3DXYA

Crystal structure of ectrmb in complex with sam
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
207
structure length
207
Chain Sequence
HALENYWPVMGVEFSEDMLDFPALFGREAPVTLEIGFGMGASLVAMAKDRPEQDFLGIEVHSPGVGACLASAHEEGLSNLRVMCHDAVEVLHKMIPDNSLRMVQLFFPDPWHKARHNKRRIVQVPFAELVKSKLQLGGVFHMATDWEPYAEHMLEVMSSIDGYKNLSESNDYVPRPASRPVTKFEQRGHRLGHGVWDLMFERVKLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Monomeric tRNA (m(7)G46) methyltransferase from Escherichia coli presents a novel structure at the function-essential insertion
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords tRNA (guanine-N(7)-)-methyltransferase
total genus 63
structure length 207
sequence length 207
ec nomenclature ec 2.1.1.33: tRNA (guanine(46)-N(7))-methyltransferase.
pdb deposition date 2008-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02390 Methyltransf_4 Putative methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3dxyA00
3HEMA 5MHTA 3O7WA 5E1MA 4E2ZA 1R18A 5EEGA 5EQJB 4BLUA 4E31A 4HC4A 2G70A 3NW9A 4Y2HA 1NW6A 2AN4A 2VDWA 1JQ3A 1X1CA 3CKKA 3LECA 4U7TB 5EKXA 1KYZA 3GCZA 4Z2YA 3LDUA 4P7KA 3PB3A 3HCBA 3OU6A 3SSMA 2GAFA 3CBGA 4RTJA 2OXTA 4E70A 2OYRA 2NP6A 1YB2A 2VDVE 3GGDA 3HNRA 3VYWA 4OBWA 5E9QA 5EHIA 3PVCA 2BR3A 5DLYA 5FQNA 3LDGA 1V39A 2NXEA 3EVBA 3NWBA 3QOWA 4OQDA 5DT2A 5GM2A 1OR8A 4MIKA 4ATNA 2Z6AA 1KPHA 5HILA 3SSOA 2VP3A 2HTEA 2AOUA 3HA5A 4QDJA 3LKDA 2IFTA 4U7PB 2OB1A 5U4XA 3ER8A 3VSEA 4DF3A 1P1BA 3EMBA 4PYOA 4RTKA 4KDCA 3EVDA 5E9JA 4YMGA 5CCBA 2PJDA 1KHHA 4IWNA 5LQCA 1X1BA 2QM3A 3GJYA 2N47A 3LGAA 4DCGA 1VQ1A 5LR6A 5FULA 3LCCA 2PXCA 1NKVA 3EGEA 4XUEA 1RJEA 3TR6A 1IY9A 5FA5A 1SUSA 4YUZA 5K0CA 5BXYA 3TPZA 3T7SA 3O4FA 2Z6UA 2B78A 2O57A 3B7PA 1NBHA 3A7EA 1NT2A 2CKDA 2XVAA 4HG2A 1G60A 1XCJA 5E9WA 5EGSA 4EMSA 4XUCA 3G88A 3THRA 2PX5A 5KVAA 4YUXA 1NV9A 3AXSA 1D2CA 1ORIA 3G2PA 3F4KA 1PJZA 1BHJA 4RTQA 4OBXA 1XDUA 3ME5A 4PIPA 2Q41A 5E8RA 4EKGA 3PFGA 3UA4A 3OCJA 3FTCA 3A4TA 2VS1A 4C08A 1N2XA 1JSXA 4KW7A 1KPGA 2CMGA 3P9NA 2BR5A 5BP7A 2IP2A 5KS2A 4HTFA 1JTFA 3M6WA 4ZTBA 5K0LA 2PLWA 3TLJA 3ERCA 3UJBA 3C0KA 3P8ZA 3ER9A 1R6AA 1JQDA 2EG5A 1ZHFA 2GS9A 2JJQA 3THSA 3DUWA 4MWZA 5JR3A 3UJDA 4CTJA 3MCTA 5EHGA 3OFJA 4M38A 3FUVA 2HNKA 3V8VA 1L9KA 4GUAA 4EK9A 3KR9A 3R0QA 4IKPA 4M7RA 1G38A 2QE6A 1UFKA 5D1NA 4E30A 5F2NA 5EMMA 3G5LA 1R00A 4AZTA 1JTEA 1XJ5A 3ID6C 5EZSA 3UZUA 2PV0A 3E8SA 2PGXA 3Q7EA 3MQ2A 3P2KA 1FBNA 2ORED 3CJQA 3CJTA 1BC5A 3I5UA 3BKWA 3P97A 5FTWA 3VC2A 4A6EA 1QAMA 1XDSA 5FUBA 3LBFA 5CVVA 1KR5A 3JWGA 5T64A 3EGVA 3OPNA 2ZULA 5DSTA 2HV9A 3KQSA 1MHTA 5CVDA 4RTLA 3LCVB 5ICGA 3GRZA 5HIKA 3MTEA 1RI5A 4PINA 4B17A 5LQNA 3MHTA 3GRUA 1KXZA 3BGIA 1YFLA 3MB5A 3OE5A 2OO3A 1VLMA 3KQVA 3CC8A 4QVGA 4QTTB 3UA3A 5ICCA 2I62A 3HVHA 4FSXA 3JWJA 1RI3A 3FPHA 4K6MA 4CKCA 1WS6A 2ADMA 4C05A 5K0EA 1R74A 3EEOA 3TM5A 2JH8A 3TOSA 1L1EA 5K0NA 1WXWA 3SR4A 2FK7A 5F2KA 3B3FA 3M4XA 3SMQA 4ER0A 3BGDA 3LPMA 5M5BA 5EVJA 3B3GA 4R6WA 4ER3A 2B9EA 4C04A 3ELYA 4FP9A 5FWAA 9MHTA 4CKBA 3PT9A 3H2BA 4KRGA 2AR0A 5K09A 5EPEA 1IXKA 1D2GA 2GLUA 4BY9E 2EX4A 3FRIA 5GOZA 3RODA 3JWHA 2IH4A 3ELWA 5T67A 1ZGAA 1X1DA 3GNLA 2R6ZA 5EOVA 3REOA 2HMYB 3UWPA 3AWIA 2HR1A 4ER6A 1UWVA 2F8LA 3KR1A 5EMLA 3LDFA 1N7JA 1NW5A 2GPYA 3CGGA 5K01A 4DA4A 5E1BA 3UJ6A 4ER7A 3S68A 3CVOA 1NW8A 1WG8A 4AX8A 3R6TA 5LQUA 2G71A 1RI1A 1T43A 3G5TA 4RTNA 3BKXA 3EPPA 4F84A 2P3LA 2YTZA 1ZGJA 4CKEA 2H00A 2EFJA 5E2BA 10MHA 2P7IA 4EQZA 3BWBA 3UJAA 2YXLA 4LG1A 2AN5A 3DXYA 3IEIA 3AXTA 3CJRA 5FHQA 1YF3A 4GF5A 1RI2A 3FTDA 2GB4A 3JWIA 4LWPA 5EZQA 4RTMA 3EGIA 2YVLA 5LQKA 3HVJA 1DUSA 5EKUA 4RWZA 1JG4A 3KU1A 4FS8A 5FWDA 3V97A 4CXMA 2IIPA 3FTFA 3HCDA 4X61A 2IGTA 2XYVA 2IBSA 3CCFA 2C7QA 2P7HA 3HCFA 3G2QA 5K0GA 1X19A 1WZNA 2IDKA 5F2OA 3BXOA 3KKZA 5EMKA 3GO4A 4PCLA 1EAMA 3UJ7A 1L3IA 2PXXA 3KQPA 2EJTA 2V7EA 3B5IA 4IV8A 2CWWA 5DRYA 2FPOA 3P2EA 4FT4A 4GC9A 1D2HA 3NDIA 2PX4A 4PGHA 3RIEA 3I53A 4ER5A 5FHRA 1YFJA 5G02A 3NVKI 4GOMD 5HIIA 2CMHA 5EMJA 1SQGA 1VP9A 3G2MA 3M6XA 3E23A 5E2AA 4CTKA 2FRXA 3G8AA 1VBFA 3TQSA 5LSAA 2OY0A 3K6RA 5GINE 5GIPE 2GH1A 2UYQA 2YR0A 5GP1A 4BP1A 2G1PA 5DXAA 5DXJA 2Y1XA 2PBFA 3FYDA 1XDZA 2ZTHA 3P2IA 5DX8A 1O54A 3ELUA 4RVHA 2BM9A 3SX0A 8MHTA 1U2ZA 3FPJA 2IPXA 1AV6A 3B89A 4X63A 4WXHA 3GRYA 1JR4A 4LECA 3DTNA 2O0LA 1WXXA 1AF7A 1SQFA 3A25A 2ZFUA 4NECA 5C9ZA 2O05A 4RX1A 1I4WA 1KYWA 4PYKA 2PT6A 4EKIA 3C3YA 5LQRA 3E05A 1XCLA 4Y30A 4CWAA 1SVUA 5CVEA 5DRTA 4DKJA 5KQRA 1BOOA 4HRAA 3HM2A 4RTSA 5HFJA 4BLVA 2P40A 4PYQA 5BW5A 3M70A 4R8SA 5IH3A 4UOEA 1Z3CA 3GRRA 2FCAA 4AUKA 3C6KA 4KIGA 3WSTA 1NW7A 2BM8A 2VZ9A 3X0DA 5CVUA 3NWEA 4M37A 2P8JA 4RSRA 2ONYA 3HTXA 2PX8A 2QRVA 2YXDA 3R24A 3KR0A 4JXJA 5DSXA 2AN3A 2OBFA 2WA1A 4PYMA 5CUQA 3FYCA 4PONA 4QQKA 4RYLA 1NBIA 4AZSA 3GWZA 5CD1A 4O29A 1YUBA 1HNNA 4IV0A 4PYLA 1EJ0A 1VP3A 1RJDA 3KR2A 4GQBA 3KQTA 5DTRA 3T0IA 3PFHA 5DPMA 5P8WA 2OPBA 4C07A 3B3JA 4QPNA 5ICEA 3PLAE 4PCAA 2O06A 4KWCA 5GM1A 2H1RA 2A14A 1JSZA 4A6DA 3ORHA 2AOWA 2ZIFA 2ZZNA 3DLCA 4G56A 2ZWAA 5K0JA 3FTEA 2QRVB 2P1DA 3NJRA 3TKAA 3UJCA 1I1NA 3LHDA 3KQQA 4HGZA 2ZW9A 1X1AA 1PRYA 3OZTA 4H0NA 4R6XA 3UFBA 