3DXYA

Crystal structure of ectrmb in complex with sam
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
207
structure length
207
Chain Sequence
HALENYWPVMGVEFSEDMLDFPALFGREAPVTLEIGFGMGASLVAMAKDRPEQDFLGIEVHSPGVGACLASAHEEGLSNLRVMCHDAVEVLHKMIPDNSLRMVQLFFPDPWHKARHNKRRIVQVPFAELVKSKLQLGGVFHMATDWEPYAEHMLEVMSSIDGYKNLSESNDYVPRPASRPVTKFEQRGHRLGHGVWDLMFERVKLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords tRNA (guanine-N(7)-)-methyltransferase
publication title Monomeric tRNA (m(7)G46) methyltransferase from Escherichia coli presents a novel structure at the function-essential insertion
pubmed doi rcsb
source organism Escherichia coli
total genus 63
structure length 207
sequence length 207
ec nomenclature ec 2.1.1.33: tRNA (guanine(46)-N(7))-methyltransferase.
pdb deposition date 2008-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02390 Methyltransf_4 Putative methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3dxyA00
3Q7EA 4M37A 4R05A 5ICCA 3G8BA 3KHKA 5FUBA 4EQZA 4K6MA 2P8JA 3CCFA 3O31A 2AOUA 3HCBA 3MTEA 1NE2A 3ME5A 3ANXA 5LQRA 2PX4A 3AJDA 3EVFA 4V0RA 2YXEA 3GU3A 2QRVA 4R8SA 5HIIA 1F3LA 1EJ6A 1INLA 5FHRA 5M5BA 4QTUB 2ZW9A 4RV9A 3GWZA 3FTCA 3HVIA 5CCXA 2O0LA 4R6XA 5HOQA 5EIFA 3T7SA 3TPZA 3NTVA 4PYJA 3LX6A 4X41A 3SMQA 3Q87B 3MCTA 1EQAA 3BWYA 2P3QA 4DCGA 3LDFA 4RTOA 2VDUE 2IDJA 1R00A 3AWIA 3I5UA 3HTXA 3EVGA 1Q0TA 3LCUA 4Z2YA 2YR0A 4EKGA 5BXYA 1ZKDA 3P9IA 1JQDA 3M6UA 5DXJA 3H2BA 5DSTA 4RTQA 1YF3A 4YUXA 2AS0A 3FUTA 3LGAA 4RVHA 2IBTA 4F86A 3PX3A 1XJ5A 3FPJA 3R3HA 1RJGA 3HA7A 1P39A 2H1RA 3KQSA 3MCZA 5CVDA 3FTEA 1QANA 2XBMA 1MJFA 4B17A 4YV2A 4DCMA 4GC9A 5BP7A 4G56A 1Z3CA 3ELWA 2AOUB 4OBXA 3VYWA 1YFLA 4WVLA 3GJYA 4PONA 1QAOA 1IM8A 3M6XA 2QRVB 4ATNA 3NMUF 3ORHA 2QE6A 3R24A 4E30A 4YMHA 3EVBA 4P7KA 4DMGA 1QYRA 4FS8A 1WXXA 2B25A 4FSXA 2IH4A 3DMHA 3FUXA 5DM1A 5DRTA 2ZZNA 1TPYA 2I9KA 5EZQA 4RWZA 5T67A 1G8SA 2O07A 3NWBA 4X63A 4F85A 4BLVA 1I1NA 4RSRA 5CCBA 2IFTA 2IPXA 2UYOA 3UJAA 1X1DA 1SUSA 4OQEA 3FPFA 3EEOA 2CMGA 3P2IA 9MHTA 1B42A 1Y8CA 2OB1A 2PJDA 3SX0A 4PWYA 2WA2A 3CVOA 1M6YA 3BWCA 2BR5A 3OU2A 4MIKA 3AXTA 4X61A 1G38A 2HTEA 2ZIEA 4P7FA 1KHHA 8MHTA 5EMMA 2P3OA 3GNLA 3DULA 3KR0A 3M33A 1FJXA 2NXJA 3EVZA 2Z6UA 4NECA 1JQ3A 3OE5A 4C03A 2FRXA 1IY9A 4JXJA 2AVDA 1BKYA 1D2CA 3RIEA 1JG2A 3O7WA 1KPGA 1WS6A 4DKJA 4FSDA 3A7DA 4A6EA 5EOVA 3NDJA 3WSTA 3KPJA 3PT9A 2IIPA 3UJ8A 2P40A 1SUIA 3HCEA 2PSSA 2FYTA 3HM2A 4AUKA 2UZ4A 3ER8A 3M4XA 5EHGA 3EVAA 3NVMB 1EAMA 3V97A 3LCCA 1WXWA 3MAGA 2OO3A 3FYCA 3LHDA 2P41A 2VP3A 5ICGA 2IGTA 1BHJA 3DLIA 3FTDA 3K6RA 4E2XA 4QPPA 4BLUA 4Y2HA 2GLUA 4PGHA 2HMYB 4C07A 5FTWA 4M36A 4LWOA 4HG2A 2GPYA 1Q0SA 2AOTA 2FK7A 2ZIGA 3B5IA 5BW5A 4RTRA 2BM8A 1PJZA 1X1BA 4P7JA 5E2BA 5K0BA 4RTJA 4GOOD 5GWXA 2OXTA 4CTKA 4YUVA 2PX5A 4QDJA 5FWDA 3UWPA 2ORED 1I9GA 5EPEA 5DM4A 2BM9A 1RI1A 2Y1WA 4HGZA 3T7TA 2JH9A 2OZVA 3KPVA 1SVUA 1VIDA 3KR2A 5BW4A 5K0FA 5EZSA 3BKWA 5DTMA 4V0QA 2DULA 1FBNA 5FQNA 5HIKA 1MHTA 4IWNA 4RTLA 1N7JA 1ZGAA 2JHCA 5DLYA 4HRAA 3SM3A 3FTFA 3ELDA 5HFJA 2ZBQA 2Y1XA 3FPHA 5E1DA 3BGVA 1O9HA 3REOA 3KQOA 3UJDA 5F2OA 4XUDA 1M0EA 3UA4A 2GS9A 1KPIA 3HVKA 3GRRA 3E8SA 3HEMA 5LSAA 4XUCA 5LQUA 1XXLA 3V8VA 4O29A 4CWAA 4POOA 4PYNA 3UJ9A 2ZIFA 1O9GA 3UJ7A 3VC2A 1KXZA 3LPMA 4OQDA 4UOEA 2XVAA 2XYVA 5F2NA 4XCXA 2ADMA 3PTAA 2P35A 3EGVA 2V74B 1ORHA 2BZGA 5FADA 2YTZA 4KVZA 3I53A 1L3IA 2C7QA 5K0EA 2FCAA 2I7CA 4RTKA 2PWPA 2QY6A 1N7IA 3SVZA 2AOTB 4KDRA 4ER7A 5GIOE 1AQJA 1BC5A 1QAMA 3G8AA 3QOXA 4LWPA 4CTJA 3FPEA 4LG1A 5T6BA 1SQGA 3ERCA 5FQOA 3MTIA 3P2EA 5LR6A 5FULA 1L3CA 2PGXA 3VC1A 4YUZA 2G71A 4ZTBA 2IH5A 4RTPA 2CWWA 4RYLA 2NNWB 4PIPA 4EMSA 3KR9A 1JQEA 3TKYA 1DUSA 2PT9A 1P91A 2PBFA 3DTNA 4IV0A 1NV9A 2YX1A 3JWHA 3E05A 2ZTHA 3P97A 3G2PA 4MTLA 5DX0A 4QPNA 4MHTA 1NBHA 2OPBA 4IV8A 4MQ4A 4PINA 5F2KA 2GH1A 2JH8A 1HMYA 2O57A 3IHTA 5CIYA 3A26A 5DSXA 1XDUA 3AXSA 3OU6A 1X1AA 5HEKA 3I58A 4GUAA 3HCAA 3ER9A 1F38A 5ICFA 2P7IA 1RJFA 5EQJB 3SSNA 3B3JA 1L1EA 4YV1A 3UBTA 2Z6AA 5GOZA 5DTRA 1X19A 3EEYA 1HNNA 4C4AA 5GM1A 3TM4A 2ZULA 2HV9A 4PGGA 3PFHA 4RVGA 3IEIA 5EMLA 4GF5A 4FGZA 1PRYA 2Q41A 4MWZA 4HSGA 3LDGA 1WZNA 1U2ZA 1YUBA 3PFGA 4KIFA 5CUQA 3BZBA 1OR8A 4FP9A 2N47A 3A27A 1EIZA 5E9WA 2C7PA 3UZUA 4HC4A 4U7PB 3KU1A 4PYKA 4EK9A 4P7GA 4QQKA 5E1MA 4RVDA 3S68A 1EG2A 1ORIA 2G8NA 3P9CA 4KDCA 5EKUA 1QZZA 3FUUA 2VS1A 4BY9E 1X1CA 2AZTA 1KP9A 4C08A 3BKXA 2GAFA 3EVDA 5E1OA 3THSA 3GDHA 5C9ZA 3R9XB 2ZWAA 3C3YA 3KKZA 5K09A 2NP7A 2HR1A 3G2MA 5K01A 2G70A 3LECA 5H02A 3C0KA 3BUSA 4GOND 1D2GA 2PT6A 2XYQA 4IKPA 5DPMA 5P8WA 2I6GA 5DM0A 2ZZKA 1UIRA 4CXMA 2R6ZA 3CBGA 4R6WA 2PV0A 3FUWA 4F84A 1O54A 2OKCA 3CGGA 4QVGA 3GRVA 3IV6A 3OE4A 1VLMA 2A14A 2VDWA 4RTMA 5EG5A 2AN3A 5IH3A 1YB2A 1H1DA 2K4MA 5K8VA 2R3SA 4BLWA 1SKMA 1R6AA 5K05A 4E2YA 5HZMA 5CVEA 2ZZMA 5JUWA 5HIMA 4OBWA 5C1IA 3A7EA 1L3BA 1TW3A 3JWGA 5K0LA 3GRUA 3CC8A 3O4FA 4A6DA 1XDZA 3TM5A 3EVEA 3DUWA 2O05A 2IH2A 4E31A 4DA4A 1RI3A 3MB5A 3CJRA 2WK1A 4HGYA 4AZSA 2AOVA 2EJTA 4PYIA 3QV2A 3IYLW 5FHQA 1TW2A 4BP3A 2OBFA 3LBYA 3E23A 4FZVA 2B3TA 1VE3A 2PLWA 2YXLA 1DCTA 5LQCA 2JG3A 2DPMA 2WA1A 3ID6C 