3B6JA

Wrba from escherichia coli, nadh complex
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
197
structure length
197
Chain Sequence
b'AKVLVLYYSMYGHIETMARAVAEGASKVDGAEVVVKRVPETMPPQLFEKAGGKTQTAPVATPQELADYDAIIFGTPTRFGNMSGQMRTFLDQTGGLWASGALYGKLASVFSSTGTGGGQEQTITSTWTTLAHHGMVIVPIGYAAQELFDVSQVRGGTPYGATTIAGGDGSRQPSQEELSIARYQGEYVAGLAVKLNG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Flavoprotein wrbA
publication title Crystal structure of the NADH:quinone oxidoreductase WrbA from Escherichia coli.
pubmed doi rcsb
molecule tags Flavoprotein
total genus 67
structure length 197
sequence length 197
chains with identical sequence B
ec nomenclature ec 1.6.5.2: NAD(P)H dehydrogenase (quinone).
pdb deposition date 2007-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03358 FMN_red NADPH-dependent FMN reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3b6jA00
4C14A 5LJIA 4CETA 1XYYA 2Q62A 3NHPA 5FA6A 4Y9UA 3SVLA 2V5UA 3L9XA 3U7RA 1J9EA 1OFVA 2R96A 2HPVA 3LT5A 1YCFA 3QE2A 3B6JA 3NHSA 4DILA 1CZUA 4N9QA 4ZVLA 1FLDA 1AKUA 4BMPB 2Z9DA 1CZNA 1V4BA 1DXQA 2Z98A 4QOIA 2FZ5A 2QWXA 2BZSA 2QX6A 1QBGA 4LTNA 2ARKA 2MTBA 4ICIA 1TLLA 2FAXA 1FLNA 4YAOA 1AKRA 1F4PA 3RPEA 2XOEA 4Y9RA 1AKVA 5ULLA 2FDXA 4YAWA 2QR2A 3KAQA 1ZX1A 1T5BA 4C76A 1YCHA 3F6SA 3TZBA 3LCMA 4M0CA 2HNAA 3TEMA 1JA1A 1FLAA 3S2YA 3W7AA 3TE7A 3GFSA 1J9GA 1SG0A 3HLYA 3U7IA 1CZOA 4XDGA 5EMNA 1CZRA 3P0RA 2QX8A 3K1YA 2MOKA 1YRHA 3N3BC 2WC1A 3O2NA 3OX1A 1XYVA 3OVMA 2B3DA 4FGKA 3NHLA 2OYSA 3FX2A 4N82A 4CF6A 3W79A 2Z9BA 2R97A 4PU0A 4LTMA 1AKTA 5F51A 1AHNA 2OHJA 3NHRA 1FLVA 3G5MA 4QOJA 2GSWA 1AMOA 4QOHA 5A4KA 4FGLA 2BF4A 2BPOA 3OX2A 5NLLA 3W78A 3JSXA 2AMJA 1OBVA 3KLBA 1CZLA 4H6PA 4Y7CA 3ESZA 4U7GA 4C0XA 4ZVNA 1RTTA 3EDOA 3B6KA 2FVXA 4J8PA 3UXHA 1TIKA 2HNBA 3NFRA 1OBOA 2Q9UA 4DIKA 2OHHA 1C7EA 3R6WA 4LAFA 1RLJA 4GI5A 2QX9A 3FW1A 4YQEA 2X2OA 4FGJA 4QOFA 4NULA 3D7NA 1AKQA 4D02A 4ZVKA 5FX2A 4PTYA 2BMVA 2W5UA 2MWMA 1WSWA 2FCRA 1J9ZA 1DX9A 5F12A 2FZVA 5JROA 1AG9A 3L9WA 3HA2A 3NLLA 3OWXA 2M6RA 3OWHA 5LBUA 5B3KA 2V5VA 1KBOA 1H66A 4H2DA 3UXEA 3OX3A 5FUQA 1D04A 4ESEA 4QOGA 1X77A 3QFCA 5NULA 2FLVA 1ZWKA 4U7FA 5LJLA 2QMZA 3HR4A 4ZVMA 3ESYA 4PTZA 3ZHOA 3KAPA 4FX2A 5TGZA 5EA2A 3N39C 1C7FA 1E5DA 2F1OA 1RLIA 4QODA 4XDHA 2ZKIA 1D03A 3ES9A 1FTGA 1YOBA 3NHWA 1BU5A 2D5IA 1AZLA 3OJWA 3QFRA 3NHUA 2MT9A 3NHJA 2A5LA 4S24A 4C0WA 1H69A 1NNI1 5LLDA 5LMCA 3W77A 3NHYA 3FVWA 1T0IA 4DY4A 1CZHA 5F4BA 3B6MA 3NHKA 5B3LA 4F8YA 3K20A 6NULA 2OHIA 1DXOA 1QRDA 3F6RA 4YAUA 1JA0A 3GFQA 3F2VA 4N65A 2FX2A 3KEGA 4NLLA 1J8QA 1YCGA 2KLBA 2V9CA 1QR2A 4YAFA 1XT6A 3NHFA 1FVXA 2BN4A 2RG1A 1XI2A 4HEQA 3FJOA 2N1MA 3FNIA 1YKGA 4LTDA 4QOEA 2KQUA 3N3AC 1YDGA 2X2PA 1B1CA 3GAMA 1ZWLA 1VMEA 2FOXA 4R81A 4YALA 3F90A 1FUEA 2Z9CA 1AKWA 2M6SA 1WSBA 3OJXA 4BMOB 3EYWA 2QMYA 3GFRA 1CZKA 1RCFA 4GQIA 2XODA 1SQSA 5LVAA 4HS4A 5EAIA 5LBTA 3B6IA 1QHEA 3ESXA 1GG5A 1KBQA 3O73A 4OXXA 1BVYF 1D4AA 1FX1A 4GR9A 1I1OA 2QX4A 5BUCA 4LA4A 4U7HA
chains in the Genus database with same CATH superfamily
1XZKA 1NLUA 1NW3A 1QLHA 4C14A 3D8RA 4HAYA 3PEVA 4FFBA 3BWVA 1XHFA 4PBTA 4CCSA 5GGYA 5LQNA 1ID8A 1E9CA 1KI3A 3TLGA 2H16A 2O8CA 3B3QA 1T8YA 3ABQB 3L7IA 4H77A 5CLQA 2EW2A 3NPMA 2FYTA 4ROSA 1A96A 1EVJA 2XD9A 3TN7A 2DQKA 3FDZA 4QQRA 5CJ2A 3QVLA 1WQ1R 1AB5A 4I1IA 4JXJA 4EZEA 3H17A 5F23A 1NFQA 4KXFB 4B4UA 1RFLA 2VJYA 4JB3A 1Z2EA 3HB5X 1U02A 3CMMA 3OLWA 1GIAA 4Q9LA 4A8PA 1N2EA 2JIBA 4CU5A 3UBTA 3PCRB 3RUDA 2X23A 1QQTA 2YWXA 3W5VA 1O0SA 1ZHFA 2IHKA 5CEEA 3ADPA 3K9LA 1GPAA 4QC2A 3NBUA 3V2HA 5FAKA 3B6JA 3K0FB 4MGZR 2H5JA 3VH2A 4B3FX 3N8GA 2J5RA 4O4JB 4DWOA 2HXGA 3SR4A 3SI7A 3SBDA 5HNKA 1W34A 2ZZNA 4JC0A 1LWOA 3CNEA 2XNJA 3E7XA 2ADFA 4RQBA 3BERA 2C2GA 4TV9B 3SD7A 2WQ7A 4KYVA 4UAGA 2O57A 1G38A 1AQIA 2AOTB 4JOCA 3EVBA 2GCOB 3O2SB 1W46A 2ZSFA 2UAGA 1JKIA 4KUHA 4JI4B 3VGJA 3KB2A 3EISA 1T8WA 4UUMA 2ZJAA 5CLIA 4OL9A 1TZJA 2O4CA 4HVTA 4ZQIA 2ZJ6A 1SH7A 3OF3A 4NQRA 3DXYA 3F97A 1VL0A 2D1RA 3ND5A 2RGXA 4ZC1A 5C34B 3JRNA 4NEHB 3MTQA 2NG1A 4ETMA 1A82A 2CNOA 3M4JA 2P4EA 2X3UA 4D9IA 1OTHA 3UH1A 2DTXA 1K2VN 1YTUA 3QVTA 1LB1B 4PNEA 2GEFA 4A2CA 1CY7A 1Y9ZA 4IILA 2K87A 2VBFA 3I6YA 1DXHA 4KTTE 2QZSA 5CB4B 1EBUA 4IQ8A 5YASA 4FHZA 5A5VA 2AXEA 2YY5A 2AL7A 1CJUC 1LW6E 2PZBA 3EUFA 4PAWA 4G3XA 5DTIA 3ZH9B 2ZRIA 4GMFA 1XTIA 3I0NA 3IDZA 2QP9X 3L7OA 2XOEA 3DV9A 4GU5A 4WZBE 2IXGA 3EPLA 3RU9A 9GPBA 4XW2A 1N5JA 2GEVA 3TLKA 1DJOA 2JFQA 2XD4A 3CN7A 1BQ3A 2H57A 1YB5A 3VISA 4BP1A 3HBLA 1V48A 3QUBA 5CJPA 1DKQA 1T3SA 2A35A 4EDFA 3LNCA 1GOTA 2GHQA 4CIXA 5K6RA 2VXOA 1YA6A 2FPIB 4YUWA 2HBZA 2QR2A 4K6FA 5FDFA 1C9KA 3LQKA 1ZJ5A 1Z5PA 1E8MA 2OKCA 2Z09A 1QJ4A 4G41A 5AR1A 1QRRA 4HLUC 1NJ8A 3BCUA 3UUWA 5LXTF 3RHZA 3U3RA 3E2IA 4AKTA 4E5DA 1AC5A 4FQ7A 4OH7A 1PJCA 4M1SA 3L4BA 5ALFA 3AUFA 2A3RA 4NJMB 3J7TA 4MYSA 4DNQA 3UPDA 3I52A 1TMGE 3GZJA 1YJAA 2JVIA 4HYQA 3VOBA 4JLOA 1CUYA 2QYOA 3QVVA 1XIVA 2ZRNA 4NX2A 5EXPA 4PYJA 4O4IA 2ONCA 1FRZA 1LRKA 1D2RA 4LJRA 4G65A 2RK4A 2WSYB 6REQA 1PBTA 1HOXA 2B61A 2WILA 2X2FA 1HO3A 3CV3A 1WW3A 3NO4A 4NDZA 1EP1B 3ROFA 1JE1A 3QLUC 1R0CA 5HSGA 