A 3S70A 3WFJA 4BVJA 1HE5A 2WMNB 3SE0A 1I3NA 2HMYB 4CDMA 4EHDA 2A59A 4XJSA 3NYIA 1G42A 2HA6A 3PLRA 1QYWA 3TGWA 7REQA 1J56A 2NWQA 3CCFA 3FHCB 1SN7A 1NZFA 2A5FA 4Q3AA 2EZ9A 4EIWA 4K9PA 1XXHB 3G1UA 4F5EA 3N2EA 3LWZA 5J2UB 2UYGA 3K4QA 5ENDA 3OT4A 3FVVA 3DV9A 1SG9A 2Q4OA 3GHYA 1I51A 3ZX5A 3ITKA 1JG2A 4FXOA 4NBRA 3JWGA 4UVEA 5CCEA 1BH2A 2PKRA 2W9XA 4AJHA 5EHGA 3NIGB 3OA0A 3TR6A 3CUYA 3WGKA 3K0BA 1E89A 2YWGA 2DR3A 3LBFA 3OJCA 4KIUA 4PLZA 4QOGA 2BONA 3KQOA 4Z9AA 3VZCA 4BFCA 2NU8A 4EBBA 5LN1A 1VMIA 4U8GA 2QTVB 3K0CC 2VWQA 3GMIA 1N6PA 5GJBA 5HHTA 4XPIB 5CYPA 1T1IA 2GX6A 1WMBA 3WAKA 2WIKA 2JKYA 3AFMA 4HDMA 2C4WA 1HRDA 2JZNA 4P31A 4Y3UA 4QTXA 1TUBA 4D9EA 4IEIA 3V1NA 3K8YA 2G9ZA 1OI7A 2HR1A 1A2OA 1ZA1A 3PJGA 5JSZB 1T8PA 1NQUA 2JASA 3RGWS 5HUQA 2IH4A 1VJ0A 3DDCA 3TLGB 1DWUA 1Q1AA 1GPKA 2P91A 3EMVA 4RESA 2JGDB 3TTUA 4KYTA 1SURA 2A94A 2AOUB 2HHLA 1W4AA 5KMGA 3EIHA 3I73A 3VVBA 4W5QA 2Q0SA 5KHOC 3SIRA 4B3CA 2REXB 1AHPA 4BMNA 4BFTA 4WOJA 2XF2A 4FGJA 4RZSA 1RCUA 3F4LA 1JQJC 3ZVRA 4D82A 2PUAA 2C20A 1UBRS 2NPIA 4R41A 5LLTA 4Y9TA 3U5TA 4KNYA 3VDRA 3QUCA 4D74A 3Q3EA 2AIRA 5CK5A 5C8YF 1RWOA 5EJGA 4D0GA 1JLLA 1XZFA 3MMSA 1NBMA 1K0FA 5TB5A 3LD9A 4DYHA 1X86B 5JYDA 2AXNA 2FSVA 1SMKA 3HXMA 2VK2A 4J0GA 3VYUB 4C4OA 2ETVA 3C8MA 3L4KA 1CW2B 5SYMA 1Y1QA 1XLVA 4TYYA 2O7QA 3EZGA 3RVJA 4JJ4A 4X9XA 3I6ZA 1AQJA 3B53X 3FIUA 4OGFA 1XFAA 2NUAA 3COVA 3EULA 3N58A 4MAAA 2FMTA 2KBFA 3IDQA 2V0NA 5JMTA 4HDCA 3ROGA 2H7XA 2VOEA 4CKYA 5JANA 2IKQA 4YB8A 1P4SA 3KYCA 1KDPA 5KO2A 5EWMB 4M1OA 1ZD8A 2ZWPA 3ILHA 4MMZB 4I1VA 4TRRA 2ZIWB 1Z45A 3G9UA 2PKCA 1Y3DE 4MKZA 1JJIA 1KH3A 1OIXA 1ETHA 2Q5HA 2J0QA 1DVRA 4CEHB 2CLSA 2OLJA 3JAWB 2Q9CA 1W93A 2WJZB 3QF7A 4RO0A 3GX1A 5ILQA 3UANA 1TQHA 3UXYA 5LB2A 1GRVA 4CM4A 1PQ4A 2I8LA 1B6GA 2WFZA 2FPIB 4H31A 1E99A 2WWHA 1RKXA 3QVJA 4OHBA 4TS3A 2XMDA 4PC3A 5HXAA 3QXCA 3VMMA 2E0IA 4G86A 2J0UB 4R2HA 3UWKA 4C0AC 2JFYA 1BE8A 4L51A 4P38A 2AD5A 1KI1A 4NYIR 4ZALA 4DEXA 1Y3HA 4JUAA 2Q6KA 1U7ZA 3OPYB 3MTDA 2VJOA 4C2AA 3T5CA 1Q17A 1QGAA 1RE0A 1W2HA 2FZ4A 2R60A 1M7GA 3QOWA 4JD5A 1C2TA 3M34A 1BG6A 2ZBFA 4UM8B 2AA3A 1S8OA 2AEFA 2AV6A 4RZXA 4XYGA 4ZARA 3WISA 4EA6A 13PKA 4O33A 5EZYF 4UFOA 1V8ZA 3HJRA 1DE0A 4ZQEA 1JV2B 2Z4TA 3GCDA 3D3EA 5DCUA 3SZMA 4KIJA 4KR2A 1Y6RA 2I6XA 5G41A 3B3FA 3T9DA 1EM8B 4NAVA 4TWRA 1VB5A 4TRNA 1Q0RA 3CUKA 1ZM9A 4MDYA 3EODA 4HDRB 4FFLA 2X0EA 1MJNA 3L0YA 3D4LA 2PXHA 4WTOA 5D3MA 2RI0A 5HK8A 2Y71A 4MUIA 2RK3A 3WICA 5LL6P 2YJZA 3EXFB 3NAQA 5CXXA 3VKHA 2IIVA 2DFNA 1MT3A 3MTGA 3NAGA 2O8BB 4HLCA 3KVVA 4M9ZA 1X13A 2FETA 3UWDA 1WZIA 2ZWVA 4HS4A 1JBEA 4QOIA 3E9YA 1UZAA 2HQBA 2OGZA 2QYHA 4AMYA 4BWFB 4BFLA 1A50B 1EXNA 1YDWA 1PFWA 4LJYA 1J97A 2RCNA 3N7AA 5AW0A 4FJ2A 2Y1OA 1MO3A 3K9CA 5CCXA 3ZOZA 1NUPA 3TIFA 2PFGA 3C98A 1I94B 4BNIA 4TGLA 2P2SA 5K3SA 3MYRA 3GEDA 2DLDA 3VTAA 4UVGA 3VR3A 3VR4H 1TJYA 4ND5A 3I5UA 5FFFA 2YV1A 4REMA 4LZWA 3L7OA 1KZGB 4YPVA 1XJQA 5A9SA 1PV2A 1K68A 4KQKA 3PX7A 2WU0A 3H2ZA 3N6XA 2VSOA 3EIFA 3HKBA 1KQOA 2FYTA 4YJFA 1KQPA 3QBTA 5TF0A 3R7WA 4G5OA 4WINA 2GO7A 2EW2A 3L4EA 4EYEA 5BN3A 3GLHB 3IIJA 1XCPA 5DYYA 1F8FA 4H4CA 1CQWA 4YRQA 1JR6A 1P31A 4PQEA 1OQAA 5F2NA 2D74A 4OK6A 1NRIA 5H9VA 2PVCA 4KR6A 1EFPA 3ND6A 2PUJA 3BXHA 1OWMA 2FN7A 3PS9A 2BIFA 3DT8A 1CQIB 3GVIA 4R1SA 5F77A 3EDOA 2XEDA 4KXQA 4M7WA 5BW6B 4K40A 1HV8A 1NLFA 1TD1A 3ELWA 3FUVA 5BSKA 3M7IA 2E5WA 4MQEB 3TNLA 3VNQA 3IPRA 4URXR 4BMDA 4WFJA 3V1UA 1F0PA 1O94A 1RHMA 1SULA 3L7MA 4UNNA 4F38A 1EFRA 1GLVA 2VRCD 3ZXYA 1CS4C 4ALMA 1KAMA 3BVPA 1GA6A 4QDZA 3RC9A 1MHPA 3TOSA 4HLNA 4OMFG 4RU1A 3P9CA 3IKLA 3PIDA 3QSGA 4I3FA 3O90A 4TTJA 4ECAA 2XGMA 2K2QB 3D6NB 3DQZA 