3B6JA

Wrba from escherichia coli, nadh complex
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
197
structure length
197
Chain Sequence
AKVLVLYYSMYGHIETMARAVAEGASKVDGAEVVVKRVPETMPPQLFEKAGGKTQTAPVATPQELADYDAIIFGTPTRFGNMSGQMRTFLDQTGGLWASGALYGKLASVFSSTGTGGGQEQTITSTWTTLAHHGMVIVPIGYAAQELFDVSQVRGGTPYGATTIAGGDGSRQPSQEELSIARYQGEYVAGLAVKLNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the NADH:quinone oxidoreductase WrbA from Escherichia coli.
pubmed doi rcsb
molecule tags Flavoprotein
molecule keywords Flavoprotein wrbA
total genus 67
structure length 197
sequence length 197
chains with identical sequence B
ec nomenclature ec 1.6.5.2: NAD(P)H dehydrogenase (quinone).
pdb deposition date 2007-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03358 FMN_red NADPH-dependent FMN reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3b6jA00
2XOEA 2FDXA 1YDGA 2Z9DA 4QOFA 2V5VA 3O2NA 4XDGA 4YAOA 4FGJA 2FCRA 1X77A 1AHNA 2BF4A 2F1OA 2Z98A 4LTNA 3FJOA 1CZNA 2FVXA 1F4PA 3NHRA 4N65A 5NULA 5LJIA 4PTYA 1YCGA 2OHIA 2ARKA 2Q9UA 2FX2A 2OHHA 3N3BC 4GQIA 4LTMA 4NULA 4BMPB 3SVLA 2WC1A 1CZKA 3D7NA 2FZVA 1JA1A 1WSWA 3LT5A 3OWHA 2Q62A 5LJLA 3B6IA 5F51A 4YQEA 1VMEA 1FVXA 3FX2A 1H69A 5B3KA 4GI5A 5TGZA 4H6PA 3RPEA 1D04A 3GFQA 1RLIA 3R6WA 2HNAA 3UXEA 3B6MA 3F6RA 3L9WA 2QWXA 3KAPA 3W7AA 4NLLA 2FLVA 2N1MA 3NHWA 4QODA 4QOHA 4U7FA 5EMNA 3TE7A 1DXQA 1D4AA 3K1YA 4N9QA 5LBUA 4BMOB 4S24A 3OX2A 4FGKA 2BZSA 1YCHA 1YOBA 1YCFA 2KLBA 1CZUA 2HNBA 2MTBA 3ESZA 2BPOA 3GFSA 1J9EA 1AKUA 3GAMA 3OX3A 1OBOA 4PTZA 2W5UA 1V4BA 1B1CA 1I1OA 2OYSA 2QR2A 4ZVMA 3TZBA 5FUQA 1H66A 1NNI1 2MT9A 2ZKIA 1ZWKA 5LVAA 1QRDA 3GFRA 3U7IA 4ICIA 1XYVA 4U7GA 3NHJA 3F6SA 4LAFA 5ULLA 3ESYA 3F2VA 2M6RA 4DIKA 3NHLA 1AZLA 3UXHA 4PU0A 1QBGA 3JSXA 4C0XA 3ES9A 1FTGA 3P0RA 1YRHA 2OHJA 4YAWA 5FA6A 5B3LA 3F90A 2BMVA 4QOGA 1J9ZA 4C14A 5JROA 4GR9A 3ESXA 3O73A 2Z9BA 3W78A 3NHSA 3ZHOA 3N39C 4FX2A 3KAQA 1CZLA 4QOJA 1QR2A 3FW1A 5F4BA 1JA0A 3NHFA 3L9XA 2RG1A 2BN4A 2QX4A 2A5LA 1T0IA 4ZVLA 1AMOA 1AKQA 5EA2A 1BU5A 1XI2A 2Z9CA 2GSWA 3NHUA 4LTDA 3EYWA 3QE2A 2B3DA 2MOKA 3FVWA 2AMJA 1SQSA 4QOEA 1DXOA 3B6KA 3NLLA 1CZOA 4C76A 1OFVA 1FLNA 1RCFA 2R97A 4FGLA 4HEQA 1FLAA 3N3AC 2R96A 3NHKA 1D03A 3KEGA 3QFRA 5LLDA 3K20A 4CETA 2QMZA 4CF6A 1ZX1A 2QX9A 5FX2A 5EAIA 3QFCA 1T5BA 1FUEA 1RLJA 2HPVA 4XDHA 1AKWA 5NLLA 3OJXA 5A4KA 3LCMA 4YAUA 4H2DA 3OX1A 1C7FA 1CZRA 1FLVA 1E5DA 2D5IA 1KBQA 4U7HA 1SG0A 1YKGA 2FOXA 2QX8A 3TEMA 5LMCA 1QHEA 4ESEA 4R81A 1ZWLA 1OBVA 3OWXA 4ZVNA 4YAFA 6NULA 4LA4A 4N82A 1XYYA 3FNIA 4OXXA 1CZHA 1TIKA 3OJWA 4J8PA 2KQUA 4Y9RA 3S2YA 4ZVKA 3W77A 2QX6A 4HS4A 3W79A 5BUCA 1TLLA 2QMYA 1RTTA 3NHYA 3U7RA 4DY4A 3G5MA 2FAXA 5LBTA 1AG9A 4Y7CA 3B6JA 4YALA 1AKVA 3EDOA 1GG5A 1BVYF 1KBOA 2X2PA 2V9CA 4D02A 1XT6A 3OVMA 1AKRA 1WSBA 4C0WA 4Y9UA 1J8QA 1C7EA 3NFRA 5F12A 3HR4A 1AKTA 2M6SA 4DILA 2MWMA 1FX1A 3NHPA 3KLBA 3HLYA 2V5UA 2XODA 2X2OA 4F8YA 1FLDA 4QOIA 1J9GA 1DX9A 2FZ5A 3HA2A 4M0CA
chains in the Genus database with same CATH superfamily
1CP3A 5IWCA 1HDGO 1R8JA 3NM6B 4O0MA 3WS7A 2OV3A 5CTAA 4YDQA 2R62A 4RA6B 5KQGA 5MDHA 3GEHA 4CUJA 2P5YA 3KE9A 5EWLA 4FDMA 3ANXA 3AM4A 4Z7QB 2G9RA 3RC9A 3G5AA 1XLWA 3GEGA 2I3AA 1K9VF 1WNTA 1DEHA 4RV5A 4ZEMA 1Y3HA 1YR3A 1RWXA 4HPWA 1TZMA 4FSXA 1FP1D 3VR5H 2Q62A 4CEJB 4KK3A 1OSNA 1I3MA 3F5DA 3WRXC 1P5RA 2RGAA 3H1BA 1VDMA 2JBHA 3ZDDA 1CXZA 1M8FA 2R6ZA 3EGXA 2WQ7A 2PR2A 2ZWVA 3IQDB 3K0EA 1AUOA 5ALTA 4M0EA 2ODQA 4PONA 3TQRA 3ICQB 4K9SA 3KUXA 3BORA 4GLLA 3E1GA 5JNWA 4S1VA 2J5XA 4MGKR 1G5PA 5BSWA 4OHPA 2OCAA 4LPSA 5ALWA 1MC1A 1YZ3A 2OO3A 1XA0A 1DEOA 3VKHA 1J5EB 3T9BA 4G1CA 4L6AA 1QRDA 1V6SA 4ND8A 3ITNA 1I1QB 3AVWA 1UP7A 1WDWB 2ZWMA 2QVYX 3K4QA 1X7YB 4GI2A 4TT3D 2WSSA 2M6LA 4AJOA 4DQ0A 3SWWA 3OLXA 4A82A 5I7FA 3E7FA 3J7AC 1NV9A 4XYLA 2UUAB 3N58A 4KWEA 1RMQA 3DL7A 1GGFA 4X90A 2QM3A 3IEKA 3WBJA 1L5MA 4ZGBA 4R98A 4UNRA 4A91A 1V16A 3D4PA 4AMVA 1K8QA 1GYRA 1Z56C 4JFAA 1JU9A 4RK4A 2LCQA 1HETA 1CIPA 1G5FA 1XN1A 1O08A 1QB7A 2PU7A 4KWCA 2GLUA 4RHYA 3V4LA 1AKQA 3RC8A 2P8JA 2Y9MB 4QQKA 3NBAA 1HK7A 1K7YA 2CSUA 2Z5VA 1VPLA 1GCUA 2QU7A 4FMDF 2HRRA 2QI9C 4BQFA 2QROA 4Q4AB 1IVSA 3AR9A 3MWDB 1L5OA 4ES6A 2GNAA 1V1RA 3SHOA 4LZAA 2QKYA 3OETA 5IT9A 3IQWA 4EG4A 4W5OA 2TYSB 1N9KA 3LCMA 2HJHA 4BV8A 3V48A 5A4KA 1Z0DA 3I53A 4CQLB 5EFOA 1TZ2A 4CRWB 5H68A 3VU9A 5CDGA 1GZ4A 4IAOA 1A8HA 2YZ7A 3BF8A 2Q45A 3OZUA 2BONA 3MWGA 4KFUA 4W8OA 4A03A 3SXPA 1L7RA 3IVMA 1UBTS 3FZNA 3OOEA 4QL3A 2D8AA 1E0SA 3JAKA 3UAOA 1AGXA 3AEUB 3JTMA 1M1YE 3IR7A 5IAOA 1AKVA 3H0CA 1J22A 1G3RA 2BFOA 1LI5A 2FPGA 5KU7A 2VAWA 1Z4QA 2GBLA 2ZJYA 4LXIA 5HE8A 1GQOA 4G4IA 1GSAA 1U9IA 4O2RA 1TE2A 2II6A 3BCRA 2IPAB 4TN1A 1DLIA 2JDIA 1EG2A 4C3ZA 3DBHA 2YHIA 1MFPA 5EMJA 5K3FB 3U9TA 5GY7A 1USVA 2PKYX 4WESA 1EFKA 1J1IA 4U6NA 1XMVA 1W6RA 4ETMA 1H6CA 1QZUA 2OCDA 3L02A 3NVDA 3PA6A 4YASA 3KKKA 4EF5A 1G8KA 4TXNA 1EMDA 1ZY2A 5KJFA 2X1VA 1A0OA 3RHFA 5FADA 5IS2A 4IINA 5K51A 1DJPA 4FWTA 1B6RA 3E18A 2GN4A 2IPXA 1KDRA 2AL7A 4N01A 4O4LA 4UU0A 3HHEA 2E0IA 4V38A 3I73A 2IYSA 1E4EA 4DV5B 3A6HA 2ZSJA 4H3SA 3RROA 2Z09A 1TIBA 1W4BA 1XDZA 