3B6JA

Wrba from escherichia coli, nadh complex
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
197
structure length
197
Chain Sequence
AKVLVLYYSMYGHIETMARAVAEGASKVDGAEVVVKRVPETMPPQLFEKAGGKTQTAPVATPQELADYDAIIFGTPTRFGNMSGQMRTFLDQTGGLWASGALYGKLASVFSSTGTGGGQEQTITSTWTTLAHHGMVIVPIGYAAQELFDVSQVRGGTPYGATTIAGGDGSRQPSQEELSIARYQGEYVAGLAVKLNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the NADH:quinone oxidoreductase WrbA from Escherichia coli.
pubmed doi rcsb
molecule tags Flavoprotein
molecule keywords Flavoprotein wrbA
total genus 67
structure length 197
sequence length 197
chains with identical sequence B
ec nomenclature ec 1.6.5.2: NAD(P)H dehydrogenase (quinone).
pdb deposition date 2007-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03358 FMN_red NADPH-dependent FMN reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3b6jA00
2BMVA 3K1YA 1OBOA 1AKWA 1YKGA 4M0CA 1AKRA 4YAOA 4XDGA 3SVLA 4FGKA 4DILA 2D5IA 3NHSA 3OX1A 4GQIA 2V5UA 3F2VA 3U7RA 4ESEA 2HNAA 1QR2A 1BVYF 1RLIA 3O73A 1CZUA 1ZX1A 2FX2A 4N82A 5FX2A 4QOIA 2OYSA 1XI2A 3F6RA 4QOJA 3B6MA 5LBUA 4H2DA 2FZ5A 6NULA 3F6SA 1FLNA 2QX9A 3FNIA 2OHHA 2B3DA 4QOGA 2QX6A 4R81A 2X2PA 4YAUA 1JA0A 2QMYA 2N1MA 1VMEA 3FW1A 4PU0A 5F12A 2FZVA 3OX3A 3N39C 3R6WA 2QX8A 1DXOA 3EYWA 1OFVA 4N65A 1C7EA 5EAIA 4ZVNA 3QE2A 1T0IA 2V5VA 2ZKIA 1QHEA 1KBQA 4PTYA 2MOKA 1CZRA 2BZSA 4U7GA 1OBVA 3W79A 4LTDA 1H66A 2Q62A 2Z9DA 4QODA 5FA6A 2XOEA 1FLDA 5JROA 1DXQA 2QX4A 4C0WA 4CF6A 4ZVMA 3HLYA 2KLBA 3N3AC 5B3LA 5LVAA 2HPVA 5LMCA 2X2OA 3L9WA 4QOEA 4YAWA 2HNBA 3FJOA 1TIKA 3ESYA 3TE7A 1H69A 2WC1A 3NHYA 4U7FA 4BMOB 2XODA 3KLBA 2FLVA 4HEQA 4YALA 1AKQA 3K20A 3O2NA 5F4BA 4BMPB 3W78A 4FGJA 3FVWA 1XYVA 4J8PA 1SG0A 4ZVKA 4C0XA 3UXHA 5TGZA 2A5LA 4F8YA 4Y7CA 3L9XA 1X77A 4YAFA 3HA2A 1I1OA 3FX2A 2FVXA 3NLLA 4NLLA 5F51A 4ZVLA 3UXEA 3W77A 1AKTA 4Y9RA 2RG1A 4CETA 4ICIA 2Z9CA 3QFCA 3S2YA 4D02A 1YCHA 4GR9A 3GFRA 2V9CA 3KAPA 5LJLA 2F1OA 4U7HA 3OJXA 1WSBA 2R96A 1CZHA 3B6JA 2FCRA 2MTBA 3F90A 3NHFA 3QFRA 5LJIA 1CZOA 3GFQA 1JA1A 2BF4A 4XDHA 4DIKA 5A4KA 4PTZA 1FLVA 2FAXA 3OWXA 1RCFA 3NHUA 2M6SA 1F4PA 1GG5A 3G5MA 1XYYA 1CZKA 2R97A 4C14A 1B1CA 1J9GA 1DX9A 1V4BA 1WSWA 1D03A 4FX2A 3U7IA 1YRHA 3OWHA 3B6IA 4NULA 2Z98A 1XT6A 3NHWA 1AMOA 4QOFA 5EA2A 2Q9UA 3NHLA 1J9EA 1FLAA 2FDXA 3TEMA 1CZNA 1AG9A 1QBGA 3NHKA 3OX2A 4N9QA 4OXXA 1QRDA 2W5UA 3GAMA 3LT5A 5NULA 5FUQA 1FVXA 4LAFA 3ESZA 3NFRA 2Z9BA 1ZWLA 1BU5A 3D7NA 3NHJA 5B3KA 4S24A 4C76A 3P0RA 1FTGA 1E5DA 1SQSA 4FGLA 1AKUA 1YOBA 2MT9A 3GFSA 2QWXA 3ES9A 3KEGA 1FX1A 3ESXA 2KQUA 1D04A 3EDOA 4GI5A 1RTTA 4LTNA 1AKVA 1TLLA 4HS4A 5LBTA 2MWMA 2FOXA 3OJWA 2AMJA 2M6RA 1YCGA 3KAQA 3OVMA 1RLJA 1AHNA 1T5BA 2BN4A 4LTMA 3LCMA 3NHPA 3HR4A 3NHRA 1C7FA 1ZWKA 2GSWA 2QR2A 5EMNA 4YQEA 1NNI1 1D4AA 3RPEA 5BUCA 3B6KA 4DY4A 4LA4A 5ULLA 1KBOA 1J8QA 1YCFA 4Y9UA 4H6PA 1FUEA 1YDGA 1J9ZA 2OHIA 2QMZA 1AZLA 1CZLA 2BPOA 4QOHA 2ARKA 5NLLA 3ZHOA 5LLDA 3JSXA 3TZBA 3N3BC 2OHJA 3W7AA
chains in the Genus database with same CATH superfamily
1QH0A 3AIIA 1D6NA 1JVSA 1K97A 3HYSA 2VK1A 4FN4A 3CPHA 3VC1A 2ECQA 3ZCSA 4EGSA 3NO4A 1ESNA 2NACA 3MTQA 4RIIA 3M9XA 2RD2A 2C4KA 5HF6A 2PWPA 4KAAA 3CIFA 4A0SA 3KKOA 2H08A 4RZQA 4CM8B 2KLHA 3BKXA 4MVJM 1ESDA 3QOYA 2VDJA 4TN5A 2W43A 5KC9A 4LFAB 3K9WA 3QTTA 4MIKA 4IHQA 1ZH8A 4YUXA 5ALWA 5JYDA 1WTCA 5AW4A 1OROA 4AIIA 1K7FB 1Q7RA 1QGYA 1QKIA 1SCQA 1NVFA 5K0ZA 5T7BA 4EKEA 2PIDA 3IT2A 1IH8A 1Y1TA 4L3OA 1DOHA 4QWWA 2FEOA 3T4XA 3AWIA 5IM5A 2D8MA 1JT2A 2CE2X 2TRSB 3P9IA 3IAHA 1KK3A 3JAWB 3B1VA 2FJPA 2PKQO 3ZI7A 4G0XA 3P4UA 1J1UA 3A4TA 1PJ2A 4DIFA 4LEIA 4W9NC 4PZLA 1RZUA 4X45A 1RHRA 4EA6A 4MVJI 2VHJA 2A5LA 3LDUA 3U1TA 1ZH0A 2KM1A 1VE9A 1MG5A 2UZ3A 3OEEA 4JUAA 4YAFA 5KYTA 2NTJA 3DDSA 5KHAA 1NPTO 2HCTA 1N4DA 3ZU5A 4X66B 1SVWA 3Q7TA 2AXPA 3MMXA 3U2QA 2O06A 3TAUA 1FW6A 1CR2A 2ZE7A 1ISSA 2X9LA 4OX9Y 3E9NA 3WLSA 4PZ9A 3OZTA 2P91A 1TTQB 3BWYA 2FAXA 1TF7A 2XNKA 4U6QA 4LX0A 1LC3A 2RHBA 3QOWA 1GEEA 3GVCA 1SXJE 1XVAA 1WSAA 3EGXB 1P3Y1 3K9GA 1SXJD 1X1EA 3CUVA 4PAQA 4PSVA 2G9NA 2QXTA 2J6HA 3JQAD 4IJWA 3ORYA 2O8NA 2GD0A 1WUHS 2J7PA 2WUVA 5BQPA 4AJOA 4EGCB 4RTMA 3Q8MA 3ANSA 1LK0A 1X1AA 2XXJA 4N5IX 1QHXA 4OYRA 1I8TA 5B3KA 2EJUA 3U6KA 1HT2E 3REOA 1K68A 4EBBA 2RG7A 4LJ5A 1IHDA 3PNVA 3FZEA 2I54A 1WZ2A 2DQSA 4L2IA 3FYCA 3HVIA 2UUBB 1I2AA 2BKVA 4PPNA 5B36A 1KY3A 2BZ0A 3HP7A 4DDTA 4EKIA 1MJGA 3SVZA 3K96A 3FR8A 5DNEA 3L5OA 2QVXX 1VSUA 3C7DB 3QPBA 5JNUA 3KXIA 4M36A 3UJ3X 4YT4A 5IFLA 3VKUA 3RT7A 2WYIA 3KL4A 4ZOLA 1YSCA 2C7RA 3C3WA 1RWQA 3E05A 1NRWA 3S27A 2RHWA 2QGZA 2DQZA 2O7VA 2Q3MA 3GNSA 1A2BA 3TW6A 1VJRA 4IPTA 2Z6VA 2WTEA 2XTAA 4OJQA 4OIFA 4M0PA 4TV8B 4DLWA 1Y1PA 2AVDA 4NBKA 5L9AA 1L5OA 2CK3A 1DKUA 3PXXA 1D7AA 4EWLA 1CY7A 2HRQA 1JS1X 4R9RA 4RENA 3FSRA 5GMOA 2JGDB 1RRCA 4OI0A 3K0CC 1J49A 3GJZA 3O8QA 4AX8A 3T61A 1Q19A 3K1TA 2XGGA 1QR2A 2G9UA 1ZVJA 3EGXA 4QASA 4YPOA 3EPLA 4JI4B 4UDXX 5ESRA 3T7RA 1TM5E 4Y2JA 4RKQA 1PK7A 2VP3A 4LXUA 4ZDIA 1W1WA 3PHHA 2NTEA 1ISIA 5E4TA 2YJ4A 5CBPA 1JSCA 3H1EA 4H2DA 4EJSC 1IXYA 2P5SA 3W8FA 2GJ4A 2B3DA 1WJGA 5K3SA 3JX9A 1TOAA 2E4XA 3GQBA 1VJ5A 