3SXJA 3HCDA 1KYWA 2OY0A 3AY0A 3B3GA 3E7PA 2B78A 3DOUA 3OZSA 5DX1A 3T7RA 4AZTA 3HVJA 3C3PA 3NDIA 2JHAA 2G72A 4OA8A 2P3LA 4RTNA 1RI4A 3UJBA 5FWAA 5LQNA 3TQSA 2C7OA 4PYOA 2EJUA 4OA5A 2AN5A 1YZ3A 3HP7A 1AV6A 2H00A 3G2QA 3LDUA 2CL5A 3MQ2A 4ER6A 3MHTA 3UJCA 4ISCA 1NW3A 4HTFA 5CVJA 5LQAA 3DXYA 5E8RA 4RVFA 2GA9A 10MHA 3OU7A 2NP6A 1RI5A 3DMGA 1JG3A 1JR4A 2PY6A 3KQMA 5CM2Z 3SR4A 3JWJA 1VQ1A 3QOWA 2PKWA 4BP1A 5K0JA 4PCAA 2EG5A 2AOWA 5KYGA 1VP9A 3SSOA 2JJQA 3ELYA 5FA8A 2E5WA 5KQRA 4PCLA 1G8AA 2HWKA 5LQKA 5EVJA 5DWQA 4AX8A 2PXCA 3KQYA 2P1DA 2AN4A 3DH0A 3LBFA 4EKIA 3GRZA 3B7PA 2CMHA 4P58A 3NJRA 3PB3A 1EJ0A 3GO4A 4RTSA 3CKKA 4E2ZA 2EFJA 5FA5A 3F4KA 3HCCA 4LECA 1AQIA 3DLCA 4GBED 3OCJA 2O06A 2PXXA 1FPQA 4FT2A 2B9EA 3HA3A 2ERCA 3I9FA 3KQTA 3PVCA 1NW7A 3BXOA 4PIMA 4YMGA 5E2AA 3P9KA 4OX9Y 2ZBPA 1R8YA 2I62A 2OB2A 2AR0A 4C04A 5E9JA 2NXNA 3R0QA 3BT7A 5EGSA 3PS9A 2V7EA 5GM2A 3TKAA 4HTFB 4RX1A 4CKBA 2F8LA 3KPUA 4KW7A 4DQ0A 3DXZA 1YFJA 1FP2A 3LL7A 4YUWA 4R8RA 2C7RA 3OFKA 1XDSA 5KQSA 2ZFUA 1KYZA 5EHIA 3G2OA 1NKVA 3C6KA 3G89A 5CD1A 3U81A 1NT2A 3DP7A 2FK8A 3BWBA 3MGGA 3TMAA 4X1OA 4C05A 3P71T 1WY7A 3OFJA 2IP2A 3ELUA 2NXEA 3THRA 4E33A 4DF3A 5KVAA 3EVCA 3NVKI 1WG8A 2P7HA 3P8ZA 2UYCA 2FPOA 5MHTA 3I64A 1VBFA 2AVNA 4H0NA 2BH2A 2QM3A 3RW9A 3SGLA 2YUIA 4WXHA 4GQBA 4PNEA 3EGEA 4FT4A 1XCLA 1XTPA 5D1NA 3GXOA 1XCJA 3BGDA 3EMBA 5GIPE 1NW8A 4DM3A 1ZGJA 5T64A 3P2KA 2ZWVA 5EEGA 3TFWA 5JR3A 2FHPA 3HA5A 3UJ6A 2ONZA 2VDVE 5CVVA 1D2HA 4E32A 5DM2A 2B2CA 3OZTA 1I4WA 4DZRA 3X0DA 4KWCA 5E9QA 4GEKA 5K0CA 1G55A 5K0GA 4KIGA 3EMDA 2BR3A 2G1PA 3R6TA 4GC5A 1NW5A 4X60A 3FPGA 2ZBRA 3A4TA 3FRHA 2ZCJA 3K0BA 3P9NA 4L7VA 2ONYA 4Y30A 3M6VA 3OZRA 1P1BA 3PX2A 5ICEA 1RI2A 3TRKA 3G5LA 3G5TA 7MHTA 5DRYA 1JSZA 4XUEA 5EKXA 5K03A 5DXAA 2LD4A 1P1CA 3B3FA 5LQJA 1M6EX 3C6MA 5EC8A 3FRIA 1NV8A 1KIAA 3KQVA 5DTQA 3KPYA 2VZ9A 3MERA 4HH4A 2Z6QA 2ZLBA 2GB4A 1JG1A 3KQWA 3M6WA 4AZVA 4GOMD 2EX4A 3DXXA 5U4XA 2IBSA 3HVHA 5ERGB 3B89A 3LCVB 3LSTA 2NYUA 2PX8A 2PWYA 4PYLA 3KPWA 4C06A 3LKDA 3TR6A 3GCZA 5HILA 3EGIA 1KPHA 1R8XA 2XVMA 3KR1A 5EMJA 3BWMA 3DMFA 1VPTA 4FR0A 1UWVA 1YZHA 3FUVA 1NW6A 2BR4A 3GGDA 4QVKA 1L9KA 1N2XA 2YXDA 2UYQA 1KR5A 4U7TB 5EMKA 1FP1D 3UFBA 1DL5A 1SG9A 1RJEA 3G7UA 1V39A 3GIWA 3GRYA 5B1SA 4ER5A 1G60A 4QDKA 1UFKA 5KS2A 3JWIA 2PVCA 2OYRA 2KW5A 3TOSA 1IXKA 2HNKA 1T43A 5GINE 5E8JA 1QAQA 2XYRA 2UYHA 3L8DA 3LKZA 4M38A 3TLJA 1G6Q1 2ESRA 1AF7A 3BGIA 4E2WA 3NWEA 3SSMA 5EIWA 4ER0A 1ZG3A 3EPPA 3KQQA 2NXCA 4GOLD 3HCFA 1BOOA 1R18A 1SQFA 2IDKA 3KQPA 5IKMA 2ZVJA 1RJDA 5E1BA 2YQZA 5C0OE 5DT2A 5DX8A 2JHPA 4YV0A 3A25A 2CKDA 2PXAA 4M7RA 3HNRA 3FZGA 5G02A 2AOXA 5EEHA 2PX2A 3OPNA 3VSEA 4YUYA 1ZHFA 1ZQ9A 1JG4A 1JSXA 1R74A 5GP1A 5CVUA 3PLAE 1NBIA 3CJQA 5FCDA 5K0NA 2ZSUA 3FYDA 4AZWA 3T0IA 4QTTB 4EVIA 1VL5A 3CJTA 3G88A 3RODA 3M70A 4E70A 4PYQA 5D1HA 4ER3A 2YVLA 4PYMA 5HIJA 2H11A 4CKCA 1XVAA 3DR5A 3NW9A 4KRGA 3D2LA 4CKEA 4QQNA 1JTFA 2QYOA 1VP3A 3UA3A 1JTEA
chains in the Genus database with same CATH superfamily
2OBNA 2EG9A 3QPVA 3ZG6A 3OKAA 1PJTA 4N82A 3OO1A 1DBPA 3WLNA 3HCBA 4LXTA 5AIBA 4CG2A 3Q3IA 3ME5A 3KFVA 2WU1A 5TQ2B 2QTFA 4D4HA 1EWTA 1OXTA 1UAYA 2VF5X 4PGMA 3FWZA 3KKMA 1EP2B 5JD3A 2QR2A 1TEZA 2A2ZA 3ZHTA 3PGA1 3AJRA 3ZVKA 2XTNA 1CJKC 4XFJA 4PNZA 1YNSA 1U5AA 1YFZA 4LVNA 2Q29A 3F5QA 4YCBA 2R751 4LC9A 2J0VA 2P2SA 4X65B 2P69A 4D4IA 1NBOA 4D9JA 1K7EB 4UMDA 4NOJA 3HXOA 4FW8A 5A5VA 2H1OA 2O59A 5B5SA 1W0CA 4NMXB 1ZAYA 4YECA 9LDBA 4ZODA 3IEMA 2QPAA 2LPMA 3DVQX 1CEQA 4R7GA 2RH4A 2ISCA 4P3OA 2GGSA 1UM9B 2HRQA 2OCDA 3HDYA 3PXBA 4YUXA 1BXGA 3GH1A 4ZA2A 1FUEA 4EY4A 1SOVA 2GPBA 2BMJA 2BDTA 2C59A 4L8GA 1TYCA 4D97A 1FSZA 1HF3A 1CIVA 3M4NA 2EW1A 5C34B 3UQYS 2E82A 5HGJA 3FB1A 1XMXA 1VBMA 3NANA 1G18A 1KYTA 1RMTA 1VBKA 1D3AA 4FFDA 4L74A 4RJ2A 4ABYA 4BRSA 1YFLA 4IRUB 2HFJA 2W6IA 3GEDA 5PGMA 1HV8A 1QFJA 1FYVA 4WJZA 5HK9A 4MZDA 1CF2O 4KX3A 5KKAA 4HHEA 4YMHA 4O4IB 1UBGA 3PC2A 4EELA 2UUAB 1DJQA 2I6FA 4P98A 4OF4A 3GAMA 4CCSA 5DRTA 1N8TA 1Q84A 1VFPA 1GPWB 3EA4A 3G1UA 3ONWA 4JGGA 4RWZA 5AVYA 1TJ4A 4MPPA 5DOZA 1E9BA 5CAEA 4DW8A 1X92A 2IPXA 4F8EA 1SCJA 2LGJA 4Q82A 4A5OA 1OX5A 2I87A 6REQA 1Z06A 4JLJA 4OM8A 2EQ5A 3V8EA 2CMGA 3BMNB 5HOEA 1WF6A 4CMJA 1I4EB 3GB9A 5IULC 5CJ2A 1QYWA 2G36A 3S40A 2GILA 1FXWF 1PG0A 1TKRA 1E2UA 1TU0A 3C98A 2WNIA 3IIKA 3PQFA 4YLGA 5IJWA 1DV2A 4KMSA 4AP5A 1DEHA 1DZ3A 2GBCA 2OOKA 2ACWA 2JBWA 3AONB 4PU0A 2EZUA 3IUPA 3U2QA 3G9UA 3VNSA 2OWDA 4IXDA 1GGNA 1OWLA 3O7WA 3ZD8A 1K1EA 3WNBA 1PKXA 1QHHB 4MS4B 2RKOA 5EOVA 1U28A 3KPJA 4GNRA 4XM2A 1IOZA 3UJ8A 3ZWVA 4JBWA 4YWHA 3O8LA 2HO5A 4YXWA 3IQGX 4LJYA 3SIRA 4LXIA 1A7JA 1F1BA 1T6ZA 3L5OA 4Q1BA 4D8XA 4CIVA 5EHGA 2UZ4A 4K9DA 3KYCB 2HJVA 1FVOA 5LP6F 2ASEA 4ARAA 3B1JA 5BN4B 4V39A 4W6ZA 1BHO1 1CRPA 3ZDAA 2ZRKA 1PNRA 1HT2E 3RU7A 1CQJB 2PMCA 1E94E 1XRQA 2SICE 1VHJA 3L0YA 2GPYA 4HX2A 4Q4DA 5CA1B 1QXSA 4R7TA 3DD5A 3G0CA 4IH4A 4X7RA 1Z16A 2OXTA 4W5OA 3QLUA 4HWSA 1FUKA 2GZSA 4KVFA 4TL6A 4HUJA 4YP1A 4ZEOA 5IVHA 2IKSA 3Q98A 3L04A 1W2WB 4YRRA 3HU2A 5HFAA 3UMSA 5EJ4A 4NZPA 4BCBA 1G7TA 2M6SA 3LHSA 3SYMA 1JH9A 1XXHA 4LYDA 2C7VA 1E4EA 2BI8A 2H2WA 3HR7A 3FTFA 