3FWYA 4BLSA 3HKEA 1N1MA 5MN5A 1C3LA 2IU3A 4FFRA 1FDSA 4UDYX 3UJPA 2CCGA 4F21A 5JFGA 1O89A 2PRYA 4X93A 5DW0A 4YLEA 3VI3B 3DZIA 1PS9A 5G0UA 3GLTA 3ECCA 4CT0A 1HBJA 3JQ7A 1JG3A 4MR7A 5GVSA 1Q1GA 2JDID 2O7NA 2Y93A 3PX3A 3COYA 4KH1A 4EYQA 4UDNA 2XNSA 5GJBA 2I6XA 4ZOLB 2OM2A 2O8CA 3WK5A 3L8EA 1IXKA 4LZPA 2NU8B 2BPOA 3OCUA 2QX7A 1WSAA 1ZIYA 1ZI6A 1Z33A 2FN7A 4OLBA 2GN8A 3A06A 3HJBA 4RHXA 3LPLA 3KU1A 2ZW9A 1NASA 1ZUNB 3MWKA 1MXHA 1Q16A 3DC2A 3KKLA 4NBUA 4YH1A 5L4LA 2UZ4A 3IP9A 1BVHA 2OCPA 2QXUA 3ZDCA 2Y1KA 3R5SA 5C35A 4QGFA 2HJRA 3E84A 4FYJA 4RPGA 1JIVA 2OC9A 1RKBA 1D9ZA 5JZOA 4EG0A 3NDIA 5EP1A 2FETA 2O2JA 4RMHA 3FTNA 1NXPA 2ES4A 2P1RA 3KAQA 3OPXA 5DT2A 1MU0A 4L08A 5BVGB 1U5BA 1JFLA 1UQTA 2FV8A 2UZ1B 4CCSA 4YMVA 5HYVA 1W5EA 5HRUA 3IUYA 3EYWA 2G1AA 4RVHA 3FMPB 4DCCA 2K4MA 4P84A 1J8YF 1YR9A 3LZ6A 3QLEA 5IKOA 5IKEA 4FHEA 2B83A 2PZGA 3FLAA 3RIHA 2I8CA 4D9KA 4MMXB 4GOMD 1AQIA 3MAAC 2CJYA 8GPBA 1SCUA 2BLNA 4I1YA 4GC5A 1NLUA 4MV5A 1FW6A 1BFUA 4N0PA 4DIOA 2P9QA 4X20A 2O1XA 4D9NA 2C3PA 2HQSA 2ZDGA 3JS5A 3M6UA 3EY9A 4JASB 4LXTA 5JI2E 2DECA 2G72A 4K0RA 3VR5D 3OFJA 3PDJA 1PO7A 3RBZA 4AUKA 4JVSB 4K3UA 4WOPA 3WNZA 1XALA 4Z8XA 1W47A 3A70A 3WWCA 2WPNA 4J94A 2OQVA 3LUFA 2H65A 1KP2A 2W6ID 3BAZA 4GDMA 3Q87B 4RDHA 5LD2B 3SQMA 2JEZA 3JD2A 2XMGA 5CJPA 2A1TR 2GFQA 3V46A 4DLTA 5KYUB 2EW8A 4UNNA 2VUSA 1H8EA 1KI9A 4ZCLA 3K7EA 2Q5FA 4KRYA 5A03A 1B3RA 1R0XA 1C0KA 1CY8A 1PJ8A 2EG9A 3DT8A 5IVDA 1BXRA 2Z4SA 1SKBA 1ZUIA 2BUAA 2DKOA 4WNAA 5U4XA 3OQOA 2XXAA 5C8YF 4E15A 2PDAA 5IXSA 4KV7A 3GJSA 3QG1A 4ZI7F 2AZTA 1T4DA 2A1UB 2JK1A 1HTBA 1X92A 1O57A 2WD7B 5CCBA 1C5KA 4EYSA 1QH8A 5KTMA 1Y7TA 3NX4A 5AHOA 1DRUA 2UVPB 2C20A 3M34A 1I4DD 4MVJE 3U4MA 3IUQA 3IXQA 2R86A 3O9ZA 1YNOA 1N2CE 2N75A 4FILA 4K8RB 4MUBA 1DEXA 3FOEC 3DA8A 1X1BA 4BMNA 1ZJWA 4BNZA 2VUTA 3CNEA 1RLIA 1M0TA 2FYTA 2Q3MA 4JYPA 2W48A 2F1IA 4HVLA 1D2MA 1YV9A 2QUHA 2V0CA 1YFKA 3CCBA 3GRVA 1FZQA 3BWBA 5F76A 3VISA 2VKTA 3LW7A 3ZW8A 4AXXA 4MHSA 3MTEA 1QHYA 3AEQB 3MF4A 3QVJA 3ZUPA 4ZYLA 2MTBA 3PUKA 2Q6IA 3DAHA 3F8WA 2PD3A 4O5OA 3RVQA 3UM9A 3VVLA 5F73A 1K92A 4AJHA 3HM9A 3FSRA 2JFQA 3VAYA 1DFIA 1ZL2A 4EWLA 3WJAA 4M7OA 1VKHA 1MJNA 5PGMA 3I72A 3MHPA 3GF4A 3R24A 4MPJA 5B7NA 2HHHB 1LLCA 2XUHA 3C3BA 5JRJA 3O26A 3WA6A 5JCZA 1H9BA 2VBCA 3A27A 4LOJA 1W1UA 4DEYA 3BJMA 1FDOA 1ZM9A 1WMEA 2NZUG 1FTGA 4CF5A 4JWKA 2A9KA 3JAMA 3MK31 3TM5A 3G0IA 4G5HA 4BGIA 4OHBA 5K8VA 3GCXA 2IOYA 2YNMD 3C7AA 2OXTA 3RU3A 3UJAA 4ENVA 3T9FA 1NI3A 1P1JA 1RLOA 3ICVA 1T0IA 5K5EA 5JVDB 1YAHA 2HM7A 1M66A 2FFAA 3FNGA 4Z9YA 3Q6MA 1AXGA 2J4FA 4OG2A 3A9SA 3WK6A 1B2LA 1E4OA 1V16B 4AMZA 1GAEO 3WIDA 4BAGA 4NCAA 3D6NB 1CJTC 3DFFA 4QFCA 4NZZA 3KEGA 4EO9A 2I4LA 1JR4A 2CNOA 4AWAA 3G2OA 4MVJH 2V7QD 1J33A 3BQMB 1XCOA 2AGVA 5I7SA 2J6HA 3AK4A 3H4IA 3EVGA 4JJ7A 4WN9B 3OZWA 1OAOA 3F7TA 4F5DA 1MX3A 2BGMA 2O8NA 1M1XB 3R5FA 1Y4AE 1EE9A 1AC5A 3LO8A 5AM1A 5CD1A 1BH6A 2H2IA 1JVNA 4GFDA 4LYDA 3LY7A 4RHTA 3N5KA 1NIJA 1AQYA 4L15A 4PSUA 3CEJA 2PZMA 5LMUB 5B1HA 1IXRC 1R37A 1UDBA 4G26A 5DM4A 1GTZA 5C8YB 5IVKA 2QX6A 4Z9XA 1Z13A 4F93B 4L5CA 3HHPA 4R9SA 3RF7A 1FXUA 1U28A 3VU9B 4DOMA 3LM8A 1W85B 3EQ2A 3JSAA 3D4OA 4MKIA 2W6IA 3BTOA 3QVLA 4CODB 1FRQA 2X5KO 5AM2A 1IXSB 2C07A 3NWEA 3I9LA 3TLGA 5FFNA 5J58A 4M55A 5JJLA 2VTBB 4KACA 1WLYA 4E30A 2QN9A 1KY2A 1YS2X 2ZSAA 2E2WA 3EC2A 4N40A 3VX4A 3PGA1 3BMQB 1CR4A 1RBQA 1ZHHA 5EJIA 2KB0A 3RS7A 5E6RB 4YYZA 3VYSB 3V8BA 1M1UA 1EG7A 1EH5A 3CC8A 4DCOA 1V7CA 3CTPA 5IN4A 3C6MA 2OE2A 3EXAA 4PCVA 4GZ5A 2IHYA 1K1EA 2KLHA 3GGSA 3ODGA 4YAOA 4IGKA 2XNCA 2BGKA 4J75A 3U0BA 1C1HA 2RI6A 1FDWA 2P5TB 5EE5B 3TSOA 5DYYA 4E6EA 5JS1A 1UDRA 5EZ6B 3RC2A 4V0KA 1B8NA 2JBAB 4CMEA 4XGKA 1FPMA 1KZ9A 2LZ0A 1KEZA 1BH2A 2XX3A 3PXBA 5J4LA 1SXJD 3L06A 4V24A 3DP9A 4Y1RB 4D99A 1P4RA 1EVIA 3QJGA 3LFUA 4BN4A 5A2QA 3W0LB 4HYEA 1BZYA 3GOQA 3ZIUA 1JLLA 5ESWA 4REMA 5IC6A 2X0EA 1W6UA 1SXGA 5EFZA 3ZWXA 4Q9AA 2E4YA 2F3TA 3D8UA 2QPAA 3LY9A 3Q5EA 3REQB 1SOMA 1YZHA 2CNNA 4DIDA 5BYKA 3T35A 4X0EA 2WAMA 3IBTA 4E1BA 3GAMA 3F4BA 2YWJA 3AG5A 3K30A 1QGYA 5TPZD 3K94A 5EQJB 3ZCRA 2XBLA 3PR1A 3TZLA 2QM8A 4RK5A 4UOQA 4YDSA 3P9ZA 4X1YB 1WE2A 2VF2A 1ZNWA 1QVZA 1X19A 2YYZA 4KH0A 2Q9CA 1FS4A 3UA4A 1APBA 4BVFA 3KNZA 3RVNA 2CDNA 1B15A 2G8LA 4FLEA 4IHKA 4WCFB 1H22A 5AKHA 1PQWA 2PBLA 4F9TA 4G4SO 1DADA 5J59A 3EFBA 3CY6A 4XGNA 1N3BA 2IVFA 1W0KA 2V1UA 3GLKA 4JUCA 4Y0NA 3AOEA 3CUYA 3RRFA 1PKXA 3KXIA 3ASYA 2IYTA 3UV7A 4A0FA 4U9IS 2REOA 4GICA 4AY6A 3CSDA 4HKTA 2FEXA 1MN6A 2ZSFA 4MW2A 4JBLA 1G3QA 2GRJA 3KWJA 2A4MA 2DWQA 4FFNA 3SZMA 1UMDA 1VOTA 4Y2HA 6REQA 3A6JA 3CMMA 5IJXA 1MV8A 1JIJA 5KHOC 5BVGA 2VOEA 2PUEA 1XZDA 3DNPA 1EPUA 2IVZA 2JRCA 4GGMX 4NCXA 4UU7A 1EVYA 1LUAA 1NXTA 1FFHA 4KG7A 5AVZA 1R5NA 3U3ZA 1J25A 4JNCA 4X71A 1TKAA 2XZTA 4NAHA 4LXQA 2G6BA 4WDRA 5TPWB 3AFOA 3NBMA 4XJXA 5ALSA 3QY9A 2IF2A 1VM6A 1BD4A 3IEIA 3NRCA 1T9GR 4C7VA 1IZ8A 2ODTX 3D8BA 4Z0PA 2BHLA 1XZMA 2WR8A 3ETDA 4R81A 3BTUA 4OXNA 1KTVA 2OBBA 3MBOA 1RADA 2A5YB 1QANA 2ZI5A 3HCFA 4OXXA 5KSYA 4I55A 2FSVC 4DR7B 5F78A 2JCVA 4F38A 1USUA 3ER8A 4JUDX 2CLEB 1E1QA 2BM8A 2EFJA 1MMFB 1KOGA 4HPXB 4DDVA 3ZNQA 1YR8A 