4U2DA 1XZPA 2W0SA 2QHXA 5ALMA 1XO1A 4YV2A 2JGNA 2VCHA 4R2KA 4PYQA 4RH1A 4KRGA 5GM1A 2AOVA 3PXCX 4I5EA 5CCXA 1MGPA 4ZQEA 3IAFA 2DPHA 4LGCA 3IKTA 3O9MA 2WMOB 3OLCX 4U6NA 4WNCA 1XNHA 3I83A 1D7AA 4WDQA 3F3YA 2XUJA 4K86A 2WOJA 3N8HA 2IY7A 2NZVG 2R6ZA 1NASA 2OWEA 4RTRA 1SU8A 1WF3A 1XMPA 2OYSA 3KQVA 4N82A 5L95A 1CD5A 3EXAA 3R9WA 2DFNA 3FPEA 1FVFA 2XCLA 2IYEA 3HCCA 1Y4ZA 5L4LA 1TMKA 3EBPA 5F9MA 3IVRA 3U3MA 3ET4A 3ZY4A 3R5SA 2XMPA 3DB2A 1J06A 3QNMA 1AHNA 5JO9A 3SNHA 1GNPA 1PEAA 2V7GA 1K7XB 2XMRA 4CVNA 3COVA 3C3WA 3PX3A 1RWMA 4X1IB 4FGWA 5KTYA 3BIXA 4J7XA 1U8XX 5AP9A 5KCMA 3UFBA 2NXNA 2XMBA 3DLIA 1G7CA 3Q3EA 1WW8A 3ITNA 3PWZA 4X71A 3TX2A 5U4XA 1PP4A 1MP0A 3HGQA 3I30X 1PT9A 1W581 5K3DA 2V8OA 3R6DA 2QTRA 1XZCA 1FDSA 3ZNPA 4X1OA 1ISSA 1AGRA 1N0IA 3TLYA 5G4KA 1R15A 1L8LA 5KTKA 4RS3A 3IQHX 2VPZA 3B9PA 1Z5NA 3LKBA 2HYDA 1YT5A 1EP2B 2PZMA 3AM3A 2HGZA 4QTTB 2CWDA 7YASA 1HTTA 5CIWA 2DG2A 3T12A 5L4NA 3EZ9A 3KKEA 1EUCA 3R6GA 1NBMA 4FOLA 3WYAA 2V6IA 1VL6A 2GZDA 3OESA 4ZV7A 2VJDA 2VP6A 4F3RA 5E6UB 4XIJA 2FSVC 2FVXA 3BXEA 1AN9A 4QYIB 1EPUA 4GVPA 2HNBA 1CJBA 3KD2A 4C04A 1P4AA 3OCWA 4O33A 4RK7A 1SKQA 1TQDA 2XQGA 4D74A 1FMCA 2ICAA 1Y9EA 1TCAA 1R37A 3CNNA 1Q19A 1T8TA 1U1GA 3R0JA 4NKRA 1YASA 3B1WA 5BT9A 2HFKA 1DIHA 2O7QA 3QVJA 1ZK0A 1DWUA 4P98A 4XB6B 4R1SA 5C8YA 3DMTC 4W5JA 2XYGA 4YUAA 3R3VA 2YWEA 2ZB8A 1NP7A 4INZA 4Z7OB 3I2IA 1UJ2A 5IAGA 1OBCA 1LV7A 2Q1XA 2G4CA 1I9GA 4MR9A 4U2GA 2P6PA 4PRYA 2VDUE 3RYTC 2GILA 4C4PA 2FF7A 4E5NA 1N3IA 2IOFK 5ERYA 1SUCA 4NULA 1QC5A 4QTUB 3SJAA 1KVRA 5JS2A 5JSHA 4BIIA 3FNBA 4HNVA 4ZVKA 3ZE6A 1HUQA 3R5JA 5FX2A 3GLKA 2UVPB 3EHDA 3I28A 4PTYA 2MR5A 2OCXA 2PA0A 3BXZA 3CEMA 3DHVA 3O4FA 3PC4A 3Q8XB 4JU8A 4D3SA 1G0OA 2ZSUA 2EBWA 4TV8A 1I32A 3WHIA 5JISA 4S0XA 5EXXA 3UJBA 3T1QA 2B6NA 4NZ9A 2VDWB 2OV6A 4JQYA 2W5UA 1HDYA 4MROA 4DM4A 5CHYA 1TZMA 3ETNA 5TX7A 1WSWA 3CF6R 2IPXA 4OSOA 4LNUA 3TQCA 2A9FA 2R7KA 1PS8A 4DWVA 1IJEA 1SD2A 5KJ6A 2SBTA 5FOTA 1DLIA 1C8KA 2B21A 1M66A 4Y2RA 3BMQA 3AERB 3EH2A 3TQTA 1E7SA 2HJWA 4K9RA 3ROZA 3JYHA 1YZLA 4NEGA 3DDZX 2RC5A 3C48A 4HBGA 4KN6A 4QIHA 5T8KA 2VF4X 2R86A 1HE5A 2IXBA 3I61A 2QM8A 1GYPA 4OOEA 5JROA 2WFAA 2Z5FA 4FYHA 1JFFB 4MUMA 2DC1A 4LF4B 2CLKB 4TMVA 2DH6A 3G2NA 1NONA 4XVHA 5TEWA 2X7HA 2OO7A 1NT4A 1BJTA 1REQA 4HNRA 1QKJA 2IEZA 4X3CA 5ITSA 1IWPB 4EEXA 2PBZA 4Q47A 5EG5A 2WE7A 4IVNA 3ZLTA 2I4RA 1TIBA 1JIKA 3CX6A 3CG0A 5DYIA 3Q5DA 5EIEA 4D56A 5L6LB 1K4MA 2H4XA 5EWJA 2R6FA 3FPCA 4IV8A 1H1TA 1X77A 1P2DA 2GCPA 3C8HA 2G5CA 2IHTA 4YJ2A 3VJRA 4U7FA 4DA7A 2H8GA 1Q11A 2MSEB 2CD7A 4Z0PA 3QMVA 3HR4A 3H5IA 3PUWA 4ZT2A 3OC0A 5ILOA 4HZGA 4FMBB 1J4AA 3B1ZA 2GYWA 3QVUA 2QZJA 3U6BA 4KBGA 1LF5A 2QUHA 4IG4A 5IAJA 1Y3CE 3WDKA 4FDAA 3NWBA 5KTOA 4FB5A 3HKDA 1NN5A 2I1WA 5KKNB 1T29A 2AQKA 3D6AA 4RK6A 2B92A 1FRFS 2TRSB 1E1CB 1N7IA 1VQ1A 2OUIA 2XDAA 4B6QA 4ZI7B 1CRWG 3COPA 1OGIA 5ALYA 2VSOA 4MJ3A 1H4VB 5IN5A 2EL7A 2WW8A 3K96A 3L93A 4PLHA 4CTKA 4Z7NB 1KWGA 4J07A 1H9AA 1ZZGA 3EIHA 3PFWO 3P52A 2FB9A 2P77A 2FWPA 1ECCA 2WT8A 5FV7A 1LZLA 2BM1A 5F5NA 5KI6A 3D9QX 3D8SA 4P4SA 1O9HA 3K5HA 1YV9A 2UUPA 1BU5A 2YN2A 4HEJA 2RK6A 4G5SA 3RKUA 5I6DA 1A0OA 2PH7A 4C6RA 3EARA 5K8LA 2PIDA 1R00A 3BFVA 4TRJA 3U37A 3CKKA 2QAIA 4ZOLA 2ID4A 4A91A 2NUPA 1IMJA 2Q4DA 2EZTA 1E6KA 1R0ZA 1WCYA 4MEAA 4PSAA 1N3LA 5GOTA 1Z22A 4PZ0A 2COEA 2I54A 3DEIA 4KN9S 3TI7A 5JOQA 1OUMA 2Y0CA 4FW8A 2QPLA 3ZE0B 1LGYA 2GPNA 3AUTA 4POOA 2F8MA 2VT2A 2ZR9A 3ROEA 4P3PA 3T61A 4LWZA 1PEKE 4GYJA 3VR1A 1JW9B 2ZSKA 2P11A 4Y2QA 1W4AA 2H7YA 1NMZA 1Y5RA 2VAPA 1P1RA 5J2TF 2I4TA 5SY4A 2A4MA 5EIFA 4BP8A 3UWDA 2I7TA 1TB4A 5DN6A 5CLLA 4HGQA 1IHOA 1JT2A 2XE6A 2XKBA 5GM2A 5ICEA 3FHCB 4IS2A 2VSNA 5AK3A 1X7XB 2I2XB 4FMCF 4NOJA 3WLEA 4BP3A 5C7YA 3X1JA 2QR3A 2CNWD 2DHEA 5E2IA 3BZUA 4N48A 2QZZA 1WV1A 3W5BA 1N1DA 4N39A 2QTGA 2W2MA 3SK0A 4CKCB 4YPOA 3LZDA 1V1RB 4B3RB 4FSDA 2GHRA 1HT2E 1E89A 3M0EA 4PPQA 3UMCA 2ZJFA 1ZITA 4EY6A 2PSDA 1VI2A 3DNMA 4Z0NA 1CB0A 1NWCA 5FA5A 3V8PA 2OKGA 5IPFA 3DVRX 1LSJA 3QHAA 2YKGA 2NZJA 3RSFA 3ULKA 4XWGA 3PDWA 2HDHA 1G5TA 2IHYA 2W7TA 3LHIA 5SYAA 4ENQA 2YXPX 1L2TA 5DHUA 1VJ5A 4L6CA 3C45A 4MW0A 1L4GA 5IYZF 2YVLA 4CFYA 5CAEA 5ICSA 2IS6A 3LO5A 2IHVA 1OB2A 1A4IA 3D3EA 2BMDA 3EMKA 3G23A 5K0SA 4MVCA 3F8WA 3DZFA 4IIJA 3VKGA 4KOEC 2HAEA 1PSZA 4OH1A 4HGOA 1AQ6A 3CUVA 4I8IA 3BMNB 4K7JA 5E4TA 4ZCPA 3QMMA 4KREA 2J0SA 3ZWNA 2R4UA 3ZZTA 2FKNA 3DV2A 4ZZ3A 4PNZA 3PL5A 3KZNA 5KVQA 1IBCA 1XI2A 3VPBA 1UC5B 3OLQA 4JSTA 3OEEA 1K8QA 1NURA 1WMEA 1KFCB 4NYJQ 3DCYA 3PQEA 3LXXA 4IZOA 4NHOA 1HDXA 4GGOA 5EFZA 1I4WA 5ALWA 3TIIA 2QENA 2Y1OA 3TGPA 5JCZA 1XJCA 2EZ9A 1DIRA 2PS0A 4Z5XA 3EF1A 421PA 4KKVA 3M9LA 4AN0A 4HLQB 1XL0A 4RZ3A 3CONA 5DIZA 3FCCA 1KETA 4LVCA 4HQOA 1FL9A 2MMCA 2VT6A 3DVLA 4OQEA 4YALA 2VAWA 5K03A 2J4CA 3BN3A 1BSVA 4B44A 3GP8A 2W6MA 2V1UA 4JA0A 4IWYA 3BYZA 3NTXA 4RYLA 4OA8A 4NATA 4BNJA 4BVAA 3RUCA 3S1AB 1WQ4A 1XNJA 3WMWA 4CT5A 3NBMA 4RK0A 3UCEA 1F6WA 2D2IA 1OXMA 3V8QA 4URVR 1ECPA 4EG3A 5CG2A 3E4CA 3SLKA 4GNKA 1FYXA 4FONA 3ZQKA 4IHQA 4LQLA 1H22A 2VK4A 5K3EA 4KK4A 3GFPA 2FWMX 3RUEA 5E7JA 2VDOB 3PJEA 5KSYA 3GZNB 4ZCIA 1ONNA 3K9WA 2F90A 4NYIR 