1N6LA 5H4HA 4BIMA 4PHFA 1K68A 4CTOA 2BM0A 5DCLA 2GNOA 3K0CC 1KK1A 1O9HA 2X9LA 3KWMA 4D6XA 1YR9A 1E69A 1M0EA 1EXMA 2LTAA 2DH5A 2FZKA 3HKCA 3AIKA 3O9MA 3A04A 1EUQA 2CSXA 4BMZA 4C7VA 5DNUA 4RSHA 4OXQA 2ZIFA 2OO5A 3T9BA 2F7SA 1N6NA 3QVVA 4Q48A 4I14A 3SNHA 4XCXA 1OH5A 3W3AH 1BAPA 2YOHA 1NW9B 2ODBA 2JD2A 2VG8A 4ND8A 3ZU6A 4DLAA 4UOZA 5HIAA 4JUFA 1JB1A 1VHDA 3I53A 3O90A 4IMPA 1FUIA 1OZGA 2IYPA 2D1FA 4KQKA 4S1VA 4U5XA 4H1VA 4MVCA 3Q8MA 1U3VA 5KYYA 2G5CA 1AQJA 2KWIA 2QVZX 2EKQA 4LYEA 2M6LA 3V1MA 2FFJA 2XV1A 5E9AA 3TQFA 2V7PA 1P5HA 4H7HA 4LVOA 2VK2A 4NATA 4BC1A 1QGUB 3UYLA 4RVSA 2Q3MA 3OX3A 4KQXA 1Y7PA 2QSJA 4E22A 4RMNA 1N2GA 1PR5A 3LPDA 4IZIA 5AUQA 2X2PA 3U7FB 1LF5A 3GHYA 1YDEA 3H4IA 3NORA 4BB9A 4OSEA 3GP3A 4ARZB 1V4NA 4M0UA 2WTMA 3KD2A 3CNBA 4FGWA 5JEDA 2WWGA 2BUBA 1F2DA 3BPSA 2YQ5A 1FMLA 3E2IA 2D62A 3C2QA 5F2KA 1IHPA 1DMSA 2FW8A 3FETA 4YAGA 3M5DA 1PUJA 2IEYA 2PGAA 1LDBA 3PU6A 3QHPA 3FIJA 2J46A 4MOWA 1H0HA 4NJMB 1LI7A 3V2GA 3KOUA 1ZN7A 4FBGA 4OQXA 1UJNA 2Q6IA 1ODIA 4JC0A 3PNYA 3QVWA 2Y76A 4B7UA 3T3HA 1R0SA 3E4DA 3Q0EA 5FTJA 4KL8S 4MGKR 5CIWA 4I1VA 1TZMA 3CF4A 3FYSA 3K5HA 2D0OB 4HP8A 1MGOA 4DMKA 1IFXA 5CB4F 4GI7A 4Q4JB 2PUHA 2O8BB 2VH2A 3VR2D 4UXIA 2JZNA 3ZU2A 3EDRA 4J0JA 3UMRA 4C20A 1EZZA 4D7AA 4I8XA 1XCPA 1UH5A 1DC4A 2P90A 4PRZA 5C5EA 1CSEE 4BVEA 2RJOA 3E84A 3MJEA 2ZJBA 4DIFA 3TPCA 3IE1A 3BRWD 3IBSA 2BC9A 3DGFC 3EFOB 3TO5A 2IY8A 3OUTA 1ACLA 1GN9A 1I6LA 1XRSB 4C08A 1QFZA 5JLAA 5J2UB 1U0SY 4N5DA 3MFQA 2V55B 4MI3A 2MSNA 2XCIA 4UUAA 1ZZGA 2WP8J 5ALFA 1JLSA 3LUDA 2WM2A 2XCTB 3BXEA 1QC5B 2AQKA 3MJRA 2ZS7A 4YO8A 5J4YA 3G0OA 3UMGA 4NI5A 5JCOC 4NESA 3KJHA 4UAJA 3FHCB 4EMBA 4F4CA 3BIWA 1XEWY 2K4MA 4ZYZA 4PC1A 1KP3A 3DTVD 1K9SA 5DNDA 4C88A 1AXRA 4KQEA 1U8FO 2WG0A 3JD0A 1JKMA 1PSWA 2SNIE 5JD5A 3A7EA 4B3TB 1ZIYA 2P2DA 4N41A 1AKWA 2Z1NA 1IWPB 2IUEA 2RCYA 4YLYA 1E0AA 1TIPA 1Z0DA 2HK6A 2O3SA 2J5RA 4Z4HA 4HDMA 2Y92A 3AUSA 4Y6LA 1Q0HA 3HHPA 1KY5A 4Q7JB 1RAFA 1XMQB 4M89A 4Q19A 1C29B 2QLJA 3IYLW 4I1UA 3UM9A 4AULA 4AN1A 5KQGA 4FFOA 3KJEA 5IBPA 1GTJ1 2DPLA 2DTEA 3P0IA 4EYKA 3NYRA 4US2R 2PUGA 2IHJA 3MS2A 4M1OA 2VZ8A 4UEWA 2P4UA 1E32A 2Y0DA 5EIEA 4TVKA 4IZOA 4MRNA 2YHAA 2O7RA 3JAKA 4N9WA 2RI6A 5AK0A 2XD9A 5LQNA 1KE2A 2WSYB 1Z56C 2I1LA 2OCLA 3FKJA 1JPNA 4ZHQF 3A4NA 1FTQA 3DE2X 3O93A 2KQUA 2IV2X 4L5CA 3ZQUA 2B83A 4B6JA 4TX1A 1E64A 3HU1A 2AQ8A 2VXCA 5CGZA 4IMRA 5E8RA 1RWMA 5D7NA 1RWBA 1FNBA 4FE4A 4RFLA 5EXPA 1RPNA 3KBOA 1JG3A 1X2EA 4ZKEA 3VJLA 1E7SA 2PIDA 4BP1A 2OP0A 1IZ8A 5CFMA 4ARCA 1ZYUA 3FNGA 3WAKA 5JMWA 1MCZA 4JELA 2D06A 4MA0A 4RQTA 3SYNA 4IQ4A 1L4NA 4AX8A 2HPZA 3PWZA 2UVDA 3RI3A 5JG7A 5IASA 4TWZA 2ZAGA 3ILYA 2IYXA 3MTAA 2EERA 4JLNA 4XPZA 4MVJP 3WVNA 2HWWA 5JZMA 2C5AA 2ZOSA 1V35A 3OOEA 3WDSA 1AQIA 4F7WA 4CODB 1T5TA 5D3ZA 3KSZO 4L27A 3W2GA 2VYVD 1DZIA 4CLRA 3MS7A 3G3EA 4N01A 5ESRA 1T5SA 5H80A 4RPGA 4DBVO 2V5AA 2I62A 1IDOA 2WT4A 3GVXA 3L7BA 4FZRA 4PICA 3W7AA 1ESMA 3DLHA 3S1LA 2WIGA 1DP4A 1NULA 4JMLA 3BQNB 2VLIA 1EFCA 4AN4A 3KPUA 1FYXA 3I3SR 4WOBA 4R0VA 5AP9A 3CMCO 2OQIA 2GESA 1MA3A 1H2HA 1U6JA 1Y1SA 2W6ZA 2ZVPX 3WB2A 3D1JA 2A0YA 3T9FA 4X3PA 1S2OA 2PZBA 5JSUA 3F3MA 4K87A 4BJ3A 1G5IA 1O94A 3D5QA 4O4JB 2IP2A 2CCJA 1KZ4A 4ETMA 3J7AC 2DFPA 1XX6A 3A6EA 2MSDB 4H0NA 3WB9A 5K0TA 4LZZA 2NZJA 1IATA 1JXAA 4WXHA 3O26A 3PNMA 2PXHA 4GQBA 4WKGA 3ZDYB 4CFZA 1Q19A 3EC2A 3E5NA 5D1NA 5FWNA 4BFSA 1JIUA 3ANLA 4AB1A 4CQJA 3O9ZA 1YSCA 1DOZA 5DTIA 4AJEA 1GM5A 2FHPA 2QD2A 1JA1A 2ZE5A 4LIPD 1KAQA 1THZA 3LP8A 5EYPA 4GPEA 1FS4A 4ZWNA 4LYJA 2X42A 1XT6A 2OUIA 3PLNA 4ZPXA 4EG8A 4UFPA 2F3UA 5HQJA 3Q9NA 5ALYA 1Y3HA 3N6VA 4PNHA 5IBRA 1QGYA 1HG1A 1P4SA 2Q46A 1SM4A 5I7AA 4C4YA 1OHHA 3OJCA 4EF4A 1UBKS 4U02A 3ISVA 1S2MA 4RMHA 1RJWA 3A4TA 1OBVA 1ZD1A 3MTJA 3DZBA 3HUEA 3PZRA 4BE7B 9ABPA 1FVHA 1G6HA 1T4BA 3D8HA 3EHEA 1G9XA 4Q7LA 1OY1A 1LI5A 1W88A 1RXSA 4A0HA 3P4YA 3CRZA 2WTAA 3LUJA 5K03A 1ZD2P 3ZLJA 1T2VA 3ZU5A 5HYVA 1U81A 5CH8A 3SC6A 3IEXA 1V1RB 1QRAA 2HTFA 1B14A 1Z0JA 2HT1A 3MIZA 3M6WA 5L9AA 3H42B 4MS1A 4BKOA 2CBXA 2A9KA 2WJWA 3AUTA 3CWQA 4ZXPA 4F06A 3DQZA 1VSVA 4XWYA 1ZUWA 3LKDA 1PG5A 3HWWA 4ZVRA 5K0ZA 4HDSA 2FR1A 2R5NA 3GMTA 4DUZB 1WVGA 2PEZA 4TXHA 1I3OA 4W5JA 5AVRA 4QJ5A 3L8FA 5DLQC 1QIDA 1RRGA 3Q85A 4K05A 1PE0A 2A5YB 1A1SA 3FSRA 3RSZA 1BWRA 2V6GA 2MYNA 3UFBA 2D1YA 5M7EA 3OJWA 4JQYA 3ZY5A 1RJEA 1UEJA 4ZO9A 4P0PB 4YS6A 4FSHA 2O8EB 2GYUA 2PJUA 3KHUA 2A9FA 1GRVA 4CQMB 1GFWA 3DD1A 4I5EA 4R1QA 3H4VA 1JKXA 1YHYA 3CT4A 5SYNA 1ZH4A 2C3PA 1EUCB 2IJGX 2XSZD 3BERA 1A69A 1DC3A 3RRFA 4EI8A 4CGZA 1OWOA 4N6NA 2VBCA 3GRCA 3DEYX 1RJDA 1H8HA 4L5IA 1XZGA 4GVXA 1JTVA 1A2QA 5DX8A 3SJCA 4D0SA 1DSSG 3GMIA 1TO1E 3LBHA 3N8HA 4ERXA 4PAOA 1UJMA 1DEKA 3KOZA 3MAJA 2GPAA 2QMZA 1KY2A 5GPBA 4K6FA 3IJRA 1MIOA 1NP6A 3KWFA 3PXEA 2V54A 3CO0S 2ZYSA 1G9SA 4X1KB 4F2PA 1N5IA 2VR1A 1L0BA 1S01A 3R8XA 4CV2A 2XE6A 4JYMA 1A97A 2IA5A 1IHYA 5D1HA 5LYJA 3AUFA 3C3WA 1Y1PA 2ZWPA 3VR5A 1YI1A 3M5WA 4WBNF 1P5ZB 2BI4A 1RJ9A 1ZUNA 4WCFA 3QM1A 4JVMA 4YFYA 4BWVA 2ZROA 4MVWA 4FN5A 3AM1A 2XKAA 4KRXA 2GM4A 3SQXA 2WABA 1YS6A 2PQ2A 5TQ0B 1T0HB 1T2CA 2QP4A 1JZTA 2VA8A 1NYQA 1J2EA 1P29A 2PX4A 3O95A 3W4IA 