3DXYA

Crystal structure of ectrmb in complex with sam
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
207
structure length
207
Chain Sequence
b'HALENYWPVMGVEFSEDMLDFPALFGREAPVTLEIGFGMGASLVAMAKDRPEQDFLGIEVHSPGVGACLASAHEEGLSNLRVMCHDAVEVLHKMIPDNSLRMVQLFFPDPWHKARHNKRRIVQVPFAELVKSKLQLGGVFHMATDWEPYAEHMLEVMSSIDGYKNLSESNDYVPRPASRPVTKFEQRGHRLGHGVWDLMFERVKLEH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tRNA (guanine-N(7)-)-methyltransferase
molecule tags Transferase
source organism Escherichia coli
publication title Monomeric tRNA (m(7)G46) methyltransferase from Escherichia coli presents a novel structure at the function-essential insertion
pubmed doi rcsb
total genus 63
structure length 207
sequence length 207
ec nomenclature ec 2.1.1.33: tRNA (guanine(46)-N(7))-methyltransferase.
pdb deposition date 2008-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02390 Methyltransf_4 Putative methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3dxyA00
5CCBA 2P3OA 2OY0A 3BWMA 2EJTA 4L7VA 3O4FA 1D2GA 2PLWA 3ELWA 1F38A 4BP1A 3NMUF 1HMYA 1JG1A 5DTMA 2AVDA 5K0CA 5E1OA 1X1BA 1P39A 2IP2A 3OE5A 3KR2A 3EGVA 5E2AA 2PT9A 3B3GA 5E9JA 3DULA 2UZ4A 3PX3A 4ATNA 5LQAA 4K6MA 5EEGA 1NBIA 3FPEA 3K0BA 2C7OA 5CUQA 1EJ6A 1RI5A 2FYTA 3G2PA 3KQOA 3HTXA 2AOWA 3ELDA 3M4XA 3NDJA 4YV2A 1BOOA 4AX8A 4C04A 2AZTA 4WVLA 4ER6A 2G1PA 3SSOA 1FPQA 3LBFA 1P1BA 3NWBA 5DX1A 1SUSA 3DLIA 4QTTB 4A6DA 3EVBA 4U7PB 3LECA 1IY9A 3AXTA 2OKCA 2Y1XA 3P2EA 2IH4A 2PXAA 1TW3A 4ER5A 4FS8A 4R8RA 2VS1A 4RWZA 2OB2A 3HP7A 2AN5A 1F3LA 1QYRA 3FYCA 4RVDA 2ONYA 1IXKA 1NW8A 5GM2A 3FTDA 4MWZA 2P8JA 2XYVA 1EJ0A 9MHTA 1NW3A 1I1NA 5LQRA 5DSXA 4CKCA 3D2LA 3NJRA 5DM4A 3GNLA 3PTAA 1HNNA 4KVZA 3C3YA 4PWYA 3G8AA 3LKDA 5E1DA 2DULA 1L1EA 4PGHA 4DCGA 4BLWA 2NP7A 3PT9A 1RI3A 4FR0A 3PFHA 5F2NA 4RTSA 1MHTA 3G2OA 3TKYA 4CKBA 2BM8A 3HM2A 5DSTA 4P58A 2YUIA 2KW5A 5FA8A 3VSEA 3NW9A 1XDZA 3LX6A 1M6EX 3EPPA 5K05A 5MHTA 3KKZA 4LWOA 1H1DA 4OBWA 3FPHA 1G6Q1 2P1DA 2CWWA 8MHTA 3AWIA 3P2IA 1UWVA 5K01A 2Z6UA 4E32A 1O9HA 4E30A 1SUIA 2R3SA 1X1AA 3VYWA 3IEIA 5CIYA 1L3IA 2B9EA 4QDKA 2AOVA 3HNRA 5ICCA 4HTFA 1WXWA 3AY0A 3HCEA 5EKXA 4IKPA 1G60A 1NE2A 1XVAA 2GA9A 2NXJA 2PJDA 2UYQA 4XCXA 4Y30A 5T64A 1FP1D 5EZQA 3PLAE 2ZZNA 4M37A 5HIJA 4LECA 3EVFA 4EVIA 2HMYB 1SQGA 5DX8A 3HVJA 5EG5A 1AQJA 4HC4A 5LR6A 2JG3A 5D1HA 4P7KA 3HA5A 3ORHA 1BC5A 3BWBA 3P71T 3DUWA 4FGZA 2ZCJA 5CVVA 2O57A 3JWGA 1VIDA 2XVMA 4KWCA 5FA5A 1T43A 5E1BA 2K4MA 3FUTA 3MGGA 4FP9A 2ZW9A 5FQNA 4YV0A 5ICEA 3B89A 2AOTA 4RTJA 2ZZMA 2IPXA 3VC1A 3CCFA 4GC9A 2ZSUA 4QVKA 3C3PA 1RJGA 1XCJA 3DR5A 4PCAA 3MTIA 1EIZA 3G89A 2VDVE 4HGZA 5JUWA 5DX0A 3KR9A 3GRRA 3SXJA 1SKMA 4POOA 1ZQ9A 4HG2A 2IBTA 2AN4A 4GOLD 5CVDA 4RTKA 1SG9A 2ZZKA 1NW5A 3DMHA 3EMBA 3KU1A 4YMGA 5M5BA 2IH5A 3FUVA 3CGGA 3GRYA 4JXJA 5DTQA 5E9WA 5EHIA 3TLJA 2JHCA 3GRZA 1JTEA 2VP3A 4XUEA 2PXXA 2YXDA 1EQAA 3BUSA 2O07A 1YUBA 2B25A 3P2KA 4C08A 4XUCA 4QPPA 4V0RA 5EEHA 5GP1A 1KPIA 1VL5A 5BXYA 3FTEA 4O29A 5U4XA 1KYZA 5K0GA 4ER3A 3G88A 4BY9E 3G2QA 5KVAA 2NP6A 4KW7A 1NV9A 2NXEA 4P7JA 4E2YA 3FTFA 2IBSA 1FP2A 3OFKA 4X41A 2H11A 4AZVA 1XJ5A 4X61A 3OE4A 2Q41A 4F86A 5DPMA 3RIEA 2OB1A 4M38A 4RX1A 2AOUB 2I9KA 3EGEA 2IIPA 2R6ZA 3I53A 5GIPE 2O0LA 4OX9Y 1VQ1A 4DM3A 2IDKA 1RI4A 3KQWA 1YF3A 5B1SA 3LCVB 3MQ2A 2P41A 5K0JA 3GO4A 3FUWA 5HOQA 1FJXA 5EMJA 2PVCA 3FYDA 3OU7A 4E33A 4DCMA 3P9KA 1NW6A 3BGIA 3DXYA 2YQZA 4C05A 2CKDA 3UJBA 3VC2A 3HVIA 2XVAA 3PFGA 1WXXA 4DA4A 1QAOA 1JQEA 3GDHA 4NECA 3DXZA 3QV2A 3RODA 2UYHA 3SSMA 5EZSA 3T7TA 1TW2A 5K0BA 3T0IA 3WSTA 2G70A 5HIMA 2ZVJA 3L8DA 3SMQA 4YUXA 4RTNA 4R6WA 3DMFA 3OZRA 3GCZA 5LQUA 1SVUA 1JR4A 1ORIA 2HNKA 2JH8A 2AN3A 3LSTA 4KDCA 4U7TB 3G8BA 3LL7A 2JH9A 5DXAA 5FTWA 5DWQA 4MIKA 1NT2A 3A7DA 5EQJB 3R3HA 2EFJA 2ZIGA 2HR1A 4RTMA 4GQBA 3SR4A 2PXCA 2PY6A 2QY6A 3ID6C 2NXNA 2E5WA 2ONZA 2CMHA 3KQTA 1QAQA 1UFKA 1JG2A 4H0NA 4PYNA 5EPEA 3TR6A 3LDUA 4PYQA 2FRXA 4EKGA 2YXLA 1YZHA 5EC8A 4RTLA 3B3FA 3GRUA 1IM8A 5E8RA 4MQ4A 2XYQA 3OZSA 2ZTHA 3T7SA 5ICGA 1JG3A 3KQMA 4KIGA 5KS2A 2XBMA 3E05A 3ERCA 2ZIEA 3THRA 4QPNA 5E2BA 3PB3A 1TPYA 3CC8A 3TQSA 3E7PA 2JHAA 2V74B 4HSGA 2PT6A 4C07A 5FHRA 4EQZA 5ICFA 3I58A 3MB5A 2FCAA 4B17A 5EMKA 4HH4A 1RJFA 2B78A 3M70A 3MHTA 2PX8A 2GH1A 3MCTA 4M36A 2Z6QA 5GINE 2I6GA 1NW7A 2YTZA 4A6EA 2G72A 4M7RA 1G8SA 4R6XA 1KR5A 1L3BA 5HILA 3UA3A 3X0DA 4CXMA 2C7PA 3IV6A 3F4KA 2P40A 2YR0A 4FT2A 3CBGA 2JJQA 1R8XA 2NXCA 3V97A 2PKWA 2NNWB 4OA8A 4PCLA 1VLMA 2BH2A 2EX4A 4RV9A 5F2KA 1MJFA 3DLCA 3P97A 2QM3A 3KHKA 5E8JA 3FPJA 4PGGA 5BW5A 4PIMA 1P1CA 1KXZA 3UJAA 2ZLBA 5C1IA 5CVUA 2YVLA 3BWCA 4GOND 3UJ6A 2ESRA 5DXJA 4YUVA 3M33A 4MHTA 4AUKA 3UFBA 4BP3A 3MTEA 3TFWA 3HEMA 3KQYA 4Y2HA 4RTRA 1PJZA 4Z2YA 3TMAA 5FWAA 5CVJA 1JTFA 4EKIA 2PGXA 2P35A 4IV0A 5FUBA 2I7CA 3PVCA 4LWPA 1G38A 2IDJA 2G8NA 2H1RA 4RTQA 3UBTA 1R8YA 2O05A 1R00A 2BR5A 3M6XA 3AXSA 4OQEA 1N2XA 1UIRA 5FHQA 2XYRA 4GEKA 1QZZA 3CVOA 5FCDA 4ER0A 1ZGAA 3LBYA 5ERGB 2BM9A 3BWYA 2AVNA 3M6WA 3V8VA 3A4TA 1U2ZA 1BHJA 4ZTBA 4HRAA 4DKJA 3BXOA 5HZMA 2UYCA 3CJTA 2QYOA 4P7FA 3GXOA 5FADA 1ZKDA 2BZGA 1L9KA 5LSAA 1JSXA 2Y1WA 3JWJA 