3VOSA 1RFGE 1PK9A 3LUKA 2C5FA 4BCCA 4EJSA 4BY9E 3H8SA 3B6IA 4JC5A 4MWBA 3E3LA 3QVSA 4RY2A 4EL5A 1YSCA 2O8CB 4B3CA 3IV7A 3AILA 1T5HX 2PSHA 3Q6IA 4S05A 2LR0A 4FHCA 3CUWA 1JHXA 1ORDA 1NMYA 1QZTA 4H6XA 3FDZB 4LYJA 4MW7A 1XE3A 4I3HA 3U9LA 1X2BA 1A8IA 3BGIA 3SEQA 3PUHA 2QRHA 4L5IA 3BK2A 3T7EA 1K6IA 5FWNA 5F98A 2A9PA 1OWPA 1KS9A 1QYCA 2QOEA 3LYUA 5HK9A 2PVCA 1XU9A 2GH1A 5AJZA 3CWCA 4O1IA 3QKWA 5EZYA 4EGFA 4AC9A 4DLTA 1Q74A 3G85A 4OYRA 1RMYA 5FD8A 4WBSA 4TMKA 3H1FA 3CN9A 3NZEA 4D4MA 3DOJA 2PZJA 1WUJS 2D3WA 5CA1F 1LFAA 3OFVA 4HS9A 4ALLA 1ZCFA 2EFYA 3M81A 4BO3A 3M33A 1YHYA 4PTLA 3UJCA 5LQRA 3LDAA 1HQCA 3FWNA 1HG1A 2AYZA 3DMYA 3ZDDA 3H9EO 4PIMA 2FNAA 2HA3A 2TMDA 4DM7A 2J3HA 1HEUA 1MW9X 1QANA 3GYBA 3TJMA 4Z3KA 1PJAA 1CEEA 3RUPA 3OFNA 2R1ZA 3PYMA 3WGTA 4RSHA 4W5OA 2EX0A 5JANA 2B4AA 4HLDA 4CQMD 4E2WA 3M49A 4K3VA 5AQEA 1P2FA 1A97A 6AT1A 3FTCA 2PDAA 1Y1LA 4RM2A 1JT9A 3BEDA 1I3KA 1QFZA 2YWDA 2P3QA 3KUUA 4OPMA 4JLAA 3FPKA 4I50A 4EHKA 2JASA 1W76A 4DYHA 3BRSA 1Y8QA 1T8PA 4L8WB 2CVZA 2P40A 2C04A 4C87A 1P72A 5BRNA 4K28A 1NBMD 1A7AA 1B15A 2DUMA 5IM5A 2GKGA 2YYSA 4LJ8A 1CKEA 3TRJA 3BHIA 1BDIA 1G2QA 5G4LA 4ZT6A 1D8TA 2YZGA 2CHQA 2J3KA 4NU6A 4E0BA 2C29D 2EBHX 3KJZA 4GO1A 1GDHA 4BZWA 1OH7A 1GEGA 4RZSA 5E7IA 1H2BA 4KP7A 1H94A 1OZFA 1PWXA 2Q21A 3G8YA 4FKBA 3SXJA 4KOAA 1W52X 1WXXA 4MQ4A 2GAFA 5LNK1 2Y8EA 5HFJA 4MUNA 3DE3X 2ZM6B 2GAIA 4TSFA 2QD5A 4TMFA 3VOAA 1G8FA 1K6XA 1N5IA 1YU9A 2QYHA 3THYA 4HX9A 2BR4A 2VUUA 3HJUA 4G9EA 2AC7A 4HQLA 4WASA 3S29A 1RJWA 3ACCA 4E11A 2PWYA 5AK5A 3SSAA 3ZGOA 3MSXA 2ADMA 2HCRA 3QK7A 4GXRA 9ABPA 3RU7A 1AKRA 2YFYA 3GPLA 1O0CA 4BQQA 3QYFA 1J0AA 2CLHB 1R2QA 2ZI6A 2FMTA 1XNRB 4FLMA 2ZUFA 3E18A 4YMIA 1MG0A 3A6PC 4HWGA 4O4IB 2O5CA 2P30A 2JIMA 3DE1X 3EEBA 4L5AA 5DI9A 3MYRA 6REQB 1X7WA 821PA 2XQJA 1GCAA 2ZATA 3C8ZA 5DK6A 1X70A 2AG0A 2PSEA 4BTEA 1FDRA 2XOKA 3WP0A 2V45A 3H2HA 4M0CA 3AFNA 2P68A 2QG4A 3DZBA 4U7TB 3JQGA 5F33A 2RFLA 3H19A 5FJJA 3DMDA 1Y9AA 1U7UA 2Y2VA 2R6DA 1JZTA 4ZOBA 3WYBA 2BR3A 1NM5A 3VO1A 2VEDA 4FS8A 4J43A 1SC6A 3SY8A 1XPOA 4RY9A 1SBCA 4JCOA 1PLJA 3MD9A 4KQWA 3KTFA 1VKHA 4E51A 1GUZA 3W6OA 1B16A 1COWA 4KQ1A 5AVXA 1E2JA 1BYUA 4WADA 4FOPA 1EGMB 1T1SA 2ZBDA 2Q0HA 4M99A 4MV3A 3L05A 3UANA 2INGX 4RH3A 4GZ5A 3L7JA 2MMGA 4D0LB 1O96A 4KO4S 1QE3A 2R7AA 3I4FA 3GG9A 1SXPA 3OX1A 1OH5A 1IIBA 1ZUIA 4CUZA 4NBWA 2RAUA 1C7ZA 4KXMA 4MV0A 3SSOA 2GT1A 1OMOA 4DCTA 1II0A 2QZ9A 3O91A 3TLCA 2QZPA 3OVMA 1ZEJA 2VYND 3BD6A 3INGA 1ZOPA 4M0LA 4S12A 4AECA 2C5BA 4TQGA 4J1TA 4DJFC 2B3DA 1Z0AA 4LGMA 2CFIA 3AUSA 2D0OB 4M1WA 5AOCA 4DJEC 1X9HA 5A5FA 4RTQA 1ZUNA 4KI7A 1RAFA 1I4DD 1LF0A 2QG6A 4GE3A 3QWBA 4NBLA 2PH3A 3HA3A 3O75A 2ZRAA 5EUBA 3UZUA 1NDHA 3LZ6A 3C7TA 1NDQA 5H68A 1P9NA 4FZRA 2QSYA 3CUSA 3GJ6A 2E2WA 2NP6A 5AI0A 4MYTA 3F73A 4JV5B 3UTCA 3KQNA 1OF1A 1AY0A 1DMSA 1GPUA 1VYTA 5G4KB 3FTNA 3TTXA 4MTCA 1XEWY 2IPNA 1TO6A 3ZKWA 2OHJA 1A72A 4CIYA 2FZLA 3UT5A 5ALOA 5DNWA 2IVFA 2YNMA 2GETA 3GIDA 2W98A 5D3ZA 4A2QA 3X3HA 3G5TA 3C8MA 1XXHE 3MS7A 1B6GA 2PS9A 1EUCB 2ZITA 4FGLA 4IIDA 5I45A 1EK5A 1ZHOA 4ZZ2A 5AKIA 5ALTA 3F3SA 1R5NA 4KQFA 5B4VA 1N5OX 1ORWA 2YJ4A 3TBKA 5CFZA 1GUDA 1G2PA 1WZCA 2ETVA 2DH5A 2QRQA 2YWHA 4UBLA 2P79A 2AZDA 1W96A 3SIXA 3TLEA 1CU1A 2I3BA 4BB5A 5HRUA 1FZQA 4X0EA 5K51A 4Y7CA 4HYEA 3JVVA 3PG5A 3KVRA 5CU7A 1SPBS 3L6OO 1IVNA 5C8YB 1Z4QA 2ZRCA 3VNUA 2J0VA 1WWKA 2LXNA 2BJHA 5HQJA 4DUPA 1PNVA 3CGGA 3RUAA 4MR9B 1CBUA 1EFPA 1T26A 5G1PA 4FWTA 1XQXA 1RKBA 2HMUA 5HMMA 3S2EA 7MDHA 1NATA 4FUQA 8AT1A 1QC5B 2VYQA 1KYWA 1P0MA 4ERXA 4TRRA 1KYIA 1S2GA 3HXTA 3TWOA 3IE2A 3GLGE 1A2OA 1PR4A 1QV6A 3TFQA 2JI7A 4JLSA 4PV7A 4QULA 4PAQA 4BNWA 2ZANA 2MJLA 1P1CA 3ESDA 3LIPA 3P2YA 3WBFA 4CI9A 4TV8B 4DF3A 2LV8A 3ZD8A 1MIHA 3DUWA 1KMHA 3JVIA 4IBOA 4QUDA 4HDRA 1ZXXA 2FUCA 1DWOA 1XRSB 1GFIA 4M1KA 4L22A 5DN6D 1YB6A 1VGQA 2SNIE 3DSRA 4FR2A 4ZT7A 3ZCPA 4EP1A 4MP3A 1YQQA 5LWQA 3KBBA 2QRPA 2UZAA 4GOOD 3ZVLA 3IIEA 2QB5A 2BI8A 2DVMA 2QROA 4LNUB 3ONWA 4M0MA 1PNOA 1HDOA 1Z33A 5IVDA 3P9RA 2YMMA 1JJIA 3S1SA 1X1EA 5HS4A 5EP1A 4ZO6A 1N5DA 2H2IA 3V00A 3O8BA 1I5OA 2XTZA 3ZK8A 4DMKA 5K8VA 1KU6A 3QJGA 1Z37A 4HQFA 5D3QA 3N58A 5FUXA 3JRWA 4P5DA 2YV2A 3MCWA 4R5MA 3REGA 2YN4A 4P4UA 2L19A 1OR8A 1N6LA 2GZRA 4YMTA 1EIZA 2BZ0A 2G63A 4WW0A 2ODQA 3CCFA 3LBHA 4GPIB 2IYAA 5AIAA 1L7QA 2JLXA 3AP2A 2X13A 4MKHA 3CB2A 2EFHB 2C92A 1REQB 3UJNA 3ZXSA 2OC9A 2JL1A 5EWLA 2R2GA 3HGMA 3FZYA 3OT5A 4FLFA 1FXWF 5IJAA 3DMHA 3PF9A 4E6EA 3PJDA 3CPEA 4LS3A 1EJ0A 2NZ8A 4OM8A 1UXJA 5BNZA 3T5PA 4K9LA 3V2GA 1IPFA 2VPTA 3K0AB 1LWNA 1UFVA 1ZRHA 3DT6A 4ZANA 5EWJB 5AUQA 1I6MA 4WCVA 1G4AE 4DG8A 5DKFA 1OASA 1I01A 4HDOB 2DRIA 3N6XA 1RRGA 3KEFA 4FZVA 4IQGA 4PC1A 3OEED 5CUQA 3DLPX 4MGIR 5AW8A 3TPCA 3UNXA 2GO7A 5CT8A 3WRXC 3PFIA 4DV2B 4O25A 3EZGA 4FI3C 3X43A 2WWYA 3DR3A 3T9AA 4AIRA 1B8OA 3EXG2 4WGGA 4HADA 4IQ4A 1SC4A 3VHLB 2F1KA 3H11A 4U6SA 4Z0HO 5HYVA 2J32A 3IV9A 5JO0A 1IM8A 5D1NA 4XYLA 1HNZB 1RBYA 3HKDB 1CSEE 1PK7A 4QDOA 5FUQA 2O0JA 1USKA 1ZUHA 2CBZA 2XT6A 3GFVA 2WJ6A 3IQIX 4F12A 4CLRA 3OCUA 3FFBA 3LL4A 3C3CA 1XA4A 5JY1A 3DCIA 4I9GA 4JITA 4LQDA 5A3VA 3LYLA 2JBHA 1ANKA 1JU9A 4CTJA 1VDZA 