2FZVA 1UZMA 4KV9A 3HO1A 4IEFB 3AOEC 2W4MA 1FPQA 5EAIA 4YCSA 2PWAA 4ZZ2A 2WM3A 3HCRA 3U17A 1Z82A 2JHFA 2ZRAA 3JQFC 1PZGA 2VZ9A 3S2FA 3SE0A 1UBOS 2JJ1A 4ZHSA 5KPDA 1NF9A 2NTYC 2GAAA 3K5HA 4BNNA 3RIHA 1KTIA 4C7XA 3IQIX 2O1WA 2AV6A 3QQPA 5E7IA 3QK7A 4K88A 1MEJA 3UYLA 4MR8A 1W5AA 2B20A 2Q0SA 2PU7A 2IF0A 2JFVA 2CFRA 2ZSAA 3GIWA 4RA9A 2RE8A 4WUVA 1LA2A 2PN1A 2ZIWB 2DQ4A 3A3KA 4O1MA 5AW1A 1GARA 1ZZEA 1W4AA 2BFNA 4MICA 3NKLA 2R47A 4HUQB 4NIMA 1V9CA 4GKKB 3VR3D 2E5LB 5B1EA 1J1ZA 2XA2A 1Y8QA 4M1MA 5FR1A 1U2SA 2Y1LA 2CDNA 2PX5A 4KAFA 4JLDA 4NK5A 4I50B 2R25B 1JQJC 1JIKA 2FUG6 3A4NA 3PUIA 4Q1AA 4WLNA 2BI8A 1VHDA 4F7DA 4ZIRA 3FA2A 1KPHA 1P19A 4K7JA 2OYRA 1GTJ1 4A2WA 2HRCA 4DIKA 2VYVA 3PRYA 2NUTB 3PIRA 4KFUA 5DJ5A 5BNWA 4MGEA 4WNAA 1B6RA 1WE2A 1U1GA 1R4AA 2P75A 2G4LA 3U0BA 2PMDA 4AL4A 3OTOB 4ZEWA 4X3CA 5EXSA 1GPLA 2CCJA 3IDAA 1TQ2A 4KR0A 3W6NA 1ODFA 2AC7A 2X8LA 5A3SA 2E6KA 3CW9A 4N5DA 4QTTB 1G3QA 4EJ6A 3DMGA 4N5HX 1V6AA 3UMCA 3S1AA 2ZYVX 5LP1A 1EESA 3JQQA 1GRNA 4LZAA 4RHUA 1S7GA 3FPFA 4EG1A 3CH5A 2BELA 4FBLA 4DANA 2FQYA 2XSZD 2B2NA 4UTXA 2V7XA 5A5FA 2CL0X 5FWDA 5IDVA 3R5SA 1T5TA 5ISMA 2A1TS 2ZRPA 4GOLD 3BERA 1IYZA 1Z07A 1VFNA 2BAGA 2YHSA 1FX1A 5AQEA 4ZT6A 3WQRA 7GPBA 1PT9A 2NNWB 3FH0A 1V8FA 2HSGA 2H52A 4AZSA 3LXXA 3DBVO 3L0DA 1VLZA 1WCXA 3DAPA 1O3YA 4NYMR 4X6YA 4N0PA 5I8WA 2RGCA 2JGNA 1W49A 3B13B 3AB8A 4E7PA 1J8MF 2NVBA 2IEAA 4KLNA 4R3WA 1T0JB 3AC0A 1ULBA 2CN1A 2OFFA 4JYPA 1R6VA 3KUUA 1TC1A 2I29A 5K0LA 3ZLVA 4AJ2A 4UAUA 2IZ0A 4E1AA 4NCIA 5JD4A 3WLQA 3MAAC 4WGFA 3KU1A 3W2HA 4BPBA 1RHQA 1KQ3A 1OMOA 4PCUA 5D5HA 2RHHA 1JDBB 1M1ZA 2DBQA 3O47A 3DT6A 4I8DA 1TKCA 4ZT4A 5G1NA 2WIAA 4MKIA 3IXQA 1UP4A 1X7DA 4G6ZA 4O4JF 3VU3A 4ARBA 3U4IA 5CFMA 2E87A 1QH9A 3HJHA 3NXKA 3BGIA 4KLRA 5MN5A 3RYHA 2EJWA 3UGQA 3JAMA 1GAQA 1YRLA 4I4TA 3VI4B 4G1CA 2ZR8A 3FCSB 3GRYA 2WVJA 2OHHA 4ZXFA 3MRVA 2W83A 1DJMA 2BCEA 2WDPA 3PPIA 4Q3EA 3ZK7A 3HCOA 4XPIB 1E2GA 1LB1B 1QGUB 1Z17A 2VNIA 2XX3A 1BDJA 3SXUA 3AFGA 3BGVA 4EZBA 1X9GA 1XAHA 2WKQA 3IVAA 1SY7A 3GAZA 2XTJA 1KJNA 3ELUA 2C5HA 2Q62A 3L7NA 1IXKA 2DQKA 5EE9A 3GXBA 1CULC 1GTL1 3IQEA 3MAGA 3BJMA 3QPAA 1PL8A 1W5SA 3B8HA 3OECA 2P69A 1FRNA 4GEKA 5I5GA 3T1VA 4BKOA 1MO6A 3LQKA 3FPBA 3RIXA 1L5FA 4RWZA 1OLXA 3D6NB 4WXEA 4IMRA 4L0DA 4GYKA 5EPOA 5TQ2B 4TTVA 5D84A 2HIAA 5DOVA 2ATIA 3AIMA 3HY3A 5DBFA 3UHAA 3ZHUA 3L04A 2L2QA 4ZMRA 4DUGD 4ENPA 5JJLA 4MV7A 4EYOA 1ECFA 5ICGA 3VU1A 4R8MA 2HK7A 3DL2A 3GZJA 3IJPA 3QKSB 3RVQA 3RFUA 2R5FA 3ZHRA 4EAAA 4ZQHA 4AVYA 9MHTA 5HRAA 5JSUA 3FDZB 1LBQA 3FROA 3GMDA 2BHTA 3B1JA 1I5RA 3NBKA 1N2OA 4PSAA 4BMVA 4LRYA 3T7SA 1XF1A 4D9GA 4EJ0A 4ESHA 2LKDA 2OHOA 7ABPA 3CC8A 1ISPA 1MC4A 2FJ0A 1I3KA 5TPZD 3KSBC 4L57A 3SM9A 3C3YA 1CQIA 3H9JA 1VLMA 3FWPA 3BDAA 2C00A 4LI0A 4JI7B 2HAEA 4Q3NA 1XTSA 4O8ZA 3PFCA 4YH1A 1V8DA 2Q9UA 1FLAA 4V1CI 2IW3A 2XOKA 3FHLA 5M5BA 1LRJA 1JG7A 1D2MA 5G0VA 3W90A 2BTEA 3STUA 2VHYA 1PEKE 5BUQA 1L3CA 2I62A 2W90A 3KU4A 3L79A 4D3SA 1QUFA 3KS9A 5FWYB 3LQ2A 4MITA 3UWOA 3EXEB 4WBNA 3T35A 3JZAA 4IHJB 3H13A 2DR0A 5JC8A 4E5VA 4KODA 3HDJA 1GR0A 3C6KA 2BFPA 1HOTA 4F71A 1WXFA 3TTTA 4DLYA 2HRZA 1YASA 3W06A 3PC8C 2VP4A 4OQFA 1EVEA 1TMGE 4P81A 4PXAA 1NV8A 2XRYA 5FEUA 2X5OA 1LJ8A 4RHXA 3I2YX 1B15A 3IBTA 4NFLA 1C7FA 2QVCA 5DZSA 5C0OE 4DA0A 5GINE 2VT3A 4G8BA 1XCPA 2QLMA 1FW8A 3AI2A 4EG6A 5JNLA 3A6GA 4PY2A 3IOCA 1WB4A 2H9AA 3K31A 4Q3OA 3JYQA 4QJIA 3JD4A 5DX8A 1GGVA 1Z0DA 2C4WA 3OIVA 4QL3A 4R2KA 2I78A 3IO3A 4YP0A 3SX0A 3K8QA 1K4YA 1KA9H 2O1EA 3M1YA 1JZSA 3F2VA 4IXDA 4WZBB 3T99A 5B4TA 2IWHA 3B60A 1F2VA 5KWSA 4MUXA 3JD2A 3B1XA 4LOHA 3F7MA 3EW7A 3DTVD 2X4GA 1IJKA 3LFUA 4IX9A 2SCUA 4OQ4A 1PG5A 2J0UB 4NY1A 4RH1A 4RE5A 3DNPA 3D3QA 5CLFA 2GARA 4ZPJA 3RYIA 2PIAA 4RSMA 2B6NA 4D9BA 3K9QO 4F86A 1QGZA 2CNWA 2R8YA 4MPTA 4KK4A 2ZYWX 1K63A 2C2WA 2R11A 2WJ6A 3QSGA 1HH4A 5KX5F 1U0NA 2X0IA 4DLLA 5E7JA 2JFHA 2FX3A 3OIGA 5L3SB 1JKIA 2YXEA 3UWDA 2OP1A 4MRSA 4RYLA 2Q7OE 2I6SA 1TK3A 1RWVA 3D4LA 3KQVA 5JWRA 3D2LA 2F3PA 3EGWA 2AMVA 4F4UA 3RVDA 1KFBB 5HIMA 1C4WA 3J7AC 2ENUA 4ZAFA 1B0ZA 2PS9A 3DVAA 3V7UA 3U1BA 4TTSA 1ATZA 5IK2D 2I87A 4RD2A 4BFLA 1TTHA 2ZZNA 5JCZA 3LFTA 2C7BA 2OEPA 2PT7A 3OZGA 4XB6B 1V5IA 3GV0A 4X7RA 3I8OA 1B16A 3KWJA 1E2JA 5EP4A 2XEXA 1NYLA 1S2DA 2G09A 2XGMA 3DE2X 3M3PA 3L8YA 1DNPA 2W2NA 4HJXA 4QBIA 5DHPA 5EMHA 4LQDA 4AF6A 4HPJB 1VE1A 2L69A 4JUFA 4S1PA 3UPUA 4RY0A 1VPWA 4KWCA 1TFUA 4DRXA 4YY3B 3QELA 3H2YA 2A4MA 3GPBA 1XZEA 3KZXA 3D0OA 3KR0A 5H70A 4QGAA 4FX2A 1NUTA 3BJRA 3PEWA 3NMUF 5B2EA 5F3WB 3VTFA 1P17A 2GCNA 3P9NA 3F9RA 2FHSA 4QDXA 3UY4A 1ZK0A 4C78A 3GAFA 4KQ1A 5B1SA 1J90A 2A86A 4JLWA 5JVDF 4XUEA 4RTJA 1TTTA 3CRVA 5EJ4A 1Z7EA 3E15A 5AK4A 4YREA 3DZIA 4BBJA 2NW6A 2FX5A 1DC3A 4HGRA 1IFXA 1M7BA 1JAXA 1DDIA 1E5XA 1S7CA 4JVSB 4NVRA 4P36A 4BX0A 3AVUA 4FW8A 2DAPA 1Z0ZA 1UDWA 1FZQA 1HMPA 1OSNA 1V71A 3O2SB 1QJ4A 1G0NA 3HVJA 4S1TA 3WXBA 1S8OA 3BDVA 3CNHA 3ZLJA 5H1YA 3JALA 1J21A 4S0ZA 5ALDA 1SCNE 5KVCA 3KSAC 2OB1A 3L8MA 2ZEJA 5LP6C 5SY9A 3OT1A 4WXHA 2ZJBA 3P94A 1IN7A 1YRWA 3UT6A 4CQMD 1D4AA 3UGJA 5J2TB 4TL6A 3AEUA 3QOFA 5ULLA 5JAZA 5EXPA 1GXSB 3A31A 2P9YA 4NOJA 4OQNA 5LQMA 