3KR0A 4AZTA 1AF7A 5HIKA 1DL5A 2AOTB 3G7UA 3NDIA 5EOVA 4C03A 5JR3A 3GRVA 3I64A 3LPMA 4P7GA 3IHTA 5DM0A 1KHHA 1KPHA 3SX0A 3Q7EA 1KPGA 1KYWA 3G5TA 4DF3A 1SQFA 2C7RA 3EVAA 2YX1A 1KP9A 2FK7A 4PYLA 1JQ3A 5HFJA 3GIWA 3R24A 5EHGA 1O54A 2B2CA 4ISCA 5EMLA 3B7PA 3B3JA 3UJ7A 2QE6A 4PYOA 3JWIA 3CJRA 3RW9A 1G55A 3BGDA 5EMMA 5KQRA 3HCCA 3KQPA 5LQNA 2IH2A 3BKWA 3H2BA 4AZWA 1WS6A 1RJDA 1X1CA 1ORHA 3TPZA 5K09A 3KQQA 4YV1A 3LCCA 3TM5A 1RI1A 4KRGA 3EEOA 3I9FA 1YB2A 2AS0A 1I9GA 3NWEA 3ANXA 1QANA 2FHPA 2OYRA 7MHTA 3UJCA 3EEYA 3O31A 1Y8CA 1NV8A 1WG8A 4C06A 1RJEA 2OBFA 2PV0A 3DP7A 2PX2A 2CMGA 1OR8A 5CVEA 4QQNA 3UWPA 3EGIA 3KPUA 1Q0TA 4G56A 4X1OA 2V7EA 5IH3A 3EVDA 2WA2A 3FZGA 2DPMA 3G2MA 5K0FA 4ER7A 4CTKA 3CKKA 3UZUA 1YFLA 1VP9A 2ZBPA 3EVGA 3FRIA 1ZG3A 3KPWA 4QTUB 2PX4A 2VDUE 3JWHA 1NKVA 4FT4A 3TOSA 4KDRA 4EMSA 1XXLA 3OCJA 3ME5A 4QVGA 2PBFA 4E2ZA 2OPBA 4GBED 2PX5A 3P9CA 1INLA 2HTEA 5H02A 5HEKA 3Q87B 1VE3A 1M6YA 3DOUA 1JQDA 3E23A 1EAMA 5GWXA 5CD1A 3FUXA 2ADMA 1G8AA 4FSDA 4WXHA 5GM1A 5C9ZA 4PNEA 3KQVA 4FSXA 3E8SA 3G5LA 3DH0A 1P91A 2EG5A 4E31A 5LQKA 2Z6AA 2ZFUA 4BLUA 2IGTA 2A14A 3QOXA 1PRYA 3NTVA 5FWDA 4C4AA 4EK9A 5D1NA 5P8WA 4PONA 2N47A 2YXEA 1VP3A 3A25A 3HCAA 3SSNA 1VBFA 5DLYA 2UYOA 4E70A 1WZNA 3HCDA 2AOUA 2VDWA 4IWNA 5K0LA 3SM3A 3TRKA 4RTOA 3ER8A 1EG2A 2PSSA 3KQSA 4RVGA 5K0EA 5EKUA 2FK8A 3R0QA 2C7QA 3OFJA 5CM2Z 5T6BA 5K8VA 1XCLA 2BR4A 3K6RA 2H00A 3A26A 3C6KA 3M6UA 4PYJA 4GOOD 1X19A 4XUDA 2G71A 3BKXA 1XTPA 4QDJA 3SGLA 2HV9A 4CKEA 1JSZA 5EIWA 2VZ9A 3KPYA 3TM4A 2JHPA 1XDUA 2OO3A 3HA7A 2ZIFA 2PWYA 2P7IA 2F8LA 4X60A 3UJ9A 5HIIA 3R6TA 2GB4A 2ZWVA 2IFTA 4KIFA 4R8SA 2GS9A 2I62A 2ZBRA 3B5IA 4UOEA 5GIOE 3C0KA 3HVHA 3UJ8A 1DUSA 4GC5A 2QRVB 5F2OA 1V39A 3OU6A 4RVFA 5C0OE 1RI2A 5E1MA 2ZBQA 3PS9A 4R05A 5DRTA 5EVJA 1D2CA 5CCXA 1ZGJA 3P9IA 3OU2A 2OZVA 4OA5A 2ERCA 2LD4A 4PYMA 3EVZA 4DMGA 3O7WA 4GF5A 3OPNA 4HTFB 5FQOA 2P7HA 1KIAA 4CWAA 3EMDA 4DQ0A 1R18A 3DTNA 5T67A 5BW4A 1N7JA 3UJDA 4OQDA 1AQIA 2P3LA 3AJDA 3S68A 3C6MA 2GPYA 3FPFA 4CTJA 3DMGA 5FULA 3ER9A 5K0NA 3LGAA 3GU3A 4PINA 5DM1A 3DXXA 3NVKI 4BLVA 1ZHFA 2ZWAA 3T7RA 1O9GA 2B3TA 5GOZA 2FPOA 5DRYA 4AZSA 3THSA 4YUZA 2WA1A 3HCBA 1Z3CA 1L3CA 3FPGA 3ELYA 3FRHA 3REOA 4YUWA 1I4WA 5DT2A 5KYGA 3P9NA 4PYIA 1M0EA 1DCTA 4F85A 1JG4A 2CL5A 3KPVA 4QQKA 4RTPA 2EJUA 1BKYA 3A27A 4OBXA 3GGDA 1YFJA 2AR0A 4FZVA 2GLUA 3MCZA 3M6VA 5EGSA 3MAGA 5IKMA 5DM2A 2ORED 3BZBA 5DTRA 4V0QA 2P3QA 2HWKA 3GWZA 4HGYA 4DZRA 3TKAA 4GUAA 3EVCA 1R6AA 1YZ3A 3ELUA 3FUUA 4IV8A 4RVHA 2PWPA 3BGVA 3EVEA 3LDFA 3A7EA 1R74A 3FTCA 5BP7A 3KPJA 3LCUA 3MERA 3P8ZA 1B42A 3QOWA 4X63A 1QAMA 3NVMB 3PX2A 4F84A 4YMHA 1XDSA 3SVZA 3LDGA 5E9QA 1X1DA 3LKZA 4RSRA 2WK1A 4LG1A 2AOXA 3CJQA 2ZULA 3HA3A 3HCFA 4RYLA 1D2HA 4YUYA 10MHA 5K03A 2GAFA 1Q0SA 4PIPA 1AV6A 3OZTA 5LQCA 2NYUA 3IYLW 1FBNA 2OXTA 4E2WA 3U81A 4PYKA 4GOMD 2O06A 1NBHA 1WY7A 5LQJA 3I5UA 5EIFA 5KQSA 3KR1A 3UA4A 1N7IA 1VPTA 2BR3A 4E2XA 5G02A 3R9XB 3GJYA 3BT7A 2QRVA 4MTLA 3LHDA 3HVKA
chains in the Genus database with same CATH superfamily
3RF7A 5CHYA 2WWIA 1HDXA 1E8NA 1XIVA 1UBHS 2GGSA 4RJIA 1O6ZA 4RH1A 2MCFA 2FW9A 1P5ZB 3HLYA 3KFLA 3PF8A 4XGNA 3BTOA 3CSUA 4DYHA 4MUYA 2H18A 3W3AA 5FL7A 2OP0A 3D8UA 2UZ4A 3FDZA 3PX3A 3AL2A 1U0EA 2H54A 2N3ZA 2W70A 3T7KA 2DUJA 1N6IA 1O77A 1RI5A 1XZNA 5FAXA 2JLVA 2ZYIA 4AS3A 1D0IA 3P20A 3TQQA 4KYIB 3N3AC 2JEZA 1JVSA 3Q9LA 1O89A 1R6XA 5ECWA 5EWLA 4GLLA 4ARZB 5LIPA 3S2YA 3ECCA 1C14A 1QHIA 3FETA 2G5GX 4PLYA 2DP4E 1U9ZA 2Q9UA 4U39A 4DSOA 4F4FA 1G21A 3LUPA 4JR1A 5C7IO 2GK6A 2FUG1 4L8GA 4U3JB 4OXIA 1WF6A 2FZLA 1USUA 4PNPA 2F90A 3EARA 3HR8A 2NZUG 1QG0A 4NNPA 4YJ3A 5B3AA 2I7VA 4OHPA 1M6VB 4Q39A 4DLBA 3SF0A 2SCUB 2E87A 3PC2A 4LMBA 3IL2A 4QUBA 5KAPA 1QOPB 3IJPA 5F73A 5AXBA 2ID4A 4WACA 2LWIA 3PPVA 3VSAA 3DKKA 2OM6A 3A6GA 9MHTA 4Q3AA 3CX7A 4WL0A 1RPZA 5AR1A 3QPAA 3UCFA 4C6TA 3CLRC 1HYHA 4CDGA 3P9RA 3OFVA 4OGGA 3FAZA 1L1EA 2FN4A 1EWYA 4LZAA 2CDAA 2J45A 4K9LA 3IDZA 4EWLA 1G42A 1H1LB 4MYDA 1EVIA 4J29A 1M72A 1SVOA 4DCOA 3VSEA 3ZKAA 4KX5A 3NW9A 5HKBA 3GLGA 2OCBA 2AXEA 4IILA 5J5CA 2FEAA 4YRLA 3UN1A 4BL5A 2EIXA 5AYVA 4CODB 1GUBA 1V8ZA 3N0XA 3MPOA 1VJRA 3ITKA 4OREX 2QIOA 3N8IA 1MVNA 4H60A 4Y2YA 1T0BA 4G24A 5K01A 3S8YA 4UBLA 1K98A 5C1PA 3A10A 5I7AA 1JDBC 2Q1UA 3GGCA 2DBQA 2IYLD 3MS7A 1UP4A 1DKMA 3DNFA 4L57A 3SFVA 5C3MA 5KTMA 3SR3A 1E9EA 2ATXA 1PQPA 1JZTA 4TV8A 1U8EA 2IYQA 4G0PA 1ESMA 4MUIA 4MVJA 1EUCA 1G7TA 3FNFA 3B51X 3K2QA 3R4CA 5F5XA 3QNWA 1XBTA 2CLMB 3BJIC 5J2TB 3O8LA 2B4TO 5DX8A 4TV9A 1I5RA 2D0PB 1GPLA 3LC2O 1WB6A 3LY9A 5EG5A 2V6BA 4J4HA 1PWYE 2O8DA 1I4EB 2H63A 3OUZA 4NJEB 4DABA 4GX2A 5ELMA 4IH4A 3RC7A 4C0BA 3LTNC 1FP6A 1BFKA 2DQKA 2XVZA 1SD2A 5EYPB 2Q7OE 4B74A 5KSPA 2HWWA 2COEA 5ALZA 4ZEVA 3HCRA 4LZNA 1UP6A 1MO2A 4CF5A 4YV0A 2OFWA 2XCTB 3HJFA 1AS2A 5B64A 2Z2KA 3MTJA 1MNAA 3HJAA 4KVAA 5K3EA 4UDYX 4KH1A 1U0JA 4JBHA 2PLNA 1A7UA 2XE8A 2DQZA 3PRKE 4LXGA 3JX9A 2I1VB 5TR9A 1AHIA 1R0SA 3SXJA 3K70D 1SKMA 1TFRA 4AKGA 4YYZA 2FE4A 2ZZKA 2E18A 2O5EA 1GFIA 1ZM2A 1YUNA 3Q3IA 2DTXA 3ONDA 5F7ZA 2IYYA 1JTEA 3EPKA 2ET6A 8GPBA 5IBQA 3PUWA 5IX8A 1DTEA 3MGBA 3FTEA 5GP1A 3OFND 5GV8A 1KVTA 1QDUA 