5DASA 1AKMA 4A26A 2Q4OA 3AOEA 2HY7A 1EK0A 1VM6A 2F1JA 3H42B 3ISTA 4HEA6 5G0VA 4L0MA 4YRJA 4C7BA 3FPLA 1DI0A 3NT2A 2VNKA 4FLEA 1CRPA 1EFVA 5TR9A 4C0BA 2OTCA 1L8OA 2QYTA 4K9QA 4P4SB 4Y3UA 3TG8A 1AZTA 4MRMA 1FOEB 1MX3A 5KNLA 2V4UA 3UMMA 4CEJA 1T3HA 2RGNA 1MB2A 4YRSA 4JI0B 1YO6A 3BJMA 1B6TA 2O4UX 3O9VA 4ZOLB 4Z9YA 3VA7A 2NUPB 3ZI7A 1WZ2A 4WSOA 1JR2A 2UYYA 2D1YA 5JC1A 1KFJB 1UBJS 4EI2A 1E5DA 4QT0A 4ZV9A 3UWOA 2IOQA 2PFGA 4QODA 4CMAA 3SZOA 2BFMA 1VBFA 2ZB3A 5AFSA 1KOGA 3VX4A 2V7BA 4FGUA 1CG6A 4FX5A 3OE1A 4J3JA 4MGHA 4FQ8A 4IG9A 4LRTB 2FWNA 3ES9A 4XIYA 3A9VA 3S99A 3R8XA 5KPJA 1R3DA 3KXIA 1EWVA 3E82A 2ZU6A 4MYDA 2PZFA 2UDPA 1P0IA 4L5YA 4CPDA 1Q17A 3A58B 3CNQS 1SXGA 2XCSB 3LWBA 1RADA 4DZRA 3B9BA 2YOGA 4Z51A 3UAYA 3WK9A 3N8KA 1EXVA 3VSAA 3HFRA 5DLPA 3RK1A 2GYUA 1KF0A 1FJHA 3E8XA 4S24A 5FWDA 4HI0E 3V4RA 2R5FA 2VHUA 1XQ9A 1KSGA 1NJGA 4E5VA 2PBRA 3FF1A 4A2WA 4X61A 1HRDA 3RAFC 3QKUA 4AMGA 1UMBA 1DAIA 2IYUA 3ZLUA 2M98A 2KMLA 2KM1A 3RSCA 1VG1A 3WXBA 1NW5A 4EG6A 1UFQA 2V3CC 1DO0A 2R62A 2VP3A 1P6UA 3G2LA 1ZUWA 3AB7A 4JI3B 1IY2A 1DBVO 1KJWA 5EHIA 1Y5NA 1QG6A 1CUCA 4XB1A 3ZQJA 1OZAA 1QH8A 4B3SB 1PCXA 1IQPA 1OBFO 4G5HA 5CAEB 2Z2KA 3BAZA 4X6LA 3SU8A 4MOWA 1HLPA 1YGYA 2J9XB 3DAYA 1ZZEA 4IIJB 4MVWA 1J1IA 1RXEA 4HKTA 3L4JA 1GZ4A 4BKPA 1JMKC 4I2NA 4WXHA 1FSGA 4PBRA 1S9HA 1ZEMA 2ZK7A 4ND2A 1GUAA 1P1HA 5FKJA 4U8HA 3T1NA 1YVRA 4ZCTA 4JLJA 3RASA 4CMEC 2Q2VA 4AP6A 6ADHA 1NRXA 1GARA 3AMVA 1L6IA 1G6KA 2JLBA 2OHXA 2RGYA 1MA0A 2P9ZA 2I29A 1PQUA 3LY5A 4IJQA 4Q3AA 4XE5A 4LXHA 4RU1A 3QE9Y 3H13A 4FFMA 4E07A 3LHFA 3LY7A 3KOXA 3QFHA 4TSFD 3VSDA 4YRAA 1ZR2A 2JG3A 4PG7A 1TVEA 4LDNA 2WDPA 4KJZA 3NOQA 2YCBA 2KX7A 3IBTA 1E60A 2GQ0A 2PLRA 3LX5A 3LHDA 2JW5A 2P75A 4FDUA 3ZDFA 3JZIA 1KYXA 2AEJA 4G0MA 4G0WA 4YAIA 3RFTA 1XTKA 3UH0A 4V1CA 3CR7A 1UIMA 3UHFA 2NZYA 5CA0B 1GZHB 1T6NA 2CLFB 2GK7A 2PQMA 1E2IA 4BJHB 4ALJA 5GINE 1T2AA 2J87A 2FPGA 2MYTA 2QUAA 3AFOA 2FETA 3WQHA 4GAEA 4JK3A 1QHHA 4Z99A 1T9BA 3CEJA 1VL1A 3LBYA 2POQX 4U7WA 4L4XA 5CXUA 2VQFB 4LTDA 1ZNYA 2J08A 3OZAA 4LCEA 1K92A 1G7RA 5JTUA 1RJEA 3I2YX 2J0EA 4O4LA 3AKYA 3GAMA 4KX3A 5B2ZA 4BEJA 3EDQA 3PEYA 4CIAA 1UFOA 1ZG3A 1L1FA 4A5SA 3EQ9A 1W47A 1U8AA 2YVKA 1Q0ZA 3EXIA 2GTPA 4AZVA 1I2MA 3EEOA 3D1VA 2DWCA 3WY9A 1MFPA 2FPRA 1V11A 4DMUB 7REQB 4ALKA 4P34A 4IH1A 4YECA 1XAJA 2QT0A 3IJEB 3T9DA 4LBYA 4EJSB 4ER3A 1L1RA 4DLLA 3WGVA 3G49A 2Z9CA 3M70A 4G6ZA 4B4VA 2PZEA 3PTZA 2DY1A 1A9QA 1KXJA 2PSSA 4D45A 4X8MA 4YRPA 3VI4B 4EKIA 4EYGA 3RDPA 2BTOA 1WULS 1YZ3A 1H8ED 2VTVA 4B3DA 3SYLA 4C05A 3F9IA 1D2MA 2OCLA 3B3JA 4UCFA 1Y37A 2JFHA 4NG4A 1JPVA 1KFEB 4R0NA 3S70A 2QTFA 1FFDA 3IA2A 4ZREA 5EZYB 4HS4A 3ESQA 3GY0A 3HJBA 1NL3A 4V0LA 1RYEA 1PKXA 2RBKA 1VJDA 1PWZA 1W6RA 3AY0A 3NYIA 4A82A 3GLUA 1SXJE 2J07A 4OI0A 2E5LB 1RWPA 3GA0A 1VLHA 3O73A 4M9XA 4NV0A 1JIIA 1NQTA 4QLBA 2II6A 5E3IA 4RTLA 1FJXA 3VR2A 1OFTA 4XLLA 3LBAA 3VNQA 4HFNA 1ZESA 1YHNA 2ZJOA 1QAMA 3G9QA 4G1UC 4MSUA 1ADJA 4CODB 3BQNB 4CQJA 2IEIA 3K9CA 1K9VF 1V9LA 3WR5A 1L6RA 3D7KA 3OECA 4EGSA 1J21A 2OFFA 2D8AA 1PDOA 2LZ0A 4I50B 3RT7A 2VPXA 1A27A 4WPGA 3RC8A 1C2TA 1U2QA 1Y8QB 2CKMA 4KIFA 4MKFA 4CLDA 1CPYA 2NX2A 2VHTA 5CXXA 3CNHA 4HZIA 3P32A 5C3UA 1Y89A 1M7BA 2AX4A 3CX8A 3QPCA 1DZIA 1FDWA 1IHYA 3E03A 2ORYA 5ALGA 1AD2A 3QLJA 3F1LA 4RJ2A 1YIAA 2DSNA 2VJAA 4HOYA 4HDKA 5BOVA 2Q6KA 2XVZA 2M6KA 1J9EA 1XKLA 3SHVA 4IO0A 3ICQB 1XROA 4GDMA 3LT5A 1LQUA 3IP5A 3NAMA 1YCFA 2E55A 1D2HA 1UC4B 1GR0A 3FDIA 3T34A 1MJFA 1UQUA 1E4EA 4L4ZA 5CGQB 3THOA 4CM4A 1HI9A 4PX3A 3OSUA 5BN1A 1HFKA 5HQTA 5I9NA 3CZ4A 3TUJC 4ZEOA 2ZB4A 4A1FA 4P83A 1TCVA 2QTCA 1LX6A 4DA0A 4N9QA 2PIAA 3THYB 2JLYA 1P18A 1FYWA 2BEWA 3R9KA 4CUKA 1QONA 3ITDA 4JOSA 2VA9A 4EB8A 1OOEA 4BMPB 5AW2A 1ZGGA 1DBRA 2ECQA 2E1RA 2VF8A 1I2AA 2Q1YA 2ZWPA 2XA2A 4OBBA 4X6XA 3VPDA 4BKOA 1UWLA 4AS3A 5C8ZA 4MJ7A 4MB2A 2FRVA 3WL4A 1QZXA 2P4HX 1QCCA 4YRDA 3KHSA 4QELA 3QU9A 5KOHA 3K1TA 5M5BA 3JARA 4RVCA 4F9EA 1WXFA 5B12A 3MERA 5CVJA 3GDHA 3K2IA 4II7A 2BMWA 4LWPA 1TRKA 2BRUA 2AR9A 1X7WB 4RV4A 4DC0A 1DAHA 1OXUA 1IM2A 2P4QA 2VKQA 5JCJA 4NP6A 3RVRA 3ZCQA 2IUSA 3JD0A 2ZUEA 1ZMOA 3OEHD 4OFZA 4DQDA 10MHA 2NV6A 2GPYA 3C6QA 3NETA 3VU8A 4XDYA 3HXPA 1YL7A 3O8NA 1UXIA 3DE4X 3GLGA 1TF7A 1SKYB 1Z2AA 1G8YA 1ZNWA 3JQGB 3T3EA 1UKZA 5EGNA 1I3NA 1OROA 1IHPA 2PXHA 1V7ZA 3PPVA 2Z6AA 1TXGA 2IZZA 3AW9A 3UIEA 3DH0A 3B20A 4BC0A 3PDIA 2ZIXA 3KDAA 2XLCA 3ZY5A 3PCTA 2OV3A 2PRKA 4ZQFA 2B4KA 5MN5A 1WUYA 2J6CA 4JI1B 3CGWA 2FDXA 2NVBA 1G4HA 4E09A 5B1IA 4KAAA 4YAWA 4DVGA 4E30A 2AW3A 1OAOC 1MBZA 1O96B 4IL5A 4J3NA 2IPOA 1UBTS 4BJ3A 1EM6A 3AK4A 1NFRA 4C0LA 3F6YA 4GLOA 4TLLB 4UVDA 1YVEI 4QSMA 5FH9A 2CNBA 4KVGA 5I4IA 2BJWA 4BN4A 5I9TA 1GCUA 1Q6ZA 3BEOA 3ZK7A 2YQ4A 4H4DA 2YYAA 4NSNA 5TQ0A 5BQXA 3JR7A 1ESMA 3I23A 2FE1A 4FYPA 3UF0A 1CZOA 3BF7A 4L8YA 5ICGA 1CUEA 4Q7EA 3LL7A 3MJTA 1Q7EA 1ZUNB 4WL0A 4DSNA 3R23A 4HD8A 1DIBA 1GVNB 5B1YA 3IS3A 4KKXB 2V7WA 4QBFA 3C3XA 3L6CA 4DT1B 2NSLA 2PKXA 3PI6A 2CVFA 4P92A 3ZHYA 1Z45A 5JZBA 2EQ5A 3N3BC 1QJCA 1XHEA 2D5CA 3C41J 5CFQA 1IY9A 2G1JA 2E4UA 4DLZA 2X0NA 2EWMA 4B6PA 3V4SA 3ZKWB 2AXPA 3E23A 2V0GA 1LDGA 2ZU0C 4ZTBA 3UT5B 3V34A 