1PGOA 2OCXA 1S2IA 5I7EA 1O87A 3WYEA 1IMJA 1FYEA 2FMFA 2B21A 3G0DA 3RSHA 2FA9A 4RNCA 3TWOA 1KI6A 2E0IA 3EUEA 3IOMA 5AKYA 5F7ZA 5TRTA 3D1VA 4KUEA 1W94A 2QZSA 4W6QA 4PS0A 3PEVA 2Q7DA 3GLIB 1GTL1 3SX4A 1XMJA 2JZCA 1V11A 1WW2A 4O3FA 1GUAA 1T2UA 4GPD1 2ORIA 1J22A 4QUEA 4OAPA 4Y2UA 3I5UA 2FZCA 3KZNA 3B3AA 5J23A 4HJRA 4U7HA 3QY9A 4FGJA 2JLXA 5C80A 1Q0TA 3KB6A 3LCUA 5G2OA 4JBGA 3P9IA 1CEEA 2R47A 1J6UA 1YF3A 1ZN8A 4PR0A 2V9CA 3FUTA 1NNLA 1BU8A 4LJ4A 5K3BA 3OWHA 1KYXA 1M5TA 4BMVA 2IBTA 3KQSA 3E7DA 3GLFE 1W9HA 4TS3A 4LXXA 5AI6A 3KJNA 3N7UA 2WD7B 2JW5A 2O5CA 5TB5A 1HYBA 2VAPA 5AM2A 1KBZA 1H1LA 5SY9A 2XT0A 4DV5B 3GJ8A 5KUTA 4FYKA 3MGAA 1TZBA 1V5FA 4PONA 4WVLA 4XGNA 1AB5A 2G0TA 3QBTA 5JMTA 4ZYTA 2JGFA 1CDZA 3CX4A 4LISA 1VCOA 1LBQA 3NUZA 4LQCA 2ADFA 4YA6A 1JW9B 2RK3A 5HPYB 4Y2TA 2VAMA 1JZQA 1XRMA 3HCPA 5FB3A 3SYRA 4Q7MB 2ZZNA 1DWPA 3S2EA 4LY0A 1YV9A 3ZHCA 3NWPA 4HNHA 1W2GA 2JLAA 3PKZA 4X63A 2CYAA 5IVIA 1MB4A 1W59A 2BOVA 4PBSA 1XFAA 1Q16A 5BVHA 7ADHA 2DQKA 3FXAA 3AL2A 5TT1A 1SUSA 1UJCA 4CT4B 1R37A 2DB3A 4HT3B 2C1ZA 4GM4A 5CFPA 5EWLA 1K5DA 2DFDA 3MWYW 4R9UC 3KDPA 1NM5A 3ZK7A 1MDBA 3CR8A 4U39A 3CYFA 5E3JA 1JLMA 5CXUA 4AY4A 2GMWA 1KIMA 2R7MA 3EXEB 2PVPA 3JR3A 4KQWA 4TYMA 2QI9F 4H6PA 5JSZA 5TE9A 4PO1A 4C6SA 1T6XA 1RP7A 3TEFA 1YB7A 3BXXA 3LUKA 5JAIA 3AEQB 1WCIA 3LVBA 1TAHA 4MV7A 1IVSA 1IZ9A 4TWRA 2GVZC 2D1QA 2R00A 4PQEA 4Z99A 1Z75A 2FQQA 1VPLA 2CSUA 3AERA 3C8HA 1W4BA 1M1YB 1U2EA 1DJPA 2P40A 3V1YA 1T26A 5BR7A 4GKKB 5BUCA 3DO5A 4WZ6A 1AHPA 4F9EA 3BMQB 1X3LA 1BQEA 3GV0A 3HI6A 3OLQA 4P3NA 2QENA 4F91B 3UMMA 3H9CA 4TKMA 4RHYA 5DO9A 4EFDA 3MAGA 3CT6A 1PS8A 4BNFA 1JLLA 4DSOA 4TVSA 4Y2HA 1VL2A 1M6NA 1Y3BE 3P0JA 1KK2A 4V0KA 5JV5A 4KO3S 2C9BA 2PHZA 1FFAA 2V8OA 4WLUA 4DM4A 3W6PA 5CG1A 2AOTA 4G25A 3RVRA 1JPVA 3OJEA 4RQBA 1E66A 3MG9A 4D81A 4J0IA 5IYZB 1KF0A 4NZNA 3KUKA 1I9GA 3L6RA 1B93A 1RI1A 1TKCA 3VBCA 121PA 3Q9UA 3BKWA 4QJ4A 3HY3A 3QMWA 4GWLA 3IEUA 4C7BA 1Z15A 4AM8A 4DLXA 1ZOPA 1W34A 1YBHA 1NUSA 5B58C 2JCBA 4FDAA 4MMXB 3E22B 5HKOA 4WVFA 1TF7A 2HUNA 3H5AA 4WZAE 4DKXA 1K8YB 3FCOA 1RAGA 3ANYB 4NOMA 3NIWA 3V8VA 2VFAA 4AECA 4QLBA 4CWAA 5AW0A 5IM5A 1AGYA 1E4YA 3T12A 2XKBA 4BO0A 4C2AA 2H1LA 2AFHA 2XYVA 4C0WA 2GD2A 3CY6A 4JFRA 3HCNA 2V74B 3KZKA 3WYAA 1GZ3A 4DDVA 3KJZA 1JMVA 4J1QA 1G2PA 2F3QA 3GJTA 2I7CA 1G20E 3K0FB 4TYPA 1T3HA 3PGXA 3NV7A 5T8KA 5FTNA 2H08A 4DQKA 3LWZA 4KXWA 4B3CA 3CM0A 3H5TA 3X2SA 1NN0A 3I2HA 1ISIA 4A8HA 2V7XA 1GQYA 4ZOLA 2Z98A 1D04A 2XZOA 1BU5A 1FFSA 1PK8A 1V4VA 1MABB 1T8RA 1F2TA 2HCRA 3IBCA 3EGDB 1A27A 1PS9A 2Q1TA 2FWMX 2VP2A 3LLUA 3QKRA 5DK6A 4AF8A 1GDTA 1VI6A 3QX7A 2QOEA 3QPDA 3WMFA 5CITA 2H2GA 4H4EA 4DDUA 2ZB4A 3K31A 5CXXA 1NXWA 1JPJA 5ECWA 4Z8XA 3C5EA 5GY7A 2FE4A 3W8NA 4C6TA 5BSVA 1ZM9A 3G2PA 2JB9A 1MEJA 2PKQP 1ZC3A 4MHTA 2JZOA 1T9GS 2RBGA 3KB1A 4YMTA 3QQPA 5M34A 3WAJA 2C29D 4ZZ0A 4FZJA 2GH1A 4FIZA 3O8CA 4BNXA 2NZYA 4Z9AA 3KQLA 1DAEA 3OQBA 2AXPA 4L0QA 1W87A 2WLTA 1OQAA 4M9RA 4BAGA 3ND6A 3WYDA 1FOEB 3FVTA 5JYCA 5M2QA 3S2YA 2XGGA 1VKRA 4KPGA 1M2OB 3ROZA 2VPIA 4DGSA 1QMPA 3IP5A 5ICFA 5HK8A 2Z6AA 2ACVA 2ZSFA 3VM6A 4YRSA 3I37X 3H9EO 1QNLA 3E61A 5DTRA 2C2XA 2CLOB 3ZLBA 2CFIA 1JX6A 3NBZC 3OWXA 2OCIA 5JNTA 4HLDA 1P3Y1 5EJ5A 3L8MA 1J21A 1VTKA 5T3YA 4JN6B 5AJVB 2Q41A 1MD9A 2HHLA 4MWZA 4Q9IA 1JHXA 3ACCA 1A9ZA 4Y8VA 1D2AA 4MVJE 1Y8RB 2VYQA 3D4OA 2NU9B 2VKQA 3ODPA 1CY2A 4Q3EA 1KO5A 1OR8A 4Q93A 2OV8A 1Z88A 5K3DA 1GNPA 3BJIC 3RFVA 1LNZA 4TLLB 5LL6P 4KKXB 4N8EA 1PV2A 3BA1A 3I5AA 1EBUA 1C8VB 2OK7A 4RCZA 1X80B 3EA5A 2PS9A 1BXGB 5FYDA 3BKXA 4F12A 3N0VA 3EISA 1DUIA 1RD4A 3ND8A 3NIGB 2OCAA 3UHAA 4GOJA 4MR9A 4OCZA 3USES 3KSBC 3E9MA 3A1EA 5FPTA 4CR6A 5KMGA 4OKIA 2X9GA 3HDQA 1NUAA 3OPYA 3V46A 3JQEA 2MYTA 1ZITA 1UIRA 4CXMA 3KE8A 3I9MA 1AZLA 4H27A 4CU5A 3C43A 2HXSA 4V0ME 1FPMA 3RGGA 5L4NA 4O63O 1IMOA 1G3RA 3RG8A 2VDWA 3O1IC 5IMSA 2QM8A 2AN3A 4U7FA 5HIKA 1GZSA 3LLMA 2J6CA 4ENRA 3KRTA 1ZD5A 1OLUA 3I01M 4OVKA 1DE0A 5HZMA 1U1EA 2FI1A 4WNCA 5CAEB 1IHOA 2BMVA 1OTYA 4GPZA 2NN3C 4JR1A 1UZNA 3RVNA 4A6DA 6REQB 1BX1A 4JUIA 4BC0A 4NQZA 5BMVB 2ZR7A 1J8YF 3R3ZA 3ZGZA 4U2CA 3WKEA 5JC8A 4RD6A 1FRZA 2ZYTX 3DHNA 4B3IA 5IJZA 4HLUC 1ZA2A 2AOVA 3ZWNA 1CDDA 4BPRA 2QBYA 1GYQA 2ZTUA 1OIVA 1EFAA 2K7FA 4GDFA 4ENWA 1UR5A 5M29A 1IHUA 5CFOA 4HNTA 3AFIA 1TEVA 2PLWA 1DCTA 1Z8NA 1CZUA 4XX0A 1UPUA 3KYDA 1QH0A 4Q7QA 5A5EA 1MTOA 5T4FA 4WTOA 3AR7A 4NENB 2C4VA 1I8TA 1ZRNA 4TLCA 1YRBA 5JXIA 3BD7A 4U5QA 2C3OA 1X7XA 2ZIXA 5DCUA 1XCOA 3KLMX 1YACA 3P20A 2VBFA 4I3HA 2VRBA 1RVDA 2NQ2C 2TMGA 5KYUB 3HP7A 1K8XB 2QXYA 3NVDA 4QFDA 1IN4A 4AUEA 2DBZA 2YINC 4DMRA 1GTSA 3DHWC 1TAUA 4CBVA 3LUPA 2P6UA 4QTXA 5JXHA 4NYMQ 5A0FA 3IAS6 3MPOA 4MRMA 1XTVA 4BVKA 3L7YA 4L4UA 4OBEA 4R0NA 1C1DB 3KEMA 3EQ7A 3JWJA 3LW7A 5TNXA 1D4AA 4YPFA 2BFCA 3KTFA 3ZWWA 5KYGA 1HSOA 2JJQA 5LQKA 5FA8A 3R9KA 1ZGCA 5KQRA 2CF5A 1A72A 1FMJA 1UKEA 3EULA 1HDIA 1KWKA 4ZZIA 1RM5A 2V96A 1CUIA 2YNMC 1P1JA 2W2LA 3PUVA 4GMFA 3EF3A 2IV3A 2ZWMA 4O08A 1YZFA 4LJRA 3WI7A 1FFCA 1P74A 3FW1A 2DKNA 4IGIA 4LJ5A 2YWFA 1RR6A 2VDRB 2FGKA 5FA5A 1KDYA 2O6LA 2PQMA 4P92A 3BSSA 4UEJA 5C5CA 2Q5QA 1VA5A 1I0IA 3KQTA 4G8DA 5EIBD 4UPDA 4C22A 