4HQ0A 4YUYA 4Q5IA 4R1TA 4CM7A 1Z8HA 3A27A 3AP1A 1L7XA 4I8XA 2LNDA 1JJAA 3TLBA 3KKLA 4G36A 3JRWA 4M9UA 2CY0A 2EHDA 4YASA 2YV4A 4OHCA 4UCXA 5KJFA 4RF5A 5LU8A 3G2KA 3JAKA 2PUVA 2PGJA 3BE5A 4B7XA 4V38A 1P4HA 2WB2A 2WG2A 4AY4A 3B1FA 1VSVA 2CLDX 3LX8A 4N82A 5HCIA 3GEPA 4ZO6A 1VECA 4OHZA 1J0EA 1MR3F 4H1WA 3HUDA 3IOMA 4J4TA 4L95C 4NAUA 2R4QA 4KQ9A 3JARA 1N5IA 3RC9A 3TR6A 3WL3A 4L5JA 4EB8A 2KE5A 3FWZA 4PC3A 1IXZA 1ITZA 1JDBC 1UPCA 1V11A 1MPXA 2O14A 2G67A 3QJGA 4R7TA 4U2GA 1XXLA 1KQGA 2ZRDA 3PQ3A 3KT3A 3M3DA 2QMOA 3SHTA 5DLDA 1JILA 2Y0EA 5JY1A 3V2IA 1ZSYA 4OQPA 1GGFA 2AI3A 5T4FA 4C5CA 4CM8A 1LBTA 3SMVA 2CXSA 1KKUA 2JW5A 4XSVA 2NZWA 3UAWA 1XDGA 3D5TA 3JQBA 4LBVA 4AMYA 2OWDA 2NU9A 3HL0A 2NO7A 2EV9A 3PRJA 3EPJA 4BL5A 1GRCA 1M7GA 4RFVA 2VLIA 1D2NA 1XTVA 3OESA 4XOUA 4E0BA 3OFJA 4W82A 3BREA 3WAKA 1M6HA 4QQFA 5F1YA 4IKEA 2VYNA 2EF1A 4Z0NA 2BEVA 4I6JA 3F0TA 2EG5A 3ZU4A 5I51A 1FFHA 5KAMA 4M60A 5CBKA 1AGXA 1USVA 4WN3A 2JIZA 3R5XA 1EWKA 3RTBA 2EDAA 2QQEA 4BVBA 4C08A 4EDHA 5BMOA 5F7XA 1PR3A 3EMVA 1H9AA 1TQHA 3K0AB 3UENA 2QG6A 2JIMA 2XQVA 1WOYA 1DOAA 1KVSA 3GELA 4RHTA 3UXEA 3R76A 4D02A 1JIIA 1L5KA 4DLPA 2RCYA 2VYQA 4EO9A 3U19A 1S6YA 1Q7BA 2Z4RA 3WKCA 3E5HA 3TLZA 4Y2SA 2JEZA 2P8JA 3LT2A 4P4UA 3AEZA 3Q5GA 4OXYA 2IEYA 4XDHA 1QS0A 3UIEA 5DYYA 1CJVC 3OICA 3GJSA 1QQBA 2GD1O 4LWQA 1RXEA 1T8UA 2QUBA 4XUGB 1PAUA 5HKBA 1FEZA 2XZPA 2YZKA 4K1LA 4F3CA 1J7JA 3L7IA 4BNMA 1K7YA 2R68A 1CYEA 4OBWA 2B1QA 5AI6A 1LSUA 3SR3A 2FMHA 2HL6A 1SHKA 3E7DA 1A72A 1Q16A 1Z4PX 2W5UA 3GAMA 4HB3A 4JS0A 1SOWA 5BSTA 3I01M 4BJ3A 1PK8A 4ND5A 4V02A 2UUCB 1XC7A 3P9CA 5J5AA 3VNVA 2X5KO 2ZPTX 3F8SA 2J3QA 3FDZA 4BQNA 1GL6A 2JBWA 2XMQA 3EUWA 3PNOA 4YT8A 3IVCA 3UT5B 2F55A 3I9JA 4P0PB 4GI5A 4HXFB 3RVSA 4WADA 4GXTA 4ALLA 3D54D 3WBKA 2JVIA 3BSSA 1VJTA 4HGZA 3S7TA 3TE6A 4KAJA 2RI6A 3IJRA 4D82A 4KQXA 1H9BA 4L5IA 2AF4C 2FVYA 8MHTA 3W6ZA 3KQLA 2J32A 1EFVA 4XI9A 1Q7TA 1R12A 3SQWA 2QORA 1W73A 2X15A 4KO3S 5HGJA 4G2NA 3E9RA 3SYMA 8LDHA 2QMZA 2OWEA 2VNKA 3O74A 3AJ8A 3B20A 1I4DD 2B8TA 3GZTB 4MTCA 4TTTS 1PX2A 1T3LA 3EGEA 5JQGF 5IMSA 3AI3A 4WOBA 4XWWA 1ZD4A 1LK7A 1NTRA 3RVOA 4XX0A 1RQLA 2HNKA 3DO6A 3DVRX 2VHTA 4MV6A 5CDFA 3HWWA 5FBHA 4GC9A 2C4VA 2WU0A 3HCCA 3OCVA 1YNOA 4F46A 3UTDA 5BT8A 2FX2A 2QEQA 3CGGA 1M6NA 2P67A 3RASA 2Q6TA 5BURA 1F2UB 1XQYA 2A3NA 2HSZA 4HAIA 4AC9A 1ZVMA 1K6JA 2R00A 1CS0B 1US8A 2WF7A 4UUAA 4HP8A 1TKAA 1UBLS 2R8BA 5J1TB 5A0FA 4UUPA 5FI5A 3Q2IA 1BQ3A 3BAFA 4G5QA 4UBJA 1M6VB 3CISA 1NBIA 5AM2A 3DS8A 3DZKA 3ON5A 1VBKA 1XDZA 4C7OB 4WJLA 3GUVA 3JS5A 4LJ6A 2ATEA 1M34A 2JAPA 3DBRB 2COUA 2E55A 3O90A 4FP9A 4L7QA 4HAZA 2PFSA 2FEAA 2P2LA 3P5BA 2FRDA 2JBAA 3MS4A 4WV3A 4E2ZA 1EXNA 1MJHA 3I2JA 2I2DA 3DOEA 1FTYA 4ZOBA 4A92A 5DYIA 4MV1A 5FFFA 3CEJA 3HB9A 1CUZA 2YASA 3RVJA 5JH7F 1CRWG 3D6FA 3EBPA 1GRRA 1BIFA 3RUAA 1PGQA 3EDQA 4U2CA 1DFGA 1SPBS 3T1TA 2RARA 3ITNA 3OO1A 2REXB 2RGDA 3U37A 1E69A 3H5NA 4GICA 1PGJA 2C07A 1CP3A 3E70C 4IXTA 4OBXA 3S2YA 4QT4A 3A1FA 3GRAA 3OTIA 1LF0A 1YS4A 4UHBA 1SU7A 2R96A 4PHFA 2UVPA 1QFJA 1X14A 3SOPA 1NNSA 3VAZA 3HUTA 5G40A 5H59A 1DRKA 3WGYA 5CXQA 1MG0A 4GBMA 2VLBA 1NUQA 2CDRA 1BH2A 3F3MA 4PS0A 4DARA 5I9NA 4RVUA 4P08A 3ZQ4A 1O5IA 1S2GA 1RCUA 3BQNB 4JMLA 3C15C 4MX8A 1XWFA 4G5FA 4NU0A 4S2UA 3S2SA 3DTTA 5A05A 3V1UA 1QF9A 3F2IA 4Q7MB 5ECDA 1OI7A 1XDDA 2W2LA 1BX3A 5C31A 3TB6A 1NVGA 5EHNA 1P2DA 3G2NA 2C3MA 621PA 1GFWA 3QUCA 3MS2A 1VZ2A 5K0BA 5E6RB 3O8QB 1PNRA 2PCJA 1N9GB 4O6VA 3EE6A 1RBYA 3UICA 1ZK2A 4MYTA 3F49S 1L7AA 1O6BA 1AY0A 3CCBA 4ZPXA 2V7QA 1OD6A 4WK2B 1P7WA 3NC0C 4PQFA 3AFNA 2C88A 4MULA 1AS3A 2P62A 3S55A 3VC2A 4ER5A 3FPAA 4N0QA 1NYTA 2Z3ZA 3CMMA 2QX7A 1KIMA 2AFHB 1U2EA 3WZMA 4F4HA 1T35A 2H00A 4K6HA 5FI0B 3LU1A 1K86A 1ES9A 2WG1A 5E8JA 1R18A 5KAPA 3U3KA 4UAGA 1AURA 1SQGA 1N92A 2MYUA 3TRJA 4ZGWA 1F4VA 1N3IA 3DHWC 5SZKB 2WABA 1OAAA 2O2DA 5IVIA 2DLDA 2IFTA 1N7JA 2A14A 2O0LA 1PT5A 3HPRA 5FWXA 2RKOA 3ETHA 1YJBA 4TTPA 3IDOA 4F93B 1GUFA 5JD5A 4GQIA 3LE8A 2D0IA 3TJMA 1GILA 2CLIB 3CCFA 1ZI6A 4QFMA 3ZDBA 5DU2A 2GYWA 4JJ7A 1NY6A 2VHVA 2ZAIA 3LO8A 4EVRA 2E48A 4W5NA 3IA7A 2GN4A 2IHUA 1K4MA 3PVCA 4WIAA 1X70A 1XDUA 4MJLA 3IBYA 4G9EA 5JEDA 4WK4B 1ZN7A 3QW2A 4BP8A 1NJSA 1K88A 4RD4A 3CF0A 5F12A 1A2KC 2ADFA 3O3MB 2CVOA 4HS9A 5JZVA 5DHQA 3WGQA 1A5ZA 3A7DA 4NBNA 1GDTA 3W2GA 1LQUA 1P2FA 2WF8A 4ND1A 1FY2A 2IEDA 3DWEX 3E8MA 4F97A 1FJXA 1JH8A 1EEHA 4MHOA 1S0UA 1QNLA 2RH9B 2HW8A 1TJYA 1ZONA 4EY7A 1E4OA 4FFWA 4UATA 5CB4A 3K6SA 4I1RA 1D2AA 4TV9F 1Q6YA 3OZAA 3ST7A 2VC2B 2VJKA 3QF4B 1MU0A 1T2AA 2CXHA 2GYYA 3QI2A 4C03A 2NAFA 2Z3VA 1GZ4A 3PHIA 1D9ZA 1N6OA 1VDZA 3OAAD 2LZ0A 4HDMB 4WH0A 2FFQA 2ZJAA 4EG3A 3OQ6A 4B8ZA 2ZROA 4ZTBA 2VK8A 4N3CA 2NOAA 1E3SA 3RTGA 3N8HA 2UVPB 2VJAA 2Z08A 3NWEA 4HDNA 3QXSA 4BZWA 1DCTA 2J31A 1CUFA 2ZDHA 3NRCA 3GDGA 3WLIA 3DDNA 4Y6GB 4CMHA 2RH8A 2MSWA 3DPUA 3DD5A 5BYKA 1M1UA 3KELA 3RYFA 1K7EB 4OQLA 1M6EX 3DEHA 1E1MA 3VAYA 4WK0B 2ZJOA 5KNBH 3IUEA 5DWQA 3SZRA 1GM5A 1O95C 5A4KA 4EJ2A 4O29A 4K9LA 1PGNA 2ERXA 1FLVA 3WIOA 1DJOA 2ZB8A 2YHBA 3LCRA 1I13A 1V9SA 1DINA 1XYYA 2B94A 1NU6A 1XDBA 3U39A 1SKYE 2ZIGA 5CA1A 1V4BA 4EG4A 3FLBA 2H0RA 1NYQA 