4C30A 1JG1A 3K6SA 2V9CA 1CVRA 3WLJA 3ZDXB 4HBGA 4EHLA 1E3WB 2BZ0A 2OO5A 3PV0A 4KQCA 4M54A 4XVRA 3T7AA 4L4XA 4Q21A 4NJMA 3UNXA 3ZLBA 2AWOA 2K87A 1G63A 2P69A 3HR4A 4D45A 1JQBA 5C46F 5CFZA 2Z0MA 3D54D 3VZDA 1IK4A 4JB2A 5DNVA 3NJRA 4BPRA 2C61A 3SYLA 5COAA 5HR5A 1P4SA 2CL0X 3L4KA 1KZ6A 1NZFA 3DM5A 1X0XA 3HA3A 5GPBA 2OXFA 1LVGA 4UCXA 1JDPA 2E55A 4UUAA 1LF0A 2YWGA 3O4RA 5FNVA 3ZDZB 2FQWA 3MRVA 1NTRA 3GA7A 3TGLA 2PUCA 2J45A 4DIFA 4DLKA 2XHEA 4S0ZA 4JBGA 4M38A 3KEMA 3CX8A 4JXZA 3PEWA 4TOIA 1T6BY 3QK7A 1FQOA 5SV2A 4DVGA 1AZTA 1JZQA 4Z1OA 1U3DA 3BZWA 2AV6A 3D1JA 3HU5A 3ND6A 4Y1FA 2AWNA 3L92A 3KQLA 4Z9FA 2NP7A 2WC1A 4XEUA 3I6QA 3VPSA 2Y6VA 1A95A 4CN8A 5JXWA 2XMSA 3TXXA 3BB4A 2OHVA 3WGTA 5DPMA 4H7HA 4FYMA 1BDBA 4BYMA 1FU4A 1TYEB 4Q4AA 3C15C 2IBTA 3E0XA 3PSHA 3E22B 2F4VB 3QXGA 1RXYA 4N9QA 4PLTA 5H59A 4EG1A 1DQSA 5BNWA 3VYTB 4OAPA 2AQIA 3ITEA 4UZEA 1Y1PA 3BXHA 3C6KA 2QMEA 3CNBA 4JJAA 2C92A 4RJ2A 4UMEA 1KOJA 2XUPA 3SF8A 4DMGA 3OEWA 5CG1A 3N0TA 3WFZA 1SVUA 1LPMA 1RPTA 1W35A 1TUBA 5FV7A 1M73E 1ZWKA 3BWCA 4P2GA 1HYGA 4QAJA 2E37A 2R6HA 1QPGA 1YDFA 1XRSB 3QQ5A 2RBGA 2D2EA 2J3KA 4LSZA 5IZCA 3RSSA 1RBZA 3QJYA 2MSLA 1ZVVA 2B82A 2V0NA 4KXMA 1TMGE 1HM5A 3RFXA 4XWGA 2X8AA 3MS4A 4KE9A 3LGXA 1P5ZB 4L0MA 1WS6A 1Z5UA 2FPGB 2V97A 4BBJA 2GFHA 1DJQA 1HYBA 3N7AA 4ZVQA 2BY4A 4BGUA 4EDHA 4FS3A 4ZTZB 3RYFA 1Y6QA 3W8DA 3VSEA 4RZ3A 3UV6A 4H1WA 2DBYA 1U8ZA 1V5IA 3NT2A 3KWLA 4EO7A 1P0CA 5JNLA 5EI5A 5CXXA 2DTEA 1NW9B 4YMLA 3SFZA 4NJOA 3PPIA 3HCPA 1U4NA 1CE8A 4J49A 2RGNC 5KSPA 4JOSA 4QFMA 3GZTB 4HF7A 2FXVA 4KGXA 1XQ6A 3OD1A 1UCFA 3F9RA 1SUCA 4KN5A 1FU7A 1LC3A 3NEPX 5D3QA 2Y0PA 4IDPA 1U2SA 2JGDB 1V9SA 3ESAA 3G49A 3TI7A 2GO7A 1BNCA 3P9CA 3Q3GE 1RNLA 5CX1A 3CZQA 1DINA 2ZT8A 3JQRA 4GXTA 3ZYZA 3ZCVA 3K0FB 1IQPA 1VP3A 3Q9SA 2ZLBA 3IP8A 1J0XO 4GDFA 1P2VA 1YKGA 3RRNA 2DAPA 3GEEA 3QTLA 4FOSA 4ZVNA 1ND6A 1U8XX 1U3CA 2GA8A 2YZMA 3MD9A 1RT9A 4TKMA 4RJLA 4DB4A 2CVPA 3EF3A 4P54A 4YEDA 4MW6A 2IY9A 2QMYA 5E8RA 3CT6A 4EB8A 3T7IA 4MQ5A 4TVBA 1A9ZA 1E2IA 1GD1O 1ZM4A 4JBWA 3WLNA 3GGGA 4YRLA 4AS2A 4FYXA 4D44A 4RANA 3EDOA 3G7SA 1Z34A 2F7SA 4YRFA 2YUTA 1PZXA 3BHJA 1NNSA 4XQGA 5C0OE 2C54A 4G09A 1QH0A 2ZU0C 5C8YA 1C7JA 4FC6A 2ID7A 2OVFA 4EMSA 1DKQA 3C97A 1BC5A 2YJ6A 4LN1A 3RBVA 4DQDA 5FTLA 4ZCPA 3TL2A 2HEGA 1YJCA 1JEQB 3EK2A 3GPIA 4GPBA 4CIWA 2HA0A 3ANMA 3MN1A 3UJNA 2QYTA 3CH7A 3L0BA 4C2BA 4E2YA 2HF8A 1QC5A 4PRZA 3CXRA 1JPJA 3B5IA 3DV9A 3NIWA 3X2FA 3C39A 2DM6A 4GP9A 3FPBA 1EXDA 1CS4C 1Z68A 3HZZA 1JAXA 4MUNA 1G1AA 1TF2A 2ALJA 3L1UA 1XNQB 5C7LO 3IJPA 3O74A 2L42A 2HSEA 2Q27A 4KFRA 3E9CA 1IATA 5DYGA 1CK4A 2MMGA 4EQ6A 2WTBA 3TUIC 3QWFA 3AO0B 2ZAOA 2R8YA 2FPXA 4NABA 4ERXA 5EUBA 1NVKA 2QLBA 3K92A 3LL4A 1JLKA 4OHRA 2X9LA 1QE3A 2QD2A 1ZUD1 1YAJA 3DP7A 2UYQA 2E3JA 2G71A 4G9EA 3B6MA 1JFFA 2OZKA 3BH7A 4L22A 4WKCA 4WFIA 2VIIA 4C06A 3SYMA 2RARA 3UT5B 4D41A 5DCUA 3EN0A 2VK8A 3BSFA 4O2AB 1A8SA 3RU2A 1X87A 3HWWA 4JUFA 4EP1A 2X5NA 3NDBB 2A4KA 1KEWA 1RKXA 3RABA 3WQBA 2V7VA 1C3XA 3V3TA 2ZE7A 1V4BA 2HSJA 4UTOA 5KU1A 3LS2A 3TF5A 3U4CA 1Q15A 1JFVA 5JAUA 2X9NA 2GUWA 2JJMA 5DLEA 1FP7A 5CVEA 2QN7A 1RQRA 5K0EA 4ZMRA 2XR1A 1VFNA 821PA 2QSZA 3K6RA 3MNFA 1Y3IA 5K01A 3TVTA 3HXPA 4KREA 2G7ZA 1NLMA 4YAWA 3OJCA 2WSYB 3KQOA 2C9CA 4QT0A 1MF7A 1XA3A 1ZK1A 2PUJA 2D5AA 4WFQA 5JCJA 3T41A 3C8ZA 4IV0A 3BIXA 4KMRA 3CRRA 4JZKA 5IW8A 2Q3BA 3PNLA 4EW1A 1EVZA 2AG5A 2ODNA 4MQ4A 5IKPA 3GJQA 2A3NA 3O9VA 5BRAA 3AJRA 3U0VA 4EUEA 5IYZB 1XELA 2VRNA 4HY3A 1T91A 3ONEA 3S2GA 5L7YA 1Z7EA 3SS7X 5F98A 1C1DB 2WSSD 3IT1A 3IP6A 4AG6A 2EIHA 4EL0A 1RU3A 4GGPA 3B70A 2FR8C 4PW0A 1RR6A 4MGEA 3MOGA 3TYXA 8LDHA 2DWCA 5K0ZA 1AMUA 5B4UA 3W4IA 4C9BA 2VH5R 4BVAA 1W4ZA 5KWIA 2X0JA 1X1CA 3TQQA 3ZJ4A 9LDTA 3J81k 3A32A 5F52A 2FN4A 1JS1X 2H31A 4LJKA 4FFPA 1A2BA 3TXAA 2P78A 1EWRA 3BWEA 2I2FA 1Z28A 2ZITA 1LRLA 4G85A 5K3BA 2DU8A 4YAFA 1ZC4A 2X0KA 1QP7A 4D4MA 4DTIA 1FFDA 4HN4B 2DGDA 3LG2A 5D1HA 3QLJA 3ACCA 4DUYB 1W5FA 4OBBA 3CR7A 3PXGA 1LLUA 4Z0NA 1H65A 1XZJA 2GF9A 1G66A 1OI7A 2JGAA 3BIFA 4GT1A 4PSAA 1IJBA 2QF7A 1Q12A 4TRRA 3LC7O 4QHSA 3ISTA 1QRSA 2HTEA 1XLTA 3DT9A 4FZ3A 2CFTA 4CLRB 2R68A 4F1KA 1HNXB 3V6LA 2XW6A 4XFDA 4BX3A 1UT5A 4CKXA 2NG1A 3OLVA 4TTVA 2DUNA 2ZS8A 1E3WA 1H2WA 1PJZA 4DGQA 4ALNA 4X8MA 5K3OA 5LM3A 2AFHE 2HU8A 4Z8YA 2RHBA 5FYQA 1BS1A 3B60A 3IKJA 1JYFA 2BCEA 2KX7A 1CZNA 4N65A 3WGIA 3VR4A 2WMDA 3TIGA 3DWGA 3L1HA 3QW2A 1JF8A 5TGDA 2XE8A 4OP2A 4G0PA 2WJGA 3I23A 3FSEA 4OREX 2W6OA 1PE0A 4UHEA 1Z74A 2QW8A 3GLFB 2HO4A 3DOCA 4QBFA 1CS0A 3FGPA 2Q2OA 2TS1A 5PNTA 4A5SA 1ODLA 4DSAA 4PSDA 3ZKWA 1IIBA 2JI6A 2O1WA 3KKEA 2MU1A 4A8PA 2H52A 4YCLA 1G41A 2X13A 5J47A 2FEPA 4ZU3A 2IXAA 3H7IA 3NRBA 3CLTC 3HO6A 3N5CA 4W6QA 4ZRNA 2PGDA 4AYTA 4WGGA 1H0KA 5JPIA 4MXDA 1CUEA 1NUUA 1ORWA 1MKYA 1NSFA 1V35A 3ADKA 3IE0A 4B3DA 3NTQA 1HUQA 1ONNA 2HH9A 1BIFA 1Z5OA 2AEFA 3KOZA 3VV3A 4CDMA 4ZJZA 1NDQA 5B55A 5BRJA 1YOVA 4G0YA 4RQBA 1ZP6A 4MEJA 1UZNA 2JHFA 2L0XA 4RSMA 3U9LA 3Q7TA 2JLVA 4UU1A 2D2VA 3KALA 2P1DA 3JY6A 4MLDA 3EASA 5DO9A 2PFKA 2VJOA 5AOCA 3TB6A 3ZV4A 1N8NA 5HS6A 5F2NA 4W1QA 1IDN1 2UUBB 3IP3A 1VE5A 1Y63A 2HJSA 4UVGA 4XYMA 4PYJA 4DA6A 