4I4TA 4E94A 3A4VA 2QUHA 4JDUA 3WA7A 4XW2A 2CT8A 3GRVA 2ZTMA 1JG6A 3GDWA 2BM8A 4D56A 3WL4A 3OKCA 1MO2A 2Y4OA 4OYRA 3G9ZA 3TZEA 1XCGB 4AU1A 5F21A 1A82A 3SKYA 2OCDA 3MMNA 2F8MA 3Q2IA 4IHJB 5H68A 1X1EA 3GR6A 5K05A 2GZ1A 3CXRA 4AECA 2OCAA 5CLQA 3ER8A 1YR3A 3LRPA 2GYWA 3AP2A 2XVYA 1KJZA 2D5IA 4BDTA 4Y9SA 5M3BA 1K9VF 3C6KA 5DBIA 3EWSA 2WD9A 4M1QA 4UEWA 3PR3A 1SNYA 3FFXA 2NXWA 1XSEA 2PVPA 1QS0B 4K88A 2OD2A 3DC7A 1BW9B 2HREA 4UQOA 3SNKA 4CFSA 3T35A 2XJ4A 2P5SA 4CG1A 5AFSA 1CCWA 1MV5A 2QD3A 4QTUB 4BV2A 1KZ1A 4Q47A 4QXAA 2QSJA 4YMVA 2GAFA 4TKVB 4BTVA 4DBLC 4DDKA 4F71A 5T4BA 4R84A 2RHMA 2QP9X 1JEAA 4IF4A 5KTTA 4M89A 2CL5A 3EGDB 1BXGB 1HYQA 3W5SA 1E1CB 1TQ8A 5L6MB 2EIXA 2R00A 3Q1LA 4UUNA 3D8UA 4V38A 1GYQA 5SZKB 3SZOA 1QIKA 4JXXA 4L8YA 1T3TA 1QV7A 1IH8A 5EUCA 1A8PA 2CJXA 2XKJE 3JQAD 3W3AA 4V3CA 2XH8A 1OWNA 1J2JA 1B6SA 2IYVA 4DG9A 4KO4S 4YONB 4BJHB 3JVIA 2XWJI 3BQNB 3KBOA 3R3JA 3V4OA 3FAZA 4GMKA 2UVDA 3C6YA 4GX5A 4X8MA 3A4LA 4JB3A 5H02A 5J5VA 4UM9D 1Z34A 4EY7A 2Q46A 5KVSA 2ZRIA 4M1ZA 3SEQA 3E7WA 3RK0A 1HT3A 4NJEB 4KREA 5JAOA 3PCTA 4CCSA 4DNXA 1TIKA 1IN6A 3TRFA 4A3SA 4NH4A 4RY9A 4XE5A 3BD6A 3MXTA 1S8AA 3Q8LA 1SPXA 4CTKA 1TMKA 4UHBA 4U7HA 2RH9B 4NTZA 3I0ZA 3RIHA 1L5GB 1J2UA 2QS9A 4NHOA 2YW2A 5JD3A 3PENA 5ALQA 5EIOA 4AJJA 4II7A 4R0NA 1S2MA 3AVVA 3PG5A 3V4ZA 1NNI1 4M46A 4BFSA 4MCJA 1GR1A 5AM0A 3WLLA 4K9RA 3EQ2A 2LCQA 3FRIA 2HU8A 3H4IA 3ADOA 5CGZA 1Y9DA 5F12A 2CLHB 4W7HA 3B48A 1RRVA 5LJIA 3M9XA 4JLUA 3BC1A 4K1XA 1MFZA 1ADGA 3TM4A 1VKHA 1MPXA 1CWUA 2V45A 2XE8A 1ISFA 3TQRA 2O3QA 4XSGA 5FTNA 4U2KA 5A4DA 1E9VA 4BQFA 3P5BA 2KYRA 3AR7A 1RKBA 5GZ3A 1BMTA 3OJOA 3MWLA 2IHNA 3LVBA 3JV7A 1TGYA 4JB2A 4D5GA 1C1DB 3DULA 1Z17A 1DBWA 2ESRA 5JISA 2HF7A 3O8NA 1GILA 4C6SA 4BX9A 2YC4C 1Q3TA 2IUSA 4OJQA 4S24A 1Q7BA 1EHYA 3BN3A 4R05A 4Y9DA 3GEEA 3U17A 5IBPA 1PT7A 5JT1A 4WLUA 1N25A 3A9SA 1K92A 5CM8B 4BNFA 2QTTA 1NPDA 3RREA 4PN3A 2YBEA 1FDVA 3H0CA 3JU3A 4NBSA 2C1ZA 3CEJA 3C7KA 3HU3A 3HJFA 1FTQA 1GL6A 2CJPA 4ECEA 4UU8A 1EAMA 5CX1A 3DC2A 3Q7QA 4AJNA 3F8SA 5JQGA 5E6SA 3KCNA 3OHSX 9ABPA 1YZUA 1IEWA 1EZ4A 1O6FA 4IOJA 1TPYA 3CRRA 4H4EA 4P33A 5F3RA 1WB5A 3W5CA 1Y6ZA 2OHOA 2WM3A 4CMEA 3AL3A 2RGEA 5SY9A 1JTVA 1TT5B 2XIQA 2A4KA 4MINA 4MVCA 1ZH4A 3L01A 3S2ZA 3EMBA 2YY7A 1O4VA 2GPWA 3QV1A 4ARAA 2G08A 1CU1A 3P2OA 1QRSA 1BVUA 3IS3A 3GVHA 2FMXA 2GZRA 3W2HA 4JJGA 4HDSA 1KBOA 3T0FA 2LGJA 3RS9A 2QJWA 3VZRA 2C4KA 2WZCA 4DF3A 1RS0A 4C5BA 4KL8S 1J7KA 4BQRA 5KVVA 4TL9A 5H81A 1RTTA 1LTKA 2QW8A 2QRUA 4HDQB 5EVJA 1J0CA 1WHTB 1R50A 2XW6A 1JHZA 4PRKA 2W00A 3R7LA 2ZRQA 3SF0A 4E33A 1FJXA 1GSAA 2FG7C 2PH3A 3BB3A 2V7WA 3ER6A 3PKZA 4XVUA 3HU1A 1UWVA 1KK0A 4DN6A 3KKQA 4B47A 4E5YA 4BZQA 3N05A 2O06A 3V8QA 4E09A 1H4QA 4MQ6A 1C3OA 1II8B 1NX6A 3AOGA 5EZ6B 4AS1A 2Z09A 4V0LA 4NG4A 5CH8A 2AOVA 2G9UA 4D8YA 4EB6B 2KQUA 4RE5A 3VFDA 1ZY2A 4AQDA 3PQ5A 3RJTA 4GNKA 2PSJA 1KEPA 2PYIA 3B5JA 4KMOA 1YJQA 3BXGA 4EGAA 3OD5A 4TTRA 2ZSUA 1B6RA 3NRJA 3ML1A 4PQFA 3P2IA 4GX2A 1XEXB 3AC0A 5DH9A 3X1KA 4D9BA 1G98A 2JLZA 1R4MB 1V5EA 3ZHTA 1HLGA 3B78A 1XYVA 4CHTA 3RU2A 3L7AA 3LUKA 5F9FA 3OQ6A 5BXYA 1OBOA 4JC4A 5FQNA 1NN0A 3PRYA 4DJFC 4LE2A 4ZTUB 1SHKA 4J0KA 4PSVA 2IDMA 5BMVA 5HS4A 3KUDA 1C30A 2PX4A 1YTLA 4OHFA 5JD6A 2Q3HA 4Z1MD 4ZJYA 3ZHOA 3RYFB 4J0JA 5I7WA 4EUEA 1NDUA 3D3WA 2HA2A 3E5NA 4LFAB 2FPLA 1I3KA 3N2YA 5THKA 2CZQA 2COUA 2XTMA 2PZAA 4FNMA 4AJEA 5F7XA 4OU5A 4N5IX 3C5EA 3ZU2A 3ZGXA 3EXIA 4GSKA 1Z0KA 3NT4A 1JFSA 3G2QA 4UARA 3G89A 1HFWA 1UC4B 2VF8A 3HA7A 5FQOA 2GCPA 2PTGA 2DT8A 3ZHVA 1SVNA 2NSDA 3H5OA 4YBRA 5AOVA 4F46A 1SXPA 3C6QA 3NYQA 2BGLA 5IU6A 3TCXB 4LYGA 2B4YA 1ZZEA 4EUKA 3ZU4A 1CULC 2BT4A 2J4FA 