4AJ9A 2ZWOA 4DJJA 2ZRKA 2QLNA 4XZ3A 4RDXA 1I3CA 3IE0A 4B3IA 2HT6A 2ISSD 3SG0A 3NC0C 1G5QA 1E2NA 3PIRA 5JATA 3B60A 1GHTA 2Q3DA 3Q2IA 4UKDA 3PHIA 2ZUCA 2R7MA 1QFMA 4QHSA 2ZWMA 5C1OA 1UKEA 3EUEA 2FPPA 4X5OA 4W8HA 3MJFA 3TDKA 3VJLA 4CF6A 2R84A 1USVA 1RCUA 2L2QA 3DYIA 3ICWA 4S1PA 5JY6A 1EEXB 2JH9A 4D8WA 4INPA 4JBLA 1IOZA 1BKYA 4PQFA 1VCIA 4UE6A 2D1TA 3W3AH 1FQJA 4MGYR 5E2BA 1Q1QA 1TEHA 1RU3A 1C1DA 1XTQA 3S40A 5AW1A 4OXRA 5JNUA 2DTDA 2RGRA 3RVOA 3NNSA 1UKAA 4NZPA 1VZ3A 2F62A 1EFPB 4TTAA 1XTVA 2ZSEA 1XWWA 1HEIA 3ZZ0A 1VPWA 2JLCA 3K09A 4W5TA 3PGMA 4FR0A 4HVCA 1Y6GA 3FTFA 3C1OA 1HE3A 1NWHA 3W78A 3JSXA 4UDNA 2WEKA 2IUTA 4OKNA 4TVBA 1XZMA 3WMGA 2VK2A 1XMJA 1TK2A 2P62A 4YASA 4WXPA 2C31A 4MV1A 3ESZA 1YCDA 4U7GA 4F6LA 5I7AA 1KMHB 1VHLA 4F2WA 2MDTA 1KP9A 3DBRB 4ALIA 2VATA 5I7UA 5KNBA 2CLLB 4DE5A 1RLMA 1U0FA 3QWAA 3SC3A 2IUEA 3JAWA 3SF0A 1N6RA 4Y98A 3WJ2A 2Y9PB 1Z7EA 2QD4A 4MVXA 3G2QA 3ZV6A 1O08A 2VJKA 4FN4A 5IMBA 2V7TA 3IHWA 4YDRA 4JLNA 4KFCA 1CX9B 4EY5A 3KJHA 1ZLXA 3B3FA 3ORQA 5JJIA 1JHZA 4TXHA 3NFRA 8LDHA 1GPYA 1N0WA 1U04A 3T7RA 3OU6A 2Z4SA 4E14A 2B36A 1XMSA 3EVNA 5EIAA 1UEXC 4JMLA 4KVZA 3RADC 2CFOA 2ZQ5A 1A7KA 5FV4A 4INJA 1KWKA 4BQSA 2DR3A 5DFAA 5JH7F 3KQMA 2ATVA 2EKDA 2OEPA 4N5DA 1XA3A 1D8AA 5DNEA 4I4LA 3MGCA 4YQEA 4A10A 2PGDA 4WN9A 5TQJA 2XMGA 1KEZA 4FGJA 3VDQA 5EWLB 5HZGA 1GZ5A 1NN1A 2QRJA 1TGVA 1P2BA 3D7NA 3SNKA 4BFWA 2BGKA 1TDJA 5IDWA 5J63A 4EHFA 2YJ3A 3QQPA 1E6CA 1HA3A 3VVBA 2DGDA 1SVMA 4CM9D 1WY7A 4O4HA 5F2KA 1B0PA 4BYMA 4OYLA 2W8ZA 3Q7QA 3LLCA 1ESNA 3H6GA 3SDZA 2WJAA 3X44A 4ER7A 5A05A 3ZS9A 2GPWA 3KQQA 1SK8A 5KNCH 1KJQA 6LDHA 4WESA 1NP3A 4JUDX 3AEXA 4MQLA 2WOOA 2JGDA 1QORA 3F1KA 3MA0A 5ISMA 3A25A 4KU4A 2BFCA 3AUXA 1ECLA 4OQYA 2DB3A 5LQSA 4KFTA 5BT8A 1J9ZA 3VHXA 2P9EA 5I51A 1DKNA 2C2XA 4QXRA 5B1SA 5ALVA 2VJCA 1FA9A 3H7AA 2OHFA 3RC9A 4YRLA 2GZHA 3QLUA 3L1IA 1CUIA 2LUOA 2JGJA 5HJ5A 4YMGA 5DN9A 2D2EA 1T1EA 5C81A 3AR2A 2CK3A 16PKA 4OHUA 3ETJA 3TLZA 5CCEA 4CLRB 3P9ZA 4FCCA 2YINC 5JAIA 1WXQA 1USGA 2PVSA 3T7SA 4Y2GA 5HGJA 2I67A 1NG1A 1E99A 4Z86A 3SLRA 2WKWA 1BS1A 1M8JA 2JEYA 5AW3A 4YLEA 5AH0A 4L4YA 3V1LA 4UM5A 5C51B 3KQUA 3C3DA 4RFVA 4TKUA 3PXAA 2QTZA 4QRDA 4EI9A 2H2DA 2P2GA 1SUAA 2YICA 3WB0A 2Z08A 5BN4A 3BCHA 2GBGA 4MVJE 5B3KA 1EFVB 2HRDA 4N5IX 4FC7A 2JF0A 1PFVA 1K3FA 2BOVA 2XYQA 4AP5A 4MRMB 3VR3D 5HXAA 1JPNA 2EATA 4TVKA 4YMSA 3MJEA 5TJHA 5L8VA 3AIMA 4CEJB 4OQNA 5C4IA 1O8BA 4OM7A 4MINA 3V4VB 3LSTA 4JP5A 2XVYA 2VRCA 3ZE2B 3ZYCA 1JFVA 2UZ3A 4I1OA 4G2TA 2FSFA 3E7PA 1Z13A 4QOGA 4EGAA 4IY1A 1TJ3A 4URXR 1MNAA 1TMOA 5EXSA 1N8SA 2E1PA 3KSMA 1D1QA 1I7NA 1ZWKA 5DWDA 4CE6A 5K0ZA 2ID8A 4MPDA 5EGSA 5FB3A 3ZNNA 5C31A 2DFLA 2OVFA 2GX6A 1KMNA 5DEOA 3URKA 2X19A 4IJ5A 1UK9A 4H1UA 1ZGHA 2GRAA 3OURA 4ND8A 4X91A 3KR1A 2F59A 4NZOA 4IF6A 4FX2A 4J03A 4M37A 1H2EA 3E70C 2GVNA 2QRLA 4WECA 3PC6A 3NH9A 4OFXA 4YCJA 3A4VA 4PXSA 4B6GA 1V8ZA 4S35A 1PL8A 5E7QA 4D46A 4ILKA 1NW8A 1TKBA 3OIWA 4R1PA 1B23P 4NOMA 4AY3A 3U44A 3OIFA 3DEJA 2Q2QA 4CCWA 4OGGA 5BW8A 1KEEA 3KWJA 4R6XA 1A4RA 2AOXA 1SOUA 2JI6A 2QI9F 4RL4A 5DTRA 5FWXA 2F8LA 4BNKA 2GJAA 1GPWB 2C77A 4PHHA 3SVZA 1RWNA 5GJCA 1UMBB 5ERXA 2H65A 2H7XA 3NHWA 4JJGA 3EY4A 3VR2D 4EVIA 4IZHA 4G8DA 5KDDA 1N8TA 3C6YA 4YP5A 4KQ2A 3NH6A 5CD9A 2ZW9A 2GR9A 4NZNA 2HRZA 4UEOA 5E95A 2PBLA 2J7PA 2H63A 3E3OA 3UCFA 3GLQA 5AESA 1QH8B 2UZ1A 1KJIA 3DMTA 3H04A 1XU7A 3E9QA 2AXNA 1BGVA 1RYNA 1SXJA 3IAEA 5DHFA 1V3UA 2O8EA 4KQMA 2KBEA 5K0NA 3U7QA 1FMTA 3M6WA 1MCZA 3R75A 3L06A 4LDAA 2WKSA 1WVGA 1E3TA 4AY5A 5JXGA 3OTGA 3PT9A 4QUHA 1EXNA 3GV0A 3Q3GE 1ONBA 4FMPA 4HB0A 3O2QB 2NPFA 3L3BA 2WU1A 1A76A 2HMYB 3CEAA 4UM7A 1J0EA 2EFEB 2H6EA 1T3TA 3D6UA 3R3UA 4KTVE 3GZTB 5F7ZA 5IM4A 3U4IA 4OO3A 2EW1A 3VO2A 2G4LA 3EDCA 3QXJA 2Y4NA 5B3LA 3DXXA 3DOUA 2XBLA 1URPA 2IEDA 4KE9A 4MMXB 4BE4A 4DMLA 1EK2A 4NPHA 1O95C 4XXHA 5CX4A 3SZUA 3GVCA 2R8EA 3PXXA 1X38A 1G17A 3A6JA 4Y1GA 5D6NA 4DS3A 1PZGA 4UU8A 4F97A 4S04A 1LS1A 2YHAA 3RC7A 3BICA 4KACA 5KQSA 2H59A 1EG2A 2EYQA 2NWQA 2ZUUA 4C22A 4GBMA 3U60B 4V1CB 4YMLA 1ZIXA 4IGAA 3I4LA 3LT1A 2VRWA 3W7VA 4B7AA 1QIFA 2XYPA 3EF0A 3F2VA 2QE7D 3RI3A 3HQ4O 1ZISA 3K0CA 1VXOA 2X8WA 3SOPA 4EA6A 2FPGB 3DGEC 4XYEA 1T9GS 4MLPA 3ZIAD 2AZTA 2HK9A 2IODA 4JGIA 1G60A 1QHHB 2CNDA 4KLZA 2JFWA 3UMFA 3TXXA 2VF2A 2W90A 3HI4A 4HXEB 4E94A 3RABA 1U4SA 1Z6PA 2NAFA 3GOHA 3MUNA 1U2GC 2AN3A 1YJXA 3O1LA 4O4LB 4PZAA 2PM8A 5IFLA 3R0ZA 1HXHA 3C5VA 3LH5A 5JCJD 4TYPA 1OLOA 1PWEA 1DX6A 3EXIB 3FBTA 3FPSA 2DFVA 4ZRMA 1JR6A 1V11B 4PM4A 3U4HA 3NIWA 4UMFA 3RG8A 1Z4NA 2VI5A 4B2PA 3IGFA 2O8VA 2RG1A 1CJSA 1X8XA 4DGQA 5EEHA 3SHQA 4ENTA 2OZLA 4MW6A 3HXQA 2BWJA 1YKGA 3HXOA 2VUHB 1ZXLA 1GNVA 3DBLA 2X8JA 3O82A 2EG5A 2IELA 3N2IA 1WOYA 2C9OA 4X84A 4N3CA 3TO5A 4LSZA 3ZHQA 2JJQA 1V1MA 2XIJA 3B8EA 2CMFA 2GBCA 2W22A 2PX3A 2QVGA 2WTXA 3WGQA 2RONA 3LD9A 5FR1A 3A3NA 4GMDA 1JSXA 1J8DA 1LI4A 1UH5A 3Q1KA 1W19A 1U0RA 1TF5A 5ARDA 5J4VA 1KMCA 3EHEA 3N5KA 1EE9A 1N4AA 2WJHA 2XITA 2ZE5A 4PVCA 1YR1A 1JEJA 3GVXA 3KO8A 3TXAA 4EY4A 1L7PA 4BNXA 2NQTA 3GFRA 5L4SA 3LC0A 3KL4A 4J1QA 3CLUD 3HCEA 4DXHA 4M4SA 4B35A 5DSXA 1SZDA 3HKCA 1XLVA 2QL9A 1P4SA 3C16C 2JGAA 