4GLFA 5ESRA 5IARA 5A4FS 2PUAA 1U65A 1NW9B 5H5JA 4B8WA 2AJCA 4WLOA 3JD2A 4NCNA 2XBLA 3LC7O 1WQ3A 4DSNA 2V6IA 2H52A 4KGVA 5BPHA 4TXMA 4V39A 5B4UA 2HJRA 1MXFA 3F6BX 4Y2GA 4YNBA 2V6JA 1TEZA 4TVSA 1Z5OA 2Y1LA 4NBTA 4PHFA 5IC5A 3STUA 4DUGA 2DR2A 1Z4JA 3OOJA 5FXMA 1KQ3A 2XIQA 3QOFA 3BAZA 3QWIA 5IFKA 3QH4A 4QPZA 2I4OA 3F67A 1BZYA 4HVTA 4JC8A 2O3QA 4MRPA 3VC2A 2C5AA 2Y71A 4UM9D 5JDIA 4UHEA 4M99A 5THXA 1ZR4A 1N0UA 4RV4A 1DC5A 1E3QA 1D6MA 3M2TA 5EQTA 4PZ0A 2G70A 4YRNA 1GAXA 2OV8A 2H2AA 1HE4A 3UHJA 4RZ3A 4EKNB 2O8DB 2O8VA 2P0EA 1LRKA 1JR4A 1X2BA 1EP2B 4FFMA 1J97A 2FFJA 3LRPA 2ONCA 3UUGA 1PV4A 1C0PA 3R76A 3SOPA 1E2MA 2E21A 2WJ3A 2Y77A 3EBLA 5T4FA 1S7GA 4AZ3A 1VMEA 2JGDB 4DEXA 5FPQA 2EEZA 3D8RA 1K88A 3PNOA 4FKMA 3QXCA 2J9XB 4OH1A 2NQ8A 3VTAA 4CQMA 1BAPA 3ID6C 1LS6A 2P27A 4OYHA 5EPEA 2J33A 4IG9A 4UHBA 5KTKA 1JHMA 3KUDA 4AJJA 1BG6A 3LDUA 4IPTA 3CR3C 5IASA 1C7JA 1JT2A 1YZHA 5IHXA 3O4RA 3OQBA 3HDHA 4BLSA 5T6MA 3WQQA 5L7WA 4X66B 1T1EA 3G9XA 1DMRA 1Z38A 3HKBB 2HFKA 1TUBB 1EEHA 2HO5A 4GMFA 5H81A 4CTNA 4O2AB 3U6KA 1T29A 4YJGA 1NFRA 5FUXA 5M04A 2PNFA 5ALDA 3IOYA 2CXOA 2GN1A 4UHDA 2CDRA 2KWIA 4C3UA 2PT6A 2FX3A 5HS6A 3MTAA 5J4YA 1G3RA 3OP1A 2DLDA 4JIGA 4Q3CA 4JA2A 2XYPA 1ZN2A 2VJAA 5B1HA 1ZEJA 3OT5A 3C3WA 4HD8A 4QIHA 4BKMA 3T15A 4WASA 4Z2AA 3LQYA 4MYUA 4FT2A 4QASA 4MRNA 2ZJ0A 1LPMA 4CQLA 3B6ZA 1ZN9A 3SYKA 5C8DA 4BRSA 3NU1A 4IZIA 3RR2A 4L15A 2KB0A 4WIAA 1OD6A 5F2KA 3KETA 4B8ZA 3THXA 3GJ7A 2QTAA 5LP6B 1NMSA 2V0GA 1QUEA 2FQXA 2ZJBA 3B5EA 2FTKE 2ZITA 3EN0A 4P4UA 1DZIA 1U1IA 1UC4B 2H2DA 4MWCA 4U5XA 3NOQA 3RGGA 2ZLBA 1T1RA 2PFSA 4JYPA 1AK2A 4HMPA 4GOND 1GGKA 2Q2OA 1H8HA 4ARZA 4YRBA 8ADHA 4K81B 3BPSA 3H0EA 5FL3A 3PNBA 5D5PA 3TMAA 4XPZA 5BQOA 1TJPB 2YWHA 1FW8A 4IMRA 2XODA 3N0RA 5JMOA 3KZCA 2MT9A 3LUJA 3Q7PA 3ABZA 2JIZA 5KYWA 1RLJA 1JFLA 2XTMA 5FBVB 3L1IA 1WPQA 4TRRA 5AM5A 5DVZA 5T8KA 1ZGAA 1ML3A 1KI1A 2EF0A 2QLNA 5ECGC 3ZY2A 3ZGXA 2WZBA 4FXOA 3R75A 2JFHA 4BLTA 4TN1A 1JMKC 4MCJA 3TIXB 4GMKA 4KREA 3ZLVA 3EIEA 4YRMA 3ZE8A 1FMCA 4HRAA 1RP1A 3HWX1 4YROA 1YHZA 3OTIA 5AVSA 2PGDA 2C4TA 3FNHA 3QF7A 6Q21A 2O8EA 1J24A 2XUKA 4OPMA 3HFRA 4HK4A 2XOXA 2GPBA 3H75A 4MUFA 3E81A 2MINB 2VJBA 1DUIA 1JQAA 1DAIA 2JBWA 5JRZA 3WIOA 1US8A 5DTEA 1YBAA 4DIDA 5EJGA 5EYPA 1EYZA 2C61A 4RHCA 5SYNA 3ZU3A 4CMBA 3AX6A 2GBGA 2ISQA 2C88A 2ZAYA 2H7XA 3UJ7A 1N25A 1G20A 1PU2A 3EQ2A 3HB7A 1I6MA 2FETA 3EXG1 3KEGA 1E2HA 4MPRA 3QLJA 3OZXA 5K51A 3S1AB 1T5TA 4B0OA 1NR5A 4M0DA 3H11B 1ONNA 2TECE 4PLHA 1TZKA 5ALPA 5JARA 4FGLA 3UIEA 2TRSB 2P9ZA 3FTPA 4E5MA 1A1VA 1W8DA 1Z82A 3PD0A 4QARA 3GT3A 2QJRA 1VMKA 4A4DA 3LLUA 1W46A 1BKSB 1QCYA 1QFMA 1YB6A 2JI7A 1RJEA 1PR3A 1U0OC 1WZCA 3FSJX 3JVEA 2VFAA 3FPSA 4JITA 4XD7A 4TZTA 5H59A 2Q2VA 3BG5A 3X44A 2BKXA 4QQNA 3P52A 5IT0A 3CEHA 3WGZA 4EYEA 1C81A 4X6LA 3ZXSA 1FQOA 1QYXA 1VG8A 2PVSA 1TQDA 2VNAA 4OHVA 3N9IA 4B3BA 4DA7A 4BMVA 1QTQA 3VNQA 4YCJA 3PJDA 3VZBA 1CB7A 3T0GA 2HFJA 2QSYA 3ORRA 3QFHA 4R81A 1I4TD 4Y9DA 4OUDB 3RUHA 3PXXA 4OKSA 4P4LA 5DNDA 4PC6A 3LH5A 1XTVA 3Q87B 2JAWA 1XA4A 5A03A 4JL5A 4BO3A 2ADOA 2UXDB 3U3OA 1E5QA 2IDMA 4MINA 1PJQA 4IMIB 4Q9DA 5JTTA 4BLUA 1GHTA 4XASA 1PRYA 3G85A 5LU8A 2FPXA 3SY8A 4OHYA 2VDRB 1V9LA 2RGNC 2VLIA 3M83A 3ZW8A 5BPFA 1QMGA 1VFPA 4A1FA 2I4NA 1IFXA 1QFYA 3EWIA 2ANBA 5AW6A 1AH2A 2WHYA 2UYOA 3A1EA 3FF1A 5K0LA 2Q0SA 1EG2A 2IXDA 1T0PA 3LU1A 2EWMA 1GSHA 2YFYA 1NATA 5ALIA 5HRUA 4EJSB 3KAJA 5C7LO 2HA6A 1OB5A 4RC9A 1UDAA 5CM2Z 4QM7A 1AQUA 4L5CA 3K6RA 3BRWD 2H00A 3C6KA 3HDVA 2HJHA 2W4MA 1C3JA 4JEMA 1XQ9A 1X19A 2G71A 4JJZA 3DDSA 5AT1A 2EERA 4UTVA 2CHGA 1FYEA 3GW8A 1JHQA 1M8PA 3VR0A 4EFLA 4GBJA 4EY5A 5DP2A 3EDQA 1EFLA 1ZCAA 3F3MA 4DWOA 2JFNA 3DBRB 4FCTA 5LDDC 2I4TA 1KE2A 3U3KA 3R44A 5KJ1A 2GS9A 2YRFA 3FN4A 3KXLA 1HDZA 2G1AA 3KQKA 1BKDR 5G41A 4IICA 3WHPA 4XB6B 3GLSA 1V5GA 2GQ0A 4BO8A 1ZKMA 4I50A 4I8DA 3PWKA 4RVFA 4D99A 2GYUA 2A5YB 4WJLA 5JMWA 1N36B 1JJFA 1M0TA 3GCWA 4HXEB 4XJXA 2HHJA 4IO1A 4MGIR 5AH0A 2OZVA 3G5MA 2AG6A 2ERCA 3NNNA 3JQ7A 1ND6A 4DMGA 2E49A 3V80A 5AK3A 5TY0A 2P7HA 2Q9CA 3FVTA 4A82A 3O8NA 3RU9A 1CZHA 3Q0IA 3TNLA 5MN6A 3DJFA 4RLSA 3VPFA 4ALNA 4M7PA 1WB4A 1LLCA 2E1RA 1TQ2A 2G9RA 4IUCS 1WE2A 3LGAA 1E8MA 3RK4A 1R27A 4LVCA 1ZSYA 1T2VA 1YS7A 1T4BA 3ETNA 3TTTA 3VVMA 1O9GA 1ZK0A 2B3TA 2BCEA 3R5XA 3ZN2A 3THSA 3S7TA 1EKXA 2JDIA 3D0OA 1V7QA 1FRQA 2V7XA 1PS0A 2WYWA 2WZDA 4F85A 1G2PA 3PEUA 2OBNA 3GLRA 3HG7A 3LCMA 4UBOA 4Y1EA 3LF2A 3WADA 4EJFA 3O75A 3E22A 2YASA 4LDNA 3U4QA 1OSNA 3UAYA 1S2MA 4RENA 4MNTA 4R8MA 1W93A 1UKZA 3LLMA 1AT1A 3JQ9C 5CGZA 5JALA 3QBEA 3W8DA 3TJMA 2IHJA 2VJKA 1FBTA 2I87A 1R3DA 2BRUC 4DLKA 2PX6A 2QD4A 3JVUA 1H5NA 4ZMRA 3JQCA 3BGVA 4N0DA 1W87A 3V2GA 2F1OA 1SA0B 3PUZA 3RVSA 5JYBA 1G21E 1FQKA 3O84A 4CM3A 3L8HA 2JHFA 1ZH8A 2BFMA 4QT4A 5E9QA 1ECGA 3A9SA 4XYEA 1IQPA 4H7KA 1YL7A 4JI3B 5JDCA 5JXHA 4RYLA 3TLGB 1W1UA 2ECFA 3ZY4A 3ZWAA 2F67A 3OKCA 3LFTA 3IYLW 3NBAA 2OXTA 1QS0A 3W6UA 2CD9A 3I2JA 5T57A 1IAVA 1Q3HA 1H66A 1D7AA 3P94A 2O06A 3ZGOA 4OJKA 3EAGA 3KLOA 1N2SA 1U28C 4KAAA 2GD0A 3VBCA 4C2TA 3UA4A 4WJZA 2BELA 2BEVA 2WSBA 3OHPA 1NF9A 2GZSA 2NU6A 3OM8A 3ENQA 3V6LA 1OZ0A 2HEIA 4OIMA 4OHOA 2GCPA 2GBLA 