2WVGA 3DWEX 1RYBA 2H07A 1QUEA 4LVOA 4YP1A 1MOZA 3QNMA 3WLNA 1YQXA 3HDQA 1AZLA 1G0NA 2VQ6A 4M9CA 3PE4A 5ICSA 1K8YB 4W5HA 1PTKA 4C7VA 1CP2A 3VKWA 4RS3A 3K0FA 1EG7A 5J59A 2FW1A 3M82A 4R31A 1QV9A 5ESXA 1A9TA 421PA 3JYQA 1CB7A 1IWOA 5JLAA 3CNOA 2PRSA 1G1MA 1HRKA 3GHHA 4M0UA 4BLWA 3SBXA 4DEVA 3AILA 1F4PA 2VNJA 1NBHA 3NJ8A 5AESA 1UBMS 1JXAA 3C1OA 2OV6A 2VP3A 1JLKA 5BWOA 3A10A 4RSHA 3SZ3A 4G0WA 4HJXA 1NNLA 4P93A 4YECA 3T9FA 4Z0NA 5ADHA 1QXSA 5GVRA 4EFDA 1MT0A 2JARA 4KE8A 3S2UA 1BWRA 4HRXA 2PR2A 2PMEA 1QP0A 1LPPA 3I09A 2XODA 5HMLA 2A3RA 4YHHB 2VC2B 1YT5A 5FI0B 4RS4A 1JMVA 5GY7A 3CLVA 4CRWB 1GJRA 1X0VA 3I8OA 4FIDA 5KB3A 2Z2ZA 3L8GA 2AH5A 2YQ5A 2JGIA 5KBYA 2ZUVA 5EMJA 2JA1A 1MABB 5K4AA 1EVIA 3VPXA 5A5FA 3G9TA 5JNRA 3A1CA 3LT0A 4AC9A 1XVVA 3UH0A 3FUWA 4A2QA 2ETXA 4RTSA 5TXGA 2VEDA 4Z3OA 4ZDWA 4I0WB 2ZQZA 3HU2A 1KI6A 4ESHA 2WICA 2BC9A 1XCBA 3DE7X 3K9HA 4HB3A 4DZTA 3GLIA 3LXRA 1U28C 2IWHA 3VR4D 1XG5A 1LQUA 1YZNA 3JZAA 2CDNA 3JQ7B 3TTYA 4O1HA 1JRLA 2PX2A 1KF0A 4X92A 1P6QA 5BV0A 5G0VA 3ELYA 1ZM7A 5A06A 5IMSA 4ZOLA 2ZAYA 3AUSA 1WSWA 3KPJA 4CIBA 1B76A 5KZMB 3IRUA 3KP1A 4XQ9A 1ESDA 2QN3A 4M0EA 2MMGA 1NFFA 2OBFA 4U6NA 1E9RA 4M1EA 3DNMA 3EY4A 2Q5JA 5FUBA 5GGYA 4CCYA 1M7BA 3DF9A 1WW2A 1GPWB 4M9UA 1X1QA 2GN2A 3HGTA 3DDWA 2W2XA 3SSOA 1P4AA 3WNZA 4DOMA 5JCJD 1J24A 3C45A 1OXBB 4D4JA 4Q03A 4KIWA 1X7XA 2IY7A 3OLWA 3UWPA 3S2FA 2J9ZB 4DLNA 4URWR 3AP3A 4IDGA 5FCDA 2P8SA 2VDJA 1ZVJA 1EEHA 1CZOA 4HN2A 5AHOA 2W2TA 1HPLA 3PT5A 4MEBA 3TQFA 4BIIA 4ZPXA 1ONSA 3B1WA 3H1BA 2YWEA 1NQVA 2HF2A 2JIZA 1TF7A 5HJ2A 1EESA 3R76A 3X43A 2Z6QA 3CCBA 3K5HA 3WK8A 3VV2A 1XELA 1D6MA 1C0KA 1XQWA 2FP3A 4WPGA 5SZJA 3VO9A 1OW3B 1T4GA 1ZFNA 4O0LA 5C3UA 1LDGA 3P19A 2HLNA 4ZI7B 2D0OB 1R10A 1UPUA 5DHUA 1G18A 2NTNA 3OWHA 2H1SA 3H2HA 1VSVA 2OM6A 1KEWA 1W0JD 1UJ6A 4S3MA 3V4LA 4J8PA 4PFQA 3PXCX 2DZDA 1MB3A 4DBLE 4BP1A 5TGDA 2PKWA 1GCGA 2XGOA 2YRFA 2G0NA 2WE7A 4PSAA 1BVHA 4GZLA 5AI8A 3VOTA 4N6GA 4MUJA 4A8HA 3CVUA 2W83A 5IVIA 2I34A 1JJBA 3NR2A 3A6GA 4GR4A 3I5YA 1UZMA 4HB0A 4OXYA 4WCFB 5TMBA 1KKUA 3EXHC 3WQRA 2DULA 1UM8A 3KZVA 2IVFA 1IB6A 2Z4SA 3VH1A 1BC5A 1W49A 1RWMA 4JLNA 4PX9A 4N8SA 4AZ3B 4DCGA 1MD9A 5IULC 3W6NA 4BTEA 3ZJUA 4MNTA 3I83A 4MQBA 1RIFA 1UFRA 1OKKD 2YMPA 3AU8A 4HDKA 4W7SA 2SKEA 1O97C 4GBMA 4AYTA 3RSZA 1REQA 1A4UA 1EINA 3GLVA 2N46A 3R09A 1N6OA 3AHIA 2F67A 3GMTA 1K8RA 2PAAA 4P32A 3C3YA 5A4KA 3AL0C 1S3GA 1XL0A 4H7KA 3U4QA 2LCIA 3ANSA 1HG1A 3D5TA 5DN9A 1KNQA 2HO4A 2QQFA 5F1OA 1X8KA 1TKAA 1H5NA 3LLSA 3OF3A 4DSOA 2Q4TA 3W5AA 2B9VA 2YYSA 3NQ41 5LXTF 3UYLA 1NR1A 1THZA 3HDYA 4RUKA 1TK3A 1XRPA 3TCKA 4RL6A 5H1YA 5AKGA 3UJ3X 3B6MA 1RJFA 2GAAA 4WBNB 4JP8A 3CNHA 4WERA 5F2KA 3IP8A 4TKMA 1VPTA 3AERB 3IXQA 4G5SA 1PEKE 5KDLA 4CIVA 5ALOA 3KXDA 1EGHA 1K5GA 2Q1YA 2HAEA 2N1MA 2PV0A 1AS3A 4KAXA 3TL2A 3HM2A 5GJCA 4C6RA 1ST3A 1B43A 3GARA 4OXNA 2JH8A 3IGFA 3COPA 1RC1A 5LOVF 2FAXA 1FFXB 4B2YA 1GP2A 3LWBA 3UXHA 3KUKA 3JQGB 1JT9A 1EWKA 1ORHA 2H8KA 1U3TA 4DHEA 4F5WA 2ADFA 3DMGA 4OY3A 2XRZA 2Z58A 3WP0A 1ADCA 1BE0A 5GOTA 4YBZA 4P3OA 2ZTHA 3UAVA 1JDTA 4DRYA 5I45A 3I04A 3QZUA 3RJ9A 2GR9A 2GD1O 2FCAA 1U7UA 4JXKA 2ASEA 3UB2A 1BDBA 4MB2A 4B48A 4YMHA 1NG9A 2E1RA 4FC7A 1VG0B 3GGCA 3WBFA 3AIKA 4ZO8A 2OESA 4RMNA 4M4SA 3ZJYA 2NXNA 3LL4A 4WZBE 3RPEA 1HX7A 3D3JA 2PGJA 2C4TA 1TNDA 1FMLA 4XCXA 4C87A 3UM9A 6Q21A 3H04A 2PUBA 3I04M 5BNIA 1O4WA 1R5BA 4ACBA 1SBNE 4Q9KA 1OFUX 1DX6A 4CQMA 4HQLA 5HUJA 1T9GR 3OQBA 2XYQA 1LK5A 2QLMA 2YW9A 1JPNA 3RR2A 3ZQ4A 4MUKA 2IPAB 3KR9A 1NT2A 1DEKA 3ZI0A 2FU5C 3HCWA 1JHUA 2WV9A 5K0SA 5D1NA 4HV4A 4Z1MA 4ZCTA 1I2ZA 3G5MA 4MB6A 4UTXA 2XTAA 1K97A 1B8UA 3QXHA 4PG4A 2O50A 3LLUA 