4G97A 2A2ZA 4IYJA 1A04A 1JB9A 1NXOA 3RM3A 3UMRA 4E2ZA 1OXKB 2EYUA 1SVLA 3FOBA 3RRZA 2UZIR 3GCXA 1YZNA 2G6BA 2JAXA 1X74A 3ILYA 5LBTA 3RVBA 3SSNA 1NULA 4RENA 5AXBA 1Z2NX 1R4MA 3DE6X 3W9UA 2SKEA 4JUAA 5DISB 3WMFA 4F72A 2VJNA 1K7EB 4KGZA 2P0YA 1KBQA 2PD4A 2ZJ7A 3OOYA 1RPAA 4BVEA 3SKXA 5JSUA 3P0FA 4F9GA 5JIBA 3M6AA 3P2EA 4IGEA 4IM7A 5CB4F 1Y4SA 1D4AA 1XJ0A 2IXEA 2FRDA 3PGLA 3ILXA 4I5FA 5CVCA 5J4LA 2F8SA 1FX1A 2R00C 4EPWA 4MUGA 3GN1A 4FS3A 1KPHA 4GD3Q 3X1KA 4HDKB 1WZEA 2V58A 4KJXA 4XUEA 1Q14A 1T9HA 3WX0A 4U7HA 4MEJA 1P9WA 2P91A 1O1YA 2A1UA 1KGDA 1R50A 3O4VA 3OJLA 1ZJ4A 1U8YA 2ZUBA 4GZ3A 1HZZC 1T4DA 4CM4B 1E4EB 2NTJA 1KI9A 2Y27A 3IKMB 1JNXX 1VPEA 1L3IA 3PXEA 4HDMB 5ELLA 3NCTA 3JTMA 4Q66C 2PUGA 4OX9B 2GRUA 2VK8A 3N7UA 3L0DA 3PZBA 5D7NA 1YZUA 3ELWA 2Q62A 1LDNA 1RRKA 3AUKA 4RKYA 2WTEA 4Y30A 5DGXA 2QUBA 5DXJA 3Q11A 2RJOA 2BEWB 2QP4A 2A9KA 3WQRA 4Z4CA 3SVLA 2J59A 4AAYA 2CCJA 5IJ0A 1C3VA 1HKHA 4BUJA 5C3MA 2JCSA 3T3OA 3AF4A 4WFIA 4ZOCA 1IJFA 4CR8A 1JE0A 3EW7A 2R96A 1NVUQ 2DFDA 2I3ZA 4GRIA 1F2UA 4Y6PA 4AG6A 5GTDA 4EK9A 3T0GA 1AURA 1NQAO 3JARB 2VJMA 1KRHA 5EWMA 2PJRA 2AI1A 5CDFE 3OOEA 4RVGA 5JUWA 5L7YA 4LF9B 3V46A 5JAZA 3FSGA 5LQMA 4MWEA 4D6YA 4NCBA 1EB8A 4JL5A 2FHPA 5TARA 5KWVA 4U02A 3IXQA 4X54A 3PKZA 2ZI3A 3NWOA 3CVVA 4J0JA 2ZRDA 3OT4A 2Z2ZA 1GGJA 1RWQA 1XR3A 1CY4A 2C4WA 3BMCA 2O3TA 2QQGA 3OQPA 4V0MA 3U4AA 1ZH6A 3A4MA 5EMMA 2I4IA 2D1FA 4MVJP 4EBFA 3HU5A 1K7YA 2ES4A 2Q7XA 1MQAA 2KPOA 2ATEA 2ZIXB 2I62A 2C0QA 1T8SA 1A2BA 3PDIB 1Q7CA 4R1NA 3HNPA 4QX6A 2BMJA 3QPDA 4KBYA 2XNCA 4TOIA 1EU1A 3FD8A 4IFTA 4M9UA 4LTNA 4Y9TA 5G1NA 4FYYA 2EJUA 2ARKA 3KKNA 4Q7KA 2VAMA 3PNQA 4WJKB 2IZOA 2XTNA 4YCCA 1IJBA 3DO8A 2Q27A 5BUZA 3KC2A 2FAXA 3PLAE 3WK4A 1BFDA 3PNYA 1DC5A 1OGJA 1Z83A 2NNLD 2NUAA 1CUXA 2YBDA 3MWJA 4G8BA 5IXYA 1ILWA 2IQIA 4MMYB 4H3VA 3H65A 4OXYA 4RX1A 1UFKA 4P0PB 4QKQA 1ZUD1 4OHCA 4R9RA 2G1KA 1L4EA 5TQ0B 2ROQA 1RIIA 2WSLA 3SC4A 4S2UA 3GPBA 2BT4A 2W6JD 1P60A 1UPAA 3MTGA 4FMDB 4WHMA 4BYGA 2EZ8A 5L53A 2XUIA 1C5KA 4RGVA 5LWHA 3AGPA 2I7DA 2NXJA 5BQOA 3CVOA 1VYVA 4QXMA 5TPZA 3X1XA 1ZX1A 4W1SA 4F4FA 1N25A 3JZMA 3PFHA 5BW6B 1YDEA 2A0KA 1XSEA 4N3GA 3P1JA 4TUYA 1SVSA 2VDJA 1XB2A 2FGJA 2HLHA 2ZWAA 4GWGA 4MARA 4RJJA 4MLCA 3SICE 2X9VA 3QITA 1XNQB 4Z2AA 1M2KA 2BGIA 3B13B 4CXMA 2WIGA 1J00A 1MEJA 3ABRB 5HE8A 5F5XA 3GUYA 1E5LA 5IRCD 1I6WA 1J9GA 2QRGA 1MEEA 2W2XA 3GPDG 2A1TS 2ORWA 2XGGA 3U7IA 4F92B 2Q5CA 3K6RA 2RGDA 2Y67A 4B40A 2VXCA 4MS4A 4CNBA 2F67A 3BWYA 1Z8HA 2FPPB 3IR5A 3B3AA 3WLFA 3ZI4A 1YC2A 2QKYA 1ULSA 4RY0A 3NWEA 2X0FA 4XD7A 5JTTA 1Y9DA 5CX1B 3JD4A 2PUAA 1A5AB 3MIZA 5KVAA 1VP9A 1FSPA 2D59A 1U3UA 3EZFA 1C1DB 1ZVVA 1NRWA 3WGLA 4ZDWA 4BFLA 2I80A 2WVGA 2WB2A 4DMFA 1SELA 3C4JA 2VRCD 1TZBA 5EPUA 1GAEO 1BN7A 2Q1TA 3OUUA 4DARA 2YIVX 3A26A 3WNZA 3ZJ5A 1WNTA 4QXAA 2YZMA 3A2LA 1BE1A 1VJGA 3ZY6A 1YMQA 3CZMA 4MQEA 1MO5A 5K3FB 4YMHA 5JNVA 1SVWA 4D4GA 2X3YA 4ON9A 5DP2A 4PLTA 4MVJA 5AM5A 3KYIB 3L7KA 1EUQA 5IKXA 1WZUA 4CF7A 4Q12A 3VR5H 2C54A 3S0JA 3L6EA 1FFWA 1YFJA 1BWPA 1L8QA 2CDBA 3LHKA 2MU1A 2ZVDA 2H4JA 1FLVA 1W4LA 2J48A 3OCVA 4RGYA 2OOSA 4TN5A 4FHGA 1SD5A 4RF3A 2DT8A 4ZVPA 4C7VA 4OXIA 3JAWB 1IN5A 3H9GA 1GAQA 3CLSC 3S55A 3TVYA 4AN1A 3BHJA 1IB6A 4YCBA 2E4XA 3HCNA 3TQRA 2HUPA 1XZEA 3BE5A 3E8MA 1H65A 1XVLA 4JT8A 4KSCA 2I4NA 4C0JA 3KLPX 3LPLA 1OBVA 3GRUA 4EGCB 4AX4A 4L72A 4HT3B 3U1BA 3PE4A 3D6JA 1VSQA 2XRMA 3BXXA 4DDUA 5HFNA 4ZU6X 3DE5X 3MLBA 4Z1MA 3GL9A 4GL2A 4PYNA 1Z0DA 1F20A 3EFHA 4K6HA 5ALPA 2G80A 3QMWA 5L3RA 3KQLA 4YQYA 4J9VA 2R48A 3LUGA 2ZYUX 4ZVTA 1X1QA 4JZKA 3Q3VA 3RIMA 1DP4A 2BDEA 4RETA 1SEPA 2YVAA 6CHYA 4WN9B 4JX9A 2A7XA 3T95A 3B6ZA 2LD4A 1KI6A 2WHPA 1E6EA 2IYPA 3OU7A 1JAYA 1SXJD 2CE7A 3D2CA 3JYPA 2ANBA 3DAHA 4IF4A 1EINA 1XMQB 5C7OO 3FFTA 5TE9A 3ISJA 1CEYA 3U9TA 1OBOA 2HV8A 2M32A 4ARZA 4AO8A 4DIKA 1ICEA 3FGPA 3FGOA 5CLGA 3ZV4A 5I7VA 1OU4A 1K5DA 3GJ4A 4O4HB 3WGHA 1QDUA 5F1OA 2O2CA 3OETA 4HQRA 1W5AA 9LDTA 2FA9A 1UMCA 3QJYA 1K6MA 2YY7A 2ZJ5A 3K0HA 3LK7A 4LV8B 3PRYA 3SEZA 4EHNA 4WESB 2D13A 2HBYA 2JGDB 3FW1A 3MILA 3T54A 3COJA 3MNFA 4LZJA 1G21A 1RYDA 1RBZA 4MUHA 3HO1A 1KFBB 4I36A 4P81A 4X97A 5AM4A 5TF0A 3VHXB 2MSKA 3T52A 1AKQA 4XA8A 5DJ5A 4DAOA 3ECSA 2DQZA 2IC5A 2NACA 1A1VA 2GPBA 5TS3A 1I30A 3EDYA 1KZ7B 4J0EA 3IVXA 4BNIA 3MCVA 4I7EA 1LI7A 3I1JA 1Y6QA 5HUQA 3I2KA 3JVUA 3BCRA 4OTZA 2BONA 5U4QA 1FYFA 4YP0A 1GTRA 2K2WA 2AFIA 3M1YA 2BEJA 1M2FA 1XTJA 3HJAA 1P1JA 2JIZA 2HCTA 3L7BA 4O02B 3GLVA 4XOUA 5HE9A 2W2LA 4CZ2A 4TKUB 2A78A 1GPDG 2OMKA 2RI0A 3LBIA 2YXDA 4NHEA 3GZ4A 5BN4B 2QN6A 3WZLA 1PZMA 1SC1A 5EMKA 4R8SA 1ZL2A 1MX5A 3NC1C 1SVOA 2HQRA 2AFHE 3LX8A 3WKCA 4D8VA 2XT9A 4D8XA 4IIBA 2Q3JA 5EJEA 5KYYB 4BL5A 1M34A 1XALA 4KUGA 3G0CA 3PSHA 3CRQA 5JLAA 4XWAA 5JRDS 1ZO8A 1A95A 4EG0A 2O52A 2O2HA 2V7VA 3MWEA 4QGFA 2I7XA 2OXFA 4RSRA 2B9EA 3PFFA 5LNK6 4AZWA 1D09A 1JTEA 1W4ZA 4HFMA 2G7ZA 4S3MA 2QUZA 1JSZA 2M6RA 5EKTA 4D5GA 2ONZA 4MCJA 5LBUA 3PF8A 3HMQA 1U31A 4MJXA 1FQWA 4LRXA 3ZDEA 3L0BA 3F7MA 4QUKA 4W6ZA 2KE5A 4TSRA 2W2OA 1U2ZA 2F6RA 1NVVQ 3EA5A 3HU1A 4ND8B 3V8RA 5A3QA 1R3UA 5CVTA 3DPIA 1I4OA 4KXLA 1TMYA 2H1VA 4EAQA 1NBEA 4EEZA 2FXVA 