4MTLA 1L3CA 1VL5A 4PGGA 1FJXA 3RW9A 1XTPA 5T6BA 1F3LA 2XBMA 3OZRA 1NW3A 1UIRA 2JG3A 1BKYA 4GEKA 3NTVA 2IH5A 3ELDA 3SSNA 4DCMA 4RTPA 1EG2A 1JG1A 1FPQA 2XYQA 1ZQ9A 5KYGA 4FGZA 7MHTA 5D1HA 2AOTB 2WA2A 2AOTA 4V0RA 3M6UA 5DTMA 2ZBQA 3TM4A 2PVCA 4X41A 3TKYA 1JG3A 2ZIGA 3EEYA 1F38A 3NDJA 4DZRA 1G8AA 4E32A 4F85A 2NXJA 3EVFA 5K8VA 2ZBPA 4MHTA 4PIMA 4PYJA 3DR5A 4R05A 4PNEA 5HOQA 3D2LA 3MGGA 4HTFB 3ANXA 4RV9A 3DULA 2WK1A 5C0OE 3FUUA 4RVDA 2AVNA 4YUWA 2C7RA 4X1OA 4P7FA 3EVGA 1ORHA 3MCZA 3DOUA 5K03A 4RTRA 4YUVA 3VC1A 3R9XB 5FA8A 3HCEA 4AZWA 4HGYA 3M33A 2G8NA 1SG9A 1R8XA 3HP7A 2FHPA 4EVIA 2I6GA 3PS9A 5DTQA 1QAOA 3KPUA 2ZBRA 4YV1A 3BWYA 4F86A 2ERCA 2YXEA 1VPTA 4V0QA 4MQ4A 4RTOA 3A26A 3EMDA 4GOOD 3C6MA 1G6Q1 3P9KA 3IHTA 5DM2A 3PX3A 1XXLA 5K0BA 1TPYA 1G55A 2FYTA 3IV6A 4GBED 2EJUA 1M6YA 4QQNA 5DM1A 3LL7A 3UJ8A 3OU7A 4PYNA 3FUXA 5K0FA 3R3HA 1VIDA 1QANA 3HA7A 1NE2A 4LWOA 2PXAA 3AJDA 3T7RA 2UYHA 2G72A 1NV8A 4GC5A 5E1OA 1RJGA 3TFWA 2I9KA 2IBTA 3TRKA 5BW4A 3DH0A 2FK8A 2IDJA 4DQ0A 4POOA 2H11A 5CVJA 1TW3A 3FUTA 2JHAA 3DXZA 3PX2A 3QV2A 4RVGA 2PWPA 2ZWVA 4KDRA 1WY7A 2KW5A 5DM0A 3SGLA 3PTAA 3G7UA 3I58A 2OKCA 3EVCA 1ZKDA 3TMAA 3HCAA 3FPGA 4PYIA 4R8RA 2ZVJA 3T7TA 2K4MA 1HMYA 1P39A 3DMGA 1KIAA 2AOVA 2AS0A 1G8SA 2ONZA 4KIFA 3LKZA 2DULA 2P3OA 2OB2A 2I7CA 4P7GA 4WVLA 3OE4A 2YUIA 5GWXA 1N7IA 2XVMA 3GIWA 3DMFA 5EIFA 5DX1A 1IM8A 5B1SA 3C3PA 1QAQA 2QYOA 4X60A 5DM4A 1XVAA 5LQAA 3E7PA 4OA5A 3GU3A 3KQYA 1P91A 3P71T 3Q87B 2E5WA 3NVMB 4QDKA 3I9FA 3DLIA 3KQWA 4C4AA 2UZ4A 3L8DA 1VE3A 1M6EX 5FADA 3SM3A 1M0EA 4OQEA 4YMHA 5HZMA 3QOXA 2ZLBA 4FT2A 2P41A 1Y8CA 2B25A 3SXJA 4YV0A 2B2CA 3BZBA 1FP2A 3SVZA 1H1DA 4YV2A 2C7PA 3FRHA 5EIWA 3UJ9A 3KPVA 2JHCA 5IKMA 4P58A 3O31A 5DWQA 5ICFA 3G8BA 4FZVA 4HSGA 3BWCA 4YUYA 2DPMA 2PX2A 3BT7A 1O9GA 2Z6QA 1RI4A 1FP1D 4C06A 3FUWA 3FZGA 3LSTA 2B3TA 3FPFA 3M6VA 2ESRA 4XUDA 5ERGB 1QZZA 4BLWA 4KVZA 1P1CA 5EC8A 2ZSUA 3A27A 5FCDA 4AZVA 2HWKA 1YZ3A 3BUSA 1INLA 3DXXA 3EVZA 1QYRA 1ZG3A 3OFKA 4FR0A 3G89A 5DX0A 3A7DA 3K0BA 3KPYA 2AVDA 4E2XA 3G2OA 1KPIA 3U81A 1AQJA 4BP3A 2Y1WA 5HIMA 5KQSA 1JG2A 3KHKA 2NYUA 2R3SA 2P3QA 5LQJA 1I9GA 1B42A 4C03A 2C7OA 1R8YA 4OX9Y 2AOUB 2ZZKA 3GRVA 3HA3A 3MAGA 1JQEA 2JH9A 2PSSA 5H02A 1AQIA 4GOLD 1O9HA 2V74B 3NMUF 3LCUA 3FPEA 1TW2A 3BWMA 5EEHA 3OU2A 3EVEA 4RVFA 4GOND 3KQOA 3LBYA 1YZHA 5CM2Z 3HCCA 2ZIEA 5CCXA 2PY6A 1RJFA 4OA8A 5JUWA 1MJFA 2PKWA 2YX1A 1EJ6A 3DP7A 3MERA 4E2WA 4FSDA 4QVKA 3OZSA 2P35A 3KPJA 1EIZA 2ZCJA 3DMHA 2PT9A 3KQMA 4QPPA 2AOXA 5EG5A 5GIOE 3P9CA 5CIYA 2NXCA 1DL5A 1EQAA 4E2YA 4HH4A 2PWYA 4M36A 3IYLW 4ISCA 2AZTA 4PWYA 5K05A 1SKMA 2BH2A 2JHPA 2BR4A 3AY0A 2UYCA 1L3BA 3I64A 1SUIA 5HEKA 3GXOA 3HVKA 2CL5A 5HIJA 2NP7A 4L7VA 3P9IA 2UYOA 2QY6A 3KPWA 3MTIA 2IH2A 5E1DA 4DM3A 3HVIA 4P7JA 2LD4A 2BZGA 4DMGA 2YQZA 2NNWB 1KP9A 2GA9A 3LX6A 4XCXA 4E33A 4QTUB 2OZVA 1Q0TA 5C1IA 2XYRA 3EVAA 5FQOA 2NXNA 2ZZMA 5E8JA 2O07A 3BGVA 3UBTA 3GDHA 1DCTA 2VDUE 1Q0SA
chains in the Genus database with same CATH superfamily
4D9CA 3QU4A 3OQIA 3OMXA 1BX0A 1TUEA 4WFKA 4WCFB 2FPGA 3X1YA 4A6XA 4K5QA 4XQEA 1VIMA 1DDOA 1NW6A 4H1TA 5C4GB 3I73A 5E3HA 1AUOA 1O7JA 3ZVNA 4J8PA 3DBIA 3U7GA 1NDUA 3FRJA 2H5EA 3I37X 1DNPA 3K4HA 4WNYA 2QLTA 4WE3A 2HHLA 1DTEA 4G1VA 1T34A 4IIFA 4JHXA 2UAGA 1MOQA 3QEBZ 3R9XB 3O8DA 1RYEA 2PGIA 2QU8A 2ZR9A 4PAOA 4F8EA 5JFOA 1Z83A 1CUEA 2HTEA 3P52A 5ECGC 2QBYA 1W5AA 4KQEA 1QIEA 1Z4OA 3ILHA 1AMUA 1JLSA 4JP2A 4OHZA 4XCQA 1AKYA 1SIWA 3JW8A 2WB2A 1YA6A 4A8TA 5JH7A 1O94C 1ADCA 4KXXA 1GQOA 2PGDA 1I2DA 3GA5A 3VPHA 1C9YA 1LDBA 2N47A 5BMVB 1CCWA 4TYPA 2ZS8A 4CNQA 1RFGE 1SUSA 2VT7A 1YS9A 1EP9A 2IP1A 3G5UA 4D4HA 2GUWA 5DZSA 2Z6UA 2B30A 1OC2A 2BCGY 4O5AA 4QASA 3H8JA 4RK0A 2I99A 2FPXA 1ABBA 2VWPA 3VYSB 3G88A 3IJRA 3NS7A 2QZJA 3EEIA 1ORIA 4I9UA 3BMXA 3LDHA 3ZWYA 2PLFA 4FI3C 1BHSA 1M1UA 4NYIR 1GPLA 4D46A 5LA6A 1Z4QA 1EA5A 2GI4A 5AOCA 2DCUA 1T9AA 3JQBC 1KVTA 1I1OA 1SXJB 4JVMA 5KC8A 5KS2A 3ADCA 2H31A 3RVQA 1NT4A 2PLWA 3OWHA 4NZMA 1MC8A 1OXXK 4M55A 1MOSA 1GRQA 4N3GA 4RD4A 4DLRA 1NVUQ 1ZK1A 5KAMA 4ZQGA 3P0EA 3ICCA 2IUFA 3VAZA 4EHNA 2ZUFA 1N2OA 2JJQA 3AY6A 3EW9A 1S2MA 2OD2A 4KODA 5DDIP 4Q18A 1KK3A 3FUVA 4Y98A 3A9VA 3IULA 3HHPA 4EYKA 1GPNA 2RGUA 1Z68A 5TSDA 1R88A 1G0NA 1KS9A 3PLNA 1UDBA 3OQPA 4MS1A 4C7KA 3TK1A 4I99A 4PLGA 2Y2VA 4YA6A 3QLEA 1X6VA 2UVPB 1XEAA 3QVGB 4P6VF 3VV3A 2WAXA 3VYRB 4F5DA 5EZSA 3DYIA 3SJBA 1ZUIA 4GZMA 4POAA 5DJ5A 4K46A 1FQKA 1M1YA 4WOKA 2JCVA 4LN1A 1CUAA 1QAMA 3PDIB 3RSHA 3WK5A 5CFLA 4JXXA 3EOAI 5BV0A 5KWSA 1XCGB 1K6XA 3JWGA 3OPNA 3OOEA 1XXHA 2AFIB 1PNVA 4QDTA 2EQ5A 2D1SA 3M3DA 3ZGLA 4BP9A 5AJTA 3B78A 1U2TA 4QQRA 3H1BA 4PS1A 5G3YA 2HT6A 1BCSA 2CB9A 5JWOA 1EMDA 1QHFA 2A3NA 4EL0A 3K70D 2G06A 2I1VB 3QI2A 3PC8A 2NT3A 3F8WA 1SIOA 3NETA 1GTRA 3N39C 4EHAA 4D4MA 4H7DA 1ZN9A 3PUIA 4ZC8A 2Z8YA 1TM1E 4H6XA 1I4EB 4QTTB 4YGYA 3TNFA 5C35A 3LW8A 4NDAA 3WVNA 1NIJA 3R7BA 3I6YA 2ADMA 2P2DA 3P9QA 3CEPB 4PR3A 5IDYA 2XCSB 3ZK9A 1ULAA 2IUYA 3K9QO 1BE8A 3HG7A 3SR4A 1ZN7A 1UK9A 3M4XA 2RARA 5G41A 2B7LA 3GGPA 3ZS8A 5AVXA 2AB0A 3DZDA 3JCZA 4PY2A 1V3TA 4BO9A 4DYHA 2W2KA 2NVOA 2NZVG 1XMSA 1M73E 1CUYA 1U0GA 3A70A 3JZFA 