3WV4A 1XWWA 2L0XA 4LXIA 2HWXA 1E3JA 2BN4A 1XROA 1E0SA 3O4FA 4B87A 1D2GA 5K1ZA 3AJEA 1ONOA 1OF1A 3MTDA 4JJ4A 1TRKA 2EG9A 5GTDA 1VPDA 2PIAA 1C9NA 1TAUA 1J8FA 3EGVA 2PT9A 1WDWB 3K0FA 1GTG1 3O95A 1M2VB 1NSYA 5C5IA 3EGXB 5J40A 1Z0IA 3FPEA 5EP4A 3ZI4A 1ESZA 5LP6C 1SD5A 3O4GA 4BKOA 1H6CA 4XVHA 2FAXA 2I3BA 2GTHA 1DG9A 2XMCA 3D31A 3KVRA 3R0IA 4PTLA 5JD6A 3OIVA 1XTBA 2B1RA 3MJFA 3PYMA 1SXQA 3DEIA 2AZTA 1GITA 3GX1A 1X9HA 3DBHB 4FDUA 2GWHA 1JFSA 1P77A 3MHPA 4QL3A 2GAAA 1M2WA 1HBJA 4LZJA 5TQ0B 4BJ3A 2OKCA 3FGPA 5EXDA 2H48A 1BFDA 3O0TA 2IL1A 1VJCA 5CX1B 1Z6XA 4BQPA 4G0UA 3DM9B 4Q12A 3SHVA 2HRBA 1P6QA 4IJQA 1XNRB 2IOHA 2RGRA 5FOTA 1G8HA 3N2GB 3OSUA 1XMVA 1W75A 3OE1A 2QL9A 2XOKA 4M55A 3TCXB 1XR3A 1BXGA 1T24A 3OX1A 4M0LA 3VQTA 3ZHCA 3MUNA 1GGNA 3D2LA 4WZAA 3T7IA 2Z5GA 1YO6A 1YHYA 2I6SA 5DV9A 3WX0A 5A06A 4IHKA 1EWQA 1Q0UA 3BWDD 2E3JA 2ZBFA 4QGBA 5DYTA 3SYRA 1KEEA 5B12A 4KR9A 1NNEA 4MV9A 5BQFA 2CFRA 4RTSA 4GKAA 1FDRA 3HXPA 2J0UA 2C3PA 3TRIA 3E2PA 2HU7A 1IZ0A 2P6PA 5GOTA 1PL8A 4BX8A 5THKA 5MHTA 1Y4DE 1XRJA 5D6NA 1R4NA 1AUQA 1JGTA 5FLYA 3IE1A 1FFXB 4PR0A 1OXKB 1B2LA 2P1DA 1BDHA 1G4HA 3F5QA 1UWVA 1RVDA 1R8QA 4PFQA 4UXIA 3RJMA 1PSZA 4GKBA 2QXTA 4KFUA 4CPDA 2QZPA 2ZU6A 3EH2A 1QR6A 3ZWYA 1T9GS 2F1IA 3RVRA 4E51A 2B9EA 5CYOA 2H9IA 4PGFA 1GP2A 4EUEA 3VNUA 1SXIA 5I8WA 2ZRJA 1T26A 3N8KA 5TT0A 4PO1A 3HCEA 3IT2A 4OXRA 2PH1A 1I7NA 2GA9A 3GRCA 1J39A 3C15C 3I2GA 3NBXX 4RCZA 3HBNA 3MWKA 5K8CA 3EVFA 16PKA 3B1VA 3ZZ0A 3OM9A 1E0AA 1WB5A 1U2GC 2ORYA 5LR6A 2YICA 3NHMA 4E7OA 4XSVA 3VU1A 1KJQA 3LQ2A 2WDZA 2XOEA 1IG0A 3T9AA 2G67A 4L51A 4JQYA 2CMDA 3DUWA 3CW2A 2D0OB 1VBNA 3EQZA 3A6DA 4A0HA 6REQA 4HDMB 5DBFA 1CUBA 1LDBA 3R8XA 5AI6A 2WE8A 1N9GB 1TX4B 1UH5A 2V98A 3FSEA 3GRAA 3IVRA 4D1YA 3D4OA 2P67A 4IIHA 4NPHA 2HRCA 2ZI7A 5I8PA 1XHFA 2FG7C 1S2GA 1OLSB 3K5IA 4K2AA 1G16A 4GC9A 3R7DA 1YVUA 1NJFA 1W581 1Z6AA 3G17A 3KUCA 4PCAA 1RADA 4S04A 4P0TA 2Q7DA 4RMIA 2XD4A 4DM4A 1ZQ9A 2FW6A 2ZRIA 4JJGA 1A5ZA 1VBMA 2O2ZA 4B4OA 1YVDA 3INNA 3UJ3X 3GRYA 5FPPA 5DEIA 1PTJA 3DBRA 5EHIA 2PUFA 1E2GA 2VTKA 2XEXA 2JHCA 5AK0A 4AUMA 2G08A 1VXOA 3OPYA 4M7OA 1AG9A 3RPEA 3P2KA 2AB0A 4TZKA 3JALA 1QK5A 3QWBA 1RZRD 1OFUA 4GBGA 1VL5A 4H7JA 5H9VA 1IZ7A 4WK0B 4BEBA 2R0QC 2O6HA 1KVSA 2WWVD 4BLPA 1OREA 3NATA 2DFNA 3EG9A 1TUIA 5FYQA 3UVEA 2AFRA 1XMOB 2YJ4A 5JJBA 1OW3B 2D2EA 5CRIA 3B70A 1TYBE 3DE3X 1U3TA 5A2QA 4DQXA 2JGMA 1J20A 2XCIA 5FI0B 2EBFX 2HBRA 2M6RA 5HVNA 3U44A 2WYOA 4E5YA 1ZPDA 3JASB 4PTZA 2Q45A 2OEPA 1RRMA 3F74A 3LG2A 3OD5A 2GEJA 2ID8A 1YH3A 1JHVA 2VAPA 5CA0A 4BMSA 1YZTA 3OKPA 4FMDB 5K0JA 1W4CA 3P9KA 3QXSA 3FZQA 1X70A 4LOIA 4O0MA 4C0SA 1BRTA 3CX3A 2E48A 4BC1A 3VV2A 2BFCB 2GZDA 1YRYE 4TQGA 1EFKA 1LRJA 2UUPA 1A88A 1RPTA 5BMVF 3PYXA 1X74A 2QYSA 4PRZA 1U8YA 3AHCA 3EDCA 1QE3A 1WDMA 4ND1A 5JSYA 3V4SA 2H1OA 3WIDA 3W04A 3PQ6A 5FWXA 1W4AA 4QA9A 5TF4A 5KDOA 1PEYA 3VDXA 2CFCA 3M5DA 5LQUA 3A3NA 1ODLA 3GLGB 1U0TA 1E6MA 1GZ3A 5J2TA 2SKCA 4G65A 4Q3NA 2QRNA 3DUFB 2FZCA 3M2PA 1Y5IA 3GFBA 4AJEA 2VOJA 4K9OA 3AUSA 1JL3A 4H3SA 1V6SA 5JD3A 3PKZA 5JSZB 4Q15A 1WWKA 4UHCA 2VYNA 3GYBA 1EK0A 4WKNA 4XVCA 3NAZA 4RU1A 4Y1RB 3TQFA 3MG9A 4AKEA 2ZRHA 3DAFA 4HNSA 4XX0A 1Y6RA 1QOQB 4Z3OA 1VJGA 3N07A 1N2OA 5FRDA 1JJ7A 2EGGA 1O94D 2QQEA 3BB4A 4ITVA 4XSGA 3STWA 4OLBA 3GRUA 1FS4A 5E8RA 5G3ZA 1RZVA 3PGA1 1DAHA 2F6RA 2XYQA 1AUOA 3DVRX 2ZBGA 4GM1A 3ZU6A 1UC8A 4GMHA 4E4TA 1N0IA 4TTSA 5JECA 4KIGA 5I7VA 3DGEC 3B2NA 5ENZA 5A9SB 4NCAA 3DMRA 4R7GA 3WRVA 5U4QA 5KCZA 3OIUA 1JSLA 1HRKA 2FFBA 4WKPA 3NWJA 2Q07A 1VSVA 4KAJA 4D4IA 2HK8A 3EHDA 3GT7A 3JAMA 3AB8A 3MGCA 5EMKA 5FBQB 1KDYA 1HGXA 4W5QA 4NBRA 1EK1A 1RLIA 1PW7A 2GH1A 2JBAB 3EFBA 4Q93A 1NW7A 4JP3A 3T12A 1ATZA 1PHRA 2JA2A 3EXHA 1Z5GA 2WYVA 1BTOA 4M7RA 1USIA 1SB8A 4RLQA 4L8YA 5ALKA 3X0DA 4BLOA 3JQ7B 3ZW9A 2YR0A 2I1WA 2G9QA 1AKEA 3WL3A 1K1EA 2UVPB 2I99A 4UVGA 3V4PB 3PEWA 2A6PA 4G85A 1DTWA 3W78A 2CNBA 4V0NA 5CDHA 4JKIA 2VHYA 4Q6WA 4HGQA 3RH0A 5A9RA 1XTKA 5ELXA 4QLOA 4FI3F 5DMXA 2QJWA 2WINI 3TBHA 1QHYA 4RK7A 4B3FX 2XB8A 2B1QA 2C9OA 1L4FA 3ONNA 3G2NA 5E4YA 5C1IA 1MU0A 1NIPA 2JGRA 3LK6A 3T4UA 1V3VA 2C20A 4C4SA 3UGTA 2ZXEA 3I6IA 2YQ5A 3IIKA 2V7UA 3TFWA 2GJKA 4H27A 4W6ZA 4ZO7A 1I3LA 4DCSA 4JR2A 1Y48E 4RTRA 4GXQA 4EKIA 3IEUA 4Q9KA 5ALYA 1UFOA 2DHRA 3EHEA 1ZK2A 4XVUA 2IUTA 2NUPB 3Q4GA 2KBFA 4A91A 5I4BA 3BE5A 3UHPA 3OX4A 3LT4A 5JYEA 4D5EA 2EP8A 1L7VC 1DNPA 3MFQA 4PAMA 2A1TS 2XSZD 1K06A 3TZKA 2GM3A 5EJAA 4DWJA 1QVVA 3C5WP 4ZTBA 1CZUA 1ORWA 1N5DA 4MPPA 1U2TA 3CS3A 1LW6E 2XF2A 3EBPA 3CEAA 3M49A 4S35A 4P7FA 1ZNXA 4RYDA 2JI6A 3LCJA 2CJWA 3H5TA 4AMYA 2XWPA 4F93B 1L9KA 1Z12A 4G0XA 1S89A 4YP0A 1J5PA 1VL0A 1K8ZB 1H4TA 1X77A 2O0HA 2VYND 3E9YA 4XZ3A 2WQ7A 5LMNB 4PBTA 3IILA 4HGRA 3HYNA 4Y0NA 1QYIA 1T8PA 1U9CA 3PHHA 1KPHA 4OLHA 5JI3E 4BVLA 1SC1A 1X42A 1ZUD1 3B9BA 1NG1A 1KEZA 1FTNA 2C03A 2JCXA 4RF3A 4TRNA 5JAUA 1OI7A 1ZESA 2AFIE 5E95A 4QRDA 2VSXA 2H1CA 4DY6A 2PMCA 2R4TA 3QTTA 4J07A 1JXQA 4BFWA 4MW4A 3X2FA 2QSUA 1G55A 3A1NA 5EMMA 4L4XA 4BZXA 2IH2A 4KQIA 4KCGA 1ADJA 3LTEA 1RJDA 3E3AA 1ABEA 2Y2VA 4K86A 5F5NA 3LDHA 2FDXA 3NJ8A 4GP9A 3RU2A 1BGVA 4F9TA 4PZUA 3I1YA 3RS2A 2IEBA 3QVOA 3ZY6A 