4L8YA 2RHCA 1M2EA 2UZ1A 5ITZA 5E2AA 2A0WA 2X3FA 3I1FA 2II6A 4AWBA 3LCMA 2DMRA 2OB2A 3ONVA 1DEAA 2W48A 2IV7A 2NV0A 2XNJA 1OW3B 4QARA 1TJ5A 3ETNA 2ID7A 4CKBA 4UXHA 4KW7A 5H0IA 5C4IA 3BJZA 3I9OA 4QUAA 2Y4NA 3DV0A 2FW1A 4BFUA 1Z7YA 2WZDA 5EHIA 3I6YA 4CM8B 4ZI7B 2Q6KA 1EPUA 4J7CA 4IO0A 2E4AA 3TMAA 4WADA 4W8GA 4TZ6A 5AUNB 3OIFA 5AM3A 4EB3A 1A9SA 3H83A 4OX9B 4AMBA 4ZYYA 5LD2B 3A1VA 3KLBA 1GZUA 3HKEB 3WLFA 3PQEA 1DDIA 3PR3A 3ZLTA 2QYTA 1AQYA 2P7HA 1K89A 3FR8A 2NO0A 2YYAA 3G2KA 4IQFA 4KVAA 4PW0A 3WGYA 5BR8B 1MMFB 2UUCB 2AVNA 2AN1A 3QBDA 1S96A 4LYYA 3W8RA 1MAAA 5K3OA 4EFMA 2YUIA 4D74A 3CLUC 1BS1A 4DNXA 4OB8A 2P4SA 1XCJA 4TGLA 5F2EA 4MQUA 2P0AA 1AS0A 1HLFA 2PCJA 1U3TA 1XALA 2ZJFA 3FYUC 3LD9A 4G36A 3VR4H 1C2YA 5CA0F 5MN4A 1ZX1A 1Z22A 2PRYA 3JVIA 1P4HA 4ZOQI 4J1SA 1K88A 4C6RA 4F2DA 3FHTA 1PVOA 1D0SA 5AOCA 1JFVA 3WA6A 3IKMB 1MIHA 1KR2A 2HQSA 2MJLA 1SEVA 4FMPA 4DJFC 5I45A 1N2JA 4GC5A 2O2CA 1ZS9A 2PZFA 5ED4A 4L0DA 4K9PA 2YCBA 2QTAA 2XTMA 3DDCA 4W1SA 1L5HA 3ROPA 3SZRA 3WO1A 3G49A 4B4VA 4CNBA 3GFPA 4NU8X 5B7NA 1UZAA 2YHSA 3BQMB 3Q3CA 3DVLA 1CQXA 1BX3A 2QLLA 3ZE1B 5MGBA 4MQMA 2WF7A 4AF7A 1GPUA 2YC2C 3CLRD 3NYWA 4W9NA 4LXUA 1JG1A 3DXXA 4YT4A 4LOLA 3HVHA 3ZHSA 4B74A 4UTPA 5KEIA 4ABTA 2ATCA 3NS7A 1GAXA 2EKDA 4RXMA 1CV2A 5JPIA 3QWAA 3JTEA 2Z09A 4UQOA 3RC2A 4Q18A 1FNNA 1VG0B 1HL7A 1MO2A 3IJPA 4PSCA 4XZ3A 5CIQA 1IJKA 4YPOA 5L3VA 1OT5A 4OLBA 3SZMA 4M8SA 2AK3A 3DEHA 2XUJA 3AHHA 1OOEA 2NUTB 5KZMB 4GYWA 3RDPA 5FLXA 4U7TB 4IF4A 1F8FA 3E4CA 1OLSB 4B4OA 4KNWA 3ND5A 2Z83A 3TOSA 4KK3A 1YU9A 1BH6A 3QITA 2PPVA 3I9KA 5AR1A 1H4VB 1KNXA 2FFRA 3GJ6A 4IAOA 4BGDA 1QTRA 3OE7A 1WQ3A 1X7DA 1Z2PX 1ZC4A 5FT9A 3HBAA 2AIRA 4IDBA 4LWZA 1NG1A 2BI7A 4NJEB 3RS5A 3THXB 2J07A 5JYDA 3DZKA 3THOA 3JTMA 1C41A 5DT2A 2JHPA 4HZIA 3A25A 4GHWA 1PFKA 2H4WA 3RIHA 1HY3A 2PXAA 2GN8A 4PZ0A 3F4BA 3Q3GE 1RKXA 2PA3A 2BELA 2PKYX 2WF6A 1CNFA 3CRQA 2B5VA 1LQTA 1XZPA 3A3NA 2ZYIA 3RVMA 3AB7A 1IN5A 5A4KA 3CEHA 1OH8A 4QWMA 2A8YA 2NXWA 2GSWA 5LBIA 4HFMA 1Z2NX 2W2KA 2WUFA 3COSA 1W6UA 2BHSA 4AZ3B 2Q07A 4IIJB 4N8DA 4QOGA 4EVIA 1A0OA 3HO8A 2QIOA 1BGWA 3SCZA 2J4CA 2R7KA 4W9RA 1KU0A 2AWNA 2TMDA 4JI0B 2A9QA 2H11A 1MC4A 3LLSA 1Q1QA 2ATVA 3NW9A 2F48A 2P6PA 2V1XA 4IXNA 5K9ZA 1QOQB 3AGPA 5EESA 5MGNA 1G1AA 4JR2A 1SBNE 3TLXA 1W49A 4K6MA 4JI8B 2AG8A 1MOSA 1MV5A 2J3EA 2PD4A 1T2DA 2FSVC 3KUXA 3L46A 4LJAA 1FX0A 4MTCA 1C9EA 1NY6A 3DEAA 4NHOA 3N07A 4R8SA 5IRCD 3A6DA 4PC6A 2PZAA 2WE8A 3VNUA 5E4FA 3FTCA 4PX2A 4LE0A 4QA9A 3QIAA 5AM5A 4Z8YA 3GLGA 2ZUEA 4EGSA 1S89A 3OT4A 1FS5A 3NTVA 1OGYA 4DC1A 2RI0A 4ZT6A 1DADA 3ABQB 1WMDA 4PYJA 1OFIA 1SU8A 2FOXA 3QOFA 4HO1X 4I4IA 2QAGA 2VO1A 1DAPA 4I9FA 3J80A 4LYFA 5LP6C 2F1RA 1GP2A 1A50B 1M8KA 3DL7A 5ALHA 3T5MA 2J48A 1GV1A 3WWCA 3QLEA 4YCSA 3EVGA 4JLVA 2P6MA 2WM9B 1MT3A 1ZR2A 4FEAA 3INYA 1NVWQ 3DFKA 4RSGA 1CS0A 2MCFA 3TCXB 1AHHA 2D5LA 4YC7A 1DTSA 5FFNA 2W0SA 4H16A 1UODA 4L5AA 2C78A 3HCRA 3M6UA 4GX0A 2FZ4A 2WUEA 1PYOA 1G8MA 2FX2A 4PO8A 1RRKA 1P6XA 1FP7A 1NRIA 5EWJA 3ST7A 3NAZA 3TTYA 5EMNA 1PL0A 3FTEA 4IX1A 3ESBA 1D03A 3PCTA 4HRVA 1PU2A 1M0WA 1XQYA 5F76A 1Z3CA 3PQDA 3ZWDA 3GWGA 4GGOA 1RYBA 4R2KA 4FGLA 2A0KA 3GAFA 1QK5A 1CNEA 3E9QA 1VDZA 4CLRB 3BF8A 3IIMA 3O3OB 4PX3A 5HXAA 2F4VB 3OBBA 1D8TA 1XCGB 3AW8A 5TLSA 2H57A 4UUQA 3EVBA 4REOA 4G63A 4BQPA 3D6NB 2INGX 1WKCA 3CPJB 1FY2A 1QMGA 4F85A 4F4FA 1CHNA 1P9OA 4H1HA 3RJ5A 4TZ0A 3L92A 1W6RA 1J00A 1JEEA 2IFTA 2PKQO 4IJKA 2Z95A 5TMEA 3ZHRA 4D4LA 3BRCA 3CUSA 4BQNA 2ZVDA 3OJLA 4RA6B 5ALPA 3SX0A 3L0OA 4L16A 5IVPA 3E81A 5JIBA 1II8B 2W6QA 2ZR9A 3K1ZA 1XOIA 5D3QA 4KFTA 4CHTA 4O1IA 5F9MA 4EGJA 3Q7QA 3T9AA 3OQHA 3VJMA 3L3BA 4BLRA 4F71A 2CHEA 3UANA 2QVCA 3EH1A 4JJAA 1UMBA 4PTLA 3ZK8A 1FJXA 4IWYA 4MQFA 3OE5A 4L9SA 4QLOA 4WZBA 4YHBA 4Q9NA 1A4XA 4ZQEA 4TL9A 5GONA 3N9IA 4EM6A 3K9FC 1CE8A 3DKKA 4I19A 1J9ZA 3FDXA 1WS6A 3KJQA 4V03A 2ERYA 4A10A 1RVV1 4FEGA 5F3RA 2NPFA 4EIWA 4KLCA 1E1MA 2R1VB 4KP7A 3PT5A 3SC3A 3TSOA 4KFUA 2PSSA 4D0RA 1HYGA 1R5JA 3AKEA 1L5GB 4TN5A 3W8FA 1BHQ1 3NVMB 4AK9A 1E3TA 1PX2A 2YCLA 4GU5A 1WXWA 4Y7CA 3H2SA 5GJBA 2OV4A 5E6UA 4S3MA 1BHJA 1QYCA 3BB3A 1P5FA 3DLIA 3KG2A 4W1RA 5CEJA 4KK4A 5DXFA 4U3JB 1PJ8A 3AW9A 1DCFA 4GQAA 3PEYA 1ZKMA 3PNSA 4QD3A 4RKWA 3LT2A 2VTBB 3OHPA 5J4VA 4KQ2A 5FTWA 3ORYA 3JD3A 3DJFA 3LYAA 3B5IA 4GKAA 5HX7A 1P0FA 1EGAA 1TA9A 4L15A 1OKKD 3KTAA 4P7JA 9ATCA 1YD7A 4YUVA 2E21A 3B20A 3EZFA 3OZVA 1SVWA 1COWD 3IT2A 4JY7A 3U4IA 1S8FA 3TQIA 1FUUA 1FQKA 4YALA 4DUPA 5CB8A 3EMVA 3GLFB 4M6WA 3JQRA 4KMRA 3W9UA 3E8MA 2JCYA 1UBCA 4HDSB 1KSHA 3JVDA 4QATA 2JHCA 5EFZA 3N1UA 3TIXB 1M7BA 4EENA 1T2EA 3BMOB 4J1TC 1QNFA 1WU8A 3FPHA 4J7UA 2J9GA 1A96A 1J8FA 3PHGA 4XRRA 4HMPA 1TZKA 4IH9A 1BFUA 1NXTA 2H1CA 3UAWA 4CM4B 4TSFA 1W52X 5DLEA 3GJRA 3DJYA 4R9RA 1XMPA 4O5OA 5HP4A 2I9PA 3UJ7A 5K8CA 1C4WA 4L57A 4TT3A 3GDGA 3KT6A 2VSXA 2BMDA 1UCFA 2JI6A 2WZBA 2O48X 3CRW1 5J1TB 3SKYA 5GZ6A 1ZVKA 2RGYA 4FNMA 1V0JA 3HB7A 3UV3A 1UDCA 3MK31 1HDGO 2QROA 1LBHA 4KXYA 2X3UA 4Z9FA 4BGVA 1FYDA 2OP1A 2HADA 2OD2A 4LNAA 3D0QA 3G8AA 4MUHA 4IMJB 1N2OA 4UDNA 1Y6QA 4RGQA 3CX7A 1WUJS 3VDQA 3UPUA 3MTIA 1M0TA 1ITZA 2ODEA 2VUSA 2CK3A 2YMMA 3D9QX 3E82A 