5J5AA 4BVFA 2AJCA 4DSTA 2PUCA 1XDBA 3O9MA 2VZ8A 3T35A 4QECA 5HG0A 4MQLA 3FRIA 3CRVA 5JXWA 1C50A 1VHDA 2ODTX 4RV5A 4OXKA 1LNZA 1VHLA 3WI7A 1Y5NA 1Q3HA 3I9V6 5ADWA 1AGYA 3ZWVA 3MF4A 2Y2UA 3K0AB 1JBKA 3OEED 3ND8A 5CJPA 5TQ2A 1LF0A 3SC4A 4IZ6A 4IINA 3ZWQA 2AZDA 1E92A 4UHEA 4CCWA 1VJ0A 1IMJA 3OJXA 2P65A 4M22A 2XJ4A 2Z3ZA 4ZZIA 2FW7A 3SEFA 3G5TA 4FFOA 2BGMA 1IY8A 3R9WA 3MG9A 4L0MA 2XMRA 1FU8A 3DQQA 3GUCA 3ILXA 3KEFA 4X3OA 3QTTA 3A9CA 1RWMA 2D54A 3IIJA 2AN5A 2HMWA 2PPVA 3E3OA 1F9EA 3GMTA 5ALKA 1FYXA 3HXKA 3AM3A 3FTDA 2VP5A 3D6HA 1L8AA 3COPA 4ZQHA 1IQPA 1ZK4A 4MVJP 4GWLA 3V1UA 1QUEA 1WCWA 5L95A 4XTCS 1FTGA 1WPQA 3G9QA 1KYTA 1EFVA 4Q3BA 3JQAB 4WNCA 1NF8A 1NC3A 3L6UA 4IFEA 2I80A 4CLDA 1HZZA 2VHJA 1TKAA 3PD1A 5THQA 1HE4A 1YJ5A 3K16A 3RFTA 1J2UA 3UUGA 2HXGA 1QRDA 1W35A 4FHDA 4PGHA 3OFVA 4X24A 5AM3A 2FSVC 4RC9A 5U1PA 4EYSA 4ZOBA 2XVXA 4C0XA 1CP3A 3ZDEA 2PRKA 1CQJA 3CPEA 3QENA 3ROEA 4MZDA 2J4DA 4OFZA 1NW4A 4OQYA 4CM4A 2WUEA 3G8AA 4PX5A 3TQSA 4IHJA 4GRIA 3TLGA 3U1VA 3W79A 5GINE 1DARA 3KTOA 2YR0A 3EPKA 2YJZA 3FYDA 2PBFA 4NE9A 1XDZA 3ULKA 3E1KA 3BA6A 3KKLA 3RPEA 5KOIA 4DA0A 4X1KB 5KNDD 2J5QA 1WU7A 1QIDA 4MP6A 1PT6A 4PWZA 1CUUA 5ALUA 2DPGA 1N6OA 3ZE1B 3V8MA 1ZEMA 4D4IA 1ZD2P 5IVKA 4RM3A 1K5GA 3HRIA 4KUGA 1Z06A 2R60A 3QEOA 3MLEA 3REFA 1E9SA 3EIUA 4G0UA 4B3XA 4J1SA 5KTRA 1JKXA 3F90A 1B6SA 5BW6B 1SXJC 4LXXA 2O8DA 4PHCA 4RE6A 1RR6A 3R23A 3PR1A 1BKSB 3EFHA 4FKBA 1QB7A 1OREA 1C30A 1R9NA 3C6KA 1AC5A 1OGJA 5CT4A 3OQ6A 1G9TA 2O2GA 2XRFA 4GP6A 5LBUA 3SXUA 1PBNA 2D7CA 3GCDA 5TQVA 4MPRA 3X0DA 3NWEA 2O2YA 4RSRA 2RHJA 2BRUC 2EHJA 1N7HA 4PC7A 3O73A 2W2LA 4JXJA 1N25A 1PWZA 2GEFA 1QF6A 3LPDA 2DBRA 2R62A 3C8DA 2A67A 4PYMA 2ERYA 3ZLVA 2ZUBA 3IBFA 2BYTA 4JB8A 4BNMA 4O29A 3RYCA 4UVDA 1HNNA 4WBSA 4OLBA 3ZWOA 1I3NA 3UWMA 3RU9A 4NP6A 1DCFA 3KQTA 3B13B 4ZMBA 1E2IA 5FAKA 1JX6A 4OH1A 4WTOA 3DLTA 2Z2YA 3VFDA 4Q4CA 3QA9A 4TWJA 4Q39A 4I3HA 7REQA 4CGZA 3R5XA 3LT1A 4TLEA 1DBRA 4BQRA 4DIUA 5HKKA 3DLCA 1WW8A 2P91A 2QLMA 3O94A 4IP0A 4RD1A 5JYBA 3I1IA 1SHJA 2WIJA 3NRBA 2P1DA 4IIEA 1LXCA 4DBLC 4BQEA 1NKTA 3KOOA 2H2HA 3D02A 5E4JA 3FDZA 3TQQA 4JGIA 4XOUA 1GSAA 4JHLA 2R1VA 4MW1A 5TMDA 4C3VA 4N0PA 1XTPA 2O14A 3K8QA 4QGSA 2HCFA 3ZH2A 1W1UA 3U5TA 5ALYA 3VDXA 4W5TA 4NH0A 4A4DA 1KMCA 3VJMA 1JLRA 2JGLA 1P4RA 1UBLS 3U60B 3F6YA 1E7SA 4G86A 4CGYA 3LQFA 2BVNA 1AN0A 5GGXA 3S2IA 3PNLA 1H9CA 2BSXA 5ED0A 5C31A 5IBRA 2NUPA 1O2DA 4YIHA 2CJWB 1ORDA 2V7TA 3ZWXA 5J2TA 3V7YA 3N7AA 4YP0A 1GKLA 3WYCA 3WGGA 4PYJA 3GJRA 2PYIA 1BGXT 3GBSA 2BW0A 5I8ZA 4ZJUA 5IX8A 1W4ZA 2PFGA 4RVDA 4GQAA 4FKZA 5LU8A 2HWYA 4FFLA 4GGOA 4H08A 4AJ2A 2V4ZA 2BL4A 3RVLA 3ADDA 3CN7A 2H59A 1K7SN 1EGHA 1ZNXA 1ZH2A 3EGOA 4WZBA 2QYHA 2LIVA 2MSLA 4N0QA 3U0BA 1ISPA 3U9SA 2JATA 2PKQO 4IDQA 2WWIA 1UFRA 5KNBA 3L7AA 4F2HA 2G8NA 1H2RS 4H4EA 4CKXA 3HP7A 4B6OA 1XTIA 3GFGA 4XD7A 1ATIA 1SU6A 3ASYA 1YVPA 1IJKA 5AQ1A 4G1EB 3D64A 3HRHA 5C8YA 2PLNA 1J2TA 4JAVC 3HBNA 1D2MA 2L69A 4A8JB 4TVOA 1SA0A 5BQ3A 1DIHA 3E22B 2C2KA 1TYEB 1MC5A 3OPMA 1A88A 3AHCA 3PX3A 3ZDFA 5FWYA 5LLTA 2ON6A 3K94A 1LDMA 5I7OA 3EH2A 4DAEA 2HJRA 2YOHA 3FUXA 1VIDA 3IS3A 1AS2A 2IYWA 1T2EA 3F74A 4IXDA 4MVJD 1QRSA 3DHYA 1AB5A 2IBTA 2YN0A 2VJPA 3ESQA 1PR9A 1IHDA 1KP2A 2ZR7A 4CT5A 2IY8A 4M87A 4CIWA 3DW1X 4NEHB 2XXJA 3W9SA 3PX2A 4EATA 3IEKA 4DLXA 4YT4A 3ASVA 2D8MA 4R0VA 5EERA 4IRMA 5DM0A 5A05A 1XF1A 4P08A 2FETA 4M9XA 5CNKA 3SGLA 5BUQA 3PTAA 3ICVA 3TW4A 3DMPA 2ZQYA 2UU9B 2Y05A 4QUDA 5CLFA 3BBLA 3X1XA 1ORVA 5EZYF 2HOQA 2P67A 3DW3X 3UAXA 1SUDA 4IBOA 1JDVA 4YJ3B 5FUVA 4EG4A 1B0PA 1EE9A 2XUZA 2Q29A 4MVJE 1C7RA 4NYJR 1N2CB 2JGNA 4DA8A 1L5OA 1XRQA 3NBUA 4DV4B 2H4FA 4I4NA 2A1UB 1Q7EA 2QAGC 3ETHA 4M4SA 2HRBA 4DC0A 5I6DA 3A1SA 4O4LB 4K9LA 4N76A 1OYYA 3IMFA 2Y6UA 1NVMB 4MUYA 3SKYA 5C8VA 1A4UA 3Q87B 2XA9A 3R3JA 3SQMA 1GP2A 1USKA 1NXTA 3FBGA 4OQMA 2BN4A 1ZO8A 5IWCA 1US8B 5BN5A 5I7HA 1CVRA 2W4MA 3GUHA 3UYLA 4UNSA 1PF7E 1D3AA 4JL8A 4YV0A 1Y9JA 3HPQA 1XX6A 3EXEA 3V8RA 4KFTA 1TYDE 1NR1A 3EUFA 2VDQB 4P58A 4TRJA 2RH8A 1ICIA 2V96A 3BWCA 4FFMA 3L0ZA 3RF7A 2HCBA 1O9GA 2Z6QA 4AVYA 1FP1D 1PT5A 4WX2B 5E7MA 4YP6A 2BFNA 4RHYA 1DV1A 4OAPA 4IGFA 4XUDA 2JJ2D 3IBYA 5A9SB 3WDKA 1W36C 4KR9A 4OKSA 4DJ5X 4EUFA 3LHKA 2ZSEA 3ICPA 4KQFA 3L43A 4I6GA 1NNUA 2LTAA 1HG1A 1VC2A 2R96A 4UCXA 1HL7A 5HTKA 3GGCA 1P4HA 3FVVA 3GRAA 4RMJA 2GXAA 4KHZA 5BW8A 3ROQA 1RRMA 1XB2A 3Q12A 3IILA 3CUSA 3EFOB 3K35A 2Y1WA 5REQB 5TMBA 5WRFA 1KC1A 1SY7A 4IXNA 3GI1A 5B3JA 3ONNA 1OTXA 4OCZA 5FP0A 2E4WA 3P0IA 4LGCA 3VVMA 3A1UA 3HO1A 1UKCA 4YCBA 3PQ4A 3RK1A 3BTOA 5BOVA 3RUFA 4YMWA 1GNLA 5JFGA 2QTLA 3FGNA 1GGNA 2VAWA 1EUDA 2YZ2A 3FN4A 2GCOB 4Q1BA 3RIXA 5BSRA 4BFSA 4XDHA 2JAOA 4RYDA 3PD7A 4F3KA 4W7HA 4Z4IA 2Q9AA 3Q7IA 3JATA 1E2BA 5C51B 2BAGA 4D9MA 3MERA 4E2WA 3UMRA 2OUKA 4IILA 2C95A 2VDWB 5I3CA 3FOFC 2F8TA 3PNYA 5EG5A 2ZB8A 1PK7A 4CKEB 4EB6B 3QU2A 1KEUA 4ZU3A 1QLWA 4ROTA 2PGOA 3IYLW 1KI6A 4ISCA 4MEBA 2OCAA 3RKUA 4L57A 2I55A 2CLHB 3ESRA 2C3MA 3AY0A 5F73A 1BX3A 5CYPA 1ADJA 4URYR 2X1VA 4ZVTA 1CPYA 1BXRB 2X0JA 2Z8XA 4M0PA 3KSRA 2VH1A 1ZBQA 3P9IA 4R2XA 3USES 1RHKA 4EOGA 7AT1A 1Y1QA 3V4ZA 2Q5EA 4EAAA 3CO5A 5H3CA 4K81B 