1N1EA 1U0SY 2OCDA 4ECEA 1N6PA 2Y1DA 3EUAA 3I8SA 4HS4A 3A6PC 5M7EA 1YU6A 2RHJA 1LJUA 2XRYA 3O5AA 3EJ6A 4HNAA 3ZS8A 1YRLA 1L4UA 5HQTA 5FNVA 3WGTA 1IHUA 3DZIA 5JAZA 5HK8A 1IOZA 1GZUA 3A9RA 2ZAOA 1GU1A 5L3QA 2NN3C 5KQMA 3HKEA 3ESZA 1KYYA 3KPWA 3PPXA 1TKBA 4KTVE 5EXPA 2WSSA 3NP7A 4AS2A 4N48A 5B6IA 4X62B 3CWQA 3DFZA 3QA9A 1OH5A 4ND2A 1LVUA 3JQ9A 2NPFA 1WP4A 5I3ZA 4CDRA 5KQPA 1VPWA 4EKYA 4Z5XA 3B6KA 2PGIA 3GAAA 4URYR 2ZI3A 2ZJ2A 3AT1A 3SJBA 1ZD2P 3GLFA 1EAMA 2FFAA 1BIFA 1DXQA 3D4NA 3DDWA 3FUXA 3R5TA 3K9WA 2VT2A 3AEYA 3K8YA 3ZDQA 1AKVA 4EBBA 4JELA 2W6NA 4U2DA 4LXXA 3ILSA 3Q7QA 1J8QA 2GBCA 2IQIA 3VM6A 2A14A 4G36A 3ZWNA 4REQB 3RLIA 2BKLA 1ZGGA 2VDKB 1WLYA 4JI1B 4PONA 4LHVA 5FPSA 5JANA 3ZHTA 1YQTA 1E9BA 2CK3A 2QTGA 3Q2IA 1N6KA 2DF8A 1HETA 2XT9A 4BKUA 3LBHA 1ZI9A 4B7UA 2YWBA 3I30X 3ZDAA 1RABA 2P2GA 4MR8A 2CVPA 3SJUA 4UNNA 4DRYA 4NESA 3R0QA 2J3IA 2R84A 4JAVC 2W2NA 4RJTA 1W9MA 3DLAA 2IOQA 3HU1A 5ALLA 1I7PA 1OBCA 1ZXXA 3KUKA 4R40A 5BYBA 4CLHA 4N5LA 4XUDA 4OK6A 1ZC3A 3D81A 1Q57A 1FUUA 2WSLA 5IW8A 4BQIA 3ZLJA 2HDOA 4TTPA 1U04A 3L4SO 1GPKA 4HDRB 2FPGB 4YS6A 3F90A 5K0TA 3E61A 2P7IA 1PDWA 2F8LA 3EZYA 1A8QA 4IRMA 4B6QA 1QORA 4LIPD 4JI4B 4HWSA 1FFSA 3VR4A 4BATA 1SHKA 1SJ9A 1XB2A 3WNQA 2WJ6A 3T7DA 3EOAI 3GFPA 3OLWA 1KWGA 2JLRA 2ON6A 1GD1O 1O57A 4U2FA 1KZ6A 1WBBA 1IHOA 1SK9A 3JAWB 3DPIA 3LHIA 4HLCA 1KYQA 2J41A 2EZ9A 5CXSA 5EVJA 5A4IS 4EFKA 2WQ6A 4HN2A 1CW2B 4G2NA 4MYHA 1BHQ1 3Q88A 5I9NA 4ZEMA 4L22A 3HUEA 5FOSA 1LBIA 4B1FA 1FIUA 5FQOA 3TTYA 1FLNA 5FUWA 3LUBA 1NXWA 3FMPB 4GYYA 4J7CA 4UAUA 3RANA 3G02A 1P19A 1DIRA 4NS1A 5I9BA 2FMTA 3H97A 2BGIA 3C6MA 5BOVA 3SSAA 2EKZA 4RE6A 4EECA 4WH0A 1TRHA 4NYIR 1I6LA 2BEJA 3EDMA 4K9QA 1U7XA 1TVCA 2QGNA 2VRCA 5IAKA 3WHIA 3QEOA 3WWOA 4O4LA 4YJ2F 2CMKA 2X19A 2QSZA 1OXSC 1DDGA 2ZE8A 4JSYA 3K9NA 4MDYA 3BK1A 1X15A 5JSHA 4OHZA 4UDXX 1BE8A 3QKSA 1QH0A 1SC3A 2J0UB 3FPGA 3EIHA 4NSNA 2KPOA 2MMGA 1Z35A 4IIEA 4MA5A 3DZKA 4UU7A 4XR9A 1DCTA 2HWUA 1T3LA 5CLJA 3A32A 3N1UA 5LYYA 5D7NA 1XLTC 4JMLA 5I9SA 1PJRA 2D5BA 3MCZA 4AYTA 3H1GA 2WKRA 3IUQA 5FBHA 2CMFA 2YV3A 4HBGA 4N5MA 4BQEA 1CRZA 1MAAA 1BJRE 3GJ8A 2HWKA 3N86A 4L8WB 4CM4A 3MTQA 3BREA 1H8ED 4TLDA 2XWSA 3EVCA 4Y6GB 4O59O 4P3OA 5JWHA 1Z15A 3SDSA 1E61A 2LNDA 4B80A 1PT8A 3KOUA 5GZ1A 5J4KA 2PCJA 2P5YA 1E59A 1UK9A 1Z83A 4KZKA 1QAMA 3PX2A 1JPJA 3JQPA 5LXTB 1HORA 2I2CA 3E9RA 5IM4A 3QHAA 2DSNA 3R7AA 1A8PA 1UWKA 4FCVA 1Q1AA 2AT1A 2RHTA 2WK1A 4LG1A 5ESXA 5ER9A 3HM9A 2VHWA 4IHAA 5LYJB 2AMYA 4UJ5A 3KJHA 3Q12A 3F7NA 1N2CE 1E1QA 1BMQA 3P9SA 4IWXA 3DZFA 3LOQA 4F56A 3D2BA 1UJMA 1XQYA 1SK8A 3P4YA 3YASA 2WF8A 1OAKA 2DWQA 3HYSA 3PE3A 2OGWA 3G1UA 1Y37A 4K2HA 5BSUA 1CR2A 3NRJA 1M2NA 4INOA 4X8HA 1WD7A 1M10A 3C85A 3KBBA 1DAFA 1CNFA 1WXHA 4POAA 3CNLA 4PRYA 1Y3BE 1U5BB 3UMVA 1C8KA 3T1NA 3DL7A 1E9VA 2QMQA 4C2AA 1U8ZA 2PLWA 2ZJ4A 1G1MA 4QQRA 3TE6A 5TJHA 4MRSA 4ZCTA 3OE5A 4YAJA 2WKPA 4TMFA 1JYSA 3F78A 4L5BA 1PWXA 4CFYA 3WTCA 5JNTA 4MPJA 4YMIA 3G2PA 3H2SA 2HLDA 1XZCA 3MS4A 4GYWA 1JHZA 1VJ1A 3V4LA 2EOAA 1NBWB 3AYXB 2NSDA 4KGZA 3AVPA 2JLCA 1UMKA 1IQUA 3U3RA 4C04A 1B0AA 1PTJC 3ZI7A 4E94A 2C2YA 1FPQA 2XIJA 2I80A 4FMCF 4JJAA 4P81A 2PRZA 2X3FA 1L7XA 3C3BA 2BGMA 3PHJA 4BFSA 3DLBA 5CK5A 4CL0A 4G86A 5CNKA 4GPIB 2F43A 2QTHA 3LYLA 1KJYA 4H7FA 5HGXA 2XV1A 3EFEA 1L4YA 3LMKA 4BB6A 3W5VA 4D97A 4BU1A 1XMIA 1M6NA 5CNMA 1K7FB 2H29A 1X1QA 4E09A 5C4MA 3K6JA 1Y4AE 2Y1KA 1EUCB 4L3VA 3SHTA 1N0WA 1XE3A 3ZNPA 1OLXA 1FYDA 5IJ9B 1MOQA 3BH0A 2XZDA 1XCBA 2A1IA 3ZVLA 4FYYA 4MQUA 2H16A 2LUOA 3IP9A 2GDJA 1PBTA 1W5BA 4WBSA 4ZT5A 1P1FA 1VKZA 1JKFA 1VYTA 1AOXA 1JDUA 3V8EA 5IZCC 4W7HA 3G2OA 2DAPA 2Z98A 3U4IA 3RTEA 3T7JA 1PBNA 3PC7A 2ZM6B 4CKBB 1K3FA 2CDBA 2YNMC 4MVJP 5IZ4A 2CLCX 2L19A 4TV8B 4UTPA 3T3IA 4CIDA 4OBWA 3FPHA 4OHUA 5L51A 5ITZB 5CDTA 1JQLB 2RFLA 1PR6A 2A9VA 1O9HA 2E0IA 4HATA 3G49A 1MF7A 3WGQA 4ACBA 2IOYA 4KP7A 1Z7YA 1AS3A 1ARZA 2FOXA 2IPNA 1OLUB 4ID9A 3W4JA 3KTAA 2C5HA 1C9YA 1GXSA 5EI5A 4E5DA 5KTNA 1GRRA 4EI2A 3T5PA 1TZ2A 4C2BA 3AP3A 2C29D 2RHCA 5M34A 3KDAA 3H1PA 5KOHA 4D56A 4DDHA 2SCUA 1WB9A 1KR2A 3TSZA 5L8VA 1PIWA 1WDKA 2HF2A 3WLIA 3DTYA 4LZWA 4QDOA 2N42A 2AW5A 4TM8A 3QX9A 1BC5A 1X2EA 3BWBA 3KDPA 2W98A 1R6TA 4I3GA 4LZLA 4D9GA 1BDIA 3OZ7A 4ZQFA 3N2KB 4H31A 1IZ9A 1DC8A 3G7NA 2QN1A 3TFQA 5EZ6B 3MCUA 3NBKA 3DA8A 3KT8A 1L5MA 1NVGA 1PT5A 1C9EA 1P2GA 1NQUA 2XTZA 4L4YA 5IYZF 1V7ZA 3S0JA 2VCEA 1Y9DA 3IR6A 1XCJA 1ES9A 2LGJA 3MTIA 3EZ7A 3EY9A 5KOIA 5DX0A 5TRTA 4H7DA 4XM1A 4A27A 2V4MA 4Y2JA 3SQLA 1C41A 3FUVA 2AV6A 2OCXA 1KFJB 2WTMA 4I9FA 1KKLA 4TTIA 3AFGA 4WVFA 1CUSA 4RIGA 5L40A 3BJMA 2XRMA 5C5EA 2RGNA 4QUEA 4F6LA 1QHXA 3SIRA 2WAYA 3FXAA 5JHGB 3I9LA 5CFLA 1TF5A 1B15A 1RJ9A 4NZOA 2RHBA 1E7QA 4LYEA 1NV9A 4NDNE 4TMTA 1IVNA 2NZXA 2QZJA 5FOWA 2A5DA 1XRNA 3C97A 4COKA 2GN9A 4M88A 1XJ5A 2Q41A 1G8JA 1W52X 4F86A 2RH5A 3KOWA 3DKIA 3C41J 1B7GO 5DTJA 1HWYA 3GFOA 1QF7A 3HDGA 5AJWA 3SKXA 5U9CA 3U5ZB 2I9KA 5GIPE 1KS2A 4L4UA 3HADA 4OUDA 3TTXA 2QUJA 3PKJA 4GOJA 4IDEA 4A9AA 3I32A 2FPUA 5JPDA 3HXKA 4E5UA 4XOIA 1UMBB 4B46A 3ZHUA 4YRAA 1FJXA 3AMVA 2WD8A 3OU7A 3C7KA 4NCIA 1UWCA 3RSCA 4ZYVA 4W5NA 1FVFA 2QG4A 4FUQA 3D0QA 4L6CA 