4QPPA 3DDOA 4X95A 3PJFA 3GUUA 4FE4A 5DP2A 1Y9ZA 1SUDA 1KL7A 2HOQA 3C24A 4MYHA 1TU0A 1MJGA 2QR2A 2PJRA 5GV8A 1DT5A 2FR8A 3DL4A 3FYTA 4WNIA 3PA8A 3SIXA 1GPLA 4CKWB 2ZZMA 4YCJA 1U6KA 3ZLUA 3CXUA 1R8JA 2ACWA 2IPXA 3NOOA 4GGMX 1CFJA 4ZZ2A 4MI3A 5I7OA 1PUXA 3THOA 2H59A 2QPOA 3MJEA 1LFDB 1ATZA 3HNRA 3N2NA 4CMIA 4FP9A 2W6PA 1G8PA 4GMFA 5U1PA 4HQ6A 5C1PA 5K6AA 4OB8A 1FSPA 1FP2A 1E4VA 1JE1A 1LBSA 1FZQA 3K0AA 3O2JA 4GFDA 4JA2A 1N7GA 1Q14A 1L5SA 1ZDMA 2OFOA 4RF3A 3WOHA 4BAZA 2Q2QA 2GJKA 2O2YA 3DMTA 4JUFA 5F5XA 1LRLA 3R9IA 5K5EA 4OHYA 2NT4A 4NJMA 3WMFA 3R3VA 3ADKA 3ZWVA 1RI4A 3IKMB 3E3OA 3ZWNA 1VI5A 1Z6YA 2IBMA 2FP4B 1PX0A 2D4HA 3UWSA 1L8LA 4O2AF 1QGOA 1Z74A 6YASA 1JA0A 1EZZA 1NBIA 2IPNA 5HJEA 7MHTA 2JJ1A 5BQFA 1GPBA 2DH5A 4O4LF 4H35A 5A02A 1SC9A 2Q2VA 4IXTA 1NYRA 5MFPA 3D8BA 4LY9A 4Q1BA 3QX7A 2VHTA 2GPSA 4W5OA 4D1YA 3I2KA 2G0TA 2LCFA 1OH6A 3C3PA 3CLUC 2QRKA 3RYHA 4FHGA 5A62A 3NGXA 1DKOA 3HCDA 3NHSA 2OO7A 3DO6A 1UMCB 1EK6A 4IQ4A 1V71A 2B21A 4J7CA 1PGOA 2EFYA 2FK7A 3VRHA 2P4UA 4IS2A 2EAUA 5U9CA 3PV0A 4JBXA 4LWZA 4D45A 2AC2A 2RGBA 1KP2A 3H9GA 2ZRFA 3UV3A 4DLYA 5BRJA 4DQKA 5L51A 5B7PA 1W9MA 5IJAA 4BGEA 4X65B 2FPWA 1VCIA 1QFZA 4NZ9A 3OLYA 2QSUA 1LDYA 1GPMA 3DAOA 4G1VA 1QO7A 1YUNA 3R3SA 3QLJA 2Y0PA 2QVYX 3BJZA 4QTTB 4W1RA 4ZOCA 2QR3A 3S68A 2VAWA 1CERA 2PL3A 1BOOA 1SC4A 3KZCA 4RA9A 3JRWA 5C8YA 2WHEA 3KKPA 3P0EA 1UKEA 2O20A 1VG1A 1L9XA 4Q39A 1C41A 1ZNYA 3RRBA 5LPNA 1MU0A 1BD4A 3QVOA 3LPAA 1PJTA 3GT4A 1YS7A 4FMCF 1A76A 1BHSA 3K09C 1I7NA 3T41A 2A58A 3ROQA 4AG6A 5TPZA 1XO1A 1D07A 2W6JA 4DY4A 2FCRA 3GOHA 1KVRA 5C9ZA 4HWKA 4NYMQ 2QIOA 5AVWA 5L7WA 3LT4A 4LMBA 3TFQA 3E7FA 3UJBA 3G88A 1UKCA 4QDKA 4DCPA 1MRNA 2O0MA 1UOOA 3IJRA 1Q0PA 3MB8A 2YN2A 1CHNA 4BU1A 1D0SA 1TM7E 4LRTB 2OM2A 4CLDA 5LZ7A 4UCXA 2DT5A 5TT1A 3W34A 4ZO7A 1XU7A 2NQ8A 3T52A 1YK0A 1E9EA 4IXNA 5K6RA 4CG3A 4EI8A 1JEYB 1E5TA 1UKVY 1TX4B 3D6AA 1QK5A 3G2OA 1UM9A 3SM9A 3GH1A 5JADA 2HXGA 2QTMA 4Y2TA 2GEVA 1N4AA 3U5ZB 3L6DA 3KE8A 5E1OA 1W59A 3KPVA 5FR2A 1JW9B 4ZHQB 4L9SA 1EE9A 2JJMA 2ZANA 2PLRA 4QOHA 4OHKA 4LCBA 2AW3A 2ZXEA 4HEA1 1DV1A 1O6GA 4KVAA 1CDOA 1CY2A 1FYVA 2OR3A 3RNOA 1BCRA 4QSHA 4F97A 5CXUA 4CTMA 1MUUA 1XMOB 3H5VA 4JLAA 4MPJA 3LY8A 1DB3A 1JJFA 3NETA 4IH1A 4L76A 4QREA 4ABYA 1X8XA 3AXTA 1RQRA 4RL4A 2H9IA 1Q1ZA 3QKSA 5G0WA 4E46A 2I4NA 2B7LA 5KKCA 2Q07A 1RJEA 3CJRA 4RBNA 1KARA 1XHEA 3P9SA 3RU9A 3D0RA 4A0RA 5ALVA 5LQAA 1DDOA 4LOLA 5ALGA 4HDOB 3A9TA 4RVOA 1DS6A 2AOTB 4HQKA 4KLZA 4ZC1A 3ROXA 5LNK1 1SIUA 2J9FB 5EZYA 3ZNOA 3IP9A 5IJ0A 3NIWA 3GGGA 3USES 2QRVA 2VWPA 3GG9A 2BFFA 3AEZA 4F9FA 3STUA 5BN4A 2UDPA 4RD2A 1BA3A 2GCOB 1TL7C 1M0WA 3AEUB 3ACCA 2NVWA 1V7PC 3AV3A 3O31A 4OLHA 4QLBA 3PXGA 4L08A 1X8JA 4N7BA 4EJ2A 2AFHB 4J90A 5GADl 4J9UE 2ZIEA 4YAJA 3WLKX 4CPDA 4QA9A 2HXYA 2BEWB 3OPMA 3GJ4A 3LLCA 1WZUA 4LJLA 4XEHA 5DW3A 4BC0A 1JDPA 1WXDA 3IH5A 2DFVA 3BWCA 4N01A 1XJ5A 3I28A 3PZBA 1SZJG 3F6RA 4FWBA 5TV2A 3ORQA 4XM0A 1OX6A 4B3XA 5ALYA 1E1NA 2WTUA 3G85A 3G1WA 1HKHA 4Q4JA 1BEZA 3FWPA 4NPHA 3FOEC 5AI6A 1ABBA 4EY5A 2B8TA 2YV4A 2CNDA 3O9MA 4REOA 5ITZA 4ESVA 2WMOB 1HI9A 1T2FA 3JWHA 1XAIA 4JUIA 2XYRA 3FM9A 3MWFA 4NC9A 1O8CA 4G0YA 2FUG6 3WI7A 3KPWA 4BMCA 4O29A 4YJGB 1NP6A 1WTCA 1ZK0A 1QPZA 2BSXA 3CZ5A 3FKQA 1SIOA 3FNGA 2FPUA 2YBDA 4EF6A 4F1WA 4G0NA 4QWWA 4EY4A 3MCUA 4FLFA 5JRZA 3L7JA 4D8TA 4U2GA 1RXVA 2HCBA 3KYJB 4S1NA 3QTTA 4ZPJA 4MEAA 2J08A 1P7VA 2ZR0A 1PVVA 1R8QA 8OHMA 1OXSC 2ODNA 2HYIC 4O4JF 3ZLTA 1C8LA 3I01A 3UYKA 4NHEA 2YWJA 4OH1A 3O3NB 1AKYA 1XPRA 1ARZA 1TD9A 3OZSA 5AHKA 3PQ3A 2H1IA 2JFHA 4WK0B 4KTTE 4XWOA 5BUCA 4JLPA 4WLNA 2LIPA 2X58A 2PSHA 3K70C 2EF1A 3GAMA 3O03A 2ID7A 2VPXA 