4DF3A 4Q4HA 4KWEA 2RKBA 3LCVB 4BRZA 3KOXA 4M1WA 4RS4A 3VNQA 3VZCA 1L4EA 3W7VA 1TYCA 3FKJA 1RZRA 3BZWA 3PC7A 3TRIA 1T4BA 2JJQA 2VK4A 4DDMA 2IU6A 3L4EA 2HMAA 3VC3A 1WBBA 1I2DA 1GLVA 3CLHA 3HHEA 5C8DA 3K0KA 5HSGA 2Q6VA 3BILA 4YX9A 2PKQP 3CONA 3IJEB 9ATCA 3IXMA 1L4GA 1JFFA 3V4FA 1K8YB 4DBVO 5SV2A 2XCIA 2DTXA 2HTFA 3C1OA 2F64A 4FCVA 2GXQA 4F9TA 1KZ6A 4GYJA 4PGFA 5JI2E 5BYBA 3RROA 1I4LD 1KK2A 4OX9B 1GADO 2YNMD 2DY0A 5EUBA 4LS3A 1P2TA 3BA6A 4M1QA 4WAUA 5DWDA 3TK1A 4YYZA 1L6IA 5JECA 1X7GA 2GETA 1E8MA 4YCMA 1UJMA 4PSKA 2Y92A 5FNVB 3HUEA 1E2NA 2OY0A 1R5OA 2VPQA 1CE8B 4R2WA 1LKZA 2B0JA 3MRTA 3FSEA 3GNLA 3ZVLA 1YKGA 4M89A 1EFTA 1SVSA 1CUYA 3EMKA 3EVTA 1TADA 4XWKA 2I2BA 1JNXX 4REOA 4HY3A 5EEHA 3GY0A 3DM9B 5D8DA 1JEOA 6YASA 3LLSA 3O8BA 1G4AE 4MR7B 3WWPA 5BRNA 3WVNA 2QSZA 5JNTA 5J3JA 3EEYA 4WXPA 3IBGA 1XTPA 2WYHA 1M2KA 5HBRA 2Z8XA 3B9QA 1SC3A 4KO2S 2VJMA 2YKGA 1NI3A 4R1UA 1W25A 1Q91A 3NBXX 4D4MA 1JEYB 1H2AS 5K99A 5J4YA 1LQ2A 3QI7A 1ISMA 1QBKC 5MGNA 5BWNA 4FT2A 2AT1A 3RWMB 1NW8A 3NKFA 3A4IA 1DEKA 3P8ZA 1TPYA 2I6FA 1E79D 3MQ4A 3QVMA 3ZG6A 4YDQA 1O6ZA 3AF2A 3UVEA 5C4GB 1MRZA 5BWBA 2NO0A 4FI3F 5LYJF 4HWTA 1U4NA 1W88B 4A0GA 4BOYA 1PV4A 1A9QA 2FN7A 2PZJA 2RGUA 3FYSA 3HVUA 4FYHA 1SG6A 2EJTA 2WC1A 1SEVA 1VG9B 1AE1A 1Z75A 2AMFA 3B8EA 1C7JA 3G2IA 1P6XA 4H08A 3PUYA 4ZQEA 4BMPB 4F3YA 1Z25A 1WG8A 2A57A 2VJPA 3EGVA 1SXHA 2KBEA 2GKGA 3EUAA 3O4VA 5DTMA 3D64A 4FMBB 3WSVA 1I94B 1G1AA 3I1FA 4PVCA 5DNAA 3ZE1B 4AJKA 1BVRA 3HA2A 3HMQA 4PO3X 4HLQB 3OCZA 3A3YA 3MTJA 5ARDA 1G59A 1ADCA 1K7SN 1U65A 2H4XA 3I52A 4LZLA 1TAUA 4CUKA 4QUAA 4ZEXA 2O8DA 3OPYI 3QLTA 4UZEA 5C8VA 1KMHB 4F0JA 1XEXB 2FCRA 4AS2A 4WL0A 1DKPA 5CAEA 4GOOD 3UPTA 1KSFX 1BCSB 1P1RA 2P2NA 1G60A 1RKBA 2GEFA 1GG5A 3EOZA 5A1JA 3R0QA 3KKMA 4PX2A 1K5HA 1EGHA 2Y1EA 2XECA 4J9UE 2OENG 1TJ3A 2FPPA 3A1UA 3V4VB 5F21A 2OCAA 1JE1A 1S2LA 3E6AA 5GONF 3WYBA 2YS6A 1EIWA 4DB4A 5E0KB 3EPRA 2YS7A 4EMSA 3WJ2A 2RK3A 1HX7A 3O4FA 2PRJA 4ZYUA 2R6FA 3KVNA 3D7NA 4BB6A 1HNWB 5DTEA 1NN1A 4QXQA 1BHJA 2P8SA 1NPYA 1Y3FE 3SIWA 3TR0A 4D0SA 1XJ5A 3LAWA 1RRPA 2ZRFA 3GRUA 1PW7A 2PSSA 2GTIA 2X4LA 4HYEA 2B8NA 2R6HA 2ECFA 4KWIA 4NYJQ 5GM1A 1PG2A 2BOVA 3EVFA 5B55A 3C3EA 2QYTA 4Z86A 4EG0A 4B80A 5KTYA 5HZKA 1Y48E 1IPFA 2JCXA 1HZZC 3B5EA 2FR1A 4DJFC 2QJTA 1Z5UA 2DR3A 6ABPA 2GK7A 4OATA 5E1BA 3PX2A 3B9BA 4QFDA 4H1UA 3VPHA 2P68A 4ACBA 3N5KA 3AETA 4L5AA 3UGTA 1K27A 1HTWA 1JXQA 3GCWA 3IULA 4NHEA 4B9AA 3GJ0A 3ETNA 4M0LA 2PM8A 4DY4A 4U00A 2V0GA 4WKCA 3V4SA 5B7QA 3RYFB 3C3PA 3HGMA 4JQSA 2E49A 1JTVA 4PO8A 1CZLA 4ZI2A 2X7HA 3WL4A 4QPCA 3AL0C 1ENZA 3MOIA 4XUCA 4YRTA 1Z4IA 2VZ8A 3JY6A 3FD8A 5EJMA 4GOKA 4PPYA 4JVOA 421PA 5FOUA 1YD7A 4CEJA 4JJAA 1AKMA 4AWAA 3AVVA 3MUOA 2IYFA 3ZH9B 2EATA 3W5AA 1Q1EA 3AEKB 1DU4A 2NUPA 3DMFA 5MN6A 3G02A 1RWXA 5J2UB 2ICAA 4HH4A 1Z7YA 4NJEB 3KQPA 5FTWA 1Y6FA 1ND5A 1ADBA 4B17A 1C9DB 4YUWA 2AYXA 3NYIA 5JCOC 1VRVA 5D3ZA 4HFJA 1UK7A 4C2AA 3DXFA 4YJHB 4PTYA 1C7ZA 3PICA 5H4GA 5KTPA 3VJRA 1NP6A 3DDHA 4MS4A 5AI8A 4TUYB 3SHWA 4DQXA 1JDJA 1N7IA 1UWVA 2GLUA 3OM8A 1P5RA 3RYCA 2W22A 3ABIA 2ZM5A 1Y4DE 3OTGA 2XCQA 4J2TA 4MA5A 1FDWA 5GVRA 5J4KA 2W42A 5K8LA 1T25A 2PL5A 3FI9A 1QX3A 1DB3A 1UKAA 4HLUC 4TVOA 2PGDA 3STVA 1ZUHA 3JPYA 2QLFA 3H4TA 1WNFA 2UZIR 2F3QA 3AR7A 1RYEA 1DDGA 3TQHA 4DDUA 1RW4A 2JCBA 3H6KA 2IS2A 1H5QA 2OV3A 1YB1A 2WSBA 3F5MA 3DT9A 6AT1A 2GZAA 3AEUB 4V3CA 2VHUA 5BUSA 1WV1A 1YJQA 5CH3A 2JEOA 4DR5B 4UREA 2RGRA 4HV4A 2HJVA 1MAVA 2HMWA 2KYRA 2BR3A 3KSRA 1WZNA 3IALA 4A16A 3W9BA 2WDZA 1OXBB 4L3VA 4A1OA 3ANMA 4WY2A 3ROKA 4YXWD 2ORYA 1YRQA 2VAXA 5EMMA 5AKHA 1WD7A 5DYGA 2DT8A 3P2OA 4OAQA 4JGIA 3I6BA 3G79A 1TZCA 4D8XA 1N5JA 2ZANA 1FFXA 5U4QA 1JLLA 3DJYA 3K4HA 2I7XA 3IPXA 4EFDA 3IP3A 1P80A 1TX4B 3ZHYA 3EIEA 5CNJA 3X3HA 3KHSA 2QSUA 4BQPA 1TAGA 2JAUA 2WNSA 5AJVB 4C76A 3R9IA 5BUZA 2IHNA 4CR7A 3MHTA 3CBQA 1T8YA 3R0XA 4PX3A 4Q24A 5EZSA 1X1RA 4UW9A 3VU0A 1Y42X 1KJ9A 2D2XA 4MROA 3ZDFA 3RREA 1WA5A 2W4IA 3KBOA 4PQGA 1H1TA 3GLFE 4BU0A 3SG0A 5B3JC 2PL9A 2Q6KA 2NU8B 3WGOA 1VL0A 2WMDA 5L7WA 1C3OB 1I33A 3DVQX 3U4QB 1O0BA 5E2AA 3BRSA 3KAQA 1DL5A 3MCTA 1ZBQA 2X8JB 4Q4AB 1QG4A 2VUIB 2PJUA 3GG2A 2D1SA 4AULA 3STTA 3ZEAA 3LIPA 2I4MA 5BV8A 3HABA 1OXXK 1Q22A 2YZNA 3G7NA 3THXB 1U0BB 1V7CA 3A6LA 2ZJFA 4W63A 4R0VA 3D4NA 2WJ3A 5AM5A 1F06A 5IBRA 2OC4A 2QZ4A 2ZQ5A 3BWDD 3FUUA 3HHPA 1PRYA 3EWSA 3L4BC 5FTMA 3ZWVA 1Q1GA 3H4IA 1FNDA 1MN6A 2FPMA 3L7DA 2XWJI 3KHTA 3PUVA 1CRQA 3BRQA 1YC5A 2NXCA 3FUVA 1C7RA 4LBZA 1W93A 3AFMA 4QU9A 3A0RB 4O63O 5BYJA 3T0FA 3H65A 2JATA 5G0WA 2REQA 3G82C 1JZQA 1O97C 1J4AA 4IVQA 4LQ4A 1JLKA 1B73A 3C87A 5KB3A 3ZD6A 3PXBA 1MJGM 1Q7CA 2QT9A 2H1FA 2H3HA 4PC1A 2WTNA 3PQCA 3O1IC 5C52B 3AV0B 3CXUA 1JGTA 4O2BB 4JEUA 3RFFA 2E21A 3FW1A 5DN9A 5EKXA 3JQ9C 4LV8B 3G0IA 4Q0MA 1YZQA 3KUDA 3PSHA 1UOQA 3EXEA 4MJ3A 5SICE 5LDGA 4XGNA 1H8HA 4G0WA 2HDHA 4ZV7A 4D6PA 2EHJA 2NQ2C 3AHEA 5J40A 1GA4A 5DBOA 4PFQA 4Q7LA 1OH7A 2UZ1A 3QLUA 2HN9A 4YIKA 1R15A 4M0MA 1E6WA 5TJ9A 2ES4A 3DWIA 1UJ2A 1VCHA 5KYKA 3VR4H 4JLJA 1UBNA 1PL7A 3KZVA 3QWAA 1E1NA 2NPIA 1XEAA 2VNAA 2QTBA 1P91A 4RVGA 1UAAA 1E9EA 1WKVA 4DG8A 2REBA 3WB0A 2KBFA 