4K6CA 5TPZA 4EJSB 4GMDA 3S8EA 1NXPA 5I9LA 4FX2A 2F9MA 1K0UA 3E3MA 1KZGB 2GZAA 3LZCA 4WEOA 4MVJM 2VHTA 4M22A 1JAHA 3LLVA 1UFQA 4HQ6A 3AEUB 1I2AA 5AKLA 2IYUA 3K0CA 3NWJA 1U8XX 4PRLA 4CF7A 3A1UA 2FW7A 1CUJA 3KZ1E 1U1IA 4NAUA 4ZCQA 3UTCA 4CQMD 3L06A 3K9BA 4WCFB 1Z35A 1TCVA 3KLNA 2Z8XA 3RJMA 2O8FA 3WLMA 4E13A 3GRAA 4CETA 4LOHA 3E5MA 2O8VA 2UVPA 3JXEA 1C30A 3WDKA 5KQMA 5CPFA 3M4ZA 1W85A 5HEKA 1Z4OA 5CXQA 3FOCA 3R7AA 3FBGA 1CHDA 1YCDA 3HKDB 3JQ7B 2WDPA 3T54A 1MF7A 2VUIB 4A0QA 1Z2CA 2X5NA 3D5TA 4AXBA 4UUNA 3QFCA 1F8UA 1LBSA 4YQEA 4EHJA 3TRJA 4C4AA 4NYMR 1IY1A 1I5EA 4RVGA 4D0LB 1N3YA 2VF2A 3CLSD 3CZMA 1DCKA 1U3FA 3OZXA 3QU4A 1CUXA 3AT1A 3D6HA 5LIPA 4P83A 3IP7A 3RUPA 3VPBA 2Y77A 3SK0A 3QXHA 1MB3A 3IXMA 3JQDA 4W63A 4LXHA 1RAIA 3SZLA 2VJKA 3EQ8A 2OCBA 4NSNA 1EG2A 1FZQA 1QK4A 2G8NA 1QZZA 1A8PA 2BKEA 4WCVA 4ZVOA 2IKQA 1JEDA 5JNWA 2YN4A 2O7VA 3R9XB 1SXQA 5H7XA 3HM9A 4WZAB 5B30A 1UQTA 2BBOA 1FMCA 3PFIA 4H35A 1V4BA 2IOFK 4QXPA 4X9XA 4IL5A 4XWTA 4Y98A 5F1PA 2NSJA 3M8KA 4J2OA 2G70A 3LECA 1IBSA 4JNKA 4M1TA 2C2BA 1JEJA 3O38A 4IOLA 4RBNA 5DM0A 3WISA 4D42A 1XYYA 1Z5NA 5CVCA 2PU7A 3CWCA 2OKCA 3CGGA 3IUNA 3V6LA 5LDDC 1FSGA 5BWLA 1S4MA 1A9PA 2FUG1 2PX3A 3IQIX 1SOWA 4OPMA 1G20B 5EZYA 4OXNA 5LLSA 5BWNA 1I1HA 2XDWA 5HF8A 5IH3A 4Y2JA 5ER9A 2PX6A 3KVRA 3ZE0B 1KDRA 3HZHA 1WXIA 1JDTA 3M9WA 4KQ6A 5AHKA 1LRKA 4F04A 4KSBA 3W3ZB 3SHTA 4PG7A 3AQIA 5BVHB 3FLAA 2HJHA 2R6HA 1EVEA 4EO4A 4OHWA 4YJGA 4Z0NA 1V3UA 4OQQA 1ZNWA 3DUWA 2O05A 2QUKA 3CZQA 1EX1A 4NU5A 2HIHA 3A31A 4UM7A 5FAXA 4AZSA 1HURA 2ERXA 4LW8A 5AVUA 3RTAA 3PR1A 4PZ9A 4DLVA 3JPWA 2IYAA 1XQ6A 2D74A 2FRVA 2GXUA 1C9NA 2WPNA 2G88A 4PY2A 4XSGA 2XITA 5BW6B 2WA1A 5H16A 3SXJA 1HC7A 3DZ8A 2HR1A 3DGEC 2O0HA 2WB4A 3ICCA 3QUTA 3T7RA 3UK7A 1W4AA 2OZLB 4IG4A 4DANA 1GTMA 3I72A 1TKAA 4M49A 4EVQA 4YRIA 3CPSA 1IUKA 2RG1A 1Y48E 1JEQA 1ZW6A 1D09A 4XWGA 2YJ3A 2AFVA 2JLCA 3RHFA 3RK0A 4ZICA 4PYOA 3RKUA 1V3QE 1OAKA 2QTZA 2IEGA 3VHXB 2FP4B 5JNVA 1PF7E 3X2FA 2EKLA 5JCOA 3GH3A 3LDUA 1L8QA 3Q11A 4LS3A 3STYA 3DC2A 4H08A 1NW3A 2VRWA 2AH5A 3MT8A 4L4SA 3S7ZA 1QO0A 5LC1A 3UJPA 2RE8A 4M1ZA 4CIYA 2M9MA 4HRXA 4HATA 4C3OB 1L6RA 4AQ7A 3Q9SA 5KPJA 3FMGA 4Y9DA 4QECA 1LVGA 2UYYA 3ELYA 1IM2A 3E58A 2C9ZA 4MVJH 4PHCA 3KUUA 4AJIA 3GPLA 1MO3A 3EDCA 4GOXA 3J81A 3DEZA 1N9GA 1YK0A 2HM7A 2C2WA 4QO8A 4EKIA 1JLRA 2IHUA 3NJRA 1ZN9A 4HUTA 1U80A 2YC4C 2J3IA 3A14A 3K1TA 3EA0A 2ACEA 3D6FA 4MW9A 1M83A 2Q3HA 3VAZA 1LD3A 4G9EA 3AVYA 4PIVA 1IAVA 1V5EA 4GBED 1VGQA 2EP7A 5B1DA 1FPQA 4HDQB 4LX0A 4ZDIA 4J3JA 3VVCA 1WHSB 5A0VA 1CLEA 3FE2A 1T5OA 3VU0A 4ZV7A 2F3SA 1AQNA 2I2BA 2GZHA 4TPKA 4DMUB 2FSPA 1ZSYA 3TKAA 4K5QA 4XAQA 1T0UA 2IS4A 3AR2A 2ZFUA 1ILWA 3SDZA 1VCMA 1A2OA 1Y5LA 2HWXA 2JFUA 2WFLA 3T3GA 4B82A 2IITA 1H3EA 1GRQA 1EGHA 5ALGA 3U16A 4G8BA 2VWPA 4C05A 2QL9A 2P2YA 3LC1O 3NZEA 3LX5A 1YJQA 2QTRA 3OFJA 4AY3A 2PKXA 3O91A 2W6NA 4QJ3A 1U2DC 4ENPA 4H59A 2P6OA 1D2EA 5CDYA 3AOEC 3QHQA 3J7TA 1SY7A 4JFAA 3UHPA 4DT1B 4I4TF 3RW9A 1ZRSA 2BGTA 4DPKA 5TC4A 2A5DA 1HQDA 5L51A 4EATA 5KOJB 3HNPA 3CEJA 1KU6A 4QHSA 3EMBA 1DRWA 2AC2A 5I8PA 3H0KA 4I8IA 4C87A 1YIOA 3AZPA 3M6IA 4ZARA 1P6QA 1XZAA 1Z4LA 4BNKA 4Q00A 5JR3A 4C6TB 3GOQA 1P9WA 3C3CA 3TNLA 2F1HA 1LBTA 5LYYA 3TRIA 4OUDB 1CUFA 1ZINA 2WHEA 3NBXX 5KSPA 2G1PA 3UF0A 3QE9Y 1F5NA 4KH0A 3R6TA 1PZNA 4KR2A 1VKHA 2WIKA 4PQFA 4OSPA 4IKOA 2BFDA 3FRHA 3CF4G 2RGXA 4H7EA 3CLVA 5LKAA 4QDOA 2DZDA 4I4LA 4R0MA 4HZUB 4B8ZA 1NL3A 2FEMA 4KR6A 1YL7A 3T34A 1GIAA 1ZI8A 3W5DA 1ND6A 3SJZA 4QU5A 2IHVA 2BMEA 2GEBA 1YMQA 3GJ0A 1TTPB 3LC0A 4WNAA 3TQQA 1MPTA 4W9MC 2Z6QA 1RHUA 3IQXA 2EX4A 1JQ5A 1QHGA 3FF4A 4HRYA 4YRTA 1ST3A 2ZB7A 4TWIA 4I5FA 2V4ZA 1JS1X 3OZ7A 4ZZ3A 3PCXA 1ZNXA 5DU2A 3EGIA 3TUJC 1PX0A 2EFGA 4NG4A 1B3BA 3IKVA 3GUHA 5LXTF 1YB1A 4C14A 2XVZA 1G7SA 2IHNA 2P5SA 1XPUA 1YZNA 4ZREA 3UK0A 3D8TA 4UAUA 1BEEA 1C0IA 1ZVQA 4OFZA 4ASUD 4X66B 1N77A 4EYGA 2IDMA 2NUPA 3QU2A 2HCBA 2H2FA 2J6BA 2GTPA 1A5SB 2R6AA 2VYFA 4P9NA 4QDKA 3IB6A 4PNPA 1IXKA 1VSTA 1T43A 2C77A 2HNKA 5E8JA 5FUQA 4TS1A 4MR9B 2XD4A 1A2KC 1E2PA 1Q1ZA 1ID1A 2Q4BA 1ZQ1A 2Q5CA 3P4XA 5BQ3A 1A9XA 2UYGA 3BGIA 5DI9A 3T5DA 3QK7A 4Q21A 4M7OA 2W43A 1XZNA 2OMKA 2YFKA 1HZZC 5C8YB 4B83A 1SA0A 4G85A 4PLGA 4JCOA 5J43A 5E1BA 2AW5A 3D64A 3R6GA 4N9QA 2R84A 4FLEA 4ALIA 3HFSA 5IW8A 5BUSA 4YAWA 2J9FB 2CKDA 1JFLA 4KIWA 2IYLD 2PA0A 1T34A 1TT7A 3LKVA 1W35A 4HNRA 4UBKA 5HCUA 3PD7A 3ZY6A 3D6VA 3OD5A 1ULHA 3O3NB 4IUBS 3T35A 4MYHA 5CVUA 4Z1MA 2XQGA 3WIOA 3CN9A 2CXNA 2QMHA 3PC8C 4WJLA 1TD9A 1O96B 4F5WA 3JQBC 3KDSE 2CV1A 3RODA 1Y5MA 1YQGA 4PYQA 1KRWA 4ER3A 1MXHA 3NC1C 2ZJ1A 1PQYA 2ZRQA 4PYMA 4ZPJA 2XT9A 4S05A 1OUMA 4G0OA 3GDOA 1IEXA 1XVAA 2WT9A 3DR5A 3EODA 4N8SA 4UDYX 2VPWA 3UGKA 4M0CA 2HMWA 4L08A 3U17A 1N6RA 2RHMA 3CXUA 4D43A 3ICQB 1X9HA 3L4JA 1Y4AE 2BE9A 2R48A 3B9QA 1AXEA 4PHGA 4L02A 2XF8A 3WNCA 3HLKA 1TUIA 2Z2YA 1FTYA 2AOUA 4QICA 4ZQGA 3TLGB 3TZ6A 3L1IA 5L3SA 4TRJA 1SQ6A 5HIIA 4EGAA 4F8JA 2AJDA 2YV4A 1EJ6A 3SJAA 2H65A 2ZIXB 4E5MA 3T7KA 1F5SA 4P81A 3LXXA 3GWZA 4M7WA 5CCXA 3CB2A 1LSOA 2WFZA 4IFEA 4H7JA 3F7OA 1MOQA 1XF1A 2O3QA 3AHJA 3DVRX 3FCEA 5KNCD 3BWYA 1ODJA 1T1SA 3KEGA 3URMA 1H8ED 