4XJSA 4LF6B 2Z56A 2C2XA 1XHLA 1M75A 1GFWA 1O7JA 3HCOA 3LQ4A 2HMTA 4CN8A 1CUWA 3INYA 4YAEA 4OMDA 2FLKA 2ORVA 3AV0B 4KXLA 3FMVA 4QBKA 3AR9A 3WAGA 2VPPA 3A6FA 1Q7BA 3LSTA 3OP4A 5JSZA 2QL6A 3QYPA 1JKXA 5FTWA 2IUUA 4W8GA 5CR9A 1RWWA 5TT1A 2C1XA 2P2NA 2CLIB 4WNYA 2IHVA 1IUKA 2OQRA 2ZU0C 1RM4A 4WOCA 3T3HA 1H94A 3FYUC 1K97A 3I12A 4CI0B 4IG4A 3GEMA 3CZCA 3K35A 3KTAB 3ETHA 2FWRA 4FOTA 1A5TA 4QBIA 4EW6A 5IWAB 4KO1S 1NRXA 5C18A 1F51E 3E9CA 1DOZA 3W5HA 2Y1FA 4I3FA 1OZGA 4JDUA 2CUTA 4PAWA 4KV7A 1HURA 2V7GA 3KSZO 4MAAA 4YR7A 5CA1F 1YCFA 2I1LA 4BN4A 4KWEA 2AH5A 4FX2A 3II6X 1WL8A 4OYLA 4EY7A 1VKNA 3GZTB 5DGCA 1Y3IA 1TZCA 5KS2A 4JWTA 5CTAA 5F2EA 3IP5A 2P6OA 5IG2A 2VF5X 3UWDA 4I50B 5DIZA 1LFDB 3E7PA 4HSGA 4DZZA 3DJYA 2COUA 3I58A 2B8JA 1QHGA 1MO3A 2FCAA 2L42A 3PHCA 1DHRA 3R23A 4HH4A 1V9CA 2B78A 3E5MA 4YP7A 3RYIA 1DKLA 1MRNA 4F1WA 5HILA 1U2PA 5E3JA 4TTJA 4FFSA 4F2DA 4QOGA 3JY6A 1N8TA 3WNZA 2IYTA 2GBFA 4CETA 5YASA 2PRYA 3OQJA 3V97A 2IPAB 2RBEA 3PHGA 1CETA 2O7NA 1V1JA 2O8EB 4E5KA 4EATA 2IU3A 4GL4A 3S4YA 3LY7A 3QYAA 1F5NA 4LHZA 2C2KA 5AW3A 2C2HA 1Y34E 1KXZA 3HBLA 4EBFA 1XP8A 5IRCD 3HXLA 2HOQA 3UJ6A 4YUVA 5BT8A 2JCYA 5AKLA 5DSZA 4EMTA 4HDOB 1UJ4A 2NUBA 1CE8A 4M0UA 1DX6A 1OZAA 5D86A 2PGXA 2V5UA 2DMRA 4IGAA 2OAQ1 1ZH2A 3ADPA 3L8FA 3KOOA 3ZWOA 3RUIA 4UOZA 1SHLA 2B37A 4GNKA 3M6IA 4YT4A 2P9JA 1IHXA 1EBUA 4CDMA 3R6GA 2QZ4A 1XNQB 4KL8S 3OQPA 4BJHB 4C7BA 1J5EB 2R1ZA 2D2FA 3IE2A 1XZFA 3OAAA 3OQ1A 3ADBA 1Y1RA 2WJZB 3K8OE 2WG1A 1T15A 1J22A 3T9FA 2QPTA 1KL7A 4Y9SA 3CLSD 1UJ6A 1TIKA 4IDPA 3ZWVA 3PCTA 5THQA 2IOFA 2GZ3A 5FADA 3STVA 2FPLA 1P29A 2OSVA 3FI9A 3JWEA 3KR0A 2GXAA 1STOA 3F6PA 4B3JA 2OWDA 3WBFA 1YDHA 2OHIA 2RHHA 2OGTA 4QG7A 4XGKA 3WMWA 4PX2A 2I78A 1KPGA 2QGZA 2JIDA 4QSMA 3TQCA 2NMVA 1CBUA 4H59A 1KP9A 2E4ZA 3EEIA 3EUFA 1QR2A 1Z4QA 4Z3KA 7REQA 1A9SA 1BHO1 2F1HA 1O54A 2P5SA 1CUJA 4HWKA 1MC5A 2R2AA 3KJGA 4XUGB 5EMLA 1UT6A 4M1SA 2X0FA 1K92A 4HQNA 4DY4A 1MMFB 1JLKA 3LXXA 3CJRA 4HRXA 4JN6B 1CEYA 3KQPA 3LK7A 1CZNA 3HB9A 2G1JA 2G06A 2HDWA 2BF7A 1X1CA 2JB9A 3FYTA 5G0VA 1TIPA 5K09A 4MX8A 1Z2OX 5L7YA 1XEFA 1T3GA 3EQ7A 3EIOA 4S1VA 5H16A 5D3MB 1KK1A 1LUAA 3UGJA 1JEQB 4I66A 3AY7A 4URWR 1NWCA 1QLWA 1W4LA 3S2UA 4FGWA 4C0KA 5JAMA 5JRDS 2WB2A 4Q3DA 1FPMA 4DR7B 2FZWA 3WNCA 1VB5A 3DP7A 4Z6KA 2WIFA 3MA0A 2PZMA 3K16A 4MKFA 2JLZA 1OR8A 3G0OA 5KNCA 5H1YA 1WV0A 4DS3A 3B78A 3NIDB 1NF3A 3FZGA 5K0FA 2H7VA 1QONA 2XUOA 2JFFA 3GGSA 3NFYA 5DGTA 5D5QA 3TGWA 2RH4A 1HOXA 1XXLA 3KNZA 4D9NA 1SB9A 3C6QA 5LMUB 4OGLA 2F43B 1YWGO 3H3JA 2PKYX 4LJAA 4D4HA 4IF4A 1E2EA 4I7EA 3GZNA 5HEKA 5HRAA 1X7ZB 4J49A 3VO8A 4WXHA 2CFIA 4PNEA 3KLBA 4K26A 3IBYA 4TLAA 3AUTA 5C3UA 3RRXA 2ZIUB 4E31A 3IKVA 5DYWA 3R9WA 4RFVA 5JY1A 3MMXA 3QOXA 4PNZA 3GLIA 4C4AA 1APBA 3CH6A 4EEKA 1ID8A 5JAIA 2ZQ5A 1VGVA 1PQUA 2BSXA 2BM0A 2PRKA 1KDZA 4EPWA 2NO0A 1QCZA 1F0NA 1Y4SA 1YZUA 5KHOC 1FP4A 1P3DA 3IQFA 1C30B 2NPIA 3LT2A 4KQ1A 4J2HA 1TQ4A 1JDZA 3BWVA 3ES9A 5AQ1A 1QQTA 4OOEA 4MKGA 1PEDA 3VHRA 2OOKA 4AB1A 4FM9A 4BVKA 1A97A 3M6UA 1G7SA 4D41A 2FX2A 1W36C 3BZWA 1J90A 3MAAC 3GLIB 4GI1A 3FIUA 1G7CA 1CUCA 1O03A 2VSFA 3TSOA 3EGDA 4WCDA 3P5BA 3N2IA 1ZISA 4P3NA 4ZDWA 1MCZA 2C0PA 5HNKA 4AJHA 1F7VA 1UJ2A 2RAVA 4JLWA 3SQOA 4DV0B 1Q3KA 3TCNA 1Y5MA 3RYFA 1JIVA 3PXGA 1WCIB 4WK4B 4BGVA 5FH9A 4R2HA 1WOYA 1JIQA 2ZG6A 4CMEC 5GONB 1BH6A 1AXEA 1GUFA 5KNBH 2B4AA 1GZ5A 5LKRA 2WFAA 1NMZA 2C1ZA 4X3PA 2IE8A 1ZXBA 2RGGA 3FRJA 5E1MA 3SJ7A 1E6WA 1F1JA 2H51A 2BPOA 2PR2A 1QX3A 3ZBUA 5BVHA 1ZGJA 2YMLA 3D7MA 5EE0A 3PUIA 4W9NA 1E9SA 3BL5A 4K28A 3U62A 1QIJA 1T6NA 3LZ6A 1EXDA 2O19A 2Z83A 1TL7C 3QFCA 1KZ1A 3DFIA 2QN9A 3SWWA 4CTMA 1Z5NA 1R18A 4OHBA 3ZDCA 2B8NA 2O2XA 1ZN7A 3R9IA 2PMEA 5KTSA 3H9JA 4S1PA 2GVDC 1MJNA 1EWKA 2HU2A 2YWXA 3A4LA 2GPNA 3H6KA 3X1WA 1G8GA 2I6QA 3OEHA 4YAGA 3Q8LA 1M8KA 3ZCTA 3NDBB 5DHFA 3NCTA 1A9OA 1BA3A 4FYPA 4NOJA 1TMKA 4ZTZB 3A4YA 1X7GA 3H1TA 1JWLA 1NN5A 4OQFA 4ZPJA 3AGQA 4HAIA 3WLMA 2EBUA 3ESQA 3LY5A 4AIRA 4UVEA 1TF2A 2IUSA 2AC4A 2CL5A 2VZLA 4QQKA 4F12A 2EJUA 2Q28A 5ITVA 2PDAA 3NHPA 3JQQA 2AR0A 1G59A 2V7VA 2TMGA 4EP1A 3BC1A 1U80A 3U9SA 1JEDA 1UKEA 2ORED 5E9AA 1ENZA 1ORRA 4RHXA 2HBYA 4IEIA 3G2HA 1RMYA 3IO3A 5DU2A 2VT6A 4AG5A 3NTQA 1KAOA 3UJHA 2HXYA 4EENA 1R6AA 2YJ6A 2Z08A 4F2GA 4ZO6A 4A8PA 1QG6A 4RJKA 1F8FA 3QXJA 3WI7A 1QX4A 3ZDBA 3QOWA 1B42A 4OLAA 1FNCA 4J75A 1E6KA 1LX6A 3IHWA 3L4BA 1BE1A 2IXEA 4H6XA 3ZDDA 4HB0A 1GPMA 3J7TA 1MLDA 4QUHA 3H1FA 1SOMA 3BRSA 5JAPA 1QB8A 1SCQA 1S0UA 2QF7A 3CZRA 1M1UA 2I6UA 4KKXB 4H4EA 1D2HA 1R64A 3HSKA 2OVFA 3QHQA 2Q50A 1IUOA 1AV6A 3F71A 4OHXA 3CPEA 1NLMA 4AJLA 2WWGA 1QZ3A 1ZRMA 2QM7A 1CY8A 4HDRA 5LMZA 3S1LA 5ALHA 2A35A 3JVIA 2G17A 3RSOA 1KHTA 3CX4A 5EIFA 5TE9A 1ITZA 3D4BA 1EJ2A 3DM5A 3KEMA 3MLAA 1ODKA 3NC0C 1JI3A 3G0CA 1ADGA 1FSZA 3GJYA 1T6BY 3I4LA 4R16A 3K0FB 2Z3VA 5DGIA 4D9BA 5KSWB 1KY5A 1QV6A 3W7VA 3QY9A 1NULA 3K7EA 1EUQA 2BHRA 3L1KA 2P4UA 3EZ6A 1IL0A 2D6FA 3GWGA 3QSYA 3JYPA 1YA6A 5FFMA 1XPOA 1C9MA 2ZI9A 1HMYA 2VP4A 2ZWOA 4ZOBA 3ICVA 3A36A 2ODAA 1LNSA 1L5KA 3W5BA 3WIUA 2OWEA 5CDUA 1RQNA 2O48X 1A9PA 1C7FA 2NUPA 3CUTA 3GDFA 4NDAA 4D82A 5A0TA 2G04A 2ZPTX 2ERYA 2HRDA 4IUYA 5BURA 