1N1DA 3NHFA 3AR6A 4K86A 4Y6QA 1YF3A 1IY1A 1Z0IA 2Q5CA 3EWSA 3C1TA 4IDFA 4JT2A 4XGQA 1UQRA 4OLFA 4HC4A 2J09A 1WUIS 2VDRB 1YE5A 4QEKA 1A2QA 1J1ZA 4RKFA 4DZRA 1H8ED 1HOXA 3KZMA 4MVJP 4GVXA 3UMFA 4JGBA 2FPIB 1BGWA 1NI4A 1X1EA 1Z7YA 4L9AA 2XRZA 2PH7A 4RF2A 3DFUA 3PG5A 1L5RA 4AIRA 1IXZA 1P7YA 1CV2A 1MTZA 2OOSA 1GJRA 4ENPA 2R60A 4L9SA 5DE3A 3DFKA 3IDSA 2ZYGA 3PHJA 4JBYA 4MIKA 4UM7A 4C03A 4E5MA 1KSHA 3P8ZA 1CIVA 5AW3A 1MAUA 1K0UA 1NL3A 1OYWA 3O0DA 2VZ8A 5TQVA 4O4IF 3ANTA 3WLLA 1E6UA 3VV2A 1ZWLA 4NOKA 4NV3A 2RGRA 1NVFA 1Z2EA 2GNPA 4CZ2A 3Q0TA 3HMKA 3OJWA 1TIKA 4QNNA 5DGXA 1YJAA 3PGVA 3RSHA 4PTLA 1VG1A 3BMCA 1B73A 1SZJG 3PCXA 2YFHA 3Q7QA 4KRGA 4WRRA 5FWAA 2J5KA 5KWEA 4K6FA 3C2QA 3TK1A 2G4CA 2BKAA 3REQA 4KXYA 4QVKA 1WDKA 1NX9A 2PZBA 2XTJA 3AC0A 4TMFA 1UAGA 2AC4A 4HDNA 4XJTA 3SMVA 5FPKA 2E87A 2NYRA 3BTVA 4OBEA 2EVWX 2XRFA 4NYJQ 4YRTA 2FDRA 1E9FA 1BW9A 5DASA 1U2DC 3EMVA 1BO6A 1G98A 3NTLA 5DM0A 2OVBA 1NKTA 3EVCA 1Z2AA 1EX9A 1W8DA 3HU2A 4DMHA 3IDFA 3WZ2A 5JIBA 5JPCA 1DV1A 2REBA 4NOJA 4Y9TA 3VR4D 2M2IA 4FGJA 1UFVA 1HE5A 4AY2A 3GUZA 3O8QA 5ILQA 4M6WA 4MV9A 2UZ0A 2PSSA 1T25A 2WFLB 3QBTA 4G1UC 5EGNA 4KXLA 4XOUA 2MSCB 4BVHA 3CNLA 2QSUA 1SVSA 1PFQA 3GOHA 1FP2A 4IVRA 3TAHA 4BJ6A 2ZROA 3EPRA 1U3UA 4D80A 1R8QA 3K4PA 2B4KA 2QQ5A 1XKXA 2X2FA 3EZGA 3FRJA 3FIUA 1QX3A 3OZGA 2O8VA 3ED1A 3JYOA 4HI0E 4CGYA 4MDFA 1DXHA 4M2LA 4MDEA 2VBIA 4OU4A 3VPAA 2FMKA 3ADCA 3UXEA 2VKQA 4BAUA 3K71B 2AOXA 2YMLA 4TS3A 5JSUA 1C1YA 1N2GA 4WADA 3ASVA 3DCJA 4PCLA 2OFXA 3DE6X 3E82A 3VMMA 2BUBA 1XEFA 1KZ7B 2GF0A 3WI7A 2GHRA 2BFBA 5TMPA 1VDZA 2W6CX 1CZUA 1NQAO 1DJLA 2HNBA 5TPZA 1F9EA 1ZSYA 1G8FA 1WWKA 4PTZA 5FR1A 1O6CA 3WLOA 1B1CA 3ZY4A 3THYB 1UJ4A 2X6QA 3T9AA 2BP7A 2AEMA 3ZGVA 2VLIA 1T8YA 3I92A 3TZKA 4KFTA 3QVKA 1WX1A 4KN9S 3NHJA 5ETJA 1CR1A 2DPHA 3DOHA 3L1IA 1T3SA 1ZC3A 1DHTA 2UZ3A 4HBZA 1ZCJA 3ZQ6A 5KYTA 3ZWOA 2VF5X 2WAXA 1PTJC 4RK6A 5IYZF 4JQOA 5JO9A 1LQTA 3RUFA 3UCEA 2ANBA 3LLSA 4WY8A 1Z6XA 2G5CA 3N2NA 4II2A 4NENB 4EENA 2GEJA 2OGTA 3FBGA 2Z95A 3H42B 4TV9F 3ZUGA 3MAJA 4KUEA 2XA1A 3I6BA 2K2QB 1HO3A 1NJ6A 1JIKA 1SU4A 3WGMA 4F8JA 4FNOA 4BLQA 1COWA 4D0NA 4BDSA 3AF2A 3TFQA 5EZQA 3VOAA 1U1IA 2ADMA 3QE2A 4C0JA 4JLBA 3LBHA 4RTNA 5EVCA 3AF5A 3OY2A 1OTHA 5AW8A 3AVTA 1EP1B 3E81A 4JBHA 3WLAA 2Q3LA 4C05A 5JANA 3QF7A 5EPUA 3ZBPA 3D6FA 4JROA 1FUEA 1WB5A 2NTNA 4ARBA 4OMFG 2X19A 4YP0A 3K9NA 4M21A 2FSVA 1SH7A 3ZX4A 1JDZA 1MPXA 1T5HX 1Y8AA 3QU2A 3HXMA 2APJA 1CD5A 4GBMA 3Q11A 2D7DA 2KW5A 2B4AA 4AKGA 4JGGA 1BAPA 1NM5A 1OROA 3L8CA 4QPJC 1XXHB 4ZTBA 4CL2A 1W48A 1CY6A 1JFTA 2ZQYA 2NO5A 2C1ZA 1ULAA 1O1YA 1UC8A 2OO5C 1OXSC 1YZYA 1XEAA 2O2XA 3BWDD 3L6EA 4HWPA 3ZCSA 2ONZA 1G59A 3NHYA 5T6MA 3LDHA 3O7WA 2NLOA 4TRJA 3ROGA 4FJ0A 4LXHA 5JAIA 2ZWIA 1O8CA 1FNBA 3DBLB 4QARA 4TZTA 3SXJA 3ZDAA 2GVNA 2IUTA 2YTZA 2UV8A 4ZCSA 4LRUA 5FCDA 4DG9A 5HTOA 5IDXA 1SVIA 2JNWA 2QRQA 3AF1A 4GXQA 4N5LA 4U3JB 4Q3NA 1ND5A 1S1CA 2X22A 5DGIA 4TS4A 2O50A 3DYBA 3F9CA 1ISPA 2GO1A 2XODA 4QDXA 3EISA 5JWOA 4L4SA 4X61A 3RNOA 3E58A 4B3CA 4EZEA 2QUBA 3UK0A 2DYKA 4MQEA 4RULA 5EIOA 4OHXA 4EG6A 3LGSA 3FHCB 5DSXA 4FOLA 5IM4F 1YZQA 1AS0A 1E8DA 1I2DA 2PSJA 2RHCA 5JXGA 4BHTA 2OZLA 1PGOA 3ONFA 2QTHA 1KH1A 4MQUA 2GTPA 1II8A 2BGLA 2PUVA 3BFPA 2QGZA 4Z7OB 2F62A 4YCAA 1R16A 5C8ZA 2ZUFA 2I4RA 1FS5A 4PO8A 2C7OA 1N75A 1Z75A 3DW1X 3OZCA 5I9NA 3UC9A 5FTWA 1JEEA 4NU0A 3JR7A 1K7SN 2O0LA 2W37A 1SCJA 5ICMA 1W30A 3CEAA 2QRNA 3NH6A 4JQSA 2YINC 3R6WA 3ZXUB 3DOJA 5H4GA 3L9WA 1G2QA 1N2OA 3NP9A 2I29A 4WKGA 3OLZA 3D59A 1G9TA 4J9VA 3ZGXA 2IH5A 4QDOA 4BO3A 1JMVA 3URKA 4L07A 2ZUCA 5IZCC 1A97A 3H6GA 4WV3A 3K8QA 5LVAA 4KZPA 1EK2A 3LRXA 1WW3A 4A73A 3D5TA 5HCNA 5T3YA 4JUAA 5COBA 3RFVA 1DQZA 2H0AA 3KPYA 4FGSA 4R83A 4NBNA 2XBMA 4YVFA 1T13A 2AZMA 3BGDA 5EJGA 3B8EA 5ULLA 1J2JA 2PBFA 4AS3A 1F5SA 5KWSA 3PNYA 4MEAA 3JPWA 3ZD8A 3FETA 2VP0A 4CEHB 3VUEA 4C87A 7MDHA 2NX2A 2ECKA 3PE6A 3W5VA 3A04A 1RMYA 2VDUE 121PA 2EW1A 3E3AA 1NLZA 2YV5A 4Q0MA 4QOJA 3ULKA 4QUIA 4BNTA 4PXAA 1YK1A 4IOLA 2FRDA 3HBLA 3L5OA 3OH8A 4ZQHA 4DJEC 1YZKA 4CE6A 1GZ5A 1XI2A 5EL0A 2GSWA 1NBEA 1SBCA 2GCIA 1VBKA 2HLPA 1MOQA 3I5AA 4FIZA 2PNFA 1GL9B 1R9JA 3L0YA 4QUHA 4LXUA 5CM8B 3W2GA 4CMEC 1XQ1A 5G53C 4PYNA 3JQ9C 1ZJ4A 3KU4A 1VSQA 3ELWA 3OOHA 2DR2A 3KCNA 2XKKA 3TW8A 2IS6A 1J24A 3WSWA 1XKTA 3EUWA 2Z2YA 2IK8A 3QXXA 1CUJA 3E2MA 4IIHA 2IPMA 2R1UA 4R2XA 3AF6A 2QUAA 2O7QA 3X1JA 4I6JA 5CRIA 1KBQA 2I8AA 5LR6A 4C5AA 2GHIA 1NJ8A 4XD7A 3QELB 2Z6VA 5B7QA 4LSGA 1M6VB 4ALLA 1PFWA 4ESEA 1L8OA 1DFHA 1PJTA 3C4QA 3SSAA 2OP0A 1MRZA 1O0SA 4UUMA 4FTWA 1ODFA 3UGTA 3FFBA 3R0QA 3VO1A 3DLIA 5KHLB 3MTJA 1QK3A 3PJFA 4G4JA 4DA7A 4JI5B 5IHPA 2F55A 4RY9A 3QSGA 4OGFA 4QJ5A 4RVOA 3WICA 4FMCB 4TQAA 2GXUA 3CFYA 2ZR7A 2IYXA 4NL4H 3EIHA 4P38A 3A9UA 1PZGA 5GMOA 3IQEA 2YY6A 4AMGA 3BE4A 5IF3A 1RQPA 2VSXA 4RK1A 3CXUA 1N8SA 1EVKA 3AVQA 1JHDA 1I0ZA 3LZCA 2QLTA 1E6KA 1OU0A 2V8BA 3MMZA 4P36A 5I4KA 5IF9A 1E1DA 4IVPA 4OYLA 1VRVA 3B6EA 3EODA 4YT4A 5JQGA 1E99A 5DM70 4CM3A 1NYTA 1SBZA 1TU3A 2BE9A 3CEPB 1W96A 5KHAA 4BLRA 2K7ZA 2XB2A 4HGOA 4TYYA 2WP8J 2WZDA 3FI9A 3GROA 4P82A 4PVCA 4Y9SA 4RYLA 3WOVA 4F2PA 5BQXA 