2WUDA 3PXAA 3GYGA 4ZCMA 4RL4A 2GA9A 1C4KA 4X3PA 3P94A 2XYRA 4P22A 1OQAA 5AVRA 3CSUA 3GDHA 4ZC1A 3AVVA 1JWBB 4ZKDA 3ORQA 1MP0A 1KDPA 4UAVA 2D6FA 3IPYA 4FOSA 3BHNA 3E2MA 3EHEA 3OOYA 1W7AA 1HL3A 4AYWA 2D7DA 2AN4A 3HBFA 5DHRA 5AOAA 5K0SA 2H7YA 5BT8A 2MINA 2VJOA 4UASA 2E82A 3CBGA 5IT4A 4RTJA 2NP6A 2PZJA 3PA8A 2F1IA 5IHPA 4M46A 2WF9A 3BFPA 4NPHA 5BN1A 1IATA 5HR5A 3AY3A 4N0EA 3FCYA 3A36A 3CX6A 4MIKA 5DV9A 3AB8A 3DOCA 4ZVMA 5ENVA 1RHRA 2J9RA 3K1YA 4IIHA 1S2OA 3CUEF 5H81A 3E3AA 4ZGGA 2BFFB 1CF2O 4BN0A 4IS2A 4KNWA 4D45A 4TXHA 2Q3EA 3CEMA 4K88A 1JG7A 1SB8A 3F1KA 4ND6A 4NH4A 3RHZA 2MR6A 5KO2A 1SOMA 3H13A 1CLUA 2IUSA 3UAWA 3VUEA 1HKUA 3PNVA 1O6FA 2BSQA 1QR6A 1TJPB 4QOJA 5HZHA 4KXWA 4CM9D 2HD4A 5DTEA 4CLRB 3IPXA 3C70A 1OAKA 1ZSVA 4RWEA 3H9EO 2GBLA 4KN6A 3NDPA 1SCIA 3OCWA 4B3CA 4PVCA 3ZDBA 2ZJOA 2NSYA 2TMYA 2XIJA 3IAEA 4YRPA 5B7PA 3AXSA 2O19A 3LKBA 1X8JA 1HYEA 4LOJA 2QQ5A 3NC1C 4BL5A 1C4OA 4AP9A 1M3SA 1TI7A 1DRJA 1H5QA 3HYLA 1YI0A 2XMZA 3RT9A 1O97C 5DNAA 1O87A 3L1IA 4B31A 2X40A 4NBNA 1KH2A 3ZIDA 4C08A 2BGLA 5JBQA 3AFMA 4IXTA 5B58T 2MMGA 1TVCA 4Y2XA 3SSAA 5JIBA 1H66A 2D2EA 4F6RB 1VE6A 1BWQA 4HNRA 1BDJA 5EJ5A 3GCGA 3I2KA 3ELBA 3CV3A 3EG9B 5KOYA 4E2FA 5DE3A 3RKRA 2YNMA 3FPBA 2OXCA 4NCBA 1T5OA 2PYDA 1HE1C 3A1TA 3GR6A 4EGJA 4P35A 5BWCA 2NZ2A 1JIUA 3GOQA 4ZAGA 3R7WA 2VAMA 3QEMA 4IKPA 3R0QA 5C80A 2R11A 2HPAA 4FCTA 2G5TA 1OXMA 2POCA 2W7TA 3M82A 2CLFB 1B14A 1XJ5A 1P31A 4IOKA 3ZWNA 1CDZA 3NHBA 4N82A 2FLKA 5TQ0B 2H4ZA 3I5UA 2ACKA 3AI1A 1E1NA 1BC5A 1SGWA 3C5EA 2ZETA 4X71A 2IEYA 2C5AA 1XDSA 2ZK7A 3TW8B 3JZAA 5E6UA 1ZJ4A 3DC7A 3ZV6A 4AT1A 3QYFA 2QTCA 5EI5A 2O2DA 2GXQA 4L16A 4JJIA 1SKAA 4A7PA 4CODB 1YGYA 1HSZA 2CNBA 2HIMA 3LCVB 2IYOA 3Q98A 2ZAMA 4MW9A 4PINA 4S12A 3M83A 4X6YA 4Y1FA 1JH9A 1OU4A 1DADA 4P4UA 4RD6A 4F3CA 2G4LA 4A0SA 5A4MS 4GMHA 1U0OC 1VSVA 3L0DA 2YS6A 4TZTA 2PMDA 3T34A 2P9YA 4QXPA 4K6MA 4A10A 4G4SO 3UJNA 2ETXA 4WGFA 4G0PA 3G6WA 3DD1A 5G53C 3DFIA 4XX1A 2GBGA 3AHDA 1XVTA 1MABA 4PRZA 1H6CA 4FFWA 2IZ7A 1Z2AA 2CZGA 5BSEA 5LP6F 3WLFA 4DT1B 3AL2A 3ILSA 4R6WA 3L7LA 3UM9A 1EH5A 4ER3A 1TZMA 2HBZA 3B9QA 2C57A 4L9AA 4KTTE 4L3VA 1EFKA 3L9XA 4OI2A 3CF4G 5B6IA 3ZCXA 3ENNA 3N8NA 3BMQA 4QGBA 3PXGA 5HW0A 2QZSA 2CXQA 2F3QA 2FEXA 4F97A 1G1AA 4MR9A 5ADVA 4JQSA 2NZUG 3RIYA 2AEJA 3PRKE 4RH0A 4KQ2A 3AETB 4YO7A 3VR2A 2ILTA 1XMIA 2NTNA 3OT5A 2Q27A 3KJFA 1X1DA 3WYGA 2WWXA 2W93A 4L5BA 4MGIR 3DEYX 3KR1A 3N8KA 1W59A 4K03A 1DEAA 1NVKA 2X13A 4JQZA 5CB0A 4UDYX 2X9VA 1YL6A 4BBZA 5BSWA 3A3PA 1SBZA 2EQAA 2RB4A 3RIHA 3TBHA 3ZDDA 4NXNB 5CB6A 2PZFA 2C04A 1M2VB 4HNAA 4RTNA 1LI5A 2QTTA 1OD6A 2VZEA 4U02A 3ZJYA 1LBEA 2D1QA 4JBYA 1M6WA 2GBIA 5DOVA 4EFMA 4HYEA 3DAPA 3QFSA 2GLXA 2DPXA 1IHPA 1Z4NA 2IXEA 3GEIA 4Q1AA 3UJAA 5CYGA 1ZUNA 5DN6D 3V48A 1AF4A 3CH7A 1XYGA 4JNKA 4QSMA 1GADO 2RKOA 5T8KA 2JAUA 5B5SA 2X1LA 2WDZA 2JIPA 2XYPA 4GKVA 5I7VA 4RTMA 4N40A 1FFEA 4HYTA 4P53A 4RWZA 1XNQB 1XP8A 5EE1A 2EU8A 2Q99A 1BD4A 4DLYA 3E2IA 4RCZA 4X61A 1EFCA 2XYVA 2CXHA 2ZTUA 2FLWA 1F60A 3RB8A 2PH3A 3U44B 2IDZA 5IC4A 1W5TA 2I2AA 4JLKA 4V3BA 1U9IA 3QW2A 2WABA 3D4PA 3URMA 2A9PA 2DX7A 3B1WA 4NF2A 4O63O 2K5UA 4CMAA 3ESAA 4GM0A 1C8KA 1Z6GA 3VNSA 1KO4A 4XJVA 4J76A 2PX4A 4V38A 3WMXA 1L4LA 3R3ZA 1VG1A 1L7PA 4G26A 1AQLA 3G2MA 4NS4A 4UOQA 1VTKA 2W42A 3IB6A 1YJCA 1GZUA 3OHSX 3PYLA 2WIKA 4Q7KA 3ITEA 5KU7A 4NENB 3U49A 4BP1A 1QOPB 4A0GA 3PE4A 1LPMA 2I3AA 1V96A 1EX6A 4EY8A 8MHTA 3CS3A 1J42A 1RLTA 4MQBA 5AK5A 4CE6A 1AV6A 1C0KA 2CZCA 2JGDB 2ZUTA 3W6PA 5JQGA 1BXGB 2QN8A 2FG7C 3PPIA 4L73A 2C94A 5CM9C 5DIFA 5ALRA 4JI3B 1FRNA 4F2GA 3VR6D 4MUBA 1D07A 4EHHA 4CWAA 1N2EA 1WQ4A 2XF2A 3UQYS 1G5HA 1QDUA 1IBSA 2Q62A 4LHSA 2P62A 3DE2X 3HM2A 5GV8A 4AMBA 5H70A 1KFCB 1W36D 5AW0A 5F4ZA 1RPZA 5IH3A 4N8SA 4EL5A 1CF9A 4UOEA 5JCZA 1T9GS 2H4XA 1IM2A 1XAJA 2AEEA 5KNCH 2B1IA 3L6OO 3LO5A 4DMUB 1C7ZA 5EWMB 4O4HB 1WE2A 4Q9NA 4GYYA 1ESDA 3V7WA 2Q8NA 3AI3A 1MNQA 4AK9A 5FUQA 2V1UA 1HYGA 3GUZA 5CUQA 1GNPA 1XJWA 1L5NA 5FWNA 4DR3B 3U1BA 4QJ3A 4I9NA 1D1QA 1GPUA 1C3OA 3AEKA 5DM60 2CCKA 2QVCA 1N0IA 2FX2A 2RHOA 1MQ8B 5A6SB 4F96A 5LFAA 1DEHA 3KR2A 3T6KA 2QF7A 5DLQC 4RAQA 3VDNB 5ICEA 4K05A 3OIUA 5JPIA 1NASA 1ZXLA 3ITNA 1ZK2A 2VJLA 4RJIA 1EFRA 1W34A 5IJAA 4E4TA 5K0JA 2CXXA 2GEDA 1C7IA 3HXMA 1NW9B 3T7EA 2JFFA 1EBUA 4C6SA 1U7UA 3QHPA 1MRZA 4LJ6A 3PQ3A 1PRYA 2BHSA 4PG5A 4YBZA 2YJ6A 4BLOA 3LS2A 2XBLA 3GJ5A 2H08A 1FJXA 3WY9A 1PGPA 2AUTA 1H8HD 4S0XA 1JHQA 2PX0A 4F4CA 2GK6A 4C88A 1GT91 4IW3B 4W1RA 1NDQA 2HUNA 3NGMA 5BQOA 3TX6A 4IDFA 3PNPA 2QJRA 1SC6A 3MINB 4W8HA 2WE8A 2XYQA 2IH5A 1ZQ9A 3CF6R 2XUQA 1M1NA 3OURA 4U2BA 2AOTA 3A4MA 3LPAA 1H2XA 1U94A 4I46A 2J41A 4LXUA 4MKGA 3IJ5A 1C9KA 4B0OA 2EW8A 4B33A 3U31A 2IPMA 1UMCA 5KU1A 1GRRA 4ZXPA 1NJ6A 3AERA 2ECQA 4BNLA 4C5AA 1E4VA 4CFYA 4EG7A 3KVNA 4IO0A 1YQDA 4H3HB 1KTIA 4RLQA 1P3JA 1GCAA 4QQFA 2VWQA 4QYMA 5TJHA 1F1JA 1OU0A 1V6CA 5KSPA 1RXYA 2VYVD 3FOBA 4ZDIA 2P0EA 3DP9A 2R5NA 3D8TA 4MGKR 1U3DA 2A9VA 1EEXB 1UOEA 1TX4B 4HAVA 1GN9A 3O8OA 1JR3D 4MUNA 1YKSA 4YUVA 1IY0A 3GD7A 2W6PA 4LFAB 1ZW1A 3DB1A 4BKMA 4P93A 2IW3A 2VWGA 4UM7A 4W6QA 1N8NA 3EHDA 4A91A 5C1DA 4YV1A 4NFLA 1VIYA 2FPKA 2YXEA 