1P2TA 1ZG3A 3DE2X 4E1AA 2O5RA 1FJ2A 3T7CA 4KFSA 2EDAA 2VLBA 5MGBA 3KG2A 1HDEA 3I01M 3RLFA 3AHDA 1O9HA 4J3JA 3RRYA 3DXYA 1P44A 3LPDA 4QGSA 3L6UA 2ZIFA 3ROMA 2YL2A 5LQCA 1Z6QA 2HSJA 5ITVA 1CSEE 1PLLA 2IUFA 2QM8A 2AEMA 4XGNA 1V8PA 3FCEA 2O2IA 4QIHA 3SLKA 3UMBA 1SBCA 3EDQA 2CD9A 2HPHA 4BCBA 1RRMA 4CT0A 3H5WA 4AJKA 1DT3A 5DISB 1Q22A 3BD9A 2DRIA 2PBRA 1YA8A 1IBMB 2AOXA 3DZHA 1E1KA 2BM9A 4ZFNA 2QM0A 4MQ4A 1SRQA 4P4LA 2B83A 1U02A 3H2YA 2VDOB 4OKIA 4XVHA 1OOEA 5REQB 1PR5A 4DR4B 3BXFA 4RORA 2RGXA 2J3JA 1Q7CA 1S9HA 3AIOA 5DM1A 4MX8A 1SIWA 3IHKA 1MBZA 1K3UB 1RM4A 4DV3B 1X92A 2ODBA 4XI9A 3K8OE 2NP6A 3HNOA 1CUBA 2GK7A 3VPFA 1GL9B 4K1LA 1JN0A 3OZVA 5ISMA 1LBHA 3A9CA 3QKRB 4ZO6A 3VTFA 4OD0A 3TVYA 2Z6VA 1CFZA 4H15A 1SUEA 1M6NA 4FSHA 1UXJA 3H83A 5ILGA 5C5EA 3BXEA 2JLXA 5B2ZA 5CMLA 1TA0A 4RH0A 2NVUA 4IG9A 2OXIA 1XMJA 4DXDA 3L92A 3OZXA 4C5CA 1E0SA 3EDCA 4EW1A 1E4OA 1MIHA 1XPOA 4MIOA 3AMVA 3PDIA 2YYAA 7GPBA 2OVFA 4JKYA 3A7EA 3LW8A 4BPBA 3NNNA 3IBYA 4C4RA 5AVZA 4PG7A 1BO6A 4GZ6A 4BNYA 3NNSA 4AN4A 3KO8A 4EVQA 3GLFE 2HQRA 5LP6A 1A9SA 2HHAA 2JLBA 4IDPA 1SD5A 4TSFA 1DAPA 1RLTA 1YCDA 4ZREA 3T94A 5JAUA 2O8CB 1EUDB 1VMAA 4FB4A 1YS6A 1EUCB 1XZGA 3D6TB 4C7OB 1XV5A 4IEFB 5CB8A 4MYSA 3WWZA 1K8XB 4HX9A 4DS3A 4NXMB 2E37A 4Z6KA 2NUPA 5IW8A 2EW8A 4CT5A 3IJEB 4F4UA 2ONZA 1U80A 2VYCA 4X6LA 3ZJ5A 1ENYA 2GPYA 3W5DA 3VTZA 4D3DA 4PICA 1QHEA 3TRJA 2F90A 3UZUA 4HFRA 1SXJC 5E4TA 3BD7A 3R4VA 4TXLA 4MITA 2XJ9A 2A6PA 1GQOA 1PGPA 3NXSA 5CDTA 2CFRA 3OE7A 2XOEA 2ZUCA 2ZWAA 5DNAA 5CB0A 3S8YA 1CE8B 2O1WA 1N6KA 2IL1A 1P73A 3F4BA 1M2JA 1QG2A 1H1DA 4P6VF 2CHEA 4U63A 3GJYA 3PDHA 5ITWA 1P9RA 4O5OA 2Z6UA 3AG5A 3LC7O 3U61B 1EHIA 2CL0X 2WU1A 2XB6A 4DVJA 621PA 2HMVA 1W44A 3T7EA 4MLPA 5HF8A 3F6EX 1LLQA 1FTYA 5FDFA 2MDTA 3X2FA 4CL0A 2C4UA 4K86A 1OXMA 4WVLA 1FQKA 1V3QE 4C7BA 2FPOA 1JU9A 1YVEI 1U8CB 3CWZA 2FPPB 3JYOA 4ND8A 1Z68A 3O8OB 1NIPA 2P0YA 3RC1A 3TJZA 4MW4A 4AF6A 4E32A 2A1UA 2HWKA 1COWD 3T9BA 5TGZA 2HSGA 3F7TA 3HLYA 5KVQA 3VYWA 2C92A 4D2IA 2NUTA 3TJRA 3ZHSA 4W5TA 1KDOA 2AQ8A 3KUXA 2Z98A 5AJUA 2BMEA 3KOZA 2O5EA 1P6XA 4I14A 1JHAA 3U3XA 3ND5A 2N9UA 1ZIYA 5FNVF 4QYTA 2YS6A 1WPQA 2P1RA 2ZB2A 5IEBA 1T36A 1T1GA 4BRUA 5BYKA 3WJ2A 1JU3A 3WLQA 1ZJJA 1FX0B 1QTIA 3V4VB 1SUWA 2XMZA 2ZI5A 4FR5A 4KITB 2IS2A 1YQEA 3TZBA 3CU5A 5AVUA 4CHGA 1YO6A 2G5CA 1EUZA 3OJWA 2YY6A 4IIVA 3T6KA 4CN9A 3TDKA 4JBWA 1V16B 3EVZA 1R0RE 3ANNA 2E5LB 5HQJA 3LF1A 2ZJ8A 4EYOA 3GBSA 1XALA 4OQNA 1I33A 2M1XA 3OPYI 1WF3A 5ALXA 2FTKE 3ZGNA 1AY0A 1W0KD 2G82A 1HOXA 1ZUNA 3BGOS 3MERA 3NHKA 3V55A 3GD5A 5M34A 3B13B 1RPAA 1BX1A 4M83A 5HR5A 2W22A 5PNTA 1BJKA 2FQXA 2BY4A 3CT4A 3GRUA 1T13A 4WQMA 1BE6A 4Q48A 3T54A 4H08A 5LB4A 5DSZA 2ZDQA 2HSEA 4HAIA 2LKCA 2EC5A 3GIDA 3H05A 2HNKA 4RIFA 1XJ0A 9MHTA 4QU0A 1P75A 3RWBA 3RM3A 4D98A 1U0HC 3VDXA 1ENOA 1TZ2A 3H4MA 3ZS9A 2P7HA 2FW6A 2WSSA 4KE6A 2CFIA 2CVZA 3FLMA 2MSCB 1V5WA 3A1TA 3FDFA 1FE8A 4N5HX 4OI1A 3SLGA 2O2ZA 2C2KA 4UHCA 4DJJA 4F21A 4LNUA 4L5YA 4BAGA 5ECWA 2OXTA 2OV1A 1NVEA 3CLTD 1MQSA 2PT7A 3ZCTA 4H9GA 2DERA 2PT9A 4R8KA 4E5VA 4X1KB 4F11A 1JHMA 3H8JA 4LWQA 5CA0F 9LDBA 1DHTA 1IBKB 1GYRA 3FLAA 1RWVA 3ONFA 4DQDA 2VJLA 3AF1A 3NATA 4L1KA 2ZVJA 4JBHA 2WHQA 3KVOA 1IUNA 1GUZA 3BJEA 4I6JA 4YV1A 1L8AA 4PGHA 3B36A 3AJ9A 2J7PA 3BWDD 3NXKA 4GI5A 2PZBA 1MX1A 3H9UA 3HN6A 1LNQA 2JAOA 2XCLA 3M81A 2CLIB 1SUSA 1I6KA 3OOJA 1I6LA 3DTVB 4HQRA 4RHFA 1ORWA 4A1OA 1YBMA 3GVCA 1EH5A 3DYVA 3K5WA 4QJ5A 5FA5A 3O84A 4NE2A 3SEZA 3O4RA 1II0A 3TXXA 1J8FA 1WMSA 3K1AA 5F23A 3MZ0A 5AW1A 4UNIA 1AMUA 1ZRHA 4K03A 4P0QB 2G4VA 3R6LA 3OF5A 3V7UA 3KUCA 3VU3A 4OGKA 2RHRA 4CYMA 3B6JA 1A4IA 5I7VA 4U2FA 1EA5A 2WP0A 