2XMZA 5IC5A 2JZNA 1PK9A 4UJ3A 3QEAZ 2G9UA 4N8EA 1CP2A 2WUEA 3OMXA 4O6VA 3BC1A 2WQZA 4XIJA 4AB1A 4C0KA 4M9SA 5A02A 1UAYA 3JW8A 3RVSA 3UC5A 2BGRA 5E9AA 3O8NA 2FH5B 4WX2B 2R6R1 3QVVA 4QWWA 5FB3A 2QUIA 4P4SA 5FBLB 5LA6A 4WBSA 4BNIA 5JBIA 3X1XA 3ZDBA 4BNUA 4KVFA 2J9GA 2NQ8A 3KB1A 3WSTA 2WICA 4BZQA 3HVRA 2M32A 3HG7A 1QZZA 3D0KA 2GD6A 5JYEA 1ZH6A 4OJYA 4FM9A 3OI7A 3P9YA 3AP2A 1KPHA 4MWZA 1MAHA 4TWRA 2N47A 3BXEA 3E61A 3UENA 4IEFB 4UAJA 2XF2A 1V9CA 5DCYA 5HHTA 3HI6A 4CU5A 4UMVA 3GFOA 5AW0A 2BFBB 3K35A 4AMBA 3CIOA 3NI2A 4AWXA 2ILVA 4AWBA 5ITZA 5MFZA 5ALNA 3QX7A 2VXCA 3NHLA 1XEWY 2C8JA 4IIGA 2XMCA 4E70A 1YVUA 1PZFA 2H1CA 2YJGA 1FP4B 1Q77A 5HG0A 3ZDEA 3ABOB 1Z2NX 1WG8A 2FGJA 2Q6LA 3K15A 4TUYB 4GKKB 4AICA 3O8BA 4JYMA 4A2CA 4HGNA 3PQCA 1XEXB 4X1YA 5HKKA 3N8GA 4L28A 4G0ZA 4IEIA 3USZA 3R74A 2G04A 2QW0X 3FA2A 3PHLA 2XEDA 4IUCS 4ZOEA 5DLYA 5KEIA 5DH9A 3UYKA 5GJVC 3WV4A 3O3CA 2V7BA 4N8DA 2LCFA 4CFYA 3STHA 3GT3A 3GGCA 2VT2A 1EFUA 1SC6A 2FEWB 1C14A 4EM6A 5HK8A 4P6VF 5KTRA 3ACBA 4C21A 4F92B 4QIHA 4A0QA 1T4BA 3NCTA 4IDDA 3X2SA 5FLEX 1E6EA 4J6FA 5KO2A 3HYLA 5FTKA 4NCNA 3ZV6A 3COZA 2JLYA 1YL5A 3GQVA 1OYVA 4C7MA 2CVZA 3U1VA 5DYTA 1BJTA 1P1IA 1N3IA 2WHPB 4MVXA 4U6SA 4QICA 2PX0A 3DJFA 5BV2P 5KKCA 3LC1O 5HA5A 1FXWF 1EX7A 1DCMA 4RUKA 3WHPA 3G89A 3OZEA 4V1CA 3LHKA 1FDTA 4Q12A 4BVEA 2WIAA 1E1QD 3LVBA 1ZVQA 5EE9A 3WMGA 2QAGA 5ESDA 1KRXA 2WWXA 4OX9B 2ID8A 4K9KA 3TPCA 2ZJ6A 5IJWA 3TW4A 1J99A 3WSVA 1MOZA 1TCVA 2GEUA 1MOSA 2I1WA 2C03A 5CP8A 5FTMA 3AL2A 3QUCA 3TZHA 4AZSA 3K9BA 2V6BA 1FX0A 1Q14A 3P52A 4I55B 1QQ5A 2WHRA 4ZEXA 1NYLA 4KPGA 2GPWA 1ELOA 1WPGA 1U81A 1LNZA 3MRTA 4J4TA 4JP5A 4YGXB 2IHZA 4LOHA 5KYXB 3LW8A 2PXAA 1VBFA 3I2GA 3OURA 3HGQA 5EP2A 2BT4A 5HIIA 2RGBA 3KOWA 1X7HA 2CD9A 2QUZA 3GFTA 4BRSA 4MWCA 2GBIA 1SO8A 1TAQA 4E21A 2AD1A 1D6JA 3GRAA 1BKYA 1U1DA 2ZI6A 2BI8A 1BFKA 2CLHB 2XB8A 3WLRA 4EK9A 4WZBB 1CUYA 4MRRA 2E5WA 4RACA 1X39A 1QYVA 3W9YA 3AERB 4E11A 3B5JA 1HDEA 2FE1A 2FPLA 1QFZA 3R77A 2GH1A 4NHOA 1P9RA 4OLHA 1Q2XA 2PGOA 3RS4A 1QG6A 2AKAB 5IRCD 2F59A 4K0KB 1OZ0A 2N1MA 2BFMA 4FR5A 3LNTA 4FMDB 3K9FC 1L7PA 1PNTA 3IV9A 1H4QA 1IJFA 1PTJA 1N34B 1ZU4A 2B37A 4IQ4A 1TO2E 4N5DA 4EHNA 2HHAA 1YZFA 1H1DA 2FB9A 2CF6A 2GTHA 1TEXA 2JJ8A 1UK7A 1XP5A 4WH0A 3RUAA 4UREA 3K1TA 3ZG6A 4AJNA 5EIAA 2O7RA 2QG9A 1Z25A 5U1PA 2HSZA 2QW1A 2NO7A 1R0WA 3CLUD 4CMAA 4IO1A 3LXUX 4H35A 3S2SA 3SBDA 3E4CA 3UK1A 1F8GA 3Q5GA 4HNSA 4Q4LA 4J3JA 3GRYA 3BD7A 2C58A 2BH9A 2B2XA 2P2CA 3F90A 2GK4A 1WEKA 3QFTA 5EJ4A 1UBGA 3EUEA 3LKVA 5MGNA 2JLAA 4D8TA 1PL7A 3MOIA 2XQGA 4P5DA 2EZUA 4BTLA 3LSYA 4EO4A 3VYUB 2UVPA 1MIHA 3VC3A 2WOOA 2WJAA 3HE3A 2IXFA 5HKBA 1H9AA 1PZNA 4ZQIA 2VJMA 4N3NA 3LT4A 2QL6A 4RKQA 3L6OO 3LBYA 5F3WB 2D62A 4YIHA 4KR7A 4B4OA 2XY4A 4NPHA 1L5ZA 2RIPA 3EZLA 3M49A 5EXXA 1DNPA 3KT8A 4OGLA 5IDYA 2QTNA 3FNRA 5KOYA 3EY4A 5CXQA 3O8OA 2IXGA 3WDLA 4PAWA 2BEJA 3HK2A 1QCYA 3H2ZA 2LTAA 2V4UA 2XCQA 3DTVB 1H1TA 1AGYA 3OIFA 4HQFA 4B6PA 3OJXA 1KP3A 1I3CA 1U9CA 3CLTD 1A76A 2PQ6A 4JH0A 1N6HA 2QY9A 3A4TA 4DMUB 5LMNB 1WETA 1ESZA 4IIJA 5DBHX 3VKGA 3E9DA 3A14A 4AUMA 1TZCA 2R8PA 4JR1A 1SUEA 4D2IA 3NYWA 4WLEA 2FG7C 5BW4A 6ADHA 2BDTA 4DCMA 2WIKA 2OV6A 1QYIA 2Q46A 3K72B 1HEUA 4MULA 4TTRA 4CTNA 3DV0B 2PMWB 4F8EA 1KBZA 5JMWA 5CFMA 4L2IA 5JI3E 2HSGA 2O8DB 3WL6A 4LDQA 2ZB3A 4KAXA 3F6CA 5CT4A 3RF6A 3DO8A 2B4TO 2VJMB 2RMKA 1UPAA 1UPBA 4DSOA 5A5EA 1VP9A 3M81A 3VJLA 2W2NA 2WSMA 4HK4A 2B1GA 2Q50A 1NJGA 4DILA 2X14A 4IWXA 4DWOA 4EFKA 4MQ6A 1UXHA 2GD0A 1OWOA 1AA9A 4EVIA 3AMVA 4QYWA 1ZGAA 2FUNB 3MB5A 2I2BA 3I1YA 1JVBA 1IWPB 2MSWA 4FE4A 3TCNA 2P11A 1N4DA 1N33B 1RHRA 2RAVA 2L69A 4X6UA 2JAHA 2EZ9A 3Q98A 1L7OA 6LDHA 1PBNA 1F4PA 5MN4A 2FUG1 1WBJB 3OCZA 1KYYA 1ZGBA 1WZCA 1GYQA 3GY0A 4ZC1A 1I3OA 2LE0A 2ZTHA 4I9GA 4WK2B 4ZV7A 3K2IA 1NRXA 5CLFA 2XMPA 3OJEA 2ZBEA 4TYMA 5ALHA 1A5AB 1KK1A 1TM5E 2BGTA 3ADPA 3JZIA 3OBIA 4DZZA 2ZOSA 3HLTA 5HUQA 1GZHB 4TMTA 4TKUB 4R7GA 2R47A 3A4NA 5CVDA 3SHVA 4PPFA 3DDUA 2R751 1LK7A 1U7UA 1Z22A 4CM4B 1QIMA 3MWLA 1KQNA 3S6JA 3X1DA 4D4JA 1RD4A 3ZE2B 1GEGA 3AF3A 1EDBA 1FJ2A 3TE7A 2NO6A 2C9BA 1KDZA 2O2HA 4UE6A 3FNFA 2WW8A 4JOCA 1YRAA 4M9CA 4XRGA 2GM4A 1KAEA 1Q17A 2AI3A 2R7NA 4PGGA 2G80A 4UFPA 4KI7A 5KNCD 4F11A 2X5XA 2FJPA 4K03A 1VKNA 4P81A 5C2JB 2VSQA 5E6UB 2XCTB 4YMIA 4GMGA 3SHFA 4AQ7A 1UWVA 3KZVA 3IVGA 4OQEA 5JAHA 4LQDA 3ZXYA 1IN5A 3TBKA 4HAOA 3INRA 4OQNA 1LX6A 3E9YA 3H9GA 1XGKA 2R25B 4TMVA 1XQ9A 4OBXA 3VPDA 1JIIA 2GDZA 3LKZA 4QTXA 4R0MA 3S2YA 1PK7A 1OTXA 4B3HA 1ZCBA 2XUAA 5H7XA 3I32A 5B1IA 1MW8X 1VIYA 3I5MA 1JXQA 4RTPA 1B41A 1J2EA 1G8SA 3QHAA 2EGUA 2CY0A 2XADA 4XPIB 3KQKA 1DARA 2CN1A 4Y2SA 1RRVA 1W44A 3ROFA 3V7FA 1K63A 2HA7A 3LCUA 4PO9A 1NOJA 4HWGA 4D8YA 1JLLB 1PR9A 2C94A 4X9XA 2A9JA 3HSKA 1LU9A 5ER6A 1WDLA 1HZJA 1GGKA 3NIFB 4H6WA 4Z99A 2Z2KA 4K1XA 4YJ3B 5G41A 5KQLA 3U6BA 2YXDA 3HVJA 4B3TB 10MHA 4N7MA 1LH0A 3WG9A 1II8B 1U8EA 4ZOLF 3RM3A 2R85A 3RS2A 2ZI7A 2H6EA 1CQPA 3CVJA 4MGHA 3GNLA 3V9AA 2V9ZA 4YPFA 7YASA 3PLRA 4R1SA 4I1OA 4AY3A 1G6Q1 2WE7A 3W3ZB 1W9HA 1Y6RA 2WFMA 2ZTVA 3CGWA 4PHTA 4DXAA 3UVEA 4HLUA 5AI9A 1P9WA 4PQYA 3C87A 4MV0A 4XQCA 4ZK2A 1RQGA 5LD2C 