1W4LA 3ZG6A 1IOZA 4MMXB 1VZ2A 1YMQA 1K4KA 1ZD3A 3AR8A 2XIQA 1KKMA 5FI1B 2I6SA 4KB5A 4RJJA 1X3LA 4OH7A 3NYRA 2ODPA 4B4KA 3CF2A 3L1UA 3Q72A 3K70C 3GJ8A 4X3CA 1T0HB 1AKWA 1QK4A 2NO0A 1DQPA 4HFNA 1N6KA 4OXNA 4A3SA 8LDHA 4MRAA 2UYHA 1I7DA 4GC5A 3VNBA 4KQHA 1C3LA 2WP0A 4ESEA 2DH5A 1CX9B 4O1HA 1C80A 1J6UA 1TW3A 3NM4A 4Q01A 3FUTA 3IAHA 2DWCA 5EFZA 3E9DA 5BWMA 1KJWA 3NEYA 4IOJA 2IYNA 2ZWVA 4PNHA 1DO8A 5TJ9A 1UMBA 4ALNA 3OJOA 5D01A 1ZZGA 3OZWA 1E32A 2QTFA 1PT8A 1YRAA 1CBUA 2QD3A 1M67A 5DBIA 1U5BB 4TRNA 4XYEA 1SUBA 2C0QA 4A2CA 1OYWA 2AQHA 3QEMB 3K70B 821PA 1AKUA 1C2YA 1M83A 2AZMA 5AKIA 2DC1A 1Z2PX 4DBZA 3VNQA 2ZJ4A 2QN7A 4E4YA 3PENA 2XGJA 3QBEA 4RKEA 2FPUA 3C3PA 3IVCA 4E1VA 3KNZA 3QUAA 1ORRA 3RRNA 1G6HA 1E1MA 5CFMA 4TSFD 5TEWA 2VJDA 3MIIA 1BJRE 3I1YA 4Q9DA 4J7CA 3IURA 3ED5A 3PQ8A 1VE3A 1IRIA 1CJTC 1LLCA 1UFQA 1Y7LA 4F1WA 5HKKD 2JGMA 1YJBA 2EDAA 2ZIWB 3RK0A 2C5EA 2AJBA 1K7FB 4UAGA 3NBXX 3WOHA 4RY9A 2KB0A 1E4EB 1ZMBA 4LEIA 3O31A 4Y6LA 1AZWA 5ICFA 4FZVA 1BROA 1U2GA 3WB9A 2G0AA 1JZQA 3PTLA 5MN5A 1M8GA 5FOWA 4GX1A 4XH9B 4YECA 5ERGB 3H87A 3B82A 2ZSUA 5E6RA 4FK8A 2QRMA 3KKOA 3PQDA 1A9QA 1INLA 4AX8A 2W9XA 1B2LA 2FQXA 1C3VA 2VKQA 3GJ6A 1SOWA 2QP4A 4YYZA 2ENWA 3UW3A 1EM8B 3DMYA 1RJ9B 2XMSA 4P0PB 5HP4A 1CRZA 4FYMA 4G8JA 2IUTA 4NZYA 4OUKX 2BFFA 3EA0A 4KH1A 5JD4A 1LKZA 2BC9A 1X2EA 4JB2A 1NTRA 1A5AB 4YJHB 4QDZA 3K09A 2JGJA 2FUG6 1O1YA 2EZ4A 3BGOS 4HDMA 3L7JA 3KJQA 4L5JA 4NBKA 2C58A 3NR2A 4MAAA 5TPWA 5DNCA 1F7VA 3HGQA 3EVNA 2M6RA 1E3JA 2GBLC 2Y67A 3QYAA 3R5HA 3ZPXA 3K5IA 2AKYA 3KQOA 4R2JA 1PCXA 5CM2Z 3WQSB 3N2IA 4DGQA 3RVSA 4W9MC 4BLSA 3BGWA 3IMEA 4J4HA 4AWAA 2VRCD 1ZL0A 3MSCA 3SOZA 3TX2A 2JIBA 1X42A 4XWTA 1HDYA 4AZ3A 1DIAA 2BDEA 3NHFA 3RAJA 5JCJD 4MYDA 4XD7D 1JQLB 3VI4B 1HDOA 4QFDA 3DZHA 2VDKB 3IBTA 3AF0A 4TV8F 2DAPA 3F1LA 4QPDA 2YQ4A 1MB2A 3NKVA 4M98A 4N0MA 4GKKB 3DB2A 4KR3A 4F9GA 3NWOA 1FNSA 2AQ8A 4RQBA 3ECAA 1FW8A 3SX4A 3TXAA 1NQAO 3QU9A 4DIOA 1B15A 2H7XA 4UMEA 3H9BA 3TZQA 3L7IA 3CT4A 1TF7A 4XVHA 3EG9A 3MZ0A 4HYYA 3LWNA 2YQZA 3ZTYA 3GLFB 3IQFA 3RV4A 4PHFA 3R76A 1DBPA 4IIJF 1UBGA 1QH1A 1ZXBA 2HSDA 3DDHA 1Y5LA 1KYVA 2I7VA 3Q0EA 4ZU6X 1B0UA 2GZAA 2ZWIA 5JNRA 4N0DA 1P44A 1U8FO 1U31A 1BRTA 2OGWA 2Y1GA 3D6FA 4RGBA 4M1EA 4IUDS 3PC4A 2HA7A 4XEUA 4K8RB 3TLBA 1OW3B 4P7KA 4D82A 3J7AC 3V7FA 2BZSA 1MX9A 4H17A 3VYWA 4L50A 4F2PA 5KYYA 3NWBA 2M32A 3EVBA 2Z6AA 4C2TA 3COSA 2B0CA 4MVJH 3T3OA 4G8BA 4E1AA 4QOEA 1N9GA 3PP8A 4G63A 2B34A 1N1DA 2J8ZA 4X93A 4J03A 4PYOA 3FFBA 3PNQA 4G5FA 2QW8A 5L7YA 3AINA 4RA9B 3EIOA 1T6BY 5E6SB 5A3VA 3BFJA 4B8ZA 2JI7A 3GJYA 3F3SA 1SD1A 4Q5IA 1VQ1A 1XTRA 2Q3FA 2PXCA 3TGLA 4UXHA 4WN3A 4ZZ2A 1MCZA 4U39A 3MOIA 3E7WA 4R71A 2ZRNA 3Q2OA 4M8NE 1GNRA 2CXNA 4CNBA 2Z98A 3S2ZA 1J0AA 2AXQA 1E8DA 3TD9A 4HZIA 3D6UA 2XGOA 2A88A 2CKDA 2X9GA 3KTAB 4X6XA 3ZUPA 3X43A 4NU5A 1OLUB 1X80A 1SBQA 3R0ZA 1NJ8A 2HBRA 2PGJA 1IAQA 3BBPA 3TGPA 1QB8A 2VXCA 2MINB 3EDQA 2JD2A 4TTQA 1PWYE 4CQLA 3IVMA 3VU3A 5CDFE 2PEZA 1C8LA 1JAXA 4LVUA 3NM5A 2GBCA 1YR9A 2X41A 2QXTA 2Z9DA 2VS1A 1AKVA 2PQ0A 5BQFA 4B43A 1EVEA 1TJYA 4KW7A 3BXPA 2Z58A 4B34A 3THWB 1MIOA 4LNUB 5LJLA 3GP8A 3STHA 3A2KA 4A5OA 3OJCA 2JCYA 3P8ZA 2OM6A 2EG5A 3KUXA 4ZI7A 3C87A 2GS9A 2R79A 4R69A 1E79D 2EL9A 4H7PA 3K5HA 3QVLA 1Y5MA 1JBQA 4J0QA 4B3BA 4KITB 3F9IA 2R8BA 1MX3A 5EEHA 1MOZA 4ND1A 1ONBA 1SK9A 3O2NA 2O2EA 3GEMA 4L8YA 5I01A 4L07A 2A33A 3L41A 4HDOB 5REQA 2P11A 3T5PA 1RYFA 1AHHA 4XQ0A 3WOVA 4B81A 2A1IA 2CL0X 2RGXA 3HDQA 3IQEA 1K0FA 3MRVA 4H59A 3AUFA 4NQZA 2WZBA 2P9QA 3RAEC 1XTQA 2CT8A 3AUYA 4IEFB 3G82C 5CAEA 4HLQB 5CVVA 3UMVA 2GFIA 2R8YA 4QNNA 2DPLA 2MSKA 3NAQA 4U7JA 3QLVC 3E8XA 3OZAA 5AP9A 3REGA 4F6CA 2GYYA 1S2DA 5CVDA 5E6SA 3SFZA 3LFHA 4I5IA 5HZKA 2OCLA 1QRRA 3GD5A 1II8A 3BXGA 3H9GA 3BWDD 3INRA 4YMUA 5I9MA 1OPRA 3JQDA 3NOXA 2QLLA 4GMDA 3UO8B 5L4LA 4MOWA 2XTAA 5AM4A 3D8UA 4YCAA 4YY3B 4J0CA 1AQNA 2FW1A 1ZJYA 1DSSG 3DGEC 2CMKA 1M0TA 1FA9A 5CVCA 1A7AA 3N8HA 1S2NA 1L1RA 4C05A 2PT7A 4DOMA 2QI9F 2GJAA 3SS9X 1PVOA 3TG8A 3VTAA 2Y0PA 1V7PC 1TFUA 4TX1A 2X2EA 4UHCA 4OO3A 1IXYA 2A4KA 4PLCA 4UEWA 3T5GA 3FMOB 4DY4A 4FEEA 2R00A 2IYAA 4Q9HA 3QWAA 1PR5A 9MHTA 4CM4B 1AHPA 4FZ5A 1PUXA 4HQOA 3TBFA 1CUHA 1XOIA 1O0CA 1C7FA 4HAZA 1R4MB 3F97A 1ZYUA 1R5BA 4IXMA 3TJZA 3VKWA 4BY9E 4BO6A 4MW7A 3TSOA 2O3QA 2P0YA 2QAGA 3SF8A 2IYEA 1GGJA 1OTHA 4KQ9A 4Q37A 4MP8A 4N9QA 1DQZA 2VUTA 3CEJA 3PHBE 4F2DA 4KN9S 5F1OA 2D00A 2CJWA 3FXAA 3TD6A 1UC4B 1FRZA 1ODFA 2LWIA 1OLOA 3A6ZA 3JQ7B 1MH1A 1U0TA 2Q3LA 3QXSA 4I9GA 3KOYA 4JLNA 3GW8A 1QYCA 2X9LA 2R84A 3ZWCA 4YJ2B 3ZGVA 4BJ5A 1VA5A 2V9ZA 4RGQA 1XTUA 4GW3A 5TMEA 2H7CA 3FYHA 4KSBA 3PFCA 1U3WA 1UIMA 3PICA 3KYIB 3CRZA 2ZB3A 1U0BB 3R8FA 3EPPA 3MA0A 5JAZA 2QVLA 2ZSIA 3FSJX 2R8ZA 4Z9XA 4ZICA 1A9XA 3NBFA 1SBCA 2WWGA 4X65B 2BCJQ 2IRWA 1U4OA 1XYYA 3PGMA 4I2VA 3K9CA 3B1JA 1Z7EA 4JLAA 1CNEA 3C14C 2SKDA 4MHSA 2HDNB 5FHQA 3DR3A 3KJEA 4D0RA 5KQPA 4CCYA 4AW9A 4DCTA 1QC5A 3F6CA 4FYIA 4KE6A 5EJ6A 2ZREA 5IZ4A 3EPLA 3VC3A 2EJBA 1DUSA 1YE8A 4P0QB 1RXVA 1AO3A 2JLSA 4MUJA 2X6TA 3I01A 4N65A 4RHCA 4Z4EA 1YB4A 3K53A 1YS1X 4GOJA 1T6XA 1Y89A 4KXYA 4UHFA 3SCZA 2OOKA 2G09A 4G5YA 4H3KB 2GJ8A 