2FH5B 4EG4A 2SKEA 5MFPA 5EQFA 2CNLA 2XNKA 2WWHA 1WCXA 5LIRA 4B6EA 4Q4AA 4BVAA 5TT0A 1DVRA 1XVTA 3UB2A 1RT9A 2QVBA 4PZDA 3UXEA 1Y4ZA 2XRFA 3JQAB 4PR3A 4A8TA 4KO4S 3RSQA 4E07A 3LRXA 4JZYA 1IUPA 4XSVA 4QRHA 4MHSA 3U4MA 3V33A 1YRLA 2X8JA 4D9IA 5G40A 5T41A 2B1GA 2G77B 2VRCD 3WY9A 1Q95A 3IQDB 3F71A 1LBEA 5IBQA 4B17A 3D4LA 1FDWA 2VF8A 3EZGA 3Q3VA 5TXGA 3WTBA 4DXAA 5KJCA 2O8CA 2GZRA 1FTWA 1JAIA 2JF0A 3A6LA 3A06A 5AI8A 4PRKA 4ZAWA 3TD2A 3TL6A 3T61A 1BWQA 3M5PA 1PEYA 3CX8A 4ZAXA 1MEOA 3U13A 2PLRA 3VDNB 3L0CA 5A5FA 1SQ5A 5IABA 5ITZB 4HSEA 3M0EA 4KTVE 1QYRA 3ETCA 3BZWA 4R98A 5CP8A 3DMHA 2QR5A 2DTDA 1F48A 3L7AA 4QEZA 5K8TA 1G8SA 1CY8A 2CY0A 4IXTA 1FTSA 2XA1A 5THXA 3H2YA 3AV0B 1GU7A 3GLUA 4G89A 4OLHA 5AW7A 3FPFA 1CP3A 1OI2A 1XHFA 1T36B 3L6UA 2R97A 5EUBA 2OB1A 3Q7RA 4NU0A 3OECA 4EDHA 4O4HA 4JVNA 5COAA 2H9IA 4MQLA 1AHIA 4NAVA 3K4PA 4TKUA 3R7LA 1W1UA 1J42A 2XJ9A 3BWCA 1L7PA 1KDVA 4C0AC 2JBHA 3AXTA 3DUFA 1T0IA 3AEXA 1EUDA 3SQMA 3C7DB 3BHNA 2V6JA 1D6JA 2ENWA 3RIGA 4BIIA 3U3RA 3N0XA 1JPUA 3AUKA 4DV1B 1WA5A 3E48A 3L49A 4F3RA 1JIJA 1GSHA 2FRXA 2QV7A 1M10A 4ZRNA 3ZCXA 4URVR 1KOGA 1NUTA 1PUIA 2BHRA 2L0XA 5A3VA 3HSKA 1J39A 1UXOA 1O4VA 1SU6A 1ZP6A 4K88A 3EIQA 4OMFG 2JHGA 3NDJA 4W5HA 3B52X 4EUSA 2BVNA 3H3FA 3LBAA 3ANSA 4X20B 3U62A 4B5LA 4LV5B 4B35A 1ANKA 2ZUFA 3KXKA 1Q17A 3KZMA 1C9DB 3HS3A 3WHPA 2ZRCA 5EQDA 2YFYA 3FYCA 4D0GA 2GK3A 2IGTA 2OC9A 3SE0A 3WV4A 2WUWE 4KBGA 4AXXA 1UINA 1Q0LA 3CIFA 4Y2SA 3TB6A 3ZD9A 5KU7A 3NTQA 4EMTA 1YTUA 1KJZA 4OK3A 2IYNA 4PXSA 3OOYA 5A6SA 2UXCB 1W581 1LB1B 3FOFC 1WJGA 3Q3EA 3IE0A 2EEZA 3HI4A 1YNOA 3MBKA 4NEGA 4PXAA 1DQYA 3X1WA 1Q6ZA 1NONA 2OEPA 3NNDA 3WAGA 3VDMA 1AF4A 3HB9A 3L7MA 3OEWA 3UWPA 3R3XA 5FWDA 2AB0A 3Q2IA 1XWWA 4GSYA 4TUYB 4WY2A 4YJFB 3WZMA 1YCFA 1PWXA 3B6MA 1VIDA 2IIBA 2J9YB 3KR2A 3ECAA 3VR4D 4IDCA 4RNDB 3OY7A 5BW4A 4QYIA 5FUWA 2Q9UA 1FBNA 2FR8C 5A02A 4MKFA 1N2SA 4RTLA 2X2FA 2PYIA 3IAXA 4YASA 3FZYA 3E9RA 2GUGA 4MS3B 4UEQA 1UL1X 4GZ6A 1WMBA 4EQ6A 2JAXA 2X23A 4G5OA 3FWYA 1KWGA 1MG5A 5LSAA 2P65A 4CEIB 3HEMA 1QUFA 3DMYA 2B35A 2RIPA 4MR7B 2LKCA 5FWYB 1WPRA 1ZK0A 3GA0A 4IR7A 1U7PA 5ALLA 1GNSA 1KAMA 5K0FA 3D31A 2RHGB 1V7QA 3ZWYA 3VC2A 3AI1A 5F2NA 1KOFA 4KDEA 3HE3A 5LWHA 1XMSA 3SQOA 1Z3IX 1USIA 4YI5A 4Y18A 1XQVA 2TS1A 3RAPR 2CLIB 1XTRA 3ONFA 1CUUA 4MVYA 4OP3A 2H4XA 4ER7A 4X1YA 1QU2A 1VJGA 3QOXA 2B34A 1KQNA 3FPEA 1CB7A 4HH1A 3QPBA 4MUXA 4QUHA 3K9HA 1N5RA 4Q15A 1R64A 4C21A 3L8HA 5BV7A 2ST1A 3DAPA 3DOCA 1PJAA 3OKCA 4ZCSA 2CXHA 3WIBA 5I01A 2CFRA 3QVXA 2ZK7A 2HWUA 3PICA 3Q8WA 1DIHA 1TRKA 1UWLA 3PUXA 4N7RA 3OTQA 4BQFA 3MMXA 2PBFA 5KAPA 1R27A 3WMWA 4KFCA 4D3YA 1C1YA 2YX1A 4OG2A 1A95A 3RQSA 2ZTHA 3P97A 1Y8ZA 4QGGA 4MEJA 1LTKA 4X84A 1NJ8A 3GUZA 2CXTA 4QFCA 2W8ZA 3O8OB 1ZR4A 2IEZA 2NNLD 2C7BA 2VSYA 1Y42X 1NHGA 2HHJA 3AR6A 4MYCA 4QAQA 2GO1A 1D4ZA 2O57A 4BCCA 2Q1XA 4DYHA 1N5LA 5BSFA 2GAAA 3EF0A 3ESZA 2OQRA 3IHTA 1S4QA 4FK8A 4MQ5A 3T5GA 1QHFA 3AXSA 4YJ2A 3WMGA 2YV3A 3WL4A 2VT7A 1KRXA 1DRUA 1L1EA 1JXMA 1QCDA 3UMVA 1FRFS 5KX5A 3I2KA 3EEYA 2VPYA 3WLEA 1MX3A 3OA2A 1HNNA 4FI3F 4GS5A 3ABIA 3VA7A 2G5GX 2R8ZA 1P31A 4IHKA 2Z56A 2B6HA 3WX0A 2JS7A 2QP3A 3M2TA 2BFBB 2AXNA 4BO4A 3IEPA 4NARA 2OXCA 1HE1C 2R62A 4OXIA 2VDOB 5B2ZA 1YI0A 4B4WA 1U2ZA 1DRJA 4KIFA 1F14A 5CLJA 2P91A 3A27A 4NY1A 1NYRA 3CHYA 1AMOA 3B9BA 3EPJA 4S1OA 2Y1DA 8ABPA 4JLKA 1PAUA 1X8KA 3PXGA 4XSHA 4WK2B 3AEKA 2BWJA 1IN1A 1Q0PA 2YIDA 4NMWA 3DOIA 5EWJB 5TR9A 3WQRA 5BOSA 4J3NA 1MW9X 1DQSA 3F3YA 5HJEA 4GI3A 4M46A 3EQ6A 4FFPA 4B6RA 1IBMB 1KK3A 1D2GA 2UV8A 3T8YA 5JE8A 4NP6A 3EE6A 4CKZA 5ITVA 2ZZKA 3IQZA 4N65A 4NMMA 4X1IB 4XGQA 4F6RA 5I6DA 2V3WA 2O4UX 3DMRA 4KIUA 3FSGD 3PC3A 4B40A 4M9QA 4BLSA 3ROGA 5LQDA 3OE4A 1EESA 4ND6A 3SKXA 3O83A 4JBHA 4G86A 5TS3A 3GCGA 1H69A 3SU8A 1DAMA 5KDLA 4BMDA 3H5RA 3RPEA 5LZ5A 3M9LA 5FI3A 4TTTS 3HB5X 1KQGA 3LUAA 1SCUB 2QKYA 3T52A 4L6CA 1LJLA 1U9IC 2IXFA 2WY2D 4EJMA 2ONJA 3FLEA 4E31A 4UU7A 1TJPB 3TL2A 4DIMA 4N5IX 2VWQA 4ME6A 5GADl 1BQ4A 1YXMA 3QV2A 5DGCA 3V1KA 2NSHA 3TKLA 3QBJA 4BP3A 4YJHA 5GMOA 3ZK9A 1KAOA 3LBYA 1J2RA 4C2BA 2YV5A 5IUNC 2IE0A 4DWJA 2XAAA 3IPAA 1VE3A 4OIMA 5DHQA 3REQA 3W9SA 1QRDA 3TLKA 2VA9A 4GLLA 5I7FA 3B3GA 1JIVA 1J5PA 4EHDA 1H1TA 1E1DA 3WO0A 3ZY3A 4WCDA 1AQ6A 2P3LA 1BWPA 2XA2A 5HW0A 4RTNA 5K4HA 3AR9A 2ZTMA 2HU7A 1B6RA 1VI5A 4EZBA 3VSDA 4OD0A 3HJNA 1YU6A 5ADVA 2NVWA 4ZVNA 3G82C 5AJXA 1DXOA 3D7MA 1G0NA 2ZYDA 4F1KA 1SC6A 4ZEMA 1QZ3A 1NMYA 3GFFA 3TSYA 4OP2A 4AVYA 4D9HA 1Q50A 3VHRA 5J1SB 3NPMA 4YJKA 2D5IA 3BHIA 3ZVRA 4WKPA 1LS6A 6PFKA 1XA3A 1UT8A 1XEWX 3LUHA 1WEHA 1X0XA 1IEWA 3NO4A 3RUCA 3SIWA 3U31A 1IXZA 3VR6A 3MJFA 4R16A 2Y9PB 1J8VA 4HLUA 1G3IA 1NMSA 4YLEA 1VL8A 3G0IA 3KS9A 2V5VA 2OILA 4QU0A 1KNQA 1MAUA 1UPFA 4DUGA 3GO4A 4PZEA 2UAGA 4D26A 3V7WA 2OM2A 4IOMA 3E53A 4XD2A 5AXDA 2MSKA 3U9SA 1QK3A 4LECA 3TDNA 4ZJZA 3DLCA 5KBYA 1U3UA 2F59A 3UW3A 4AKIA 3GLHA 1NW7A 3UJ3X 3B1YA 3QU9A 3OT5A 5BT8A 3NGMA 1D9XA 1KIFA 2QLBA 2XKJE 3JCZA 2ZT7A 1GG8A 1ZMRA 3LOUA 4D4JA 4ZCMA 1E1RA 2ZB3A 4KGDA 2AR0A 1H22A 4BN5A 3AYZB 1WXEA 2DPHA 1T3LA 3EZ9A 3PUJA 3WL7A 2BF4A 1N4AA 2J32A 4R1SA 1YFJA 4MPJA 4G0XA 4WBSA 1QP4A 4YUWA 1BEUB 1A8HA 