2CCGA 1Y8CA 4RV4A 3ZJVA 1K6EA 1OXMA 2PLWA 3GLGB 3EWAA 3PYLA 1XP8A 4ZCPA 4NYJR 4MARA 2XGOA 2HMVA 2P7HA 4FDLA 4LC1A 4WHMA 1EIZA 1PFVA 3P4XA 2I2CA 2PL1A 1RXCA 3V32A 3IDFA 4KTTE 1G2OA 4KXLA 2QE7A 5LWHA 2DETA 1K8QA 4KXYA 5ESDA 4AN1A 1Y9JA 4B3DA 1TTPB 1Y5MA 3KWLA 5IAOA 2WQZA 2ZBEA 3C6XA 3LKZA 3PUKA 4TT3A 4HL6A 3QE4A 3N0WA 1EFVB 5C7YA 2QS9A 5HF5A 3O9ZA 2QAGB 3AL2A 5EXEA 4HB4A 3L05A 4V0QA 3ML1A 2BTQA 4IY1A 3ZDCA 1GHTA 5CFQA 1ZXLA 5EIWA 3IVMA 3HTXA 3TZQA 4QXPA 1SKQA 1VGRA 4DUYB 4CM9A 4ZOAA 4A8JA 2ZSHA 1FRVA 2GOYA 3CE6A 1L8OA 3L1JA 2OV2A 4LQCA 2YJZA 2QD2A 4KXWA 3PQ4A 2MINB 3EJ6A 1Z4LA 1JWAB 2WUWE 2GTHA 3HU2A 1B4DA 2ECOA 1BZYA 2W48A 1KZGB 3TMAA 2EKLA 2PJZA 4PG8A 2ZM6B 1MCZA 4YT2A 1DAMA 3EGCA 1V5GA 4K2HA 1K2WA 4J75A 1B8UA 1Q1ZA 2F7SA 1HM5A 1Y7LA 4RQAA 1MTZA 3QW4B 3IBFA 3ZVNA 1JQLB 3M5WA 4CV0A 5EIXA 3PFIA 4GLBA 4EGQA 1DUSA 1H6DA 1PJSA 2Q3FA 1NOKA 1RZRD 1T8SA 1DKMA 4H3SA 4ZVRA 3TPCA 1DZ3A 3NHRA 4IDHA 5FXMA 4G5XA 5SY4A 4D4LA 1MA0A 2XMZA 1WHTB 3NPMA 2G5PA 1SU8A 4YJDA 3AHDA 2H7VA 3BK2A 4C4XA 4EHFA 1XZQA 1JHYA 5HF8A 3IAS6 2VJBA 4D92A 1PTKA 3AUKA 4R9VA 3AHGA 3Q7RA 4Q4HB 2IXBA 3PTZA 1K8ZB 3AVWA 1RYZA 3JARB 4C89A 4HAYA 4J0FA 4DILA 2Q3CA 3FZNA 2RBEA 3BB4A 2H8GA 2HCJB 3TN7A 2AN9A 1EP1B 4U2FA 3FF4A 3W6PA 4P4TA 1FFXB 4B4OA 3L5KA 1KJIA 1YUNA 1SUEA 2A4KA 3AKEA 4LOLA 2F4NA 3K2IA 5LA6A 4KVZA 3ZWXA 3SIRA 4Y98A 3SYLA 3I28A 1PZEA 3M1AA 4G5OA 1E9CA 3G3EA 4LNUB 4QBFA 4NICA 4ZVSA 3JWHA 4FONA 4NEGA 3S70A 2EGHA 4B75A 1RJWA 2ROQA 2XTNA 3S44A 3E2IA 2CUZA 3GPDG 4ABYA 4Q9JA 1OCEA 2YINC 3OCUA 4HUJA 3PKIA 4TQAA 4O1HA 5AM0A 4D3XA 2VS1A 4G24A 1J97A 1UJ5A 4ETWA 2O2SA 4YMGA 4HX9A 4ZVOA 1HFKA 2W6OA 3N2KB 1K9SA 3IHWA 4KR9A 2NYAA 2WFLB 4B3JA 3JALB 4DWOA 2J48A 4QUKA 3OZUA 1THTA 5KJEA 4N3AA 2B1IA 2WM2A 5BQ3A 2WM8A 4MYUA 2O50A 5JAUA 1RRKA 3KYDB 4MH0R 1ONOA 3OM9A 4P22A 3U3JA 3OT5A 1XKTA 1UZAA 3ENWA 2C7QA 4CMJA 2EFYA 8ATCA 3EARA 1JDPA 1U6KA 1I30A 2P2DA 5AW9A 5CB4B 4IVRA 1C8LA 1QCCA 1RD4A 2XQKA 5TGZA 3UUGA 3CWZA 4IP0A 2VWQA 5FOSA 1PFUA 4D98A 5DGHA 4OTZA 1YZTA 4H7HA 5CDHA 5FT9A 4BP9A 5HQ3A 1W6RA 2FPGB 4QU5A 1MJFA 4HRYA 3UA4A 3NC1C 1TEXA 4J1SA 1GTMA 1AB6A 4BVEA 3GBSA 1JXOA 4ALNA 3GYBA 3SVTA 1VP3A 1FFEA 1N2SA 4MAAA 4TGLA 3KSZO 1HDYA 3NG1A 5KQPA 1M83A 1NU8A 1GKYA 1FUYB 2LGJA 3ABSB 3H9QA 4M21A 4Q4CA 1KSJA 3DUWA 5FWXB 3U49A 2HWUA 1O95D 2OO3A 4RVNA 4CNQA 3DFMA 3JWIA 5K05A 2BEUA 1Z3CA 1BYIA 1VL5A 3UANA 1Z16A 3AKCA 3D2BA 3OLXA 1YR1A 3ZY6A 1ZG3A 3HB0A 3Q3CA 2Q3EA 4G63A 1XZGA 5F5LA 1DXYA 1RWMA 3BX1A 3TZEA 3V8VA 3O91A 3L7OA 4B6OA 4OXKA 2F8SA 1NLZA 2VATA 2QMHA 3BF8A 3GAAA 4EFNA 2XWBF 5MDHA 3THYB 5FNZA 3U4DA 5DKFA 2QUHA 2QM7A 1QV7A 1RBZA 1FZTA 1QCYA 4YTEA 2YV2A 3WK7A 1ZRNA 1JF8A 4B71A 4NYMQ 2OSBA 3QYPA 4B6EA 4IDQA 1GT91 3INYA 4FXPA 4CTKA 2H7YA 4JI3B 3OQMA 4GR4A 1EWRA 3BHNA 3HJAA 4MQEB 5D5PA 3BXEA 2GN8A 4LI3X 2F9LA 3PZBA 1KSGA 2GPSA 4CMIB 1JEEA 1JLMA 3BIXA 1T6ZA 3HFJA 3N2ZB 4DCVA 5BV7A 3B3GA 2H57A 3JD3A 1HDCA 3C85A 4FYKA 1AZLA 4F85A 1TJPB 3RYCB 2QRHA 3INNA 4DSZA 3GMTA 4QQRA 2YNMC 2BMVA 1T5SA 1JG4A 2R1VB 3BGDA 1WXEA 3GLVA 1ID8A 5J43A 1DX4A 1QB8A 1O8BA 2PMWB 1W35A 2IOFK 1RXYA 2JHPA 1SXGA 4IH4A 4PV7A 1NRXA 1GPNA 4W1SA 1PHPA 1VJDA 4JJGA 4PGMA 4QOIA 4QQNA 2PMEA 4X20A 3UBTA 5EE1A 4Q00A 3G8BA 3NEAA 1Q1QA 1TU4A 1OKKD 4NZMA 3RK1A 3WY9A 5B4VA 1GCIA 4F8EA 4D4JA 1JFLA 1PR5A 1CVIA 5J5VA 3TKYA 3OO0A 4ZI7B 1U3TA 1ZJZA 5HIAA 5K0CA 2JHGA 3DCYA 1QYRA 3JWEA 5CB6A 4D0RA 4B81A 1Z34A 2BSXA 4EM6A 1PE0A 4N8SA 5IK2A 1GY8A 1BXKA 3V1MA 4KV7A 2P9ZA 3UKJA 4OFZA 4HMPA 3R7SA 3QH4A 1E96A 3A0UA 3HP1A 5EJGA 5TT1A 2Z58A 4DR6B 4PG5A 2J33A 3B5IA 3DNMA 3EBLA 5FJJA 1LDGA 2IV7A 4MHSA 1XIVA 1P1KA 1VZ3A 3TDKA 3UG7A 4DG9A 3E2PA 3F78A 4C43A 1QQ7A 3BXOA 1IZ0A 3G0GA 4IIJF 4JP5A 4V03A 3LUKA 4WOKA 2ZKLA 3DFZA 5H82A 1FX0A 3GJXC 4JB3A 2EFDB 4JU9A 1ZK1A 4KK3A 3TOVA 4PWZA 1IBRA 1V26A 2YYAA 4CV1A 4ZEVA 3HCWA 3OZWA 3RF6A 5B7PA 4N3BA 2CJWB 4FOOA 5IDYA 1IQRA 3RBXA 4A1FA 5KJCA 2HOQA 4GD3Q 4OL9A 3K1JA 1ABEA 2VTVA 3L7JA 2GUWA 1ZKMA 2FP3A 3WRYC 3UAZA 4B4WA 4NARA 2JIPA 4KVGA 1UJNA 4DL9A 2CHEA 3QEMB 5CT6A 4D8VA 1PG0A 2IPOA 2J87A 3GRFA 4P0TA 3RG8A 3UUEA 1AZWA 2ZT8A 1J33A 1CS0A 4R1PA 3F46A 2FPUA 4ARCA 3K0BA 2WD8A 3IX7A 4HBGA 4H60A 2BMDA 1A8PA 1G6KA 3DMTC 1Z4KA 1GNPA 2AWOA 4LFCB 4AO6A 4U2DA 5I9MA 3GLKA 4RSGA 5EA2A 1S8AA 3NGLA 1L8QA 4M1OA 3UQYS 2ZWMA 1B7GO 2V8BA 1P1HA 2PRYA 2ZQZA 1J0DA 2PZLA 3DMRA 3X1KA 4IW3B 4RKRA 2J8ZA 4S1WA 3WLKX 5JMPA 4EKGA 4MQFA 4Q9KA 1TI7A 1BJTA 2ENWA 1K06A 3KYCA 4II3A 1CB7A 1QYXA 4B7ZA 3PRKE 2RGGA 5FBRB 3TL6A 4ZFNA 1DC6A 1DIOB 2NYVA 3LVQE 1RJGA 4GVLA 4OV6B 1O57A 1Q6ZA 1OWMA 1EK1A 2SNIE 4IJ6A 4LXQA 4LY6A 3UXHA 4O2AB 5EWMB 3ZJUA 2YQ4A 1N9ZA 3P9ZA 3SJCA 1EE1A 1V7ZA 3I1JA 3I2IA 3PQ5A 4KSCA 5LOVA 5HXAA 3ME5A 4BKUA 5BWOA 4DLZA 5HKKD 2IYEA 1VP9A 2FYTA 2VXCA 2VF5X 1Y98A 2XEDA 4R2LA 3SK0A 2FSGA 1AHPA 1J2EA 2FG5A 4GC5A 1PTJA 3F6EX 4Z9AA 4GSLA 2PGLA 1Y81A 2D54A 4TT3D 4RACA 1HO3A 2PX4A 1TIPA 3IAFA 1HNNA 1CRLA 4JYBA 3EFBA 3LHKA 3WV5A 1UK6A 5CFZA 4MWBA 4LF5B 4HSEA 4K0RA 4XM0A 3RBVA 1TU3A 2XA9A 3EZ9A 3ZN2A 1DAOA 1IBCA 4FGWA 2G40A 1NUHA 3MYYA 2OYSA 2J67A 1UDRA 1XEXA 1WY5A 4NZOA 1SXJA 4B3IA 1Z3IX 