2P2NA 1Q2UA 2P3SA 3REOA 3MPOA 2JFOA 2PHZA 1G2OA 2VHQA 1W0JA 2XGSA 3IHTA 5JJBA 4RFSA 1Y8RA 3U44B 4RCVA 4MW4A 5F9HA 2AOWA 1E1YA 1KEEB 1UBMS 2C1XA 2RJNA 3N9IA 3OUTA 1L4UA 2DPGA 1SNYA 5K8JB 2FR1A 3KVNA 1YBFA 4IQ0A 1I4EB 4YP9A 3U3XA 4ZO8A 3AKCA 2DWPA 2HGSA 2L69A 2XUDA 3Q3IA 4PWZA 1CYEA 4YCSA 5BWNA 1BDMA 1R74A 3NDPA 4C3VA 3ABIA 4DQXA 1AIPA 3EW9A 4B2LA 1VE1A 4YRFA 1EVKA 2CZCA 4HN9A 2IH5A 4FTWA 5DI3A 4KRFA 4LHXA 2GM9A 4GEKA 3OIUA 3PIDA 2PKYX 1DIAA 3WADA 1DG1G 1XQ6A 3TSZA 4L75A 2W93A 3NASA 1GGHA 2UZ1B 3BZBA 4QU0A 1T6YA 3R24A 2VBGA 3C5WP 2G0NA 2HWWA 4EVRA 1M1YE 1NF2A 4QDTA 5GGXA 1KJZA 1J8MF 1SIBE 4BU1A 2WYOA 3GMTA 5DCUA 4DBLC 2UKDA 3U7QB 1ZOLA 3Q87B 4QBHA 2F1RA 4X93A 1WD7A 1RLIA 5E38A 2JVJA 3LU1A 3VHQA 4Z3OA 1DWPA 1E3WA 2IEBA 3P45A 1IBSA 4X6YA 3DOOA 3PEFA 5IKOA 3HB9A 1PNRA 5KO2A 2JLAA 1BZYA 2X4GA 3HJGA 2PYIA 2ENWA 2DWOA 4E5KA 1P5RA 3G59A 8GPBA 4P0QB 4CG2A 2F3TA 1X0XA 4TTTS 3MBOA 4JVOA 3MMXA 4AF8A 3WIEA 4AQDA 4BJ6A 3DE7X 4BNDA 3D7SA 3U5TA 1NYQA 4JQZA 4XRRA 5LR6A 5L6MB 1JG4A 1GTZA 5K3CA 3NHZA 1V45E 2EERA 2OBYA 2Z5VA 3KPUA 3NHJA 4YXWA 1NNI1 2CDCA 2H4ZA 1U5BA 2OFPA 3DL0A 1M1NA 1JVNA 2OXIA 1ZGZA 1F5SA 3V4ZA 3ZVMA 5JWHA 1D2AA 3Q9LA 3GLHE 1AQUA 3G0OA 3I9FA 4JAVC 2DU8A 3JR3A 3K7EA 1JI3A 1QAOA 4E70A 1G7SA 4OHZA 3B1KA 3S1LA 4RXTA 3OZRA 1JAIA 2FXIA 4Z54A 2ZE8A 1KQ3A 1ZP6A 1GDTA 3RR2A 3EVGA 3A6HA 3OZDA 2OG2A 1N5MA 3KELA 3OLYA 4FOOA 4R9UC 2Z3WA 2ZBPA 3JQ6A 3HPRA 3BULA 5DBHX 4ZJZA 4O08A 1HH4A 1IC6A 1PBNA 3DDHA 2Q4EA 3ZGZA 4AS2A 4RZ2A 2OAP1 3EMVA 2F4VB 1YQWA 3FAZA 4OIMA 4P5PA 1KZ1A 1ZIPA 4BEBA 3KKMA 2OENG 3RS3A 3TMYA 1YRLA 5FYQA 4ZK2A 3RKRA 3TDMA 3FBWA 1UK8A 5IWAB 4I3FA 2X86A 3JQQA 5J40A 3IEPA 4BGVA 1R16A 2P35A 4YJ3A 5CNMA 1XG5A 1OIXA 5D3KA 2R25B 1J42A 3STTA 3VNRA 5FAXA 5I9IA 2JFNA 2OZLB 3PT5A 3R20A 1NQXA 1F4LA 1ND6A 3DBLB 3OIGA 2X8JB 1CV2A 3ADKA 4H3SA 2BLLA 5CK5A 1EP3B 3FUWA 4X90A 4QQNA 2JH8A 5BW4A 1JFTA 1V1MB 1CXZA 3A4IA 3OKAA 2B35A 1W29A 3WRXA 4E1AA 3SMQA 4I55F 2A1IA 3RG2A 4UHEA 3FSEA 1W4RA 4K2AA 2OBMA 1OXSC 1EA7A 5IEBA 3G7SA 3SYTA 3UV6A 5GV7A 4QUIA 3TM5A 3OU2A 1L1EA 2REQA 2YCLA 3REQA 3VYSB 4CCAA 2EG9A 1NC1A 3TINA 2CXUA 3KXPA 2P2YA 1GL7A 1X7YA 4JJ7A 2COUA 2PGLA 4WNIA 3GUCA 3ZHRA 4RIFA 3ACBA 1RR6A 2FQYA 3D1LA 4COOA 3F74A 4J0GA 4OHBA 1T3GA 2VHJA 1ZQ1A 3R4CA 4NARA 3OJEA 1U0LA 3IBSA 2CJXA 4UCQA 4QHYA 1YDGA 2C5HA 2PKEA 2QMQA 4L3WA 5KYWA 3IODA 1PJSA 1K98A 3HKCB 2OSVA 5B64A 4L02A 4LJ7A 2FHSA 3FZQA 4J1NA 1YR9A 4QUBA 4V0OA 1VE9A 2R0QC 1M2VA 1SCDA 1PLLA 2BDUA 1BXGA 1YB2A 2QG9A 1R4MB 4CRWB 2QDKA 4KFUA 2W0MA 3OFKA 4LPKA 1XCLA 4PHCA 2Z83A 4HDNA 3H1AA 1P1IA 4MIOA 3RS9A 1U80A 1H2ZA 3QEJA 4XQ9A 3QG5A 4C03A 3SQWA 4NICA 2GYYA 4QBKA 5KWEA 1FSSA 1E0SA 4QPZA 4P36A 2F48A 2PZAA 4CV2A 3ROGA 3CRMA 4UHJA 2DUUA 4E2XA 2IBSA 2G9UA 1CF4A 3LOQA 2HDWA 3ESAA 4GQIA 4QFBA 4O2LA 3KT0A 2A1UB 4PCVA 1J1UA 1TUEA 3R3WA 3GARA 3HU2A 1ZD4A 4S1OA 3MJVA 4WK2B 1CVIA 1HYBA 1MG5A 1XHLA 4U9HS 2IBMA 1AK9A 3RF7A 1SC9A 4NYMQ 4KLNA 3ANYB 5AMXA 5F1KA 3H6KA 1F9AA 3RVPA 3EDMA 5FTWA 4XJTA 5B36A 2HSJA 1BVYF 3CH5A 3KB6A 5L3QA 5EKSA 5LMNB 1UINA 4XX0B 5EIHA 1N8KA 1DKOA 3IXLA 3HCDA 5IJ0B 1M8FA 1CLEA 4JYPA 4LDQA 5K0FA 3FYUA 4MNTA 4RGBA 1VHDA 1E1RA 1Y63A 4QVKA 5AJTA 4GGMX 4MVJD 4LXUA 2B1RA 4YRTA 2OILA 1XCBA 1F2UB 2O8BA 1QHYA 2G1PA 4PSVA 4TKLA 1G4UR 4RHEA 1W73A 1ZAYA 3PGJA 3B5IA 5EWMB 2VWGA 3EVAA 3UK2A 3AYZB 1BH2A 2Q1UA 3IAS1 5C46F 1JHVA 2QP3A 2DY0A 5CDYA 4ND6A 4A0RA 2F3SA 2VHYA 2V54A 3WLKX 1FRNA 2NT4A 4LHYA 4PONA 1YAHA 5IC4A 3KTDA 4DUGD 1QHFA 3NHPA 3FYSA 1XAIA 4HP8A 4UU1A 4Z4FA 1DGQA 2QLTA 4HEHA 4RD4A 2A59A 1SQFA 2H2AA 2X58A 3F5DA 4JELA 1ZXBA 3BMCB 1QYRA 4ONEA 1WLSA 1UBEA 1MO6A 1TD9A 3X1YA 2PNJA 3KP1A 1E77A 5LB4A 1LJ8A 1LJUA 2HPVA 3UXMA 4AW9A 4TKZA 1F2VA 3G5UA 3MS2A 4CMEA 4LK2A 5C37A 1KA9H 2Y71A 3P8ZA 1TTTA 3BB3A 5BUQA 4QU5A 1JQDA 2BKXA 4L76A 1V8PA 3H2GA 3RSLA 1QUFA 4JXKA 3W7BA 5I48A 4Z4EA 2GPJA 2C9CA 2Z30A 4I8DA 4BRWA 5KMGA 1VKJA 1NMQA 1UAYA 4XIGS 1HMPA 4CL2A 3FDXA 3HYRA 4E3ZA 1OFIA 2NUAB 1QGZA 3L0IB 5HKOA 3G9ZA 3EPKA 1LPNA 2P5SA 2JKVA 3LKZA 3MWGA 3QA9A 2Q7OE 4YJKA 4PS1A 4EHIA 5J4YA 1GD1O 2JI9A 2YRFA 1E1KA 1XZNA 2NU9A 2QYSA 4JT9A 1QLJA 3HJNA 1DARA 4KWEA 1JIQA 1PJZA 4M9QA 2NYAA 2FQWA 3NIFB 3E7WA 1CCWA 1JHAA 1MRZA 1PIWA 2ISQA 2VUIB 2Q0QA 3QHPA 1YBVA 2FJ0A 2PT7A 3P26A 1U2DA 2ZWIA 4YT2A 5IF3A 4ENWA 1FFHA 4Q24A 1PD0A 1PR3A 3HWX1 4AF7A 4F5DA 2J33A 1JLRA 3KUXA 1RLTA 4BQRA 3L8ZA 1XP8A 1GN8A 1UP4A 3HUFA 1TA0A 4YAGA 1LV8A 1G3MA 2AVDA 4TUYB 3VJMA 4ZHQA 4L8GA 4J0DA 1K06A 2ILTA 1MJHA 5CLFA 2EZUA 5J4HA 4AMUA 1ZCJA 5B3JC 4DV0B 2J31A 2PT9A 1V8OA 2IOFA 2ZVPX 2A5FA 2H5EA 2V6BA 4FBLA 4TMTA 3KJNA 3C1AA 2HEIA 4D4KA 4G8JA 4MS4B 4IUBS 4E5SA 3RH0A 3JQ7B 2W2LD 3AI1A 5CT6A 5B57C 1YDHA 4M1QA 4RF5A 3RK4A 3FHTA 4H0FA 4UFOA 3B7PA 4ZXPA 3G88A 3M1LA 4HYTA 4C0QC 4UC0A 3S28A 4REMA 3STYA 1DE0A 3FHJA 2CXPA 4QAJA 5DPMA 1NUHA 3G2IA 5IKPA 1QIMA 3D54D 5DRYA 3C8UA 5JRZA 3ODGA 4R1UA 5EQDA 2WFZA 4M1MA 5K09A 1MW8X 3MTDA 3P2KA 4F21A 1YE5A 4M87A 3L82B 3AEZA 3GRZA 3IERA 2O5RA 3KEMA 3PYLA 4MUFA 5EMJA 5REQA 4AJNA 1TTPB 4MQEB 5CVDA 3TOCA 4O2AB 3ZZNA 2JA1A 1RI3A 1ZGAA 4BO0A 1TFUA 2XKJE 4QGSA 1R6BX 2CMDA 