2GN1A 3V8PA 3TQFA 1JJFA 4HHEA 5AD1A 2QTLA 1JEDA 4H18A 5E2IA 4LDZA 5AJZA 1QIJA 4CG1A 1KKLA 4YP5A 1ZDMA 3Q85A 2HHLA 2X9GA 1XK6A 4N5MA 4ONEA 2JAWA 1T4GA 4KQJA 2WLTA 1UJ2A 4MKRA 1ZIXA 2C7BA 5BWMA 2VLBA 4H15A 1XQVA 3PGMA 1AKTA 1KHTA 3PIDA 4Q4CA 2COEA 1SU8A 1GZUA 3HA7A 3HDTA 3IPAA 4F06A 1YVPA 1TDJA 2H16A 3PC3A 1F2DA 1VIDA 4PZ0A 4QU0A 1QOQB 1YRWA 4OHMA 1YO6A 1OXMA 3A1DA 5TQ2A 1GXSA 3FYHA 2JVIA 2W0SA 4N6OA 2FCRA 4LYJA 1QLJA 4BNFA 1QKKA 1FFCA 2DY0A 4LNUA 4Q3LA 1LZLA 1F9AA 2YIJA 2R84A 4FLFA 1ODCA 1AQUA 5FHQA 3H9BA 1R6AA 1O94D 4PVDA 1F8XA 2NUAB 3MYYA 4GYYA 2VTEA 1E92A 3G8AA 5EWMB 4P9NA 4PHHA 3T5BA 5KKNB 4S04A 3TKLA 1IG0A 1CUVA 1USKA 2B99A 2HK7A 4LF9B 4QVGA 3W8RA 3UKOA 1VL6A 2J3IA 2NU9A 3NOQA 4FUTA 2BFFB 3ZK7A 3AT1A 1AURA 2W4QA 4HDRA 1LDYA 1KVUA 1B8OA 1MJHA 2UUOA 4I4IA 4XB1A 2C04A 4ZVRA 1U3VA 3UICA 1HZZC 1HNWB 2CHEA 1E3TA 3BE6A 3UO8B 2AJDA 1QJCA 4AM8A 3FKSD 3AHDA 1GG9A 3R3UA 4XASA 3VJRA 4JHXA 1F17A 3L0OA 4QWMA 4DRXA 1TCBA 3H97A 3OEEA 4N18A 3HJRA 3F2VA 1NF2A 5EIEA 4KYUA 4DF3A 4K9PA 3QE3A 3W8NA 5A9SB 1Z35A 2H48A 1ZK2A 5JMPA 3I45A 1YR6A 1E3IA 4FEAA 3WWYA 7ADHA 2A0KA 3LXRA 1USWA 4YRNA 4IX1A 3NATA 1Y4DE 1NNEA 1TMOA 4G5RA 1OZFA 1J0AA 4C5CA 3QX8A 1HKUA 1T2FA 4KX3A 4I1RA 3JYNA 1GT6A 3NASA 4A6EA 1GKIA 3CCFA 2MYNA 1V8BA 4X84A 4RFSB 3OPNA 4B7CA 4B3MB 4RCYA 1OV4A 1DC4A 2ZZKA 1T2VA 3ZWQA 3E9RA 2HTFA 3RBAA 4RKRA 3CT4A 3CLSC 3HA5A 1QF9A 1O95C 1PCXA 2Y71A 3QLUA 5JADA 3NM4A 5HIJA 1PYDA 4C4TA 1EM8A 1G5TA 4K5QA 4TSRA 5JD4A 3BIWA 1HOTA 4B44A 5ED4A 1UUFA 1Q50A 1G16A 3GRPA 4DR6B 1A4XA 1NZDA 1HLPA 2EL7A 4H2DA 1W5TA 4X95A 1YA6A 1XZAA 5J2TA 4HQRA 4NH4A 2ZYDA 4A8JC 1QAOA 1X7YA 2NT4A 1TLFA 4FJ1A 1V7PC 5EPEA 5AW7A 4IW3B 5JV5A 1GL3A 3PQ5A 4LFBB 4ZK6A 1IUKA 1M8GA 3AUXA 4EVQA 1C1XB 1QFJA 3IIIA 4CWAA 1T3GA 1H4TA 2D0IA 4R0VA 5LZ4A 3JASB 5JO0A 1N6IA 5DHFA 1KBOA 1EFRA 1Q5PA 2R2AA 1K4KA 2CMDA 1UKCA 4PG4A 3Q2KA 4RHEA 4ZYVA 1P0PA 1ZOIA 2R5NA 1PYOA 4BEBA 3CX7A 3R4CA 4ACBA 3CZ9A 4K9LA 4B74A 1GITA 3D8NA 3PFIA 5DWDA 1V25A 1MAAA 4RZ2A 3FFAA 3SZLA 1IC6A 3HVUA 5JS7A 1VPDA 4ARIA 3PUWA 4TRMA 4LF6B 3ZHUA 2ZXEA 3OT1B 4F56A 1VHQA 2XGGA 3FWNA 4OAOA 2MYPA 5CLLA 1EM8B 4IJMA 1CE8B 1X8XA 3O8CA 3N8DA 1QP0A 4GXNA 4X3CA 4BMYA 4MDHA 4OB7A 4YTEA 1R10A 3AFNA 1ECBA 5I6DA 1A7UA 2JGDA 3CF6R 3K0BA 4NZOA 2QN3A 1XUOA 5LZ8A 1ECLA 3QFHA 3N3BC 4FHGA 1FJXA 3IRUA 4DA9A 3NH9A 1CY4A 3PPYA 4FX5A 2YV4A 2WAOA 1GAXA 5TF4A 4BDTA 1C1XA 2JIMA 3W5AA 4GNKA 1C0LA 1SN7A 2H7YA 2O1SA 5B5SA 2G36A 2YFQA 2GM9A 4HFNA 4QO7A 3K6KA 1PD0A 2OUIA 3EA4A 3EW7A 3QBDA 3QTTA 4GI5A 4LK2A 2VG8A 4M0LA 3DNFA 3ZHRA 5JZSA 4MWOA 1U28C 4JJ4A 3PYXA 3RJ5A 4D97A 3GDWA 3R5KA 4KQEA 4Q01A 1DXQA 3T3HA 3WRWA 4KPUB 4HWTA 1XAJA 2YJ5A 2Z58A 3R3JA 1TUGA 4NFLA 4NFYA 5K7SA 2M9MA 2VQ6A 4L5JA 2COKA 2W4MA 4WECA 5DNYB 5B1SA 4ZARA 4AJKA 3QPAA 2GK7A 3BERA 4WESB 2YFYA 1E7SA 1II9A 4O2LA 1DRKA 3KOUA 1AN0A 4D0SA 2AG8A 4M1EA 4DIUA 1LCIA 2J41A 4JYBA 3WRYC 3H7AA 1JRLA 5BSRA 3NHBA 1IU9A 4JC8A 2ZS9A 5JSHA 3E1KA 4TQ9A 1I7DA 4NXMB 4LHWA 3KXLA 2QAGB 3TQCA 3MUOA 4GQBA 5WRFA 3M2PA 4UEJA 4QLBA 2C3MA 1ORVA 3DKPA 2LV8A 3IMCA 3TZQA 5JCPA 3C5EA 4ND2A 2Y27A 4X1IB 3IE1A 2EGHA 2YRXA 3VDMA 2UYCA 3TAUA 2GKGA 1U11A 1Q84A 1THZA 3GMDA 3PIIA 1W94A 4ER3A 4PFQA 4JR2A 5FO0A 4NCIA 1T29A 3NKFA 4QATA 2BN4A 3EZFA 1WXXA 4L8GA 5BR1A 3K31A 3O1LA 4B45A 3OPMA 3C5VA 4FOPA 4HNAB 4YQZA 3K0CA 2HA6A 3UH1A 5ALRA 3RFTA 4I4CA 5JTUA 2C5BA 3GZNB 1Z0ZA 2C0QA 2ATXA 3A1TA 3UJ6A 1OILA 3MCTA 4ZREA 3QPVA 1F0YA 5FBQB 2C2BA 2YOFA 4B6GA 2X7XA 4ZCTA 1QP4A 3NWOA 3N2EA 4Q6WA 5B3JA 4CLDA 4KX5A 4DCJA 3T7JA 3RCBA 2XOKA 1ITZA 1GGEA 4BZXA 3DFIA 4KMSA 3PBKA 5J9FA 4DIMA 2HDOA 2Z5LA 1W2HA 4PEVA 1Y7HA 3P4YA 2QD3A 4DARA 3QF4A 1QR6A 5KYYA 5JSQA 2YV3A 5JSKA 1GNLA 3U3RA 3QWBA 4QDKA 2C98A 5C4GB 4DA8A 3BWMA 4X7PA 1SU7A 1BCSA 1PWYE 2NSLA 1FS6A 4GM0A 2W93A 4P8RA 1T0UA 5MF6A 5G4LA 4BB6A 2O3SA 4LHZA 1AOXA 2ZKLA 4ALKA 4IP0A 2BSQA 3AVYA 4JXJA 1H94A 5CB4B 4PAOA 1X70A 4N5IX 1JT2A 2V7QA 2VC2B 1US8B 4RJKA 2ZE6A 3Q8MA 3NBZC 3OZRA 1JXOA 4RPKA 3RREA 3L79A 2R1TA 3S27A 4F7WA 3IEMA 1E3EA 3TQTA 1YULA 1C9NA 3RYCA 2BL4A 1U7WA 1FDIA 3KHUA 4XRRA 1JKXA 4UHHA 1SCUB 4HVAA 4J3NA 1OT5A 1E59A 3U7HB 2HWWA 4M8IA 2A9OA 1SIBE 3O1JC 5JMTA 4W7SA 2I8LA 2LD4A 4ZJYA 2XD4A 1IL0A 2FZ4A 3P9SA 1MT3A 3DR3A 3R4VA 4YQYA 4KXUA 2ORYA 2PQMA 4J1SA 4IJQA 5A4IS 4X5OA 5HQ3B 3GJ3A 2AN9A 3UV3A 1F5NA 3AJ9A 4WBNF 3NV7A 2P75A 1J4AA 3RTCA 3PWTA 2F8SA 3B1XA 1Q7BA 3EFOA 5FR2A 1UF9A 4MI1A 3K0KA 4RZUA 3IE2A 1IZ0A 1GLGA 1L7MA 3O95A 5AICA 3SJ7A 4BMOB 4F91B 4DLSA 4P80A 1NMSA 4ENUA 3LTEA 3SQXA 4UZSA 5EHIA 2XB4A 1H6DA 1FNSA 2R3SA 3T4PA 2GRUA 2H06A 2ZAGA 1VSUA 1YQUA 4CCAA 2XXAB 4OUDB 3WLPA 2E9SA 5JD6A 1QV9A 4EEKA 1Z17A 5SZKB 1DCTA 2AUTA 3F6BX 3PHIA 2FA9A 4RD2A 4YBZA 2JFFA 4HUQB 4RIFA 2GM5A 2VXYA 4Y6GB 4K9NA 1P4HA 2X8LA 4PLGA 5EP3A 5BPFA 3JD0A 1UOEA 5BVHB 5JAMA 3KCQA 2X5JO 3LMKA 3OQ6A 2AW5A 4Z1MD 4ZV4A 5JEEA 2NZYA 3T1QA 1G55A 3JALA 2PHZA 4M37A 3RTAA 1TO6A 4ZO8A 3VSCA 1UXKA 2PIDA 4ME6A 3V33A 3T3NA 3DSRA 3L6CA 4OKNA 2RBEA 3GG9A 1D6MA 3NORA 4O2BB 3EQ6A 4XX1A 2FWJA 3QMPA 4LCEA 3PEFA 4MLZA 1TA9A 2IDZA 1KMCA 5IEJA 4EQ6B 3LX6A 2NU6A 1NZJA 4EHAA 1WKCA 2PG3A 