2CB0A 4E6EA 3TZBA 5EMKA 2R1TA 5EWLB 5B57C 4Q4JB 1WMFA 1EAMA 4S1PA 2NTJA 2XKJE 4MUXA 2EWWA 4QEDA 1TCBA 1CUBA 4K6KA 4L3WA 1IFXA 3ANLA 2G9NA 3UKDA 4MCHA 4WBNF 5H9WA 1L7VC 1VBFA 4LJSA 4R0MA 3A6JA 4YRNA 4ZDWA 3QTBA 4B8WA 1EXMA 5FIUA 3AUKA 3DLHA 4KFRA 3PEYA 1SVWA 5K51A 1E4EA 5KJEA 1T15A 3JALA 2AEMA 3KDAA 4HVAA 4U3JB 2BFCA 3SBXA 2HV8A 3MS4A 1NDHA 2ATCA 4NCHA 4QOIA 1UMCB 4H4DA 3KQKA 2YHSA 1DC4A 4KXLA 4PBTA 5JWHA 4YRAA 4YCMA 4ZEXA 5T3UA 2EJVA 3TPFA 3UCXA 4B80A 4AJIA 5DNEA 4QEZA 4QX6A 1UBRS 2MSWA 2BRUA 5JD3A 4JP3A 2VPYA 2H1IA 1FFXA 4PZZA 3ZD7A 3UKOA 3OUTA 2WZCA 3LY8A 4GXNA 3WIBA 4WJKB 3GVIA 1J22A 4MI1A 1R6TA 1TKBA 2FCAA 1Y8RB 1P1KA 2G88A 2XE7A 4QTXA 4U2KA 5DGXA 5FO0A 4KIGA 2MU1A 9LDBA 2MYUA 2JIDA 2WHPA 2Z08A 4UHKA 4EGQA 5HWSA 3HB4X 3M8KA 3T9EA 5AW8A 2BFDA 1ZNZA 4TN5A 2UZ3A 3TQFA 4I7EA 1YQQA 2Y8EA 4GT1A 1X94A 1N6IA 4OU5A 4XCVA 4ZREA 4C4PA 2CK3D 4R1MA 4F12A 2JC3A 1W73A 3PEEA 1EZ4A 5KWVA 1P0FA 2P9FA 2YV4A 3V32A 2FGJA 1TUIA 3IJEB 2F2TA 3B85A 4L8VA 3GCWA 3UC9A 4L5YA 3ZBTA 4Y2QA 3DBHA 1VCHA 3R7SA 3L8EA 4LTNA 1U6IA 5P8WA 1SB9A 2HK8A 3FAKA 1AOXA 2IYZA 2REQB 3F6EX 4FILA 1M54A 4LNHA 5LWHA 4BV9A 3ZYZA 2HMAA 1C3JA 5E4FA 4BVHA 3ZDCA 3IRUA 5I7SA 2QYTA 4F6LA 1VHWA 2WSLA 4G56A 4MV1A 2PT5A 1G42A 4O4JF 2JLVA 3R3WA 1LBQA 3AVOA 1DMSA 1AZLA 4UTVA 5GJVC 1BDHA 1TIBA 2VBCA 4AY4A 4C6HA 2UUAB 1NSFA 4DPLA 4P36A 4AULA 4E51A 5NLLA 3ODGA 3LRTA 2ODWA 3P27A 1KIMA 1AS0A 2XNDD 4GRDA 3TSCA 3W5HA 2IS6A 1NW3A 1O6ZA 4M1KA 3R4CA 1UIRA 1ZCFA 2VYND 2YRFA 1EVJA 4RJ2A 3MJFA 4G0ZA 2WD7B 4YK7A 3GJ7A 5BN4B 2H4WA 3N59A 1JG1A 4I14A 5MN4A 2QM7A 4GI5A 4C4XA 4RTLA 3UNXA 5L8VA 1NZFA 4V0RA 2ZRLA 3ZH9B 1NTOA 1JG3A 1UC9A 2B8JA 2PBLA 3EEYA 4EJSC 3CB2A 1BKDR 3H4VA 2VIIA 4M0DA 4NOLA 4ZYWA 1FC0A 4WDRA 3ZJUA 4D0LB 2H07A 2V0NA 5T4HA 2DB3A 4DMHA 1WABA 2ANBA 2I4LA 2RHRA 2WZQA 4DADA 3UATA 5HHTA 4ANFA 3LUCA 2ZAGA 3ICOA 1IULA 1GSHA 4M1ZA 2P5TB 2XTNA 1U0SY 3FSRA 5AH0A 4Y2UA 4H6VA 5EJ8A 4X1OA 1F8GA 2CGEA 4YCCA 2N1MA 3DAGA 2LGJA 1LI7A 4RPJA 2YJNA 1GQYA 2R6HA 3NIWA 3K6SB 4ZKEA 3H5OA 4JBGA 16PKA 1IUPA 1HFWA 2BGNA 3GDGA 3LQYA 5AI5A 1VJCA 3QF4A 3K9GA 2W2NA 3QPCA 2ZJ2A 2ZBRA 1K7YA 2XXAA 2XMBA 3C1UA 1W8DA 1Y7PA 3L4BC 3I5AA 4J3NA 3BILA 4JJEA 3E82A 2JAPA 4NU0A 3ESZA 3V2IA 5A2QA 2WM3A 4G8CA 3VZQA 5TT0A 4RQTA 3VQTA 2VUSA 4PTZA 3A37A 4RLHA 3NFRA 3CVVA 1NVEA 1DRUA 1AA6A 2PMCA 2G9QA 3ZVKA 4YRSA 3WDMA 3OQJA 2ATVA 4UCQA 1K9VF 2XUDA 2WAAA 1TCAA 5ELMA 4Y2YA 4LYJA 5D51S 4BMOB 1XRJA 2ZPAA 3AY7A 2Q4DA 3HL0A 4NRDA 5DLDA 4BC0A 5BQXA 1E2MA 3NWJA 1T3LA 5H3LA 4L8WB 3CUYA 3ANSA 1KI9A 3FMGA 1Q50A 4PYIA 3BB4A 3GUYA 4ZTZB 1JH8A 1SG6A 1ULHA 5DCLA 2G1UA 1H4SA 5SZHB 2AOVA 2MYTA 4FLMA 4HAYA 5JXIA 1IEQA 4FEAA 2I1QA 4RS4A 4CTOA 2VDLB 4E46A 2J31A 3KXIA 9ATCA 3TTTA 4ZYYA 1E1LA 2WYUA 4RPCA 3B48A 3L7YA 3Q0TA 4Q21A 1RQ2A 1KKLA 5CGQB 3JQ9A 1UC8A 3ANMA 2WUGA 3N8IA 3HA2A 3RRYA 4B3IA 4W82A 2GERA 1J0DA 2CYCA 4WJLA 2XRZA 5KVSA 4PZPA 2N3ZA 2VPIA 1JXMA 3MT9A 4TV9F 1TK2A 2CJFA 5FO1A 1GZ5A 1M1NB 4KPUA 4RXMA 5LA6B 2ZE8A 2AQKA 1I94B 2YJTD 1MQ9A 2J9GA 1P7WA 3LO8A 2A6PA 3LX5A 1HQYE 1P0MA 5FBQB 1TQDA 2PRJA 4BO5A 4ZI2A 1V1RB 1N8KA 1DZIA 2WUFA 4HEJA 4PZCA 9ABPA 1G8YA 2PX2A 1HGXA 1KDZA 3SEZA 3N6XA 4HDRA 5H7XA 1AM4D 3EXHB 3QVMA 2XKBA 1P5RA 2H2AA 1E6CA 5C1BA 2INGX 2ZRIA 3ADOA 3K72B 4P1ZA 2W48A 1JKFA 3ESDA 3OM1A 3DXXA 1M5RA 5K3SA 2IYSA 5C4MA 2CVOA 2DSNA 3G89A 5DBFA 1AKMA 1FCJA 1ECBA 1JWAB 1LFDB 3KDPA 4D96A 4OLAA 1JG2A 5LQJA 2P3QA 2QTMA 4MA0A 1P7VA 4HEQA 4HWGA 4EB0A 3B9PA 1R0KA 3WBFA 4US2R 2QBYB 1DO2A 4JU8A 4LUCA 1NMQA 4QNMA 3ZHOA 1X86B 3QMMA 3ECCA 3BIFA 3LCUA 3OIWA 1M2KA 1YS2X 5FPHA 4I3GA 4KVFA 3PUYA 1H3EA 1JEQB 1D5WA 3IIMA 3DEAA 2CLCX 3CY6A 4OA8A 4UBJA 3AR5A 3AF6A 3I4FA 3JVEA 5KTTA 3DP7A 3P4XA 1EB8A 2Y1DA 1UZNA 4GD3Q 1EIZA 2KBEA 3HK2A 3EIFA 5FLKA 1K86A 1T1SA 3MQFA 4RH3A 5EN4A 1P2DA 3AVTA 2HT1A 3ANTA 3LC1O 3D6TB 1DJLA 4K28A 3WL7A 2PWYA 2FFAA 3NOVA 4ZPXA 4HI0E 1SKMA 2HQ1A 1J5PA 3VYTB 1N3YA 1TYCA 1XKTA 2VLBA 2IU6A 4J0DA 2A5FA 2B4AA 3II6X 2BP7A 4URZR 3GLGA 2EP7A 2N75A 2Q49A 4OATA 3RYHA 2IOFA 2G9VA 2NP7A 3O2QB 4F5ZA 3TEFA 3P32A 4MDFA 4KK3A 1MGOA 1OMOA 1WNTA 3HVIA 4FX2A 3COWA 1HFJA 4LOAA 4UDNA 3SICE 1Y1RA 4O8CA 2Y92A 1ICEA 3B36A 2ZTVA 4BRSA 3OCXA 5C1IA 1JDBB 1OKKA 3FY4A 5JH7B 3HBJA 2XNHA 1D4FA 3BGVA 1F6WA 2RHBA 1LA2A 3NGXA 5A1TA 1DCTA 1Q0SA 4O2BF 1LI4A 1BVYF 2GHRA 2P6UA 1Z4JA 2GA8A 2EKLA 4GH5A 3AQIA 5G3ZA 5JXHA 4QU5A 5I5GA 3H2SA 1JHAA 4LQLA 3FMIA 3PB3A 3PPYA 1XVVA 2FN8A 1FEZA 4FYXA 4BDTA 5JXGA 3HUTA 1GGEA 2XVYA 5BPFA 1XRSB 2XT9A 2Y77A 1WSAA 3GGDA 3U6BA 4OBWA 3IAM1 3PVCA 4LWQA 1V39A 2WF8A 4Q9IA 3EULA 4DYDA 4WLUA 4E14A 2QDKA 3DOEA 3VPDA 4ATNA 2FZ4A 3HDHA 1RQNA 4N6OA 3DF7A 1VKOA 3L92A 4QT4A 1MORA 3CWQA 1X8KA 3RWMB 1PK8A 2HU5A 1XZDA 2YZKA 3R6LA 1LWOA 3OLWA 1QLJA 2PVPA 2A4MA 3SZMA 5BPHA 2QM3A 1X1EA 4BFVA 4CIXA 4BNYA 1ZM3A 1C0IA 3GOHA 3OE7A 4C2BA 2PD3A 1VG8A 2A9OA 1UJ6A 3H2ZA 2KWIA 2XB8A 2VK2A 1E9AA 3BMCB 3NIDB 4TS1A 4HFRA 1U2EA 4M49A 1Z8DA 3NUGA 5HK8A 1Y9ZA 1FX1A 4Q82A 4ZAZA 2JLXA 4EMSA 1Y8RA 5EGSA 4ZEMA 4RDXA 2O8BA 1Y42X 4NPAA 1KO1A 1TU0A 2X23A 3G2PA 1GPKA 4FBLA 4HNAB 4U4AA 1FFXB 1PJZA 1PYOA 1XDUA 2C00A 2Q5CA 2JARA 4J07A 