1E7RA 2C97A 3ISTA 3VISA 2DBVO 1CE8B 5L6MB 1KETA 1QS0B 3GUZA 4N41A 1F9EA 4HZIA 4HWGA 4I1IA 3T3PB 2Z2JA 2VNKA 3WS7A 4OJQA 4KNVA 5FB3A 1UFVA 4DQKA 4QTTB 3OT1A 4XDYA 4IEFB 5CEJA 4UQPA 1M6HA 3AQIA 821PA 2H1VA 1IY9A 2YWJA 1IXZA 2A92A 3AL0C 1R9MA 4H1VA 1KC1A 2BJVA 1DE0A 5LOVB 4ADSG 5J2UA 3GR6A 4E13A 4ND8B 3PGLA 4ZDIA 2YFQA 2YBEA 4CIXA 4X20A 5C81A 3CN9A 2ONYA 2GA8A 4BEVA 2RGCA 3TPCA 3VR2A 3RUCA 4GX1A 4JLJA 1GZ4A 2FPRA 5COQA 1XNJA 3VX4A 4DXHA 1JR6A 2QTCA 2FOIA 4QPJC 5AM1A 3CF4G 1AK9A 3OQMA 3CINA 3ZPXA 2NSYA 4LZOA 1SIWA 3PTAA 3IQHX 1P1IA 2IY9A 1IZYA 3C3YA 3HDJA 3U4QB 2IHYA 1WZEA 2VRBA 5T5QA 2QQGA 2J7PA 1Y8AA 3T7EA 3P2MA 4PSUA 5EIAA 1YRAA 4TROA 1KTVA 4CT0A 2VPTA 3IPAA 3K1AB 4J1SA 3HM2A 4NK5A 3FOFC 1H4VB 5FA8A 1BDJA 2CL0X 5HGJA 2JKYA 2ASVA 3K6SA 1I2ZA 1M2OB 3QEAZ 3ZV3A 2F3TA 2FG5A 3GP3A 2X9NA 1KQFA 5JVDB 3GJRA 1J0EA 8OHMA 4HYYA 1VE9A 3H5VA 1J8VA 2PUGA 4DLXA 4BMDA 3OBIA 1MV5A 3O8OB 5IABA 3KVNA 2M98A 4GLJA 4OQPA 4IX9A 1MIOA 3QPUA 3S55A 5T64A 5A2GA 1L5YA 3RF6A 1NN1A 3OLQA 1LKZA 4IDNA 5TQ2A 2ZZNA 3IQZA 4I1SA 1UOOA 1XQ6A 3ZTTA 3EZLA 1QOZA 1XTRA 1GPAA 1TTHA 4IXMA 4C7OB 4PG7A 4CMEA 1F17A 2GZMA 5TS3A 1ZY2A 1KO1A 3J81k 4OG2A 4E4YA 2RK3A 1C3VA 4UPDA 3DGFC 4YGYA 3WLFA 4DILA 2ODPA 1HMPA 3TOXA 1XZBA 3RU7A 4TGLA 4C0JA 4D80A 1AY0A 4TWAA 2H85A 4G1UC 2NT3A 3FE2A 3SQMA 1VTKA 2QIPA 4GT1A 5KDDA 2H1WA 3Q10A 1GZDA 3O8QB 1PR4A 1U7OA 4OK5A 4OQYA 1HSOA 1ONBA 2XNJA 1EB8A 4CLOA 4HXYA 2FJ0A 4QZVA 3I62A 1Q77A 1YZKA 4CR8A 4OU4A 7AT1A 5KYUB 1ZL0A 1EQAA 2WG0A 2FHSA 3BTUA 4DJAA 1L4LA 2DPXA 2Y0BA 3AR6A 1YA4A 1U2RA 4W1QA 3DL4A 3EIQA 3F7MA 4EF4A 1R0CA 3H5NA 1I14A 2J08A 4KN6A 4UVIA 2X14A 2IBSA 1FP2A 1GU7A 1M7GA 1HDOA 2H11A 3C14C 2HB6A 5G0WA 4KN5A 1WDLA 1B2RA 4FLFA 4TSFD 4U8HA 5DPMA 3UB4A 2QZZA 2GJ4A 4B7XA 1ZNYA 1Z37A 2H07A 3C5EA 2IIPA 4OX9Y 1VKRA 4N6GA 3SJCA 1RI4A 3RABA 421PA 4MA4A 2Y1EA 3CZ4A 5ICSA 1DTWB 3ICCA 3GO4A 1OLSA 4GH5A 1MOZA 4IVPA 1UQTA 2OLKA 4H3VA 1JDTA 3KTFA 5JU6A 3V8BA 4AULA 3PFGA 2EAUA 3THWA 5FLEX 1JQEA 2QR3A 3GDHA 1QFSA 1N57A 4G0NA 3OCZA 3B9PA 3G82C 1CCWA 4FJ2A 1N2IA 3JXEA 2QRQA 3LZDA 4R71A 5KTPA 3LWZA 3GA7A 3H5IA 2A9RA 2WSMA 3SLRA 2WU0A 5JOQA 1RYZA 4O63O 2J9FA 1CIPA 1Y9AA 2W5UA 3PQCA 4I1RA 4U0JA 3RAPR 4I8XA 4AJOA 3OZBA 4HL6A 4TLMB 3ZXXA 1JQKA 2XHZA 1ABBA 5JIBA 3DBVO 1R5BA 3DAHA 3H2GA 3NDPA 4OEHA 1FY2A 5C1DA 2WIAA 1OUMA 4OU5A 1NF8A 1EFRD 1NVVR 1OTYA 2YDYA 3D9QX 3LBAA 3SZMA 2QVYX 1KRXA 4H0NA 2CMHA 3IEXA 3VNRA 3TR6A 4K0KB 4Q24A 3CLVA 1RFLA 3TOCA 1P18A 2DT5A 1LPSA 3L04A 3Q8XB 4S2UA 3OICA 4DV5B 3DLPX 4F3NA 3AINA 2XHEA 3DEZA 4KFCA 1YSCA 1JPUA 4WV3A 2W2QA 4A8TA 1VE1A 3M3PA 3PPYA 1TLLA 3AKZA 1JH9A 3FWZA 4BDSA 2OO5C 1RRFA 5LCXA 3T7SA 3TJRA 2C7VA 9GPBA 4MWSA 1U9IA 2PE5A 5ER6A 4DBVO 1XMQB 1GEGA 2C9CA 2CDNA 3QKTA 3ZWXA 5AVWA 3CNNA 2P90A 3NG1A 2OYSA 4YXFA 2ZI4A 2HSGA 2ANCA 2I3GA 3WB2A 3OZDA 2R86A 2GILA 2NVOA 1O96B 1UEXC 2HL6A 5EIBD 4LYHA 5FUYA 2HO4A 3GGJA 3V9AA 3WK4A 5KQGA 1A5AB 2PJRA 1TYDE 3UMJA 2C8LA 3Q5EA 1XAJA 3W5DA 5J23A 1U7WA 4LW8A 3EXEA 1M7BA 3Q9SA 2Y67A 3ZU2A 3C1OA 2B20A 3B7GA 1MJ5A 4WADA 4XVQA 4YGXB 4MUEA 3U3JA 4EQ6A 4V1CA 2H31A 2Y9PB 3P7MA 4B4WA 4J9UE 1VLMA 2FVYA 4KTTE 2EX4A 4OQNA 4C6SA 1A4UA 1YKGA 2OBYA 4N8DA 1R0ZA 1K66A 2B1IA 1ZMOA 2V5VA 3I37X 2OR3A 4L8FA 5BW5A 2ODQA 3ZE9A 5DBEX 2YYZA 3WGNA 2FMHA 5CVUA 1KJJA 3RSSA 3UPDA 1FP4B 4YDQA 2B34A 3PQ2A 1HG1A 3K96A 3M6AA 1PJZA 1CF9A 4U7GA 1ZIYA 4QM6A 2WAMA 1X7HA 2E85A 2HA0A 4MLPA 5ARCA 1HXHA 1UM8A 1KGDA 4ALIA 2UZ3A 4UMFA 3LE8A 1ZAYA 3MJ4A 3TAUA 5F23A 2F3UA 2X0IA 3V8NA 1XRLA 2P9GA 3NTOA 4UPVA 2OCYC 3R3VA 4O6VA 5GGXA 3V1YA 4AG3A 1FFAA 3INTA 4GEKA 1QZZA 1OTXA 1XF9A 5FCDA 2CBGA 4GRIA 3RIHA 3PJRA 3DE6X 2PKXA 3N28A 5AKJA 2XZOA 4B31A 5JQGF 1CIJA 4US1R 1GTSA 3MJTA 1BHJA 2J0EA 3P96A 1F12A 2O9JA 4YFVA 3NBUA 4QYSA 5K3OA 1DGQA 2I2WA 3AHGA 5KYYA 3AJAA 3ZIUA 3IIIA 2FN9A 1EBBA 3ZG6A 1CS0B 1ZKDA 2VCYA 3NEPX 4EQ6B 4FFWA 4QBHA 4HHEA 4KB5A 5DT9A 2H9AA 5BRNA 1G17A 1C7RA 4HEA1 2P2YA 2AYZA 4IHJA 1H5UA 2HIHA 3W6ZA 4M0CA 2MMCA 2QLBA 4OL9A 1G3MA 4ILEA 1K6MA 3KKEA 3MTBA 3OQ6A 4TMXA 3GFQA 3LYHA 4EJ0A 1G8PA 1U8FO 5EJ8A 1YR9A 2DFLA 4IVQA 2QYHA 1W96A 4NJEA 4ZVTA 4MV7A 2QJFA 4E1AA 1SXPA 2Q3DA 1Q21A 5LXTA 3LVFO 1BD3A 5KQRA 4GLBA 4JHLA 4JL6A 1VGQA 2DE0X 2BSAA 3QVSA 3H2BA 4KR0A 1LBEA 1FXSA 3A1DA 4G26A 1ECBA 2NUTB 3ICPA 2NSHA 3VVCA 4BJ1A 1O0SA 1UJBA 3PQ3A 2QZ9A 3NVDA 1NJSA 3LCCA 3BJZA 2C5EA 3HI6A 4JODA 4YLGA 3VZCA 4DRXA 2NGRA 3E2IA 2GN8A 3EEYA 4FHCA 5KNDD 2X5XA 1RAGA 2C00A 3H0KA 2FRVA 1KYIA 4FFLA 5JFTA 5ARDA 2IV3A 3GLIE 1PNQA 1Q0TA 1AXRA 2UVDA 3KYDA 5CM9C 5G40A 4QYXA 4WNCA 3HN2A 1FTWA 3L6EA 1EG7A 4REOA 3C3CA 3WAKA 2DU8A 1RFGE 5ALTA 1NI4A 1CYDA 3A4VA 3VAAA 4DJFC 3IFSA 2WJJA 1ZA1A 4G0WA 2PZKA 2NTEA 2VBFA 4ZHQA 2ZDGA 2P9CA 4LZZA 4LYJA 4FOPA 1M0WA 3F3KA 2BWJA 1I7LA 3WKBA 4ZAYA 1GADO 3ADCA 1BA2A 3A3PA 3E3MA 4KLNA 3G5LA 4IIJB 4XYBA 2OC4A 3W7AA 1ZCBA 4ZANA 2Z6AA 3R3UA 3DT6A 2CCJA 2HIMA 4GE0A 3WGOA 4KQEA 1OFHA 1OYYA 3UNXA 2HPVA 2P8SA 5P8WA 1ZUNA 1DBQA 5SY9A 2PEZA 4GGPA 5E38A 4DMLA 2VDWA 3U7QA 1ZZGA 1QO0D 2WHPB 4OCZA 1K6JA 1WXQA 1QHSA 1JUDA 2O1WA 2WJVA 4QC2A 2Z5LA 5D8DA 4WBNA 2O2EA 3S70A 3COSA 3RYHB 3FFAA 3A31A 1FLAA 