4EENA 2P41A 3DLBA 3D6HA 1N6HA 3H8VA 2XA1A 3O8RA 3Q15C 2B1JA 2X2OA 3K8QA 4O3FA 5DB4A 1QH1A 3MWKA 5CW2A 2VJKA 4KXNA 2FZ5A 3HY3A 2FSVC 3C39A 4OM8A 1PYOA 3JWEA 2RJ3A 3RVNA 2I4MA 3SF8B 3TEJA 1AXEA 2Y3IA 2BMDA 2Q7XA 2HJ9A 3V8VA 2GKSA 2BZ0A 2IJGX 1Z7BA 2WVHA 2VUHB 4QDOA 3ZD9A 2YHSA 5ALUA 3TUJC 5BWBA 4C3OB 5GV7A 3EPPA 1UWLA 5L6LB 2A9PA 3GNSA 1L5ZA 4F72A 3K20A 3AKCA 4RVNA 4MUFA 2M32A 3BL5A 1H3FA 3QRWA 5K1ZA 2A9VA 4DR7B 4B6SA 1D9ZA 4F06A 5LMCA 3AO0B 3C5VA 1JUDA 1EWTA 4O4IA 3V8BA 5DMXA 3V9AA 3CFYA 3LO5A 2J7KA 4E30A 1F3LA 2AYYA 3UV7A 5HP4A 1KP9A 2F1OA 3K94A 3DBLB 1GAXA 1GUDA 4N03A 4KOAA 4KODA 1OAAA 2VK8A 1ODKA 3NDRA 4LRQA 1M8GA 1R4ZA 2XWBF 1WETA 4JA0A 1RAAA 3O8LA 4KBYA 2R0QC 4LDPA 1GKYA 1C0PA 3FTDA 1QU2A 2GLXA 2CFTA 3ZNQA 3G2PA 4LHZA 1UT6A 4NEGA 3REGA 3BORA 4KZPA 5C8ZA 1E8DA 4PIPA 3TPFA 1C0IA 2IV7A 4FE3A 1QFJA 4BMOB 1ZIPA 1P7ZA 2GYUA 4R8SA 1G20A 1H4SA 3NHRA 5AK5A 4PNPA 5HIIA 4E12A 4XJTA 4JITA 2M6SA 3CVJA 4EHIA 1J23A 2EYUA 3KV1A 1PL6A 2D0DA 3GUYA 3O74A 1AX9A 4FLEA 3KD2A 2ZYRA 4G3XA 2E55A 5I9MA 4MS1A 5TARA 2I4LA 2FR0A 4RF2A 4CUKA 1Y4SA 2DPLA 4IMJB 2VA8A 1GG2A 4M0CA 1L4HA 4DC1A 1BKYA 2COEA 4K9LA 2CNOA 4C7KA 2JHGA 1FYFA 2BFCA 3BCUA 3KYBA 5JY1A 4DDUA 1GEGA 2IEZA 5IK2D 2GZAA 1WKBA 5BW4A 3GMSA 2DPHA 3CSSA 3DZJA 2XOKD 3T99A 1ESCA 3DBHB 1NR5A 4DR6B 2H48A 1J2RA 2HGZA 3LX6A 3QVGB 4WRRA 2Z6AA 3T1TA 1EK1A 1MEOA 1DG1G 4NI5A 4U0JA 1PG2A 1NW4A 1VCMA 1Z0AA 3DHVA 3RFUA 2J5XA 3KHUA 3ZTWA 5LBIA 4P3XA 1CLEA 2RHBA 1FMFA 2F3RA 2R62A 1HSZA 3EYAA 1WG8A 1N2HA 3KQQA 4Q24A 3IKVA 2J48A 1DPGA 3DEJA 1M2OB 4Z49A 3KKMA 3E0XA 3QFCA 1ZMXA 4G97A 1EK5A 5CFPA 2PUDA 3RK1A 2P9EA 1TADA 2Z30A 2R5NA 2ZI6A 4QKQA 5DCYA 4K6GA 4OYYA 3TE6A 1FUEA 3WDSA 5AUPB 3HEAA 5B7GA 1YJ5A 4HSEA 1XZMA 4B3IA 4CT4B 1MOQA 4N6NA 1D5WA 1ZJYA 3KQYA 2E9SA 3ECAA 4CF6A 1L7DA 3RVDA 4IIHA 2JVIA 3CIFA 4L73A 1ZMBA 1G4AE 4FFBA 4I6GA 1DEHA 5TEWA 3B85A 4A0SA 2HDNB 4KRYA 3D02A 3RFVA 5AM1A 2YVQA 3MQ4A 5HDQA 2YFHA 3M6LA 1KZ9A 4TRJA 4UBOA 1GFZA 4O2BA 1DSSG 2C99A 1D03A 3ETLA 4P4TA 1C3EA 2QE7A 1PNTA 1JYSA 1Y4DE 1X9GA 2X19A 3MT0A 5DCWA 2JLYA 4CEJA 2ZBVA 3JZFA 2EJWA 2GJSA 4QTYA 1C5KA 4L9AA 4QELA 2JAQA 1F8YA 3SQNA 3PNKA 1NBOA 3AINA 2HB6A 3UHFA 1L7OA 2XZLA 2Y0BA 3EQZA 3GO4A 4E14A 2CMFA 3R5JA 2BKXA 4TMXA 1IU9A 3A1EA 1KBQA 1V35A 2AF3C 2CXSA 3E70C 4Q9HA 3ZD8A 4YXFA 1Z6TA 4IY1A 4JU9A 1O94C 5AW5A 1OFUA 3SQLA 4C43A 4EJFA 3IOCA 2ACEA 2HMUA 3U56A 3NT2A 2C5AA 5DMHA 3OD1A 4PZLA 2IYZA 3AOEA 3ROKA 2PSFA 1DELA 4XGRA 4DR5B 3BIWA 3C7AA 3I4CA 2YZNA 2BEUB 4P54A 4X3PA 2E4AA 3V8RA 3SHFA 3HCCA 5I5GA 4BKUA 3HKCA 2PHZA 5FV7A 1TM1E 1COWA 2FRDA 4CLOB 1T3ZA 3PFHA 4R2JA 3OE1A 2ZRPA 4KPGA 1QIHA 3KWFA 4RK1A 2HCJB 5E7IA 1I5OA 4PQYA 3VR2A 1G8AA 1KPIA 1V3UA 5A3VA 4KQMA 1KDZA 1L5HA 3GLSA 4RFSB 5B1DA 1J21A 2JHAA 2O54A 4Q6WA 4P3YA 1VLZA 5GQSA 3T12A 1BJRE 4C07A 1KY3A 3LUDA 1VQ1A 2CL6X 2X0RA 5DN6A 1NC1A 1E5DA 1YBAA 3NBMA 2CXNA 3P8ZA 3QE3A 4OVKA 5F2EA 4BQQA 2UU9B 2PVSA 5DNWA 1Z2EA 5C31A 2WZDA 1SXJE 1D0VA 4MV9A 4B45A 4MGEA 1EEXB 1X9HA 5KQSA 2I9KA 1KWGA 4GI2A 4B2LA 1EGMB 3FOWA 1MO4A 2KBEA 1PR0A 4RJTA 5LXTA 3CLSC 2ZCJA 4ZYXA 1N6RA 3EIUA 3G9QA 1GL7A 2QA5A 4L6CA 3PSAA 1P60A 2XTNA 4RNCA 2NU9B 3SIWA 4HEJA 1AB6A 1CR4A 3KQMA 4LNHA 5FOWA 5SICE 3DE6X 2F1RA 3DE0X 4ZHSA 4GXTA 5GPBA 1E5QA 5B5SA 3JQ8A 1L5OA 2O7SA 2R00C 4JNCA 4KB5A 1QGZA 1QDLB 1WKVA 2C58A 4HBGA 2JCGA 2VUIB 3DCYA 1TVEA 3EEOA 3S99A 5E3JA 2SCUA 4AJPA 3HCPA 5L3SA 3L7LA 3DCNA 4HLDA 3ZOKA 1C8KA 1XI2A 3TO5A 3L6BA 4R9VA 4ALNA 1FFWA 1N0WA 3RBXA 3C6XA 2AG5A 1XRLA 3OT1B 4YN3A 3CF6R 1KA9H 3Q3JB 3ROEA 3EVAA 4QOEA 1QCCA 2C2HA 1L8QA 2VYND 3ZV4A 4GWLA 4FS3A 3U7GA 3GU3A 2HPVA 4HAZA 4ZXFA 2WVAA 