1XD2B 3K2QA 5CYOA 3DFUA 3K2EA 5TS3A 4EEZA 1DHTA 2IF2A 4LYYA 1PDWA 1SCQA 3UAGA 3AIMA 4LK2A 1D04A 3DONA 2OHGA 3Q85A 5BP7A 2PZLA 3A3NA 1IY2A 2ASVA 3NI2A 1A77A 1AKNA 3M1YA 1ML3A 1PT9A 4TMFA 2QENA 1HT0A 3AOEC 3LWBA 4LW8A 1RCUA 4XQ9A 4FB5A 1XPRA 2V1XA 3THSA 4IYJA 3CNHA 4EFLA 1KH3A 1WPXA 3OA2A 3BL8A 5IDWA 2IWRA 1OVGA 3RYFB 3IQIX 2YV3A 3DOOA 1XZNA 4FVTA 4I50F 1TE2A 3KLOA 2WINI 3AGQA 2QE6A 2WC1A 1EK1A 2FLVA 2HIHA 3MUFA 1DC5A 4PSUA 3HJUA 5AI9A 1RC0A 4C29A 4E30A 4BLQA 2HF8A 2EKQA 3ID6C 3UZUA 3UXYA 2PV0A 2ZRDA 2NYRA 2TS1A 4PGFA 3M1LA 3Q1LA 1ZN2A 3CJQA 2AUNA 1ZD4A 2XAUA 1YS4A 4DR6B 1ADFA 4HQ0A 4Q4DA 1LSSA 1N6HA 4GICA 3LJKA 4ZZ3A 2H2FA 1AUQA 3HU1A 3M6MD 4WPGA 4PZAA 6CHYA 2CD9A 3AVPA 3QU7A 4INZA 5JYCA 5ANRB 1JKJB 5ICGA 1UPCA 4JY7A 3RYTC 1MW8X 2G63A 2JFXA 1SD5A 3GRKA 3DUFA 2UXCB 5HNKA 4X7MA 5ETJA 1HX7A 2EFYA 5CDSA 1I01A 2SHKA 5HK9A 1V8DA 3WJ7A 4EPTA 4O0MA 1PQ4A 3A0UA 5DKFA 1ZRNA 3FPHA 1NMSA 5F12A 2ZJZA 1PJ3A 2OV3A 2PIDA 2AGVA 4YRTA 4P5EA 5EP3A 1D1SA 5K0NA 5F2KA 5IC5A 3V5NA 2HRCA 3U13A 1UKZA 1A8IA 2QN6A 3N2YA 1DKPA 2QG9A 4ZV9A 1EFUA 3LPMA 2F4NA 2EVWX 4J7AA 3ETJA 1NUHA 2A0FA 1QIIA 3E0XA 2W2LD 1OI2A 4LHEA 4OGLA 4MPJA 2WPDA 5T3YA 4HDQB 1BFDA 2WHPB 1YQTA 1GXSB 3CNQS 4CG3A 5JANA 1M6HA 2C9BA 4B0PA 2WWTA 5JYEA 4AQ7A 2X1MA 3NUQA 1Z33A 3U4CA 1XCBA 4EF5A 1JNXX 1ISFA 1KJ8A 1SEVA 1U9JA 4BO3A 3DMTA 4XSHA 3L5OA 4UARA 1B3BA 1K3UB 4IG9A 2MSCB 4KO8A 5AOVA 4DMMA 4GBMA 3AHGA 2HC9A 3IEXA 1Q0RA 3DKPA 3HFJA 3OOJA 2JCGA 3R7FA 3THYA 1L4HA 5KI6A 2QE7D 3CPHA 4MLDA 5A7GA 4DA4A 3IBCA 4FI3F 4R7TA 4BZPA 1MAUA 3HABA 4G9BA 4ONEA 1Y8QA 1KZ1A 1NW8A 3E9QA 3N07A 3RFUA 1T43A 1FX0A 1XRNA 1QNLA 4ZJYA 2J3HA 3HNPA 1R10A 1BDMA 2CCJA 2EWMA 2IU3A 3ANYB 1B6GA 3BMQB 3EEQA 5JBIA 3NHKA 1F8FA 2WU3A 2YVKA 3SNKA 3WGMA 4B3TB 4PC1A 3RS2A 3DMNA 4KR6A 1TZ2A 3SFVA 2CMDA 3D43A 1H3NA 3AKEA 3PBKA 4LRYA 1SOVA 2JBHA 1R0BA 2QPLA 4LJAA 3NHPA 3O4HA 1TA4A 3RHSA 4B48A 2G8LA 4HQLA 4JR1A 3IQXA 4L4SA 3E70C 4Z54A 4ODIA 4V1CA 3HVJA 4MV5A 4UU1A 3LQ1A 1RHQA 1SBIA 1G20A 1LRKA 1WB4A 1LDGA 1XE3A 2OG2A 3ZXSA 2TMKA 3ESXA 5A04A 1YRWA 5JC8A 3O91A 4M6WB 2C7QA 1DJMA 1UK6A 2B35A 1WW3A 2C0PA 4Z49A 2QW0X 1DRVA 3VVLA 1L4BA 1EDBA 4AO7A 5J4KA 1L5MA 5EE3A 3VI3B 3N87A 4XIJA 3V33A 1V5EA 2XH8A 5F7XA 4IV8A 1T4MA 5DRYA 4LA4A 3WLNA 3NX4A 4GVXA 5AK6A 4BFYA 5JDIC 4GBJA 1D09A 2P4SA 3ACDA 2J9XB 3GLIE 1M33A 1L0BA 3IA7A 3O92A 3UWDA 2ZYSA 3OF5A 3RBVA 4NBSA 5HGJA 2WSMA 2D1YA 2J7PA 1E1YA 3PFFA 1LK7A 4BQOA 4NJMA 4BRZA 5GIPE 3O3OB 3KJHA 5GP1A 1CZHA 3HJNA 5DXJA 3CX7A 1NBOA 3ZDXB 3WISA 1V7ZA 3A6KA 1KJIA 1NOJA 3K8ZA 1T4GA 4Z1MA 3E3NA 4G81A 4KP7A 2BLNA 1CY4A 1E9RA 5AUPB 4CF4A 3FOZA 1M2HA 2M2IA 1N3IA 1JFSA 2XZTA 2DLCX 1KI7A 2DFKB 3H8WA 4WKBA 2J6HA 5LQRA 2IODA 1L7QA 3C3YA 1XCLA 4Y30A 5DN9A 2QT1A 4M53A 4XAQA 3R7AA 2GNOA 2VDPB 3SZLA 4XWOA 3TNYA 5F9MA 4QUEA 4CIAA 3OQHA 1BOOA 2CBZA 2M1ZA 3HR4A 4WINA 5DLEA 3NONA 2BHNA 3M70A 4BB0A 2ZRBA 5BW5A 2A1UA 1ZNQO 3U3OA 3I04A 3R6GA 4JX9A 3G49A 4NNPA 1JAIA 3NDRA 3GVHA 3VR4H 4YONB 1NVTA 5ED4A 1YQGA 1FP4A 2AF3C 2HADA 4M37A 5I9SA 5JARA 1LH0A 2O2JA 5LUBA 4PC2A 4HQNA 1JHVA 4ESOA 3T5TA 2X4LA 3TTXA 2X0IA 2JFQA 1IHYA 3LT5A 5CA1F 1C1HA 1L8QA 3I0NA 4ZYUA 1D4OA 4K8OA 4RA9A 1OXBB 4Z9AA 1L4YA 2GHIA 2QUKA 1XTBA 1MB9A 1N8TA 4LRQA 4YNBA 5AWFC 4H6WA 5TV2A 3RC1A 2BKAA 2H65A 3DCNA 4ARAA 1EJ2A 5CX4A 2BUBA 2HBQA 3HFRA 5C7LO 3AKDA 4WLNA 3VZRA 1WCIB 3DPSA 3MTBA 3PFHA 1E5XA 2X14A 3SDSA 2IOYA 4WKNA 4ENVA 4KDEA 1WV1A 2YRXA 4WLFA 4X7RA 3HR7A 4QJBA 4I1SA 1OFHA 3Q6MA 3I05A 4NMMA 4L76A 4D3YA 3NDBB 4FBGA 4IWYA 1E4OA 4L08A 4ZOLA 3FTEA 2ANCA 2L17A 3QJGA 4G07A 4L4RA 4XX0B 1SUWA 1IK6A 1HH4A 4LV8B 2PS0A 4TT8A 3UOWA 4DV2B 3H3JA 2WD8A 3EXG2 3IAXA 4RIEA 5GMOA 3O84A 2WILA 4WZAA 3OP4A 3VTZA 3KKMA 4TUYA 3OBIA 1QFZA 2FZVA 5B7NA 3G9ZA 3OZUA 1W4BA 2JG3A 4INOA 2C5SA 4LZZA 4DCMA 3PR2B 1WMAA 3A11A 1W19A 1U81A 4F46A 4RE5A 4X7PA 4TYMA 1KY2A 1QZ3A 1A8HA 4QREA 4NDNE 4C4OA 1B73A 3IPAA 4I55B 3EUWA 3BJMA 5BN3B 2FP3A 2BUAA 3BD6A 4L28A 1J20A 3PE6A 2IY9A 2NXJA 1HLGA 3WFZA 4AF8A 1Z0ZA 4ZHQB 2NSHA 1TT7A 2G4CA 3P9ZA 2FJUA 1ZSNA 3GJ3A 4FJ0A 2DLDA 4II3A 1PJCA 5FH9A 2PR2A 3O03A 4D8WA 2V03A 3PTZA 5TRTA 4LYAA 1SHLA 4HGPA 4YP7A 5JMTA 1N77A 1AY0A 3CVWA 3EVGA 3IIIA 1N6NA 4AY6A 3EC1A 1BXRA 1PHRA 3UV7A 4BLPA 1I6MA 1Z88A 3VAYA 1E0JA 2XR1A 3THOA 5BRAA 5K8TA 1QGUA 2CXPA 5FT9A 3PKJA 4KYIB 4DLBA 4HGYA 1DJNA 4I1OA 3J80A 4BWYA 3WQBA 3MUNA 3LXUX 2VRBA 4IVQA 2I6GA 5DTQA 3BTSA 2P90A 3VOTA 2C0CA 4KKXB 1ZVKA 4F11A 2DF8A 3I2HA 3R9IA 2DWUA 3CRNA 3QIAA 3QZUA 4RTOA 1G6Q1 1Z07A 3NCTA 1YKGA 2O7RA 3SE7A 1H6BA 5GONB 1HMPA 3WO1A 5BXYA 1SCUA 1YGPA 3ES9A 3U48A 4UU7A 5MN6A 4C7BA 1JDNA 3H9CA 4EY6A 3BAFA 3NGLA 1AH2A 3GQBB 1XD9A 4N7RA 5BO5A 2QEQA 2W6JA 2KMLA 2BBWA 4NEQA 3SMVA 3WRYA 4B4DA 2NQTA 1YQEA 5K4AA 1D2EA 2JHAA 2C8VA 5DH9A 4AY5A 1KS2A 2O3RA 3D6NB 4JOCA 5EIBC 3S44A 2ZT6A 3WYAA 4EDFA 5LZ4A 1U63A 3EDRA 3CUWA 4ZVPA 1SXIA 5HDQA 3S1AB 4C1NA 1ETUA 4JYMA 5FBKA 4R9RA 4NU6A 3KXKA 1P39A 3W3AD 3NEPX 2RD2A 2PZAA 2EWVA 1TK3A 3HJAA 3AP3A 3LKZA 2DULA 2IYVA 4JBXA 4ZT4A 3GFRA 1E1RD 3FETA 2OXFA 4IS3A 1WMDA 4JUCA 5A5VA 3M4ZA 2MYNA 4W6ZA 1U1CA 3E5MA 3HI6A 4WDQA 4NNOA 5DI9A 1PJ8A 3CE9A 