2GZDA 4TMWA 5JAHA 4Y1FA 2JFNA 3RS4A 3KX2A 4W5TA 1YU6A 3UEOA 3MZ0A 3THWA 4OGGA 4BGIA 3D8UA 5ITZB 2D06A 2PS3A 2AD5A 4ARAA 2YWDA 4LY3A 4PPGA 3Q6MA 2YVLA 4F92B 1XN1A 4QOSA 3UMVA 3AF3A 3Q7SA 5KYYB 1H66A 4HDRB 4UVHA 4BQSA 1XD2B 2HADA 3H3XA 4MVJG 4BEVA 5JROA 2W0SA 4HDKB 5DK6A 3F7OA 2Y93A 2ZRLA 2WFMA 1TT7A 1PQYA 1UPTA 4HGOA 3H2SA 5AKJA 3SS8A 3WAGA 3IKTA 1DBPA 1MIOB 1JEJA 1ULUA 2VEOA 3KEFA 2FLVA 3GP5A 5K1ZA 5JXHA 2VAWA 5KNDH 1XB2A 1SBTA 5KMGA 5KKNB 5KOJA 2OUKA 4W8OA 3PGMA 3ORRA 4AJLA 3WFJA 3F6YA 4FKBA 2HSEA 4I4CA 1SVUA 4ICIA 3G5TA 3G2JA 1W1UA 2MINA 2V7WA 1PKEA 3H1TA 5AKEA 5J2TF 3VV2A 2Y0CA 4JXZA 4G1VA 4XD2A 3DV2A 1SJ9A 1NHGA 1WSDA 4LHZA 4ZCSA 2XYHA 4X00A 1Y7IA 3RUHA 4QICA 3KWFA 1PJ3A 1RCFA 2IY9A 2G5CA 3T9DA 1H2XA 1T6NA 3FTQA 5JDIA 2B37A 3HADA 4IYJA 4F4DA 2XY4A 1V48A 3BH0A 1T8WA 1WVIA 1WM1A 1HC7A 2WSLA 3FR7A 4AY3A 1U9YA 1ZMXA 3WGTA 1U8UA 3GUYA 3L84A 2IS4A 4UDYX 4P31A 1FU8A 1ODIA 4PNPA 1SULA 2OD7A 5LKAA 4AI6A 3F6BX 4NS4A 1GQSA 3TBFA 3X1WA 2C5BA 4RK0A 4DLRA 3LCJA 4BFWA 4ED9A 1GGHA 2M32A 5TARA 3KQUA 5IRCD 1EE9A 2ETVA 5KQLA 1QKJA 2X0NA 5ALMA 4ZVUA 1W6UA 2AD1A 2YJ3A 4QFCA 3MIIA 3F8WA 1BDBA 1CR0A 1Z33A 3WLTA 4XSHA 3A1SA 3BT7A 2OGZA 3RT9A 2IZ7A 1XKXA 4M76B 1P73A 3CZ5A 3GJ8A 5C8YB 2BFWA 2ZJ3A 3QU5A 4DNFA 2XLCA 3URKA 1FRFS 3TXAA 4C3OB 4Z5XA 5ALQA 3AUSA 1TF5A 1K08A 3II6X 1DTWB 4IM7A 5CX1A 1LTHR 4JLVA 5H3HA 4RAOA 2BLLA 4AIRA 2BHNA 2FP4A 2Q5IA 4YUZA 2O8FA 2HH9A 2L19A 2GI4A 2OO5C 5CT8A 4EKNB 5CBPB 1G2IA 3LUFA 3T7JA 3K70C 3Q98A 3ACCA 1SOVA 3ZTTA 1EHIA 5FD8A 3WMFA 3KZ1E 5ERXA 1H8HD 4OGFA 3R24A 3RGWS 3K9NA 2C7VA 1AOXA 1CDEA 1U7WA 1YZUA 1C29B 3K3PA 3LK6A 3R3YA 3MCWA 5EIFA 3W4IA 1BE1A 1EK6A 4TWRA 4AU1A 4ZEMA 5LQAA 4TMXA 4EY6A 5IEJA 1KBZA 1IUNA 3H11B 1E6MA 2JKYA 4Q3LA 4NENA 1BCRA 1E5LA 3RHFA 3O8OA 5JARA 5IZCC 1K4KA 4PFKA 1Z0SA 3GUHA 3LPCA 2W8BB 4JITA 5EEGA 4PBSA 2QX8A 1PO7A 4CF3A 2R8PA 1SC6A 2XYRA 3RS5A 4BCBA 1I0LA 5F2OA 5KNDD 5B6IA 1HSZA 2V5VA 2V4UA 4YECA 3F8TA 3GC6A 1M5RA 2FE1A 5EIBD 2X3FA 4OK6A 3CTMA 4EY5A 2JLWA 2CHGA 4KGZA 1J8FA 3DAGA 3U61B 5I7UA 3QYFA 4DEXA 2IY7A 4MJXA 1CP2A 2RCNA 2BE7A 4RQTA 5KVVA 2FR0A 1W47A 4O02B 4ZZ0A 2ATCA 4RETA 5I9LA 4NHOA 2R3SA 3FJOA 3O1JC 5AVRA 5J47A 2C3OA 4AZ0B 3SWWA 4JVMA 5LC1A 5DEIA 3T3DA 4NBUA 2B69A 1IXSB 3LD9A 5F23A 2BMEA 2PVSA 3WWDA 1EZ1A 1LWNA 4B7CA 2HIMA 1ZVQA 3O4HA 4PANA 5CVUA 2H0QA 3ZW7A 3R7AA 1PSWA 3NAQA 4GX1A 5FLYA 1MX1A 3DBIA 4HTAA 2O1XA 1KI4A 5TV2A 3LG2A 4M6WB 1HSOA 3O26A 4WACA 2OBYA 4JD5A 4PLTA 1V35A 3GARA 2JC3A 2F1OA 1JKFA 2D5CA 3ETJA 1F7UA 1G3MA 4QGHA 3TVTA 4ENRA 3S8MA 4TV8A 3RDPA 4LOIA 1NG9A 5CW2A 2VDUE 4AY6A 3L0ZA 1WHSB 3G9QA 4NL4H 1MABB 5F33A 3NHUA 5KPJA 1KE1A 3TR5A 3TRFA 2I76A 2HRRA 1WOMA 3V8NA 3CRW1 3NIGB 2QM8A 4EH1A 3OWHA 1A5AB 1R0YA 1T5LA 1N3LA 1VL6A 4DBLE 1FVFA 1B14A 4HPXB 2G63A 2IRWA 3I5MA 1HE2A 2ZVQX 4GPIB 2AMYA 4XR9A 1R9MA 1QYWA 3A3NA 3HXLA 4DC0A 1IY8A 2HPHA 3EHEA 2G83A 1ZWLA 3ZU2A 3NHJA 4S24A 2IXGA 5EZ5A 5T6BA 3V34A 4ENUA 4XYLA 3Q3IA 1PFKA 3ZIDA 1BRTA 4G4SP 2ZTUA 4MGHA 3NTUA 5L3RA 2W6NA 1SQSA 2OM2A 4MIEA 4WE3A 3WK8A 4D9EA 2AZXA 3CS3A 3KQOA 2QWXA 3WE7A 1VC2A 1GGNA 5LJLA 1M2FA 3Q72A 3F7TA 3FWHA 4D4GA 1FFYA 1Q3KA 2FP4B 3R0IA 1QJCA 4P7BA 5AHRA 3VPDA 3QFTA 1Z2PX 4V0RA 4XIYA 5CGQB 1U0SY 4QBTA 4FKMA 1NUUA 1ODJA 4ZXPA 3B3FA 2WIBA 3VVMA 4JI0B 4GMKA 1J8QA 4OHBA 3ZHBA 5ABPA 5DF1A 3DDUA 2JCYA 1MOPA 1USKA 3KD3A 3SI7A 1PSZA 1Y33E 2FZEA 1EB8A 1M0TA 1BGWA 1Z62A 3ESDA 4MS3B 3PL5A 2QW0X 3RUEA 2H5EA 2ZYSA 3VSCA 5KU7A 1V16A 3ZKWB 3ER8A 1G42A 2EG9A 1YTUA 1HI9A 2PRSA 1OLUB 2W6QA 5E6UB 2VFAA 3DT8A 5I3CA 1XI2A 3E4DA 3F6RA 3K92A 3G0OA 4MYRA 4Z4QA 3NUZA 1OFHA 3F6CA 3RC2A 4MQ6A 4PAGA 4TRMA 2COEA 4WFIA 3LWBA 5C3UA 1N7HA 3C43A 4JP8A 2FPXA 1X8XA 3DUFB 4F3KA 3FPJA 3SNHA 1E0AA 2C9DA 2MSCB 4L8LA 4ZYYA 4F2HA 4YK7A 1E2EA 4DLSA 5K20A 2ZB4A 5K0SA 3PNKA 1VLVA 3U4CA 3DLHA 2DHCA 4DDKA 3X2EA 2Q2QA 2D1FA 2XTMA 4CM1A 4LUCA 2VT7A 2F6RA 1JRLA 2C2BA 4L0QA 3AHCA 5D5QA 4HGPA 4IV0A 4EFMA 5JW6A 3AT1A 2C8LA 2X9QA 1KXZA 2PO7A 4GLOA 4EB3A 4M88A 1T1RA 3P0EA 2GZRA 3PDJA 3UAOA 3D2CA 3U4MA 4QM6A 1L5YA 5AVKA 3UXYA 4BO6A 3DHEA 3PD0A 4YUVA 2Q41A 4PS1A 4RDIA 3UMFA 3FNGA 4DMLA 1EFKA 1YDWA 3D02A 4OG2A 4RHFA 1NBMD 2BLNA 1RAIA 1SHUX 3H1PA 5KYUB 2NV0A 2MHCA 1B8VA 3IP5A 4G8DA 4MLCA 3FMGA 2ZREA 4N18A 4N49A 4KOAA 1LDBA 4Y2XA 5CTAA 3G2LA 5C1IA 3NTRA 3TSYA 4EF6A 2DLNA 4MWEA 2IH4A 4EHNA 1BRMA 3VGPA 2GZSA 1E2KA 1CDDA 1IB6A 5BORA 5IDWA 1SC4A 1VMIA 3I3OA 2AB0A 3SZOA 1A9PA 4UQOA 5CNIA 5AVVA 2Z6QA 3HR8A 3IEIA 1SNYA 1CZKA 1EP9A 3O7MA 1ZRHA 1D6SA 1CUJA 1U28C 4J0CA 1MO5A 1WSWA 5EHGA 4Z2YA 4HEA6 1HLDA 3R23A 3ROTA 1THMA 3NHWA 2VF8A 3RUDA 2GCOB 4LJAA 4UNPA 5DP1A 1Q3HA 1KDPA 4FI3C 4MCJA 1G20B 1M10A 1WP9A 3R0VA 4IG9A 5A4DA 3H5LA 5CD9A 1GQ2A 5CH5A 2F1IA 5FFMA 4M0EA 2O8DB 4AJPA 3RIEA 5ICMA 1GV1A 2OM6A 4H6XA 2G1PA 3P2YA 1HLFA 3AUUA 3HNOA 2XMGA 2VSOA 4GLFA 3KJEA 4DVGA 2UUAB 3BIWA 4HVAA 1SK8A 2D1RA 1AHIA 1AO3A 4HAOA 3GOQA 3TBKA 3VBEA 3R74A 3VYTB 3KEGA 2B99A 2C9OA 2Y0PA 3RKRA 3GRKA 2YWJA 4OQDA 1W75A 1YI0A 4JNCA 3GLIB 3HV0A 4XWOA 3E0QA 2C54A 2V9PA 5CHYA 1STOA 2H31A 3MJFA 3T7AA 3N8GA 1H4SA 3UC9A 1L7PA 2BBWA 1JAZA 3S2ZA 1YR2A 1K7XB 