2BR4A 2VBCA 2Z2ZA 4ZZ1A 5IMSA 1ZLXA 5ALUA 4EFDA 2CV0A 2DR3A 2DHQA 5BOSA 2DUNA 3DDOA 4Q1CA 3X43A 2UKDA 1PR0A 1UEIA 1JSZA 1JF8A 2P5TB 2IGBA 3UV6A 4GMDA 4ZEOA 4C20A 1J0AA 1XVVA 2LP4Y 4P33A 5KYUA 1UBNA 1E2FA 5ALOA 3UK2A 4LGCA 5ADHA 4AWAA 2XDAA 4YRQA 5JXWA 1D09A 1TM5E 1GQRA 3IMEA 5E7JA 5IYZA 2XI4A 3FJYA 3V8RA 1TCVA 5CB4F 4A2CA 1B8NA 2QRVB 1JWBB 1W0KA 2NU6B 2ZYSA 4N0PA 5JCZA 3OU6A 4GL2A 4D25A 3AEUA 3WVNA 5BNWA 2D4AA 2ZBQA 1ACLA 2HRZA 1H2RS 4KQFA 3ZHSA 4DJEC 1H2XA 1PYOA 4HLQB 2QBYA 1TYZA 1EP1B 4H1WA 3WAJA 3D7KA 1H69A 2IBMA 4UMVA 1Y4ZA 4IF6A 1T35A 4DIFA 5JYDA 3C7AA 4DQ0A 5CB4A 5ADWA 3S8MA 2CXUA 2WKSA 4XX1A 3COZA 1E2IA 2X4DA 1C0EA 2D5AA 2XNDD 3GU3A 5GAJA 1NM5A 3I4CA 4BRWA 3HYLA 3MYYA 5A5EA 2EYQA 5BUQA 4KE8A 1RYMA 2F00A 1HI9A 1OA0A 2AX3A 3JQBC 3OIDA 2UZ1B 3LOPA 4BGDA 3FB1A 1VB3A 3FCCA 3HCBA 1HNZB 1JU3A 2OXRA 2XOKD 2XZPA 3KS9A 4BNGA 4PYIA 4BNDB 3DVLA 1AZSC 2Y1OA 4LJ9A 1CQIB 1BKYA 4XE5A 4N47A 2J3KA 2ZBEA 1ZNZA 5L3RA 4YRFA 3WY9A 2ZIAA 3ZJVA 1R4ZA 1ZHHA 5DBIA 3ZDZB 5JVDA 2RKWA 2QOEA 3NBQA 4Y98A 1E94E 1VPVA 2A0FA 3BE6A 4IH1A 5GQSA 3RBVA 3SZGA 3W3ZB 4Q1VA 3DCNA 2QAGB 4JB8A 4NFYA 4C4XA 4Q6BA 2FZEA 2GAJA 1RCFA 4KXYA 1XV5A 3VJKA 2E89A 1YZ3A 2HCBA 4DA0A 4CEJB 3IIMA 3RS8A 2X3YA 3FDXA 3QVKA 4XSHA 3D7LA 3ZJUA 1M6VA 2CUZA 1J2TA 1SXJA 4L02A 4RDCA 4O2AF 4M2LA 5F2OA 1QP7A 1GRNA 3H4MA 4XARA 2F1JA 1XDSA 1SXHA 2YRWA 2YW2A 1EPUA 3MW8A 4R9SA 2YWRA 2F4NA 3LDGA 3ZWPA 3EZ9A 3LKZA 3G0BA 2E5LB 2GAFA 1OH6A 3ZH2A 2PD4A 2HLNA 3AO0B 3LNCA 1Z26A 2PQ0A 3PXBA 4EB0A 2FX5A 2QDXA 4ZJYA 1QCDA 1ZN8A 5LQCA 3UC5A 2W58A 1GTL1 2CYCA 2WLTA 4KOEC 3SICE 4GOMD 3U3ZA 1A2KC 1I2BA 1V26A 3G8CA 1REQB 5EJ2A 4ZQEA 4JOCA 3WGVA 2ONJA 4DG8A 1R0LA 2QUIA 3E27A 4GIBA 5FJIA 1CDZA 4UUPA 2QRVA 4UE2A 1NHGA 2ZSBA 1D2NA 3GNTA 3IQIX 3ZVKA 3PXUA 4LY3A 1MB3A 2J4FA 5AO9A 3WZLA 1LD3A 3OO1A 4OB8A 2X2EA 1AZWA 2OP1A 3BWMA 2VTDA 4XI9A 3U09A 3GLKA 5KNCD 4HCJA 4FNGA 2VNHA 2GJ8A 1WM1A 2AR9A 3DE1X 3QWHA 4LRUA 1RRKA 3CWCA 4P1ZA 5IS2A 2DLCX 4HH0A 1U94A 3O38A 4J91A 2PS9A 3OBBA 4PYRA 5DTIA 5J4HA 5LQAA 3N76A 1NJ2A 3SIPA 3K0BA 2ZQZA 4JXKA 2G3YA 3FDIA 3ER6A 1HQYE 3VV3A 1JIXA 2QV7A 3WMGA 3T3MB 1U7TA 3OPYB 4O4HF 2RHMA 3HZZA 1GR0A 4IBOA 4D92A 1TCBA 3HI4A 4YV2A 1YQXA 1TTQB 1K2WA 1EM8B 1W5AA 2D8MA 2O2YA 1LSUA 3LBFA 3O73A 5TVGA 2H2HA 3R7LA 4YO8A 4B83A 2YZ7A 3WG9A 3ROEA 4K6FA 4A6DA 3C70A 5A6SA 3IPCA 1BROA 3NUZA 3A9VA 3LYUA 4NZ9A 2XDQA 3VDMA 1RM0A 1MX3A 5EJ9A 3WLJA 4KPEC 1FF9A 1CD5A 2CFTA 1YXMA 1TCCA 1X7YA 2A9FA 2XMQA 2MSWA 4P92A 3B9QA 3KQNA 1OWMA 3TDKA 4MQLA 2PFGA 4M3NA 1A9XB 4A0RA 4BUJA 5LZ4A 4DBLC 1PFWA 4GR9A 2BI4A 3QKRA 4V03A 4XWWA 4RETA 3OIYA 1TUBA 2GXUA 4MWDA 2FWBA 2HTFA 1N3IA 2QA5A 1QDEA 5J5VA 1EUYA 4Q7MB 4LJLA 4XYMA 5A4AA 3RLFA 3VUEA 4D74A 2R48A 5A3JA 2P69A 1N1GA 1VRVA 2J3HA 2BDTA 3I34X 3I4FA 1MH1A 2O7RA 5B1DA 5C4IA 1NQ5A 4DZTA 1ZAKA 2WZQA 3SZOA 4EMBA 5K5EA 3L4EA 1ZSNA 3AG6A 1WVIA 2FH5B 2XJ9A 4BNDA 4CLDA 2MSNA 3WYGA 2TMDA 3C98A 6GPBA 4W7IA 2JEOA 3QA3E 1NN0A 1PFUA 3QTBA 4BQNA 4ZVNA 2W00A 3ESCA 3IO5A 3L06A 4G9BA 4JA0A 4PLFA 5DSTA 5FKJA 1P31A 5CLFA 3ZVRA 4URFA 1OH8A 3RUPA 3KKZA 3CEMA 4WLEA 4LVNA 4MUKA 4QGHA 2G40A 2R6HA 2APJA 3NUQA 4MHSA 3IEVA 3CNOA 1TQ6A 2YYAA 3HFGA 4XWYA 4D43A 1YQQA 1BXRA 1Z4NA 2HJVA 2I2BA 5LJLA 2PQ6A 2RB4A 2BZ1A 2A4MA 4DRXB 3U0VA 3CLKA 1EX6A 5EXEA 4AZ0A 3KB1A 1BX0A 4L9RA 4WUVA 4KPUB 3MRVA 4M37A 1G6KA 1O95A 1TUEA 4WLVA 3IVGA 3GT4A 1T0IA 3ZQ6A 5KYYB 4FVTA 2JLQA 4R1LA 4AWXA 3R9KA 2DETA 1H3NA 5A1JA 1JDVA 2GHTA 4ZT4A 4F4HA 2BYTA 2VUUA 3PGJA 7YASA 1S01A 1DC6A 4Y2QA 4KWCA 4PC7A 5A3VA 3BTVA 4TV9F 1PUXA 3ZQUA 5CU7A 1MNQA 1KI8A 4YECA 3ZD6A 5JMTA 1F8GA 3CWZA 2VNIA 3EG9B 1OWNA 3PFCA 4UKDA 4M0MA 1LLQA 1GGEA 3BXZA 5EMHA 3TD9A 3IT0A 5BSKA 4YC7A 1PZHA 4C4RA 4MZXA 4NICA 3QFRA 1DAEA 2F1KA 2QX7A 2ZUWA 3D3EA 1TXGA 4O2BA 1YD7A 3DCYA 4LK2A 5CGQB 1A2BA 3USES 3WJ7A 4KITB 1HEUA 1PZNA 2IYNA 1W36B 1T10A 4FE3A 2AW3A 2A9PA 1WMEA 3U37A 1K68A 4E5SA 2AFVA 3VKWA 3C7CB 2C4KA 3CGGA 2RGEA 3FKSD 1KSHA 1GWNA 1QO7A 3OG9A 2ZB7A 3OMXA 1HDCA 4LX0A 1I4DD 4RIFA 5AHRA 3RVMA 2FI1A 3WKEA 2PXXA 3SEZA 2Q6VA 3QF4A 4O2BF 3FM9A 1EHIA 4XUCA 5BXYA 3KB6A 1CUXA 4Z9AA 4OKIA 1HA3A 4JBNA 4ZVPA 3GHYA 1H3FA 1TYEB 5A7HA 4AJ9A 3AKDA 4TLLB 4OHWA 4CQNA 1C30A 4MV0A 1VSBA 5P21A 2NV0A 2V59A 3KT6A 1FNSA 2WP0A 2QP9X 2WUDA 3VKFA 4BZPA 2PG3A 1U8UA 3HDQA 2PFKA 1O2DA 2CB9A 2WIKA 1A72A 2J07A 4AUEA 4X1KB 5EMJA 5JTUA 3ABOB 4A0SA 3UWMA 3SYTA 3F96A 4Q4AB 1FFHA 1PJCA 1WXXA 2I8CA 2AR7A 2VBGA 1HV8A 3DXZA 5D2CA 3K4HA 5CBKA 4KXWA 2Q8NA 3LQKA 4JZYA 4QXRA 2XH8A 3L8DA 1EK2A 4X8MA 4Y2RA 3KJQA 1LLDA 4R6WA 1CY2A 4CU5A 3E9NA 2P0YA 3NC4A 4HZGA 1SVUA 2HNKA 2R8OA 2W71A 3AW9A 4U2EA 5EXTA 1M73E 1R10A 3DOFA 5CIQA 5AOVA 5FBWB 5FI1B 4A2QA 2GM4A 4S0ZA 4DR2B 1K8RA 4PNHA 2G25A 4I4LA 1NLUA 4RF2A 2K7FA 3UTCA 2HR1A 1T2FA 2FZGA 2W6ZA 4WOBA 3PNYA 4L73A 4RTMA 1J8MF 2R7LA 2P9EA 1Q6ZA 2NAPA 1PVVA 2RAPA 1NZFA 4HI0E 4LSZA 1M1NB 1RMTA 3R77A 2GRAA 3S29A 4Q47A 4PYQA 2FRXA 1EUDA 1WW2A 5HOEA 1NBEA 1Z2PX 2HIGA 2HCTA 4FC7A 3NXSA 3OSZA 1ZH6A 3ZU4A 3EF3A 4D0SA 3EC1A 5HCNA 4PC1A 3HSSA 1ODJA 3HS3A 2XNSA 2Q4DA 3SZRA 3DDCA 3QX7A 1N5MA 1IBLB 5ICGA 1JG3A 5FO0A 5FX2A 1ZEMA 1GGFA 1P0MA