4ZVLA 4QBTA 4WNCA 3HCRA 3UHAA 5K6AC 2P0AA 1E3QA 4I1UA 1PFYA 4WPGA 1E62A 1PDWA 3UANA 4KWIA 1E96A 2J48A 1RLJA 2ENWA 5L3ZA 1QFXA 4EYKA 2HCRA 4F3NA 1GGJA 1RQ2A 2CD7A 2GPJA 5COQA 5DLDA 3MA0A 3EULA 1JTVA 1D2RA 4LV5B 3MJDA 4MOWA 4UMFA 5I8ZA 4AYXA 1QAMA 4CF4A 1MEEA 1XMQB 3PUVA 4Q15A 3BKWA 1QRUA 8OHMA 1L7NA 1VC2A 1F60A 1VCHA 1R6VA 1Q21A 2H08A 2WWFA 4JJZA 3VU3A 3CH4B 4E32A 4ZO9A 3BXPA 1M1NB 1Y8RB 1ZM3A 3H5WA 4HRVA 3OT4A 5ALZA 1IM2A 2XOXA 4OXQA 2N42A 3SG0A 2WYHA 2CL7X 1M6HA 4ALIA 3T5AA 3AFGA 3O91A 5CU7A 3VR4H 5A4MS 3DC7A 5FWNA 3GH1A 5KNBD 1R0RE 2JFHA 1JN0A 2ZTLA 1ZFNA 3SX4A 2WSLA 3DKKA 2DJ5A 4HDQB 4LV6A 5EPOA 5EE0A 4ZQEA 1J1UA 4MI6A 3KJQA 1V6CA 4RQTA 3NONA 4O4IB 3RVBA 2IXTA 5IZ4A 1RQNA 3L1KA 4WZAE 4YY3B 1NFQA 3JQ8B 4LI3X 1PTKA 3ODPA 5CLGA 4CV0A 1DMSA 1UBUS 4YCBA 1MB9A 2OCLA 1O94C 2FX5A 5T8KC 1B16A 1R0LA 1XMIA 2FW6A 3MSCA 4WDQA 5AKXA 1D0VA 1P7PA 1TW2A 2WVGA 4KVZA 1GR1A 3HDVA 5CYOA 1SG6A 3SC4A 3OF2A 1T34A 4M0FA 4FYIA 2O59A 4I4TF 3IAS1 2ZDQA 4MH0R 4YJFA 1BE0A 1ZGGA 2BEUB 4L4UA 3X1KA 4UM9D 4UHJA 4ZO4A 1SXJA 3HEMA 2A88A 1HTWA 2J30A 2JJYA 4L02A 1QG0A 4KO8A 3M1YA 4TMKA 4BQPA 4RTQA 1ZXXA 1ZSNA 6Q21A 4ETWA 2FF7A 1ECFA 4EJSA 4DBLE 2Y0BA 5CIYA 1D4FA 1EFPA 1UBKS 4MR9B 4XH9B 3JAWA 2F3PA 3CO0S 3FKQA 3MBKA 4QUDA 3E6AA 1JHMA 1KI7A 3A1EA 2OAQ1 3Q3HA 3ZOKA 3V7YA 1YRLA 1RWOA 2IZZA 4U5QA 4QRIA 3TIXB 1OH6A 3ZD6A 1DCFA 3WMEA 2PA3A 4XLTA 5KMGA 1GPMA 2IEZA 3ZHCA 5E6RA 4YPOA 1NULA 3Q0EA 3T5GA 3M1IA 4DCGA 3M4JA 4LRXA 2ZWOA 1LSOA 3COSA 3MCVA 3TDMA 5GIPE 3U16A 1FNCA 4LJ5A 1N25A 2H4WA 5BUZA 1FNMA 2HDNB 4C14A 1G18A 4PX3A 1XTKA 4PFJA 5IUKC 4BX8A 2OBXA 1NR5A 1XAIA 1A96A 1HE8B 2EL9A 2ZIFA 4YJFB 5DNCA 1YUBA 1Z5GA 3CNQS 4JQCA 1QUFA 1N3YA 2Q4OA 2VT7A 2QBYB 2W6JA 4JU8A 2A5LA 1IWOA 3OCVA 3MYRA 4LVUA 4ZV9A 1V2HE 4E3ZA 4X1IA 1E4YA 2P3LA 3OTQA 4Y98A 4BXOA 2PM8A 4IZIA 4TVKA 1JDBC 4EPVA 5FEUA 4KQ6A 1GQYA 3RT1A 3RQIA 4D8WA 4PGFA 4Q9NA 2PUAA 1XTIA 3EC7A 2CLSA 4Q7JB 5GV7A 4OO3A 3ZS9A 4LNUB 2YYAA 5TB5A 2RKOA 3WJ2A 1Q0LA 2R7MA 3VM6A 5B58C 3HACA 5DN6A 3EVZA 4HLUC 2O8BA 5IDVA 2HUPA 2ZU6A 3O2SB 1K06A 2X4GA 1ZOPA 3HB7A 1SUIA 3ICOA 1EXVA 4P53A 4LHYA 5A0VA 1CBUA 1NP6A 3NIGB 3CUUA 1UPCA 3H2KA 5AOBA 3SIRA 1HE3A 1N6RA 3GVHA 3BL8A 3HCDA 4FS8A 1LBHA 1UXOA 1VA4A 1X38A 1C9DB 2YN4A 1X1DA 3KQPA 4UTXA 1CJSA 4V0QA 5I9SA 2TRSB 4FT4A 3SICE 3ZWKA 1W19A 4D96A 2SICE 2GEKA 3OOJA 3RLFA 3VNBA 3QF4B 2A57A 2PZAA 4BGEA 4QPZA 1C2YA 4EKGA 3W7BA 2EBWA 1QH9A 1KMMA 5F7JA 4JD5A 2I6FA 4G67A 3FF4A 3A6LA 1T8RA 3GVCA 4HR7A 3E8XA 2JARA 2ISQA 3CS3A 3AEKA 1NW6A 1WVIA 2KYRA 2X2OA 2FEAA 1FLDA 1PG5A 1XTQA 3CCCA 5ENZA 1HE1C 2P40A 3V4SA 2G07A 4EYOA 4MVJM 5JYCA 2Z9DA 3VGJA 4Q7KA 3SNKA 4G2NA 1WMAA 1QRAA 3PFHA 1V8PA 2H4HA 5IN5A 2QAGC 1L8XA 3NP7A 2O8BB 3TUJC 1KMHA 2FU5C 4GZ6A 4QDUA 5DRYA 4MIOA 3N2KA 4XM0A 5T8KA 1RCUA 2XE7A 3LU1A 4E5SA 2C5FA 3I0MA 3MT9A 2P35A 5FLXA 4HGQA 4UULA 5HQTA 1JBKA 3LA6A 3E3LA 4YECA 5AR1A 3VXKA 1WBBA 2X15A 1FSSA 2NZ2A 4RVFA 1GU1A 2YFKA 2YJNA 5KSOA 3NWBA 2VK1A 2FZWA 2ZULA 3MWEA 1O9HA 2NU7A 3MXOA 3A6DA 4XVUA 1K5GA 1TF7A 3KAPA 3OIGA 4WEOA 3WMXA 1TI7A 4BC1A 4YRKA 4DV2B 2REQA 4DLZA 5U9CA 1IBLB 1PR3A 3K53A 3VSBA 1N77A 5EJ5A 4XR4A 2VDWB 3NFRA 4HP8A 1Z7WA 4YONB 5ILGA 3S2ZA 4EA6A 1SUPA 2DPLA 5DK4A 1XLTC 1SK9A 1UFRA 3MTQA 3EXIB 5CIWA 1OXUA 2NIPA 4GD3Q 3IHTA 5G0TA 3C43A 1R4ZA 3M6LA 1EJBA 3EXHC 5EQDA 4N6NA 1KDPA 4BBZA 4BCBA 4CFZA 4OPMA 1MB3A 3R6GA 5EIWA 5IMSA 2X9VA 1NVBA 2HMWA 5CT6A 1MIOB 5EHZA 3QNUA 4IX9A 3JRNA 2BMVA 5ALIA 2NAFA 3CLKA 1T15A 5JNUA 1G9XA 5ICGA 3ZI0A 4R2KA 1KI1A 4FT2A 4GF5A 2O9JA 4QM6A 1YDHA 2VUIB 4KQFA 2V4ZA 2TECE 1NXVA 3KKQA 4XYEA 5CJJA 5FI3A 3WL7A 2G76A 3I64A 1P5HA 3UMYA 1TYDE 1VG8A 3AYZB 3SE7A 3D8SA 3JZDA 1DU4A 3CRZA 3PXAA 5F2KA 4BE7B 1YQQA 3B13B 5GONA 1GGNA 4V3BA 3W3AH 1PWZA 1Z0SA 5AHXA 5FUMA 2WKQA 3CSUA 5TS3A 5I5EA 4HDKA 4H3KB 2OAP1 3MS7A 2GOYA 6NULA 3T34A 1Q0ZA 1M34A 4MW1A 1Y9DA 2WU0A 4ZQCB 1UFKA 1H1LB 2G25A 1ZAKA 1JBEA 1K6IA 3BEDA 2WT4A 3GFBA 2XV1A 5EHQA 5H9VA 4F2HA 4UD2A 2X1LA 3UIEA 5AT1A 4EFNA 3OWXA 4FCWA 2CUTA 4V0SA 2ZIXB 5D6OA 3JQQA 2R6AA 4OIFA 2E5FA 1AKYA 1U2RA 3Q72A 4G36A 1O94A 3QKSA 4G97A 4B6SA 2ZANA 2ZJOA 4F12A 4PIMA 5G3YA 4ZI2A 1UPUA 1FB5A 3H4MA 1A72A 4XR9A 5CH3A 1G291 1EFCA 2IP1A 2EKZA 5DYIA 2W6PA 3H65A 4WA7A 2IYOA 5FOTA 3SIPA 2C2WA 3N7TA 4D42A 3S99A 3GUCA 4CFSA 3Q3VA 1JHRA 3ELUA 1VXOA 1DWUA 1NFFA 2GBFA 2JHCA 3CRVA 3FCXA 3R6LA 4RL4A 5KDDA 3GGJA 1CC1S 3IX7A 5IVPA 1IY8A 1TMKA 3LF2A 2N9UA 3LQ2A 2EJCA 3W2HA 4YDRA 3N8NA 2GPSA 5BN1A 2XUQA 4B4VA 1KHHA 5EC8A 4DJFC 3RIYA 2XWJI 3N05A 2OO7A 4ZHQF 1TGVA 1QK5A 5EJFA 1GIAA 1NRJB 1RRMA 1NVVQ 1DUIA 2EW2A 3TRFA 1S3SA 1CYDA 1JDNA 2EKPA 2HWKA 2QRHA 1UK9A 1QB8A 2IP4A 2Q3EA 3B85A 5FP0A 2AK2A 3T7CA 2PPLA 4N3AA 1WAMA 2E48A 2UKDA 3LYUA 4J29A 1KFCB 1BDMA 1P81A 2H3EA 2JGFA 4LTMA 4Q19A 4XM2A 3GGPA 2V6IA 2IUFA 3AIMA 3O3OB 4MYRA 4NAVA 1SRRA 5JUWA 1FXWA 3BMOA 3KELA 3VBCA 1NLYA 2XT6A 1CU1A 2HN9A 1YB6A 4FBLA 4UNQA 4HQLA 2PZ8A 3RVJA 4CNQA 4RIHA 3ZZTA 3B6IA 3DFMA 5CUQA 4XVCA 3AXTA 3L8GA 3HZRA 1I10A 4E12A 3ZHVA 3K9QO 3GFQA 1CR0A 4QU5A 5GOTA 2C4NA 3BJZA 4PBRA 1P2FA 4M1QA 4AURA 2MR6A 3AV3A 3CUSA 3FPEA 1W4RA 4NNPA 