2PUGA 1X3SA 3HVKA 3MLBA 4FSDA 1OPRA 4UNNA 5EWJB 4ECEA 4TV9B 3WGKA 4ZDJA 4KPGA 4M98A 1NN5A 3U7FB 1YU9A 4LC0A 4Y9DA 5EYPA 1NQTA 4A82A 1Z26A 4ZAVA 4CKEB 4G4GA 1GKLA 3WBJA 1NMYA 2ZFUA 3AO0B 3BH6A 5DMXA 4F5YA 3KDSE 4J1TA 1EX7A 2C8VA 1NI4A 3ZXIA 1IHYA 1OKKA 4BAZA 4ESEA 2FLKA 2V5UA 2TMKA 2HNAA 3LUPA 3AR3A 4V0KA 3FLMA 4MW7A 1QGED 5FX2A 3U3OA 5F5XA 4OHXA 3NTXA 1ZH6A 2AGVA 3G0DA 3G5UA 3NAMA 4HN4B 4QUEA 4BQQA 4MRMB 5D1NA 1W87A 2N42A 2HQRA 4GF5A 1CETA 3AILA 4W1RA 4WZBE 5B2FA 5I7RA 3IE1A 1VI2A 3D43A 2WF9A 2OILA 3PXCX 1VMEA 4XH9B 4JBWA 5AVYA 1T3HA 2AUNA 4IXMA 4QXAA 5C80A 2E4ZA 4TL9A 1S02A 5E9WA 4DTIA 1KYXA 3I6ZA 3CXRA 4PG7A 3D4IA 3SF8A 3D0RA 1RLUA 3JYOA 3KV1A 4GX2A 1S4MA 1FP7A 4RA9B 5ECYA 1M1XB 2JARA 3ZBPA 2V7BA 5F3RA 2ONCA 2Z5VA 3WOHA 1ODCA 3FMVA 1L5MA 3MPUA 3EEOA 3PUWA 2IPAB 3PEYA 3P1JA 5B6JA 1K6IA 2P27A 3DZDA 1YL6A 3T3NA 3O21A 2H92A 2ZBGA 4M38A 1KKLA 3F96A 4BO1A 1CUVA 3LZ6A 3PU6A 3SN6A 3TVYA 4LXIA 4F6LA 3Q8KA 3LXMA 1ZZGA 3HKEB 5AXCA 3VO2A 2WSSA 4HTFB 3KE9A 3P7MA 4FJ1A 4X93A 4IFTA 1AF7A 4Y2TA 3K9CA 1M9NA 2C94A 2IIPA 5FV7A 1AM4D 1SZPA 2ISSD 3L92A 3LS2A 4BJ1A 1T5DX 4GVPA 2O8EA 2H2GA 4Y2YA 2D8AA 2IHJA 3H05A 2K87A 2VO1A 2W6ID 4KXQA 1FX0B 3V3KA 1T1EA 4NR0A 5IU6A 4X85A 3N7TA 1J07A 2W2TA 1NKTA 1IONA 3A26A 3I0ZA 4LVCA 3C6MA 4Z9BA 5I5EA 3PWTA 2YHIA 1KRXA 1JJVA 3CH6A 4H0NA 4AZ0A 3OIDA 4OAPA 1NPDA 1Q0RA 1UKCA 1Y1KE 4EHDA 3CKMA 3KZCA 4XYMA 1EEXB 4PLHA 2JLAA 3T9AA 4BQFA 5ICCA 3KDPA 5CCBA 2Y4OA 3ANYB 2L17A 3G5AA 1XL0A 1QHHA 4G41A 4UHFA 3U7QA 3TZCA 3WBBA 2FMUA 3L7LA 1ZNXA 1CEEA 1NP7A 4GUDA 1SH7A 3SC2B 1U2GC 5DT2A 2BKEA 1CZNA 5C32A 5KTNA 4O4LB 2ECKA 3AZPA 2Q5CA 4C21A 2XCTB 3PEUA 3EUEA 1VBMA 4MRRA 1T4CA 3NFRA 5DLQC 5H3CA 3RHSA 5DBIA 3CSDA 1AA6A 4OKIA 4MIOA 3LYAA 1JQBA 1FDIA 2IYUA 3MJ4A 3OT1B 4DEVA 2OXIA 4OB6A 4OMCA 1YQGA 1FJGB 2Z04A 1IOWA 1HY3A 2J4DA 2XUIA 2AJ8A 1RBMA 3G23A 1OTYA 3ES9A 4XIIA 5GY7A 5BQXA 2V1UA 2OLEA 5LNK6 1N5OX 3RNLA 3H6HA 3TLYA 2J3HA 1VLHA 4RFLA 4DMGA 4BIIA 4BNIA 3OVMA 2PXXA 3RKSA 3RE1A 4QXRA 3CVVA 1DCFA 4JB2A 4MCAA 4QM7A 3KLPX 3RPEA 1O4WA 4LA4A 5FFNA 3H0CA 3UT0A 4EL5A 3I62A 4NOLA 3H11A 2ZLBA 5CDFE 2XKKA 4DLAA 3QYJA 4YS6A 1UXGA 2GPBA 3NH9A 3X1JA 5JXGA 4FHDA 4MUNA 1JIJA 4YC7A 1FP2A 1Y1RA 3E0XA 3GH3A 5EMJA 4MCIA 1AKRA 3QIVA 1YZKA 3ESAA 3MWJA 2Q1UA 3T1HB 2FB9A 2XWSA 2ZYAA 5EHIA 1CQJB 1DT3A 4OVKA 3DFIA 3HKBA 3KJFA 2ZUEA 2CJPA 1T2FA 3DW3X 3KFLA 1F1JA 3MQ2A 3O73A 4R16A 5DP2A 4O4HA 5DM60 4BJ5A 4BKMA 1BEUB 4CMEA 2EX1A 2JK1A 1M0EA 1DARA 3GEGA 2WE7A 2QRVA 1DO0A 2YZ2A 4MO2A 4FOPA 3TRKA 4Q3KA 3WHIA 1H94A 1R7RA 1RVDA 5K8IA 2BH9A 2RGBA 3P0FA 4I66A 1XL1A 4HEA1 3C45A 2BJVA 4LVNA 4ZGGA 1B0AA 1SBQA 2P77A 3WJAA 4PEVA 3RSZA 4ZMBA 1V1RA 1R0KA 2Q5QA 2R7NA 4GBED 3P2EA 4UEQA 4V2UA 1TUIA 4RTKA 4KDCA 1QO0A 2ZBDA 1XNGA 4UU7A 4GPZA 5FUBA 1D5WA 2O5CA 1LLUA 1RHUA 3DBOB 1LDEA 4KLAA 4ND8B 4RJLA 1F8GA 3NCHA 4IIBA 2BL4A 4U7FA 1YAHA 5ALIA 2BKAA 3EF1A 3K9HA 4B73A 5FOTA 2JLUA 2Q4BA 2HCRA 4FGJA 1W2HA 1DBQA 4JXJA 1ZRMA 4WZAE 4DPLA 2XDWA 3ZV3A 2RHMA 3F4LA 5CLJA 3SJBA 4DA8A 3ICQB 3DP9A 1O87A 3G2OA 2SECE 4CVNA 1W94A 2N9UA 4RTLA 2C2MA 3L18A 4RHCA 4TUYA 4O2RA 3ENQA 3PUZA 3OPYB 4R8SA 2X77A 4BLPA 5K4GA 1SBYA 1VOTA 4FHEA 4JR1A 4TZKA 5EQJB 2IUFA 3ETCA 1WY7A 2IQ5A 3LWZA 3G1TA 5ERGB 3OWOA 2H54A 2O2YA 2ZVJA 4NESA 2NSHA 4PZ0A 1ZCZA 2ODPA 1FL9A 2VP9A 2OCXA 3DOOA 3SBOA 4EYKA 3HJFA 2H1HA 5JPDA 3TUJC 1JIUA 5GIOE 3IHTA 5DBGA 2BISA 1M2EA 2Z5FA 1QO9A 3D4OA 3FXAA 3JQ8B 5MFZA 2ZSKA 1Q74A 4UHEA 3CSSA 1TXGA 5H8WA 3IUSA 3BFXA 3E3NA 5TDHA 1XLWA 2WUFA 4O4JB 3LA8A 3VU9A 5K51A 1E8NA 2YY7A 3I9V1 3OFSA 2XNHA 3OLZA 3Q7IA 1RHKA 2ZBUA 5HUJA 4M7WA 4IMIB 5ITZA 3RH0A 5J2UF 1P31A 1ZMBA 3K70B 3UV7A 1YQUA 1PBTA 2VTDA 5C8XA 2HRBA 4WFKA 2BONA 4PHTA 1IUOA 4GM0A 5L95A 3M2PA 1F2DA 2N0SA 4A0QA 4AZVA 3TQSA 2UXCB 4XRGA 4F2DA 3E84A 1A9OA 4B32A 5T57A 1RYDA 1G2PA 5KUTA 4YR7A 4FCTA 1C9KA 2P9TA 3RJTA 5BUCA 5BWCA 1H6CA 4J0KA 2CUKA 3KOZA 1WW8A 3M6WA 2IIQA 3HBMA 1TDJA 5EC8A 1PT7A 1MQAA 2SKDA 3RSFA 1WDKA 4HDSA 2GEKA 4E51A 2J7PD 3ERCA 2FWIA 5KVAA 3LIIA 5EHQA 5HCNA 3FHOA 2QD5A 1UH5A 3AM5A 3GF4A 3GCGA 3R9KA 1SA0A 3ETDA 4BTEA 4BS9A 2Y9MB 4EI9A 3T3MB 1KWGA 3QVJA 5CLHA 3FMOB 1RLIA 1VCMA 2XQJA 3UN1A 2XVAA 1U9IA 2NQTA 2FWNA 1CT9A 4N6NA 2GJSA 1E59A 4OL0A 5U1PA 4O4HF 3UMJA 1QS0B 1HORA 1GUDA 1GGEA 3ZQKA 3NS7A 5I6DA 2IYZA 4ZK6A 4KPUA 1AKEA 4EJSA 3KLNA 5EJAA 1EX6A 3JV7A 1KVUA 4IIVA 1PR0A 4IDCA 3RD5A 5KQSA 3G5LA 2FGKA 2X9GA 3N5CA 3OQBA 4XLLA 4B76A 1WEKA 4RIEA 1MOQA 1C3JA 1ZA1A 2VJMB 5ALRA 3VJMA 3TL3A 4QODA 4OSEA 3THWB 1W96A 1GUBA 3CKLA 3ZGLA 4D99A 2NUAA 3KUXA 4RVDA 1CLEA 1ORWA 1KI7A 4AG5A 2QUZA 2BFDA 4MA0A 1XPOA 3CRNA 2W4QA 1N2BA 4JHXA 1PFGA 2D3WA 3N53A 4TRRA 2MSDB 5MN4A 5LNK1 3PXAA 4ZO7A 1ZM2A 2REQB 4KACA 2AOUA 3FX2A 3RIMA 3QVGB 4XQ0A 2QYOA 4QX6A 1QHNA 5BPFA 1BXGA 5F52A 3R41A 4M9CA 3LTNC 1DC5A 2CZCA 5CH8A 3NNSA 4MAMA 4RORA 2WD7A 5AJHA 1W5TA 3LOPA 1D3AA 1DQPA 1XMXA 4WPGA 1YI8A 5CNKA 5F3DA 5CEEA 5JSQA 1XQVA 1C3XA 1QWSA 4MPJA 1XTKA 1JTFA 2W2QA 3KB1A 3VZRA 5BMVF 2R1VA 4GZMA 5K0NA 5KDOA 4FB5A 4UXJA 1KYZA 1RRVA 5B1HA 1MKYA 3TDMA 1N36B 2ZRMA 4KIFA 1JIQA 1XZIA 2IW1A 4NCJA 3ICCA 4PZPA 3ZCTA 