1QLWA 2AFHA 2BFDA 1IXSB 1NR7A 4TV8F 3E61A 4RPJA 4XWTA 5CGZA 2YL2A 3AB8A 2QU8A 3GGJA 4PRLA 4R3UC 1IZ9A 2IWHA 3UAZA 4JR1A 2VPWA 3IQWA 5ECWA 3RQSA 1QYIA 3DL4A 3E58A 3MJCA 2GXUA 3B82A 5DGTA 3RAPR 3WJ7A 2PZGA 2CXTA 3F6BX 4JB2A 5WRFA 1CUSA 4NOKA 3WFZA 4DR7B 4C7MA 3BWEA 1QU2A 1NAHA 5JYDA 2VWHA 1RPTA 2JRCA 5DYWA 3ZDBA 1JLKA 1DUIA 1K8ZB 2A88A 2C8KA 3X0DA 4BWYA 4D3ZA 4GI7A 1D4FA 3CIOA 3IUEA 1P7WA 3BFJA 3CJQA 1JQJC 2DLNA 2ZE6A 3B38A 3NAQA 3I12A 4JFRA 5H83A 3W79A 4D82A 1SA0A 1JBKA 3BTSA 1XTSA 3FNHA 3MWYW 4G09A 3N0WA 3C5HA 4OYHA 4ZYTA 2JJMA 5TSDA 2RGWA 4U39A 3V7UA 5AVQA 3WG9A 4RTNA 1Q6YA 3NHRA 5HA5A 3LPAA 4XVUA 1PO7A 2OCIA 2VKTA 4G8CA 5FFFA 4F4UA 1YR7A 3LLSA 3IYLW 1C4XA 5COQA 5A4KA 3DL2A 4GOXA 3ER8A 1UJ5A 3L84A 4RIIA 3LRPA 4PYOA 2WTNA 1KI6B 1SHZA 1U0EA 2LIVA 2V97A 2WHPB 3DLCA 3BH6A 2VWQA 3PDHA 2BVNA 1N5KA 2Z3ZA 2FFJA 1T6BY 4LKRA 1SKAA 2LBPA 1RI4A 4QO8A 3TVTA 4DNPA 4HNUA 2W42A 1XKTA 3C7KA 1BDBA 2AV6A 3H1TA 1UT8A 1JL3A 1DBSA 2PGJA 4ZJPA 5HIJA 4Q4AA 3U2QA 4ARZB 3GQVA 1BW9A 1CT9A 1YQ9A 4LY0A 1MENA 1NUPA 5AVSA 2KJQA 3MVEA 2RHJA 1GTVA 4P6VF 2X9GA 3TE6A 4BO8A 1UKYA 5FFNA 5FL7D 1H4QA 4AULA 2DHDA 3VNAA 2VDNB 3FTQA 4D0GA 4BGUA 1UMCB 2FZCA 5KX5A 1ZH8A 2Z4RA 2XYVA 1OXXK 5AI4A 1AOXA 3FOEC 1JU3A 1GL3A 2X14A 3DTYA 3FCAA 4YJ2F 4DIBA 1U8FO 3DT9A 5IABA 4KR7A 1OD6A 2WIJA 1G21B 1M1YA 1MVNA 2C2MA 3B6KA 4M9ZA 4O6VA 4WJLA 5D87A 3K9GA 4ZN6A 3JWJA 1RM3A 5JNRA 4OVKA 4FXOA 3T41A 5C1BA 2CUKA 1ADYA 1TIKA 1XJQA 2O1XA 2VDQB 1RQRA 4RLQA 4U5XA 3UYLA 4YYZA 4LDRA 3W5AA 3T94A 3ANLA 2REXB 2QA5A 1NJ5A 1SUFA 1XZFA 3A14A 1I24A 3NU1A 2OHHA 4ZOAA 3VR4D 3O93A 1PQ4A 2X22A 5JD6A 4ID3A 5LZ7A 4JT4A 3V3TA 2WR8A 2AFIB 2OO5A 1CS4C 1XN1A 3IMCA 4PO9A 4QDUA 3E0XA 3O8OA 4FD2A 1A5ZA 2H1RA 3X1ZA 3ZCUA 4LF5B 3DVQX 1UT6A 2O7SA 3IALA 1Z0FA 4YI3A 1ZNQO 4QOFA 3WYCA 2XX3A 3SZGA 1KZYC 2IUFA 1L5ZA 1S7GA 1G41A 1XVTA 3A70A 3E9EA 5FTJA 5THKA 4QUAA 2L82A 3A6EA 1GRRA 4NF2A 4YRRA 5H9VA 1OAOA 1M34B 5BW5A 2HJVA 4PC7A 1UC9A 5KTNA 3KLMX 3O03A 4G1VA 2EV9A 4NFHA 1THMA 5COBA 3ZCVA 1OC2A 4N03A 3MWEB 3V33A 4ZOLF 3VU9B 1ZC4A 3K2QA 1TQ6A 4WEOA 1BEUB 3DWGA 3QP9A 4M60A 3VFDA 1G7TA 3GQBA 2GFHA 4RTSA 3H1BA 1W25A 1QGAA 1EWYA 1N92A 4LHVA 3QOXA 3ZCSA 1B26A 3I72A 4DLVA 3U5ZB 1QH9A 3C5EA 3T5CA 4WCFC 5CRIA 5FPQA 1QK3A 4MPJA 3L1UA 1T5SA 4EKYA 3HYCA 2YYYA 5KQPA 4ZT5A 2Z2YA 5EJ9A 2D4AA 5AI9A 1QH1A 1DOAA 4UARA 4RDIA 1MJGA 1QKIA 2J41A 1EFLA 3NOXA 4DPMA 4QGHA 3WIOA 3MWKA 2LDXA 4A5OA 1AQJA 2YXNA 3H84A 3K35A 4RK4A 1PR2A 2JHPA 4LJSA 5H0IA 3E9NA 3B9QA 1Y8RB 3HDYA 4Q93A 4RFSB 5C1PA 2FZWA 1XC7A 1GILA 5G41A 1O6GA 5LKRA 5DM60 1AGYA 3NLLA 2EKZA 1GG9A 5FUVA 3JTEA 1SOMA 1XCPA 1NN3A 4XSGA 3L7DA 2RAFA 3WWDA 3OJOA 3SFTA 1QCZA 2REBA 4DQUA 2EX1A 1GPMA 4KODA 2HF7A 4MV9A 4RVFA 2QVBA 1O6BA 2VT7A 2RHWA 2ZPTX 4QZVA 3WMXA 1QQ6A 2WHRA 5DI3B 3ZKAA 1YK1A 1WCXA 1QV9A 3ZX4A 3D0KA 2Q5LA 1V2HE 3UFXA 4ENRA 3U1VA 5AVVA 1XZQA 3M1AA 3V8MA 1MC1A 2Q5HA 3KX2A 2NOAA 1U3TA 4M7OA 4LBZA 3T4UA 4CKYA 2X4IA 3K6JA 2PL1A 1NXVA 4JJFA 3C3PA 4OUKX 1QHXA 4IDNA 4RD2A 1E3WB 4OQMA 4X24A 3BF8A 2AG6A 3BRWD 4DVJA 4QU8A 3WWCA 3BTOA 3EPHA 1Q7GA 3LE8A 4MGEA 3SXPA 3A7DA 4EPYA 4JJ4A 1F9EA 1KIMA 4B6EA 4QICA 3R1IA 3JATA 4RF4A 2RCYA 4BNDB 1H1LA 7ADHA 4PLGA 1Z08A 3ILVA 4M9SA 3HWRA 4TLEA 1AKEA 1U3GA 1QHIA 1U5BB 1N9ZA 1E8DA 1JEQA 1M1NB 2QSJA 1B6RA 2Q4TA 2X1MA 4D9FA 2JHFA 1U99A 3PX2A 2EJBA 1C8BA 4MICA 2XUGA 3P9NA 3QTBA 4XPZA 4YRIA 1E1RD 1E4YA 2Q8PA 3PQ4A 5G1OA 4ABYA 2IK8A 2D62A 4HAZA 3EAGA 2PGAA 1EKXA 3M9WA 3SMVA 1LDBA 1TLFA 4RSGA 4EF4A 3T1YB 1E20A 1TVKA 3FNQA 3PWKA 1EG7A 2WJ3A 2MSLA 2P27A 3N8NA 1DO8A 1FNCA 4IV0A 3BCSA 5CBKA 4P35A 1J97A 5JNWA 1T5DX 1YB1A 3DD5A 4P3OA 3O90A 4OD0A 3DCNA 4FNMA 1OHHA 3HYNA 3KV3O 3Q88A 1V25A 4MUYA 4N3NA 1NQUA 4PO8A 4I6GA 2HB6A 3I6QA 3PKIA 3QPAA 4LVOA 2VDKB 4BNZA 2JC3A 2H1WA 2PFSA 4TM7A 4DNFA 3RVQA 1ULBA 4YJ3B 5KYXA 5CW2A 4YAKA 3ODPA 1XL1A 1IIRA 4YRBA 4ZEMA 4ANFA 2ZIFA 1K4KA 2Z1DA 3NPAA 2FSHA 2V5AA 4BMVA 2PMCA 3AR4A 3OZTA 3WLLA 3X1DA 4RTMA 2ZCUA 3KKLA 4YLYA 1Q16A 2VR1A 4DR6B 4Q39A 2AN4A 3IUPA 1RXVA 2NSDA 4OFWA 3KVVA 3RTGA 2Q6LA 5CB6A 4Q7JB 5I47A 3A28A 1DU4A 5EZYF 3WWPA 1LPAB 2REQB 4Y1EA 3REQB 3UKOA 1ZJWA 3L8EA 3MAGA 3A1VA 3GFQA 1PE0A 2XZPA 5C18A 1KI8A 1X7YB 4N65A 4YR9A 1PL7A 2HSDA 4TMYA 5KKAA 1HT3A 3ZXYA 1KBZA 2HH9A 2QAGC 2D74A 2QN7A 3B1FA 5G3ZA 3T15A 4BNVA 1G8KA 4ESOA 1TA9A 1PS0A 2C1ZA 3IEIA 3QWIA 4D0SA 4JI5B 3QY9A 1TO1E 2FN4A 5DXAA 3QTLA 4LHZA 1PS9A 5JI2E 5KYWB 5EZ6B 1U0BB 4RBNA 5FHRA 2O2SA 3VH3A 1QR2A 3TJRA 4IUCS 4K9PA 3WK5A 3E15A 2I9PA 3EIEA 1M2VB 3ZBTA 2RKBA 3IMGA 3W2GA 1FDVA 4C20A 2VSQA 1BXGB 2P9BA 3I9JA 3VPHA 4AICA 3DMFA 3ZGYA 1WJGA 3RS0A 2ET6A 4HWRA 1YDMA 1YDWA 2Z8XA 3B1YA 1SKMA 1HDCA 4HDNB 1X9IA 2P9QA 4DCGA 4LKOA 1M2HA 2QD2A 4N0EA 4KMSA 1YB7A 2WLTA 1GTSA 1UUFA 1E4OA 3PFNA 4KO8A 1C9JA 1VZ2A 1B42A 4QJ4A 4YFVA 3U4CA 1GQYA 2X0KA 1J5XA 2QEQA 2R8BA 4BFUA 4W5RA 4R2WA 3OT1A 1M0EA 3NKVA 4QECA 3TOVA 3BQMB 1MZVA 5KWSA 5KOJA 1DEXA 1PZHA 2ZRJA 1J49A 5EYPA 3PNPA 4R7TA 5IARA 1JMYA 4E2YA 5EMHA 4AJ4A 1RQNA 3GUUA 1QIDA 1MAWA 2FOXA 3C74A 1GTMA 4EHDA 4DZZA 2VO1A 1ZI8A 4IOKA 1PJQA 3RIGA 4K6GA 1B0UA 1IAQA 2QU7A 3CO0S 5IT9A 2FWJA