3S7ZA 3V4PB 4ZKDA 3O1JC 3HE3A 3B1XA 2W6QA 3HWSA 3QVLA 1YR1A 1IN8A 2ET6A 2XMSA 4AP6A 3D7SA 3OU7A 5JXWA 4BMYA 2HRQA 3CR8A 3EFHA 3EXEB 2IPMA 3QUBA 4QE3A 5F3WB 4Z5XA 5JPDA 2BI7A 2R7LA 3GDGA 1K63A 4P5PA 1QV6A 4B4OA 1XLTA 5INTA 4XIFA 3ENVA 4QRDA 2QXUA 3RRZA 4CE6A 4ZK6A 3GCXA 2QAGB 3I3SR 3EZLA 5LSAA 3Q40A 4IRMA 4NMWA 4YV0A 4E5DA 1RWXA 4PLVA 3CH6A 4F2PA 1HE2A 1KMCA 2FX5A 3ECSA 1P5FA 4HQ0A 2JFVA 4OUKX 5ESDA 4D46A 4E1BA 5GM1A 1TCCA 4KJZA 4KR7A 2QN1A 1Y6JA 4FYMA 3RS5A 1P5ZB 3AF3A 4ZQFA 1YMVA 4ND3A 4URFA 4ROSA 4Q66C 1UKAA 2ASVA 4R8LA 4D3YA 2UYYA 5E38A 1UEXC 3GNTA 5B6JA 5E6UB 3BL6A 2L0XA 1D1QA 2BF4A 4MH0R 3HDTA 4QGHA 4OLBA 4UCWA 3NKVA 3GFPA 2V7EA 5D5PA 1C9EA 3OCWA 5HTKA 3F5MA 3IVMA 4AN1A 4IDDA 2HRCA 3PQDA 1IK4A 3MWEB 2KS6A 2WJVA 3MSCA 2VJDA 4R2WA 3BMCB 3B8HA 3QY9A 5DHRA 2Q7OE 2XEXA 3ESRA 1M8KA 1IHDA 2W8BB 3IURA 1FSGA 1MX3A 4K6HA 1WCIA 2BE7A 5C3MA 1U9YA 3QKWA 1AM4D 5DHAA 2EL7A 2CXUA 2WF6A 3BFVA 1EJ0A 4TWAA 1W36C 1KAHA 3HKDA 5HE9A 5I8PA 1U7HA 5ES3A 4LJRA 4KAAA 4NESA 4R0MA 2ZYGA 2ZJ2A 4GP7A 5JVDB 4DHWA 5C7IO 4YWJA 2B7BA 4P3PA 4CMEC 3UGJA 2CW5A 1SK8A 3N86A 3R8CA 3F67A 2PYZA 1NFRA 2QRZA 2YDYA 3QK7A 5LBUA 5JTTA 8ABPA 3KVRA 1VRVA 1KAGA 1KIFA 3E8MA 3U1VA 2Q3JA 5EVCA 2APJA 2HM7A 3CJQA 1CY8A 5K3FA 1FQOA 1KMQA 4RTPA 1E1YA 4HH3C 1N2BA 1SQ5A 4M8NE 2RKBA 4LZOA 4N7RA 2IS4A 1F2TB 2R5WA 3F78A 4S1VA 5E7JA 4KFUA 2WJGA 2E87A 3BAZA 4DRXB 3BKWA 3JY6A 1I4LD 1Z37A 4GF5A 3DV0B 1P19A 4OHPA 4P4SB 2WFLA 1WP9A 4LRSB 1GVNB 2E48A 4ZAFA 3V4FA 2XWPA 3E81A 2PLAA 5ER9A 5GOZA 1CUDA 2BFMA 2D3TA 4M0KA 1ZMTA 1NBME 2VF5X 4NV0A 1WW3A 4TQUS 4ND7A 4BMPB 1L7BA 4NENB 3S7TA 4FYKA 3GW8A 1W85A 1H2XA 2A35A 5EIWA 2MSEB 4IPTA 2XUQA 1KPHA 4RHCA 3LY7A 3FMFA 1IM8A 4OHCA 1ZL0A 3CPEA 5EMLA 5K8UA 2PXXA 1PT9A 1D2MA 4RQBA 1C1XA 1AZTA 2RGWA 3CNBA 1ZN9A 4D97A 4ZCRA 4XKJA 5B3LA 3LTNC 2HWWA 2W6CX 3FJOA 3QU7A 2BEVB 4MVWA 1WRBA 1M33A 4D9NA 4RPGA 1D2NA 3GQBA 2OCIA 3PP8A 3QEJA 2QMYA 4QXQA 4EFKA 5MDHA 4MRVA 1P0CA 4HFNA 1VKOA 1E6LA 3B5IA 2P9QA 5EJFA 3UXMA 5JS7A 1R1DA 1CZHA 5KYXA 4EPTA 2WAAA 4NDAA 1N2XA 4OI4A 3WNDA 2QMEA 8ADHA 4QAQA 1B8OA 4Y2GA 1YIDA 4YS6A 1AB5A 3HCOA 1PCXA 1C2YA 2AFRA 3BXXA 3U4IA 2P69A 1IOVA 1OT5A 3GZNB 3CX6A 3JQ6A 1NQTA 1DQYA 3ZZMA 2YXEA 4C9BA 2WIAA 3WTBA 1XTJA 4F1KA 2BTOA 4LI3X 3MWGA 3HJHA 1PU2A 1WOYA 2Q1WA 3PWZA 2XUPA 3GN2A 1JKMA 4YA6A 3DPIA 3GEPA 1OGYA 3DPUA 4X44A 5CDHA 4DC9A 3FNIA 3F8TA 2EOAA 2VH2A 2I7VA 4UCQA 2VTKA 4LJ5A 3EA0A 4YUZA 2W42A 3DZFA 4G4IA 1GPAA 3PEWA 3BHJA 1EFVB 2EG5A 3D7RA 3PLNA 4WACA 1P4RA 5L7YA 2DC1A 4L78A 2JIBA 2FMHA 3L02A 3RFXA 4B0OA 5IKXA 4IWNA 2OWEA 3U7JA 1YBHA 2HCFA 2ZROA 3NOQA 4MVJI 1EI9A 2CBGA 5FI3A 1AKVA 1Z26A 3LIIA 3PC4A 5BSHA 3EQ7A 3M70A 1DKRA 2UUPA 2Z1DA 4GQIA 3A9UA 1PGNA 1GG8A 4FOSA 4IWYA 3VNAA 5J4VA 2A78A 2GVDC 3S2YA 1VRWA 2JIQA 4H18A 4KQEA 4YQYA 3TIIA 1FUYB 2ZUWA 4JP5A 1YC2A 1YWGO 2WDPA 3DVSX 2VPWA 3GJRA 1W87A 2DE0X 1XYYA 1O5TA 1K06A 3FYDA 4NDZA 4YPFA 3M6VA 4LDRA 2I99A 2VEOA 4ZXPA 4YX9A 1KTVA 5IBRA 3SJCA 4EUHA 1B93A 1FFDA 3KT8A 3ECCA 3GLGB 1T1JA 5CW1A 2ZRBA 1RACA 5CCDA 2JD1A 1KDYA 1MG0A 3NO4A 3IDAA 3WV4A 3CRW1 1E2DA 1KEZA 1YHNA 2NO1A 3NDPA 4ARIA 1J8VA 4QODA 5A2GA 3T1YB 4BKPA 2AZXA 3E5HA 3WJAA 2RMKA 2BFDA 4OUDA 3RC7A 5EERA 3RSSA 1M2HA 4NOJA 2D1QA 3GRFA 4PG5A 3LECA 4DC0A 4LGMA 2NTEA 2ZYWX 1QVZA 3DJFA 3M0EA 3QELB 5J1TB 3THYB 3Q7EA 2L42A 1P33A 3V1KA 1KVQA 3OTIA 3KXKA 3CKYA 2ERCA 3INRA 3KB1A 5L3ZA 2B4TO 1DJNA 1RYNA 1ZUWA 3PQ7A 3ASVA 1UJ4A 3IEKA 4CQLB 1BXZA 3IE1A 2ISCA 4QRIA 1F20A 3L6CA 3VZSA 2GK6A 3HB0A 3HP1A 1N75A 1A9PA 1GN8A 3DFKA 2QV0A 3M6AA 1ZGJA 3OPXA 4XJXA 2ZBUA 1UXHA 2P1ZA 1MB2A 1ZUD1 5CLGA 2XY4A 5AKKA 5C32A 3VAAA 4MKHA 4CFYA 