2CNLA 2QVLA 2O20A 2WD9A 1DAHA 3V8VA 3V00A 1K3UB 3AZPA 2HB6A 1G4UR 2CDCA 2IOQA 2Z3WA 1IRIA 4NOMA 1UDXA 1CQIB 1QIFA 2WJ6A 1KK0A 3OWOA 2XIQA 4RHCA 2RD2A 2DFTA 4GPAA 4BRWA 3CF2A 3HL0A 1CFZA 4B8YA 2FFRA 1SCQA 1T8UA 1TCUA 5LDHA 1GY8A 4I5FA 2R4QA 5FFMA 5KNDH 2I1VB 4MW0A 2JD2A 4LXYA 4CM8B 3TGPA 4WFJA 3VOBA 2EEPA 5EUMA 3DPIA 1XTUA 5ECDA 3T7SA 4R2IA 4L8LA 2JAOA 2B36A 5F23A 2RIRA 4RVGA 5F3RA 5KIAA 4MHOA 2FDCA 1PSDA 1UPTA 2VXBA 2H7XA 3DLCA 4JI1B 5CYFA 3KQMA 3UB3A 3PWZA 4YUXA 3GMIA 5AOAA 1E0AA 1N2HA 3MEQA 3QPWA 5CT8A 3D8HA 3SEFA 3LY8A 2Q3JA 3BZUA 2QS9A 1RI2A 3FVWA 2I1QA 5K2MA 4E2ZA 2OGZA 1ZRSA 4PF1A 2DUWA 4NCKA 1FLNA 2YOGA 1YJQA 1YI0A 3QENA 4FOOA 5AK0A 4DKXA 2I1LA 2H4JA 3A0RB 3E2IA 5B6PA 4DSNA 3NRJA 4C1NA 5ALLA 3SX0A 4BV9A 1R8YA 5HM6A 2WIFA 3TTXA 4DC1A 4WUTA 3QIAA 3LT1A 1HDYA 1QDEA 3SPXA 3IDOA 4TLCA 2WWVD 4ENSA 1I5OA 1QM5A 4C88A 1L4FA 1ARZA 1RWWA 5BR4A 4IIXA 2J0UA 3L0IB 2OR3A 2OTCA 2QQGA 1ZIDA 3IAAA 1LV7A 3R7WA 4NYMQ 6PFKA 4PPNA 3RR2A 1JEOA 4X8LA 1CUBA 2QRGA 3ZKAA 4I50B 3C70A 3K9HA 5TMDA 2ZATA 2WJJA 3D2BA 1FRFS 4OK3A 3KBOA 3T1YB 3B1FA 1OHHD 4EI9A 5E4YA 3C3YA 3K0AB 8MHTA 3MMPA 4RV9A 3HPQA 2CYAA 1P77A 1BMFD 3EBOA 4MPTA 1YR1A 3KSRA 3SLGA 5DCWA 2COUA 1WDMA 4AJJA 4L8YA 3VNRA 4K6MA 1A8PA 1Y3DE 4DJJA 3OM9A 1CRWG 4MUYA 2AG0A 3ENNA 1Q7GA 3LYHA 4JDUA 1ODTC 4JB8A 2PUBA 5ENDA 4KR9A 5IUJC 1K7EB 3C16C 2WAYA 1YBAA 3VNAA 5E1DA 5TVGA 2FVYA 3RIXA 5DX1A 4B7UA 2D74A 2XVXA 2YH2A 3GYBA 2RHDA 4LDJA 3C7TA 2J0UB 4IL5A 1JQAA 1P9NA 4GLOA 2PLFA 2P9BA 1TQDA 5C1PA 2VSYA 2NO9A 3JWHA 5DSZA 4YQEA 2PX2A 2B98A 1IONA 1Q1AA 5JALA 1L9XA 4F4HA 5CPBA 1DI0A 3FY4A 3GUVA 3FWPA 3L7IA 3I9NA 4K6HA 4LCJA 3H99A 4MS4A 4X91A 1LPOA 5HGJA 1QG2A 3THOA 2KE5A 1Y1KE 1VHDA 4Z7JA 1GZ3A 1CY2A 5I4CA 4JLSA 2BFFA 1GADO 1JH8A 1RIFA 2YQ5A 4CLRA 5LU9A 4RGQA 4FQ8A 4B81A 2QR3A 1FYWA 3U7IA 4AJ2A 4B7AA 4C29A 5L6LB 3H17A 1RC8A 3GBSA 2QB5A 3DDSA 3TUZC 1I7QB 4IFIA 1F8UA 4EAQA 1N78A 1NUSA 2QVCA 4LX8A 3RUIA 3EXIA 4MW4A 4ARZB 5IM4A 4R1UA 4WXPA 1YQXA 2A9VA 3WIEA 4Z86A 4UPVA 5JARA 2GTIA 2KS6A 3OD5A 2OBYA 3THRA 2C77A 2YMQA 1JU3A 5H82A 4AX4A 1TTQB 2DZDA 3HYNA 5CVTA 2ZRDA 4H7DA 4OCZA 2QX4A 5DBEX 1GQ2A 3MGBA 5CAEB 2D1SA 4YV0A 2IZ0A 2PZFA 2ATVA 2E18A 4C0QC 1MB2A 1MQSA 2XSZD 1HXHA 1KL7A 2C2GA 2WNSA 4P4UA 1ORTA 5D2CA 2OK8A 2QMZA 3P4UA 4QTZA 3W5BA 2CF5A 4PHCA 1ULTA 4XCXA 4YACA 4BQRA 1BX3A 2B0JA 3L8HA 4UBMA 5LUBA 3MGKA 2JAUA 5BMVB 2IYAA 4KJZA 4PICA 1DJMA 1Z08A 1XRNA 5AKGA 3DAOA 2AN4A 4KO1S 4GRIA 4J9UE 3ZI4A 4MGIR 3OCJA 3B9PA 1SXJB 1YB5A 1ZD8A 4HCJA 5K20A 3EZXA 3T7KA 1FMJA 2BFCB 3I3SR 3K32A 1OAOC 4ZJPA 2PWZA 4DV0B 1R4NB 1IJEA 3IESA 3DT6A 2CVFA 4JSTA 2J07A 1RQLA 4MR9A 4AZ3B 5AHKA 5KNBA 1J42A 4G5SA 1PSWA 4DNQA 4JLOA 1XT6A 2HL6A 3HB9A 4QGBA 1AUPA 4ZT3A 2Y1LA 5DF1A 2P27A 5AM3A 3OY7A 4L95C 3RTBA 3Q7RA 2A33A 3T9DA 3OU7A 3EIQA 1H2EA 1P4JA 2EJVA 2EEZA 4N49A 1IQ0A 1QYCA 1Y9AA 3MWYW 3QZUA 1RVV1 1SWVA 2XMRA 4EECA 5IJ0A 1COZA 4E13A 5LQJA 3KQNA 2FW0A 2FPIA 4UAGA 3B78A 3MT7A 1EB8A 5ER9A 4DE5A 3P2EA 2C0PA 2NN3C 3DFZA 3LQ4A 1R2QA 2HA3A 2PGNA 5BOVA 4RE5A 4B0OA 2YDXA 3QY0A 5HBRA 1GL6A 3VC7A 1REQA 4TLMB 1F7VA 4JDPA 2FG5A 1IUOA 1UC4B 1KA9H 4XYBA 1YUNA 4JODA 3BH0A 1H3EA 1ECGA 2BAGA 1VRCA 1T9HA 3EDQA 4OFBA 3R9KA 2VNIA 5FI1B 5ICCA 4OJTA 1HQYE 1Z45A 3HYSA 4J0QA 5DBGA 1E2QA 4Z0TA 1EWKA 5H83A 2VZEA 2PZEA 2NVUB 1UJBA 3KVOA 1AZWA 3G2KA 1R5JA 8AT1A 3SFVA 5B2EA 1OVMA 2X1MA 4ERNA 3L8MA 1CB7A 4HRAA 2R8XA 3H5OA 5JD5A 2GXAA 3RHTA 4E46A 1BQEA 2BFNA 2WNHA 3AU8A 2G4LA 2Y77A 3EMKA 4NBSA 5FULA 2AK3A 3O4VA 2RGGA 3GFSA 4NE9A 1A1SA 3EOBI 3DW3X 3QM1A 4GBJA 2PZKA 3PC6A 1Z47A 4AO6A 2FI1A 4D9GA 1EUDA 2CMFA 2IOFA 1HQDA 1CDOA 1V71A 4K2HA 3OQJA 2I7TA 4UOEA 3B7PA 4KPUA 3ITDA 4KQXA 1HFWA 4HQKA 5DISB 3ROQA 6ABPA 1IVNA 4WACA 2E4XA 4TL7A 3PIRA 1QU2A 2YCBA 3V4PB 2W6QA 2ZB2A 3EIEA 2WDPA 1E63A 2D7JA 1NY6A 4KXQA 4LXXA 3RYIA 1MGOA 4JKIA 1KDTA 2FSUA 4N6GA 1RPZA 1TM7E 3KEFA 2XGMA 4FFWA 1O97C 2DT8A 2Q0QA 4PGMA 3ROPA 4B87A 4DBVO 5C8XA 4BPBA 3IAEA 3IOBA 2WQ6A 4Y1RA 2AD5A 2CUNA 2GKOA 1EFVA 3BD9A 4MINA 4XDZA 3EQ9A 1ZU5A 3L6DA 4FYHA 1OXTA 3RO7A 4IQFA 3R5XA 4PR3A 2CC2A 2FSIA 2NM0A 4R8KA 4BIIA 2C96A 2AN3A 2ACWA 4MW9A 1L4KA 1Q95A 1T2NA 3IEUA 1VPVA 1JTEA 1RMTA 2HREA 3AY0A 3QFSA 1DP4A 4P1ZA 2XT9A 3TLMA 1FUKA 4V0NA 1NMEA 1U8YA 4XWTA 4FONA 2BP7B 3C5HA 1Y9ZA 3D2CA 2EJBA 5CNIA 3TS1A 2VJPA 1FL9A 1IPFA 2P9JA 1CUWA 4QGSA 3BA6A 1ID8A 3PXXA 1DT3A 3RAFC 2YWCA 2PRSA 3ZCTA 3PB3A 4RZXA 1AB6A 5DXFA 2WF8A 1GA1A 2XCRB 4MVJA 3HY3A 2GILA 2HWUA 2QY6A 3FNIA 3M3HA 4N82A 4J8PA 4OQXA 1M7GA 2Y2VA 1JPUA 3LUKA 3BXXA 2JLQA 4X1KB 2FRXA 4XJSA 5EKXA 3I76A 4KLNA 1H42A 4UVEA 2GQ0A 1E5LA 3KWMA 4Q9DA 1FDRA 5ERGB 3DDOA 1YHNA 1S4QA 1XXLA 2WIJA 2BTOA 4QO8A 3AI3A 3QPUA 1PSZA 5FLYA 3VH4A 2O54A 3PPXA 4IH9A 3V8MA 1WUJS 2QGNA 2QRVA 1NVXQ 1XTRA 2QPLA 1K5PA 4K40A 3Q15C 5BV0A 1N9GB 2BJVA 2PWYA 1M2GA 1T26A 2GWRA 1JKIA 2HJWA 5M2QA 5CDUA 3I39X 5IT0A 1C3EA 1ISJA 3OZ7A 5AXDA 4AY5A 1P0FA 5LP6F 4YNBA 4CKZA 4C20A 4J03A 5KDLA 4D1YA 1JHXA 1LPNA 2VN8A 3VHXA 2L82A 2NZVG 4Q00A 3FCYA 3G13A 3BXFA 4DHEA 4Q9JA 6GPBA 3HBFA 1I9GA 2HXYA 1I24A 2R00C 2VA9A 3PFFA 4CG0A 4ZOQI 1SOWA 1A88A 4BB5A 1SZDA 4D56A