1YK0A 1EXWA 2X1HA 3AYZB 4AT1A 5G53C 5KEIA 2BGWA 1FQJA 3H5TA 4WCVA 4WXMA 5HTOA 1PV1A 1E4EA 3IIEA 1F8FA 2NTVA 4OEHA 4URXR 1SKMA 1K8RA 1CJTC 1YVRA 1M54A 1QBGA 2JDID 2W2PA 2QD1A 1NBMA 1P5ZB 2DFDA 1NJ2A 2C5GA 1U90A 1LLDA 2JK0A 2VN8A 3B5JA 3L6OO 3OZVA 1GUZA 1L5NA 3S29A 4ZQBA 4L5YA 3B7WA 3L82B 4EFLA 4CE6A 5AI9A 2YWFA 5I9BA 3TFOA 1GNLA 1YUMA 4PYQA 4X7BA 1Z2EA 2BWJA 3ASUA 5J2TA 2P9FA 3V33A 4F3TA 1SB8A 4Q6WA 1UXKA 4K6OA 5EG5A 2V0NA 521PA 2QVGA 2YW2A 5IASA 2AK3A 2XZOA 2TMYA 1T1SA 4GP7A 3RIGA 3TWOA 5BVGA 4OAOA 5EMNA 2DY1A 1TCAA 4MPRA 1UF9A 2AKEA 4C6HA 4II7A 1KO8A 1PQWA 2PV0A 1YR8A 2P6NA 3OX4A 4TYNA 1H4VB 1PGOA 5KYXA 1DJPA 2O2GA 2ORIA 3U3MA 2GD2A 4NE9A 2ID4A 1NJ6A 4WGGA 1CUIA 1XXHE 2CNBA 2Z5GA 4HFNA 5CCDA 3HEAA 4EUNA 2QRZA 4Q21A 1R4MB 2FPLA 2CJWA 4M0CA 4EEZA 3HKCA 1VCOA 2PT9A 2DJIA 3VDQA 1F17A 5K09A 4G56A 3HRHA 4DLKA 1DC8A 1YB7A 5DX0A 2BBSA 3B1YA 3OJLA 4HWOA 3QOXA 1Q21A 4BU1A 1LVHA 1U7XA 5CFRA 2QT1A 2MYNA 2VDRB 4DHEA 4C30A 3OCCA 5DN6D 2YMLA 1BMDA 1DSSG 2GUGA 4YJ3F 5AW7A 3D5EA 4XTCS 2IPNA 1GL9B 4GBJA 4KJZA 3WGJA 3E22A 2CC2A 4E13A 4EI2A 3IMCA 3NI2A 3IPAA 1SU6A 3Q6NA 3UM9A 1DBIA 1MD9A 5ED4A 5KIAA 4TLMB 3ONFA 4IL5A 4LHSA 4YV2A 1QLWA 1YQQA 3WB9A 4IV8A 3HC7A 2R751 1MB9A 1GL3A 4KW7A 2ZTLA 3U40A 1N1MA 4LZOA 4KRGA 1OYOA 1B6GA 1RE0A 1REQB 3AEQA 3E9ZA 1ZD1A 3KJNA 5T41A 1A4XA 4K8RB 2KSQA 3GFPA 2X2EA 4J0GA 3KM0A 2BGRA 1LVUA 4TVKA 4FDVA 3TZ6A 3MERA 3P0JA 4YCNA 2VSQA 1NHWA 5ER6A 1DCMA 2JIQA 4H77A 3K0CA 5SYMA 5EKTA 2OCPA 4LWPA 2Q3DA 2C4NA 1JR3E 1NMQA 3FGOA 5EVCA 1KO7A 3K30A 1CUBA 4HMOA 3ENVA 4Q4LA 3EZNA 4G0OA 3L9XA 3MYRA 3U7QB 4QC2A 5L3SA 2EL7A 3EMDA 3MGCA 1ZW6A 3QPDA 4BTVA 5EE5B 2XVYA 2XWQA 4ZOLF 1NUAA 1R0BA 3W2EA 4U9HS 1ISGA 3DE7X 1D2HA 3WZLA 2X1LA 5EJ2A 3B3QA 4JT8A 1IEXA 3KPJA 3ZXSA 2YY6A 3G8CA 1GN9A 3DXXA 4J43A 1F14A 1YA6A 3WYGA 3CF4A 4R1QA 4D2IA 2HXGA 5L3VA 4D74A 1NWCA 2GM9A 1IB0A 3MGBA 2H1IA 3O92A 4GI1A 3IUBA 3RSQA 2AN5A 3RYTC 4CFYA 2CV1A 2JGFA 4MCHA 3W5IA 4K9OA 1NF2A 1M8KA 5ALGA 5JNVA 3VSBA 3M6XA 1Q0QA 5DN6A 4CT0A 4X65B 2B34A 4JXKA 5BXYA 3COJA 3R3ZA 5FTLA 2ODBA 4IICA 1R4NA 1KARA 4WBSA 1P18A 1RYMA 3BJZA 4X1IA 3DE6X 5WRFA 4BV2A 4DC9A 4FOSA 2QSJA 3E9DA 1VL1A 1V5FA 1TYZA 4EZEA 2FW9A 2YXDA 3CZRA 2Z2JA 2WWTA 1BX0A 3BMOA 3U3RA 5M34A 3RSHA 5EXTA 3RNOA 4QNMA 4QU0A 4IV5A 2XUGA 1U2PA 3O1HB 2GZ1A 4LDJA 3GDFA 4LX8A 4ZQFA 2B7LA 3M6LA 1FSGA 2V7GA 3AW8A 3E5RA 4L16A 4BMYA 1LDMA 2ZIEA 4FOLA 3VOBA 4ZJPA 1QHFA 2NSDA 5J59A 4XX0B 3T5GA 4DG5A 2DLCX 1TJ5A 3F6PA 3PGKA 4ZEOA 3CUEF 3PE4A 1K5PA 3WI7A 1QHGA 1P2VA 2PSEA 2HFKA 3BM5A 1I36A 4DIDA 3RG2A 1NXXA 1YWGO 2HQ1A 3PB3A 4YCBA 3ULKA 4KR6A 2JHAA 3HBNA 3FMIA 3OURA 1RQXA 3I05A 1MBZA 4R1OA 4EF4A 2BGMA 1OV6A 1N2EA 4OP2A 3WGIA 1Y3DE 3IQZA 3PPVA 4QJ4A 3M6FA 5CHEA 1QU3A 1DTSA 2Y1OA 5CFNA 2BH2A 3GLHB 3VR6A 3D6MA 2WAXA 4JI1B 2R8ZA 2VH2A 3MA0A 3PR3A 5CYPA 2FFBA 2JPDA 3M7IA 1LLFA 4A0HA 2A84A 3EC1A 1OX5A 4P3XA 4D0GA 4YMTA 3OQOA 1ZOLA 4N76A 1JSLA 1YZGA 2OCYC 4LMRA 4WCDA 2PT5A 3ORFA 3IESA 2TYSB 2AR7A 2XMBA 3JYNA 2VUUA 2VZEA 3IL2A 4NC9A 3QHQA 1EFUA 1TO2E 4UD6A 4WNCA 5KOYA 1IN5A 2QAJA 2IZ1A 2Z3WA 3NYQA 2DTDA 4I1UA 4DMMA 1YHYA 2BZSA 3CEAA 3T3PB 4MUHA 3X1DA 2QIOA 3ZV6A 5JDIC 1N6KA 2BMJA 1Q0HA 3OZIA 5DB4A 3LDGA 1M1NA 2CBXA 2XPCA 1S8NA 5EJ5A 1ZJYA 3KEQA 3CCCA 1LDNA 1M2JA 2X8AA 3TQRA 2ZBFA 4Q7KA 1NZDA 4UQPA 5FPHA 3OE1A 2NO4A 3LO5A 1UAYA 5TF4A 3ONVA 5K2OA 1CQZA 3BYZA 2Q9AA 3JATB 4YP7A 4PFSA 3V8EA 3EOAI 3TIGA 1UBSB 4XRRA 4UM5A 4M86A 4JJ8A 1BAPA 1UPFA 1Z5GA 4JC0A 5I4BA 4Y7CA 1R64A 1H1LA 1UC8A 2GBLC 2QKYA 2I55A 2RHJA 3N0VA 4EELA 1ZOOA 4Q01A 1HDRA 2D5AA 3I45A 3PNMA 2PBRA 4BC0A 1TYAE 1DKQA 1JQAA 2Z4SA 3Q3VA 3AY3A 1QHSA 2OOSA 4GR9A 4RDHA 4RV5A 4DOMA 4HQ6A 1H2EA 1JG6A 3TSWA 4IGEA 4MDEA 2IEIA 4JX9A 2RHLA 1KAGA 2WUGA 4J94A 2O48X 3DVLA 2D1YA 4X6XA 2UXDB 3QXJA 4G84A 2ZJ6A 5CYOA 1PLKA 1G2QA 4L28A 5IXJA 5IPFA 5ETJA 3RVRA 1RNLA 3RBZA 1NXPA 2QOEA 3OKAA 3H9UA 2CHFA 1YIAA 4HBZA 4PLVA 4R6WA 1HT3A 4RANA 4BNDB 1QRRA 2IU4A 4IS2A 4BXOA 4UOQA 5EQTA 2Y6VA 1VJCA 5TPZA 2IUSA 1NBME 2OZEA 4FFDA 1QTNA 4LZZA 3L1KA 1SUDA 3LT5A 2GWRA 3OPNA 4BRSA 4C0KA 5IJ0A 2V6JA 1COZA 1E6KA 3AW9A 3TW8B 3F74A 1EVLA 3T7EA 4ZQGA 3RJ5A 2D4AA 9LDTA 4BO3A 1OFGA 1VFPA 3PWSA 3KO8A 4AAYA 5LP6B 4AKHA 3V1TC 4BVHA 3NALA 1LI7A 4H35A 2DUUA 2AJCA 4QBHA 2I6GA 4R2IA 3UG6A 5B57C 4BO5A 1FJ2A 2RIRA 1FRZA 3WK4A 5BOSB 4FE7A 4J0EA 2UDPA 4CUZA 1D4OA 1A7UA 3BGSA 4X0EA 4H17A 2RI0A 2EW1A 3E1KA 2C7PA 4DQVA 2C2YA 1OYYA 4CJXA 1RZVA 4F8JA 1YMQA 1SXJB 1NSYA 1T4GA 1XGKA 4RL4A 1MLDA 4Q1BA 2D0PB 3F9CA 3RLIA 3H0EA 1LCIA 4QAJA 2HA4A 4QGFA 1GITA 1Q0LA 2IF2A 1LK5A 1E79A 4FLEA 4I0WB 4B8YA 3FAKA 4KXFB 3Q0EA 5AI0A 4C7MA 2IE0A 3HL4A 4L4SA 5AMXA 4GUAA 1G20E 5HG0A 5KSPA 4ALJA 3PQDA 1IUKA 1ML3A 3LHIA 4HFRA 4L51A 4RVFA 4Y1RB 1S1MA 1LSSA 3AX6A 4J0HA 4B45A 3OP4A 1P3JA 3CFYA 4IEIA 1KDZA 4F3NA 5K45A 5H81A 1W8DA 1KJWA 1O95A 4ZA2A 3IELA 3KAKA 3CJQA 2FUNB 2IWRA 1JEAA 2P4SA 3ZE2B 1GFSA 5EJFA 4CTOA 1PNQA 3FWYA 4CQJA 1V4NA 3EVZA 4Z7QB 5FWNA 4GKJB 1I32A 3H5IA 3W2IA 4X91A 2W2LD 3DKKA 3JD1A 1DDOA 2AVNA 4Y0NA 4YMUA 1P3DA 2OT3B 2C4HA 3DHVA 2FXIA 3JYPA 4Q3CA 4RCVA 1UUFA 3WGVA 3AF1A 3MS7A 4J4HA 1U80A