4CKEB 3AESA 3KD3A 2WHRA 4JJZA 2ZSJA 4FMDB 1V3TA 2MYNA 1V8FA 3E18A 3MYYA 3FUCA 3NUZA 3D2LA 4AKHA 3K6KA 4CM9A 3IQZA 3GVXA 1S1CA 5LC1A 4F6RB 1ML3A 3ZY5A 3NUGA 1JHQA 4LF5B 5JWOA 2VDNB 2DETA 4RGYA 1JIUA 5GONF 1O95A 3QEBZ 3PF9A 1RSZA 3T7SA 1RHJA 2R44A 3ORFA 1ZSVA 2GLTA 5JCOA 1GU7A 3IJPA 3MRSA 4P4GA 1A1VA 1P4JA 3OCZA 1IEVA 2CCKA 4EQ6B 5KDOA 3LZ6A 1XZIA 3ESAA 4JB0A 4Y9RA 5B1SA 3KQNA 1W30A 2A57A 3THXB 2CB9A 3T3NA 2YHIB 5LZ4A 3P4XA 3M6MD 5FBQB 1RQLA 5FYDA 3WR5A 1LZKA 2G9VA 3NC1C 4FINA 2O48X 2CDRA 3PFWO 3RK4A 3IVXA 5DLQC 3UFXB 5KOJA 2IE0A 5KNDH 5AJTA 3PGVA 3CVOA 3VHRA 3SHVA 4CMCA 2ZRHA 5M29A 2R7MA 2LR0A 4PPFA 3AZQA 2R9VA 4LC1A 2OGWA 1P18A 5EYPB 6ABPA 2BHRA 3KKZA 2A9FA 4Q00A 5G3YA 3W8FA 3WHKA 4CMAA 3HR8A 1H05A 3PUXA 4S1WA 3MUOA 1HFEL 1WP4A 1DQNA 1BSVA 2WKSA 2Y6VA 3ONDA 2PMKA 1TO1E 1B4DA 4K3VA 4BNUA 1MDFA 4G8DA 2ZRDA 3RUDA 3SJUA 1NLUA 2BJHA 3NYRA 4FT4A 5T4FA 3BXZA 5LDGA 1X1RA 4OFZA 1AQLA 5CT4A 2VNAA 1W5TA 5TPWA 1AC5A 4JP2A 4MDFA 3HBAA 3SXUA 1FVFA 2WYHA 2X7HA 1LDMA 2VDPB 4B4VA 3AZPA 1E2GA 2ERXA 1KMHA 1VJCA 2SICE 1NY6A 4AQYB 1CYEA 1S4QA 2H18A 4KH0A 2RFLA 4V39A 4WNAB 5F78A 1XE3A 2CHFA 1SQSA 2W2NA 3PI7A 1CJVC 3U31A 3WLTA 4C4TA 3IKJA 2R5FA 3FNBA 3FETA 3A32A 3B6EA 1Q0SA 4HUJA 4JNKA 2DKOA 2J09A 1HT0A 3A4YA 4N47A 3T9CA 4B2IA 2HF9A 3GPBA 4E5NA 5K03A 1QTQA 4QBGB 2YYYA 1G19A 4ZRDA 2MYUA 3H1AA 2XUAA 3K4PA 4A6XA 3WYNA 4ZV9A 4F3KA 1HWYA 3OZWA 4H6XA 3ZV7A 3BE4A 3MTBA 4OHRA 1Y7HA 1VL1A 1VLMA 3R8XA 3LDFA 5D6OA 1UPTA 2OD9A 3PKJA 4IFEA 5L4LA 5LIPA 4YDRA 3M5CA 3QJGA 4GE0A 4S12A 4E5MA 1KGSA 2QTNA 2O8DB 4WOKA 1JG1A 3FCOA 4H7HA 1Z15A 3GRYA 3DEKA 3ETDA 4QYIB 4W8HA 4QFCA 1A9XA 2OWDA 2OQVA 3CIOA 1XMSA 2RGRA 1EHCA 4MA4A 1T6NA 4X41A 1O87A 2AN3A 1J07A 2P9JA 3HKEB 1K7EB 3KFLA 4OMCA 4LXHA 2C83A 2WSIA 4RTLA 1YIAA 1RU3A 3LCJA 3BRWA 1SGWA 2QP4A 2DWOA 2HSDA 1GA4A 3VOBA 2VXCA 3CZ4A 4UU0A 4KNWA 2F43A 1YI0A 4I1UA 3OMWA 3GXBA 2BSAA 2B4RO 3QU9A 4B43A 3B3JA 1P7PA 2OAEA 3TKYA 1QJCA 1XXHA 2CF6A 1AMNA 4C0JA 5J2UA 3EAQA 3ZG6A 4CWAA 1XVUA 6NULA 5IM4A 3KK0A 3ZN2A 4FNOA 4M1TA 3L04A 4ZZ0A 2WQ7A 4XR9A 1I7QB 1CT9A 1YKGA 3HYTA 4HB2A 1E2PA 4BN5A 2CXXA 2DGDA 3WBBA 4GX1A 4CG2A 5EUMA 5G53C 3TRDA 4B6EA 5JRJA 3Q3HA 1VDZA 5GMOA 1ZI9A 2TSYB 1KJQA 3E3LA 2J3EA 2PY6A 3PNQA 4ZV7A 3NHJA 3U3OA 4CR8A 4LDJA 1U4SA 3L1KA 3MLAA 4WMLA 3RT7A 1V25A 1VLJA 1NF3A 2D2IA 2QTVA 3HB5X 4F56A 3U7QB 4Y2UA 4XPIA 5J23A 4DKJA 2XQKA 3I6BA 1NI5A 4KAJA 2H1HA 1E66A 5DNDA 5A71A 4KG7A 3EC2A 4QUJA 2WSYB 4XDGA 5HZHA 1V2GA 1X7WB 3HFRA 1GZ3A 5JNVA 5BSTA 5A7GA 2XNDD 3S2IA 1I2BA 4U2EA 5KVCA 5JSZA 1ORTA 1GPDG 2LZ0A 5BT8A 2CVQA 3TLGA 2J46A 4KDRA 3DMRA 1R66A 3IPYA 4WLFA 3F6PA 3B3AA 2BUAA 2JGDA 3D2BA 3MS7A 3NI2A 3PR2B 3SDSA 4HRAA 4EH1A 3FPSA 4NRDA 3UTCA 1E5XA 2FR8C 1OBCA 3IEIA 2AOUA 3QPCA 1F3OA 2YVKA 3L0IB 3JCZA 4R3UC 1VYHA 4TLLB 3EVEA 1G2PA 4JP1A 1VJTA 5CFOA 3EUFA 5DBEX 2EQ5A 3PNSA 5CHEA 4OJYA 2QR5A 3N59A 1Q19A 5C4GB 1K8QA 3L0PA 5D85A 3L3BA 5CVJA 5HK9A 2ALJA 2PS9A 1NLYA 1Z8NA 4LECA 1NAHA 4URYR 4L72A 5IDYA 2JDID 3U3MA 5K6AC 3DBIA 3DD5A 3AF5A 2JATA 2JFGA 2H2DA 4GP9A 1Y3FE 2RGDA 3WNCA 3RYIB 3WYFA 3FSRA 1FNNA 3DMTC 3IVCA 3F90A 3LFTA 4C30A 1IN1A 1CQJB 4BVLA 1HNXB 3JSXA 2AKEA 2B8NA 1Z5VA 3WRVA 3ZW9A 1T2NA 3QEMB 2EZTA 4B3GA 1XKQA 3CPSA 3H86A 1VKRA 2EKLA 1SC3A 1EFDN 3R24A 2C7VA 4DLZA 2GA9A 1FLDA 1LI7A 2Q99A 2AKAB 2EJTA 3L18A 2ENWA 3C3DA 3OPNA 4MUHA 2N0SA 3D54D 2XSZD 4RA6B 4CUZA 1ZSNA 3DKIA 1MAAA 3TSAA 3LPNA 3ISJA 3OF2A 4ZEMA 4TT3A 5KNBA 3BE8A 3NTOA 5KYUB 2X1LA 2F8SA 4GOND 1F17A 5EWMA 5GP1A 3B1KA 5HJ5A 3KJFA 4HG2A 4YRZA 4TX1A 2W6ID 1EDZA 1G3RA 1ZINA 2G88A 2OKGA 3D4PA 4DA6A 4EY3A 4KGZA 2D7CA 3FOAA 2IF2A 4V2UA 3K7EA 1AK2A