3I0MA 1S2IA 3ZIAD 4HB4A 1VJ1A 4EZBA 5IT0A 3IUEA 4IDBA 3DL7A 3WFJA 1LTHR 5C7OO 3U39A 1I5EA 2X4DA 3AFIA 4BBAA 4Z0NA 4UVIA 1KFEB 5CEEA 3A6LA 4CM8B 4IEEA 4FYWA 4Y0VA 2JFWA 4HLUA 4BNVA 4DUYB 1U2PA 1D8AA 3H65A 4R1QA 3I8SA 4AN0A 1Z4LA 2YXBA 3ICQB 2B25A 5ECWA 3W8FA 4J9VA 5EIWA 1U7HA 3DA8A 4G5OA 4BV8A 5IKMA 3GLHB 3AONB 4RADA 1DO0A 1S3SA 1TK9A 1HBJA 1IJBA 1XFAA 2C5LA 3D3QA 1NVGA 3HUUA 4GNRA 1HQDA 3G85A 4Z3OA 1CP2A 2W8BA 3ZCSA 5SY4A 3LSTA 3KUUA 5HRCA 1F8YA 1QYVA 5GZ1A 4QUGA 3M5WA 5JADA 1U4SA 2XMGA 1DFGA 3HSKA 4KE8A 4L51A 3SVTA 5FUWA 1EP1B 5LQMA 1VPEA 1SCJA 5DW0A 3MT8A 1WKVA 2J87A 3KUKA 4ICIA 3K0BA 5ABPA 1KYQA 3L04A 4GVPA 2XZPA 4PLZA 4BP3A 1ID8A 1T0UA 1T1JA 2ZEJA 4L5IA 4LRTB 4DUZB 1FRVA 1QCDA 1ABEA 3DBVO 4C03A 1GA1A 3HI4A 4XZ3A 4OX9Y 3X3HA 2R66A 2QTWB 5IP5A 2C9OA 4C14A 1KF0A 2XUKA 2AR7A 4COKA 2WYWA 3F73A 3WLLA 2WJVA 1GRNA 3I9LA 1CYDA 3RANA 4RH1A 2RHTA 3TCKA 2OGZA 4TWIA 4HEHA 4QYXA 3LK6A 3PIRA 3QG5A 3HU2A 1RKQA 1LNQA 5FOXA 1XA3A 1SA0B 3DZJA 4O59O 3KQMA 4TLMB 1O4VA 1YDWA 3PSAA 2G9UA 4RPHA 4URHA 5KWJA 2QX8A 3G17A 3JS5A 2EX0A 1UM9A 3THXB 3FJ1A 3QNMA 3RU7A 4DNFA 4EX7A 4WA8A 3BQMB 5CB4F 2ZIXB 3TL6A 5IULC 1E6KA 5LL6P 4WOJA 3VSDA 1W76A 4LJ5A 1JE0A 3MJCA 5HMMA 2WWRA 3GFPA 3PC3A 1J5EB 4XX0A 2BZGA 1RZRD 3U4AA 3OFND 3VKVA 3WAGA 1JIQA 3IUSA 4AAYA 2AFVA 3IGFA 2BLLA 4QTUB 2C07A 2D74A 5FQOA 2F1KA 1D7OA 1GLVA 2YUTA 3HB0A 4QPJC 3MYYA 1DIOB 2NUPB 3CTMA 3O90A 4MQUA 5E1MA 1Z28A 1DAKA 2XD4A 4LXGA 4PPGA 4Q1EA 2QUIA 4R7ZA 3ZKWA 2NW6A 3CKKA 1E2JA 1YR8A 4R1PA 3QXHA 4OMDA 1VL1A 5IBQA 2V6FA 4INJA 4A36A 1SZPA 4OQQA 3MFQA 3SHFA 4FGJA 2QL6A 4OGFA 3BVPA 6Q21A 4FJ1A 4Y6PA 4YXWD 3QVGA 1ZY2A 1F14A 2AC2A 3KP1A 4IM7A 2BR3A 3VH1A 4D5EA 4DV5B 4LJLA 1S89A 4Y2TA 2OLEA 4I3FA 3WMEA 3WGUA 3UK7A 1FP6A 4IIBA 1RPJA 2LBPA 3I42A 3WSWA 1K89A 4YQYA 3IIEA 2E21A 2V7XA 5IK2A 3W5DA 1YMVA 3CRQA 2A3RA 2RDMA 2FPIA 2YIVX 3GLTA 4OYRA 3W2GA 2R8XA 1G5QA 7REQB 3KOXA 2B83A 1ZITA 3OMLA 1ZX1A 1X2BA 3UMFA 1EVLA 4EBBA 1Z8NA 1IXZA 5A2GA 4BS9A 3KB6A 4KXNA 4LC1A 3AJAA 1L6IA 1PJRA 2C2MA 3TZCA 3D7SA 1H9AA 1RBZA 4FCCA 4HAIA 4H4CA 4LOHA 4RCYA 2B78A 1E3SA 2O1EA 2XNCA 3OKAA 2XVAA 1SKYB 1JIKA 4LV6A 3ZCPA 4E21A 1PL0A 3THRA 3AV3A 5JZSA 2DBYA 3BWEA 3EG5A 1V47A 1YFKA 2AJ8A 1XN4A 2GILA 1BNCA 3D0KA 3QX7A 4HWKA 3V8QA 4DAOA 4D43A 1UPAA 3CGWA 3PPWA 3ITDA 1E9CA 2BI7A 3U7EB 1YRYE 4EKGA 1Z82A 2PL1A 2ZBVA 3VHQA 4UEJA 1N2XA 2QG6A 4Z0TA 1OZFA 1AQUA 2BV3A 1KPGA 2QXUA 2VUIB 4RY8A 2KQUA 3ABZA 1PSWA 2P4QA 2YZ7A 5EXSA 2GPTA 2IXFA 3T0GA 4FXOA 1TQHA 1UP7A 3DGFC 2C20A 3EZLA 3W5SA 2WUWE 4G6ZA 5JNVA 3ERCA 1S96A 2LCQA 1NP7A 5HBGA 5FDFA 4IHJF 1Q16A 3A58B 4ENSA 2AFIE 3RNLA 4M38A 3U26A 4UAJA 3AHHA 2FZEA 2ZM5A 2E4YA 1L9KA 3FCSB 1P4JA 2H57A 1L4GA 2GD6A 1WDKA 3OX4A 4M7RA 2BHLA 2EYQA 3LRXA 1PSZA 2WVGA 4D1YA 5GY7A 1AIPA 2JKZA 3B3AA 4GPEA 1F17A 3DV2A 2V97A 2X9QA 2ZYVX 4IX1A 1SC3A 2A84A 4KWEA 3OTOB 3VZPA 3WLPA 2GLTA 1JILA 4J3FA 3X1JA 4FONA 1F0YA 3FFXA 5ITZA 1K6EA 3H5VA 3AF3A 2YW2A 1QS0A 3ILVA 2D2XA 4IDDA 4Q9JA 3UMYA 1E5LA 5HQ3B 1U3UA 1RP7A 2F1OA 1TMGE 3LFUA 3JQ8A 3LU1A 4PZ9A 4TTPA 4EWLA 5ALLA 4YRJA 2B3DA 3VR6A 3ZNOA 1EVZA 4IUBS 3ZQ4A 2QNIA 1VKHA 5HIAA 2FJPA 4ZCQA 2GEJA 4MB6A 3JTEA 3Q3GE 4PRKA 5AFSA 2GX6A 5A6SA 3HM9A 2O8FB 4W5NA 1TTHA 2MSNA 3JRNA 1GZDA 1AZSC 1ENOA 2GDZA 2BMWA 4KAFA 1EHIA 4RVNA 4Z8XA 1Z0IA 4FWTA 2BOVA 2Q3HA 3B3FA 1GG9A 2CWDA 3H1PA 4ER0A 3Q5GA 5AJZA 3U7RA 1IDN1 2E7ZA 4YUAA 1YK1A 1Z74A 5EVJA 4ARBA 4BQSA 4BE4A 4U2DA 1ISSA 2HU8A 4UZFA 4OEHA 5A4DA 3JTMA 1VXRA 1YSCA 2XPCA 1A9PA 3LLMA 3HNOA 3QV1A 4QJ5A 5AI0A 4CKBA 3I6QA 4G89A 2EBFX 2BGRA 2OCPA 5KNLA 4K0RA 1JJFA 1TVKA 4CMKA 4OAQA 4XYBA 2ACVA 4CEIA 1OXVA 1A8PA 5EQTA 4MCJA 4BMPB 3AG6A 1WXHA 5FBLB 3IHKA 3OPQA 1NQ5A 3MNFA 1DKQA 1CQZA 1K27A 2COUA 1WEKA 1W6RA 3LBAA 3QPVA 1CUXA 2TSYB 3C97A 4PBSA 3WLHA 2EF0A 5HXAA 2ZRQA 4BNFA 4L2IB 3S68A 1F51E 4OGKA 4LVNA 4EF4A 3RGGA 2C7BA 1NFFA 4MI9A 3FNIA 3OO0A 1NUQA 5D8DA 4HT3B 3BKXA 3S29A 4R9SA 1L5QA 4KI7A 3LLCA 3V9AA 3ON5A 2KPOA 4HNUA 1UMDB 3DFZA 5AW6A 2PIAA 4OP1A 2RK4A 2CV1A 3IEIA 4ZGBA 1PN3A 3VZCA 3ICWA 1CULC 1FMLA 2PS9A 5E7IA 4ZPJA 4MH0R 3TR0A 1HE8B 4TS4A 4Z86A 2F9FA 2C4UA 4GI3A 4JB0A 5JBNA 3SQOA 4L0QA 1IUKA 1CDEA 1JG4A 3KU1A 2X0EA 4EHFA 1DP4A 2XDWA 1JF8A 3HBMA 5HF6A 1T2UA 2EL7A 2Q6LA 3DE6X 3RVOA 1J7JA 3WGHA 4AURA 4GXTA 2GETA 2HMTA 1X19A 4DANA 2P6MA 1Z5VA 4IJMA 3SJAA 1YDHA 4QLAA 1CY2A 3AIKA 3ZY2A 4BTLA 1XZJA 4TVSA 2OGUA 2ZWPA 5F52A 5IKPA 1L3IA 4HDAA 4I6JA 3ZWPA 1E3MA 4W63A 4OG2A 4KU4A 2I6UA 1FMCA 5ALWA 1N5OX 2VSOA 4UBNA 4ER5A 3NOOA 1WDLA 3L6RA 5HIIA 3HPRA 4EY4A 4B4WA 3ZHZA 1PUIA 4OMUA 3GFVA 2YIJA 3JYPA 3FTQA 1IBKB 1BQEA 2XRYA 1JVNA 3ANNA 3DOHA 2DCMA 3FJYA 1YA8A 5IW8A 5C34B 1VGVA 5AD1A 2G83A 1NMYA 5IXYA 3NJ8A 1OWOA 2F1JA 2BT4A 2DBZA 3P2IA 2UZ1B 1ZD1A 3RVDA 1NYTA 5FXMA 4H7KA 1JU9A 2I4TA 4WXHA 3ZS9A 2L2QA 3JQRA 1QQTA 5HRUA 2YVAA 4J1TA 2CF5A 4EHJA 4RX1A 1P33A 1YI1A 4RZQA 5ENDA 1ISIA 4ZIRB 1V5GA 2IE0A 3HL4A 1LDEA 3FVTA 4CIBA 2I6QA 2GHTA 2Q3MA 2Z5FA 1U8ZA 4O6VA 1CZNA 1E1KA 4OQXA 1QPBA 4RY2A 4AP5A 4BMCA 4DIKA 4DC1A 3FOEC 3FNHA 2IYFA 3D8RA 3UOGA 2PKQP 1DX6A 1QG0A 4KVGA 4G3XA 4C7XA 4XOIA 4AJ9A 4KBYA 5JLAA 3MT0A 4HPXB