3FG9A 4GPAA 2OAP1 4A27A 4OTZA 3HBNA 1TMOA 5DW0A 5J63A 2E5FA 1GZVA 2AFIE 3U81A 2BAGA 5JISA 3BWBA 4IGEA 1W8DA 5TGTA 5F1KA 1E9DA 3F3KA 4V3CA 3S55A 4MQEA 2GNAA 3VDXA 4C4PA 1JR3E 1SUWA 3EVCA 2XMQA 3U40A 1MOZA 1XK6A 4X71A 2YNMA 4YPVA 1A9TA 3K1YA 1K3UB 5IK2D 4YJ3B 4AMZA 5ELXA 2EX0A 2HJ9A 4E1VA 2IE8A 4R1OA 3DYVA 2WWWA 3ACDA 2VJLA 1USKA 1G5TA 3ORRA 4CNQA 1UDXA 2NSLA 1HE8B 4FFBB 4XD7A 3K71B 2PU5A 2BFWA 4OIFA 2HSEA 4IDDA 1RIFA 1SHKA 5CCDA 3Q8KA 2ZDQA 4RHEA 4RZSA 4TN1A 5D5QA 1WQ1R 4EPXA 3R7WB 1I1QB 4J43A 2GD6A 3AM5A 1NKTA 3SS9X 4N5LA 2OHIA 4DRXB 4D4GA 1NW5A 1XEXB 2O8FB 2F6RA 5DN6D 3O3MB 1WAMA 1H4QA 1EP3B 2I2XB 1DHRA 5PNTA 2I5PO 3OZRA 5JVDA 1YE5A 3TRKA 1LF0A 5JQGF 4FDTA 2OGWA 2P9GA 4XUEA 4D4KA 1TCCA 5LQJA 1DS6A 4TZKA 2B7CA 2UZ0A 2AI1A 2WMYA 1WSBA 3W6UA 2OLEA 5DNYB 2ZRMA 3QTBA 4J2HA 2LVBA 4P34A 3UK6A 1PG2A 3HXKA 5B36A 4KAFA 4KXQA 3GZJA 2PJRA 3KD3A 4I81A 4PSUA 3IQFA 5J2TA 3LSTA 2O8DB 1NVXQ 1A77A 5JZOA 5K8UA 4PYLA 3KPWA 1L4BA 3U4QA 4MO9A 1VE6A 2Z57A 3E35A 5ALQA 3X2EA 2X8WA 3KOXA 4O2BA 2Y05A 1IY8A 1VHTA 1K2VN 1K4KA 5EMJA 5LJIA 4II2A 1ULAA 2Q3DA 3FYUA 2B1IA 3LNTA 4QVKA 1L9KA 2MYPA 1OV4A 1P19A 2YXDA 1G4AE 3M3HA 5ENDA 3RIYA 1RFLA 1NRWA 1SG9A 5GV7A 5HRUA 2JA2A 2ZTSA 4NYIQ 2WILA 4HMOA 4BLTA 1FQOA 5EUCA 4YMLA 4JL5A 1PNVA 3IAS1 3HBLA 1SCQA 1HT3A 1SUBA 2B61A 4IHJA 4BNJA 3TLJA 5KJ1A 2Q4EA 1EFPA 2WHPA 4Q3LA 3FNQA 3A32A 1NBWB 3INGA 3LHFA 4KZKA 3WQQA 2OV3A 1EQUA 3KQQA 1H05A 1KQOA 4REQB 1F7UA 4FE7A 3HB0A 3HY4A 2ZAOA 2C4KA 2QLTA 1KDZA 1V3TA 1KI8A 1V48A 3CUYA 1GKUB 3DO8A 1XDGA 4V0MA 1ONPA 1Z2EA 1G7CA 2PRKA 2GOYA 1E3QA 1U8EA 3OIUA 1XTBA 4R54A 4F2GA 4YUYA 1XD2B 5IXSA 1TTTA 1HFWA 3V4FA 2ZRIA 5K0NA 4OFXA 3VMFA 5JS8A 3NKLA 1JQAA 1XK7A 3JQ8B 4HUQA 2NTVA 2NVUA 3KLOA 4JSRA 4X95A 4QTTB 4D8VA 1N0IA 3DAYA 2DSNA 3E9DA 2FVYA 3LT1A 4E70A 1CNMA 2Q2VA 1LSJA 5K45A 1P4JA 3A6HA 3DBLB 1AGPA 1SH7A 3A2KA 3IPXA 4WINA 4PAWA 5NULA 4KRGA 4CDMA 4NH0A 4EB6A 3HXTA 1JTEA 4IVQA 2ZAYA 3QSYA 1PQWA 3IAFA 1GUYA 3ZD6A 2DVMA 2IEIA 4EPWA 3P9YA 4EQZA 1QHYA 3WFJA 4M4SA 1R3UA 4NCHA 1NX6A 3BDAA 3EVFA 3U7QB 4K7JA 2HMUA 2QRVA 2ZB8A 1R4MB 1N5MA 4G65A 1P2SA 4J94A 3U7JA 3K0AA 5E4JA 3OQMA 4QTUB 4RV9A 3TSWA 3ZPXA 4UHDA 5CYGA 2CJPA 4HVAA 2NUAB 1OWPA 1QKJA 1FLAA 4DE5A 1L5YA 1DFIA 1L7DA 1EX7A 1XDDA 3A05A 1QG6A 5JAPA 3TLBA 4NBNA 1Z7BA 4FGUA 1JEOA 3RSGA 4LF7B 1CJUC 2JFPA 1J49A 3AESA 3JD1A 2QZPA 4DCUA 1TECE 3L0IB 1KO1A 1UBOS 4P0QB 1R00A 1NBMA 1KBOA 3VPDA 1U1DA 4MARA 5D3KA 1RZRD 1FW6A 3DV2A 3U3MA 3FFAA 1R0YA 5FTLA 3NKVA 5I9MA 2QZ9A 2MMGA 4QASA 4D4MA 2WWYA 3MB8A 3VPFA 3CSSA 2JJ2A 2Q5HA 3A9SA 1J7JA 3WBBA 2C5FA 1CY1A 1KERA 1SBIA 2ZS9A 2YWRA 2WSBA 4MDEA 4ZEXA 4LI0A 4JKIA 3B2QA 3HA7A 5DLPA 3V8BA 4TTIA 3L6CA 1RLOA 3M3PA 1FXWA 3H19A 4MP6A 2ZXFA 5I5GA 2J08A 2PCLA 5JNUA 4LRQA 3U80A 4FQ7A 2WEKA 1Z4NA 3HR8A 2ZRPA 3MAAC 4GD3Q 4TRRA 4BMCA 2V0CA 2HMAA 1NR5A 4BU1A 1WTAA 3THYA 1BD3A 2ODTX 3UKDA 1C4OA 1OILA 2X5OA 2FSVA 4O4IF 5EGNA 2XMZA 2HA5A 3B1XA 2BT4A 3GJYA 1QAOA 4NCIA 2Q1UA 4NE2A 3W05A 3ENKA 3A1WA 4ID3A 4CF3A 6YASA 3NMUF 3UCXA 4O2LA 3M4YA 1WZIA 3WSVA 2WKSA 3ED1A 3BHJA 3HDGA 3PG5A 4LV8B 4FSXA 5HM8A 1SAYA 4JJEA 2HCFA 2YZKA 5IDYA 3GDWA 3JVVA 1Y80A 1LRJA 3W5IA 3RH0A 4CL0A 1QV9A 1FF9A 4YDSA 1E98A 2VZEA 4KYTA 3CUVA 1YB6A 1SVOA 1U8ZA 4MVJD 3PEWA 3ZN2A 2Q0HA 1T4GA 5LP6A 1GO2A 3LWDA 1S0UA 4MWTA 4R01A 4UTOA 3IIJA 3MTQA 3EEOA 5D3MB 2OV6A 1OZHA 3DAOA 2WUDA 3MPUA 2PJDA 3UV7A 2OBMA 3T5BA 4NZ9A 4RA9A 1MFZA 3HDJA 2BR5A 2BGMA 3NTXA 4Q34A 3GEBA 4PSVA 1IIBA 3HL4A 1G38A 4I9UA 1F0YA 1GG2A 3TH5A 4G5QA 3TNFA 4HAIA 5FJJA 4A2WA 1AGNA 2P3OA 4P93A 5DMXA 2CMDA 4BO8A 1XO1A 1ZUD1 3BWVA 3WQHA 4IDPA 2HU2A 3FDJA 3TQHA 4BFXA 4C03A 4JXJA 5IC4A 4DV6B 3T9DA 2O52A 3F6CA 3P9ZA 4KB5A 4M1KA 4DNPA 5JXJA 1U04A 1D1QA 1LSSA 4C5CA 3A7DA 4HNVA 1XLTC 2AZDA 1X9GA 3JYPA 1T5IA 2X1MA 4JLAA 4RABA 3OJFA 4F4JA 4V1CI 3O1JC 4AAYA 2I03A 4FD2A 4OHOA 5AMXA 1RLIA 2WWXA 3LHIA 3FKSA 4DVGA 1OC2A 2HF8A 1W36B 4MRRA 3U4AA 1E0JA 1Z29A 2W71A 2W7TA 4HDKB 1BMDA 4X8OA 5AH0A 4Q7EA 5EERA 3RUDA 3M1AA 5CA1F 1J20A 3RC8A 3SXPA 4P4LA 1GCGA 4JJIA 1FLDA 4JZKA 4YT8A 4LWOA 4TL8A 2P6RA 1ZO8A 1CK4A 1O0BA 3ZU4A 3S81A 3R3VA 1L2TA 1ULSA 1DTWA 1WNFA 2PZEA 3M82A 4GFDA 1SD1A 1Z47A 4GOOD 3GZTB 1C4XA 4BJ1A 4DY4A 3USCS 1KI3A 3MUNA 4KPUB 1XNHA 5LU8A 1IUNA 2E85A 3T7TA 4KLAA 3CX6A 3V8RA 2P0EA 1C1XB 3I12A 2VI5A 2AMLA 5FOWA 2PE5A 1H0RA 1JWLA 2IGBA 1Z4IA 2WSLA 2CHGA 2AC4A 2NO4A 2X3YA 3A9CA 4XQ9A 1PT9A 5AJWA 5T4HA 1G3MA 1E9CA 3OTOB 4WA8A 4ARVA 4PC7A 4D9EA 1TF2A 3H17A 1R0BA 2HWYA 3RVKA 4EKEA 5GZ1A 1YJ5A 1GA6A 2B4RO 2MIIA 4LCJA 4Y6PA 3DNPA 3LF1A 2B0CA 1OTXA 4RJIA 2GS9A 4QRDA 2BTQA 4IBOA 3OIYA 1FJHA 1HDOA 5IDVA 2A7QA 1M74A 3AR5A 4LJSA 4NNPA 4UPVA 2WIJA 3UO8B 1T4CA 4UOEA 1S1CA 2XVAA 2FN3A 3HP4A 4CF4A 4EZIA 4YCAA 5AW2A 1COZA 4N7JA 5FP0A 2WPDA 1IEVA 2W6JA 3C3JA 5ALWA 5FADA 2EGUA 4HN2A 2O2HA 3FVRA 3H4TA 521PA 1LSUA 1GG9A 3SHWA 4C0BA 1MX9A 5J3JA 4CIWA 3SKVA 3S2FA 2IQ5A 3OEEA 5AQEA 3ZVLA 2QVYX 4MR8A 4CM1A 1P4RA 3P27A 2JCGA 1NYLA 3EZYA 2WD8A 5KJFA 3ZR4B 4C7XA 4KR0A 4P6VF 4L76A 3TEMA 4RH3A 4L5JA 1I6WA 3KVOA 4JKYA 4MAAA 4B47A 1BYUA 4YUZA 4ZIRA 3P52A 3HWSA 5CB4A 2AX3A 4L3WA 4EMSA 2QQ0A</